1WMBA

Crystal structure of nad dependent d-3-hydroxybutylate dehydrogenase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
b'MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
molecule tags Oxidoreductase
source organism Pseudomonas fragi
publication title d-3-Hydroxybutyrate Dehydrogenase from Pseudomonas fragi: Molecular Cloning of the Enzyme Gene and Crystal Structure of the Enzyme
pubmed doi rcsb
total genus 92
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wmbA00
1JKFA 4UUMA 2YV3A 2YUTA 1GR0A 2ZB8A 1E7WA 5EL0A 4LK3A 3GN2A 1N5DA 1KC3A 3V1UA 1JQBA 3GK3A 1Q7CA 1LTHR 3DR3A 2C5AA 4FBGA 3VVCA 3E18A 4CM4B 1YL7A 4M86A 3TZCA 3WYCA 2PV7A 4OJNA 4CL3A 4KMSA 3NDRA 1JDJA 4TVOA 3DZBA 1IUKA 4KUEA 1CF2O 4D3SA 3RC2A 4OM8A 1P1JA 3KZVA 1CJCA 1R12A 2GF2A 3BXXA 3JSAA 4ND3A 3MWDB 1PJSA 2FR1A 1K6JA 4CR6A 3OA2A 4BNHA 4ND5A 2XAAA 1DXYA 3HFGA 5CG2A 4R01A 3INRA 1UXJA 1PZHA 2FOIA 2VYNA 4WE3A 3TQHA 4CQMD 1SB8A 5DF1A 1NWCA 4Q9NA 3JD3A 3B1KA 4CLRB 2C0CA 1HWYA 1IL0A 1EBFA 2ZATA 4IJVA 3U49A 4B3HA 1TB4A 3OP4A 3QVWA 4GGPA 4WCFB 3EC7A 4RF4A 3R3JA 4YJHB 1U4SA 4BNIA 4L4RA 5THKA 5C7OO 3QWHA 3RAJA 4BL5A 1V3VA 5I9LA 2GYYA 3D0OA 3DWFA 2J3KA 2VWHA 3RWBA 3ZWAA 4FFOA 4DUPA 1YBVA 2NQTA 3KB6A 4RVFA 1ORRA 3AI1A 3OJOA 2DTEA 5DBFA 4YQYA 5HA5A 1U3VA 3UFXA 1NVTA 2YDYA 3HDJA 2B4TO 2LDXA 4CLRA 3WGTA 3VHRA 1HSZA 1B8UA 3KHUA 5TJHA 4UVIA 2PGDA 1Q0QA 1NTOA 3PP8A 1ZUD1 2P5YA 2O23A 1MFZA 3GGOA 1NAIA 3JQ7B 1A9YA 1F12A 4HFNA 3RKUA 4EYEA 4KQWA 3ZI0A 1LI4A 2IRWA 4HP8A 2HLPA 4K6CA 3I6QA 5L4SA 3ZCXA 1F17A 4D42A 2CDCA 4F3YA 2JAHA 4JBIA 1ULUA 2J5QA 4I5EA 3DHYA 1E6WA 1ADCA 1NR7A 3BMNB 4N5LA 4LVUA 3ICPA 1KVQA 4XQGA 1T2AA 1XCBA 5BNFA 3AM3A 5A5EA 1QXSA 2EERA 5T57A 3ORFA 4BNXA 2POQX 1R0LA 3Q2KA 4XRGA 3DQPA 3ICCA 3I9MA 3BYZA 4INAA 4BNNA 1LNQA 3UH1A 1X7DA 1T24A 3R3SA 4DREA 3GOHA 5JMPA 3QLJA 1YWGO 3GG9A 3WXBA 1U9JA 3DMTA 4CV0A 5HS4A 4WCFA 4QO7A 1R4MA 2HJSA 3H9GA 4DLAA 4BO5A 4BO6A 3TPCA 5CAEA 1DLIA 4AJJA 3R6DA 3ROQA 4XJTA 2XXJA 2OBYA 4W7HA 2Y66A 1T25A 3QE3A 3D3EA 4WLNA 4XD2A 4IPTA 4DQXA 1U8XX 1PR9A 1E7SA 4DPLA 4KUGA 2AXQA 2E49A 1O8CA 3AU9A 3SJUA 3GH3A 1IZ9A 1JTVA 3DBHA 5TGDA 5FI3A 1U7HA 5IFLA 4Z0HO 1ONPA 5TT0A 4MVJI 3JYLA 3ANMA 4MP6A 1G1AA 3JD1A 4N18A 4C4OA 1BSVA 3PDUA 5IG2A 3GRKA 1QYWA 5K6AA 1UP4A 5FWNA 3HDYA 1PEDA 1PJBA 2DBVO 4W9NA 3TZHA 2YZ7A 1WZEA 3OEWA 2B4RO 2DTXA 1NR1A 4RPHA 4E6PA 1DIGA 1FMCA 2DFDA 3F6YA 4YYZA 1P9LA 3KYCA 4CV3A 3GVHA 3QVXA 4MO2A 2DT5A 2JAPA 4CUZA 3BMOB 5A9RA 3ITKA 4ZRNA 4ZA2A 1DHRA 2O4UX 1LC0A 1GQYA 3WOHA 2H9IA 3GN1A 1PJ2A 5IXSA 1P1KA 3PJDA 3GPDG 3WNVA 1E5LA 1SOWA 3RU7A 2QQ5A 3RUDA 2VHWA 1E6UA 5KVCA 2EWMA 1EUDA 2ZYDA 2DLDA 2IXAA 3QWAA 2J5KA 3UCXA 1LC3A 4CV2A 3T4EA 3PLRA 3W6ZA 2YV1A 4WNCA 3U9LA 5DP2A 4E33A 5KJFA 1LXCA 1DJNA 1NVMB 4I5GA 3G79A 2ZB7A 3I4FA 1N7HA 3C7DB 3KVOA 3LF1A 3PFWO 3G3EA 3TZ6A 1GZ4A 1DIAA 3E8XA 4GQAA 3A14A 3DBLB 1ZJZA 3CSDA 1YS4A 1SEPA 2X9GA 1DDOA 3PDJA 1GYRA 1LLQA 4AJ4A 3I4CA 4NDNE 4XA8A 1LSSA 1NP3A 4BB6A 3D64A 1RYEA 4B3IA 3H7AA 1QV6A 1UZLA 2BFMA 1YVEI 2EW8A 1Z7BA 1K6IA 3UW3A 1UZNA 1U3TA 4J1NA 5U1PA 1LSJA 2PH3A 2X5JO 3AUSA 4HFRA 4CQMA 1CETA 4RPGA 3C7CB 1MXFA 5IN5A 5TQVA 2NVUB 3SEFA 3WB9A 3CZMA 2Q2VA 1ULSA 3INGA 3ROKA 1LLDA 5TS3A 1B26A 4R69A 4Y6RA 4E0BA 4XDYA 1SB9A 2Y05A 2H6EA 4IJKA 3ZWYA 4JIGA 1ZJYA 4XKJA 4I5DA 3DMYA 1GDHA 3HN7A 3VH1A 4CMEA 5G0WA 2YHIB 4ALIA 1TVEA 1C0LA 5JSFA 3WMWA 1DAOA 2ZB4A 3HJAA 2AG8A 4Z3KA 3RBVA 2C7VA 4MVJD 1OC2A 2DPGA 2PKQO 5C3MA 2GN4A 4D79A 1I5RA 2Q99A 4GSLA 4BQRA 4FFLA 5I7FA 4CLOB 4BS9A 3AY3A 5C7LO 2CDAA 4RQTA 7MDHA 4PGFA 5ICMA 5CFZA 2Z5LA 1ISIA 5JC8A 1YL5A 3IUSA 4H16A 4CQMB 5TSDA 1Y8QB 1NPDA 2FZEA 4CM7A 4EJ0A 3Q9UA 3CUKA 3OQ6A 4LGVA 5EINA 1ZK0A 1WW8A 3GGPA 3VTFA 4FJ1A 2P5UA 3C1OA 2HKIA 3RFVA 1ZCJA 4FIZA 1WDKA 4DIOA 3BMNA 1PSDA 3K5PA 3GA0A 4IDBA 5AXAA 4L76A 1I33A 1PWXA 1DFGA 1MV8A 2NU8A 4QFDA 4FSHA 1J4AA 5ENVA 3CMCO 5CEFA 1E1LA 2IZ0A 3EY4A 3WJ7A 3OMLA 3ZNPA 1LDEA 4ZQFA 1ISHA 1Q0LA 3ZWVA 3W6UA 2GLXA 4B8ZA 2G17A 2YW9A 1VL6A 4JGBA 4LW8A 5IXYA 4PN3A 1DOHA 4ITUA 2C2XA 1YRLA 3H65A 3KSZO 4C7JA 1AGNA 4D41A 4MVJE 4BOYA 1FJHA 3I3OA 2FR0A 3IL2A 3CZRA 3HNPA 4EJ6A 2J6IA 2DM6A 1YQDA 4JROA 3E9MA 2NQ8A 3F47A 4R9RA 4OQYA 2V6GA 1J0XO 5F1OA 1HE3A 1ZMOA 4RVHA 3RU9A 4UREA 4ZD6A 3ZU2A 3BMQA 1R6DA 4FN4A 4LRSB 4DIBA 2I3GA 1T2EA 2P4QA 2D5AA 3DZJA 3IC5A 3FTPA 1L1FA 1YDWA 4YTEA 1PQPA 2ZYAA 3NAQA 4Z9YA 4P4LA 3K2EA 5G0TA 1ZK3A 2QW8A 4Q3NA 1TEHA 3ZHXA 4AJ1A 2WYWA 2Y68A 4Q3AA 3JQBA 1PTJA 3VZPA 5A05A 2A9FA 4YT5A 3PXXA 4LCEA 4WLOA 2HMWA 4RORA 4CM8A 5LC1A 3W8FA 3EMKA 4GAEA 1V3TA 5CPFA 3VC7A 5CEJA 4PCVA 2AEFA 1BXKA 5JDIA 4YAIA 3V2GA 1SCUA 2FSSA 3IDSA 1T4DA 3PWSA 1B2LA 1O89A 1UH5A 1I2BA 1LDGA 4J16A 4Q3CA 4M87A 1DC6A 3EZLA 1LRLA 3TZQA 4A7PA 1I2ZA 4CMHA 2GCGA 3RUAA 2RBEA 2W8ZA 1U7TA 1DRVA 2ZJ1A 1DB3A 1DEHA 4MKRA 4YBZA 4YEDA 4FQ8A 3S2IA 1O0SA 3I52A 1TI7A 3GZNB 3WJAA 3V2UA 2O2YA 3WGHA 4CM8B 4CM4A 4LSMA 2F00A 1RM4A 3WWZA 4AL4A 1ZSYA 3AW9A 3I9JA 3E5MA 4FPXA 4YCAA 2FPGA 4W99A 5L3ZA 4K26A 4NK5A 3RI3A 1WMBA 3WBFA 4J4TA 1F14A 3INTA 4DLBA 1OC4A 3A9WA 3ZV3A 2CVZA 4CL8A 3RC1A 1PU2A 4BO0A 3L07A 3HDHA 4IZHA 1V0JA 2O50A 4BNLA 2WTBA 3C1AA 3JQEA 3TN7A 5JE8A 4W4TA 4XR9A 3K8ZA 3VAZA 5DDIP 2NTJA 1NHGA 2X6TA 3K30A 3KTDA 4BO1A 1MA0A 1T2FA 2EP5A 3LYLA 2IZZA 3HWRA 3RUCA 1MB4A 4DQUA 2A35A 1LDBA 4QT0A 2WYUA 1ENPA 3DAGA 5T67A 9LDBA 5JW6A 1E0DA 5H82A 2Q2WA 3L6OO 4E2ZA 8ADHA 2AE2A 2X7HA 1K6XA 1R16A 3VKUA 3AOEA 4CLXA 2ZTLA 1HXHA 3H2SA 3GC6A 2W98A 2TMDA 4I08A 4PG7A 1M75A 3T7CA 4Y6SA 1MGOA 2ZK7A 4OOFA 4DBZA 2BI7A 2XXBA 2C5EA 3KSUA 1SBYA 1WZIA 4NNJA 4J4BA 4ONEA 1B3BA 5KKCA 1ID1A 4JXKA 4OGWA 3PJEA 3EDMA 1QORA 3K92A 1IY8A 3L4SO 2NTVA 4TMFA 3JQBC 4L9RA 3WSVA 1NQOA 4BMNA 4BB5A 2X4GA 1PJCA 3FRJA 3RBZA 4A0SA 1P33A 2ZTMA 3AU8A 1BW9A 4BNZA 1HLPA 3ENKA 1M66A 5ER9A 3O03A 4QECA 4CM1A 1Y8QA 1BWSA 2B69A 5JO0A 4FB5A 3QVSA 4E5MA 2UAGA 1PL7A 3BIOA 3MWEB 3GZ4A 1T2DA 1UAYA 3LC1O 3SX2A 3KYBA 4R68A 3V5NA 4WKGA 4CLHA 3QWFA 3ZWMA 3GEGA 4U0KA 3NDJA 4ALLA 3WQRA 1DJQA 1MLDA 3BMCA 4I5FA 2QRJA 2YHUA 1IPFA 3FR8A 1XDWA 1IZ0A 2YJZA 3QSGA 4ZU3A 5CHEA 3KEOA 3OJLA 4IY1A 9LDTA 5JYDA 1UP7A 3G1TA 3VDQA 2ZCUA 3AFMA 4Z3DA 3TL2A 2E4AA 3B1JA 2DBQA 1IB6A 3SC6A 1CYDA 3GMSA 4WLVA 3JD4A 4G81A 3Q2IA 2G76A 1G6KA 4R54A 3JYNA 1XU9A 4RDIA 2WJPA 4JBGA 2P91A 3D4PA 4BNJA 1DRWA 3LU1A 4YRDA 1XKQA 1RM3A 3D4NA 4GMFA 1TT5B 2B4QA 2BF7A 4RQUA 2GN6A 1U5CA 1VL0A 1H94A 1WNTA 5KJCA 4J3FA 2CD9A 4DL9A 3IJRA 4BQPA 4OSOA 3DZIA 1H6AA 5ITVA 3L6EA 4CMBA 1EVYA 1E1KA 4G65A 4ZVVA 1QYCA 1A7AA 1IYZA 1I2CA 1PZGA 4Z0TA 4PVCA 1I3MA 2HQ1A 5DP1A 3FCOA 4A5OA 1WLYA 4A27A 3NTRA 3GNSA 2DVMA 4UVHA 4JX8A 1JWBB 1NM5A 4J1SA 1NAHA 3K96A 1HDRA 5A3JA 1C0PA 2E48A 2HO5A 4FOOA 2EV9A 1BVUA 3Q0EA 1EZ4A 2H1SA 4I1IA 4NH4A 2VHZA 4JQCA 1IULA 5G4KB 1T26A 3E9NA 4FC7A 5JAZA 3IKTA 2WD7B 4NBVA 5TF4A 1GEEA 1FDWA 4UVEA 5G2OA 1VJTA 3TL3A 3UVEA 4R5HA 3QQPA 4BO3A 2JD0A 2YFHA 2W90A 3KLMX 2UUOA 4LSWA 1KYQA 5HTOA 3ZN2A 1DPGA 1VSVA 4KWIA 3PEFA 1AE1A 2Z1MA 5FFFA 2QYSA 2EEZA 5DBGA 2EXXA 3DB2A 3AI2A 1GV0A 2WD8A 2X8LA 4KDFA 5TNXA 1CRWG 5F1KA 3KRTA 3LDHA 3D5QA 4AVYA 3K6JA 3RASA 3ONFA 5JCJA 1KVUA 3EAGA 5DOVA 4CMAA 3BA1A 2C2YA 4R9SA 5KVSA 4PG6A 2RAFA 3DZFA 5JXWA 3K2BA 1V3UA 4L4SA 1YQXA 4O5OA 4URFA 1IE3A 2PGJA 3SXPA 3ANNA 3DONA 3FNGA 2NUAA 1EK5A 2Q1SA 3OFSA 3I9LA 3PI7A 5L4NA 4NFYA 3CPSA 3GNQA 1GQQA 3FPLA 2B35A 2J3HA 4XYMA 4A10A 4E2YA 4MIOA 4J43A 4OXYA 3HN2A 5IZ4A 4AJHA 2FR8A 3WYEA 4HUJA 2PK3A 5K0ZA 1AHIA 3GDOA 5TJ9A 1LQTA 4PLTA 3P2YA 3NTOA 1OAAA 1YJ8A 3IS3A 4OAQA 4MKZA 1BG6A 1UXGA 2CF5A 2YY7A 4DRYA 2WE7A 4XCVA 3RVDA 1XGKA 1H6DA 2QRKA 4FFRA 3ROPA 1H93A 3RJ9A 1D1SA 3ZDFA 1KERA 1R4MB 4NI5A 2JFFA 1T1SA 1XG5A 4EBFA 1UAGA 3DDNA 3MJEA 3PIIA 4PLFA 1Z82A 4FCCA 3LSYA 1X15A 2VHXA 5T5QA 4JCOA 3OM9A 3WLEA 2FPPA 3F9IA 3TOZA 3W1VA 3H4VA 3JQAA 5GY7A 4YT2A 1Z74A 1TA4A 5CEEA 3GG2A 4BO9A 1ISMA 3BHMA 1I0ZA 1R37A 3QP9A 1OBFO 4YQZA 5AXDA 1NX6A 1H6CA 1AXEA 2EIHA 2O3RA 5ILGA 2OUIA 1JA9A 4PRKA 2O3SA 3AOGA 2VWPA 2ZTUA 3U4CA 1ZXBA 3GZNA 1P44A 5TT1A 5CDTA 1ZBQA 3SBOA 5EQDA 1ZEMA 1UP6A 2EGGA 2JJYA 3WGOA 3AI3A 3VPGA 3KXDA 3PFFA 1LUAA 3G0OA 5GMOA 1LA2A 2ZCVA 1NFRA 2GDZA 3U09A 3ULKA 5HRUA 2QZZA 4D43A 3UN1A 1F8GA 3TOXA 2NTNA 3ANLA 4RVDA 1KY4A 3KV3O 1A4IA 1EUZA 4WLUA 3BHIA 5B37A 4WCDA 1P0FA 1LDNA 3BMCB 4NBWA 3HZZA 3KYDB 1NASA 5TC4A 3WDSA 1JU9A 2AHRA 4IS2A 4RZHA 5COAA 3JQAB 4EDFA 2PTGA 2X9NA 1OI7A 2OBNA 1PR3A 1HKUA 3JQGA 4IDFA 5IAAA 5K6AC 2O48X 5MDHA 5MGBA 4XX0A 4L75A 2FMUA 2NV6A 4MVJF 4YB8A 1V35A 3AFNA 3GNTA 1E7YA 1YB4A 1SO8A 2VOJA 5JCXA 3NT4A 4FFMA 1P0CA 2WYVA 4M89A 4H7PA 4NZ9A 1N1EA 1T4BA 3QJ5A 3GEMA 3VH3A 4BGUA 3RFXA 1LDYA 4BNWA 1JN0A 2JHGA 1B8PA 5BR7A 4PLWA 3IOYA 4R5MA 4YJDA 3KYDA 2I6TA 5DCWA 1P77A 4W9NC 1X0XA 2QZ9A 5JDCC 1E1NA 1I10A 4JP3A 1P3DA 1UDBA 3OIFA 2ZTVA 3OICA 1Q0HA 3PPIA 2PGLA 1X1EA 1D3AA 1OZAA 3H9QA 3W4KA 5BSEA 3NT5A 4JJIA 4YT8A 5A3VA 1EK6A 4E21A 1Y8RB 1BHSA 2I3AA 3KOUA 3SJ7A 1LJ8A 3GF4A 1D4FA 2NVWA 2G82A 1F0YA 4CV1A 2OL4A 1DBVO 4U8GA 2DBZA 2IE0A 2ZYGA 5AXBA 4EUEA 3RD5A 1TXGA 4QUKA 1CERA 3DZGA 1N92A 4FS3A 4UUNA 1WAMA 4B3JA 3L77A 4LRTB 5F1PA 1MG5A 3CTMA 4TKMA 1DLJA 5HS6A 5ITWA 3W4JA 4L73A 2PY6A 2X23A 1KBZA 4YJHA 1E3JA 3WG9A 4AJNA 1ZW1A 3O4RA 4IXWA 2OFPA 5HWSA 1E3WA 1HDGO 2J3JA 5JO9A 1KY5A 1P31A 4H15A 4RF5A 2Y0EA 4ALJA 3FWNA 5IZCC 3JYQA 4Z6KA 2V65A 4LCJA 5AOVA 2PKRA 2O3UA 4GPD1 4RCVA 4R3NA 1JKIA 2GZ1A 4WK6A 4W7IA 5CPBA 5ER6A 4YRBA 3AJRA 3PHIA 4LVCA 2GGSA 3DTTA 3OSUA 1IOLA 3F4LA 3FBTA 4NBUA 1EDOA 4HXYA 2PLAA 5H81A 2EGHA 2CF6A 5EPOA 4EUHA 3KO8A 2Q46A 5FI5A 1O6ZA 4Y98A 4BO8A 3BTUA 3K9QO 3LT2A 4YPOA 2NM0A 4BMSA 4D45A 3RUEA 2JKVA 3LZ6A 1GZ6A 2PD4A 1N1GA 1O95A 1VL8A 3GPIA 2Q3EA 3K73O 3JYOA 3V1TC 3ZNQA 4J49A 1UZMA 4MINA 3ENNA 1QRRA 3WIEA 3EUWA 1X14A 3ONDA 1EVZA 3DXFA 3BZUA 3ONEA 3ZGYA 4IM7A 4PG8A 2PNFA 1DFIA 5DCUA 4YVFA 2R6JA 1EFLA 1U8FO 4MIYA 1KEUA 3GGGA 3QHAA 2DKNA 3OJEA 1HZZA 3U62A 4WOJA 3AM5A 3S2FA 5TLSA 3GVPA 1F06A 4OH1A 5I7EA 4CM5A 4LMPA 2YQ4A 4BKOA 2YDXA 4XRRA 5IF3A 1NHWA 4AJPA 1C0KA 5B4VA 3NGXA 3A4VA 1LLUA 2VNSA 2HMTA 5A06A 2RIRA 1NPYA 3VH2A 1KEVA 4JNKA 4N7RA 4O6VA 1I36A 2AQ8A 3VTZA 2CZCA 1ISJA 2HMUA 3H9JA 3HQ4O 4QXMA 2WDZA 4XYGA 3RROA 2C54A 4OQZA 4CM3A 3TWOA 4H3VA 3HUDA 3DHEA 5B12A 3UCFA 1YH3A 4GLLA 5K9ZA 3FNEA 1YKFA 1HDXA 3P7MA 5IDYA 2Y93A 2VRCA 2G0TA 3LLSA 3AK4A 1YBMA 5BT9A 3W8DA 3L0DA 3ETDA 3GUCA 3ROMA 5HBRA 4PG4A 2C20A 4QEDA 3EK2A 1GL3A 3ZHZA 3B1FA 3JQDA 3HADA 2UV8A 4RO0A 3T4XA 2Y99A 3C3XA 4FJ0A 8LDHA 2VHYA 3IJPA 2D0IA 4E5PA 5FYDA 4TVBA 3E03A 2X5KO 4CLOA 2AW5A 1NYTA 4YJGB 4GSKA 4CUKA 5U9CA 1ARZA 5DCYA 2PD3A 3KEQA 3VKVA 2TMGA 5CDUA 4MP3A 2E6UX 2EKPA 4J2HA 5KOIA 3PQFA 5HM8A 1NFQA 2H5LA 3GFBA 4J7CA 4MVJG 5IDQA 4BNYA 3E48A 5EJ2A 1PS8A 3AY6A 2CY0A 2YHIA 2IXBA 3Q6IA 4AJKA 4QFCA 1MC5A 1C0IA 2HAEA 3M6IA 1P1RA 3DMTC 5KTKA 1YOVA 1Y5MA 4R3WA 4Z9XA 4A73A 1VM6A 3B6ZA 3JQ8A 5T8KC 2A94A 3PHLA 5BQFA 1I3NA 3O26A 4DQVA 2ET6A 1VJ1A 3LF2A 4E31A 1E6EA 3WFIA 4Q3BA 3MTGA 3GT0A 1HE2A 5FF9A 2IEDA 3PYLA 5JS6A 3C85A 4GVXA 4QQRA 3S1LA 1JW9B 3H9UA 3WGQA 2NACA 5I9NA 3FI9A 2IYPA 4Y8VA 4K9DA 4BMVA 4GBJA 3DZHA 3BTVA 2Q4BA 1MUUA 4Q39A 1FDVA 4PG5A 1HETA 3ZHBA 1GCUA 4EZBA 1W4ZA 1EDZA 2HK7A 3SVTA 3H5AA 5G0VA 1RM0A 2P9GA 2VZ9A 3KETA 2PKQP 1ZKMA 2BFOA 1GFSA 4FFNA 3RQSA 1PL6A 4ROSA 3ZU3A 1GQ2A 1PQUA 1E5QA 3X2FA 2VWGA 1FXSA 2GERA 4NBTA 4DGSA 2WE8A 5AVOA 1PJQA 3VZSA 2VUUA 4MIEA 5G4LA 3ASUA 4R1SA 3CMMA 3LT1A 4R1NA 5JDCA 3PZRA 4L74A 1PZEA 4GI2A 2UDPA 4IBOA 4CMIA 1RYDA 1GYQA 6LDHA 5G0SA 3OBBA 4RLHA 3ADPA 4AG3A 3WFJA 4E2XA 2EP7A 4IUYA 6ADHA 3WQQA 2QHXA 2VYVD 4RVSA 3L6DA 2VRBA 1KEWA 1AXGA 4WOKA 1KOLA 3AUTA 2JHFA 5F5LA 5BSHA 1BDMA 5L53A 3VDRA 1PGPA 2GNAA 4WLFA 1R15A 2D3TA 2VHVA 3GAFA 4M1QA 4BNKA 3NGLA 3WLFA 2O4CA 4LISA 4IIUA 2UVDA 1P1IA 4L8VA 3P5SA 5DULA 1YJQA 3L4BC 4CMIB 2CSUA 4RPKA 2OORA 1GAEO 3PTZA 1NQTA 3Q1LA 1G0NA 3MTJA 4CR8A 3RCBA 3O9ZA 4ZJUA 1H2HA 4BVAA 1EE2A 1D1TA 4RPJA 1PX0A 7ADHA 2O3JA 1IHXA 5CDYA 2BFPA 3OH8A 4NPCA 5JC1A 1BVRA 2NU6A 3VPXA 5L7WA 2HMVA 5JY6A 1K5HA 1HT0A 1E3EA 2BD0A 3N7UA 4IGEA 2GPTA 3MOIA 2ZQZA 4BNTA 4OXKA 3AOEC 5I8ZA 1I01A 3LK7A 3HSKA 4PZCA 3JQFC 2DUWA 2X22A 5KJ1A 4U6QA 1ZXLA 4UULA 3ZHYA 1HDZA 3NV9A 2OHXA 1U2DA 4KWHA 1NVGA 1BXZA 2V7PA 1O5IA 2AQHA 3OQ1A 3QWBA 4IDEA 3ZV5A 1EEHA 2X9VA 4NFSA 1L7EA 2VZ8A 4KP7A 3PJGA 1A5ZA 4W82A 3IQDB 3QVTA 4FGWA 4XQCA 3NYWA 3Q3CA 4IJWA 1GYPA 1LLCA 2BFAA 3R1IA 4CM6A 2BMAA 3JQ9C 3JYPA 4ZICA 3FF4A 4IZIA 4EEZA 2O3TA 2AEMA 2BH9A 2ILTA 1SAYA 4F6CA 2PZLA 2I76A 2DPHA 3D3WB 3JQCA 4TZTA 2F1KA 1DC4A 4EUFA 3N74A 1PGOA 4R1UA 2VNAA 4PZEA 5EQFA 4N5NA 1JWAB 2VT2A 1WP4A 4FGSA 1E3LA 1X13A 1J6UA 2VYND 1MP0A 1M6WA 3DOCA 2BELA 3FD8A 5ES3A 3RUFA 1PGJA 1ML3A 1ZO8A 2UYYA 4E4YA 1CWUA 3IUPA 5EMHA 2SCUA 2P2SA 2IDZA 4NJOA 1LEHA 5CDSA 5IZCA 1VKNA 1KC1A 1B14A 3TDKA 4B7XA 3WGZA 1HE4A 3E5RA 2IYOA 1I3KA 3CXRA 2FP4A 4MDHA 3WTBA 3H5NA 4XQ9A 3LQFA 1GEGA 1I24A 4RV9A 4ZN6A 1UDCA 5ILOA 4EJMA 2DC1A 2X1HA 4YAEA 1DSSG 4YRAA 1Y9EA 2BHLA 3I9OA 2OP0A 1H9AA 4BV8A 2C82A 1HTBA 3IMFA 1HF3A 5A9TA 2DU8A 1N7GA 2VWQA 4GX0A 1ENZA 4WEQA 1Q2XA 3H3JA 4J7UA 3U0BA 4D3FA 4DPMA 1R0SA 2J8ZA 5ENDA 3C24A 3OECA 1YOVB 4D0RA 4GWGA 2EJWA 2OMEA 4R16A 4TRMA 3GRPA 3ZWCA 2O7QA 2QG4A 4PLGA 4X54A 4BV9A 1QYDA 2HMSA 3LLVA 3GHYA 1KVRA 4GX5A 1VE9A 4HFMA 1WVGA 3NUGA 3G1UA 1GPJA 4E5NA 2A92A 1JAYA 5L51A 2GZ3A 2I9PA 1ZFNA 2CMDA 2EG9A 4J0FA 4YAKA 5B1YA 4XGIA 4J2OA 3QRWA 4RVUA 5GZ6A 3ABIA 3E82A 2B37A 5A02A 1FF9A 4B4UA 1CQIA 1BRMA 4NHEA 1C1DA 4DYDA 4DC1A 2FHSA 4NMHA 4GKVA 3TZKA 1Z7EA 1TT7A 4NJMA 1S7CA 3GQVA 4JN6B 2OOSA 2Z1NA 2RHCA 4BNVA 5THQA 3JQ6A 1W8DA 3ZH2A 2BLLA 4PVDA 3EVNA 4J1TA 4J9UE 3OEYA 2ZB3A 2V6BA 4Z9FA 3PGJA 4WLEA 1QMGA 4BGEA 1ADBA 4DC0A 1HEUA 3B20A 4DPKA 3ITDA 5G0UA 1YE3A 4AJEA 3I9KA 3ZV6A 3KUXA 2P4HX 2RHRA 1EFKA 3VOSA 4BGVA 4QSMA 4HY3A 3SLGA 3VZQA 1BDBA 1PS0A 1U5AA 4U6SA 1B0AA 1B16A 1LQUA 4K28A 1AUPA 3UOGA 5BSFA 3M2TA 1WXDA 3ZWWA 4YR9A 4RJTA 4R4JA 4C7KA 4DVJA 1MXHA 3L9WA 4O59O 1PIWA 2Y0DA 5T8KA 2CDBA 4DTIA 3BAZA 4KZPA 3GEDA 3EHEA 5CDGA 5DT9A 2Y1GA 4B7UA 3WQSB 2D8AA 1J49A 3GDGA 3MJCA 2QRLA 1LX6A 4FW8A 3GFGA 4XEHA 2Q49A 4MVJP 2JCVA 3GVCA 4U7WA 4DMMA 4WJZA 3PYMA 4ND4A 1U3UA 4FC6A 3WICA 4P4GA 2NLOA 2EKLA 4E5KA 1AN9A 1RM5A 1UXKA 1XHLA 2X58A 2BGKA 4I9UA 4K6FA 1A4UA 2GSDA 1KIFA 2OXIA 1X1TA 5DN9A 1GUZA 2ZQYA 3NJ4A 1N9GA 5C5IA 2JL1A 4P22A 4E13A 5U4QA 2IZ1A 3ETGA 3SC4A 5DOZA 3DL2A 2G5CA 4UVDA 3QIVA 1LSOA 4J0EA 4GX1A 5KJ6A 3DZKA 3U4HA 3GVXA 1M76A 4U0JA 4TWRA 4CMCA 3RIHA 1Y5RA 2VRCD 4FD3A 5AXCA 3GDFA 5EIOA 2GR9A 3LT4A 3IAHA 3NRCA 3OHSX 4P4NA 1Y7TA 4OOEA 1RKXA 3OJFA 1HDCA 1EE9A 1QKIA 4IXTA 3RKRA 3RUHA 4CODB 1FDUA 5JFOA 1Y8RA 1WDLA 2EHDA 4DYVA 1GTMA 4AJ2A 4YAJA 1JAXA 3EGOA 1NFFA 1LRJA 2VQ3A 2I5PO 3PHHA 4XZ3A 3WSWA 1L7DA 1MFPA 4II3A 3ZV4A 1SC6A 1ONNA 3O8QB 3RFTA 1FDTA 3V2HA 3M1LA 1DC5A 3VVBA 4PRLA 2AG5A 1W6UA 3R0IA 4NR0A 4JP2A 4UEJA 1FDSA 4GKBA 1K2WA 2BGMA 1GPDG 4E3ZA 2PA3A 4CM9D 4DLLA 3O38A 3UUWA 2C29D 3I6IA 1A71A 1CEQA 4FR5A 4XB1A 4EEXA 2YV2A 4M55A 1MC4A 4GX2A 4A03A 1ISFA 3A1NA 3RC9A 3BTOA 1VRWA 4J1QA 1ZEJA 4O0LA 3H2ZA 3PWZA 1PJ4A 4JLWA 3D1LA 5C37A 4LN1A 3ST7A 1C3VA 1P74A 4GH5A 1VC2A 4O63O 2VOEA 4J9VA 1XLTA 2Y1OA 3JCZA 4TSKA 3WBBA 3K31A 5KWEA 4PLCA 4ALNA 1VSUA 4MVJM 1WPQA 1V9LA 1NWHA 2Y1DA 3DBHB 1DIHA 5JPIA 4KQXA 1DO8A 3P19A 3X2EA 4CMKA 3PIDA 1I3LA 4CMJA 3ZW9A 3MZ0A 3NX4A 1EQ2A 5IJZA 1V8BA 3LT0A 2HU2A 1LDMA 1GZ3A 1BXGA 1ONOA 1R0KA 1H2BA 3B70A 5L4LA 4CMGA 2AMFA 2W2LD 3WNQA 1HL3A 1ZK1A 1ZK4A 2Y0CA 3PQEA 4HWKA 4M49A 4CQLB 1C14A 3KBOA 5I7VA 4R51A 2I67A 3WTCA 2V6MA 5JDIC 3NEPX 1KS9A 3HE3A 1K3TA 1OMOA 3JV7A 4ZQHA 4B4OA 2X0RA 1O94A 2DTDA 5I9MA 4J90A 3ZNOA 1JKJA 2RCYA 3ADOA 5EERA 1H6BA 2FRDA 3H5RA 4WUVA 4OXNA 3UHAA 4PZDA 4E12A 5ICSA 4DMLA 4MJLA 3JQ7A 3C7AA 5F21A 1E7RA 4OKNA 4CLEA 1SEVA 2EF1A 4XQEA 5LDHA 1WDMA 2VN8A 1ZMTA 1HRDA 4AICA 4FDAA 4Y6PA 4YACA 4R1TA 1A27A 2VZ0A 4UUPA 4MP8A 1ENYA 2Q2QA 2DAPA 1M6HA 2D4AA 4NG5A 4TRNA 4BNMA 4E32A 3OF2A 3HB5X 4IINA 5BNTA 3IP1A 1SMKA 2UUPA 4MKXA 4XR4A 3C1TA 5C7IO 2VUSA 4OHUA 4Q3EA 4A26A 5JMWA 1YONA 3FSRA 1NXQA 3PVZA 1N9GB 4TKLA 3NTQA 2Q45A 4HKTA 4XDZA 1O9BA 2Q1TA 2HJRA 3EYWA 1IPEA 5JY1A 4PFJA 4XIYA 1T1RA 1B3RA 2O7SA 5EESA 4XYEA 1CDOA 3FHLA 3MJTA 1ZNQO 1XQ6A 2G1UA 3JQGB 3NKLA 4PLYA 4CPDA 2OZPA 1XQ1A 3I23A 3VPFA 4IQ8A 4XYLA 2ZJ0A 2RH8A 2Y1CA 1GY8A 3FN4A 3O8QA 5DBIA 4FOSA 4PLPA 5L45A 1LU9A 3JQ8B 3E9QA 4OMUA 3QWIA 2GN8A 4XGKA 1LBEA 3NT2A 4XYBA 3IIEA 1QR6A 4P8RA 1KVTA 1CQJA 2W2KA 3F4BA 3MOGA 5A9SB 4KTVE 4D7AA 1ADFA 1NPTO 2LDBA 4HV4A 2WD7A 3ZWOA 1X0VA 1S6YA 1E1MA 2FPIA 3L9XA 1P1HA 1ZK2A 4UAGA 5G4KA 1KETA 1E92A 1KEPA 1DHTA 1HDOA 3T7EA 2CNBA 3KSDO 3PK0A 4G5HA 4GMGA 1RJWA 4DA9A 2I99A 4IS3A 1H5QA 2C07A 3STHA 4J6FA 4Q3DA 3G49A 4BO2A 2RH4A 2AE1A 1WWKA 4FFPA 1QLHA 1RPNA 4XGNA 4CR7A 3LVFO 4MOWA 2HK9A 1YB5A 2GD1O 3DEYX 1D7OA 2H63A 4IMPA 3U4DA 2PD6A 2J5RA 3GHHA 3VZRA 1X7GA 4M8SA 5A4DA 4GGOA 2NU9A 3HHPA 4HNGA 1XIVA 2NADA 4ESOA 3PWKA 2NNLD 4D44A 1LSUA 2VTEA 4S1VA 2BI8A 2PWZA 1W73A 1G0OA 2JD2A 3DTYA 2Y1EA 3DBLA 4NFHA 4BIIA 4EITA 3M2PA 4RPLA 1Z73A 1C1XA 3PZBA 4B4WA 3D7LA 5I8WA 1ZIDA 4TZKA 3AUAA 4HBGA 4D3DA 4ZRMA 4ALMA 2Q4EA 2O3QA 4OYRA 2CFCA 3WGIA 3D4OA 3JQAD 4TQGA 1JVBA 5GZ1A 3ZU4A 2PZMA 3AM4A 2R00C 3OQBA 4NIMA 4D0SA 5B4UA 2VT3A 3LC2O 5TRTA 2D59A 2FY8A 1GADO 5KKAA 4OIMA 2QX7A 2E37A 1VLLA 1Z45A 3W4IA 5JNLA 4YWJA 3WR5A 3DFUA 1OFGA 5JYEA 1ZH8A 4IMRA 1P1FA 1UDAA 1DIRA 3DBVO 4RGBA 3FPCA 4BNGA 4KUHA 1GUYA 3Q9NA 2NVUA 4WCFC 3SLKA 5DNAA 1AHHA 1E77A 4BO4A 1QYXA 4IQGA 3OETA 3EZYA 1Q1NA 4OKIA 3ZWPA 3E6AA 1GUFA 3KYCB 2B36A 3RJ5A 1H9BA 1R4NB 1HE5A 3PGXA 4XIJA 1K89A 4NJMB 3COSA 3AY7A 1C1DB 1SNYA 4S3MA 4J91A 3JTMA 5L95A 5BSGA 3F5QA 4BNUA 1ZSVA 3D5TA 3EW7A 4NBRA 3HG7A 4WGGA 4CJXA 4BO7A 1N2SA 2OGUA 1B7GO 3TSCA 5A5FA 5JLAA 2HCTA 3D3WA 3ZW8A 1R66A 4ND2A 4TRRA 2XPCA 3MJ4A 3TNLA 2NWQA 4EW6A 4OSPA 5I7SA 2P9EA 3ZWBA 1PJTA 2V6FA 2D5CA 1GU7A 4Z0PA 3ZWNA 1UUFA 3DHNA 2GN9A 4QTZA 4B7CA 4YAGA 3W8EA 1SOVA 4Y9DA 1Y9AA 1DC3A 2NVBA 3JD2A 3MCVA 2HUNA 3RSHA 3CE6A 3F3SA 3NDIA 1E3WB 4E5YA 3ZU5A 3WYBA 4GWKA 4MVJH 3IP3A 2HRZA 2WSBA 3DAFA 4CQLA 5F3RA 5JAQA 2JD1A 2D2IA 4PIVA 2IEBA 4HADA 3A06A 5KVVA 3UXYA 3WWYA 2HDHA 3BMOA 2X0NA 1QG6A 1Z6ZA 3FNHA 4XB2A 1BXGB 3DFZA 1U3WA 3DBRB 1YXMA 3GVIA 4RZIA 4B8WA 5J23A 1HDYA 2FZWA 3IKVA 3EVTA 3PQDA 1VJ0A 3CIFA 3N58A 3QW2A 5T6BA 1QYVA 3HFSA 2P9CA 4BHTA 3QV1A 4AJLA 3MJVA 3ETEA 3CH6A 3MJSA 1E3SA 2I66A 1IHYA 1UR5A 2B83A 2PH5A 4BKRA 4IJUA 1V6AA 4YA6A 4CMEC 3PHJA 2P68A 4KOAA 1H0KA 4EGFA 1TLTA 1YO6A 2GUGA 3S8MA 3U5TA 4ZQGA 2HRBA 1MG0A 2W2LA 5H83A 2GASA 3FNFA 2AA3A 2CVOA 1SPXA 3JQ9A 1Y6JA 4RVGA 4RF2A 1EQUA 2WM3A 3GUYA 3A28A 4GLOA 3H8VA 2E82A 3G17A 4YXFA 2GRAA 1PJLA 1VKOA 4YDRA 1U2GA 1YB1A 2GZ2A 4B4VA 3M1AA 1BW9B 1KVSA 2GO1A 4CUJA 1F8FA 2DFVA 3I5MA 5EN4A 3DO5A 4QX6A 3PRJA 4DWVA 3FR7A 3CINA 4HX5A 3UICA 2AQKA 4L0QA 5A04A 3WGYA 3TJRA 1MX3A 3RUIA 2CUKA 3VH4A 3DC2A 1B8VA 5KIAA 1HYGA 3HDQA 3GAZA 5JCJD 4BKQA 1HZJA 4I8XA 4D46A 3DAPA 1EMDA 4WEOA 4IGFA 5LDGA 2FSVA 3I1JA 3CEAA 2AEJA 1A7KA 3UF0A 5IDXA 3VPSA 2BRUA 2W4QA 1HYEA 2BGLA 3AWDA 1RWBA 4XWYA 4HFJA 5KVQA 2C7GA 4CM9A 5ADHA 3TFOA 2QYTA 2OO5A 2JFGA 4ZQBA 1Q7BA 1X7HA 1Y1PA 4JK3A 5IDWA 1XSEA 3L4BA 2PZKA 4JBHA 3DBRA 4QO8A 5TIIA 4DXHA 5JBIA 1B15A 2EW2A 5LCXA 3V1YA 2B5WA 1PS9A 1D8AA 4AJOA 5L40A 1LRKA 3ZNNA 1A9ZA 3S2EA 4YJFB 2YQ5A 4UVGA 3WS7A 4MVJA 2Q1WA 1XEAA 1NQAO 4II2A 1I30A 1PJ3A 2X86A 4RLSA 2ZIZA 1YGYA 1OOEA 3H6KA 3H9EO 3BTSA 4BNFA 1EBUA 2EJVA 2DQ4A 2ZKLA 2XOXA 4I9NA 3V8BA 4BUCA 3H3FA 3KLPX 4J7XA 4DIFA 4W6ZA 2JCYA 1U28A 5COQA 5L9AA 4RDHA 3UKOA 1EVIA 4IDAA 2J3IA 1XA0A 2YYYA 3WGGA 1NNUA 1PZFA 1NQ5A 2YFQA 1QSGA 3TF5A 3JD0A 5IN4A 4NU5A 4G2NA 3TRIA 5AYVA 2PR2A 4HNHA 1EUCA 2Y1FA 5F5NA 2IODA 3F5SA 4AFNA 3HB4X 4BKUA 3VPHA 2X0IA 3UGKA 3F1LA 1C1XB 3GMDA 3OJ0A 1Z75A 1ZSNA 2VYVA 4MPDA 2A4KA 4B79A 1PWZA 3GR6A 4GVLA 2WMDA 3JQFA 4WNIA 4YJGA 5KNLA 3GY0A 2JFHA 1XWFA 1Y81A 2HK8A 1UXIA 4F6LA 3GLQA 4J4HA 4NU6A 1SZJG 3PJFA 1E3IA 4A2CA 1I8TA 4FJ2A 4ID9A 4N54A 1FK8A 4L4XA 5A03A 1I32A 4ZGWA 1UXHA 2VUTA 2DBRA 3ASVA 3FWZA 2AQIA 3OIDA 4RF3A 4IDGA 1QV7A 2EKQA 2R00A 3WIDA 5AQ1A 1DAPA 2PZJA 3LC7O 2XF8A 1E7QA 5COBA 1HYHA 4O1MA 1K0UA 1BGVA 5CG1A 1PGQA 4ND1A 4XJSA 2HSDA 1TT5A 2B0JA 3F46A 4TROA 5L7YA 3MEQA 3BMQB 1ENOA 4F45A 3U4IA 1YBAA 1ZZEA 4UUOA 1A72A 2QIOA 1Q7GA 2FWMX 2PFGA 1JLLA 1ZVMA 3UAGA 1XR3A 3PYXA 2FN7A 3C8MA 4ZHSA 1JVSA 3FBGA 1M2WA 1U4OA 4K1LA 4OL9A 2BKAA 3RBXA 1DRUA 3WMXA 4M54A 4DBVO 3WX0A 2Z95A 1M67A 2CVQA 2NSDA 2Q50A 3I9NA 1YQGA 3QA9A 4JJGA 4RL6A 4U5QA 4ALKA 2Y67A 1R4NA 3OA0A 3BHJA 1CIVA 5KJEA 3F1KA 3P2OA 1BTOA 1BMDA 2I65A 4WASA 4NQZA 2C59A 2X0JA 3KM0A 4IDDA 1GD1O 2R2GA 4IQ0A 4PLVA 1J5PA 3U3XA 5GZ3A 2O2SA 1YDEA 3FTNA 1U1IA 3TFQA 1XU7A 5FEUA 2DUUA 2VTDA 4KDEA 1QP8A 3QVOA 4F46A 2JCXA 4ILKA 4ZQEA 5JAMA 5CP8A 1HLDA 1HSOA 4UEKA 1XELA 2OP1A 2Q1UA 4R41A 4WECA 5T64A 4E2WA 5JAIA 5KCZA 4PLHA 4EI2A 1T2CA 3QY9A 5DZSA 3OIGA 4CLDA 4IIVA 1QLJA 4BKPA 1PL8A 2D1YA 5TX7A 5B4TA 4KTTE 4LMRA 1ISGA 4IDCA 1P45A 3DOOA 4UEOA 3S2GA 3S55A 1DIBA 1ADGA 4N5MA 1N8KA 4JJFA 4NK4A 2W2KB 5A9SA 4AJIA 4Y67A 3DOJA 5BNIA 2B5VA 1YL6A 2VCYA 4BGIA 1VI2A 1EVJA 1W0CA 4TRJA 3I83A 4GL4A 1UJMA 1GV1A 4P38A 3RC7A 3PHGA 3E1KA 2WWRA 5A1TA 4OO3A 5L7TA 2WEKA 3UCEA 1WMAA 1E7MA 2NU7A 3Q11A 1XYGA 3AUUA 1NBOA 4E30A 4PLZA 4I9HA 1GCOA 4WPGA 4YT4A 3NJ8A 3ZZNA 1PGNA 1DFHA 3PLNA 1VPDA 4YJFA 3ZWXA 1PQWA 3ON5A 3CKYA 2X5OA
chains in the Genus database with same CATH superfamily
2O2CA 4FW9A 2IQIA 1Z2DA 4MV8A 1C1YA 2VPYA 2G9VA 3PQ5A 2YUTA 4NENB 3BL8A 3S40A 1PSZA 3KAJA 1GSHA 4A6PA 3GN2A 2ZAIA 1J8DA 4D9KA 1H0HA 1Q0SA 4TTSA 4FKBA 3DR3A 5A0FA 3OOHA 3AFIA 3E18A 2TRSB 3Q5EA 3DTNA 3WDMA 3WYCA 5AM4A 5ABPA 2PV7A 2PAAA 4CL3A 3SM9A 3CR8A 5HF6A 5SY6A 1M1YB 1BFDA 1P3Y1 5AOAA 3NDRA 2R5WA 2I71A 4L8WB 2B1RA 1CF2O 4BNDB 1P18A 2QF7A 2YXLA 4YH1A 4YFYA 4HQOA 3RYFA 1QH1B 3RYCA 4GC9A 3RC2A 3GLIA 1PKEA 4L5BA 2QSYA 1E1RA 4Q24A 1R12A 2XXAA 2Z83A 2JNWA 5G3ZA 1PJSA 1U7WA 1W0JD 3OA2A 4HDKA 2H29A 3WKEA 5H1YA 2ID9A 2XAAA 4G1FA 1VHJA 4CCAA 3CKMA 2O2XA 3IVAA 5ALXA 2FMXA 1PZHA 1TK3A 2VYNA 4FUTA 5DM2A 2UXBB 5DF1A 2C5HA 2BFEB 2HDWA 4GEKA 2ZATA 1IL0A 1XTKA 4IJVA 3U49A 4BYMA 4BCDA 4CKBB 3DLCA 3JRWA 3OP4A 2H07A 2VDPB 3P52A 3QVWA 4GGPA 4TYYA 2HGSA 4L2IB 2FG6C 2EZTA 2VDMB 1XXHA 2ZAGA 4BNIA 1U4SA 2ZM5A 3P96A 1QDEA 3AP3A 4WZBB 3L84A 1SN7A 3KTAB 1AB6A 4WZBA 4JYPA 4AZVA 4XSGA 3V7NA 1Z39A 5EHXA 1VHDA 4PXYA 5C8XA 4HUTA 1YBVA 1Z9BA 4I66A 3EMVA 3GQBA 2XB8A 4MQ5A 3AI1A 3OJOA 5ISMA 3OQJA 1MC1A 1R0ZA 1UJBA 2H2FA 2ZROA 3HDVA 4L3VA 4R1PA 4YQYA 1FS6A 1NVTA 5DBFA 1FP1D 1FXUA 1XKLA 3L7IA 5K2MA 5B3LA 4ZO7A 3WL3A 2JLXA 3SS9X 1HSZA 1UADA 5LZ7A 1B8UA 4TL6A 3KHUA 5TJHA 2BIFA 4UVIA 2I54A 1Q0QA 1RIFA 4NQRA 5BV7A 1RFLA 1P81A 4BXOB 2Z5GA 1JX6A 1CULC 3TLXA 3C87A 1MFZA 1NAIA 3JQ7B 1A9YA 3EDRA 1C81A 4PPQA 5NULA 4KQWA 3ZYCA 3ZI0A 1WU8A 4OBWA 2D5LA 2I8AA 2AD1A 2GLUA 2I55A 1CQXA 4XTRA 3NFRA 3RYFB 3D3JA 1T6YA 2YL2A 1AO3A 3ND6A 4XI9A 1SZDA 2CDCA 2Q4TA 3GD7A 4F3YA 3SC3A 2DKFA 1PUJA 1ULUA 4R0NA 4ND8B 2OQVA 4ZGBA 4CDNA 1KU6A 1E6WA 1ADCA 4JA0A 3BMNB 3K9LA 3LNTA 2G63A 3ICPA 3NHYA 3O9VA 3P2KA 4GP6A 4C7OA 1QH8B 1QXSA 1W88B 2EERA 2M6SA 3F7OA 1YS6A 2H7VA 2P9JA 4BNXA 5LDDC 1R0LA 3ABZA 4XRGA 3DQPA 1JNXX 2HBRA 1TCCA 3BYZA 3KUKA 5F76A 4LY0A 3WL4A 3UH1A 4CWAA 1R00A 1XMQB 5ANRB 4ZZ3A 3QOFA 3DTVA 1BOOA 4DNQA 4DREA 4X62B 1L4YA 1UBEA 1T1JA 3R5XA 3GG9A 3E81A 4M0UA 4WN9A 4A6XA 1NF3A 4I4CA 3DMTA 1NVKA 2JGKA 4PPGA 1V4NA 4U6NA 5CFMA 5JECA 3LVBA 2IXEA 1R4MA 2HJSA 2WU4A 3P9QA 3G2HA 4LOJA 4CQNA 3A36A 4YY3B 2ORVA 3RARA 1GO2A 1RLUA 3R6DA 3ROQA 2XXJA 3MCZA 2OBYA 4RX1A 4W7HA 2VP4A 1VMAA 2YWCA 2AL7A 4XFDA 2C77A 1ZR4A 1OTXA 1Z2AA 1AZLA 1S96A 5JT1A 1E7SA 4PR3A 4R8SA 4H27A 2R68A 2PFSA 2E49A 1P9WA 3AI7A 4KQEA 1IZ9A 1JTVA 1S2MA 3DAHA 1PR2A 2B4KA 2IY9A 2UYQA 4QFBA 1ZD3A 1KQOA 2PUBA 3LCRA 5IFLA 2R6GA 5M29A 4ZTZB 5TT0A 1LB1B 1N2CE 1VHTA 1W1WA 1ZJ4A 2RH5A 4ARZB 3W5CA 1SVSA 3I5XA 1HMYA 3TNJA 1BSVA 5C32A 5IG2A 3SC2B 1PJRA 1J99A 1QYWA 2XW6A 5K6AA 1C4WA 1E9FA 3OZWA 1PEDA 5IJAA 4W9NA 2C9YA 1U0FA 3TZHA 3ZHOA 1XN1A 2YWJA 1OD6A 1IIBA 3MTDA 3OEWA 1AKUA 3R40A 2MTBA 2B4RO 3OZXA 2QRHA 1QP0A 3JQQA 4GI7A 1DIGA 3AVYA 1FMCA 2DFDA 1UPBA 3LE8A 5ICEA 3LOUA 4Y9TA 4CV3A 3FWHA 3UK2A 3QVXA 2GYUA 1FFWA 2DT5A 2JAPA 1EEXB 2ID4A 2JLQA 2BKLA 3BMOB 3ITKA 2QTVB 3NIFB 5J5CA 1Z2PX 4ZA2A 1FRNA 2O4UX 3CNBA 2TS1A 1ITZA 3JWEA 2YH2A 1U1EA 4NYJR 5DN6A 4ER5A 5GVSA 2H1CA 4L02A 3PJDA 3OZBA 3G9TA 4Q9IA 2QZ4A 1WF6A 1WXGA 4B6OA 5BV1A 4URYR 4IYJA 2Z2XA 2DX7A 2HJVA 2BEUA 1E4OA 1MVOA 3RUDA 3LQKA 1HDIA 3JQRA 2OCKA 3AV3A 3BB3A 1XL1A 3NH6A 2VHWA 4HLCA 4WKPA 5DBHX 3BB4A 5E7QA 1EFDN 2EWMA 3SNKA 3VHQA 5KVCA 4KSYA 1SOUA 2IXAA 5EJIA 3R7DA 1WF3A 2AXPA 4BFSA 2FA9A 4P7GA 3UCXA 1XWWA 1ONBA 2FUCA 1A0OA 1E2EA 3T4EA 1H1TA 4UPDA 1NTRA 1QGZA 2YV1A 3MJDA 3WDKA 5KJFA 4B32A 1DG3A 4REOA 2FEOA 5D2CA 1NMQA 1SHJA 4I5GA 2VA8A 1EWTA 2X3UA 3LF1A 5I9SA 2IITA 3C7DB 3L7OA 3PFWO 4J0DA 3G3EA 3HSYA 3TZ6A 4F72A 1ESZA 3E8XA 1L5WA 1PVOA 1TMOA 1T0HB 3A14A 3DBLB 4U8HA 3CSDA 1GA6A 3BFPA 2X9GA 3HYRA 2OAGA 2ZRNA 3CCCA 3A37A 3C3WA 2BL4A 4FMBB 4BB6A 1WDWB 1RI3A 3D64A 4O8ZA 3T99A 1KI4A 3EZ7A 3ZHVA 1N6PA 1QU3A 1KO1A 3DMHA 4KGDA 5FTMA 2PUDA 4P3KA 3LXMA 4FOTA 3TTTA 2JAWA 2QAGC 1UZNA 1U3TA 5GWXA 1LS1A 4WBNA 2W00A 5TGTA 5C81A 1U6KA 4JBLA 4H18A 4PYLA 4RANA 1J42A 1LSJA 4PHHA 2QZJA 5U1PA 5C46F 5EIEA 4W5RA 1ODJA 4I4TA 3U56A 1CETA 4RPGA 4D25A 4AZ0A 2AUMA 3BWBA 4UNQA 4LJKA 2YXEA 3EXHC 2DRIA 3CZMA 2HTEA 3D8BA 2WI8A 3W2EA 4LDRA 2PRIA 1CNFA 1G20A 3TEFA 1TYBE 4Y6RA 1FY2A 2QLBA 4XDYA 2WHPB 2Y05A 3W04A 4NWIA 4UOEA 2VEOA 4LQ4A 1SXIA 4KLCA 3VH1A 3HABA 4CMEA 1MIOA 3UT6A 4RPCA 2VTBA 4QXAA 4JYAB 2BGNA 3ICWA 4OAPA 4QG3A 4E13A 1CNMA 1UKEA 4BMCA 3MPUA 2I4IA 1BC5A 1DAOA 1Z0UA 1V1MA 2ZB4A 1LWNA 4LVOA 4HQ0A 4QGBA 4DAOA 2XVMA 2C7VA 4MVJD 2WYOA 2QJTA 3KQVA 2G1AA 1HG0A 5C3MA 2GN4A 3RRXA 1XF9A 2IV3A 1M73E 3CLHA 4D79A 5A6VA 5DNDA 1CSEE 5BMOA 3CC8A 4FFLA 4BAZA 1JHYA 3RS4A 3WKAA 5JXIA 5C7LO 2PBLA 4RQTA 4PGFA 2FWBA 5FIUA 4LV8B 5ICMA 1XEFA 1ISIA 1CZRA 1M2EA 2Z5LA 3D0QA 3IUSA 3OJCA 4H16A 4CQMB 1MJNA 2FUG6 3IVGA 2R66A 4BRSA 1Y8QB 1NPDA 2FZEA 4CM7A 3HPQA 4Q7EA 2V5AA 3Q9UA 4Q5IA 3BA6A 3ETCA 4KPGA 4WOCA 3OQ6A 2D2XA 1ZK0A 1WW8A 4TTVA 3OCJA 3X0DA 1XB2A 4EX7A 1AG9A 4TV8B 5DYTA 1ZCJA 3HS3A 1NVUQ 1MZPA 4RSHA 2Q3JA 3ZR4B 2FK8A 4IGIA 1E4EB 3BMNA 1PSDA 1UZAA 2EFCB 1JDBC 3GA0A 5GJVC 1R9NA 4L76A 1PWXA 2C1ZA 4KOEC 4D0GA 5UKDA 1DU4A 4QFDA 1K92A 5JPCA 2QVXX 4JV5B 2WG1A 2BZSA 4DV0B 4EQZA 4MULA 3NBMA 4DANA 1E1LA 2IZ0A 2JRLA 2P6NA 4DCOA 3V8RA 5BN3A 3URMA 3UMYA 3TQFA 2Y2VA 4D4HA 4G36A 3ZWVA 4TLEA 3ZVRA 5IXJA 2YWEA 1W36D 3MTEA 4B8ZA 2J41A 2YW9A 4XLLA 4X65B 3DAOA 3B3JA 4G0OA 3BCUA 1AGNA 1J33A 4O08A 2V0GA 2W70A 2WMYA 4KMMA 5FNVA 3LZCA 4NABA 1AQIA 4ZXFA 2HLHA 4JAVC 3ZI4A 4D41A 1X87A 1N2HA 5A7GA 4HVLA 2C7QA 2MT9A 2FEPA 2PVSA 3CZRA 2XB6A 3DR5A 3NHJA 5E6UA 4EJ6A 2J6IA 1AURA 4L4UA 1PNOA 1VXOA 3L6RA 3QVJA 3E9MA 2NQ8A 2VJMB 3F47A 4R9RA 1BEZA 1X7YA 1QGOA 1CUJA 1HE3A 3GQBB 1ETHA 1JHQA 5IW8A 3TNFA 4P0TA 3NGMA 2GJKA 1F4PA 5T7BA 4FN4A 1OWNA 1ISRA 1Y8CA 3C74A 3O1JC 3QX9A 5AJXA 1O9GA 1T2EA 4GHWA 3HV2A 3VX3A 5CFLA 1CUGA 2F9FA 2C4MA 2XHEA 4WX2B 1IBLB 4YTEA 1L5GB 4OA8A 1PQPA 2K5UA 2K2WA 3BIFA 3W5SA 3OQNA 5HKKA 3PC8A 3S0JA 1Y8ZA 1YRAA 2ZR9A 4JI5B 5G0TA 4PXAA 1TMGE 4Q3NA 3OKFA 1TEHA 2CFRA 4C29A 1XUOA 4AJ1A 2WYWA 1XQXA 5E9QA 1ZNXA 3JQBA 3QV2A 5JBQA 2M1ZA 1UC9A 1AA9A 4LCEA 4WLOA 1JXMA 1A04A 1USGA 3PL5A 3PU6A 4CM8A 2I2XB 4ND8A 1OLXA 4PX3A 3QBDA 4ZANA 4ZAVA 4YAIA 4HB4A 2QLFA 2GH1A 4MUYA 1E6MA 1T4DA 1JIKA 1B2RA 2OY0A 1ZZGA 3PWSA 1OE0A 3O92A 2Q6LA 2Q6OA 5BQOA 1LDGA 1OJLA 4J16A 4XGQA 4LMBA 5EEHA 3F5MA 1R7RA 1WUJS 1TVCA 1VG0B 1MAHA 4YBZA 2GTPA 1JDSA 5AK0A 2SKEA 3S2IA 1SXJD 4TWZA 1TI7A 2AVNA 3V2UA 1CJUC 1RBMA 3V8MA 4PRZA 3WP0A 1JEOA 1XU4A 3A1EA 5T4EA 1VYHA 5K0SA 2DYKA 4PEVA 4OQEA 3CRRA 2FPGA 1FXWF 4W99A 4K26A 4RHEA 4DXAA 3FOEC 4G0WA 3WBFA 3W5HA 3PQ6A 4B17A 2QU8A 3JXEA 3NV7A 2CVZA 1P3JA 2G4CA 4D96A 2W43A 3ND8A 2YIMA 2F1RA 5EJMA 3TJMA 4A8JC 4Q66C 4OXRA 2VBCA 2WTBA 4P3XA 5GIPE 4AKIA 1RI1A 3LVQE 4M1OA 2QBYA 3ZTTA 1GPWB 2VT7A 2CXHA 3O4VA 1CEEA 1V47A 4TV9A 3AXSA 2FDXA 1GGNA 2NP7A 2UXCB 3LYLA 1T2FA 1XALA 3FLAA 1U2PA 2BONA 3G02A 1V39A 4B3XA 1I4OA 1NVWQ 4LDZA 4QPDA 2A35A 1C7EA 4FHCA 4BFCA 2R7KA 2VHCA 2NU6B 4WSOA 5T67A 1UBCA 3NASA 1C2YA 5FBRB 2AE2A 1E6KA 3U7JA 1J9ZA 2IXDA 1YR6A 2GCIA 1JG6A 4JR0A 4BJ5A 5CYOA 2W0MA 3GC6A 1DV2A 2W98A 5LKRA 3KQHA 3A7DA 1N6HA 4NLLA 2XUQA 1JG7A 3C7KA 3X1YA 4LY6A 4PG7A 1TCAA 4EH1A 3C6QA 4JA2A 4B40A 3IESA 4GP9A 4Y6SA 3DLBA 3TW8B 1MGOA 1Q12A 3G2LA 4DBZA 3VVMA 5EEGA 1ZJJA 2GT1A 1MA3A 3X44A 1PK7A 2C5EA 4GUAA 3HGTA 3OI7A 4MCHA 2IDKA 5LP6B 2VDWB 2WG0A 3BICA 3BWXA 4NNJA 5HIMA 3U4MA 2XEDA 1PV2A 3EDMA 2BVNA 1QORA 3EDCA 2JF0A 3K92A 4V0KA 2AG1A 3QH4A 4DSAA 4JQZA 5CB4F 4LTMA 5C52B 4U2FA 4NAHA 1M34B 2WMNB 6YASA 4PGGA 1TK9A 1P33A 4UFPA 2ATXA 1OZHA 2VP9A 3KAQA 3KHTA 3CT4A 4FFVA 4NDAA 2CXPA 5ER9A 4QECA 3WGNA 4ZEMA 1NDHA 3OURA 3WYAA 4N48A 2B69A 2QY6A 4DZTA 3SY8A 2ZQ5A 3MBKA 4E5MA 3BIOA 1PL7A 4HH4A 4IIJA 3ILXA 4XLZA 1N5KA 2PX8A 3KWMA 1N6OA 1XZHA 4R68A 2FMKA 3UZUA 5FOSA 3ORRA 1BH6A 4L27A 4TTIA 4ALLA 2DG2A 4GKJB 1E2GA 4KNYA 1U5BA 2DFPA 1C9YA 4I5FA 2WUEA 3FR8A 1P1CA 3DT8A 3BFJA 4X7RA 3OWHA 1IZ0A 2I6GA 4Y6GB 1W34A 4IY1A 3ZGVA 2R48A 2JIBA 3AFMA 4B3SB 1XOIA 3RRJA 2W93A 1CUHA 1IB6A 1CYDA 2J6HA 4BTLA 2VQ6A 5K6TA 4OCZA 4URUR 4G81A 3VV3A 4O4IA 4M88A 1MVNA 4NE9A 3PNVA 4BV3A 4HYQA 1OHHD 5GIOE 3KKQA 2YXPX 1K66A 1XU9A 4NCAA 1XROA 3UM9A 4PC2A 3P9PA 2WJPA 1G20B 5FWAA 3B9QA 1KZ4A 4ZYXA 2G1PA 4BNJA 5IYZA 2R7NA 1J2TA 3LU1A 3GUZA 4GMFA 4YRDA 1THZA 1X8JA 3QVMA 5JH7F 2BF7A 3IMCA 4M6WA 3WWOA 5I9IA 1F4LA 1DPFA 4IIXA 1O9HA 2DR3A 4J3FA 2CD9A 5IJ0A 5C51B 4NAVA 4P1ZA 4BQPA 3TGWA 1SXGA 3P94A 3PVSA 4LXUA 2HR1A 3L6EA 2F67A 2BFNA 2Q5OA 4H35A 5BSKA 3R24A 1I3MA 1YVDA 2CJXA 3R5SA 4V03A 5DP1A 4F3CA 5BUSA 5K20A 1I2AA 3FOAA 4A27A 3OE7D 3NTRA 3MUFA 5A5VA 4Y1RA 2HB6A 4UVHA 3RRYA 4J1SA 3IPCA 5GOTA 2B98A 1IWOA 3K96A 1WUTA 4RTQA 1EFPB 4LC9A 3Q7IA 4IVRA 5E4FA 1ZXXA 1C0PA 3G8AA 2NPIA 3QM1A 5KYUA 2NV2B 5KDOA 3HBJA 2EV9A 2W58A 3GRVA 2LCFA 3Q0EA 2Q2OA 1E4YA 4NH4A 2I4LA 3M3HA 2GDJA 1TK2A 4JXJA 4Y9SA 1T26A 3E9NA 3DMDA 1IN7A 4FC7A 4HAXA 4BKMA 2EIXA 5JAZA 1QX4A 4IIEA 4NBVA 5TF4A 3AX6A 2XUDA 2DOKA 2AF4C 3IDFA 2I1WA 5DX0A 4BO3A 2JD0A 2LE0A 4X1OA 4X66B 3KLMX 2UUOA 4JC8A 4MEJA 4PF1A 1IJFA 1M2GA 3TAHA 3PEFA 1WULS 2YN2A 1K9SA 3GLVA 2QYSA 3C5WP 2EEZA 5DBGA 4D9NA 7REQB 3AI2A 1N77A 1N32B 1G16A 2KBEA 5TNXA 1DX9A 3AEKA 3FVQA 1XVUA 3E2IA 2PL5A 4IWYA 1AKWA 2IEAA 5EWMA 3MUOA 2XCOA 5E1MA 1RP1A 3Q6MA 1YR1A 3D5QA 2PPVA 5INTA 2X3FA 3IX7A 2IBMA 2X77A 5JCJA 5JSQA 3VC1A 1NBIA 3L3BA 4JL8A 4GBGA 3PJRA 3BA1A 2X15A 2C2YA 3PL1A 4HLUA 4F2DA 5FXMA 3GRFA 5P8WA 1FQOA 5KVSA 4PO3X 4PG6A 3N2ZB 2RAFA 2XCQA 3BJMA 4IOJA 3SKXA 4PHTA 5A5GA 3H2GA 2G9QA 3A2LA 3Q7PA 4KHZA 3PNYA 1WXHA 2Z4RA 4OJKA 4OYHA 2XKBA 2Q4DA 2ZM6B 1UAAA 3ZE7A 1QV9A 1KDTA 3FNGA 2GJAA 1EK5A 4DLSA 2FWNA 1LF5A 1B6TA 2Q1SA 3OFSA 1U6IA 3PI7A 3MN1A 5TEWA 5AJYA 3EZGA 5D51S 3SSMA 3VR5D 1JE0A 4DJJA 1LQ2A 3PR1A 4Q4LA 3UJDA 2J3HA 4XYMA 4A10A 4ZAXA 2RH9B 1GCGA 3FCYA 5FLXA 1OH6A 4Q7LA 2R7MA 2VXCA 3HN2A 1DEXA 5IZ4A 1H1LB 3HU2A 1VYUA 2OYCA 3WYEA 3PRHA 4ACBA 1RAAA 2AV6A 5KTTA 3GDOA 3L06A 4QA9A 3ZIAD 1R8SA 1RC1A 1XTQA 4UUBA 4LVNA 3IS3A 2J6CA 4LX8A 1MRSA 1BG6A 1UXGA 3I39X 3M9WA 4LQLA 3MD9A 4LXQA 4DRYA 4EJSC 2WE7A 1IEQA 3A8TA 1HRKA 2NZJA 1U1DA 5DM1A 1S7GA 2ZGVA 3HO8A 4BC1A 3PGKA 2R9VA 3SWWA 4AN1A 1H93A 5I3CA 5DWDA 3PDIA 4DSZA 3QLTA 3GJSA 1FQJA 1KJJA 4MQMA 2R60A 2XZOA 1KERA 2V9CA 2JFFA 1GN9A 4JC0A 2N3ZA 4RFSB 3I2GA 3NG1A 3TVTA 4YDQA 1EP3B 1QHIA 1U99A 2FV8A 1ZVQA 3QJGA 1U0LA 3KXPA 3MJEA 1JEDA 4WZAA 1SXHA 2HV9A 2FRVA 4OATA 3LSYA 4OA5A 3VR4A 2ONZA 5JRDS 1KJ8A 4DFDA 1X15A 4DB4A 5AI4A 3JASA 3A1TA 3LUGA 3W2GA 3PD1A 4BJ1A 4KQ6A 3OM9A 4JNCA 2ZSKA 3F9IA 2BCEA 1W19A 3JAWB 3CSUA 4LHYA 3W1VA 1K3UB 4NTZA 1JH8A 3EVBA 4F12A 4JX9A 1SBTA 4PC6A 1XDBA 1FP4A 1AKRA 1RCUA 3BHMA 2FPGB 1R37A 2RGAA 3DMRA 1B8OA 2G9ZA 3H2IA 2HV8A 4Q4JA 1CX9B 5AXDA 2EIHA 4KXFB 1VG1A 1Z6TA 4UE2A 1LK0A 4X44A 3AOGA 2BTOA 2JIRA 1PFVA 1OF1A 2W2PA 3U4CA 1RAFA 1ZXBA 4Z99A 5TT1A 4E3WA 1ZBQA 2XUHA 1YASA 3A7EA 2ZWPA 1BIFA 5AW5A 3ZLTA 3E22A 4O5AA 4EOGA 3AF4A 4MQLA 4LXYA 3E70C 3WMEA 3KXDA 1LUAA 3G0OA 2AZ4A 4Y0NA 3U16A 1LA2A 2ZCVA 1NFRA 2GDZA 1SD2A 3HLYA 3ULKA 2NYUA 2QZZA 4UQOA 5HRUA 1XRJA 4S12A 3TOXA 4URVR 2AX3A 4MRSA 1RJ9B 4WLUA 1MOZA 2AN3A 2W2XA 5B37A 4C03A 2P67A 1RLJA 4TT8A 2FJ0A 2FR8C 1L6IA 4MR8A 1ELOA 5DIZA 1QPGA 1DT5A 3BERA 3DT6A 3THWB 3QLVC 4BZQA 3U44A 3JQAB 4ZEWA 2O05A 5CIQA 2VXOA 1H8ED 3I5UA 3IQHX 1UDXA 4OB7A 3T1VA 2OBNA 3O7WA 1HKUA 2H1RA 5AM0A 3GIWA 3TB4A 1JHXA 3JTEA 2VJDA 4L5JA 1Q22A 2ODBA 4D8WA 2WSMA 4LXGA 2F8SA 3VDXA 4HZGA 4PSKA 2DQKA 4MDYA 4MVJF 4YB8A 2Y2UA 1WUHS 3AFNA 1RACA 1XYYA 1E7YA 1QS0B 3VTAA 1PW5A 2PWYA 1T6ZA 2XB2A 2CK3A 1YVUA 2VOJA 1TX4B 1GCAA 3MVEA 4G0QA 4M89A 4MQEB 4CZ2A 1HNXB 1SJ9A 3NQ41 4NZ9A 1T4BA 4GRIA 1KPGA 4BGUA 3GP8A 3ZJUA 2JHGA 4G5RA 5EI5A 4DMUB 5BR7A 5J2TB 1PZMA 3ADCA 4R5MA 2V0CA 2AFIB 1QRAA 2FF7A 4LJ7A 2I6TA 4TT3D 3QKSB 5JDCC 4UDXX 4JP3A 2OPHA 2VP2A 5B6IA 1UDBA 2QMYA 3OIFA 3N2EA 3OICA 4JD5A 1RHKA 2OZEA 4G84A 4TKUB 4UDNA 4X3CA 1OZAA 2LCIA 3CHYA 3W4KA 4YAUA 3OCXA 3WMFA 3PIRA 1M0TA 5HQ3A 1F7UA 3I1FA 4K0KB 2QU7A 4AP9A 2G08A 1EGHA 3ILVA 1BHSA 2LPMA 3K9CA 4RXUA 2I3AA 4DMKA 1KTIA 2GJ8A 1LJ8A 1JXOA 2WM8A 4IIBA 2OXFA 3GF4A 5ECYA 3PEUA 1G2QA 4O2BA 1X77A 3SZGA 2W2MA 1WQ4A 3EUAA 3TD9A 5G1PA 3BCSA 3DE6X 2OL4A 4CGYA 1UMCB 4MR7B 2HPAA 4XARA 4Q1CA 4GZ5A 5AOCA 1T8TA 4A8JA 2WVJA 3C97A 4QJIA 2PU7A 3PUIA 3OIUA 1BWQA 3IUJA 5JQGF 3V00A 3MNFA 4OH7A 5MFPA 3EGCA 5IAEA 4FS3A 4WK4B 4AF8A 2ADFA 1WAMA 4AY5A 3P71T 3UT5A 3L77A 1Z5UA 2ZJYA 3NEYA 2MYTA 4LRTB 2P40A 5EJ6A 2JAQA 2QBYB 1SFRA 4Z49A 1G6Q1 3B51X 1K5GA 1E0SA 5ITWA 1DNPA 2IF2A 3RDPA 3W4JA 1XCMA 1XXLA 2H3HA 3ZE2B 4YJHA 4DXDA 1WUIS 1I7DA 3QXXA 5LLDA 4EBBA 1GPBA 4B2PA 4EHNA 3V4FA 2FSPA 4DCSA 1NVAA 1E3WA 1KJZA 4H1WA 1DJOA 1RXIA 2J3JA 2QRGA 5F7ZA 2CUNA 2Y0EA 3EF3A 5LQMA 3KFXA 4EA6A 1G8SA 3JYQA 4HWRA 3OCZA 1D2CA 3MWGA 3IERA 4C0AC 4LZWA 5CU7A 2OFOA 4NYIQ 2P2GA 4Q16A 5CCDA 5ALSA 1UOPA 1XPJA 3NHSA 3U1TA 2PKRA 1QHFA 4OEHA 2PGIA 4NPHA 1E2LA 1ECLA 5CPBA 1N3LA 4EG3A 1W1IA 3AJRA 1G66A 4LVCA 2H1FA 3O8LA 4G0PA 1M10A 1ZONA 1IRIA 3I37X 3R0QA 1LNSA 4RKRA 5AJZA 3SMVA 2PLAA 2BDTA 4BVLA 1JT9A 3CLTC 1U2DC 4MVWA 3RU3A 5EPOA 3D5EA 5MN4A 4C6HA 4EUHA 2ZIVB 4MO9A 2C42A 4W5TA 3KO8A 3QNMA 4BO8A 1O6ZA 2AOTA 4P3OA 3THXB 5FAXA 3TG8A 1FSZA 1KK0A 2C88A 3NWPA 4HAZA 3W1WA 5KYTA 3C8ZA 2PO7A 4Y1RB 3FPAA 1GZ6A 1SU6A 2YYSA 1DV1A 1N1GA 3K73O 1V2GA 2Q3EA 3DOEA 3JYOA 3V1TC 5IKXA 1MT0A 1UZMA 4MS4B 1S4QA 5JXHA 1PHPA 1BCSB 4K05A 2G6BA 3ONDA 3PQ8A 3GJ0A 3ZU6A 2NGRA 3ONEA 3MWJA 2ZI4A 5HNKA 4IM7A 4Q7MB 3BGIA 1SUFA 2XNKA 4YDSA 1BE0A 2PNFA 1D2RA 4PG8A 1IFXA 2R6JA 1GFZA 3WWPA 2NXWA 4JYCA 4DR1B 4X45A 5K0TA 3U19A 3QHAA 1GKUB 3EYAA 3RVNA 3HTXA 1WB5A 3QXSA 1T9GS 3PC2A 5IABA 1GOTA 3P9KA 2F64A 1DO2A 1SXPA 1KF0A 4ZQIA 1F06A 4ZCTA 1SIBE 4Q48A 2R8RA 4OH1A 4UNRA 5I7EA 4HXGA 1G5QA 1W4RA 4C08A 4RMHA 5CITA 2YDXA 3AZPA 1UPTA 3DKVA 3FYUB 4MGYR 3S7TA 2B25A 4XIGS 2IFTA 3B8EA 4EQ6A 4AJPA 3FH0A 1C0KA 3GFSA 3UQZA 1UBRS 1W2GA 3A4VA 4D98A 1FNMA 2YN4A 4JI1B 2VNSA 4DG5A 3DM9B 1QANA 1Z6YA 3KQMA 1NPYA 3G7UA 1KEVA 3Q15C 1LLFA 4JNKA 4OF4A 1ZD4A 2RHMA 1I36A 421PA 2DGDA 4L57A 2IHNA 2AQ8A 4KR9A 2V7XA 2HMUA 3H9JA 4UM8B 2GBPA 4XYGA 2GPYA 3RROA 5BN3B 5TPZA 3ODGA 4DT1A 3GJZA 2NUTB 3HUDA 1KSJA 5EYPB 3FROA 3OC6A 3ITEA 4G5FA 4UKDA 2DWUA 4HEA6 4TGLA 1T13A 1ACLA 5FFNA 3BH6A 5HRCA 3IR7A 4KR2A 1X74A 3W7AA 3EJWA 2FRDC 1AK9A 5K9ZA 3A3PA 5DRTA 5JXGA 5HMLA 2ZVJA 5DTRA 5IDYA 2Y93A 4LIPD 3SAJA 1R6AA 4HRXA 4KAFA 1PJZA 3GLUA 4AU1A 1UWVA 1ZAKA 4BEVA 1YBMA 3HJCA 2NO0A 5T4HA 1QVWA 4PG4A 4I14A 2GCPA 4BP9A 1Z25A 4QEDA 4P7JA 5H3LA 1J2RA 4MRMB 4LE1A 1GL3A 4LQCA 1ZAYA 4H6PA 4YV2A 4OX9B 4M46A 4HH0A 2XZLA 2VSXA 4RU1A 2OCAA 1FU7A 1W5AA 1IXRC 3BXZA 3Q10A 5EXSA 3BVPA 4D92A 1I1OA 1M1YE 2OUKA 5EE9A 4E5PA 2PXAA 3KHSA 4TVBA 2IGBA 2AW5A 5D8DA 2DFKB 1G38A 4OQQA 1ARZA 3IE1A 1R74A 2NO4A 3CWQA 1E2QA 5DCYA 3I6BA 4MWZA 2HZ7A 1W48A 1T5OA 2QAGA 3BK2A 3KEQA 5C4IA 1D5WA 5LLTA 5DV9A 2D06A 4DSUA 1ZOPA 1SVIA 1DEAA 4EHLA 2EKPA 3HCWA 5KOIA 5BQ5A 3V4OA 1MO5A 1EX9A 1RCTE 2H5LA 5LU8A 2QTFA 2B8NA 2E4XA 3GFBA 1DZIA 1TFUA 4NV1A 5IDQA 3OZFA 3TW4A 1PS8A 3AY6A 1BJRE 1CUCA 3IQGX 3RT1A 5I4KA 4EFKA 2IXBA 1C0IA 1L2TA 2IIPA 1Y5MA 2VP6A 4A73A 5BQFA 1VM6A 1JRLA 3B6ZA 3JQ8A 3FIUA 4EUNA 1G8KA 1GR1A 3UB2A 1J90A 2G8NA 2QD5A 3FDZB 3DLIA 1E69A 5EMJA 3TTYA 3GLTA 1M74A 2J0UB 4LC1A 1E18A 1EZ1A 3WFIA 3FOFC 1E79D 2CJYA 3S99A 4BLSA 2IUEA 2JGLA 1RYYA 2PL1A 3FJYA 3B52X 3KKMA 3HXOA 5B1IA 3HJFA 1NW9B 3W34A 2ZYHA 3S1LA 4YO8A 3TBHA 3WGQA 1JXQA 2FZGA 3FI9A 4JJKA 2IYPA 1JEQA 1EFVB 1ZKDA 2BJWA 1HBJA 1OXSC 4N7BA 3OE5A 1BNCA 5FNVF 5E8RA 4Q39A 6AT1A 5FUQA 3EFBA 5JTUA 1H23A 3LUJA 2WJZB 3KOMA 4Y2RA 3C45A 3LBHA 4JP8A 2GILA 3EPLA 3IJ5A 1UJ4A 3SJZA 4HQ6A 3NEJA 3K1AB 1AJEA 1YRYE 1THMA 2IUUA 1ZD2P 4M2LA 3SVTA 5C1PA 4ER6A 3LAWA 5NLLA 2WAAA 4KAXA 4DA6A 1M7GA 1ZMBA 2ZJ3A 5EG5A 1KY3A 4JBXA 4YMLA 2DJIA 1M2HA 2XMRA 1F3LA 1GPAA 1MPXA 5EAIA 2R0QC 5KTNA 1GZ5A 1P4AA 2WE8A 3F90A 4NBTA 3WAJA 2VT6A 3CWZA 3E9RA 8MHTA 1PJQA 2PX0A 2O8VA 3FLEA 1ZM4A 5FBVB 3LQ1A 1GNTA 4B3GA 4ZKEA 1BDHA 2ZRDA 3HZHA 4JZKA 3FVVA 3Q7TA 3KKKA 3U7EB 5JDCA 4P58A 4LSZA 4X1YA 3WLQA 5E7JA 5KNBA 3D2CA 3DT9A 4IBOA 1U94A 1K98A 1Y3BE 5EKUA 4H1UA 4DCUA 4HN4B 3EGEA 4PNEA 3PD0A 5K8LA 4RS4A 4ZALA 4R98A 2FW6A 3OBBA 4HZUB 4YCNA 4RLHA 1PKXA 4YCMA 1B76A 1W4AA 3RF7A 3IALA 6ADHA 4IKEA 3TKLA 1XRNA 2VYVD 3JZAA 4RVSA 3WQQA 5ALTA 1U0JA 2DR2A 2QT1A 1OTYA 3AUTA 3EOBI 5E4TA 1UFVA 3H3XA 2I1VB 3UA3A 2AR0A 1BE1A 4WLFA 1SCBA 4YP0A 5A7HA 3SDZA 1TW3A 3NHWA 5I7UA 1FDOA 1KEEA 2O4CA 3RADC 5JAUA 4IIUA 2UVDA 4R2MA 4BZWA 3QMVA 1G8JA 4A8JB 1U04A 3BCRA 3U3MA 3SGLA 4LYYA 2OORA 1QUEA 3SX4A 5C18A 1I0IA 2NAPA 3QFHA 2WTAA 1L4KA 1XJWA 4CR8A 3VSBA 1KK2A 2DQSA 3O9ZA 2QR2A 1H2HA 4FE4A 4BVAA 2NO7A 2YIDA 3CVJA 1FUIA 2EKZA 2C3UA 2Z2KA 3CQ9A 1GPH1 3L7DA 1PX0A 1UOEA 2DUJA 2JJ8A 3AUKA 3IA2A 3ITNA 4FZ5A 5F3DA 1T8PA 1YIAA 1ZH2A 4OU5A 2CXNA 3TE6A 4AZ3B 3OH8A 3UXMA 4NPCA 2CLFB 5JC1A 4QQ8A 5DM4A 5BYAA 2NU6A 5L7WA 3VNUA 5JG7A 4M1MA 3D6NB 4RVCA 4DIDA 4QHYA 5JY6A 2BD0A 1MJFA 1KQNA 3MOIA 3SYTA 2O1SA 1EFRA 2ZJAA 4OXKA 5E9AA 1U0OC 2OXEA 1NE7A 4J3JA 1MO3A 1ULTA 4PZCA 4V3BA 4B31A 2F8MA 3UMVA 2DUWA 2X22A 4FYIA 3FPFA 1JEEA 1ZXLA 1C7QA 4MPPA 4UTVA 1E2FA 1E2NA 4JP5A 1COWA 1NVGA 3B3FA 3QXHA 2V7PA 3QWBA 3OQ1A 4IDEA 3EW9A 1FYEA 3W3AD 4A2WA 3PNQA 4MQEA 1QRUA 4NFSA 1V2HE 2D1QA 3DNMA 2VZ8A 2RGWA 3PJGA 3PC6A 2HQSA 4W82A 4D80A 4FGWA 4XQCA 1Q11A 2AOVA 2BFAA 3R1IA 4EHKA 1NATA 3JYHA 4DCPA 4CF6A 3B5EA 4EO4A 4QM7A 4DZRA 4ZICA 3WKCA 3FF4A 2A4MA 1WOYA 2AEMA 3KXKA 1GFIA 1NBHA 3OLCX 1NMEA 2CJFA 3T7RA 3VISA 3WOVA 2I76A 2C8LA 3CLRD 3D3WB 2FN9A 5IARA 4BLTA 1DC4A 4LZJA 2GARA 2VHQA 2VAVA 5E3JA 2VNAA 3QVUA 4OHMA 4KVFA 5EQFA 5EXPA 5F3WB 2VT2A 2WF8A 3T5DA 1SULA 3G88A 4FGSA 4E51A 1VBNA 3EODA 1X13A 4EUSA 3IBCA 2CE2X 1MP0A 1M6WA 3DD5A 1CZKA 5ES3A 1P7PA 3L0SA 1ZO8A 4Y2GA 1MAUA 3RHZA 4E4YA 4ZI3A 4J3NA 4J03A 1V6CA 2P2SA 4CYMA 1JIXA 1FFDA 3IAM1 4NJOA 3HCPA 4ETWA 2I6UA 3IT3A 2AK2A 1OFTA 4W5NA 4Y7CA 2H2HA 3SBEA 4GRDA 2IY7A 3A32A 4ZQCB 2DJ5A 3FTEA 2KWIA 3WTBA 4MDHA 3CE9A 1RZRD 1E4EA 3IE2A 1ZNYA 1OLSB 3L82B 1A8UA 3GLIE 3ET4A 2X1HA 3RODA 1WB9A 3F6PA 3I9OA 4BWFB 1J09A 4CETA 2C82A 1HTBA 1GG8A 3IMFA 3KE9A 1BHQ1 1XF1A 4GYWA 3REQA 1CVIA 1VA5A 2VWQA 1N7GA 1VZ2A 3IDQA 3OHMA 5ELLA 4CE6A 1HY3A 3M4XA 4QUHA 1OX4B 2QNBA 1Q2XA 3LYAA 4J7UA 2QTCA 4PGAA 4WEQA 3U0BA 4DPMA 4KCGA 5L3VA 1SVOA 2IUFA 1ABFA 2VNKA 1A96A 2CMHA 1RWMA 3EXEB 4KGVA 3IIMA 3FDXA 2ECOA 4IOKA 1QZZA 2EJWA 3FXAA 1RAGA 4RHXA 4CIAA 1QVZA 2O7QA 3QU2A 2QG4A 1XXHE 2Y4NA 3LLVA 1YNSA 3BD9A 1KVRA 4GX5A 5HQTA 1F1JA 3ROFA 2IYVA 3V1LA 2HSJA 3G1UA 4HGNA 4ZT6A 1I4LD 5KSWB 2WG2A 3G9ZA 2GZ3A 5DEIA 4NH0A 1QIMA 4HDSB 1YC2A 1RZVA 2DSTA 2W11A 3QRWA 4R2XA 1LCIA 1H1LA 3D6UA 4RVUA 5GZ6A 3U60B 2XLBA 1FQKA 1FCJA 2HA5A 1G18A 1NU6A 5FBLB 3VYTB 5KYUB 1XTTA 1LV7A 2L69A 4YRCA 5EUQB 3EZXA 4UAJA 1BRMA 4NHEA 5IAOA 3VKHA 4EFDA 3TAXA 5KC9A 1X19A 4J1TC 1Z29A 4KXNA 1XL0A 3TZKA 4HAOA 1QIKA 4NJMA 4YCBA 2R4UA 4JN6B 3V97A 3EVFA 2RHCA 1RLTA 2HF7A 3AC0A 3T15A 1ANKA 4CKEA 4AROA 4B8YA 4KFSA 1YZGA 4TXMA 2ASVA 3EVNA 1EB8A 4KN9S 4NOMA 2OESA 5HPYB 1X70A 3E8MA 3PTLA 4TTAA 3D6TB 3PGJA 4BGEA 4X95A 3ENQA 4FBMA 3I2HA 1HEUA 4WBNB 3ITDA 4CKEB 5K4AA 2QAIA 1YE3A 2R8OA 5KX5F 1JT2A 1XRSB 5EJFA 4JITA 1W0KD 3KUXA 1A2OA 2P4HX 3FGPA 1EFKA 3GLKA 1G5HA 3SLGA 5FD8A 3V80A 2MINA 3LFHA 1PS0A 3VZQA 3WHIA 1KNQA 2OT3B 3ZZ1A 2OEPA 1ZA1A 1JQKA 2GXSA 5CH8A 1B0AA 4NYJQ 4YNBA 4KN5A 5JAPA 4F06A 2EFYA 4UBKA 2I4RA 3NYRA 4OPMA