1WMBA

Crystal structure of nad dependent d-3-hydroxybutylate dehydrogenase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
publication title d-3-Hydroxybutyrate Dehydrogenase from Pseudomonas fragi: Molecular Cloning of the Enzyme Gene and Crystal Structure of the Enzyme
pubmed doi rcsb
source organism Pseudomonas fragi
total genus 92
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wmbA00
1C0IA 4I5DA 3RJ9A 4PG5A 3AI3A 2CDAA 3ZNQA 2JFHA 1R6DA 3H9JA 4XB1A 3V2UA 3ZWNA 4B7UA 4IZIA 4TRRA 4CM1A 3B70A 1ENZA 3OJOA 4YA6A 4LRSB 3PYXA 3S1LA 3E18A 5C3MA 3WGHA 3L6OO 1ENOA 4KOAA 3AUUA 4E5PA 3PJGA 3VTFA 1J5PA 2ZB8A 4O0LA 1SBYA 4XQEA 2Q1WA 4IIVA 4JLWA 4MVJE 3KYDA 4GLOA 3F47A 3LYLA 5A02A 4HKTA 3FRJA 3RBZA 3QE3A 4M87A 4NJMA 1DFIA 5I9LA 3HADA 3UUWA 1GQ2A 1M6HA 1NASA 1T2EA 4GX1A 2A94A 5C7OO 3F5SA 4WNIA 1UP7A 2IEDA 3DMTA 4Z0PA 4DIOA 1RYEA 4RPGA 5JAMA 2Z1NA 3HB4X 1XR3A 2EW2A 4NHEA 4WNCA 3C1OA 4YAGA 1CYDA 3D3WB 4A5OA 1ISJA 1LJ8A 1VM6A 1V3UA 3TF5A 5TT1A 5T5QA 1XSEA 3I5MA 3TWOA 4NU6A 4IMPA 3E1KA 3ANNA 2FZWA 3QA9A 3KB6A 1A9ZA 3HZZA 5TF4A 2GZ3A 5DCUA 2VUSA 5LDGA 1C3VA 4OOEA 4KQWA 4R5HA 3OEWA 3ZU3A 4DYDA 1GZ3A 4CMIA 4EEZA 3A9WA 1ZUD1 2GYYA 1E3WB 2O3JA 3DZIA 1UDCA 2DBZA 4P4NA 4WCDA 1JAYA 2V6BA 1O94A 3PHLA 2O4CA 2I65A 3HB5X 3ST7A 3D4OA 2ZB7A 1P1IA 3QVTA 5FYDA 3M1LA 4CM4B 2ZB3A 2B35A 2VWHA 2PGJA 1NPYA 4XJSA 2O2YA 2VNAA 3COSA 1PJ3A 4U6QA 3AU8A 5K6AA 3VH2A 2YQ4A 3AI2A 4UVHA 2EF1A 2Q2WA 1JKIA 4O59O 1DRUA 4BQRA 5BQFA 5KJ1A 1H6BA 1F12A 1IZ0A 2C5AA 2OMEA 3DXFA 4Q3BA 2OP0A 3W8EA 1Q7CA 3HG7A 2D4AA 4DIFA 4MVJP 1SB8A 3CUKA 2UAGA 1E6EA 3BZUA 3MJSA 4QEDA 2C59A 1VPDA 4IMRA 1F8GA 2TMDA 4IGEA 1GUYA 2VT2A 4LRTB 1DPGA 4PN3A 1MP0A 4NBTA 1ZK4A 2JAHA 3FNHA 3P7MA 1T2DA 1WDMA 4WLVA 3ZNOA 3ROMA 1VC2A 1ISIA 3GR6A 4CUJA 3C8MA 1PIWA 3JQ7A 3ZNPA 1HDZA 5DNAA 3VDQA 2VYNA 1S7CA 1F14A 1BMDA 3ASVA 4BGVA 3GN1A 3PYLA 1NVMB 3WFJA 3UF0A 4MDHA 3DDNA 4YRAA 1U1IA 4I08A 5KVSA 4JP3A 4OXNA 3FNEA 2CF6A 3AUAA 1EE2A 2FP4A 4MP3A 3JD0A 4R9RA 3WNQA 2E6UX 4WJZA 1U9JA 4TRJA 5DP2A 2YQ5A 1ZSVA 5AXAA 4WASA 3WGTA 1GYPA 3L9WA 4BNJA 1MA0A 1R0SA 3FHLA 4FN4A 1JQBA 1RM5A 2CFCA 2RHRA 4FCCA 3NGLA 1TXGA 3ZU5A 1VSUA 3PHHA 3RFVA 2Y05A 1VLLA 1BW9A 1YGYA 3ZCXA 4Q9NA 1P3DA 3GUYA 4XYMA 1MXFA 3S2IA 4BNWA 5JBIA 2HAEA 1B8PA 4D3SA 4A7PA 1EQ2A 5CG1A 3VAZA 2FSSA 5DULA 4GAEA 4AL4A 4OIMA 3H8VA 3P19A 3WJ7A 4IZHA 1TI7A 5JMWA 2I6TA 4ND5A 3ZWCA 1PZHA 3FNFA 3NEPX 3V2HA 2YV3A 3VH4A 4AJ2A 3ZWMA 4M89A 3EVNA 1PJ4A 3CH6A 2W8ZA 4R68A 2EGHA 1CQIA 1P1KA 2YDXA 4LMRA 3Q1LA 4D42A 4MO2A 1BG6A 2X86A 3L9XA 4GGOA 4N54A 5EIOA 2Y68A 3S2EA 4BNYA 4AJPA 3JQ8A 2BGLA 4FJ1A 3PVZA 4W4TA 3AU9A 4DLLA 1U3UA 3HDJA 3L0DA 1NTOA 1Y5MA 3PDJA 1O0SA 4IQ8A 4K1LA 4E4YA 3DTTA 3MJTA 3FSRA 4NFSA 4PLHA 4FW8A 1GEGA 1YBVA 4XRRA 3NT4A 3V5NA 4FC7A 3DB2A 3QVXA 2HK8A 2FR1A 1WP4A 3Q6IA 4MINA 1P44A 3AY3A 2PGLA 4RZIA 4GI2A 3S2FA 2GASA 4XKJA 4CR7A 1H6DA 1DFHA 2J5RA 4YR9A 2VZ0A 3RUDA 1KEUA 5I8ZA 4NU5A 1SZJG 1PJLA 4XDYA 3WLEA 4R1TA 3HJAA 5G0UA 5H83A 3EZLA 4YRDA 5CPFA 1IE3A 1R4NB 1D1TA 1IPFA 2HMVA 2X0NA 2WD7A 2Y1CA 5KJCA 1H5QA 3F4BA 4KZPA 1IB6A 4NNJA 2GF2A 4HUJA 4R01A 1P1RA 3ZW9A 1B3RA 1LDGA 3QWHA 2IODA 5L7WA 4WCFC 3FR8A 5JDCA 1FK8A 2AXQA 2UDPA 2YFQA 3H5AA 1HZJA 2J6IA 2JKVA 1KVTA 3PQDA 2EERA 5H82A 5T67A 5EJ2A 4D44A 1YKFA 1V3TA 4UVIA 4RZHA 4ONEA 4RF5A 3IKVA 4H3VA 3RUAA 3PJFA 4RVGA 2DPHA 5JSFA 2DUUA 1B16A 4P8RA 5CDYA 1BXGA 1VSVA 2BI7A 5TLSA 1B8UA 2IZ0A 1E7RA 3DAFA 3KYCA 4AJEA 4XWYA 4BO0A 2JHFA 3NYWA 4FS3A 4Z9XA 2HQ1A 4J1QA 1DB3A 3SJUA 3RU7A 5CDSA 3NV9A 2GSDA 1RM3A 3FBTA 1ISMA 3TNLA 1CWUA 1YE3A 5CDTA 3RUIA 2O50A 3ADOA 4B7XA 5C5IA 5KKCA 1EMDA 2O48X 4CM3A 4DXHA 3BMOB 1IHYA 3PJDA 4FFRA 4H15A 1MG5A 3ZHZA 2FOIA 4NI5A 3NUGA 1J6UA 1PJCA 1Y9AA 1TVEA 3CIFA 2QHXA 3ZWWA 1ZKMA 2AE1A 4QSMA 4BNGA 4YAIA 4LCJA 4BNTA 1A27A 1ML3A 3FPCA 3K2BA 4DUPA 1BHSA 2WD8A 2D59A 2I3AA 4L4XA 3FTPA 4S3MA 1KY5A 3PIDA 4B4WA 3QVWA 2QRJA 3DBLB 3RFTA 4Q3DA 4U0KA 4MVJG 1F0YA 3AUTA 2YHUA 3GG2A 4NZ9A 4J7XA 5IJZA 3DBRA 4L0QA 3OHSX 3KTDA 5A9SB 1ZK1A 2P9CA 2B36A 5COQA 2RBEA 4PG7A 4EUHA 2B4QA 4UVGA 1CF2O 1LSSA 1XU7A 3CKYA 1E3SA 5KVQA 3GMDA 3PPIA 5DBGA 1HL3A 3PYMA 3BMNB 3WGYA 5EESA 3ETDA 4ZVVA 1BXZA 1IYZA 3GN2A 1FMCA 3CZMA 4YVFA 3QLJA 2AQKA 4TRNA 1NQOA 3C7DB 1AXEA 1M67A 1R66A 2X5KO 3LSYA 2O7QA 2JJYA 1ISHA 4J43A 2UYYA 3L4SO 3U9LA 4J90A 3DFUA 3NDIA 2VHVA 4W7HA 2RIRA 4UUNA 1XYGA 1VL0A 3QY9A 2FPIA 1OOEA 4AFNA 4NPCA 3B1FA 5I7EA 1IY8A 4EYEA 2GN8A 5L95A 2HU2A 3EZYA 4GH5A 2EJWA 4DQVA 1DJNA 2J3JA 2ZTLA 3MCVA 1GZ6A 3AOEA 6LDHA 1FDSA 1TB4A 1GCOA 2NU6A 3JV7A 2Y93A 1ZMOA 4PLTA 5KKAA 3OFSA 2QZ9A 2W2KA 2X4GA 4LVCA 3UGKA 3B20A 2HMSA 4J9VA 4AG3A 4H16A 5JMPA 1B15A 1QP8A 4HADA 4BO2A 5JW6A 2O3TA 1E3EA 4B3HA 2P4HX 2WYUA 1T26A 2EV9A 3LZ6A 1Z6ZA 4M8SA 5DP1A 1UAGA 3PRJA 4YT4A 4OXYA 2NM0A 3VDRA 1DC3A 3E5MA 3H3JA 4NIMA 3VTZA 4DYVA 3DZJA 3JQFA 1IL0A 3LT0A 3OM9A 1E7QA 2Q1UA 3E6AA 1E77A 4Y8VA 3S8MA 3T7EA 2PZKA 4ID9A 3G1UA 2I67A 2X23A 5KJFA 2Q2VA 3DEYX 3I9LA 1LC3A 3K92A 1QLJA 2WE7A 4UULA 4W7IA 4CV2A 4FFNA 5DT9A 1Y6JA 3RC2A 5IZ4A 4B3IA 1AHHA 4Y67A 3VZPA 4NR0A 1U7HA 1LQUA 4FOSA 2P9EA 4JGBA 3DHYA 4EEXA 5CHEA 2VUTA 3LC7O 4GLLA 4FPXA 4MIEA 4IJUA 4M49A 4KWHA 5IDYA 4RLHA 4FC6A 4YTEA 1NBOA 4G81A 4Z0TA 4ZRNA 3V1TC 3MEQA 4URFA 1GY8A 4KWIA 4B4VA 3OP4A 5T6BA 4DTIA 1Y8QB 3TPCA 1VKOA 2DTEA 2Y0CA 4FJ0A 4BO1A 1BRMA 2NQTA 1ADFA 4AJIA 2AQIA 1YH3A 4EW6A 3U49A 3R1IA 3NT2A 5AXDA 3AM3A 3TOXA 3GY0A 1PJBA 1Q0LA 1T25A 4I5GA 1CEQA 2F00A 3KVOA 4IIUA 4J6FA 4LSWA 1DDOA 1ULUA 4J1SA 4FSHA 4YT8A 1O6ZA 4P4LA 3FTNA 4C4OA 2VWPA 4CPDA 1PJQA 4UEKA 1DEHA 1T4BA 1Q0QA 1DAPA 4J2OA 3LC1O 4QFCA 3WS7A 5B4VA 3WNVA 2UV8A 3ROKA 3RUCA 3O26A 5F21A 2QZZA 1PTJA 1I3MA 3ZDFA 5A3JA 1YS4A 4P4GA 1H9AA 3ASUA 1MB4A 2QRKA 2IYOA 4PZDA 4R16A 1LLUA 2D3TA 2EIHA 1DC5A 1HDGO 3U5TA 4EI2A 2NV6A 5EMHA 3GH3A 4XYBA 5GZ1A 3Q9UA 3CPSA 5BSGA 2AQHA 3PFFA 4OO3A 3IJRA 1U5AA 4XA8A 1NAIA 2PH5A 1NR1A 1DIRA 1PGQA 1ZK3A 4BNIA 1KC3A 3E8XA 2RH4A 4IDAA 4OQZA 3INGA 2Q4EA 2X6TA 2P68A 3JQEA 4A2CA 3RI3A 4BNLA 4E5MA 3QJ5A 3JD2A 1K6JA 5ENDA 1P45A 2ZQZA 2C29D 2P5UA 3DBVO 5ITWA 4FDAA 1PS9A 4N5LA 4WLNA 2FRDA 4M55A 4ROSA 3A4VA 4ZHSA 1CIVA 4KUHA 5EN4A 5A9TA 3CZRA 2AMFA 1I8TA 3LVFO 2GCGA 2GERA 4E5YA 4GGPA 3ZNNA 4ND3A 1MGOA 3C7CB 4WEOA 3Q11A 2DQ4A 2OHXA 3RQSA 3ETGA 3GVXA 3H5RA 4G65A 2G76A 2VQ3A 3RKUA 2BD0A 2BRUA 3V8BA 3RUEA 3PHGA 3JQBA 1N9GB 3WLFA 1U8FO 2ZKLA 1OAAA 1GEEA 2X8LA 4MVJA 2WDZA 3BMCA 4CLRA 2FMUA 4XB2A 3LF2A 1C1XB 4EJMA 1LDMA 1XDWA 1BTOA 4CR8A 5IDQA 5THKA 1A4IA 4RLSA 1KVSA 2HMWA 4IJWA 4ZQGA 4D3DA 3GAZA 2EW8A 2POQX 3JCZA 4GMGA 4QO8A 3UHAA 4Q39A 4PLVA 3AW9A 2YHIB 4CMEA 1U28A 1LRKA 4GPD1 3WYBA 3M2TA 4J0EA 2NVUA 3OA2A 3GLQA 4EJ0A 4YJHB 3I6IA 2CD9A 2R6JA 3JQFC 5A03A 7MDHA 2EG9A 4BO9A 2B0JA 4BHTA 4PCVA 3LT2A 2P2SA 3GVIA 4GQAA 4BNXA 2NU9A 1VRWA 2G1UA 2VNSA 5HA5A 4J4TA 3N58A 3KEOA 3SX2A 4DLBA 1B14A 2OXIA 1AHIA 3SJ7A 3DZKA 1HSZA 2A35A 3V1YA 1SAYA 4K28A 5CFZA 2CY0A 4CR6A 1YJ8A 3TZQA 4J16A 1VJTA 3L77A 3PI7A 1UXJA 2R2GA 2H9IA 1ZXLA 3OJEA 1NAHA 3OQ6A 4DQUA 2PY6A 5FWNA 1SNYA 5FEUA 2X9VA 1E7MA 2NADA 3UOGA 3OJFA 4CV1A 2C82A 3OEYA 5HM8A 1BDBA 1MXHA 2Y99A 1RPNA 3G3EA 3ENNA 1L7DA 4XDZA 3VZRA 3Q9NA 3WFIA 1FF9A 1KVRA 3OSUA 3ZZNA 1PQUA 1YJQA 4TROA 5I8WA 1CETA 5JO0A 3ORFA 3AM5A 4FBGA 3L6DA 4A10A 4WOJA 4OM8A 3JD4A 3U62A 4CQLB 3GZ4A 4J91A 4DRYA 1PL6A 3IP1A 1BVUA 4ZJUA 1EUCA 3KYDB 3I9JA 1NWHA 3E5RA 2BKAA 1N2SA 3GT0A 4OOFA 1M75A 4WE3A 3A1NA 4NJMB 3TZHA 1NM5A 3WGQA 1HYEA 2CNBA 1N7GA 1CDOA 3EHEA 1YQDA 1K89A 3A28A 4RDIA 1M6WA 4MJLA 2D1YA 1YVEI 2E48A 1N1EA 3CXRA 3EC7A 1DC4A 2W98A 1HLDA 3BMQA 4LMPA 1YB4A 3ICPA 1ZSNA 5JNLA 3JYQA 3LF1A 5JDIC 4CLOB 3RC9A 3GOHA 1YXMA 4W99A 1U3TA 3ZWOA 1KY4A 4CM7A 4CLEA 3DZFA 2HO5A 4II3A 4BNHA 1T2FA 4HWKA 4D46A 3DFZA 4E13A 1EDOA 4BKOA 1LTHR 4CMHA 5IZCA 4BQPA 1XKQA 1XG5A 1G6KA 2VTDA 4GVXA 4TRMA 3KSDO 4WCFB 3VOSA 5KTKA 1NR7A 1VI2A 1JAXA 2ZYGA 3PHIA 4L9RA 1HZZA 3FWNA 5ICMA 3EAGA 3ON5A 2Q46A 4ZA2A 3LT4A 1LX6A 4GMFA 4IUYA 3KXDA 4Q3NA 4TZKA 2C54A 4FFMA 1NVTA 4M54A 1GV0A 2PD6A 3NJ8A 3RUFA 4ILKA 3IUSA 2C7GA 3D3WA 3LQFA 1L1FA 2EGGA 1ADCA 2NTJA 1A7KA 1TT5B 3RIHA 5G4LA 4ZU3A 1DHRA 2VHYA 1J0XO 3A14A 5JO9A 3INTA 1UXKA 1E6UA 3RJ5A 4IQGA 4OAQA 5G4KB 4MVJF 1U4SA 3QVOA 1E1NA 5HS6A 2HUNA 2RAFA 2EHDA 1D1SA 1HDOA 3GVPA 3GGGA 5CDUA 1ZSYA 1ZEMA 4IJKA 1E3WA 3JQBC 3G79A 3M6IA 3ZWBA 3F3SA 1SMKA 1ID1A 3GFBA 3I3OA 3PP8A 1X7GA 1AE1A 5B37A 4IDFA 4BNKA 4CM4A 3JQ7B 1CJCA 2JL1A 1NFRA 1T2AA 2IE0A 4XYLA 4XJTA 1U4OA 4TQGA 1Z45A 1ULSA 5THQA 5TJ9A 4I8XA 5DOVA 4Z3KA 3E03A 1I2CA 3RU9A 4XRGA 1NP3A 4UVEA 3KETA 1X7DA 3H4VA 4IXTA 2WM3A 1KEPA 2CVOA 4I9UA 4YJFA 3VPFA 1HSOA 3D64A 1B26A 1HDRA 5F3RA 4PVDA 3JQCA 1P1JA 5TNXA 4I5EA 3PIIA 4NMHA 3VH3A 1R4MA 2BELA 3K73O 4Z6KA 3MTGA 1DIBA 5EQFA 3OICA 3CSDA 5GZ6A 3GAFA 2RHCA 4HXYA 3WOHA 4XGNA 2OO5A 1GV1A 3BTOA 3OIFA 4RV9A 2BH9A 1AN9A 4BMNA 4E3ZA 4IDBA 2NVWA 4Q3EA 3WYCA 1C0LA 2PR2A 4AVYA 1WXDA 1H93A 4FB5A 2BMAA 3HFSA 1MC4A 1V0JA 4ALKA 4CLXA 3MOIA 1WMAA 1G1AA 3TFOA 4LSMA 2XAAA 3ZHXA 4A03A 2I66A 3NTQA 4DBZA 1LA2A 1LNQA 2FWMX 4BO6A 1TLTA 4NDNE 4BKRA 3I52A 2NUAA 4Q3CA 2X5JO 3KV3O 2QIOA 2NSDA 1JWAB 3KLMX 2AW5A 4W9NA 1A7AA 3IMFA 1WVGA 4J7CA 1B7GO 1A71A 1JKFA 4CM9D 4GX0A 2ZK7A 2EKPA 2JD0A 2PA3A 1YQXA 2IZ1A 3VC7A 2GRAA 4I9NA 1PWXA 4RVDA 3FNGA 3ADPA 3JYPA 3JQ8B 4R51A 4BO5A 4R5MA 4DWVA 4YPOA 1B8VA 4JQCA 1C1DA 2CUKA 1EVYA 9LDTA 3W4IA 2VYVD 3DBHB 3U4CA 2Q50A 3FBGA 4ZD6A 1KVQA 3NGXA 4R69A 5AOVA 4BGUA 1A4UA 4BIIA 4EZBA 1U3VA 3ONDA 1CRWG 4D45A 3N74A 4RPKA 1XQ1A 3GQVA 4E2WA 2I76A 2JD2A 1JW9B 3F1KA 3H9EO 1H94A 3KO8A 1XLTA 4D0RA 4XGIA 4O1MA 1I3NA 3GNQA 1OZAA 3DMTC 3SLGA 1NQTA 1YL6A 3G0OA 2WD7B 4JN6B 4AJ1A 1T4DA 2C7VA 2VYND 1E3LA 3P2OA 4JBGA 1XA0A 4UREA 2VTEA 1ZJYA 2ZTUA 5BT9A 5BNIA 3PLNA 2G82A 1XIVA 1QKIA 2LDXA 4MKXA 2ZCVA 2ZQYA 1K6XA 4HFNA 3OQBA 1DXYA 2PWZA 3GVCA 2VWQA 4NK5A 6ADHA 2DAPA 1QV7A 3DAPA 4FFOA 4TKMA 4E21A 2Y1GA 1DRVA 3ZV5A 4LK3A 2VN8A 4MIOA 2A92A 4N5MA 4O63O 3DHEA 3AFMA 4ZQFA 3WJAA 3EY4A 4I9HA 4CMBA 2E49A 2PH3A 5BNFA 4PLPA 5FFFA 3VPHA 1XELA 4XQ9A 4BMSA 5K6AC 3GF4A 2AE2A 1R4NA 3GEMA 4J0FA 4E0BA 3I9MA 2G5CA 3W1VA 1E7YA 1DRWA 1E7WA 4PLCA 2QQ5A 1PJ2A 1ZZEA 2X7HA 5A5EA 2B5VA 5HRUA 4GX5A 4O5OA 4NBVA 5DBFA 4AJOA 1QXSA 2D0IA 1PR9A 3KHUA 1ONOA 4YAKA 3ROPA 1P0FA 1LU9A 1UP6A 4IS2A 1RKXA 5ER9A 1DIHA 5G0VA 3FI9A 1IPEA 1EFLA 4XQCA 1JWBB 5EL0A 2PNFA 4CLHA 3HN2A 4NK4A 3W4KA 2J3IA 3D5TA 1HYHA 2EEZA 1YQGA 2FZEA 3ZI0A 1KS9A 5CAEA 1K0UA 3KRTA 4BB6A 1M76A 2VRBA 4ZQEA 3DBRB 1ZNQO 4FIZA 4YDRA 4ND2A 1KOLA 2V6FA 1X0XA 4FD3A 5I7SA 2BLLA 1GAEO 1WMBA 1UJMA 1DAOA 1DO8A 5JAIA 3AUSA 1I01A 3TZKA 4WKGA 5K0ZA 3RC7A 3EK2A 4WLUA 2VZ9A 1P1FA 4YCAA 3BMOA 3LK7A 2VT3A 3BXXA 1W8DA 4NBRA 2C0CA 4J4HA 4E2ZA 1G0OA 4RVHA 3GPDG 3PLRA 1U8XX 2PZLA 4GBJA 2FPGA 4QUKA 5C37A 2ZYDA 1LDYA 1I3LA 3IKTA 3EVTA 1NYTA 3ROQA 1H6CA 4TWRA 5JYEA 5T64A 3X2EA 4OL9A 4BS9A 3PEFA 4I1IA 4DGSA 3GVHA 3HDYA 5KVCA 2X58A 3GMSA 5JCJA 1W0CA 4AJNA 3F9IA 2FR0A 4B8ZA 1BXKA 3WQRA 2C2XA 2YDYA 4YQZA 5TT0A 3X2FA 2BFMA 4CL8A 1LBEA 4E12A 1QYVA 1SOWA 4PIVA 3DBLA 2W4QA 4OGWA 4QECA 4R9SA 1EUZA 4W9NC 3WICA 4BGEA 5A9SA 1B3BA 1SO8A 4RPJA 1OC4A 1I33A 4KTVE 4MVJH 3VHRA 4J49A 2EKLA 1PWZA 5IG2A 4RDHA 3E9NA 3I4FA 3UICA 1MC5A 4CJXA 4JJFA 3WGGA 4DC1A 4WLEA 3NRCA 4B79A 3U4IA 3IUPA 4NJOA 2DT5A 3E9QA 3JQGA 3MWDB 1LEHA 1PX0A 2NQ8A 2GUGA 2C20A 3D7LA 4ZN6A 1I24A 1FDTA 3WSVA 4D7AA 1GYQA 4EDFA 2UUOA 3BMNA 1F06A 1XGKA 3IQDB 3WBBA 3PGXA 3O8QA 4RVUA 2ZJ0A 3ITKA 3MTJA 4BO7A 3K31A 1FXSA 1YBAA 4UUMA 2W2KB 2ET6A 5DDIP 1JKJA 2JAPA 3FWZA 3WIEA 1Y8RA 4U0JA 4JBIA 2VWGA 3MZ0A 3AK4A 3M1AA 1GQYA 3M2PA 3TDKA 3I9OA 1KEVA 4D43A 4RQUA 3L6EA 2CVZA 3O4RA 2BFOA 4HNHA 1KEWA 4JXKA 3MJCA 3VKUA 4YQYA 4GL4A 1IHXA 5IN4A 4GKBA 3HSKA 3CE6A 3TOZA 3WYEA 4CM8A 1P77A 1EDZA 3A06A 1NPDA 1GQQA 3IP3A 2A9FA 4BL5A 4E32A 5T8KA 5B12A 1ISGA 5TC4A 1ARZA 3T4EA 3S2GA 5JDCC 3AI1A 1PS8A 4E2YA 1VJ0A 4RGBA 3IJPA 4FOOA 2NNLD 1N1GA 5I7VA 4PVCA 1P0CA 4DIBA 3C1TA 3QSGA 3DO5A 2HJRA 5A4DA 4FGSA 1DFGA 5K9ZA 2HRZA 1HWYA 4OJNA 1RM4A 2Y1FA 2YY7A 3P5SA 2JCVA 4P38A 5IDWA 4E30A 5F1PA 1GDHA 4ZQBA 4XD2A 4E31A 3KLPX 1JDJA 1ADBA 3U4HA 4QTZA 5L4LA 4BOYA 3IDSA 5CEJA 1QR6A 4W82A 3DQPA 3PJEA 2YZ7A 1I2ZA 3HN7A 3H7AA 4IJVA 3B1JA 3F6YA 1MFZA 4PRKA 4QXMA 1J4AA 2NACA 1QSGA 1ZFNA 2YUTA 5JC8A 3T7CA 2YJZA 3DZGA 4LN1A 2WSBA 2NU8A 3K6JA 1R0LA 3R0IA 3BAZA 4UUPA 1QYXA 2QW8A 3OQ1A 3PWKA 2DBQA 1ORRA 4HFRA 8LDHA 3RCBA 1KVUA 4OSPA 1ZCJA 3AM4A 4N5NA 5A04A 1N7HA 4CQMA 3PQFA 4CL3A 4MP8A 3PWZA 3ETEA 2CZCA 5IXYA 3PK0A 1EK6A 1GU7A 1JVSA 4GSLA 4YB8A 1T1SA 3ZWYA 3ZH2A 1DOHA 1E3JA 2Q1SA 2PZMA 3S55A 2X5OA 3PHJA 1WW8A 5DZSA 5TJHA 4B3JA 3WG9A 1GZ4A 5L51A 3I6QA 1S6YA 2VCYA 1Q0HA 1SOVA 4ALJA 2WE8A 3OIGA 5EERA 1YOVB 5ER6A 1WPQA 3MOGA 1E92A 1EFKA 3GNTA 4ZQHA 2RH8A 2W2LA 1LSOA 2D2IA 3KBOA 3VKVA 5JFOA 1EVIA 4TSKA 5KWEA 3HDQA 1AGNA 4B4UA 2J5QA 2PKQO 3JYNA 4DVJA 1G0NA 4JCOA 5H81A 4II2A 4L74A 3HDHA 5BR7A 3GG9A 1K5HA 2ZTVA 4OKNA 2XF8A 4KUEA 4AJLA 2CMDA 3H2ZA 5AXCA 3D5QA 4FFPA 1I32A 3EUWA 5TS3A 3U3XA 1KC1A 2WEKA 4WLFA 4J1NA 4WEQA 2PKQP 4ZICA 4KTTE 3VVCA 3QV1A 4J1TA 4CM5A 2Q3EA 1M2WA 1T2CA 3RUHA 4PLFA 4EBFA 3TJRA 3H2SA 1R0KA 3HE3A 2G0TA 3GGPA 1HDYA 1I3KA 1CQJA 3H6KA 5BSFA 3AOEC 4RF3A 1H9BA 1LRLA 1B0AA 3N7UA 4BNUA 1KBZA 3CMMA 4IINA 4J2HA 3C1AA 3E48A 1UZLA 4XEHA 2VHZA 3GGOA 4U5QA 2A4KA 4JNKA 4F46A 1R37A 2X0RA 4FR5A 3GZNA 1XEAA 2NVUB 1NHGA 4MPDA 3TL3A 3WMWA 4ALIA 3NDRA 3HNPA 1DLJA 2PTGA 1X15A 3OA0A 1V6AA 3C7AA 2D8AA 3GDFA 3O38A 5LDHA 3RAJA 2H63A 3H3FA 1JTVA 4BO3A 3HHPA 2HDHA 1KYQA 4X54A 5A9RA 1SB9A 3FN4A 4IDCA 4R54A 4PRLA 4HNGA 4MIYA 3UAGA 5T8KC 3EMKA 4BO8A 3EYWA 3HFGA 3NX4A 3H5NA 1TT7A 2DC1A 2QRLA 3TN7A 1N9GA 7ADHA 1ENPA 4YT5A 3SC4A 2PD4A 4XR4A 3JQAB 2B5WA 3KYBA 4DPLA 1PGOA 2Q45A 3DONA 2NLOA 2Q2QA 1H2HA 4IBOA 3ZGYA 5JAQA 1UAYA 4FGWA 1E3IA 2YHIA 4BNNA 2IDZA 3GA0A 3PXXA 5LC1A 1YWGO 2GPTA 3R3JA 4L8VA 5C7LO 1ZVMA 4YJHA 4CLDA 3LT1A 1E5QA 1HRDA 1K6IA 1YDWA 1X1TA 4TVOA 3ENKA 2DVMA 1HTBA 2GD1O 1EZ4A 2OP1A 1PSDA 4C7KA 4OMUA 5J23A 1EE9A 1GTMA 2ZATA 3OIDA 1Q7GA 2IYPA 4PZCA 2VOEA 3OBBA 1SCUA 4HBGA 4L4RA 5EQDA 3RBVA 4YJGA 5JY6A 4NG5A 3AY7A 3EGOA 4WECA 1M66A 1UXHA 2X0JA 2I9PA 4A0SA 2VRCD 3TZCA 1UDBA 1UXIA 4GVLA 4CMGA 1VE9A 3JYLA 3OETA 3BMQB 3H9QA 1MLDA 4RPLA 3WIDA 3GNSA 4S1VA 2O2SA 3MJ4A 3VPXA 1I2BA 4ZGWA 2JFFA 4MVJD 3VZSA 4BNZA 5JYDA 5IXSA 4CMAA 1ADGA 4BUCA 4Z9FA 3WMXA 1FDWA 1VJ1A 2DUWA 2LDBA 2J3KA 2YV2A 3FPLA 5KOIA 4XYEA 1FJHA 1VL6A 2JHGA 3I9NA 2PD3A 4IPTA 4CQLA 3OECA 1UZMA 3DOOA 5CEEA 5JC1A 3PTZA 5BSHA 4J3FA 5GY7A 5TRTA 2IXBA 4O6VA 1HE2A 1A72A 1PGPA 5AXBA 1GR0A 3UW3A 3WTCA 2ILTA 4RCVA 2Y67A 5FI3A 1GL3A 1P1HA 4Y6PA 1OMOA 1E0DA 3BHMA 5ILGA 1XWFA 3OF2A 4CMIB 1Y1PA 3VVBA 4RF2A 3K9QO 4J4BA 1IUKA 3SXPA 3WGZA 3GFGA 3TZ6A 1BWSA 1R15A 4KMSA 5AQ1A 4KDEA 3L07A 3TRIA 3C85A 3QP9A 1EVZA 1IOLA 1W4ZA 2CDCA 4PG8A 2QG4A 4BGIA 4IS3A 4K26A 4CLOA 3JQAD 4NBWA 1FDUA 2J8ZA 4DPMA 4UUOA 1T1RA 2C07A 4BV8A 1MX3A 2D5CA 4PLGA 3FR7A 1HEUA 4OH1A 3KZVA 3VPSA 1KIFA 2UVDA 2Y1OA 4ALLA 4RJTA 3JQ9A 5KVVA 4G5HA 1ZXBA 2FSVA 4WCFA 1Q1NA 2AEJA 5T57A 1KETA 2O3UA 2GDZA 2PKRA 3MWEB 4RO0A 4RF4A 1E1LA 3GHYA 1EBFA 3BTUA 3C24A 4AJKA 2X9GA 4B4OA 5B4TA 1YL7A 1JLLA 1R12A 3QRWA 5CP8A 2IEBA 1R16A 4Y6RA 2EWMA 4EUFA 4QO7A 3HQ4O 1DHTA 3W8FA 4BMVA 1WZIA 3WXBA 2Z5LA 4CM9A 2EP5A 3I9KA 4PLWA 1YL5A 3AY6A 5KCZA 4HFJA 3UH1A 1QORA 1TEHA 1ZIDA 1I30A 1SEPA 3DR3A 3DOJA 3W4JA 3GRPA 2QYTA 1YRLA 1RWBA 3KOUA 4GX2A 3WWZA 1O8CA 4YJDA 1GPJA 3OJ0A 1N92A 3RKRA 2ZB4A 4OKIA 4CMEC 5G2OA 1WLYA 1TT5A 2VYVA 4YJFB 4DL9A 3O9ZA 5AVOA 2WMDA 2WTBA 4MOWA 3NTRA 1GADO 3K96A 5G4KA 4JP2A 4L4SA 1R4MB 4N7RA 1QLHA 3INRA 5HWSA 5EINA 4W6ZA 3GPIA 3QWBA 5JXWA 3ZV3A 4FJ2A 1NNUA 3CINA 4QX6A 1V35A 3O03A 1PR3A 2ZYAA 2Y1DA 3JSAA 4LISA 2AEFA 3IC5A 3W6UA 1UZNA 1BGVA 3QWIA 5TIIA 3F4LA 1EBUA 2HRBA 4YAJA 3T4XA 1BW9B 5L53A 4M86A 3G49A 1QRRA 4JK3A 4PZEA 3SC6A 2DLDA 2XOXA 1YB1A 3IIEA 3K2EA 2GN9A 1I0ZA 1NXQA 2O3QA 2OFPA 5MDHA 2Z1MA 2BFAA 3AFNA 4IXWA 3LDHA 4RVSA 1XHLA 2HLPA 3QIVA 4HP8A 4KDFA 1DSSG 3Q2KA 4XYGA 4XX0A 5JE8A 1VL8A 1DBVO 2CF5A 4WGGA 5CG2A 1NQAO 3ABIA 1N5DA 1PGNA 4E33A 4M1QA 3V2GA 3WQQA 2FY8A 3ZU2A 3D1LA 1BVRA 1ENYA 5DBIA 2TMGA 3OMLA 1C1DB 4U7WA 1HKUA 3Q3CA 4GWKA 3ONFA 1GUFA 1D7OA 4YT2A 2NVBA 2DPGA 2GR9A 4IM7A 1MFPA 1LSJA 3BYZA 3LC2O 4IDDA 3ZWXA 3DZHA 4YEDA 1E1KA 3PZRA 3E82A 2GN4A 1V9LA 2NU7A 3SLKA 5F1KA 1ONPA 5DN9A 4BKQA 1BSVA 1HDCA 2DBRA 1O89A 2BF7A 3PQEA 2BGKA 4XIJA 1PEDA 2GO1A 5JAZA 2E37A 1EEHA 5G0SA 4Z3DA 4YACA 1OI7A 5LCXA 4G2NA 3G1TA 3UCFA 1MG0A 5A3VA 3OH8A 1GYRA 4ZRMA 4RQTA 5IZCC 4E5KA 5F5LA 3PWSA 3NDJA 4Y98A 3DBHA 5COBA 1MV8A 4XIYA 4WLOA 5L3ZA 3WX0A 2Y0DA 5ICSA 5JS6A 1HLPA 1LLQA 2O3SA 5DF1A 4JIGA 4CMKA 4LVUA 3D4PA 1E7SA 3ZV6A 3RC1A 1W6UA 2QX7A 3F46A 2BFPA 3GEGA 4Y9DA 3H65A 1SPXA 3L4BA 5HBRA 2C5EA 3IS3A 1D8AA 3GHHA 1BXGB 4JX8A 4Z9YA 4R3WA 3D0OA 2DBVO 3K8ZA 4BKPA 1Y81A 1O9BA 4DLAA 2Q4BA 3KYCB 4AJ4A 4DPKA 3RROA 2GNAA 4BVAA 3GRKA 3QVSA 2PFGA 2V7PA 1NFFA 2G17A 3NJ4A 3JQ9C 4BNVA 1HDXA 5B1YA 4IDEA 4BKUA 1LUAA 1BDMA 1PU2A 4UEJA 3ZV4A 4A73A 3VPGA 4R41A 1P33A 3F5QA 4QT0A 4CMJA 1Y5RA 3WBFA 2XXBA 1C0PA 1EQUA 1Z82A 3VZQA 5IF3A 3WQSB 4MKZA 5G0TA 3VH1A 3WWYA 1QYCA 3ITDA 5KJEA 4CUKA 1FDVA 1U5CA 5I7FA 1YO6A 2VHXA 3IAHA 1F8FA 1UR5A 1JN0A 1U3WA 5L9AA 2C2YA 3GUCA 3RBXA 1OC2A 1LDEA 1I5RA 3B1KA 3JQ6A 3KEQA 3JQDA 3GC6A 3PFWO 4ITUA 3V1UA 4EUEA 3ZWVA 4WPGA 5KIAA 4INAA 1K3TA 5JY1A 1DJQA 1YONA 3WGIA 2E4AA 4XGKA 2P9GA 4NH4A 1GFSA 3H9GA 1Z73A 4LW8A 2Q99A 4PLYA 5JLAA 5L7YA 4RVFA 3E9MA 1H2BA 2ZJ1A 4R3NA 4XR9A 5L7TA 2ZCUA 4F6CA 3ANMA 4FQ8A 2R00A 3DWFA 2FR8A 4MP6A 2GN6A 3GDOA 3JTMA 5U4QA 1RJWA 1HF3A 4BB5A 3FF4A 1U7TA 1XU9A 3JD1A 3PDUA 5L45A 1ZJZA 4CV0A 2NTVA 5FI5A 5DCYA 4HV4A 1HETA 2HSDA 3RSHA 2FHSA 1Y7TA 2YW9A 5A5FA 4D3FA 1ZW1A 1LQTA 1X13A 4XZ3A 1GUZA 1HYGA 1DC6A 1F17A 2I99A 4JJGA 2EXXA 1D4FA 2O4UX 3R6DA 3BHJA 4P22A 1LRJA 2X22A 4YAEA 1PZEA 1U2GA 3RFXA 2V6MA 4R1SA 2I3GA 3IL2A 4UEOA 4BO4A 2YYYA 1Z7EA 2V65A 1AXGA 2XPCA 3Q0EA 4JJIA 4TZTA 3SBOA 2V6GA 3JD3A 1B2LA 4K9DA 3SVTA 3ANLA 4E2XA 2WJPA 4CODB 2JD1A 2O3RA 8ADHA 3JQGB 3CMCO 1YDEA 1P31A 4R1NA 1W73A 3I23A 1AUPA 1L7EA 4CMCA 3UFXA 1C0KA 1I10A 1QYDA 4HX5A 3O8QB 4LCEA 1U2DA 1MUUA 4GKVA 4DMMA 2B83A 2Y1EA 4I5FA 1ZMTA 5IDXA 4FFLA 3WR5A 1ONNA 3ZHBA 2CDBA 1HXHA 5I9NA 3SEFA 1Y8RB 2X0IA 3KUXA 1P74A 4WUVA 1ZBQA 2AEMA 9LDBA 1HE5A 1UP4A 1PQWA 1X14A 1PZGA 2AA3A 3MJEA 1OBFO 4L75A 3F1LA 4U6SA 4RL6A 2WYWA 5CDGA 3ZWPA 4DREA 2DM6A 2H5LA 1D3AA 4GWGA 1GCUA 1OFGA 3RASA 1WNTA 4PLZA 4CM8B 5F5NA 1LLDA 1PGJA 3HWRA 5GMOA 2H6EA 3CEAA 5JCXA 1LDNA 1WDKA 4JROA 2DKNA 2IZZA 1QG6A 1V3VA 4KQXA 1X1EA 4A27A 3DC2A 4LGVA 4R1UA 4MVJI 4OXKA 3RWBA 3WB9A 3D3EA 3PGJA 2EP7A 2GZ1A 4GSKA 2DTXA 4CM6A 1ZH8A 1NPTO 3L4BC 1A9YA 4JBHA 4PG6A 5IFLA 3TL2A 1QV6A 2IXAA 3UCEA 3LLVA 3RVDA 4CV3A 5IAAA 5JCJD 1UUFA 1HE4A 2YV1A 3PZBA 4F6LA 5C7IO 3AWDA 4Y6SA 4RPHA 4AJHA 3I83A 2IRWA 5TGDA 4EJ6A 2YFHA 2W90A 2VHWA 5A1TA 3QWFA 5ITVA 2P5YA 2NWQA 3QWAA 3G17A 4AICA 3GK3A 4XCVA 3DHNA 4OYRA 4K6CA 2PK3A 5A06A 2B69A 1TA4A 4NBUA 4QFDA 1NVGA 2GZ2A 4HFMA 4IQ0A 2Q1TA 1GD1O 1YBMA 4NFHA 3EW7A 3U4DA 1E5LA 4B7CA 3DTYA 2HCTA 2WYVA 2Y66A 3DOCA 3KSZO 2BI8A 2JCYA 4AJJA 1JU9A 1PL7A 5IN5A 1PQPA 1Z75A 2AHRA 5BNTA 4CQMB 5BSEA 4ALNA 2PZJA 1H6AA 3DMYA 4WOKA 1C14A 3RD5A 4C7JA 5ILOA 1Q2XA 4PG4A 1K2WA 4B8WA 2FN7A 3ZWAA 4BNMA 2R00C 1HT0A 1NQ5A 1EK5A 1I36A 3P2YA 5HS4A 1WAMA 1Y8QA 2OL4A 5HTOA 2VZ8A 4E6PA 4L76A 2DFDA 3B6ZA 5I9MA 3MJVA 2CVQA 1Z74A 2F1KA 3BIOA 2ZTMA 4DMLA 1VKNA 3WTBA 1LLCA 2O7SA 2Z95A 5MGBA 1NX6A 1QMGA 1XCBA 1Y9EA 3UKOA 2JFGA 2B4TO 1SEVA 3NTOA 3QW2A 5DCWA 4BV9A 2J3HA 2OBYA 1ZO8A 2OORA 4F3YA 1JVBA 1LXCA 4U8GA 4RORA 4TVBA 2O23A 3NAQA 4IGFA 1WZEA 5JDIA 2OOSA 3LLSA 4OSOA 5CEFA 3WGOA 1IZ9A 1LSUA 1NWCA 2AQ8A 2WWRA 4J9UE 4QQRA 1Z7BA 3I4CA 5TQVA 2FPPA 2VUUA 2P4QA 4R4JA 4EGFA 4PFJA 2CSUA 3C3XA 4J7UA 1SC6A 5U9CA 1EUDA 4N18A 1DLIA 1RYDA 1YOVA 2PGDA 3UVEA 1O5IA 5L4SA 2HKIA 4D0SA 4ND1A 3BA1A 3W8DA 3NKLA 2HMUA 1PL8A 2E82A 3FCOA 3QQPA 3R3SA 2X1HA 4ALMA 1YB5A 1KERA 3ZN2A 5L40A 3DZBA 1Q7BA 2HK9A 4ESOA 1PZFA 2B37A 4BNFA 3BMCB 4CLRB 3DL2A 3AOGA 3GZNB 3FD8A 4EITA 2GGSA 3CTMA 1H0KA 4Z0HO 2VOJA 3WDSA 2GLXA 3TQHA 1PS0A 2OUIA 4YBZA 3STHA 5KNLA 3AJRA 4NQZA 1WWKA 1ZK2A 2Q49A 4F45A 1DIAA 1ZK0A 2HMTA 3Q2IA 2DTDA 5G0WA 2EKQA 4DBVO 3U09A 4A26A 4MKRA 3KM0A 4UVDA 3GEDA 2VRCA 1PJTA 1RM0A 2AG8A 2BGMA 3TSCA 4CQMD 4CUZA 1DIGA 4YRBA 3ICCA 2BHLA 3ULKA 1IULA 2DU8A 4K6FA 1UXGA 4ND4A 1J49A 5AYVA 3W6ZA 3BHIA 5ENVA 4D79A 2JCXA 1O95A 2ZIZA 3OJLA 1CERA 2PLAA 4TKLA 1X7HA 1NHWA 5EPOA 5ADHA 1P9LA 2OZPA 2RCYA 2DFVA 4DQXA 4OQYA 4D41A 2NTNA 1N8KA 2I5PO 2AG5A 2P91A 3JYOA 3KSUA 2SCUA 2XXJA 4DC0A 3UXYA 2UUPA 5U1PA 3K5PA 4PGFA 3HUDA 4HY3A 3UCXA 4E5NA 4YWJA 1V8BA 1C1XA 5A05A 2HK7A 2B4RO 4KP7A 2W2LD 5CPBA 2EJVA 4KUGA 2PV7A 3ZW8A 4UAGA 3UN1A 4NFYA 4YXFA 3EDMA 5TSDA 1XQ6A 5FF9A 1ZEJA 1A5ZA 1UDAA 1UH5A 1E1MA 2H1SA 2OBNA 2QYSA 3QHAA 1NFQA 4MVJM 1JA9A 1EVJA 2OGUA 4TMFA 3IOYA 3U0BA 1LC0A 4Q3AA 3TFQA 4DA9A 1GPDG 5KJ6A 4YYZA 3D4NA 2Y0EA 3ZHYA 3LU1A 1QYWA 4WK6A 1PJSA 3ONEA 3H9UA 1HE3A 5JPIA 4YJGB 5B4UA 3BTVA 1WDLA 3JQAA 3WSWA 4IDGA 3BTSA 1LI4A 5L4NA 2X9NA 3ZU4A 5ES3A 3K30A 1T24A 4H7PA 1E6WA 4IY1A 4L73A 3DAGA 2HJSA 5COAA 3NT5A 2J5KA 5GZ3A 3I1JA 1ISFA 1LDBA 3GDGA 5DOZA 5TX7A 5F1OA 2D5AA 4OHUA 1X0VA 4XQGA
chains in the Genus database with same CATH superfamily
4C30A 3RJ9A 3AI3A 3V2UA 5EWMB 1G21E 1U2PA 4TRRA 2Z4TA 4RKYA 3OWXA 1E2GA 5HIAA 3OJOA 1PNRA 1NBWB 1TKCA 4YA6A 2BCGY 2ZXFA 3CGGA 4TV8B 3IV7A 3GJ7A 2RHMA 2V1UA 1MTOA 5AKJA 3S5UA 3L6OO 3AUUA 1TF7A 1W9HA 4B2PA 3GLIB 4JJEA 1ZI6A 4Z86A 4CN9A 1NKSA 1NW9B 1L5MA 3R5SA 4HDNB 1I0LA 3UA4A 4QQNA 2PS9A 3CW2A 4GLOA 3LYLA 4ARBA 5A02A 1AO0A 3VNQA 3ZBQA 3H4TA 1MU0A 1D6NA 1TFRA 1GGEA 3JZFA 3CN9A 1JIKA 3OZBA 3PQ2A 4ZV9A 2PSEA 2H2AA 1XRMA 4BPBA 3ACCA 2Y4OA 2VXCA 3TECE 4KFTA 4EI9A 1DRKA 1UKZA 4N0EA 3UUWA 1DDIA 2B4YA 2QY6A 2A94A 4MITA 4PHCA 5EZYA 1ORDA 4X1IB 1Z0FA 3R8CA 4HDKB 3PCXA 4I3GA 3IO3A 4TUYA 2WWYA 3OC0A 3FCUB 3DMTA 2VF5X 4Z0PA 5ICGA 2Q6TA 2UZAA 2PXCA 4BC0A 1V48A 2Z1NA 5I7OA 3HB4X 1QPGA 2B92A 4JH0A 2GYUA 5ICEA 4M0PA 2NX2A 3C1OA 3A05A 1CYDA 5BSWA 1LJ8A 3A27A 3DEIA 5KI6A 3BF7A 5HIKA 4G67A 3NATA 3NH6A 3I5MA 3QFCA 4G0WA 4NU6A 4IMPA 3ANNA 1SVUA 2FZWA 2Q28A 5CR9A 1NDQA 3KB6A 4CTOA 4U2DA 5BUSA 1QH8A 2SECE 4AZ0A 1C3VA 3BQNB 3FCCA 4KQWA 4DYDA 4KAFA 1JYEA 1VDMA 2CLMB 3W6OA 2PBLA 1WL8A 3ZU3A 3A9WA 2DG2A 4XUEA 2GYYA 3K5WA 3P9CA 3S68A 3MCZA 1U1DA 4DMKA 3OE5A 3QUBA 4EM6A 4WCDA 5FOUA 1JAYA 1FNBA 2V6BA 1O94A 3PHLA 3AHFA 7REQA 3USZA 4BJ1A 5FYDA 4L78A 1N8SA 2NT3A 3L0CA 3MTBA 2OWEA 1GKUB 2ZB3A 4RK5A 3F8SA 3EC1A 3RYFA 4CM4B 2J0QA 4O2BA 1XVUA 5HVNA 2QUAA 2WU4A 3FFTA 1NPYA 3COSA 2C95A 2VNAA 4U9UA 5HJ7A 3REQA 3DOFA 4FK8A 2NUPA 2YQ4A 3AI2A 3B89A 3BGDA 4WXHA 1T5OA 2DH6A 1V2HE 1K98A 4EA8A 3F90A 4Y7CA 1KSFX 1L2TA 3OE4A 4DNQA 3GLRA 3BJEA 1DKNA 3ROFA 1DRUA 5BQFA 4PXYA 3OQIA 1IZ0A 4G41A 4D25A 3H5OA 2OP0A 4UE6A 2X15A 1ZINA 2QTTA 3GRAA 3NBMA 4URYR 1N4AA 1O95C 4DIFA 3Q12A 2XZOA 4AZ3B 1EG2A 2Q27A 5ELLA 2C59A 4MQ4A 3MXTA 4JJZA 2XA9A 1BU5A 1CR6A 2KB0A 4IMRA 4UQLA 1I3CA 4RCZA 1E2IA 2TMDA 5LWHA 2Q3JA 5CBPA 1AB5A 2VJYA 3HRKA 3ORYA 3TQSA 1AN0A 4ZT3A 2JJ8A 4LRTB 1DPGA 1QHFA 1MP0A 4HI0E 3P7MA 3FNHA 3S1AA 3WL3A 3RF6A 3ZUPA 1CFJA 1WDMA 4U2BA 4YN3A 1KYVA 3EIWA 3GR6A 3IUEA 4X94A 2DULA 1N2ZA 1PIWA 3C8MA 5E1DA 1HDZA 4CUJA 1F2UB 1NULA 1L3CA 3EEFA 4B81A 2WICA 3S8YA 1W7AA 3D6JA 4QC2A 4V0SA 4WXMA 1E1CB 1LB1B 1WDWB 4D9EA 4O2AF 3GN1A 2GCNA 1N5IA 3WFJA 4BZWA 3UF0A 1YVPA 5JG7A 3DDNA 1KPIA 4HR7A 4YRAA 4O0MA 4XX0B 2DF8A 3KLBA 4INPA 1C9NA 3D0QA 2NUAB 1YC5A 3FNEA 2CF6A 4A8PA 4F1KA 4YRMA 2FP4A 4MP3A 3JD0A 1RFLA 3HUUA 3W2HA 4G4GA 4UDYX 4TRJA 5DP2A 4QBIA 4C4AA 2EIXA 2WHPA 4YCCA 5KQMA 1YB7A 3OCCA 4PY2A 4WASA 3RLIA 3WGTA 1IXKA 4DR1B 4Y0NA 4FN4A 2YVLA 4MWEA 5LMZA 2B8EA 2RHRA 3EG9B 3BDIA 3NEJA 1WCYA 4NICA 2OCDA 5IAOA 1PFUA 1UBMS 1K6MA 3RS4A 421PA 3PHHA 5LQCA 2Y3IA 1FDIA 2VBCA 2W6PA 3HP7A 1F2TA 4BE9A 1YGYA 3B82A 3KTOA 1WOMA 4OI2A 5DB4A 4Z8YA 3VDNB 3ZZMA 1PNTA 4Q9NA 3L02A 4HRXA 3W3AD 2YVUA 2PCLA 3K0AB 4BU1A 5GOTA 3QX8A 2CXXA 3HJFA 2HHCA 3QNMA 5E9AA 3RIGA 4PO9A 4QAJA 3Q7TA 4FVTA 3KT8A 4H35A 4OIMA 3WJ7A 4IZHA 2ZRAA 1TI7A 4MQEB 4WZBA 2I6TA 4H17A 3WMRA 5KWJA 1PZHA 2JJQA 4Q1EA 1CZOA 3VH4A 3ZWMA 3C4QA 1YASA 3RS3A 2VZEA 8ABPA 3HM9A 4R68A 2VJBA 2C3OA 2HWWA 1U9CA 2J9FB 5ALPA 3L8ZA 3E1SA 3SDSA 2PT9A 3B5EA 2YDXA 3JAKA 1O4WA 3Q3VA 2EU8A 4FQ7A 3QEAZ 1Y63A 4EB6B 2PSHA 1BG6A 2P9ZA 2X86A 3F7MA 2IITA 5EIOA 2IYXA 4YMWA 4FDUA 4GPTA 1VRVA 4JYPA 1V41E 4DLLA 4AJPA 4D9BA 3Q3GE 3A6DA 1WG8A 3AU9A 4FGZA 3HDJA 4C2BA 5EXDA 3TSOA 1NTOA 2OBFA 4DEXA 4IQ8A 4FCWA 2FETA 2YV4A 1TTHA 2ZJ8A 1NNEA 4QOFA 1P91A 5BW4A 1UC8A 4PSDA 4XRRA 1KU0A 3NT4A 5AH0A 5AK5A 1RQLA 3DB2A 1LK7A 3F67A 4JLAA 3V5NA 2FR1A 4XVHA 3EGXB 1P44A 3AY3A 5D5HA 3S2FA 3QUSA 5KYXB 4IVRA 1FSGA 2DWPA 1H6DA 4XD7D 3GWGA 3CF4G 4N3AA 2I4NA 2YWJA 3OPMA 5GONB 3V9PA 2VZ0A 3RUDA 1A9SA 4FGKA 4BUJA 4M88A 2VPQA 5JQGA 4Z3OA 2IJGX 3BG5A 4GXRA 1LKZA 4HGYA 2WUEA 2EJTA 3CB2A 4TQ9A 4UDXX 4R1TA 2WFLB 1G5HA 3HJAA 1ZAYA 1F51E 4FFBA 4HDSA 1IE3A 1R4NB 3VAYA 2NN3C 4MWOA 1ZVVA 1VCIA 5D7BA 1H5QA 3F4BA 1NSFA 2QAGC 3VHQA 5DNWA 3LQ1A 4ZHQB 4HUJA 3Q98A 4NJEB 4D3XA 1NE2A 2QENA 3FNRA 2VXBA 4ZYVA 2HX1A 4B9EA 2EYUA 4QASA 5J2TB 1IVYA 4PYLA 1KAEA 4CTMA 1PWHA 4A2QA 5JDCA 4MGYR 1RI4A 1XK7A 3H5AA 1RWWA 4H0FA 2Z09A 2Q5EA 5AM2A 4BAGA 1S8OA 1AUXA 1O94C 4LVNA 5EJ2A 4JL8A 1DAEA 4QNMA 1U3GA 5AOCA 5AW1A 1HLFA 4UVIA 3NTUA 4RZHA 5H0IA 4MX8A 2QTWB 4QBKA 3RUAA 1R4AA 2I4MA 3BIFA 3KQNA 4ZFNA 3UV6A 2C8KA 5LVAA 1BU8A 4PFSA 1B16A 3QW4B 2WV7A 4ZO7A 2PYZA 1N0UA 3T1HB 3V7FA 1G60A 3NIFB 3DAFA 5T41A 4AJEA 4BO0A 2GX6A 4CTKA 3EEQA 4NZPA 4UE3S 4U6NA 1WCIB 2PZFA 4KLCA 2HQ1A 4AUEA 5E8RA 4ARVA 3S28A 2X6QA 3NV9A 2O8BB 2GKSA 1J97A 2F43A 2JK0A 4GSYA 4HAUA 1UEIA 2JGFA 4RDCA 2XCIA 4QYTA 2OZKA 4WERA 5CDTA 1BRTA 1ZICA 2RGAA 3TG2A 2BTQB 1NBEA 1EMDA 4Q4JB 4RHTA 4DXHA 3OBIA 1IHYA 1A3CA 2HV9A 4MULA 3RSFA 4IH9A 1DV2A 4N5IX 2XT6A 1NU8A 3HY6A 4XGRA 2A1TR 2PXAA 2YOGA 4TMXA 3Q6NA 5JI2E 4IL5A 3NUGA 1J6UA 2YJ6A 1ZKMA 3GJXC 3TCNA 4X1KB 1SQSA 1CV2A 2ZWOA 3L40A 3NBKA 3OZXA 4LCJA 4QGHA 3K2BA 2RFLA 1KYYA 3C43A 4FWIB 3AHGA 2D59A 4L2IA 5A4AA 3UG6A 2ZZNA 1KY5A 3PIDA 1T3TA 2ZU6A 2VZLA 3NWOA 1TEXA 2OXTA 2Z6AA 2ZE8A 3K7EA 1ORVA 3DBLB 1H3FA 1XMPA 1F0YA 1ODCA 4MVCA 1IMOA 3E22B 4LV8B 3GG2A 3NWEA 4F9EA 2ZJ2A 1XLUA 4ZEWA 1YMUA 3T95A 5A9SB 1ZM3A 1QFSA 4FWBA 1XI2A 2B36A 2ZWAA 2FX5A 4RVOA 3WQHA 4KXWA 5COQA 1Z4PX 3A1UA 3RC3A 3DQQA 5CA0B 5KYGA 3QI7A 4DSOA 3UANA 1WBJB 2HFKA 1CF2O 3TLEA 1H1LB 1E3SA 1IWOA 5KVQA 3UFXB 1V4NA 2H1RA 1UKVY 4IUDS 5DBGA 5K2MA 4ISBA 1RAEA 5K05A 5D85A 4KDRA 5EE0A 3SQOA 2H07A 5EESA 1EK2A 4ZVVA 1Z6AA 3BBLA 5EUQB 5IPFA 4R9UC 2IWHA 3PXCX 2CDNA 2QSUA 2WJHA 3FPGA 5DSXA 3LWZA 4P3XA 4TZ6A 3TMYA 5KTMA 1QB7A 2LW7A 4YVFA 4ZYYA 5IMSA 1BS2A 3FFAA 3OIUA 4LWZA 4N47A 2RHDA 4KV9A 4EL5A 2QVXX 5C9ZA 1NKVA 1T8PA 1VIDA 3R40A 3UGQA 3PRHA 1N7IA 2CFRA 4RACA 3UWMA 2J9RA 4R6XA 3K0FB 4J43A 1ISHA 3IALA 2DWCA 3CF6R 1ZOLA 2I2WA 3EIEA 5KQPA 2GNOA 3NDIA 3P4UA 4Y9TA 4W7HA 2I2AA 2RIRA 3W9SA 4UUNA 1VL0A 3SKYA 2FPIA 5C8ZA 1NVXQ 1QIFA 4B43A 4YO8A 3B1FA 3K1TA 3C15C 3BJZA 2HU2A 1E18A 1UKEA 3EZYA 2ODBA 1RS0A 3IESA 2IPXA 1DJNA 2ZTLA 3AQIA 3CG0A 3HVJA 3UT5B 2PUCA 2EQBA 4QTTB 5FV7A 4CI0B 1GCOA 4EAQA 1X87A 2XT0A 4KHPB 2J07A 3Q9SA 4TT3A 5ECYA 2Y93A 1CUEA 4XUCA 1JR3D 1VG9B 4INZA 1SCDA 5KKAA 2Z5FA 4MQ6A 2W2KA 5JZ9A 2IU0A 1YDHA 1DEOA 2GZAA 3CBGA 4GGMX 4MTCA 3I73A 2OYRA 4AG3A 4IEFB 4DB4A 2VDMB 2PG3A 2B0CA 2G40A 4L8LA 1SXJA 2CSXA 1UQUA 2IP2A 1PSWA 2P1ZA 2VS1A 2GXSA 2XQFA 3P9SA 1QIJA 1TAHA 1W29A 2YZGA 1WKBA 2C61A 3ZR4B 4KR6A 2XGGA 3GXBA 3LZ6A 5DP1A 5HJ2A 1MRNA 1UAGA 2JLQA 4PHHA 4DMRA 3COVA 3HKDA 4G09A 3VDRA 3H3JA 4K46A 4FHDA 4XVUA 3EE6A 3ZDDA 1C9DB 1HC7A 1IL0A 3NM4A 1RVV1 3QXHA 3P0IA 5HKKD 3LD9A 1BO6A 3ICOA 3M81A 2Q1UA 5KAPA 4Y3UA 4ECAA 4QUAA 3E6AA 1T0HB 3T7EA 3AI7A 2IY9A 2D06A 3VU3A 2X23A 3LI2A 1R50A 13PKA 2CLDX 5DRTA 5KJFA 3VJLA 2F90A 2Q2VA 4OXRA 4O8CA 5JRJA 1CY6A 1DTSA 1DU4A 2C42A 2Y6VA 4W7IA 4FFNA 5EP2A 4BYMA 2IUTA 4S1PA 5DT9A 1Y6JA 3H5WA 4NE7A 2FRVA 3QG5A 4AY5A 1K7EB 1OTHA 2QTLA 1KSJA 3OLWA 5EJAA 2NU8B 1G3UA 1YTLA 2FKAA 3D3KA 5A5DA 2VHJA 4NR0A 1U7HA 4CDMA 5FTLA 3B7PA 1J0AA 4RLQA 2QUZA 2Q3LA 1SUEA 5CHEA 1W36D 4WKNA 2X40A 3AH8A 4JGIA 2WIKA 4Q24A 1ZHHA 3KTAB 5JYCA 3U4AA 4MIEA 2OBMA 2UVPA 4IJUA 4M49A 3TL6A 3A6HA 3RYHA 5M34A 4YTEA 2H2FA 5SZKB 3T3NA 1HR0B 4IHJF 3NM6B 3TINA 1Z33A 3V1MA 4ZRNA 5JW6A 5EKSA 3V1TC 4URFA 2W7TA 2JS7A 4MA5A 4OVKA 1GY8A 4K3UA 4C7BA 2XMZA 2F1IA 5T6BA 1NF8A 3LBNA 3A3PA 4V0ME 3Q85A 2X3FA 4GQIA 5LXTF 1P29A 3D8RA 5ALGA 2NQTA 2AQIA 1DC7A 2CL5A 2PBZA 4BEVA 3AP3A 4DBLE 1EAYA 1PJBA 1T25A 2IHTA 3FZEA 3GY0A 4Q4AA 3UOWA 4U2KA 5KSYA 3AJ9A 5K3AA 4LOLA 2V4ZA 4IIUA 5ECWA 3K0HA 4P36A 3R7AA 3ICQB 1B0ZA 5J58A 4MMXB 1DDOA 1AF4A 1IJEA 2B6HA 4HWPA 3RAEC 5DYNA 1ULUA 2OO3A 1UFVA 4YT8A 1N6HA 3D7RA 1XDDA 3QPAA 5FLKA 4KU4A 4D9CA 3FTNA 1VCHA 4TLLB 1M2VB 3G2JA 1E9EA 1CK4A 3M7IA 4NCAA 1PJQA 3DMNA 1X8XA 4UEKA 4NAUA 3EXFB 3IT2A 2K87A 1I1OA 2H00A 3COYA 1Q0QA 5ELMA 3LC1O 1MH1A 3ZLBA 1ZQ1A 4J76A 4GFDA 3ROKA 1HLGA 3Q6MA 4LRYA 3ND9A 5LQSA 2FPPB 3ZDFA 2AFHB 1PTJA 1ULHA 3LIPA 2H18A 4P4GA 2ST1A 1ECJA 2JVJA 3OZSA 2QRKA 3KWFA 5H5JA 3I04M 2IYOA 3UV3A 3TGPA 4F9TA 1A9OA 2O6LA 3DWGA 3M5WA 4OHVA 3MG9A 1USKA 1Z5VA 1T4GA 1XTQA 5JR3A 3AUYA 3SZ3A 1W34A 1G8GA 3PFBA 3GH3A 1JHMA 4LJAA 4XYBA 3WO0A 5GZ1A 3THWA 5CYPA 2GEBA 2R8ZA 1U5AA 3OU6A 2HPVA 1ZK3A 3TI7A 1DG1G 5KSWB 4ZANA 5IC5A 4ZKEA 4YUXA 2EARA 5E3JA 1SHZA 3ZXSA 3KKEA 1O57A 4XLZA 4BP1A 3SZLA 2NTEA 4YRPA 1JE1A 4ESVA 1PG5A 1QE0A 3JQEA 1M10A 2BGIA 4DZZA 3JARA 4BNLA 4FHEA 3URKA 3KQYA 3ZK9A 3B5IA 2G4CA 3HDGA 5ALLA 5IULC 1DKUA 1JHOA 4R8KA 2NUTB 3C5HA 3GD7A 2LE0A 4FDAA 2OGSA 2QP3A 3E61A 4MEAA 4UXIA 4ZO9A 4BWGA 4I55B 2FRDA 1LF5A 4M55A 3W78A 4EY4A 4L85A 2HF8A 2RG1A 3A4VA 4DA8A 2L42A 4ZHSA 4KUHA 4G4JA 5HGJA 3X1MA 4LSGA 1GAQA 4RFLA 3TLMA 1HRKA 5FCDA 2GERA 4E5YA 3ZQJA 3KUUA 4A16A 5FO0A 5H9VA 3M9WA 4WEOA 1IBKB 1USGA 3Q11A 4DDUA 3OZEA 3DCJA 2DQ4A 1GTVA 3CLTC 2ZIFA 3D2LA 3CPJB 2WRZA 1FXWA 2ZAIA 2BF4A 3DM5A 5AKKA 4BLUA 3V8BA 5CT6A 3PHGA 3E9ZA 1LPAB 1MO2A 2DKOA 2VJQA 1FU7A 2IVFA 1XZKA 3BGSA 2ZKLA 4PX3A 2X8LA 3OZGA 3RSGA 1GZ7A 2WDZA 3BMCA 1GU0A 5FNVF 4XB2A 3TW8B 4EPVA 1C1XB 5I45A 1LDMA 3A7EA 1BTOA 1GVNB 1FS4A 3MQFA 1JPVA 4AX4A 3GAMA 1SXJC 1KVSA 5IKEA 4G5OA 4PAQA 1TTTA 3HKCA 4IJWA 2D54A 2OLJA 2VRNA 1XD2B 3GAZA 1IATA 4GMGA 3PC6A 4MI1A 4QO8A 4WFKA 5AICA 5LKRA 3AW9A 2QLTA 4GPD1 1EFPA 1W87A 4P3NA 1QH9A 4J0EA 3WYBA 2NVUA 1N1MA 2HA5A 4AY6A 1G3IA 2IW1A 1VLJA 3VOAA 3KZKA 1Y9ZA 3I6IA 1A8UA 2CD9A 4J03A 5GM1A 2AS0A 5B3KA 2NXEA 4JITA 1KP3A 4G8DA 5A03A 1D09A 3BEOA 3OUUA 1XT6A 1NXVA 1Y6ZA 4BO9A 4EJSB 1Q57A 2X8JB 1ECGA 3C48A 1ZW6A 2A1UB 5AKLA 1G20A 1VRWA 4TLBA 3FOFC 3ES9A 4RESA 4KJXA 4WDRA 3T7TA 1T15A 2HQRA 5BQ5A 1JDTA 2ODWA 5J5AA 3N58A 2IEGA 3SLRA 1NXPA 2UUAB 1ZM7A 2A35A 3UTCA 2HBYA 3V1YA 4KIFA 4I4TA 4Y2QA 3UJAA 3EGVA 3VBCA 4A3SA 1YKGA 1YJ8A 1FSZA 3IPCA 1CIPA 3KAQA 1Y6FA 1W94A 3B1ZA 4J16A 4D9HA 1CF4A 1ESEA 3PI7A 2J30A 5CIWA 5EY5B 3K9NA 3LX5A 3CVYA 1CUUA 2PY6A 1Q19A 1VP3A 3IUNA 1ILEA 1RC1A 4BECA 1Z0ZA 3OJFA 4CV1A 4B48A 4BEJA 1TCAA 2HI0A 2C2OA 1SUSA 4OH7A 5EWJB 4ZWNA 1PN3A 2Y99A 3ECCA 5JPCA 5L3SA 3O93A 2ZS9A 3G3EA 1L7DA 1T3GA 4XDZA 2OPBA 3U0VA 3V3KA 1DBPA 1OLXB 3VYVA 1C3OB 1V3QE 4QQFA 3WFIA 3ZZNA 5I8WA 2NOAA 3HVUA 1Y7HA 3HO6A 4ZIRB 4JYZA 4MW4A 1K97A 1QB8A 3CPEA 4N0PA 5ALWA 1O96A 2MJLA 4LBYA 3EGCA 3I5UA 4MS1B 3QEMB 4ZJUA 4H6XA 4UBNA 4EATA 2GEUA 1H8HD 1C4OA 3I9JA 1SVIA 1G8JA 3U31A 3E5RA 1VIAA 2BKAA 2JJ2A 2ZUCA 4OOFA 5BWNA 4F6RB 4X3PA 1SK9A 2Q3DA 3A1NA 1WXIA 4NJMB 1CUSA 4NV1A 3WGQA 3T5AA 3RHFA 2CNBA 3QPVA 4Z7NB 3EXAA 4HAVA 1DCFA 4PXAA 4EGQA 3J7AC 4JOSA 1G55A 1AKYA 3RS7A 4IOKA 2CVPA 3LIIA 2RIPA 4X1YA 3BE4A 3A6ZA 3WLHA 2E48A 3EC7A 1DC4A 5F23A 5FQOA 2OORC 4UUQA 2QT9A 1RRCA 4LMPA 1YB4A 2NPIA 3L7YA 5D7NA 3K8QA 1CUBA 2BFDA 2FMHA 2FQ1A 3KJFA 4P92A 3WLJA 4PYMA 3GW8A 3MS2A 4B4KA 4TWZA 4JSRA 4WBNB 4TWJA 4D02A 1RLOA 4P3OA 3RS0A 3O7MA 4TV8A 2QD3A 3Q5DA 4K9RA 1WB5A 3LHDA 4HXEB 4OA8A 4CLEA 4EWLA 4RK4A 4P80A 1T2FA 4JEIA 5EFZA 3WO1A 3LM8A 3EZXA 4D46A 5J5CA 3UC9A 1EDOA 6NULA 2J0VA 9ABPA 4Q7LA 4HDNA 4QDJA 2FSPA 4LX8A 3FZNA 4GVXA 1JAIA 4QU8A 1GKYA 5LD2B 1TVKA 1FQOA 4LHWA 4R0VA 1NONA 4X20B 4U7PB 1U81A 5BSUA 4NOLA 1XRJA 1HZZA 1X86B 1C3LA 2A0KA 1GQOA 4HCJA 1TYAE 3TPZA 4AS2A 3GIDA 4ZA2A 4EFDA 3MMZA 3W0LB 1Q11A 3AERB 2PIAA 3LT4A 4X1IA 4EY3A 4YAOA 4HDKA 3KXDA 4B80A 3H87A 4TZKA 1B8OA 3M70A 5E9WA 3U44A 4MHSA 1Q2UA 4M54A 1GV0A 3ZDYB 5LQKA 5CT5A 4ILKA 3IUSA 2B99A 2CLEB 2C7GA 2FRDC 2H52A 4FZ5A 4GZ6A 1CJKC 2J08A 3CONA 3VKGA 3PV0A 2QORA 2GLTA 4FZVA 5EUCA 4D0GA 3NTXA 4X64B 1WBDA 3L4KA 1FJXA 5AIBA 1A7KA 4F56A 4ODIA 3K9CA 3RFCA 1AC5A 5EP4A 4EG7A 2RI6A 4AMGA 3A14A 2P41A 5JO9A 1E6UA 1Y1QA 5G4KB 2JC3A 4G5XA 3BWCA 1E1NA 1CNFA 1T4CB 1TLLA 3T9EA 2VXYA 6GPBA 4C7XA 2DETA 1NMSA 3FI0A 3TUZC 3VSDA 3RQIA 1A9PA 3CZ9A 4AWAA 3JU3A 3N53A 3LPMA 4IJKA 3VYSB 4PE5B 4ZOLA 2G0AA 2FSGA 3GFBA 3TJMA 1IK4A 3MAJA 5JI3E 3C3PA 3DHWC 1R8YA 1QH1B 1EA5A 4WZZA 2WUDA 4DIKA 5L6MB 2YJGA 4WVFA 4CM4A 4IDFA 1MABB 1CJCA 3EZFA 3JQ7B 1NVAA 3UGJA 1R6TA 1W88B 1NFRA 1T2AA 1WUHS 2PYIA 4NBNA 4Z4FA 1M0SA 4GOKA 1T5SA 2PA0A 1Z45A 2IPNA 3N8NA 5FOQA 3HRIA 3FMVA 1OYVA 4X44A 5TJ9A 1DP4A 1C7EA 4I8XA 5JNSA 1QUEA 4UZSA 4TYQA 4OA5A 3RU9A 3GZTB 2E5FA 3STUA 2AXEA 3KXLA 4X8LA 5BUCA 1VIVA 1T6NA 1J8QA 1YCDA 3QV2A 1GNLA 4HOYA 5KUTA 1UBGA 3JASB 3M4YA 3D64A 2J4CA 4OJMX 1ULAA 1XDBA 2GN0A 2HDWA 3MT9A 5F3RA 4PVDA 1JR6A 1WQ1R 1P1JA 4RY8A 4IJ6A 5IBPA 3VH3A 3PIIA 2AH5A 3BIJA 1NX9A 4AZ3A 1C9EA 1SVLA 1H42A 2J31A 4PWYA 3UIEA 5HOEA 1YZNA 3I05A 4N8SA 1Z18A 2FZVA 2RHCA 1FMTA 3G9UA 4LK2A 4XGNA 2OO5A 3BRCA 3BTOA 3P8ZA 1HDEA 3HKBB 3NHUA 4FDMA 4RV9A 4YJ3B 5LDDC 4J16C 2E55A 3FMFA 2BOVA 4NU0A 2ZRDA 1TJPB 1BVYF 2JRCA 4Q3EA 5FA6A 3WYCA 5AK0A 4Q9AA 1SRQA 2P4SA 2VK8A 3L5KA 4TLMB 3TD6A 2CFSA 3HFSA 3USCS 1V0JA 4CLXA 4ALKA 5LP1A 1GPYA 1OKKA 1Z4IA 2I22A 4LSMA 2XAAA 3ZHXA 4ENPA 4AY2A 3NTQA 4NKRA 5JXGA 1A9QA 1DWQA 2A3NA 1HFEL 3DTVD 5K3SA 5IYZA 2NUAA 4XQ0A 2X5JO 2P75A 1E1YA 2QM7A 3Q9LA 1T3SA 2FW9A 4G36A 1GXSB 3AX6A 1GSOA 1JQKA 4MJXA 4NTZA 1E0SA 2NSDA 2P35A 4RKEA 4O4HB 4W9NA 3VGJA 5EKTA 3GCGA 4QZVA 1OTXA 4J7CA 1B7GO 1EE1A 4Q4HB 3UMMA 4BJ3A 4Q1VA 4CM9D 3KAJA 2ZK7A 2A67A 2EAUA 3CLKA 3CR8A 4PTLA 3SZUA 3WYGA 4YMTA 2BISA 1YQXA 3LTNC 3VC7A 2PE5A 2CHEA 2PQ6A 1V45E 1PWXA 1ZM4A 4NMLA 3ADPA 4R51A 1OREA 3JQ8B 4BO5A 4R5MA 4DWVA 1YUNA 1C1DA 3AUFA 3GYBA 5JEDA 1TF2A 1BWRA 2JH3A 5ERGB 3AL0C 2VYVD 1CY0A 2DH5A 3OQMA 2XSZA 4ZD6A 1KVQA 3IPAA 4FSXA 1Z0JA 4EF4A 5CB0A 1M83A 1T8YA 5G1NA 1J0CA 1U3VA 2ZI9A 1CRWG 1IRXA 4XTRA 5C31A 3NORA 4RPKA 4D45A 1Z68A 4QXRA 4TLAA 1TK9A 4ASUA 4MQEA 3ZVMA 3TRJA 3BUSA 3DLPX 3F1KA 3N8KA 1ZISA 3KO8A 3O0DA 1NOJA 4Z5XA 3H1EA 4AUKA 5MN5A 5KC9A 2QZPA 1BWPA 1OZAA 3WRWA 3M3DA 4PTYA 5FBQB 4F3TA 3UXMA 1EJ6A 4PS1A 4F5DA 2B94A 4QUJA 4EB6A 2VYND 4NCIA 2X41A 4YHBA 2H4FA 4QG7A 5LMNB 3LXMA 5AI5A 2PWAA 1ZJYA 4CVNA 5BT9A 2GLUA 3TBKA 1D1PA 1I6WA 4JLNA 1O54A 1QKIA 4LFAB 2JK1A 3ENQA 1W5TA 2Q62A 3KR0A 3M82A 4LDNA 3UK6A 1K6XA 4D9KA 3L2OB 5TPWB 4JI4B 3MT0A 1COZA 1MVNA 4XFJA 3SHVA 4RC9A 5DM60 6ADHA 2VWQA 1Q0ZA 2P1DA 2GBGA 3FBWA 2ARKA 4FFOA 4LKRA 1U98A 2JCGA 1HZZC 4KKXB 4UUBA 3ZV5A 4DE5A 5JJBA 2WDPA 5CB4A 1Y6GA 4DQLA 4WJLA 1DL5A 3HCCA 2VQDA 2X0KA 2A92A 2CVHA 3EGXA 3D43A 4MIOA 3H4IA 2VL7A 1ST2A 4O63O 1X74A 3DHEA 1SRRA 4ZJPA 4WESB 3EFOA 1SG9A 2DPYA 2VBFA 4PC1A 3WJAA 2QRQA 3E4DA 3T7DA 4BY9E 3EY4A 1KOJA 1UBHS 1M8KA 4I9HA 4CMBA 2O8FA 2E49A 4PQGA 4TTQA 4MYSA 3VPHA 4XQ9A 5AJWA 2R79A 3HMQA 4KN6A 1B41A 1R4NA 1FYEA 1G291 1HEIA 2DECA 2WMYA 3GEMA 1RPJA 3KOZA 4J0FA 1IM8A 1NVKA 4AQ7A 5LOVB 3NHPA 2JIOA 1E7YA 1AQIA 1E7WA 4PLCA 4ZO8A 3UPDA 3WY9A 3E0XA 1PJ2A 1ZZEA 3DCNA 2BMFA 3QGMA 2NYRA 4ZHQA 4NJEA 2X2EA 4A0HA 4D4IA 3E9RA 3DO6A 4LA4A 3ZCTA 1MJ5A 4CBVA 5J4YA 3HR8A 4NBVA 5J2TA 4TMTA 4U8HA 4BDTA 3OZUA 2GVNA 2A9KA 2ISSD 1PR9A 4FDVA 4RMGA 1ONOA 4PYJA 3ADCA 2A30A 2WPDA 2OKGA 3ESQA 3RRBA 1LU9A 3LS2A 3OZAA 4WZBE 4Q03A 1HO3A 1SQ5A 2Z04A 2E5WA 1IPEA 3C6KA 1G98A 2YXPX 1JWBB 1RADA 1NW7A 2PNFA 4IEIA 1NG9A 1M7BA 4QVIA 3WQBA 2EEZA 4OQ4A 1QRSA 1K8YB 3N2LA 3L6BA 3DJFA 4DARA 5BQXA 1M8FA 4M0UA 1M54A 1ZMBA 3ELBA 4AT1A 5BPFA 2J3EA 2WA1A 2PEYA 1XEFA 2O1XA 3F9RA 4TXNA 1W4AA 3DBRB 1ZNQO 5IH3A 3SR4A 4INJA 3K4PA 2GAFA 3IURA 1K8RA 4ND2A 4YDRA 4BZXA 5CW2A 2AFIB 2O8BA 1NLYA 4HAXA 3H7IA 2QTMA 3AIIA 1UJMA 4IWNA 2H31A 5KB3A 3FHCB 2BTQA 1I01A 5HDBB 4WKGA 3TZKA 2XNKA 1T5TA 4CNBA 2VZ9A 2GJKA 1GNTA 1E2LA 1X3LA 4Q4JA 2NSLA 2OXCA 4YCAA 2ZS7A 4WT7A 1L3BA 1W49A 1KF0A 1PWYE 2N75A 4Q7JB 2E89A 1A69A 3VV2A 2OO5C 5DTIA 4RZQA 3T0FA 2VPIA 3OUZA 3PLRA 4QWWA 4CGYA 3CNNA 1PK9A 2ZYDA 4J75A 5ULLA 3IKTA 3EVTA 1ECFA 2BMEA 4BVBA 1JXQA 1NW5A 1H6CA 4HG2A 4JLDA 1QOZA 2HQSA 4TWRA 4X1KA 4YBRA 4IUBS 2QP9X 1AQYA 4ZTBA 2FG5A 4LJKA 5EMJA 1Q83A 3GVHA 2QVLA 3HDYA 4U39A 2OFXA 5EFOA 2ZULA 1EHCA 4MQMA 4PIPA 3TNYA 4C43A 3DW3X 2C2XA 1JHAA 4CL8A 5BYKA 5LBTA 1LBEA 2ZSIA 3OZVA 4OHMA 3CLVA 3ILSA 3FPEA 4PIVA 3O75A 3DBLA 3GRYA 1HQDA 1BN6A 2JFQA 1DKQA 5AW2A 2ORVA 2OV3A 3OTWA 1CP3A 4OQMA 4JWKA 1RI5A 4W9NC 5BSMA 3WICA 3K2IA 4BGEA 5A9SA 1B3BA 1SO8A 2C98A 1EESA 5K8IA 1OC4A 4KYUA 4EVIA 4E6EA 4LFBB 4QEZA 4MVJH 4J49A 5F9HA 2FGKA 3FLEA 3MJDA 3MS7A 5JSZB 3I61A 2Q9UA 3MGGA 3NH9A 4MUGA 3NCTA 4RDHA 1K8XB 1VLMA 4DC1A 2DFKB 4AI6A 4B79A 3IUPA 1FUUA 1SA0B 1JB9A 3JQGA 2ZW9A 1V96A 3ESAA 1G7TA 2BHRA 1LEHA 1XB2A 2NO6A 2QTRA 2GUGA 3KD2A 1MOQA 2JANA 2EGUA 3MMSA 1FDTA 3QH4A 2VSNA 4GI3A 5F7XA 3PPVA 1DO2A 4E03A 1XGKA 4GC9A 4MRVA 3PGXA 1T5IA 2YICA 5DBHX 1PD0A 3CUWA 1GG9A 4F5WA 5D3MB 4MPRA 1AQ6A 1TF5A 2C4MA 1YZUA 2ET6A 2JAPA 4WK4B 1PDOA 5KOYA 1GCGA 3GP3A 3M83A 4BV3A 3O2SB 2J3MA 3M1AA 5FPPA 5I4CA 2I1QA 1B8NA 1YIDA 1E2HA 2WM8A 1C30B 4A0RA 3PR2B 3L6EA 4K9SA 1C1YA 2X8WA 4HRAA 1UINA 4JXKA 3MJCA 1EK0A 2CGEA 2BEWB 4CT0A 1I0IA 3GB9A 4HAWA 4C0LA 3I6YA 3CKMA 1UC4B 2PBFA 4ARZA 3O84A 3CE6A 1VECA 4Y2JA 3C45A 1P77A 3A06A 4BFUA 3V33A 3N2NA 3ELYA 4QDXA 4N3GA 2VTKA 3Q8WA 1YA6A 4K87A 3T4EA 2PUVA 3S2GA 1Q3HA 5F2NA 2EFJA 3ESYA 1NMQA 3AI1A 4Q3KA 4GNKA 4M1ZA 4BJ5A 4HVLA 3FM9A 1BFUA 1D0VA 2QTHA 2ZWPA 4GQBA 2ADOA 2IE8A 4IP0A 4GWLA 1S3GA 3T9CA 4LE0A 5IUJC 3SZRA 2GHIA 1U9ZA 5I7VA 2X4IA 3G8YA 1I80A 2YY6A 4KPFC 3TMAA 1ECBA 2G70A 3F6CA 3R6TA 3GGDA 4BP8A 3WJ2A 2CXPA 3WYFA 1D4AA 3DO5A 3H0EA 3SOZA 2C2BA 4Z9AA 3H17A 5F12A 2HRZA 1HWYA 1NDUA 1BS9A 4JBXA 1JJVA 4OJNA 4M1MA 2YY7A 3P5SA 4CG0A 4D4HA 1P2GA 3HC7A 4FYPA 4XWTA 5DNEA 2J46A 5CXQA 3IJ5A 1GDHA 4GR9A 5FL7A 5FJJA 1I7LA 4ZAZA 3OY2A 1VPWA 4B6JA 1GRNA 1Z63A 4D6PA 4GHWA 5ISMA 3NHBA 5C35A 3NRJA 2G6TA 1AVTA 1FCJA 2YZ7A 2XADA 4B83A 4X62B 1JMYA 2KW5A 3L7NA 3PKIA 3H7AA 4IKPA 4MMZB 3FKSA 4OHPA 3OEED 1U8ZA 1UK7A 1MFZA 2NACA 4V24A 3U7QB 2F64A 4J0KA 2Q1YA 2QRVA 1QIGA 4PX2A 4Y2RA 3MILA 2NU8A 1R0LA 3KT6A 1U9YA 3I04A 1QYXA 1F3LA 3OQ1A 1ZPDA 2AX4A 4LDJA 4CHTA 2FI1A 5J3JA 2C96A 2HJ9A 1XYVA 1CHDA 5A71A 2AFVA 4B0OA 1XDUA 5KNDA 1NG1A 5A04A 1N7HA 4BVHA 3WGNA 4D9MA 4L8FA 4G9EA 5AW3A 3ETEA 2FZKA 2CZCA 4D82A 5REQB 4FIDA 4ZCSA 2AZDA 3OX1A 3ZWYA 3RGGA 4HK4A 1E3JA 1V8ZA 2G08A 2WF9A 1YNOA 1QJCA 1SGWA 4TXLA 1WW8A 4ZAGA 1BQ4A 3WG9A 4B2LA 5B6PA 5DKFA 1CX9B 3GFTA 3C3DA 1WY5A 3EA4A 1RYZA 1TAGA 5GJWC 5A7FA 1Z8HA 3GFSA 3FSGA 2ZUUA 4ZVSA 1UBKS 3N2GB 2WE8A 2ZSUA 3A36A 1KMIY 1LD3A 1YOVB 5EERA 4D57A 1E2FA 3DXZA 3MW8A 3NDBB 3HXLA 5GJCA 3ZH9B 1B93A 5M04A 1SXJE 3R9KA 4YR7A 1LSOA 3CVJA 3A10A 3DT8A 2AYXA 2B30A 2ZYTX 3DGFC 1ZNYA 2VA9A 1OXMA 2BY4A 1W5BA 3HDQA 4FHCA 4NYJR 1AGNA 5BN3B 1VMKA 1I7DA 4AO8A 1K0FA 3VR2D 1M2VA 4V3CA 3WK5A 4D9IA 4FLFA 3BAFA 2ZIAA 1NMZA 5H81A 2ZRBA 3EXFA 3GG9A 2ZTVA 2BGJA 4FQ5A 1S9DA 2CE7A 4AS1A 2ZRHA 5AVRA 1RWOA 3IAM6 2CMDA 4UZEA 4DLSA 2XYVA 1Z2PX 4INOA 1P5JA 3K70C 2AFHA 5DTJA 2AZ4A 4L0MA 2AOVA 3AF3A 3U3XA 1EXWA 1AKTA 4JFAA 3O4IA 4ZU1X 5C46F 2HA7A 5JPDA 3OT4A 3V1KA 4KQEA 5JMWA 1O8BA 4KTTE 3VVCA 1TLFA 4QHTA 4R2JA 4CM5A 3TE6A 4F5ZA 1E69A 1L5QA 2Q3EA 2XUZA 3FOBA 2ZIXB 3RUHA 2YXBA 4QXPA 3UMFA 5KWSA 4K9MA 3MMPA 1JECA 1MEJA 2VYQA 3TJRA 1YFJA 3BEDA 1QQ6A 2B20A 3HE3A 1Y5LA 4PGAA 2GPNA 4ZQCB 3UHPA 3GNLA 5DO9A 4J0QA 2W2OA 5EMLA 3ZW7A 1I3KA 3QU7A 2YIVX 2YZ2A 1OLOA 1QYIA 3HBFA 1P7CA 5A4KA 5ITZB 3DT9A 4KXVA 4EKNB 3DUFA 2FEWB 3FFWA 3J7TA 1RQ2A 4KN9S 6YASA 4RA6B 4LHXA 4R3UC 5AVVA 1KBZA 3CMMA 2E4XA 4IINA 4J2HA 3E48A 4XEHA 2OFOA 4F4UA 5A4FS 2FSUA 2OT3B 4JNKA 3CW8X 3KPVA 4NG4A 3NALA 2NUTA 2Q3HA 4UTPA 4B5KA 3ND7A 1JI0A 4KAXA 1XZFA 3NHFA 4MPDA 4ALIA 2WNHA 2VDPB 3T5DA 4OLBA 1N78A 4W5OA 4FS8A 4ZODA 2BPOA 5DEOA 4C6TA 3ND8A 4CZ2A 5FWXB 3G2PA 5K09A 2HDHA 1J33A 1SB9A 2V9PA