5C2JB

Complex structure of the gap domain of mgcracgap and cdc42
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
191
structure length
191
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase activator/signaling protein
molecule keywords Rac GTPase-activating protein 1
publication title Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
rcsb
source organism Homo sapiens
total genus 67
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5c2jB00
3D7MA 4ZI2A 3UG6A 2QMHA 3LQRA 1OFUX 3CO5A 1HTWA 1E0SA 3W8NA 2NZ8A 2J7PA 3LBNA 4KXFB 2AK2A 1F2UB 3IBGA 4B32A 4LOAA 1OFTA 1W2HA 2F6RA 2REXB 1ZD8A 3IPYA 2ZAMA 3LA6A 4D26A 4R7ZA 3Q72A 4LC1A 4G5QA 4UXJA 1RYHA 3KJIA 2J7PD 3VNUA 3RAPR 1FMLA 1G1MA 1R7RA 5JJLA 3QY0A 4TL6A 1WBDA 1RW4A 4JJKA 2JDID 4TWZA 5G3ZA 3IUYA 1MO3A 4EPRA 2BHRA 3O8CA 2VH5R 1JB1A 1E9DA 1T5LA 1G291 1PLLA 3THXB 4IW3B 4MRRA 5FBRB 1G3IA 2YC2C 3KQLA 2IS1A 1D9ZA 1RRCA 3C14C 4OK6A 1EK0A 1X86B 2W0MA 4TYYA 4PPFA 3A4MA 4ZKDA 2WJYA 3D8BA 3I8XA 1OF1A 1LS1A 4POAA 2IXFA 4Q48A 1YR6A 1ZBDA 4YC7A 1KMHA 5B57C 2ZJAA 3GJ8A 3LLUA 5KTYA 4Q1AA 1BYUA 3HR7A 5C18A 4QNMA 5CB8A 5L3RA 5A4JA 3GJ4A 4ZCIA 2O8CA 1AQUA 3BFXA 1NVVR 5JZVA 2B8WA 4TL9A 2YOHA 3OZXA 4PANA 1E9AA 5FOXA 5HKKA 2QP9X 1D5CA 5EQTA 4C7OA 1XD8A 3QQ5A 4W7SA 3S1AA 4DUGA 1VYTA 5CK4A 4YDHB 4Q4JA 4Z54A 1KO4A 2EU8A 3IEUA 5JWHA 2WTUA 1GTVA 2IYTA 3B60A 1TEXA 2OFXA 2VHUA 5DYGA 1II8A 2C78A 2RMKA 1Q21A 4WZAE 3IHLA 3CRMA 3U7GA 5K8IA 2OEPA 4LBZA 4JBYA 1XEWY 4QGAA 2ZRHA 2F9MA 2IYRA 3AF4A 3LNCA 3U3OA 1G6OA 4YMVA 4RZ3A 3R8FA 4C2TA 1JBKA 2QA5A 3EG5A 2ZJBA 4Q00A 2RGNC 3SJBA 2ZYUX 4W5HA 4JBWA 4Q4AA 3LW7A 4NMMA 4URUR 1KK2A 5LB2A 2JJ2A 5FUVA 4TLDA 5A0FA 2WVJA 3A58B 5AUPB 3AM1A 4A1FA 2GBLC 3GMTA 2IYSA 2W6IA 2DPXA 3FKQA 2BMEA 2HF8A 2MSCB 3ZS9A 2JJ2D 2ZSEA 2GBLA 2WKQA 4BLQA 4C0SA 4KJZA 4UXHA 2WAYA 4GFDA 2W6ID 3GQBA 2J45A 5SZKB 1FNNA 2V1UA 1H8EA 1JPNA 1P72A 1E79A 4RKEA 2NOAA 2XJ4A 4Q4HA 4BECA 1GRRA 1H8ED 4Q03A 3RRMA 4X8LA 1E79D 5JECA 3L8YA 4YMWA 3MJHA 3M4YA 1T4GA 1VECA 3ZZ0A 2QTHA 3T61A 2EFCB 4LV8B 3B1ZA 5LPNA 2WKRA 4Z1MA 3CRVA 2KBEA 4H9GA 3K0CC 1KI7A 2GA8A 1E69A 2WSSA 1EFUA 2CEAA 2IYWA 3SC3A 1LNZA 3AP1A 4ZCLA 3K0CA 1NJGA 1W7AA 4Z1MD 2HJVA 2GWHA 5HR5A 4MUBA 3G0HA 3TVDA 1TUEA 3SFZA 3QKUA 5HCNA 1YZTA 4NL4H 2H92A 2HCBA 2YOFA 3FDIA 1G5RA 1RC8A 2ZE5A 621PA 3R9WA 1TQ6A 3DL0A 1KAOA 1ZNYA 3KUDA 4IOKA 4MKFA 4WXPA 2CVHA 2A5GA 2JASA 2OESA 2ZRKA 4HYYA 3JVVA 1KDPA 2VF7A 4ZO4A 3B1XA 3ICEA 2VO1A 1G64A 2IYZA 2Z6VA 4URYR 4V0NA 2NO0A 2VQSA 1LY1A 2I1QA 2FMXA 3QBVA 2ZUDA 4HSEA 4DDVA 1HV8A 1GNQA 3ZDQA 1JAHA 4KAXA 3TW8B 1AQYA 3BS4A 4TMKA 3WHLA 1YR9A 3SJAA 2QORA 4LYJA 4XTCS 4HEJA 1CR1A 2CLCX 1OKKA 1DO0A 3ONWA 4KFSA 2LCFA 4CEJA 5HZKA 4EJSA 1N0UA 1ZJ6A 1ZNWA 2QN6A 1XEWX 3ZIAA 2QMEA 3MCAA 2C96A 4ACBA 2AD5A 4PX9A 1JI0A 1OKKD 3TH5A 3D3QA 2GILA 2HV8A 4XTRA 3SBDA 3RC3A 1RPZA 1U0LA 2EVWX 2IT1A 3ZIAD 5KOYA 3AVOA 2PEYA 3PEVA 5EE5B 5EXPA 2O8DB 1MT0A 4P3YA 4NU0A 2PX3A 3B1YA 5ANRB 5EXSA 3QBTA 4BZXA 4YMTA 2R6DA 4GP7A 4KITB 3VHXA 5CM9C 1IHUA 2GCPA 5HPYB 2ZI5A 1E2DA 3CNNA 1NMYA 1TF2A 1JQLB 4BQSA 4PHGA 4BLOA 2CJWA 1E2QA 3B82A 1FPMA 4A9AA 4B76A 2VA8A 3EC1A 4BEJA 4F91B 1G16A 4Q66C 5F3WB 2F55A 3SJCA 2EFDB 4HZUB 4TMWA 1T3HA 5KO2A 2ZR7A 1XF9A 2WBLC 1NG1A 1ZCBA 2VSXA 3MG9A 5ELXA 2JJ1A 1R0ZA 3HP1A 1E4VA 3TJZA 2QRZA 1GL6A 2Q9AA 2ZRLA 2I1VB 3CX8A 3U3JA 1U8ZA 2JJ1D 2FN4A 1NF3A 4N0DA 1UBFA 4B71A 3GLIA 2G83A 3NKVA 1CP2A 3DKVA 3LAWA 2J3EA 5C1BA 2RB4A 2ZQ5A 2GZDA 2CCJA 3LD9A 1SKYE 4LJ6A 1OH8A 1YZUA 4XH9B 1OPXA 2HT1A 2PCJA 1EX6A 3FWYA 4A6PA 2ZUCA 3AUYA 4TL7A 4GOKA 4PXAA 2E1RA 3W90A 1ZRHA 1XTKA 2FSHA 4M1TA 3VU9B 5JCZA 3K09C 2QRNA 5FUXA 4OYHA 4LDJA 1S1CA 3DDCA 1ZM4A 1E99A 4I1OA 5E7IA 4AYXA 4R2IA 3A36A 1VG1A 4PO9A 3FHTA 1M7GA 1KMHB 1U94A 2DHRA 4RZXA 1KSJA 1VCIA 2QZ4A 3GEEA 1OHHA 4B44A 2W83A 1J90A 1P4SA 3IBYA 3E1SA 1D9XA 3NH9A 4NYMR 3GJ3A 4QRHA 2BMJA 4YDSA 3UKDA 1J8MF 5FUYA 4HB4A 3ADBA 2VHCA 1KI6A 3A4LA 3B85A 1JALA 2OE2A 3LLMA 3MFYA 4LJAA 4NCKA 3KKPA 2ZRMA 3MD0A 3VAAA 4LJ7A 2HLDA 2DWQA 3CF2A 1ZM7A 2SHKA 3AF2A 4OI4A 3N2IA 4A8JA 2NZJA 4N0EA 4PC2A 1IN8A 1I2MA 2IXGA 1UDXA 4XD7A 5CDFA 1L4YA 2HLDD 3AGQA 3HU1A 1R8QA 3FVQA 4NH0A 1F48A 5DGXA 2XTNA 2ODEA 4MGIR 5L8VA 5EP3A 1Z47A 4GOJA 2PBRA 3P20A 1KI3A 1P73A 4D4JA 1FTNA 3ECCA 5DSZA 2ZS8A 1DELA 1FNMA 2WOJA 2GAOA 121PA 1LF5A 3VMFA 1Z0KA 3NTUA 3SOPA 4JVSB 2RCNA 1ZD1A 5L3QA 1KK0A 2JCSA 3TUZC 2W2TA 2DCUA 5AUQA 1JECA 1XTIA 2AKYA 3V4FA 2XZLA 1FMJA 4C0QC 1YZQA 5EJEA 3J81k 4AKIA 1IOZA 4L8GA 4NYIR 3ND9A 1WCV1 3OIUA 5FPTA 5EXTA 3W5IA 5FR1A 4H1VA 2YVUA 1K5GA 2AFHE 1DO2A 1E32A 2Z83A 2AXPA 1Z5ZA 4MH0R 1DAIA 1N5KA 5JI2E 3RS5A 4OQXA 1KZ7B 1ETUA 3SNHA 1KDTA 2FV8A 1E1QA 1UDWA 1XXHA 1H65A 2XAUA 3WMGA 1NY5A 1T3LA 4QJ3A 3A37A 4DLYA 3EX7C 1DAEA 2QQEA 3AQ4A 2Q21A 3SZRA 3EZ7A 1JJVA 1E1QD 3THOA 5G3YA 1CEEA 5SZJA 1VYVA 4CIDA 3RSLA 1ANKA 1XCMA 4J0QA 3L82B 3KQUA 1KY2A 2WWFA 4KFUA 3RS0A 3N2EA 1XMSA 1YQTA 3FYHA 1WE2A 2IYUA 3BFVA 5FI0B 5FL3A 3K9HA 3C5HA 1VPLA 1CR2A 1GZSA 3KL4A 2F3TA 1Z28A 1PUJA 5FTJA 1NLFA 4EPXA 4BZQA 3L8ZA 1K6MA 3CM0A 5TV2A 3EPLA 5CIQA 4NCIA 5E3HA 1AIPA 1AS2A 5HCIA 4WZBE 2QU8A 4NYJR 3WBKA 1MO5A 4WZ6A 3GJ7A 2CVFA 2FF7A 4K81B 4Q5IA 3PJRA 2XTZA 1UKYA 5FUWA 4C3ZA 1W48A 4A0RA 3GLGE 3HYTA 4DDUA 5F9HA 1EESA 4URWR 4G01B 4GDFA 3NBXX 1UADA 1BMFA 3U4QB 5BW8A 4KSBA 3EIHA 1UF9A 5FTLA 1CRPA 3EZFA 1ZYUA 2DYKA 2D7DA 4OI0A 1NLZA 3ZZUA 4DRZA 1A1VA 1BMFD 1E96A 3QXXA 4RD0A 4TYNA 3SQWA 1F2UA 2ZITA 2W0SA 5KDLA 3GLGA 5H70A 1HQCA 2OBNA 2REOA 2Q9CA 4AG6A 2QNRA 2R2AA 1Z29A 3T5DA 3X1YA 1ZVQA 5JCPA 4JYCA 1FL9A 1RRGA 2P0EA 1KNXA 1ZUHA 2FZ4A 4URVR 2WPDA 2EW1A 1DAGA 1GKIA 3EW9A 3DMNA 2YKGA 4A0FA 2H7VA 2O0KA 3THXA 1VHLA 3EZ9A 3GFPA 2V4ZA 3ASYA 2CXXA 5IHPA 3U7FB 2PT5A 2WPDD 3REFA 4XVUA 2FFBA 2J7KA 2N42A 4MYUA 2F43A 1ZCAA 4Q47A 3B78A 4PHTA 4RD3A 2D2FA 1YR7A 1Z3IX 2IS2A 2BCGY 2CL0X 4LYHA 4AK9A 2WWIA 3CNLA 3R7WA 1PZNA 1HT1E 1Z2CA 5M04A 5K8UA 4S35A 2ZE7A 4P4UA 1M7HA 1MOZA 2C99A 1TTTA 1OB2A 3A1WA 4JVNA 5GADl 2G88A 3B1WA 2GZAA 3UMRA 2V1XA 1A2BA 5JLJA 2IK8A 2PMDA 3W3ZB 5JWRA 4DSNA 1R6BX 2ZRIA 3K9NA 2FSFA 1SXJE 3UATA 1ZNZA 1TAGA 1UKVY 4O3MA 4Q21A 3OESA 5TB5A 2ZRPA 1N6HA 4CZ2A 3TUJC 1Q3TA 5GJVC 2DB3A 2FZLA 2HDNB 5F2EA 2QG6A 2YWFA 3QXSA 4W9MC 3O8DA 4K46A 3GEHA 1SXJC 2A5JA 3O8BA 3QF4A 3Q5EA 3NVAA 1IY1A 4IVQA 3NBFA 3QI2A 2ERXA 2ZI6A 1N6KA 3VR5A 4BFTA 3OE7A 2YINC 1E2MA 3KKOA 1SKYB 1VDZA 4TTPA 4DSTA 2WZQA 5CYOA 3OE7D 4JVLA 5FFMA 4D4MA 5BN4A 1Q22A 3CPJB 1O3YA 4D25A 4QM7A 3K1JA 3Q7QA 4DIDA 3SFVA 2R8RA 3THWB 1X1RA 1W4BA 3RABA 2ANBA 1YE8A 3B2EA 5H1YA 5J4HA 1S9HA 1FTSA 5KSPA 3O47A 3FE2A 4HAXA 4HLQB 2FU5C 3T15A 5CB6A 3TLXA 1JPJA 2PH1A 2XSZA 2ZSDA 4UJ3A 1G8PA 4B48A 3LXRA 5FOVA 4DKXA 1ZNXA 1H8HA 5K8TA 5EXXA 2A5YB 2XSZD 1NIJA 4Q01A 3TR5A 3I8SA 3QENA 5EP4A 4ARZA 2CHQA 4X8HA 4PHHA 2FG5A 1H8HD 3EIQA 3HPRA 4M22A 1Q57A 1ZD9A 4B2PA 2FWRA 2G1JA 3AUXA 2REBA 4FCWA 1G5TA 2ZUBA 3Q9LA 1DEKA 5IRCD 1EWRA 1SGWA 2Q0HA 3NHAA 5TXGA 1XBTA 4F93B 4PO1A 4WXRA 5LD2C 4I1SA 2BMFA 5L3QB 1IN5A 1T91A 5EZ5A 4DXAA 3SHFA 5DE3A 2ODNA 1G7SA 1YZKA 1X8KA 1IJEA 4GMXA 3V9PA 1US8A 4TMVA 5TVKA 3X1XA 4D4KA 1G7RA 4A15A 1X1SA 1G18A 3TSZA 3AVUA 1XTRA 3W6NA 1N5LA 1V43A 1NRJB 4NKRA 5JWOA 3DKPA 4FMDB 1P60A 3B8HA 5TDHA 3MRSA 2ZAOA 4V02A 1MH1A 3A1UA 4LHZA 1OXSC 4RZ2A 3UIEA 1GL7A 1VG9B 3QNUA 4LV6A 1TQDA 3SN6A 5IT5A 4A36A 2C77A 2O5VA 2ZSBA 2IYQA 2NTYC 3FKSD 4IXMA 2GJ8A 3OEEA 1E2KA 3BB3A 4A6XA 5DNYB 3ZZTA 1R5NA 3FHCB 2GETA 2H18A 2RGDA 3RS4A 1LFDB 2J0SA 2XNDD 2VHJA 1GVNB 3R20A 5FOWA 3CW2A 2VPPA 1X8JA 5IK2A 4DEYA 4LHWA 4DLRA 1O87A 2WV9A 4QL3A 5L3SB 2WICA 5DO9A 1Z22A 2G3YA 5KNDA 5IK2D 1TMKA 1UKZA 1AS3A 1ZU5A 2A7QA 3PUVA 5GJBA 3AEZA 1IY2A 4LC0A 3PXGA 2ZETA 1TUIA 5DHAA 1XPOA 4LHYA 2VBCA 4Q7LA 2X19A 4UJ5A 1NN5A 2DWPA 1LW7A 1II0A 1Z2AA 1JR3E 1XPUA 1P2VA 3CB4A 1XTJA 3SS8A 2CNWA 3KJHA 5DI3B 3EA0A 4BLPA 3QKRB 1BS1A 2D74A 4BLSA 1YZNA 1II9A 3CF0A 1JR6A 4HZUA 4PFSA 2ATVA 2ZREA 4FMCB 2NQ2C 4UNSA 4LPKA 2CNWD 2ZI4A 2L0XA 5KSOA 3QPWA 3BD9A 4B3DA 1BYIA 2ZJ8A 3L2OB 4Q9JA 1CJTC 1FQKA 3GLFE 4DEXA 2GZHA 1WA5A 5JS8A 3GLGB 1KI4A 2DFLA 2GHIA 2GKSA 4M9SA 3AF3A 2RH5A 2GRJA 2QMOA 1U0HC 3TRFA 5AUOB 4BFSA 2IUTA 1U0JA 2NO6A 4KLZA 5AR1A 2ZU6A 5CLLA 5H8WA 3B5JA 4ACAA 4E5UA 2A78A 1XEFA 2ZRAA 1E94E 3C4JA 3CNOA 3GLFA 4M0LA 3D31A 4ZPXA 1KI8A 1W5TA 3VU9A 3G82C 1QHXA 2ZVQX 2F43B 2JJ8A 1QG2A 1F3OA 3ZD7A 3SDZA 2O0HA 3THYB 3GJ5A 1TU4A 1UEIA 4TLBA 3U44A 3SQXA 4F4IA 1QDEA 1E2NA 4WOPA 5FTMA 2EWVA 3W8RA 4DCTA 5JBQA 4XOIA 2ZM5A 3KTAB 4MGKR 2J1LA 3EWAA 4Q4LA 4WW0A 4ILEA 3R7WB 3H4MA 4G0NA 1W36C 3SE0A 3V00A 2BBTA 1E2HA 1KKLA 4BUJA 4II7A 3L0SA 4UQOA 2BKEA 3DM5A 3AB3A 5FPSA 2JATA 2I3BA 2OV2A 3SBEA 4EDHA 1B23P 3RRYA 1AJEA 2EFGA 4AYTA 1S9DA 1T0HB 2ONJA 1GRNA 1SVMA 3W34A 4UNQA 5G40A 1TX4B 4OI2A 2XB2A 4B3GA 2W2XA 4FCTA 2P3SA 4MGZR 3RSOA 4IOMA 4OQLA 3ASZA 5HKKD 1E9RA 2IYXA 4D0LB 1KSHA 1JQJC 4DUGD 1CULC 1XMVA 4A0HA 4DSUA 3LWNA 3Q8XB 1QHIA 4BE7B 3QF4B 2XJ9A 2WWYA 4YXWA 1MR3F 1SXJB 3I61A 4GSYA 1Z0AA 1Q3HA 2B7BA 1E2LA 4YXWD 3TQCA 1A82A 4JVMA 2RAPA 2B21A 4HATA 5FPHA 2RGNA 4DB2A 1S0UA 3CWQA 3SU8A 3TW4A 1FZQA 1KYIA 2GNOA 3CH5A 3K9LA 4JZKA 5BXQC 3RLFA 3TKLA 2QAGC 3DOEA 5H68A 2CHGA 3NIBA 4V0LA 4P31A 2MSDB 2ODBA 2QAGA 4G5SA 4M53A 4JSTA 3QF7A 3CKLA 4N3NA 2G1KA 4LV5B 1E9BA 1W5SA 3R9XA 1Z0JA 3NG1A 3NXSA 4LYAA 4IJMA 3MGCA 2G9NA 4TLCA 4DZZA 4TYWA 1L8QA 2NO7A 4R98A 3IHWA 2B6HA 4O0MA 1HQYE 4HAVA 2ZRCA 3H84A 1AA9A 3E2IA 4ARZB 3KXKA 4BFUA 3BIFA 5FL7A 5EE3A 1OXXK 1ZC4A 2BJVA 4LBWA 3U60B 5JS7A 3L0PA 2R6FA 4JYBA 3PCRB 1Z6YA 4Z8YA 2Y8EA 4TYQA 1TEVA 3KKNA 4M9QA 4OJQA 4X8OA 3UG7A 3C8UA 3VR1A 1Z6TA 3DZ8A 4B6EA 1ZM9A 3T12A 3GPLA 2GCNA 2RGXA 3KB1A 2WSSD 3FHOA 3KX2A 4AIIA 4TL8A 4G5OA 3MAAC 4RD2A 3K70C 1US8B 1OJLA 2N46A 2VLIA 1EFCA 4MITA 4Q18A 3T34A 3TIFA 1DPFA 4EPWA 1NBME 1RZ3A 3ND8A 4MDEA 2ONKA 1BOFA 4M1SA 3QKSB 5DHFA 2JLXA 4DLUA 1OYYA 2VHTA 3QXJA 4NZYA 3CRQA 3LW8A 1GM5A 2JLUA 2FSGA 3K70D 1CBUA 1VKJA 2V6IA 4PR0A 2EYQA 2P6UA 3MLEA 1AGPA 1SVOA 3QE0A 1L4UA 2G77B 3TQFA 3U4QA 2WHXA 4M1OA 3P4YA 1NBMA 2XZPA 3C16C 4TTQA 1G41A 2C98A 1DBSA 1R0XA 4FWIB 4TQUS 1U8AA 3G5UA 2R44A 3DVLA 1XTQA 4XIGS 4LWZA 1NKSA 2QP3A 1NN1A 2QY9A 1AZTA 4JMPA 4PHFA 3SYLA 4D81A 5EE9A 3PENA 1JEEA 2OCAA 4URZR 4C9BA 1OXUA 4D0GA 1E0JA 2FE4A 2I4IA 2IYYA 4RY2A 4YLGA 1GIAA 1ZU4A 1KO1A 1Y63A 3EC2A 1CXZA 3I5XA 1T0JB 2ZR0A 1OIWA 3ZVNA 3NWJA 3VX3A 2QTFA 3KUCA 3A1TA 1E6CA 1PVOA 2CK3A 2IEZA 2DFNA 1GILA 1S1MA 4F4JA 2O8EB 1N6NA 2YOGA 4IOJA 4XVRA 3BB4A 1E2EA 2OCPA 5E95A 2NMVA 4OK3A 3LXXA 2QPAA 721PA 1DS6A 4JLKA 1S4QA 2JLVA 2XZOA 5JRJA 3U6BA 2QQ0A 5EP1A 2O8FB 1A7JA 1M7BA 2J0UA 2VP2A 4EQ6B 4LGMA 4TQAA 2HT6A 2H57A 3BRWD 1R4AA 1G7TA 2QAJA 1TNDA 1NG9A 4NE2A 1AGRA 3HU3A 2ORVA 4MRVA 4PC3A 5C4GB 3REGA 4QNRA 1FUKA 4OI1A 5HZHA 2FGKA 5JHHB 5KSZA 3MSXA 2PJZA 3WP0A 2JEOA 2ZRJA 4GI7A 2AN9A 3TGPA 3QIAA 2ZEJA 3K53A 4NPHA 4Q9IA 1G4AE 4LY6A 1ZUNB 5FTKA 1YR8A 4B2IA 4IEIA 4QHTA 4E03A 4WAUA 3GLFB 3JVUA 2BOVA 3KXLA 2WJVA 4AC9A 3TSOA 4B43A 4TN1A 3PVSA 1Q20A 1HEIA 2A9KA 2GXUA 2IWHA 3K09A 5GVRA 5KYKA 4M1KA 3U44B 1QBKC 2OG2A 1FP6A 1FX0B 3KB2A 1KO8A 3AGPA 4L16A 2X2EA 4KBFA 3RS2A 3OAAA 4JIMA 5JMTA 3NBYC 3LDAA 3T1QA 3UPUA 2RGAA 2ZS9A 3GCGA 4F38A 5SZIA 1G8HA 1R2QA 2B7CA 5C46F 3ADCA 3THWA 3W6PA 1E3MA 4IDPA 3I5YA 2PT7A 4G5GA 3OAAD 4D0NA 2Q3HA 1W36B 3GJ6A 2UZIR 3RYTC 5FBVB 5GJCA 4RZUA 1OHHD 1UBCA 5KDOA 1OIVA 2FPMA 2OSBA 1JJ7A 2AKAB 4KI0A 3TK1A 1LTQA 4XVQA 821PA 1S3SA 4B33A 1WMSA 2WMNB 4F4CA 5DISB 4HB3A 4DC9A 5CK5A 1LS6A 2QENA 3CLVA 3PUYA 3VHLB 5JJKA 1T3SA 3A8TA 1FP7A 3NH6A 3ZVLA 4DB4A 3TBKA 3P27A 1W2GA 4M9XA 4E22A 1CJVC 1E9EA 2P67A 1A2KC 2OHFA 3FB4A 2KSQA 3H2YA 4XD7D 3MWJA 4IHQA 3IPXA 2OAP1 1KK1A 4JKIA 4HAYA 4BFXA 4MA4A 4HLUC 4M9ZA 4QC2A 3TR0A 5DI9A 3CZPA 3KFVA 4FXPA 3FPAA 4HLUA 4CW7A 2D62A 2H16A 4ERNA 1KSFX 3H0KA 2R9VA 4P32A 1CF4A 2ZS7A 4Q7JB 4A4DA 2B8TA 1SVLA 1EG7A 1R10A 1XDBA 2C5LA 5J4KA 1TQ4A 4OKSA 1W0KA 1C1YA 4MDFA 4CEIA 4JLAA 2ZU0C 2QAGB 2DFTA 1VCMA 4ITRC 5FBLB 1UJ2A 3QKTA 4A2WA 2GK6A 1QHHA 3KJEA 1RE0A 4Q9LA 1W0KD 1W46A 1HE1C 3BB1A 1NSFA 4I4LA 1KJWA 2AWOA 1G19A 1E2PA 5FOTA 3IILA 1RJ9A 3WMEA 4B35A 2IEYA 3NEJA 2AXNA 2IHBA 2J5XA 2JIZA 3GLHE 4GRAA 4NCHA 4PSKA 4GOXA 1KSGA 2AD1A 5JJIA 3U2QA 4G3XA 4S2EA 3AP3A 4KFRA 1KTVA 2PZFA 2NO1A 4KV9A 5J4LA 2ZYTX 2OBLA 2WJIA 2JIZD 1GKUB 4HUTA 1KI1A 2GEVA 2YWGA 2ZTSA 4R71A 4Q1DA 5KHOC 5BWMA 2BMDA 3I92A 4OQNA 3HYRA 2QBYB 1I2DA 1GNRA 1KZGB 2QUZA 4AG5A 1UPTA 3RHFA 4JLDA 2CCKA 4LHXA 3QG1A 3TAHA 3CZQA 5L3SA 1BIFA 2FNAA 1U81A 4V0ME 2QGNA 3KKMA 1E2JA 1ZM3A 4OQFA 4PAOA 1C9KA 1RRFA 1SQ5A 3OEHA 3Q3JB 3IIJA 2PL3A 1E2IA 2IL1A 4AKHA 2ZJZA 1SVWA 1Z6GA 4RD6A 2GAAA 3B9QA 3K70B 2ZE6A 3M6AA 3TUIC 1M74A 3OEHD 3PQCA 3QXHA 5TY0A 2WOOA 2KJQA 1Q1BA 3QVUA 1S96A 4CEHB 2X77A 2PLRA 2C8VA 2BBSA 2GVZC 2HYDA 3K0FA 5KPJA 2ZRDA 3EZ2A 4PTLA 3IDQA 3K9GA 5DI3A 2RGCA 4JL5A 3LVQE 1UAAA 1ODFA 3QKRA 1MABB 4XSHA 2ZJYA 3UANA 3BWDD 2EFHB 2KB0A 8OHMA 2DFKB 3LRPA 2ZI3A 1NKTA 1G8YA 4NCJA 2WSMA 1YJ5A 6Q21A 4DCSA 4LZZA 1NL3A 5DN6A 4DLZA 2WWGA 2OZEA 4RSGA 1HYQA 2J41A 1DG3A 4V0OA 3FGNA 1XCPA 3T1VA 1P61B 2XOKA 2Z4RA 4Q02A 5DN6D 1I4LD 1KAGA 3KJGA 4R9UC 1TQ2A 4OHWA 4US2R 1IM2A 3D6TB 1VG8A 2XOKD 1SHZA 2YYZA 4RFVA 3VX4A 3M0EA 5AJZA 4U02A 1KJYA 2RGBA 5EP2A 4IDHA 1P5ZB 3EXAA 4IDNA 2F3RA 3FMIA 3THYA 4Q7MB 3FMOB 1W1WA 4QBGB 2FA9A 4IRUB 3U3MA 2IW3A 2RHDA 4E09A 4IDOA 1F5NA 4JLVA 1YRBA 2KBFA 4BEBA 3KTAA 4KU4A 4LJ8A 3B9PA 4OJKA 4UNNA 4DCUA 1W47A 4LJ5A 1E4YA 2YWEA 2ZPTX 2ZANA 3PUWA 4G1UC 2D06A 4HLDA 2J0UB 4UNPA 2XB4A 1ESMA 3ZVMA 2R6GA 1XZQA 2C9YA 3CPEA 1QHSA 3H1TA 4P4SB 3O8RA 2WWWA 1SKQA 4B34A 4HB2A 4G5RA 1XB2A 2GCOA 4DLXA 1MO4A 2WWXA 4UXIA 5F98A 4EPTA 1MKYA 3RANA 4C0JA 2AHOA 4M1YA 4AWXA 4FIDA 1W4AA 4QGFA 2PJRA 2ANCA 2GJAA 2AWNA 4FMDF 1SXJA 4US1R 2YC4C 3L43A 2QGZA 4JL8A 4NCNA 4B3FX 3WRXC 4JT2A 5KU1A 5FPYA 1SXJD 4Q1FA 1ZMXA 3Q5DA 4UNRA 2UKDA 2BKUA 2QT1A 4C0KA 1XMIA 2NPIA 4TLAA 4QBFA 1ZC3A 1S3GA 2QE7A 5J5CA 3N5CA 1YZLA 1CIPA 1YHNA 4ZIRA 3FOZA 1Q12A 3IQXA 4TQ9A 1VMAA 2QE7D 5BYJA 5JRZA 3EPHA 3VKWA 4OHZA 1J70A 4ESHA 3NDBB 3VKHA 1OIXA 2VSFA 3TNFA 4GZLA 4BLRA 4B75A 1P75A 1YZGA 1Z08A 2VP0A 4Z8XA 3W9YA 1IN4A 3DMDA 3FFBA 1UKEA 3C5CA 4V03A 3T1OA 3UXMA 4A92A 1G20E 3QVVA 5BN3A 5GVSA 2QM8A 2BJWA 2GESA 1OH5A 2X2FA 2ZR9A 1PLJA 2ECKA 4XJXA 4MQBA 1K8RA 4TTRA 4BLTA 3SYNA 2RGEA 4JL6A 1AM4D 1J2JA 1FFHA 1P9NA 5J47A 2GXQA 1R0WA 2RHMA 4PAQA 2XXAA 1OSNA 2QSZA 3F3YA 4A2QA 4FMCF 1Q0UA 4M21A 5B30A 4LK2A 2B92A 1JEDA 2Q6TA 2YZ2A 2GXSA 1DG1G 2D2EA 3ZLJA 4CEIB 4ZI3A 3I32A 1OH6A 1D6JA 4F92B 2GEUA 1NVUQ 3QKSA 1QHHB 2PEZA 4HAWA 4KBGA 1W0JA 4RFSB 1Q1ZA 4LJ4A 3ZGXA 1RJ9B 1XP8A 4FI3C 4PSAA 3GP8A 4ZKEA 3UK6A 1ESNA 1W0JD 3JZMA 4LBVA 2FEMA 1U9IC 3EAQA 3LQQA 4QGGA 2Q3MA 4ABYA 3MWYW 1CTQA 4KSCA 2IS4A 2IF2A 2ASEA 1DTSA 1U9IA 1Z83A 2OBMA 3P26A 4DIEA 2HXSA 1GUAA 3OEED 2H8KA 4ON9A 2FH5B 4D82A 1EFRA 3EASA 4O25A 1R5OA 1WBBA 5JFGA 3LV8A 3M1IA 3CF6R 4AI6A 1F60A 3W5JA 2JLSA 1IY0A 1W49A 3A4NA 3W6OA 4D2IA 3OFNA 1XEXB 3PUZA 3PEWA 1CKEA 5D3MA 3BERA 3I1FA 1YU9A 1KHTA 1XU4A 4QXAA 2QROA 4RD4A 3HU2A 1KO5A 1W4CA 4DCNA 1NY6A 5B58C 3OFND 3CUEF 5G53C 2GJ9A 3LH5A 4LYFA 2O0JA 1T5IA 4JLNA 4PSVA 5CJPA 4GT1A 3X2SA 1DAHA 1FUUA 3T35A 1C4OA 4JLJA 5E4FA 1VG0B 1VCNA 3UWKA 1SZPA 1NJFA 1HE8B 2CL6X 4KYUA 2VF8A 2BCJQ 3K0FB 3MUFA 2X8AA 1M8PA 4LBYA 3BC1A 1FOEB 2OXCA 3RRNA 2O8EA 3AF0A 1QVAA 4PAMA 4Q7KA 3DO6A 4TYPA 2G0NA 4PZZA 2IYLD 3WXMA 5LDDC 2AFIE 3VR2A 1KJZA 1DAFA 1G21E 2R6CA 3L0OA 3PITA 2O8FA 2XX3A 2ZRFA 3K0EA 2ZI7A 2VP5A 1JR3A 3JZAA 3TE6A 1DAMA 1JXOA 2LKCA 4RD1A 4E07A 1D2EA 4OBEA 4EQ6A 2FOLA 1G8GA 3GJ0A 1QHNA 1JR3D 4URXR 4C0HA 1ZM2A 4Y0VA 2ZROA 4KYIB 2IHYA 4MRPA 2Z43A 1IONA 3SEAA 4QM6A 2ZSFA 5FBQB 3F5FA 5KUTA 4MGYR 2FFQA 4LSGA 2AK3A 5J4YA 3BH0A 1CJUC 3RRZA 1WRBA 5KNCA 4UKDA 2XNSA 4BASA 1KY3A 1U8YA 1M2OB 4B74A 2KWIA 1Q1QA 4WVFA 3I72A 2VTKA 3RDPA 2JDIA 4CYMA 1FX0A 3PEUA 1P2TA 3SHWA 1YRAA 2PZGA 1W44A 1OT3A 4N1AA 5AJWA 5DLQC 5CLQA 3CRRA 3OIWA 3UWOA 3EA5A 4JLBA 1VYUA 4BWYA 3ETLA 4EIWA 3B7GA 2IUSA 1E2GA 4B6FA 1RRPA 2ZRBA 2O8BB 1QRAA 1N6OA 2FPKA 2J46A 4XWOA 4YMSA 1W36D 1W4RA 3CH4B 2BVNA 2JLQA 2J0QA 4JSYA 3KQKA 1P2UA 3KQHA 2P2LA 2BBOA 4MKHA 521PA 2E87A 3KDSE 2O52A 4W5JA 4B3CA 4LJYA 2GCOB 5JI3E 4LCBA 2OM2A 1E9CA 2V55B 2W58A 3WYGA 4QHYA 1GWNA 4BFVA 4PQYA 3PEYA 3ZS8A 1SVSA 1E1RA 2D4HA 2NGRA 3AKDA 4NTZA 2GVDC 2GTPA 3QUSA 4PZYA 1XJQA 4JBXA 2CE7A 2RGGA 1DADA 4IEEA 3SR0A 4YONB 1LV7A 1E1RD 1EFHA 3BGWA 2GJKA 3HPQA 4KODA 1NLYA 3AVPA 1NVWQ 1CJMA 4GMDA 5HE9A 5HTKA 3PIRA 5CM8B 2CMKA 2BDTA 4M4SA 2NPFA 2FDCA 3LBIA 2QPOA 4RCYA 2YJTD 2G6BA 4QGHA 2VL7A 1VCOA 2JAQA 1N6RA 4ZIRB 2PLFA 2VYFA 3B1VA 1E0KA 1RKBA 1KI9A 3OIVA 5JEDA 1AK2A 3U3KA 3NC1C 4GNKA 2CE2X 5TMPA 5CIWA 3CONA 3MJRA 5FPKA 1JXMA 2OFWA 2BC9A 2Q3FA 2FEOA 2P5TB 4MUAA 1U98A 1Y3AA 4AYWA 2NG1A 3DZDA 221PA 3HR8A 1IXZA 3ADDA 3BAFA 4TLEA 5JSZA 1SVIA 2ORIA 3HWSA 4BRUA 1TU3A 1A4RA 3VNVA 1GITA 1U2RA 4QG7A 5FL7D 1XZPA 2BM1A 3PG5A 4TSFA 2QBYA 2HYIC 4EFMA 1G7CA 1D2MA 1ZINA 3WP1B 2HF9A 3E70C 1JAIA 4Z51A 5AWFC 2QPTA 2XXAB 2IS6A 5JHGB 4R2HA 4ESVA 4TSFD 3IEVA 2WMOB 1R5BA 5LD2B 2XEXA 3ICQB 2OT3B 1G3QA 3LY5A 4DT1A 5AUNB 3T5GA 3DHWC 4I1UA 4RCZA 1Z6XA 1G3MA 3UMSA 1NMXA 3VR3A 2FX3A 4MYCA 3ZQ6A 4CEHA 1L2TA 5FOSA 1TF5A 2VSOA 1PUIA 1OE0A 2OCBA 4DLSA 1CJKC 1NSTA 3P1JA 3T06B 5FR2A 4ZDJA 1CRQA 1MABA 3IO5A 3VQTA 4AKEA 4B47A 3IIKA 3LVRE 2OCYC 4A0GA 3IQWA 1NNEA 4K8OA 3I73A 2W6JA 2HUPA 2ZJ2A 4BGDA 2EQBA 4HUQB 3K0AA 5B2ZA 3AKCA 1ELOA 2JLWA 1NBMD 5KDDA 2C95A 2W6JD 2FPLA 4PC7A 2ZYVX 2X1VA 1AS0A 3AP2A 4LHVA 3BK7A 5EZ6B 2H5EA 1E9SA 3ZYCA 3QEJA 5D3MB 3X1ZA 3NDPA 4JLPA 2Z5FA 4CT4B 3AV0B 4I1VA 1IBRA 3A1SA 2QL6A 4IXNA 3LBHA 4ZDIA 2F1RA 1XMJA 3VKGA 4H1UA 3B13B 5FH9A 2RKOA 4B3BA 3WNBA 1OH7A 4BFYA 4EJSC 1P6XA 4C0LA 4DHEA 5BN5A 1T9HA 3TMKA 1GRQA 1AKYA 1PJRA 1E9FA 1YKSA 4C4PA 2OLJA 1X6VA 1N0VC 5AJYA 3MMPA 4FD2A 5BYKA 4M1MA 1SHKA 4ASUA 4ZDKA 4M1WA 2IUUA 2PX0A 3TSWA 2CK3D 3IIMA 2P6NA 1XD2A 4Q19A 3CIOA 5EE1A 3EPJA 4PQFA 1J7KA 4ASUD 1TADA 2KE5A 2PCLA 2PZEA 3A6PC 1SULA 1G8FA 2A30A 1M34E 1R0YA 1CU1A 1KDRA 3AVVA 2FFAA 3IKJA 1CLUA 3PFIA 1KI2A 4FINA 4JJZA 2ATXA 4V0KA 5KPDA 1NVXQ 4PPGA 4P4SA 1P62B 2QMUA 5EE0A 4HAZA 3BXZA 1OYWA 3GLIE 3ZJYA 4DDTA 3GJXC 4MKIA 3PV0A 1WDTA 4FCVA 3DPUA 2C2HA 3VTKA 2D7CA 1XD9A 4YMUA 4L5BA 2JA1A 2GK7A 3RWMB 2A3RA 3RVBA 2AX4A 4FMBB 3RC8A 2G0TA 1IN7A 3CR7A 3VFDA 1MO6A 2BEJA 1F6BA 1TF7A 4U00A 2YNMA 4A2PA 5IDVA 5A5GA 4YQFA 3OF5A 4D6PA 4LPSA 1J99A 3QEOA 4BFZA 3HDTA 1Z8FA 4HLCA 4NDZA 2A5FA 2WJHA 4IOLA 4DCVA 2WIBA 1I4DD 3N70A 1QHGA 2OUKA 2H1LA 3ZH9B 1MV5A 2EWWA 1DOAA 2E9SA 1I4TD 2VRWA 4JS0A 4B73A 1OXTA 2ORWA 3ADKA 421PA 3OIYA 4DLVA 1N3BA 3FMFA 4QFMA 5DH9A 4HDOB 1DVRA 2Z4SA 3K0SA 2YWHA 2MSEB 1S2MA 1G9XA 3KZ1E 4JKYA 3BOSA 1AN0A 2BEKA 5FOUA 3BH6A 1RYFA 4P33A 3Q7PA 1D8TA 4L15A 2EYUA 3W3AA 4MRNA 5CDFE 3VR6A 3UMFA 2DY1A 5TARA 4PPQA 1NVVQ 1PV4A 2O8CB 4Q9KA 2OAQ1 2VP4A 2CLSA 4P4TA 1UEJA 4A8JC 3I3SR 4GP6A 1DAKA 4RKFA 4C7OB 3BBPA 1EFTA 1P2SA 1E98A 3S1AB 1TPZA 4Q4JB 1Z07A 2EFEB 1G3UA 4PQRA 3BH7A 1LF0A 3BJIC 1II8B 3X1DA 2DWOA 4KVGA 4WA7A 3P4XA 5BQ5A 1SVKA 3AH8A 4TMTA 5J4VA 5DIFA 1EWQA 3P32A 2ZJOA 4O2RA 3PR1A 2DR3A 4XSGA 2R6AA 3U3RA 2LKDA 1VTKA 1F2TA 3T1TA 2LWIA 1GNPA 2MMGA 3WNDA 1BO6A 1QF9A 4CVNA 4CF7A 4RFSA 4MKGA 1DARA 4Q4AB 4OHVA 4L9SA 1EX7A 1ONBA 3AVQA 4PC6A 1WP9A 2AR7A 1Z06A 3EPKA 2H17A 3CX6A 2JGNA 1KDOA 3IO3A 3KKQA 4JLOA 4MRSA 2UVQA 4WBSA 5D3QA 3WY9A 4EUNA 4Q1EA 2HXYA 1P9RA 3DOFA 5SZHB 3QG5A 1XXHE 5JSZB 1G6HA 2NO9A 2Q9BA 1N5JA 3QXCA 3WNCA 5F9FA 4CT5A 1V5WA 4Q1CA 1N6IA 1P7CA 1BKDR 1IXSB 1IJFA 2C04A 4FW9A 4LI0A 3QPUA 3F0TA 2IWRA 2R62A 3DM9B 5AK0A 2BBWA 3GLHA 2ZSAA 4M2LA 1Q44A 1XEXA 3FTQA 4Q4HB 4QKQA 4EPYA 4RVCA 2ZXUA 4X8MA 2NIPA 1OB5A 1GL9B 4QJ4A 4A82A 1XRJA 2IXEA 2UZ3A 1HUQA 3GD7A 4I81A 4LUCA 4DT1B 1AKEA 3U7EB 1KNQA 2MMCA 3WYFA 4CRWB 4TMXA 2FFHA 1IQPA 1RIFA 4DLTA 4EKDA 1GAJA 1ZW6A 2WAXA 2XITA 2JLZA 2FJUA 1EGAA 2BWJA 1XX6A 2QEQA 1FQJA 4V0MA 2IA5A 1N25A 4DVGA 1ZIOA 5E7MA 2F9LA 1QHYA 4KLNA 1CR0A 3NHBA 2F1JA 2BM0A 2C03A 4AKGA 3EIEA 1K5DA 3WBJA 4MYHA 3CPHA 4BZPA 2A2ZA 5CITA 3K0AB 4QHSA 4ZCMA 1P3JA 4F7WA 2V3CC 2BIFA 3QJYA 5C2JB 4M8NE 1GKYA 1U99A 1Z6AA 2ZVPX 1KGDA 3TVTA 3CRW1 1VIAA 3X1WA 1CR4A 2QSYA 3CR8A 1T8UA 4JLMA 4L4UA 4KHZA 3SJZA 5AJXA 2HCJB 1XJCA 3U5ZB 2HJGA 4Q9HA 3WYAA 4BPBA 3I62A 4KO8A 4NBSA 3C15C 5FI1B 1RFLA 4OHYA 2AL7A 1GFIA 2CL7X 4XWKA 2GDJA 4PZLA 2P65A 2WJGA 2VIIA 1KO7A 5EUMA 3WMFA 1VHTA 4CEJB 4EJSB 4KFTA 1GG2A 2F7SA 2PMKA 3I4LA 3RS3A 1G3RA 1HY3A 1NN0A 2BV3A 2P6RA 3MWKA 3OHMA 1Z63A 4GZMA 5P21A 2OLKA 4US0R 1Z0FA 4HDQB 3R9IA 3WRYC 1COWA 5EUQB 1XD2B 2WM9B 1Z0DA 4DJTA 2ZYWX 1QZXA 1S8FA 4EFNA 3U7HB 3CBQA 3MWLA 1COWD 4LRWA 3B6EA 1G5PA 5C4MA 4DLWA 2O8BA 5B64A 3BE4A 3KQNA 2VHQA 3KXIA 3BORA 3R8CA 2YHSA 2JLRA 2OILA 1Q1EA 1J8YF 3IGFA 1Z0IA 3RNLA 2CJWB 2ZI9A 1OFHA 2ODWA 2TMKA 3BFKA 4QOSA 2J0VA 4AURA 1NMZA 1M1YE 1AZSC 3AF1A 2Z0MA 4OHXA 4O2LA 1KK3A 1IXRC 1L7VC 2V9PA 3FMPB 1QVRA 4GPTA 4FWTA 4EAQA 3RWOA 1E2FA 2P5SA 3A1VA 3E5HA 5G41A 2IX3A 4GL2A 1OFIA 4PO8A 3GLIB 3LX5A 1GOTA 3HJNA 3K8YA 2ZRNA 2VP9A 2CHVA 4FN5A 5FBWB 4D80A 4TZ6A 1XWIA 1PLKA 3EZ6A 2OXRA 1KIMA 1ZP6A 5FTNA 1XTSA 2V54A 3AKEA 3NEYA 1X3SA 4WIAA 4QBHA 4KVAA 1IAQA 2FSIA 2IF0A 4TZ0A 1XNJA 3GEIA 1A5TA 2CLDX 3F8TA 4TT3A 4CDGA 1EXMA 1UBGA 3NC0C 4DWJA 4L9WA 1P9WA 4IVPA 4W5WA 3RS7A 4LJ9A 4DBLC 4DDWA 4ZV4A 4OK5A 1LVGA 1N6LA 1NP6A 4U5XA 5HE8A 4TMZA 3ZD6A 4TT3D 4MYTA 4IFBA 1NIPA 3C7KA 5LB4A 1GDDA 4C0BA 2CBZA 1XCGB 5LBIA 4NYMQ 4AD8A 1G4UR 3AVTA 2CDNA 1HA3A 1OXVA 5E7JA 2ERYA 1N2CE 2K5UA 1LB1B 2QTVB 1KI6B 3V4RA 2HEIA 4BRWA 4LX0A 1BH2A 3U6KA 1WXQA 3QPVA 1KKMA 5IF9A 4A8JB 2ZE8A 5AJVB 3U61B 3ZVRA 1RVDA 2D3WA 4AY2A 2OFOA 2W00A 2WWHA 1WB9A 3CX7A 2CCGA 1JNYA 5L3VA 2QM7A 4HDCA 1FW6A 3LX8A 3EARA 3VR4A 3LFUA 2J87A 1WF3A 2C9OA 1TL7C 3H86A 3SYKA 2V8OA 4B2LA 3DEFA 4NHOA 1HH4A 1MRSA 5CJ2A 4C2UA 4OQMA 1F2TB 5CYPA 1D2NA 1VIYA 5DYIA 2WIAA 1NI3A 5KNBA 2F1HA 1NN3A 2IYVA 1OV4A 4BFWA 1E0AA 1XJ0A 4IDQA 4HAUA 4HZIA 4HB0A 3EWSA 4NP6A 2GXAA 4KCGA 2GF0A 2QI9C 3C41J 3FFAA 5K8LA 4HUQA 4NYIQ 5GJWC 2XGJA 3GFOA 1CS4C 2IC5A 2V6JA 4GBMA 4P0TA 1XPRA 1UBEA 2WJJA 1OLOA 5KSYA 1R8SA 4B3XA 2ZIAA 2R65A 3FKSA 2DBYA 3GLHB 1OW3B 1KMQA 2J9RA 4EFLA 2YV5A 2FGJA 3QOFA 1EFRD 2XTMA 2GEDA 3ZQJA 4XWAA 1YVDA 1T6NA 1T8TA 4DSOA 4PC1A 2GF9A 1XXHB 3AVYA 3GFTA 5J40A 1B0UA 4CGZA 1G17A 3AKYA 4D4LA 1MRNA 2XNDA 3QSYA 1UFQA 2KI5A 2V7QA 1X8LA 3Q85A 1IN6A 4EPVA 2JLYA 1N0WA 1ZIPA 1ZUIA 5JEEA 3LO5A 1GSIA 3SI7A 1DE0A 2V7QD 4IFEA 1HT2E 3L0IB 4OL0A 4QJ5A 2N1BA 1U90A 3WHKA 4RJLA 1WQ1R 4PPNA 4NONA 1HURA 4JT4A 3CWZA 3KFXA 2GJSA 2O8DA 2A5DA 4QBIA 1UM8A 5UKDA 4U7DA 2VEDA 2VP6A 4I99A 4NYJQ 1N5IA 1N6PA 1XFAA 2W2VA 3AVXA 2F1IA 2QP4A 2C9CA 3AVWA 2ZRGA 3PUXA 4Q1BA 1KOFA 4HI0E 1QG4A 1ZAKA 4IKEA 2WKPA 2IBMA 3TAUA 2ZJ5A 4C0AC 4ZDWA 2OO7A 2QT0A 3NBZC 4C30A 4Y0AA 2J59A 1GP2A 1M6NA 4IVRA
chains in the Genus database with same CATH superfamily
1G60A 3JYHA 2VEOA 5AW8A 1OFUX 1B14A 1YAJA 4Y6OA 3L0CA 4F6RA 3OD5A 3DXFA 3C8ZA 3KVNA 4FE7A 3JZIA 2AK2A 4B32A 3QEAZ 5A71A 1IQRA 3UMJA 3T3OA 3N05A 2ZAMA 3TDKA 3PGKA 4A16A 1Z5NA 1U3CA 4IRXA 4R7ZA 4G5QA 3KJIA 2J7PD 1PS0A 1A8PA 1X7HA 1G1MA 1WCIB 4AJIA 4TL6A 2GYVA 4LS3A 2P7HA 3JV7A 1LC3A 4RQUA 4TWZA 4EG8A 3IUYA 4MWOA 1MO3A 2BHRA 1A9ZA 3O8CA 5LNK1 1Z6ZA 3R7AA 1JB1A 4DY4A 4H31A 1PLLA 2V97A 3U4GA 3PA6A 4EH1A 5HJ7A 1G3IA 1GEEA 1GQYA 2Y27A 1D9ZA 1RRCA 3C14C 1QZTA 1Z38A 1SAYA 4PPFA 4KN5A 4OATA 2WJYA 4X90A 1VMKA 3KVOA 2MCFA 3DEJA 4O4HA 2P3OA 1WSWA 5HTOA 3EEFA 4XFDA 2XRZA 3V2GA 3N59A 5H9VA 3S5UA 2HRDA 1LJUA 2IXFA 4Q48A 3SIXA 1YR6A 3GT3A 1U9CA 4JQCA 1Z7EA 3KYCA 5D6OA 4UEOA 4AKTA 4N0PA 1J25A 1LI4A 3DEAA 2YHIA 3HBNA 2WQ6A 3H5RA 3PHCA 5DHQA 2W7TA 3K4PA 4YJGA 4YRRA 4DMFA 3WMRA 5BUZA 1HLFA 1A5SB 2DMRA 3NRJA 3ZTTA 3HCDA 5B1SA 5DNEA 2YWRA 1S7CA 2YOHA 4K9QA 4MWSA 1E9AA 3B3AA 1FNBA 2CLHB 1MVOA 2OB2A 3OKPA 5DWVA 5EQTA 4FZJA 4YUVA 1O0CA 2VQ3A 4MR9A 4FEAA 1VYTA 2FLKA 4YDHB 4Q4JA 3QQPA 4C4AA 5IKEA 3RUIA 5KJCA 2FN9A 3U7JA 3W5DA 4O4LB 1TEXA 3EXHB 5DYGA 4WZAE 2C78A 3TOZA 4ER3A 4U7JA 4YV1A 2NT3A 5K8IA 4GQAA 2UYCA 3RCBA 3WJ2A 3WRVA 2J3LA 2JK1A 3K30A 4YMVA 2IYRA 2XNHA 4NZNA 4YRKA 1G6OA 2XY4A 4RZ3A 5JOQA 5L95A 3R8FA 4C2TA 2R1TB 4P7JA 5AK4A 1K92A 4RZSA 1DMSA 4DR1B 1XN1A 1WTCA 1SA0B 2F8MA 2QLFA 1NATA 2ZYUX 3ECSA 3PDJA 3LC2O 3MJTA 3DVQX 1QR6A 2ZK7A 3PGLA 4GPBA 5AI8A 3DAFA 1K8XB 1KK2A 2JJ2A 2DPHA 3T3EA 3ZY5A 3CN9A 1SUEA 3BMOA 1XHLA 2DPXA 1KU6A 1GKLA 3G5LA 4CV0A 3N87A 5E2IA 3PDWA 4ITVA 4R2MA 3ZS9A 2WKQA 3EUWA 2PWBA 1A5BB 1JUDA 3GLKA 5IVHA 2XZDA 3KYBA 1JAYA 2O2ZA 3TZKA 1TK2A 3C85A 1QFSA 3GQBA 4Z7JA 4EG1A 4DQXA 2PIAA 3ZWBA 4L9AA 2PYDA 2I4TA 4OXRA 3TD2A 1JPNA 1P72A 3VJMA 2UXBB 4L1KA 1E79A 1JYSA 4E30A 1OYOA 4I6JA 4BECA 2YWXA 4J0CA 2GBCA 1LX7A 4OB8A 4BLVA 5JD5A 4Q03A 5JECA 4X8LA 1FSGA 2VNAA 4RH3A 3L8YA 2VP3A 1RQ7A 4YMWA 4Z2AA 2HZ7A 3S0JA 3NTQA 3NHWA 3KZKA 1Y1QA 3ZLUA 5CU7A 2Z6AA 1ZXBA 4NMHA 4PGGA 5LPNA 2H4YA 5HYVA 1XQWA 3UBTA 4G0WA 5ED4A 2GFQA 2YRWA 2PXAA 3AIMA 3HDVA 1KI7A 5FFFA 2WSSA 5B7QA 2JIBA 3UJ3X 4OGKA 2FW1A 4ETMA 5DHPA 1RPNA 4EO4A 1QIFA 2O5CA 2RJ3A 4KL8S 5HR5A 4MUBA 2POQX 3Q6MA 1C7QA 4RGBA 1JIJA 1YFLA 4XD2A 4QVKA 2ZB8A 1YZTA 2BTQB 3U1TA 4YAIA 5LLTA 2H92A 2JZNA 2YOFA 1Y98A 3WYDA 3TIVA 3DL0A 1KAOA 1ZNYA 4F8YA 3DFMA 4WXPA 2JASA 2OESA 3E23A 4D3DA 3JVDA 3JVVA 4QLOA 1KDPA 4RCVA 5IAKA 5I8WA 4E31A 2OBYA 3TXYA 2XYRA 1S01A 5I9MA 1V9LA 1UZNA 3NMUF 3LVFO 3JQ8B 3BJMA 5HQJA 2O3QA 1XTPA 3GJQA 1H85A 3BJRA 4IHJF 2VQSA 2IOFK 3R0VA 2G5PA 2PPLA 3AFNA 4MP3A 4QEDA 2V4UA 1HV8A 3ZDQA 4WPGA 2WNSA 1AGXA 3BS4A 3BXHA 5F77A 2PE5A 1GPDG 2KMLA 2RK6A 4PS1A 4RVOA 3TX2A 4AZSA 1OKKA 2JFXA 3P45A 2LCFA 4EITA 4LF9B 1O1YA 2RHOA 2ZPAA 3A32A 4TKMA 4EJSA 3LE8A 3HBAA 2QN6A 1LTHR 4B8WA 1PF7E 4I1RA 3ZIAA 3ET5A 2C96A 1BFKA 3B6KA 3HFJA 2AD5A 1V2GA 1XDWA 2F2TA 2XVZA 3BUSA 3C8HA 4N40A 4XPIA 2YXNA 4XTRA 1Q74A 3GBPA 3KAQA 3RVPA 4WFQA 4EMTA 1RPZA 4RL6A 3SC2A 2YZNA 3KPJA 1IRIA 1AUVA 1DSSG 2PEYA 3A4YA 3AVOA 1KEWA 3FNBA 5EE5B 3VHRA 2O8DB 1FCJA 3NFRA 2H4WA 3B1YA 3P2MA 1UFOA 3QWBA 4E94A 4YMTA 4ENSA 2NN3C 4I4TA 4KITB 3MCZA 3VHXA 2QDXA 3HNPA 1FFYA 1ZESA 3L8FA 5CM9C 2SNIE 2YZ7A 5HPYB 3GX1A 4JELA 4KRFA 1TKCA 4MRMA 1Z5OA 2RFLA 5I8ZA 3ZCUA 2JVJA 4EECA 3CC8A 3USES 1JQLB 2Q4OA 4BLOA 1A7AA 1E2QA 3B82A 4PZAA 3ZWVA 3C1TA 1TO1E 4E14A 2B1IA 4DA9A 3YASA 1CVRA 1PAUA 3CF4A 2F55A 3E82A 1Z8NA 1NJ8A 2M6SA 1QJ4A 4HZUB 1T3HA 4TMWA 1GTMA 1GDHA 4GPIB 4GKAA 2C94A 3OM0A 2VSXA 4B31A 3Q3GE 3CISA 4ZD6A 3HP1A 1E4VA 1T13A 4E21A 4ERXA 2AA3A 2W6CX 2ES4A 4F5WA 2Q5OA 5HXAA 2CJXA 5JSZA 4HNRA 5DTMA 1V95A 3H2GA 1FP1D 2ZYDA 3BIJA 1XIVA 3KKZA 3LUDA 3OJCA 5HHTA 4DE5A 1NWHA 3LAWA 4R68A 3A10A 2CJPA 2GZDA 1BROA 2CCJA 3HYLA 3P9YA 4FU0A 4M8IA 3ZVKA 1FDTA 4MQ4A 1IRXA 4OXXA 1HKUA 2C88A 2PWPA 3ZU5A 1P4AA 3PGMA 4LNUB 2Y4OA 4F6LA 3X0DA 5L4LA 3SQOA 2H9IA 4J0JA 1Q15A 4I9NA 1VZ2A 1S2NA 3K09C 2JBAB 4J90A 3SE7A 2HZBA 2OAGA 1GUDA 3E3MA 1HOXA 3E8MA 1YE5A 1D0VA 2C4NA 5HQ3B 4DHWA 2BFCB 4R2IA 2B4RO 4R2LA 4S1NA 1UFVA 1VG1A 2Q49A 3ZX5A 1M7GA 2CUNA 1SCAA 4FBMA 4EEXA 1WXHA 4RZXA 1KSJA 1YDHA 1EVYA 2O1EA 1VCIA 2QZ4A 2Q0XA 3C98A 3UGQA 3O2SB 3R0JA 3GLTA 4HRVA 1XLTC 1XMPA 2AEEA 2P11A 2P2DA 1VLJA 4GOMD 1D9XA 4OJNA 3UAOA 4BLUA 4FGSA 4QTYA 3GJ3A 4QRHA 1DX4A 2BMJA 1UJCA 2AH5A 2NZ2A 4HB4A 5EVCA 5JQGB 3DTYA 1YRLA 5FT9A 5JTUA 3I2JA 2P9JA 5ILOA 1L5QA 1J5XA 4NIMA 3OOEA 4OXQA 2ZRMA 4KE7A 2Y0EA 1X7DA 2DWQA 2WMDA 3AF2A 2SHKA 4LJ7A 3ROGA 3HK2A 1GQQA 3PHJA 4A8JA 4DEVA 5GONB 4HS4A 1MB3A 4RBNA 1M1ZA 2NUTB 3IDFA 4PC2A 2XD4A 4PGHA 1I2MA 5CA0B 5ALDA 4YYZA 5D5QA 5INTA 1E6UA 4ZI7B 2WT9A 1P81A 3SNKA 4D8YA 2IH2A 3E9RA 3FVQA 2Q5CA 2XVXA 3N75A 4REQB 1JJAA 1WR8A 2ODEA 5CH5A 3IPLA 3QY9A 4IQGA 4Y6GB 3ZXXA 5CA1F 5L8VA 4MWTA 4NDNE 1Y3BE 2FETA 2XOXA 3FUTA 2FZWA 3BE5A 1KI3A 2WU4A 3OLCX 2PMEA 4D4JA 4OUDA 3HZZA 1YV9A 4D9GA 4F5EA 2ZS8A 4EY6A 1R0CA 1O6ZA 3H87A 2GAOA 2PANA 3ROMA 3NKLA 3EDQA 4F60A 4JVSB 2RCNA 5K0GA 4G0VA 1U3GA 3CZAA 3KQTA 4G0YA 4S0XA 3RSZA 3LGXA 3OZTA 3TUZC 3ESXA 4JI8B 5COBA 4RLHA 5KKNB 2YIJA 1A97A 1JG3A 1ESZA 2AKYA 2HHCA 2J9ZB 4HX2A 1EM8B 2XZLA 3NJ4A 3VYRB 4P3NA 4GLFA 5EJEA 3J81k 1B15A 4BKRA 2C61A 5FWAA 1CS0A 3PVCA 4R1QA 3COVA 3CU5A 4QFCA 3W5IA 4C5BA 1E92A 4H1VA 2YVUA 3OZIA 4X3PA 4AB1A 2J0SA 2G25A 2QRMA 3QE3A 1I8TA 1SXIA 2AXPA 3CH7A 1L7PA 4HDMA 3GZNA 3BCUA 3A3OA 1ZJWA 1ETUA 2BGJA 1DX9A 2FV8A 1K5HA 2VBFA 3IUPA 3JPWA 1N8KA 3WLLA 2QLMA 1ZVJA 3RHSA 4ZN6A 2X2PA 1DAEA 3EX7C 3DDOA 2Q21A 3BREA 2XWSA 5G3YA 1JEQB 1VB5A 2HO4A 2HPVA 2WHYA 2AN1A 2WJ3A 4J16C 4MQ5A 2ZOSA 4WQMA 3EIXA 4J0QA 4BN4A 2ZCVA 5IN4A 3ZDBA 1NUTA 3A6FA 3VYSB 3NIDB 1O03A 1PS9A 3EW7A 1YQTA 1IQ0A 4MQEB 2WQ7A 3JWPA 2IYUA 2NXCA 2GWRA 3C3WA 5FI0B 5FL3A 3C5HA 3O4RA 5FWYB 5BSEA 5KOJB 1DKPA 2F3TA 1NQXA 1X2BA 2BEWB 5EKSA 3CJRA 1MB4A 1NLFA 3HDJA 3ZE6A 2W5UA 3L8ZA 5TV2A 3EPLA 3MBIA 5CIQA 1OTXA 1AS2A 1L3BA 2JRCA 3EF3A 4GIBA 4XDHA 2QU8A 4K03A 5FJJA 2I54A 3UV6A 4JUIA 1RYBA 2FF7A 3PQDA 1KZ6A 1CERA 1CP3A 2HA4A 3OCXA 3RARA 4D9FA 1T8YA 2A9VA 2XTZA 3PJRA 1YVUA 1OA1A 2JF0A 4ZODA 1FX1A 1AX9A 2C07A 2FK8A 2ZTLA 4A0RA 2VHXA 3HYTA 1TFUA 1CB0A 1MD9A 2GH1A 1SQ6A 2WKWA 4L4XA 4N9WA 3JASB 4G01B 4Y6QA 3NBXX 2R6R1 1IN1A 1BMFA 1LSUA 1JGTA 3U4QB 2I6XA 4D8UA 1DKOA 5IBRA 4NMLA 2TS1A 3DUWA 1ZYUA 1T2DA 3EZFA 3JWEA 2QXYA 4FGZA 2ZJ3A 1NLZA 1Y33E 2VAMA 5IYZA 1M75A 1E62A 4DRZA 1A1VA 4P83A 2JEZA 3ZWMA 2KQUA 3BMNA 4PX2A 5M34A 1F2UA 2R6HA 3CG0A 4D8WA 1NKVA 1KZYC 4WLNA 4DQVA 1AUOA 2OBNA 5AW4A 2AJBA 4Q4DA 1LDMA 1TVCA 3BA6A 3UPDA 2Q9CA 4ZRDA 1HG0A 1OCEA 5DB4A 1TKAA 2D1TA 1Z29A 2RGYA 1C2TA 2GM9A 4LVOA 5JYEA 6ADHA 1HRKA 2P0EA 1VHDA 3E18A 3LPLA 1WBJB 1DAGA 4KQ2A 4JBGA 2B1GA 2JJYA 3ZWDA 4A0FA 4C3OB 2O0KA 1RPJA 4XWWA 4Q9NA 3GVPA 3U7FB 1EBBA 1YUBA 4KN9S 2WPDD 2E6UX 4MPJA 4UCFA 1QH8B 4XDZA 1WAMA 2JANA 2N42A 4Q34A 4MYUA 4EEZA 1PFWA 2WC1A 3AILA 4Q47A 1EJ2A 1V1JA 3B78A 2BSAA 3VC3A 4R1TA 1QV7A 1NUHA 1SQ0A 5AXBA 3DV0A 3DVAB 2QRVA 3M1AA 4LY9A 1ZXXA 3ZBPA 3BEDA 3CUKA 3WGTA 1PJCA 1W2WB 2EHJA 1PZNA 3Q9SA 4XFKA 3RWBA 1CUUA 1YOVB 1Z2CA 5FNVB 2XNJA 2Q8NA 3K1AB 4MGEA 4S35A 5K8UA 3HUTA 5LN1A 1M7HA 1M34B 1MOZA 2VF2A 3MCUA 3MJSA 2FY8A 1TTTA 3W77A 3AF5A 2OBFA 2ENUA 4JVNA 3B1WA 3C7AA 3OQPA 1JMVA 1C7FA 4R69A 1LC0A 2EP8A 4W5TA 1QR2A 1WWKA 2Z4TA 1CETA 3EGEA 2EIHA 1SHTX 5GV8A 2X0DA 3HKDA 2BLNA 3W3ZB 1JLMA 5E1BA 2I1WA 1XZCA 2ZRIA 3NOQA 1VMEA 4R9NA 1L4NA 3UATA 1ZNZA 1TAGA 3FPHA 4O3MA 3KT3A 4P80A 1TD9A 1T3ZA 2HRCA 2ZRPA 3HC7A 4UU7A 4ZQHA 5TB5A 5I51A 5BT8A 2V5UA 3AM5A 4HK4A 1S89A 1Q3TA 3PHHA 4RA9A 2HDNB 2QG6A 4YCNA 4AY5A 3VZSA 5K99A 2YWFA 4EUHA 3FLBA 3O8DA 1Z7YA 4NHEA 3UOAB 1BMQA 1QONA 1YBVA 2H08A 1DIGA 5T4FA 1VI5A 3QF4A 3KELA 3OSUA 2OCGA 3QMMA 3NVAA 2O7QA 1XI2A 4BFTA 3AUJB 4C2AA 3DLBA 3VR5A 3ISTA 1IXKA 4Y2QA 1R4MB 1XHEA 1VJDA 1NNUA 4XUGB 3GVHA 2YINC 4NS1A 3I5AA 3KKOA 4I55B 1N5MA 1VDZA 4GX2A 4ISCA 1QKKA 3PXAA 4TTPA 1UBSB 4LNHA 1IZZA 1ODJA 1SCKA 2FX5A 1TLTA 5DXFA 2WZQA 3HH8A 3JALA 1Q22A 1J4AA 4D25A 3QNMA 2PNFA 4M6WA 3SFVA 2R8RA 3WLPA 5C7LO 3THWB 3U9LA 3OP1A 1YE8A 4DQKA 3RODA 3B2EA 1RMTA 2XCOA 1PKEA 1ZVVA 5HF8A 3ZY4A 8ATCA 5KYTA 3O47A 1YHYA 3H0CA 5F12A 5BVGA 4HLQB 2FU5C 1H6CA 3E58A 5JJLA 5C7OO 1H3NA 1AO0A 4GMKA 2DBZA 1OLUB 4DKXA 4BO8A 1R50A 2B8NA 3SMVA 2H1RA 3TIXB 4EJMA 2P3QA 4QGBA 2NUPA 2AE1A 2AMJA 1ZUD1 4EGQA 1PSZA 1PX2A 1Z4PX 2HJHA 2PO5A 3LCUA 2FG5A 4X8HA 3CZ5A 5CNMA 1Q57A 3TNJA 3VSEA 2X9GA 1ZD9A 2FWRA 4L5IA 4FKZA 3IIEA 1ZHFA 2ZIEA 1KEVA 4H7HA 1G5TA 5TPZD 1L6IA 4O2BF 2ILTA 2WAOA 1QQ7A 5BW6B 4BGUA 2AG8A 3AKZA 4UHKA 1EBFA 3LPDA 5LD2C 3NV7A 3P2OA 3V34A 2HHJA 2NSLA 1FTQA 2BMFA 2QJRA 3JTEA 1NQOA 1IN5A 2EXXA 2XV1A 1T91A 3KAKA 4PYMA 4DXHA 2L42A 2ODNA 3COWA 1X8KA 1IJEA 2ZBPA 3DNPA 1US8A 3K94A 1ZOIA 2G5GX 4GMXA 1LDYA 2DT5A 3HFSA 3AYZB 3CKYA 4Q12A 2A88A 4A15A 3F7NA 3NOVA 5C32A 5T8KC 3DUFA 3MMZA 1N5LA 1U1FA 3IHTA 2QTZA 4NKRA 4IUDS 3USCS 1P60A 3A31A 4GBED 5TDHA 3WL5A 3R4VA 3SGLA 2ZAOA 1J33A 1MH1A 2AVNA 2ODTX 1OXSC 2QY6A 4MI6A 4E33A 4AM8A 2WYVA 2HSJA 2A9RA 2FWIA 3HKEB 1IJBA 1CQJB 2E4AA 3BL5A 4LV6A 2XHEA 4J0HA 4BNNA 2PWZA 5AHXA 2ZKIA 3RT1A 4IXMA 4I50A 2B69A 3IUJA 2R4QA 3OPYB 1G2IA 4RIHA 4KR7A 4V0QA 4IH4A 2ODPA 3MTAA 5AM1A 1RP1A 4YBZA 1RE1A 2AFHB 3RVKA 1GGEA 4KPYA 3DWEX 4UPEA 1QLHA 4BU0A 1RWNA 1V1RB 3MS2A 3QHAA 4FOLA 4JU9A 5I9SA 3UKJA 4RQAA 3JSXA 3R20A 1ZD2P 2I6QA 1VIDA 1TCVA 4WK4B 3SSNA 1LNSA 5KOHB 1U5BB 1UANA 4CG0A 4LHWA 2I67A 3ZTYA 2WV9A 3CUTA 4QL3A 1YL5A 5L3SB 2OWDA 5A3VA 4DNFA 2H11A 1TIPA 1GYRA 1AKVA 1LSSA 3KE8A 1KQNA 1MPXA 1UKZA 4L8FA 2XWPA 5GJBA 5KHAA 1HC7A 3RUHA 2H1IA 4OFXA 1AOXA 4W6ZA 3UNXA 2ATCA 2V6BA 2VBCA 4LHYA 2FPGB 4Q7LA 2DEUA 1X15A 4UJ5A 1Z4LA 1LW7A 1DCKA 2GD6A 2H0RA 2HFKA 4JLUA 4GZ3A 1Z2AA 4B6JA 4UHDA 4BB0A 5I5EA 5L3QB 3MNFA 4Q82A 3LHIA 4UBIA 3KHUA 5KX5B 3WWDA 3PQFA 1SELA 5IDYA 2C7QA 2CNWA 2C54A 3UV7A 4CKEB 4R54A 5DU2A 4UU0A 3OT1B 3AC0A 4F46A 3S27A 3HI6A 4RVUA 3URKA 3HY6A 2J33A 4LPKA 4NI5A 5C80A 2F1OA 3BJZA 3IAM6 5JS2A 1ILEA 1ZLYA 3GDGA 3ZV7A 1FQKA 3S8EA 4RMIA 4JDUA 3TZLA 2XNCA 3DAGA 4ED9A 1WA5A 5JS8A 2DFLA 2GHIA 4M9SA 4YTEA 3AF3A 2RH5A 4NPCA 2XUKA 1JHVA 4PZLA 2KX7A 4F4FA 4IJVA 1U0FA 1Y4ZA 4IWXA 3N74A 4NXNB 4GLOA 4KLZA 2ZU6A 5CLLA 5ALYA 5BR8B 1GZ6A 4V3BA 4E5UA 1JIQA 2A78A 1ZUNA 1VKRA 1E60A 3KYDB 1ZXLA 3CNOA 1XNGA 1NXXA 3O5AA 4EJFA 4YDQA 2ZCUA 4B3HA 3L02A 2DUNA 3KLPX 5IJ0B 4HEA6 4IF4A 3WG9A 1E8NA 1QHXA 4WUTA 4JMLA 1F3OA 3E9CA 5JY6A 3H9QA 1SWWA 1CYDA 4GM0A 4DMGA 2XLCA 4Y2PA 4TLBA 4EY8A 1YA6A 3RRBA 4ROSA 4PIMA 4WOPA 4RANA 3UPTA 4H3HB 4FDLA 3KTAB 2VRNA 2OTCA 2VBGA 3R7WB 1SB9A 2BN4A 2OFPA 4ILEA 3RPEA 3H4TA 3SE0A 1GQ2A 1E2HA 3AF6A 5FOQA 4Q93A 5FPSA 5BUSA 5HK9A 2KM1A 3AESA 3QBJA 1BFDA 4KNVA 2EFGA 4AYTA 1T0HB 1Z7GA 5U1PA 3TZHA 1UK7A 2CNNA 3KAPA 1Q7TA 3E84A 4WBNB 3GELA 3L6OO 5KTSA 1RYZA 3UHJA 4YCCA 1ISPA 4R2KA 4HN4B 4KG7A 4OI2A 4TS9A 1C4WA 3ICCA 9LDBA 3RSOA 1FDSA 1IDOA 2UVPA 2ZIGA 3QEMB 3P9PA 3ASZA 2VXBA 4G5HA 5JMOA 3T3MB 5BMVF 5KTTA 1A50B 4C4YA 3ILHA 1JQJC 4DJEC 5L7WA 2NV0A 5SICE 1N78A 2IZ7A 1CULC 4E13A 2QSUA 3WTCA 4U2KA 1I9CA 2VTBB 2P9ZA 2WIDA 4YUZA 3MERA 1K27A 1CRWG 1OPRA 1ATZA 2EX1A 1B1AA 4YXWA 1DCTA 1MR3F 3C3XA 1U6KA 1P7VA 2VOEA 1EB8A 4GGPA 5DPMA 2QM0A 1I1QB 2WK1A 4QRIA 2HEGA 2HQOA 2OHOA 4LRYA 5IU6A 2ZCJA 2J9FB 4JVMA 5AXDA 3MWEB 1ZPDA 4EM6A 2RGNA 5JXWA 4WZAA 3TLZA 4D3SA 1O8BA 3DTVA 1AD2A 4GI2A 2ST1A 2YQ4A 4JZKA 4ALNA 3I2KA 5C5EA 5I7VA 1U8XX 5BXQC 3GDWA 1ZI8A 2QAGC 3BQNB 5CFNA 4IZ6A 1XDUA 2CHGA 3D6HA 4UREA 3DEHA 5EZYA 1JFVA 2COKA 2O2EA 4HXYA 2HMWA 2QAGA 4WY8A 1UWVA 4Q15A 2QYOA 5CHEA 3FTPA 1NWCA 2JGKA 2PH3A 2PV0A 3EJWA 4G07A 4R0VA 3R3YA 1M10A 3WGOA 1GEGA 1DKNA 1W5SA 2ZAIA 2PXHA 4LYAA 4LMBA 1L5MA 4BATA 2FPPA 4ZGWA 2FXVA 4G89A 4P1ZA 4R81A 1P29A 3IHWA 1QX4A 5BSHA 3L3BA 2AQ8A 2Q6VA 1XVAA 3LF2A 1Q0RA 2J31A 3H84A 4N5LA 2GDZA 1ZHOA 1DFIA 3RIHA 6CHYA 4L28A 1ADJA 1HE5A 5EE3A 3VXKA 2VWPA 1TUBB 2VCEA 4R05A 1L5SA 3AEUB 3PGVA 1GU7A 1V16A 1EGMB 2EEPA 3AW9A 3ZOZA 3PCRB 1USWA 3WZ2A 4V1CB 4LQ4A 2XE8A 4TUYF 1UT6A 5I8PA 2DX7A 4OJQA 1QS0A 1EFVB 3C8UA 5CX1A 3IESA 2Y68A 3R0ZA 5HRUA 4JEHA 1KVSA 1WDLA 5HUHA 1LNQA 2WFZA 3GPLA 1L6RA 3KB1A 2WSSD 3H7AA 4G1MB 4J94A 5EWJA 4UOEA 1HT0A 2NLOA 3KOXA 3LQKA 4BZZA 1H2RS 4TL8A 4G5OA 1YF3A 2OC9A 2YXDA 3VR6H 2YN2A 2Y1FA 3H9JA 1SCJA 2XKJE 5EJ5A 1EFCA 3K70C 1OTYA 3HVRA 4DQDA 2CFOA 4UVDA 1IZ8A 5HIMA 2R60A 5CEFA 2G28A 4NAVA 4EMSA 1RZ3A 3ND8A 4ZZ0A 1NXOA 2ONKA 3AI2A 3QLTA 4LHEA 4OB7A 2JAWA 2OHJA 3QKSB 5CFRA 2VI5A 1RM5A 2VN8A 2VHTA 3DE6X 3QXJA 4NZYA 1FLAA 3CRQA 3PC7A 2IEAA 2P30A 5A9SB 5EJFA 2FSGA 3D2BA 4YUYA 1XWWA 5DNUA 5D51S 3BCHA 1VKJA 2PBFA 1PJTA 2V6IA 3O94A 4PR0A 2P6UA 2QUKA 4OG2A 4WECA 1AGPA 1ZSNA 2PD6A 4FC7A 1SVOA 3RO7A 3FR7A 1EGVB 3V3KA 1YB4A 2G77B 2WHXA 5DZSA 2XZPA 4QREA 5JANA 4QOHA 5HOQA 3LT1A 1KRWA 2C98A 4HRXA 4CQMA 1JSXA 1SUDA 3V32A 3I28A 4BMNA 3GUZA 3IT1A 2OA0A 5I9IA 5L51A 4TQUS 2CSXA 3RSFA 1X2EA 4ZT3A 1WNTA 2R44A 2AJ8A 2Q5JA 1FRVA 3EQ7A 1ZIYA 5JV5A 2QY9A 1I7PA 1ZISA 2FZEA 4DR2B 3I8OA 2W2KB 3PENA 4W5RA 3PFFA 1JFFA 5K8CA 4P86A 3JYPA 4ZZ3A 3DCYA 1OXUA 4C9BA 2FE4A 4BX9A 4FYWA 1Y1PA 2Y1KA 4WLOA 3DP9A 1GIAA 1ZU4A 2AI3A 1KO1A 4O4JF 5LYJF 4K1XA 4EP1A 3I5XA 1RYDA 1T0JB 3G9QA 1T9AA 2V7XA 1WW8A 3N07A 2L82A 4YV0A 1GU1A 1GZ5A 3L6CA 1E6CA 3JQDA 2CK3A 4KQKA 3DMRA 1L5NA 4F84A 1S1MA 4F4JA 2Q6OA 1V6AA 2IHUA 2O8EB 2EJTA 2IJGX 1W96A 3O7MA 4XVRA 5CBPA 5HS4A 3ZK7A 3JZFA 2NMVA 3AX6A 4OK3A 1CUAA 5ALKA 3DMFA 3CEAA 4XCVA 3DDSA 3SSOA 1FDWA 1FFCA 1M2KA 2HA3A 1S4QA 4JLKA 2XZOA 3VKUA 2JBWA 1XVIA 2VWGA 2JI6A 3VNAA 4J7UA 2C29D 1AXGA 3H99A 4JUDX 2LDXA 4EQ6B 4EZEA 3GFVA 3BRWD 1YQ9A 4W8OA 1G7TA 1WB6A 2REQA 2HGSA 3AUUA 4FLFA 4IIJF 4V39A 4MVJG 3WLTA 3O93A 2ORVA 4Y18A 3MYRA 4BB5A 4TS3A 2VAVA 1MRZA 3REGA 5JALA 2Q1UA 2LNDA 1WDWB 1FUIA 5HZHA 2JGAA 2Y0PA 3NAZA 3ZBTA 3MSXA 2PJZA 1N4AA 3VNBA 2J09A 4CMIA 4EK9A 3WP0A 4GI7A 2AN9A 1AZLA 2ZT6A 3K53A 3QU9A 1MVLA 1W9MA 4JB3A 5JMPA 1YR8A 3A9SA 3VZDA 3W5HA 3KR1A 4DMMA 5HIKA 3GLFB 1BCSB 2JZCA 3E61A 1AKRA 1AUQA 1JSLA 2VLBA 3O83A 4YWHA 4TN1A 3IMKA 3PVSA 1SKAA 3KOYA 2VYQA 2A9KA 1SG6A 5AMXA 5LOVF 4JODA 2DVMA 3JQAD 1KEEB 3W2IA 5CT6A 1P39A 4QODA 2WR8A 4HH0A 5GVRA 1P4RA 5KYKA 2ZTVA 1OYVA 3HB0A 3U44B 1LSJA 3ND7A 1FP6A 4PZDA 1AH2A 2BCEA 1MT3A 1SXQA 4COKA 1S8AA 4RM2A 4KNWA 1E18A 1EEHA 4JIMA 3RS2A 5A03A 2Q45A 3ENVA 3LDAA 1E3TA 4MUFA 3T1QA 1KC3A 3TSCA 3WIEA 1PEAA 3LBAA 4F38A 3PP8A 5JZSA 1G8HA 3JQPA 3AI7A 3R5TA 1RWPA 3SKVA 2CBGA 5EIWA 2Q6KA 1W36B 1GZUA 3MZ0A 3PQ7A 3P9NA 3HVUA 3HP7A 1KP2A 5EQJB 4FFVA 5BWCA 2PGAA 4V0SA 5I01A 1MC5A 4GF5A 1XZKA 3ANMA 4UZEA 1CQIA 3TK1A 3ZIUA 4YX9A 1CHNA 3OJEA 4XVQA 5JFOA 4MPRA 4JUAA 1WMSA 5AOBA 2K2WA 2WTMA 1UJ5A 4HB3A 4DL9A 5CK5A 4E2FA 4CIYA 4H59A 1RSZA 4ZA2A 3VHLB 1SC9A 1CUIA 4K9MA 4L7QA 1FP7A 1F7VA 4LRSB 3TBKA 4GI3A 3L7AA 1WO8A 5EIFA 5CFZA 2BF4A 3LY7A 5FLYA 4EKYA 4W1SA 2J08A 3DDUA 1E9EA 4Z7NB 3FCUB 3MN1A 2VDJA 3QKIA 2KSQA 3H2YA 3IUBA 4GX0A 1I3KA 4J76A 2BKXA 2EKPA 2BKVA 4FZ5A 1CC1S 2OAP1 2YCLA 4FWBA 4RZQA 1KK1A 3DE0X 2V7PA 4KAAA 5JJBA 4PQGA 5JS1A 2CGEA 4BO1A 4EF4A 1KKUA 4QC2A 4X7PA 4BNTA 4PCLA 2QV7A 3TR0A 1FK8A 1Q0HA 3H5OA 4HNAB 1HI9A 4MWGA 1KSFX 3GP3A 3H0KA 1CNFA 3M5CA 4UQLA 4Q7JB 2B8TA 1FFXB 3A2NA 2PTGA 1R10A 5F52A 1PZGA 3HJGA 2PZ8A 2WU8A 3PSAA 3UUWA 4OKSA 5AQEA 4FR2A 5MN6A 4KDEA 2VZ9A 1VCMA 1V11A 1NZJA 3EGXB 1QHHA 3I6QA 1RE0A 3JAKB 3KJEA 4MQMA 1W0KD 1K9VF 4WTOA 3SZUA 5LLDA 1KJWA 1L5HB 1LJ8A 1WXXA 1G19A 1E2PA 3KV1A 3MBKA 1RJ9A 3DBHB 2QOEA 2IEYA 2QZ9A 1I1OA 2JFZA 3N86A 4GRAA 4NCHA 4R3WA 4ZYZA 4DM3A 3TKYA 2AD1A 2H1SA 2NYRA 4G3XA 3AP3A 1TC2A 4FR0A 3OJOA 1KTVA 2PZFA 5FA8A 4ZEVA 5J2TF 2ZYTX 4U7PB 3T3HA 3PRHA 4CL2A 4PONA 4WE3A 2PLNA 3IVXA 5KHOC 1XNQB 1T2NA 2VJMA 4X1YB 3F73A 1Z5GA 5FLEX 2BSXA 2CNOA 2OD9A 3I92A 3HYRA 1YS9A 4YACA 3MOGA 1MQSA 3K05A 3RHFA 4TRMA 5D2CA 4PLCA 3SJUA 3UICA 4U9HS 2M6KA 3RFUA 1NDQA 1EZ4A 1BIFA 1W1UA 1U81A 5F2OA 3RADC 2QGNA 1XLVA 1QOZA 1U4SA 4PAOA 5IASA 1C9KA 4L7VA 3OQIA 4CM9A 1INLA 1QIHA 1SQ5A 3IIJA 3FBTA 2PL3A 1E5VA 3HCFA 4MV1A 4PG7A 5LA6A 4DMRA 3DOOA 4AKHA 4UFOA 1SVWA 3ABQB 4RD6A 1D1SA 3B9QA 3CWCA 1FQWA 2ZE6A 3RASA 4M7RA 2MSLA 2MSKA 3OEHD 5AKYA 1I3MA 3T7DA 2HM7A 4EHDA 3QVUA 3R3XA 4F3KA 5KWJA 4BNFA 3SZMA 5JNRA 2GVZC 3AWDA 4HVTA 4NJMB 4F9GA 3TF5A 3HI4A 1IZ7A 3N7UA 5ABPA 1GSHA 3IDQA 3TAXA 2X6TA 2D0PB 3ABSB 2RGCA 3GY0A 3R76A 3QKRA 3AL2A 1MABB 2WHRA 3WWEA 4U7WA 4JNCA 1YS2X 2WSIA 2B3DA 2HJRA 3ZBQA 4BZWA 1A04A 5L7YA 3VR4H 4LAFA 2KB0A 3QVGB 4QDOA 3EWNA 1RWQA 5C7IO 3SDSA 4KMMA 3N2GA 1K7XB 2CVZA 1ZH8A 4NCJA 2AN3A 3TNLA 2PS9A 2WD7B 4E2YA 1ZHHA 3WK7A 4DCSA 5GM1A 6Q21A 4LZZA 4MUXA 1HXHA 3HACA 4F04A 3HYNA 1LWNA 4X3CA 2OZEA 3ETNA 4RSGA 5I4KA 3QLUC 2PVSA 3R74A 3FGNA 1XCPA 3T1VA 4NFLA 4GI1A 1LEHA 1HPLA 4QQKA 1KAGA 1YS6A 4AMBA 3KJGA 5ITZA 2N0SA 4BVLA 4RSMA 4US2R 3OQNA 3D6TB 3ZY2A 2HMYB 2XOKD 1SHZA 4XLZA 3S2YA 3VX4A 3M0EA 3OZDA 4U02A 5AJZA 3WDLA 5BN1A 1UJ4A 2OQVA 1W94A 4EARA 1PNRA 3NM6B 3Q3IA 4IIHA 1P17A 2F3RA 1M2OA 2HCTA 4BOYA 3P4YA 3ED1A 2J6CA 5BN5B 4QBGB 1ZK2A 2UYYA 3MQ2A 2FA9A 4P84A 3F6SA 3TMYA 2Y77A 1YBMA 3OUUA 4YJ3A 1G8AA 2RHDA 1XPJA 3OA0A 3S2ZA 2BGIA 1Z18A 1BW9B 1ZK4A 1R9MA 3UN1A 3KG2A 4OJKA 3KTDA 3EC7A 4LKRA 4UNNA 2QVZX 3ETHA 1E4YA 2JI8A 4FW8A 1V7QA 2L2QA 2QVLA 5E9WA 2WAMA 3AONB 4WESA 4PNPA 3WLMA 1XRPA 4HLDA 2I5PO 2J0UB 4Z7QB 1BXRB 4N5DA 3R6WA 2XB4A 4MVJP 1DAPA 1KFJB 2R8YA 5I48A 1JKFA 4NBKA 2NQ8A 3HSKA 1G2OA 4NECA 4XQ9A 2ATEA 2B1RA 1YS1X 3HJUA 3Q6IA 3S55A 1HNZB 3PFHA 3WOVA 3W7BA 4CUZA 3KETA 3KIPA 5HFNA 2IKSA 3K4HA 2WWXA 3Q7EA 5F7XA 1AKQA 4M0EA 1MKYA 1ES9A 4AWXA 1N7HA 1U3FA 3G0DA 4J3NA 2ANCA 3UHPA 1G59A 2Z09A 3OKCA 1KMNA 4DIBA 2AEFA 3L43A 1JILA 4TXNA 3ELYA 4D9CA 3C7CB 1ETHA 2G1AA 3OY2A 2X40A 4EB3A 2OO5A 4N3CA 2LXNA 1W6RA 2CWWA 4GGOA 5FPYA 4O02B 1HDGO 2CD7A 4AT1A 4DNPA 4LN1A 1YMVA 2IV3A 4BNWA 4N8EA 3I4CA 4XB6B 1DIOB 3JQ7A 2BKUA 5DW3A 4WJZA 2JFVA 3G2KA 2L19A 4RLSA 1LPAB 4H3VA 3RJMA 4D42A 1PW7A 2Y93A 1CVIA 4PRKA 1EP9A 1R1DA</