5C2JB

Complex structure of the gap domain of mgcracgap and cdc42
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
191
structure length
191
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rac GTPase-activating protein 1
publication title Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/signaling protein
total genus 67
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5c2jB00
4FI3C 2H16A 3K9GA 1CR2A 1YZNA 2AK2A 3FPAA 1KNQA 3N2EA 2QUZA 2EWWA 1T0HB 2WSSA 3LA6A 5HKKA 4XTRA 2YVUA 4KFRA 5FOVA 3PUXA 3E70C 5TARA 1T5IA 2AXNA 4N3NA 1G6OA 2F9MA 4IDNA 4LDJA 1M8PA 4M1TA 2J7KA 2J7PA 1Z0KA 2XTMA 3VHLB 1CBUA 2ZE5A 3CF6R 3SHFA 3U7GA 3ADDA 5L3VA 1QHYA 1E1RD 3NBYC 1LFDB 1S0UA 2O8FA 1AJEA 2ZJZA 3T35A 3ZIAA 3DPUA 2CE2X 3A1UA 4BEBA 4Q66C 4F91B 2ZSAA 4E07A 3LH5A 1U0HC 3MWLA 4ACBA 1NN3A 4OHVA 2VP9A 4WBSA 2IXGA 1KKLA 4GZLA 4OK6A 1NLZA 1YJ5A 4AG6A 3VR1A 3ZLJA 2JLVA 4EJSB 1FPMA 2ANBA 4CVNA 3I61A 4KYIB 3UPUA 2VP0A 1E3MA 4FWIB 4NU0A 4BGDA 1VCOA 4FMBB 2CJWA 3BH7A 1R7RA 2IYUA 3T1QA 1E9SA 4V0ME 4DLVA 1X6VA 1R8QA 3CO5A 1UBEA 2IYYA 2J87A 3IEUA 4QHYA 4AY2A 121PA 4P0TA 3NC0C 3T1OA 4LWZA 3RS2A 4IOMA 2IX3A 1CIPA 1AN0A 3IQXA 5CYPA 5JHGB 1JR3E 4XWKA 4V02A 3TIFA 2Q9AA 4IHQA 3Q7PA 4PC6A 1YRBA 1BYUA 3HR8A 3W3ZB 1LNZA 1UPTA 5C4MA 2GZDA 3LWNA 3GLHB 5JWRA 2ZETA 1YR7A 1HEIA 1E2PA 4XSGA 3UKDA 1G21E 5CYOA 4NTZA 3QPWA 4HLCA 4HAXA 4B3FX 3AP1A 4OQLA 1EWRA 3BB4A 3REGA 1SKYE 1IN5A 4RJLA 5EXSA 2OAQ1 3X1DA 4PAOA 2CLSA 2GF0A 1XZPA 1VYVA 3QEJA 4OL0A 2GESA 3EARA 4E03A 1NMXA 1EK0A 2W6IA 3U60B 4C4PA 4D26A 2HLDA 2BM0A 1FFHA 3WNBA 3DM5A 4BWYA 1ZU4A 4UNRA 2PL3A 4L4UA 3CUEF 3TE6A 4LC1A 1IAQA 2ZVQX 5K8UA 5GJBA 3WBKA 4QGHA 5DHFA 4RY2A 2A5FA 2IYXA 1XCPA 3ADKA 2NPFA 5FPYA 1FL9A 3WBJA 1G5PA 1IHUA 1X1SA 3UATA 1LVGA 4P31A 2F7SA 3U3KA 1Y63A 1DAKA 2XSZD 1DAEA 2Z6VA 3ND9A 5FH9A 1A4RA 1TL7C 1NSFA 2QROA 1W0KD 4L8GA 2GF9A 4Q03A 2O0KA 4YC7A 4WOPA 4ZI3A 4QHSA 4TL6A 4MDFA 1G7RA 4FMCB 4TQUS 3BK7A 2CBZA 1OYYA 1W5TA 3AF2A 2I3BA 3FFBA 4QJ3A 2ERXA 3AP2A 4JBWA 3MGCA 3SDZA 2FWRA 1JQLB 5AUNB 4DKXA 4Q1EA 1XTQA 1A2KC 1TQDA 2ZJBA 4JLMA 4US2R 5IRCD 1HQCA 1IONA 3A36A 2QGZA 2ZEJA 1P75A 3BB3A 4LHVA 3ASYA 2ZAMA 4PQYA 5DO9A 3I1FA 4TSFD 5HZKA 5G40A 4TT3A 2J0UA 4C7OB 2R2AA 1A82A 1BH2A 3CX6A 3PEYA 1HTWA 4NBSA 1AZTA 1KHTA 4A6XA 2HCJB 2D4HA 1ZNZA 4ZKDA 1UKEA 3WYGA 1XF9A 1Z28A 4CDGA 5EXPA 1KY3A 3CF2A 4YDHB 3UG7A 5JEEA 5BQ5A 2XJ9A 3VKWA 3D8BA 1KI6B 3LBHA 1XD2A 3DZDA 3RS4A 3A1VA 2RHMA 4EIWA 1G8GA 1KJZA 1PLJA 4S2EA 1R0XA 1KK0A 4M2LA 2REOA 2ATXA 3FMIA 2P2LA 3CR8A 1CJVC 3AF3A 2VHUA 4CRWB 4A92A 4GOKA 2ZI7A 4D0LB 2GXAA 2D7CA 4I99A 3VX4A 1OKKD 1XEWX 3CM0A 3L0SA 4MKIA 2V7QD 4UNNA 4BFWA 4NKRA 3U6KA 2WWIA 1WBDA 1ZD1A 2H8KA 3C4JA 3ICEA 1UJ2A 4M8NE 4F4JA 4RD6A 3QUSA 1BKDR 2LKCA 1VCNA 4JYBA 4QNMA 1LS1A 2ZRLA 3GP8A 4AK9A 3FHTA 1WBBA 1RRGA 2H92A 2TMKA 1YZGA 4URUR 2D3WA 4RZ3A 1OH8A 2F1RA 3VNUA 3DM9B 1XMJA 1PVOA 3WMFA 1E2QA 4C2TA 1EFUA 2DHRA 221PA 3K9LA 5FL3A 2EYUA 2FG5A 4FCVA 5JI3E 2V9PA 1X8JA 1Q21A 5F3WB 2CHGA 3NBXX 3LVQE 4B3CA 2WAYA 2QRZA 2GZAA 4TLBA 1DBSA 3ZVMA 1TPZA 2R62A 2O0JA 2J41A 4CT5A 1VIYA 3A1TA 4DRZA 2IYWA 5L3QB 3SJBA 3TUZC 2Z83A 4JLKA 5FUXA 4MRRA 4EJSA 1Z29A 3Q5EA 1XTSA 2GAOA 2ZREA 3KJHA 1L4UA 3B13B 1YE8A 1GOTA 2CHQA 3CNLA 1GDDA 4PHTA 3AM1A 2IF0A 3RSOA 3I92A 3QXSA 2GHIA 1IY1A 4QM7A 3GPLA 3QF7A 1UEJA 1FW6A 5IHPA 5CDFE 1SXJD 3PR1A 4DB4A 1E69A 4JLJA 5GADl 3AF1A 3ZH9B 2B8TA 1E98A 1U98A 2J5XA 5CLLA 4IVQA 3TQFA 2JLUA 4XWOA 2GBLC 2VLIA 2VA8A 3QKSB 4OJQA 4MITA 3VR5A 4TLCA 1XTIA 4OHXA 1NBMA 1KMQA 2PT5A 2JIZD 3LLMA 4YXWD 5LD2B 1CKEA 1OHHD 4O2LA 3FGNA 3JZAA 1SVWA 1XX6A 3GLHA 3A4MA 5JJLA 3HJNA 5EUQB 3W6OA 3SN6A 4OYHA 1G1MA 4OK5A 5JCZA 4DLYA 2EFEB 4NCIA 3SEAA 3VR6A 3RC8A 4DJTA 2Z0MA 1YZTA 3RS0A 3LLUA 3AF4A 2QT0A 2RHDA 4TL7A 4AYWA 3LBIA 2ZJ8A 3MWJA 2AX4A 1IY0A 2HCBA 3AKDA 4KXFB 4WZAE 2IYLD 2O8CB 4TMXA 3SNHA 5KDDA 2C95A 4QBFA 1RE0A 2CHVA 2FFBA 4PFSA 1II0A 1Z08A 1QG4A 4E22A 4B3GA 1GVNB 3NXSA 4B32A 4UXHA 821PA 3G0HA 1YU9A 1RIFA 2H1LA 1KYIA 2Z4SA 1N0UA 1XZQA 1ZM7A 2IYSA 2ZVPX 3K0CC 4G5QA 4Q1FA 4QOSA 5GJCA 1Z2AA 3TK1A 3VR2A 5FOXA 1SVLA 1ZNXA 2ASEA 2WSSD 4RCYA 2RGBA 3AUXA 3EZFA 5HKKD 1W36C 4FD2A 4RZUA 5E7IA 3GLGE 2IT1A 1K8RA 3SJCA 2IS2A 4BE7B 3FE2A 4G5GA 2GDJA 2J7PD 2NO6A 2VHQA 2YINC 1Q20A 3EC2A 4W7SA 1R0YA 4QRHA 4ESVA 5AK0A 4AI6A 2FSHA 1C4OA 4ZCMA 4DCUA 1TEXA 4IEEA 2XZOA 5BYJA 3U3OA 1JXMA 3NHBA 4P4TA 3ZIAD 1XCMA 2RGGA 3TMKA 5CB8A 2PX0A 2DB3A 1AK2A 3K70C 5TY0A 3BH6A 4D80A 4OBEA 2CE7A 2OLJA 1Z2CA 4RZXA 4B76A 4UNPA 4IRUB 4C0QC 5AUPB 5DNYB 1N0VC 4NL4H 3AVQA 1OB5A 1WQ1R 2CXXA 1FUKA 5HR5A 5JI2E 4D81A 4C7OA 3DHWC 3FKQA 2GNOA 1QHGA 1N0WA 4BFZA 1BS1A 4PO8A 2AK3A 3SBDA 1NN5A 3U5ZB 4M9SA 2PCJA 2AL7A 3QXXA 2NPIA 4RZ2A 4WAUA 2D62A 2L0XA 1IJEA 1D2MA 2JCSA 4U7DA 4NH0A 2PCLA 1KI6A 3AVTA 1U81A 3B60A 5DH9A 5JLJA 3CNNA 1E2DA 1H65A 1L7VC 3GJ0A 2B7CA 4M21A 1DTSA 4JL6A 3EW9A 2J0VA 5JEDA 1T91A 2WWWA 4EDHA 2ORVA 4Q7LA 1RZ3A 3WMGA 2F1HA 3SFVA 3EWSA 2YV5A 3THOA 2AD5A 4YMTA 2QBYA 5HE9A 1E9BA 4PR0A 2C9YA 2NO1A 2FEOA 3X1ZA 3FB4A 5BN4A 3PENA 4A2WA 4BFYA 1CJTC 3QOFA 2GEDA 1OW3B 4QNRA 5C2JB 1SXJB 4RCZA 2J59A 4WXRA 2EYQA 2X1VA 2FGKA 1ZJ6A 3EA0A 521PA 1D6JA 2ZPTX 1QHIA 1ZUNB 2FMXA 2VH5R 2WIBA 4CYMA 1JPJA 2OE2A 2YZ2A 3QF4B 3A8TA 1NL3A 4KFUA 2YWHA 4A2QA 3C5CA 4JVNA 2R6CA 3E5HA 3W5IA 2W6ID 4BECA 2HLDD 4KU4A 5J47A 2YWGA 4EPRA 4M1KA 5JWHA 1U8ZA 2QI9C 1KAOA 4Q9KA 3IIJA 5FPSA 1P9RA 3KL4A 4EAQA 3K70D 3RYTC 4Q1DA 3R9WA 3MFYA 3KFXA 2VIIA 1WCV1 5L3QA 2ODBA 2GJ8A 1HV8A 1CJUC 5HPYB 2R8RA 1NVWQ 3TUJC 3T12A 2O5VA 5AJZA 3GEHA 2E87A 3K0AB 3OIUA 5DN6A 1KY2A 4EFLA 2GZHA 1XJCA 3PXGA 2WV9A 4V0LA 2ZAOA 5GVRA 3ADCA 5FBVB 1NG9A 4GOJA 2JLSA 5EE3A 2GA8A 3QKSA 1G18A 2RGXA 2XEXA 4DT1B 3TQCA 1T8UA 3IPXA 1X86B 1Z6GA 5DE3A 1AS3A 1WXQA 1B0UA 4WVFA 2ZSDA 5B57C 5GVSA 4TT3D 1NN1A 3O8CA 2C96A 3FWYA 3BIFA 4LBVA 2H7VA 3GD7A 3SYKA 2N1BA 1ZU5A 3NH9A 4KI0A 3OEHA 1VCMA 4PZLA 3WYAA 2OT3B 4IOLA 2ZJYA 1V5WA 1E99A 1G7CA 1ZW6A 4AURA 5CK5A 1U8YA 3OF5A 4G5RA 1N6LA 2B7BA 2A5DA 1CP2A 2O8CA 5SZKB 3ASZA 4RKEA 1LTQA 4O0MA 1E0AA 3SU8A 3TLXA 2ZJOA 1YZLA 3KZ1E 1GRQA 2PEYA 3VHXA 2R6AA 4RD4A 5DIFA 1O87A 3T5GA 1DS6A 3Q3JB 1TTTA 2EFGA 1JPNA 1Q1EA 3QPUA 1E2FA 1VYUA 5D3MA 2VSOA 1E2MA 2P0EA 5D3MB 2QNRA 1M6NA 3TKLA 5K8TA 1Z22A 2EW1A 2ZUBA 3NG1A 4P33A 4PPGA 1KSHA 2VF7A 1G17A 1VYTA 2FSFA 5CK4A 4IJMA 3OZXA 4F4IA 1GSIA 5DLQC 2J3EA 4NMMA 1VCIA 1VHLA 2XZPA 2RGAA 3K1JA 4IDOA 2ZRDA 1EX6A 4LY6A 2G0TA 4Q7KA 3EXAA 4LYHA 1Z0IA 1OYWA 2QORA 4QJ5A 4W5HA 1XTJA 3JZMA 4L9WA 4BFXA 1S9DA 4V03A 5EUMA 2WJJA 2CL7X 2WWFA 2ERYA 3EAQA 5EJEA 1MRNA 4LJ5A 2CL6X 2GJAA 1MH1A 1F2UB 1YZUA 3W8NA 4KBFA 1RJ9B 1RYFA 2VTKA 1KK2A 2DFKB 2QAJA 2UVQA 4PAMA 4ZCIA 4B3DA 4R2IA 3CRVA 4DXAA 1XJ0A 1Q1QA 3CNOA 3GFTA 2ZRGA 4Q01A 1U90A 1NG1A 5IF9A 3P1JA 2P6NA 3IDQA 4A2PA 2A78A 2Q3FA 1XMSA 3C16C 4I1SA 4R2HA 2GETA 1SQ5A 2RGNA 2F1IA 3FYHA 2ONJA 1XXHE 1QHSA 4NYIR 2DR3A 2KJQA 2OHFA 3PUZA 2VP5A 4Q4AB 1P2SA 4Z1MD 2OUKA 2XX3A 4BLPA 2WOJA 4MGIR 4ASUA 2BJVA 1K6MA 3QG5A 4Q7JB 5EP1A 3IQWA 3VAAA 1CU1A 3KJEA 4JKIA 2BMEA 5D3QA 3AVUA 1QVAA 2MSEB 4FCTA 1TQ6A 1PV4A 2PX3A 1NBMD 3R7WB 3TAHA 5GJVC 2JDIA 4K8OA 2FH5B 2JJ1A 4BZQA 1VG1A 4MUBA 2IUUA 4BZXA 1KK1A 3HR7A 1J7KA 1L8QA 3HU3A 3DKPA 2C98A 5SZIA 1UDXA 1AS2A 1SXJA 5FOTA 4TN1A 2RGEA 3OFNA 4TMWA 1OSNA 2A7QA 3NH6A 4IDHA 4NYIQ 4KODA 1H8HA 2RB4A 4PSVA 3NBZC 3QF4A 1JR3A 4OK3A 5DISB 2ZR0A 2N46A 3FMOB 3KXLA 1G6HA 1Q3TA 1N6RA 5J5CA 2HF9A 1P4SA 4WXPA 4JBYA 1HUQA 1V43A 4B33A 4NE2A 1N6HA 4FMDF 5GJWC 3FOZA 2VSFA 2D2EA 4LBZA 1DOAA 4PSAA 3QXJA 1YHNA 5SZHB 1TU3A 1GNPA 2BMFA 4XD7A 4KO8A 3AH8A 4DLZA 3WHKA 1IM2A 3NWJA 3SHWA 4P32A 4O3MA 5KDLA 4KFSA 1VMAA 3TUIC 3P4XA 1WP9A 3MWYW 4HB0A 2ZR9A 2EVWX 4IVPA 3L0PA 2HJVA 1KI9A 4MGKR 2ZI6A 3LQQA 4DZZA 1SVSA 4TLDA 3K0AA 4Z51A 1AKEA 3I32A 1KNXA 2C77A 1KO5A 3WXMA 5AJXA 5L3SB 3SQXA 5TXGA 1TADA 1N5IA 1VG0B 1BYIA 2FE4A 4PO9A 3PFIA 1TNDA 1NN0A 1OH5A 4Q9IA 4UXJA 1UAAA 5BWMA 2F3TA 5E7JA 4D4MA 1T8TA 2D74A 3EASA 4F92B 3GLGB 1IN6A 2HT1A 4DT1A 2MSCB 2WJIA 3ZYCA 1SVKA 4Q1AA 4MRPA 2J0QA 4A6PA 2QSZA 1EFHA 4Q1CA 2HYIC 4GSYA 4HLQB 3ZJYA 2YYZA 4JVSB 1TQ4A 2WVJA 2MMCA 4LHWA 5KNDA 3GJ6A 2KSQA 2REBA 1YR8A 1M34E 4HDQB 1BIFA 3EWAA 4A36A 2XB2A 4KBGA 4Q4HB 2OG2A 2BOVA 5J4HA 1DELA 2ZRFA 1D2EA 3MCAA 5F9HA 1N25A 2HEIA 2MSDB 4Q7MB 3O8RA 4TMTA 3FKSA 4KLNA 3K0SA 1GAJA 2KI5A 2BEKA 4TMZA 4QL3A 2PZGA 4LJ8A 2R9VA 2NQ2C 1W4CA 3X1YA 1YRAA 1IY2A 3UWOA 3ZDQA 2AXPA 3G82C 4YMWA 3RS7A 2EWVA 3B9PA 5C1BA 2WKQA 2W2XA 4II7A 1D9XA 2LWIA 2IYRA 1FMLA 3ZZ0A 4FWTA 3QIAA 1T3LA 1IXRC 2EQBA 4K81B 1GL7A 3B1YA 5IK2A 1XPUA 5JFGA 2A30A 5TMPA 2HYDA 3CH5A 3KB2A 4HB3A 1B23P 1OV4A 3R9IA 3T1VA 5EXTA 1NKTA 1T5LA 1TF5A 3K9NA 2ZYTX 3W5JA 1XBTA 2QPTA 3K9HA 4ZPXA 3KQLA 1Z0JA 4QBIA 4B6FA 2QE7A 2SHKA 2OM2A 1JXOA 2W2TA 2J9RA 1IJFA 1S9HA 3V4RA 3C14C 1FTSA 1HY3A 5JBQA 4CEJB 4ZCLA 4PANA 3V9PA 1F2UA 5K8LA 4DDVA 1A5TA 4YQFA 2WM9B 1RJ9A 4F7WA 1TEVA 3U7FB 2I4IA 4MKGA 3KQHA 2ZE6A 5LDDC 2XXAB 5EE0A 1CTQA 1G3RA 4EPVA 2OBNA 1JQJC 3KTAB 1G3QA 2VHTA 1Z3IX 2NG1A 1DARA 4TZ6A 2IL1A 4A15A 1ZRHA 3L43A 4LHZA 4C0JA 3U6BA 3TBKA 1ESMA 2NGRA 1IN8A 2OZEA 3CRQA 3DO6A 1E2GA 2YJTD 3QJYA 3C15C 4N0DA 4D0NA 3GLIB 4O25A 3RVBA 3MD0A 2NO0A 3UMRA 5DN6D 1DG3A 4Q4AA 1F48A 1WF3A 5DSZA 4B75A 3PIRA 5FOWA 1NMYA 4DVGA 1X8LA 1N5KA 4LSGA 4B34A 4BEJA 4LZZA 5DI3B 3VU9B 3EZ2A 2IXEA 4RD2A 3R7WA 1MO5A 3EIHA 4X8MA 1Z06A 2OFWA 3AKYA 1ONBA 4BASA 4H1VA 2PMDA 2QAGC 3QVUA 1JEDA 1VG8A 4LJ9A 2EU8A 3BB1A 2ZYUX 2W0SA 3SBEA 3OEHD 2B21A 2IW3A 1RPZA 1ZCAA 3B1XA 1E1QA 4WZBE 1YZKA 4JL8A 5DYGA 4Q18A 1L4YA 3B9QA 5HTKA 1R5NA 1ZM3A 2W58A 4DDTA 1JI0A 3EC1A 4FCWA 1Z0AA 2WWGA 3BS4A 5TVKA 4Q02A 2ZRNA 4A8JB 2DBYA 1NKSA 3OEEA 3RWMB 4DIEA 4Q9HA 5FI1B 4EQ6B 3F3YA 4HSEA 2JLRA 2WJHA 1PLLA 4AWXA 2V3CC 1XEXB 2P67A 1M7GA 1NIPA 1RW4A 3L82B 4LHYA 1GL6A 1SXJC 2JATA 2PMKA 4QG7A 3ZZUA 2PT7A 4A1FA 1DPFA 1F2TB 3I8SA 4PHGA 5JZVA 4CEIB 2AKYA 2LCFA 3TR5A 621PA 2PJRA 2WJYA 2IEZA 3ZZTA 5KSYA 4HATA 1GITA 4ZDWA 4ZKEA 4JS0A 3EPLA 3H84A 2OAP1 1P73A 3D3QA 4JLDA 3TSOA 4YMVA 3W9YA 4LV5B 4I1UA 2DCUA 1GNRA 3D7MA 2WKPA 4GBMA 1J8MF 4XIGS 3NC1C 3U7EB 4M1MA 4K46A 1J99A 2F6RA 5B2ZA 3BGWA 3TSWA 3EZ9A 2ZXUA 5A5GA 3TW4A 2FGJA 4DLXA 5L3SA 1KI2A 1FOEB 2XZLA 2FDCA 3ZVNA 1G16A 4LYJA 4ACAA 3AKEA 1MT0A 2CLCX 4WW0A 5FBQB 1K5GA 1XRJA 2GEVA 3GLGA 1ESNA 2V4ZA 1DVRA 2QQEA 2CEAA 3GLFB 2C5LA 2QP9X 1E79D 1MR3F 5KUTA 1YKSA 4JLBA 1CEEA 2QP4A 2ZRIA 1E2NA 4OKSA 5B30A 4D4JA 2XTNA 3TAUA 4AG5A 1KSJA 1W1WA 1NSTA 1OXTA 1R10A 2GEUA 2WKRA 1G8FA 3P32A 4X8OA 1DE0A 1NMZA 4Q4HA 4AKGA 1I4LD 1N6PA 4ASUD 3PUVA 3MWKA 3T15A 3L0OA 8OHMA 1NRJB 4RSGA 2IK8A 4ZO4A 3Q7QA 2D7DA 1DG1G 4PC1A 1AQUA 5CB6A 5TB5A 2O0HA 2VP2A 2XJ4A 2JDID 1SHZA 2JJ1D 2C78A 5KTYA 1MKYA 2VHJA 4PC2A 3U7HB 1GTVA 1P7CA 3O8DA 1TU4A 3KKNA 2OLKA 1GKIA 2P65A 3U61B 4Z1MA 4MRSA 1G3IA 1UKYA 4JVMA 4MGZR 4ERNA 3OFND 2BBSA 2G1KA 3PUYA 2X2FA 2IYVA 5FL7A 2NO7A 2WJGA 1H8HD 1JNYA 1QHHB 4UNSA 4Z54A 1JR3D 2X8AA 3HPQA 1CR1A 5J40A 5AJVB 2AN9A 1NVVQ 4KVAA 1P9NA 5KHOC 3IUYA 4OQXA 4A0HA 3BOSA 3GJ5A 3LVRE 4DCTA 2GCPA 1UBFA 4DCNA 4IKEA 4LUCA 2P6UA 2QRNA 2ZSFA 1ELOA 3EZ6A 3R8CA 1UBGA 1W0JD 2QL6A 4XD7D 4C30A 4M1SA 1A2BA 3A6PC 2XXAA 3O47A 1DAFA 5FBLB 1KO8A 1OFUX 3RRNA 2ZRCA 2FPMA 2ZSEA 2JLXA 1LF0A 1CLUA 1RRPA 2BKEA 1JBKA 2G0NA 2GVZC 3KTAA 3L8YA 3NKVA 5FFMA 3SR0A 1KI3A 4FN5A 2V1UA 4UXIA 1OIVA 2VYFA 3GEEA 3NVAA 1NNEA 1Q44A 2KB0A 3HDTA 4W5JA 2DWPA 4YDSA 4HB4A 3GLIA 2HJGA 1QVRA 3RSLA 1S3GA 3SJAA 1N3BA 2Q3HA 3HP1A 2IUTA 3M0EA 4BPBA 4DBLC 1M7HA 1KDRA 4IEIA 3SOPA 2FZ4A 1ZNYA 1SHKA 1JB1A 2FV8A 2GJ9A 3BAFA 1XD8A 4HAVA 1U9IA 1W47A 3LV8A 2IS4A 3H1TA 5DI3A 3OIVA 3VU9A 4G3XA 2E1RA 3K53A 4JJKA 1US8B 2J0SA 2PZEA 3CRMA 3VTKA 2OBLA 5F2EA 1DAMA 1AKYA 4U5XA 2X77A 4DUGA 4CZ2A 3LX5A 1EWQA 3I5YA 2OILA 3B1WA 4TZ0A 2UKDA 5L3RA 1YVDA 2WMNB 4KV9A 4GPTA 2PZFA 4NYMR 3QG1A 3I73A 5TV2A 3U44B 3KUCA 3SYLA 1Z6TA 4D82A 3EPHA 4JIMA 4OHYA 2GXQA 1RFLA 3FKSD 1P2TA 2G77B 1AM4D 2QQ0A 3T5DA 1G19A 2KBFA 4W5WA 1FTNA 1U99A 2XB4A 4A8JA 1G7TA 1M74A 1GKUB 4EQ6A 2YWEA 1E32A 4U02A 3FHOA 3UMSA 4I4LA 1AGPA 2F9LA 3IHWA 2ZI9A 3F5FA 1XEXA 4DEYA 5ELXA 3GQBA 1QBKC 1GILA 2ZUDA 3AF0A 1XMIA 2PJZA 1E0SA 1F2TA 1VECA 2O52A 1M2OB 2YHSA 2ZYVX 3QEOA 1NY6A 3LW7A 4JKYA 4FXPA 4M9QA 2O8EB 2GWHA 1KIMA 1KSFX 4NYMQ 1YR9A 3MG9A 2BCGY 2W6JA 1ZBDA 5CM9C 4XVRA 2WWHA 2QE7D 2O8BB 4OI2A 2OSBA 4C0KA 1F6BA 3EX7C 1G7SA 1G5RA 2DFLA 1OXUA 3FTQA 3PG5A 4Y0VA 2ZS9A 1Z63A 1LS6A 4LV6A 1KAGA 2BBWA 5B58C 5BN3A 3THXB 3OAAA 2VP4A 1Z6YA 2QTVB 3P4YA 3QPVA 2G83A 2DFTA 2QMOA 2D2FA 3LXRA 1XJQA 3GLFA 4L15A 2FF7A 4GOXA 1COWD 1UADA 1SKQA 5LB4A 4IXNA 3QXHA 3U2QA 1TMKA 1UBCA 3MLEA 4JL5A 4DWJA 4B35A 2G1JA 4X8LA 4CEIA 3RHFA 1JECA 1NBME 4RD0A 5KOYA 4DLTA 3ZVLA 1GZSA 2O8DB 1S4QA 1SULA 3GLHE 2JASA 2GXUA 2C99A 4YONB 4PX9A 2B6HA 4RD1A 1SKYB 3DEFA 5CIQA 4HB2A 1XB2A 2J1LA 3QI2A 3BFXA 4TLAA 4BFUA 2UZ3A 4PSKA 2EFDB 1KO7A 1ANKA 4Q19A 1VIAA 1KI7A 3D6TB 4PO1A 1W4RA 4I1VA 1UDWA 2V6JA 4M1OA 1BOFA 1KZGB 3SYNA 2QMHA 2C03A 4V0NA 5FUWA 1E9DA 5H1YA 2DPXA 1KJWA 4B73A 1KDOA 2QENA 4P3YA 1W7AA 3RAPR 3PV0A 1TUEA 1T3SA 4HEJA 1D9ZA 2GKSA 3CRW1 3M6AA 3W6PA 1XPRA 2CK3A 2UZIR 421PA 4HZIA 1E1QD 2IYQA 4UJ5A 4D6PA 1S8FA 4OQFA 2WWYA 1Q3HA 2FEMA 4TWZA 4QGGA 5FOUA 2R6GA 4PTLA 3OIWA 1QHHA 3KFVA 5HCNA 4OJKA 2EFHB 4M22A 1XDBA 1ZC4A 3QBVA 4URYR 1L2TA 3U3JA 1KO4A 5FOSA 3LNCA 4EJSC 2ZJAA 4G01B 3KUDA 3OEED 5G3ZA 1IQPA 4XOIA 3NIBA 3KKPA 2HT6A 4OI0A 2ZE8A 3MMPA 2ZJ5A 4DLWA 1OLOA 3SS8A 2IF2A 3JVVA 1UKVY 5KO2A 3B85A 4NDZA 3ZS9A 5JJKA 2YOFA 3RNLA 5M04A 1W2HA 4C0AC 3IPYA 4M53A 1CULC 4PPFA 5FI0B 4TL9A 1IOZA 3FFAA 3R8FA 1N6NA 3T34A 4JLPA 1J70A 1ZD9A 2H5EA 2A5GA 1VG9B 4CW7A 1D5CA 3P26A 721PA 3LW8A 4DIDA 2WIAA 2IUSA 1NF3A 3EIEA 2JLWA 4BUJA 2ZS7A 3DKVA 2BCJQ 3RRMA 1Z0DA 4A9AA 4MGYR 1JAIA 1NJGA 4QGAA 3WP1B 1OFIA 1US8A 2BBOA 5EZ6B 1QZXA 4LK2A 2GK7A 4KVGA 1DAIA 1RKBA 4AYXA 1H8EA 4R71A 1E2EA 2H17A 1FUUA 1IXZA 2G9NA 1FNNA 1HE8B 1XEFA 3S1AB 1KTVA 4HYYA 2GTPA 2QMEA 4HDCA 4Q4LA 2W00A 3RS3A 2QMUA 2MMGA 2ODEA 4QC2A 2NTYC 2FZLA 3IBGA 3U44A 1HURA 1HA3A 2C9OA 4J0QA 2GJSA 1Q57A 2QT1A 3PCRB 1E79A 3CX7A 4B47A 2BWJA 2ZM5A 2I1QA 4N0EA 3ETLA 3THWB 2AWNA 3IIMA 4Z8YA 1CR4A 4ABYA 1RC8A 3HPRA 2HV8A 3BJIC 2ZANA 3DL0A 2IA5A 2QGNA 2V6IA 4V0OA 3PEVA 1Y3AA 4A0RA 4BLOA 1IXSB 1NVUQ 2CLDX 3VFDA 4BLTA 5JS7A 1DO2A 5J4KA 5EXXA 2C9CA 2FSGA 3KKMA 5FPKA 2ZRJA 1X8KA 1A7JA 4JYCA 5FPHA 2OO7A 3DDCA 1W36B 2G6BA 2O8EA 3SE0A 1EFCA 5FL7D 2IWHA 2N42A 1GM5A 2Q6TA 4AKEA 1XWIA 4RFVA 1DEKA 1P61B 5G3YA 3I3SR 2O8BA 1S2MA 2R6DA 3HYRA 1KI4A 3L0IB 1KDPA 1Q1BA 1QDEA 3IEVA 4D4KA 3EZ7A 4V0MA 2GRJA 4FMDB 3THXA 3TGPA 2GCNA 2AHOA 5KPDA 3Q72A 1FX0B 3B5JA 1E96A 1II9A 2ORIA 2QA5A 3CF0A 3LO5A 4JZKA 2IEYA 5G53C 2ZIAA 4R7ZA 4H1UA 4G0NA 4MRVA 4BZPA 5KSOA 3VQTA 2ZYWX 1Z83A 2IC5A 3OESA 4OHWA 4B43A 1NLFA 3X1WA 1ZNWA 2ZRAA 3C41J 2K5UA 4Q48A 4TMKA 1E2KA 2A5JA 3WHLA 3M1IA 2ZR7A 2O8DA 4HZUB 1SVOA 1CRQA 4CF7A 2YKGA 1W0JA 1R5BA 4PQFA 5BXQC 1T9HA 5IDVA 2ZRPA 3WNDA 3GMTA 4P4UA 4B71A 3TNFA 1HT1E 2FOLA 2ZROA 3VR4A 1NIJA 3AEZA 1MO3A 3ECCA 4D2IA 3CW2A 4POAA 1UFQA 1OF1A 3IHLA 4MA4A 1ZC3A 3O8BA 2W2VA 4A82A 1P72A 2CCGA 2XITA 4DUGD 1R8SA 2EFCB 2GAAA 4ZDIA 4Q47A 3HU1A 2RMKA 1E2HA 4BQSA 4C0HA 2OFOA 2WSMA 3CRRA 1J90A 4BFVA 5CLQA 1CR0A 2P5SA 1XNJA 2ZI3A 1CF4A 4AYTA 1NJFA 3KJIA 1OH7A 4LGMA 4EFNA 3A4LA 5AUQA 4V0KA 3LAWA 3AP3A 3BFKA 3PEUA 5F98A 5TDHA 5EP2A 2CVFA 4R9UC 5EQTA 2C8VA 4JBXA 1ZIOA 3CWZA 5FBRB 4CT4B 1WDTA 3WMEA 4DLUA 3VKHA 2GCOB 1UF9A 1II8B 4NONA 5AR1A 3ZD6A 3HWSA 4TTQA 1RRFA 2V55B 3KXIA 3CPEA 5J4VA 1CS4C 1Z8FA 2KWIA 3QKUA 3MSXA 1P2UA 4GRAA 3MJHA 1Z6XA 4URVR 1J8YF 2BV3A 1ZYUA 1JAHA 3UXMA 4XJXA 2LKDA 2QEQA 2W6JD 1OFHA 4IDQA 1E2LA 1ZVQA 1N6KA 5LD2C 3CWQA 2ATVA 2GK6A 1MRSA 1Z47A 5KSZA 2RKOA 4HLUA 3OE7A 2VEDA 4PXAA 1NLYA 1DO0A 3K09A 5KU1A 3OAAD 2D06A 3BXZA 3THYB 2PBRA 1G9XA 3TSZA 2XNDA 2GBLA 2I1VB 3SZRA 3ZVRA 4L9SA 1JR6A 4URXR 3X2SA 1ZUHA 5LB2A 4GP7A 4F93B 2DWOA 1D2NA 1JEEA 2RGCA 3C8UA 4LV8B 4GP6A 1P60A 4L16A 3ADBA 4ZV4A 4LJAA 3D31A 2CCKA 1E2IA 4BRWA 1VHTA 3LX8A 4IVRA 1Z0FA 3QKTA 5C18A 4C0BA 1E0JA 1PUJA 2VRWA 3H0KA 1KI1A 4EKDA 4JLVA 4JT2A 1HQYE 3GJ4A 3S1AA 4MYUA 3TVTA 1F3OA 4LI0A 1IN4A 3IGFA 2VPPA 1SGWA 2QM8A 1FP6A 2XAUA 2AFHE 3VX3A 5JSZB 4AC9A 4TL8A 3GJXC 2RAPA 3CKLA 1SXJE 3DMDA 2XOKA 1U0JA 3LY5A 3KQNA 3AVXA 1COWA 5EE1A 5AJYA 4TQ9A 4A0FA 1N5JA 1IN7A 4ZIRB 3THWA 2ZS8A 3BC1A 4PC7A 4AD8A 4YLGA 2ZRKA 1AQYA 1W49A 2QZ4A 4G5OA 4L5BA 4C9BA 4DLRA 4XH9B 4BLSA 3B82A 4Z8XA 3UWKA 3K0CA 2DWQA 4QBHA 4X8HA 3GJ7A 2IXFA 4UQOA 3KX2A 3LQRA 1EFTA 2BJWA 4JLOA 1UEIA 3HU2A 4ITRC 4NPHA 4EPXA 2ECKA 2BVNA 2FJUA 2YC2C 2CK3D 1U94A 3F0TA 5KSPA 4LOAA 1TF2A 5CJPA 5FR2A 1G4UR 3BBPA 3B78A 1N5LA 5JRZA 3R20A 3TJZA 4LX0A 5CIWA 1R5OA 2WMOB 1U8AA 3L8ZA 4RFSB 4QM6A 5G41A 3KQKA 1ZP6A 2XNSA 3AUYA 3GJ8A 1OT3A 1QHNA 4LPSA 2CVHA 3U3MA 4G1UC 1QG2A 3QQ5A 4NZYA 1AS0A 4HLDA 2AD1A 2J45A 5CDFA 3QKRB 3T1TA 1GIAA 3B1VA 2RGNC 2C2HA 3PJRA 3CX8A 4MRNA 1FX0A 5JS8A 1ZM2A 1LV7A 5AJWA 2QG6A 3U3RA 3DOEA 1OXXK 4IW3B 3ZQ6A 5FUYA 1BO6A 1G3MA 1G8PA 2OCAA 4E5UA 4MQBA 2HDNB 3OHMA 4CIDA 1LF5A 2B92A 2W0MA 2NOAA 2ZITA 4HZUA 4Q5IA 1XTKA 3RDPA 3B7GA 2YNMA 3W34A 3GJ3A 1KDTA 2P5TB 5BN5A 1SVIA 5DYIA 2WOOA 2Z43A 3OIYA 2ZUCA 1QF9A 2Q21A 3FDIA 3H2YA 4GL2A 4DDUA 2YC4C 1GRRA 3K0FB 2DYKA 2ZRMA 1KOFA 1FQJA 1WA5A 5FUVA 4FMCF 2IHYA 5FTJA 3RRZA 4CEHB 4M9XA 1H8ED 3B2EA 1R0WA 2YWFA 1W4AA 5FR1A 4QKQA 2OFXA 4HI0E 1EX7A 1NVXQ 1HT2E 1WB9A 1GNQA 2F1JA 3AGPA 5E4FA 2P6RA 3LFUA 2FFHA 4MDEA 5KNBA 1D8TA 4EUNA 1Z07A 1LB1B 2A9KA 3IKJA 5E7MA 3Q9LA 1G3UA 3LXXA 3N2IA 2OCBA 4GMDA 4B44A 4KLZA 4FIDA 3QE0A 3RANA 3U4QB 5IT5A 3QSYA 2NMVA 2QBYB 2IHBA 2NZ8A 5JJIA 4NCJA 3CLVA 4B2PA 2GXSA 4Q4JB 2IYTA 2HUPA 4A0GA 2H18A 4TYQA 2GCOA 4D0GA 1II8A 5EZ5A 3WRXC 2ZI5A 2VQSA 1S1MA 3UK6A 1BMFA 2H57A 1R0ZA 1NVVR 1SVMA 3KDSE 3RC3A 2PLRA 2R6FA 1JALA 2F3RA 2Z5FA 1OIXA 1XPOA 2ODWA 1PJRA 3W90A 3CZPA 2ZRBA 3I4LA 3BRWD 4XVUA 4BLRA 4WA7A 4DSTA 1XXHB 1LY1A 3K8YA 3PQCA 5P21A 1T0JB 3GFPA 1EXMA 1ODFA 4WZ6A 3L2OB 2ZQ5A 3EPKA 4O2RA 1I4DD 4BFSA 1OXVA 1ZM9A 3THYA 5H68A 3NEJA 4DSUA 1NY5A 2DFNA 4NCKA 3B6EA 5FTKA 2A2ZA 1ZIPA 1U0LA 2WPDA 1GKYA 2FA9A 1M1YE 1P5ZB 3CR7A 4DEXA 2X2EA 4LYFA 3KKOA 1KGDA 3F8TA 2RGDA 4CEJA 2OESA 1E9EA 4TMVA 2QM7A 3W3AA 3AVOA 2JLYA 5H8WA 2A3RA 3IILA 4HLUC 5KYKA 5ANRB 3WNCA 1AGRA 5JSZA 1GL9B 1NI3A 4I1OA 3BWDD 4NHOA 3K09C 3MJRA 2IYZA 1ZMXA 3ND8A 1E4YA 1SZPA 1X1RA 1W44A 2JJ2A 3MAAC 3NHAA 4ZIRA 2Q9BA 3BORA 4EPTA 1JJVA 3IO3A 4D25A 1Q0UA 1R4AA 2BKUA 4KJZA 4AIIA 1OH6A 3UG6A 1MO6A 4TLEA 4DHEA 5HCIA 4URWR 3RRYA 2Q0HA 3KKQA 1S1CA 2VO1A 4FINA 3PITA 2QN6A 4QGFA 1P9WA 3TRFA 1HE1C 4Q21A 4KSBA 2GJKA 4HUQB 5E3HA 3CZQA 3PEWA 2JJ8A 2BBTA 4MYCA 2VL7A 4HDOB 2V54A 1F5NA 3PUWA 1HH4A 3E2IA 2CNWA 4DLSA 5DHAA 4TYPA 3QXCA 4RFSA 4IFEA 1KO1A 3TR0A 2C04A 2QU8A 3AKCA 3VNVA 5C4GB 2ZSBA 3R9XA 1ZAKA 1MABB 1XCGB 1G64A 4KHZA 1Z5ZA 3I5XA 1GFIA 2F55A 4P4SB 3IIKA 2QTHA 5EE9A 1E9CA 4XTCS 3GFOA 3QKRA 4JLNA 3B8HA 1Q22A 4ILEA 4PHHA 2V1XA 1EFRA 1M7BA 2IS1A 4PPQA 2OCPA 4UKDA 4KFTA 2NIPA 1FZQA 5LPNA 2AWOA 1YQTA 1GRNA 4LJYA 3M4YA 5A4JA 4LRWA 3DVLA 1JJ7A 4U00A 3EA5A 2CDNA 3T61A 4OI1A 1A1VA 1MV5A 5A0FA 4B3XA 4LPKA 3AQ4A 2V8OA 3BFVA 2IS6A 1G5TA 2KE5A 3A1SA 4IFBA 1UKZA 1O3YA 4KCGA 4LCBA 4RVCA 3UMFA 3CB4A 1AA9A 2RH5A 5H70A 3VKGA 3AV0B 1KKMA 2FN4A 1WE2A 4JSTA 1E2JA 4DDWA 3OE7D 2B8WA 2F43B 1T6NA 2ZRHA 5FBWB 2XGJA 4M9ZA 1DAHA 1XU4A 1TQ2A 1PLKA 3ICQB 2ORWA 2FNAA 2ANCA 2XNDD 4QXAA 2FSIA 5KDOA 2OCYC 5DI9A 4B2IA 2IBMA 5CJ2A 1AIPA 4N1AA 3K0FA 3UANA 3UIEA 3C5HA 4YMSA 1N6IA 3ONWA 4CEHA 2ZTSA 1I4TD 1E9FA 1U2RA 3A37A 2QAGB 1E1RA 2GILA 2JLQA 4JVLA 1PZNA 3AVVA 1E6CA 5JHHB 4Q9LA 5SZJA 4GDFA 4PPNA 2P3SA 4LJ4A 2NO9A 4PC3A 4PZZA 1I2DA 5EP4A 1RYHA 1ZCBA 1KI8A 3WYFA 3FMPB 4IDPA 1CRPA 2IWRA 4GZMA 2ZU6A 4B74A 3LD9A 3EPJA 2XOKD 5AWFC 1T3HA 4EPWA 5EP3A 4KSCA 2QSYA 2X19A 2XTZA 3SFZA 3QBTA 3NDBB 4MKHA 4Q00A 4MUAA 3X1XA 1KMHB 2WTUA 3U4QA 4C3ZA 1MOZA 1WMSA 1TF7A 4HAZA 3LDAA 4GMXA 1TAGA 3IO5A 4OQNA 1Q1ZA 4Q4JA 3TVDA 2BC9A 1KK3A 4YMUA 1ZINA 3A1WA 1W46A 4NCHA 1XFAA 1T4GA 2WICA 3Q5DA 2HXSA 4W9MC 4ZI2A 4JSYA 3EIQA 1W36D 1CXZA 1G4AE 2AKAB 4RD3A 4MKFA 3V4FA 2BEJA 3PVSA 2Z4RA 1G41A 4C0SA 2Y8EA 2PH1A 1GWNA 1FQKA 1NP6A 4R98A 4C0LA 4HAWA 5JCPA 1K5DA 5IK2D 1XXHA 1C9KA 4MYHA 1P62B 2ODNA 4NCNA 2ZU0C 3GLIE 4IXMA 2VHCA 2ONKA 3RABA 4US1R 5JECA 4RKFA 1CJMA 3LRPA 1YR6A 3RLFA 1P3JA 2BMDA 2G3YA 2E9SA 5E95A 4LYAA 5DGXA 4M1WA 4FW9A 4ON9A 3TW8B 4LC0A 1QHXA 3VR3A 3CH4B 1R6BX 1VPLA 4IOJA 4ARZB 2WWXA 2FPKA 1DADA 4D4LA 2OXRA 1W48A 1EGAA 2OV2A 3MUFA 2JAQA 2BHRA 2GVDC 4GNKA 4NYJR 4ZDJA 4S35A 5BW8A 2Q3MA 3VMFA 3E1SA 2BMJA 1GUAA 4GT1A 4XVQA 1P6XA 4BFTA 3MRSA 5EE5B 3BH0A 4IOKA 4DSOA 2A5YB 2XSZA 3DOFA 1J2JA 1LW7A 1Z6AA 3P20A 1XP8A 3Q85A 4M1YA 5JRJA 2YOGA 3ZD7A 4EFMA 4JLAA 1W0KA 2PEZA 3N5CA 4PAQA 1FNMA 4TTRA 1N6OA 4OI4A 4GFDA 2RCNA 1S96A 2AFIE 5LBIA 2BM1A 1RRCA 6Q21A 3IBYA 2FFQA 2O8FB 3WY9A 4HUQA 3SC3A 3RS5A 3AVPA 3K0EA 4HUTA 4NYJQ 3CIOA 5B64A 4JMPA 4UJ3A 4B48A 1W4BA 4QBGB 5KNCA 1OJLA 2Q9CA 3KXKA 2CCJA 4TSFA 2CL0X 5FTMA 2ZJ2A 1MABA 1UM8A 4HAYA 1S3SA 2VP6A 4G5SA 4P4SA 4Q9JA 4MH0R 3SI7A 3C7KA 4TYWA 3TH5A 2QTFA 4QFMA 1I2MA 4LJ7A 4XWAA 3SQWA 2R65A 4WIAA 3HYTA 1N2CE 3N70A 3NTUA 2CJWB 4LBWA 4PQRA 3AGQA 2PLFA 5C46F 1TX4B 3A58B 1EG7A 4BLQA 1OPXA 4TYNA 3ZGXA 2OEPA 4Q1BA 4NP6A 3CPJB 3GEIA 5J4LA 3J81k 2REXB 1BMFD 3W8RA 3G5UA 1OFTA 2VF8A 1Q12A 2FFAA 2WJVA 4Y0AA 3GLFE 5FTNA 1E94E 1U9IC 1ZUIA 4M4SA 2WAXA 1W2GA 4JT4A 1ZD8A 3WRYC 1QRAA 2WBLC 4B3BA 1FMJA 1ETUA 1OKKA 2JGNA 1FP7A 1HYQA 4TTPA 2V7QA 4DCSA 4TQAA 1DAGA 1OB2A 5F9FA 3DZ8A 1G8YA 4QHTA 1CJKC 3ZQJA 2F43A 4B2LA 4DC9A 1IBRA 3WP0A 4UNQA 2DY1A 1AZSC 3I8XA 1P2VA 3BD9A 2JEOA 4ESHA 1WRBA 1VDZA 1G8HA 2WPDD 4LJ6A 1GP2A 2JA1A 4EPYA 3QENA 4LHXA 4AKIA 2QP3A 2QAGA 2ZE7A 3W6NA 4M0LA 4I81A 4F4CA 3RWOA 1E9RA 4A8JC 3REFA 2G88A 2BIFA 3CBQA 1VKJA 1E0KA 3KQUA 3I72A 1TUIA 4CGZA 5BYKA 4C2UA 1G20E 4KITB 3K70B 2FX3A 2OBMA 3V00A 5J4YA 3LBNA 1F60A 1RVDA 3NEYA 2JJ2D 4DCVA 4B6EA 1KMHA 3B1ZA 4OHZA 1XTRA 2WHXA 1X3SA 3JVUA 2YOHA 2KBEA 1W5SA 5JMTA 5FTLA 2R44A 3QVVA 4PZYA 3BERA 4US0R 2AR7A 3SJZA 3QY0A 1MO4A 1ZM4A 1VTKA 3FVQA 3GCGA 4LBYA 5KPJA 4E09A 3KB1A 5HE8A 3NBFA 4DB2A 4ZDKA 1XD9A 1OE0A 4BRUA 3AVWA 4MYTA 2CMKA 2VBCA 3FHCB 2VSXA 3ZS8A 4A4DA 4PHFA 5L8VA 3NDPA 1OIWA 5FPTA 4GI7A 4H9GA 2CNWD 2OXCA 4KYUA 5JWOA 2QY9A 2FPLA 2JIZA 4DSNA 4YXWA 3P27A 1OHHA 3KJGA 4TYYA 1XMVA 3AB3A 3FMFA 3Q8XB 1YZQA 1XEWY 4QJ4A 1KSGA 2J0UB 2ZI4A 4KAXA 4HAUA 4XSHA 5AUOB 5CITA 5HZHA 3CONA 2QPOA 3EG5A 5CM8B 2WZQA 5K8IA 4JJZA 2QPAA 3H4MA 1C1YA 1G291 1KZ7B 2BDTA 3H86A 2HF8A 4URZR 4AKHA 3QNUA 1EFRD 3CPHA 1E9AA 1OXSC 2W83A 1EESA 2NZJA 1E4VA 1XD2B 4F38A 1GG2A 4OQMA 4ARZA 2FU5C 3A4NA 3T06B 3DMNA 1KJYA 3AVYA 2J46A 1R2QA 3BE4A 5UKDA 1PUIA 2JLZA 2HXYA 3I62A
chains in the Genus database with same CATH superfamily
4FI3C 1QRUA 1C0KA 3H8SA 1FSGA 2JL1A 1YUBA 5IH3A 2JAPA 3K9GA 1KDVA 2AK2A 3KV1A 3RAEC 2QUZA 3KHTA 4TKUA 1X74A 1T0HB 1WZ2A 3IMFA 3ED1A 3WLOA 1ULBA 3G2LA 4RETA 2YVUA 1DBQA 2BHNA 1QO7A 1TJPB 2GAIA 4KFRA 4XTRA 1EFPB 1Z37A 3ORSA 1PHRA 4DIFA 3FPBA 2J7KA 4QYMA 4HDRB 2JBAA 2J7PA 4YO8A 3WIDA 3VHLB 1T24A 1C8KA 3GG9A 3U7GA 2CHEA 5E2AA 1DIGA 4UW9A 2E1PA 1QHYA 5F1OA 3NBYC 5IAJA 1LFDB 1S0UA 5BWBA 3GVHA 2O0MA 5E4TA 1E7YA 2PUCA 3DPUA 1DAOA 5HA5A 2WM8A 1CDDA 2CE2X 2V7EA 3CQ9A 4WNYA 5JSQA 1C30B 4MUXA 3E15A 4ETIA 1MX3A 1D2GA 5IC5A 3H4IA 2I67A 5BRNA 3SWWA 1P1KA 3Q8LA 4LVUA 3SKVA 1J1IA 1T9AA 5H80A 4ZV7A 2IXGA 3VR1A 5F1YA 2DTDA 4BYMA 3HN7A 1E1LA 3SLKA 2VP0A 3U4DA 5DTMA 4PAGA 2EJTA 4NU0A 4EHAA 1WX1A 2NZVG 3A28A 1XC7A 3CNQS 5E38A 3RYHA 4QO7A 3VVMA 5ULLA 1R7RA 3T1QA 1RHKA 1X6VA 1PK7A 1O77A 4O4JB 2VPZA 2ZM6B 3CO5A 1MAUA 1N2BA 1QPBA 4YAEA 4BDSA 4FHCA 2WD7B 4QHYA 5DT2A 1CY2A 4OHFA 1PNVA 4W6ZA 3MLAA 1A5BB 3F4BA 2VDKB 2XD4A 3JQBA 4LWZA 5AI6A 5EAIA 2PR7A 3I76A 2JK1A 5I8PA 4MI9A 5JHGB 5CYPA 3E9ZA 4L8WB 5A05A 4I9HA 3VVLA 5ALEA 3NHKA 1JI3A 1O6ZA 3TIFA 5A04A 5D5PA 3D6AA 3Q7PA 4PC6A 5CJJA 3UTCA 5E7QA 2PT9A 5C4MA 3BMQA 4AO6A 2QN3A 4Z3OA 2A0FA 3F8SA 5C1PA 3DLIA 3ABZA 5EC8A 2Q8PA 4J3NA 4B9EA 1D6SA 4LVNA 2C59A 1G21E 1D07A 1N1EA 4HLCA 3AWIA 3EW7A 3V1TC 3ZLTA 4BO0A 3BB4A 4W7HA 1SKYE 1IN5A 2Y1XA 4RJLA 2OAQ1 5EXSA 4ARIA 1A9ZA 1P17A 2AOXA 5JS2A 2JFYA 1DMRA 1RHJA 1XZPA 3GAMA 4OL0A 2GESA 2IZOA 4QUDA 3UGQA 3W7BA 5ISMA 2VJKA 1W5AA 2AQKA 2Q1SA 3DAFA 4TS4A 1EK0A 1YZYA 2YYYA 4BGVA 4M9UA 1U0EA 2W6IA 1DXQA 2HLDA 4TM8A 1XZKA 3R5SA 1QV9A 4MIYA 4MRSA 2X9QA 1QH1B 4GC5A 3U1BA 2OBBA 1OGIA 3KOUA 3CUEF 3CTPA 3ORHA 3QWAA 4K6GA 3B6ZA 4YRMA 5K0BA 1CIJA 1LDMA 2P4HX 4WY5A 1TZ2A 3WBKA 1PZGA 4QGHA 1QM5A 2I71A 5K6RA 4G0QA 4G4GA 5HFAA 1XCPA 1Z4NA 2YS6A 4K40A 1NQXA 2JCGA 2PRSA 3K2QA 3R41A 4NATA 1GQSA 4X71A 5AI5A 5FPYA 3P2MA 3WBJA 4ENVA 1CFJA 1F12A 2BTQA 3WLQA 1T2VA 2HNBA 4DGSA 3U3KA 1Y63A 1DAKA 3RLFA 1OD6A 1T6YA 3ND9A 1XDGA 1QTNA 8ABPA 5J2TB 1SRRA 1TL7C 2VDQB 2KS6A 4LXUA 4B09A 2P5YA 2JVKA 4ALNA 4F5EA 4WBNF 4YC7A 4ZI3A 4ABTA 3Q3GE 4QHSA 2O2XA 4E5KA 1L6IA 4MDFA 3HB5X 4FMCB 1WMDA 5ALWA 4PLYA 2BSAA 1ZD5A 1NOJA 1W5TA 4BXOA 4I2NA 4AG3A 3EAFA 3I9V6 2DQKA 2ERXA 3AP2A 3OOWA 4AMVA 2FWRA 4BN5A 1HDOA 2Y0PA 3DLPX 3QVKA 5CA0A 3T41A 1IK4A 4DKXA 5AUNB 1O96B 4Q1EA 1TQDA 4FC7A 4Y2SA 4EY3A 4C07A 5IRCD 2JIQA 2R1VB 1HQCA 4PBSA 3T4EA 1BE1A 1W19A 5HKAA 1CUFA 2QGZA 2OYRA 3BB3A 3H04A 2PXAA 2FXVA 3ASYA 2ZAMA 2P69A 2A88A 1OX4B 2IODA 4O29A 2WIFA 1YQWA 4UMFA 2I1WA 4N5DA 4EX7A 4RPLA 2WF6A 4TSFD 2CVQA 3BXEA 5HZKA 1MMFB 3K7EA 3PT5A 4M9RA 2R2AA 4O5OA 4YRZA 4BV8A 4NBSA 1JJIA 1Y7IA 2DEUA 4ZMSA 3ANXA 1ZNZA 2E3JA 4NS4A 4CM9A 2XCRB 2R7LA 1CY4A 1T2CA 1XF9A 3WYGA 4M8LA 3I30X 3NORA 1CDZA 4E5MA 3G8AA 4CDGA 5EXPA 2G9QA 3CF2A 2VHXA 3R8XA 4JXZA 3WNVA 1JU9A 1VYHA 4IGKA 1QOQB 2QRHA 1KI6B 1QFMA 1SCNE 1Y82A 3M1LA 2RG7A 3RS4A 3RSZA 3V32A 3VDXA 4BGIA 4EIWA 5LNK6 1ETHA 1KJZA 4IHAA 5BVHB 5IAOA 2HL6A 3AFGA 4Q93A 3FMIA 4NZMA 4PLHA 1CDEA 1ML4A 3VO8A 4D46A 1EDDA 1EP1B 5CDSA 1ND5A 3I9LA 4FP9A 5KYVA 1K89A 4H4CA 3VR4H 3LP5A 3A6ZA 4QASA 3ANMA 5BY2A 2ZG6A 2ZXEA 3OTIA 4MKIA 1MOPA 2CC2A 2DT5A 2I8CA 3DVAA 1G59A 1WXDA 2X4LA 3DQQA 3V8BA 3U6KA 1V37A 5DTQA 1ZD1A 2H8KA 1DDIA 2OMEA 3EWIA 5FHRA 1D1SA 4FEYA 4F4JA 2WT9A 2O19A 5LN1A 1BKDR 1XYVA 4UOZA 2PZ8A 3AR5A 3DV9A 4JYBA 1N32B 1DFGA 1U2SA 2VZEA 2JA2A 3FHTA 1RRGA 3USES 4E7PA 4IKPA 3TTUA 1H9CA 3GBSA 4F1WA 2G67A 2ZULA 4K2HA 3S0JA 4HNTA 4JWTA 4RZ3A 4TVBA 3WGVA 3DM9B 3Q6IA 4FFRA 2QN7A 1VE7A 3TYXA 3WMFA 1H66A 1PVOA 4R6WA 4TTJA 4YYEA 1L3BA 5I9IA 4W5TA 5FL3A 1SXPA 3JATA 5KQRA 4Q16A 4D5EA 5AVTA 3BSFA 4FCVA 1K0UA 5FWYA 5KEIA 1C7IA 1Q21A 3OEWA 1D2RA 5DN9A 3KBBA 5DNVA 5KNDH 4OGWA 4TLBA 2E82A 1MQ9A 2OM6A 3ZU4A 1VP3A 4E4YA 3IXQA 3ABIA 4K1LA 3ZWVA 3OZRA 5EKTA 2WQZA 2IYWA 2H85A 4A03A 3KALA 4BO2A 2RK4A 2PUTA 2QN2A 1XV5A 1Z5UA 2YHBA 2ZREA 2VSYA 2ZTVA 1ESCA 1N7JA 3AR7A 1GUFA 1YE8A 3B13B 1W88A 4FZ5A 1HDXA 3AHGA 3CNLA 4PHTA 5C52B 1OFVA 1MZVA 1YA6A 1H2YA 1EFVB 3MOGA 3O92A 4GC9A 1LC0A 4UUMA 2BTOA 4DR3B 3KLOA 1USKA 3R3HA 2V8BA 3KSMA 5IHPA 3FZEA 4DLAA 1SXJD 4FOOA 1ID1A 3L6RA 2VZ9A 2Y92A 1GFZA 4KN8A 1R9JA 3ZDRA 4AP5A 1R88A 3LBFA 1VPVA 4IJKA 4WEOA 2VLIA 4G56A 4MITA 4MWBA 3SXUA 2DRIA 2OBYA 1FIUA 5IKOA 5C32A 4YQYA 4H0CA 1KMQA 5ES4B 1BGWA 2JIZD 3E7FA 3L8MA 3P0JA 1MX9A 4O2LA 4OQPA 3ZZ1A 5H9VA 3KQMA 3FGNA 3ZTYA 1GUDA 3G2IA 3GLHA 1XX6A 3OJFA 3GROA 4U2KA 5JJLA 3HJNA 4GU5A 1Z15A 1IK6A 3AERB 1G1MA 4OK5A 2EFEB 4NCIA 3SEAA 2I4OA 1H9BA 4UMEA 3VR6A 3LUJA 4EKGA 1B7GO 4AQ7A 1DOHA 2DERA 4AYWA 1P2BA 1C1XA 1SUBA 1XT6A 3IAS1 2AX4A 1IY0A 2HCBA 4LXIA 3SJ7A 2O8CB 2EX4A 2CJPA 2VUTA 4IZOA 5KKAA 3AO0B 5C35A 3D4LA 1FFDA 2A59A 1T5OA 2ZTLA 2BFCA 2FFBA 4QT0A 1NMQA 2YCBA 3PYLA 1DIHA 1BCRB 2BGRA 3LP8A 3U49A 1ZEJA 1U2PA 4YJ2B 4E22A 2Q4BA 4XWWA 2A6PA 2DKFA 6REQA 3S29A 821PA 4DV1B 3G0HA 1UT6A 2VAPA 2FXIA 3L4BC 3KWLA 4NZOA 4BATA 3BDVA 2Z4SA 1ZM7A 4QOSA 3TK1A 3VR2A 3G8DA 1Z2AA 3JZDA 5K99A 1RP1A 3OVMA 4EMBA 1OI7A 1CSEE 2FETA 3SKXA 3H0EA 1ZNXA 5B2FA 3T9AA 1DWPA 2VQ3A 2WSSD 1I4OA 3LC2O 3AUXA 3EZFA 1YOBA 2HMUA 4ZVQA 4GYKA 5HKKD 2WA1A 2TS1A 1YB5A 5KHLB 1Y8QB 4GX1A 1EA5A 1O0BA 3GLGE 2IT1A 4N5HX 1OLSA 2HPVA 1DQPA 2XB8A 4BE7B 3IBTA 4KDCA 3O4JA 4U9UA 5JVDA 1FLDA 2VHQA 2YINC 1V4BA 4MLCA 5HS6A 4B87A 1TA9A 1LPAB 1L4MA 4ESVA 4V1CI 2ZIUB 2RG1A 4RVDA 4ZCMA 2VA9A 3ZBTA 4ER5A 2BD0A 2BLLA 4NF2A 4EZBA 3ER9A 3UJ9A 1FF9A 3D8TA 1VSQA 1JXMA 3NHBA 4K6CA 3GGPA 4LTMA 5E2IA 1IDOA 4ZZ3A 2AG1A 1RC0A 3EFBA 2XMQA 2XE6A 3IPAA 4EGJA 4NJOA 2IZ1A 2F8MA 1R0SA 3NHZA 2Q4DA 3MS7A 5DX1A 1LTHR 1WCXA 2A67A 3CH6A 3F4LA 4MUNA 5IARA 3RLIA 5BXYA 1WHTB 4MP8A 2AE2A 4D57A 1NBOA 4U7JA 3TR6A 4GECA 4F3RA 2PO5A 4Y2RA 2KQUA 1C0PA 4FSHA 3RVKA 3DHWC 4BFZA 3USCS 4OJMX 3G8CA 3ZCXA 4C7OA 3OMXA 4EAAA 1ZNQO 2AK3A 4J2HA 4KGXA 3JQ7B 4UOQA 4M9SA 3BCUA 2PCJA 1MC8A 1ZK3A 3MHPA 4WAUA 4WWHA 2VJNA 1WUKS 1EXNA 1MQAA 3GA5A 3MXOA 4D6XA 2G9ZA 1VOTA 3VMMA 2QW8A 1D2MA 3TXXA 1D6NA 2XCTB 3AVTA 1XLTA 1ZOIA 3AL3A 1AH2A 1KEEB 3GGGA 3RYFA 5LC1A 1NTOA 2ZZNA 1RI2A 4J16C 3FUUA 1DTSA 3FYSA 3NHRA 3K9BA 3VNBA 1PNTA 1T91A 2WWWA 4CBVA 5JEDA 1J22A 4U9IS 1I0ZA 4CGYA 1KEKA 1LQUA 4UM9D 3ZLVA 2FPXA 1VHWA 4QYWA 3ZX5A 3THOA 3CEMA 5K9ZA 3NETA 1LSJA 4WACA 2X0DA 2C9YA 1WB6A 2FEOA 2J4FA 2WF9A 3FB4A 3ZE9A 3KVNA 3PGA1 1E92A 4A2WA 4ZEMA 1V5FA 5BN4A 2E21A 1LBHA 3A25A 4QNRA 1KA9H 3QOXA 2G5TA 1SXJB 2OY0A 2AH5A 2WHPB 4M1ZA 4X1IA 2PIAA 4OHPA 4XLTA 4WXRA 2F8TA 4XGIA 3H1GA 3T3EA 4KAFA 2ZPTX 3L0BA 2BI4A 1QHIA 4CM7A 2WIBA 3FDJA 4CYMA 1N1MA 2OE2A 2YZ2A 1JT9A 1A2QA 3QF4B 4UFPA 1GKLA 2J4CA 2YWHA 1U7HA 3F5QA 2I6TA 1JS1X 3KBOA 3O74A 2E89A 1QLHA 1WD5A 3W5IA 1TCCA 1P4HA 3IUMA 1SR8A 2XQJA 3PPWA 3ZHZA 4BECA 4KZKA 2ONZA 5KJEA 1ZZGA 5JWHA 2QI9C 3RKUA 2YIVX 1V7QA 2GPBA 2YFHA 4NE9A 4JP1A 1QAQA 4C20A 2G5PA 2BFNA 2P77A 3W2IA 2NNLD 5HKLA 4EAQA 1E59A 3OC6A 1WU8A 3R9WA 2AUMA 5TE9A 3KFXA 2X13A 1U31A 3LZDA 4DPLA 4BVAA 4U7TB 5HQTA 2VTBB 5L3QA 3O7MA 3Q11A 2V6GA 1S7CA 1OI4A 3O9VA 1TT5B 4TWJA 3TM4A 3FNHA 2YWCA 5HPYB 1ZLYA 3U4CA 3GUYA 4GI7A 4QG3A 4E5NA 2XADA 2EJWA 3LPNA 3T12A 1QKKA 2ZUWA 4KOAA 3V1LA 2PLAA 3I39X 4Y1GA 2QM0A 5EXEA 5DN6A 5TLSA 1KYXA 4MDYA 2GZHA 1GZ4A 1NI4B 2WV9A 6ADHA 3ADCA 3CEAA 3QWIA 1CWUA 2R6HA 1GTJ1 3HB0A 5EJ9A 4GOJA 2Y3IA 4G6ZA 2A0WA 1DKQA 1BNCA 5JJ5A 2RGXA 4R6XA 3D4PA 1SCBA 4YR7A 1CY6A 2W8BB 3E3MA 5M34A 3BXOA 3A4IA 1OA1A 2Z04A 4PXSA 1Z6GA 3S99A 4PYOA 3ZDDA 4ZANA 1ZDMA 1ZGGA 5TJHA 2UYGA 2ZSDA 3UVEA 1NN1A 3KUXA 1I7NA 3O8CA 2C96A 3T9CA 2CLIB 3GEBA 4Y2HA 4WBNA 1QX3A 1RFGE 2HA3A 2J9FB 2DMRA 2CF5A 3KSZO 1VCMA 2YMPA 5TEVA 3E22B 1V5WA 3U39A 1ZW6A 2E4UA 4AURA 1YE3A 2AYXA 5B7GA 3VZCA 4QTZA 2GN4A 4IDBA 3RASA 5JXIA 1N6LA 1HLGA 3LU1A 3AW8A 2R5NA 4AFNA 2I7TA 4DR5B 1E0AA 1PV1A 1UQTA 2HUNA 2OHIA 4HLNA 3SU8A 1N36B 4FK8A 2JIDA 5BSMA 3JX9A 1TTTA 4AZTA 2GSDA 4Y1FA 4BCCA 3PUIA 1ZPDA 4M54A 1BHSA 5HHTA 1SUCA 4PTZA 2P2GA 3JQQA 1O95C 3EXHA 1XMXA 2VSOA 1E2MA 5FI3A 3O95A 1P6QA 4R3NA 3TKLA 1PFQA 2F1OA 4BVGA 2EW1A 2PGOA 2WTBA 2R4QA 3ABQB 3KKZA 4NFYA 3L7MA 2FQ1A 4P33A 1IUNA 3NGXA 1GY8A 2FSFA 4UZFA 2CY0A 1ISHA 3OZXA 3KZMA 3TCXB 1IOLA 1VLLA 3FIUA 3B52X 3GRZA 1LEHA 3PC7A 3NC4A 4BJ3A 4Q7KA 3P2YA 2G5CA 3PLNA 4MJ7A 1PSWA 1S9DA 3ZDEA 5EUMA 5A4AA 1G98A 4X65B 2XIQA 4N3BA 2X0FA 2A9JA 3EAQA 3EXG2 1C4KA 3MERA 3PLAE 4PYQA 2IGTA 2BLNA 4LJ5A 4NZ9A 1K7EB 1MH1A 4R40A 3HEMA 4BP1A 5CFMA 3WK7A 3TLCA 3W8NA 2G28A 4YP9A 1BKYA 4K8RB 1RJ9B 4OSPA 4QFCA 2VBGA 4ODIA 1RYFA 3VYWA 2JFFA 1J7JA 1IVYA 1WWKA 2EKDA 1JHMA 2E5WA 3ICCA 4MINA 3WK9A 4D3DA 3I58A 2BKLA 3BXPA 1TTPB 3REOA 5JANA 1XJ0A 5CH5A 1Q1QA 2O7VA 1U90A 3A6LA 2H08A 3OFVA 3TTWA 1UFKA 5KZMB 4AUMA 2M1XA 3P1JA 4FB4A 3IDQA 5AVRA 1KY4A 3DD1A 1V0JA 2VJCA 2X76A 3MMXA 4RVOA 4PZUA 2FOXA 1I9GA 2R84A 4WXYB 1XXHE 2R8EA 4YIKA 2DR3A 5CA1B 1XDDA 3NX4A 3L9XA 2VRNA 4GPD1 1N4AA 2FPUA 5BSEA 4Q4AB 3L0DA 2XTJA 4DA0A 2J3DA 2FPIB 3GN1A 5H7XA 3K5PA 1GDHA 1T4MA 2XUDA 1MO2A 1XQXA 4HQ6A 3HVIA 4MGIR 1RWQA 1M1YB 3QG5A 2QTAA 3ZEIA 2WUEA 1Q91A 3FZGA 4WZZA 2Q7OE 4C76A 3IQWA 5MFPA 4WA8A 5D3QA 4NZPA 4QOJA 4PX3A 3PC8C 5TEWA 1H22A 2QF7A 2MSEB 4A8TA 2D1QA 3WS7A 1LJUA 1PP4A 2XF8A 3HUTA 4F5ZA 1NBMD 4L5JA 4NRDA 3R7WB 2JDIA 2JJ1A 1B43A 3PC6A 4XCVA 4BZQA 4FJ2A 3BK1A 1UXHA 3IMGA 4XFJA 1YJAA 2AFHA 2IUUA 4BZXA 3ZLBA 2XKAA 3M33A 5AJUA 3JAMA 1NX9A 3T7RA 3ZHSA 4AJOA 4HWPA 4IG4A 5KVCA 4LOLA 5LR6A 5CXSA 5B1EA 1L7XA 2L19A 2RGEA 3OFNA 4TMWA 2DULA 4TN1A 2NU8B 5BVGB 3KU4A 3DOIA 3NH6A 1PF7E 3NM4A 5GAJA 1YQ9A 4KODA 4DFDA 2ZKIA 3U3ZA 3VYUB 2GRUA 4CQMA 1J20A 4X66B 1KZ6A 4RJTA 5DISB 5B5SA 4UREA 3KXLA 2YIMA 1TYAE 3CUWA 1G6HA 4MVJI 2EBFX 4BNJA 4CKXA 3IEKA 3VTFA 4D0SA 1RHMA 4QDXA 3FCCA 4G67A 2HCFA 5ALYA 4BDTA 3ZNPA 4IO0A 1HUQA 3T5BA 4B2YA 1N6HA 5FUVA 2YWJA 3IJ5A 3FOZA 2J08A 2O1WA 3QXJA 2XDYA 4KQ9A 4PSAA 4UEQA 1ODSA 3G2HA 4D3ZA 3EGDA 5AJHA 3U48A 5KREA 4RENA 1TU3A 5LZ5A 1TAHA 2J3HA 4KO8A 4DLZA 4DCMA 2I80A 4BKPA 1X14A 2FW1A 2Q7XA 4F2WA 4WN9B 4F60A 4KFSA 1IPHA 3N07A 4N8SA 3LQKA 3UT5A 4DJAA 1RQ2A 1IN1A 2IU4A 3P4XA 4QYIB 1I3OA 2GYVA 1TC2A 4BMZA 6GPBA 3B6JA 4HB0A 5HMMA 3U9SA 4YS6A 3EVZA 4JCOA 2ZR9A 5DCWA 2WMYA 4F85A 1CEYA 1U6JA 2A1UA 2HJVA 4G8CA 4MGKR 1FFBA 4R16A 3ANSA 3BYZA 5IZCA 1XA0A 1JWAB 1CD5A 4DZZA 1SD1A 1SVSA 2UDPA 2WB2A 1HM5A 4IMPA 2YL2A 3WXMA 1YR2A 3DE7X 5AJXA 2HLPA 2LIVA 2QSJA 5GZ6A 1N5IA 3M4XA 5EN4A 5TXGA 3QU2A 4LCJA 1TNDA 4GG1A 3RF7A 4ND7A 3STWA 2HT1A 3H9UA 3IOBA 3L7DA 4PZ0A 1IN6A 3DB2A 4ZQEA 4AY3A 4EOGA 5JROA 1SQSA 1LKZA 3VNSA 1W94A 2AB0A 5DKFA 2J0QA 3OOJA 4A6PA 2JHCA 3WLRA 3HADA 1WB4A 1JB9A 4AP9A 4HLQB 5DYTA 4CR7A 4KHPB 4FTWA 1SZCA 1O97D 3PUHA 1CZHA 4XB1A 1VFPA 3ZJYA 2IZ7A 2YYZA 2WVJA 1BHO1 1U5BA 3GZ4A 3W78A 2HWXA 2WKWA 3GJ6A 2KSQA 3ZY6A 1BJTA 1M34E 4RTJA 2QTGA 1QOZA 3D9QX 3KR1A 1BSVA 1E89A 3EWAA 3FWZA 2CLMB 3GMSA 5IX8A 3C3EA 2XB2A 4HX9A 4NNOA 1KZ9A 1J5EB 2V7GA 4MIKA 3DULA 2I91A 2ZTHA 4E1VA 5F9HA 2NSHA 4J4TA 4NG5A 3S5UA 4MHTA 1K6IA 5FI5A 3HVUA 4MWCA 1WXWA 1HYBA 1GAJA 3EEYA 1A4UA 2VTDA 3JWGA 4MA0A 3TWOA 3U26A 4F4FA 3AZQA 4BO3A 1SC3A 1V2HE 4S1WA 4J1SA 3KU1A 3ZDQA 4B84A 2P3QA 2AXPA 4U7GA 4LDNA 1K4YA 2J5QA 4UUBA 5DBHX 4WMLA 3WVNA 4BB6A 3B2QA 1YDMA 2LWIA 2WZBA 2IYRA 1FMLA 3ZZ0A 5EJ5A 2QTBA 2PPLA 3G0BA 3PTAA 2CUNA 2XYGA 3B1YA 4H3HB 5HW0A 1XPUA 4R1TA 2A30A 4D3XA 4FFLA 2HYDA 1UFVA 2O06A 2VHVA 3KB2A 2APJA 3G7SA 5C8ZA 1OV4A 3FHJA 1B23P 5SY9A 4YO7A 5CD9A 3VGJA 3G2MA 3TM5A 4BNHA 2D2IA 3NAGA 4GLOA 2AS0A 2NZ2A 3LKDA 4WOCA 1ZRMA 2QE7A 2OM2A 2ZAIA 1JG4A 2J9RA 2PD3A 2WJ6A 4O0LA 4UUNA 4YH1A 3UNXA 4DPKA 4K0KB 3ILSA 1YBVA 1PQYA 2Z8XA 4UU1A 5KWEA 5LJLA 2ZPAA 1F2UA 4E21A 4KG7A 1PGNA 4DDVA 3QVJA 5K4GA 1YCGA 5DW0A 1UWLA 1SUSA 4F7WA 4YRCA 1MIOA 1I2AA 1TEVA 3LECA 1ZKDA 4G65A 4MKGA 1M3SA 5EESA 3V55A 3HB4X 5EE0A 4AB1A 1CTQA 5CH3A 1G3QA 5AW8A 5KYWA 4QELA 1R64A 5AVKA 1YU6A 4ZVOA 2XA2A 3IEIA 4LFAB 2VKQA 3L43A 4GO1A 5KQMA 4NICA 2BMVA 2C2ZA 1NQOA 4XIIA 2W6OA 1IN8A 3IAHA 3MJSA 3GQVA 3C15C 3QJYA 4FLFA 3NHWA 5H0IA 4EB8A 1G2QA 1PGOA 3MD0A 4R83A 4M1EA 5HQ3A 1JHVA 3AM4A 5BR1A 1LTKA 4MKRA 1PSDA 2IYOA 3G02A 3PSHA 2AV6A 1WF3A 4U3JB 5DSZA 2XE4A 4C21A 1HZJA 2AMYA 2MHCA 1NMYA 4J0GA 1ZGCA 4DVGA 1U0NA 3WKBA 5EUCA 2JFXA 1B6SA 4RGQA 3SYTA 3ZE0B 4O2BA 4B34A 5DI3B 3EZ2A 3GRVA 1O2DA 1EZ4A 3EQ7A 3GAZA 1FVXA 4C22A 1MO5A 3TRKA 3X2FA 2G7MC 3GGOA 3TLGB 4H1VA 4YRKA 1OR8A 1JEDA 4LJ9A 2EU8A 4G1FA 2W0SA 4XDGA 1ISJA 1JLSA 3KPWA 3OEHD 4W8GA 2B4AA 3S2GA 1HFJA 2DQSA 3L7OA 1J6UA 3QX8A 1LNQA 2FQYA 3DMGA 3I3OA 2PL1A 2VPQA 4CKBB 3KL2A 4Q18A 1L4YA 3E4CA 5HTKA 1R5NA 1ZM3A 3C97A 4M3NA 1ECBA 4BZZA 5CG2A 2Y1OA 2D0OB 4I55A 3JD2A 1E0DA 4PONA 4FMPA 1Z0AA 2B7LA 2CW5A 3NP9A 1RC1A 3ZU2A 4BTEA 5TVKA 4Q02A 2AKEA 1IZ7A 4AQDA 2YR0A 2DBYA 1NKSA 4E4TA 3M3DA 3V48A 3F3YA 3KLPX 3VISA 1B6TA 3FF1A 1NVGA 1KBOA 1K97A 1PT6A 1T6BY 1TYZA 2GHQA 1PLLA 4WKGA 4QSHA 4DXHA 4UBIA 3RTDA 2V3CC 3ZHVA 1JA1A 2P67A 3GFGA 2WFZA 1TGVA 3BTSA 3L82B 3RE1A 4PNEA 4DQLA 4ZI7B 1FPQA 3PA8A 3B1JA 4I4TF 4LHYA 1S8AA 1SXJC 1CZUA 1YSCA 2JATA 2PT7A 4A1FA 1DPFA 1F2TB 4LKOA 4EWLA 4LS3A 4X6YA 3TR5A 1LK7A 1QYCA 1U6IA 2PJRA 1HMPA 1PJAA 2WJYA 2IEZA 2XGMA 1RBYA 3K35A 1O4VA 4Y1RA 5IANA 3MVEA 4ZKEA 2GF2A 4WADA 3X2EA 3LC0A 2OV3A 4X3CA 1P73A 3AFMA 3BFPA 4JLDA 5JE8A 2EC5A 4BKMA 1ZH2A 3W9YA 4I1UA 3D7MA 1GNRA 4P86A 1P33A 2BF7A 5EZQA 3U7EB 1RYZA 1DFIA 2VYVD 4K3UA 4TKZA 1AY0A 1PT8A 2HK9A 5IBQA 3LT4A 2ZXUA 5A5GA 2UZ1A 3H0CA 1KU6A 3TW4A 1NXPA 2FWMX 3D54D 4PEVA 3P45A 3SEQA 4ZAFA 3ROTA 1PWYE 3ZVNA 1G16A 4ACAA 4X61A 2OKCA 4EHFA 2V4ZA 4KPGA 5E8RA 1VIDA 2WFLA 3FPJA 2C5LA 2XE7A 3DNMA 4LZPA 4BU0A 4CN9A 7REQA 3WQSB 5KUTA 1CEEA 3T5AA 1E4EB 4FNMA 3TLAA 4XYGA 4PRYA 3ZQKA 1WKBA 2ZB2A 2VHEA 3Q9UA 4HEA1 2EP7A 2ZRIA 4J4HA 4M0MA 4OHBA 5H4GA 1TYCA 3EEIA 4D4JA 4DPMA 2QUKA 4LSMA 3TIXB 4CMBA 1IC6A 4KK4A 1KSJA 3SD7A 4JP8A 1NSTA 1SD2A 3CLRC 1XZNA 4TTIA 5JNUA 1A8SA 3E6AA 3M6FA 1ODKA 1FW8A 4MVJA 4MQEB 4UE2A 3PR2B 1NMZA 2CBXA 1VBNA 1FU8A 1WZCA 3INGA 2FTKE 4II2A 4X41A 3UJDA 2CWWA 3WK6A 4QBTA 3E61A 1R3UA 3GUUA 3PUVA 5C4IA 1X7DA 2BJHA 3H5OA 3L0OA 3T15A 4F71A 1H2WA 1U9YA 8OHMA 5KIAA 5FA8A 3JQFA 2D7DA 5IVIA 1DG1G 1HOXA 5CB6A 5TB5A 5JXJA 3Q8MA 4MV4A 2O0HA 3KR0A 2XJ4A 1NW5A 3J7TA 1JLLA 4M6WA 3SJBA 5A6SB 5KTYA 2C78A 1MKYA 1WABA 3INRA 5U4QA 1GTVA 1J06A 4LOHA 1RE1A 5CLJA 3O8DA 1QB8A 1S2DA 1YCFA 1G20B 1GKIA 1X80B 3DE5X 3ENNA 1E63A 1UKYA 2DH5A 3MTAA 1XVUA 2XMCA 3ELBA 1ACJA 4JVMA 1Y1QA 1VP9A 4ERNA 1F2VA 4D9EA 4QQKA 3OI7A 1CIVA 1UOQA 2NZYA 2WSBA 1C0LA 2NO7A 3JQCA 4KYTA 1A97A 2M32A 3VZQA 4B31A 4C3UA 5LP6A 3AG5A 4N40A 1C41A 2X8AA 1N8SA 2B9VA 3FMVA 1CR1A 1EWYA 1UMDB 4YCBA 3MRVA 3BX1A 4E88A 2AN9A 4ND1A 4G0PA 1UPBA 2Z8YA 5ITVA 4R8LA 2BRUA 2H1WA 5J4LA 2D59A 4KQGA 1A8IA 1TK9A 1UAYA 2QRNA 2AOUB 3EOBI 1RQRA 4K3VA 1ULTA 2HY7A 2Q29A 2XRFA 2QXYA 2X7JA 4G84A 4XD7D 1PK9A 4M1SA 2AX3A 4TWBA 4BMSA 3A6PC 4ZO7A 1UANA 1TW3A 1DAFA 5FBLB 3FTFA 3RRNA 2QXUA 2ZRCA 2XKKA 2DFVA 5BPFA 3KTAA 2G0NA 2JLXA 1P9LA 1UWKA 4QXRA 4BRSA 3FCXA 4H35A 4O4HF 2V1UA 3HHPA 1OIVA 3A06A 4PLWA 1UDBA 3A1NA 4D9KA 1Q44A 3O3OB 1RPNA 4CR6A 1CRZA 2VNKA 3AEKB 3KVRA 4MRMA 1S3GA 4EF4A 1E9VA 3VYSB 5ALHA 3I52A 4C4XA 2OAEA 4DBLC 4D6YA 3HB9A 2VZ0A 4IEIA 3OEYA 1NZJA 2KM1A 1ZNYA 2AEFA 1H3FA 2BAGA 2FV8A 4G5XA 2NUBA 5FT9A 5LUAA 2DZDA 1ZZEA 1AHHA 3EGCA 1U9IA 1W47A 3LV8A 4QYSA 5JR3A 4LSZA 1GU1A 3H1TA 2IS4A 3VU9A 1CPYA 4ZRMA 5BNIA 2E1RA 3MTBA 1US8B 3BMOA 4LMRA 2PZEA 4K5QA 3VTKA 3NXKA 2VC2B 2OBLA 3CZ4A 3PRJA 5E1OA 3KLBA 3WLSA 3PJEA 3ZGZA 1G5QA 3HS3A 1QLWA 5CB4F 3ENVA 3VO2A 5KWJA 1O0SA 2ZJ3A 3I5YA 1NTRA 3LQYA 5KNDD 5IZ4A 4KGZA 2UKDA 4LDZA 1JUDA 1V1RA 3H5IA 4JOBA 4PBTA 4CV1A 5BV2P 2RK3A 5FBHA 5EWJA 4WKCA 1R74A 3UAWA 3FLBA 3UM9A 1A2OA 3LYLA 1L5RA 1YC2A 5IT4A 3U44B 4ZP1A 2VKTA 4M98A 3SYLA 2ZCJA 1PFGA 3H5AA 3RC1A 4OLHA 2IXAA 5JSUA 1T1GA 3NHPA 5BQPA 1RFLA 3FKSD 2AFIA 3UF0A 3V2HA 2HA6A 1HWYA 3V2GA 4D41A 2A4KA 3HYLA 2QQ0A 3L6BA 4LRQA 5HUHA 3ZJTA 1FTNA 1U99A 2XB4A 4QAJA 4A8JA 2P3LA 1IHPA 3EMVA 3EH2A 4NFLA 4EQ6A 1MXFA 2HU2A 2VUHB 1WMAA 1TDJA 4NBLA 3VOBA 1VFNA 2JVJA 4I4LA 3ZHQA 4CQLB 1ACLA 4LTDA 1OBFO 2EAUA 3F2IA 1X42A 3WGYA 4EM6A 4Q7QA 1YIDA 1T4CA 3KS9A 4YIHA 4IIDA 5C1IA 1DI0A 2NQTA 1BKSB 1GILA 2QMZA 3AF0A 3BE6A 3NCHA 3OO1A 1M0EA 4JKYA 2YZGA 3CUUA 2O8EB 1K75A 2O3JA 4RZSA 2CV2A 4IWYA 1K8YB 5KYXB 5T6BA 1C3LA 4HWOA 3PD7A 4L0CA 3UYKA 2LD4A 3MG9A 1EFAA 2BCGY 5EYPB 1SEVA 1YA4A 3N5KA 3O8OA 4RXTA 3T0IA 2WWHA 2FSPA 5P8WA 4OI2A 1QR2A 1K0FA 2GX6A 4JYPA 1QH9A 4GR9A 3U7JA 3W5UA 2GCEA 1G7SA 2VXBA 4G2TA 3EX7C 1PBNA 1KQOA 3NEAA 3PG5A 4I3FA 4Y0VA 2ICAA 3AHCA 1CZRA 3U19A 3FSGD 4LV6A 2WNIA 2C2WA 3WQBA 3JVIA 2QZSA 3P4YA 1NAHA 1OBOA 4J6FA 2OHVA 1TKAA 2F48A 5TS3A 9LDTA 3HBNA 2VJYA 2A57A 3NHFA 1EB9A 2QMOA 2D2FA 3LXRA 1XJQA 1U7OA 2NPOA 2XODA 2FF7A 2ZSUA 4JJFA 1RXEA 2B69A 4OHOA 4XGNA 1UADA 4P3KA 3VZBA 3DV2A 1PL8A 1I24A 3U2QA 2PH3A 2Q41A 3LMKA 2RGWA 4EQZA 1O9BA 1JDPA 2O7SA 1R6DA 1HDZA 4Q05A 1WSDA 3I53A 1NBME 2ADFA 5EIBD 3VRHA 5F7JA 4DLTA 3ZVLA 3Q2IA 1GZSA 3Q3VA 5EZYF 1U5CA 4LXTA 5D1HA 2HHCA 4O4LF 2GXUA 4WCFA 1ZW1A 2B6HA 2FPOA 1GG5A 4ZOCA 5BOSA 1K8ZB 4BFUA 2BI7A 2UZ3A 4QEKA 4NENB 4E5PA 1F8GA 5CCDA 1FJXA 2EFDB 1KO7A 2AYZA 2CFRA 2OXTA 1ANKA 1TFUA 2VQDA 2OHGA 1KI7A 3CG4A 1SO8A 3N7AA 1Y48E 1KFEB 1MXHA 4RFLA 5EWMA 3I0MA 3P2IA 1UDWA 4I1VA 4M1OA 3B6KA 2VDWB 3MNFA 1P1HA 5DP1A 3M81A 1YQQA 2W2KB 3AUAA 4OHKA 1P18A 5MF6A 4IAOA 3HACA 1E9DA 1HL7A 2DPXA 4JB3A 4PPYA 4BEWA 5KX5F 1CUXA 3RAPR 1JIIA 1GPWB 4BNDA 1T3SA 4MI3A 4TN5A 2FW9A 4RMJA 1W4ZA 1W76A 5LQSA 3W6PA 1XPRA 3ET5A 3RT1A 1USVA 4UJ5A 1E1QD 2H06A 3K31A 4OQFA 1OZAA 1Q3HA 3BGIA 3IQIX 1CQZA 1Z13A 2YMLA 1XKTA 3PQEA 3QA3E 4FZVA 1NW8A 4YAOA 3WWEA 4B4KA 2WUDA 3KFVA 3LSYA 3R1IA 4KQIA 4OJKA 2BHSA 1ZC4A 1N8TA 1TZJA 2C31A 2CFOA 2EF0A 2O2YA 3STYA 5AM2A 3S8YA 2NACA 2J8ZA 4KLRA 4G4SO 4P3OA 1S01A 3HA3A 5EHZA 1GLGA 4JX8A 4EJSC 2MYUA 3OEED 4EYQA 1OWLA 4XOIA 1I7SB 3NIBA 1RPJA 2GN2A 3VPDA 4BNGA 2OR3A 5FPPA 1OYOA 4NBNA 4KFCA 3MMPA 3P0HA 2IF2A