1WMBA

Crystal structure of nad dependent d-3-hydroxybutylate dehydrogenase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
b'MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
publication title d-3-Hydroxybutyrate Dehydrogenase from Pseudomonas fragi: Molecular Cloning of the Enzyme Gene and Crystal Structure of the Enzyme
pubmed doi rcsb
source organism Pseudomonas fragi
molecule tags Oxidoreductase
total genus 92
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wmbA00
3U4HA 4CMGA 1B14A 3UICA 1WZEA 3E5MA 1ULUA 5AXDA 4GL4A 3UF0A 4YYZA 2G0TA 4RVSA 4E5MA 4FC6A 4A03A 5I9LA 4MP6A 4KDEA 1QKIA 4NK5A 3ZDFA 4B3JA 2VT3A 3GQVA 5G0UA 3PWKA 2J8ZA 4DPLA 3I4FA 4GLOA 4CQLA 1OI7A 3WIEA 4CLEA 1EVIA 1FDVA 2Y1GA 3L9WA 5CEEA 1ZSNA 1XU7A 5KVCA 5TJ9A 3EMKA 3JQFA 5BNFA 2NVUB 4PLYA 1W0CA 4AJ2A 3ZHXA 1UDCA 3HZZA 2Z5LA 1H0KA 4IDGA 2DUWA 1LSSA 3N74A 1N7GA 4DIFA 1QYDA 4MPDA 1H6CA 4XYMA 5KVSA 4XYGA 1LQUA 2GN4A 4QQRA 5DCWA 4LRSB 3GNTA 4K6CA 1Q7CA 4JBGA 1LLDA 1ORRA 4YJHB 2ZQZA 5TJHA 4XYLA 5DDIP 4DBZA 4BL5A 4FC7A 4XDZA 1GDHA 3RFXA 3K2EA 4NK4A 2YHUA 1PJCA 1WLYA 3EAGA 2X86A 4RGBA 5L4LA 5B12A 2I67A 1U4SA 3OIDA 4PVDA 2X7HA 3QVWA 4BNVA 3R3JA 5I9NA 2FPIA 1XG5A 4J4TA 4GWKA 3TFQA 5JO0A 3H7AA 1WDKA 4ALMA 4JROA 5L95A 4AJKA 3UCXA 4NR0A 1Y8QB 4ALKA 1H6BA 4JXKA 3K9QO 4MINA 3NT4A 1EFLA 2O3SA 3E9MA 1JAXA 3JD0A 4J4BA 3TZQA 4D7AA 1QYVA 1T2FA 2RHCA 4Q3NA 1UXIA 4NPCA 3I23A 5I7EA 5KKCA 1N1GA 4TMFA 4WCFB 1XSEA 3RASA 4OIMA 1PZGA 2RHRA 4CMKA 5IDYA 2NVUA 4BV9A 7MDHA 3K5PA 4BO0A 1Y7TA 5KJFA 4O0LA 3NGLA 2YY7A 2GCGA 1E3SA 4I5GA 4ZRNA 2OL4A 5F21A 3V2HA 3PI7A 3CMCO 1PEDA 1NASA 5TF4A 1KY5A 4BO3A 2VWHA 4WCFC 2GN9A 3D1LA 3F6YA 4GSKA 1R37A 2JL1A 3ASUA 4GX0A 4BO5A 1R4MB 4OKNA 2D8AA 1LLQA 1ULSA 4DLBA 4PVCA 3RFVA 1MG0A 5AOVA 2EF1A 3E03A 1A72A 1K3TA 1BHSA 2DVMA 2ZTVA 2D5CA 2CVOA 4NMHA 1NX6A 5DCUA 2YYYA 4GX5A 2AW5A 4LISA 3RC9A 5L4SA 4GVLA 1Y8QA 3KO8A 1QRRA 4AFNA 3FWZA 3VDRA 1PWZA 3WBFA 3AU8A 3PJDA 3OJ0A 2VHZA 1AE1A 1KVSA 1I5RA 1GZ4A 3B1FA 4DUPA 1PJSA 4YWJA 1K5HA 1HE2A 3UW3A 4H15A 1V0JA 4WCFA 2VNAA 3AOGA 4DIOA 5BNTA 2DKNA 4PG4A 1UR5A 4FJ0A 1G0OA 1ONNA 1AUPA 4YT2A 3TQHA 3BXXA 3AM5A 3GN1A 3D4PA 1ZSVA 1A5ZA 1YKFA 3IIEA 4ZD6A 4DREA 4EDFA 3WX0A 1ZUD1 3GUYA 2CF5A 3NT2A 3QVOA 2J3JA 4BQPA 4XYEA 2B0JA 3PP8A 3WQSB 2NWQA 4PZCA 1JDJA 5JMPA 4ALLA 4LSMA 3RJ9A 1R4MA 4UUNA 5JFOA 3DHNA 3INTA 4BNGA 2PZLA 5ICSA 3DB2A 4R3NA 5KKAA 1GPDG 4Y6SA 1O5IA 3C7DB 3LQFA 3V1TC 3T4EA 2J5KA 3KHUA 1ADGA 3BTOA 2WE7A 1U2GA 3I3OA 4BO6A 4P4LA 3PDJA 2C7GA 4ND4A 4P4GA 3BTSA 1FF9A 2VWGA 2I76A 3DZKA 1GD1O 4D41A 4L4SA 4YB8A 1HL3A 1K6XA 1HDXA 2BELA 2EKPA 1I0ZA 2X0JA 3ONDA 1IPFA 2J3KA 2A4KA 2IRWA 4MIOA 3HB4X 1IL0A 3VDQA 4BHTA 4CL3A 3CH6A 1E1LA 3BYZA 2HMUA 4A0SA 1VJTA 3DWFA 1GV1A 2X4GA 1JVSA 4PLFA 5CDSA 4WNCA 3PJGA 4ZHSA 5HWSA 3ZWOA 4TSKA 4AJEA 3QE3A 4J91A 5ENDA 1HZZA 5A9SB 1YDEA 1ZSYA 1RYEA 3LYLA 5CAEA 4DYVA 4TWRA 5CDUA 3WMWA 4J1NA 3WGTA 1L1FA 3DEYX 5KIAA 4Y67A 3UOGA 1XQ1A 3GDOA 1LDYA 4YT8A 1KY4A 1VL6A 2JFFA 1WZIA 3AY6A 5G4KA 3T7CA 1XGKA 2G76A 5F5LA 2Y68A 4S1VA 4OJNA 4L76A 3DFZA 4DTIA 1DJNA 4D45A 1NFRA 3L9XA 4MVJD 3BMOB 4NHEA 4RDHA 4BNLA 2WSBA 4DQUA 4E5KA 2R00C 1SB9A 2E4AA 2X0NA 2X8LA 4LGVA 4WASA 3RFTA 1AXEA 3GC6A 3L4SO 4A10A 4DQVA 4J1TA 2QW8A 4U8GA 3ZWCA 4HADA 3KETA 3PQEA 4YAIA 1Q0LA 3OIGA 5GZ6A 4DC0A 1LSUA 4FJ1A 5TC4A 4Z3KA 2A35A 4J2OA 3H5NA 4LW8A 3L0DA 2VYVD 1RPNA 3GK3A 3P2YA 3NDJA 4RVHA 4WEOA 1DBVO 2J5QA 3IDSA 4YACA 3QIVA 4BNJA 1UH5A 2BKAA 3GDFA 3MJ4A 4WOJA 4KDFA 4DIBA 3ROMA 1UXHA 5C37A 1ZMTA 5JMWA 5CHEA 3JQ6A 1LDEA 2V6FA 2Q2WA 5T6BA 2XAAA 2YV2A 3GHYA 1P9LA 2GNAA 3DXFA 3RKUA 4C4OA 4OSPA 5A9SA 1LC0A 1QLJA 3H5AA 3UN1A 2VRCD 5FI5A 5F1KA 4ZVVA 4E30A 3HG7A 2Y1DA 3RD5A 2R00A 3AOEC 3DFUA 4MIYA 5ILGA 3E48A 3DZHA 3ICCA 4OAQA 2E82A 3RKRA 4XIYA 2X1HA 4J7UA 1ISGA 1V3UA 4FOOA 1A7KA 3FNFA 2BF7A 4CQMB 2HCTA 4PIVA 4HNHA 4XYBA 1AXGA 4J49A 1T2AA 1ML3A 2CDCA 4HFJA 1BDBA 2C07A 1KEUA 1PGQA 2QG4A 3OHSX 1DFGA 1E7YA 3PYLA 3ZWAA 2JFHA 1E6EA 2NU6A 2XOXA 3V8BA 5IAAA 3QVSA 2Y67A 3S2IA 3C7CB 2F1KA 2ZCVA 3DBLB 5IG2A 2H1SA 3V2GA 1F14A 3EC7A 2PGDA 4QT0A 5HTOA 3FPCA 4LRTB 3HNPA 4H16A 4DVJA 5HA5A 1ID1A 1LDGA 2BRUA 4J9UE 2GYYA 3A06A 3P5SA 3VH1A 5J23A 1TT5B 1E3EA 4JJIA 1DB3A 3ETDA 3JD1A 4D3DA 2XPCA 4GX2A 3G79A 1SOVA 4NBUA 1O89A 1SPXA 2VZ8A 1JKIA 2OOSA 4YAJA 5TT1A 3AOEA 4KTTE 3ITDA 3FRJA 4R69A 1DRWA 3WGGA 3FF4A 4OGWA 5CEFA 3OIFA 1T4DA 2GUGA 5CEJA 1DFIA 4Y9DA 3GR6A 4NJMA 3DMTC 3H2SA 1U3TA 2CUKA 1PL7A 3AUSA 3PGXA 1BXZA 2QHXA 2FSSA 3FBTA 2EKLA 3PTZA 1LDNA 4CV0A 4GQAA 3CUKA 3RUFA 2EGGA 2ZQYA 5A02A 3WYEA 1TI7A 3NTQA 4OYRA 3CINA 4CQMA 4I5FA 5IZCC 3IQDB 4XEHA 4IJVA 1C0LA 4RVUA 1V8BA 4GI2A 3TN7A 3PPIA 4XJSA 5BR7A 1H94A 1MX3A 4E31A 1M75A 2PK3A 2Y93A 2AEJA 2JAHA 3GRKA 1PX0A 3WNVA 4DBVO 3JYOA 3DBLA 1HSOA 2NU8A 2H5LA 2UUOA 2HRBA 4EEXA 5DZSA 3FR8A 3GEMA 3I9JA 2J3HA 2X5OA 4O6VA 4NZ9A 2FHSA 3GAFA 3WGHA 1D7OA 3F3SA 1I10A 3DHEA 3RU9A 1HEUA 4XB1A 3VHRA 2FMUA 1TT5A 2J6IA 4AJNA 1BRMA 4Z9FA 3CZRA 4B4UA 1HDYA 2I3GA 3DMTA 4NBRA 3KXDA 4R1NA 4ZGWA 1R12A 5DN9A 2QZZA 3BHMA 4TZKA 2AMFA 1DO8A 1LEHA 1X13A 3GG2A 3GZNB 3ZW9A 2Q1TA 4PLZA 4CJXA 2HJRA 3ZV4A 2YJZA 1G0NA 5IZCA 1OFGA 3PYMA 3G3EA 4E12A 1NP3A 4IINA 2OMEA 5EJ2A 3ULKA 3EUWA 1JWAB 5C7LO 4BNTA 3MOIA 3NGXA 1HTBA 1WDMA 3HE3A 2CMDA 1N2SA 2PWZA 2JD2A 3JQCA 1DLJA 4KUHA 1P0FA 3MEQA 3JV7A 2PZJA 2YV3A 3T4XA 1UZLA 3ANMA 4KP7A 1TVEA 4MVJF 2GF2A 1DHTA 4W6ZA 3AFMA 5U4QA 5KCZA 4QFCA 4NG5A 3JTMA 4EJMA 1R66A 3MWDB 4FS3A 4RO0A 3ZHYA 4YRAA 2ZJ1A 2Q46A 4EGFA 2X9VA 1GTMA 1CEQA 4E2XA 3F4BA 3P7MA 1KBZA 2EXXA 1FDSA 1N7HA 3AY7A 4GGPA 4RVGA 1C0KA 4HFRA 1PGJA 2EJWA 1LC3A 3RBZA 3VKVA 5U1PA 3RUDA 1YH3A 3GHHA 1VJ0A 5ADHA 1P45A 1T26A 1I33A 1JQBA 4UEKA 5U9CA 1GQQA 1PS8A 2WEKA 4P4NA 4ZQBA 2P9CA 3ZCXA 4NH4A 2BLLA 2QRJA 3WSVA 3KYBA 3RUIA 4E6PA 5DT9A 3OJLA 2I99A 3F1KA 3I6QA 3NYWA 1PTJA 1YQDA 4MVJE 1R0LA 3GZNA 3IOYA 5JDIC 1NQ5A 4RPHA 4D0RA 1ZKMA 2WM3A 3S8MA 4MIEA 5KJ1A 1P1RA 2DPHA 2YQ4A 3IS3A 3OQBA 2HSDA 2VTEA 4YRDA 4OKIA 4CLOB 5I9MA 3VVCA 4AJOA 3AJRA 2Y0EA 4ND5A 5F1PA 2B37A 2GRAA 1EFKA 1GYPA 1HF3A 2GZ3A 3T7EA 1Y8RB 3DL2A 4PLHA 2PNFA 2H63A 4FFOA 2AE2A 3A9WA 2DFDA 3DTTA 4GMFA 2B4RO 4GAEA 4XQCA 1RKXA 1YVEI 2QYTA 2DTDA 1H5QA 2Y1OA 3GDGA 3UFXA 2C5AA 4FOSA 4XDYA 1LQTA 1MP0A 4IS3A 1TT7A 4XIJA 2BFPA 3DZJA 5JDIA 2LDXA 3JYLA 1QYXA 1DRVA 3ORFA 5KVQA 4BVAA 1SZJG 4B3HA 3EYWA 3PIDA 4EW6A 1G1AA 4HFMA 1LDMA 4O59O 3ZU5A 3PLRA 1J6UA 4DA9A 3VKUA 1WP4A 5TT0A 1PJQA 5ER9A 1YOVB 1A9YA 3L4BC 2O3UA 1G6KA 1QG6A 2YHIB 5TLSA 4PN3A 1PR9A 4FGSA 4I5DA 1M67A 3QWAA 3PZRA 3H8VA 4FSHA 1Z82A 3RCBA 3M1AA 2UAGA 4JK3A 4FDAA 3LT0A 2R2GA 2DT5A 2H6EA 5LC1A 2HMSA 2HDHA 5IXSA 4MP3A 3PK0A 5L53A 3BZUA 1RYDA 2DTXA 4IQ8A 3W4JA 5JYEA 1DAOA 3VPXA 1MXFA 1E5QA 4LSWA 3UHAA 3QVXA 1Y1PA 3PJEA 1B26A 3I9NA 4I9UA 3WGIA 1GCOA 4DLLA 1ZNQO 4ALNA 1MUUA 4FD3A 3ZWMA 5CPBA 4ND2A 4BO9A 4Q9NA 1S7CA 4J0FA 5KJEA 2HQ1A 3FHLA 3LF2A 2GASA 4HP8A 2JCVA 4ROSA 2VYNA 5EPOA 3SXPA 3KSDO 2PH5A 3CZMA 4ZN6A 5FWNA 2AHRA 3D4NA 4GH5A 4R51A 3C3XA 2W8ZA 2Z1MA 1QMGA 3L4BA 3A4VA 3O4RA 5C7OO 3A1NA 1Y5RA 2C5EA 2DBQA 5AQ1A 3NRCA 1VLLA 3NJ4A 4CQLB 5I7FA 4II3A 5HRUA 1I3LA 4PG6A 3FI9A 1YONA 3ENKA 2D3TA 2H9IA 4W7IA 2HKIA 1ZK3A 1YOVA 3VC7A 1IB6A 4K1LA 2YZ7A 4XR4A 2ZKLA 3O9ZA 1FK8A 4YT5A 4PGFA 3MWEB 2I3AA 2D2IA 3PRJA 5C3MA 4I08A 4PZDA 4BKQA 4MVJG 2NQ8A 4W7HA 4CM4A 2VCYA 4DLAA 4Z3DA 3HN2A 4YQZA 3M1LA 1XLTA 4J90A 4JQCA 2X0IA 3GGPA 3SC4A 4CM1A 3ZHZA 2Y99A 4M87A 1MXHA 1C14A 1HDOA 1ZK1A 2IZZA 2WWRA 1N8KA 2HJSA 2VHYA 3X2FA 1A7AA 2CY0A 3OQ1A 3VVBA 1KEPA 1NVTA 4Q3EA 4CM6A 5A3JA 4GBJA 3V2UA 3PLNA 1B0AA 2FSVA 2GO1A 3UVEA 3JQAD 1E92A 2I66A 3UUWA 1SOWA 2HO5A 3W8EA 1FDUA 5IDWA 1I32A 1E7QA 3WGZA 1P33A 4ID9A 1PZHA 2ZB4A 4XQ9A 3TPCA 1B8PA 3RQSA 4XWYA 4FN4A 4YJGA 3I83A 2O2YA 2V65A 3TSCA 1KS9A 1BXKA 5TSDA 1N92A 1YL5A 3BMQB 4E0BA 3NDRA 4MKRA 5BQFA 1JKFA 1WVGA 4RORA 3FNHA 2CSUA 3EVTA 2VUUA 3GEDA 1LX6A 3FD8A 3M2PA 4BKRA 3WICA 1HDZA 4NBVA 5EN4A 3ZV5A 1CQIA 3ZWNA 5LDHA 5DP1A 1I3NA 4E2YA 4AJ4A 2NNLD 2PR2A 4KTVE 4XGNA 2YFQA 1FMCA 4GLLA 3RWBA 1TXGA 4IBOA 8LDHA 1YB4A 4L73A 4G81A 2WD7A 1CIVA 5KOIA 4INAA 2WYUA 3E9NA 2E37A 1UP6A 2YW9A 3OMLA 1GY8A 2JAPA 3CEAA 4IDDA 1XCBA 4KUEA 3PHJA 3GZ4A 3GFGA 2B83A 4F45A 3OEYA 5BT9A 1QV6A 3I9MA 3WR5A 3ZU4A 3KUXA 2VZ0A 5CP8A 5JAIA 4MDHA 5IJZA 4PG8A 4WLNA 3ANLA 1LXCA 5A1TA 1ENYA 4BIIA 1GYRA 4Q39A 2UUPA 3H9QA 4YRBA 3H6KA 3EZYA 3I1JA 1QXSA 4RVFA 5AXAA 2RAFA 3KTDA 1EQUA 4BOYA 1YO6A 4E13A 3BMQA 2ZYGA 1T25A 3AUUA 3PGJA 1L7DA 2Q1UA 3B70A 5EINA 3BMCB 4ZQEA 3ON5A 3WS7A 5BSFA 4D3SA 3DBRB 3E6AA 1QYWA 3JQDA 3ZWWA 4LK3A 2PV7A 1FXSA 1T2DA 4DWVA 4OL9A 1U4OA 4QX6A 3DZGA 3ADOA 1E7RA 2JCYA 1DOHA 1AGNA 3H9EO 3OA2A 4QUKA 2B36A 3ZGYA 3ZN2A 3B1KA 4G5HA 4FFNA 4E3ZA 3KEOA 1X0XA 4ONEA 5JCJD 5HS4A 1Z74A 1I01A 1EBUA 1ADCA 1NFQA 2PD4A 2YUTA 3PDUA 4M86A 3ZV6A 6LDHA 1U7TA 3QQPA 5JS6A 4RPGA 1Z45A 2EV9A 2WTBA 1PL6A 1XELA 2SCUA 3JD4A 3DOCA 1DRUA 3NTRA 4G65A 3ZI0A 2P68A 1EE2A 1ENZA 3KRTA 2W98A 5JAMA 4YJFB 2NM0A 2Q1WA 5FFFA 4XQEA 3PWSA 1ZJYA 5JXWA 4EEZA 4ITUA 1ISMA 4TKMA 1PR3A 4BNWA 4PG5A 3S2FA 2IZ0A 3EDMA 4PG7A 3A14A 4JJFA 3U9LA 2HRZA 3BAZA 1HKUA 2B4QA 4U0KA 4OQYA 1EEHA 1PGPA 1SMKA 4CLXA 2O50A 3BMCA 1LRLA 3DBRA 1XIVA 3NV9A 3PFWO 4MP8A 4N5LA 2IE0A 3WJAA 1F12A 4Y98A 4CMBA 4FPXA 4QFDA 3WB9A 3GVHA 3GOHA 1T2CA 2D1YA 2V6MA 3D64A 3FNGA 4M89A 4D44A 3RI3A 3GH3A 5JW6A 4XGKA 1DFHA 3ETGA 4WECA 4BNFA 5HM8A 3QWIA 1PQPA 4CMCA 3O03A 5IN4A 4FBGA 3E5RA 2ZATA 1H9BA 4N5NA 2HU2A 4BNIA 1UAYA 2HAEA 5G4KB 4BO7A 2A9FA 4LVUA 3H9JA 4MVJA 4MOWA 4WNIA 1MGOA 4AJIA 1B3BA 2FZWA 3HDYA 3JQ9C 2DBZA 1XKQA 4U6SA 2EEZA 3F5SA 4E4YA 1OOEA 2PD6A 1T1RA 2DAPA 3OSUA 4YJFA 3U0BA 5A5FA 4J4HA 5CDYA 2O48X 1ZEJA 1YB1A 3F4LA 1BMDA 2TMGA 1ZK2A 2W90A 4O63O 3TOZA 2NV6A 3JQBC 4OM8A 1IZ9A 1WPQA 3E1KA 1H9AA 4D46A 3ZW8A 2Q99A 3OICA 5KWEA 1UDAA 1XR3A 4YVFA 4MO2A 5IZ4A 1UZNA 1ZZEA 3ONFA 3R3SA 3SVTA 4BKOA 1EK6A 4CMEC 5I8WA 4CLHA 1P1KA 3FR7A 3GY0A 3W8FA 3ZV3A 2GSDA 2VRCA 3G1TA 4O1MA 5L51A 2HMWA 3F46A 5EQDA 4EUFA 2JKVA 3OETA 1D1TA 1QYCA 1R6DA 3ZNPA 3WTCA 5A03A 3JQ9A 2O2SA 4RVDA 1LSOA 3CKYA 3VTFA 1TA4A 1UXJA 2QQ5A 4IGEA 1XEAA 1RM4A 4OO3A 1QR6A 3IAHA 4R1SA 4FQ8A 4K6FA 1WMBA 2FRDA 3UCEA 3VZQA 3AW9A 3TF5A 1LI4A 4D79A 3EGOA 5ICMA 2E6UX 4WGGA 4TKLA 3GLQA 3N7UA 1ONOA 3JQBA 4TZTA 4CODB 4Z0TA 1X15A 4UVIA 2O4UX 3VZSA 4M1QA 3C1AA 3I9LA 1CJCA 1ADBA 1N9GB 2C0CA 2P5UA 3OM9A 2QIOA 5CG1A 2I5PO 4CMEA 2O3JA 3ZWVA 2Q1SA 2ZYAA 5C7IO 1I24A 2NU9A 3LF1A 1JW9B 3D5TA 3WYCA 1LUAA 2HMTA 3I4CA 3JD2A 4ZJUA 3VTZA 4HXYA 2X5KO 1GZ3A 3OJEA 1VL0A 4LMRA 4AVYA 4Z9YA 3Q6IA 1IZ0A 1EBFA 1U3WA 4LMPA 1UXKA 2ILTA 2X23A 1PJ3A 3MJSA 4EUHA 1U8XX 4JN6B 3AM4A 3UCFA 5T67A 4XRGA 4LN1A 2DTEA 3KZVA 4N5MA 1XU9A 4IQGA 2AA3A 4U6QA 1D3AA 1GV0A 4IS2A 2PKRA 3RU7A 1CERA 2X0RA 4UUMA 3KYCA 4NJMB 2P91A 2IZ1A 4ND3A 2OFPA 1J4AA 1DIRA 1ISHA 3FN4A 3PIIA 1NAIA 4LCEA 3I5MA 3O26A 1U5AA 3ABIA 3C1OA 2B35A 3VAZA 3VPSA 5JAQA 3G49A 2ZTUA 3E8XA 1NPYA 3OA0A 4FIZA 4GWGA 3IUPA 4NFSA 4MVJH 1PZEA 4B3IA 2DFVA 3JQEA 3LC7O 1PU2A 1YE3A 4D3FA 5AVOA 5JE8A 2CF6A 3SLKA 4UUOA 5LDGA 4P8RA 2WYVA 1N9GA 4JBIA 5AYVA 4N7RA 3IUSA 5DP2A 4ILKA 5DOZA 4BS9A 4NNJA 5GZ3A 3S2GA 1SEVA 5T64A 1C0PA 3DZFA 1BVUA 3GVPA 4B8WA 1DJQA 1X7HA 3P2OA 4WCDA 1MLDA 3W4IA 4D42A 1K2WA 2YV1A 1I3KA 2QRLA 4JCOA 2PLAA 5L7WA 1EDZA 1YL7A 5F3RA 4PLPA 3GG9A 4PLCA 3DOJA 1LRKA 2IXAA 2OBNA 3AWDA 4O5OA 1X0VA 1A27A 1CDOA 1PJTA 3U4IA 1BWSA 1GR0A 5TIIA 1KVQA 1XDWA 4CM9A 4NJOA 3HB5X 3GNQA 2NUAA 4YXFA 2VT2A 5JDCC 4WK6A 5BSGA 1BTOA 3MTJA 4WLEA 1JU9A 3IJPA 4BGVA 4WLUA 4MJLA 4XD2A 3IJRA 4QO7A 4XZ3A 1MC5A 4OOEA 1Q1NA 3VPFA 3ZU2A 2UDPA 1ARZA 1Z7BA 1DXYA 3PYXA 3RUCA 3CTMA 1MB4A 5K0ZA 3UAGA 4CV3A 1P1HA 3AM3A 3AFNA 3GPDG 4UUPA 1C0IA 2DBRA 1T1SA 1ZEMA 1E3IA 1O95A 3KLMX 1J49A 2EERA 5KTKA 3C1TA 3DTYA 1KC1A 4OHUA 4URFA 5CG2A 3HHPA 1IHXA 3WMXA 1I3MA 4ALJA 1GEGA 2VOJA 3G0OA 3OJFA 1U2DA 2EGHA 1NPDA 3TZHA 1U3VA 3GGGA 3LT1A 4FCCA 2AEMA 5EERA 1BG6A 2X22A 5JDCA 3ADPA 3BHJA 3Q11A 5L9AA 3TZCA 3H5RA 1JVBA 4TROA 4YDRA 4BB5A 5KJCA 1SB8A 1B16A 1X1EA 1NYTA 5JCXA 1GEEA 2W2LA 5JC1A 1IY8A 4FJ2A 3WNQA 1UUFA 4J1QA 3FPLA 2FPPA 1VKNA 4MVJP 4NFYA 1D4FA 1O94A 3D0OA 3CIFA 1EE9A 1AHIA 3CXRA 4M49A 1S6YA 2XXJA 3PQFA 4GGOA 2NADA 3UH1A 4EYEA 2P4HX 4GMGA 3F1LA 3INRA 3HFSA 1P1IA 5EMHA 3U49A 1P44A 4ZU3A 4BGUA 5CFZA 5A4DA 5L45A 1B15A 3WFJA 3E18A 4GPD1 4L74A 4CMHA 1BDMA 3C24A 3ZNQA 2ZB8A 3M6IA 5T57A 5IDQA 3CPSA 1XHLA 1KIFA 1ZXBA 2PGJA 1M6HA 3JD3A 4NFHA 5CPFA 3QLJA 4EI2A 1DC6A 1I2BA 4U0JA 3KSZO 2J3IA 1B7GO 3PXXA 3SEFA 4CLRA 2DC1A 1UAGA 5DBGA 4FFRA 3WFIA 4CQMD 1QLHA 2P9GA 4L9RA 1I2ZA 3R0IA 5ILOA 1IUKA 3WDSA 4DXHA 1GCUA 1I36A 5DULA 3LC2O 1V35A 4BNNA 2C54A 3I52A 3IC5A 1J0XO 2A92A 1PIWA 3HFGA 2EHDA 3I6IA 3JCZA 4IDBA 3RBVA 4A5OA 1HT0A 4DGSA 1MFPA 2D5AA 3A28A 2UV8A 1HYHA 5HS6A 2WDZA 3H9GA 3K92A 4WLOA 1PGNA 3AUTA 1HSZA 4IZIA 3WXBA 4HWKA 3OBBA 4RQTA 3TWOA 3P19A 1KVUA 4NDNE 4AJJA 3MCVA 1K89A 4NBTA 1F8GA 4FW8A 3RUEA 3D3EA 2NQTA 2V6GA 3Q0EA 4MKXA 4M8SA 1VRWA 5JNLA 2X9NA 3ROPA 3SC6A 5ENVA 5AXCA 4YJDA 4E5YA 2YQ5A 1ZH8A 5MGBA 1ZFNA 1ZXLA 1E5LA 1LJ8A 1NWCA 3GVIA 2NLOA 4H3VA 2AXQA 4NI5A 5F1OA 4DMLA 2OZPA 2WD8A 3JYPA 2IDZA 1IULA 4B4OA 1KEVA 2RH8A 2OGUA 4Q3DA 1LTHR 4CUKA 4KQXA 3NX4A 2VZ9A 1R0KA 3AI3A 3COSA 1DC4A 3OECA 1YL6A 4XRRA 2AQKA 4J1SA 2GGSA 4PRKA 4CV1A 2DPGA 1LLUA 4RCVA 3TOXA 4J7CA 1U1IA 5ITVA 2ZJ0A 1YWGO 4I5EA 3W4KA 4IY1A 3TL2A 4ZRMA 2Y0DA 1Q2XA 1AN9A 2NTJA 4QEDA 2VOEA 3RROA 4RJTA 2Z1NA 2HUNA 5B4VA 5BNIA 5JO9A 1DIGA 1N5DA 3Q2KA 1D1SA 4TVOA 2WE8A 4CM4B 2FP4A 1E3JA 2D0IA 1ZO8A 1ZW1A 1MC4A 4A27A 1KVTA 4CMJA 3QHAA 2QRKA 5DF1A 3INGA 1LRJA 2RCYA 1CRWG 2CD9A 2RBEA 4JP3A 4UVEA 4YAEA 4KMSA 1A4IA 4GKVA 4N54A 1IHYA 4IPTA 4J3FA 3CE6A 3JQAA 4J0EA 3WOHA 1A9ZA 2B5VA 2GZ1A 4Q3BA 1YJQA 2P9EA 4QXMA 2JD1A 3HN7A 4AG3A 4YEDA 3WTBA 5JY1A 4IQ0A 4R54A 2JD0A 4FFLA 4K28A 3WJ7A 2D59A 3DZIA 5THKA 2VHVA 2FY8A 3ANNA 3EY4A 3JQGB 4WOKA 4ZQFA 4Z0HO 4IXWA 4RZIA 5H81A 4BV8A 1K6IA 5IXYA 1BSVA 3IP3A 1B8UA 5TQVA 3KYDB 2P2SA 4YJGB 2AG8A 2CFCA 1PQUA 3RC1A 3PWZA 1NHWA 4K26A 1YDWA 4R4JA 2E49A 3FCOA 2PGLA 2RIRA 4BO1A 1Q7GA 1VE9A 2QX7A 3ROKA 4Z9XA 2POQX 4YA6A 5A9TA 3S1LA 4A26A 4RV9A 1PJBA 4R5HA 4JP2A 1GL3A 1H6AA 2C2YA 2VHXA 2IEDA 5FI3A 4BGIA 2I9PA 1FDTA 1NFFA 1R4NA 4WJZA 4BUCA 2WD7B 3GNSA 3ROQA 5DOVA 3LLVA 1ENPA 2HK7A 3CMMA 2OXIA 5B4TA 4IDCA 4HY3A 1XWFA 1JLLA 2EP7A 4UVGA 3K30A 3GFBA 1CF2O 4R9RA 1M66A 1P3DA 7ADHA 2BGMA 1PS0A 4BB6A 3PZBA 3ENNA 4HKTA 1LLCA 3QWFA 4NBWA 4RLSA 3E82A 5L4NA 1E7WA 3AI1A 4IDEA 3JQGA 1EK5A 3F9IA 2B69A 4WPGA 5T8KC 4BQRA 4DYDA 3VZPA 3KYDA 3BHIA 4YBZA 5EQFA 3ZU3A 1NAHA 2R6JA 4KWHA 4JBHA 4DMMA 2JCXA 3K8ZA 3HJAA 1RM3A 2VYND 4F3YA 2DM6A 2YDYA 1OZAA 5G0SA 3PHLA 5ITWA 1E7SA 3OH8A 4Q3AA 3H9UA 1VM6A 1ONPA 1Z6ZA 1ZVMA 3WGOA 1JTVA 5FEUA 5A05A 4J9VA 1TLTA 3ZWYA 3NEPX 4CM5A 4R1UA 2WJPA 1E77A 4XJTA 4ZA2A 5G0VA 1B8VA 2NTNA 2Q50A 2Y1EA 5KJ6A 1A4UA 3OP4A 3QWHA 2YDXA 3PEFA 2NSDA 3JQ8A 3HSKA 5JCJA 3PHIA 1WAMA 3ZHBA 3TNLA 1V6AA 3H3JA 3LK7A 4TQGA 4CL8A 1KC3A 4BMNA 1CETA 3U62A 2PKQP 1HE3A 1IE3A 2AG5A 2WMDA 5A9RA 2EKQA 5T8KA 2JJYA 2X5JO 1ZK4A 3HWRA 4IGFA 4UREA 3GVXA 4YCAA 5JLAA 1W6UA 2GZ2A 2O7SA 3QJ5A 3TZKA 5TS3A 1CYDA 2Y1CA 1KOLA 4BNHA 4MKZA 1UP7A 2DBVO 2VUSA 3EHEA 5MDHA 3EVNA 4HFNA 4BNZA 1GQYA 2X9GA 3KBOA 4DL9A 5JPIA 4Z6KA 1R15A 2YFHA 3G1UA 3BTVA 4Q3CA 1DC5A 2OO5A 5IFLA 5JC8A 2DU8A 9LDTA 4M55A 4R41A 4E32A 2FWMX 3H4VA 5K6AC 2UYYA 1UXGA 2ZIZA 4PCVA 3H2ZA 1LA2A 5JYDA 2Z95A 2Q49A 1ADFA 4II2A 3KEQA 1YBAA 3DC2A 1EUCA 4C7KA 3DO5A 4IJUA 1X1TA 4YTEA 5COBA 4LVCA 3Q9UA 3U4DA 4RF2A 5BSHA 3UKOA 3GUCA 1EZ4A 1Y5MA 2OP1A 1YBVA 2O23A 5CDTA 1HRDA 2GPTA 1CWUA 4IUYA 5ER6A 1T24A 3IL2A 5G4LA 3LSYA 2G17A 2LDBA 3K6JA 3FSRA 4XB2A 2C82A 1GQ2A 4BMVA 1M76A 2EW2A 4GKBA 3W1VA 1BVRA 3NT5A 1U8FO 3AI2A 1P31A 1U28A 1HYEA 4R9SA 1U3UA 4YJHA 3AK4A 3WLEA 2GDZA 1NVGA 4KQWA 1XA0A 4U5QA 1EQ2A 5L3ZA 3ICPA 5DBFA 3STHA 4B79A 1GZ6A 1X7GA 2PTGA 4X54A 5LCXA 4RZHA 5G2OA 5K6AA 2NU7A 2I6TA 1SAYA 4ND1A 4PZEA 3U5TA 4QECA 1YJ8A 3DAFA 1MFZA 4R3WA 1DHRA 3OEWA 3LVFO 3QW2A 4I9NA 3SX2A 2EG9A 1B2LA 1GADO 3JYQA 5GMOA 4IXTA 4E21A 4XQGA 1QP8A 3QRWA 4ZQHA 4EJ6A 2ZB3A 1VKOA 3ZWPA 4RF3A 2ZK7A 4EITA 4YQYA 2W2KB 4HUJA 2AQHA 4LCJA 3N58A 4JJGA 1YXMA 2O4CA 4QSMA 3WSWA 1NVMB 2GN6A 2I65A 2PD3A 3MJTA 4I8XA 4W4TA 2FR0A 4H7PA 4E33A 2VUTA 1M6WA 8ADHA 3OFSA 3WIDA 4Y6PA 4P38A 4RQUA 4BNXA 3FBGA 1W4ZA 1ZJZA 1E1NA 1JAYA 5COQA 3RJ5A 1HWYA 2BMAA 3ETEA 1TEHA 2W4QA 1X14A 4UVDA 4BO2A 1KYQA 1P1JA 1VSVA 3HADA 3NUGA 5C5IA 3KVOA 1WWKA 2BFMA 2GR9A 1YS4A 4KWIA 3U3XA 3IKVA 3D3WB 2EJVA 4OXNA 3VH2A 2NVWA 3L07A 4XKJA 1RJWA 1W8DA 4NU5A 4PLTA 2VYVA 4GSLA 4ZICA 1MA0A 1CQJA 2Y1FA 4F46A 1Z7EA 1DSSG 1JKJA 4R01A 3RUAA 1NTOA 1E7MA 1HDGO 4RL6A 6ADHA 2ZTMA 2NVBA 4CM3A 1NR1A 1R0SA 5F5NA 1HLPA 3HQ4O 4I1IA 1NQOA 1KVRA 2BFAA 4D43A 4BMSA 1IYZA 5GZ1A 5L40A 5I7VA 5B4UA 3F47A 3NKLA 3JSAA 2C29D 3ASVA 4JGBA 2W2KA 3TZ6A 1NR7A 4CUJA 3GAZA 2GERA 2G82A 2O7QA 3KYCB 5G0TA 3RVDA 1T4BA 1Y9EA 2WYWA 4AL4A 4YPOA 5I8ZA 4B4VA 5ES3A 1DLIA 1JWBB 3DONA 4EUEA 4TRNA 3MJCA 5IF3A 3V1YA 4OQZA 4CR6A 4F6CA 2FPGA 1OC4A 4MVJI 1DAPA 5K9ZA 1UZMA 1IPEA 1F06A 4C7JA 3TFOA 4J2HA 1EVZA 5IDXA 4EBFA 4L0QA 1GUZA 4RPLA 1HETA 3D3WA 3GVCA 1PL8A 3KB6A 1PJ4A 1OC2A 4RF4A 4W99A 4P22A 2O3TA 1ISFA 5TX7A 3I9KA 3HDQA 3WYBA 1RM0A 1MG5A 1P0CA 1NQAO 3OQ6A 4XCVA 5TGDA 2GLXA 4AJHA 2ZCUA 3H65A 4G2NA 1O6ZA 3DAGA 3LDHA 4IJKA 2FR8A 3ZNNA 4BO4A 5EL0A 5JBIA 1B3RA 3VH3A 1DIBA 1RWBA 3KLPX 3DHYA 3QSGA 1QV7A 4W82A 3FTNA 3ONEA 4B4WA 1C1DB 1R16A 3BTUA 1E6WA 3EW7A 3Q2IA 3QV1A 1Z73A 2BI7A 1F8FA 3IKTA 3RAJA 3LU1A 4IIVA 2AE1A 1OAAA 1YB5A 3MJEA 4NIMA 3KOUA 1HE5A 3QP9A 5FF9A 1VSUA 4CM8B 1PSDA 4N18A 3ZZNA 4L75A 4DRYA 2FR1A 1K6JA 1ZCJA 2F00A 3HDJA 3PFFA 5COAA 2IEBA 3BA1A 3GA0A 4J16A 1KETA 1VC2A 3D4OA 3F5QA 3I9OA 3FWNA 1NM5A 1WXDA 4AJ1A 1E1MA 4PRLA 3UGKA 3WGYA 1U7HA 5KVVA 2AEFA 4XGIA 1EVYA 3DAPA 1LNQA 1J5PA 4CLDA 4UEOA 1YQXA 1AHHA 2P4QA 3C7AA 1ZK0A 1QSGA 4GX1A 4M54A 1E3WB 3EK2A 1PS9A 1HLDA 4Y6RA 4DQXA 1Z75A 4KZPA 2VHWA 3BMOA 4CM7A 1Y81A 1W73A 4U7WA 2C20A 2O3RA 1NHGA 2ZB7A 3WLFA 1OMOA 4IIUA 4RDIA 1OBFO 2AQ8A 1HXHA 2QYSA 3VH4A 4FFMA 1C1DA 3NTOA 5HBRA 4XR9A 5I7SA 4K9DA 3RUHA 4DC1A 1HYGA 3GF4A 4EZBA 1VPDA 1QORA 1EDOA 4J6FA 4F6LA 2HK8A 5BSEA 1V3VA 1FJHA 1ISJA 1VL8A 4S3MA 4OOFA 4CM8A 2P5YA 1HZJA 2DQ4A 4XA8A 2GD1O 4CMAA 2BHLA 4R5MA 4FB5A 3L6OO 2Q4EA 4A73A 4BKUA 1WW8A 1GFSA 3L6DA 1SCUA 1LSJA 1PZFA 2D4AA 2PY6A 4OMUA 1DIHA 1H2HA 4CR8A 5JSFA 1UJMA 3LZ6A 1IOLA 5KNLA 1E0DA 2V6BA 4PLWA 4TRRA 2FZEA 2C7VA 4OSOA 1WDLA 4QTZA 1E3WA 3U09A 2BD0A 4UVHA 5IN5A 3B1JA 1U5CA 3KSUA 4L4RA 4FFPA 1BW9B 1I2CA 2DUUA 2X58A 3TDKA 3LT4A 4CLRB 3K31A 3PVZA 4R16A 3SJUA 3WBBA 3PJFA 3Q1LA 1C1XB 2OORA 3K73O 3R6DA 4JNKA 3V1UA 1I30A 1RM5A 3TRIA 3L77A 4PLGA 3VOSA 4E2WA 2IYOA 1X7DA 4AJLA 2CNBA 5AXBA 3KM0A 3QA9A 4TRJA 1MV8A 1DC3A 5L7TA 3BIOA 3RC2A 1EVJA 1V9LA 3HDHA 1HDRA 3D7LA 4R68A 5B1YA 2JHFA 1JA9A 2XF8A 4UEJA 3NAQA 2PA3A 1ISIA 5L7YA 3DMYA 1LDBA 1Q7BA 4WE3A 4YAGA 4IDFA 1WMAA 3H3FA 3R1IA 4BNYA 3S55A 3DR3A 1DDOA 4B7UA 3WG9A 3GN2A 1NNUA 2VQ3A 2VRBA 3HUDA 2AQIA 3RC7A 3S2EA 2O3QA 3MJVA 2Q2VA 4L8VA 3LLSA 4IMPA 5B37A 1F17A 1GUYA 4CM9D 5A5EA 1ENOA 4JIGA 3ZH2A 2FN7A 3D5QA 1BW9A 1YBMA 3JQ7B 1BXGB 2VTDA 1E1KA 3QWBA 2Q4BA 3W6UA 1C1XA 2ZYDA 3ZWXA 5EESA 1K0UA 4YT4A 2G5CA 3B6ZA 2BI8A 5JAZA 4AICA 2IXBA 4WUVA 4RLHA 2FOIA 4OXKA 1PQWA 4D0SA 3IMFA 3OJOA 4JLWA 5CDGA 1GU7A 1FDWA 3FNEA 3GT0A 2HK9A 3RBXA 3BMNB 4B7CA 3PQDA 2Y05A 2PZMA 4NQZA 1PWXA 5G0WA 4BNMA 2G1UA 1H6DA 2RH4A 4TRMA 4B8ZA 1M2WA 1E6UA 4IDAA 1PJ2A 1DPGA 3L6EA 3Q3CA 3SLGA 2JHGA 2B4TO 4UULA 1YQGA 3QVTA 1XYGA 3B20A 3K2BA 5EIOA 1LBEA 2VN8A 2J5RA 2ZTLA 2GN8A 4JX8A 4CUZA 4CR7A 3E9QA 2E48A 4WKGA 4EJ0A 1DEHA 1O9BA 4YR9A 1D8AA 1E3LA 1XQ6A 4GVXA 3UXYA 2OUIA 2W2LD 1PGOA 1KERA 3JQAB 3GGOA 3WQQA 1Q0QA 2Q3EA 4PFJA 4ALIA 3AU9A 4CPDA 4TVBA 1T2EA 1N1EA 2EIHA 1Q0HA 3RIHA 1NBOA 3CSDA 3JQ7A 1BXGA 2TMDA 3M2TA 4OXYA 5A06A 2PH3A 4R1TA 1YRLA 1BGVA 2BFOA 5TRTA 1NQTA 1WNTA 1YGYA 3ST7A 3TJRA 1SEPA 4WEQA 1KEWA 2HLPA 1L7EA 2PKQO 5H83A 4BGEA 1DIAA 1SC6A 1ZMOA 2CZCA 2IYPA 1LU9A 1VI2A 4CMIB 4HX5A 1NXQA 2Y0CA 3BMNA 3DZBA 4BO8A 3VPGA 3Q9NA 1GPJA 4RF5A 4ZQGA 4AJPA 1A71A 3GPIA 4IM7A 1P1FA 4KUGA 1TB4A 2X6TA 1O8CA 3WQRA 5A04A 3AY3A 2NACA 3O38A 1U9JA 4ESOA 4KOAA 3VZRA 1GYQA 4NU6A 3ZNOA 3X2EA 4RPKA 1NWHA 4UAGA 4HV4A 2IODA 3WGQA 3SJ7A 1HDCA 3DBHB 4J43A 3FTPA 3WWZA 3RSHA 1R4NB 4L4XA 1EUZA 4XX0A 5DCYA 3G17A 4W9NC 3KV3O 4DPMA 3NJ8A 1I8TA 3QY9A 3O8QB 2C59A 2OP0A 9LDBA 3EZLA 4Y8VA 1SO8A 2CVZA 1GUFA 4A7PA 4DPKA 4QO8A 1SNYA 4B7XA 4E5NA 4E5PA 4CLOA 3JYNA 1VJ1A 1O0SA 1P77A 2VNSA 5T5QA 1C3VA 1P74A 2OBYA 3W6ZA 4RPJA 3C85A 2BGLA 2ET6A 2CVQA 3DDNA 3NDIA 3LC1O 2EW8A 3MZ0A 3GRPA 2EP5A 4IJWA 1H2BA 1Y8RA 2BH9A 5DBIA 1UP4A 5A3VA 3ZWBA 3DOOA 3LT2A 2B5WA 1Y9AA 2HMVA 1EMDA 4HBGA 1PJLA 5H82A 4CMIA 2DLDA 4IMRA 3MTGA 4HNGA 1HE4A 4FGWA 5JY6A 4WLVA 3AUAA 4J7XA 1UDBA 3MOGA 2A94A 2Q45A 1NPTO 3K96A 2VWPA 3PHGA 1Y6JA 4PLVA 3V5NA 3VPHA 3IP1A 2V7PA 1EUDA 2Q2QA 3PHHA 3ITKA 1SBYA 2Y66A 4YAKA 4Z0PA 4W9NA 2UVDA 4IZHA 1H93A 4FR5A 5FYDA 1F0YA 3WWYA 3GMDA 5THQA 2NTVA 1V3TA 2VWQA 3DBHA 2BGKA 4OH1A 2PZKA 3JQ8B 2YHIA 3C8MA 2C2XA 5TNXA 1ZIDA 3DBVO 1JN0A 3TL3A 3SBOA 1ZBQA 5DNAA 4CV2A 2OHXA 5GY7A 3U4CA 3O8QA 3W8DA 4BKPA 3GMSA 4BNUA 4MVJM 3JQFC 4A2CA 2XXBA 4BNKA 2CDBA 3DQPA 4WLFA 2EWMA 3GEGA 2PFGA 4E2ZA 3OF2A 2JFGA 4I9HA 1GAEO 2CDAA 2QZ9A
chains in the Genus database with same CATH superfamily
4HEA6 3K35A 3SZLA 1B14A 3ENWA 3SZGA 4L0MA 4NYMQ 5AICA 3UICA 3P97A 2VPIA 3F2VA 1HEIA 3GAMA 3U26A 2R0QC 4RZUA 4GL4A 1YZQA 3MS2A 1EK1A 3FFBA 4DQKA 1UKZA 3KZKA 4S04A 3BFVA 4A03A 2CCKA 4GP6A 3LJKA 1OT5A 4B1FA 2RH9B 3PRKE 2D74A 5I9LA 2NT3A 2PU7A 1YB6A 2E4VA 2ZU6A 1KMMA 4UBKA 3LD9A 4RZQA 3FNRA 4UXHA 5BRAA 5BO5A 4NZPA 1XQXA 2J8ZA 1N5LA 1O5TA 3PQCA 5TVKA 5AW4A 4GLOA 2JJ2D 3TLYA 4FBMA 2VDPB 3EEOA 3CE9A 1Y3IA 1DBPA 2A30A 1DJLA 1FDVA 3BGOS 3ZE7A 3PC6A 2VF7A 3EBLA 5KVCA 4Q5IA 5FTWA 4C29A 3EMKA 1RJDA 2FQYA 1EWRA 2PSFA 4XPIA 3JQFA 5BNFA 2NVUB 4Y2RA 4AJ2A 3RKSA 1SBTA 2Q4OA 1ZVVA 1OYWA 3HZZA 2O8CB 1H0KA 3FAZA 3RVSA 3B7PA 5ICEA 2ZIFA 4EVSA 5KYYA 1TJ4A 1XLUA 4XVQA 3TGLA 5LQMA 1XL1A 4JBYA 1M7BA 2VRWA 1T9CA 3HZRA 4DSZA 1QYDA 4MPDA 4F5DA 1TW3A 1BWRA 3JVDA 3CEPB 3PGKA 3W8NA 3AILA 3AX6A 2AFIA 3IQIX 1KI4A 3WJ1A 5JXJA 3QHQA 1PQYA 3GNTA 1XQYA 4JBGA 1ORRA 4W5JA 1E94E 4MYSA 4DBZA 1ORHA 3DAYA 4XDZA 2YZNA 3K2EA 1G5PA 3U3RA 2FK8A 2FCRA 3W6OA 1WLYA 3EAGA 4RGBA 4GDMA 2GBFA 3GNLA 4TTQA 1NJSA 3AIOA 1U4SA 3V7FA 3FZEA 3D0RA 1VPEA 2H57A 2XA1A 1U1GA 1W2WB 3E9EA 1SHZA 3QVWA 4KQHA 2VDUE 1WIWA 3BGWA 3GFVA 2QSZA 3K0BA 4J4TA 1IBCA 1RRPA 1WDKA 3VMFA 1UFOA 2H52A 4JROA 1DV2A 2H4ZA 2CJWB 2HJ9A 2QTVB 2RDMA 3RTEA 3F3YA 4LY6A 1J2YA 4L1KA 3ESBA 3SKVA 5A3QA 1E18A 1SBCA 4IV0A 3FYCA 3MW8A 1E60A 1GRQA 3KOZA 4JYPA 1I7SB 5LZ8A 3QX8A 1KO7A 3BCHA 3TG2A 4FDUA 5JJIA 4O4IB 1QIIA 2FPRA 4AYXA 3TZQA 1OAOC 4KVGA 3ZCSA 4Y6LA 4NPCA 1NQVA 2ID4A 3BFPA 2WWXA 3CTPA 2XSZD 2ZR8A 1AUOA 3CNOA 4TMFA 4GICA 4WCFB 4X3PA 4B3RB 4CMKA 5IDYA 5LR6A 4XLZA 5C18A 1YRBA 1RFLA 3NVDA 1Q3HA 2NV2B 3T9BA 1F2TB 4V0LA 3MMXA 4O0LA 2D0PB 1TOAA 3Q98A 3G6WA 4ZRNA 3ZWDA 2RKBA 1NASA 1Y3AA 4XDHA 4IVPA 1QAQA 5TF4A 3BAFA 2OG2A 3AEUA 3JZIA 4MAFA 4OA5A 4PNEA 3F6YA 1EJ2A 1W2HA 1U8CB 3BJRA 1L7RA 3DDWA 2BT4A 3ND5A 4RIFA 2XA9A 4BO5A 2XD4A 4LJRA 4URHA 4AP5A 2V8OA 1R4MB 4DIKA 5K3OA 4LOJA 1WSDA 1OF1A 2D8AA 5JR3A 5ELXA 2PRSA 4BEVA 1FTNA 1RBMA 3UMRA 5JD5A 5AVRA 1YR2A 4P3KA 3E03A 3TW0A 6GPBA 2CNWA 2XRFA 2D4HA 1K3TA 2FF7A 4CN8A 3GRRA 3EZFA 3KSAC 1J2EA 3I37X 2P0EA 4A2WA 3PL1A 2WTAA 3DVAA 2X0KA 4MWEA 5DYIA 1F1JA 1N5MA 4LE1A 1ZQ9A 1ZXXA 2KMLA 1F4PA 2DKFA 2VATA 4RUKA 3TS1A 3VR4D 2GYWA 4IHJA 1G20E 1VYUA 1MIOA 1KHTA 3O4HA 3P0HA 1MAVA 3SJZA 3P45A 2NPFA 4F21A 1DQNA 3SSMA 1NMEA 4RTSA 1KVSA 4JSRA 3KQOA 2O0JA 4N1AA 1T9GR 5KSPA 2WP0A 5EJ9A 2WBLC 1J39A 1PJSA 4KIUA 2IYUA 4YWJA 1TX4B 4L57A 1NLYA 1B2RA 3AOGA 1VB5A 5CDFA 1PR4A 2II6A 1IN6A 2L0XA 3GA5A 5BNTA 3G8BA 3IJEB 3Q7PA 1DVRA 4PWYA 1ONNA 1XNJA 1AUPA 4QWMA 5HCNA 3WB1A 4RTPA 1UM9B 4YREA 3AM5A 3DDZX 5IUJC 1YKFA 1U7PA 4EDFA 4V1CI 2CF5A 3N0XA 4NXNB 3GELA 1MPTA 5F98A 4TMKA 4P84A 3F98A 3DMGA 2QF7A 3WQSB 1KA9H 3K0SA 4QATA 5CLJA 2FPKA 1ND6A 2BKXA 2RHDA 4OJKA 4G0WA 2WG2A 2PV0A 2QI9C 4NDZA 4NF2A 3AKCA 4FCWA 3UT0A 4NV3A 5JFOA 3RYCB 4N01A 4D9JA 2WTUA 3N0VA 1VRCA 3DUFB 2IV3A 5EE9A 1Q14A 5A1JA 3GGJA 3G0IA 2PH1A 4R3NA 3QSYA 4G1VA 2X2OA 4ZO8A 3QU7A 5KKAA 3WDLA 1UFRA 4PU0A 2QUAA 3WISA 1SUPA 4TM8A 1O5IA 3EGXB 3C7DB 4KQ6A 1R8XA 2P5TB 5T4EA 3O8RA 1QK4A 2CLFB 2GPAA 5FFMA 1VA4A 1BDHA 4MLCA 3HGQA 4NTZA 2EJCA 3KHUA 3LX6A 4QU5A 3QKSA 2WE7A 4KPUA 3M7IA 4R8RA 3EY9A 4TPKA 2NYVA 5DNDA 1TQDA 2C7GA 4ND4A 4QUGA 3BTSA 2JA1A 4Z86A 2NIPA 2PWBA 4DMUB 2NYUA 2JH9A 2OZVA 1JEQB 1NE7A 2I76A 4IQFA 1HL3A 1XX6A 4GXNA 1K6XA 2QSUA 4U3JB 1HDXA 1W2GA 3PEEA 3OPYI 4R40A 2BW0A 3MJFA 2X0JA 2E87A 5EIWA 2OILA 3ONDA 1C1YA 1COZA 4K03A 1JKMA 1P5ZB 2IRWA 3HB4X 3PUWA 4WKOA 3VDQA 3BD8A 3ZU6A 4AY5A 4BHTA 4ERXA 3WAKA 1N25A 4R1QA 3BILA 1Q3KA 4I8IA 3GBVA 2HMUA 4WX2B 1YDHA 2IHVA 3T1HB 1YIAA 3DWFA 1QZ3A 1GV1A 2ZBUA 2X4GA 3VVMA 4PLFA 1EM8B 1N2OA 1PG0A 2ZJYA 3PJGA 4WNCA 4CQJA 4CTOA 3ND6A 2D1TA 2NUTA 1UPUA 1NT4A 3LXMA 4G4GA 3QE3A 2R1TB 4TSKA 4J91A 2G07A 4A91A 4A3SA 3LYLA 5CAEA 2VAVA 4DYVA 4TWRA 3M82A 4L3WA 5KIAA 3KQUA 3V7NA 3UOGA 1AKVA 3ORYA 4FNGA 4JXXA 3BCSA 4OQQA 1P8AA 1VL6A 4M6WB 4B6OA 5B2EA 2OZEA 221PA 3EWIA 3GD7A 4I1YA 4OHZA 3QYPA 1WP9A 4OJNA 1B41A 4C08A 1WOYA 1IBMB 4DTIA 2E4ZA 3ES9A 4OI0A 2FI1A 3BMOB 3VOTA 2DEUA 4HGRA 2J5BA 3P0RA 4ACBA 4HB2A 3VZDA 4KO3S 4NWIA 2BCEA 2GA8A 3KCQA 4BQOA 2QD2A 1Z83A 4WASA 1P2FA 2AOTA 1AXEA 3GC6A 3WC4A 2FFQA 4J1TA 1S3GA 2QW8A 4RDCA 4U8GA 1PT8A 4WCVA 3WLMA 3KETA 1YDGA 3FMFA 3PQEA 4YAIA 3IBGA 3UJNA 4A6DA 2VDJA 1LSUA 1PR1A 4C0AC 4IYJA 1R0XA 3PQ6A 4LW8A 5LOVA 5FV7A 2O8VA 3QVMA 1NV8A 1XTSA 2QTAA 3BJEA 2B2NA 3NDJA 1MJ5A 1Z4KA 3P2YA 1MF7A 3IDSA 4HNRA 3LX8A 3QIVA 1P0QA 3HCFA 4OQXA 3RSCA 4BNJA 5E6UA 3DNMA 2A8YA 3M4YA 4EJSB 3Q0TA 2CFRA 5CHEA 3Q8KA 3JQ6A 1NMXA 4FCTA 4MYUA 4QYMA 2V6FA 2XCIA 4LE0A 3EZ6A 4TWZA 4BFTA 1AO0A 2WQ7A 3V4ZA 4DQ0A 2XAAA 3KWFA 5IULC 4FYXA 1R88A 4LNUB 5IBPA 2AFHA 4OSPA 3V8MA 3WADA 4MV1A 4P36A 4YLGA 5DGDA 3ANSA 5IABA 2H07A 2VRCD 3K1YA 2ZJ6A 3AESB 1P7WA 5FI5A 3MTEA 2PSEA 4XB6B 2ADFA 3PFGA 2R00A 3DFUA 4RYLA 2PJRA 1GLVA 1P19A 4K40A 4X8MA 3X1MA 4R2JA 1ZMRA 3ICCA 3TD6A 5IM4A 2J9RA 4KXLA 2E82A 3IOCA 4OAQA 5JPDA 4DIUA 4OJTA 5M3BA 1LVHA 3A1TA 4J7UA 1ZVJA 1O2DA 5JRDS 2ZI9A 1L4LA 2W6CX 3CLVA 4FDLA 1A7KA 5DGCA 2BF7A 3U48A 1KI8A 4EHLA 4QTYA 4XYBA 3DV0A 4KPEC 1C7QA 2SHKA 2CDCA 3HP4A 4V03A 2C07A 2ZXEA 1JAZA 4HDQB 1XFAA 4NZYA 5ERYA 5BN3A 1VHJA 1DFGA 4MI3A 1E7YA 1XTIA 3FIJA 3P20A 3ML1A 1B0UA 4L5JA 1NYLA 1E6EA 4ZAVA 3USES 2NU6A 4NAVA 1U0JA 2XOXA 3CF4G 4E1BA 3V8BA 1R8YA 2ZCVA 4MVYA 2QTFA 4QREA 2NU8B 3UB2A 3V3TA 3GJRA 2PGDA 3W9UA 4PTLA 2AVNA 1EGAA 3FPCA 3QUBA 4LRUA 2NUPB 4H16A 1HFKA 1XTUA 5HA5A 4KGXA 2WQZA 3QBEA 2B8NA 4J9UE 3A06A 3P5SA 1YULA 3FSJX 3I6YA 4OMDA 4R9VA 4DT1B 4JJIA 2OCPA 4D3DA 1S01A 1DWUA 2XPCA 5J2UA 4TKZA 1CT9A 1SOVA 3A1VA 1JF8A 1SPXA 2HJGA 3G79A 2WNHA 1X70A 4MEBA 4YDSA 2C2ZA 2YBEA 4ZVUA 3ER8A 1E32A 4IIHA 3B1YA 1H2XA 2WPDD 1DRWA 2A1UB 5G1NA 4RSGA 5FO1A 2ZRBA 1DU4A 1T4DA 2GUGA 4N0MA 4DCSA 2CZGA 4D0LB 2ECQA 1G4AE 3ETNA 3DMTC 1L7MA 5E8RA 1Q2UA 2Y92A 1I7NA 3FBTA 3SQLA 3VXKA 2HIAA 1RI1A 3M49A 3NRBA 3R6GA 3ESCA 4JI0B 5AVQA 2YCBA 4M4SA 3WYEA 4P6VF 4DMHA 1D07A 1FUIA 2B3DA 3ETHA 4CQMA 5IZCC 3Q7EA 4L22A 4UQPA 2AGVA 1FX0B 3IQGX 4FEYA 4RVUA 1P5JA 1WD7A 2O52A 4EYOA 2RBKA 4WBNF 3L1KA 2EZ8A 3L82B 1LFDB 4RDXA 3KAQA 4QYIA 2AN5A 5JH7A 3P9QA 2AEJA 2JJMA 2JAHA 2QTBA 3K9LA 2PX4A 3GRKA 3PD0A 4IXMA 4JXZA 4EYQA 1K7SN 2J4CA 3FHCB 5FLYA 4ZMRA 3DBLA 2UZ1B 3R3VA 2HRBA 4EEXA 1JYSA 5DZSA 3FR8A 3GEMA 3I9JA 2C4KA 2INGX 2KSQA 3D1VA 4U7TB 1Q0SA 2QRUA 3GAFA 2OR3A 1VJDA 3TUJC 5BPFA 3DHEA 5D3QA 5H02A 1A9TA 1HEUA 3VHRA 2G5TA 1TT5A 4AJNA 4RL4A 2Z6AA 1BRMA 3TJMA 4R9NA 4G1MB 4PYOA 3CZRA 1Q17A 3DKPA 4B4UA 3SJAA 4ZK6A 1TYZA 4YRLA 1R12A 4OGKA 1HURA 4O4JF 4POAA 4RSRA 4EQZA 5LU8A 5K3DA 3RWMB 3UG6A 5DN9A 5JNWA 1I13A 4TZKA 2KWIA 5EHZA 1XMJA 3JZDA 4MR9A 3A58B 2YFYA 2F8LA 1XOIA 2HJRA 5H3LA 1G0NA 4EL0A 4QVKA 2IUSA 3ZHCA 1NW4A 4RCZA 1NP3A 4MPJA 4L0DA 3R0ZA 2WJJA 3E53A 2OMEA 4EB6B 4F7DA 1FDIA 3Q7TA 4IIYA 3HXQA 4HAZA 1ZAYA 5C7LO 4BNTA 3MOIA 1PTJC 3NGXA 4CEIA 1HTBA 1WDMA 1SELA 1GXSA 2XQGA 5SICE 3EGWA 3M6AA 3PNQA 4B09A 5KNDH 1P62B 4BMOB 2ROQA 4MGHA 4PY2A 2PZJA 2X6RA 3DEFA 4JDPA 4L3OA 4LC1A 4PM4A 5FFNA 3F5MA 3ANMA 1TVEA 3M5CA 1DEKA 2I9KA 1JHPA 1ZM7A 1DHTA 4R81A 5CA0A 3KR0A 4QFCA 2NSJA 4EJMA 2E5FA 3FH0A 2XQVA 3MWDB 4RO0A 1Z2AA 2C2MA 5EJEA 2Q46A 4EGFA 3L8FA 3RTBA 5KQGA 3H1AA 2BEJA 3OY2A 5TPWB 1M2EA 3L7OA 3SJCA 3UMYA 5BUSA 1JQLB 4RSMA 3P7MA 2A0UA 1N7HA 2UZAA 3AY7A 1YMUA 4N0PA 3ROFA 3WP1B 4HFRA 4KBGA 3VKVA 3D81A 3EFEA 2FWIA 3MBKA 2I1VB 4KSCA 2GXQA 2Q4TA 3GHHA 5U1PA 1I33A 2WMYA 4UEKA 5U9CA 1JE0A 1NJ2A 3ZHSA 2P9CA 4FD2A 4FXPA 4NAHA 4X8HA 5LL6P 1ECGA 3IKLA 2E1PA 2VPZA 5DT9A 4LXQA 3HA7A 5EYPB 4ZYWA 2YXBA 5EIEA 5JFTA 1UDRA 5G02A 3D8NA 1KKLA 5TQ2A 4IO0A 3FVVA 4DMKA 2YWXA 4MVJE 1NLMA 2C5BA 4OJQA 4V0RA 3S5UA 5DHQA 2JGDA 1X9IA 2PX8A 3I9V1 5GONB 2WYOA 3KL4A 1ZKMA 2D0OB 5AI5A 3KG2A 1DXQA 1S8OA 3T12A 4EW2A 3U7IA 2E4UA 2X1LA 3HBNA 4Z51A 1J2RA 3ABZA 5LFAA 2DPHA 2HYDA 1IIBA 3NNDA 4HDMA 1FYWA 3T7AA 2ZIXB 1QVZA 1C9KA 4RHCA 1KI7A 4LS3A 1M2VA 2CFTA 2JNWA 4I6GA 4MGYR 1REQB 5I9MA 2FEWB 4ZKEA 3F3MA 1W0JA 2J3LA 4M9UA 3DPUA 2MSLA 4WVLA 1TQHA 3LYUA 1NBAA 4MDEA 5KYKA 1ZM2A 5ETJA 1EFKA 1GYPA 2J9YB 3SOZA 4TSRA 4UBIA 3FY4A 3D43A 4LHXA 2DMRA 1CUHA 1KKUA 1IM8A 1K08A 1N6PA 2H63A 2AE2A 3W5UA 4B46A 3ZGXA 1RRKA 1H2YA 2FK7A 2UVPB 1V71A 2B0CA 2PTHA 3ADKA 3ESZA 1SG0A 4KVAA 1TCUA 3FWYA 4EPYA 1YV9A 3T4UA 2DTDA 2F1IA 2Y1OA 1FRQA 1NDUA 4ZRDA 3GLGA 1G8KA 1LQTA 1C9NA 1MW9X 4GYYA 1JHAA 1CY2A 3IQWA 3NFYA 3OKCA 5E4JA 3CR8A 3LRXA 4F4CA 4JAVC 1U80A 1AMUA 3ED5A 3JYLA 2CJXA 1QYXA 1RCUA 3LH5A 3LPNA 3OOSA 3Q3GE 2QZ4A 3DF7A 4HDKB 4R7GA 2Z98A 5KVQA 3RK1A 2CLSA 2ZYVX 3EYWA 3B60A 2O5VA 4HFMA 3OURA 2XDYA 4RAOA 3K32A 1NMZA 5L8VA 1A4RA 1DTSA 1LDMA 4HH3C 1I1QB 3LTEA 3PLRA 4RY2A 3ZU5A 4BLTA 1GR1A 3HYLA 3N87A 4NBNA 5ER9A 3ZTTA 1K7FB 1YOVB 4HDRB 2O3UA 2YHIB 3ZCPA 5SZHB 1XRSB 4C0SA 2IP2A 5IJWA 4ZAFA 1DMRA 5CFLA 1US8A 4R83A 13PKA 4I5DA 1M67A 2G7ZA 2XNHA 2JFVA 3QWAA 4FSHA 3RCBA 5KKNB 1Q6ZA 5ERXA 1NRIA 5AJHA 2VQDA 3TLEA 4HV4A 4JK3A 4QLBA 1JR3A 2OC4A 2ZUUA 2BHTA 2DT5A 2H6EA 3NAZA 3QY0A 1L3CA 3PK0A 3MHPA 3RVQA 3VYRB 4X60A 2DTXA 2IW1A 2ZYRA 1CY7A 3R3YA 3WLIA 3ZHVA 3VPXA 4G0PA 4FHGA 2YJ6A 3CW2A 3NHPA 2Y4NA 4C20A 2GXUA 4UHHA 3OCJA 1Y1PA 3C70A 3PJEA 4IICA 4PQYA 1XXHE 3M6UA 4KBYA 4MW2A 4GOND 4DNOA 3WGIA 4WJKB 1T2UA 2NQ2C 4R05A 5F7JA 1H2EA 2XYGA 5EZ5A 4IVNA 3N07A 3TJZA 1XLTC 3LECA 4O02B 1IEVA 3G8CA 4BO9A 3CRZA 3FFTA 4LTMA 4WKPA 4G0UA 4ZCMA 3SXPA 4YMTA 5FWNA 4C9BA 2NP7A 2YMLA 3UBTA 2XUIA 5IK2D 5KTRA 3IQZA 1G2QA 3EPLA 2JGNA 1QMGA 3AR6A 3L4BA 3BB4A 4Z53A 3S3TA 1Y5RA 3G8DA 1ZUIA 1U94A 1MOPA 5BMVA 2FSHA 4FHCA 4CQLB 4II3A 3PXUA 4BAUA 4X1OA 1Z6XA 1I3LA 1B1CA 3L8HA 3C7TA 1YONA 2B99A 2GS9A 2H8GA 4FR0A 5DLYA 5AM4A 1CDDA 4R6WA 5ALDA 4Z2YA 1OLXA 5ULLA 5ARBA 3I39X 1IB6A 4NCKA 3H05A 4YNBA 2R8XA 3ASZA 1UF9A 4K1LA 4MGIR 4E5UA 3DLAA 3N2LA 4D96A 2ZKLA 4LK2A 1NN5A 2NXWA 4DKJA 4YT5A 2HQSA 1JHZA 5C3MA 4KI7A 4P86A 2CL6X 1DPFA 4I08A 3AERB 1LKZA 2AFVA 4BKQA 3H5OA 4V0OA 1NW3A 1DTEA 1BYIA 4MVJG 4W7HA 1PK9A 4C7VA 2VCYA 5CB8A 1QVRA 4G26A 1UFQA 3HN2A 2PMCA 2WU4A 2YS6A 4JQCA 2X0IA 2IXFA 1KAOA 4ND7A 1NG9A 4WSOA 1HDOA 5D1NA 1UMCA 1E3MA 1M2OB 1VOTA 2VHYA 1A7AA 3L01A 3OFND 4LSZA 1KEPA 1YR9A 2BLNA 2EG5A 3FYSA 5ARDA 2BUBA 4IJ5A 3KB1A 5JVDB 3F7OA 4CI9A 2YCLA 3DGEC 1T2VA 5BSMA 3V2UA 3VU1A 3CLRD 2ACVA 2FSVA 2QM0A 5SY6A 2GO1A 2HZ7A 2A84A 3SSNA 3UVEA 2FSUA 4NXMB 2C9YA 2MR5A 4DN6A 3FTEA 1E0AA 3QVKA 1TQ4A 3HYRA 2HO5A 1JBQA 1JBKA 5GQSA 3W8EA 4XIIA 4EJ2A 1EP1B 3WFZA 3KT3A 1SCDA 1E7QA 3SZUA 1I6LA 4GR5A 1OZ0A 3ZGOA 4UM7A 4IG9A 3LOPA 3Q5EA 1RU3A 4I1UA 2R8ZA 2VH2A 1BS1A 3ICOA 4WZAA 4FN4A 2WV9A 4AMYA 4DQLA 3EQ8A 1C8VB 3HGMA 2JKZA 4FUTA 3BREA 3TSCA 4JLOA 3IEXA 3LRTA 4ESEA 4DUYB 2VK1A 1BXKA 1XCGB 2P9TA 5TSDA 5EJ7A 2P2YA 3UHFA 1F2DA 4LQCA 3BMQB 4MV3A 1I1HA 3NHJA 1OLSB 4YCJA 5JT1A 4P32A 5IKOA 2G04A 4AQDA 3FNHA 2YXPX 2VEOA 2IW3A 3OOWA 4OK6A 4BKRA 1HDZA 4NBVA 3ZV5A 4QXPA 5GJVC 3KFLA 3B89A 3NEJA 3L7LA 1H0SA 3MF4A 3OUZA 4E2YA 3T3GA 2BBWA 2H16A 1AX9A 2PR2A 2XT6A 4KTVE 3CLUD 3MT0A 5FUWA 5FPSA 4CT5A 8LDHA 4QOIA 4PPYA 5HFAA 1R3DA 1ZISA 4GR4A 1JU3A 1Z18A 3E2MA 3FYUA 1TMKA 1ZNWA 1FTGA 2X2EA 2QMUA 5KOIA 3LW8A 3D59A 1GGFA 1O7JA 2GD0A 2WYUA 2N46A 2V3VA 3E9NA 3KJHA 3ONNA 4JU9A 5CYOA 4WBNB 3R4VA 5C3UA 1E3TA 1GY8A 1X77A 5HDBB 1JTEA 3CLTC 2WG1A 4HLNA 4IDDA 4EP1A 2HR1A 3W7VA 3B82A 4IJ6A 3PHJA 3GZ4A 4RC9A 1L4HA 5C0OE 2B83A 4F45A 2SCUB 3IQXA 5EHIA 4KVZA 1D4AA 4AP6A 4HQRA 1U65A 3A3NA 3CUTA 3I9MA 3GJSA 5I7WA 3SZOA 5CP8A 4PG8A 4FGKA 5IT5A 4U2BA 1JGTA 3ANLA 4I3FA 1LXCA 4MWTA 3NCHA 5JZMA 4AO8A 4YMWA 1ENYA 3SIXA 2GM4A 4BIIA 2VSNA 1YVUA 2UUPA 3H9QA 1IBLB 2BMDA 5DTQA 3K6RA 1H8HA 4M1YA 4RTKA 1VFPA 2AJBA 1QXSA 1RRFA 4F5EA 4UBMA 5AXAA 3UK7A 1PNRA 5CX4A 1XAHA 1NZJA 1MQ9A 1EQUA 1TL7C 2QYOA 1YR8A 2YNMC 3PU6A 2R44A 1L7DA 2Q1UA 3B70A 2PHZA 4O4JB 5HJ5A 3ON5A 1FTYA 3K6SB 2AS0A 4D3SA 5B58C 1CUGA 1KK1A 1QYWA 1ATIA 3JQDA 1VMDA 3NXSA 1RXCA 1WHTB 1XD9A 1KZ7B 3ZWWA 1FC0A 4FUQA 5JCOA 5E6SB 3PXCX 4KFUA 4OL9A 1Q12A 1U4OA 4V0ME 1WF3A 4H7KA 4QX6A 2WHRA 1QNFA 2PR7A 2WWHA 3ADOA 2JCYA 4I0WB 2I6UA 1DOHA 1AGNA 3OA2A 4D8YA 1TTTA 3W5VA 1WCWA 1IZYA 2JI7A 4FU0A 2XKBA 5TF0A 3LZCA 4O2RA 4FFNA 1IY2A 1O3YA 1RWWA 4X93A 4YBRA 4E3ZA 4GQIA 1X0XA 2WPNA 4OHBA 1SHKA 1T13A 1TPYA 1VPVA 1XEXB 4P3OA 3TYXA 4DJFC 1VJCA 1I01A 1V11B 1ADCA 1ZZGA 2GLUA 2PD4A 5FBVB 3UGTA 4GO1A 3GEBA 1BEEA 4UFOA 4FQ7A 4UBOA 1W581 2AHOA 4L8FA 2QLBA 2JFOA 2NXCA 2XMBA 3C6BA 4KYIB 2MINB 4BV3A 1G6HA 2VBFA 3OEEA 5K8JB 3IAS1 4BGDA 4G65A 1SKQA 3GPBA 3LY7A 3HDGA 3T0GA 3VR0A 4B3FX 2P68A 2PKEA 3AG6A 1N7JA 1NGSA 1U98A 5HUHA 3OQNA 4AY2A 2NM0A 1JAIA 2Q1WA 5FL7D 1Y1SA 3NIDB 4R1LA 4UUQA 4QASA 1ZJYA 5IH3A 4B6EA 5ITZA 1WU7A 3U19A 4TKMA 1TMYA 2ONZA 3RRYA 4XI9A 3VTAA 3L7YA 1Z3CA 1XROA 4AZWA 2XZLA 1QG4A 1BQ3A 4EL5A 1HKUA 3OM0A 4ME6A 5FA8A 3B5JA 4CI0B 4RESA 3EGDB 1KZ4A 2LIVA 3GUVA 5I4KA 1DWOA 1SK9A 2R86A 5IHPA 3BMCA 5CB4F 3STWA 4I46A 1W52X 4L8GA 4N5LA 1NT2A 4OAPA 4BVEA 1CUWA 1WULS 4CMBA 4QFDA 3BBLA 3BORA 2A0WA 2ZTHA 3GVHA 2LTAA 2IZ7A 2MMGA 3G88A 1EWKA 3GOHA 2DXIA 5JSKA 2E0IA 3D64A 3NPAA 3OT1A 1JIUA 1TM5E 1KDPA 3IEPA 4YRBA 2UVQA 1MZVA 4XGKA 4ZMSA 5KBYA 3FIUA 3ETGA 4WECA 4K0RA 4AF6A 5HM8A 3QWIA 1PQPA 4CMCA 2FXIA 3O03A 4YROA 1JV2B 4CF7A 4Q7LA 3MVEA 5AK0A 5IN4A 1AHNA 4LHYA 2GNOA 4F84A 1H9BA 3NC4A 1SUCA 2BEWB 2IUYA 3KWMA 5GVSA 4LYFA 5KOJA 3U5ZB 2ZR0A 3K2IA 5REQB 4R0VA 3EODA 4AS3A 2E4XA 2GUWA 3G8YA 4NVRA 3DCJA 4RVCA 4MOWA 1MGOA 4HVLA 1ZWKA 4QU8A 1UWKA 5IJ0A 3O6VA 1XKQA 4U6SA 3QE0A 4ZJYA 2EEZA 1KH1A 1GJRA 3F5SA 3L1JA 4RANA 4UTXA 2FUKA 4X1YA 4QZVA 4K1XA 2B20A 5IANA 1G59A 2R7AA 1BS9A 2Y1LA 1KI2A 2C9BA 2YYZA 4KE6A 4UAUA 3U0BA 5BR8B 3KC2A 1FUYB 3AB8A 3T61A 5KSYA 1VHDA 3RIXA 2C2HA 2O48X 1NE2A 1EFPA 1WV0A 1G8GA 4O63O 2Z5GA 2CNWD 2NV6A 5E7JA 1FW8A 1EGVB 1T5TA 3R5SA 2J45A 4MQ5A 3BKXA 1H9AA 2ZIUB 2Q99A 3OICA 1O4WA 3ZW8A 1A2QA 4A8JA 2VJAA 1K5PA 1N8TA 5IZ4A 4MO2A 4YRIA 1OU4A 2HDNB 4J0HA 5JS2A 3R44A 5I47A 1G4UR 3HUFA 3KELA 4CMEC 4Y30A 2A5DA 1I5OA 1VGQA 3FR7A 3GY0A 3L0SA 4MGKR 2A33A 3WHKA 2J1LA 1RQLA 1YVRA 2JIMA 1PUIA 2XUHA 5EQDA 3JRXA 5DISB 3OETA 1JFTA 3PQ4A 4EGSA 1RXIA 3E3NA 1C80A 2AJLI 2W2NA 3JQ9A 2O2SA 4RVDA 1OB5A 2PX3A 2AOVA 2CXRA 4EWLA 2AV6A 1TUIA 2QVBA 3U3ZA 3VTFA 1QHEA 4CV0A 1NBHA 5DM0A 3HPQA 2HO4A 2QQ5A 3DH0A 4O2BA 4LSGA 4TMWA 1QR6A 2WWVD 1YRYE 4D80A 4FLMA 4M0EA 1H3EA 4KKXB 5C1PA 4ZZ0A 2VT6A 3VZQA 3AW9A 3CX8A 3D31A 1KMHB 2GTPA 1MO6A 1LI4A 3ECCA 2RC5A 3EGOA 4NV0A 2R65A 2EZUA 4D79A 3AVOA 2RFLA 1UOQA 2R7MA 2I0FA 1EFHA 4JQYA 3MSCA 5LIRA 1WB4A 2H5JA 5BQ3A 3DKRA 3NS7A 3GLQA 2Z8XA 1O96A 5E9JA 5EEGA 1LJLA 1ACJA 1UBRS 2QRVA 1ABBA 1Y5LA 1UC5B 3VZSA 5A6SB 2ZREA 4M1QA 1CUZA 4ZVRA 2VPTA 3FLAA 2G4LA 2QIOA 3PCTA 2NW6A 4AN1A 1VCIA 4H7FA 1EEXB 3CB4A 2PKWA 3LP6A 4ZCSA 2OA0A 3WYCA 3HXTA 2HMTA 3I4CA 3WKCA 4S1NA 4ZJUA 4FWBA 4HLQB 5G3ZA 4HXYA 2AMJA 4QQKA 2PS3A 3VTZA 3UT5B 4S12A 4U2CA 1P5RA 4ENWA 3ICQB 3MTBA 3RHSA 2R1ZA 1P2BA 3FDZA 5JYBA 3ESDA 4KOEC 3D7KA 1OFHA 4DJAA 1D1QA 2BE9A 3W90A 3UCFA 2KM1A 4ZCIA 2DTEA 3QHPA 5CYFA 3RB8A 4X85A 3UUEA 1D3AA 1GV0A 2H08A 3GLKA 2PKRA 3M4JA 3RU7A 2P35A 1NXVA 2BHRA 4Y7CA 3R9XB 4IDQA 5K8VA 2P91A 3EVBA 4I4TF 4K46A 4B32A 1YHNA 1JHUA 2VDWB 2B5OA 3FN4A 3PIIA 4M98A 1NAIA 4OMCA 4CFZA 3I5MA 1U5AA 3COJA 1VSQA 2B35A 4L5YA 3D3NA 3PNVA 1ZOLA 5A3SA 1K98A 1Y7PA 3E8XA 2F1OA 1TVMA 3BRWA 3IXLA 3OA0A 3HGTA 2DJIA 2DRIA 3D7NA 2OK8A 3OQIB 4MVJH 5JAOA 1FFCA 3AP1A 3JQEA 4ZPJA 2ZBGA 1PU2A 1EP3B 4F7WA 5JSYA 4HGQA 2AOWA 2I29A 1SUDA 3NPMA 4GSYA 4HS9A 2ZYTX 3QU9A 4UUOA 1JQJC 5LDGA 3VJKA 5EP3A 4P8RA 3T1NA 5BYBA 4MV4A 4MX8A 1QZUA 4UNIA 1H5NA 1BH6A 4N7RA 1RMYA 1N0WA 1NNEA 4D4HA 4TWIA 3JQQA 3P71T 4FW9A 1O0CA 2XUZA 5FPHA 3VJMA 5GZ3A 1SEVA 1C29B 1ZM9A 4C7OA 4EKEA 3NHFA 1GZUA 3DZFA 1BVUA 1Q15A 3EFBA 1V95A 2C57A 3BSFA 1DJQA 4NYMR 4TS4A 3LUPA 1MLDA 4ZOLA 3C6QA 4JVMA 3LKZA 3T54A 3W4IA 4D42A 1VHLA 2AK2A 2L2QA 2YV1A 3HEBA 2JI9A 3KEGA 1AO3A 4Z1MA 5LD2B 5KCMA 2QRLA 4UE6A 2PLAA 3CLSC 3E35A 1ISPA 2J3DA 2OLKA 2V4ZA 1YL7A 2Q8PA 3GP5A 4GC9A 3AH8A 3M0EA 5HG0A 2JLYA 4QQ8A 4PLCA 2FSGA 4OXQA 5IEBA 1CBUA 2XQIA 5I4CA 1CDOA 4KMMA 5KYXB 2VTBA 2BSXA 3CRRA 1BWSA 1GR0A 4KR6A 4HBZA 5AJYA 1KVQA 3C5VA 2PNJA 1KZHA 3PL5A 1U2DC 4UD6A 4GZ5A 1EDBA 2NUAA 1MN6A 4YXFA 4NYJQ 3AL2A 4RD2A 4Z8YA 3D7SA 5FTMA 5BSGA 1BTOA 4HXEB 3H42B 1XVLA 4L2IA 2DCMA 4P4UA 4HNQA 2ZULA 1L7PA 4XZ3A 1GNVA 4B3MB 1Q1NA 2J9XB 3A6DA 3ZLBA 1ZM4A 3A1WA 3MJHA 5DHAA 1AKMA 2OBBA 2VZEA 4FGLA 4OHFA 2VJLA 3QBJA 1O94C 2ZT6A 3QKIA 4FGZA 4K8RB 5LQAA 5K0ZA 4RK5A 1MAAA 3DGFC 1XBTA 3ANTA 3G2OA 3AM3A 3R4CA 4MICA 4WW0A 5DHFA 3RFFA 4A8HA 4OHWA 4DV5B 1Y4SA 2ICAA 3I64A 3WDMA 3TSZA 1EAYA 5FPPA 4P5DA 1WABA 3KLMX 1O95A 3GFSA 4QT4A 2EYUA 5KTKA 2D7JA 4NFLA 4LOKA 1CB0A 1C7JA 2O2HA 1MKYA 2YRXA 4JBLA 4QNNA 4URFA 5H1YA 3IP9A 3JVUA 2J7PD 4NESA 4EPTA 5BWNA 4ALJA 3UC5A 2ZRQA 2HYIC 3IQFA 1G5IA 1AGYA 2K2QB 5KC8A 1VJGA 2BZ0A 2XV1A 1CR4A 1CUCA 1CD5A 2W6JA 4FHDA 4IIGA 1BG6A 4UBNA 5JDCA 3WIBA 5IBQA 3AG5A 2OHIA 3H5RA 1BMFA 4F4HA 4BB5A 5F4BA 4HXFB 5KJCA 1NYTA 1E69A 1SCQA 3T7IA 5CD9A 4FJ2A 2VZLA 5JCXA 1SUIA 3KQHA 1QG2A 2R6HA 1CJVC 2W8BA 5AKEA 3LP5A 5AHWA 4J1QA 5EE3A 4CFYA 1NU8A 4H4DA 5CFPA 4XM0A 1VKNA 2MSDB 5KSZA 3GDHA 4KWEA 2WFAA 2JFNA 3M1YA 4RTMA 1Q77A 3U2QA 4QARA 3FXAA 4F92B 1YRWA 1DADA 1XZAA 4EYEA 2XITA 2NADA 4BASA 4QJ3A 4H59A 3INRA 2V98A 2I03A 1LTQA 2V7VA 3D6NB 4RV9A 5FCDA 3J7AC 2NZ8A 3QFTA 5A4DA 4ZVMA 3EXIB 4CMHA 1D0SA 1F7UA 2F3SA 3L7DA 2AR9A 4F0JA 1YS2X 3ITEA 4QELA 2ZB8A 3M6IA 1TUBB 1MDBA 2B82A 4QG3A 4YHHB 4TVKA 3CPSA 5IDQA 5FIUA 1ZXBA 2C03A 3TL6A 3R6TA 1XPJA 1DC6A 1I2BA 2WWIA 3OIUA 2JLRA 4URVR 3QLUC 4U0JA 4N0EA 2XDWA 1B7GO 1G3RA 4DAEA 2I54A 4LJ9A 3D8BA 3PNBA 2DC1A 3FROA 3TRDA 3TCKA 5I7OA 2QS9A 4HUQA 1A8IA 3PLAE 3ZWKA 1IK4A 1AUQA 2H5EA 2JZOA 4H7EA 1QLHA 4XGQA 4IH9A 3TK1A 1ZLXA 4X65B 3MRTA 4LTNA 2PDAA 3FFXA 1E5VA 3KJQA 3L0IB 3L92A 2CGEA 1IRIA 3LC2O 4MMYB 4YJ2F 3WRYC 1IOZA 4CG2A 3W2GA 3H11B 1CZRA 3CIOA 4UTRA 3IC5A 1J0XO 2A92A 4LJ4A 3FPGA 5IMSA 1PIWA 2FSPA 2BI4A 3F6BX 3KHTA 2BM9A 1XA3A 1T1EA 4G9BA 2BAGA 2EHDA 3I6IA 1F0NA 3Q9SA 3FOAA 1NYRA 1MFPA 4FT2A 4ARZB 3EIUA 1D2RA 2WLTA 3EMVA 5BV8A 4WLOA 4Q1BA 1Z0DA 3GLRA 4YRSA 3QQ5A 3BB3A 5CVDA 4IGIA 1CUFA 3OT5A 2XCOA 3N05A 2GVNA 3BCRA 3OBBA 4LXUA 4M8LA 5K0LA 1Z35A 1KVUA 3KUKA 3P19A 2G9VA 1FNNA 2C8VA 4BFZA 1UZAA 3TLXA 3D3EA 3SAJA 4QUIA 2FOXA 2PGNA 1O4VA 4GL2A 1G63A 4ER7A 3HRIA 4HDOB 1BHO1 3TDMA 4EZEA 1P2DA 1GSHA 1QDLB 2ZR7A 4MUXA 4YJDA 4EI9A 1N32B 3IAXA 5AVXA 3EX7C 2BJVA 1D5WA 4RWZA 4PBRA 3CR7A 4BMXA 3GVIA 1E5LA 3NRJA 4G0VA 2C4NA 5F1OA 4KO2S 2OZPA 4ZVKA 3A1EA 4B45A 4CFSA 3KOOA 2O59A 2DHDA 1EYZA 2IDZA 3JARA 1QX4A 3JATB 4LA4A 2X6QA 4UFNA 5AOBA 4B4OA 4D8VA 4RABA 4AZTA 3F97A 4CEJB 2OGUA 5EGSA 1E4YA 5A7HA 1M1ZA 2VZ9A 1R0KA 3AI3A 1NURA 1E89A 2BM1A 2JGEA 1EX9A 3HO1A 4XRRA 3MPOA 4EMUA 1KMNA 4ESHA 4FYYA 4GP7A 5GPBA 4C6TA 2AOXA 2X3YA 2MYUA 821PA 1DAMA 4RCVA 3TOXA 1J8YF 1U3CA 2C4VA 2NTEA 2VA9A 4EA6A 4OBBA 3TL2A 3ADCA 1QJ4A 2XXAA 1KZYC 2W6MA 5BWLA 4QEDA 4AKEA 3THXA 4F91B 1JA1A 1XCLA 1ZC4A 2VOEA 3JZFA 3KP1A 4WN9B 4DB4A 2DY0A 2GBGA 3EIHA 3ZQ4A 3GA7A 3VNRA 3LIIA 4BFLA 2JVIA 4PZ9A 1Q95A 5TY0A 3VU0A 3ECAA 4KDRA 1NIJA 4IMIB 4DW8A 1Y5IA 4YQEA 1KJ8A 5JO9A 4EKNB 1DIGA 3UK2A 3KJZA 5B4VA 1FW6A 3ZTYA 2P6NA 1I2AA 1QANA 2FP4A 4RHEA 4YCBA 1RLOA 1Z47A 3I58A 2OGZA 4ARSA 3V8QA 1KVTA 1LPSA 5FP0A 1K88A 4FEAA 2G9ZA