5C2JB

Complex structure of the gap domain of mgcracgap and cdc42
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
191
structure length
191
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rac GTPase-activating protein 1
publication title Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/signaling protein
total genus 67
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5c2jB00
1N6LA 2VHQA 1VG1A 1SVIA 2C96A 3ZLJA 2J0SA 2NO6A 5CK5A 2OBNA 2ZAOA 4D4MA 4TLAA 5C1BA 2WV9A 5JI3E 2QT1A 4F4JA 3TMKA 4QGHA 4A0RA 4C0QC 1IY1A 3PCRB 1P9RA 5H8WA 1N3BA 5FBLB 1N6HA 5EE5B 2IXEA 3BRWD 2Q6TA 5FPTA 3R9WA 2GEDA 2ZRHA 1T8TA 3FTQA 5FL3A 4A15A 4GSYA 3B1ZA 4MKGA 2JJ8A 3IPYA 4B6FA 5B58C 4BZQA 3RS3A 3GLGB 2CVHA 5P21A 1RIFA 2GZHA 1R6BX 2BMFA 1NVWQ 1Z6GA 3WBKA 4JL8A 3I61A 2QMHA 4ZKEA 1YZNA 1XBTA 3CWZA 3OIVA 4JS0A 3DO6A 3TVTA 3U6BA 3QSYA 1TF7A 1DELA 2XTMA 2VH5R 5HCIA 5K8LA 3Q3JB 4OQFA 1ZD9A 3EPHA 2QP4A 2PCJA 2H17A 1CEEA 4B33A 5JSZB 1XPOA 1II8A 1N6KA 4NCNA 5IK2A 1FQJA 4C30A 3IHWA 3QKSB 3C15C 1Z5ZA 5IF9A 1CF4A 1E0SA 5CM8B 2ANCA 4LCBA 3GJ4A 2ZRAA 3TAHA 4ACAA 4ZIRB 2JLYA 1ZM3A 5JFGA 1FMLA 4LUCA 1E99A 2DR3A 2VBCA 4I1UA 3UMSA 1IM2A 2JDID 4L9WA 3U3MA 1GKYA 3ICEA 121PA 1XMSA 2CBZA 5UKDA 1H65A 1E9BA 3QG5A 4FCVA 3PEVA 1ZW6A 1OLOA 4OJQA 3CONA 3G0HA 3VFDA 4HAVA 1GL9B 4JLMA 3IO5A 5KSZA 3SBDA 4F38A 3HYRA 5C18A 1ZRHA 4S35A 2J3EA 1Z2AA 3SHWA 3TRFA 1U9IA 1YR9A 3LX5A 4NYIQ 1OH8A 1S1MA 1DTSA 3U44A 4G01B 1WQ1R 1XTSA 5JLJA 1SVLA 4LYFA 4TLBA 1ZU4A 2BM0A 1FTNA 4V0NA 1E2HA 1RRGA 2G88A 2JLRA 4HAUA 5FI1B 4RKFA 5F2EA 4QNMA 2DYKA 2XSZA 1D9ZA 2GA8A 2EU8A 4BE7B 5DHFA 3V4RA 2YZ2A 2FWRA 3K0CC 3NC0C 4RZUA 1OPXA 2WWGA 5DGXA 3LRPA 2ZE8A 5EJEA 2QSZA 1VG8A 4UNRA 2ZI7A 2GETA 3H86A 4GT1A 3D3QA 1HY3A 5J4VA 4KU4A 4D4LA 4NH0A 3EG5A 4MDEA 4NTZA 2FFAA 4H1VA 1SQ5A 1FX0A 1G8YA 2ORVA 1F5NA 1LS1A 5B57C 3B6EA 1Y63A 1DAHA 4QHYA 3VU9B 3K0SA 1R0XA 1PV4A 2CJWB 2D62A 1GKUB 3LLUA 1BOFA 1RW4A 3B82A 1DO2A 2JLVA 1TF2A 2A5DA 1T8UA 3SJBA 2HCJB 1UEIA 1E0KA 2F9MA 3FHOA 4QBFA 1NMZA 1R7RA 5KTYA 4AKHA 1JQJC 4UQOA 5L3RA 4V03A 1UDXA 4DDWA 1N2CE 3AVYA 5EXPA 4LHVA 1D2NA 4DC9A 1N6IA 4AI6A 2KSQA 5EZ5A 2AK3A 4D80A 3ZIAA 1YRAA 4NL4H 3ZVMA 3KQKA 3EWSA 4B3DA 5AUPB 1XU4A 4HYYA 4OL0A 1KKMA 4MA4A 1A7JA 3P27A 4NYJQ 4Z8YA 4AC9A 1K5GA 1V43A 1YZQA 2VYFA 1E1QD 4Q19A 2QPOA 4LJ9A 2CK3A 5FOUA 1UADA 2FEOA 3GJ7A 2ZPTX 3PUXA 4PR0A 3REFA 4BUJA 1KI7A 5AJZA 5TXGA 2OCPA 1E9EA 4QOSA 3OFNA 4OQXA 4Q1DA 1KSHA 3KDSE 621PA 4DB2A 3IEUA 2JJ1A 5FBWB 2PZFA 1HTWA 3CM0A 4KO8A 1D5CA 2O8CA 1ZIOA 1NVUQ 3VNUA 4A1FA 3TVDA 3FYHA 4PC6A 2I1VB 2O8EB 3BB3A 3SOPA 5B64A 2BCJQ 3FMOB 3K09A 1S2MA 3LFUA 3AQ4A 4N3NA 4JBWA 4ESVA 1QF9A 3T15A 5F3WB 4KYUA 3MWLA 2A9KA 1US8B 1R0WA 2QQEA 3AKDA 3A1VA 4W5JA 2A5YB 1TAGA 4DDUA 5JWRA 1KK0A 5J47A 2QMOA 1NG1A 2KE5A 3I1FA 4CEIB 1HQYE 3WY9A 2ODNA 3KXKA 3D8BA 2ODEA 1NVVR 2GEUA 2PMKA 3GLGA 1XD8A 4KODA 1LF0A 4AKEA 3VKHA 3TAUA 2OM2A 2P65A 2YWEA 3VAAA 4E5UA 2GJ8A 4O25A 1G19A 4N0DA 4PTLA 1H8HD 2IXFA 2ZS9A 2W6IA 1XRJA 4MYCA 3U3KA 1KZ7B 1W49A 2GCNA 4OK6A 5KSYA 2IWHA 1T6NA 1T91A 2YV5A 2ZRPA 1SXJB 1QVAA 3LD9A 4UNPA 2REOA 5JSZA 1FPMA 1HYQA 1M7GA 1P75A 2WIBA 2WVJA 2NO7A 2NIPA 2FFQA 2AWOA 5FOVA 3FFAA 2J1LA 1R4AA 1NLFA 5FTJA 3TQFA 5AUNB 4HB4A 1NG9A 1IN7A 3O8BA 4F92B 2WICA 3EZ9A 3PR1A 4HZIA 5FPSA 2R2AA 1DS6A 3F8TA 2NPFA 3K70B 4V02A 1Z6AA 2NMVA 3CBQA 2CDNA 2QM7A 2QAGC 4Q21A 1L4YA 2ZI9A 3K1JA 2GF0A 3DKPA 3SE0A 1W1WA 4DCNA 4PHTA 3BXZA 1DAGA 1N5KA 1G20E 3QKUA 3BB1A 4Q00A 4TQAA 4M22A 2FOLA 4MRPA 5TB5A 2WMOB 2X8AA 2ZSDA 3L0IB 1CKEA 1JXOA 3GQBA 1LNZA 3N2EA 2VP2A 2XTZA 3T1VA 4TYNA 4OQMA 1IQPA 4DBLC 2RMKA 1Z08A 2OEPA 4ERNA 3JZMA 5FR1A 3DOEA 3H1TA 4AYXA 5KNBA 3L8ZA 1DAIA 2KJQA 2IHYA 3ZD6A 1FTSA 1N0VC 4L4UA 1ZCAA 1G291 2JLSA 3B7GA 3LQRA 5DYIA 2H18A 1NIJA 2OCYC 4CGZA 1R10A 3CB4A 2G6BA 1XMJA 2DCUA 1D8TA 3O47A 3VKGA 3LW7A 4JL6A 1PVOA 3IUYA 4EJSC 4RJLA 3QVVA 1DPFA 1LF5A 3UMRA 1LTQA 2ASEA 4OBEA 3OEED 4URYR 4R98A 3VU9A 1KK3A 2CJWA 1FP6A 3LXXA 1EFRD 1X86B 3K0AB 2YHSA 1EFUA 1G5TA 5FBVB 2FMXA 1LY1A 3AF1A 5EE3A 1H8ED 3ADBA 1DG3A 1M7BA 2CL7X 2OLJA 4EUNA 3T06B 4Q02A 2ZRMA 2D06A 3NWJA 3QQ5A 4GRAA 2VP0A 2Z6VA 1AS3A 1T5LA 4R9UC 1HE8B 4N0EA 4DCVA 2A78A 1MABB 1QRAA 2VHCA 3DZ8A 3RANA 2OXCA 5SZJA 2IT1A 2ZRBA 2GILA 2G77B 2FNAA 2G9NA 2WJVA 3CZPA 1Z2CA 4DSUA 1W36D 1KJYA 1S4QA 2LWIA 3RS7A 1R8QA 3K9LA 3LW8A 2ZUCA 2IYLD 4TT3A 4AD8A 3HYTA 1JECA 3CNNA 1ESMA 2A5GA 3A58B 1TU4A 4KFUA 1JXMA 1JJ7A 3NHAA 4G5QA 1EESA 3GLGE 3SJAA 3FHTA 3QE0A 4KV9A 2OFWA 5E4FA 1NIPA 3MGCA 1AIPA 3KJIA 1P9WA 1E4YA 3BH0A 2D4HA 3KKPA 1KDPA 1U8YA 4MRSA 2ZJAA 4ZDWA 1TMKA 2FA9A 4FMCF 3PUYA 3UWKA 1J70A 2JLQA 3GFPA 1E2DA 4MGZR 4Q1BA 4A8JA 2KWIA 2B92A 1MV5A 4NCKA 2IYWA 4D2IA 2WWYA 1R5BA 1XD9A 1FMJA 1B23P 3KKOA 4PHGA 2Z5FA 2ERYA 4C9BA 1GL6A 1W46A 1YR7A 1NN1A 3VKWA 3CKLA 1U0LA 1UJ2A 2D3WA 3IIJA 3C41J 5DH9A 4K46A 3PV0A 2I4IA 4W9MC 3IKJA 3NDBB 5FH9A 2OZEA 4V0MA 4JIMA 3S1AB 1CR0A 2JAQA 3QKTA 3UANA 2DFKB 1ZP6A 3TE6A 3THOA 2Q9AA 4ASUD 1NL3A 2H57A 4Q47A 2XJ9A 4RZ2A 5GVRA 5TV2A 4QBHA 1XEWX 1X8JA 1F3OA 4LSGA 2AN9A 2QENA 4RY2A 4Q1CA 5LB2A 1Q44A 2IYTA 4TQ9A 4F7WA 1T3HA 4YLGA 5JI2E 2CNWD 2DB3A 2G1KA 1NBME 1I2DA 1QHHB 1G21E 2YOFA 2VP4A 3WRYC 1L4UA 2OXRA 3CIOA 3RSLA 2BVNA 5DLQC 4AYTA 4DZZA 3EPJA 1Z29A 2HXSA 1TADA 1CTQA 2GRJA 2UVQA 1G8HA 1EFHA 4I1OA 2JIZD 5E3HA 3AUYA 4D0NA 2IUUA 2GHIA 1KNXA 2HJGA 2BBOA 3TUZC 1P2SA 1NNEA 1W4AA 2R62A 4QBIA 2P0EA 4P4SB 3L2OB 3PXGA 5FTMA 1YU9A 1XZQA 4WZ6A 2W0SA 1N6OA 2ZU0C 1JR3D 1FNNA 3IO3A 4KJZA 1S1CA 3RYTC 3SU8A 3LA6A 4AYWA 1G3UA 2OAQ1 4FMDF 1XXHB 5CK4A 2WSMA 2G3YA 4OYHA 4TSFA 3EPKA 4DB4A 1G6HA 4A2QA 2QM8A 1SVMA 3BBPA 2D2EA 3PJRA 4E07A 4WBSA 3L43A 2VO1A 2RGEA 2QBYB 2OCBA 2R9VA 5F9FA 4LHZA 1GP2A 4OK5A 2YOGA 2XTNA 2F9LA 1AGRA 2BKUA 2C98A 4LBWA 4IOKA 2ZU6A 3FOZA 2C9YA 3WMEA 5EP1A 1Q3HA 4JLNA 4XH9B 2QSYA 3R8CA 1G7SA 2IYUA 3DL0A 3KQNA 3UWOA 2EFCB 3ZS8A 1QVRA 1OFIA 3VHLB 4BRUA 1KI9A 1VCOA 4YXWD 2GVZC 1E2MA 3TIFA 5H1YA 4K81B 1VMAA 2NO1A 1FFHA 2IW3A 4XWAA 4U5XA 4HSEA 2V55B 3QEJA 4BLQA 4XWOA 5EUQB 5BN4A 2G1JA 2H16A 3EXAA 2REBA 1VPLA 3R8FA 1GSIA 4FMCB 4Q4LA 2ZRJA 3CRVA 821PA 1WA5A 4DKXA 3B85A 4JLPA 4MKFA 1O87A 4F93B 3FHCB 5JRJA 1G5PA 1OE0A 1UKEA 2Z4RA 1UBCA 2VSOA 3QBTA 2GJAA 3Q72A 5CB8A 4H1UA 1YZUA 3SEAA 2X19A 2ZI5A 5FL7D 3K0AA 3VHXA 1E1RA 1Z6TA 4YMTA 1YZLA 3T34A 4LJ6A 3SJCA 3W9YA 1BS1A 2BJWA 2CE7A 4P31A 2PZEA 5JJLA 4QG7A 2AHOA 4YMWA 2EFGA 5L3SB 5DNYB 3NKVA 5AJVB 1W36C 4ITRC 1TNDA 1MABA 3UXMA 1A1VA 2IS2A 4UXJA 2JJ2A 4ZO4A 1D2EA 5ANRB 1W0JD 1YVDA 2BOVA 1XX6A 3OAAD 1XB2A 1WRBA 4L9SA 1IXRC 4QBGB 2WSSD 2GXUA 2ZJBA 2BIFA 1IOZA 3A4NA 4GP7A 4DLXA 3FWYA 4C7OB 4XSHA 5FUWA 2GBLA 1O3YA 4NYMQ 1CR2A 4JBXA 4HAZA 1RFLA 4V0ME 4B75A 1P60A 3V00A 1CBUA 4JYBA 4OHVA 2GWHA 4OI2A 1J99A 5J5CA 1NN5A 4BFXA 5BN5A 4DCTA 1XZPA 2ZI6A 1IBRA 1IY0A 1N0WA 2WJHA 1MRNA 2XAUA 3MUFA 3MRSA 4POAA 1Z8FA 3LVRE 4CEJB 5A5GA 4M1TA 2H8KA 4Q9IA 4JJKA 2ZTSA 4JT4A 5KNDA 3PG5A 4DXAA 4A2WA 1KY2A 5J4HA 3IGFA 2V1XA 3QXCA 3P4YA 4NU0A 3O8DA 3AM1A 5L3QB 1ZMXA 4ARZB 4FIDA 2FN4A 1OYYA 2PJZA 1SXJE 4BFVA 1UBEA 3QOFA 2ZS8A 1OFTA 3GEIA 4LYHA 4PZYA 1AM4D 2W00A 3CRW1 4JLVA 4CIDA 3KKQA 3C8UA 2RGXA 4PAOA 2NTYC 2ANBA 1OFUX 4FMDB 3AVOA 3QF7A 4Q4JB 5DN6D 4KBFA 1P7CA 2V7QA 2ZRKA 3PEYA 2O8FB 1KJZA 1GILA 4TYQA 2HUPA 1KKLA 3RVBA 2HCBA 2AFIE 4D6PA 2FGKA 5BN3A 1EFCA 1LV7A 3S1AA 5E95A 1AS0A 1CU1A 1VYVA 5JEEA 2O8DB 2B8WA 2VSFA 5A0FA 3ZVNA 3KQHA 3CWQA 1E2IA 1E2FA 2HT1A 4MRNA 1Q12A 4A4DA 3QKRB 2XOKD 2IS1A 3DM5A 4OJKA 4OKSA 2GJKA 1PUJA 2QG6A 2QN6A 3Q9LA 2GZAA 1OHHD 3RAPR 4Q9KA 1E6CA 2YJTD 1J8MF 1GZSA 1QHHA 4M1KA 3PEWA 2GNOA 3RS4A 1G16A 1K8RA 1G1MA 1QG2A 3HU3A 3R9IA 3BJIC 3IQWA 3U4QB 1KI3A 3ZYCA 3TSWA 5SZKB 1VIYA 3UATA 1XNJA 3NHBA 4HLQB 4DUGD 4F91B 2FPMA 1M8PA 4IOMA 1PLLA 2HLDA 2I3BA 1ZNWA 4PQFA 5JWHA 4HEJA 3CX8A 2UKDA 4RKEA 2ODWA 5KYKA 1XWIA 3EWAA 4P4SA 5FUXA 4BPBA 1IXZA 1UFQA 3IBYA 3ASZA 4DSOA 2W83A 4E03A 3EZFA 1VG9B 2PEZA 3A1SA 1U8ZA 1GVNB 2OG2A 3GD7A 4GOJA 2N46A 2ZE5A 1XCGB 3AKCA 4URXR 1XXHA 2OESA 1CJMA 2ZQ5A 4BLOA 4D0LB 4EDHA 3J81k 2GXQA 3LWNA 3I32A 5JJIA 3GLIB 1NP6A 2XX3A 4HLUA 4ZCIA 4TL9A 2H5EA 1JEEA 3BC1A 4I1SA 4C0SA 5C2JB 4FMBB 3FDIA 3IILA 3W6PA 4PPFA 1JI0A 1G18A 2EQBA 1EX6A 4B3FX 3BD9A 4NCJA 2C9CA 3CR7A 4TTRA 2ZJYA 1VCNA 4PO9A 1S0UA 4CYMA 4A2PA 4BQSA 1W44A 3FPAA 2B7BA 3UK6A 1C1YA 3CX7A 2CL6X 3MJRA 3QPWA 1RRFA 4CT4B 2PEYA 1E1QA 4G5OA 4TWZA 3VQTA 3RS5A 4JSYA 2V9PA 4HB2A 2F6RA 1WB9A 2PLFA 2FSIA 3M6AA 3Q7QA 3OZXA 3OEHD 3DPUA 4B2PA 5HPYB 4BEBA 5EP2A 4IEEA 4DEXA 3Q5DA 4DRZA 3W6OA 2OFOA 1TU3A 3LNCA 2W6JD 4WZBE 4Q7KA 3AP1A 1G7CA 3DZDA 2CHGA 4MGKR 1QHGA 4QC2A 3U7FB 1E2QA 1ZC3A 3AF4A 2QRNA 3M0EA 4M0LA 2HYDA 1OH6A 2A30A 4W7SA 2WMNB 1E2LA 1MO3A 1II9A 3T1OA 5KOYA 2BBSA 2WHXA 4OQLA 2YWGA 1P2UA 1SHKA 5L3SA 4WW0A 5EE1A 3DM9B 5JS7A 2JA1A 2ZRFA 3B1XA 2GAAA 2WKPA 4YMVA 3SQWA 4MYHA 2A7QA 2RGAA 4LX0A 4QGFA 1G7TA 2FSHA 3CRQA 4JLJA 3SJZA 4A8JC 1H8HA 4D4KA 3I5XA 1GFIA 4C7OA 2NQ2C 221PA 5G53C 3ZS9A 2V8OA 1I2MA 2A5FA 4IDQA 1G64A 4C0KA 1QZXA 1XJQA 4IJMA 3OHMA 2Q3HA 3X2SA 5SZHB 4EFMA 4BFTA 4LV8B 3WYGA 3NTUA 2RGCA 4HLCA 4C3ZA 3K0FA 1AS2A 2BC9A 2BBTA 2ZJOA 4DLUA 1JBKA 5L3QA 2ZI3A 5CYPA 1OYWA 4IKEA 5EE0A 1ZD8A 2YC2C 2F3TA 2ZYVX 1ETUA 1ZM9A 3ZGXA 3PIRA 3K9GA 1U0HC 2DWPA 4ZI3A 3QVUA 3TR5A 4NPHA 2QE7A 2QPTA 3GJ3A 1CIPA 3NC1C 1DVRA 5HKKA 2E1RA 1GNPA 2GESA 2GTPA 1G8FA 2O8FA 3AH8A 4QNRA 5LD2B 3THXB 4MUAA 4HB0A 4YDSA 1FNMA 1R8SA 3G5UA 2O8DA 3DEFA 3BB4A 4P4UA 1RRPA 4EFNA 2EWVA 3NVAA 3HWSA 1XXHE 3HJNA 1NJFA 1KMHB 3GJ6A 3EW9A 2YYZA 4B71A 1R2QA 3QKRA 4QL3A 5DIFA 4YMSA 1U90A 3AB3A 3DVLA 3KX2A 5HTKA 4D4JA 2VF8A 1DAMA 2GJ9A 2OE2A 4GZLA 2QT0A 3EZ2A 4DHEA 2FU5C 2C5LA 2F55A 4RD0A 4BZXA 1E79D 2YOHA 2AD1A 3M4YA 5G3YA 4U7DA 2IUTA 1YRBA 3ND8A 1KY3A 1FP7A 3KB2A 2ZYUX 2RGGA 3B5JA 3OE7A 3LV8A 1OF1A 4E22A 3HR8A 3CRRA 3LDAA 4X8LA 3PVSA 2XITA 2WPDA 4TMTA 3RWOA 2QTVB 3AF2A 3FB4A 3QBVA 4URWR 2MSEB 2RGNA 3GLFB 5HZHA 1NF3A 2BWJA 3RS2A 2YWFA 2GZDA 1JEDA 4PANA 2VTKA 4R2HA 3LXRA 3NEYA 4PZZA 2OV2A 2ZRNA 5FBRB 3QNUA 4JSTA 1EWQA 2VP9A 1AKEA 4JVNA 1G17A 3MG9A 1KI4A 1CJTC 3GLIA 1DEKA 2BV3A 1MRSA 4Q4AB 3CNOA 2V3CC 2AR7A 1RYHA 4C0AC 3WNDA 2FSFA 1TEXA 4MGYR 4OI1A 2ZJ8A 2GCPA 2F3RA 4AK9A 4ZCMA 4F4CA 3G82C 4AWXA 1AQYA 3EIHA 1PLKA 1TQ2A 3BOSA 4PXAA 3ZVLA 2RCNA 3P1JA 3TW4A 5B30A 3F5FA 1G7RA 1W4BA 1U99A 1G41A 1ZD1A 2RKOA 4TYPA 5IK2D 5K8TA 2AKYA 2J0UB 3EA0A 1BMFA 3IBGA 1CR1A 2XNDD 4UNSA 4YONB 4DLRA 5E7MA 4XIGS 3E2IA 5H68A 1KIMA 2IYVA 1AZSC 4B6EA 4ZV4A 1COWA 3SR0A 4YMUA 2ZRIA 4IW3B 2P3SA 3CF6R 1BYUA 4IXMA 1R0YA 4MUBA 3U3RA 4TTPA 2D2FA 1Z0IA 2QP9X 4TTQA 4WOPA 3TJZA 3TW8B 1VYTA 2ZE7A 3IIKA 4KVGA 3SYNA 4EPXA 3VTKA 2AXNA 4ZPXA 2IF0A 3GJ8A 2KBFA 3QKSA 1Z28A 2GBLC 3L0OA 4ZIRA 3QENA 2H1LA 4P33A 3EC2A 1AJEA 2ERXA 5GJBA 2KBEA 4AY2A 5EUMA 1X3SA 2PH1A 3CPJB 4B43A 2GEVA 1TL7C 2ORIA 2PMDA 4ON9A 2X77A 2ZSEA 4NBSA 3THWB 5BYKA 2V1UA 2WWIA 1XD2B 5EZ6B 1Z0FA 1Z47A 1OSNA 2CLCX 3ASYA 1Z07A 2ZS7A 4ASUA 1Z6YA 4CZ2A 3A1TA 2RB4A 5K8UA 2WTUA 1ANKA 1MO5A 3GLHB 1GWNA 1TF5A 2XSZD 1EWRA 1XEXB 4NONA 2JLXA 3QPUA 4M9QA 4BEJA 4TMXA 3JVUA 4UJ5A 4TMZA 3ZQ6A 4GMDA 3AVVA 3W3ZB 1NBMA 1KAOA 1RZ3A 2GVDC 3DOFA 3REGA 5JJKA 4LJ8A 3A4LA 1OT3A 1N0UA 1GG2A 4IEIA 1W0KA 4CT5A 1SULA 2C99A 1ZC4A 2CXXA 4QM6A 4C2UA 1JQLB 2NGRA 2P6NA 2NO0A 1ZM4A 1QHIA 3U7GA 1WBBA 3U7EB 3ADCA 4ACBA 1T5IA 3CX6A 5EQTA 4BFUA 2R8RA 3NBZC 1E9SA 1CRPA 1UEJA 1FOEB 1NI3A 1JAIA 4XD7A 4EQ6B 4Z1MA 5AUOB 2IYQA 2PX3A 3CLVA 4KFRA 3CW2A 4TLEA 1JB1A 1NY6A 2YVUA 3FMPB 3GJ0A 1Z0AA 1GDDA 1P73A 4JYCA 1JR3A 2J59A 1F48A 2C78A 2DY1A 3R7WB 2PBRA 3SZRA 3SYKA 1ZNYA 3FVQA 2PT5A 4FINA 4LHWA 5GJVC 2XEXA 1J8YF 2ZROA 1YZGA 1BYIA 2C8VA 2WZQA 1XTIA 3A8TA 4TL8A 4MITA 3W5JA 1KMQA 2C9OA 2WJGA 4C0HA 1TPZA 2DBYA 4TZ6A 3LLMA 1ZBDA 2W0MA 4YQFA 1KSGA 4HATA 1YQTA 1GAJA 1KI8A 3UPUA 1J7KA 1IJEA 4KYIB 1GRNA 4LBZA 3CNLA 4PHHA 4ARZA 2WOJA 5LBIA 3KQLA 2BMJA 3GLIE 2C95A 4IFEA 3KFVA 2CK3D 3PEUA 3EASA 5FOTA 2FX3A 4L5BA 4DWJA 4I99A 2AKAB 3H0KA 1CRQA 3EZ7A 4O3MA 3AP2A 2QMUA 2R6CA 1N6RA 3OFND 2IWRA 1VECA 3N70A 4TYYA 4HLUC 421PA 2JJ1D 2HV8A 3B60A 3I72A 1GRQA 5TY0A 1NVVQ 4LC1A 4JVLA 3KXIA 5BWMA 5JMTA 4Q18A 2IS4A 4JLKA 2OO7A 3P26A 4Z51A 4Q9LA 5KO2A 2IEYA 3L82B 3ADDA 3GLFA 5DI3B 4PPNA 2FF7A 2REXB 2YC4C 1HV8A 4FWIB 2NG1A 4MKIA 3SBEA 4Q9HA 4I4LA 2WKQA 1Y3AA 4LJ4A 1ZNXA 4QXAA 4B2LA 1Q0UA 4NDZA 2O8EA 3EX7C 1X8LA 1OJLA 2Q3FA 3PUWA 4LY6A 5J4KA 3P20A 1SVOA 2G0NA 3WXMA 4ABYA 4B3BA 2VSXA 5JCPA 1US8A 2CLDX 2Q9CA 1ZNZA 4JMPA 4R71A 3JZAA 3KKMA 3AF0A 4CEIA 2ZYTX 1VIAA 1XFAA 2VHUA 4US0R 2JCSA 3Q7PA 4JKYA 4BLRA 2J7PD 2J0UA 4RCYA 3DMDA 2R6AA 2O52A 2OFXA 4Q1AA 4UJ3A 4IDOA 5BW8A 4KITB 1FW6A 2ODBA 4IOLA 3SN6A 721PA 2F7SA 2X2FA 1KO1A 1CR4A 3ZZ0A 4MRRA 1RE0A 5B2ZA 5IRCD 2IYZA 1P61B 2J0QA 3L0PA 4LZZA 4H9GA 1JJVA 4KFSA 5FTLA 2DHRA 3B9QA 2IX3A 1SXJA 4PC1A 4UXIA 4YC7A 2ZIAA 2FZLA 2VF7A 2AL7A 2QROA 1Z0DA 4HDQB 5AUQA 3SDZA 2IC5A 4O0MA 4EPTA 3CPHA 1U9IC 3FMIA 1W4CA 3K0CA 1GKIA 5FPHA 3UG6A 3GFTA 1QHNA 4A6XA 1TQ6A 4V0LA 2FH5B 2HXYA 4OQNA 2WWFA 1UF9A 4R7ZA 2QMEA 4LOAA 2RHMA 1AK2A 2AWNA 2LKCA 3NG1A 4EJSB 2QEQA 2Z83A 1PZNA 2GK7A 1XD2A 3P4XA 5LB4A 1JR3E 1EXMA 1OV4A 2IHBA 4PX9A 521PA 4AG6A 3A36A 3TSZA 3QF4B 4HZUB 4BFYA 4M4SA 4FW9A 3EIQA 4WAUA 1XEXA 1IAQA 5JHHB 2O0KA 4BGDA 1U81A 4WXPA 2VHJA 3BAFA 5CITA 3BE4A 1AKYA 4D26A 2JLWA 1YR6A 3BFKA 1Q21A 3ZH9B 2OCAA 2ZR9A 3FKSA 4B74A 5F9HA 4CDGA 4KXFB 4B48A 2ZM5A 1ZU5A 1DARA 2ZI4A 3WBJA 2WWXA 2Q0HA 2XZLA 3NBYC 2ZUDA 4A0HA 3TKLA 1GM5A 1M6NA 4FI3C 1II0A 1MO4A 4HLDA 1XP8A 4URUR 3W34A 2A5JA 2Z43A 4EQ6A 5KDOA 1DO0A 4OK3A 2C03A 2IYXA 1UKZA 1EG7A 3VX3A 3RWMB 3WYFA 4LYJA 4AG5A 2A3RA 3R7WA 1P5ZB 3NIBA 1MOZA 3KZ1E 2DFTA 1Z83A 3C7KA 3KTAB 2DWOA 1W7AA 3IIMA 1M74A 3BFVA 1AZTA 4TMWA 1AQUA 2AK2A 3A4MA 1IXSB 1P62B 2EVWX 3U3JA 1Q20A 3GLFE 1HE1C 2QQ0A 4ZDJA 1KDRA 1W4RA 3HPRA 2RHDA 2FGJA 2PL3A 3W8RA 1ZVQA 3W6NA 4TT3D 2G83A 3WP0A 2Y8EA 2D7DA 4A0FA 4BASA 2XJ4A 3VR4A 4KFTA 1J90A 1W47A 3LH5A 5AK0A 3T35A 4Q01A 3ICQB 3CF2A 1MKYA 4G5RA 4PHFA 2P5TB 2W2XA 2AXPA 2ZRDA 4P32A 3U6KA 5DO9A 1LS6A 4QGAA 1SZPA 2KB0A 2VQSA 1A2KC 1UBGA 2ZR7A 2ZYWX 2R6FA 3BORA 3K09C 2QGZA 4LJ5A 2LKDA 1OH5A 2QP3A 4X8HA 1TTTA 5JWOA 2B8TA 2BDTA 1KHTA 1CULC 4HUTA 2P6RA 2W58A 4PAQA 4LGMA 1W5SA 5FFMA 4B35A 3H4MA 3WNBA 3NEJA 3RHFA 1XPUA 1XF9A 3T1TA 4KI0A 3U2QA 2ORWA 2O5VA 3RRYA 5JCZA 4M1MA 3E70C 4JJZA 4KLZA 4LPSA 2RAPA 4IXNA 1G3IA 3QXJA 1U94A 5KSPA 2QAJA 4P0TA 2JDIA 3PQCA 4RZ3A 1OXUA 4PPQA 3WMFA 4R2IA 1XTRA 4DIDA 4TMKA 1KJWA 3B2EA 3EPLA 2FPLA 4BLPA 1HURA 1OFHA 1YZTA 2C2HA 2Q3MA 2CL0X 4HUQB 5TARA 1NRJB 5CB6A 4G5SA 4KAXA 1P2VA 3RDPA 2CE2X 4N1AA 1E32A 2EFHB 5AJYA 5DI9A 1ZUHA 2OT3B 3AGQA 4GP6A 1XDBA 5K8IA 4A82A 1RYFA 2KI5A 4PSAA 4BLSA 1AGPA 3GJXC 3TH5A 1VTKA 2V4ZA 4AURA 5GVSA 1W2HA 3X1DA 4DVGA 4A36A 2WWHA 1E69A 2ZJZA 2QPAA 4A0GA 4BZPA 4IHQA 2Q21A 3I4LA 1XMIA 2ZVPX 2J0VA 1OKKD 3MWJA 4WVFA 2QGNA 1OW3B 1Q3TA 3GLHE 1GL7A 1GIAA 3KJHA 4E09A 1SGWA 5FBQB 1NKTA 1ZJ6A 2QL6A 1Q1QA 2VP5A 4FXPA 5LDDC 1Q57A 1QBKC 2VL7A 4AKIA 4G3XA 4J0QA 5CIWA 1MO6A 4HAYA 3WRXC 4HAXA 1G3QA 4NYIR 2R44A 5D3QA 2BMEA 4DLTA 3B8HA 4GOKA 1UBFA 4TSFD 3I73A 1T0HB 2VPPA 4JBYA 4I1VA 1S9HA 4M8NE 2XZPA 3V4FA 4DDVA 5M04A 4IOJA 2J41A 2P2LA 3KFXA 5CLLA 1KNQA 1D6JA 2IYRA 5HE9A 1DAEA 3MLEA 4IVRA 3ECCA 4TL6A 3RNLA 3VX4A 3NDPA 3TLXA 1Z22A 4A92A 1E94E 1DAKA 2C04A 3AV0B 3Q8XB 2IBMA 1L7VC 1X8KA 4PC7A 2RGBA 3QF4A 3QY0A 4HZUA 4UNQA 4Y0VA 3P32A 2WBLC 4BRWA 1ZINA 1A4RA 1Q1ZA 2QBYA 3SHFA 1DAFA 3LY5A 1Z63A 4A6PA 3OF5A 5SZIA 1W36B 5D3MB 2CCJA 1E79A 1SKQA 2ZAMA 3ADKA 4NE2A 4NCHA 4FN5A 4ZCLA 4D0GA 5CLQA 2RH5A 1VHLA 2XZOA 5LD2C 1QHYA 5J4LA 2O8CB 3TSOA 1FUUA 1NN0A 4D81A 4DLYA 1ZCBA 2PJRA 3PUVA 1IN8A 3NBFA 6Q21A 1WE2A 2C77A 1E2JA 4GMXA 4O2RA 2XGJA 1GOTA 3KB1A 1E1RD 1VDZA 3AVQA 3QG1A 1WP9A 3I3SR 4ZDKA 4WXRA 3D7MA 4B32A 4EFLA 4LHXA 1HT1E 4HDCA 1T3SA 2B21A 1NVXQ 4LPKA 1OXXK 3KTAA 3QJYA 4MQBA 5DE3A 2WJIA 2JJ2D 2BMDA 4NYJR 2O0HA 3U60B 2VIIA 5CDFE 3GMTA 3PITA 4XJXA 2IYSA 4Q7MB 4CVNA 2ZJ2A 3CF0A 1XTJA 3AVPA 3X1YA 3UKDA 3IDQA 3EAQA 3MSXA 1N25A 2WAXA 4QM7A 1QDEA 1OIXA 3HU2A 4BFZA 1RVDA 1N6NA 2UZ3A 4Q4HB 1BIFA 1W2GA 3QPVA 3UIEA 1G8GA 2J5XA 2XNDA 2VHTA 5G40A 5FUYA 1ZIPA 5EP4A 5JRZA 1B0UA 1T0JB 3B1YA 2PLRA 1SVSA 4B34A 5J4YA 4BWYA 2HF8A 3FE2A 2FDCA 4DCSA 3L8YA 3C4JA 2ZRGA 1N6PA 2O8BB 3CZQA 4CEJA 4IVPA 2ATXA 2J9RA 3QIAA 4NKRA 1GRRA 3BERA 1M2OB 1KO5A 3LO5A 1G3MA 5KU1A 4OHYA 5KSOA 1W5TA 4XVQA 2A2ZA 3BIFA 1ZUIA 4XTRA 3M1IA 2OBMA 2V7QD 1T4GA 3PUZA 1NLYA 5BQ5A 4P3YA 3O8CA 4FWTA 1OIVA 3CPEA 4V0KA 2WIAA 1OB2A 3A1WA 3A37A 5ELXA 3IQXA 1MR3F 1XJ0A 3R9XA 1L2TA 1U8AA 1D9XA 4HUQA 1SXJC 3B13B 5DYGA 5C4MA 4DLWA 4S2EA 2WOOA 4Q4JA 4PZLA 2MSDB 1GTVA 1LW7A 2QRZA 1IHUA 1NMYA 2IS6A 3KXLA 2GKSA 2PZGA 4B44A 3AF3A 3A1UA 1RKBA 4DSNA 3TUIC 5FOWA 1XTQA 3IPXA 3C5HA 1Z06A 3K70C 3I62A 1JPNA 5KHOC 3W90A 2V6IA 4HI0E 2OBLA 4MGIR 4JLAA 3LX8A 3QEOA 2EWWA 2HLDD 2NZJA 2DWQA 4URVR 2F1HA 1OH7A 1KI2A 4CEHB 1EK0A 3MMPA 2ATVA 5J40A 4LBYA 2QTHA 1T3LA 2QUZA 2X2EA 3CUEF 1N5JA 3F0TA 3U4QA 3AVWA 2W2TA 3ETLA 2HEIA 1SKYB 1PLJA 3Q5EA 4IDNA 1AA9A 5CM9C 4MYUA 1PUIA 4BLTA 5HE8A 2DFNA 3OEEA 1C9KA 4EAQA 4URZR 2BEKA 3X1ZA 1E2GA 4XTCS 1G8PA 2NPIA 1EFRA 5KDLA 2VP6A 1DE0A 1WDTA 1H8EA 1KSFX 3MD0A 3GCGA 4HB3A 4Q1EA 1PJRA 5EXTA 3ND9A 3EC1A 4PO8A 3ZQJA 3U3OA 2EYUA 3MWKA 4XSGA 2BM1A 5TVKA 3B1VA 1MH1A 3T12A 2ZXUA 5FTKA 2OHFA 1C4OA 4ZKDA 2J7KA 4DEYA 3N5CA 3OIYA 3I92A 4RD2A 4Q5IA 3FKQA 3WYAA 1KI6B 1DG1G 4ZI2A 4MKHA 4X8OA 5D3MA 1BKDR 4KSBA 1P72A 2GCOB 4GOXA 3O8RA 1XMVA 3GEHA 2BCGY 3OESA 4B3XA 5F98A 4KCGA 4A8JB 4RD1A 3WHKA 3OIWA 2CHQA 2ZUBA 4L15A 1E4VA 3MJHA 2QY9A 2UZIR 4HDOB 4M1SA 1DBSA 1YE8A 2FFHA 1KO4A 2JEOA 3LBIA 4CW7A 3SFVA 2LCFA 2OAP1 1A2BA 4Q7JB 5JS8A 1NKSA 1YJ5A 1M34E 3ZVRA 4EPRA 1ZAKA 1Z6XA 4TZ0A 3TQCA 5AWFC 1QHXA 2CLSA 2ONJA 1S8FA 1G6OA 3W3AA 1E2KA 4X8MA 5HZKA 5CYOA 4AKGA 2GXAA 1K6MA 2R65A 2QNRA 3VMFA 4DIEA 1G9XA 4QGGA 2E9SA 4LBVA 5E7JA 3BK7A 3VR6A 4F4IA 2GK6A 1X6VA 2F1RA 4UXHA 1KDTA 3V9PA 4DT1B 1YZKA 4Q4HA 3VR5A 2J7PA 1IN4A 5AJXA 1BO6A 2VRWA 3BFXA 5FI0B 4KVAA 1VCIA 3QXSA 2NZ8A 3GEEA 2H92A 4XVRA 2MSCB 1LB1B 5JBQA 5G3ZA 2X1VA 1P3JA 2CNWA 3C5CA 1Q1EA 4MDFA 3GFOA 1GNQA 3QUSA 4NCIA 3VR3A 1DADA 3MFYA 5FR2A 2P6UA 2O8BA 3BWDD 4M9SA 1SVKA 5JZVA 2MMGA 4LYAA 3U5ZB 4RCZA 2QE7D 3PFIA 2JIZA 4LHYA 1F2TB 5BXQC 5HKKD 4W5WA 1E9DA 1T9HA 4P4TA 2HJVA 3RC3A 1TUEA 1NY5A 4JLBA 1HA3A 2DFLA 1CS4C 1HQCA 4TYWA 1E0JA 4ILEA 4G0NA 4Q03A 4W5HA 2Z0MA 3KKNA 5FTNA 1F2UB 1KZGB 4M1YA 5CIQA 4ZDIA 1A5TA 1KSJA 4NP6A 1WCV1 3I8SA 4Z8XA 1UAAA 1UDWA 2XB2A 4OI4A 4LK2A 2FZ4A 1FZQA 1SVWA 2J46A 3SQXA 4M9XA 3THXA 4YDHB 1KAGA 2D74A 4Q48A 1CLUA 5LPNA 5E7IA 1KDOA 3TUJC 4FCTA 2QU8A 3ONWA 3ZIAD 3CO5A 1YHNA 4RD3A 2BBWA 1VHTA 5TMPA 4Q9JA 3OE7D 2BJVA 2PCLA 8OHMA 1RC8A 2ZRLA 1JNYA 2PX0A 1KMHA 2GDJA 3K8YA 4IVQA 4LRWA 5JEDA 1JAHA 1S3SA 1P4SA 4C0BA 2EFDB 2WPDD 3THYB 4PPGA 3LAWA 3QXXA 2WWWA 4CEHA 3AEZA 4US1R 4NZYA 5DISB 1BH2A 4TLDA 1U0JA 4YXWA 3ZD7A 1OIWA 1S3GA 1OXSC 4GPTA 2F1IA 4GFDA 4FD2A 3UMFA 3RLFA 2PT7A 5IDVA 3TR0A 4JLOA 1IY2A 2AD5A 3EA5A 4LC0A 4LV5B 4DCUA 2R6DA 1TQDA 3B78A 2XXAB 3UG7A 2YKGA 1HT2E 1N5LA 1KOFA 1CP2A 1GITA 4QJ3A 4IFBA 3WNCA 1ELOA 3CRMA 2WAYA 4PC2A 1V5WA 5C4GB 1TQ4A 2DPXA 1IN5A 1CJKC 2BKEA 3HR7A 4B47A 3I5YA 3K9NA 5FL7A 4Q7LA 2RGDA 4QFMA 4G1UC 4QHSA 4JZKA 3I8XA 3BS4A 3HP1A 1W48A 1ONBA 2IL1A 3NH6A 4C4PA 1Z0KA 2N1BA 3F3YA 4KBGA 1E96A 3T61A 1D2MA 5KNCA 1BMFD 4L16A 4Q4AA 3CH4B 3RS0A 1W0JA 2FEMA 1COWD 4B3CA 1CJUC 3OAAA 3TNFA 5L8VA 1RRCA 2W6ID 1S9DA 1KI6A 2CEAA 2WSSA 4KHZA 2GJSA 2GCOA 4DLZA 2QAGB 1KGDA 1LFDB 1KK1A 4PAMA 3C16C 3T1QA 4GZMA 3E5HA 2FFBA 3H84A 4TL7A 4PFSA 4GDFA 3KUCA 3SFZA 1NLZA 5C46F 1FL9A 1HUQA 3CH5A 5KDDA 4WZAE 3AVUA 1VCMA 2YNMA 4D25A 5IT5A 1ODFA 1RJ9B 2MMCA 2WJJA 4Y0AA 3QXHA 4XWKA 4TQUS 2NOAA 2QA5A 3L0SA 4NYMR 2FE4A 1G4AE 3GJ5A 4RFSB 2ZVQX 4D82A 4XVUA 2CCKA 4V0OA 1XEWY 4M2LA 1J2JA 1SHZA 1Q22A 3MAAC 1NJGA 1RPZA 2XB4A 4QHTA 4QJ5A 1CJVC 1YR8A 4I81A 4PO1A 2YINC 2ZJ5A 5DN6A 3K0EA 3C14C 3OIUA 4TLCA 1AN0A 1XEFA 1I4DD 2GXSA 2ZSFA 4JLDA 1NBMD 4MYTA 3IEVA 1X1RA 3T5DA 3THWA 1FQKA 5EXSA 2I1QA 1OXTA 5FOSA 1W0KD 5BYJA 3ZDQA 3VR1A 4US2R 2WJYA 4DT1A 4DLSA 4BECA 1F60A 3LBNA 3KQUA 4B3GA 1KO7A 4BFSA 3KJGA 2BHRA 1HEIA 2HYIC 3GLHA 1OKKA 2XOKA 2K5UA 2NO9A 1E2PA 4II7A 4XD7D 2ZR0A 2F43B 1QHSA 2QTFA 5EP3A 4Z1MD 4C2TA 1OHHA 4DSTA 1XCMA 2OSBA 2Z4SA 2EW1A 5KPDA 3SS8A 1G4UR 3AKYA 4KLNA 1E3MA 1XCPA 2JATA 1E2NA 4JVMA 3X1XA 1NN3A 2QORA 2E87A 3SC3A 4DJTA 3U61B 2BEJA 2CHVA 1X1SA 3KL4A 4PQRA 2B6HA 3NH9A 2FPKA 4Z54A 5GADl 3H2YA 1E98A 2IF2A 1N5IA 1ZYUA 4DUGA 1NSFA 1EGAA 1F2TA 2VEDA 2WM9B 1TEVA 1E9FA 1JPJA 4Q66C 3LBHA 4KSCA 4OHZA 3RABA 3TBKA 3ZJYA 4QKQA 2D7CA 1OB5A 1OXVA 3DHWC 2IA5A 3B9PA 2F1JA 5EE9A 1HH4A 1XPRA 1E9CA 2WKRA 1F2UA 4JT2A 2J87A 1SKYE 3LQQA 3WMGA 1DOAA 1LVGA 2P5SA 4M1WA 4GL2A 4PC3A 4M9ZA 1A82A 1IN6A 1MT0A 3CR8A 3MCAA 4RD6A 1R5OA 4U00A 5AR1A 4RVCA 3RSOA 3SI7A 4M21A 3JVVA 1U98A 3BH7A 5G41A 1KO8A 2IEZA 2ZITA 1EFTA 4B2IA 3PENA 3ZZTA 3AP3A 3R20A 4NMMA 1P9NA 2OLKA 1I4LD 5AJWA 3D6TB 4AIIA 2RGNC 2ZREA 4RZXA 1II8B 2FJUA 2B7CA 3MWYW 3NXSA 3THYA 5H70A 4A9AA 2JASA 2GAOA 3X1WA 4CRWB 2ZE6A 1WXQA 2IYYA 1FUKA 4GBMA 1NSTA 5JHGB 3TK1A 1CXZA 4WA7A 2Q9BA 3QI2A 3AVTA 1R5NA 1ZM7A 5FOXA 1VYUA 3OEHA 4B76A 2ZSAA 5HR5A 3VNVA 1E2EA 1Z0JA 2HT6A 2N42A 4RFVA 5KUTA 5FPYA 1G5RA 2HDNB 2XXAA 4LI0A 2VLIA 4L8GA 2AX4A 3RRZA 3HU1A 2W2VA 5DSZA 1VG0B 4RSGA 4LDJA 1YKSA 3AGPA 4MH0R 4U02A 2W6JA 5CDFA 1KI1A 3WP1B 1P6XA 3EARA 3VR2A 4CF7A 4BFWA 1E0AA 1UPTA 1E9RA 2TMKA 5DI3A 2IXGA 3A6PC 1WMSA 3SNHA 1TX4B 4M53A 4FCWA 4NHOA 4EPVA 2VA8A 2XNSA 5JECA 2JGNA 4UNNA 4JVSB 5HCNA 3W8NA 3U44B 1NMXA 4O2LA 1UM8A 4MRVA 1Z3IX 4TN1A 5IHPA 4G5GA 4OHWA 1S96A 3W5IA 3EIEA 2EYQA 1XJCA 5TDHA 1M1YE 3GPLA 3K0FB 1IONA 4GNKA 4PSVA 2GF9A 3LVQE 1L8QA 4LV6A 5A4JA 2QAGA 2ZANA 1ESNA 3AKEA 3EZ6A 5GJCA 3U7HB 3K9HA 1SXJD 2ZRCA 3TGPA 3N2IA 1K5DA 4C0JA 1XTKA 1ZUNB 2HF9A 3FFBA 2JLZA 1KK2A 3DMNA 2ZEJA 1JR6A 3GP8A 2IK8A 3K53A 4OHXA 4RD4A 2V54A 2YWHA 5DHAA 3HPQA 1F6BA 4QRHA 1QG4A 1UKVY 1TUIA 1FX0B 1Q1BA 2ZSBA 3B1WA 2G0TA 2CVFA 2P67A 5CJ2A 4K8OA 2H7VA 4Q1FA 3K70D 1G3RA 4B73A 4LJAA 3RC8A 5GJWC 1RJ9A 2OUKA 1JALA 1WF3A 3ZZUA 4HAWA 4IDHA 3AVXA 1KYIA 3E1SA 4WIAA 4EKDA 5L3VA 1U2RA 3SYLA 4RFSA 4UKDA 2IUSA 2OILA 5FPKA 4LJYA 3NBXX 3DKVA 1P2TA 1I4TD 3T5GA 3HDTA 4GI7A 3IHLA 2QZ4A 2AFHE 1M7HA 1VKJA 3Q85A 2O0JA 4QJ4A 2CCGA 3KUDA 4C0LA 2FV8A 2ECKA 2SHKA 2CMKA 3D31A 3FGNA 3RRMA 4IRUB 2FSGA 2JLUA 4M1OA 4EJSA 1IJFA 4TMVA 1WBDA 4EIWA 4LWZA 4ESHA 5KPJA 4DLVA 2L0XA 1GUAA 1ZM2A 3AUXA 3FKSD 1KTVA 2ZETA 2ONKA 1GNRA 1E9AA 2QI9C 4EPYA 4EPWA 4JKIA 1R0ZA 1UKYA 4LJ7A 3WHLA 1EX7A 4XOIA 2V6JA 3FMFA 5EXXA 2J45A 4OI0A 2F43A 3BH6A 4PQYA 4PSKA 2FG5A 3BGWA 4JL5A 3RRNA 5CJPA 2EFEB 3DDCA 4DDTA 4IDPA 5FUVA 2R6GA 3KJEA
chains in the Genus database with same CATH superfamily
1OXMA 1N6LA 1T9GR 2PA3A 1W30A 2QD1A 5CXSA 4CN9A 5FOQA 3ZLJA 5IBQA 3ONVA 4FR5A 1H6DA 3CY6A 3RF6A 1Z4MA 1BMTA 2ZAOA 5LZ2A 2Q3LA 2H1RA 2J6CA 5JI3E 3C98A 4CNBA 1N2CA 2HRCA 3CTMA 1P0CA 1VIVA 2YHIB 4AYTA 3W8EA 3PCRB 4UOZA 4XIIA 1PIWA 5J2UA 1N3BA 3PDIB 5EE5B 2VZ0A 1EDEA 2B9EA 3JAKA 4WJZA 3C45A 1IHOA 2OHVA 4Q39A 1ODIA 2Q6TA 1FXUA 1X0VA 3PGJA 3NXKA 5KEIA 5FL3A 1L3IA 3EGVA 2HA6A 5DRYA 3Q7IA 3KVRA 4KAFA 3F6YA 2YRFA 1TVMA 1TJPB 3GT0A 3RS3A 1K9VF 2MINA 4MCJA 4XASA 5IYZF 3NB0A 4B6PA 1NURA 2PX6A 4FFRA 5TT0A 1UC5B 3TZHA 2XCRB 1I32A 1Z6GA 3I61A 4QULA 5IDYA 4CF4A 1YZNA 1XBTA 2PGJA 1TZJA 2PVCA 3BRSA 3DO6A 4JS0A 3TVTA 5HM8A 2E82A 1V1MA 2HSGA 4D9HA 5A0TA 2XTMA 2VH5R 2ID9A 3MUOA 3UQYS 2H2DA 1PVVA 1GSHA 1XLWA 4FYYA 1ZQ1A 4JBHA 3VPXA 3ASVA 1CEEA 3CUKA 5HF9A 5AH0A 1AKVA 3CFYA 4N12A 1C1XA 4D6YA 1JZTA 1GQ2A 1N6KA 4D97A 5IK2A 1XPOA 3QZUA 3CSSA 3IHWA 3NWBA 3N8IA 2JFUA 4BFCA 3UAOA 5JNWA 4LCBA 1ACJA 2ZRAA 4GPIB 4RSHA 3WLKX 4ACAA 2RARA 5JFGA 3MJCA 5K99A 4JI2B 3EZLA 4BY9E 2DR3A 5D6NA 2CC2A 3VJLA 1RDFA 1YB7A 3ONNA 3M6UA 3KB8A 3HHEA 3D02A 4QICA 5JAHA 3KLNA 4L9WA 1CYEA 4FDLA 3AWIA 1ODCA 1R3UA 2D5IA 1DIAA 3P0HA 4OY3A 3R7FA 1QQ6A 2CBZA 3M5PA 3QUCA 3P2KA 3TZLA 3ZE0B 4XYMA 1IN1A 3IDSA 1VJ1A 4XPIA 1OLOA 1U2GC 3PT9A 3A9TA 3CONA 5KSZA 2NTVA 4F38A 3HYRA 3TF5A 1X80B 1ZRHA 4FB4A 3OJEA 2YTZA 1TKAA 3V4SA 3GDOA 1QUEA 4ROSA 3WFZA 3KPVA 1OWNA 4KGDA 4YNBA 3SHWA 3TRFA 5LP6F 1YR9A 3QE9Y 4KMOA 1OH8A 3A04A 3LDUA 1S1MA 4N0PA 1DTSA 1UINA 3D4BA 3ZW8A 4PZPA 4Q0MA 2QQFA 1ULAA 1XLTC 1TK3A 1PFUA 1CZNA 1XSEA 1ZU4A 3KZKA 4M89A 4O33A 3WGTA 3NDJA 5JAZA 4DR3B 2WWVD 2QTWB 1RRGA 2JLRA 5DASA 4MGHA 2WYHA 1EIWA 2XRMA 4WBXC 2WG0A 3R0IA 3BX1A 2UYYA 2DYKA 2XGGA 3U9LA 1D9ZA 2GA8A 4TLLB 1JLMA 3NI2A 1GFWA 1KAEA 4OMUA 3B6JA 2X7JA 3ZCUA 2JGLA 2YZ2A 2FWRA 1Z5NA 3NC0C 4RZUA 3OY2A 1KMCA 5BV0A 1Q1AA 4BYGA 4QO8A 1CJSA 1P19A 1UMKA 1ZUNA 2ZE8A 2QSZA 1BVRA 3ZU3A 4N8DA 2ZYAA 1P4JA 3H86A 3G8DA 1I01A 4E5KA 1NAIA 2C2BA 3TTWA 4BJ3A 3L18A 2ID8A 2JCXA 4CQMA 4NH0A 4D4LA 4KR2A 1DL5A 5KU7A 1OLUA 2FFAA 4G0QA 4H1VA 4WOBA 5CNIA 1G5QA 2ORVA 4UDXX 1LS1A 2QQGA 1NMSA 1WKVA 4ZZIA 1DINA 1ODSA 3WWYA 4F11A 1P91A 3LLVA 1R0XA 4R2KA 2CJWB 3AR4A 5KJ1A 4BNDA 2QVGA 2PSSA 5B3JA 3JD4A 3OCVA 3QOWA 3Q9UA 3TRDA 2P9TA 1D6SA 3NAQA 2BAGA 1CEYA 4F5DA 4FDMA 3NV9A 2PIAA 3DVSX 4FR0A 2YYYA 2FPWA 1JDZA 5G0VA 1DUVG 1RVV1 1V8BA 2I1LA 3SJBA 5HQ3B 1PWHA 1UEIA 3NJRA 4I5GA 4F9FA 1V41E 1JYEA 3D8UA 1DKQA 3NDIA 3RKRA 3NPAA 5KTYA 4Q4DA 2C1XA 2A9QA 2EERA 3GFBA 2MR6A 4DDWA 3LQ1A 5JNTA 5DJ5A 1ST3A 4EHBA 1Z2PX 2O2HA 2XKKA 2H1HA 5K4HA 4JB2A 2OECA 1BXRB 3H6GA 1JLHA 1Q14A 3I01A 4PQEA 4RJ2A 2KSQA 3TVYA 5JS1A 1HM5A 3HVIA 4NL4H 5F73A 3V1TC 4YP5A 1CRWG 2GHRA 5I01A 4JXXA 1JU4A 4ARCA 3KHUA 1KKMA 4MA4A 4HPJB 4NYJQ 4Z8YA 3SQDA 4DA8A 3UXYA 4HMPA 1J33A 1K5GA 1V43A 3FUUA 1YZQA 2GN2A 5AT1A 2VYFA 1MX3A 3D8RA 1QIHA 2FPIA 2PS0A 3L93A 5HQJA 4Q19A 1IVNA 2FQQA 5FOUA 3PUXA 1V35A 1OX6A 4PR0A 3KE8A 1U1GA 4MV7A 3EXFB 3H11A 3GIWA 2XVYA 2G36A 1E9EA 4BOYA 3HUUA 4UFOA 3C6MA 4DMCA 2FXVA 4H0NA 2VUIB 1HO3A 4P7FA 4DMUB 1KFCB 4J07A 1R1DA 1YDHA 4ZQFA 3WZLA 3BXFA 5U4QA 2PO5A 1HTWA 2PZFA 3JQ6A 4KO8A 4L8YA 1D5CA 1WQ3A 4DSAA 5BWCA 2O8CA 2WVAA 1PV1A 4J4BA 4KQCA 4O4JF 5C9ZA 4A1FA 3QITA 1LK5A 4BNVA 2I1VB 4EB6B 3SOPA 5B64A 3L49A 2BCJQ 4GRIA 1SCNE 4DV4B 3V8EA 2JAXA 1AB6A 3EQ8A 4RM2A 3MXOA 1QF9A 5JE8A 3M6MD 3CZAA 3U0BA 1P80A 4KYUA 3TQQA 1US8B 2X76A 3HA5A 3KXDA 1CQPA 3A1VA 4UUMA 2A5YB 4WXYB 3T3HA 3K1YA 2RKBA 1ORIA 1J9ZA 1EJ0A 1SBIA 3F96A 2X41A 4JP3A 4JUCA 2NNLD 4Y2YA 1NG1A 4AFNA 5EVCA 5F4BA 1H9BA 4LFAB 2ODNA 3TJRA 1YB1A 3D8BA 5DRTA 3WKAA 2DT5A 5EZYF 4JROA 4PFKA 1NVVR 3CUVA 2GEUA 1XD8A 2QW0X 1FYDA 4QWWA 1TKBA 1LF0A 2XCIA 4KODA 1HKHA 3TAUA 3N2GB 4DDTA 1X94A 4BUCA 3VKHA 2FQYA 1MUUA 1VL2A 1YZHA 3K6RA 2IXFA 1NHGA 2E37A 3ANSA 2QVZX 3F5DA 1B3RA 3SM3A 3U3KA 1KZ7B 3MCZA 1K3FA 2GCNA 1H22A 5KSYA 3H2GA 3S40A 2RI1A 2OB1A 1E3EA 2BHSA 2HWYA 2YV5A 1SXJB 3D81A 1V11A 4UNPA 3K9BA 2CKDA 4F2WA 4IUYA 3WWPA 5JSZA 1F6WA 2WVJA 1KQFA 4DQKA 1C9NA 2NIPA 3FF1A 5AKHA 3FFAA 4R3UC 4MLDA 3ZWOA 2APJA 1R4AA 5AUNB 1O6FA 4E5PA 1Y89A 3DOUA 4HB4A 4M8IA 1K63A 1NG9A 3BMNB 5KHLB 3D6AA 3NTLA 4L22A 2WICA 1NUUA 3CEMA 3DTNA 2VTVA 2SNIE 3F8TA 2AFIB 3H1GA 3CBQA 2CDNA 3HTXA 5C35A 1QUFA 3BE6A 3CLTD 5IARA 3BAZA 1WB5A 4UU0A 4HGNA 1N5OX 3IPCA 1F6DA 4EZIA 3T9CA 2FP4A 2BT4A 2LDXA 3EDYA 2GF0A 2WYUA 3SE0A 1W1WA 3BTUA 4DCNA 5JNRA 1GYPA 3BXZA 4QXRA 5I7FA 5LWHA 2PFSA 2XHZA 1NF9A 2HA2A 5FDFA 1M5RA 4KKVA 5E38A 3GHYA 3ZDBA 4MRPA 4C20A 4GPEA 2X8AA 4A2CA 4MPTA 2HA5A 1L1EA 2Z8YM 5A9SA 5T7BA 2ONYA 5DX8A 4CFSA 5BMVB 2V4MA 1CY1A 3I2HA 3WOHA 1DCTA 1UOOA 2F3PA 3L7KA 1RD4A 4XDHA 1ZOPA 1NX6A 1IQPA 3GXOA 3GAAA 1X7YA 5EKXA 4DBLC 1GUDA 3OQBA 4MWTA 4KR3A 3KBOA 4L1KA 2OEPA 1BHJA 1G4HA 4JBLA 1M1NA 2C31A 3BXPA 1XOIA 4TMYA 3DOEA 1MAVA 2PGDA 4PIPA 1HPLA 4WOJA 5EMKA 5JNVA 1ISMA 2JS7A 5BV8A 5CDHA 2KJQA 2IHYA 1JFTA 1FTSA 4L4UA 1G38A 4RKQA 1PTJC 1WHTA 3ITEA 2GD0A 1NC3A 1NIJA 3W2IA 4QUAA 4C03A 2AZTA 1K4KA 3GBSA 5E1OA 4KW7A 2L18A 2H1VA 1JG3A 4MW0A 1NXXA 5IZ4A 1ISFA 3FDXA 1WD5A 4YT4A 5ALEA 1SC6A 2I2BA 3QFRA 4JL6A 1N2XA 1WX1A 1UM9B 1ZLXA 2VK2A 5HF8A 5LYYA 3PPXA 1SCJA 3AB7A 4H18A 4XGNA 4QUDA 5A04A 1LTQA 1IBMB 3WIBA 3VU9A 4TKUB 1DBWA 1J56A 1UDRA 2GN9A 1X86B 3ME5A 1I5RA 3K0AB 1JR4A 2QW1A 3HXKA 1G5TA 3U40A 5EE3A 1LY1A 5FBVB 1TLFA 1H8ED 1OAOA 9MHTA 1JQ5A 2B5WA 2VUHB 2ZXEA 2AEMA 4B3HA 5BYBA 2DBQA 1XP5A 3PTZA 4OIFA 4C3UA 1E5VA 2YZGA 4UE3S 3W1WA 1AF4A 1T35A 4G1MB 5BURA 1E5TA 2DT8A 2JFHA 3QVTA 4R9UC 4DC0A 3Q8LA 2AI2A 2DKNA 3DUFB 4DCVA 1YJQA 4P3PA 2A78A 3AEKB 3DZ8A 2VHCA 4RVDA 3ZDFA 1VLLA 1O6BA 1OY1A 4I6JA 1H6BA 1GGFA 4NY1A 5GAJA 1C4KA 4LOIA 1JZQA 1HFWA 1YASA 2BCEA 3E5RA 4O4HF 4ZVKA 4PX2A 4E11A 4RTJA 1POWA 4IXTA 4DQLA 3KQQA 1IHPA 2YXLA 2ZUCA 3CXUA 4X54A 2DKFA 4AJHA 1ZR4A 3CNNA 3O31A 1ESMA 4F5YA 5MGNA 3VH2A 4NU5A 1TU4A 4G5QA 4TXJA 4BS9A 2QLBA 1CDDA 1O58A 5DBEX 3SJAA 2H1CA 4QTYA 4KV9A 1PWEA 3L4SO 1THMA 5E4FA 2X86A 1V3UA 3DHEA 5GM2A 1BX0A 1P9WA 1PFVA 2VDKB 1KS9A 3DXZA 3RTEA 2LIVA 3BH0A 3KKPA 3UICA 2RAUA 3JYQA 4MRSA 3OLVA 4DNOA 3DVAB 4ZDWA 1TMKA 4X1IA 2FY8A 3MWFA 3H2JA 3SC2A 9LDBA 3M4ZA 4IZIA 5HW0A 3UWKA 1S8NA 1T5TA 4DDMA 3GFPA 5E6SB 4Q1BA 4A8JA 2B92A 4PEVA 4WH0A 2WWYA 1N1MA 1B23P 1V6CA 4NAHA 1XHEA 2VHZA 3ANTA 2ERYA 4O4LB 4WNCA 4ZQBA 1ZH4A 3QX9A 2BL4A 1JX6A 3RU2A 3ZWNA 1SC1A 4RWZA 1P45A 1Q6YA 3CVOA 3W3AD 3JZFA 1AB5A 4F9GA 5IXSA 3I9KA 4MICA 5L53A 2CB0A 4Y6OA 1UJ2A 1BDMA 4OB8A 4OD0A 4F1JA 2Y4NA 4V3CA 5DH9A 5BXYA 7REQB 3VVMA 4J76A 3KKKA 1Q77A 3LYLA 4YO7A 5FH9A 4S0XA 4IIXA 1L5GB 1PR4A 4CMAA 1PJBA 5PNTA 4EGQA 2R5FA 4GKJB 1EM8B 4MYDA 4DNQA 1DHTA 3C74A 2DFKB 3UANA 3V1YA 2ID4A 4X45A 4DWVA 1I3OA 4RZ2A 3JXEA 2IEGA 1GCOA 1I3NA 1J42A 5GVRA 2YWDA 3WNQA 2AUMA 2JC3A 3E8XA 4LSGA 1M10A 4K6KA 2FXIA 4PTZA 4PTYA 1ECLA 1H93A 2P91A 4Q1CA 5H9WA 3PE3A 4GU5A 1L5NA 3G8BA 3RYIB 4FSHA 1T3HA 2NVUB 1CP3A 4YLGA 4F7WA 1X14A 5JI2E 3GJQA 1ETHA 4WLOA 2VN8A 2VJNA 3HDGA 1UMDA 4RFLA 3V4LA 1CY6A 2YOFA 5COBA 1XZLA 2I62A 3HKEB 4CL2A 1QTQA 2OXRA 5IBPA 3RSLA 3SF8B 4B84A 1Y1PA 3EPJA 1RADA 3TZEA 3AUSA 4RK5A 1CV2A 1AV7A 1NVMB 4GOMD 4R6WA 5F64A 3LQYA 1D4FA 4WFKA 1TADA 3BMOB 3BGVA 2UVQA 1RIIA 1G8HA 1R15A 1X3LA 4TLMB 4M36A 3WDKA 2Q6VA 1LLCA 5C3UA 2IUUA 4D0NA 1Q0TA 4B81A 1P2SA 1PAUA 2XQIA 1V39A 2XPCA 4AF8A 3OZEA 4QBIA 2P0EA 1GARA 1GADO 5LXTA 1XZQA 3G0OA 2JI4A 3DNPA 3T7DA 4ZA2A 3DBLA 3W5HA 4BMPB 4C1BA 3IP3A 1TT7A 2O23A 4H4CA 3BBLA 3JASB 4MS1A 3RYTC 1S1CA 5K0TA 4RL4A 2QTMA 5L7WA 2GBPA 5AHRA 5EMHA 1G3UA 1YB4A 5CA0F 1N8KA 3OQOA 4KWTA 1SD2A 2CL5A 2QJWA 5BWBA 3F5SA 4TSFA 5COQA 3EUFA 3ABRB 5F51A 5D2CA 2AOUB 3FUXA 3RS9A 1PG5A 3L43A 3WLFA 2VAVA 3LWZA 3TAXA 3QX3A 4JXKA 2OCLA 3HMKA 1Z35A 2AI3A 1QM5A 2R9VA 2RG7A 4TS1A 3TM4A 4MS3B 4Y67A 5ER9A 4J7UA 2O9JA 2VTBA 4E5DA 2WNIA 4GL4A 1AGRA 3M34A 1V8DA 2ZU6A 2C9YA 3FYTA 2PBFA 4KWHA 5FF9A 3RUPA 3WMRA 1YRLA 2HY7A 2IQ5A 3ZDDA 3KOMA 1DHRA 1HK7A 4DCGA 1Y4ZA 3R8CA 3JSAA 1G7SA 2JNWA 3OFJA 2EBUA 3DL0A 4BNIA 2HD4A 3ACBA 3E81A 4RBNA 3KQNA 1OFIA 1VHQA 3SKVA 3UJ7A 3O8QA 4UTXA 3HRHA 2OO5A 3AEYA 1KI9A 2JPDA 3QJGA 2FPGB 2HNBA 4H6WA 4LJSA 3SP1A 2H51A 3L1HA 1BXGA 1UXHA 3V7NA 5G1OA 4K81B 5H1YA 1RM0A 3VI3B 2FR1A 1LLQA 3PX3A 5IG2A 3FWHA 1FFHA 3I9LA 2QTRA 4EYQA 2PRKA 4UEWA 3QEJA 4L5IA 4BLQA 4D56A 4R9NA 4XWOA 1O6GA 4NICA 4GP9A 2G1JA 2LPMA 3EXAA 1VPLA 2VYVA 4Q4LA 4XB6B 3CRVA 3FYUA 1U3DA 2PXXA 4JQZA 3RYHA 1DO8A 1YXMA 4QPZA 4F93B 3HDHA 3ZG6A 4YPOA 3M49A 3HM2A 2QRVA 5G2OA 4EDFA 4MIEA 2GJAA 1Q7GA 1W5BA 2WZDA 3Q72A 3FAZA 1H6AA 2X19A 3Q11A 4LVUA 1F06A 4L3WA 5CYFA 5FL7D 2Q5JA 3SEAA 5KSWB 1Z6TA 3TX2A 4YMTA 5BOSB 3EFOB 1EFVB 1Y1QA 1SELA 1L4EA 2HFKA 3Q7RA 3QUBA 4UM9D 5ENDA 1O0BA 1LLUA 5H5JA 3W2TA 2ZULA 4HGRA 5JJLA 5INTA 4ETMA 4TYMA 3LGXA 1H2EA 5DNYB 3ZCPA 2AC2A 3GT4A 2YDXA 3IAM1 4JP1A 5K6AC 1A9XA 1W36C 2V7GA 2UAGA 4J0KA 4IZ6A 2H1FA 4INZA 5H9VA 5HIJA 1A1VA 3D8HA 3N7TA 4NLLA 1OASA 4AJOA 3NW9A 1RAHA 2KX7A 4K9RA 1W0JD 4HWPA 1J20A 2XADA 3OAAD 4N3BA 4L9SA 3B1FA 4QBGB 3UUFA 2RJ3A 1L5RA 4EHNA 4B6OA 1G8SA 2GXUA 1L1FA 4BV3A 5C80A 3DAFA 3HJGA 3RV4A 4GMKA 4QEDA 5ALVA 1JR2A 3N87A 4V0ME 1SC3A 5UKDA 6NULA 1P60A 3V00A 3ZTYA 1CBUA 1NNSA 1DLJA 7YASA 4BFXA 4BO2A 3LT4A 4JU8A 4X00A 4DCTA 2FWNA 2ZI6A 4K6FA 1N0WA 2WJHA 3OUUA 1MRNA 5CT6A 5J5AA 3MRSA 3SC4A 4XM1A 1GU1A 1UWLA 1JW9B 2H8KA 4MTLA 4XCVA 4CNQA 1LNQA 1XCOA 5DW3A 1DUIA 2ZTSA 3PUKA 1ZA2A 3B89A 2GM4A 3NFRA 5J4HA 1KY2A 2M98A 4N03A 3AETB 3P4YA 4NU0A 4DNFA 3HV2A 5LYJA 1ENPA 5L3QB 1ZJZA 1DZ3A 2ET6A 3HYNA 5D7BA 2PJZA 1SXJE 4A6EA 1Y8AA 1UBEA 5ALHA 2ZS8A 4LYHA 5ALXA 2OZLB 1IQUA 1CJBA 3PVZA 1K7SN 1PG2A 2OFPA 3OJ0A 1JEYA 4FYHA 1KJQA 2XB6A 3O8LA 2ANBA 5YASA 1XKLA 4EG0A 1LPSA 4FMDB 3S55A 2Z9CA 2GM3A 3AVOA 3QF7A 3V9AA 2DHCA 3H9EO 3KTOA 2IGTA 3NETA 1NNUA 4FFOA 2V7QA 5DK4A 4YRZA 3ETHA 1WM1A 1GILA 3U1BA 4E94A 4GM1A 5KNCH 2AFIE 1WSAA 4FILA 3OZWA 4CQLA 3LYUA 1M73E 4DFDA 1T8WA 1CU1A 4EKIA 4J94A 2H08A 2VSFA 3EPPA 1VB5A 2WE7A 3F7MA 3CWQA 3PDWA 2PRIA 4RTQA 3JZDA 2Q5CA 3OEWA 3WK4A 4YJ2B 3BREA 3KKLA 3CE6A 3QKRB 3CYFA 5HIIA 4A4DA 1DV1A 3C2QA 4OKSA 2DXIA 1G63A 3DLBA 1QLJA 3G6WA 3KD3A 2QN6A 2GZAA 4ZCRA 2GK3A 1JB9A 4J6EA 4AO7A 4M8LA 3NM6B 3S7ZA 4Q9KA 1L8OA 1J8MF 4M1KA 1QHHA 3V80A 3PEWA 3EG9B 5C51B 3COWA 4BVJA 5E1MA 2BKVA 5TVGA 2HIMA 4I9GA 2KMLA 3TL6A 2W4QA 3U4QB 1IPHA 1KI3A 3ZYCA 4F3NA 3UA4A 4MUKA 5I9LA 1UH5A 3KT3A 1XNJA 4U7JA 1LBEA 1DQPA 3NHBA 2J4CA 4DUGD 4F91B 2IZOA 4EKYA 5IMBA 2B8NA 2HLDA 1YS9A 3FLEA 3ILHA 3HB5X 4HEJA 4IIFA 1TIKA 4RKEA 4CIXA 1RZUA 3KOZA 4DRXA 5IAJA 1U28C 5FUXA 1UFQA 2RK4A 3I9FA 3IBYA 1E77A 1SA0A 1ZITA 4BAUA 5IANA 1EQUA 3ASZA 4EUSA 2X4IA 3HWWA 4OXRA 2WHYA 1U8ZA 2OG2A 5C5EA 2D2VA 1T43A 4L4XA 4X64B 2V0GA 3W9UA 3T4EA 2OESA 4RLHA 2UZAA 4H3SA 4MVWA 3NCHA 4HDNB 4EDHA 5DTEA 5I4BA 5JJIA 3DT9A 3GCXA 3BG5A 3Q1KA 1HNNA 4NATA 2WILA 3CLRD 1GPMA 4JA2A 4KN9S 2ZB7A 2O6LA 3FDIA 3IILA 3OD1A 4QT0A 4H4DA 3NAMA 4QFDA 5CEEA 2WD8A 3RBZA 4B3JA 3I6IA 5IM4F 1J22A 2P9ZA 2PX8A 2C1ZA 3P0JA 4X1YB 2PH5A 3ZBPA 3BD9A 4BTLA 2C9CA 3CR7A 1IY9A 2Q3EA 2ZJYA 4TTRA 4FXOA 5FAXA 1XQ9A 4IZOA 5ICCA 1PR5A 4CYMA 1Z82A 3ITKA 1NPYA 3FPAA 4MB0A 2B7BA 3UK6A 1RAAA 1C1YA 3MJRA 4BU1A 4CV2A 5I4KA 4ND6A 1RRFA 2Q27A 3Q8KA 1QP4A 5C52B 4G5OA 1FTYA 4ZEVA 3ZWVA 1EU1A 2HA4A 4J0HA 1QRDA 2ECPA 2V9PA 1R27A 5HDQA 4RELA 4RM3A 3M6AA 2PZAA 5JCXA 3KSAC 3HH8A 4A91A 4Z3KA 4MW2A 5HPYB 3IBSA 4L07A 4DEVA 2WVHA 3QE3A 3Q5DA 1ZGJA 4ALMA 1TTPB 1TU3A 2PUFA 1K98A 4IGFA 1BFKA 3AP1A 2Z4TA 2Q1TA 1J1IA 4EKEA 2YWBA 1FS6A 4K5QA 5AMXA 3L8CA 4G37A 1RQXA 2VAXA 2QRNA 2VPZA 2DF8A 4G23A 4M0LA 3FR7A 1ZBQA 2WMNB 1E2LA 3S4YA 4HDAA 3DAGA 5ALIA 2YWXA 5KOYA 3AR5A 3HADA 4DR6B 2FPRA 3HG7A 3L6BA 4HH3C 4O2BF 1E64A 5L3SA 2Y2VA 4WW0A 3NO4A 4YH1A 4ARBA 2WMDA 4C6TB 1F38A 4FYIA 4HNGA 3ROPA 2Q1WA 3EWNA 1AH2A 3LCUA 1PKXA 4MULA 5CCBA 4KTTE 3RRXA 2B25A 2AW5A 3BULA 4GH5A 5JNUA 1JWBB 1G7TA 3CRQA 2I6XA 2RHCA 4RZQA 4A8JC 3GFQA 2O8VA 2H1OA 2Y1DA 4EG8A 4KNVA 5A3SA 4C29A 1MG0A 4CFYA 5JQGA 5KAPA 1RS0A 3VAYA 1YJCA 2A59A 4RLFA 4HNAA 4Y2PA 1MP0A 6GPBA 2DWCA 1C41A 3A06A 1LBQA 1LRLA 3AJDA 1G64A 3WB0A 2XB8A 4UEKA 2PU7A 4KPUB 5K03A 2BFMA 1YL7A 4IJMA 1UXKA 2GH1A 1WB6A 2YNMC 3TDMA 1N0IA 1URPA 4WK2B 4CM9D 3AOGA 1GN8A 1HC7A 3EB9A 4IJ5A 4AN1A 4EFMA 2XT6A 3HCBA 3K0FA 2X14A 2ONCA 2YWRA 1HZZA 3KOXA 1JHDA 1VI2A 3QFTA 2EIXA 2BBTA 4TROA 3IP8A 1T2DA 3JR7A 1S7CA 2RG1A 5GZ1A 4BQIA 5AM3A 2YH2A 3MGKA 4IKEA 3CMCO 2F3TA 4IBOA 1GTZA 3OQ6A 1ZM9A 2WD7A 2YMPA 2HZ7A 3PIRA 1Z17A 4ZVVA 4E2XA 2CJXA 4MMYB 3S81A 3PLRA 1P2FA 3QVUA 5BSUA 4BB5A 4AT1A 5JISA 3S8EA 5ALNA 1XMXA 2VDNB 4W1PA 1WUIS 5EWLA 3N86A 1PQUA 2BGRA 1H66A 1U65A 1AY0A 1ISRA 3K6KA 4R6XA 1O9HA 3I83A 3UB4A 5TIIA 4QNRA 5K6TA 5A3QA 4XCQA 4QUHA 5FX2A 2XYHA 5BPFA 1Z9BA 1QQTA 3UYKA 3CVJA 3KPYA 3V8RA 3C7CB 4GR5A 5JYCA 5B7QA 2FWIA 2A0WA 3NUGA 3HJNA 3GJ6A 3TL3A 6PFKA 4KL8S 4B71A 4QL3A 1XQ1A 5DIFA 4ARZB 4IDEA 1B00A 4PS0A 5J43A 2ACWA 2ERCA 5KCMA 3A1DA 5K8CA 3PKZA 10MHA 3D2AA 1RPJA 4N49A 2A57A 3HA7A 2P1RA 2VF5X 4DMRA 3PS9A 4DHEA 5DDIP 5KYXB 1RXEA 1C30A 4DCJA 3N8HA 2F55A 4RD0A 5LA6B 4BZXA 2CF6A 3AR7A 1E79D 1FBTA 3OJCA 2V3WA 4OYLA 3ND8A 1KY3A 2HNKA 5L4LA 2NV0A 1UBJS 1QQ5A 2ZYUX 2RGGA 3KSBC 4ZTUB 2EJWA 4HQRA 1GPAA 5IKMA 1FLVA 2NV2B 4GC9A 4Z3OA 4F2PA 4GLFA 3AERB 2Y0PA 3B3AA 7GPBA 3PXUA 2QTVB 2W2PA 1N9ZA 4O8ZA 5LBUA 3P9SA 1PZXA 3KPUA 1G59A 5TS2A 1YQQA 5AI4A 3WQHA 4PSUA 2I2WA 2WYIA 5TQJA 3HO8A 1RRVA 3GLFB 3WDMA 2BWJA 2DVMA 2Y66A 4HWTA 1ITZA 4HMOA 3DW1X 4WBNB 3ZCSA 5CG2A 4OLFA 4PANA 1XNQB 2VRBA 2ZYRA 3DSRA 5K0EA 2OO5C 1NTRA 1PS8A 3LXRA 2ZRNA 3RVKA 1SU4A 1BG6A 3QNUA 4WACA 1V5EA 1N2OA 4LDZA 5H16A 1EFPA 4JJ4A 4JVNA 5GPBA 1HETA 1NP7A 1Y6JA 2GPNA 3GLIA 1DEKA 1E4EA 3KALA 4EP1A 13PKA 3CNOA 1GTSA 4QARA 3ZR4B 2V3CC 2VOEA 1Y34E 2ZIGA 2CFTA 1LLDA 4C0AC 2EX4A 4MKRA 3UAVA 3AYXB 2PBZA 2YWCA 3DXYA 2GCPA 3FYUC 1GPNA 1A5AB 4MGYR 4OI1A 4F4CA 4AWXA 1P29A 3OCCA 4NBLA 1NMQA 1TQ2A 3AILA 3BOSA 3KAQA 1P7YA 2EJCA 2QHXA 4NVRA 4QLAA 4WDQA 5B30A 4RDXA 2GZRA 5C1OA 5LMCA 1U99A 5LFAA 5GONF 4BX8A 4BIMA 2Q5FA 3U5TA 1GT91 4YJKA 5FI3A 3T5CA 3CSUA 1UJNA 2WNHA 3AF5A 4MWSA 1KFJB 3TIVA 3PWZA 5E7MA 1T4CA 5JYEA 3EVZA 5TQVA 4J0GA 5THKA 1YH3A 2WF9A 4I2NA 3CF6R 4FGJA 3HYSA 1T2UA 1Y1LA 2PRZA 2DQKA 2D2FA 4TTQA 4INAA 3NM4A 3TXAA 2C54A 1VYTA 5EIHA 2IP4A 1TO2E 3EQ9A 2HHAA 5EJMA 3IQFA 2B61A 3HVRA 4UCXA 3SYNA 4EPXA 3RK1A 2J08A 4CIYA 2UZ4A 3ETEA 3QKSA 1W88A 2H5LA 5AD1A 3MWDB 4LNUB 4NH4A 1C7IA 4GPAA 1IU9A 4C7MA 1YQUA 3I9OA 1SPBS 2LW7A 2H1LA 1OGIA 4KE9A 4NPAA 4HDSA 3USCS 5GJBA 4AY2A 1M2EA 3PNOA 1AJEA 1ZK1A 4MHOA 2PH1A 3IMEA 1DXQA 5TQ0A 2ORIA 1L3BA 1UKCA 3KU4A 1JFVA 2X77A 2G4VA 2ZSEA 1FP4A 1OU0A 1MAHA 3ENVA 2PUCA 4UMFA 1C3OB 3ACDA 1XD2B 2AR0A 3IV7A 2J4DA 3C3KA 4JMLA 3UOWA 2GZSA 2ST1A 4DQDA 2Y9MB 4KOAA 1K08A 2CLCX 2K6GA 3F1KA 2YV4A 4HDMA 4CT0A 2G25A 2UUBB 5EOVA 4CZ2A 5KQRA 4Q3KA 1AGXA 3T38A 4G1VA 2GS9A 2O3SA 1MO5A 4ZRDA 5I8PA 1XMQB 4BWFB 2XSZD 2C7BA 4KHPB 3LTNC 2ZKLA 3QOYA 4FPXA 3R3WA 4Y2SA 1MW8X 5GGYA 1F14A 2X0IA 4G4SO 4UJ5A 3UV3A 5K8VA 3W3ZB 2Q5QA 1NBMA 1KAOA 1KMMA 1M8KA 1P8AA 2GVDC 2XE6A 3REGA 4LJ8A 1RAEA 1RYZA 2L82A 3C4QA 4IEIA 4L3VA 4OVKA 3HKDB 4EYKA 2C99A 4LEIA 3T9FA 5D3ZA 1JA9A 1ZC4A 1EWYA 3HYLA 4BX9A 1ZM4A 2WU8A 1GNTA 4FNAA 4WGFA 3ET4A 3V1UA 3U7GA 1T5IA 3CX6A 1G2OA 2R8RA 3ZZNA 5F23A 1E9SA 3ID6C 5HZGA 4YHHB 3IR6A 1V2GA 1IMJA 3F7TA 4JR0A 2NUPA 2FMFA 2VDUE 2Y1GA 1XA3A 4XD7A 3WLIA 5AUOB 3RAFC 3H97A 2PX3A 2G9VA 4KFRA 4Q3OA 1SU6A 2UZ0A 4TLEA 5IUNC 1NY6A 3K9QO 2V58A 3FMPB 3FPCA 3DZFA 2J85A 1Z0AA 1Y3HA 2B0JA 4AS1A 1X7HA 2D1RA 2GA9A 2DY1A 2G40A 3VYUB 4WN3A 1JPUA 1GSOA 4B8YA 5JANA 3H6HA 3RFUA 5ERGB 5GJVC 3HO1A 3IUEA 4M38A 1XTIA 2PL1A 4PV7A 4P38A 1M6YA 2IZ7A 4YJHB 4IHAA 3KOYA 1KMQA 1KQOA 3HCOA 3RRFA 4XWWA 2DBYA 3SNKA 1UAGA 2YFHA 3LLMA 2VXOA 1U7HA 4YQFA 4G0YA 2CB9A 3OT1B 1TGVA 3D3JA 1GAJA 1Z13A 3WGZA 1RKVA 1WVMA 4F60A 3JWJA 2Y3IA 3LIIA 3DWEX 3QVWA 4EX7A 4L27A 3CNLA 3N07A 3GA7A 1EQ2A 1B1CA 2XWBF 5AP9A 5C31A 5B6PA 4TS4A 4XX0B 3A3OA 2A14A 4JEIA 2VH2A 3PX7A 3I9JA 3FZYA 1VJ5A 2FX3A 1A97A 3ONDA 4L5BA 1PR9A 2AKAB 1RTKA 2C07A 3EZ7A 3H0KA 1ISHA 2QMUA 1N6RA 4IPTA 3OFND 3JQBA 1HFKA 2BEWB 5CFOA 4IO0A 1GGHA 1EVQA 3PCTA 3WL7A 1P1HA 1XEAA 1JQDA 2HV8A 4Z0PA 4LC1A 3ZY6A 2HA0A 3TE7A 4CFZA 4UD2A 1ZN8A 2YIDA 1X7WA 1QMPA 2UV8A 1NXSA 2R1VA 4S1PA 4UUAA 5BWMA 5K9ZA 1XZFA 2P6PA 1BCRB 5EAIA 1WHSB 1A8HA 3P26A 2WP8J 5HILA 2VPTA 1RPAA 4R0MA 2IZ1A 1WZ2A 1N9GB 2VATA 3FZNA 4KMRA 2QD2A 4BB0A 1XLUA 1N5RA 2YC4C 3C43A 3DBHB 3HE3A 3SBEA 1GAEO 2IYOA 1HNZB 2BONA 1IPFA 1VKOA 3VPDA 2V59A 4GYKA 1EWKA 1IQ0A 1B2RA 1HYBA 1N2BA 2ZWMA 3A1FA 3UH0A 2CFIA 4DOMA 2WE8A 4B2LA 3I76A 4UZEA 1Q0UA 2W6CX 5DNVA 3EX7C 1X8LA 1OJLA 4DZTA 3KWFA 1RPTA 4HAOA 2O7QA 2WLSA 5J4KA 3NC4A 3V7FA 4EWLA 3TRIA 3ZGYA 2J4FA 3TM5A 2DHQA 1EJ6A 3WXMA 1YKFA 4HVLA 3AI1A 5B2EA 2VT6A 5JCPA 1JLKA 2NUAA 2WFZA 2PZMA 1ZNZA 1KJ9A 1WKCA 1ZXBA 3F90A 4R71A 5B7NA 4EG5A 1ECJA 3JZAA 3AF0A 2ZTHA 2ZYTX 2QD4A 1XAJA 2BHLA 4WK6A 4UC0A 4CJXA 4LGVA 4US0R 1G60A 1TAHA 2JCSA 5EIBD 5EKTA 5EYPA 3Q7PA 3KR0A 3OBBA 4GECA 4MAFA 2J7PD 4O08A 4CM5A 4EB3A 1N33B 5FA8A 5BW8A 4E13A 1CR6A 4IDOA 1FW6A 3ZUPA 1H0KA 2O7RA 2W6ZA 4IOLA 1TCAA 5DBHX 4CTJA 3LPLA 5KJCA 3ODGA 5LVAA 5IRCD 4C4TA 2NTNA 1YA8A 1SKUA 2H4JA 2KS6A 2J0QA 1MPTA 4H9GA 1JJVA 4LZZA 5KWVA 2B69A 2DHRA 3IIEA 2OCXA 3I45A 2HW8A 3D5TA 2CSXA 3DHNA 5DM2A 3G59A 1QTRA 3INTA 4YC7A 3CHYA 4RAQA 4KGVA 3SX4A 2A58A 5BVGB 4X91A 2QROA 1Q7CA 3LZ6A 2YFQA 1K66A 3SDZA 4EPTA 2IC5A 2O7SA 4O0MA 5KYGA 1JBQA 4OEHA 3JSXA 1EK2A 2CDAA 2J09A 5FPHA 3JATB 3V8NA 3GFTA 1QHNA 1TVKA 1NVDA 2D0IA 1XZBA 3L46A 3NBKA 2QIOA 4XPZA 5FP0A 3ZTTA 1TQ6A 2WU0A 3GX1A 4V0LA 5FBHA 4OQNA 4JJEA 1TRHA 3O4FA 1N8NA 4G25A 1AK2A 2AWNA 2P2SA 2F00A 2QEQA 4EJSB 4IIGA 1TUBA 3KWLA 1GUFA 1MJ5A 4B4DA 3KETA 3P4XA 1QIEA 3MOIA 3NRJA 4WLUA 1H05A 1EXMA 1F7UA 1RLIA 1PNTA 1V4VA 5TSDA 3TSZA 1CIJA 2ARKA 4HH4A 4KO3S 1BGVA 1GY8A 1QX3A 2C61A 4FW9A 4M0CA 3RROA 4YREA 5KNBD