4GP6A

Polynucleotide kinase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQLKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Metallophosphoesterase
publication title Structure and mechanism of the polynucleotide kinase component of the bacterial Pnkp-Hen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 66
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gp6A00
1KAGA 1AK2A 1W4CA 3CRMA 2G0TA 4ZCIA 3KB2A 3QI2A 2LWIA 5F9FA 2QE7D 2UVQA 1JEEA 1N6IA 2IK8A 4Q4AB 4IOKA 4QC2A 1JXMA 2CCGA 2QENA 2NMVA 3KFVA 1TNDA 1QHXA 2RGDA 3A1VA 3ZDQA 1CJUC 1UKYA 2YHSA 3L0OA 5EZ5A 5BXQC 3N2IA 1Y63A 5IHPA 3EC1A 4YDSA 2DPXA 3QVUA 1SVSA 3AF4A 4BLPA 4Y0AA 4BEJA 1YZKA 2REXB 3KTAA 1GL7A 4QRHA 1E99A 1KSFX 4OQMA 1X8KA 1D2EA 1P9RA 2YWHA 2FGJA 5DGXA 5IF9A 2J41A 3K09A 4URZR 1N6NA 3I73A 4Q7LA 2Q9CA 3IIJA 1XWIA 4Q4AA 2PBRA 3FPAA 2PX0A 3Q8XB 3QXJA 1CLUA 3FTQA 4HATA 1EK0A 3NEYA 4BWYA 4A15A 2XOKD 4Q66C 2FX3A 3L2OB 2B8WA 1MOZA 4EJSC 1F2TB 3SJCA 4JBWA 1KK0A 2IYZA 1YKSA 4JLMA 1UM8A 2WWWA 3RVBA 2GBLC 3UWOA 1X1SA 2BKEA 2ZVPX 4XVQA 1Q1BA 3OIWA 1E2JA 1E1QA 4JVMA 4LBZA 1H8EA 3CF2A 4MRNA 3ZQJA 4MYTA 5LBIA 2EWVA 5FPTA 3L0PA 3MWKA 2C95A 3LVQE 5DLQC 3WMFA 4PSKA 2AD5A 5DIFA 2WBLC 4DSTA 1W4AA 4HLDA 5EE3A 3IO3A 4BRUA 2EFDB 1IAQA 1F2TA 1NVWQ 2QMUA 3HJNA 5L3QB 3OF5A 3QBTA 3UPUA 5D3MA 2GVZC 2OEPA 4EFLA 1SXJB 5K8UA 1A2BA 5AJZA 3CNOA 2ZYTX 2GZHA 2GHIA 1KO4A 1OV4A 1WF3A 4B3GA 3O8RA 2ZRDA 3EC2A 4QHYA 3OEHD 3B9QA 4N0DA 3PXGA 1M7HA 1KDTA 2CHQA 1QHGA 3RS5A 1W49A 4AY2A 2BBTA 2YJTD 2Z4SA 1IXZA 4KBGA 3E5HA 4Q1BA 1T5IA 3IQWA 4R7ZA 3T5GA 3NBYC 4PPFA 5DN6D 1DTSA 4JMPA 5L3QA 3LXRA 1U8ZA 2HYDA 2OZEA 3V4FA 5TXGA 3RC3A 2BM1A 4BPBA 5LD2C 1SXJA 2WWFA 2Z4RA 3PFIA 4KYIB 1P6XA 5TY0A 5FUYA 2CBZA 3FFBA 4IXMA 2IL1A 4YXWD 3K70D 4QFMA 2WZQA 1KMQA 3EA0A 2QROA 4EUNA 3RWMB 3TRFA 3E70C 5DYIA 1I4LD 1G3QA 4M2LA 4B3DA 4KHZA 4AYWA 821PA 4A2QA 4B32A 4TYYA 1XZQA 3BC1A 2CLCX 4JLPA 3KQUA 1SVWA 4A2WA 4B34A 1E2FA 4LHVA 3TE6A 3GJ6A 5A0FA 4MRPA 5CJ2A 1NG1A 3D8BA 1KKMA 4QM6A 1KKLA 2W6ID 1M74A 1G4AE 3WRXC 3LX5A 4Z1MA 1AA9A 3G0HA 1Q1QA 2TMKA 1FP7A 4KLNA 3NHBA 1G8YA 2Z5FA 3AKEA 4M1TA 4NU0A 2V54A 4NH0A 4PC6A 5J4VA 1OT3A 1E2DA 3THOA 3EIQA 1P9WA 4OL0A 3AVUA 3EPJA 2XZPA 3AP3A 3QE0A 3X2SA 3GCGA 4ESHA 3U44A 2FSIA 4QGAA 4NCHA 1UBFA 3LBNA 4URYR 3C5HA 4TLDA 4DBLC 2ZI5A 1F6BA 4B74A 4EFNA 3VR2A 2ZR7A 2OBNA 1JECA 2WJYA 4PXAA 2E9SA 1IHUA 2K5UA 3IHLA 4JSYA 3IPXA 3FFAA 3RHFA 5TDHA 2YWFA 1TADA 1MH1A 4HAVA 2R8RA 1PJRA 2WVJA 4FMDB 5DH9A 4MQBA 4BFUA 1Q3TA 4BZPA 3LFUA 3HP1A 3LLMA 1MV5A 4M1YA 1AM4D 4TLEA 2P65A 1RW4A 2GF0A 1ETUA 2HT1A 3CZQA 4QHSA 3ND9A 3FGNA 1VG8A 2H1LA 4D81A 2XXAB 2DFTA 2LKCA 1W0JD 1EFCA 5JJLA 3BD9A 4E09A 1OFUX 3CX6A 1VYTA 1X6VA 4P4SA 2QAGA 4IOMA 4MKGA 5CM9C 3ZVNA 2VRWA 2W0SA 2C2HA 3SJAA 3AVXA 1AS2A 1E1RA 2OV2A 1Y3AA 1AS0A 4LJ4A 5E3HA 1ZM3A 3U4QB 1OB5A 3LV8A 4QJ4A 4UNNA 2X19A 4Q00A 1B23P 2OT3B 4QL3A 4AIIA 4V02A 4A6PA 2XXAA 4ASUD 3K0FB 1U99A 1QHSA 4C3ZA 3DKPA 1IY2A 4NZYA 3QSYA 2EW1A 1C4OA 3MFYA 1GRRA 1GIAA 3BH6A 2CCJA 1SVMA 1FMJA 2IXEA 3RABA 4C2TA 1ZC4A 4LK2A 4H1UA 4AKEA 1G18A 2ZUDA 4DKXA 3U4QA 1YVDA 5FI0B 3AM1A 2H92A 1CR4A 1Z6AA 3GP8A 4S2EA 1EFTA 5CIWA 2WPDA 5CM8B 1DARA 5FL7A 4TSFD 4B2LA 3K0FA 1KNQA 3EZFA 4IOJA 2OAQ1 4B71A 4QJ5A 3K0CC 3QEOA 1VKJA 1NLZA 3MMPA 4PC2A 5KSYA 2NOAA 4Q7MB 2BV3A 2KSQA 3RAPR 2FFAA 3AF0A 1JPNA 3G82C 3P4YA 2ZJBA 4F7WA 2JIZA 2FFHA 2NIPA 3CZPA 2FMXA 2ZSDA 3R20A 2O8CB 4GMXA 2J3EA 1G7CA 1R0ZA 3OE7A 2QMOA 4R2IA 1W4BA 2JEOA 2HXYA 4NCNA 2C5LA 2IEZA 2FDCA 1HURA 1YZNA 3FVQA 2MMGA 3NKVA 2ZUCA 3B6EA 3NBXX 4L4UA 4Q9LA 1CR2A 1L2TA 4GMDA 3EX7C 1PLJA 2J0SA 3C16C 4TMVA 3FHCB 5L3VA 2EU8A 3AGQA 4URUR 1G4UR 4QHTA 5JI2E 4TT3A 2AK2A 2VHJA 2O8DB 2RH5A 4V0OA 1BO6A 4JVNA 3H84A 4R98A 2O8CA 2BVNA 4EDHA 1EFUA 1LFDB 2EYUA 2GWHA 4JVLA 2QMHA 2ZAMA 4D2IA 1NBME 3SNHA 4ACBA 1E0AA 1VHLA 1F48A 3LRPA 2VO1A 2CK3D 1GVNB 1N2CE 2YVUA 3V4RA 2GCOA 2BMFA 2QTHA 1XP8A 4JLAA 2XB4A 4XD7D 2RGGA 1UEJA 3TIFA 2FFBA 4KITB 3CPJB 5JBQA 5AWFC 5TVKA 2D4HA 4AG5A 2RAPA 3VKGA 1G20E 4JS0A 4TL9A 2FV8A 2O8DA 1VECA 4V0NA 5KDOA 4CZ2A 3GJXC 3ICEA 1FZQA 3TW4A 2IT1A 2ZE6A 2IHYA 2ZS8A 3PQCA 4BASA 4US1R 3I62A 2JLXA 1RZ3A 2QGNA 1N3BA 3L0IB 3A1UA 5AR1A 5GVRA 2F3TA 2XZOA 1ZM9A 4L9SA 5TB5A 1LY1A 1W7AA 2ATXA 5JCPA 1JEDA 1TQ6A 1YZTA 3N70A 1RVDA 3BOSA 1WB9A 3I8SA 1W36D 3AKCA 4OK3A 1YRAA 1NIJA 3BWDD 4M1KA 1BS1A 1QRAA 3BJIC 1G8PA 1NN5A 3QPUA 721PA 2Q21A 1XCMA 1OKKD 2ZJ5A 4PAQA 1T8TA 2A7QA 4KJZA 1EXMA 2OXRA 5D3QA 4PZLA 4NBSA 3QXCA 3AP1A 4TMTA 3W6NA 2JASA 1N6HA 4DIEA 3F3YA 4Z51A 1AIPA 2WKQA 4LHWA 5DI9A 8OHMA 4BUJA 3GJ4A 2FNAA 1WBBA 3CLVA 3TUIC 2QEQA 3L0SA 4S35A 4LJAA 3IDQA 1N0WA 1NVXQ 2X8AA 2HV8A 5HKKA 4GPTA 5ELXA 4JZKA 2J0UA 4E22A 4LBVA 2QPOA 3J81k 1RYFA 2NO9A 3I92A 4ABYA 1J8YF 1EESA 2R9VA 4DLZA 4HAZA 1C9KA 1E69A 3KKPA 3QF4A 5A4JA 3KDSE 3W3AA 1SKYE 2P3SA 2R6AA 2E87A 1NY6A 3ZD7A 3AKDA 3P32A 1DOAA 5FOUA 1JAHA 2B6HA 4IVQA 4PO9A 2V9PA 4US0R 4IXNA 5EXSA 3LBIA 4HDCA 3H4MA 2JLQA 4OYHA 3B60A 1N6KA 2QQ0A 5FUWA 3NBZC 1H8HD 4KI0A 3QXHA 3SQWA 4A6XA 1R5OA 3MD0A 4H9GA 1OPXA 4FINA 4J0QA 4MGYR 5FFMA 1OW3B 1UDWA 2ZUBA 1XFAA 5G3YA 5HTKA 2I1VB 1S96A 2XJ4A 5JJKA 1T9HA 3SR0A 3ZS9A 5FBWB 2ANBA 4DLWA 2FZ4A 1QDEA 2Q9BA 3PENA 2O8FB 2OSBA 3E2IA 3MUFA 1F3OA 1XMIA 4I1UA 1FX0B 1WMSA 2W6JA 3AP2A 4WXPA 3DKVA 1HQYE 3B13B 1QZXA 4FIDA 4PX9A 2JLZA 3A8TA 4QGHA 1U8YA 4WVFA 2V4ZA 3QKRB 2REBA 4M53A 2QM8A 1L4UA 5HE8A 1N0UA 3CB4A 3RYTC 2WSMA 4GP6A 5EP3A 5KPJA 2Q3MA 4A0FA 1HEIA 5FBRB 4NE2A 3DZDA 2D62A 2O8FA 2VHQA 4TLBA 3IUYA 3A4NA 1Z3IX 4L5BA 1FX0A 1JR3D 1KK1A 1Z06A 1MO4A 3BB3A 3ECCA 5GVSA 5DISB 1T0JB 4CW7A 1U9IA 4HAWA 5KHOC 1W2GA 1YR9A 3QKRA 1NVVQ 1ESMA 2D2EA 3Q9LA 2GEDA 3GJ0A 2VF7A 4M8NE 2IW3A 1KDOA 1E6CA 3VR6A 4A8JB 1QVRA 2PCLA 4D0NA 5E7IA 5F9HA 3MRSA 3T5DA 1G21E 2J5XA 1SVKA 2H16A 4XVRA 3L43A 3SFZA 3U3OA 3B1VA 4EPWA 2J59A 5L8VA 3X1DA 2WJGA 4B6FA 4PZYA 5GADl 3FKSA 1MT0A 2GNOA 5JEDA 1QHNA 2R6FA 2ZE7A 3HR8A 1TPZA 2B7BA 5J4YA 1NG9A 2KB0A 3AVQA 4ZO4A 5B57C 3JZAA 1RE0A 2GJ9A 4M1MA 4DLSA 3WHKA 3VQTA 4G5OA 1J90A 1HYQA 3AKYA 5BQ5A 2ZIAA 1E96A 1Q0UA 4A8JA 1KSJA 4TN1A 1Q20A 2OLJA 4C4PA 4GI7A 3VR3A 4I81A 1JAIA 4LWZA 4Q01A 3X1WA 3QNUA 3ZQ6A 4DSNA 1E32A 4IVPA 4XOIA 3QENA 4XTCS 4Y0VA 3AVYA 4FMCF 5AUNB 3ICQB 4CF7A 3UMSA 3G5UA 2B8TA 5IDVA 1KK2A 3K0AA 4F93B 4UXHA 1N0VC 2ZI4A 1E79D 1UADA 3ZIAD 3T1TA 3I5XA 1X8JA 1UKZA 2WSSD 3NIBA 4DJTA 1MO5A 1KSHA 4MYUA 2VP4A 4DDWA 2D7DA 2NQ2C 2ZETA 4ZPXA 1XEFA 3QY0A 5EJEA 1AQYA 5C2JB 4M9SA 4NYJR 4ACAA 3BFVA 3B78A 3C8UA 4NP6A 1G8GA 5AJVB 4C0QC 3OEEA 3EXAA 1FUKA 3KKNA 3IQXA 3DVLA 2QA5A 4JIMA 5KSZA 5KYKA 4D4KA 4IFBA 3W6PA 4AURA 4IDQA 4F4IA 1BH2A 1Q1ZA 3Q7QA 4W5HA 5IK2D 1DAHA 1OIXA 1WP9A 4QBIA 4ZIRB 1XPOA 1JB1A 1TF2A 2EQBA 1G5TA 2RB4A 2D3WA 4LZZA 2ZRAA 4Q4LA 3TKLA 3TVTA 3WBKA 3CW2A 1VCNA 2P5SA 4FWTA 3B2EA 3AV0B 3KUDA 3OIYA 2ZRMA 1PV4A 1ZCBA 3UMRA 3KXLA 2XAUA 2HJVA 1A7JA 1Z07A 3N5CA 3VX4A 4NYIR 2ORVA 4FCVA 4NTZA 1E3MA 2ZM5A 2ANCA 1CR0A 3B1XA 2NO1A 4RD3A 5JZVA 3SBEA 5J40A 3SJBA 4ESVA 4ZIRA 2IX3A 4Q1EA 4BFVA 1R6BX 1A2KC 2F43B 3AF3A 2AWOA 2P6NA 2Q0HA 4RCZA 2OFXA 2Y8EA 2XNDD 2F1IA 1TUEA 1DG1G 4UJ3A 1OHHA 1NMZA 3B9PA 3PITA 4XSHA 2R6CA 2R6DA 1EFHA 2QY9A 4XWOA 2VP2A 4RD1A 1ZD8A 4HB2A 3OIVA 4KAXA 4PO8A 3IBGA 4OHVA 1FNMA 1LF0A 5C18A 1EX7A 3GLIE 4PPGA 1TU3A 2QU8A 4O25A 1PUJA 4EPTA 4AKGA 3M4YA 4TMWA 1NMXA 1O87A 4LGMA 4BFYA 2F43A 1N6LA 2ZROA 3DL0A 2HEIA 1P2UA 1RYHA 3U7GA 1I2DA 5SZKB 1CU1A 1S9DA 3U6BA 2Z0MA 2UKDA 5CK5A 4LJ8A 4P32A 2J87A 2Q6TA 1T91A 1W2HA 2NTYC 2OCPA 2RMKA 1DAKA 3SN6A 4DZZA 1G7TA 4KLZA 3F8TA 4MITA 4WBSA 3B1YA 2DCUA 2A2ZA 2VP5A 1KO7A 5HZHA 1TTTA 1AGPA 2FWRA 5G3ZA 1EGAA 1FOEB 1NBMA 1BMFA 1TF5A 2O5VA 3KTAB 5EXTA 2LCFA 2OG2A 4A2PA 4NONA 4LC0A 4MH0R 3HYTA 1ZBDA 5H1YA 4ILEA 3W3ZB 5DE3A 1II9A 1E2GA 4FXPA 3NWJA 5FBLB 4ZI3A 4PAOA 2CLSA 1YZLA 3PEWA 3K9GA 1S9HA 1OXSC 4LI0A 1ZUIA 2P0EA 2BJWA 3A58B 2IYQA 1E2PA 2FSHA 5FI1B 1OYWA 1I4TD 1L7VC 4G01B 2ZAOA 2AXNA 1T3SA 4JSTA 1XF9A 2BMEA 3EASA 3R8FA 4EQ6A 1E9RA 1XD9A 5J5CA 1P75A 2VH5R 1HV8A 4M1SA 521PA 2ZQ5A 1Z0AA 3PEVA 5JSZB 1P4SA 4DT1A 3HPQA 1XD8A 2ZRGA 4AI6A 1CRPA 1G3RA 2KBFA 4YC7A 4RD6A 4TYWA 1NY5A 1P62B 5CIQA 1RPZA 1NMYA 1E2IA 1COWA 1SVOA 1KI2A 2AFIE 3W8RA 4ZV4A 1YJ5A 2GESA 4LRWA 3QG5A 4Q1AA 5J4HA 1LS1A 3REFA 1S1CA 4V0ME 4MGKR 2OFWA 3ZS8A 2FSGA 1S3GA 2WOJA 1SKYB 1Q12A 4H1VA 5D3MB 3TR0A 3W90A 3WMEA 1LF5A 2VSFA 5E7MA 2HT6A 5JSZA 2C9YA 4Z8XA 1YQTA 5FOWA 2ZRHA 1JJVA 3P26A 1GRQA 2ZI9A 1Z5ZA 3BIFA 2QPAA 1W0KD 3Q5EA 3HWSA 1GL9B 4DCSA 2FSFA 3LA6A 1BYIA 2HDNB 3BB4A 5K8TA 1JQLB 1E2NA 1P61B 1KI9A 1E0KA 1NL3A 3ZZTA 4QBGB 3BGWA 1HY3A 3X1XA 1TQDA 2P67A 4TYNA 1EFRD 5G40A 3X1ZA 1AZTA 1NJGA 3LDAA 2J7PD 4IFEA 4JJZA 3DO6A 221PA 4QJ3A 2JLWA 5L3SB 4JLKA 3T15A 4CRWB 1KSGA 4LUCA 2G1JA 3X1YA 1DO0A 3LVRE 1R10A 2BIFA 5DHAA 3EWAA 3FMIA 4PHHA 1CTQA 4HZIA 2NGRA 3JVUA 1UF9A 4Q4HA 3UG7A 1E9DA 2QE7A 1JJ7A 4PQYA 5BN5A 4WAUA 1IONA 3HPRA 3TSZA 2VPPA 2ZVQX 4DWJA 4EPXA 3AQ4A 2IWHA 4A1FA 5L3SA 4OI0A 1Q22A 3BB1A 1KY3A 3E1SA 2ZRIA 4Q21A 3IIKA 5J47A 1MRSA 4DCNA 2VP0A 4IDOA 4C7OB 1U2RA 4RD2A 2IXGA 1II8B 5CJPA 3U44B 2C9OA 3LW7A 4N0EA 4CEJA 2GBLA 4HDOB 4K46A 4RZ3A 1M2OB 1G3MA 4OK5A 3VHXA 2OUKA 4BFTA 2FPLA 3OESA 4DSOA 2DBYA 2IYUA 3GFOA 4PR0A 1K6MA 1ZP6A 4LPSA 2ZU0C 3SEAA 4OKSA 3VX3A 1M1YE 2XB2A 2ZXUA 3QIAA 5FPHA 4BECA 2XOKA 2QAJA 3UANA 3NC0C 2ZRJA 4LJ6A 2ZTSA 4CT5A 2JAQA 2VA8A 2WAYA 3LX8A 1BKDR 2XTNA 4KU4A 1I2MA 4C7OA 4A9AA 3LQQA 1II8A 1OFHA 2WWYA 1II0A 3T1OA 3TBKA 2BEJA 3TK1A 4GDFA 4UXIA 1W5SA 4LYJA 5B58C 4LYFA 4CEIA 1VCMA 2CHVA 1V43A 1XCGB 3DHWC 3LO5A 1F60A 2PLFA 4FD2A 1DG3A 2GEUA 2BHRA 1GG2A 4LOAA 1FW6A 4P4SB 1ZNXA 2QAGB 4C0LA 1VYUA 2G0NA 4TWZA 2ZI7A 4AYTA 1XEXB 3GPLA 2GK6A 5CB6A 2WWHA 4LV5B 3QKTA 3D31A 1OYYA 1CULC 1UJ2A 2J7PA 1YE8A 1KI8A 2ZJ8A 2JLYA 3EW9A 3NXSA 4X8MA 2JLSA 3ZZUA 3MWLA 3CUEF 2CLDX 2RGNA 4MDEA 3RS4A 4I1SA 4B3FX 1KO1A 2R6GA 1RRCA 1IY1A 2BBOA 4P4UA 3K70B 1TEVA 3FMOB 4Q1CA 5GJWC 1TQ2A 1ZJ6A 2OE2A 5F98A 3SDZA 2YC4C 2ZRKA 3OEHA 4FMDF 4G3XA 1QHIA 3Q72A 2D7CA 4B2IA 4NMMA 3U3JA 5JEEA 1KOFA 1Z6YA 2N42A 3PV0A 1XEXA 2PLRA 2CVFA 3WNBA 4UJ5A 2XZLA 3THWA 1HE1C 5DN6A 4DB2A 4U02A 1OF1A 3EIEA 3U3RA 3LQRA 4B3XA 3ADKA 2ZPTX 3F0TA 2HLDD 4RD4A 3IKJA 3ZYCA 3KKOA 1JR3E 5AJXA 2IF2A 2NPFA 3AH8A 4D26A 1W46A 3FOZA 2ZEJA 4YXWA 2IA5A 1MR3F 2BDTA 3ONWA 4QOSA 2YKGA 1O3YA 3P27A 2CNWD 3L8YA 1ZW6A 3RANA 4GZMA 1E9SA 3UWKA 2W83A 2PZFA 2RGCA 1E0JA 1SHZA 3LXXA 2DB3A 4GRAA 5IRCD 2IXFA 4BLSA 1G64A 1G16A 1BIFA 3KUCA 1XDBA 2H8KA 5EE9A 2BWJA 2GCPA 2W6IA 1OIWA 4IDNA 2JDID 3GLFE 2X2FA 4XWAA 2FN4A 2ONKA 2C99A 3C14C 1NP6A 4AK9A 4DVGA 4BFZA 4ZKDA 4M1OA 5G53C 4NCKA 1LNZA 1NSFA 2DYKA 2QSYA 1NVUQ 4FCWA 1YZUA 2OHFA 4C30A 1CS4C 2H57A 4QXAA 2XTMA 1M8PA 2OCBA 1MKYA 5GJCA 2PMKA 2VSOA 2W2TA 1C1YA 2C96A 3EPLA 1P3JA 4G5RA 4I4LA 3SYLA 1LW7A 2C9CA 1DAGA 3ETLA 4U5XA 1XTRA 2WIAA 3KKQA 3REGA 1NLYA 4FI3C 3GD7A 3DM9B 4OJKA 2QI9C 3GEHA 4A0HA 1DELA 2ZE5A 2A5FA 4OBEA 3GLIB 4A36A 2CJWB 2GCOB 3IEVA 2ZSEA 4TYPA 3ND8A 2F3RA 2J1LA 1ZMXA 3MAAC 1BOFA 1W0JA 1IN7A 2EYQA 2QG6A 1PLLA 3WMGA 2I1QA 5H70A 5SZIA 5HCIA 4IKEA 4X8HA 4M4SA 4BFWA 3MWJA 2OCYC 4JYCA 2BJVA 4TLAA 3TGPA 3WHLA 4URWR 2WWXA 3ASYA 3TR5A 2QBYB 1XXHE 1A4RA 4GOJA 5BYKA 3KZ1E 3GLIA 1OE0A 1IBRA 2CJWA 1VPLA 2VSXA 1KMHA 3FHOA 2YOGA 3VTKA 4YQFA 2PCJA 1JQJC 4ASUA 4XVUA 1Q3HA 2BM0A 4M9XA 2HF9A 2ONJA 4QKQA 4D0LB 5FTLA 3AVPA 2VF8A 2C8VA 1TEXA 2XEXA 2KBEA 4W5JA 3VAAA 1E9BA 2GDJA 3TAUA 4LJ5A 1G5RA 4TL8A 4P33A 1MABA 2QBYA 5EUMA 2RGAA 4P31A 1U0JA 2G77B 1WCV1 1W1WA 3QXXA 4BEBA 5FTMA 3U7EB 4Q9KA 1Z63A 4JJKA 4TSFA 2NO6A 1ZYUA 3ZGXA 3AUYA 3MLEA 4JVSB 3Q5DA 4D25A 4GFDA 2J0UB 5C1BA 1SHKA 1PUIA 2I3BA 5JS7A 4PO1A 3K1JA 3EARA 1G19A 4KFSA 3RRMA 3AUXA 2C77A 1A5TA 2GETA 3QF4B 3AEZA 4Q9JA 4FWIB 3RLFA 4DEXA 2GA8A 4FMBB 1G7RA 4OQLA 3HU3A 1Z0JA 3BAFA 4PC1A 1N6OA 3K53A 4HSEA 3GMTA 1EWRA 1FUUA 4M1WA 1JR6A 121PA 4TZ6A 3UG6A 2O8EB 1BYUA 2H7VA 4RZXA 4GOKA 4GBMA 4AYXA 3PJRA 2GJAA 1UBEA 4C0BA 4L16A 2P6RA 2OESA 1GDDA 1K5GA 4UNPA 1AKYA 1YHNA 3TUJC 4MYHA 2GTPA 3PEYA 4IHQA 2OM2A 4NYMR 1GAJA 3ZD6A 3ADDA 2ODBA 4N3NA 4LSGA 5JCZA 4TTPA 2JA1A 2BMJA 1IY0A 3LBHA 4Z8YA 3ZZ0A 4V0MA 2NZJA 2OFOA 4TQUS 1GWNA 2HCBA 3M6AA 1PLKA 5C4GB 1E94E 2CK3A 2O8EA 1XTQA 4DC9A 1OXUA 1P2VA 1JXOA 2G1KA 3EZ2A 3IIMA 4XD7A 4C9BA 2ZRLA 1W4RA 1B0UA 3C5CA 2F9MA 1W36B 5JI3E 2QM7A 2B21A 1P73A 4B73A 2R2AA 1Z8FA 1U9IC 4M9ZA 3MGCA 2V7QD 4FCTA 4JL5A 2OCAA 2ZR9A 3PUZA 4MKIA 1G3IA 3RS3A 3QF7A 2Z6VA 4D82A 4Q18A 5FPKA 2WIBA 3HU1A 1CJVC 4D80A 5HE9A 4Q9HA 3R9XA 3B1WA 5FBQB 2MSCB 4B43A 4O0MA 1H65A 4FN5A 4BLQA 1Z47A 2OXCA 4DRZA 3GJ8A 1T8UA 2QL6A 2XJ9A 3BFXA 1N25A 2QUZA 1E9EA 3WBJA 1OKKA 1ZNZA 2VYFA 2ZI6A 3A6PC 4KSBA 4PC3A 1WBDA 3RSOA 3QVVA 1IJEA 4DLXA 1IN4A 3K8YA 3KQHA 1W44A 3K9NA 3ZVLA 3L82B 1G5PA 3WYAA 1VCIA 3SE0A 4JKIA 3TVDA 2OAP1 2QRZA 1HQCA 3A1SA 3CKLA 5BN4A 1Q1EA 4EFMA 1R7RA 4AKIA 4Q7JB 2FPMA 4DDUA 4NDZA 4YMTA 2JJ1D 3MWYW 2ZS9A 4ERNA 1WE2A 4OJQA 5ANRB 2XSZD 2DWOA 4LDJA 1SULA 3CX7A 1OLOA 2AX4A 1Z0KA 4RD0A 1ZRHA 1Z22A 3OAAD 2IYWA 1R2QA 2NO7A 1XBTA 3LY5A 3LH5A 3QKUA 4JLVA 3VHLB 1G6HA 2ZRBA 3UIEA 4QGFA 5FOXA 1OJLA 3A1TA 3KJIA 2NG1A 1E2MA 2FOLA 2VHUA 2PEZA 3KJHA 3CRRA 2GCNA 2F55A 4DCTA 2RGBA 3VKHA 2E1RA 1VIYA 4NYMQ 2P6UA 3LLUA 4Q03A 2ZI3A 3ZJYA 4RKEA 2AN9A 2ZJ2A 3K0AB 4YMUA 1Z83A 4Q4JA 3OFND 1XJQA 4KXFB 2JJ8A 4MGZR 3SHWA 5DSZA 1MRNA 1H8HA 1QF9A 2IBMA 3U3KA 2V6IA 1ANKA 2O52A 1QBKC 1S4QA 3CRVA 1X8LA 5JWHA 1EWQA 2P2LA 2GJSA 4JLNA 4OK6A 3EPKA 4I1OA 4PZZA 4JLBA 2G6BA 2OLKA 4QNMA 1D8TA 4TLCA 1VIAA 2IF0A 1ZD1A 3QKSA 3VR1A 4B33A 1Q44A 4G5GA 2R62A 4F91B 2A30A 2FG5A 3NC1C 5H68A 1U0HC 2JGNA 4JT2A 5JHGB 4HLCA 2JLRA 1GNPA 3W9YA 1ZINA 1JI0A 2O0JA 2VP6A 1G41A 4MKFA 3T1VA 3PCRB 3CRQA 3VNUA 3BFKA 4HAUA 5FTKA 4KVGA 5EUQB 4NPHA 2O8BB 3GJ5A 1QG4A 1E9AA 1RRPA 3O47A 3P1JA 4MRSA 2D2FA 4BFSA 5JRZA 2ZR0A 1WQ1R 2W58A 3EZ6A 1YR7A 4HLUC 1HT1E 2LKDA 4KFTA 5JHHB 4B75A 3LD9A 4GZLA 1WDTA 3RS0A 1X1RA 2F1RA 4BRWA 3GLFB 1KGDA 5EP1A 4WXRA 2CL6X 5KDLA 5K8LA 1JR3A 1DVRA 1ELOA 2HJGA 1OXTA 1XU4A 4MKHA 4AG6A 1Z2AA 2JJ2D 4CIDA 4DXAA 2BBSA 4LBYA 2SHKA 1NN0A 2X77A 4LBWA 1UBGA 2O8BA 2X2EA 4WIAA 3CM0A 4ZCLA 4D4JA 3DPUA 1TL7C 1R0WA 2WMNB 4U7DA 5L3RA 2IEYA 2NZ8A 2UZ3A 1GUAA 4HDQB 1ZD9A 3EAQA 3GLFA 1KTVA 3WXMA 3DDCA 4CT4B 4BQSA 2QORA 2GAAA 3WNCA 4LV6A 3QJYA 1P2TA 3CX8A 2IC5A 4JBYA 3D6TB 4GNKA 5FUXA 1GZSA 3IGFA 2HF8A 3JVVA 2FJUA 4LPKA 4EPVA 1GNRA 2CEAA 4E5UA 1F5NA 4KCGA 2ZRFA 5UKDA 1FPMA 1KY2A 3I72A 1HA3A 3KJGA 3M0EA 4HZUB 4XH9B 5FUVA 1Z0FA 3CIOA 1P60A 4EPRA 1V5WA 3K9LA 1KIMA 1XTIA 1E4YA 2PH1A 3IILA 1OH6A 1WA5A 2A78A 2RHDA 4R71A 2ZRNA 2AKYA 3GJ3A 3TQCA 4G1UC 3EIHA 1YR8A 1M7BA 2WTUA 5AJYA 2XTZA 2FF7A 3DZ8A 2QZ4A 4ZKEA 4ZDWA 1FQJA 2AFHE 3EZ9A 4TQ9A 5KDDA 4LYAA 1TQ4A 3C4JA 1QVAA 1XXHB 3WY9A 2D74A 1DADA 1DAEA 4XSGA 3QOFA 3RWOA 1IQPA 1CJTC 1ZC3A 5AUQA 4PTLA 1E79A 3BRWD 3PR1A 4HZUA 3ZIAA 3A4LA 1SKQA 2WSSA 1KI7A 3PIRA 1U81A 2ECKA 1KYIA 3NG1A 4PSVA 1W47A 1N6PA 1VHTA 2V8OA 4LCBA 3F5FA 3K09C 2XITA 5JRJA 4HB3A 5DNYB 4Q19A 1LTQA 3KKMA 1ZNYA 3N2EA 4RKFA 4EAQA 1AKEA 4ZCMA 1Z6GA 5P21A 1E2EA 2DFLA 2L0XA 5JMTA 3TSWA 1E1QD 1DAFA 1Z2CA 1H8ED 3EZ7A 1XRJA 2IYYA 2MSDB 4EQ6B 3AVVA 1T5LA 4NYJQ 1XXHA 3U7HB 4QBHA 3TQFA 4IRUB 2V1UA 5DI3B 2F1HA 4HAYA 4DT1B 1RKBA 3FKQA 2QTVB 4JT4A 1XZPA 5IK2A 1Q57A 1KDRA 2BCJQ 4B47A 1TUIA 2QMEA 1SVIA 4B3CA 2OBLA 2W2XA 2VQSA 4W9MC 1UFQA 3BE4A 4O2LA 2QP4A 2IUUA 3PUXA 4PPQA 1G291 6Q21A 2VEDA 1FTNA 3EG5A 2R65A 2PZEA 4KODA 5CYOA 3CH4B 4LJYA 1DAMA 4A92A 3VMFA 1R0YA 3VNVA 1AGRA 5DI3A 1VDZA 4NYIQ 3KQKA 2H5EA 2OILA 2P5TB 2WKRA 4LJ7A 5C4MA 2XGJA 1XJ0A 4RFVA 3PG5A 5LDDC 3DOEA 3WRYC 1UKEA 4C0HA 2ZJAA 3EPHA 1E4VA 2XNDA 1ZM7A 4BFXA 1SXJD 1WRBA 1YU9A 2ZANA 1G9XA 2H18A 1SGWA 2IYTA 2OBMA 5FOSA 1NNEA 4WZ6A 1U8AA 3O8CA 3TMKA 2AL7A 3AF1A 4C0KA 2HXSA 4B44A 1KO8A 1JALA 1ONBA 1JPJA 4OQFA 4ZDJA 3MSXA 4YLGA 2GKSA 4IDPA 2ZRCA 3I8XA 4GP7A 3D3QA 1JNYA 4QM7A 1NSTA 2XNSA 4Q4HB 1SXJC 2C03A 4KVAA 2DY1A 4RJLA 4Z1MD 4K8OA 4BZQA 2A5DA 4QNRA 3NTUA 4L15A 4KSCA 1D5CA 4HB4A 1A82A 3BBPA 4URXR 4C2UA 4RY2A 4AKHA 4ITRC 1M34E 2D06A 1NI3A 3DOFA 5E7JA 2CL0X 3KQNA 5JS8A 1Z08A 3CBQA 3TH5A 4P0TA 5FPYA 1CXZA 3Q7PA 4V03A 4EJSB 3R7WB 4DLTA 5DYGA 2RGEA 4CEJB 4LC1A 3R9WA 1R4AA 2KE5A 2DWQA 3SHFA 5LB2A 2VTKA 4W7SA 2N1BA 2IYSA 1CP2A 3SJZA 4G5QA 3NDBB 3C15C 3KXIA 3U5ZB 2FU5C 5EXXA 1S2MA 2VIIA 1ODFA 3H0KA 4NCJA 3QUSA 3ADBA 3T34A 5FTNA 1CKEA 1GOTA 2QT0A 3QBVA 5BWMA 1D9ZA 4EJSA 3NVAA 5E95A 2IYVA 3R7WA 5FH9A 5FTJA 3WYGA 2QT1A 4JLDA 4OI2A 3BERA 4CEIB 1P72A 2EWWA 1Z0IA 1XEWY 1YZQA 4XWKA 1XPUA 4MYCA 1HUQA 1S8FA 4DHEA 2X1VA 1E1RD 2N46A 2RGNC 1XD2B 1ZVQA 4PQRA 5EE0A 1DPFA 1E9CA 3C7KA 4OHZA 2VLIA 3B85A 3QG1A 5KOYA 2ZJYA 1GITA 4MDFA 2OO7A 1NN3A 2A5GA 1S1MA 4II7A 1MO6A 2QAGC 5DO9A 2ZREA 1VG1A 4F4JA 2YOHA 1S0UA 1IOZA 1M6NA 1RRFA 4HB0A 1N6RA 3SS8A 2DWPA 3TLXA 1XNJA 1NKSA 5LD2B 4JL6A 3CF6R 1W0KA 4E07A 3H86A 4UNQA 4B76A 4Z54A 3RDPA 2ODEA 1P2SA 2WJIA 1ZIPA 2ERYA 2J7KA 4KO8A 3T06B 1KI1A 2WWGA 2WJHA 4LHYA 3T1QA 1XD2A 1Q21A 4RZUA 3K70C 2W0MA 4LHXA 4YDHB 3VR4A 4D6PA 4QBFA 5EP4A 3THWB 2WPDD 1W5TA 1EFRA 5FL7D 1KI3A 3VU9B 3ZH9B 2VP9A 1R8QA 1G3UA 2DFNA 2KWIA 1OH8A 4GT1A 2EFHB 4B35A 3R9IA 1RJ9B 3SZRA 4KFRA 1IXSB 1XX6A 2F7SA 2GJ8A 3CNLA 2IUSA 3W8NA 4RVCA 4OQNA 4OHYA 2JIZD 3MJRA 2AD1A 2QRNA 4OI1A 2RHMA 3OE7D 3O8DA 1PVOA 4M9QA 4V0LA 1W48A 3AVWA 1XMVA 4RCYA 4RFSB 3CH5A 1GTVA 1T0HB 2PZGA 2HUPA 2QGZA 3FB4A 3VU9A 4DLUA 1A1VA 2GZAA 1KJYA 4JL8A 5H8WA 3LAWA 1KK3A 3I4LA 4PHTA 3AGPA 4L9WA 1RJ9A 3NH6A 4TQAA 4Q9IA 3TJZA 3W6OA 1UAAA 2REOA 5CDFE 4ARZB 3RS7A 3B5JA 3RRZA 2PJZA 2RKOA 5FBVB 4TT3D 2ZJOA 1TAGA 5C46F 3GQBA 3P4XA 3HDTA 3NBFA 4DUGD 5F2EA 4TL6A 4RFSA 3CR8A 2FEOA 5KSPA 4P4TA 3T35A 2IWRA 3BK7A 4IEIA 4URVR 2Z43A 3WNDA 4DDVA 2CE2X 2GXAA 1DBSA 1ZM4A 4M21A 4QGGA 2HCJB 3AB3A 4C0AC 1KO5A 1AJEA 2ZS7A 5IT5A 1E2HA 4U00A 1OIVA 4ARZA 2MMCA 1XEWX 5SZHB 2O0HA 1G8FA 1GL6A 3VFDA 5B30A 3NHAA 2YC2C 2ZJZA 3TW8B 2DFKB 1XMJA 2WKPA 3A4MA 1TX4B 1R0XA 1T3HA 1VG9B 3CNNA 4POAA 2EFGA 3OIUA 4MGIR 4EPYA 5HPYB 4A0RA 1P9NA 2Q9AA 4LJ9A 5CK4A 2VHTA 5KTYA 4B6EA 3ZVRA 1PZNA 4OI4A 3UXMA 3U60B 2VBCA 1LVGA 4PHGA 2VHCA 2EFEB 2WWIA 4TMKA 3W5IA 1XPRA 4BLTA 4HEJA 3P20A 2IYRA 3FE2A 3FMPB 1KMHB 1TU4A 3IPYA 3M1IA 1DAIA 1UDXA 4US2R 2CVHA 2BEKA 1WXQA 3W5JA 1ZAKA 3C41J 2FEMA 2WJJA 3GFPA 2H17A 2YYZA 3D7MA 1DS6A 2PL3A 5HZKA 3U7FB 2G83A 1CBUA 4UNSA 3BORA 1ESNA 1QHYA 1IXRC 621PA 1GKIA 1FFHA 2HLDA 1I4DD 2IUTA 4M22A 1MABB 5A5GA 5KNCA 1P7CA 5HKKD 4Q1FA 5JECA 2GVDC 3CPEA 2R44A 2FA9A 1HH4A 4LHZA 4NKRA 4PANA 1FL9A 1GILA 1NRJB 4O3MA 3BH0A 2FFQA 4K81B 4OQXA 4WOPA 5FOVA 3GLHE 3TNFA 2CL7X 2IS4A 2CNWA 4KYUA 5EE1A 3VKWA 4TL7A 1J99A 2NPIA 3B82A 1IN6A 3KXKA 4R2HA 3NH9A 4DUGA 1XTJA 2ATVA 3GLGE 3LW8A 1D6JA 3K0CA 5K8IA 2PX3A 3A37A 1GRNA 1KZ7B 2A5JA 2JATA 2WHXA 5JJIA 2PJRA 3H2YA 3GEEA 3FDIA 2JDIA 1CF4A 3DMNA 4ON9A 2ORWA 2C98A 4DLRA 3AF2A 1VCOA 2BOVA 1G1MA 3S1AB 4IJMA 4Q7KA 1E2KA 3ASZA 3GEIA 3GJ7A 5E4FA 5G41A 4R9UC 5TMPA 2DHRA 4A0GA 1UEIA 3FHTA 1MO3A 3CONA 4UNRA 1NLFA 2AHOA 2G3YA 2BBWA 4PSAA 5LPNA 2CCKA 1JBKA 1UKVY 4EKDA 1TF7A 3A1WA 4WW0A 5BW8A 3SFVA 4HUTA 5KNBA 3UMFA 4GL2A 3THYB 4KV9A 2W6JD 2FGKA 3IBYA 3HYRA 2O0KA 4UKDA 1KI6B 4GSYA 1SZPA 1KZGB 1P5ZB 2GEVA 4TMXA 5B64A 1HTWA 2WOOA 3S1AA 4YMWA 3Q3JB 4HLQB 2YOFA 4DCUA 1OXXK 5TARA 5TV2A 2QQEA 1XB2A 1AZSC 3SQXA 3SU8A 3AVOA 2F1JA 2ODNA 5LB4A 1G17A 2YINC 4DIDA 3PUYA 3SBDA 1TMKA 3H1TA 2WV9A 4DB4A 4JLJA 4I99A 3THYA 1XJCA 4G0NA 1OFIA 3RSLA 1NVVR 2FPKA 3IEUA 1KI6A 4NHOA 2F9LA 1SVLA 5KNDA 1W36C 2V55B 2CDNA 3CR7A 4AWXA 1QHHB 3QEJA 1NJFA 1CJKC 3ADCA 1K8RA 2J46A 4A82A 2DR3A 5CLLA 4TZ0A 4JLOA 4DLYA 5CB8A 4TMZA 4YMSA 5KUTA 2I4IA 2YZ2A 2QP9X 4D0GA 1LB1B 3V9PA 2GF9A 1IN5A 5KSOA 3KQLA 1GKYA 3CWQA 5KPDA 5FOTA 3FKSD 1KI4A 2IYXA 4IW3B 1J2JA 3VR5A 3RS2A 3L8ZA 4F38A 1R5NA 3ZVMA 3B7GA 1T6NA 1CIPA 2GXUA 4BZXA 5JLJA 2RGXA 1EG7A 3DMDA 3IO5A 2GXSA 1QHHA 4MRVA 4YMVA 1ZCAA 4W5WA 4F92B 5B2ZA 1X86B 3B8HA 1KDPA 1X3SA 4HYYA 1L4YA 1AN0A 5HCNA 2YV5A 5FPSA 3NDPA 3RC8A 1ZM2A 2CXXA 4V0KA 5JWRA 4GOXA 3U6KA 1J7KA 1S3SA 4X8LA 2PEYA 4E03A 4M0LA 1OH5A 4O2RA 1RC8A 4CDGA 1SXJE 3K9HA 1U90A 2A3RA 5M04A 4Q02A 1CR1A 4CEHB 2BKUA 2YWEA 1T3LA 3CO5A 3I1FA 4OHWA 4CVNA 4CGZA 2FH5B 2W00A 2ASEA 4A8JC 3DEFA 2AXPA 4PAMA 2GK7A 1J8MF 1YRBA 2RCNA 3KB1A 4OHXA 4YONB 4AD8A 1KNXA 2ZE8A 1YZGA 4WZAE 4DSUA 2QTFA 2A9KA 4HAXA 3UATA 3SYNA 1IN8A 4Q4JB 4TYQA 2CE7A 4B2PA 3THXB 3AVTA 2KJQA 4X8OA 421PA 5AJWA 3CPHA 2QSZA 3I61A 1KHTA 2XX3A 2ZITA 4N1AA 1Z28A 1RIFA 3QXSA 2PMDA 1AS3A 3OEED 2Z83A 2Q3FA 2UZIR 3B1ZA 2GILA 4PC7A 1OH7A 4CEHA 1R8SA 2ERXA 2J0QA 1DE0A 2W2VA 3CF0A 4C0JA 5BN3A 1FP6A 4BLRA 1D9XA 3BS4A 3TUZC 2A5YB 4Q47A 1N5LA 3QKSB 4DDTA 2IS1A 3Q85A 1CEEA 5EQTA 4RZ2A 4XTRA 3BH7A 3KJEA 4LV8B 4MA4A 4MUAA 1G6OA 2V3CC 1FNNA 4MRRA 3THXA 5SZJA 3T61A 3EA5A 4QG7A 1Z6TA 1DO2A 1U0LA 1EX6A 3MG9A 1E9FA 1GSIA 2J45A 2VL7A 3OHMA 1VMAA 4DEYA 1CRQA 1U94A 4NCIA 1RFLA 5DHFA 4B3BA 2V7QA 3U61B 1GM5A 1VG0B 4WA7A 1RRGA 5KU1A 2ZSFA 4I1VA 2ZYUX 4HI0E 1DEKA 1FMLA 1G8HA 1AQUA 4Q48A 3I32A 4AC9A 2AK3A 3KFXA 2MSEB 3O8BA 4FMCB 4LX0A 1OHHD 2WAXA 1KJZA 2JLUA 3V00A 1KAOA 1NKTA 1ZNWA 4TTRA 1N5IA 3GFTA 3UK6A 3RRNA 4RSGA 4LY6A 3PVSA 1IJFA 3NEJA 3UKDA 3WP0A 4FW9A 2ZYWX 1NF3A 1GP2A 1XCPA 4XIGS 1M7GA 2EVWX 3KL4A 1E2LA 1OFTA 1ZUNB 3K0EA 1CJMA 1SQ5A 1F2UB 5KO2A 5BYJA 3CRW1 5JFGA 1D2MA 2QN6A 2IS6A 2B92A 3CWZA 1E0SA 1LS6A 5CLQA 2QNRA 3QQ5A 4TTQA 5CDFA 3WYFA 2QPTA 4DCVA 5HR5A 1GKUB 1N5JA 1Z6XA 2JJ1A 3HU2A 1HT2E 5CYPA 5FR2A 3T12A 4BE7B 2PT5A 2JLVA 2ZSAA 2XSZA 3R8CA 2EFCB 2CMKA 4C0SA 3FYHA 3OAAA 3LNCA 1NBMD 1BMFD 4WZBE 2BC9A 5GJBA 3U2QA 2V6JA 4D4LA 1GFIA 1F2UA 1R5BA 3TSOA 1IM2A 2AR7A 2ZRPA 4Q5IA 2ZU6A 1LV7A 1E98A 3U3MA 2GRJA 1XTKA 1T4GA 1ZUHA 3BXZA 2IS2A 1VTKA 2AKAB 4B48A 4LYHA 3TAHA 5GJVC 4Q1DA 4PHFA 5AUOB 4MUBA 4L8GA 2FE4A 4UXJA 3PUVA 1FQKA 3OFNA 3EWSA 5AUPB 1ZU5A 3PUWA 4ZDKA 3SOPA 1ZIOA 4HUQB 4F4CA 4IEEA 3PEUA 2IHBA 5J4LA 3ZLJA 1E2QA 1UPTA 3IHWA 4IDHA 5J4KA 5AK0A 1HE8B 3OZXA 3SI7A 1YR6A 5EP2A 4JYBA 1US8B 1NIPA 2QP3A 3FMFA 1U98A 4PQFA 2WICA 3RRYA 2F6RA 3QPVA 4HLUA 1Z29A 2JCSA 2G9NA 2WM9B 1COWD 2ZYVX 5JWOA 3MCAA 1D2NA 2NO0A 2WJVA 4P3YA 4DLVA 1XMSA 4IVRA 4EIWA 3SC3A 5EXPA 2BMDA 2CHGA 2C78A 4ZDIA 4HUQA 4NL4H 5FL3A 3GLHB 5EE5B 4CYMA 3I5YA 2KI5A 2GJKA 3I3SR 2J9RA 3MJHA 4KFUA 1OXVA 3FWYA 4PPNA 2GAOA 2B7CA 5FR1A 3GLGB 2C04A 2BCGY 1US8A 1Z0DA 3HR7A 3DM5A 1VYVA 4KBFA 2IYLD 5F3WB 1NN1A 2AWNA 3SYKA 3K0SA 4G5SA 2J0VA 1J70A 2ORIA 1G7SA 4BGDA 4A4DA 4PFSA 2V1XA 1FTSA 1XTSA 3JZMA 2FZLA 1GNQA 3LWNA 1L8QA 2PT7A 3WP1B 2JJ2A 3RNLA 4UQOA 1QG2A 4IOLA 3GLHA 3A36A 2HYIC 1K5DA 2YWGA 1N5KA 4D4MA 2G88A 3KX2A 4ZI2A 2ZSBA 4BLOA 5CITA 5EZ6B 2GZDA 1UBCA 2Q3HA 4JBXA 1KJWA 2YNMA 3GLGA 3W34A 1ZU4A 4XJXA 1OB2A 2WMOB 2ODWA 3QPWA 2GXQA 1OSNA 4JKYA
chains in the Genus database with same CATH superfamily
4X24A 4KXUA 1OUMA 3QI2A 4E4TA 4OUDB 3ZDCA 4RKQA 5GY7A 2LWIA 3IAEA 1LZKA 2QE7D 1JEEA 4Q4AB 3E9QA 5AI8A 2CCGA 4MKZA 3JYPA 2RGDA 3IC5A 1XHEA 5G0VA 5FBHA 2A58A 4K3UA 3ZDQA 1UKYA 5K0ZA 2D8MA 2QVLA 3JQBA 5LIPA 1W75A 1Y63A 1NW8A 4KC0A 4RXTA 3TDKA 4ZZIA 1H23A 3QVUA 1TVCA 3N8GA 4BLPA 4BEJA 1WMBA 3NBUA 5IJ9B 2HRBA 2P2YA 3PX3A 1LX7A 1J0DA 1KYZA 4JWTA 1GL7A 3H7IA 4QRHA 1E6EA 3UMMA 4L6IA 1EXDA 1X8KA 1YV9A 2OORA 3UFXA 1D2EA 2VZ9A 1XRSB 2C7OA 1P9RA 3K05A 2VKTA 2AEJA 4XFKA 2Q9CA 3IIJA 3FCUB 2YHIB 5E0KB 3CZRA 5EHQA 3OCZA 3WL8A 5BWOA 2DQKA 3Q8XB 1BH6A 2B78A 3MGBA 1OVMA 4CV3A 1DLJA 1YAHA 4HATA 4Y6PA 1PJQA 1K86A 2PUFA 1E8DA 2LPMA 4YRJA 1DUVG 3A05A 4RVHA 3L2OB 1NLMA 4MS1B 4EJSC 5ESDA 1GZ5A 3P96A 1UM8A 2WWWA 3O2QB 1H0HA 2HEGA 5DM2A 1X1SA 5FV7A 3EXIA 3S99A 1FCJA 1AA6A 1YGYA 1QLHA 1E2JA 4EEZA 1AX9A 3CF2A 4L75A 3F49S 4MRNA 3UW1A 2CNKA 3L0PA 2Y77A 3MWKA 4E2FA 1VE6A 1FTWA 4E33A 3OE1A 2I6SA 4NENB 3G1UA 4PSKA 4NU6A 5DMHA 5HOEA 2WBLC 1TCVA 4MI1A 1YC5A 2NZWA 4L2IA 1U0TA 4IR7A 2D2IA 2OSVA 1FNSA 4O8ZA 3GEBA 2QMUA 3SIPA 5L3QB 1EBUA 2GNPA 3A6HA 5K1ZA 3QBTA 5YASA 4UTZA 2OEPA 2C94A 2ARKA 1U4OA 3KTOA 3DOHA 3HYNA 3OPNA 1NUAA 1ZVKA 4IHKA 4NDNE 2EIHA 3SBOA 2IOYA 3UHPA 4C3OB 3KOZA 5IVKA 2XGOA 5K01A 3AEQB 4HX5A 2ZRDA 3EC2A 3ANLA 4QHYA 4LGYA 4CUZA 1OXKB 4WJKB 1GTMA 4C14A 2PUGA 4R05A 2ZIXA 1KDTA 2BMWA 2I2WA 2QW8A 3LT1A 2HR1A 1W49A 3IH5A 2BBTA 2JJQA 5JFOA 2YJTD 1FDUA 2Z4SA 1IXZA 1G5FA 2GN2A 3E5HA 1D2HA 1T5IA 2HHHB 4PPFA 3RFVA 3IAFA 3TZEA 1U8ZA 3WGLA 1C4XA 3PXCX 5TXGA 3C3XA 4W1QA 3RC3A 5F2OA 3CKYA 3NHUA 1IG3A 1SXJA 1SKAA 3IVGA 2IX9A 5FUYA 1J56A 1SUPA 2CBZA 3KOUA 4YXWD 3DONA 5CDGA 3AZOA 4QFMA 1GPKA 1NM5A 3NVMB 5ALZA 3TIIA 1WLSA 3V6MA 4AYWA 2O7RA 3E70C 4LYDA 4M2LA 1M5TA 1ZN8A 2ILVA 1C8BA 821PA 5IUNC 1QRDA 4XXHA 4NULA 5AFSA 3I9JA 1XZQA 3BC1A 3QKWA 4HL6A 1FXSA 4JLPA 2EIXA 4JEMA 4YHBA 3TCKA 1RPNA 3TTUA 3AI7A 4INOA 4A2WA 1K97A 4B34A 4CCSA 1P45A 4WZAA 1TEZA 2DETA 3B12A 4MRPA 4O4JF 1O94C 1X7HA 5IX8A 4Q24A 5ECDA 1DPGA 1NG1A 4D6XA 1BN6A 1NPDA 1LQ2A 1NDUA 1G4AE 1NF2A 3FYSA 4N9WA 1MJNA 1WB4A 2BR3A 2TMKA 1FP7A 3FCXA 3HVIA 2Z5FA 3NHBA 3QNWA 4KO1S 4M1TA 2V54A 3PT9A 4MS4B 1WWKA 1QCYA 1QFJA 2W6CX 3HS3A 3EIQA 4J91A 4NH0A 4WUVA 3THOA 1K68A 1B6SA 2HPVA 2V74B 3EPJA 2XZPA 3DUFB 3QE0A 4O1HA 1OBVA 1M2NA 3C8HA 2DERA 5TLSA 2A0XA 2C9DA 1ZI8A 2WUFA 5IP5A 3K6SB 1IBKB 3RV4A 1UBFA 4H59A 4DBLC 1EVJA 3MGKA 4EGQA 1F6BA 4B74A 5T6MA 4WBNB 2DBVO 3HL0A 1KZ9A 4L72A 2MR5A 1Z4OA 3PYXA 4MULA 5GONF 1N8NA 3BKXA 5DJ5A 2BEUA 3UO8B 4YX9A 2H1IA 1EFPB 3IHLA 3G49A 4I5DA 3U16A 3OZTA 3R6DA 1I6MA 4JI6B 5SYMA 2NTVA 4OMCA 4FMDB 5AXBA 4PLTA 4BFUA 2REQB 1IK4A 3PGXA 2PAFA 4B17A 1NXQA 3L40A 3STTA 1MV5A 2WYOA 3KB6A 1AM4D 1EG2A 3DR5A 4O08A 2P65A 4N65A 4A26A 1RW4A 2GF0A 1ADCA 2VDNB 1A2OA 3CZQA 3REQA 3LBYA 3ND9A 2QXYA 3Q9UA 4CL8A 2J9XB 3F3KA 4MW7A 4Q7EA 2PD6A 2XXAB 2WWRA 2AEMA 3PPWA 1EFCA 3JRWA 3MBIA 4UVGA 1AD2A 2HA7A 4TS3A 4B4UA 4X65B 1VYTA 1X6VA 3DP9A 4GE3A 3BMCA 1VPDA 4H4DA 4MKGA 4MV6A 4IS3A 2OQIA 1KMNA 2VDKB 2D5IA 5HKAA 3MWEA 3A9CA 3CQ9A 3HKBB 2YW9A 5HZGA 3CVWA 3HBAA 1TO6A 3V1MA 4FGJA 2AOXA 1K6EA 3AVXA 1Y3AA 1CB0A 1AS0A 1L7NA 3NT4A 5THXA 3AKZA 4KE6A 1OB5A 2WA2A 3R7SA 4Q00A 4PCLA 3TTTA 2Q7XA 2Z8YM 4CKZA 1VSVA 1Y9DA 2PLAA 4UBIA 2MDTA 2Q99A 4V02A 3T1HB 2VYVD 2FXVA 3AEXA 4J03A 4JOCA 4GF5A 1F9EA 3K0FB 3N86A 1YS7A 2NUPB 3UC9A 4C3ZA 3DKPA 3RSHA 3U7JA 3R3SA 2AS0A 2VJNA 1E9VA 4DADA 4OP3A 4KJXA 4O02B 5EWMB 5KOJA 3THSA 1C4OA 1X38A 2NZUG 3PDCA 3IP3A 4Y0NA 5CFZA 2CCJA 1SVMA 4UUBA 4RHFA 5DGDA 2QDKA 4KSYA 1X14A 3KQWA 3TJRA 2R5NA 1XZFA 4C2TA 2Q4OA 2ZUDA 4DKXA 3U4QA 3INNA 1DEOA 1CR4A 5K0EA 1E1NA 1BD4A 2A0WA 5CIWA 1OFGA 4G4IA 1YF3A 3ULKA 5FL7A 1VZ2A 5ERGB 3UBTA 5DK6A 3W6UA 4DCCA 3DE2X 2A7XA 1RYDA 3MWGA 4E94A 1DKLA 1LSUA 3GELA 1L4GA 3JQCA 5TT1A 3QEOA 1KYXA 2X7HA 2X40A 5KSYA 2XB6A 2H65A 2NOAA 1JKIA 2WNIA 2XCOA 1J25A 3BK2A 3KD2A 2KSQA 3ONNA 1FU8A 1W85B 3HB5X 3KUUA 1I9CA 3F9RA 4IHAA 1M6YA 4TUYF 5SY6A 1BEZA 1NVAA 1XAIA 2JIZA 2EQAA 2FFHA 2QG4A 5LLSA 4AQ7A 1JT2A 3I01A 1NVBA 2J3EA 1ND6A 4P2GA 1R0ZA 5HQJA 3F47A 4HGNA 1PD1A 1THGA 3I53A 4R2IA 2HXYA 3B2NA 1WHSA 2B35A 1C9YA 4IQFA 2IEZA 3OOHA 4HWOA 3SD7A 3WZMA 2BR5A 4NFYA 1AB5A 1CK4A 3KJZA 1XLUA 4BC1A 5A5VA 5A9SB 4JDPA 1H1DA 4B6JA 5LQMA 3UJHA 1DBIA 1BW9A 2X3UA 2ZR8A 3NBXX 4MPTA 4XYEA 3SG0A 4X5OA 1U0NA 4NZPA 2Z5GA 2AG8A 1YMQA 3A9RA 4HEA1 5AP9A 3O84A 5IDYA 4UVEA 4TMVA 3WLLA 4REOA 1LLDA 3V3KA 3AGQA 3R5KA 1N3LA 4JP2A 4XQCA 2VHJA 3D2LA 3JQDA 5EZYF 4JVNA 3GBSA 2BVNA 1LDYA 3IT1A 1IOWA 2EYUA 3H18A 4YP6A 1NMSA 2CLMB 5LQCA 3I9LA 1Z5NA 4KXYA 4KPEC 3KCQA 1E59A 2BGNA 4UHKA 2QHXA 4UU8A 1H2BA 3PWKA 4S12A 3LRPA 1T4MA 3PQ4A 2R7AA 5IN4A 3OE5A 2JBHA 1SCUB 3K6RA 4ZOLF 4JX9A 1NV9A 2QTHA 1CUEA 4OXKA 1QX3A 3BMQA 4DREA 2O14A 2FJ0A 3WYEA 5TF4A 3CPJB 4NIMA 2H2GA 2D4HA 4RMHA 4AG5A 4KX3A 2PD4A 3JATA 2VJQA 3H1EA 4ZVRA 5G0TA 3Q6IA 5EIBC 3DTVB 4AX4A 4LMAA 2FPRA 4M9RA 3IDFA 2TS1A 3NHKA 3J7AC 1QU3A 2IT1A 2IHYA 2D0PB 3QGMA 4RV4A 3PQCA 3OZCA 5JATA 1PJ2A 1S2DA 1LRLA 2CVPA 4FYHA 4CFYA 2JLXA 5HNKA 2YDYA 1VL2A 4M0PA 3P0HA 1YQ9A 5BURA 5GZ3A 2XZOA 2FSSA 2PZAA 4NBKA 3I76A 4RA6B 5CD1A 3QOXA 3C4QA 2GEKA 2OXTA 3RJ5A 3HUEA 2BGLA 5BVHB 4LOIA 3N70A 2W71A 3MMNA 3MYRA 4RPLA 2JC3A 1M5UA 1RWPA 2NSDA 2DU8A 4KMOA 3ZR4B 5ALLA 1W36D 1YRAA 4H35A 3MCZA 1BS1A 4M1KA 1KC3A 2OZLA 1M75A 1M66A 1NN5A 1WY7A 3D4OA 3KLPX 2Q21A 4FUQA 3HVHA 4U1RA 1FVFA 4PAQA 1W93A 2VF2A 5EJ2A 3RVOA 1B16A 2V7BA 1RPJA 4ZYUA 1L7QA 3DGFC 3PKZA 2JGJA 4MW4A 5AW3A 3F3YA 2R87A 2WKQA 1VB3A 2HQBA 3IX7A 5K3FA 4BUJA 4K9LA 4R9NA 4P0PB 3COYA 3CLVA 1MW8X 3TUIC 1DC3A 3MJTA 3LXUX 3PA8A 4QPDA 3L0SA 4BQOA 2DUWA 2VJBA 4S35A 4Z9YA 1N0WA 2P2NA 4NOJA 3GBVA 3ZKWA 4UEQA 2ZBDA 2H9IA 3LYAA 3WL5A 1DRWA 1JPUA 3WWDA 3ZHUA 4E22A 1K3TA 4Y1RA 2B98A 3ZCRA 1NBWB 3NB0A 2NO9A 4L3WA 1E92A 1EESA 4DLZA 4G09A 4M54A 5IJAA 4OXYA 1VHJA 1EM8A 1B42A 1MT3A 1JZSA 3E3AA 3IAS1 4FZ5A 3B3GA 3X0DA 2Y1XA 1MAVA 2BGKA 3FJYA 1RYBA 1BXGB 2R6AA 2R8YA 4K9RA 2YJZA 1NY6A 1LK7A 3P32A 4U0KA 2E49A 2PQ0A 5FOUA 3S2EA 4G0ZA 2B6HA 2ZKIA 4PO9A 3HO8A 5CFNA 3C6YA 1CS0A 2L19A 2YJNA 1SU6A 2G80A 5JYCA 2CF6A 3MD9A 4RM3A 2ZYHA 4OYHA 2ENWA 2D3TA 2Q62A 2Q6OA 3B60A 3ODPA 1A04A 2XYPA 3NBZC 4KI0A 4JI0B 1V7ZA 3FBGA 3MD0A 2SBTA 3UPDA 3UUFA 1W9HA 1C8KA 1NRXA 3MWFA 1EJ6A 2LW7A 5G3YA 1U31A 2JI7A 2RDMA 5CPBA 5HTKA 4R0MA 1SCKA 1NVGA 3GGPA 5JJKA 5KC9A 4FFRA 5FIUA 3SR0A 1XDUA 3KE9A 4EKIA 3HB9A 3UXEA 2XBLA 3U3XA 1R4NA 4BDSA 3E2IA 1F3OA 3JALB 3W05A 1KJ8A 2PYDA 1UK7A 1HC7A 2ZJFA 4GDMA 4GMHA 4WXPA 2PE5A 3DKVA 2RG1A 2C84A 4N7MA 1QZXA 2Q5IA 2J3MA 2LIPA 4WCDA 3ZWQA 2ZWAA 1YO6A 4PX9A 2MIIA 1VJRA 3ZE8A 4NZNA 4BMVA 2JLZA 9ABPA 3ETJA 3CLHA 2B1QA 3AY3A 3IQDB 1VMDA 4DJAA 1L8LA 2EZ9A 2WFZA 4ZU3A 5FULA 5HE8A 1P44A 2HRRA 2WYUA 3AUSA 1NR5A 2WUDA 1T10A 4UDOA 5EP3A 5IT9A 4IMIB 1HEIA 4QSHA 3CLTD 3BTUA 4MA0A 4Y2XA 1USWA 2GZ3A 3BCHA 3FSGA 3HUFA 1UMDA 4WCFC 5FUMA 4TLBA 2JFPA 4J4HA 3VNAA 1Z3IX 1KH3A 2NT4A 4L5BA 4UCXA 1KK1A 5AW0A 3BB3A 3VAZA 3JAWA 4UATA 1RP1A 4KQGA 1E20A 2VPZA 1T0JB 3WWZA 3ER8A 2F00A 4C21A 4MUFA 3LP6A 1YJBA 4YAEA 4HAWA 3RD5A 5KHOC 3RYCA 1W2GA 5EVJA 1WU7A 3RVMA 2ZCUA 1CEXA 3K96A 4JUIA 3C5VA 3QKRA 3UGJA 4LF5B 1LLCA 1Z18A 2D2EA 3Q9LA 2BMVA 2IGTA 1P7VA 3N0VA 4U6SA 2P3QA 3VR6A 1PDWA 2PCLA 2QRLA 1W5AA 3KYIB 2M1XA 1YI1A 2ID9A 3CRNA 4KO4S 5E6RA 3F6EX 3OWXA 3KD3A 5GM1A 3SFZA 3B1VA 4EPWA 3RVKA 2Z09A 2DPLA 3T3GA 3X1DA 4QSMA 2MSWA 1PJBA 1R27A 5AT1A 5GADl 3FKSA 4J49A 1MT0A 2VXOA 2BUBA 3PXDA 1J22A 2OKGA 3FAKA 1QHNA 2R6FA 3L7NA 3Q3GE 2B7BA 4XJSA 2VAMA 3AVQA 1BDHA 1MHPA 1VKNA 1RE0A 1SIOA 3A3KA 3ZN2A 3QVWA 1KRXA 3I34X 2ZTMA 1TO1E 4G5OA 3FLEA 3WHKA 5IH7A 4LOHA 1YRLA 3QVSA 1GEEA 1PHRA 2CXUA 3L79A 4FDLA 5KZMB 1Q20A 1JAXA 3KXPA 1TYCA 3O9VA 5IVPA 4KE9A 2NUAB 3P2MA 5DYWA 2JCBA 3QU2A 3RHZA 5KNBH 5BR7A 3QNUA 1ZWKA 1QYXA 3PC7A 2ZUUA 4YAJA 4XTCS 4DYVA 3AVYA 1RPTA 3E9CA 2AI3A 4FMCF 5AVKA 1D5WA 3UQZA 4CF7A 1NJ6A 1PL7A 2B8TA 4NMWA 4G9GA 4XYBA 2XWBF 4F93B 1N0VC 4J43A 4OYRA 1QQTA 3SR4A 1VI5A 1E79D 1XNHA 2WHEA 2NU6A 4HX9A 1KA9H 1M8JA 3OTOB 2WSSD 1CQPA 3GT7A 2VP4A 4DDWA 5EWJA 4WE3A 2PQ2A 2PA0A 1GNSA 2D7DA 5B6PA 1CRLA 1USIA 3BMNB 2KMLA 1GGVA 1YR1A 2E4WA 3QY0A 2JAXA 1Q0RA 1TM2A 4XQ0A 5HDQA 3DG9A 4CLOA 1I0ZA 3ILSA 4V3BA 5AJVB 4C0QC 3OEEA 4DIBA 1I7PA 3WLPA 4EHLA 1P1JA 4NBRA 4YJ3A 1E1DA 4AMGA 3RYFA 4JIMA 5AKIA 5JROA 1CUYA 3BYZA 3JY6A 3W6PA 4RLQA 3ZBUA 2Q9UA 4BMOB 1KIAA 4CMIB 2NN3C 3STUA 1BRMA 3JWHA 5JSUA 3Q7QA 5B2EA 3L6EA 3OLQA 3TTVA 1KYWA 4UOQA 2FWNA 5J43A 4RLHA 2OO3A 2EQBA 5BW6B 2RB4A 4CMJA 2BGUA 2D3WA 4Q4LA 2ZRAA 2EHDA 4B4VA 1ICEA 3L1JA 3P9PA 3O2NA 2V8BA 4FWTA 2UVDA 4HOYA 4MMYB 4MWEA 2LZ0A 3E58A 3G2IA 1OWNA 2Q2VA 3E3MA 4KIGA 3UMRA 2C1EA 2HJVA 5IT0A 3VX4A 1U28C 3LLSA 3PPXA 3V4PB 1ISIA 4NTZA 2ZM5A 4JA2A 3TYXA 1H1TA 4WUTA 1H0KA 4C43A 1BGWA 3GFQA 3WTBA 1U5AA 3SBEA 3W7VA 4P80A 4PLGA 4BMXA 3MK31 2FAXA 3SJBA 5HDBB 4ZIRA 2QIOA 2R4TA 4R81A 3HP4A 1A2KC 3JYQA 1VQ1A 2Q0HA 2Q50A 3WGZA 3QUAA 4LECA 4EKYA 4CQMA 2F1OA 2XNDD 3QRWA 4DRXB 4X20B 5KIAA 4GOOD 2F1KA 4GMGA 3CNEA 5LQAA 3B9PA 4WNAA 1YIDA 4XSHA 2R6CA 4AKSA 4ZV9A 3U62A 3SJ7A 3KZOA 2VP2A 1N7JA 3OIVA 1M2FA 3OX1A 4HB2A 5LP1A 4KLCA 3UMCA 4RTKA 4YFVA 1ZH0A 4OHVA 1FNMA 1LF0A 5DHQA 4ZVUA 5C18A 2UVPB 1JEJA 3GLIE 3PDUA 1R9MA 4IZHA 4PPGA 3ZLTA 1KDYA 1DC8A 1PUJA 2PU7A 4K86A 3GG9A 3AV3A 4E7OA 2WFLB 3M4YA 3G2NA 4PG4A 4A5OA 4HVCA 5MGBA 1NMXA 4QNNA 3O8NA 3U1BA 2C7RA 1N6LA 1RWKA 3DL0A 1P2UA 1RYHA 1BJRE 1VLVA 1CU1A 1I2AA 4IFTA 2GYYA 3HJHA 2AR0A 4DJJA 2J87A 1RR6A 2Q6TA 2WU0A 3JWGA 3CSSA 2VJMB 1DAKA 2IU3A 4OAOA 4DZZA 1G7TA 4MITA 2BHLA 3F8TA 1EGMB 5LYJF 4WCVA 2V7EA 5K20A 1O9GA 2VP5A 2Z2XA 2PUAA 3MRTA 1KO7A 5IXSA 5HQ3B 5GAJA 3IULA 1TTTA 5G3ZA 1DI0A 5LLTA 2DWUA 1FOEB 3NU1A 3IP5A 3QFHA 2QF7A 5M5BA 5AM5A 2P9JA 4LEIA 3SQMA 1REQB 3USCS 3UFXB 4BNYA 5H1YA 4ZMBA 4FFMA 4FXPA 4WNCA 1N2SA 1T4CA 3NWJA 1Z15A 4I6JA 4PAOA 3ZLVA 5BSVA 3PEWA 2BPOA 2FQQA 4QUDA 4TGLA 1S9HA 3TI9A 3RYIA 1AO0A 1A9TA 1SXHA 1J97A 3A2MA 3R75A 2IH4A 4ETWA 2X0FA 1I4TD 4X60A 3M34A 1KC1A 3D2BA 2AMFA 2AXNA 3H4IA 4BNDA 1H0RA 1S2NA 3OF2A 1BHQ1 2DM6A 3R8FA 1XD9A 4GZ5A 2QPLA 2ZQ5A 2CDAA 4JCCA 1SRQA 4Z5XA 4YBRA 1XD8A 2PZLA 3LLCA 2ZRGA 1I6LA 4NBNA 3ZQUA 2VQFB 3TN7A 1G3RA 2KBFA 4YC7A 4RD6A 3HN7A 1CRPA 3E84A 1P62B 4NJEA 4BO5A 3ISJA 4DTCA 1RPZA 2H2IA 3ND6A 1PK9A 4ZV4A 2GESA 1G8KA 4X94A 2MCFA 1K7CA 4LIPD 2NQ8A 4LRWA 3X1KA 2IXBA 3B1JA 4EAAA 3JWIA 5IFKA 2O05A 4MYRA 2FPUA 4NV0A 2HIMA 3UJ3X 2VOEA 3VO9A 3REFA 4V0ME 3C2QA 2HRCA 2FSGA 2WOJA 2YV2A 3BHIA 2GLUA 1SKYB 1BJTA 2VN8A 3CZ9A 3D8SA 2O2ZA 4ZAGA 5HUHA 3WMEA 2PBLA 5E7MA 5LMUB 4W5NA 4LSZA 5CD9A 1IUPA 1YQTA 3F7NA 3UOAB 1GPJA 1JJVA 1JBQA 1Y3FE 2WIDA 4FFBA 3OJCA 1FLVA 2HU8A 5K3AA 1W0KD 2J08A 4YPVA 5JISA 3HWSA 4PIPA 1K4YA 5HUJA 4DCSA 2FSFA 4ZT2A 5JTTA 2XEDA 1CUUA 2YCBA 3NOVA 3QMMA 2V0GA 3HJRA 3FOBA 3VSAA 3NUZA 1FUEA 1RC0A 2DBZA 4F6RA 1PYDA 3GDGA 4M76B 3IIIA 5HIKA 4I0WB 2PRYA 3VR4D 3G0CA 2CFOA 1A71A 1HY3A 4RVNA 2P67A 3UCEA 3WWEA 1XRRA 5MGNA 1NJGA 4IX9A 3LDAA 4Z3OA 2X13A 4JJZA 2DTXA 1N9GB 2Q5JA 4UBMA 3SBXA 3VC3A 1KSGA 3IVCA 3WFIA 2YS6A 4ZEOA 2F59A 1D7OA 1N4AA 2XAAA 1R10A 3FVVA 2ZWOA 2BIFA 2IPOA 4N7BA 4YJGA 3W8EA 3BSFA 1Z5VA 4PHHA 2PU5A 3TW0A 1WMDA 4IIJF 4HZIA 1IBLB 2Q0XA 1UF9A 4PRKA 3VPAA 2AG0A 1WXIA 4Q4HA 2I1WA 3D1VA 1X2EA 1NNSA 4CM8B 2K7ZA 1ZJJA 2IHJA 3NI2A 3C85A 5A06A 1WNFA 3VHXB 2F3SA 3PUIA 4BJ3A 4DARA 1F14A 5JYBA 1FXWF 4TMFA 2NU8A 4ECEA 5CG2A 3TSZA 3V8VA 3OZSA 3ICOA 4DWJA 4G5HA 4PIVA 3FWHA 3JVDA 1DWQA 1T15A 5IPFA 2AG1A 3H7AA 1BVHA 2C31A 3E1SA 1KY3A 2PFSA 1YBMA 2ZRIA 1EJBA 3FR8A 4UCFA 5J47A 2K4MA 5H80A 3RC9A 3R1IA 4MQ4A 3LOPA 4IHJF 3H2HA 3MF4A 4LAFA 3RIXA 4DMGA 1NURA 1V26A 3IQEA 1ZIYA 5CJPA 5EJ9A 3INGA 4ZI5A 1AUVA 4DLAA 4M6WA 4O33A 2BKAA 5K6TA 1YRWA 1GZVA 3C3DA 2Y6VA 4RZ3A 4DR3B 1G3MA 4OK5A 2V5VA 1QLJA 4BFTA 3OESA 2C2BA 4DSOA 4DMUB 2XRMA 4BVFA 4EYKA 4CKWB 5A02A 3QIAA 3UANA 2QAJA 4XAQA 2GLXA 1PV1A 3L3BA 4ZVKA 3YASA 2WTBA 1DMSA 4PZ0A 1Y4DE 1G21B 3PRYA 3PQ6A 2JAQA 4LI3X 2VA8A 3ACBA 3LX8A 1BKDR 4M0CA 1IWBB 1QV6A 4RVDA 2I65A 2IHUA 2Y1CA 3PEEA 4A9AA 1DKRA 1FC0A 3D7LA 4EFLA 1MNAA 5PGMA 1A0OA 4KOAA 5U4XA 3T7CA 3TBKA 3RRBA 3DE5X 4LJLA 4CEIA 1RYMA 1M2OA 4EHDA 1I24A 1CSEE 3PQ8A 4S04A 3KDAA 1F60A 2B6NA 1FW6A 2BHRA 4LOAA 4LQDA 2OGTA 1ABFA 3F78A 4R7GA 4QXPA 4C0LA 1VYUA 1CP3A 1ISRA 2VQ3A 4TWZA 3U39A 3I45A 4EG4A 3GPLA 4I55F 3OJEA 4ARAA 1C80A 1VC2A 2V96A 1MHTA 3L8CA 1VLMA 4OIMA 1YE8A 1KI8A 2VUSA 2JLYA 1ZHFA 2X86A 1WUHS 3EWIA 3EW9A 4V2UA 3HJAA 1Y8RB 2J6BA 3MWLA 2RGYA 3CUEF 1A97A 5A4IS 1K8XB 2OAEA 1RRCA 4P4UA 3K70B 3MS4A 4MVJH 5A7HA 4LXHA 1RM3A 3TQHA 4CKEA 3SDZA 2ZRKA 4YR7A 3NXKA 5DMXA 1FQWA 1QHIA 3Q72A 4B2IA 1U7HA 3A3NA 1HFEL 3T54A 2PX6A 1Z6YA 5KOJB 3PV0A 5GONA 4TSKA 4C1BA 5J58A 1HDRA 4R16A 4RQTA 1C4KA 4UJ5A 1UFRA 5DN6A 1F8FA 3U3RA 2JJMA 5ALDA 4MDYA 2Z2KA 3NIWA 4FEGA 4GUDA 3F0TA 3LKDA 4OSOA 3GGSA 2YFYA 2IKQA 5KNCD 3OZBA 2XOXA 3IKJA 2PSSA 3KKOA 2P4QA 2IF2A 2NPFA 3AH8A 2EKPA 3FOZA 3PX2A 4OHOA 2PX5A 5ULLA 2I7CA 2ZEJA 2BDTA 4QOSA 4XI9A 4ARZA 4BQPA 2YKGA 1KAMA 2XV1A 3P27A 4YQEA 1ZW6A 1VPTA 4I46A 2PZFA 1BMTA 1E0JA 4B3RB 2OP1A 4GRAA 5LU9A 3QVGB 3PS9A 3WIDA 1L8OA 1EE1A 4BLSA 4OB7A 3DF7A 4X63A 2J3DA 1JFFA 2A94A 1YB7A 3UJ9A 2CJFA 1XDBA 3SSNA 2A5LA 4JBHA 4HS4A 3U31A 2PSJA 4LVCA 3VPSA 2W6IA 1OIWA 1ZH6A 1JXAA 1GO2A 2X2FA 4PYIA 4WLNA 4ZODA 5K8VA 4GQBA 2C99A 4TTVA 3C14C 4AK9A 4DVGA 5IABA 2WIJA 4I1RA 4UTPA 2OBYA 4M1OA 2HWKA 2K2WA 3H11A 1O1YA 5KU7A 4E5YA 4YAGA 2OHFA 1CS4C 2H57A 4IPTA 2BDUA 2XTMA 3RNOA 4QBTA 4WFIA 5ADHA 2VSOA 4G63A 2G04A 2W2TA 3UBMA 2NUTA 1MB2A 5KNLA 3WDKA 4JXZA 2FEPA 4HG2A 1XTRA 1NAIA 1TGYA 3FJOA 1Q91A 3KLNA 5KWSA 3MJVA 3VSBA 1BMDA 2O6HA 5FF9A 1E8MA 1RKVA 2BFBA 1JVNA 2XB8A 1UBMS 4PYRA 5CH8A 4LF8B 1JEAA 4XLTA 4JC5A 4E1VA 4M37A 4D9NA 1BJKA 5HXAA 5H16A 1H4VB 4HC4A 2ZSEA 4TYPA 4Y1FA 1KE1A 2O2YA 1KGSA 1PT7A 1SUBA 2J1LA 4PE5B 2B94A 3E5MA 4BFLA 4YAIA 5CT5A 1HTBA 2MU1A 2EYQA 2QG6A 3JATB 2Z5VA 3TX6A 3OTGA 5JC8A 3SKXA 1M6WA 5H70A 1ZCZA 1I7QB 3MBOA 1BAPA 4JQOA 3DVRX 4OQ4A 2Z9DA 3GUHA 4DZTA 2H52A 2OCYC 1T6ZA 2FJPA 3COJA 5FOQA 2WSBA 3KM0A 2WWXA 3LTNC 1DJQA 1K27A 1GRCA 1V7PC 3GAFA 3S3TA 5ARBA 2QBYB 3GLIA 1IBRA 1OGJA 3GVPA 1J2TA 4U2EA 1KMHA 2YOGA 4HK4A 4F96A 1QIKA 4YQFA 2PCJA 4ZCQA 1JQJC 4ASUA 1JR2A 1YT5A 3MOGA 3UWSA 3HFRA 1DL5A 3A6JA 4M38A 4BO4A 2ZJ0A 1HLFA 2BM0A 1Y9EA 3VDRA 2HF9A 3AR2A 2CVQA 2XNJA 5BV7A 5CXQA 1Z0UA 1E1LA 1OX4A 4LTMA 3AO0B 2KBEA 4LJRA 3H8WA 1C7IA 1I1QB 1OPRA 2P2DA 1E9BA 2GDJA 3TAUA 1QIFA 4DYDA 3Q41A 2BZ0A 1QX4A 3O0TA 4PRYA 3B6ZA 1OLSA 1SNYA 2EJCA 2DLDA 1J4AA 5TF0A 1J9ZA 4GR4A 4TTAA 3ZWDA 1K8YB 2HA2A 5K3FB 3AY0A 3KPUA 3UUEA 1K2WA 4DMLA 4C5CA 4Q9KA 2JD1A 4B3SB 2XLCA 1ZYUA 3GR6A 3OD1A 1XCOA 4I8IA 4P98A 4ZOLA 4B5LA 1L1QA 4D25A 4F56A 4IGFA 1JJFA 2I3BA 3A3YA 3F5DA 3K1JA 3EARA 4PO1A 5JS7A 5JUWA 5DBOA 1UK8A 4NG5A 3UZUA 3VC7A 3VYUB 1XFDA 2C77A 2PVCA 4HYEA 4AQYB 1S8OA 4H0NA 2GETA 2QGFA 3SEZA 1EM8B 4Q9JA 3TD9A 4FWIB 3UV3A 4DUZB 4WGFA 4YECA 3O3NB 1VP9A 4DEXA 3TM4A 2GA8A 3BM5A 4E3WA 3N1UA 2GBGA 3HU3A 2Q5LA 4PC1A 1N6OA 1T5SA 4HSEA 5AIBA 4Y2QA 5DTQA 1EWRA 5KTOA 3S5UA 4M1WA 1PJAA 1JR6A 121PA 3K20A 4LZNA 4TOIA 4TZ6A 3P94A 4BV3A 3QEKA 5L51A 3CF4G 4JYPA 4C0BA 4J2OA 4NAVA 3FOAA 1UBJS 4RIFA 2XVYA 3ZVKA 1GDDA 2Z5LA 4KDRA 4AJJA 1QO0A 1QPGA 2GYWA 3GT4A 3ND7A 4JR0A 5DM0A 4BB6A 1TECE 2HJWA 2R79A 1RU3A 4W8OA 4JV5B 4XEHA 2OM2A 4NYMR 4TKVA 4LSGA 3O2JA 4D1YA 2JA1A 3LDGA 2Z98A 4X3CA 2Z6UA 1H6CA 2BLNA 1IY0A 1RTKA 4Z8YA 4RETA 5DEIA 1XLVA 4V0MA 1OYVA 4RL6A 3WIVA 2OD9A 5JD6A 2AZDA 2ZSIA 4OJNA 4OJYA 4ZALA 3M6AA 4AZTA 3RTEA 2AJLI 3NDIA 2YXPX 2CC2A 3BXOA 3A4TA 1WSDA 1XTQA 1OXUA 4Y6GB 1P2VA 2YXBA 4EY3A 2C92A 1ECJA 3P9YA 3OIGA 4PYKA 3IIMA 4KLRA 5EL0A 3G89A 1KVUA 3IV6A 3OBIA 2ZRLA 3T4PA 2RD2A 4OXXA 4HDSB 5LBTA 3AUJB 2VTEA 3C5CA 5JNTA 4BV9A 5ITVA 1MVOA 1A5AB 2F9MA 2QM7A 2B21A 1IRIA 1UAGA 1KOJA 1WD7A 2V6BA 3IXLA 1RLIA 3MGCA 1W30A 4JL5A 3F3MA 4G2NA 2BSAA 2ZAIA 1JDUA 3LGXA 1I51A 4XPZA 3UMGA 3ANYB 3INTA 3QF7A 1Q7TA 1UMDB 5HFNA 5CVTA 3DJFA 1I36A 3PHBE 3DQQA 4IJUA 5TGDA 4D82A 4N6NA 4OO3A 3JAWB 3RLIA 3HU1A 4BX0A 1CJVC 4D80A 1SFRA 3WQHA 5AIAA 2G9VA 3ROZA 3C3AA 1SEVA 2ZBPA 2OM6A 4KGZA 4XE5A 5JAMA 1FA9A 4ZTBA 3R9XA 2AOTB 2XIJA 4TXHA 2MSCB 2XNHA 3BDVA 3GFGA 4JB0A 4G0PA 4AWAA 5BQFA 2OMKA 4BLQA 1Z47A 4QUEA 1N2IA 1KYQA 3GAZA 2XGSA 2QL6A 1IVYA 1AGYA 5F3RA 1N25A 2QUZA 1ZPDA 3KHUA 3WBJA 3LPNA 3LDFA 3SJUA 1TCBA 3D5TA 2GNAA 4FB4A 2VYFA 4XWTA 2JFOA 3RKUA 2HNBA 2OGSA 3L0YA 3ONVA 1OWMA 3RSOA 3O93A 4CMBA 3D6AA 2EX1A 1YE5A 3IESA 3K8YA 3KQHA 4V1CA 2NQTA 5IKMA 3F46A 3E9RA 4DEVA 5JANA 3FWKA 4JKIA 2X0EA 1R6VA 2IFTA 2P9TA 3CKLA 3FUUA 5AKGA 4YMGA 3KVOA 4AKIA 1G63A 1OJ7A 4LF7B 4NDZA 2FB9A 4OU5A 2P69A 5KHLB 1Y9JA 1SU8A 2PWZA 3LKZA 3N2KB 1GCGA 4OJQA 3KK0A 5ANRB 5JSKA 1DQSA 2DWOA 4J1NA 1AXGA 1EAYA 2WIKA 4LDJA 5IEBA 5BNZA 3ESBA 3PC4A 4C07A 5BPHA 2XYVA 4RQUA 1R2QA 3LY5A 3EQ8A 2ZDQA 4QEDA 2V45A 4JLVA 4HDRA 3ROGA 3VHLB 4KYTA 1Y1LA 1N5DA 5F51A 3A06A 3MTIA 3UIEA 1TLTA 4O4HA 5FOXA 3F5SA 3A1TA 3HP7A 3MQ2A 2VHUA 5G2OA 4KR9A 4F21A 1QIEA 2PEZA 1ZK0A 2AJTA 3KJHA 3R77A 1KMIY 3S2GA 1JA0A 2PZ8A 1QHEA 3KTFA 3LLUA 4LRYA 2YL2A 3ZJYA 4QZVA 4EFDA 3A9WA 3HKDA 4EJFA 4KQIA 5JV5A 4Q4JA 5AVUA 4MGZR 4E14A 2NU6B 3IB6A 1H8HA 3H17A 3LKBA 4TXJA 2IY7A 4C78A 3CRVA 4FKZA 2L17A 4MB6A 1T1EA 4DWOA 3WO0A 3CEAA 2HZ7A 2GJSA 3EPKA 4I1OA 4PZZA 1YI8A 1XVAA 2QVZX 4CLOB 2OLKA 4K3VA 1VIAA 2IF0A 4TLCA 3FRIA 4GVPA 4I50F 1Q44A 2WHRA 4JBGA 1ZJ4A 2RJNA 4W9NC 3R3XA 5CA0B 2CDRA 1JSLA 5HILA 5H68A 2QYSA 2XMPA 2BFEA 3QX8A 4YQYA 5KYXB 1EMDA 4WCFA 4D4GA 4DXHA 5GGYA 4F97A 4WKPA 1CZNA 1HETA 4RK7A 3CRQA 3VNUA 1JJBA 1OT5A 4HAUA 5ICMA 5DB4A 3DMYA 3ER6A 4AVYA 3UK1A 3GJ5A 3G8DA 2WINI 3FUVA 1E9AA 3O47A 1DX4A 1HFWA 3EEBA 2EERA 4FWBA 4BFSA 7ADHA 2C5EA 2HSEA 3PWSA 1ZD2P 2TMDA 2LKDA 1NFFA 2IYOA 4GOMD 4GZLA 1O77A 1HMPA 3FCSB 4DZRA 4KDFA 2F1RA 3ZLBA 1U8UA 5TGTA