5C2JB

Complex structure of the gap domain of mgcracgap and cdc42
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
191
structure length
191
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/signaling protein
molecule keywords Rac GTPase-activating protein 1
total genus 67
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5c2jB00
3L0IB 2OLKA 4JBXA 4Q4HB 4WAUA 1VYTA 4TZ6A 4Q1EA 4TN1A 5BQ5A 4GOJA 3BB1A 4M2LA 3OIVA 4PC6A 3U2QA 3AVTA 1OHHA 5AJYA 3TBKA 4JLMA 4C0QC 4IEEA 4LBZA 3IBYA 3VHLB 4XVUA 2NGRA 1MRSA 1LF0A 3WMGA 3C16C 1SVLA 5FTJA 2F43B 1JJ7A 4PZLA 3BWDD 3QKUA 1S4QA 4OQXA 3W6NA 4YXWA 1OV4A 3FDIA 4PSKA 3VQTA 1P7CA 1FQKA 2OM2A 2YWEA 1UBGA 4HUQA 5J4LA 5GVRA 1OYYA 1DEKA 4IVRA 3FMFA 2Q9CA 4QM6A 3LY5A 3UMSA 4QJ4A 1U94A 3WP0A 1D5CA 2WWIA 4A6PA 1XB2A 2H1LA 3AP1A 2IXEA 4DWJA 4TL9A 1ZIOA 1EFRA 1QF9A 1E9DA 3LX8A 4D26A 1MO4A 1F5NA 4R71A 4LWZA 1U98A 2DHRA 1W5TA 3PUWA 2VEDA 5HPYB 4KFRA 5LDDC 1UKEA 2G9NA 2WWXA 1UAAA 5SZIA 3K53A 5G40A 1KK2A 3FKSA 2VF8A 5H8WA 3GJ6A 3OIUA 4OBEA 1TEXA 1ZD8A 4OQMA 5FPTA 1C4OA 1KSFX 1UM8A 4TMXA 2REOA 4IOKA 1ZIPA 2ZSAA 3WNDA 3KKOA 2JATA 2VP2A 1KDPA 1XPRA 3ADBA 2F1IA 1R10A 2DY1A 4C2TA 1LY1A 4KCGA 3W5JA 4PR0A 1G8HA 4DEYA 4HAYA 1E2MA 4HAVA 5CIWA 1NL3A 4OJQA 1DPFA 2ZUCA 4PHFA 4BRWA 4M1SA 2ZJBA 4E03A 4R98A 4FD2A 2O8DA 2FF7A 3Q3JB 2H18A 1W4BA 4MGYR 1C1YA 2YOFA 3CZPA 3QENA 4Q1DA 1R6BX 4URWR 2QP9X 1ZD9A 2FGKA 2AD1A 1K5DA 1TL7C 3A1SA 3QJYA 5AUNB 4G5GA 3EWAA 1CLUA 2FSGA 4MUAA 3T61A 3K0EA 4O2LA 1XEFA 1NRJB 1XJCA 3QBVA 4GMXA 2RGBA 4YMWA 3RS7A 3WYAA 1ODFA 3UK6A 3TQFA 3ZQ6A 1CJKC 1Z29A 2HYDA 2C2HA 4XH9B 5IDVA 4F91B 3RNLA 2GZDA 2ZI3A 5FPYA 3NH6A 4GDFA 5TDHA 3LVRE 4DDTA 3REGA 3AGPA 2ODBA 4CW7A 4L5BA 1P61B 4TT3D 2GDJA 4IDPA 2Q9BA 3EZ2A 3L8ZA 2V3CC 1II8A 1AZTA 2IBMA 3MWYW 1WXQA 1ZNXA 3TNFA 4BZPA 2GETA 1TU3A 4DKXA 1Q1EA 1NBME 1NMXA 4PZYA 4ZDWA 2V8OA 2ZSDA 3BBPA 1X1SA 1R0XA 3SJZA 3K09C 1JAHA 1GSIA 2D2FA 2OXCA 1E4YA 2ZTSA 1W7AA 1LF5A 3NEYA 4KHZA 4EUNA 4M1YA 1KJWA 4M0LA 5G3YA 2A9KA 3MG9A 2F43A 4JYBA 5HCIA 3RYTC 4FCWA 4B6FA 4FMCB 1FL9A 5JCPA 2J41A 3HJNA 1SZPA 2CJWB 2J7PA 3VNVA 1YR7A 4PPQA 4GL2A 3ZYCA 4A0RA 4AYTA 3QY0A 2QPTA 2ZR0A 1EG7A 5EE1A 4Q4HA 4LOAA 4HYYA 4A0HA 2FG5A 1SKYB 4GPTA 1G7CA 2YYZA 3LH5A 4HZUB 4RD1A 4CEIA 2XZLA 3EXAA 4GFDA 4JZKA 5GADl 2EYQA 1AK2A 2FFAA 3BE4A 4O25A 4LPSA 1JXMA 4KLNA 4OHZA 1XRJA 1ZC4A 3H2YA 3W5IA 2FNAA 3B1VA 5GJBA 3KJEA 4BLTA 1XCGB 3X1XA 1PZNA 2KE5A 2AK3A 4B34A 1KO8A 3U61B 3EC2A 3KJHA 5G3ZA 1N6LA 1VECA 2CVHA 3QPUA 4UNNA 4B74A 4MYUA 4AYXA 2HT1A 4KI0A 5IF9A 3CKLA 3RRNA 4DDWA 2H57A 4DB2A 4ZDKA 1G21E 3AB3A 5LBIA 4DIDA 1NVVR 5CDFA 3QE0A 2ONKA 1DVRA 3DM5A 5FOWA 1E2KA 1XEWX 3IO5A 4I1SA 2GZAA 4IVPA 3EPLA 4B32A 1R8SA 1HE1C 4C0LA 4NYIQ 1E2FA 3EC1A 3OE7A 4JIMA 4NCHA 2ZJ8A 1RJ9B 1KAOA 4KYIB 3CWQA 1II9A 2ZI4A 4B33A 2HYIC 4CZ2A 5EQTA 2EW1A 5JEEA 1FX0A 1U9IA 1OIVA 2C99A 3LNCA 2OBNA 1NMYA 4I1VA 4MYTA 2CNWA 3WHKA 1P9RA 3WNBA 4MDEA 3QOFA 4HB3A 1KO5A 3A58B 3GLHA 4OK5A 4UXHA 1HUQA 1TF2A 4L15A 1RW4A 1YQTA 4AWXA 1E32A 1G7SA 2R6AA 3BERA 4X8OA 5JWOA 1SVMA 2IYYA 4F4JA 1TMKA 2O0KA 3BGWA 3LD9A 4ARZB 3CX6A 2O8FA 1DELA 3TJZA 1G1MA 3GLIA 3VR4A 4A2WA 4NZYA 4ABYA 2QRNA 1COWA 2J3EA 2B8WA 4C4PA 3C41J 3ZLJA 3CNOA 3T1VA 3IKJA 1J8MF 2JLQA 2V7QA 5EE0A 2G83A 3JVUA 2AL7A 3CZQA 1FQJA 5JS8A 2G77B 3DM9B 1MOZA 3AVUA 1N3BA 2G1KA 1F2TB 2QN6A 3OEHA 4EJSC 1SULA 3ZH9B 5KSZA 1NN0A 1E79D 3AVOA 4QHTA 4I99A 1X3SA 1OSNA 1H65A 2D7CA 4JBYA 4U02A 4JLOA 2QRZA 3PEWA 3NTUA 5A0FA 1G5PA 4NHOA 1XEXB 1VG8A 4E5UA 2ZE7A 2GJKA 4UNPA 3Q5EA 4RD3A 2DWQA 2R6FA 3ZDQA 1I2MA 3GPLA 521PA 4Z1MD 2K5UA 4HB2A 1NIPA 2Q0HA 3EAQA 3B1WA 3T5GA 4NCJA 8OHMA 1CXZA 4TSFD 5CYPA 4P4SB 2FJUA 3AKDA 3L82B 1GOTA 2C04A 2C8VA 1JALA 2OG2A 4I1UA 2R2AA 1UKYA 1J2JA 4EFMA 4Q9LA 2CL6X 4LCBA 3L0SA 1JPJA 4RSGA 3QG5A 4QBGB 1QHYA 3GLFA 5JRZA 5A5GA 4A8JC 3AM1A 1KI1A 821PA 4B2IA 1KMQA 4X8LA 3IIMA 2X2FA 1NJFA 4LBWA 3CRQA 1ESMA 1P60A 3I61A 2J0QA 4TMZA 4B3FX 5DI3A 4L4UA 2ZRAA 3EZ6A 1L2TA 2KI5A 1TF5A 2FOLA 4GMDA 4DSUA 3UIEA 4PO9A 4CYMA 3WMEA 3HP1A 3CR7A 4HDCA 4LRWA 4EPWA 4XWOA 1B0UA 3CWZA 3PR1A 3F5FA 4W5WA 4PC1A 4ITRC 4Q48A 4B71A 2GESA 1PJRA 1XTJA 4NKRA 4Q7LA 1YR8A 1UEJA 1O87A 2C77A 4DLXA 2OBMA 1G16A 4Q1BA 1HEIA 1KJZA 5DN6A 2CE2X 1GNQA 3E70C 4I4LA 1G6HA 1G7TA 4RKFA 5JS7A 1M34E 1UFQA 2H16A 4ASUA 2D74A 2R44A 3KKMA 1P9NA 1OYWA 3UANA 1D2MA 1NN3A 2QROA 3AP2A 4IOJA 4A8JA 4FIDA 4NYJR 2PH1A 4IDHA 3OHMA 4HAWA 1KI6B 1XBTA 2IS6A 2AWOA 5EJEA 3T1QA 1DG1G 5DNYB 4LZZA 4JVSB 2XGJA 2RKOA 3V9PA 5H68A 3EIEA 4UJ5A 2HF9A 3PEUA 2VBCA 4QJ5A 1X6VA 5FBRB 4GZMA 4PO1A 4RZ3A 3AF0A 4Q21A 1CJMA 1KI7A 1Z0KA 1KAGA 4QBFA 3TIFA 1K6MA 1F2TA 4JSTA 2BBTA 4TLEA 1GILA 3AF2A 2DYKA 4NL4H 1E0JA 1W49A 3RANA 2MSEB 1FTNA 2AWNA 4LJ6A 4NDZA 3RAPR 1VYVA 3K70D 4UNRA 3SE0A 4EIWA 4AI6A 3KQKA 5DGXA 3LW8A 4LHZA 1G3RA 4M1TA 4RJLA 2VYFA 2EFEB 3RWMB 3L0OA 4TT3A 5KNBA 2PLFA 4U00A 3FMPB 4JLKA 4BZQA 3CRVA 1Z08A 5IT5A 1ZCAA 2PEYA 1U8ZA 1Z22A 1Y63A 4V03A 3R8FA 3FHTA 4QBHA 4GNKA 4EQ6B 2F1RA 3QXHA 4YMTA 5F98A 1HV8A 5JJIA 3UG6A 5C4GB 2DPXA 4DLYA 2D4HA 1JPNA 3KKPA 4JSYA 5CM9C 3K8YA 3ZIAA 2GBLA 2XJ4A 3MRSA 1T8UA 3A1TA 4M21A 2B7BA 2ZAOA 3VKWA 2ZRHA 2QQ0A 2WSMA 1P5ZB 2FU5C 2O0JA 4S2EA 1A1VA 2GXSA 1E69A 2J46A 5B30A 2FV8A 4CEHB 4FI3C 4FMCF 4V02A 1PV4A 4LBYA 1KK3A 4PZZA 3ZGXA 3VR2A 2OT3B 2QUZA 2BMDA 4AG6A 3BH7A 2QENA 4QGHA 4XWKA 5AJWA 3EZ7A 1QHXA 4MGIR 4Q00A 3A1VA 5IRCD 1IJFA 3DEFA 3JVVA 5L8VA 2ZU6A 3QPWA 2JLZA 3AF4A 1CKEA 1ZVQA 3OAAA 4PTLA 1YU9A 5J4YA 2EFHB 4TLDA 1NP6A 4ZCIA 2IS4A 2BWJA 2IUTA 3KXLA 1ZC3A 4P4TA 4A0GA 4B2LA 1CR2A 2ZRFA 1KI2A 3QXCA 1GDDA 1W46A 4MGKR 4KSBA 5EUMA 4M9QA 1NG1A 1JEDA 3QXXA 4BFZA 1FZQA 1NLYA 1CP2A 1SHZA 1GL9B 3IEVA 1DAMA 4QNMA 2HLDA 4KYUA 1LS1A 1Z6XA 3MWLA 1N5LA 1NVVQ 1UDWA 3ZZTA 3CR8A 3LWNA 5FPKA 1TPZA 2W58A 3FFBA 1S2MA 4WBSA 2R8RA 1KO4A 4XJXA 5F2EA 3VR3A 3U7FB 3IHLA 4URZR 2RGNC 3TH5A 3KFVA 5KNDA 4PQFA 2FH5B 1L4UA 2UVQA 5CB6A 1R7RA 5JRJA 1KI9A 5EZ6B 4DCUA 4G3XA 5JHHB 1KYIA 2FDCA 1LB1B 1II0A 4TWZA 4MYHA 4O2RA 3B6EA 5FUXA 3SYNA 5KO2A 2O8BA 3AKCA 3TSWA 1AKYA 1NBMD 3KDSE 3U3RA 1VCIA 4WZAE 5EP2A 4HAXA 4QM7A 5ELXA 2ZE5A 3VU9B 3DZ8A 1EFTA 4Y0AA 1JJVA 4PHHA 1W36B 1BOFA 3TGPA 3KTAA 3GLFB 2Q3FA 1W36D 2QI9C 2FSFA 1RC8A 4Q47A 3I5XA 3DZDA 2OEPA 4WZBE 1ZNWA 4LJ4A 5EE3A 1BMFA 4DLZA 1KSHA 1W2GA 2JLWA 3BIFA 3QKRB 4D82A 1XTIA 4FWIB 1DOAA 3CRRA 3G82C 3PEVA 1Q20A 1WCV1 4C0JA 2G0NA 2O5VA 1T3HA 2SHKA 1HE8B 1W1WA 1RYHA 2GBLC 4CVNA 2XXAA 2ZRCA 2B92A 2FA9A 2ZS9A 3B9PA 1E1RD 3J81k 3B13B 4G01B 5FL3A 1XTKA 3SN6A 2IC5A 1E98A 4A82A 2ZYTX 3RS0A 2PBRA 3I5YA 3OZXA 3EIHA 2ZROA 5DN6D 2NO6A 3NWJA 4MRVA 5CK5A 1OFIA 4DLSA 3M1IA 1CRPA 4Q9IA 1VCOA 1N25A 4RD4A 5CLLA 1P73A 2V9PA 1RRGA 2JLYA 4LV5B 1UKZA 2OCYC 5F9HA 4A0FA 2QG6A 4Q9JA 3VKHA 1OW3B 2XAUA 2F6RA 3GJ4A 1E2HA 2BBOA 4QHYA 4R9UC 2YWHA 4LJ7A 5DLQC 3UKDA 4ZI2A 1XXHE 2XJ9A 5L3QA 2CL7X 2P5SA 3THXA 1CJTC 4D4JA 4UKDA 5CIQA 2O8BB 2XOKA 5FL7D 2EU8A 2IS2A 2R62A 5FTMA 4E07A 1Q3HA 5FBLB 5FTNA 5AWFC 5E7IA 2PLRA 1OPXA 4DBLC 2IK8A 1FMJA 1GKYA 2WIAA 3T5DA 3DKVA 2E87A 3SEAA 1Z6GA 3ZZUA 5J4HA 2V6IA 2FEMA 1SXJB 3IILA 4HEJA 4LX0A 2IHYA 1M7GA 2OLJA 4JLJA 4C3ZA 2OCAA 4AKIA 4M1MA 3D8BA 5JWRA 1CU1A 1DO2A 2BV3A 4AURA 1W0KA 4ZDIA 1KSJA 2WJYA 3QG1A 3WBJA 2BJWA 3G5UA 2BM1A 2ODEA 2RGCA 3OEHD 2P2LA 2W6IA 1WBDA 3CRMA 2GJ9A 3N2EA 1G19A 2PJZA 1G41A 5GJWC 3TLXA 3ND9A 3PITA 3LO5A 5HTKA 1DARA 1OXVA 3SS8A 3AKYA 3SFZA 2RHMA 1RRPA 1ZRHA 3W34A 721PA 4HLQB 4NYMR 1ESNA 1IY1A 4D2IA 3K9NA 2ODNA 2F7SA 1SGWA 4US2R 1XD2A 1M74A 3OAAD 2A3RA 1XXHA 4NP6A 1ZM2A 3KQLA 1W44A 4Q4LA 5KHOC 1GKIA 3OIYA 4Q4JB 2ERXA 1UJ2A 1T6NA 1YZKA 3AVWA 1YRBA 4B48A 3THWB 1COWD 5L3SA 2QU8A 3IEUA 4OI2A 4BLRA 4GZLA 2QEQA 2YC2C 2BDTA 3EASA 5HZKA 1KTVA 4ZCMA 4YMVA 3NVAA 3BRWD 3UWKA 2CEAA 4NYJQ 1KK0A 3B78A 5TARA 4B2PA 2FGJA 5DI3B 2O8EA 4PQRA 4MRRA 1BYUA 1N6OA 2IYQA 4QGAA 5AJVB 1H8HD 2ZI7A 1Q0UA 6Q21A 1ZU5A 4TMKA 1SXJC 3UMFA 4F93B 1WP9A 1QHNA 2MMGA 4P4SA 3S1AB 3BH6A 3TW4A 2PL3A 5EZ5A 4IOLA 2CBZA 3BK7A 1S3SA 4JL6A 4YMSA 2J9RA 5FOUA 1OE0A 2XNDD 1U99A 1HT2E 4DLRA 1YR6A 2DB3A 1N0VC 4R2IA 1G3UA 4B3CA 2NTYC 1R0YA 2IXGA 2RGXA 5JHGB 2QTVB 4P32A 2WOJA 3HPRA 3NDBB 4A9AA 2EFDB 4G5OA 1X8KA 3B1XA 5M04A 1U8AA 2QPOA 5CYOA 2XX3A 3HYRA 1ZUIA 4LJ9A 1S3GA 4P33A 3THWA 3TE6A 5A4JA 4CEHA 3ADKA 3K0AB 1BYIA 4KVAA 5TY0A 3HU1A 1DADA 2WJIA 4D80A 2GWHA 3IPXA 3OF5A 4ACAA 4CDGA 1U0LA 1G3IA 1XPOA 1JI0A 1KGDA 1XD9A 2QP3A 1GIAA 2GK6A 2N42A 1X8JA 2C98A 3ONWA 1IXZA 3AF1A 4M8NE 4HATA 5FPHA 3SQXA 4K8OA 4YQFA 2A5FA 3A36A 5CJ2A 4CIDA 2H5EA 1EFCA 2ZE6A 1XTRA 2EVWX 5J4VA 4LYFA 1V43A 4L9SA 1DO0A 1T0HB 1AA9A 3B85A 4ESVA 2J0VA 4DCTA 5JMTA 3EX7C 3P26A 5CJPA 4OI4A 4BPBA 4ZV4A 1HQCA 2Z4SA 3W3ZB 3QXSA 2Y8EA 2QQEA 4FMDB 4DLVA 3S1AA 2ATXA 4A6XA 2AR7A 4DEXA 1W4RA 4DT1A 1RIFA 2FPLA 1JQLB 1FP7A 3MFYA 3KQHA 4DXAA 1QG4A 1QRAA 4WA7A 4HUTA 5K8TA 2C9OA 2BIFA 4P4UA 4V0NA 2A2ZA 1YZTA 3JZAA 4EAQA 3P20A 1X86B 3ZD7A 1G3MA 5BYJA 4ASUD 4B3GA 1U9IC 2UZIR 1TQ2A 1QDEA 1IQPA 3U3MA 2LWIA 2Z4RA 2P3SA 2R6DA 1YZQA 3CF6R 1S1MA 2JIZD 4PPGA 3THXB 2IW3A 3AEZA 2VP6A 3I32A 4YDSA 1EFRD 4A92A 4TLAA 2ZRBA 2RCNA 2BCJQ 3LW7A 1FP6A 3KQUA 2GXAA 1MO5A 1AQYA 3BB4A 3AV0B 3U4QB 5EE9A 1Q1QA 3H4MA 5BN4A 2PEZA 1CJUC 3K1JA 1TQDA 2B6HA 4TYYA 1Z6TA 2JJ1D 4Y0VA 3QEOA 1YZNA 4D0NA 2IYVA 1F2UA 3RS4A 2P6UA 1KI6A 4XWAA 5G53C 3RLFA 1M6NA 2GXQA 2L0XA 2BCGY 1JB1A 4Q4AB 2AN9A 3R7WA 4GRAA 5DHAA 2IL1A 1HTWA 4AIIA 2ZM5A 4TQ9A 4Q19A 2ZRNA 1EX6A 1N0UA 2VL7A 3DOFA 3CF2A 2RGAA 2GXUA 2RGDA 1JXOA 3EZFA 2HJGA 4HB0A 4WZ6A 2OFWA 3CRW1 2ZVQX 1JR3E 4PSAA 5C18A 3LQRA 1NMZA 1XMIA 3C15C 2WICA 4AK9A 4NPHA 3DPUA 4H9GA 5KDLA 3O8RA 2NIPA 5JCZA 2NO9A 3A1WA 2DWPA 3NEJA 4YC7A 1MH1A 5C1BA 2G3YA 1XJQA 1EXMA 4C9BA 3QEJA 3WYGA 5EP4A 2RGGA 2EQBA 4WW0A 2PT5A 2ZPTX 4W5JA 3E2IA 3OEED 3DOEA 3C8UA 2QTFA 1H8HA 3AUXA 4N1AA 2J87A 2H92A 5AUOB 1II8B 2YVUA 1G4AE 3WHLA 1CR1A 3CO5A 2AKYA 4URYR 3R7WB 5K8UA 2X2EA 4JL8A 3RHFA 3DL0A 4DLUA 1XTSA 3DDCA 2DBYA 2FN4A 1D8TA 3QXJA 3WYFA 4B76A 4FCTA 1Z0JA 1NVUQ 4N3NA 3A8TA 3V4FA 1E9SA 3U7GA 1J7KA 2QM7A 1W2HA 3B60A 2AK2A 4MRPA 4QG7A 5KU1A 4FMBB 4GSYA 2BJVA 2VHCA 4GOXA 4URUR 2WTUA 1FNNA 1KHTA 2J59A 2ZVPX 4PPFA 1G17A 1MO3A 3KTAB 3TUJC 1G8GA 2P6NA 5CITA 1KJYA 3GFPA 4B3DA 1OHHD 2QMUA 1TQ4A 2E1RA 4EFLA 4BLQA 1OXUA 4JLVA 4HAUA 1FX0B 4LYJA 2WWYA 1GWNA 2O8EB 1YZUA 4C0KA 4ZDJA 3QKSB 4JJKA 5C2JB 3ND8A 1CF4A 4GBMA 4MKGA 4RZ2A 1UEIA 2GF0A 5EXTA 5GJVC 2AKAB 4JYCA 5BW8A 3IHWA 4MUBA 4CEIB 2VLIA 3GJ0A 3ASZA 1XU4A 3KXKA 4KBFA 5AR1A 1GRRA 2DR3A 2QAGB 5TVKA 2QBYB 1IN5A 1HURA 3DO6A 1NLFA 3B1YA 1Z5ZA 4DZZA 1T0JB 5JECA 3BD9A 1NKTA 3N70A 5FBVB 2PMKA 2KBFA 1T3LA 5D3MA 4JLNA 5AK0A 3E5HA 1DTSA 4Z8YA 1FMLA 4B73A 2IX3A 2ZI6A 4A36A 1I4TD 3N2IA 1P62B 5DHFA 3V00A 2CCKA 3RABA 4LHWA 2I1VB 3OFNA 2GF9A 1MO6A 3TMKA 1E9FA 1ZW6A 2JJ1A 3CB4A 3C5CA 1CULC 3MD0A 2ZXUA 4MGZR 1ZYUA 5DE3A 4L9WA 4RFSB 1T5LA 1AGRA 1I4LD 3Q85A 3FE2A 1E1QA 3NIBA 3Q7PA 4EQ6A 4IRUB 3SNHA 1RVDA 2OO7A 4DVGA 1LNZA 5BWMA 2A30A 4EPTA 1KNXA 2GZHA 3KUDA 2JGNA 2WM9B 3T15A 1SVOA 1UKVY 2NG1A 2ZRDA 1XZQA 1KOFA 1WRBA 3TSOA 1WBBA 3CPEA 1J70A 2EFGA 1ZP6A 3CLVA 3ICEA 3PUYA 2QTHA 2VF7A 4A2PA 1M7BA 2PT7A 2V1XA 1N5KA 3O47A 3QSYA 221PA 1G3QA 4UXJA 5J4KA 3NC0C 1RFLA 2OV2A 3QBTA 3WMFA 2F9MA 2YWGA 1N6RA 1Y3AA 1XX6A 5JSZA 1U81A 4QC2A 4CT5A 5CLQA 2GEUA 1PUJA 3SOPA 5GVSA 1P9WA 2REBA 3ASYA 3B2EA 2QM8A 2D3WA 2JJ8A 3Q72A 4MA4A 4H1UA 2QMHA 1GFIA 4N0DA 5FFMA 2MSDB 4NBSA 4URXR 2JJ2A 5AUQA 4ACBA 5L3VA 2W6ID 2CCJA 1AIPA 1N6HA 2NO1A 1IONA 2IYXA 4IVQA 4NE2A 3L2OB 4EFNA 3C5HA 1SVIA 5KUTA 2ZSFA 4YDHB 1EFUA 1US8A 2GCOA 4OK3A 2DFNA 2RGEA 3K70C 1Z06A 4M1WA 4RD6A 4KO8A 5L3QB 1G9XA 2ZRMA 2J5XA 1M1YE 3U5ZB 1XCMA 4MRSA 4NMMA 3SZRA 3L8YA 4A4DA 4OHYA 2OFXA 4HI0E 4BFUA 3B82A 3KJGA 3HWSA 4IW3B 2BOVA 4BUJA 4GOKA 1KZ7B 1KO1A 4PHGA 1QVRA 5H70A 4OI1A 3MCAA 1OXXK 1KI8A 5JI3E 1UF9A 4FXPA 3KKNA 3GQBA 4IEIA 1RKBA 2FSHA 3U44A 1LV7A 1SKQA 5BXQC 2P6RA 2CHQA 1P6XA 3TK1A 1I2DA 1B23P 1FNMA 1ZU4A 1HY3A 3FWYA 1KKLA 2P0EA 2QE7D 1ZM4A 4TL8A 3LLMA 3KJIA 4QL3A 4G5SA 1WA5A 1JR3D 3MGCA 2F9LA 1YZLA 4DCVA 3P4XA 5KPJA 1CJVC 5J40A 2ZEJA 2IWHA 1SQ5A 4DCSA 4AC9A 1JR6A 4J0QA 5E7JA 5UKDA 4BGDA 2CNWD 4ZCLA 2WWHA 4UJ3A 3NHAA 2AHOA 1T8TA 4XTRA 3KZ1E 2ORVA 3PUVA 2ORIA 2W0SA 2J7PD 4W5HA 2CMKA 2ZREA 3KB2A 3CONA 2GHIA 4PAMA 1OKKD 1W36C 3GJ3A 4KXFB 1X1RA 1KY2A 1Q3TA 1RYFA 3ECCA 2YOGA 2F3RA 3P4YA 3H84A 2RAPA 1M8PA 2WWWA 4M1KA 3K0CA 3X1ZA 2ZSBA 2UZ3A 1XEWY 2GAAA 5JI2E 2P67A 2JCSA 3U44B 4KBGA 3SBDA 2JLVA 4RFVA 3T06B 5FTLA 5FR2A 1IY0A 5J5CA 2ODWA 2HT6A 5IK2D 2OZEA 1IHUA 4HSEA 1S96A 3K70B 4TMTA 3NG1A 3ZVRA 3A6PC 2Z6VA 1BIFA 1VG1A 3O8DA 5KOYA 5FI0B 5TB5A 5E95A 3VX4A 4Q18A 4ZKDA 1O3YA 2ZJZA 1HT1E 3B9QA 5DSZA 4LSGA 3GP8A 1XD2B 5FUVA 1GVNB 3W6PA 2X77A 1PVOA 1IN4A 1KO7A 2NPIA 4HLDA 1OH5A 4MRNA 2JA1A 2GRJA 3MJHA 4Q66C 3GLIB 2KBEA 4DLTA 1KDTA 2FZ4A 3GJ8A 2XITA 3IUYA 1M7HA 5ANRB 4A15A 2KB0A 4MITA 3VTKA 2NPFA 2VHJA 3FHOA 1ZM3A 1G8PA 1CS4C 4PC7A 3SJBA 2GJAA 4MYCA 4L8GA 3SFVA 5AUPB 4ZO4A 2OUKA 4EPRA 3NC1C 3I8XA 2I4IA 1ZCBA 1GTVA 5FUWA 1KI3A 4DSNA 2EFCB 4PFSA 4XVQA 2IT1A 2WIBA 1GKUB 2KJQA 4IDNA 1E0SA 2IWRA 3U7EB 3AQ4A 3SHFA 2G6BA 4BFYA 1G8FA 1UBEA 3D31A 4BFVA 4JLAA 4C2UA 4HAZA 4RD0A 5FUYA 3T34A 2D06A 2YINC 4ZKEA 1XEXA 2A7QA 3U3OA 3SYLA 4DDVA 5HKKA 3R8CA 1DS6A 1XFAA 3B7GA 4FINA 1WB9A 1SXJD 1OJLA 1VIYA 2IYWA 1N6IA 2XEXA 3DMDA 3AUYA 3SDZA 3WY9A 3TUZC 2QMEA 1Q12A 1TF7A 2N1BA 2V54A 4M9SA 1US8B 2BBSA 4Q5IA 1T3SA 3AKEA 2QAGA 3NHBA 2QBYA 3KXIA 4TTPA 4ERNA 1A4RA 3MAAC 2VPPA 2BKEA 1OIWA 4HB4A 4OJKA 1LS6A 3THOA 3K0AA 3P32A 3N5CA 1EK0A 4S35A 2LKCA 3I72A 1MABB 1BH2A 1FOEB 4EPXA 1GUAA 1N2CE 2YWFA 3HDTA 3M0EA 3Q7QA 4LUCA 2NO7A 3TAUA 4YMUA 1JQJC 3MMPA 1S8FA 1IXRC 3VR5A 4BRUA 5L3SB 1AN0A 3RC3A 5FBWB 5DH9A 2F1JA 2ZJ5A 3PIRA 3QNUA 3SR0A 2FFBA 4URVR 4A2QA 3NBYC 5EP3A 4M9XA 1E2PA 4BE7B 2KSQA 4E22A 3GLIE 421PA 2A5GA 2AD5A 3Q9LA 3VR6A 3WP1B 4EJSB 2DWOA 4DT1B 4BECA 4KFSA 2VTKA 1Z47A 3PEYA 4K46A 4RZUA 1WE2A 1NSFA 3U6BA 3CX7A 1GZSA 3IIKA 4EKDA 1TADA 2VHQA 1TQ6A 1Z07A 2O8CA 3Q8XB 3BC1A 4DHEA 1XMJA 1IOZA 1E2EA 4FWTA 3RS3A 1N5JA 4DDUA 3HYTA 5IHPA 4XD7D 3LBNA 2FE4A 2OCBA 1Q21A 2BMFA 4KSCA 5E7MA 1LVGA 3BS4A 4I81A 4JLPA 2HDNB 3EIQA 3PCRB 2GCPA 4US0R 4DLWA 5EXPA 3EG5A 2CLDX 5FL7A 3CUEF 1UADA 1IY2A 4L16A 1AS3A 3ICQB 3PV0A 2W2XA 3QUSA 1IN7A 2ZIAA 2C9YA 1W4AA 3ZVMA 3AGQA 2OHFA 5TMPA 3GJXC 4AKHA 1G8YA 1JAIA 4N0EA 5CDFE 3VMFA 1ELOA 2WKPA 3QIAA 1NJGA 2IEZA 3FVQA 1A5TA 4QKQA 3GEEA 3UPUA 1DG3A 2JLSA 2QE7A 2OAQ1 3REFA 1A2KC 1H8EA 4ILEA 5SZHB 2G1JA 4EPYA 1TUIA 2JASA 1VG9B 4BEBA 1JR3A 4V0MA 3K0SA 2FZLA 2ORWA 2W83A 2WKQA 5EXSA 3LA6A 3BFVA 4IFEA 2GAOA 3W8NA 3A37A 1TX4B 4V0OA 3PUXA 1NLZA 1Z0AA 2WAYA 4LI0A 1TTTA 1NY5A 3X1YA 2G0TA 2DFKB 4V0ME 3QKSA 3ZS9A 4CEJB 1GAJA 2YC4C 4TL7A 1Z63A 4B44A 1QBKC 4TQUS 1W5SA 1NNEA 3EA5A 1NI3A 3GFTA 3UXMA 1GM5A 2IEYA 3F0TA 2F3TA 5KSPA 4UQOA 3SU8A 3VU9A 3R9WA 1W0JD 4R2HA 1OLOA 2FEOA 4IXNA 1U0HC 5FOSA 1ZINA 5P21A 1Z6YA 1DAKA 3GLGA 3I73A 2XTNA 4YLGA 4IJMA 1RRFA 4LJ8A 5HKKD 2J45A 3HR7A 2AXPA 2CLSA 2ZRKA 3AF3A 1P2VA 1YE8A 4H1VA 3D6TB 1E94E 3AP3A 1NBMA 3AH8A 1QZXA 2WMNB 3WBKA 3BORA 3M4YA 5KTYA 1SVWA 3BJIC 5L3RA 4OHWA 1YHNA 4WVFA 2ANCA 4OQLA 1GP2A 3QKTA 4HLUC 1F3OA 4M22A 4B6EA 5SZJA 4MKHA 3BFXA 2BEKA 3U60B 5FBQB 1IN8A 4BQSA 5LB2A 1OT3A 2YNMA 1FUKA 4XD7A 2N46A 1NY6A 1E2JA 4UNSA 1NVWQ 2XTMA 2RB4A 2C96A 3QVUA 1WDTA 4PANA 3K9HA 3U3KA 4V0KA 3W9YA 2OESA 2FPMA 4C30A 2ANBA 4JT2A 4XOIA 4DSTA 1RE0A 3QF7A 4WIAA 3FYHA 4II7A 2I1QA 4BLPA 3ETLA 1W0KD 2IYTA 3A4NA 1ZNYA 2J0SA 1IJEA 4OQNA 1S9DA 3B1ZA 1D2EA 4D0GA 2F1HA 1E9RA 2WHXA 1PLLA 121PA 1SKYE 1W48A 2GCNA 2Z83A 3FKSD 4TMVA 3L0PA 4GP6A 1K8RA 1H8ED 1SVKA 4WOPA 4M53A 1QHIA 1MRNA 2MMCA 1AQUA 4DJTA 4F4CA 4B3BA 3TAHA 4FMDF 1FTSA 2R6GA 4HZIA 3SHWA 2PCLA 3EARA 3FTQA 2HUPA 2GCOB 2JDIA 1TUEA 4TLBA 2ZU0C 3LXRA 2RMKA 3TVDA 2ONJA 4D4KA 2ZI5A 3FGNA 4Q9KA 2CK3D 1SXJA 3VHXA 1WF3A 1LW7A 2C95A 3VNUA 4M9ZA 1T5IA 4CF7A 2TMKA 1G7RA 1QHGA 2VP0A 4PO8A 1G4UR 1R4AA 4RD2A 1V5WA 1KNQA 1UDXA 5BN5A 4Q7KA 3TW8B 1ZMXA 4V0LA 4IDQA 4LY6A 3T1TA 3D3QA 4Z51A 5LB4A 2RHDA 3U6KA 2RH5A 1DAGA 3DKPA 1VDZA 5KSYA 1E9BA 2NQ2C 1DE0A 1GL7A 1FPMA 5JJKA 4TSFA 3CPJB 5CB8A 2WSSA 4MKFA 3X1DA 1VYUA 1Q22A 2VHUA 1OKKA 2OXRA 4QBIA 2IYUA 1ETUA 4DIEA 2PZGA 5H1YA 1MT0A 3TVTA 2GTPA 2DCUA 3DHWC 1ZM7A 1E2DA 1FUUA 3CM0A 3GCGA 1TNDA 3LQQA 2R6CA 4JVLA 1A7JA 1M2OB 5HE9A 1GNRA 3WXMA 1U90A 4Q7MB 1OB2A 5KDDA 3LFUA 1MR3F 2HJVA 1WMSA 2EYUA 4WXRA 2PMDA 3E1SA 1XP8A 4Q4JA 3ZVLA 3SQWA 4LPKA 1JBKA 2ZITA 2XB2A 1P2UA 2QSYA 3ZS8A 1UBFA 2QL6A 3CBQA 5JSZB 3LXXA 3PFIA 1VHLA 2YOHA 1Z8FA 4LHYA 1Z2AA 1T9HA 1G291 3SI7A 2V6JA 3LBHA 1E2IA 3A1UA 2ZJ2A 2QT0A 3MWJA 1XZPA 3V4RA 5KYKA 3SJAA 4MDFA 2ZRJA 1FW6A 2GKSA 3PJRA 1E2LA 3K9GA 1IAQA 1E96A 3PXGA 3GLGB 1CEEA 2Q9AA 2QY9A 2AXNA 1BMFD 4JVMA 2VIIA 3GJ7A 3WNCA 5JEDA 3VFDA 3C14C 2BMJA 1VCMA 2ERYA 5FOVA 5EXXA 3IPYA 3T1OA 5D3QA 4HZUA 3MUFA 2QNRA 1OH8A 1MKYA 3AVVA 3IBGA 4HDQB 2C5LA 1RPZA 1HA3A 3NDPA 1NN1A 2ZQ5A 3F8TA 4Z1MA 3TSZA 4P0TA 2VSOA 5FI1B 2ZR7A 2V1UA 1KK1A 2ZYUX 1IM2A 2FFQA 1E9EA 5JJLA 4MKIA 3UWOA 2WAXA 3R9XA 4P3YA 1J90A 1GRQA 4HUQB 3ADCA 4HLCA 4NYIR 1XD8A 2HEIA 5KDOA 3UG7A 2A5YB 4DRZA 4KODA 1Q44A 1AJEA 3KFXA 2JIZA 4FW9A 2VSXA 5B2ZA 3RRZA 3NBZC 2LCFA 3K0FA 2NMVA 3HPQA 4JS0A 3GMTA 5FR1A 1ZM9A 2HXSA 5EP1A 4LV8B 1BS1A 2WV9A 4B75A 3GLHB 2J1LA 2GEDA 1SVSA 1OXTA 2ZJAA 3MJRA 5G41A 2P65A 2VP9A 4JKYA 3T35A 4QJ3A 4KITB 4LGMA 1OFTA 3GEHA 3A4MA 4NU0A 2QT1A 2QA5A 3I4LA 2W2TA 4O0MA 5HCNA 2H17A 2WVJA 4D6PA 3NXSA 5JBQA 1E0AA 2ZS8A 3W8RA 3OEEA 4Q1CA 2CXXA 2QAGC 2WMOB 2YV5A 4AYWA 3THYA 3W3AA 5DYGA 4CGZA 4PAOA 3GLFE 4RCYA 3RRMA 1OFUX 4DB4A 3RWOA 2WJGA 2OAP1 1Q57A 1Z2CA 3CX8A 4TYWA 3BAFA 1QVAA 1XNJA 2F55A 1A82A 2C9CA 3NH9A 2V4ZA 4RVCA 4LJAA 3EPJA 3GLGE 1Z0FA 5DYIA 1R5OA 2CK3A 5HE8A 4LC1A 2J0UB 4PSVA 1VMAA 3I1FA 4K81B 4Q1FA 3KL4A 1D6JA 4Z54A 4Q01A 2QORA 3IO3A 4LHXA 1ZAKA 2Q6TA 3F3YA 3I8SA 4Q7JB 1E2NA 4B43A 3KB1A 1XMVA 1G20E 1N0WA 4Q4AA 3RC8A 2O0HA 1E9CA 2JAQA 2OFOA 2ZR9A 4QHSA 3RS2A 4ON9A 2R9VA 3PUZA 3FOZA 4LC0A 1IN6A 2BEJA 3EA0A 3RRYA 4D0LB 2GVDC 1ZUHA 3TR5A 2QAJA 3H1TA 3DMNA 1F48A 4QXAA 4TL6A 4BFSA 4LDJA 1N6PA 1E2GA 1G6OA 1W4CA 1I4DD 1U2RA 1XJ0A 2NZ8A 2JJ2D 4GT1A 4IXMA 2LKDA 1CBUA 1NIJA 4BFTA 3R20A 1J99A 4Q03A 4LHVA 2PX3A 1P2SA 2WWGA 1L8QA 2MSCB 1YR9A 1QHHB 4BZXA 1OIXA 4NH0A 2NZJA 3KKQA 3VX3A 1MABA 1XMSA 1AGPA 3KQNA 3ZD6A 2ATVA 2JEOA 1G5TA 3CF0A 1KDOA 1N5IA 4ZIRA 4NCIA 1EFHA 1KY3A 3BOSA 1T91A 5D3MB 4EDHA 5KSOA 4RFSA 4ZI3A 2BBWA 2B8TA 4QFMA 1D9XA 4TYQA 2ZE8A 2AX4A 1E0KA 4XSHA 2XXAB 5B64A 2QP4A 4R7ZA 2VP5A 4IHQA 4RZXA 4IDOA 3KX2A 2Q21A 2CHVA 4AKGA 1L7VC 1KI4A 2ZI9A 4GI7A 3UMRA 3BXZA 2ZJOA 4NCKA 1KZGB 1VTKA 2IF2A 1ZNZA 3HU2A 3CNNA 5DIFA 4BLOA 3CH4B 2JLXA 2HF8A 2FWRA 5FH9A 5KNCA 2HLDD 4E09A 4KFUA 4KJZA 5BN3A 3ADDA 2IUSA 4CRWB 1CIPA 3RSLA 2XB4A 1G5RA 3AVXA 4NTZA 2IYSA 1Z3IX 3X1WA 1CTQA 1P75A 3QI2A 3H0KA 4AD8A 3SJCA 1VHTA 4M4SA 1D9ZA 1DAIA 4BEJA 3VAAA 1PLKA 1G64A 5AJXA 3ZQJA 4WXPA 5HZHA 5J47A 1F6BA 4LYAA 5TV2A 4C0SA 1WQ1R 4OHVA 1GG2A 3A4LA 1DBSA 3FPAA 4F7WA 4AKEA 2W2VA 3I62A 2XTZA 4Z8XA 2R65A 3HR8A 1K5GA 2W0MA 3HU3A 4HLUA 2ECKA 2UKDA 3SYKA 3DVLA 4OL0A 3NBXX 2IUUA 4BFWA 2C78A 2X8AA 2I3BA 2NOAA 2ZAMA 3FMIA 4PPNA 2YZ2A 4PQYA 5F3WB 4XTCS 4NYMQ 2WPDA 4RY2A 2PZEA 2QPAA 2BC9A 4TTQA 4X8MA 1Z0IA 1TEVA 2XSZD 1LFDB 1PUIA 5E3HA 5F9FA 3TRFA 1AKEA 2QSZA 4PAQA 1E6CA 2CDNA 1R5NA 1R5BA 4C7OB 5DO9A 2OBLA 5FTKA 1HYQA 3NBFA 3UATA 1CR0A 2QGZA 4JJZA 1KIMA 5EE5B 2A78A 4LYHA 4LBVA 4F92B 4KFTA 3P1JA 1XTQA 2VO1A 1JECA 1XXHB 2A5DA 1Q1ZA 3K0FB 2P5TB 3G0HA 4TLCA 2O8DB 4DC9A 1A2BA 4US1R 4KU4A 2REXB 3U7HB 4B47A 1GITA 4M1OA 2AFIE 2IYZA 2VP4A 5JZVA 2PZFA 1E1QD 1U0JA 4FCVA 1OH6A 1KKMA 3LX5A 5JWHA 2IYRA 2GNOA 2RGNA 1Z0DA 3H86A 5IK2A 3U3JA 2JLUA 4AG5A 4NONA 3BB3A 1OH7A 4PC3A 1XCPA 2D7DA 1X8LA 2FMXA 2WWFA 3IDQA 1KSGA 3TKLA 3U4QA 2O8CB 3IGFA 3RVBA 3B8HA 3VR1A 1YRAA 1Z6AA 2KWIA 1OF1A 4DUGD 2BM0A 1VG0B 2NO0A 3WRXC 3QQ5A 4TZ0A 4C0AC 1BKDR 1R8QA 2BKUA 2GJSA 4ZPXA 2WSSD 5FOTA 2CL0X 5C4MA 2W00A 4ZIRB 3K9LA 4KVGA 3QF4A 2B7CA 3IQWA 4LV6A 4OKSA 4G5QA 1JEEA 1E9AA 1AM4D 2A5JA 2QGNA 4IKEA 1VIAA 1D2NA 4UXIA 2JDID 2X19A 3C7KA 3I92A 1G18A 1IXSB 4TTRA 2IYLD 3THYB 2OCPA 4W9MC 2CLCX 4B35A 4D81A 5JFGA 1XF9A 5BYKA 3AVQA 2ZETA 4XSGA 4LJ5A 4DSOA 1P72A 2WJVA 4XIGS 5AJZA 2WKRA 1QG2A 3K09A 3Q5DA 1VPLA 3LVQE 2Q3MA 3RS5A 5GJCA 1J8YF 3ZIAD 3TQCA 2G88A 3QVVA 4QRHA 1DAHA 4CEJA 2GA8A 3EZ9A 1KMHA 1TU4A 1DAFA 1S1CA 3TR0A 1ZUNB 3EWSA 3T12A 1NN5A 2GK7A 4TYNA 3B5JA 3OIWA 2YHSA 3C4JA 2YKGA 1L4YA 1MV5A 1ZD1A 3X2SA 1AZSC 3I3SR 1YKSA 2ZRGA 1QHHA 4NCNA 4JT4A 1CRQA 4XVRA 2IS1A 3SBEA 2CVFA 4ESHA 2X1VA 1P4SA 1NSTA 2PX0A 2WJJA 3LAWA 1R2QA 3VKGA 4PHTA 3EPHA 1KDRA 2IXFA 3PENA 2WBLC 4BWYA 2XNSA 4TYPA 4BFXA 5JLJA 4OYHA 4OI0A 4X8HA 3IQXA 3QF4B 5CK4A 3OFND 3CIOA 3AVYA 4A1FA 3ZVNA 2GEVA 2VHTA 2WZQA 4MH0R 1SHKA 4DUGA 2GILA 3O8CA 4TMWA 1ANKA 2ZJYA 1TAGA 1VCNA 1N6NA 2E9SA 3FHCB 5FPSA 3ZZ0A 2FSIA 2GVZC 1R0WA 1FFHA 3D7MA 3BFKA 4C7OA 5E4FA 2ZS7A 1NG9A 2WJHA 1GL6A 2FX3A 2HV8A 1EESA 3EPKA 1YJ5A 4Q02A 4C0HA 4LK2A 1QHSA 1PLJA 3SC3A 4D4MA 1NF3A 3QKRA 5LD2C 4TQAA 3WRYC 1IBRA 3FB4A 3RDPA 3FFAA 2VQSA 2Z5FA 1F60A 2D62A 1JNYA 2OILA 2DFLA 2ZANA 2FFHA 4RCZA 2ZRLA 4U7DA 1XDBA 1LTQA 2ZUBA 3NKVA 2DFTA 2W6JA 2XZOA 2ZYVX 2V55B 3CPHA 2HXYA 2XOKD 2CCGA 4HDOB 1P2TA 2O52A 2YJTD 1C9KA 2ZRIA 4KLZA 2HCBA 3AVPA 3GJ5A 5K8LA 4IFBA 2ZYWX 4Q9HA 4P31A 1P3JA 4GP7A 1E1RA 4F4IA 2ZUDA 4ARZA 2O8FB 2J0UA 1AS2A 4RKEA 2B21A 4IOMA 1HH4A 5B57C 2FPKA 2BVNA 1E2QA 3GD7A 4PX9A 4EPVA 1RZ3A 1ZBDA 2BHRA 4OHXA 4DCNA 1YZGA 1E4VA 4D4LA 3LV8A 3GEIA 3MLEA 3P27A 2PCJA 4D25A 5B58C 3GLHE 3FKQA 2WPDD 5DISB 1E99A 5DI9A 4QGGA 1DAEA 2IF0A 2QMOA 5SZKB 3K0CC 2XSZA 3IIJA 5HR5A 3OESA 1E79A 2GJ8A 3L43A 2ZSEA 1EWRA 3LDAA 4QGFA 1SXJE 2VH5R 3TUIC 1EGAA 3PQCA 4POAA 4W7SA 1NKSA 3LRPA 3PG5A 1EX7A 3OE7D 1HQYE 2BMEA 5KPDA 3CNLA 2V7QD 2ZRPA 4U5XA 2H7VA 3CH5A 1F2UB 2WOOA 1Z83A 3GFOA 2HCJB 5K8IA 3FMOB 4G5RA 1RRCA 1R0ZA 5FOXA 4BASA 4YXWD 2QZ4A 1GNPA 3LBIA 2VRWA 2CE7A 2Z0MA 2ASEA 1ZJ6A 1KMHB 3MSXA 4YONB 3LLUA 4UNQA 3CW2A 1RJ9A 1S9HA 4FN5A 2VSFA 2EWWA 3KUCA 2VA8A 4JKIA 2C03A 1OFHA 1UPTA 2EWVA 3ZJYA 621PA 1W47A 4EJSA 4KV9A 4JL5A 3BH0A 2AFHE 1YVDA 4JMPA 2H8KA 5TXGA 3R9IA 3RSOA 1S0UA 2IHBA 2XNDA 1Z28A 4G1UC 1VKJA 3O8BA 4BLSA 1CR4A 2OSBA 4I1OA 5C46F 1NVXQ 4MQBA 4PXAA 3PVSA 4B3XA 1E3MA 5CM8B 2JLRA 3QPVA 5EUQB 3EW9A 3W6OA 3MWKA 4O3MA 4F38A 4G0NA 2Z43A 1XWIA 4OQFA 4OK6A 1EWQA 2XZPA 4KAXA 4CT4B 4AY2A 2Q3HA 1OB5A 1OXSC 2OE2A 3W90A 1N6KA 2J7KA 4LJYA 1Q1BA 1ONBA 2IA5A 1AS0A 4QNRA 4JLDA 4JVNA 1W0JA 5LPNA 4A8JB 4JBWA 1UBCA 4C0BA 1XPUA 2D2EA 1BO6A 3JZMA 4PC2A 5LD2B 3M6AA 1T4GA 2CHGA 1U8YA 2CJWA 2W6JD 1GRNA 4Q1AA 4QOSA 4JLBA 2PJRA
chains in the Genus database with same CATH superfamily
4FUTA 3DHNA 1H66A 1DBRA 4WAUA 1QFSA 1VYTA 1L7EA 2YQ4A 1IL0A 2PUJA 4R40A 2YY7A 4FM9A 3H5TA 3AXTA 5JVDA 5BQ5A 1KH1A 3BB1A 1SXHA 4G81A 3ROMA 3E5NA 3U2QA 4D92A 1DCMA 4YRNA 1OHHA 5HDBB 4JLMA 5JCPA 2O3RA 4IEEA 1EVYA 1DZIA 4QJIA 5JD6A 1QH9A 5JSFA 2CDAA 1Z0UA 3EY4A 3WMGA 4ID3A 1SVLA 4RTQA 1Z5NA 2F43B 4PG5A 3TLMA 4BMSA 3RU3A 1D4AA 1GGNA 2GLUA 3VH4A 5KNDH 3QKUA 2PGOA 3W6NA 3VPXA 3NRCA 4PSKA 3GOQA 1N4DA 1P7CA 3LVFO 3O2SB 4MJLA 4OHFA 1SRRA 4Z9FA 5C8YA 1JHQA 4MYSA 3WQHA 1TT5A 3SVZA 1UBGA 4LI3X 4QTTB 4BB9A 1UINA 2Q6VA 4F3NA 2Z56A 3AI7A 3E3OA 5BSTA 4TV8F 5M5BA 2QVBA 2C8KA 2Q9CA 1FFAA 3LY5A 3PGJA 5DM1A 1R18A 4HEA1 3VPSA 4TXNA 4BNLA 3W78A 4IGKA 1HYGA 1JA0A 5ADWA 4D8YA 4DWJA 3TR6A 3NONA 1K8XB 1O8BA 1QF9A 1NXOA 1RACA 1MO4A 2RG1A 1MQSA 1Y8CA 2VC2B 4I4TB 4ZEMA 5B1EA 1W5TA 5LDDC 2VEDA 2EP5A 2W6NA 2RH4A 3STYA 4PCUA 1H5UA 4YRTA 4EECA 5SZIA 5G40A 1B0ZA 2Q8NA 3LO8A 4GLBA 2FKAA 1OAAA 1VMEA 2BFFB 1TEXA 4OQMA 4U1RA 1GTMA 1MUUA 2QUHA 2XGGA 1ADGA 1C4KA 1BXGB 1OI7A 4YN3A 5K7SA 2QLFA 2JATA 4EGQA 3I45A 5HIKA 4L5CA 1YRYE 3HMQA 4YUZA 4W1SA 5AI8A 4CU2A 1GGMA 3GOHA 4ESOA 2WWVD 1EJ0A 4KCGA 2Q6LA 2Q9UA 3KJQA 1MLDA 1G8HA 3PBKA 3GPDG 4HAYA 4YJ2A 5B53A 1EE9A 2R0QC 5E1BA 1GHTA 3VR5D 1QWOA 1T1EA 2VJQA 3GLRA 3V55A 1OWOA 1TK3A 2W4QA 2VRCA 3IJ5A 4FD2A 4KQKA 4QXRA 2O8DA 1W4BA 3RUPA 5FLXA 1C1YA 3ROQA 3TE7A 4DXHA 4M6WB 2X0JA 2YOFA 2AT1A 1YR2A 1QO0D 4NOKA 3QENA 4RTNA 3PLAE 4RORA 2RIPA 2XADA 2OXTA 2FGKA 2GERA 1K5DA 2OLEA 2GM4A 1G55A 2EWMA 3BHIA 4ZVQA 2Z2ZA 3WK8A 5AUNB 5CBPA 1CLUA 3FETA 3SQDA 3NT2A 1WHTB 4TTSA 4EABA 1XJCA 1QCCA 2RGBA 4YMWA 2NUAB 2J07A 2VSQA 5KS2A 1CJKC 2HYDA 4HVAA 2C2HA 4XH9B 1EXVA 1LVUA 3RNLA 3ONNA 3DZJA 5FPYA 1EFAA 2H9AA 4JGBA 5TDHA 3REGA 4ER5A 5KVSA 1P61B 4F8EA 3G8CA 3O8CA 3PA8A 3KOOA 3TSYA 4D96A 5I7HA 1II8A 1AZTA 5K0SA 1ZH0A 2O2HA 3HVIA 4XJVA 9LDBA 1WR8A 1NRXA 4FEGA 4J1QA 5DP1A 1Q1EA 2Z30A 1UK6A 4CMHA 3C1AA 4R6WA 3WGOA 2IBSA 1GZ3A 3K09C 4DYDA 1W7AA 1OXMA 3SKVA 3NEYA 1EVKA 2A8YA 4RPLA 4M1YA 1KJWA 4M0LA 1O54A 2BUBA 4YK7A 1YS4A 3IDSA 3NI2A 3MG9A 3DOJA 3RYTC 4B6FA 1U2SA 1VKRA 4FMCB 4G65A 1HR0B 3RIMA 1J1UA 1MJGA 1OLSB 5BORA 4OIFA 2FPOA 3UAYA 5FWXA 1V3QE 4F56A 4BNXA 2QYTA 1YR7A 1Q83A 2RCYA 4IUBS 5D86A 3OCYA 4TUYF 4RSMA 1VQ1A 1NBAA 4AYTA 3H97A 2XUIA 2OBYA 3QY0A 4IP0A 3RCBA 2QPTA 5IUNC 4N48A 4HLNA 3L5KA 5CW2A 3BSWA 1SKYB 2Y6UA 2PIDA 2WJPA 2YYZA 3H9BA 4BVFA 4BN0A 4UPDA 4P4LA 1JQEA 2PUHA 3FVRA 4UVDA 3OQ6A 5CJJA 4MV8A 4E12A 4O25A 4LPSA 2GPNA 1X1QA 5NLLA 1G8SA 1XRJA 2VYND 3H2YA 2BMWA 4OHZA 5JXIA 1M1XB 1QFMA 2PD4A 3RTEA 4BLTA 1PDWA 1XCGB 4D9GA 2H3EA 2KE5A 1MXHA 5HIMA 1FJHA 2VN8A 2QT9A 4B34A 5BVGB 4L0MA 3EC2A 4EG8A 1RLMA 3KJHA 2X4GA 4L7QA 5IM4F 1HEUA 1N6LA 1VECA 4KN9S 5J23A 4UNNA 4A5OA 3TRIA 3CKLA 5DM2A 3SHOA 4DDWA 4DC1A 4QUJA 3W8FA 2GH1A 4ZDKA 4DB2A 4DMMA 2QJOA 4RSHA 4UE3S 4ZYVA 4DMRA 4QYIB 1Q5PA 1JSRA 2ONKA 1DVRA 1V7QA 3MPOA 5FOWA 3J7AC 2DHEA 3Q8MA 4G2NA 4J90A 3AMVA 3IO5A 5DT2A 1R8SA 2LIVA 5ALKA 2CDCA 4C0LA 1SIOA 1Z2PX 5DTRA 2P69A 3IKTA 1OVMA 1U80A 2XUJA 3N0TA 4FEEA 4JIMA 4MP8A 4NCHA 1GQFA 4RWEA 4E70A 1II9A 4W9RA 1XRPA 2C1ZA 3P19A 4N9QA 1J22A 1TM2A 4OUDB 4Z4QA 2IUEA 5FFNA 3JVIA 4LSZA 1SHJA 4I7EA 2X3FA 1NUSA 2YMLA 4I1VA 4JQYA 2JZNA 1ZGZA 4NZMA 3T5MA 3V8BA 1J0EA 5HXAA 3U4DA 1NC1A 3QOFA 4U9HS 2VF5X 4BMDA 2W6PA 1KO5A 3F2IA 3ZY2A 4AMGA 2CHUA 1HUQA 2UAGA 4YQYA 1TF2A 3DL2A 1RW4A 4RGBA 1CY8A 4EKYA 1E32A 4ES6A 1KYWA 1P31A 4X8OA 5JWOA 2Z6QA 3CVYA 1SVMA 2WYWA 3ZTWA 3HUDA 3UJDA 3NANA 4XSVA 3LD9A 1OI4A 1CV2A 4AXBA 4RJ2A 3GLIA 4FS8A 5GY7A 3VR4A 2PU5A 4OL9A 4A2CA 4ABYA 3LQKA 2QRNA 3KD2A 2J3EA 4C4PA 2C92A 2VSYA 5TEVA 4F6LA 3ODPA 3CNQS 3CNOA 4I08A 3EODA 2V7QA 2B20A 2HZ7A 4O4IF 1SN7A 3JVUA 5EE0A 3RFFA 5CCEA 1XCJA 2AL7A 1UPUA 3NZEA 5DYYA 3VGJA 3OPYB 3DFUA 1B6TA 2ZIXB 5JS8A 1KJNA 1NR5A 3B2QA 2G77B 3DM9B 1MOZA 1ZGBA 3JRWA 4K9DA 1UH5A 3WLHA 4ZI7A 2YXPX 4JJ4A 1J0DA 1QGZA 2YFKA 4R81A 4FTWA 3ZH9B 1GAXA 4TTAA 1NN0A 3AC0A 5MGNA 1E79D 1FMFA 4R9VA 4OXIA 1X3SA 1W1IA 3VJLA 5L6MB 1DJLA 4Q3OA 4QAQA 4JLOA 1YUNA 5DYNA 5JYCA 3PEWA 1LX6A 3CUUA 5AKJA 3NTUA 5HQTA 2G06A 3R0QA 2ZVDA 3LF1A 1YASA 4LVCA 4NHOA 4L4XA 1VG8A 3AXSA 3BDAA 2GJKA 3QTTA 1QGUA 3ES9A 1U3VA 4UNPA 4AP6A 1K9SA 4LMPA 2XCIA 5AO9A 1ITZA 3RTAA 1I2MA 1L6RA 1PIWA 2K5UA 1KJQA 1CNFA 3NPAA 3B1WA 3HVUA 2GM5A 3B89A 3C87A 3SBXA 2X8JB 1O0CA 4ZT2A 1Y3FE 8OHMA 2FJUA 3UV6A 1Z8DA 3AKDA 3WB1A 1I9CA 2AZMA 3D8UA 1U8TA 2ILTA 4AJJA 1SU7A 5BR1A 3OM0A 1GOTA 2C04A 2W2LA 3K30A 2OG2A 4L73A 3VUEA 2R2AA 2OQ2A 4Q9LA 2OWDA 3L0SA 1T2EA 2XRZA 3EXHC 1PJQA 2B7LA 3ILXA 4JFRA 4ZO8A 4D9FA 1SJ9A 4Z4HA 1FY2A 4B3RB 1K97A 5JRZA 3AM1A 1AUPA 1GLGA 1X3LA 1KI1A 1YFKA 2QLNA 4HBZA 2RI6A 3ZXXA 3MJVA 5KYVA 1C3OA 1IB0A 3G49A 5J9FA 4DMHA 821PA 2UZ4A 1CEYA 2X2FA 3GZNB 2ZDGA 3GRRA 3D43A 1IIBA 3AERA 1N7HA 3G2QA 5U1PA 3IAM6 2J0QA 4OHMA 4UBKA 4DAEA 2G17A 3ACCA 1A97A 3BD7A 5DI3A 1R0RE 2V0NA 2R68A 5LYYA 4DUPA 4Y2JA 1NPDA 1WS6A 4Q3CA 5ARCA 2XCRB 2G80A 1QVWA 3F3KA 5IJ0B 1U04A 1Y3HA 4EPWA 4LRWA 2GZ2A 4MV3A 3PR1A 4YJHB 3F5FA 4QULA 4PC1A 4OFWA 2JFYA 4XUCA 2QM0A 5HRCA 1ORRA 1UEJA 3TD6A 1YK0A 5HP4A 2OBMA 5EZYA 1G16A 4LOLA 5JQGB 1ZW1A 2I54A 3USES 3FYUA 5E1DA 4C08A 5B6JA 5EKUA 2WSBA 5F9MA 1J1ZA 1G7TA 5CU7A 2NVWA 3V6MA 4N6GA 2BKXA 2G82A 1PWZA 1SCUB 1XAJA 2EHDA 2H16A 2WU8A 2I1WA 4NEGA 2BR5A 2Q2WA 4UEJA 1F0PA 5DCLA 3RF7A 3ZK7A 2R44A 5HJ7A 2HF7A 1D2MA 2QROA 3AP2A 4I50F 4IOJA 4MJXA 3K1AA 4FIDA 2NZWA 4BRSA 1RP7A 4YUYA 2PH1A 4PZ0A 4HAWA 4NE7A 5E6RB 4C5AA 4LAFA 1XBTA 1S2LA 3PFBA 4C01A 4MQMA 1G2PA 3PKZA 3T1QA 5EJEA 1DG1G 3TZKA 4E2ZA 2YHAA 2COKA 1DKUA 3PICA 4LZZA 1ZWLA 2DQSA 4ZAWA 1WXXA 1P7VA 5H68A 1E58A 4DJJA 5KVAA 1U8FO 1RRVA 4PO1A 1THGA 1U2QA 4QEZA 4Q21A 1CJMA 1SNYA 1KI7A 3D4PA 1NXPA 4L6CA 3FCEA 2XKBA 5DHRA 4BC1A 4RC9A 4TLEA 1GILA 1H4VB 2ZIGA 2PKRA 4GXTA 4X95A 5DMXA 4ZVVA 3AF2A 2E6UX 4X44A 2G70A 1MTOA 4NL4H 1ABBA 1TO1E 5BR8B 5L40A 3NIDB 4AJNA 2AWNA 4IXTA 2JI9A 2Z3VA 1SQ6A 4RADA 5D5QA 3SE0A 5ADHA 5LOVF 5DGXA 2H4JA 2YWDA 4TV8A 1G3RA 4M1TA 5BSVA 5FV7A 1D03A 1UOOA 3FCAA 2XDQB 3FMPB 3MCWA 1N77A 4P83A 4R1SA 1Z08A 1UZAA 3F3SA 4ZCPA 1ORIA 3ZIUA 1U8ZA 4UMEA 1Y63A 4V03A 3FHTA 3MM4A 3OMXA 4CM6A 1IZ8A 1V45E 1M1NB 2F1RA 4HAOA 4MV9A 4OO3A 4CUJA 2VUIB 1NI5A 2RH8A 3EEOA 5JJIA 3AFHA 3L3BA 2YNMC 5EHIA 3EPHA 2IFTA 3EZNA 3HR4A 3I9MA 4BNTA 3KL2A 3UFBA 2GEFA 3WQQA 3KKPA 1U6IA 3MIZA 2EZ9A 4OLJA 3T6KA 1IIRA 1G2OA 2XJ4A 4R7GA 3HK2A 5IKEA 2PS1A 1LRKA 1AY0A 5F33A 3INYA 1XJ5A 3PWKA 3BRSA 4XPIB 5DHSA 2B7BA 1Z2NX 1OWLA 3H19A 1UXIA 4B9EA 2ZAOA 3VKWA 4F06A 1Y6GA 2QQ0A 3WMXA 4YCSA 1P5ZB 4TS1A 4RJIA 2G5TA 3A05A 2PO5A 2ETVA 4AWAA 3HSKA 2Y67A 5L3ZA 3QFHA 3L1IA 3R09A 4CEHB 4FMCF 2FW8A 4I4NA 4WY8A 5JR3A 3JD2A 5HSGA 2WQ6A 3QNMA 5MN6A 4KAAA 1SO8A 4KE6A 5JAZA 2OT3B 3L8CA 2WT8A 4P80A 4W1PA 5CFLA 3JALB 4AG6A 4U7JA 3BH7A 1HFJA 1NNI1 2OVFA 4L0QA 5K6TA 4BGVA 2UDPA 5AJWA 4MGIR 2ZTMA 3DBVO 3EJ6A 5CXUA 4DM7A 1YZYA 3A1VA 3JSAA 4EA6A 3DEFA 3JVVA 3DE1X 4G1VA 4FFWA 2ZU6A 4Z7OB 5L8VA 2JLZA 2H5JA 4HVCA 4JGIA 5A02A 4L72A 4G36A 4PTLA 1CETA 1YU9A 5FUQA 2DQKA 4IO1A 4A0GA 4ZRNA 3ZWQA 1J42A 3GLSA 1VJ5A 4U0KA 4CM4B 4RY0A 3ECSA 4Y7CA 5SY6A 2O0MA 2NVUA 3V8QA 3DTNA 4YVFA 4JWKA 1Y34E 4X1YB 3E8SA 2DR0A 4JA2A 1M6WA 4MLZA 1JEDA 4RF3A 5KC9A 1LC3A 1NLYA 1SHZA 3K94A 3N2GB 4OXYA 4AB1A 4BIMA 2HLDA 2VXCA 2FLWA 4G9EA 1DOHA 4MR7A 2VQFB 4EYSA 4CKXA 1UZMA 2W8BA 1V9CA 4BAUA 9ABPA 4JOQA 2C4KA 2FQ1A 5KTSA 1ZUD1 1TPZA 3SICE 4QUDA 1KO4A 3Q6NA 2A94A 3KWFA 4URZR 1FBNA 1IE3A 2F67A 2IYOA 2O1WA 3KFVA 5TQ0A 4PQFA 2Y66A 2UVQA 1KA9H 5JRJA 1KI9A 4PCLA 3Q15C 5JEDA 2VR1A 4RTMA 1LB1B 1CUAA 4MYHA 3RYFA 5KO2A 3WKEA 2HPHA 4IIXA 3VNBA 3TECE 4KDEA 4HJXA 3TSWA 1NBMD 3ZKWB 1N5OX 2HHAA 5E4JA 3U3RA 2BE9A 1DBVO 2Y77A 4JUDX 4NCBA 2IPLA 1E2BA 4I9UA 4WZAE 5EP2A 2VUUA 1UZUA 2ZE5A 1IHDA 3BIOA 2OXIA 3PVCA 3C6KA 1ZO8A 3DZ8A 3NBKA 1IZZA 3QLTA 1EHCA 1S8NA 3KTAA 1JRLA 1RC8A 3VZBA 1F2DA 3BMNA 3IMFA 2WEKA 1S8AA 3L8DA 4Y9TA 2XUOA 4DLZA 3RUEA 4QDUA 1W2GA 2WAOA 2C3OA 2JLWA 4DF3A 1CQPA 1NVTA 1ADJA 1TJPB 3LYLA 4C6HA 4XDYA 2NO4A 2R7MA 4FBMA 1DOAA 4AJ9A 3DMFA 2XIQA 3KOWA 3PEVA 3O3OB 4AUMA 3S29A 1JPVA 2G0NA 1DCKA 1NSYA 1XKLA 2JFFA 1H2HA 2GBLC 3I5UA 5M3BA 5JJ5A 2ZRCA 4V39A 4YI5A 1PFKA 2FA9A 2QVGA 4E1VA 4ENTA 3LC7O 5IVPA 1E1RD 2RHJA 3DE2X 1XIVA 3ZWKA 5FL3A 4F84A 3FF4A 2FEAA 3SN6A 3W6ZA 5IRCD 3QE3A 4A82A 1I0ZA 1NFQA 1OR8A 2VDNB 1ZMBA 2HEGA 3KR9A 4X84A 3OPXA 5CK5A 1OFIA 2BFBA 4AJ4A 4DLSA 3M1IA 2FMIA 3VPDA 4RD4A 3H05A 3U39A 3EQ7A 4MR7B 3KU4A 4RPKA 4UEQA 5ARBA 4G5FA 5I8ZA 3HJUA 2DLCX 1RRGA 5C31A 1J20A 1KMMA 2D5IA 3BWVA 3JQFC 5F9HA 4A0FA 1IWOA 5DEOA 3GJ4A 2BBOA 2YUTA 3UKDA 5IPFA 1R0SA 2VOEA 1KDVA 2CL7X 2P5SA 2R5NA 3HEBA 3PD0A 4UKDA 1GPKA 2UZ1A 3RD5A 1QZ3A 4BO8A 4OQZA 1C0KA 3ACBA 4UQLA 2Z2IA 3NIGB 3ZWPA 2HRZA 4PGFA 1S2DA 2JIPA 1HG0A 4KDCA 3W2IA 4YMGA 3IE2A 2H31A 4DR5B 2XNJA 1RYZA 1Q95A 3N74A 1O0BA 3HCAA 1HYBA 2VDUE 4G25A 5CAEB 5DLPA 1Z73A 4H3HB 2PX2A 4I5IA 3AFIA 4M86A 3ZZUA 5IANA 2FEMA 3IILA 3COPA 4LX0A 3BMNB 1B74A 3A14A 1Z8NA 1MEJA 1MD9A 2GNPA 3GN1A 2GN4A 2O50A 1AHHA 1DQZA 2I29A 2RARA 3R6LA 4JLJA 5B5SA 1VKHA 4M1MA 5DMHA 2J5RA 3MRVA 4AKIA 3D8BA 2PRJA 4LYGA 5LXTA 1MB0A 4IXWA 1W0KA 4ZDIA 3X44A 2WJYA 4B5KA 3QG1A 4S1VA 4NSNA 2L82A 2V98A 3EEBA 4DLBA 2LV8A 2MSLA 3C8MA 3NDJA 5KNLA 4QARA 2BM1A 1AXGA 3RT1A 4A8PA 3OZWA 4KGVA 3N2EA 2V0GA 4TLLB 5I01A 1DHRA 1G41A 2FPSA 4QU9A 1DARA 3SFZA 3AKYA 1MP0A 4JZYA 1RRPA 4QATA 5BSHA 1FP1D 5LP6C 4MNTA 1DINA 4CODB 1L5HA 2ZPUA 1ESNA 4KNWA 1KL7A 2WU1A 2R85A 3OI7A 1QTQA 1Z6QA 3IE1A 2Q5CA 4D7AA 4OXKA 3G2LA 1ZM2A 3N2GA 3O2QB 1QIHA 1W44A 3KQLA 2CUTA 3DD1A 5KHOC 1GKIA 1T1SA 5C32A 4U2CA 1RWKA 2YHIB 2QD2A 4JI1B 4B48A 4TRJA 3HFGA 3RS8A 5A1TA 2HBQA 1DPGA 2G63A 3GCDA 4O5AA 1COWD 3T7TA 4Z3KA 5HCUA 5L3SA 3E9MA 2A0XA 4BLRA 1RAFA 2ZYHA 4F4UA 1TYDE 2I7TA 2ZB2A 3EASA 3GIDA 4TKVB 3V1TC 5LJLA 4F5WA 1HG1A 3BRWD 3PC8C 4DLLA 4NYJQ 3B78A 2PGJA 2EP8A 2FGJA 2O8EA 5GIPE 2ZBGA 5AVQA 1U1FA 2IYQA 2ZI7A 4MPRA 3L0ZA 2I22A 2YRWA 4YPFA 1W93A 6Q21A 1SXJC 4MB0A 4F93B 1YMQA 5J5AA 5I8PA 4XB2A 1WP9A 5CR9A 3S1AB 4P4SA 2UUCB 1RJEA 4GWGA 4RHYA 3VYRB 4OH7A 1HOTA 3BK7A 3ZI7A 4JL6A 2DBQA 1BH6A 4D98A 1ODLA 3BVPA 1SCJA 3U7RA 2VXOA 4KXYA 5FOUA 1RPAA 2XNDD 3WQBA 1M2EA 2VS1A 3M6XA 1U5BB 1NVFA 5IKPA 1HT2E 3ANXA 3W4IA 5D00A 3AOEC 4ZK2A 3T9AA 2O6LA 2VPZA 2XVAA 5JCJA 3FYCA 4U5QA 2I33A 4P32A 2WOJA 4EUHA 2OPHA 3NHZA 1DIHA 3B1XA 3TBHA 4PLWA 4Q39A 5D01A 1U8AA 4GRDA 2JF0A 1P7PA 1YBFA 5CYOA 2XX3A 3DOIA 4NV1A 4QTYA 1ZUIA 4YXFA 4V1CI 3TE6A 2H1IA 1BYIA 5TY0A 4X92A 2WE7A 4XJSA 1A9YA 1FP4A 2C9BA 1P17A 1ZQ9A 1UQUA 3BDVA 1K7YA 2HWKA 1U0LA 4EB6B 4ZK6A 3NOQA 1BNCA 2N42A 2A3NA 2C8LA 1IXZA 1I7PA 3WL6A 4UTPA 3IQDB 3QWIA 3PE4A 1ZVJA 4HATA 5FPHA 4GQIA 3ZV3A 1H6BA 4HQOA 2VHYA 3N6VA 5FFFA 2A5FA 3V1UA 1SZJG 3IBCA 5JXJA 1CSEE 1XWFA 3QX9A 1O5IA 2EVWX 1H9CA 1LLQA 4QEKA 3UT5A 4L9SA 1UIMA 1C2YA 4X61A 4F85A 1T0HB 4CM7A 3IULA 2AOXA 4NMWA 1BW9A 5K3AA 2J0VA 2IPMA 2XIJA 2UUPA 2YWXA 3DWGA 3P2IA 1RBMA 4DCTA 3VJRA 3P26A 2XB8A 3ETGA 3H3JA 4ZV4A 3ICPA 1TUBB 5AT1A 3LGSA 3OJFA 4EVSA 3S1AA 4A6XA 4EF6A 2KMLA 4K40A 1J2YA 1FP7A 2BW0A 4CTKA 2VTBB 3MFYA 4EG1A 5EAIA 4DXAA 5CIYA 3CJQA 1QG4A 1FU7A 3B7PA 5IKOA 3WRWA 3HB7A 2C9OA 3V2GA 2BIFA 4K3VA 1Y6ZA 9LDTA 3P20A 2FEKA 3ZD7A 4ASUD 4R8VA 4S1OA 2UZIR 1PGPA 4K6MA 1IEVA 1QDEA 1YFJA 2L42A 3BMOA 1WXHA 1T1GA 3ESYA 3U3MA 3UAWA 4O63O 3I52A 4XQCA 2R6DA 3FTEA 1YZQA 2RK3A 4NFYA 1CVRA 4PPGA 2IW3A 2O2SA 2VP6A 3G2JA 1EFRD 5CBPB 4OHKA 2NUPB 3FOCA 3PDWA 1PJCA 4ZCTA 1E61A 4IZOA 4Y30A 4BGUA 1MO5A 1KJ9A 2RBKA 2V5VA 3OKCA 3F47A 1IWBB 4KWEA 3U4QB 4B1FA 3MCVA 3CZ9A 1OGIA 2K6GA 2QZJA 4RQBA 1CJUC 3K1JA 1NYLA 1TQDA 1CHNA 4KGDA 1Y9ZA 4RL4A 4TYYA 4Y0VA 2BHNA 4J1SA 1PR9A 1QTRA 2M98A 3LKVA 3PXUA 4FQ7A 4D0NA 5EJ7A 4PZAA 2P6UA 1YOVB 4GMFA 3RFCA 1M6NA 1SU4A 2GXQA 3R24A 1X39A 4OBBA 1UPXA 4D3FA 3KT3A 1EVIA 2G5GX 2H1SA 4GM1A 4S2UA 4Q4AB 3RQIA 2I78A 1YR1A 4FR2A 3VZDA 1NBHA 1QQ5A 4N7BA 5AK5A 1PGQA 5DHAA 1UBLS 2GN9A 3LUGA 4MR8B 1KDZA 4AIIA 5K4GA 3LCRA 2HSZA 4XCVA 1LPBB 4CKWB 4RNDB 3O4VA 1N0UA 4P3NA 5ALXA 1XZFA 2GXUA 2RGDA 1DUIA 2WQZA 5GV8A 3FCOA 1PFYA 1UEXC 2DUMA 3ELYA 2HJGA 3AM3A 1QONA 4G8BA 3ZBUA 4EI2A 2ZVQX 5F5NA 4WKGA 3IBTA 3Q98A 3TRDA 5JOQA 4PSAA 1P6UA 1RQGA 3LQRA 2L69A 4XM0A 4G0QA 1V6AA 2A0WA 1XMIA 2BFBB 5FWXB 3H9UA 5AI0A 1SXQA 2E4XA 4F11A 3WDMA 1KVRA 3DPUA 4KFCA 1H1LA 4DQDA 5JCZA 2P4SA 5I5GA 1KQGA 4WEOA 3NEJA 4YC7A 1MH1A 3P0EA 4R54A 5PGMA 4B7XA 1RTKA 1V1MB 4Q82A 1QPZA 1C8VB 1EXMA 4C9BA 1OZ0A 4Y2YA 2RGGA 1R3DA 3ZU4A 3VDXA 3E2IA 3OEED 5HJEA 1BWSA 4N1AA 2QTFA 1H8HA 1VI5A 3LYAA 4A6DA 2NTVA 1QYVA 1G4AE 1EX9A 1X7HA 4GG1A 4NPAA 1CVLA 4WT7A 5FBHA 4DY6A 3OIDA 4XWYA 3U3DA 1TYEB 3DPIA 2CD7A 3DXFA 4URYR 3R7WB 3TW6A 3ZHOA 3Q8KA 3U4CA 1JFVA 4Q37A 5K8UA 3ZEAA 3IXLA 3N05A 3F4BA 4YUWA 3DL0A 5EYPA 2Q46A 2DBYA 1C1XB 2FN4A 2QVCA 1PVDA 4NJMA 1YJQA 2AJTA 3TTTA 5CHYA 1Z0JA 2NNLD 4N3NA 1ZZEA 4HDKA 3PFKA 3JYLA 4TROA 3U7GA 2ZBPA 5GOTA 4MRPA 4P4GA 1E66A 4BQEA 3HKEB 2VHCA 1SUPA 2WTUA 2FPXA 2WLSA 1HTBA 1I94B 4EZEA 4J6FA 1MO3A 4FNMA 1SVUA 1U7TA 2YJ3A 5H3LA 5REQB 2Q5IA 2HCRA 3FR8A 1FFXB 2X6TA 3A31A 3GFPA 4UAGA 4B3DA 5HHTA 2QMUA 2Z95A 2BFNA 2E1RA 1R50A 2HRBA 2DRIA 3WDSA 4BLQA 4EFLA 4WNAB 5HUJA 2QTVA 4YPVA 4FW8A 3BCHA 4HAUA 1FX0B 3N0XA 3C3BA 4JJ6A 2QTAA 4MVJE 4BMCA 5JE8A 3FOEC 2O8EB 1LC0A 1YZUA 4ZDJA 3HBNA 4YCJA 3UYKA 3QKSB 1H93A 4K6OA 2O54A 4EX7A 3AZQA 2J67A 1KIFA 1P5HA 2HSEA 3C3JA 1BJTA 3OFSA 4GBMA 4J0IA 1HMYA 4I1RA 4MKGA 3TB6A 2ALJA 4QEDA 1FU8A 2EL9A 5GJVC 5IU6A 4E4YA 3HM9A 1W0CA 3IHWA 5BNTA 1AUXA 1SEPA 2H00A 2VLIA 3GJ0A 3PNMA 5AR1A 5B3KA 5IDWA 4QE3A 1C50A 5DULA 1LPNA 2JANA 5KNCH 1D2RA 3DO6A 4KEAA 2OZPA 1E6MA 3DLCA 2IEAA 1V95A 4JROA 3G8DA 1T0JB 1VB5A 3OMLA 5F52A 2DLNA 5AM1A 3PNLA 4YO8A 2X8WA 5IABA 5FBVB 1UZLA 5AK0A 1T3LA 2LGJA 3E5HA 4PPYA 4B73A 4Z0TA 2ZI6A 1L7NA 1Z4PX 2Z8YM 4I4TA 1M2WA 5E4YA 4AROA 3ZE2B 3FDZB 3V00A 3QV2A 5IDQA 3IDFA 3WK4A 3X2FA 3H1PA 3RABA 4BVLA 1H0HA 4UBJA 2FEPA 3UGKA 1PF7E 1SUWA 2YS7A 3IOBA 4I3FA 1KR2A 2OV6A 4GUAA 2BEVA 3O7WA 1AUOA 1CULC 3MD0A 3RV3A 2G4VA 2CV2A 5DE3A 2X5XA 1M2JA 5BPHA 2Y1GA 5F2OA 1FA9A 1FPQA 4JI5B 4EQ6A 4HPWA 3Q7PA 3KNZA 3UB4A 1USGA 4H7HA 2FUEA 5BWMA 4K3UA 1CC1S 2WU0A 4AY4A 2WM9B 3LCVB 2NG1A 3H16A 3W7VA 4NCAA 4DV3B 3ZE0B 4ZXFA 3Q1LA 3EVNA 5IXSA 3TSOA 1KFCB 2XR1A 1TC2A 3CPEA 4TXMA 2EFGA 2ID9A 2QTHA 3RGWS 4B17A 2V1XA 4O4JA 3MNFA 2FG6C 3FUWA 3QSYA 4QICA 3L6RA 3FD8A 2FQYA 3FCCA 1E1LA 3LHSA 3LRXA 5A9SA 3O74A 2C88A 3S0JA 1Y3AA 1IMJA 3V5NA 3ZWOA 1U81A 1VL6A 4QC2A 5CX4A 1PUJA 2JHGA 5BV7A 2REBA 3B2EA 2QM8A 4GI1A 4E5NA 2CYAA 2JJ8A 2AQ8A 2QMHA 4P38A 3CLUD 2MSDB 3AUFA 4LW8A 4NBSA 1PQUA 1BROA 2Y9MB 1VHQA 4FC6A 1HSOA 5A4IS 4LRUA 2PUCA 1IONA 4AMBA 2IYXA 1KFKB 4IVQA 2HLHA 3S7TA 3ZDAA 3BJZA 4OKNA 4BKQA 3RARA 3WB0A 5CP8A 1M6VB 4EFNA 3DOUA 4F2DA 4E2YA 4ZJZA 3OLVA 5KUTA 3DPSA 2HRDA 1T5BA 5DTMA 5I7EA 4YDHB 3I28A 3AF6A 3LE8A 1ZLXA 5KEIA 4TKZA 2J5QA 5MF6A 2WVGA 3KZMA 4MVJI 5TE9A 5L3QB 2ZRMA 1LWOA 1D4FA 4QOIA 3DEIA 2CXOA 2XMQA 1RWQA 5CXXA 1L5QA 3F6RA 3U5ZB 1ZOOA 4NMMA 5D1HA 1TEZA 3L8YA 1U0EA 3B82A 2IITA 4IW3B 1A2OA 1KZ7B 3TTYA 2C7QA 3H5LA 1O96B 4EB8A 1R6TA 1M2NA 3GPBA 3MCAA 4L95C 2A86A 4QDZA 1KI8A 4GWLA 4A0SA 5JI3E 3HGQA 3OBIA 4R31A 2CT8A 4FR5A 1YJCA 1RKBA 2FSHA 1YQ9A 2BN4A 3C98A 4M38A 2CVQA 1JZSA 3C3PA 3COVA 2B4AA 1NW4A 4H1HA 3GPLA 3O4IA 1I2DA 2QRHA 1B23P 1ZU4A 4KWIA 3U4MA 1P0CA 4TL8A 1ZM4A 1X70A 5C8YF 2DMRA 1N0IA 3UOGA 3WLSA 2P40A 2GD1O 3ZDDA 2MSWA 2Q5HA 1G98A 4O8ZA 3GGGA 5IF3A 5I7RA 1YZLA 4U2KA 3ETJA 4IIHA 1COZA 5KPJA 5J40A 3QMPA 3VZCA 3WGGA 1KEZA 3AFOA 4J0QA 2P6MA 5UKDA 1U9JA 5F7XA 3ZHXA 1V7CA 2C7RA 2XUZA 3ZWDA 4ND8B 1T8TA 3JYPA 3NWBA 4A6EA 3GFQA 3IR5A 4PZCA 4DREA 2ORIA 2W0SA 2AOUA 2J7PD 1U28A 4KYVA 1W5AA 5KI6A 2O4CA 2Q2NA 3CTPA 3D7SA 3OX3A 3QA3E 4XUGB 3RO7A 2CMKA 4Z4EA 3CONA 2Z9BA 4W9NA 3ZDXB 3TRHA 3AW9A 4PAMA 16PKA 4E94A 1W36C 1Z4MA 4LK3A 1WVIA 1BDHA 3ZV6A 1DV2A 1KY2A 5EVCA 1M0TA 3L4JA 1M67A 1RYFA 2Y1CA 1PUXA 4I5FA 3AY7A 4M1KA 2RAPA 1M8PA 2OAEA 4H77A 3K0CA 2XEDA 3IEPA 1NYRA 3WWEA 5JI2E 1XEWY 4FKBA 1YKGA 3F9CA 3U1BA 3U44B 4P6VF 5CGZA 3WMRA 1TYZA 4B6PA 2ZP1A 2DR2A 1QP4A 1E3SA 2VHWA 4RXTA 5FTLA 3PCTA 1KYZA 2WUWE 5ILOA 1P1FA 2ODWA 4LOJA 3DDOA 4F8JA 4L8YA 1POXA 4OXXA 2VCEA 4HSEA 2I6SA 1ISGA 3JZFA 4DPMA 4F2HA 5IM4A 2JGRA 2A4KA 4RW0A 2X0DA 4DADA 4PG7A 1VG1A 1WZNA 4KH0A 1OILA 3P9YA 1RHKA 4E3WA 3W2EA 4KQJA 5KOYA 3FDJA 2BDEA 1A9ZA 3GEGA 4AUKA 1I7LA 3KYIB 1ULSA 3QYFA 3B9QA 5DSZA 1UXOA 3JV7A 3PUJA 4B4DA 1GVNB 1SKBA 3RIGA 2HNAA 4YMIA 2JG3A 1PVOA 1ID8A 2Y2UA 1N5DA 4JC4A 3HJRA 3QWFA 4G4GA 4HX5A 3K9FC 4FYXA 1VHJA 5B12A 2KBEA 3GLIB 4MS1B 1VGRA 4H4DA 3IUYA 3GJ8A 3E4DA 4EK9A 1JKFA 1NI4A 3TTUA 1I32A 3RASA 3OX2A 1GT6A 4MITA 3FHOA 3USCS 5CT4A 1C7EA 1D0VA 2B6NA 2B61A 1XQYA 3JWHA 4ZO9A 3SJBA 1FMTA 4EDFA 4D3DA 2Y27A 3ASVA 1RPTA 3I83A 4L8GA 3RYIB 4ARSA 1N1DA 2V45A 5AUPB 2ZIXA 4NECA 4HS4A 3T94A 1VMDA 3I8XA 1ZCBA 5JAHA 5JANA 2EFCB 3GRKA 3OTOB 3JALA 4XVQA 2P4EA 3UB3A 3PGVA 2YYAA 1YDHA 3U7EB 1F0NA 3AQ4A 1AE1A 2G6BA 1FK8A 4R8MA 1G8FA 1EBBA 4LMRA 4WWHA 1YA8A 4KPYA 3UA4A 2YINC 3ZC3A 3GJYA 5JXHA 3VC7A 1Z0SA 4RHCA 4W82A 1BCRB 3PHIA 3U3OA 3SYLA 3VPHA 4DDVA 4HVTA 3KAJA 2I2AA 4Z9XA 1BE0A 1DS6A 3IV9A 3EUFA 4FINA 1SHLA 4D02A 1WB9A 3BSSA 3VR6H 1B14A 1VJ0A 2IYWA 3WY9A 3FOFC 3AUYA 3TUZC 3BHMA 1Q12A 2FW7A 2WFAA 4S0ZA 1TIKA 3OPYI 3S1LA 3SEFA 2ZAIA 3NUQA 4M9SA 3E05A 4ALKA 4UUOA 3SX0A 2WMDA 4X1IA 3NHBA 4DV5B 3QFCA 4TTPA 5CLGA 1F14A 1QFZA 3RG8A 5FKJA 5BWOA 2CLEB 4J0JA 1X0VA 5J3JA 4PYIA 3P32A 4W1QA 4UAJA 3F6BX 1EK0A 4HNUA 1XN1A 2WT9A 3BF8A 3LP8A 2EF1A 3IVCA 1VBFA 4IXDA 2VT2A 5J2TA 1W36B 1T3ZA 2NV2B 2YRXA 3A0RB 3R2JA 2C9DA 4LUCA 2AXQA 4YMUA 4RHEA 3Q4GA 3CF4A 2H59A 4U6QA 1QZUA 1P2FA 1V71A 2WP0A 3WQRA 1R8JA 4G1EB 4BRUA 3H9GA 2BTOA 3QH4A 3R1IA 5H3HA 2RAUA 3ZNOA 3C85A 3P2YA 5FBWB 4AJIA 4GOND 3ESXA 1WETA 1AQLA 3PIRA 3OO1A 2YASA 3NBYC 2C07A 1SAYA 2E4VA 4M9XA 1E2PA 3STUA 5IAOA 5T6MA 1J2RA 2OORA 3F67A