5C2JB

Complex structure of the gap domain of mgcracgap and cdc42
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
191
structure length
191
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/signaling protein
molecule keywords Rac GTPase-activating protein 1
total genus 67
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5c2jB00
4QM6A 3PG5A 3FDIA 4XVQA 1EX7A 4TMVA 3MRSA 4M9XA 3I1FA 1HYQA 5CYOA 2H18A 4YMTA 2ZRBA 3AGPA 1KI9A 2C5LA 5J5CA 2LKCA 1N0VC 4ZI3A 3GFOA 3BXZA 3AVUA 4DDTA 4URYR 2B8TA 3NHBA 3QQ5A 1LFDB 3SYKA 3EZ2A 1ZRHA 3CB4A 1LNZA 1SVKA 1VCIA 4JL5A 4US0R 4X8OA 2ZI4A 4DXAA 5JHHB 5JZVA 1RRFA 3AH8A 3EA0A 3AF1A 1H8ED 1KK2A 2X19A 2PT7A 1KJZA 3QIAA 2QUZA 4GRAA 3GLIE 5D3QA 4Q1EA 4ZKEA 4MKGA 4MA4A 1JXMA 4QGFA 1MKYA 3TLXA 4D81A 5FR2A 2A78A 1AGRA 3D3QA 1WCV1 1IY1A 1XFAA 1Z0JA 3PEWA 3LQRA 2OT3B 2YOFA 1DBSA 4TQ9A 2FSIA 2F9MA 2J9RA 1BOFA 4QBIA 4Q4AB 5TV2A 1YR9A 2H17A 4TL7A 1CKEA 2AFIE 2D62A 4BUJA 4MDEA 2REBA 1VG8A 1W0KD 1IJEA 2CMKA 3RS3A 3ZZUA 3ZVNA 3LVQE 2VSFA 2ZS9A 4CDGA 1ZD1A 4J0QA 3ADCA 3BBPA 2GJ8A 2CVFA 1UADA 1DAIA 4MRPA 4FIDA 5CB6A 4IOMA 4DLUA 1IN4A 1KDRA 4EDHA 1X8KA 5H68A 4LBWA 1G5RA 3ZIAD 3D6TB 1PUIA 4HLDA 2JDIA 1KJWA 2CK3A 4OHZA 2QMUA 1E2EA 2CDNA 3I62A 3K0FB 2Y8EA 4R7ZA 2IYYA 2H16A 4TT3D 2UVQA 3IKJA 1KAOA 1CJUC 5FOSA 3KFVA 3SC3A 1ZD9A 1J8MF 4IJMA 3U3JA 1AN0A 5DYIA 5LD2B 3F0TA 5L3RA 2R6AA 2ZS7A 1X6VA 1Z6YA 1DTSA 2GEDA 4XTCS 1F2UA 1CP2A 3C16C 4OBEA 3K0CC 5SZKB 2ZVPX 3AUYA 3DM5A 3MAAC 4DLWA 5KO2A 2RGNC 2PCLA 5DH9A 4TLBA 5CDFE 5C4MA 5DN6A 2IYVA 3NHAA 4G5QA 2MMCA 4RZ2A 1VCMA 2C77A 4U7DA 1S4QA 1NJFA 4E03A 2GXQA 4A15A 4K8OA 2ZRFA 1FUKA 3RS7A 2XZLA 1LW7A 4POAA 1VG9B 2ZJ8A 1T0HB 1TADA 4BZPA 5E3HA 1GVNB 1YHNA 5JSZA 4X8LA 4JVMA 1PLKA 1KJYA 4B2IA 4CEJA 4E22A 2ZJ2A 1E0AA 4EPYA 4A0RA 2CBZA 5KHOC 4LYJA 1QHIA 2EFGA 5KDLA 2QT0A 1H65A 3EARA 1C1YA 4PPQA 2CL0X 4Q9HA 3X1DA 3EPJA 2YOGA 4KODA 3HU1A 4UNSA 5FL3A 3AP2A 2NMVA 5B30A 2QMOA 3CKLA 4QOSA 1S9HA 2NO6A 3BIFA 1Z0IA 1IM2A 1E98A 1Z2AA 3L0SA 1A2KC 2OCAA 2GKSA 3UANA 3KJEA 2FPMA 4OQNA 1W1WA 4DWJA 4RCZA 1ZUHA 4BRWA 2O0JA 2W6JA 1G7SA 1J90A 5FOUA 3QKSB 2W58A 3W3AA 4PZZA 2VH5R 3UKDA 3OEHD 1Z5ZA 2Q9BA 2OBLA 1G3RA 1P2TA 1R5NA 1EFRD 3TSOA 1G17A 3T06B 3KTAB 3U44B 1GNRA 4A8JA 4QGGA 3LY5A 3B85A 3AQ4A 3F3YA 4OK6A 2O52A 2XB4A 2BJWA 3P1JA 4NCKA 3R7WB 1F2UB 2GCNA 1YKSA 4W7SA 1SHKA 4AK9A 2QM8A 2O8DA 3A1VA 2JLRA 3SJCA 4UNNA 3AKYA 2VTKA 2JLQA 2HV8A 2ANCA 2R6GA 2IF2A 4LV5B 3BS4A 1W4AA 1UKZA 4BLQA 5J47A 2IWRA 4QL3A 1PZNA 2RH5A 2ZYUX 1FL9A 3V4FA 1ZYUA 1KK0A 1E79A 1KI6B 3SJAA 1NN5A 3FMFA 1F2TA 1E2JA 3SZRA 2NZJA 1DAEA 1ESNA 5FFMA 1TTTA 1JR6A 4HATA 2ZI3A 4X8HA 3TVTA 3RNLA 4TT3A 1QHHA 3U7FB 5EP4A 3MJRA 4M9ZA 3RDPA 3KKQA 5B57C 5C18A 4CRWB 1J70A 2V3CC 1VG0B 2V6IA 4HEJA 4PAQA 4UXJA 1XCMA 4FN5A 2IS1A 4GOJA 3B13B 4TYPA 4DCVA 1E3MA 3ZJYA 4NU0A 3C4JA 3FGNA 3WY9A 3IO5A 4IDHA 4B3BA 1WBDA 2OXCA 2ZXUA 2O8BB 4D6PA 5SZHB 5DGXA 1ZBDA 2ZJZA 3L0PA 1JJ7A 3NC0C 3T1OA 3GLGB 4KLNA 4NTZA 5CM8B 1KNXA 4ASUA 1AS3A 1DG3A 1GOTA 2RGDA 3VU9B 3ZVMA 2I3BA 2OSBA 4NCJA 1ZU4A 3Q9LA 5HR5A 2Q9AA 5FOXA 1ANKA 2QQ0A 2RCNA 1XDBA 3AM1A 2WKPA 2FPKA 4DT1A 1QG2A 3B1YA 2KJQA 3RS4A 3WBKA 4WW0A 4Q4JA 5JS8A 1NN0A 2J0QA 1EWQA 1QVRA 2OCBA 3GLGA 5H8WA 2C96A 1U99A 2P2LA 2QI9C 4PO1A 4M4SA 5A4JA 5GJWC 1Z2CA 2XTNA 2ECKA 5JCPA 1FW6A 4TYWA 4IVQA 4M9SA 4FMDF 5FPYA 3MSXA 1DE0A 2ORIA 1KO4A 3EZ7A 2IT1A 3TKLA 2F1RA 5KSOA 1COWA 3CUEF 1O3YA 5FTNA 4XVRA 1GRQA 4I81A 4Q47A 1KGDA 1GDDA 1LF0A 1YZTA 2C78A 1Y3AA 1GAJA 5J4YA 2GK7A 2O5VA 2JJ1A 4U5XA 4CEIB 2FPLA 4A8JB 5JSZB 1E0JA 3B6EA 5FBQB 2P6RA 1PUJA 3VFDA 1D2MA 3QKRB 1LS1A 3CZPA 3PQCA 3VAAA 3PEYA 1EESA 4ACAA 4BFVA 4GP7A 2AWNA 3K09C 4Q1FA 2P5SA 1SXJB 3EW9A 1KKLA 3SFVA 3W8RA 3THYB 3NKVA 3VR6A 4AG6A 2XSZD 3V9PA 1OYYA 3GJ3A 2D06A 4A2WA 3RRYA 1RZ3A 1O87A 4H1UA 4GI7A 5EP1A 4B48A 2XNSA 3QBVA 1NMYA 4RZXA 1OB5A 3HR7A 3DZDA 4JLAA 1EXMA 2GF0A 1B0UA 2IHYA 3LO5A 3ND9A 5J40A 2XTMA 4Q01A 1E2QA 2QP9X 2P3SA 1QBKC 2VLIA 2FSFA 5GJCA 4TQUS 3BAFA 2ZRGA 4ILEA 4AWXA 1S2MA 4CIDA 1W36B 4MYCA 1TMKA 2R2AA 1UEIA 2QAGA 4G5GA 3R20A 2FFHA 2HUPA 1JEDA 3JZAA 3VKHA 1IXZA 3VTKA 4EKDA 2YOHA 1R5BA 3SHFA 3K0EA 2ZE5A 3SJZA 1N5JA 1ZW6A 2J1LA 2A5GA 4PAMA 2N42A 1IONA 4DLXA 3AVTA 3X2SA 1U0HC 5DHFA 1AM4D 3U60B 4HZUB 3CR7A 4BLRA 1D5CA 1KK1A 4MGIR 4BFUA 4D0NA 1XJCA 2OAP1 2I4IA 3P27A 3QXCA 1KK3A 2IXEA 3SFZA 3AF3A 1BS1A 1XXHB 1D2NA 2H8KA 1KO8A 3QPUA 1UJ2A 3EXAA 4MUAA 2BVNA 4MRNA 3ZQJA 2V8OA 4TLAA 1G7RA 3CBQA 1N0UA 5E4FA 4PSKA 3TSWA 4CT5A 1N6RA 1SXJD 3DMDA 1TF7A 4UNQA 3KL4A 4QBGB 4XTRA 1AQYA 4MDFA 2DBYA 4LJ8A 3TSZA 4UNRA 4Z1MA 3W6NA 3K70C 2CCGA 2PLFA 4G5SA 3B8HA 2IX3A 1KO7A 1LY1A 2J0UA 3QF4B 1DS6A 1MO3A 1Z8FA 1AIPA 5DISB 2CNWA 2EW1A 3OEHA 1T0JB 4U02A 2QGZA 4YQFA 2HDNB 3U61B 1NLYA 4HUTA 2Z4SA 4BLSA 2J45A 2A5YB 2RGCA 1A1VA 1ZM2A 3DZ8A 3EZ9A 5G53C 3U7GA 3CX6A 5BXQC 5EJEA 1RYHA 3BFKA 4RCYA 2ZVQX 2BM0A 3CLVA 4FMBB 3S1AA 4RD3A 3MWKA 5JWHA 1XJ0A 1F3OA 3DEFA 4TTRA 3BH6A 4HI0E 3R9IA 1Q3TA 3WMGA 5FH9A 3W8NA 2J0SA 1Z83A 3ADKA 2PL3A 3QKSA 3A1TA 5AUNB 3CX7A 4PQRA 4LWZA 1LF5A 4B75A 4PC1A 721PA 2O8DB 4O25A 3FHCB 1XMSA 1HQYE 2BBOA 2BMDA 2WJJA 1E99A 4LYAA 4IDQA 2JLWA 3EPHA 4V0ME 3U5ZB 2NO1A 2QRZA 4B6EA 1CR1A 2OILA 4W5WA 2R9VA 1OFUX 1R2QA 5BN4A 4BGDA 2C98A 5KU1A 2RGAA 5HE9A 2KE5A 2HXYA 4R2HA 4M53A 1C9KA 4QC2A 1E2IA 2Z43A 4PSAA 1G8FA 1D8TA 3IIMA 2E87A 2VRWA 3KKNA 2YYZA 3RABA 1U0JA 1KI7A 3OAAA 1OLOA 3AVQA 1SVWA 4YXWD 4G5OA 4QFMA 1FTSA 1N25A 4LRWA 4NKRA 3K0SA 1X1SA 3VKGA 1NN1A 3I3SR 4FD2A 1E4VA 3P4YA 3C8UA 4AYXA 1K6MA 2QSYA 4TTPA 1RJ9A 2GWHA 5KSPA 1SVOA 1NIJA 3NXSA 1J8YF 4W5HA 1SXJC 3FE2A 2WWWA 3E70C 2BDTA 2JEOA 3CRW1 4PHTA 3TVDA 1YU9A 2Q21A 1UKVY 1XMJA 4JBYA 4M1TA 4ZIRA 4FW9A 4TMKA 5FBWB 4LHZA 5ANRB 1GIAA 4M1KA 4P4UA 1BH2A 1G1MA 2CE7A 2OO7A 2P65A 4WOPA 2FEOA 1ZCBA 2OZEA 3SI7A 1JR3E 1NVUQ 3HU3A 4RJLA 4GP6A 2JLYA 1XP8A 2ODBA 3R8CA 3FHTA 2G77B 4BFTA 1U81A 4URZR 4M2LA 2QN6A 3GLIB 1FTNA 1E2FA 1E2HA 4BLTA 5C2JB 1MO5A 3OZXA 5FBRB 4DC9A 1OXUA 4MYHA 3A37A 4GBMA 4WXRA 2ZYTX 4P0TA 5EZ6B 3BK7A 1G16A 3RC3A 3WNBA 1W49A 3EAQA 2DFNA 4AG5A 3DHWC 4KHZA 1YR6A 1KMHA 4NP6A 4HUQB 2Q3HA 2CNWD 1GSIA 1JNYA 1KI4A 4LY6A 4PC6A 3GLGE 2CHVA 4D2IA 4YDHB 2YWEA 1GITA 3BC1A 3UG7A 2E9SA 1A4RA 2EYQA 4I99A 4OHWA 5A0FA 4BRUA 3I5XA 2JAQA 4JLPA 4JSYA 2WOOA 1NLZA 5AUOB 1JJVA 2AHOA 3GQBA 5HKKD 3AVWA 4UJ5A 4TSFA 5UKDA 4Z51A 1R5OA 1XTRA 5FL7A 1KO1A 4RD0A 4URUR 2WJGA 1DAHA 2BMEA 1GL6A 4ARZB 4EUNA 2VBCA 1Z08A 3T35A 4QKQA 4MKFA 2G6BA 3ZLJA 1VHTA 5FPHA 4Q4AA 1TF5A 4HYYA 1ODFA 4YMVA 3KKMA 3GLHE 4MKIA 2J87A 3MMPA 3B1XA 3L0IB 2ZM5A 1E6CA 2DWOA 3MUFA 4RY2A 3IQWA 2FEMA 1OSNA 5AJWA 1FMJA 4Q21A 1R0WA 1F2TB 3SS8A 4A4DA 3MWJA 3K9GA 2C2HA 1TF2A 2NO0A 2ZJOA 1VYVA 4HZIA 2BC9A 3SDZA 1XTKA 2VHCA 2QY9A 1UFQA 3CF0A 3DOFA 2PJZA 2IEYA 5EXSA 4O2LA 2FH5B 4DRZA 4MGZR 4JSTA 2RB4A 2KBEA 2OEPA 1XTQA 3EZ6A 2IK8A 4MRVA 3IO3A 3DDCA 1TU3A 4OQMA 2G0NA 4DCSA 4Z54A 2IS6A 3FWYA 1E4YA 4LYHA 4Q9KA 4KVAA 4LBVA 4Q1AA 2ZJAA 5JJIA 1G7CA 3KTAA 3U44A 4XD7A 3FMIA 2DPXA 3VHXA 3VX3A 4OI2A 4D4LA 3PITA 3BORA 3VR4A 2W2XA 1DAKA 4HB2A 2VA8A 1IY0A 1IN6A 2IWHA 1RRCA 1T5LA 1XEFA 2PBRA 3QUSA 2WPDD 4TQAA 1WMSA 5HPYB 1YZGA 1EGAA 3MG9A 1E2MA 4ERNA 2IUUA 3NH9A 4CZ2A 1R0YA 4M1WA 4IOLA 1E94E 2V4ZA 3R9WA 4ITRC 2BEJA 3B5JA 4H1VA 4MGYR 1Z0DA 2ZI7A 2GJKA 1G8HA 3RRNA 1Z63A 3THOA 4WBSA 2OV2A 4TWZA 1IHUA 4QGHA 3UMSA 3V4RA 3KXIA 3DM9B 1G8PA 2YC4C 4B43A 2H1LA 3NEYA 4HLUC 1RRGA 4KLZA 1AZTA 2ZSEA 3VQTA 1TEVA 2ODNA 3LA6A 2D74A 4CYMA 1UDWA 4D25A 1R8QA 5DI3A 4C4PA 3FPAA 1ZM4A 4AKEA 4MRSA 3LRPA 1XX6A 2JJ8A 4RD6A 4ZKDA 3TK1A 3I8XA 2CCJA 1NKSA 2QM7A 3AB3A 3VR5A 3KQNA 2H7VA 1ZM3A 2XTZA 2P67A 3TRFA 1NMZA 5KYKA 4ZDJA 3QG5A 5JECA 2C95A 4XIGS 1P73A 1CXZA 1T8TA 2WWGA 2NPIA 2D2EA 1VIAA 1XMIA 3VKWA 1XB2A 4Z8XA 1Z3IX 3C5CA 1Z28A 2NO9A 4BQSA 3OFND 1G5PA 4IKEA 1G7TA 4QNMA 3THXA 2P5TB 3OIUA 3W6PA 3LAWA 4B44A 4B71A 3ONWA 1UDXA 1VTKA 2YKGA 3P4XA 5EXXA 4B3CA 3B7GA 4FWIB 3MD0A 5FUXA 2BKUA 4FINA 1W5SA 2IYZA 3NC1C 4P3YA 3M4YA 4PAOA 2PEYA 3KUDA 5CM9C 3KZ1E 4OQXA 1OFIA 2XITA 3FB4A 1M7BA 1S9DA 2YWHA 4UXHA 2D7CA 2FG5A 3TIFA 1RPZA 3K0AB 2AK2A 2A5DA 2W0MA 1MOZA 1E9SA 1ZJ6A 1IN7A 2X77A 1BMFD 1PJRA 3ICQB 2XNDA 3LBHA 2L0XA 1KDOA 4A82A 2G3YA 1P2UA 3OIWA 4EFMA 4QHTA 4NCNA 4ZCLA 1L4UA 1L4YA 1JB1A 4NONA 4JLMA 3MGCA 4NE2A 5FTMA 2VEDA 1IQPA 2IYLD 4EPVA 3ZQ6A 3V00A 1II8B 2B21A 4LPSA 1H8EA 1ZC4A 2XB2A 3A4NA 5A5GA 1GNQA 1W48A 5AK0A 4B33A 4CEJB 4KO8A 3ZD7A 4N0EA 3RANA 4PR0A 4DT1B 4ZDKA 4DLZA 1NY6A 2ZITA 4GFDA 1E2LA 1Q20A 5JFGA 2WWYA 1TNDA 3ADBA 1NL3A 1OXXK 2GZDA 2WOJA 3PUYA 4BWYA 4I4LA 2QEQA 1YVDA 4Q9LA 4DZZA 3GPLA 3MWLA 1M7HA 1HEIA 3NBZC 5IRCD 1ZM7A 4HDCA 1A2BA 1E1RD 4A6XA 3NBYC 3BRWD 4YONB 2BIFA 1ZNXA 4Q19A 4BLOA 1R4AA 1VG1A 2O8EA 3LFUA 4ON9A 1G3IA 2Z5FA 3LW8A 4PC3A 3CM0A 4D0LB 5IK2A 2J5XA 4A2PA 4DDVA 5LDDC 1SXJE 3RWMB 3Q72A 2ERYA 1A7JA 1S3GA 1MRNA 2ZRIA 4LJ7A 3KQKA 1JBKA 3VHLB 2WTUA 3C41J 3BJIC 4NYMR 4LJYA 1QHHB 4QXAA 1M2OB 4DCNA 3LNCA 4XVUA 2ZI9A 3PUVA 3GFPA 5JI2E 4KJZA 1OT3A 2A30A 4UKDA 1YE8A 2MSCB 3HP1A 2VP5A 2AD1A 3AVXA 4FCWA 2FX3A 2KBFA 5TXGA 2V1UA 3QXHA 2V9PA 4PHGA 3BGWA 4CGZA 1HUQA 3EWSA 3IHWA 1G6OA 3O47A 2YV5A 4DJTA 2DFKB 4XOIA 2TMKA 5E7JA 1ZP6A 1ZM9A 1SKYE 4HZUA 5DLQC 4A2QA 4YMSA 3EG5A 1G19A 4KSBA 3T5DA 2ZI6A 4DEXA 1VYTA 4GMDA 4HB4A 2PH1A 4JL8A 2NIPA 3DMNA 3HWSA 1FUUA 3VX4A 1DOAA 4FMCF 5SZJA 4DSOA 3RC8A 1U94A 3SHWA 1OYWA 2QENA 1JPNA 4DSTA 2ZETA 4JLKA 4NCHA 2F55A 3GJ5A 5FUYA 3IEUA 2IF0A 4NCIA 5CIQA 4R9UC 2OLJA 1OXSC 1E69A 2GZHA 2VHTA 4IRUB 1RIFA 5L3VA 4CT4B 3LLUA 1KZ7B 4G5RA 2J3EA 1TL7C 1OF1A 3LXRA 3HJNA 2WV9A 4B73A 3KQUA 1ELOA 1P3JA 2WKRA 3AP3A 2QP4A 3CWZA 4DSNA 5J4HA 1DAGA 2FFQA 2ZE6A 3PIRA 3LQQA 4NYIR 1U9IC 2ZAOA 4PC2A 5HTKA 4AYTA 3U4QA 3BB4A 2JCSA 2J7PD 1KIMA 3WBJA 4BPBA 3CPEA 4BFYA 2J41A 4MGKR 1CJMA 2XNDD 1ZMXA 3ZYCA 2GEUA 2EWVA 2XOKA 3FKQA 1UF9A 1XD8A 4LHYA 1AA9A 1R0XA 1GWNA 1US8A 1NG1A 1T9HA 1TUEA 1XCPA 1XBTA 1UEJA 5D3MB 3U3MA 2JLUA 4HAUA 2AXPA 4LGMA 1GKUB 1OE0A 2EQBA 1N6LA 3UPUA 4URXR 4LV6A 3R7WA 1XD2A 4UJ3A 5KNBA 3DL0A 5AR1A 2WZQA 1QHNA 3EPLA 4KFSA 1F48A 3G0HA 3NH6A 3ZZ0A 4ASUD 2ZRMA 2ZSBA 2EWWA 3NG1A 3C14C 3LXXA 1XPUA 4ESHA 2Q3FA 4UNPA 4GDFA 3MWYW 1RJ9B 4MKHA 2JATA 1E9DA 1Z06A 2G0TA 1Z0AA 3EIQA 3FKSA 5BN3A 5FI1B 3RSOA 4NMMA 2GRJA 2ZRDA 3U6KA 1VCNA 2ZU0C 5JRZA 5FOWA 4C7OB 2XAUA 2NOAA 3TH5A 5FR1A 2QAGC 4TLDA 1R8SA 4OI0A 1M8PA 4Q4JB 4GZLA 1CEEA 2DWQA 5JBQA 1DO2A 2GCOB 3SYLA 1V5WA 1KSFX 1T8UA 5K8LA 1LTQA 1QG4A 1E96A 1GRRA 1OPXA 1K8RA 5CK4A 4C0BA 4C0LA 1N6IA 2AKAB 1Q22A 3LWNA 4B2PA 4B3XA 2QTVB 4HDOB 2WJHA 1AKEA 1FX0B 4GSYA 2H57A 1FP6A 2VO1A 4E07A 1CLUA 2GVZC 4RFSB 1P62B 2QZ4A 1P7CA 1N6HA 4JKYA 3AF4A 1YZUA 4LSGA 4AURA 4F91B 3QXSA 4IDNA 4EAQA 4OQFA 1DEKA 3CH5A 4F92B 2OUKA 4M22A 3HDTA 3I92A 4A0HA 2QAJA 2AXNA 4BE7B 4WXPA 2PMDA 4DCUA 3TR5A 3BD9A 1MH1A 1DELA 4ZCMA 5FTKA 1T91A 2R6FA 2GK6A 1XEXB 3HPRA 3QPWA 1HT1E 3KXLA 5JMTA 2BCGY 2RGXA 4LJ9A 4O3MA 1E9BA 3R8FA 1W36C 2F6RA 4LK2A 2YNMA 4P31A 2O0HA 3GLFA 2GBLA 2BWJA 4TL9A 1H8HD 2MSDB 3U2QA 2ONKA 5DYGA 4KYIB 1KSHA 2QE7A 1X3SA 1MABA 2BBSA 3H86A 3SBEA 1UBGA 1Q57A 2J0UB 1SQ5A 4GNKA 2FNAA 4PO8A 3REFA 2CLDX 4C0HA 2D2FA 4PTLA 2Q9CA 4R71A 4Q9IA 5CLLA 5AUQA 2BM1A 4M8NE 2F43A 4JLBA 1AS0A 4KBFA 1TU4A 5GVSA 2FZLA 2MSEB 4B76A 2YWGA 5CJPA 5H70A 1KSJA 4O0MA 2PT5A 5EUMA 4BFXA 3QJYA 5JRJA 1A82A 1M6NA 3OE7D 1ZVQA 2QGNA 5JI3E 2EFEB 5CIWA 5AJVB 2J7KA 2J59A 3QENA 3BH0A 3EA5A 5DN6D 4TYYA 1OHHA 2C9CA 2OFOA 4DDUA 4AI6A 2BOVA 5KOYA 1GNPA 2JJ1D 5EQTA 3SR0A 4TZ0A 2QRNA 4HUQA 4OYHA 4DEYA 1QHSA 4G3XA 2F1IA 3KKOA 4AC9A 1TEXA 2FOLA 5M04A 4B6FA 3HPQA 1TQ6A 2WMOB 3VNVA 3T1QA 1I4LD 1MO4A 5EP2A 3RYTC 4A92A 3JZMA 1UBCA 3DKVA 3I72A 4Q1CA 1T5IA 1YZKA 2A2ZA 5E95A 3TMKA 4C0KA 2ZRNA 4HB0A 2GJ9A 5FOTA 6Q21A 1E2DA 3M0EA 2Z4RA 2ZE8A 1F6BA 1XWIA 2GJSA 4KVGA 5IDVA 4JT4A 1YZNA 1U9IA 4LV8B 5JS7A 4LZZA 2R62A 2G88A 1SVMA 4IXMA 5GVRA 4FI3C 3GCGA 2WICA 3RS0A 1G291 2YVUA 3OIVA 4Q03A 5CLQA 3REGA 5K8UA 3LVRE 3KFXA 4BZQA 5C4GB 4C30A 4P33A 3PEUA 2XJ4A 1P72A 2HJGA 4P32A 4Q7JB 3EWAA 3I8SA 4GZMA 4A0GA 3GJ0A 2W83A 4II7A 4Q66C 3RRZA 1JQJC 2RGBA 5CYPA 3QEJA 1Q1QA 3L0OA 3AKEA 1ZNZA 2J0VA 1KI8A 3O8DA 3PXGA 3T34A 821PA 3SN6A 1KI3A 4TLCA 4YC7A 1QF9A 4AD8A 1M7GA 1PVOA 1X1RA 4K46A 1UKYA 4KI0A 5DSZA 1GZSA 4NZYA 4HAVA 3NTUA 3K70B 2K5UA 2GXSA 5EXPA 4Q5IA 3HR8A 3OEEA 3KQLA 1L2TA 3E5HA 1W4RA 3GLHB 3LD9A 4DUGA 3QI2A 4TLEA 3CZQA 1EX6A 2IYTA 5TB5A 3SE0A 5BYKA 2QL6A 4JVNA 4Q4HA 3N2IA 1KTVA 4MYUA 1CU1A 4I1SA 3M6AA 1YQTA 1XPOA 4F4CA 4KITB 1KKMA 2FZ4A 5EXTA 5JHGB 3C5HA 4JZKA 3I32A 3I5YA 1LB1B 1II8A 4EPXA 1IXSB 2BMFA 3TBKA 3GFTA 4M1OA 3TUIC 4TMWA 1G21E 2G1JA 1UKEA 4EFNA 3DVLA 3FTQA 4F4JA 1WDTA 4TZ6A 2GAAA 3AF0A 1NJGA 2GXUA 4OI1A 5DE3A 3K0CA 1E9AA 3BOSA 3E1SA 1MV5A 1N5IA 1VHLA 2FSGA 2ATXA 4TN1A 4ZI2A 4B3GA 3GJ8A 1S3SA 1XTJA 3X1WA 2F43B 3H2YA 3W5JA 1GKYA 3H84A 4DVGA 1GL7A 3GEHA 3UMRA 1OHHD 4MYTA 1XU4A 3TW8B 2YZ2A 3O8BA 3W34A 3UXMA 1RRPA 1NIPA 1Z6AA 1K5GA 1T3HA 3IBYA 4KXFB 4GOXA 4RFVA 421PA 3QF4A 3FYHA 4PFSA 4RD1A 2ZJBA 3CRRA 4PHFA 3L8YA 1SKYB 2PX3A 4P4TA 1KOFA 1P9RA 4ZDWA 2HYIC 4FCVA 4OQLA 4ZDIA 3AUXA 5KDOA 4L15A 1EK0A 1XZQA 1KYIA 4LCBA 2QG6A 1J2JA 4OHXA 3PEVA 2V1XA 2RGEA 1QZXA 2WSMA 4G01B 2JJ2A 4IVRA 1P60A 3WP0A 8OHMA 5L8VA 1NY5A 3NWJA 1UAAA 4O2RA 3LDAA 3LX5A 3B78A 3X1YA 3OF5A 5CB8A 1P4SA 2KB0A 3RHFA 1W0KA 1Z07A 4B32A 2GF9A 4Q4HB 3T1TA 1I2MA 3AKCA 3CH4B 4KCGA 3ASYA 3K9NA 4QJ3A 2WSSA 2N46A 4AIIA 1FPMA 4Q1BA 1WF3A 1FNNA 2IC5A 1HE1C 2ZUCA 3K53A 2ZE7A 2VPPA 1IXRC 1WBBA 3Q5DA 4BEBA 2DB3A 4DDWA 2ZIAA 4PPGA 1VKJA 5C46F 1DG1G 2O0KA 2D4HA 3U6BA 5FPTA 2JDID 1LVGA 2HYDA 1OB2A 4Q9JA 1HV8A 3TAUA 1RW4A 2X2FA 3PUXA 1VECA 3FFBA 2RAPA 2FDCA 2X8AA 3UWKA 2R44A 1R6BX 3D31A 4LJ6A 5CDFA 1AQUA 1UBFA 3GLHA 1QHGA 4LOAA 1HURA 1QVAA 2VP9A 1II9A 2RMKA 3PR1A 1XXHE 4IW3B 4RKFA 4MRRA 2NZ8A 4ZCIA 1WA5A 3EIHA 3QF7A 4DLRA 5BQ5A 4WAUA 5LPNA 1DARA 2ZYWX 1P61B 5HCNA 1FP7A 1G9XA 2CHGA 3WHKA 2QA5A 2QROA 3JVUA 2BJVA 4JJZA 3VU9A 4KYUA 5AUPB 1RVDA 3HYTA 1WE2A 3HYRA 1S8FA 3WRXC 3TUZC 3OAAD 1MT0A 3CRQA 4MQBA 2OAQ1 3SQXA 1R10A 2OCPA 2W6ID 4R98A 4B74A 5KDDA 2PEZA 1ZINA 4PHHA 3ZS8A 1D9ZA 4Z8YA 2KWIA 3B1WA 4M0LA 2NG1A 1OJLA 2PZGA 3AVOA 3CRMA 4M1SA 4RKEA 2QSZA 1P9WA 3AVYA 4TMXA 4CEHB 3OESA 4P4SA 4M1YA 2O8FB 4HLUA 2B7BA 1OIVA 1H8HA 2EYUA 1NVVQ 4PZYA 4BFZA 3THWB 2HLDD 2O8EB 1CJKC 4G0NA 3AF2A 3K9HA 4IDOA 4V0MA 2WJYA 3A1UA 2WIBA 3B9PA 3CNLA 3IBGA 4C0SA 5JLJA 5FTLA 4LX0A 1XJQA 1VYUA 4I1OA 4JKIA 2VYFA 4RZUA 2ZRKA 1D6JA 2HJVA 2G83A 5EE9A 5K8TA 1NG9A 1P2VA 1W2HA 5JJLA 1E9EA 1E1RA 5HZKA 4GOKA 3ZVLA 5HE8A 4FMDB 2GILA 2WJIA 2IYRA 2D7DA 4JLVA 2ZS8A 1GFIA 3KB2A 3AGQA 1CS4C 2WSSD 3TNFA 1OIWA 2AR7A 2ONJA 2IEZA 1M74A 2Z0MA 2AWOA 1VCOA 3TW4A 2GAOA 3A58B 1Z6XA 2FMXA 4UXIA 1XD9A 4TYQA 3ZDQA 3QXJA 1X8LA 2VP2A 3GJXC 1XPRA 1OH7A 3KB1A 2JA1A 3K70D 4C7OA 5AJXA 2F3TA 4PX9A 4DKXA 4QBHA 1W2GA 3LV8A 1JI0A 3RSLA 3KJHA 1G8YA 3QSYA 2R8RA 2VHUA 1DPFA 1RYFA 3UK6A 1KI2A 2CVHA 1GG2A 2QTFA 4DBLC 1Y63A 1UM8A 2ZUDA 3FVQA 4YLGA 2VP6A 2FGKA 4NYJQ 1G4AE 5C1BA 2QE7D 1HTWA 4V0LA 2NQ2C 2I1QA 2PZFA 1XZPA 4IOKA 2O8CA 1CBUA 2F7SA 1TQ2A 3B9QA 4IEIA 2HCJB 1Q21A 5CJ2A 1JECA 1HE8B 2ZJ5A 4F7WA 4B47A 3RVBA 5L3QB 2IW3A 4M9QA 4TMZA 1G20E 2ZR7A 2ZQ5A 2YINC 3WHLA 1Q1BA 1W5TA 1YRAA 2CJWB 1TPZA 5LB2A 1G5TA 5IT5A 3CRVA 2KI5A 2X1VA 1G6HA 2LKDA 2PJRA 5LBIA 4FXPA 1N5KA 1CJTC 1ZCAA 4L16A 4NDZA 2FJUA 1KAGA 4PC7A 5L3SA 3IPYA 4PQYA 2XZOA 3GJ6A 3P26A 3CF6R 4ZV4A 1N5LA 2OCYC 2OFWA 4LHWA 3W9YA 4A0FA 3GMTA 3WMFA 4Q7KA 4R2IA 1W4CA 2ZR9A 4XWOA 2IS4A 3PV0A 3J81k 2YC2C 1QHXA 3WNCA 1BO6A 1X8JA 2VQSA 2OFXA 2C9YA 1FQJA 4OJQA 4EPRA 3UWOA 1NP6A 2BCJQ 1ZNWA 4E09A 2V55B 3F5FA 2ODWA 5JWRA 2CLSA 2GCOA 3MLEA 4OK5A 1I4TD 3KJGA 1IOZA 2W00A 2QPAA 3UMFA 4QNRA 2OM2A 2DFLA 1D2EA 1QDEA 5F3WB 3TQFA 1W4BA 1IN8A 1Q3HA 4HLQB 2C04A 2EFDB 5E7MA 2A9KA 3IHLA 3DKPA 3X1ZA 4OKSA 1DADA 1KI1A 3R9XA 4RSGA 1E2PA 2ZANA 4JIMA 4EJSA 2A5JA 2CHQA 5IK2D 1CTQA 3ASZA 2DHRA 2PLRA 4US2R 4NYMQ 2HEIA 4I1UA 3U3KA 1SVIA 4CEHA 4URWR 2N1BA 4WZBE 1WQ1R 3GEEA 2XEXA 3LX8A 3TGPA 4JL6A 2FU5C 4IVPA 4EFLA 1I2DA 2JIZA 1XCGB 5FPSA 1ZD8A 5FBVB 2V54A 2O8CB 4I1VA 1CR4A 4KAXA 1BMFA 2WAXA 4IFBA 4JYCA 3L2OB 3Q5EA 2ZSAA 3CPHA 4JVLA 4GMXA 1TQ4A 3RRMA 4ACBA 2HT1A 2IYSA 2QT1A 4D82A 1NRJB 1JAIA 1WP9A 3ND8A 2WM9B 2D3WA 1VDZA 4LJ4A 2RKOA 2A5FA 2OESA 3A4LA 4FMCB 3U3RA 1L8QA 2Q3MA 1QHYA 3K0FA 2ZRAA 1XEWY 4H9GA 3BH7A 3GJ4A 3QPVA 4BLPA 2OXRA 621PA 1MABB 2HT6A 5JWOA 3QKUA 3KUCA 5DNYB 4NYIQ 3A6PC 4XJXA 1NBME 1NBMD 3Q85A 3PENA 4L9WA 4JLDA 2W2VA 2YWFA 5DO9A 1KMQA 3U7HB 3Q7QA 2IS2A 2GEVA 4V0KA 1OFTA 2ZREA 2MMGA 3ZIAA 2ZRLA 5DHAA 1LV7A 3WYGA 2FV8A 3IEVA 1ZUNB 1YZLA 1CR2A 4ARZA 5HZHA 3L82B 1AKYA 4IXNA 2UZ3A 4YDSA 2ZSFA 4ZPXA 1ETUA 3EIEA 2AL7A 3QNUA 4N1AA 3G5UA 2FFBA 2P6UA 3KX2A 4DIDA 1JQLB 4Q48A 1YJ5A 4OJKA 4PQFA 1EFHA 2EFHB 2JLSA 2G1KA 2VP0A 5BYJA 1AZSC 3CONA 4IHQA 3GEIA 5BWMA 3AP1A 2Z6VA 5EP3A 2OHFA 2VSOA 2WVJA 3MJHA 3S1AB 5KNDA 3EX7C 4HAZA 1Z0FA 3WYAA 5F9HA 4RD4A 2QORA 3GP8A 1XF9A 2CXXA 2P0EA 4W5JA 1G3UA 3B82A 5F98A 3GD7A 5SZIA 4LYFA 4WVFA 5HKKA 1JALA 1OKKD 4BFSA 2XXAA 1K5DA 4C0JA 3QXXA 1IAQA 1U8YA 2ORWA 4LPKA 1XRJA 4IEEA 2ZRJA 4L9SA 1Z6GA 2ZR0A 1U90A 2GBLC 1XNJA 1II0A 1ZUIA 2FN4A 1E9FA 3IDQA 3QG1A 4PZLA 2REXB 2IBMA 4US1R 3RS2A 4U00A 1OXVA 1F60A 4LHVA 4C3ZA 3DOEA 3Q8XB 3GJ7A 4TMTA 1NSFA 2CL7X 1LS6A 3BFXA 1Z29A 2XSZA 1NI3A 1PLLA 1S1MA 2BV3A 1KZGB 3OFNA 4BECA 1S96A 1E1QD 2JLVA 2FE4A 1G41A 1D9XA 4TL8A 1KY3A 2V6JA 3FFAA 2XZPA 4EJSC 4V0OA 4RFSA 4DUGD 1FX0A 2AK3A 2IUSA 2QU8A 2ZROA 4L4UA 2GETA 2CLCX 5TY0A 5GJVC 3NVAA 3QOFA 1MR3F 1W44A 2IYXA 1R7RA 5KTYA 1COWD 3CPJB 3N2EA 1IY2A 4PANA 1SULA 3ZH9B 1Q0UA 1OXTA 1NMXA 2RGGA 4D4JA 1KO5A 4JBXA 4QJ5A 2G9NA 4JLNA 3K9LA 4DHEA 5DI3B 3QY0A 1FMLA 5FUWA 4B34A 521PA 2CE2X 1E79D 2IYWA 3PUWA 3FMPB 3LBIA 3CNOA 5J4KA 3UG6A 4UQOA 1DVRA 4XH9B 1DAFA 2BBTA 5GADl 1M34E 1P2SA 3CWQA 4KFTA 2WWIA 1HT2E 1WB9A 3W6OA 2JLXA 2AFHE 3K8YA 4Q00A 4B35A 2WWHA 2GA8A 2I1VB 2WWFA 1KY2A 1KNQA 1G64A 2OBMA 1XMVA 1J7KA 1T6NA 2HCBA 4B2LA 4PSVA 4HLCA 4KFRA 1EG7A 3K0AA 3EPKA 2OBNA 1I4DD 2C9OA 2ZAMA 3AV0B 5G40A 3WMEA 5GJBA 4YXWA 4BASA 4JYBA 1TAGA 3FMOB 4GT1A 2OLKA 3ETLA 3A1WA 4IOJA 4A36A 1ESMA 2W6IA 4A1FA 1G8GA 2ZUBA 3SEAA 1W0JD 1CJVC 2ANBA 1T4GA 5B2ZA 3P32A 5H1YA 4XWKA 4TYNA 1GL9B 3TE6A 3A8TA 5HCIA 3ADDA 4DIEA 1N2CE 3PFIA 1EFTA 3BERA 2OE2A 1BYUA 3CIOA 4C2UA 1VPLA 2ZTSA 4Y0AA 3RWOA 4A8JC 2YJTD 5EE1A 3BWDD 3IGFA 3O8RA 4Q7MB 4TL6A 3ICEA 4URVR 3B1ZA 1N6OA 3IIKA 4OK3A 1FZQA 1GUAA 2A7QA 4NHOA 4Q02A 1P6XA 2C03A 4M1MA 3U3OA 4KBGA 4NPHA 3WXMA 4GPTA 4JLOA 3KQHA 1OKKA 1S0UA 3KKPA 4X8MA 3AEZA 1P9NA 1MRSA 1N3BA 3EASA 2OG2A 3ZS9A 3OIYA 1YR7A 4AY2A 2PCJA 1E0SA 3NEJA 2WMNB 4F4IA 3A36A 2V7QD 2XGJA 1YZQA 2VP4A 2XX3A 1X86B 3PVSA 4D80A 1Q1EA 2IYUA 2VHJA 1CRPA 1AS2A 3SJBA 2EU8A 4Y0VA 3WRYC 4OL0A 3FKSD 1U98A 3C7KA 3TJZA 3T15A 1CR0A 3OHMA 2DR3A 3W90A 5FBLB 4ESVA 1W47A 4GL2A 1ZAKA 2C99A 3F8TA 2QBYA 2O8BA 3BE4A 3SBDA 4BEJA 1T3LA 2UZIR 2IHBA 1RE0A 2GCPA 1NVWQ 2DYKA 3VR1A 2E1RA 4D4KA 2FFAA 5FL7D 3VNUA 4Q4LA 4LHXA 4NH0A 2ATVA 1DAMA 2VHQA 1U0LA 5EZ5A 5J4LA 1FNMA 1RC8A 4JBWA 2ZPTX 4DLYA 3WP1B 3ZGXA 2JJ2D 2ZU6A 5F9FA 2DCUA 4CW7A 4E5UA 4AKHA 2RHMA 5JEDA 2LCFA 1FOEB 4D0GA 1WXQA 1KI6A 2F1HA 2FA9A 2EVWX 4D26A 1G18A 1XEWX 3TAHA 2NGRA 4QBFA 5K8IA 1Z0KA 3VR3A 3NIBA 2QTHA 4OI4A 4FCTA 1Q1ZA 3VMFA 5B58C 3IPXA 2B7CA 2QPOA 4JLJA 5LB4A 2F9LA 4S2EA 1C4OA 3CR8A 4WIAA 4QM7A 3JVVA 1OIXA 4EIWA 5B64A 1GM5A 2NO7A 3UIEA 3THWA 1TUIA 2CK3D 1A5TA 2BEKA 1NN3A 2B6HA 2O8FA 1JPJA 1SGWA 2WJVA 1YRBA 4NYJR 5EE5B 1PV4A 3RLFA 2ZEJA 4LC1A 1KDTA 4XD7D 3PUZA 2JIZD 1AK2A 1M1YE 2NTYC 3TUJC 2XJ9A 2RHDA 1ZNYA 3OEED 4B3FX 3RAPR 2ODEA 3PJRA 5FI0B 1ZIPA 3LH5A 1GP2A 3H1TA 1U2RA 4L5BA 1ZIOA 2BHRA 2REOA 4PXAA 4HAYA 4IFEA 3IQXA 4B3DA 4QRHA 4OHYA 5G41A 3K09A 3I73A 1MO6A 2KSQA 1E2KA 2FWRA 1GKIA 4DSUA 2WIAA 1BIFA 1AGPA 2F1JA 4L8GA 3A4MA 5EUQB 3KXKA 3B60A 3Q3JB 2LWIA 4QG7A 2VSXA 5AWFC 1UBEA 4A6PA 1JAHA 1JEEA 3T5GA 1EWRA 3QEOA 3I4LA 2B8WA 3N5CA 4QJ4A 2NPFA 4C9BA 1CULC 1RKBA 3T61A 1SHZA 3FHOA 1NKTA 2ZI5A 3P20A 4BZXA 4LJAA 3SYNA 2GJAA 1EFRA 3WYFA 4G1UC 4WZAE 2BKEA 1EFCA 5F2EA 3ZZTA 1W36D 4C0QC 4TTQA 1T3SA 2QP3A 3D8BA 5IF9A 3THXB 4RVCA 4A9AA 3SNHA 3O8CA 5FOVA 4QHSA 5AJYA 1OW3B 1OH8A 4P4SB 1Z22A 1CF4A 5EE0A 3IILA 3WNDA 3M1IA 3RS5A 1P5ZB 1EFUA 5G3YA 3T1VA 3KJIA 4AKGA 1HY3A 1G3QA 1E2NA 3AKDA 3HU2A 4HAWA 1XD2B 4PPNA 4C2TA 3ZVRA 5JCZA 3BFVA 4HDQB 4QHYA 1BYIA 3KDSE 2W0SA 2JASA 1NVVR 3H0KA 1N6NA 3QBTA 4D4MA 4DLSA 4DB2A 3GLFE 2B92A 5P21A 3I61A 3EC1A 2QMEA 1HH4A 2GXAA 1IN5A 1YR8A 2VIIA 3Q7PA 5TVKA 5TMPA 1FQKA 5G3ZA 3A1SA 1CRQA 2VL7A 3MFYA 4IDPA 5BW8A 2JGNA 5TDHA 4FWTA 3NDPA 3NDBB 2A3RA 4JS0A 2C8VA 3SOPA 2IXFA 1WRBA 1E9RA 5LD2C 1ZU5A 4Z1MD 1GTVA 3NBXX 3PCRB 3CNNA 2CCKA 1GILA 1ONBA 2IUTA 2QNRA 2R65A 2WAYA 2WPDA 2WWXA 4TSFD 4EPWA 5TARA 3EZFA 4CF7A 2PZEA 1BKDR 1IJFA 2HXSA 4LI0A 3GLFB 2IXGA 2VF8A 3CO5A 3TR0A 2IL1A 2ASEA 2ZRCA 1PLJA 5KPDA 1XEXA 5J4VA 2GHIA 1OH6A 3LW7A 4MH0R 2AX4A 3QVUA 4JVSB 1NBMA 2GDJA 4MITA 5EE3A 3X1XA 2W6JD 3EC2A 3L8ZA 3K1JA 4YMUA 1JR3D 4KV9A 4EPTA 4HAXA 2HLDA 1QRAA 4V0NA 2IA5A 4AKIA 2AN9A 3QVVA 2ORVA 2DWPA 2QBYB 2EFCB 4F38A 2GTPA 4M21A 4W9MC 5CK5A 1HA3A 3ECCA 2GZAA 3W5IA 1Q12A 4XSGA 2GVDC 2J46A 1HQCA 4QGAA 4Q1DA 1FFHA 2QAGB 5FPKA 2V7QA 2ERXA 3IUYA 4F93B 3LBNA 3G82C 1NSTA 5CITA 1P75A 1E32A 3NBFA 1N0WA 5L3QA 1Z6TA 1JR3A 3U7EB 1SVLA 1OFHA 2YHSA 3IIJA 4CVNA 1G4UR 2BBWA 3SQWA 3B1VA 1VMAA 3QE0A 4N0DA 3AVVA 1CIPA 2J7PA 1NLFA 1AJEA 5JEEA 1B23P 5KSZA 1XTSA 3THYA 1E0KA 1US8B 4ABYA 4LC0A 4DLTA 1U8ZA 1KMHB 2HF9A 1F5NA 4KFUA 221PA 3QKRA 1Q44A 5KSYA 3LLMA 4S35A 4LUCA 2HF8A 4NBSA 2R6DA 5IHPA 4JMPA 2AKYA 3U4QB 2PMKA 3FOZA 1SZPA 1U8AA 1E2GA 5KNCA 4KU4A 1TX4B 1RFLA 4EJSB 4DLVA 2ZRPA 2VF7A 4LDJA 4KSCA 1S1CA 2FGJA 1KHTA 1E1QA 2WKQA 4XWAA 4AYWA 2BMJA 3D7MA 1KDPA 3BB1A 2WBLC 1NF3A 4HSEA 2W2TA 1OH5A 2ZJYA 3W3ZB 4JT2A 1DO0A 1IBRA 1SVSA 3QKTA 3BB3A 2H5EA 1XXHA 2SHKA 3SU8A 1W46A 2CL6X 1UPTA 5JJKA 4C0AC 1GRNA 5FTJA 3VR2A 3OE7A 1NVXQ 3E2IA 4YMWA 5KPJA 4RD2A 4MUBA 4V03A 121PA 4EQ6B 4N3NA 3CF2A 3CW2A 2JLZA 2H92A 2XXAB 4WZ6A 2DY1A 2X2EA 3DPUA 3DO6A 5E7IA 2GNOA 2AD5A 1E9CA 2PX0A 4ZO4A 1XTIA 4NL4H 3L43A 1W7AA 3H4MA 4DCTA 2WHXA 2ZYVX 1JXOA 1J99A 3GLIA 2Z83A 2R6CA 5FUVA 4Q18A 4DB4A 1W0JA 1OV4A 1N6PA 1G3MA 1SKQA 2ZSDA 4JJKA 3C15C 2CEAA 1L7VC 1VIYA 5DIFA 2P6NA 5ELXA 4EQ6A 3N70A 2F3RA 3TQCA 2GESA 2QQEA 1NNEA 2RGNA 1Z47A 2DFTA 4PPFA 4Q7LA 4RZ3A 4ZIRB 1N6KA 2ZRHA 4LJ5A 3CX8A 4OHVA 4WA7A 4V02A 1ZC3A 4CEIA 1TQDA 5DI9A 2Q0HA 2XOKD 2QPTA 5L3SB 2IYQA 3AVPA 5AJZA 3T12A 5D3MA 1KSGA 4HB3A 1SXJA 1V43A 2QMHA 5KUTA 2Q6TA 4XSHA 3ZD6A 4LBZA 2FSHA 2CJWA 1R0ZA 3MCAA 4K81B 4BFWA 2FF7A 4LBYA 5BN5A 2UKDA 3B2EA 3UATA 4PO9A
chains in the Genus database with same CATH superfamily
1XL0A 4XVQA 3FDIA 4XZ3A 5K6AA 4A7PA 3QP9A 3JATB 1V8OA 4J75A 4YMTA 4Y6LA 1MIHA 1QIHA 1KI9A 2ZRBA 3AGPA 4CDMA 5B2FA 3EUWA 3ZI7A 3GFOA 3WB9A 4TRNA 4EZIA 3DV9A 1TM3E 3WJAA 4FVTA 4IICA 1ZRHA 3GLQA 1LNZA 1SVKA 1VCIA 2VSYA 4JL5A 4I8IA 2WE8A 1L8AA 1V4BA 2ZI4A 1MUUA 1RAGA 2C29D 3QELA 1U7HA 1CC1S 2PT7A 1MDFA 4FX5A 3RUCA 4XEHA 3TLEA 5D3QA 4Q1EA 4ZKEA 4CMBA 5CG2A 1BRMA 1OJ7A 1RYBA 4QGFA 5FJIA 1W94A 2Y27A 4L7VA 3S2GA 4LI3X 2EEPA 4EO7A 1DQSA 4TKLA 4HVLA 1U3GA 4BGIA 2O2CA 3FIUA 3D3QA 1JLMA 1L1FA 1IY1A 3D4OA 1Z0JA 5JBIA 1FC0A 4WCFB 5I7EA 3PEWA 3LQRA 3RO7A 4U8HA 4HQRA 3CNEA 3E3OA 3H8WA 1ZSNA 3IFSA 4QU9A 3U4AA 4DJ5X 4Q4AB 1J4AA 2QF7A 2W8BA 3DBRA 1H3FA 2GZSA 4AJPA 4KO4S 4LZNA 4MCAA 4XIJA 1W0KD 1WPGA 3ICVA 1U2ZA 3KLPX 3VUEA 2B36A 3CJQA 2MSNA 1IWPB 1SO8A 2VSFA 2PKQP 2ZS9A 3BHIA 1WZEA 2AQHA 4PTZA 2YS7A 3BBPA 2VK4A 3CJTA 2GJ8A 4JU9A 4DGSA 3RC7A 3HSYA 3DE1X 5LUBA 3JXEA 1IN4A 1KDRA 4NBRA 4RS4A 1A8PA 3RRFA 3RFXA 1NUHA 4JLUA 4BUCA 3PQ5A 1HDEA 2HSWA 3R7BA 1WP4A 1H2HA 2QN7A 1PUIA 3O74A 4EJ6A 3ESCA 3K9CA 3UYLA 2CDNA 5CEEA 4HQFA 4P54A 5IMSA 3WNBA 2BMVA 1ZD2P 4A73A 4PZ0A 1DRWA 3IKJA 4KAAA 1YMUA 1AKRA 2B1QA 1SUFA 3E58A 4JUFA 1CS0A 3U3JA 4JXXA 1AN0A 3GAMA 4OLAA 1VZ2A 2QG9A 2R6AA 1GA1A 4OGLA 4X20A 2ECFA 2CDAA 2C5GA 5J3JA 3CEHA 2AFIB 4WUTA 1UBHS 1YJBA 4XTCS 3TVYA 1RM0A 3S8YA 5ECYA 1ZSYA 3C16C 1EZZA 2C9DA 3AU8A 3DM5A 3EVGA 4UNIA 1AA6A 3NHRA 2RGNC 4CKCA 2IJGX 4GUAA 5DH9A 3VSBA 5CDFE 4J4BA 1GZ5A 5HIKA 1ZK3A 4QE3A 1T8WA 2R7KA 4G5QA 4CHGA 1UP4A 4BE9A 4RO0A 1JSXA 1S4QA 2Z8YM 1L5VA 4O4HA 4RH0A 3OPNA 3FPSA 1FUKA 3ITNA 4Y1RA 2F4VB 1LW7A 3AERB 1VG9B 1GUFA 1LCIA 2ZJ8A 3G59A 4IDAA 2CN1A 2R97A 4WZAB 5CAEA 1T0HB 4EABA 2FVYA 3P45A 1GVNB 2ST1A 2PZAA 4PO3X 1QX3A 3FWHA 1PLKA 1KJYA 3PQ7A 4Y7DA 4E22A 2ZJ2A 2FPOA 2DFDA 3QYFA 2FQXA 4EPYA 4GVPA 2CBZA 4TXLA 2DKFA 2BD0A 2PWPA 4AZ3B 4KR6A 4OXRA 3T7RA 5IASA 1E3WA 4R54A 3RD5A 1J56A 1PD1A 5FORA 2CL0X 1IZ0A 1NUQA 5FULA 3AR9A 4NE9A 2AJTA 3QVKA 3RQIA 1U9YA 4FI3F 3VXKA 3AP2A 3JD2A 4QECA 4BRSA 5ITZB 1TDJA 5C52B 5F1OA 3MUEA 4WV3A 1R16A 1GXSA 1NXSA 3NHLA 2HOQA 3GJZA 2Q5IA 5C81A 1UC8A 5IMBA 5KYVA 1W73A 2OCAA 5HNKA 1OWPA 3KJEA 4UOQA 1W1WA 5CYFA 3H17A 2OAEA 3PIDA 3GRUA 4BRWA 1ZK4A 3EMVA 4ZEVA 2FI1A 3QVMA 5KTRA 2JFFA 1F3LA 4PCUA 1MJNA 1JUDA 4F5WA 2VH5R 2G63A 4FC7A 2O48X 4U6SA 3UKDA 2Q9BA 3SK0A 1VL6A 3G8BA 1G3RA 1J22A 4B4OA 4MYSA 1BHO1 1P2TA 4RA6A 1EP1B 1NR1A 3H0EA 3KTAB 4ZT3A 4KQXA 1JU4A 4QUGA 4FQ5A 3F3YA 1PD0A 4OSPA 1IU9A 1TA4A 3DUFA 3PGVA 2I9PA 3JQAB 4LX8A 1K9SA 1JWBB 3GELA 2DTXA 4FFBB 3HFJA 4LNAA 4NCKA 4J49A 4QFCA 3BWYA 5K8VA 4WERA 4DYHA 2IU6A 4OIFA 4J43A 5EKXA 1IJBA 4UNNA 1L5OA 1JE0A 4N3CA 5KI6A 4L8FA 2X1MA 2JAXA 3JQBA 3P0JA 2R6GA 4LV5B 5CFPA 1SCJA 1X7WA 3BS4A 1VQ1A 3HMKA 3H1BA 3PX2A 5KWSA 2V96A 1ISFA 1LJ8A 2SBTA 2OPHA 2GD1O 4JHXA 2G70A 3D81A 1PZNA 4QL3A 3ROKA 2ZYUX 1SEPA 3FLEA 3Q98A 3SJAA 1NN5A 4XCVA 1E2JA 4AT1A 3SX0A 1TTTA 1NZFA 3CW9A 4HATA 4IJ5A 4NV3A 3RNLA 3SE7A 1QHHA 4OIMA 3ZJTA 3U4HA 3N2GA 2FP4B 1UM9A 4RELA 5B57C 3N28A 3OZSA 1UBLS 2MU1A 3DO5A 1WM1A 3MWGA 1PRYA 1VLHA 2RIPA 4YJDA 2BGRA 3FCSB 3E22B 2O23A 3F6PA 4FBMA 4WK2B 3RBAA 4LMAA 3V2UA 4CKEA 1L5RA 2L42A 5FNZA 1BDHA 5DGHA 1OAOC 5K3BA 3B13B 4OH1A 1UBTS 3LTEA 1JHAA 4OM7A 2AN3A 1T26A 2WHQA 5L45A 3OJWA 1WKVA 4HWRA 1UOQA 3WY9A 1MHTA 3C0KA 2MDTA 4IDHA 3ZY3A 2MIIA 1DRUA 1WBDA 3NATA 4D6PA 4LDAA 3GRRA 3ET5A 4JUCA 3T1OA 2XUAA 1E3EA 3KAPA 4DA4A 4NTZA 3LOQA 3GCZA 1G8JA 1XQ9A 3A70A 3CLSC 3O38A 2RGDA 1D2HA 4QELA 5GWXA 3HJHA 1G38A 4M36A 4P7GA 4GC5A 2QLBA 4CFYA 2NV2B 3TFQA 3Q9LA 2NXJA 1W29A 3WA6A 1FFYA 2XDAA 1JLRA 1ANKA 2NT4A 2QQ0A 4DLKA 3U09A 3DR3A 2WKPA 2EBWA 2FPKA 1JVBA 1YT5A 2AIRA 3ED1A 4N7RA 2HMTA 4TVBA 4Y2UA 1KEKA 4YP7A 1L7QA 1BD3A 2KJQA 2JIOA 1BQ4A 3IR7A 3WBKA 3V6LA 1NN0A 1VE7A 4DFDA 3S7TA 4C4RA 4U9UA 1Q16A 1Y7PA 2Q4RA 3DVRX 1V7PC 3T9CA 5I7VA 1NQ5A 3AJAA 4HQ6A 2QI9C 4RKRA 4YFVA 3ZHUA 3FUCA 4ZWNA 5CVUA 4V38A 3STUA 3GO4A 1EVYA 1TZKA 4CIAA 3HKDA 1X38A 4HWOA 2AG6A 1W88A 3TKLA 1L7XA 3UQYS 4CMHA 3K15A 2ICAA 4KV7A 1L1EA 2F9FA 3CUEF 5FTNA 5IBPA 4OKIA 4ZHQA 5LVAA 3RF7A 3NHZA 4XVRA 5BSKA 5K05A 3ABIA 3H5IA 4I81A 3FPCA 3PC2A 2XADA 1KGDA 1GDDA 4KGVA 1CIVA 1Y3AA 1JSRA 3BMOB 1GAJA 1NUAA 3HKEB 1PSWA 2O5VA 3FPEA 3KSRA 1E5VA 3DEAA 3PQFA 2FPLA 3F4LA 3PJGA 4A8JB 4ZCPA 3B6EA 5JSZB 1J49A 1PUJA 1QANA 1ZN2A 1E7WA 4H2DA 3IS3A 3ZHRA 2HU2A 5KX5A 1P8AA 4MULA 4IHAA 3BWBA 4LCJA 3IKLA 4BFVA 1RNLA 2AWNA 2GZRA 3K94A 1NX6A 3SC4A 3W8RA 3SFVA 3ZJ4A 4GKKB 1HORA 1VL0A 2XSZD 1GPWB 5TGZA 3ZC3A 1M2HA 3GJ3A 1CDDA 3BRSA 5BORA 2LD4A 4XIFA 1V9SA 1DQZA 3DE3X 5CA1F 4GI7A 5IJWA 1XRQA 1N2XA 2DH6A 2EBUA 5I9NA 3IDSA 2NADA 1EXMA 2BSXA 3H3XA 3MJEA 3L7AA 1GCAA 2XTMA 4XPIA 1E2QA 2W8ZA 4IZIA 3SIXA 1NBWB 2QP9X 1QBKC 1Q7TA 2B4YA 4FR2A 2WNSA 4M6WA 5IKEA 1XK7A 2ZRGA 4ILEA 3TDMA 3MMXA 1P0MA 2FDXA 3T5BA 4AXXA 1TMKA 5LKAA 3FI9A 4G5GA 1U0NA 1FIUA 1BEZA 1F1BA 1IXZA 1A9YA 1DKOA 1VB5A 1V9LA 4I55B 1D4ZA 1XE3A 2HWKA 1UKBA 1B6RA 1KBZA 2YOHA 3VPBA 3ZTYA 5FHQA 5B4VA 1L4LA 4GVXA 4PBTA 1FDTA 5FLXA 4KKVA 2BHLA 5K0BA 2DULA 4PAMA 3K32A 1IONA 3AVTA 3PNLA 3NHUA 2IUEA 5LZ7A 3EOBI 1U0HC 3U60B 3NC4A 1YUBA 3ACCA 3CR7A 3LL4A 3EXEB 3Q1KA 3VR5H 2A88A 3ACDA 4MGIR 5TJHA 4BFUA 4D0NA 3CLRC 2HA7A 2GBCA 3I30X 1QGED 3NYIA 4O02B 2IXEA 3FM9A 5LCXA 4G81A 4QRDA 5H3LA 1YBHA 4MO9A 5IJ9B 3CMCO 1BS1A 1DZ3A 1M66A 1RKXA 1ITZA 2RB5A 2I2WA 4IDGA 3NJ4A 4O6VA 4D44A 5CFZA 3EXAA 1TZ2A 2B1GA 3EF0A 1RYNA 4MUAA 3OHPA 4N9WA 3ZQJA 4YRAA 3R23A 1VHDA 5FI5A 3DEHA 3GCDA 4WKPA 1G7RA 1YRQA 4NOLA 3FDFA 3NBQA 3C45A 3TSWA 1N6RA 4DTIA 3FUWA 1RWNA 1TF7A 1C3OA 1VI6A 3KL4A 1JB9A 2XWSA 4FOPA 3ZDZB 4JWKA 4F1WA 4UNRA 3RH0A 4BO8A 5AKIA 5I01A 3PDIB 1DEXA 3DE5X 4LOLA 3M9XA 2AI3A 3DA8A 2B99A 2HJRA 2ZJ3A 3B8HA 4XQEA 2IX3A 1KO7A 3H1FA 2J0UA 4WJLA 1Z26A 3I0NA 1D6NA 4CIBA 1YK0A 1UFOA 2CNWA 2H5IA 1SCUB 3OEHA 4U02A 2EDAA 3A3YA 3HRIA 2NVBA 3OU7A 5AM3A 2OZLB 3VTKA 4N8SA 2A5YB 1NYQA 2ZKIA 2OBXA 1ZM2A 4L5CA 3DZ8A 3KV3O 4D1YA 1U2TA 4P5DA 1ORRA 2ZBRA 1WMFA 3CX6A 3U7GA 1NF2A 5B7GA 1D4OA 4U7WA 1RQ2A 1GPLA 2VDQB 4EB0A 2FW8A 3IVRA 2IIVA 3CLVA 3SDBA 1C9DB 4E2FA 4LJRA 3RVNA 5IH3A 2L69A 5K0FA 1UAYA 5JWHA 7MDHA 3WYEA 2CV1A 5D2CA 1TVCA 1J1ZA 4HI0E 2R7MA 3GDGA 5FXMA 3TOSA 3SPXA 3WMGA 2WINI 2F62A 4FE3A 1QHFA 1Z83A 3GT7A 4GX0A 4BZZA 1H4VB 1BN7A 1QFZA 4LTNA 3PZBA 5E9AA 2YZNA 3UEOA 4KQKA 1O97C 1D1QA 1XEAA 2XGMA 1NC3A 3L05A 4Z49A 1PO7A 5CB0A 2XI4A 1ZJJA 3PGA1 3FHCB 1XMSA 3MJTA 2X0EA 4BP3A 2XDWA 1M6WA 1HLPA 5EIOA 2EHDA 3EPHA 2EKDA 4IILA 4B85A 4MW5A 1FBNA 3GCXA 3U5ZB 4F5EA 4OQEA 3P9YA 2QRZA 2OYSA 2VUIB 3VZSA 4ENQA 1O96B 4N3AA 2R9VA 1OFUX 1QBGA 4BGDA 2VPTA 2E82A 3NAMA 4P0PB 4QDUA 2JFPA 4QC2A 1VLJA 5IBCA 2Z43A 2A1IA 3GYBA 1C9EA 1M2NA 1V7CA 1JT9A 2NUTB 2FUKA 1EE1A 2HBRA 2VRWA 3HI4A 3HXKA 1UT8A 4L02A 3RABA 4KNYA 3HB7A 1TM7E 3AO0B 5CH3A 1OUMA 4DXHA 2AG0A 2AZ4A 1C2YA 1KARA 1XGKA 1H23A 2WEKA 4G5OA 5JT1A 4QFMA 1N2BA 5D7BA 2M1ZA 2PSEA 2VJQA 4LRWA 3K0SA 1EE9A 1X1SA 4WY8A 3TD9A 2TYSB 3CN9A 5MN6A 4OYRA 4FD2A 3SKVA 2VWGA 4C4TA 1JKMA 2QYHA 1M6EX 3T0IA 5TSDA 2DX7A 4AYXA 4PRLA 4AP5A 4Q34A 2AOUB 3VPDA 2H1IA 1SVOA 4MB0A 1M5TA 3RFCA 3SZMA 4LN1A 2JRCA 4CQMD 4IO1A 2I1WA 3R3ZA 4G4SO 1L7MA 2Q21A 3H2BA 5CR9A 1CZKA 1URPA 3PDJA 2HY7A 1MPXA 1UKVY 1XMJA 1L5QA 4JBYA 3IVGA 4FW9A 2BT4A 1BSVA 4M1TA 4LHZA 3LY8A 2VSNA 4TMKA 4WSOA 1BH2A 2P65A 3B53X 3HB9A 4ZVNA 3SI7A 4WFQA 1JR3E 1MJGA 1ZH4A 4ZVOA 3RC9A 3TI7A 4BJ5A 4GP6A 1JFSA 1OU0A 1ZN9A 1XHEA 2EQ5A 2ODBA 3PNKA 4XX0A 5IAGA 5DLDA 2G77B 4CHTA 4BFTA 1IDOA 1U81A 2UUCB 1L7DA 2LDBA 1E6KA 2VQFB 4ALIA 3MQ4A 3RHTA 1CY4A 1E2HA 3UZUA 2FMTA 4ND3A 1JFRA 5FBRB 5BVGA 4BO7A 3D1JA 1L5ZA 2QTBA 1G2QA 3M34A 3EQ9A 4R40A 5TT1A 1KBQA 1G16A 1DIAA 1HE4A 2G8NA 2HM7A 2WAMA 3NASA 4WZBA 1KRHA 4KHZA 4NP6A 1Y9AA 5FAXA 4LY0A 2CNWD 1KI4A 1ICIA 2AOUA 5NLLA 4PC6A 5DM1A 2YWEA 1GITA 3UG7A 1I7DA 2GLUA 5GONB 5JXIA 1GPNA 1A8HA 5SYAA 2H5JA 1CZOA 4GQAA 4R84A 5BRNA 1KVUA 2G1AA 4I99A 4OHWA 1YJCA 4E46A 3ZE0B 2GJ4A 5JCOA 3R7FA 4V24A 1V8BA 5D84A 3FYUC 1NLZA 3ZDRA 3OLVA 4MQ5A 2OD7A 4I5DA 5HJ5A 3L8MA 4O1MA 3HLYA 1PNOA 1QZTA 1T1IA 4FMPA 3AK4A 4NU5A 4XDGA 5ESXA 3ROXA 2A0YA 1YVPA 4Z51A 1XTRA 4EY6A 1E6EA 3FVRA 1DEOA 2Z3WA 2B2XA 3R0JA 1LPSA 3OQMA 1JA9A 4NZOA 4D41A 3FOWA 1VP9A 3KR2A 4JASB 3JVIA 4L5YA 4ARZB 1QOQB 4UHCA 5LC1A 3UCXA 4RJTA 1M72A 4EZEA 3L18A 2G6BA 4Y0NA 1NR7A 3ZLJA 1SKAA 4Q4AA 5IVDA 2AC7A 1ODFA 3GRAA 5EPEA 3RG2A 3K6KA 3TDNA 1XAIA 3H6HA 4XFKA 1FFWA 1E1CB 1FMCA 1N2OA 3B1XA 3VU8A 2ZM5A 3QYPA 2AZXA 6ADHA 2VYND 2DWOA 1LSUA 1BS9A 4K05A 3KG2A 3LPDA 3MTEA 3A9SA 4LVUA 4MPPA 3RSGA 4M1EA 4ZAZA 2YBDA 1WHTB 2VDRB 4YJ3F 3T4UA 3WWDA 2H0RA 2VJPA 5IZCA 2TRSB 1PZGA 1TF2A 1ECBA 1TGYA 3FMGA 3NM6B 4HZIA 3SDZA 3O9VA 1XTKA 4U2DA 2VHCA 3GJSA 3X1MA 2QY9A 4EG7A 2PJZA 4MUGA 5K0ZA 1FRQA 3ZDEA 2A9RA 1M1YA 3K5PA 4HGZA 4O2LA 3VO1A 1YOVA 3S5JA 4ZGWA 5CM2Z 5B4TA 2AI2A 1J97A 3DBVO 3S1SA 4MRVA 2K6GA 2ZIFA 3IO3A 4GEGA 5AW3A 4Z54A 3DUFB 2HSGA 5ALEA 16PKA 5BVHA 1WW3A 2WHPB 3IBTA 5E38A 1U3DA 3KTAA 4XD7A 1NU6A 4JYZA 1QU2A 3RIYA 4IR7A 3VHXA 2CFTA 1OTYA 3HBLA 3QUAA 5A05A 2IV7A 1UBNA 2CNDA 1IN6A 3E61A 5BN4B 1T5LA 1XEFA 1BXKA 3SIPA 3V2IA 5BN1A 2AN5A 3EGWA 2A1UB 2G9RA 1D0VA 3G02A 1UPBA 2MYNA 3QTTA 4WK6A 1YZGA 1EGAA 1PQYA 2IUUA 1R0YA 3TRJA 4M1WA 4C0XA 4IOLA 1VKNA 4RK7A 1L4MA 3R9WA 1PQUA 2H2WA 1IZYA 3C3KA 5LZ4A 4RS3A 3MWFA 3ZDXB 4EKNB 3RRNA 2Z04A 4MAAA 2OV2A 1UQTA 1RXUA 3V4RA 4OXXA 3GT3A 3DM9B 5BWBA 4Q3BA 2YC4C 4MV9A 4ER7A 1DCMA 5JVDA 2D8AA 2H1LA 3I2JA 3OTIA 3GUYA 2H7YA 5CYGA 4H3SA 1D4FA 2ZYSA 4TTSA 4CYMA 3A6DA 3L4KA 1JHZA 1R8QA 4C4PA 1SHJA 4LMBA 3AM3A 4L27A 3FPAA 3TPCA 4R69A 3IYLW 4AKEA 4AKSA 4M8KA 3ML1A 2GEFA 4B1FA 1JG3A 4MMYB 2YFHA 2H7CA 3DAGA 3I8XA 3KOXA 5AIAA 5DTQA 5E0KB 5F3DA 2QM7A 1QDUA 1GTZA 3B38A 3PFNA 5KVVA 3FY4A 3HHPA 2XTZA 4MWDA 2JVJA 4WNCA 5DMXA 4LF7B 1QKIA 3IOBA 4M6WB 2HA0A 5JG7A 5C5DA 3EQ2A 3WGIA 1GU1A 2XXBA 2C95A 3RTDA 4F4UA 4PGHA 3EQ7A 4XEUA 3HJGA 4W8HA 1PFVA 2NPOA 2NPIA 2WWGA 1T5TA 4ISBA 4PCLA 3O4JA 4KWHA 4RE5A 4XI9A 6REQA 4LHSA 2FDRA 5K3EA 5EFZA 1MENA 3ZKAA 3MD9A 4UBNA 1H2RS 4Z8XA 1CR6A 1Z28A 4G67A 1NNUA 4IFTA 3ORYA 1G5PA 4D98A 4P0QB 5K2OA 1G7TA 2BSQA 2RHBA 2ISSD 2RK4A 2P5TB 3OIUA 4ZPJA 1Y6QA 2NSJA 4FFBA 1UDXA 4GX1A 3DW1X 4ZVMA 1JNXX 3MD0A 3FJOA 2BKUA 4FINA 3HMQA 1FYXA 3NC1C 4RA6B 4PAOA 1X7YA 2O20A 1J2RA 1MXHA 2OC9A 4KK4A 5CM9C 5EEGA 3KZ1E 4L4XA 3T99A 3FB4A 1M7BA 1S9DA 1A5ZA 1KQOA 1DINA 1ULBA 3HVHA 4UXHA 4EG6A 4ND2A 1XWFA 4AO7A 2AK2A 4F9TA 3B12A 2W0MA 3D54D 1MOZA 2R8OA 3DTVA 3C3XA 2FW7A 3EMBA 4YCJA 5HDBB 3KR0A 1PJZA 2PSJA 2VUTA 1WUJS 1TTPB 4QOEA 5ICFA 5AOAA 5IDYA 1FMTA 3DWEX 4DA8A 4EGSA 2E5LB 1H66A 4F84A 2O7RA 1KDOA 2VPWA 3EZNA 4KXXA 2ZUWA 4I36A 4YACA 1BX0A 1C3EA 4ZCLA 1L4UA 1L4YA 1M5UA 2Q7OE 3A3OA 1FDSA 2G28A 1C7QA 5FTMA 2IYLD 3QI7A 1WCIA 1II8B 1ZC4A 3Q3GE 4JI5B 2PH3A 1OOEA 3WLQA 5C34B 5GM2A 1GNQA 5CT4A 1EDEA 2YVAA 5T4EA 1OYOA 2N75A 4CKBB 1VPDA 1E62A 2RHLA 3IAXA 3RANA 4QTYA 1QX4A 2Q8PA 4ZDKA 3UFXB 3LK7A 3ZCRA 4Q7EA 1YKFA 1V45E 3HN2A 3RGGA 4IMRA 2B5VA 3HUFA 1VKHA 5JFGA 2WWYA 2GZDA 4MR7A 2C4KA 5DM0A 1G8KA 1L4HA 2QEQA 3HABA 4O4HB 5JFTA 1F2DA 2Q3CA 1UODA 3LC7O 4LXHA 4RKWA 3HE3A 1ESEA 3NBZC 1N2JA 1PEAA 3P97A 4INZA 4RUKA 2K7FA 4WE3A 1A2BA 1E1RD 3PC3A 4BGEA 3D6FA 3DTVB 4RTQA 3UJHA 4YONB 5AI5A 4UUNA 1CE8A 4BLOA 5IAOA 1VG1A 5AW9A 1NVTA 3EOAI 1BU8A 2BZ1A 3LFUA 4YCLA 5AOVA 3FYCA 3A31A 3NT4A 3CM0A 4L57A 4K7JA 1N0IA 3P5BA 2DPGA 3CBGA 2Y0DA 1RAIA 3A14A 5LDDC 5E2IA 2VAWA 1JYEA 2QLNA 3HUTA 2BDEA 3OQIB 1MRNA 3AHDA 4WHMA 5E6SB 1JBKA 3VHLB 3KQKA 4NYMR 5DM4A 9MHTA 3KZOA 4QXAA 3EPRA 2IYEA 2Q0QA 1M2OB 1TK2A 3AV3A 3QPBA 3PUVA 5EERA 4ZYUA 2KX7A 1LLFA 1FSGA 4G0QA 3HCFA 4RKQA 2R1TB 4EKIA 2RHHA 2IZ7A 1HLDA 2PGIA 3GFPA 4KJZA 4WH0A 2A30A 4K1LA 5HZGA 4YASA 1CD5A 2OHXA 2XVZA 3QYJA 4E7PA 2KBFA 3AEQA 5FA6A 1GQSA 1RBYA 5CCDA 1HUQA 3ESQA 2ZK7A 3MLBA 4OQYA 4JENA 3WJ7A 3OTWA 2RG7A 3IHWA 1T9BA 3O47A 2YV5A 3AUUA 3UN1A 1ENZA 2GZMA 2IHVA 1OLSA 2JIBA 3C6YA 4PLYA 3VYWA 4DJTA 2E3JA 4B7AA 1VJDA 5H81A 1NP3A 3DMHA 3SIWA 3DV0B 4A2QA 3N76A 3LT0A 2IFTA 2JBWA 4IP0A 3UJCA 5B3JC 1VYTA 3ONVA 2AFRA 4B6GA 3AC0A 5HGJA 3I6ZA 3CW8X 3N8IA 3CNBA 2IPNA 3DMNA 3IR6A 3OZCA 4QTUB 3VX4A 5FWNA 4FMCF 2V6FA 2XDQB 2VDOB 4QDOA 5SZJA 5U4QA 1JEYB 2FPPA 3BMNB 1RI4A 3H65A 1PT7A 4DSTA 4I50A 4Q6BA 4RVUA 2IKQA 3IEUA 2IF0A 2Q7XA 2WMDA 4NCIA 4O63O 4RETA 1AHPA 3Q4GA 4RHEA 1KZ4A 2GZHA 1E69A 2VHTA 4EUFA 4IRUB 1RIFA 5JNVA 2OAGA 3LLUA 5CA0F 4BKUA 4NV1A 1QAQA 1XA3A 1J8VA 3RIXA 2J3EA 1Y81A 4TKVB 3IB3A 5GZ3A 4RGVA 3BREA 2QZPA 3GLRA 2YQ4A 3HV2A 3TZHA 3HNRA 5KHAA 4FDUA 4B73A 3ZWWA 3KQUA 1NBOA 3E3LA 3TEMA 1WULS 3H3JA 3IT1A 2HSEA 1AGYA 2VT3A 1DCTA 3VNQA 4XD2A 4ZO9A 2QRGA 5K01A 3P9IA 3PIRA 5KWIA 1LK5A 1U9IC 3KOUA 1R4NA 2PO5A 3U4QA 1AKMA 4ODIA 1KIMA 3WBJA 4BPBA 3CPEA 4BFYA 2J41A 5LYJA 1OYVA 1K0FA 3F7TA 2ISQA 4Y18A 3DLBA 5KVSA 1ZMXA 3E05A 5TVGA 2EWVA 3FJYA 2AMYA 4D9IA 1UF9A 2XIQA 3GXOA 4I5FA 3VI4B 3ZWDA 4FE4A 1NG1A 3WFIA 4HFJA 1WABA 2JLUA 2AXPA 3GHYA 3HJTA 1C7IA 2HH9A 3HWRA 1ST2A 3EVBA 5FNVF 3UBMA 1CWUA 1QDLB 4LV6A 3R7WA 4LVNA 3DL7A 3NYQA 2VJYA 1JDBC 2VI5A 4LOJA 3VO9A 3EPLA 1WCYA 1GSAA 2QTTA 1PYDA 1VIDA 2H9IA 2K2WA 3K7EA 2CZCA 1XZBA 1X87A 2DSTA 3OLZA 3PQ8A 3MRXA 4OFBA 2EWWA 3ILVA 4FFVA 2UYGA 3H2GA 4H4DA 4UNPA 3SCZA 2JATA 5DASA 1CZNA 1E9DA 1Z06A 2X0NA 2YY6A 4LYYA 5U1PA 4ZVUA 2ZRDA 3GN1A 4I1RA 4C7OB 4Y2QA 1SR8A 3TH5A 2J3IA 1Y3FE 2V7XA 4HDSB 4TLDA 2DQ4A 1BA3A 4DYDA 3HXQA 2H11A 3PRYA 5JBQA 3SYRA 3QWHA 3EF3A 1V5WA 3H1PA 4YR7A 1T8UA 3L1KA 3L6UA 3WTCA 3NM4A 4C07A 3IKTA 5HUJA 1OX5A 3AR2A 3UJ3X 1XN1A 2ENUA 2OV1A 5C35A 2UZ0A 4L78A 1NV8A 3KB8A 1N8TA 1OAOA 3EQZA 2AKAB 5CK4A 3B7PA 3CRZA 4B2PA 1MB4A 3NAGA 4B3XA 4BJ6A 2WJHA 5B3KA 5CCXA 3TNJA 3BRCA 4Y9UA 1FX0B 2ZKLA 4EB3A 4GSYA 4KTTE 1NRIA 4L08A 1M54A 1CLUA 2H9YA 4C03A 2XGSA 5EINA 1YRHA 5LIRA 2XXJA 1GZ3A 1NULA 4QOHA 1N6HA 3NRBA 1TZJA 3H5WA 4U2KA 2IYAA 4D9MA 1YZUA 2XOEA 1AHNA 1ZA1A 4LSGA 2PNJA 4QUBA 3U48A 1T2DA 4OQFA 4Y8VA 4IQ8A 5GIPE 4YP0A 4AJ9A 1R0CA 3LECA 4FR0A 1QQAA 4L6CA 3AY6A 4V39A 4YO8A 5MDHA 3AETA 3BJRA 4YCCA 1JEJA 5KS2A 3NP7A 3R5FA 4Z3DA 1IB6A 3N39C 4PYQA 2R8YA 1CQWA 3URKA 4G63A 2AZMA 3Q88A 4YB8A 3BD9A 1MH1A 3KLMX 1O97D 1DELA 3AXTA 3LLCA 4IBOA 4ZCMA 3AM4A 2R6FA 4J2OA 1U0RA 4FDTA 1Z35A 3RK4A 5I45A 1CEXA 4RDHA 3ITDA 3GA7A 5DYWA 5FF9A 4M9UA 1JTFA 2BCGY 3A6HA 4MWSA 2B6NA 3LUPA 2BEWA 1E9BA 4QSHA 4UVHA 1XVIA 5EMLA 4DV2B 4C5AA 3EUEA 5C9ZA 5FWYA 2V0GA 4G37A 2JLWA 2P2SA 1W5EA 4UBLA 2FFRA 2GBLA 3NALA 3KEQA 3KJQA 1GRVA 4QPJC 4C29A 2UXCB 2RK6A 3TLYA 5EJ4A 1GKLA 2ONKA 2QR5A 3DZCA 4OTZA 1XJ5A 5A03A 1E4EA 3CXUA 3OIFA 1V6SA 4WOJA 1UBGA 1YOBA 4D4GA 5HXAA 2J0UB 4GNKA 4PO8A 4MLZA 2GI4A 3COSA 1JDJA 2H63A 2ZUSA 4PZCA 1RJFA 3UFXA 1ZEJA 5I4CA 4YCSA 2XQKA 1PR9A 5DYYA 4JLBA 5GVSA 1AS0A 3DMFA 4QYXA 3NWEA 3R9XB 1QO7A 5C3UA 2FZLA 2AGVA 2YWGA 5H70A 3AFMA 1OA0A 3EEFA 3LQYA 4O0MA 3QJYA 2PM8A 4XDHA 5JRJA 3CLUD 1A82A 1N9KA 2DTDA 1G55A 2CDCA 2Y1OA 3RU2A 4E4YA 1DB3A 4U2FA 4RGQA 1GCOA 4X0EA 5ILGA 3UCFA 1BRTA 2EFEB 3KZKA 5CIWA 5JI3E 1E18A 1LDYA 1WS6A 1VHJA 2J7KA 5EMJA 3VVBA 3BH0A 5BQXA 2V97A 3EA5A 3I05A 4OL9A 3R9KA 5DN6D 1SVUA 3J7TA 1OHHA 3DEZA 2C9CA 2AQ8A 3DZFA 4HDMA 5LWQA 2OFOA 1NQWA 4DDUA 1N36B 4F21A 1PT9A 5DGCA 4OD0A 3FLAA 3IT3A 4PZDA 4R3UC 5ER9A 2QRNA 4HUQA 5KTOA 2BYTA 2F1IA 4LSMA 4NI5A 1GTRA 1WD7A 2C00A 4OREX 2FOLA 4B6FA 4TKZA 1YDMA 2J48A 2YXLA 1L7OA 5IDQA 2WMOB 3ROQA 3VNVA 3M6VA 3T1QA 1I4LD 3RYTC 1A3CA 4A92A 3JZMA 3PHBE 1MFPA 2ONYA 3MCWA 1T5IA 1YZKA 1MJ5A 2AOWA 1DQYA 1UOOA 3DLPX 4WJKB 5EGNA 1EQAA 4N5IX 4C0KA 4HB0A 4ATNA 2C61A 4J2TA 5FOTA 2Z4RA 4BO0A 2Q6VA 4FK8A 5CDSA 1RQNA 3GWZA 1I3MA 4RPGA 1C2TA 1SWWA 3NHJA 3TD6A 4Y6OA 1PT8A 4C6SA 1U02A 1RSZA 3L7YA 4PSUA 5JS7A 3ZI0A 3DKIA 2WRZA 1X2BA 3ZW7A 2R62A 1IZ9A 1NI5A 1AZWA 1V5FA 2XUZA 3INNA 2YZGA 3REGA 3BTUA 4XGRA 4C4ZA 4ENTA 3KFXA 1DCKA 2C4VA 3EH2A 5C4GB 4KIWA 1USWA 3MJ4A 5EWJA 4WNYA 4R4JA 2PX6A 2ZSIA 5A3RA 5M7EA 1X19A 2HJGA 4P32A 4Q7JB 5EWLA 3VC2A 3EWAA 2JI4A 3KCNA 2R87A 4A0GA 3ZHTA 4Q66C 2ZIWB 4BNXA 2A8YA 3AL2A 1FYEA 1JSCA 2C2YA 3RRZA 3UA3A 4ENWA 2B8NA 5BYBA 3TZEA 2H1RA 3PD1A 3PXGA 3O8DA 1EM6A 1ULTA 1QYDA 3PYLA 3T1NA 4AD8A 5IZ4A 4PVCA 4JJ4A 2QJWA 1ZH8A 1QH1A 2XDYA 4GR5A 2IGTA 1G4HA 1EX1A 1QC5A 4RACA 1YNSA 1L5YA 2VNIA 5FI3A 2EF1A 2W2QA 1SEVA 4PX2A 3V6MA 2AG8A 4KQWA 4EEXA 2JGRA 1I10A 2QX9A 3SKYA 2GXSA 2OB2A 5ITWA 3CUTA 3NVMB 2CBGA 2O7VA 2ZT8A 4GOOD 4H18A 3KQLA 3KD3A 1DAOA 1W4RA 5F33A 5F78A 5FYQA 3LD9A 4NBNA 5B2EA 5IANA 3HS3A 1DKLA 1EE2A 3AT1A 3QTLA 4KMRA 4Q3AA 4DA9A 4DDHA 4LECA 3SE0A 1GA4A 2IYTA 4IJ6A 4REOA 5TB5A 4C01A 1PJ4A 4FN4A 1MC8A 2B3DA 1OCEA 3AI1A 3K20A 3PNSA 1KTVA 4KG7A 4C4SA 3BL8A 3ZBUA 4D8UA 1RLOA 2M2IA 1BOOA 1CU1A 4MYUA 1KZ6A 1YQTA 3PR3A 3CH7A 3NFYA 4LWOA 4TMYA 3H6GA 4EYEA 5JHGB 2BUCA 1HYEA 3CKKA 3I5AA 5EHIA 2DHDA 3PTLA 2C84A 4ZOLA 5HK8A 4UTRA 2BMFA 4FFDA 1KYWA 3M6UA 2ZLBA 4Y6SA 5CT9A 4JUBA 5BWNA 1ZOSA 2VZ9A 4EFNA 4F4JA 2O1SA 4G0PA 2I7DA 4YA6A 1L5SA 3H9EO 5JSQA 4JI4B 5KINB 1JLLB 1VPVA 2OWEA 5DE3A 2RH9B 1E9AA 1ZD3A 3BOSA 4HFNA 3KKZA 4J1TC 1N5IA 1SOAA 1VHLA 3E22A 2IHJA 4NCAA 4O2BA 3F4KA 2XCOA 2BZGA 1S3SA 4BNNA 5IZCC 3W7AA 2FHSA 3HXPA 4M98A 3HVRA 1XU4A 5LBTA 1NW4A 3ZG6A 3PI7A 2YZ2A 5JTTA 1TT7A 4R2WA 2H6EA 4RDCA 5HF8A 4RFVA 2RARA 3JQ7A 2D4AA 3QF4A 2D5IA 1TVKB 3WLEA 4BNIA 4B3TB 3CRRA 4ISCA 1I24A 4PLGA 2OKCA 1RTKA 1Z8NA 2ZBUA 4J3FA 4JEIA 4YRSA 1KOFA 1LWOA 4G41A 4EJ0A 1PVDA 4YT4A 4L3WA 2Q5EA 3SR3A 3RF6A 1CQJA 1RPTA 2DKNA 3JD0A 4M83A 1AQ6A 1HDYA 2P35A 5CPFA 3S2UA 4WRRA 4YWJA 1NVMB 1IY9A 3CVYA 4ZDIA 2CDBA 3CVXA 3BQNB 4B6JA 3IP3A 3VYTB 2PTGA 1X9GA 2QG6A 4YRBA 4KXUA 5FA8A 4IF6A 3L6BA 4NDNE 3HBFA 3L3BA 1RXVA 1J5XA 2RGEA 1L1QA 2C5FA 1IBCA 1J2EA 2GO1A 2WSMA 2XB8A 2XMSA 3QU2A 1ADYA 1CUWA 3WP0A 2VQ6A 4BX3A 2OORA 3KETA 3QX3A 1UAAA 3MXTA 3ZXIA 1DWUA 2P6MA 3BJMA 2NU7A 3DG9A 3OF5A 1VSVA 2QV0A 3FDJA 1USUA 3W78A 3RHFA 1Z07A 4B32A 1ISPA 2GF9A 1I2MA 4KCGA 3CH4B 4OXIA 4EI8A 1YBAA 2PFKA 1VA4A