4GP6A

Polynucleotide kinase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQLKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structure and mechanism of the polynucleotide kinase component of the bacterial Pnkp-Hen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 66
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gp6A00
4ZI3A 3LNCA 1WP9A 5DSZA 2NIPA 3EWAA 3W6NA 1OKKD 1JJ7A 2PCJA 5LB4A 3ZIAD 3QIAA 5DNYB 1JR6A 4IDNA 4MDEA 1TNDA 4I1SA 1NMZA 4HDQB 5FPSA 2W6JD 4TLEA 3TAHA 1R4AA 3W9YA 5F9FA 1JJVA 4A6PA 3ICQB 4IOMA 1U8ZA 2NG1A 2F3TA 2JEOA 2RHMA 3AKYA 2W6IA 4CDGA 2WMOB 4LJ4A 1W47A 4TMVA 2UZIR 2Q6TA 4TMKA 2Z43A 3KFVA 1LY1A 2ASEA 2O8EB 5E7IA 4TZ0A 3L2OB 4FMDB 2I1QA 3VR6A 5B2ZA 4TYWA 2EYUA 1ZCAA 1D5CA 1EFCA 1YKSA 3VKWA 4GP7A 4JVMA 2HCBA 2WAYA 3B85A 3TW4A 4C7OB 1NVVR 1OXVA 5GJWC 1DPFA 4BEBA 4AURA 2QMUA 2WWHA 5FFMA 1XTJA 2IEZA 4M1MA 5JWHA 1CJVC 3RAPR 1E9DA 2BV3A 4YMWA 5BN5A 1VCIA 4IOLA 2GK7A 3THWB 4OI2A 1XJQA 1DAGA 2ODBA 3GCGA 3IIJA 4M0LA 3RYTC 4KFSA 3DO6A 2Q9AA 3NBFA 2QBYB 1ZM2A 1YR6A 4Q7KA 1NG1A 2LWIA 4TMTA 3TK1A 2JCSA 2DFKB 3AVQA 5H1YA 1P2VA 4BRWA 3SQWA 4KBGA 4KAXA 2WWGA 2QA5A 1FTNA 4L9WA 4BFTA 1UKEA 1KZGB 1P61B 1ZIOA 4D26A 1W0KD 1OLOA 2CLCX 1W7AA 2ORIA 1XJCA 2ZRMA 2ZRCA 1RPZA 1VHTA 4LOAA 4HAVA 1NI3A 3OEHD 4L9SA 4LY6A 3T5DA 4KFUA 1T6NA 5JMTA 2VSFA 1QHHB 4Q7JB 2EVWX 4F4CA 4NYJQ 2JLVA 4X8LA 1QDEA 1VYUA 1Z3IX 3K0AB 2ZJ2A 4IKEA 1MOZA 5FR2A 5CYOA 3C15C 2V8OA 4C0JA 1FQKA 3GEIA 1UBCA 5D3MB 3TUJC 2EFCB 4QG7A 4OK6A 1RW4A 1IY1A 1FP7A 4DT1B 2OXCA 1B0UA 1H8HD 3AB3A 4B2PA 1E6CA 5KDDA 4CEIB 3KKQA 2CE7A 3B8HA 3RSOA 3NVAA 5JZVA 1YR7A 3FYHA 1M8PA 2DWOA 2GILA 4H9GA 1S96A 1GG2A 1Q44A 4UNPA 1E9RA 5P21A 1UBGA 1SVKA 4GFDA 1XU4A 1VTKA 2B8WA 2FPKA 2GJAA 2ZS7A 4HDOB 4PQRA 5KPJA 5F3WB 4EFMA 1NVWQ 2FZLA 5AJVB 4GPTA 2RGGA 5KPDA 3GJXC 2Z4RA 3P1JA 2AFHE 1TU3A 4IFEA 3WXMA 1XMJA 4HZUA 5L3SB 1V5WA 2DFTA 3SE0A 1K8RA 2JJ2A 4OQMA 5FOTA 1T5LA 1HURA 4RD2A 4WA7A 3ZVNA 5IK2D 1MABB 4LSGA 4Q9LA 3GJ6A 1E4VA 2WJHA 3QG5A 3D8BA 4DLWA 4XVUA 1GRNA 1W5TA 2P6RA 1LF0A 1SXJA 2PBRA 1XTRA 4G0NA 2HT1A 2VEDA 3S1AA 4ON9A 1KI7A 5L3QB 3BB4A 5CB8A 3KL4A 1T0HB 2A5YB 4LJ7A 3A4NA 1TPZA 3HPQA 3QE0A 4CT4B 4JJKA 2IYLD 5TB5A 3T5GA 4BZQA 1IAQA 1U0LA 1P2SA 2FU5C 1XCMA 4DSUA 4PC6A 3K9LA 3VU9A 3N5CA 4XWKA 3RHFA 2IYYA 3O47A 3GJ4A 3TMKA 5KTYA 1KY2A 5BYJA 1SXJE 2PZFA 2VYFA 1GL7A 1NY6A 5JJKA 1G3QA 1CJMA 4D4KA 4OKSA 1QHXA 4C0AC 1TTTA 3CF2A 1E0JA 3CLVA 3LV8A 4K8OA 4PZLA 4DLZA 1AS0A 1KO5A 4PSKA 5TY0A 4IEEA 1JXMA 4EPTA 2JLZA 3FMFA 4PQFA 2NO0A 1ZRHA 3QJYA 4QGAA 1H8EA 1J7KA 2A7QA 4ASUD 3BFXA 3QXHA 4JLPA 4WXPA 5F9HA 1RYHA 4TQUS 1VG0B 1ZU4A 4DSNA 2GA8A 3MG9A 4RFSB 5GJCA 3GLFA 4OHVA 5JRZA 5DI3B 1KKLA 2NGRA 2IF0A 3ZZTA 3SU8A 2F6RA 2ZSBA 2NPFA 1SQ5A 2J0VA 2EFHB 3CPHA 3WP1B 2JLQA 1F6BA 3CR7A 1JBKA 3Q72A 5KUTA 2PH1A 3QY0A 4V0OA 4LBWA 3R7WA 2HT6A 2ZE8A 4LV6A 2QMEA 2P65A 1G6OA 3I61A 2DPXA 4ERNA 3P4YA 2PJRA 1E96A 1X8KA 2XSZD 1GIAA 2VHCA 2VP2A 5EUMA 3QXXA 2G1KA 2IYWA 4HI0E 2BMDA 4WZBE 2XX3A 3WRYC 3QPUA 2ZU6A 5HKKA 3BFVA 5SZHB 5K8LA 1C1YA 5FBRB 1R10A 4XOIA 2KWIA 4HB4A 1QZXA 1G3MA 2ZSDA 1TUIA 3RC3A 3CM0A 4TTRA 4DCTA 1KK2A 1QVAA 1ZM9A 2O8FA 1E1QA 1EESA 3U44B 4MDFA 2XITA 1D9XA 1R5BA 4Z1MA 5B30A 2XB2A 3OF5A 1S9DA 1JPJA 3ASYA 1EX6A 5H68A 2P5TB 5HCNA 5DIFA 1OYWA 2WBLC 3HR8A 1CRQA 2OFOA 3I32A 4Q18A 5CM8B 5F98A 4BLRA 3LA6A 3EWSA 5EE0A 3LH5A 4WVFA 4ESHA 2AWOA 5HPYB 1IY2A 2WJIA 2AFIE 3X1XA 2P67A 3VKHA 4TYYA 2ATVA 3MWKA 3VHXA 4AG5A 3ZS9A 5DI9A 2WJYA 1KGDA 2F1HA 1U8AA 4FMDF 4RZXA 1KNQA 4NYIR 1E99A 1HQCA 3ZGXA 2D06A 5KNBA 4NYMR 4N0DA 2VSOA 1Z83A 2H57A 1Q1EA 2PZGA 2KSQA 2WIAA 2PLFA 3MLEA 2ZAMA 4EQ6A 2ZRFA 1ZNYA 821PA 4JL5A 5CJPA 2W2VA 3ECCA 3ZJYA 3TRFA 1A7JA 3K0FB 3VTKA 8OHMA 2LKDA 3F8TA 3EZ2A 1FTSA 4G3XA 2BCJQ 3A1TA 1IOZA 3K0CA 2YWHA 4Q9KA 2C98A 3DPUA 2MMGA 3U3RA 3KJEA 4B75A 3FKSA 1IJFA 3LFUA 1OFUX 1T3SA 1W36D 4BE7B 4QBHA 4F4IA 5KU1A 4NYJR 2WWWA 1NSTA 4PPNA 3A1WA 5KSPA 3Q9LA 1HH4A 4PSAA 5KNDA 1UBFA 3LD9A 2GCOA 4I1OA 3BH0A 2WVJA 1X1SA 2ZQ5A 1KDPA 3H0KA 4B2LA 2ERXA 2UVQA 4Q1EA 1OH6A 2JLWA 1P9RA 4QKQA 4UJ5A 3AGQA 2ZI9A 3RWMB 3P26A 2PZEA 4GOXA 4D6PA 2QU8A 1EX7A 1KZ7B 1D2NA 2AL7A 2ZR7A 4G5GA 4AKEA 3F5FA 4N1AA 4B74A 2OCYC 4P4SA 3LAWA 3KQNA 3NKVA 3MWLA 2ONJA 2EWWA 2YWGA 1U0HC 3SYLA 1KSHA 4NDZA 4IDQA 1E2HA 3P20A 2RGAA 4D4MA 3L0OA 4BFSA 1FUKA 1K6MA 1N0UA 5L3VA 1XEWY 2BBTA 2WWXA 3AF1A 3FHCB 3OEED 4FCTA 4Q48A 3B2EA 2ZAOA 2R2AA 3NDBB 4GT1A 4BLPA 3B13B 1G8FA 1EWRA 3KTAA 3RDPA 2OSBA 3DZ8A 2J1LA 4B3XA 4PTLA 1WMSA 3GQBA 5DISB 4FIDA 1YJ5A 4ARZB 2ZRIA 3LBNA 4LPKA 4Q4JB 1TQ2A 4BLSA 1EFTA 1MKYA 3THYB 1DAMA 1NJFA 1P73A 1G3RA 3W3ZB 1AA9A 2QMHA 3TIFA 1CJUC 1XWIA 1NBMD 4NL4H 1N6IA 1VDZA 3VQTA 3CKLA 3K9GA 4TSFD 5LD2B 3J81k 1IN6A 2HUPA 1RYFA 3L0SA 4QM7A 4LUCA 3WBKA 2FSFA 2QI9C 1MO3A 2GDJA 1QHSA 1GAJA 1SHKA 2BMJA 3CH5A 3KXLA 3OE7A 4JVLA 4PPQA 4CZ2A 4YQFA 4EPWA 1T4GA 2VH5R 1DAEA 5EXTA 3PXGA 3UG7A 4BFXA 1E0AA 3N2EA 4Q03A 4Z8XA 3HYTA 5B58C 5TMPA 3QF4B 2R62A 3EC1A 1NN5A 4LHYA 4V02A 3CR8A 4XJXA 4PO1A 4R98A 2P6NA 2V7QD 4KITB 4LRWA 3CNOA 4K46A 1E9AA 1Q0UA 1U9IA 3Q85A 3NBXX 2ERYA 2Q3HA 3FMIA 3IPYA 3O8BA 3CF0A 4BQSA 4BFWA 5AJZA 4H1VA 2CNWD 4A9AA 4WZ6A 2IS1A 4D4JA 3MUFA 1KO4A 3PUYA 3X1ZA 2CK3D 2WSMA 1DS6A 4D0GA 4C3ZA 3U6KA 4QGHA 1N6PA 1LV7A 2VHJA 3LXXA 1ZUNB 2OCPA 4LCBA 4TTPA 2ATXA 2GZDA 2AD5A 5C1BA 3AM1A 1C4OA 4Q7MB 3KJIA 5SZKB 2VA8A 2NO9A 3AVTA 4C4PA 1US8B 1OIVA 4FCWA 1E9BA 2HJVA 3AUXA 5E95A 5A0FA 2NPIA 5B57C 3B5JA 2EU8A 1MO6A 1OKKA 3AP3A 3ZIAA 4DJTA 4LHWA 2F43A 3A37A 3VR4A 4LDJA 1IBRA 1HY3A 2EWVA 4EUNA 2W6JA 3IIKA 2V3CC 5AUOB 3W5IA 4TN1A 4IEIA 3AP2A 3SYKA 5JWRA 2QY9A 4B48A 5AK0A 4UXIA 2HDNB 3D31A 1OXTA 4GMXA 3VR3A 1HTWA 1CR0A 2XOKD 3LX8A 5FBWB 4A82A 1AGPA 1W1WA 4Q21A 4JS0A 1G5PA 2WPDD 1Z6GA 2FFAA 4LV5B 2NZJA 4NCKA 1XD9A 4BASA 3CX7A 1XPOA 2BJWA 2QGZA 2XB4A 1EFRD 4B3FX 1KY3A 2EFEB 4OYHA 1E4YA 4Q9JA 4DEYA 2OO7A 1I4DD 5DLQC 3L82B 1G6HA 1KMHB 4PC3A 3NHAA 3MMPA 3FDIA 4DLXA 1XTKA 2AK3A 4AD8A 3FFBA 2BM1A 2PCLA 2WWYA 2H92A 1BIFA 4B6FA 4Q1AA 2PJZA 1RRPA 2QT0A 4TWZA 4NP6A 1VMAA 2CXXA 4PHFA 4US0R 2IYQA 3I73A 2OBMA 1OFIA 1NSFA 1F2UA 2J3EA 3LRPA 1E1RD 5C18A 4HZIA 2CCJA 4OQXA 4LJ9A 1KMQA 4D25A 4LC1A 1D9ZA 1E9SA 4M9XA 4Z51A 1W0KA 1B23P 4EKDA 2DY1A 3OIWA 4MKFA 1E9EA 1EFUA 4EJSB 1NNEA 5DN6D 4ZDIA 1BS1A 2ZRLA 4QL3A 1SXJC 3OEHA 4LHZA 4YDSA 2NO6A 3I72A 2WWIA 2ZRGA 2DFNA 3P32A 3CBQA 4F38A 3EPKA 1ZNXA 2ZJAA 3AKDA 2NOAA 5GJVC 5FOXA 2GK6A 1ESMA 3GJ3A 4YMSA 3BXZA 4OI1A 1JB1A 1Q1QA 2QTVB 3H2YA 1H8HA 2BKUA 3UANA 4ZIRA 5KDOA 4DCVA 3U7GA 3WYFA 4A0HA 4UNSA 3EW9A 2H16A 3FE2A 4EDHA 5J47A 1G18A 2H8KA 1II8A 3THXB 2CJWA 2QGNA 1P9NA 3KB1A 2IWRA 4B33A 4CGZA 3PUWA 1GUAA 4OI4A 1KDRA 3AKCA 5CYPA 3U2QA 1I4LD 3A1SA 1MO5A 2FH5B 2PL3A 2YWEA 1DVRA 1ZNWA 2CHGA 3GPLA 3PUXA 1EG7A 3QKSB 3T15A 4S2EA 2VTKA 4GL2A 4F92B 4MYHA 4GNKA 1E2IA 1R5NA 2QTFA 2ZJ5A 2CDNA 1N6HA 3DHWC 4DZZA 1MRNA 3JVUA 2O8CB 4BEJA 5AJYA 5IK2A 2WJJA 2QPTA 1UKVY 2C9CA 2ZR9A 1JEDA 1SGWA 1CS4C 2RGCA 5JJLA 1P7CA 2VBCA 2XTNA 3GLHB 3TQCA 2GBLA 1E94E 1SHZA 4M53A 2QP9X 1VCMA 4G1UC 4A92A 1KNXA 1KSGA 1F2TB 3AF3A 4WXRA 4NZYA 5EE3A 2JLXA 3W3AA 1KI6B 1YZNA 3U60B 3TUZC 1I4TD 2CLDX 4MGIR 1Z2CA 4QBGB 4Q4HA 2PEYA 1E2FA 2FEMA 3EA0A 3HR7A 2GZAA 3NXSA 1E32A 1G20E 1HUQA 2WICA 2VF7A 3OESA 2GCNA 1IONA 4B43A 1DBSA 5FI0B 1RIFA 4PHHA 3CNNA 3WYGA 2QQ0A 1IXRC 3PV0A 4PXAA 2PMDA 4A4DA 1M7BA 4EPYA 5BW8A 5JBQA 3GD7A 3RWOA 1WRBA 4BWYA 3KQLA 2H5EA 2BDTA 4ASUA 2BCGY 4RKEA 4Q7LA 1BO6A 1G8PA 4G01B 2XTMA 2GHIA 5E7JA 4IW3B 4UKDA 4P31A 2YC4C 2UZ3A 3U4QA 1ZUHA 5EZ5A 4JKIA 4MRSA 1N5KA 1R2QA 3KDSE 5FOWA 1G9XA 1GRRA 5FOUA 4XTCS 4M2LA 2P0EA 2Q3MA 4JZKA 1AZSC 3VNUA 2DCUA 4V0KA 4DCNA 4MGYR 4TQ9A 4QXAA 3PIRA 2Q9BA 3TNFA 1ZMXA 4UXHA 1FZQA 5CB6A 2XZLA 2EYQA 4K81B 2BC9A 1TADA 2FE4A 2VP9A 2XSZA 5FPTA 1AZTA 5FTKA 1ZAKA 2ZRNA 3QEOA 1AGRA 3CWZA 2IW3A 3CW2A 2C99A 1SKYB 5BN3A 4RD3A 2OXRA 4DHEA 5G53C 4DB4A 1NMXA 1YR9A 3I62A 1XFAA 5FI1B 1OSNA 2R8RA 3QOFA 2I4IA 4RZUA 4HEJA 3TSOA 2BIFA 1RRGA 2BWJA 4LYFA 1LTQA 2Z6VA 3NC0C 2B7CA 1G8HA 2OM2A 2BEKA 3CB4A 4MRVA 4BFUA 3VU9B 1G4AE 1YZKA 3K0CC 1WBDA 2IYTA 1OHHD 1VECA 3I4LA 2YOFA 5JRJA 3NH6A 1O3YA 1KTVA 1U94A 4IJMA 2GEUA 4NYIQ 4D80A 3I8SA 3HP1A 1KHTA 1HV8A 1SVIA 4NYMQ 5FL7D 2YZ2A 3BOSA 4B73A 1JAIA 1NVUQ 3OIUA 3U61B 3SHFA 3K70C 2HV8A 4YXWD 2JDID 6Q21A 4B34A 1LNZA 2QP4A 4GRAA 2HCJB 3M4YA 2IS6A 4HUTA 2Q3FA 4NE2A 4B32A 5GJBA 3D3QA 4FCVA 4HLDA 2WKPA 1ZD1A 3UKDA 1WXQA 1PZNA 1KI4A 1N5IA 1NLFA 2F3RA 1J70A 4IHQA 1L8QA 2FFHA 5H8WA 3IHLA 1GTVA 3Q5EA 4KI0A 3AVWA 2K5UA 2X8AA 4KBFA 4A8JA 2ZXUA 2HF9A 3QEJA 1VIYA 1Z0DA 2DWQA 2CLSA 1RJ9A 3LVRE 2OEPA 5JJIA 4OHXA 2HF8A 1Z6YA 2ZYUX 3HYRA 4DCUA 1S3GA 1AIPA 1AK2A 1FX0B 1JXOA 2GJSA 3ZD6A 2HJGA 2VP6A 3Q7PA 3GMTA 2A2ZA 4BZPA 1Z63A 2YINC 5AUPB 1FP6A 4TQAA 4AIIA 1U8YA 4RCYA 4QM6A 3CZPA 1PUJA 5FPYA 4QJ3A 2CL7X 1COWD 4DRZA 1XXHA 5EP2A 4CIDA 3OIYA 5FBVB 3NG1A 3ASZA 1VIAA 3KB2A 3TAUA 3Q8XB 4DCSA 3B1VA 5SZJA 3GLIA 2WWFA 2G88A 3SEAA 2ZYTX 3FOZA 5G40A 1NKTA 4D82A 1OJLA 1IXZA 4YLGA 2XNSA 4XSGA 3KKNA 4URVR 2HYIC 4BLQA 5FUXA 2GJ9A 3BERA 4URUR 5JS7A 2J0UB 1P4SA 2NZ8A 1QVRA 1R5OA 3BWDD 1NG9A 4IDPA 1EGAA 3T1VA 5JHGB 2O8BB 3P4XA 1AKEA 4TL9A 3TJZA 3GLIE 5KSZA 2J0SA 1YU9A 3NDPA 3QQ5A 2OBLA 4MGKR 4NBSA 1ESNA 2YKGA 3RC8A 4DEXA 2FGJA 1JQLB 4M21A 3IO3A 4MGZR 4I81A 3X2SA 3FWYA 4XVRA 2GZHA 1AS3A 1M1YE 521PA 3VR1A 2FN4A 4DDWA 5HCIA 2ONKA 2REOA 1G7RA 1F3OA 1U9IC 4PO8A 2NMVA 4IDHA 2H7VA 3I3SR 5FUVA 3AVUA 2L0XA 3EX7C 2JIZD 4ZCMA 3FMOB 1T9HA 4WZAE 4TMWA 1LF5A 1YRBA 3OEEA 2G9NA 3R20A 4FI3C 1CF4A 4IVPA 1Q22A 2C77A 4KFTA 3LW8A 4HATA 1NKSA 5M04A 3KZ1E 4W5WA 3EXAA 4Q1FA 2IXEA 1X86B 3W34A 1KI3A 2O8EA 4DLSA 2RGEA 3CX6A 2C9YA 5F2EA 1FFHA 4C7OA 4DLTA 1NBMA 4QGFA 2X2EA 3UXMA 4WIAA 3SFZA 1CR1A 1Z5ZA 2W58A 4TSFA 1XX6A 2J7KA 5DYGA 3K70B 1VG8A 3KXKA 1N6LA 2Z83A 2GCOB 2R9VA 1CLUA 1I2MA 1DTSA 4TZ6A 4QHSA 2QBYA 1P60A 3C14C 2WOJA 2YWFA 2O8DB 3CRMA 5IT5A 2C8VA 1S8FA 1MH1A 1XEXA 4LJ5A 1OFHA 4C0BA 4DVGA 4PSVA 3GLFE 1G7CA 2V9PA 4FWIB 4KU4A 4IRUB 2PX3A 2V7QA 1GP2A 1XZQA 3HU1A 1Q57A 1G5TA 4M8NE 4X8MA 1N6NA 3C7KA 2RH5A 2KBFA 1Z08A 3MD0A 3O8DA 3QPVA 2FDCA 1F5NA 3ADKA 4LHXA 3ZZ0A 1MO4A 2BJVA 4LJ8A 3BJIC 3KJHA 1QHHA 4PR0A 2X19A 2CNWA 4LC0A 1LS6A 2C78A 4W5HA 3GLGB 1Z0AA 5J5CA 2AK2A 1Y3AA 2CK3A 3LQQA 3B9QA 4JBWA 3WNBA 3Q5DA 2ZE7A 5G3ZA 1QG2A 1J90A 4HB2A 1P72A 3BH7A 5D3MA 1WBBA 1PUIA 2E9SA 2N46A 2IXGA 2NQ2C 4ZDJA 3RRYA 4DT1A 2IT1A 4LYHA 1H65A 3QXCA 5JEEA 4IXMA 4Q1CA 2YNMA 4CEIA 4PHTA 4QFMA 4D0LB 4ZDKA 2BMEA 4MKGA 3JZMA 1W2HA 3MRSA 2C2HA 1SVSA 2ZVQX 4JBXA 3X1DA 2QTHA 2ZI6A 5FBQB 2ZU0C 2D7DA 2B21A 2HLDA 4HLUA 3K53A 4JYBA 5JCPA 2RGNA 5JSZB 2OFXA 4NCJA 3T06B 5EE5B 4JIMA 2ZEJA 3C5CA 1UKYA 4FD2A 2XOKA 3B7GA 3QKRB 2ZJZA 4IDOA 3KKOA 4HUQB 2XZPA 3GJ7A 3ADBA 2RGXA 1SVWA 3LXRA 1E0SA 1N2CE 1X8JA 2CCGA 1ZD8A 3EZ6A 5FUWA 5JHHB 2WPDA 5E4FA 5JI2E 4AY2A 4QGGA 1MABA 2IHYA 2KB0A 2IYRA 3TE6A 1EFRA 2WJGA 1GNRA 3BAFA 4Z54A 5CK4A 2OT3B 3CRRA 4KXFB 3BBPA 1GVNB 1ZIPA 4O2LA 3U7HB 1VKJA 5KHOC 3AVYA 3M1IA 1XCGB 2KBEA 1M6NA 1W49A 4HAWA 4FN5A 3DMNA 4TL7A 3F0TA 5HE9A 1CKEA 1XZPA 1HYQA 2REXB 1YZGA 5AUQA 4A2PA 3IDQA 4E03A 1E1RA 2BVNA 1ETUA 4PZYA 2QE7D 1XPRA 3L43A 3I5XA 1W4CA 3PENA 2QAJA 4JJZA 4OJQA 3ADCA 1NIJA 2B8TA 4I4LA 2G0NA 4I99A 3B9PA 3NBYC 2OCBA 3AVPA 3E5HA 3UWKA 3JVVA 2VO1A 5DN6A 4B3GA 1CEEA 4YMUA 3NHBA 5LB2A 1OB5A 1Z0JA 4IFBA 2GBLC 4P0TA 4OHWA 2V55B 3DDCA 4RFSA 2DYKA 4HLCA 3RNLA 1XPUA 3NIBA 2XNDD 5DI3A 1G7SA 4WOPA 4JLBA 1ZVQA 2FX3A 4X8HA 4Z8YA 4PC7A 4GBMA 3BFKA 3LDAA 3IO5A 2JJ8A 5C4GB 1MT0A 5JEDA 2TMKA 1P62B 3IEVA 1QHIA 3NEJA 2AKYA 4NPHA 2FA9A 4DWJA 4TYQA 5GVSA 4JLMA 4WBSA 4O0MA 2WM9B 4B3DA 5CLLA 2QMOA 4NCHA 1WB9A 4GZLA 4KYIB 4TLDA 3C8UA 1KK1A 1KIMA 1XB2A 2CCKA 3ZYCA 3BS4A 4DB2A 1WF3A 2F55A 3RVBA 2RHDA 4BRUA 1YVDA 2QEQA 2VIIA 1DE0A 2X77A 4PO9A 1KJWA 3KXIA 4ZV4A 1ZYUA 3VKGA 1G5RA 4Q19A 2WMNB 4IVRA 2J87A 3QXJA 2XJ4A 4NU0A 1F2UB 4C0SA 3U44A 4C0HA 3ZVMA 1XP8A 2D7CA 1JR3D 4OL0A 3EPHA 2YYZA 5C4MA 4NTZA 1CP2A 3PEYA 2YV5A 1SZPA 3QUSA 4Q4AB 3UK6A 3PEVA 1TQ6A 4DIDA 1R0ZA 2CL6X 3CIOA 4S35A 4I1UA 1XNJA 1KKMA 1A1VA 1P9WA 4JSYA 4JLDA 2R6DA 1CRPA 3CPJB 4C0QC 2GTPA 4RD6A 5AWFC 4MA4A 4FMCB 1NN0A 2AR7A 2GF9A 4G5SA 3KUDA 4MUAA 3FTQA 3IBGA 4A15A 1OH8A 5HZHA 5CITA 2ZUCA 1KJZA 3LO5A 4M4SA 3KQUA 1UADA 1P75A 2P5SA 2IBMA 1GITA 2ZANA 1PVOA 3UMSA 1UJ2A 1ZINA 5CDFA 2H18A 3MFYA 2ZROA 3CO5A 3FMPB 1VHLA 3I92A 1PV4A 1TMKA 3DKPA 2GEVA 5CK5A 3R8CA 3AEZA 3TVDA 1NMYA 1TF5A 1OXXK 2OZEA 4JLNA 5E7MA 1S9HA 3QVUA 2CVFA 4D81A 2GXSA 3T1OA 1UFQA 1E2MA 1G64A 2CJWB 1FW6A 3B1YA 3B6EA 4DUGD 3K0FA 2BKEA 3N70A 4LWZA 5ANRB 2O0HA 5JECA 4M9ZA 3SJBA 5CDFE 3D7MA 1S3SA 1DAIA 3U7FB 1SKQA 3EG5A 4IXNA 3A1VA 2IA5A 5D3QA 4U7DA 3BORA 3SBDA 4TT3D 2C03A 2QAGA 2ZRKA 4RD1A 3UMRA 4CYMA 1OPXA 1QBKC 1KSJA 2IYZA 3QNUA 3RABA 1DG3A 1CR2A 2HLDD 4ZO4A 2QRNA 4A8JC 3TKLA 2J41A 5AR1A 3GJ5A 4NKRA 5J4LA 1JPNA 1G8YA 2QSYA 3U5ZB 1KDOA 1Z6TA 2JGNA 4YDHB 1SVOA 2H17A 2JA1A 3GP8A 5EUQB 1E0KA 1D2MA 5FTJA 4D0NA 2EFDB 2IL1A 2GXUA 3O8RA 5J4HA 3C4JA 1QHNA 1X3SA 4KFRA 5G3YA 4UNNA 3SN6A 2NTYC 3R8FA 3LBIA 1MR3F 5HR5A 5EXPA 3WMGA 2ZRHA 1E2KA 4Q9IA 1CJTC 1E98A 1HE8B 2ZRPA 1CULC 4XWAA 1FQJA 1AQUA 3TLXA 1TEVA 3NWJA 1OHHA 3IEUA 3UG6A 2IX3A 2BHRA 5BYKA 4DC9A 2IUTA 1Z29A 2QRZA 3QBVA 4OBEA 3ZZUA 1W36C 5FL7A 2PX0A 2LCFA 4CEJA 1TUEA 2F1RA 4Y0AA 5ELXA 1XD2A 4R2IA 3ZH9B 3TR0A 4AC9A 3DOEA 2IC5A 4TLBA 2JDIA 4YXWA 4ABYA 3WNDA 1U99A 3MJRA 2ZJYA 3EZ9A 5J40A 1N6RA 3K09A 1L4YA 2C5LA 1BH2A 3RRZA 5GADl 3OAAD 4L16A 1Z6XA 2ANBA 4MYCA 2FWRA 5EJEA 3U4QB 2ZRJA 1WQ1R 4TYPA 2FV8A 2DB3A 4ARZA 1XCPA 2V54A 2JASA 2H1LA 4Q01A 1OH7A 2ZSAA 3F3YA 3THYA 3CX8A 5TXGA 4B6EA 3IUYA 4LHVA 4O2RA 2JATA 1OFTA 2JLSA 3REGA 4F91B 1QF9A 3R9WA 1A4RA 3RS0A 4XD7D 3G5UA 4R71A 3UWOA 1Z07A 2RMKA 1CJKC 3AF2A 2IS2A 1XMVA 4IOKA 2GJKA 1W46A 2FGKA 1T5IA 2FFQA 3LLUA 2ZETA 4A6XA 4EAQA 4BUJA 2VP5A 2YC2C 2EFGA 3U3KA 1COWA 3A36A 2V6IA 1OW3B 3QF4A 3L0IB 3L0PA 3WNCA 5SZIA 2YOGA 1YE8A 1CTQA 4AKIA 1E79D 1F60A 4QNRA 3QSYA 4AYXA 1J99A 3LLMA 3HPRA 5FOVA 3V4RA 2ZI7A 1DAHA 2F1IA 1RRFA 4HAZA 1ZU5A 3OFND 4P4TA 3EAQA 1TEXA 1VG9B 4W5JA 3SJAA 5C46F 5KOYA 1JAHA 2OE2A 2OILA 1IM2A 2GNOA 2IHBA 4FWTA 2FJUA 5AJXA 5JI3E 3PUZA 4TMZA 3VR2A 2EQBA 2GAAA 4PPFA 3RSLA 1E2DA 4ZPXA 4WAUA 5FL3A 3DL0A 3RS3A 1UEIA 4DDVA 2VP0A 2FNAA 2XXAA 4QBFA 2Y8EA 3HU2A 2GVDC 4NH0A 1TQ4A 1US8A 4KV9A 5BWMA 1ZC4A 2WSSD 1Q3TA 1XTSA 2GEDA 2ZUDA 5FH9A 1M74A 3I5YA 1U90A 1R6BX 2G6BA 1FPMA 4IVQA 1L2TA 1KO1A 2ODEA 2QM8A 4FINA 1OF1A 1NF3A 4Q9HA 3TBKA 1RZ3A 4US1R 5KSOA 1ZM7A 2J7PD 2JIZA 5KYKA 3ZLJA 4ZI2A 2GF0A 1D6JA 1YZQA 1HQYE 3WHLA 1S1CA 1E2JA 3FHOA 3AVXA 1AM4D 5IHPA 1DAKA 1LW7A 1UDXA 1AJEA 4BPBA 2QUZA 2VRWA 4OQFA 4QBIA 3AF4A 1EK0A 2RB4A 1HT1E 2OLKA 3CRQA 3DZDA 1GKUB 1LVGA 4PZZA 1YQTA 3C16C 4JVNA 4ZKDA 1IY0A 4CRWB 4V0MA 2PMKA 2QG6A 2ZYVX 2JJ1D 3QG1A 4XSHA 2IXFA 4ZKEA 2GAOA 1VG1A 2DFLA 2OFWA 2ORVA 1KI9A 2A30A 3GLIB 4EPVA 1KMHA 2P2LA 2GKSA 3H86A 4B47A 4C0LA 4RSGA 3DEFA 4JL6A 2SHKA 2VHTA 2QT1A 3SZRA 1FUUA 3FB4A 2WJVA 3N2IA 1G1MA 5CJ2A 3PQCA 5KNCA 4AKHA 2FSGA 2NO7A 2X1VA 4V0ME 2B6HA 3EIQA 2WIBA 2D2FA 4HLUC 4O25A 4FMCF 2CL0X 2RGNC 4HZUB 1NRJB 1KI2A 4M1SA 1FNNA 4U00A 3M6AA 2Z0MA 5EZ6B 4UXJA 2QL6A 4UNQA 2VP4A 4KODA 3IGFA 1GFIA 2ZI3A 3TR5A 1JI0A 2Q21A 3EA5A 3T61A 1W4BA 2JAQA 4A0FA 1Z8FA 3TVTA 1SXJB 3KQKA 3EIEA 5UKDA 3S1AB 1GM5A 4B44A 1GILA 2QORA 2Z4SA 1XD8A 5B64A 5EP3A 1OH5A 2D4HA 1F48A 1Z2AA 3KKMA 4MUBA 3AP1A 4HYYA 3ZQ6A 3T12A 2ORWA 4JLKA 3VMFA 1EFHA 2OLJA 2A3RA 4GZMA 4O3MA 2WHXA 1Y63A 1PLJA 2FZ4A 2XJ9A 2ZJOA 4X8OA 221PA 4LBVA 2E1RA 3V9PA 2G77B 4OK5A 3IQWA 4E09A 1MRSA 3IKJA 4M9SA 3MCAA 721PA 3KKPA 4B35A 1OV4A 4HSEA 4Q1BA 1UAAA 1G16A 4QRHA 1AKYA 2PT5A 4AYTA 1JEEA 1G8GA 5JLJA 3OIVA 3Q7QA 1YZUA 5HE8A 4CW7A 4ESVA 1G41A 1K5DA 121PA 3SR0A 1M7HA 2QP3A 2OCAA 4DBLC 3THXA 3LW7A 4CEHA 3ONWA 1UPTA 1UBEA 3LWNA 4AI6A 3CONA 2A5FA 4R2HA 4U5XA 1X8LA 1Z0FA 5H70A 3GLFB 4P33A 2R6AA 5J4YA 4AYWA 1ELOA 3QKSA 5CLQA 3UMFA 4JYCA 2W0MA 3FKQA 5IF9A 4BLOA 4E22A 3EIHA 1DADA 1P6XA 4KSCA 3KX2A 3PVSA 2G83A 2O8CA 5DE3A 2OUKA 2OAQ1 3R7WB 3IQXA 4XWOA 1E2LA 1ONBA 2G0TA 3EARA 1XEXB 3LY5A 3U6BA 1S0UA 1BMFD 1R0YA 2IUSA 1E2QA 5BXQC 1GRQA 3B1ZA 4KYUA 3QKTA 4V03A 3GLHA 4MQBA 3E1SA 3W6PA 3DM5A 4I1VA 2C04A 1TQDA 2BOVA 1P2TA 2ZR0A 5J4VA 3RS2A 1R7RA 3M0EA 1YZLA 4URYR 1N6KA 1NY5A 1F2TA 4KCGA 1BKDR 5FUYA 1T3HA 4OI0A 1KI6A 2E87A 1OB2A 1JECA 3DOFA 3EZFA 4L4UA 2RGBA 4KO8A 3PEWA 5CIQA 2QE7A 4D2IA 1OE0A 4TMXA 4YONB 2O8FB 3MWJA 3TW8B 3GLHE 1M2OB 2QROA 1LS1A 2ECKA 2F9LA 2REBA 5EQTA 3SJCA 4XH9B 4LZZA 1XXHE 4TL8A 5IRCD 3QXSA 5FPHA 1ZBDA 2XTZA 2QZ4A 2ZI4A 4OJKA 3K9HA 3B82A 1KYIA 3BRWD 4URZR 3QPWA 2ZSEA 4LJ6A 2XNDA 3SI7A 3G0HA 4NCIA 1KK3A 3BC1A 4F7WA 4RZ2A 2PLRA 4OK3A 3U3JA 5IDVA 1W0JD 3PCRB 4HAYA 4DLVA 4URXR 2VQSA 2BMFA 2GXAA 3VR5A 2IEYA 3VHLB 2W2XA 1DOAA 5FTNA 4Y0VA 1KAOA 4J0QA 1BYUA 4EQ6B 1XTIA 4LK2A 4A2QA 4LGMA 3T1QA 2QN6A 5K8UA 3TGPA 4KSBA 2WZQA 1DAFA 2ODWA 5HTKA 4GMDA 3I1FA 3H4MA 3AQ4A 4LYAA 4DKXA 3GJ8A 5DYIA 1E2NA 3ND8A 4AG6A 1XEWX 4ZCIA 2G1JA 1KSFX 4EIWA 2NO1A 3I8XA 5DHFA 5AUNB 2ZS8A 3RLFA 4ILEA 1N6OA 5J4KA 5L8VA 3A1UA 2FFBA 4Q4LA 3ZVLA 4OHZA 1OXUA 2ZRAA 3VNVA 2V4ZA 1NJGA 1SKYE 1JR3A 3QKUA 5FTMA 2QAGC 3DKVA 3THWA 2ZE5A 1J2JA 4Q5IA 1EXMA 1U0JA 4B71A 1I2DA 1PLKA 2J46A 3A6PC 3CZQA 4LI0A 1FOEB 2OBNA 3RS4A 3KJGA 4A1FA 3B78A 2FSIA 4PAOA 1NBME 2RGDA 4M1WA 1N0WA 2PEZA 2R6FA 1IN4A 2EW1A 1JR3E 5FTLA 3CF6R 4RVCA 2R44A 4P4SB 2ZJ8A 3THOA 4JT4A 1TF2A 5EE1A 1R0WA 2VHQA 1P5ZB 3RS5A 3SNHA 3WHKA 3L8YA 1ZW6A 5TDHA 1TX4B 2ZUBA 2KJQA 4PC2A 2XEXA 1J8YF 2XGJA 3LX5A 4YMTA 4P3YA 2D3WA 3K0AA 1W4RA 2FG5A 4PPGA 3IHWA 3VFDA 2WKRA 2J45A 2RCNA 3G82C 1CBUA 1Z47A 2W6ID 1FX0A 1G19A 4B2IA 2ZREA 3MWYW 4DUGA 4LX0A 1U81A 4C9BA 3KTAB 2C95A 2N42A 5BN4A 1EWQA 3ZQJA 4XVQA 3K09C 2FMXA 1II9A 1XBTA 3ETLA 3K0EA 3H84A 1P2UA 1DG1G 1RKBA 3R9IA 2G3YA 2QNRA 3AF0A 4QJ5A 1GKYA 2AKAB 3ADDA 2BBOA 4LBZA 4TT3A 3WBJA 3EPJA 2JLYA 4L8GA 4G5RA 2ZM5A 1RC8A 3FFAA 2ZSFA 3AV0B 5JWOA 3DMDA 1Z28A 2OAP1 2GESA 2CMKA 1OIXA 2GXQA 3REFA 1NP6A 2J0UA 3AVOA 3NH9A 3A4MA 2ZYWX 5LD2C 3A8TA 5L3SA 4E5UA 2DHRA 4KLNA 3LQRA 1PJRA 2OESA 4Q00A 2O8BA 2AD1A 4L5BA 5L3RA 2GETA 1T0JB 3RRNA 1S4QA 1ZP6A 3T35A 3MAAC 5K8TA 2IUUA 3LBHA 2JLUA 2IYVA 3FVQA 2HYDA 1OT3A 1Z0IA 5L3QA 4MKIA 2B92A 2X2FA 2ZI5A 1X6VA 1R8QA 4FMBB 4PX9A 1R8SA 3LVQE 3CRVA 4C0KA 1W4AA 1OIWA 1NLYA 3IBYA 2ZVPX 3K0SA 1G17A 1D2EA 1O87A 3K1JA 3GFOA 2ODNA 1M7GA 3ICEA 4HB0A 3QENA 1MV5A 4IOJA 4M1OA 3GFTA 2IWHA 4AK9A 3W8NA 4RFVA 2WKQA 3TSWA 2D62A 2OG2A 3OAAA 3SBEA 1KI1A 1TF7A 2W0SA 4ACBA 2YVUA 4BECA 4MRNA 1FL9A 5A4JA 5DH9A 4TL6A 1QRAA 1GKIA 1Z22A 3AKEA 4L15A 4TTQA 3VX4A 4KVGA 3TUIC 4RD4A 1ZUIA 4QC2A 1IN7A 3CUEF 2XAUA 1XJ0A 2YJTD 5EXSA 2F43B 2GVZC 4XTRA 4UNRA 2QAGB 4DIEA 5LDDC 1X1RA 4E07A 1E2PA 2CVHA 4XD7A 1QHYA 3CWQA 1Q1ZA 1W2GA 1M34E 3BH6A 3KFXA 3EZ7A 5AJWA 1L4UA 4CVNA 1HE1C 3A58B 1GNQA 3AUYA 1UEJA 2A9KA 1YRAA 1T91A 1TAGA 3CRW1 2KE5A 2OV2A 3QF7A 1RFLA 4PAQA 2MMCA 2D2EA 2IF2A 3U7EB 2AXNA 1T8UA 2JJ2D 5DGXA 2O8DA 3HDTA 4EPXA 1U2RA 1XEFA 4JMPA 4DSOA 2DR3A 4MH0R 5CM9C 1GL9B 2VPPA 3AGPA 3PITA 1E79A 1VPLA 1OYYA 3K8YA 1SXJD 3WMEA 2O52A 4KHZA 5KDLA 1E9CA 4TYNA 1E9FA 1N5JA 1ZM4A 3NEYA 3OFNA 1BYIA 2QQEA 5KO2A 2R65A 1RVDA 4V0LA 4F4JA 5HZKA 1Q21A 1NN3A 4A0RA 2VLIA 3IPXA 2YOHA 1A2BA 5TARA 3UPUA 4CEJB 4C2UA 3GLGA 1XD2B 1GL6A 3PG5A 2B7BA 4HAUA 2QENA 2IYXA 1BOFA 4PANA 1CXZA 1XMSA 1IXSB 4POAA 2CHVA 4ZCLA 4D4LA 2PT7A 2A5DA 3EASA 1HEIA 4R7ZA 1TU4A 2W83A 4DSTA 3A4LA 1E3MA 1VYTA 2CE2X 1UM8A 5EP4A 1DO0A 2I1VB 2WSSA 4LYJA 1XDBA 4MITA 5FR1A 4GSYA 5JFGA 3GLGE 1H8ED 1JALA 1Q1BA 1J8MF 4QOSA 4EJSC 3GEHA 1E69A 3SYNA 1AS2A 1DO2A 3B1XA 4G5QA 4HDCA 2J7PA 2ZE6A 3AH8A 3BB1A 1T3LA 4GOKA 4QNMA 3NC1C 5JSZA 3KQHA 1KO7A 1G7TA 3WP0A 1QG4A 1FMLA 1YR8A 3QKRA 1IHUA 4HUQA 1NVXQ 2D74A 3H1TA 5KSYA 4ZIRB 1NIPA 1QHGA 1SULA 2JJ1A 1XMIA 2JLRA 3HWSA 4QHTA 3RANA 4KLZA 4YC7A 1HT2E 3RS7A 1II8B 2AN9A 1LB1B 3MSXA 3Q3JB 2I3BA 4M1YA 5BQ5A 1V43A 1VCNA 3UIEA 4ITRC 4B3BA 5HKKD 3W6OA 2BM0A 2O5VA 2HXYA 3BB3A 3E70C 2QPAA 1N25A 4C2TA 1P3JA 1CR4A 3GJ0A 3JZAA 1TL7C 4BFZA 3R9XA 5EXXA 4DDTA 4BGDA 1GOTA 2J9RA 4RJLA 3SDZA 2J0QA 4RZ3A 1E1QD 1C9KA 1GDDA 3QBTA 3QI2A 4V0NA 3B60A 3TSZA 5K8IA 4Z1MD 2CBZA 1DELA 2Z5FA 1A5TA 1SVMA 2WAXA 4QHYA 2F7SA 2XXAB 1PLLA 3C41J 2XZOA 1Z06A 2O0JA 1UDWA 2YHSA 4II7A 4H1UA 2VHUA 4LBYA 1Q20A 3FGNA 4OQLA 3ZDQA 3WRXC 2V1UA 3CH4B 1R0XA 1NVVQ 3OZXA 2Q0HA 3SOPA 4KVAA 3SQXA 4CF7A 2IS4A 4BZXA 4B3CA 2RKOA 2C9OA 3X1WA 3EC2A 1Q3HA 4Q4HB 2ZS9A 3MGCA 4FXPA 3ZVRA 1E2GA 3D6TB 3PUVA 5A5GA 4PAMA 4MKHA 4F93B 1D8TA 4A36A 4PC1A 2VL7A 1U98A 4NONA 2P3SA 4Q47A 5DO9A 4EPRA 2C96A 3SHWA 4UJ3A 4ACAA 2CHQA 2J5XA 3CPEA 4HLQB 2BBWA 5CIWA 1KAGA 2DBYA 1Q12A 4LJAA 4C30A 1G3IA 4Q1DA 3TQFA 2DWPA 4FW9A 2LKCA 4G5OA 4R9UC 1ZNZA 3V00A 3HJNA 4JBYA 1KO8A 2GWHA 3BE4A 3BGWA 1XF9A 1Z6AA 3PR1A 1S2MA 2A5GA 2KI5A 4NCNA 2ZRBA 3WY9A 2P6UA 1N5LA 4N3NA 4Q4JA 4GOJA 4QJ4A 4JLJA 421PA 4JVSB 1IN5A 2ZTSA 5LPNA 3T34A 3X1YA 1A82A 2WOOA 4UQOA 2A78A 4DLRA 1II0A 1ZD9A 4JLVA 4PFSA 1NN1A 1G3UA 3GFPA 3FKSD 4US2R 4OQNA 4PHGA 2HEIA 1GNPA 3NTUA 3PFIA 1YZTA 4B76A 3VAAA 2BBSA 1W5SA 1ANKA 4NHOA 3K70D 1NLZA 1BMFA 4LPSA 4AKGA 4U02A 1YHNA 4Q4AA 2AHOA 4DLYA 3FPAA 4MRRA 3K9NA 3HU3A 3ZS8A 1K5GA 4EJSA 1A2KC 1IQPA 2GCPA 1W44A 2W00A 1WA5A 2ZJBA 1KI8A 3CNLA 2MSCB 2R6CA 1L7VC 5FOSA 3FHTA 2WTUA 5C2JB 3UATA 1RRCA 4EFNA 3SS8A 4BFYA 2AX4A 1SVLA 1DEKA 2WV9A 4NMMA 1VYVA 2ZRDA 1XTQA 5JCZA 3BK7A 2V1XA 5EE9A 2ZPTX 3WMFA 1UKZA 2F9MA 1NL3A 1Z0KA 4M1KA 1UF9A 3T1TA 2ANCA 2QM7A 1G21E 4N0EA 2MSDB 2FF7A 4JSTA 4MYTA 2FPLA 3KUCA 4BFVA 1JNYA 2BEJA 1DARA 1KOFA 1FNMA 4DXAA 4DDUA 4WW0A 3ZD7A 4W9MC 1G291 2AWNA 1ZC3A 4CT5A 4HB3A 4M9QA 3O8CA 4JKYA 4OHYA 3IILA 4P4UA 1CU1A 4RKFA 2IK8A 4MRPA 4TLAA 4JLOA 1KK0A 4RY2A 4XIGS 4AWXA 4CEHB 5G41A 4URWR 5GVRA 3RRMA 1KDTA 1GSIA 2O0KA 3BIFA 3EPLA 1HA3A 2QSZA 1OXSC 2ZITA 1W0JA 4LV8B 3VX3A 1GWNA 4Q66C 1WE2A 3OHMA 1XRJA 4ZDWA 1ODFA 2VSXA 3DM9B 4A8JB 4M22A 4LJYA 4HAXA 3U3OA 621PA 1RJ9B 3SJZA 4YMVA 4JT2A 5TV2A 4M1TA 4JLAA 3DVLA 1ZJ6A 3IIMA 4A2WA 1G4UR 2V6JA 5JS8A 2GRJA 2IYSA 1CIPA 5FBLB 3OE7D 4DLUA 5TVKA 1IN8A 3BD9A 5E3HA 2ZIAA 1JQJC 2CEAA 4TLCA 1ZM3A 1S1MA 5DHAA 1XXHB 3U3MA 2R6GA 1W48A 2J59A 3PJRA 1RE0A 4GP6A 3SFVA 2A5JA 1AN0A 3W8RA 3MJHA 2Q9CA 3C5HA 3W5JA 4JL8A 1W36B 1WCV1 2VF8A 5LBIA 1IJEA 2MSEB 3V4FA 1N0VC 3P27A 3ND9A 2IYUA 3QVVA 3SC3A 1N3BA 1WDTA 2FEOA 4EFLA 3PEUA 4BLTA 4KJZA 3E2IA 2W2TA 1GZSA 3AVVA 2OHFA 1LFDB 4RCZA 3W90A 3TH5A 5FPKA 1ZCBA 4RD0A 4Q02A 4PQYA 2AXPA 2FSHA 2FOLA 1E2EA 2N1BA 2UKDA 3NBZC 2QPOA 5EP1A 3L8ZA 1AQYA 4MYUA 4A0GA 4GDFA 1VCOA 1T8TA 1FMJA 4P32A 3WYAA 2GJ8A 1KJYA 3B1WA 4GI7A 2FPMA 4W7SA 2RAPA 2F1JA 2HXSA 3GEEA
chains in the Genus database with same CATH superfamily
5GM1A 4MPJA 3BWYA 4FKMA 4BMOB 5F3RA 4L3OA 3VM6A 1RYNA 2NU9A 3KP1A 3HVJA 1ZLYA 3VR4D 4ES6A 4MDEA 3U40A 4TLEA 4YTEA 4EUHA 3UCFA 4N3BA 1R4AA 3HJGA 4RFLA 2XWQA 4DCCA 1JJVA 4E46A 2XVXA 3RYIA 3MOGA 1DQYA 2RHMA 2Y6VA 3DMYA 4CDGA 2W6IA 1N7JA 3E7FA 3A28A 1E7SA 5D5PA 1FFGA 4J9VA 5FB3A 5BWCA 4OUDA 4GBJA 1EGHA 2JCGA 5A6VA 4K9KA 5KBYA 1AXRA 2B37A 5GIPE 3JQDA 4X66B 3CVJA 1X9IA 1Z7BA 2Q6TA 3SIWA 4D56A 5MN5A 3C3CA 4RMJA 2O8EB 2PJDA 1VJRA 2PAAA 5E7IA 4D41A 3VR6A 5B2ZA 4C43A 2EYUA 1G8JA 2I1LA 2IZ1A 2AYXA 4Z9FA 1KDVA 5HA5A 5J58A 2CJXA 3F5SA 1XDSA 7AT1A 1KYTA 2HCBA 2WAYA 2I7CA 1E1LA 1DUIA 1WR8A 4G24A 4GVLA 1X1AA 3JYQA 2OYCA 3N2ZB 4LI3X 5ALIA 3RTAA 2WWHA 5FFMA 2IQIA 4R2XA 2IEZA 4II2A 4RENA 5L3ZA 1OROA 4I4NA 4OI2A 3JWHA 2JZOA 3E48A 1CUEA 4TKVB 1R3UA 4TV9A 3E8MA 5HOEA 1XZAA 1XI2A 3TI9A 2DQYA 5HRAA 3LTNC 3NVKI 1Q0QA 3L4BC 4JQYA 4KV7A 4Q05A 2OD9A 2Q9AA 3NBFA 4R5HA 1XR3A 4P5DA 2MINA 1NG1A 3TK1A 1JKJB 2PNFA 4NATA 5A7FA 3AVQA 3FYDA 3BA6A 5H1YA 1P2VA 2DSNA 2J9GA 2VQDA 4KBGA 2WWGA 4O2AF 4OQPA 4BFTA 1UKEA 5B58T 4EYGA 1USIA 3HA2A 1W0KD 3MRTA 2DCMA 3DAHA 2CLCX 4OMFG 1W7AA 4OGKA 1GQ2A 4CMKA 1EINA 1IB0A 2FR8C 2X5NA 2XCQA 1RPZA 1L4BA 1VHTA 3L0YA 4LOAA 2JPDA 1B6GA 2VCEA 4NBRA 1YDMA 1HEUA 3PX3A 4LDNA 2GBGA 2QDKA 2VH2A 4YFYA 3V8RA 2XUQA 4OLJA 2Q5IA 5AI5A 4K6FA 1QHHB 5FDFA 2C4NA 4DUYB 1QYRA 4X8LA 1RVV1 1I94B 1Z3IX 1YMVA 2FG7C 3K0AB 1MOZA 3BYZA 5CA1F 3F3KA 4CKYA 3G89A 3R0IA 3N9IA 1P91A 1QHEA 3RIXA 4BKOA 4QTYA 5JARA 3B48A 1MJNA 3F90A 3HDGA 1DEOA 1J00A 2EFCB 4KN6A 4XQCA 4OK6A 2HRRA 1RW4A 2EW8A 2DZDA 3GEPA 5ELMA 4AX4A 1BXZA 2CDBA 3K30A 3LC2O 5BN4B 5LL6P 3AB3A 3COSA 3AUKA 4JI3B 4FNAA 3SHOA 4AB1A 9GPBA 4BMNA 4DIUA 3PR2B 3WLPA 3K35A 4MAMA 4BNDA 4H1WA 3EW7A 2FZVA 3OQ6A 5A5VA 5JZVA 3O0TA 3FYHA 2Q7OE 2GILA 1IU9A 4V0QA 4UU0A 3PT5A 1S96A 1JR4A 1V8DA 1Z8DA 4Z0PA 4F12A 1TZKA 2GJAA 3ZHTA 5DNDA 3NM5A 1OBOA 2W43A 1NV9A 2WHPB 2C88A 1EX1A 2FZLA 5AJVB 4AQ7A 2ZIXA 2H5LA 1IYZA 2RGGA 3GJXC 4X6LA 3SF8B 4EB6A 3UJ3X 3G8BA 3SQMA 4BX9A 1GSOA 1VXRA 5AHWA 1BQ3A 5L3SB 4OQMA 3R76A 3AEQA 4TSRA 4U7JA 5DW0A 3OQPA 3PL5A 3KPYA 4HBGA 4MOWA 4GIBA 1GEGA 3KQSA 4MINA 2B9EA 2V7PA 2ZWVA 4BLVA 4LSGA 1UBOS 3E18A 3GJ6A 1E4VA 5HYVA 2X41A 3N8GA 2IHTA 4DLWA 1GRNA 1W5TA 2KHZA 3H16A 2MHCA 1F8GA 1V3UA 4EF4A 1BGWA 2PV7A 4G0NA 2QLNA 2VBIA 4ON9A 4TV8F 5F5NA 3SC6A 4QOFA 1C0KA 4EW1A 3VPAA 2C54A 1X7ZA 5CB8A 4AKTA 3I2KA 1XG5A 4MPRA 5AVJA 2HSGA 3PWSA 1P0FA 3MCTA 3GD5A 1T26A 2WJPA 3WZ2A 3E5MA 1QYIA 2C5EA 5TB5A 4BZQA 4D57A 5IT4A 3F6PA 3ZNPA 1GTJ1 4D02A 2FU5C 2UXCB 5E1BA 4FYJA 2IH2A 5AKKA 2VNHA 2HA4A 2DOKA 4RVUA 1E4OA 4XWKA 3RHFA 2IYYA 1I1NA 3GJ4A 3O47A 5CCBA 1KY2A 4I9FA 1BXRB 4PNPA 4NQZA 5DGTA 3T5MA 1XHLA 3P0HA 4C0AC 3V1NA 2XI4A 2VUIB 3CLVA 2I1WA 3DBLB 3INNA 3LV8A 1P74A 4WLVA 3JVEA 1AS0A 1KO5A 1TCVA 3E15A 4DLZA 5AW7A 5BMVA 3GARA 5AI8A 2W2KB 3CR3C 2V5VA 3C3KA 2JLZA 2OV1A 2JIRA 3E9QA 3KT3A 1QLWA 3ELWA 4QGAA 2GZ3A 1H8EA 4ASUD 5JS1A 2PJUA 3X3HA 1JZTA 4O4LB 3QXHA 1T1IA 1GG8A 1I8TA 2VZ0A 1JHOA 5C31A 1ZU4A 1P80A 4BJHB 3L1UA 2OSVA 4MPTA 1A4UA 3CINA 3GLFA 4RTQA 4YP7A 5DI3B 5GMOA 2NGRA 1MMFB 4YAUA 1FDOA 2ZSBA 1HT0A 5FF9A 1CB7A 5KMGB 2VS1A 4H0CA 4JGGA 1H2XA 4L8FA 3CPHA 4WXYB 3SYTA 1XRPA 2WP0A 1F6BA 5F7OA 5KUTA 2PH1A 1PT6A 3RBXA 1OC4A 3NHRA 3QY0A 4V0OA 1ZHFA 1I3CA 4LV6A 4H31A 2P65A 4LCJA 1NWHA 3AWDA 4KDEA 4CF4A 1QVZA 3HCDA 2C2YA 2VNJA 4HDNA 2OUIA 3OTIA 1TTPB 4N5DA 1QFMA 3PNBA 4RC9A 3DZIA 2PJRA 2V9CA 4PGFA 4XYGA 1PZXA 1H2WA 2VHCA 5EUMA 3A3PA 3EA4A 5B3KA 1ZR4A 4ZMBA 2AN1A 2EX0A 3HXTA 3QPUA 2WKSA 4RX1A 5SZHB 1JFRA 3D0QA 3N3AC 3NHZA 5HP4A 2FK7A 3JWGA 2I6GA 2KWIA 1NVEA 4LWQA 2IDZA 1FMTA 2OAGA 2RHTA 4Z7OB 3F73A 1G3MA 1QE5A 1TUIA 1QIJA 2ZUVA 3GIWA 3CM0A 3RC3A 1OFGA 2HL6A 1G2IA 4DCTA 2I6QA 3OIFA 4MIYA 4TMYA 2O8FA 4RH3A 3JQGA 3E84A 3KNZA 1XTUA 4NECA 1P1BA 1W52X 1D9XA 2XITA 4ALJA 1N5MA 5B3JA 4HNQA 1Y6QA 3ZK7A 2AFIA 2JCXA 1MOPA 2SICE 3JYHA 2HWUA 2XB2A 2FW8A 1Y8CA 2OXIA 1HDRA 1AG9A 1AH2A 2P4EA 1I4WA 4FCCA 4BN0A 2WBLC 4DSZA 3HR8A 5CM8B 3OZIA 5F98A 4L2IB 1N2CA 3QNMA 2WF7A 1RM4A 4OB7A 3WKEA 1KORA 1ZH0A 1E1MA 4I46A 3C97A 3DFZA 5ES3A 4LJLA 2IP1A 2Q45A 3L7JA 1G0OA 1J2EA 3C0KA 3IT1A 2BEWB 3X1XA 4FB5A 2H06A 4PPYA 4RKWA 5BSFA 3QLUA 2BSQA 1FMCA 1SCUB 3C85A 3E9MA 5CBKA 3ZS9A 3VO9A 3FNGA 3DZHA 1KGDA 4NICA 1U8AA 2AVNA 2R4UA 2WIJA 2RH8A 3WLTA 4UEWA 1ULAA 4HQOA 2INGX 1X1BA 3PC8C 5L6MB 5KNBA 3QUBA 3GR6A 2HQ1A 2VSOA 2HMYB 3JASA 2YIJA 1FTGA 4F2DA 5IBCA 2BGNA 1WSAA 4EX6A 4FDUA 4KW7A 1OAOA 1GARA 1Q14A 2KSQA 3D2CA 2ZAMA 1OFUA 3TFWA 3PFHA 3T3NA 3ZJYA 2OV4A 4MR9A 4X0EA 1PJCA 1WW3A 4D3ZA 8OHMA 4GKKB 3F8TA 3EZ2A 2VDWB 5CDYA 2ZWAA 3JW8A 1ULZA 1AY0A 2BCJQ 3GCDA 4GU5A 2UU9B 3HO1A 2ZJ7A 2YXBA 1CUFA 2WZBA 2YWHA 2C98A 3KHKA 4M46A 4Q9KA 5JXGA 3U3RA 2R6R1 3BQ9A 1E6KA 3KJEA 1DMRA 3D5EA 5MGNA 3BSSA 3Q0TA 1IJFA 4UEJA 4RTPA 4F4IA 5KU1A 2FDXA 3GUZA 3A1WA 2Z98A 2AJDA 3L4BA 2BY4A 4I4CA 4QFBA 3D4BA 5KNDA 2HZBA 3M70A 1WXIA 1E4EB 2GCOA 1ZJZA 2MDTA 4XB6B 3V2IA 4A8HA 3PDJA 5HZMA 1SCJA 4N7MA 2FE1A 4GICA 1XLTA 4P34A 1AMNA 2ERXA 2UVQA 4Q1EA 5CEEA 1RI3A 5KQGA 1P9RA 3P9ZA 3GFFA 4QKQA 1ND6A 2D1TA 1H2FA 3H11B 1UXKA 2ZQYA 2VN8A 3P26A 3L7MA 3PNYA 5KC9A 1PR4A 1G63A 4BOYA 1KZ7B 2YVKA 3NKLA 1D2NA 4ECAA 4K1LA 3VO8A 4UE6A 5G0VA 2C2KA 3AHCA 1OZFA 2FX5A 4WESA 4RPGA 2HC9A 3WGYA 1EQUA 1QLHA 4N5MA 3GELA 4F96A 2I2BA 4ZHQF 3R7NA 1V7QA 1XQXA 2GM3A 2YQZA 3P4UA 4NDZA 1G8MA 4ZHSA 1T36A 1XCBA 4IDQA 3EGVA 4I9UA 1M66A 1B3RA 2CVPA 3SSAA 4MARA 5LP1A 4F72A 1N7GA 3RKSA 4IZIA 3DLIA 4F71A 3AF1A 1L5LA 3SMQA 2PGJA 5IC4A 3PVCA 3ADOA 1AF4A 3B2EA 2XQJA 5FQNA 3HR4A 3V7UA 1EWRA 3KTAA 3RDPA 4JI7B 3DZ8A 3LDFA 3R8XA 1N8KA 3W0LB 2W70A 4DJEC 1YAJA 3PJEA 1LC0A 1WMSA 1H85A 2FAXA 1W5EA 4S1VA 5DYNA 3ZI0A 4L5YA 1YJ5A 4ZOAA 2PVPA 2ZRIA 3ZG6A 4ARZB 3M5DA 2PQ2A 1EFTA 4NJEA 3KLPX 2WMDA 5B37A 1DAMA 1LLQA 1S01A 3DQZA 1IHDA 3CBGA 3ZXXA 1P73A 5IFLA 1D5WA 4M6WA 1AA9A 1L9KA 4CKEA 4C2BA 4EM6A 2RKBA 1TDJA 1CZLA 4YJGA 1N6IA 3UOWA 3WJ1A 1VDZA 3VQTA 4JWKA 3CKLA 3OPVA 3K9GA 1A72A 5EJIA 1SXGA 1IN6A 4AO7A 1EJ2A 5A5DA 4IJUA 2ZYGA 4LUCA 4ZQCB 2FSFA 1MO3A 4RK0A 2ZOSA 1G2OA 2QTZA 1N2XA 2CWWA 4CZ2A 2XWBF 4I6GA 1T4GA 5DW3A 2VH5R 3UA3A 2I6FA 1YTUA 1HDCA 1E0AA 3N2EA 4Z8XA 2IELA 1O57A 4FK8A 1XQ6A 2SNIE 3WLNA 3NHMA 2JGDB 1MQAA 5B53A 3G1TA 4XJXA 3A1DA 1ZKMA 2V7QD 3N58A 4TN5A 2XBMA 4L5AA 4CETA 3CNOA 3IQIX 2R4TA 3JXEA 3FVVA 4K9PA 4L0MA 1QIKA 5LJLA 1SZDA 1E9AA 1Q0UA 2H00A 2V74B 2GCGA 5E6RA 3ZH2A 1IY8A 2C2MA 4J6EA 4ZVOA 2Q3HA 1PJAA 5HFJA 4BO0A 3M83A 4DV7B 2O2XA 4OX9B 3CF0A 4LECA 4HXFB 4H1VA 2J4DA 2DPLA 5DPMA 1PYDA 2CNWD 2NUTB 2VK4A 1K1EA 1TZMA 3DDWA 4OMCA 4ZRMA 3TLZA 4A9AA 3MUFA 4GRIA 4B83A 3CW9A 3PUYA 4PY2A 4JVOA 4DQVA 4MW5A 4YVFA 1QUFA 1I2CA 2J5KA 1FNBA 1LV7A 3LXXA 1E66A 2BD0A 2XQIA 4JXZA 4QYTA 4Z6KA 3TIGA 5ALHA 2GZDA 4E0BA 1N78A 1NE2A 5C1BA 4B80A 5JALA 3REQA 3TX6A 3VGPA 3OQVA 2D3TA 3RRXA 4ZZ1A 4WRRA 2VA8A 2NO9A 3QEKA 5ECDA 4BAGA 2IP2A 2GF2A 2O7RA 4KAJA 4TWBA 2JA2A 3AVTA 4FCWA 2HJVA 2FY8A 2APJA 2XWSA 3AUXA 3H99A 3O74A 4IHAA 3RV4A 5KOIA 2VHZA 5A4AA 3PLAE 4L76A 5DRTA 1P31A 4LHWA 4BB5A 2WYWA 2XHEA 4YGXB 2G67A 4L5IA 5HWSA 1AQNA 5DHUA 3THRA 1X2BA 5BRNA 4MW4A 4EUNA 2V3CC 2W5UA 2XBLA 3W5IA 4TN1A 2BGIA 3AP2A 2RHRA 4B48A 4JXJA 2HDHA 1WMAA 2RHJA 3NPAA 3M3PA 4E2WA 1DHTA 4O2AB 1QU3A 2BGRA 1UPFA 5FBWB 4PS1A 4LOHA 5ALMA 4BX3A 5H3CA 4K2HA 5K0JA 2XRZA 2CBXA 4TRNA 2H2GA 1DJOA 3O9ZA 5GQSA 1AHIA 4WNCA 2Y1EA 4Q21A 1A9QA 4JS0A 3HZHA 4Q4CA 4JJFA 5AW1A 1NRXA 1Z6GA 1M6WA 2FFAA 3YASA 1M6VB 5GVSA 2V7XA 5ESRA 1XD9A 4BASA 5IDXA 1BDIA 2RGWA 1PSWA 2OZVA 2XB4A 3HRIA 3SHVA 1KY3A 1U1CA 3W5HA 1E4YA 5ALZA 3VV3A 1UM9A 1J21A 3O8QA 1G6HA 3PJGA 1XALA 5AW3A 4PQGA 5CA1B 4DLXA 3UCXA 2AK3A 4FKBA 4AD8A 5EZQA 1R37A 3FFBA 1VXOA 1IVNA 1BIFA 1R0BA 2PSDA 3E4CA 4D3YA 1PSZA 2BR3A 2GHQA 4PCUA 1HDGO 2OC4A 4INZA 4UZSA 3SZUA 2SECE 4PHFA 3T54A 3VZDA 3ZCVA 2OBMA 1DSSG 2P9ZA 5IG2A 1OFIA 3K4PA 3L0CA 3VYVA 1ZWKA 1YVRA 2ORYA 4HZIA 2CCJA 1N77A 1CC1S 5EJGA 5C5IA 1U0RA 5JZBA 2HNAA 4OQXA 1PJQA 1LNSA 3RUEA 3TJRA 4GOOD 5CHEA 5SY6A 2WSLA 4P80A 3N86A 1E9SA 2QRMA 1SQSA 1ABBA 3VHRA 1FY2A 2ZLBA 4LJSA 1KHHA 4ZVKA 1C8VB 2G8NA 1K9SA 3B89A 1G1AA 1SU8A 3FVWA 1A98A 2IY8A 3JPYA 3OFJA 4MQFB 2C83A 2D2VA 4PN3A 4GI1A 4RDCA 3DXYA 3OEHA 1YACA 4M8SA 3KM0A 5GONF 5FIUA 2HXGA 2GASA 2NO6A 3DOHA 3R3XA 5L3SA 4NCAA 2D0OB 4HVAA 1YRWA 1L5RA 3OCUA 1J23A 2ZRGA 1A71A 2A33A 1NBOA 3LUKA 2OHHA 3KD2A 2VSQA 2C8LA 3KZXA 3QELA 4ZV9A 3EPKA 4HXYA 2ZIWB 3NETA 5LXTF 5JO9A 4XM1A 3DLHA 4KPYA 5FOXA 4CXMA 5BR1A 1ESMA 2QXUA 3FHLA 4OI1A 3FTNA 4GAEA 1HDZA 1H8HA 3UANA 1GGHA 1XZDA 4DNPA 5KDOA 3U7GA 3SVLA 4P3XA 4MV9A 4Q82A 3NGMA 2ZBVA 5J47A 2YX1A 2IYOA 1QONA 5JAHA 4R2WA 1I7NA 4B9AA 4IQFA 3THXB 1JUDA 1TJNA 3T9DA 2E49A 1U0GA 5E3IA 3UBTA 1U0TA 5DNVA 3V1UA 4P6VF 4ENSA 2VAXA 1RYEA 2Z9DA 1VKHA 3AKCA 4JBIA 1EE1A 1M1NA 2ETXA 3JCZA 1XNQB 2FH5B 2W93A 2YWEA 5BN5B 2CHGA 3EIUA 4S3MA 3JQ9C 1ZK3A 3GPLA 1EG7A 2H31A 3HJUA 3F5QA 4L0QA 1V16B 2VTKA 4S2EA 3T15A 4E5SA 3UENA 4GL2A 1E2IA 3Q8MA 3S28A 3DTVD 5K0BA 1JH8A 1I3LA 2CDNA 1N6HA 2VJMB 2ZJ5A 4DZZA 4NCBA 3RIEA 1XMPA 5D84A 4B84A 1VB3A 2O6HA 3Q11A 3EDYA 4UVGA 1THMA 4AT1A 5JNUA 3FJ1A 3S2EA 4RHYA 3QTBA 1RZRD 3LYLA 2QRVB 2VBCA 1AQ6A 1QIGA 1E94E 1SHZA 1ADGA 2JFBA 1PD1A 2COKA 1GUZA 1QVVA 3C3JA 2TRSB 4BKUA 1VCMA 1WULS 2ZIZA 1HTBA 1NW5A 4ZPJA 1YRLA 1KSGA 1HEYA 2AQ8A 4WK4B 4NZYA 2ZBRA 4RVSA 2BN4A 2YJGA 5EAIA 3IP9A 5BY2A 3B52X 4IDDA 3VXKA 1YBMA 2IPOA 5A7GA 2C9BA 2PEYA 2FEMA 3EA0A 3VKUA 2GZAA 2JHAA 3QVJA 4Q9DA 1Y48E 1DKOA 1G20E 2FR1A 2W6NA 2X76A 2YY6A 3OESA 2GCNA 4O8ZA 3I5AA 1DBSA 2V7WA 4Y2QA 5FI0B 1H2ZA 1RIFA 4B43A 1J2UA 4RGYA 4QQFA 3OCXA 4L28A 1IXRC 4A4DA 4AF6A 2PMDA 4BQQA 1PK8A 4OGWA 5BW8A 2X5XA 1JSRA 2R11A 3ZWQA 3RWOA 2AFHB 3V46A 3QW4B 2QSUA 1T2NA 1C9YA 1EFLA 1U3FA 2BDTA 4JJ4A 4XPIA 4BZZA 2Z2KA 3Q0IA 4Y0NA 4PX5A 3JQAA 1W34A 3F9RA 3ED5A 4MPDA 2YJ4A 1A9TA 1XTTA 3PGXA 3IB6A 3VPBA 1NJ6A 4RJJA 2I55A 1IHYA 1KZ6A 5EZ5A 3O4HA 4JKIA 2YXNA 1R2QA 3KDSE 1C5KA 1W8DA 3OURA 1GRRA 1WSDA 4MRSA 5FOUA 4CM8B 1I7QB 4D3XA 2CLEB 3A4IA 3C48A 3PDWA 3QUTA 4XX1A 2AZXA 3VNUA 1A96A 4V0KA 4JP1A 4DCNA 1HFKA 4JA2A 1YMUA 1HRKA 1W30A 1CSEE 2D0IA 4QPJC 3V2GA 4RIGA 3HA7A 1JDBC 3WGVA 3GP3A 3W8EA 3QA3E 4X65B 3BJZA 3JALA 5CEJA 5JXWA 1CDEA 2XZLA 4K81B 2C7QA 2XSZA 2WQ6A 1ZAKA 2ZRNA 3A4VA 3FDZB 2PK3A 3CW2A 3UMJA 1SKYB 2H8GA 3W5SA 1AO3A 3TINA 4LY0A 3ZYZA 2AEFA 1YR9A 1UWLA 1XFAA 3ACDA 1OSNA 2AI3A 1OX4B 3QOFA 3I2JA 4RZUA 3TSOA 2ZULA 1JA9A 1DWOA 3AUJB 4M0PA 4LYFA 3ZHUA 1LTQA 3NONA 4H1TA 4R7TA 2BEKA 3C3PA 4HG2A 1ZPDA 3VU9B 2G5TA 1WBDA 3KEFA 3CY6A 1N9ZA 3PIDA 2NTEA 3SX2A 4KE9A 2XDWA 2WM2A 3G8AA 3NH6A 1O3YA 4NYIQ 1XDUA 1PGOA 1T1GA 2X9VA 4KXWA 3HP1A 3ZWWA 4HVCA 4X54A 1MJGA 4NYMQ 5LUAA 1Z2EA 2J6IA 1BCRA 2YZ2A 3ZCQA 4B73A 1JAIA 3U39A 3K1AB 4OREX 4FOOA 1KBOA 1ZOOA 4FDAA 3S7ZA 4E1VA 2EKLA 2ONZA 5C5EA 1LX7A 1LDYA 2BP7B 1PR2A 3AC0A 4GRAA 3VJKA 2PYIA 1RLIA 2HSWA 3AONB 4BWVA 5GJBA 1TKCA 5JH7F 4D9NA 2EQAA 4BNTA 3P9PA 1LDNA 3UV7A 5EYPB 2DBVO 4EWLA 2OXEA 4AN1A 1PZNA 1OYOA 1KI4A 2I33A 1N5IA 3TQOA 4W7IA 3RTDA 3IMGA 2P35A 4IHQA 2DETA 1LWOA 2V4MA 1GTVA 4KI0A 2YW9A 4WZBB 4D8WA 3HCCA 3OZDA 1NDHA 1Z4QA 4E11A 3A2KA 2JIQA 1UUFA 2HF9A 3KU4A 4M0FA 1MFZA 4UM5A 4ZEWA 2ZXUA 3JARA 1PFVA 1N3LA 1T0PA 2CLSA 4IMPA 4F2WA 3FHJA 3BD8A 2DHDA 2ZCJA 2YWCA 4OHXA 3QMMA 2GWRA 3I34X 5A6SB 5BW6B 3W04A 4HNVA 2YFHA 1Z6YA 4KWCA 1NHGA 4DCUA 4ZEMA 4IJWA 2HBZA 1S3GA 2JD1A 1AIPA 1AK2A 1FX0B 1JXOA 2GAFA 2HJGA 3BMCA 3GMTA 3ND6A 1YDHA 4YMIA 1GAQA 2A2ZA 2WIGA 2UVPB 2YINC 3K9CA 4HQNA 5AUPB 3R74A 1GL3A 3NEAA 4ZAGA 5KKAA 4QM6A 2WAOA 1Y80A 1UZMA 4Q3OA 4WY5A 3BFJA 5KJ6A 2BF4A 2P8SA 1O5TA 5FPYA 1COWD 1UT6A 4CUKA 4ZHQB 3ZXIA 1TCBA 5FBVB 1EVEA 3O9MA 3IUNA 2VYVD 4L27A 4B45A 4DCSA 3TG2A 4A91A 3ORQA 5I7RA 4UTXA 3H6HA 4CG3A 2ARKA 1CQPA 5G40A 3I9LA 1OJLA 4A1OA 1IXZA 3PWKA 3QPBA 2PUJA 4GP9A 4GKJB 1J6UA 2E4VA 3FZGA 2AI2A 4HN2A 5HFNA 2GJ9A 5NULA 5C0OE 5K4AA 3VYWA 4URUR 1OX6A 2J0UB 1E5TA 1P45A 5C32A 5ECGC 5JD4A 1BJKA 1Q1AA 2X4IA 3E4DA 4IDPA 3SK0A 2FZKA 1H1DA 3HFJA 2DUUA 3ZEIA 5DGCA 2P75A 3CG4A 4BE9A 3VR2D 3LIPA 4E5DA 5HX7A 3HVRA 4BLUA 3TJZA 1PE0A 2O4UX 1YU9A 2PY6A 4TGLA 4RJIA 2OBLA 1I0IA 4TLLB 2DU8A 1DQZA 4NBSA 1KP2A 2QTBA 3DVSX 4MYSA 4UQPA 4F60A 2FGJA 1N2EA 3IR7A 4I81A 4HNUA 3FWYA 3ZIDA 2BGUA 2GZHA 3VHXB 3CZMA 1RQRA 3GMSA 4X94A 1U2DA 3G5MA 5HCIA 3WB9A 2FW9A 4MV1A 5ADWA 3V55A 1DEHA 4OSOA 3TLGB 4IDHA 2H7VA 2JIBA 5HCUA 4REOA 4DA8A 4E7PA 3AVUA 4YHBA 3RV3A 2M98A 2O20A 1YDEA 5ELXA 2M2IA 4LDZA 2P77A 3R20A 4AY3A 3FLMA 1NAHA 2C77A 1SQ0A 1AKRA 5M29A 4KFTA 4DREA 1ZRNA 4LDAA 5I3CA 1M34B 4QNNA 2I2XB 4U9UA 3NI2A 1NYTA 4JWTA 3BIXA 3KZ1E 4FZRA 2FPXA 1FB5A 4W5WA 1X92A 4BNGA 1YI0A 3CCBA 3RASA 1RBMA 4N6GA 2Q27A 2Q1TA 4D9IA 2G9VA 4MUMA 4ZODA 4ETNA 2RGEA 5BUCA 2HU7A 2WA2A 1O9GA 2C9YA 2PKEA 5F2EA 1IOLA 2VZEA 4OP3A 1V71A 5H9VA 5HJEA 4QGFA 2XUIA 2X2EA 4PCVA 2H4XA 1SG0A 2P4HX 2JC3A 3UXMA 4CKWB 4DWVA 2JKYA 3HXOA 2NP6A 4Q3LA 1XX6A 5DYGA 5AKHA 1U04A 3G9QA 2G5PA 3TF5A 4DJAA 5KNCD 4GPEA 4YJ3F 1I2MA 2QW1A 3V6LA 1PDOA 1DTSA 1Q11A 4YMGA 2ADOA 4L4RA 1EVKA 1X1CA 5IT5A 1GUBA 2CC2A 3M6FA 4I50A 1T9BA 2HREA 4LE1A 4MV7A 1S8FA 4LJ5A 1OFHA 4OKNA 3ZN2A 5FAKA 1LK5A 4L07A 4ZT5A 1WLSA 1GP2A 3HU1A 3LT2A 4ZOLF 1L7NA 1SC4A 4F0JA 1MVLA 2WSBA 5EJAA 5J63A 1M54A 1ZCFA 4M8NE 2DPGA 1N6NA 3HLTA 4RQTA 2RH5A 2KBFA 3ITDA 3NDIA 1Z08A 4R81A 5ARCA 4HN9A 4AUNA 3MD0A 3O2QB 2A9RA 4FKZA 4FR0A 2GPYA 3OA0A 2FDCA 3EC7A 3ZZ0A 2I6UA 1HYHA 2BJVA 1ZGZA 4WKOA 2BFEA 4LC0A 3A4TA 3O31A 3ENWA 1VL6A 3GLGB 2P4SA 1GUYA 2D1QA 5J5CA 1QVWA 2CK3A 3KB6A 3LQQA 2Z1NA 1XV5A 1MA3A 4I3GA 4EHDA 3Q5DA 3IOEA 5G3ZA 4F7DA 1QG2A 3T3EA 4CTMA 1J90A 1M2OA 4HB2A 1P72A 2QV7A 1RZVA 3N2GB 1D0IA 1H0SA 5AM4A 4B79A 5TQ0B 4DYVA 1JHQA 2XV1A 2R5FA 1MRZA 3N8NA 6YASA 4KB5A 2NW6A 4LYHA 1H65A 3ZWDA 5BSHA 3QXCA 4J29A 5JYCA 1PQ4A 4Q1CA 4PGMA 5EG5A 2E85A 1TZBA 4CEIA 4QFMA 1VL0A 2EL7A 3KFLA 1GNTA 4HTFA 3SEFA 4DNFA 4DHWA 4JBXA 4Q3NA 4K7JA 2X7JA 3GFQA 3GI1A 4FQ8A 2RIRA 3UYKA 4UAUA 3IBFA 3M5CA 3FROA 4EJFA 1GXSB 3UWMA 4RTOA 2FPGA 2OFXA 3LMKA 4G41A 4NCJA 1UBKS 2FEPA 4MDYA 3T06B 2GHRA 1EWVA 4HEQA 4JIMA 3SZMA 4FYMA 4EG1A 2VKTA 1YDFA 3KKOA 1R0KA 5BUZA 3IC5A 3R5HA 4YLYA 3CKMA 3H83A 1JDJA 1YQDA 2CCGA 1X8JA 2HQRA 1SBTA 3BXPA 3N87A 3RVOA 3AEUB 2VNSA 5I01A 1ZD8A 5F5XA 4OU5A 2WPDA 2YFKA 3HUEA 1QGED 5DOVA 5JO0A 2HBQA 2KB0A 3KS9A 1QC5A 1YB2A 5HKBA 2Y0PA 3TE6A 1EFRA 3OX3A 2Q4RA 3W1WA 4CIXA 4X90A 1XCOA 2G5CA 2ZFUA 3KQVA 2V7UA 1OGIA 5CK4A 3U7HB 1X7WB 3BBPA 1GVNB 1ZIPA 1BN7A 3T7CA 3IT0A 5K4HA 1Q92A 4CUZA 3MOIA 3PHIA 1M8FA 1Y81A 2AC7A 2Y1KA 4MI6A 3RM3A 3ZV3A 4Z1OA 4UE3S 3SDSA 4YAOA 2D6FA 5LXTB 4W5NA 4RNDB 3DOJA 4HAWA 2P69A 1PSDA 4FN5A 3R9XB 5HE9A 1Y42X 3QEMB 4FVTA 3VUEA 3TBHA 3M81A 4NDAA 4A2PA 1V47A 3IDQA 5NLLA 2ZBGA 4KN9S 4C20A 4NRDA 3B6KA 1N2ZA 1OBHA 3FYUB 4LZWA 1XPRA 2ZT5A 1C0EA 4JYZA 2EGUA 2QAJA 2PGXA 2FEXA 4LMAA 2EKBA 3R7DA 3UMVA 3W7VA 3B9PA 3I37X 3C6BA 5EMJA 3HCAA 3E5HA 3UWKA 2WJWA 3T7JA 4GZ6A 5DN6A 1QP8A 2BFOA 4LAFA 3O83A 4F9TA 2ENUA 5MN6A 1NX6A 2CW5A 2GD1O 5E4JA 1JHVA 1Z0JA 5A71A 2GBLC 4P0TA 4LEIA 4CNQA 1A04A 2DGDA 2PN1A 2ZJ4A 4RFSA 5LU8A 4HLCA 4Y8VA 2W11A 2WV7A 3JTMA 1FZTA 1O6CA 1NRIA 2X6QA 1R00A 3FYTA 5EJFA 1QGYA 4J0EA 5ARDA 4CDNA 3KQOA 4ND8B 2IIVA 5C4GB 4BS9A 5EOVA 1XIVA 5JEDA 5EIHA 3VYRB 1DI0A 2XT0A 3HO6A 3CV3A 4RHXA 5BOVA 3DCNA 3B1JA 3HXLA 2A5LA 3OSUA 3VR5D 5ISMA 3OZUA 3ZWXA 1CRLA 3HDYA 3AY7A 1YCFA 3EXIB 4KMOA 4RA9B 4G8DA 2QMOA 1WB9A 1O4VA 2BDUA 4NBKA 5C8YF 4Y2XA 5CGZA 1D0SA 1KK1A 1XB2A 3S0JA 1T5DX 3ZYCA 5I9IA 1NX9A 3DYBA 3G68A 3H6KA 4YUYA 1YL7A 3TSAA 2A1UA 5EMLA 5EI5A 4OJMX 3DCJA 5AKGA 2QZPA 1HRDA 2W2MA 4MWGA 4RW0A 3TDMA 2FPIA 1L4GA 3KXIA 4YACA 2YQ5A 1NQAO 3LPCA 4HCJA 5BNWA 2CNKA 2VJDA 1G5RA 4F5ZA 2UUBB 3Q88A 2WMNB 4FOLA 2IIBA 1TW2A 4NU0A 4NG5A 1SR8A 1W1UA 1BHO1 4X1IA 2WJAA 4QYIB 1YJXA 1T4CA 1VLLA 1W4ZA 2R1VA 3ZVMA 1DXHA 1KEEB 1LPAB 1UOOA 2D7CA 5KX5F 1JR3D 3T3OA 2YYZA 1XN4A 2ZJ0A 5C4MA 3KR1A 3LCMA 2IZ0A 3PEYA 3UK6A 3QUSA 2PUCA 3IELA 4DIDA 1MVNA 3CIOA 4YJFA 4MWCA 2P1RA 4JJIA 3K72B 3JQPA 1M8GA 4C4SA 2I9PA 1A1VA 2ZR8A 3IYLW 4WKNA 2X42A 3CPJB 3OX4A 3FGPA 4K6GA 4M36A 3DWEX 3ZJVA 4Y1RB 4DNOA 2WAAA 1HGXA 1U80A 4G5SA 4MUAA 3HP7A 1NKVA 4B85A 3FTQA 3CJTA 5C5DA 2QUBA 2RONA 1W2WB 5HZGA 1HZZC 5BP7A 1X39A 1EGMB 2Q4OA 3CFYA 4TXJA 4BAZA 4BO4A 1ULTA 4AG3A 2DFDA 4IO0A 2Z8YM 1TE2A 3QSGA 4ITUA 3MFYA 4WKPA 4CR8A 1Q50A 4MV6A 1E9VA 4Y9TA 5P8WA 1ID1A 1VHLA 3I92A 2Y2VA 4QDUA 5FHQA 3WB1A 3DKPA 3TVDA 3R8CA 3AEZA 1NMYA 1EB9A 1OXXK 3EEBA 4WASA 1S2GA 2OZEA 2PH7A 5JNLA 4A23A 1QRTA 4WFQA 2GXSA 4Z4HA 1IEVA 4L5CA 1KQFA 4MV3A 2V7TA 2CJWB 4EH1A 1MCZA 2QN1A 1D03A 1FSGA 5TQ2A 1TLFA 2HWYA 2W8BA 3D7MA 1S3SA 3EE6A 5ALRA 4OEHA 3SJBA 3VC2A 3L0ZA 4JGBA 3QOWA 1DAIA 1VIMA 4IXNA 4KWIA 2IA5A 3WIVA 1K92A 3BORA 2O5EA 4MWEA 5DLEA 1A5AB 4TT3D 4H0FA 2C03A 2CEKA 4HGOA 2ECFA 2GM9A 4LZOA 4OQEA 3TM4A 3UMRA 4IO1A 1KSJA 1NXXA 4OP2A 4Y30A 5EJ6A 2OCDA 4Y9RA 2RHWA 1UC8A 1K4KA 1ODTC 2QRNA 1VSBA 3QLVA 4GE3A 4ZZIA 1NI4A 3R7AA 4W5RA 4NKRA 1R1DA 5J4LA 1G8YA 2QSYA 4OB6A 4YDHB 5JH7B 1EP2B 5EUQB 5LNK6 3V4SA 3ZV4A 5KAPA 4AM8A 1BQEA 4X9XA 5AIBA 1U3WA 2GXUA 2E6KA 2NUAA 3WK8A 1WVIA 2J6CA 1X3SA 5FNVA 5G3YA 4IIGA 4R8VA 1SC3A 4G5XA 3SJUA 4Z7JA 1M75A 3NM6B 1XMQB 4I6EA 5EXPA 3G0BA 3WMGA 2WUEA 2QJWA 1Y8QB 3DL7A 3T3HA 1WTCA 4NE9A 3IEMA 2GZ1A 1JFFA 1HE8B 4HDKB 2OXTA 1CULC 2FXIA 4XWAA 4JC0A 1T9KA 1FQJA 2O9JA 4CU2A 1FDIA 5KYWA 3ZX4A 5JUWA 4JC5A 5BYKA 2C0CA 2J9ZB 5DNCA 5A9RA 1QP0A 4CM4B 4DC9A 2FRDA 2IUTA 1H3FA 4OBEA 3CF4G 3ZZUA 1W36C 1HBJA 2LCFA 3JSAA 1UXOA 2D54A 1TUEA 3MS2A 4HR7A 1EAMA 2VF2A 3NIDB 2Q5OA 1A9XB 1QE3A 2IC5A 3IVCA 1Z75A 4YXWA 1A8HA 1CYDA 1HKHA 3OOEA 4I2VA 3WNDA 1RACA 1U99A 3MJRA 5KTPA 3DMTC 3BZUA 2AH5A 5AM3A 3KSZO 4CWAA 1BH2A 3G0GA 4EA6A 3SS7X 1DT3A 2X5KO 3RRZA 5GADl 1K88A 3DOCA 3DNFA 3D4IA 4AY5A 6REQA 3AG6A 1CHDA 5ENDA 3TTSA 1FVFA 3FWHA 5I7UA 4FYVA 1P19A