1WMBA

Crystal structure of nad dependent d-3-hydroxybutylate dehydrogenase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
MLKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
publication title d-3-Hydroxybutyrate Dehydrogenase from Pseudomonas fragi: Molecular Cloning of the Enzyme Gene and Crystal Structure of the Enzyme
pubmed doi rcsb
source organism Pseudomonas fragi
molecule tags Oxidoreductase
total genus 92
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wmbA00
1GD1O 2ZB3A 1JAXA 3B20A 3OA2A 4WKGA 3T4EA 3WNQA 4J1QA 4BNGA 1QRRA 3WFJA 4RDIA 4O59O 3L6OO 1IB6A 3UAGA 2GO1A 4W99A 2HRBA 5BSEA 1LDGA 4ZN6A 3LT4A 4Z9YA 5JDCC 2GCGA 3V1TC 3KLPX 3TFOA 5TJ9A 4YAKA 1ARZA 3DAPA 4DPLA 3NTRA 5MDHA 3B1KA 2B0JA 4H16A 1KEPA 4KZPA 1BGVA 4BNZA 1E7QA 3H9UA 3I9JA 4QO8A 1Y5MA 4WLVA 1BVRA 1H9BA 1E7RA 3QLJA 1PL6A 1KVSA 3DBHB 3KTDA 4HBGA 3WSWA 5IF3A 3G1TA 3MJ4A 1GZ6A 4ZGWA 3CUKA 1QXSA 2OBNA 1UJMA 1YVEI 3HB4X 3F6YA 4DIBA 3CSDA 3E9MA 4BO4A 5CEEA 4UULA 2QRLA 5K6AA 1YGYA 3A28A 3UW3A 2OO5A 4KUEA 1AUPA 4E32A 4OSOA 5AXAA 3HZZA 4M8SA 3H9EO 2DTDA 4RPLA 4Y6SA 2G82A 3LSYA 1W8DA 4D43A 2J8ZA 3ROMA 2DKNA 5B12A 2C2YA 5THQA 4WK6A 4WOJA 4GLLA 3WYCA 1QSGA 2YUTA 4JJGA 2P5UA 1A9ZA 1ZNQO 4QO7A 4IJWA 3Q1LA 3F1LA 3M2TA 5GZ6A 4R1NA 4HX5A 4UAGA 4AL4A 4JBIA 1PL7A 2VCYA 4DBVO 1PSDA 3JQ8B 1IHYA 3DXFA 4CV1A 5TIIA 4BQPA 1EBUA 1F0YA 5KJ6A 3GC6A 2Y99A 3N7UA 2E37A 3BMOB 3GZNA 3GVHA 4DBZA 2HUNA 3FTNA 4P4LA 5BR7A 5L4NA 3BHMA 2GD1O 5CAEA 1HE3A 2IZ0A 3NV9A 4BV9A 1JVBA 2HMWA 4BGUA 1T4DA 1BHSA 1GU7A 2BF7A 3SVTA 1PS0A 2UYYA 3RC9A 4O5OA 3TPCA 1BXGB 3OJLA 5JXWA 4II2A 2TMDA 1U1IA 4NBUA 2FSVA 4AFNA 3E5MA 3C7DB 3HDJA 1MXHA 2O2SA 1UDBA 4HUJA 1E3LA 3GVPA 4PRLA 1V9LA 3ZV5A 1T1SA 1UP7A 4BV8A 5DBGA 4KP7A 3RASA 4PG4A 3M1AA 3GT0A 2OBYA 5KTKA 4IUYA 4NBWA 3WJ7A 3RAJA 4TROA 5L40A 2WEKA 1YDEA 3JQEA 2OZPA 2C59A 4PG8A 1P1FA 1CWUA 1LRJA 9LDBA 2IXBA 2GGSA 4ZJUA 1FDSA 1HRDA 4IS3A 1GR0A 3MJTA 3WSVA 2NVUA 1T2AA 4PVDA 3ZHXA 4N5LA 1J0XO 4KUHA 2OMEA 1B2LA 3GRKA 2VOJA 3M1LA 1E0DA 3SBOA 2FZWA 5BT9A 2X5JO 4J4HA 4BGEA 1Y8RB 5HBRA 4RJTA 3PWSA 4XDYA 1E3EA 4DWVA 4GBJA 4NK4A 1K6IA 2VHXA 4MPDA 3NRCA 3PWZA 4Y98A 3QWAA 5A9SA 1YBVA 4FIZA 1ONOA 3T4XA 3HDHA 4WCFB 1DRVA 2EKQA 3DB2A 4GX2A 4YA6A 2DBVO 4B4VA 5JNLA 2YFQA 3CKYA 3DHNA 3KYCB 4YJGA 1RM5A 1DBVO 4XIJA 1X7HA 3SX2A 4CMKA 2GN8A 3KV3O 1B0AA 2V7PA 3ROQA 4M55A 5L7YA 1PJQA 1I2BA 2GPTA 4HFRA 1RM0A 1P77A 2AXQA 3IUSA 4UEKA 5BSHA 4Q3CA 2X0JA 3GEGA 2JFFA 4BKOA 1DC3A 2FN7A 2JCYA 4PLCA 1OZAA 2E4AA 4MVJF 3OEYA 1X1TA 3WWYA 4TZTA 3SLGA 2DU8A 2P9CA 3DBRA 3GA0A 3D7LA 3OQ1A 4WECA 3ADOA 2POQX 5FI5A 1NBOA 4RQUA 1OI7A 2NVWA 1ZSNA 4TRRA 2EF1A 3W8EA 5L3ZA 3LT1A 4WNCA 4EEZA 4L76A 1O95A 3JQ7B 1FMCA 2JD0A 3NGLA 2VRBA 2VZ8A 1A71A 3TZHA 3JD1A 3SJUA 3UF0A 1H2HA 3DL2A 2QZ9A 2AQIA 4PLPA 4DQUA 4Q3NA 4J9UE 3WJAA 5EINA 3ZV6A 1T2CA 2A4KA 3GMDA 2I99A 1DOHA 4E13A 3WTCA 4CMBA 2HMUA 1NPDA 3INRA 4B3JA 4ESOA 4NBTA 2RHRA 3D1LA 5G2OA 1PS8A 4IZIA 3D3WA 1U3VA 1UDAA 4M49A 2B35A 1B8UA 1VE9A 1LTHR 2I76A 2R00A 3TZ6A 3SEFA 4EYEA 1K3TA 4FFNA 4YJHA 3GPDG 2IZZA 4JJFA 4B4OA 1T25A 3ORFA 1N1EA 1KERA 5KIAA 2AEFA 4YT2A 2DFDA 3KYDB 2UAGA 3ZWNA 3I4FA 3I23A 1SO8A 1JAYA 2X86A 5EL0A 4BHTA 1ISJA 1RYDA 2GR9A 5J23A 5B4TA 4YYZA 4R16A 3L6DA 5JAZA 2C0CA 1YBMA 4DC1A 1IL0A 3M6IA 4AJ4A 5F1KA 1UZNA 5KJCA 2PGDA 4YBZA 3U9LA 5T57A 9LDTA 3ETDA 2EJWA 3OP4A 5FYDA 3EW7A 3CXRA 4E5NA 2FWMX 2DQ4A 1EVYA 3G49A 4A7PA 3NGXA 3ZHZA 5A1TA 4IQGA 3BMOA 5A05A 2Y0CA 4MVJD 3ZWCA 5K0ZA 3RD5A 3A14A 1GTMA 4RGBA 2QZZA 4BS9A 1VJ0A 4YT8A 5CDTA 3VZSA 5G4KB 3OH8A 2BFOA 1DB3A 1NFQA 4XRRA 1BXGA 1ZK0A 2VNSA 4UEOA 3DMYA 1MP0A 1UP6A 4RL6A 3AM3A 4R4JA 1WPQA 3S55A 1JU9A 1U8XX 3VTZA 2JHFA 4E4YA 1X13A 4MVJG 1I10A 1W73A 5JY6A 4NZ9A 5JC8A 3VHRA 2CDCA 2H9IA 3DMTC 3MJEA 5DP1A 1LDEA 3H6KA 1SMKA 3VKVA 4IJKA 5TX7A 2EW2A 4MVJA 4DRYA 1CEQA 1Y9EA 4XYEA 4E2ZA 4GI2A 4MKRA 5EMHA 1EVZA 3TN7A 2Q1UA 5IDWA 1X1EA 2PZLA 1RYEA 5IZCA 1GYQA 3PZBA 3GVXA 1ULUA 2B4TO 3WQSB 1JWBB 3HSKA 4JNKA 4PCVA 1JWAB 1CRWG 4IPTA 1KVTA 4XQEA 1LC0A 1UZMA 4DIOA 1PR3A 4Q39A 4BNLA 1Y8RA 1PGOA 3D5TA 3I6IA 4ALNA 2NU7A 4D44A 2P91A 1D4FA 5TLSA 2E49A 4BNUA 2LDBA 3BMQB 1Y81A 3IP1A 1YO6A 1DC6A 1NAHA 3QWIA 4EW6A 2OHXA 3DQPA 2GYYA 4YQZA 1HDZA 1O0SA 4BNKA 2NADA 3AI1A 3U0BA 2PGJA 3HDQA 1KC3A 1T1RA 1HXHA 1GV0A 3ST7A 2B4RO 3UHAA 3BHIA 4FR5A 5IDXA 4AJPA 3LDHA 4CUJA 1GDHA 5DOVA 1ZFNA 3LF1A 3G0OA 4J4TA 2J3HA 3E9NA 4IY1A 3R3JA 5ICMA 2EG9A 3NYWA 2C5EA 4BNWA 1P3DA 1YONA 2HDHA 4MP6A 1GYPA 1PJ2A 3OETA 1DFIA 1HDGO 5EIOA 3UN1A 3AUSA 4AICA 2XXBA 3ZNQA 3PJGA 4J9VA 5F1OA 1K0UA 4S1VA 4L4SA 6LDHA 4Z6KA 3QVOA 2C82A 2ZJ1A 4CLEA 3U09A 1R4NB 1JTVA 2CNBA 3BHJA 3PZRA 5TS3A 4B7XA 2WSBA 2BKAA 2J6IA 3WICA 4BNJA 1XQ1A 3GZ4A 3ETGA 2D4AA 3V2GA 1Z45A 2FPPA 4LSMA 4K6CA 4OO3A 1KVQA 4CM4B 2Z5LA 3BIOA 4JBGA 1LSSA 5CHEA 2NU6A 2Y93A 3NEPX 1ZK3A 1Z74A 3TOZA 3PRJA 2D0IA 3DZJA 4M89A 4LW8A 3AM5A 2Y05A 4KDFA 2W98A 4PG5A 4DQXA 2Y1EA 2X23A 4M86A 4NI5A 4TKMA 1HDRA 4BNIA 2O3QA 3GDFA 1H5QA 2FR0A 4J7CA 2EKLA 2HK9A 3PYMA 4N7RA 5L45A 5JAQA 1HE2A 3FNEA 1PQPA 3ANNA 1QMGA 4EJ0A 2NLOA 1NTOA 1KY5A 3PFFA 4D0SA 2V6FA 4NPCA 2AE2A 2Q2WA 1DHRA 3IOYA 4BNVA 4BO9A 3GEMA 1P1HA 4MJLA 3IDSA 4IDDA 5GZ3A 2DBQA 1P1RA 1QG6A 3KYDA 3VDQA 1E7YA 6ADHA 3KZVA 3RBZA 5K9ZA 1TI7A 4BGVA 1DO8A 3WYEA 3A06A 1SNYA 5ILGA 4DMMA 5JCXA 3QA9A 1I3KA 4UREA 1LLUA 2VHWA 3VH2A 1R66A 1VJ1A 5CEFA 1GUYA 2VZ0A 3D5QA 4I08A 1Q7BA 1YH3A 1M2WA 4D79A 3SC6A 3TQHA 2C29D 2HJRA 3GPIA 4L73A 1Y1PA 4WCDA 4XGNA 1BXKA 2O7SA 1SAYA 2I67A 4DREA 2YDYA 4DMLA 1F8FA 1N2SA 2DT5A 1QP8A 2ZTLA 4HFNA 1NQ5A 2Q50A 4EJMA 1H9AA 5A04A 4DYDA 1AXGA 4C7KA 3OQ6A 2PTGA 4DTIA 3VPXA 3KO8A 3CMCO 3PHIA 5TQVA 3R1IA 4CM5A 3I9OA 3PWKA 4MKZA 1X14A 1HYEA 2EERA 3K8ZA 4Z0HO 3RU9A 1Z7EA 5DCWA 1KS9A 2YZ7A 3EYWA 4J16A 2C5AA 1LRLA 1R15A 2FR1A 3KM0A 1KBZA 5EJ2A 3WQRA 4NJMB 4E2YA 2BHLA 1GPDG 2Q4BA 2ZTMA 4OKIA 2VWPA 1YB1A 1I5RA 5GMOA 1OAAA 5JFOA 1JN0A 2BD0A 3DHYA 2O3RA 4J43A 1CQIA 5IFLA 5I8WA 4FBGA 4OXKA 1ADCA 2ZTVA 1HETA 3OBBA 3GZNB 3F4BA 4GKBA 3PLNA 1WNTA 4B7UA 4WJZA 4KWIA 5FEUA 1LDNA 1OMOA 4IDFA 4J4BA 3AFNA 4J91A 3HWRA 3GVCA 4XYBA 4BKRA 3FNGA 3OJOA 4GVXA 3PJFA 1IYZA 3OF2A 4XB2A 2P5YA 5T67A 2PKRA 1P0CA 3WYBA 4RF2A 5LDGA 1C14A 3FBGA 1LLCA 4EUEA 4MVJP 3U4HA 5G0WA 5B4VA 1Z82A 1XU9A 4I5DA 4DXHA 3GG9A 3GEDA 4GH5A 3PIIA 3KHUA 2X8LA 3W4KA 3FNFA 1EVJA 1BXZA 4TQGA 3QVTA 1BWSA 4RLHA 1ZBQA 2GERA 3BXXA 1HYGA 2GNAA 3ICCA 4OGWA 3FR7A 4Y8VA 4MVJI 1NHWA 2GUGA 3JYOA 3PHLA 1NXQA 1HSOA 5L53A 4WASA 4XYLA 3OA0A 1MV8A 2A94A 2AEJA 4XYGA 1M6WA 2AMFA 4QECA 3GDGA 2I9PA 5U4QA 1HT0A 4JK3A 3TWOA 4BO5A 1ZKMA 4ZQFA 1B3BA 4IGFA 1P45A 4FD3A 3IKTA 1HDYA 5HS4A 1O89A 2O50A 3MOIA 4CLOB 3Q11A 1XQ6A 2ZQZA 4ZHSA 4G81A 3KUXA 1MFPA 4Y9DA 4WLNA 2WYUA 4B3HA 1IOLA 1B15A 5A9SB 4FJ1A 2PD3A 1R4NA 2AG5A 2HKIA 3RSHA 1LBEA 3TSCA 3WGIA 1S7CA 2DLDA 4WEOA 3L4BC 1U8FO 5A3JA 2G0TA 3KB6A 2GDZA 2JD2A 4M87A 3PLRA 4HY3A 1ISFA 1VJTA 4RCVA 5C3MA 2VYVD 1CIVA 1O9BA 3PHHA 5T8KA 3V5NA 3VPFA 4YT4A 3KSZO 1V6AA 4GAEA 3BA1A 4L8VA 4L9RA 4CM4A 4IIUA 4AJEA 4ITUA 4QX6A 5BSFA 1T24A 4RVHA 3PDUA 1ADGA 5I7FA 2ZKLA 2ZTUA 1H6BA 1EDOA 3HQ4O 4NR0A 1VRWA 2YQ5A 2V6GA 2G17A 1FF9A 1SPXA 4R68A 2PA3A 1HKUA 2X4GA 4CMGA 5IXYA 1P1IA 1QKIA 4RF5A 1PJ4A 3DBRB 4CMEC 1C0IA 1R0LA 5DOZA 7MDHA 3QHAA 4LRTB 2ZB7A 2RAFA 3DTYA 3PIDA 4LVCA 2X9VA 4BMVA 3LC7O 2O4CA 2Y1CA 5COAA 2BRUA 2VWHA 3CMMA 1FDUA 2EXXA 2PKQP 2YV3A 1T2FA 5I7VA 3GF4A 5HTOA 4CQMA 5JO0A 4HV4A 5ENDA 2VRCD 1BW9B 4TKLA 1KOLA 1UUFA 1YQGA 4R9RA 4EUHA 3AU9A 1GL3A 1XKQA 2AHRA 4NFHA 3CIFA 3JQGB 3LLSA 1XGKA 3FSRA 3RUDA 1SOWA 4TZKA 1HF3A 1PJTA 2IYPA 2J5RA 1UXIA 3H9GA 1WAMA 3MCVA 4YAJA 1QR6A 4ONEA 3D3WB 2W2LA 3AY6A 4XEHA 1ONNA 4BL5A 1UP4A 4NDNE 3P5SA 4NK5A 1GADO 4KOAA 2ZB8A 4P4GA 2QYTA 2OXIA 1GY8A 2CDBA 4N54A 1I3NA 4OM8A 3GGGA 4WLEA 4UVEA 2FHSA 4YJHB 2FRDA 2VRCA 5EN4A 4PLFA 2UUOA 4ZRNA 1XLTA 2EV9A 4ZU3A 4E5PA 1YOVA 4BO6A 4FFRA 3MEQA 5IJZA 5L4LA 1H94A 1IULA 4BO2A 5GY7A 5B4UA 3BAZA 1OC2A 2Y67A 3HDYA 4KTTE 1HDOA 4NJMA 3PFWO 3GNSA 4CMIA 1C1DA 2FR8A 1GCUA 5ENVA 1QV7A 2E6UX 2WM3A 1DC5A 1DDOA 2D5AA 3AFMA 3R0IA 4S3MA 1V3UA 2ZJ0A 4GWKA 1RKXA 3LK7A 1U7TA 4XX0A 2YQ4A 5L7TA 4MDHA 1IZ9A 3U5TA 4B3IA 4AJOA 3DR3A 1V3VA 3IIEA 2ILTA 2HSDA 2PNFA 2X7HA 2Q46A 4E12A 2WD7A 5BNTA 4IS2A 4PLZA 4RVFA 2JKVA 4E2XA 4KQXA 2X6TA 4L75A 2CDAA 5TSDA 2BI8A 4J0EA 3ZNPA 4ALIA 2CF5A 1JQBA 1KYQA 1XG5A 5CPBA 3WGZA 4U7WA 3K30A 4WPGA 4AJIA 4RZIA 3W6ZA 1MGOA 1V0JA 4TVBA 1K6XA 2WYVA 4DL9A 2AQHA 4ROSA 4BO7A 1DIHA 3U4DA 5FFFA 5HS6A 2OOSA 2W4QA 3JD4A 4IMRA 3I5MA 4P8RA 4CR7A 1EUZA 4RPGA 4TVOA 1QLJA 2HLPA 4U6QA 2VWGA 5ER9A 5AXDA 2NTVA 3AUAA 4F3YA 5EESA 2X0NA 5MGBA 4DC0A 3SXPA 1HZZA 8ADHA 4MVJM 4BNXA 4RF3A 2ZCVA 1D8AA 3GNQA 3W8DA 4BMSA 3D3EA 3ZI0A 3WFIA 2WWRA 3H2SA 4IZHA 3O26A 3OEWA 4RVDA 4Z9FA 3ZWXA 2ZB4A 4IJUA 3FHLA 2YV2A 3L4SO 4YAIA 3F9IA 1M67A 1TA4A 1B3RA 4FOOA 4ND3A 1NVGA 1EUDA 3E1KA 4BUCA 4CLOA 3ONDA 2ZK7A 3L9XA 4GX5A 4J1SA 3D64A 1W6UA 1JVSA 2GN6A 2IODA 5T5QA 1Y7TA 4Z9XA 4CR6A 5JAMA 1EBFA 4YCAA 3NDIA 4YAEA 4URFA 1PIWA 1DIGA 2FMUA 4OXNA 4JP2A 3GLQA 4UUOA 5TT0A 1A4IA 3HN7A 2DPGA 1MB4A 2X9NA 3C7CB 3NUGA 1DRUA 1Y9AA 3I83A 3COSA 3GVIA 3EUWA 3QP9A 2X22A 1U28A 3ANLA 1K5HA 3DBLB 4BO0A 3MWDB 4IQ8A 4W9NA 1ZSYA 4BNTA 1JDJA 3TNLA 4YT5A 2HK7A 1P1JA 3AK4A 4HP8A 5ADHA 3QSGA 3UVEA 5F21A 3DHEA 3GGPA 4XQCA 5KJEA 4J2OA 1U5AA 2P9EA 3AW9A 1G6KA 1ZO8A 1I30A 3AWDA 4HFMA 5BQFA 2WD8A 3E5RA 3JD0A 4M1QA 5HA5A 1ZCJA 3U4CA 3FPCA 3CH6A 4J3FA 1EE2A 1Q7CA 1NVMB 4Q3AA 1DEHA 2QRKA 3PP8A 2WJPA 2PD4A 1PL8A 3WIEA 3DZBA 2IYOA 4GMFA 4FJ2A 2FPGA 2Q49A 4W82A 1HSZA 3RUHA 5JYDA 2WTBA 3H9JA 4MINA 3S2EA 1BW9A 4MIEA 1U7HA 2PZJA 3I4CA 3R3SA 4BKPA 2NNLD 3B1FA 5TC4A 1LI4A 3GR6A 1GQ2A 4R1TA 1F06A 4P4NA 3JQGA 2Z1MA 4B4UA 3VZQA 4FC7A 4NFYA 4A26A 2HJSA 4I9HA 3ZHBA 3ZWOA 4YAGA 2OORA 4CJXA 5AYVA 1QYDA 3PK0A 4FC6A 3BTSA 3L6EA 2Y1FA 4ZQEA 2HMTA 3DAFA 1I32A 4CV2A 1PJBA 4L4XA 1LQUA 4RO0A 1NNUA 4FGWA 3NT4A 3QWFA 2BGLA 4KWHA 2C54A 1ISIA 1ZXLA 3ZU3A 4IDAA 4LMRA 2Q99A 1JA9A 3C7AA 3QE3A 1TEHA 4PLVA 3RC7A 1NQAO 3GFGA 3TRIA 5A02A 3ENNA 4DPMA 1Q0LA 4F6CA 3VH4A 2DUWA 4PLHA 3WIDA 4A10A 3GUYA 1DFGA 4TRJA 5CDSA 1BTOA 3LT2A 3H9QA 3HN2A 2NQTA 4FGSA 3RUIA 1KEVA 3WDSA 2OP0A 2VNAA 3Q6IA 2VOEA 1I3LA 1Z6ZA 3CTMA 4LCEA 1Q1NA 3JYQA 3RFXA 2Q2VA 3IJRA 1KEWA 3IMFA 3I3OA 1GUFA 2LDXA 3WLFA 3D4OA 1YQDA 2P4HX 1T2EA 1SEPA 2EHDA 3IP3A 3KRTA 4ND4A 5IZCC 2HO5A 2PZMA 2YFHA 1E5QA 5HM8A 1PX0A 1OFGA 1OC4A 4GQAA 1AXEA 2RH4A 2VT3A 3ZH2A 1R0SA 1GFSA 4OMUA 1N9GA 2PH5A 8LDHA 1H6CA 1M75A 1QYXA 3TJRA 1H0KA 1C1XA 1N7GA 2Y1DA 3DOJA 3EZYA 4FFOA 4LSWA 4R3WA 5DF1A 3A4VA 2XOXA 4Z0PA 4P22A 1N5DA 4BB6A 5TJHA 3QQPA 1VSVA 1DC4A 4BNYA 3VKUA 3IUPA 1NPTO 1XEAA 4OKNA 1PZFA 2Y1GA 4D3DA 1HYHA 4WCFC 2VQ3A 2Q2QA 1IE3A 2HK8A 4ZA2A 3S1LA 3MZ0A 4IJVA 1JLLA 2GN4A 3PGXA 4HNHA 3ZNOA 1HL3A 1VC2A 3DZKA 1HWYA 2H63A 4GWGA 1LQTA 1PTJA 1E5LA 4GVLA 3VZRA 4RV9A 4IXTA 3ZWMA 1M66A 1GEGA 1FK8A 3EAGA 3HNPA 4XQGA 4L4RA 1ZXBA 3QVXA 1XR3A 5CG2A 3IS3A 3HADA 3PTZA 4OSPA 1CETA 1NR7A 5CDUA 4HWKA 1RM3A 3EGOA 1O94A 4LMPA 4MOWA 4AJJA 2PK3A 2ZYAA 1PZEA 4FN4A 4DGSA 1WDLA 3TZQA 1NQOA 4J7XA 4CUKA 1U2DA 2PV7A 3F5SA 3ZU4A 1DFHA 2R6JA 2DC1A 3WGGA 1PQWA 3DOCA 2VYND 4ILKA 2D2IA 2O23A 3DZHA 1WDKA 3P19A 2JD1A 1DLIA 3RBVA 5CDYA 2A9FA 1E7SA 4G5HA 1N8KA 3KSUA 1D3AA 5TNXA 3I52A 3QVSA 4MVJE 3JQFC 4GSKA 3ZV4A 3RUFA 3AM4A 1ISMA 3ULKA 2RCYA 3DBLA 4XRGA 4XYMA 2V65A 3F46A 1VKOA 2B69A 3VPGA 3WBFA 4LN1A 4TMFA 4BGIA 5F1PA 3MOGA 3C1TA 2VUUA 3V1YA 3DFZA 1DPGA 2BFMA 4H7PA 3UOGA 3C85A 1E7MA 2D59A 1BDBA 1JKFA 4I1IA 5L95A 2B5WA 2P4QA 4GX1A 1ZSVA 2VUSA 2IE0A 4CLHA 3HFGA 2VYNA 2HRZA 5AOVA 1AE1A 2P68A 2YV1A 4R3NA 4X54A 5DCYA 3VDRA 5JC1A 1ZW1A 1MX3A 3FD8A 4M54A 1GEEA 3JQ9A 4BVAA 4NBRA 4G2NA 4D0RA 2PH3A 2NQ8A 5LC1A 1ADFA 4CMJA 2P9GA 2DVMA 1I0ZA 1XELA 1LA2A 2X0IA 1LJ8A 3NKLA 4W4TA 4D45A 4FOSA 4XQ9A 3UCFA 3C24A 2NTNA 1I01A 1U4SA 1XYGA 1X0VA 4RZHA 3ZNNA 5AVOA 2YY7A 5KKCA 2PZKA 5TGDA 1LDMA 3AI3A 4NH4A 3UGKA 2NSDA 4JBHA 1S6YA 1UR5A 1ZUD1 3QJ5A 3L9WA 1LXCA 5COBA 5KOIA 2FPIA 2QYSA 3K31A 1UZLA 3I9MA 1V3TA 1WZIA 1HE4A 3RUAA 3PXXA 1H2BA 4BNFA 1KEUA 4RQTA 3EVNA 4IBOA 5CPFA 3RKUA 5T6BA 4B8ZA 3B70A 2YHUA 3MWEB 4PGFA 1FJHA 3ZU5A 3E9QA 1BDMA 5BNFA 3U3XA 3LLVA 4KDEA 4QT0A 3F5QA 4DA9A 4U5QA 4D3SA 1X15A 3PEFA 4EITA 1N1GA 4CQMB 4DVJA 4E5YA 1GZ3A 4WUVA 1Q0HA 4OAQA 1E3WA 1ISGA 2BH9A 3K2BA 1D7OA 2ZCUA 4YRDA 1BRMA 2IEBA 5H81A 1J49A 2O3TA 2Q3EA 3AY3A 4HXYA 5BNIA 4A03A 2GN9A 3ITDA 4R01A 4YEDA 2CF6A 4NJOA 5I9LA 1R4MB 1IUKA 4QQRA 3HJAA 4TSKA 3PQEA 2I6TA 1PQUA 1PGPA 2NU8A 1U2GA 2JFHA 4CM9D 2JHGA 1UAGA 3F1KA 3FNHA 1JKIA 4CM1A 4E3ZA 2AQKA 4R54A 4CPDA 1PEDA 3UICA 3P2OA 5EQFA 3RFTA 4YWJA 3G3EA 4CMHA 4QUKA 3LT0A 1Q7GA 5CFZA 4XA8A 4XD2A 4C7JA 3E48A 4D7AA 4H15A 4OYRA 3NAQA 2WDZA 1YOVB 1XDWA 3QY9A 2GZ3A 1ULSA 3Q9NA 3TL3A 3D0OA 5L4SA 3GUCA 4IINA 4XB1A 3IAHA 2O3JA 1E6UA 3WGTA 1Y8QA 3D4PA 4IDEA 4ND2A 4CMIB 3H65A 3WS7A 1C1DB 1PR9A 4WLOA 1G1AA 4KTVE 3HG7A 5JYEA 4RF4A 1NYTA 2CY0A 1T4BA 3QW2A 1NQTA 4CM9A 4BOYA 5DDIP 3ZWPA 2G1UA 1NFRA 3EZLA 3QVWA 4PRKA 3ASUA 2W8ZA 3FWNA 3PVZA 3RJ9A 2BI7A 3O9ZA 3VTFA 1PGQA 2WD7B 4A0SA 1ENPA 2EGGA 4BIIA 5G0VA 3LZ6A 2FSSA 2FY8A 1IZ0A 1QORA 1X7GA 2UUPA 2XPCA 3WGHA 5ER6A 5JE8A 2BFAA 2O7QA 4CLRA 3HFSA 2C2XA 4XR9A 5KCZA 1LSOA 4ZD6A 2H5LA 5AXCA 3AOEA 3NT2A 3NTOA 4YDRA 3ROPA 1WMAA 4IQ0A 4OXYA 4ZQHA 3AUUA 4JN6B 3ASVA 5T8KC 1XHLA 1VPDA 2A35A 2YW9A 1U5CA 3ZN2A 1B26A 1HLPA 2D1YA 3LU1A 2VTEA 4F6LA 3RU7A 2QHXA 2ZYDA 2BELA 4PLWA 2W90A 4CM3A 3BTOA 3V2HA 4RVSA 3KEQA 3JD3A 1TVEA 1RJWA 4Q3EA 3BZUA 4RPJA 1PS9A 1OBFO 2JCVA 4K28A 3FPLA 4UVHA 4AJHA 4Z3DA 3GK3A 1RM4A 4YR9A 1J5PA 1E77A 2PGLA 4NFSA 4GKVA 4EI2A 3AUTA 1FXSA 4B7CA 3FTPA 5EERA 1WLYA 4FFLA 1LEHA 2C20A 3OM9A 3HB5X 4R5MA 4RPKA 1UDCA 3AU8A 1SC6A 1VL8A 5DN9A 3GAZA 3PYXA 3TL2A 3RBXA 3ZW8A 4II3A 4YXFA 2X5KO 2HU2A 1AGNA 3ZHYA 3M2PA 4CQMD 3OSUA 2OUIA 1IY8A 5GZ1A 4DLLA 2AG8A 3X2FA 5U9CA 3AI2A 1TXGA 4OIMA 3TF5A 1FDTA 3DZIA 4RPHA 4YVFA 1CJCA 1QYWA 1XSEA 5LCXA 2CD9A 1LU9A 5EQDA 1Y6JA 3FBTA 3T7EA 2HQ1A 3H5RA 4CR8A 1BG6A 3PHJA 2NVBA 4GSLA 4XDZA 1G0OA 1LC3A 1LUAA 3ZWAA 2W2LD 3DTTA 3JQAA 2OFPA 5KJFA 3IQDB 4ND1A 3ONEA 1Y5RA 3JQBA 3KSDO 3WR5A 5K6AC 1ZEJA 4LGVA 2VHYA 3FWZA 1B14A 4UUPA 4JLWA 4UUMA 1V8BA 5COQA 1MXFA 5KJ1A 1HE5A 1SB8A 4JJIA 2GSDA 1L1FA 4YB8A 4K6FA 1UXGA 1YXMA 3N74A 2UDPA 3P7MA 4MKXA 2QG4A 1DSSG 5L51A 4UVIA 2NWQA 2VT2A 1YL7A 1NWHA 3K9QO 4GL4A 1SOVA 5B1YA 2G76A 2Y1OA 5C37A 2QRJA 3PI7A 2A92A 3WOHA 4BNMA 2RBEA 3OJFA 2ZATA 3DFUA 4FW8A 4Z0TA 2QW8A 3QWHA 1R4MA 1YQXA 3LQFA 3FR8A 5HWSA 3L4BA 3OMLA 4ID9A 3QV1A 3UKOA 1NPYA 1ZIDA 3ROKA 4QXMA 3KOUA 1ZH8A 3CZRA 4YJFB 1ID1A 3IC5A 4K1LA 5A9RA 3PQFA 3O8QA 1JW9B 1ZJYA 2XAAA 4BNNA 3IL2A 2NV6A 1WP4A 3RJ5A 3IJPA 2Q1WA 1AN9A 4RDHA 2E82A 4R1UA 4ZICA 3VC7A 1CYDA 3KEOA 4CMCA 2H1SA 1ZMTA 2HMVA 1HTBA 3A1NA 3OIDA 5ES3A 4YQYA 5FF9A 4A5OA 4PG7A 3ZZNA 2I66A 4N5MA 3TDKA 3RVDA 1TT5A 3GHHA 5G0SA 1QYVA 3VPSA 3DBVO 5JDIA 4JIGA 3V8BA 4WGGA 2J3KA 4AJNA 2CVOA 1HDCA 1YL6A 2EKPA 2JJYA 1TLTA 1NM5A 3L07A 1E6EA 1H6DA 2OL4A 4CMEA 5L7WA 3UXYA 4E30A 2AW5A 1P1KA 4WE3A 1YJQA 3E18A 2DTEA 1VL0A 2OP1A 3D4NA 3VVCA 4PZDA 1PJ3A 1EVIA 3AY7A 2EGHA 7ADHA 1P9LA 1YS4A 1CF2O 1WWKA 2NUAA 3NJ8A 2HCTA 4R5HA 1HEUA 4B79A 1I24A 4IGEA 4JP3A 1EK5A 1K2WA 1ENYA 2GASA 3OIGA 3JYNA 4CM7A 2VWQA 5JDCA 1N9GB 4IXWA 1P44A 4R41A 3KYBA 1C1XB 1Q0QA 5A06A 3AOGA 3BMNB 3HE3A 5I9MA 2DPHA 2VN8A 2QX7A 1ZK2A 3UFXA 2PWZA 2YJZA 4GGOA 1CQJA 3U62A 3ZGYA 4INAA 2FOIA 3KETA 3DDNA 2NTJA 4O63O 1AHIA 1DIAA 4J49A 4NMHA 5JSFA 3JV7A 3K6JA 3PPIA 5CEJA 4XGKA 4KMSA 1RWBA 1NFFA 1YWGO 3GAFA 3EY4A 4TRNA 4FJ0A 2J5QA 1MC5A 3NJ4A 4Q3BA 3STHA 4QEDA 1P31A 4AVYA 2TMGA 2DBZA 3Q3CA 4W9NC 1M76A 1GV1A 3BMCA 3Q2KA 5G0TA 1KY4A 3RQSA 1YL5A 1VM6A 4D3FA 5F5NA 4CL8A 3ZV3A 1O5IA 4CUZA 4ALMA 1E1NA 2GLXA 4E31A 3RWBA 5DBFA 3BTVA 4MIYA 2J3IA 3U4IA 4Q9NA 3I9NA 3KBOA 3PQDA 1A5ZA 4IM7A 5H82A 3R6DA 2H6EA 4BQRA 2C7GA 4CM8A 1YBAA 1W4ZA 2B36A 4GLOA 4XKJA 1UXJA 4L0QA 1I2CA 5G0UA 1GQYA 3CE6A 2JL1A 1E92A 2W2KA 1E3JA 1J4AA 3G79A 3GH3A 3WBBA 4N5NA 3K73O 3T7CA 5JAIA 1LSUA 2BFPA 3VAZA 4JROA 4E5MA 2NACA 3P2YA 4LVUA 1SB9A 4PZEA 2JCXA 2CVQA 2EJVA 5DNAA 1P33A 1GAEO 1QYCA 2IEDA 1I36A 3RROA 1A4UA 4RLSA 3ZU2A 1YKFA 4CQLA 1DRWA 5IXSA 1YRLA 2D3TA 3DOOA 5DZSA 2O4UX 3Q0EA 3UCEA 4BNHA 1EE9A 1ZMOA 1AHHA 4B8WA 1LDYA 4PLTA 3FN4A 3OECA 4KQWA 4J1NA 1C0LA 3H2ZA 1EMDA 1FDVA 2R00C 3O38A 1ZK1A 3MJCA 2NM0A 4HFJA 3W4IA 5ILOA 3W1VA 2X5OA 5KVVA 1CERA 1E1LA 4CV0A 4ZQGA 4LRSB 1YDWA 2YYYA 1KVUA 1UH5A 3JQCA 4HADA 1EK6A 4A2CA 1LX6A 4OQYA 3H8VA 1P0FA 4G65A 3GY0A 4CMAA 1PU2A 3QIVA 3HUDA 4EDFA 5L9AA 1SCUA 4W7IA 4Y6RA 4YRBA 3ABIA 3WGOA 3KVOA 1V35A 5JBIA 5IAAA 4FFMA 2EW8A 1DAPA 3UUWA 3X2EA 1ENOA 3L77A 3V1UA 3WGYA 4U0JA 5JW6A 5C7LO 3KLMX 5LDHA 3SC4A 4EGFA 3BYZA 3V2UA 4WEQA 4E6PA 4NQZA 1EFLA 4NG5A 1WVGA 4Y6PA 4YPOA 3OQBA 5ITVA 2QQ5A 3OHSX 3SLKA 4YJFA 5I7SA 3G17A 2X58A 2UV8A 5JLAA 1PJCA 2GF2A 4J7UA 5KKAA 5IN4A 1QLHA 2VUTA 4WLUA 2PKQO 3EK2A 3K92A 1XIVA 1GCOA 3ICPA 3S8MA 1K89A 3H3JA 2ET6A 3CZMA 2PFGA 1N92A 1E3WB 4RVGA 2WMDA 2EIHA 2ZQYA 1SZJG 4N18A 1MLDA 3DBHA 3OICA 1YB5A 2GZ2A 2Q45A 3NTQA 3GOHA 5F3RA 5A3VA 3FI9A 4NIMA 1GYRA 3DO5A 4CL3A 4UVGA 4AJ1A 3GFBA 2DUUA 4BKUA 3UH1A 4DPKA 5I9NA 4NU5A 3RIHA 5AXBA 3EVTA 1L7EA 4OOEA 4EZBA 4J0FA 1B8VA 4Y67A 3RKRA 1XA0A 2F1KA 1I3MA 1O6ZA 2B37A 2CSUA 3PJDA 4MIOA 4WNIA 3W4JA 4BMNA 2D8AA 1BSVA 1LSJA 2CMDA 2YHIB 3ZWWA 1I33A 1MC4A 3WX0A 1EZ4A 5T64A 3BMNA 3BTUA 4EBFA 3WXBA 1DHTA 1I2ZA 4I5EA 3WB9A 3GQVA 1C0PA 2O3UA 3JQ8A 1HLDA 3G1UA 3GMSA 2Q4EA 4DIFA 1E3SA 4GGPA 2VTDA 1ZVMA 1WW8A 3WLEA 5JO9A 1Y8QB 5IG2A 1EFKA 1GZ4A 4E2WA 1B7GO 1R16A 3LYLA 2RHCA 2DBRA 4I8XA 1MUUA 3PHGA 4XJTA 5A9TA 5A5FA 3I6QA 4XWYA 2Y0DA 2RH8A 5IN5A 3ZWVA 1WDMA 3EMKA 1PJLA 3WMWA 1ZEMA 3WQQA 4J2HA 1PGNA 4GPD1 3DZFA 3GN1A 4OL9A 1DIBA 4UEJA 3W6UA 5KWEA 2YDXA 4FDAA 4U0KA 1ISHA 1M6HA 4AJ2A 1BMDA 4QFCA 2PY6A 1U9JA 4D46A 3GN2A 1R37A 3LC2O 5CG1A 2CZCA 2FP4A 3E82A 4CLRB 4DUPA 4F45A 2ZYGA 4CV3A 3E6AA 3ETEA 1VL6A 3VOSA 1ZZEA 3JQ9C 4OH1A 5C7OO 3DC2A 4GX0A 4ZVVA 2F00A 4AJLA 1QV6A 2VZ9A 1DJNA 3K96A 2EWMA 3F4LA 4O6VA 3JTMA 1DJQA 4LK3A 3MJVA 3H7AA 3C1AA 4I5FA 3B1JA 3S2GA 1DAOA 1TB4A 4O1MA 1B8PA 1XWFA 4W6ZA 3C8MA 1CDOA 4J6FA 1HDXA 2EEZA 1N7HA 2I3AA 1YJ8A 3H5AA 1I8TA 3EC7A 3I1JA 1KVRA 1Z73A 4FSHA 3RUCA 4DQVA 1VI2A 3A9WA 4YRAA 2UVDA 3CEAA 4WCFA 5KVCA 3JQDA 1A72A 1R0KA 3GGOA 4R51A 1TT7A 1D1SA 2O3SA 4QTZA 3WNVA 3KYCA 1O8CA 3DMTA 5TF4A 4J90A 5F5LA 2V6MA 2O48X 2Z95A 1IPEA 4NHEA 3DWFA 1T2DA 2IZ1A 4R1SA 3S2FA 1MFZA 4XZ3A 4E0BA 4D42A 4R69A 5IDYA 1SBYA 2QIOA 3JSAA 3WMXA 5JS6A 4HKTA 3ZCXA 4H3VA 4FQ8A 4DLAA 3I9KA 1C0KA 1ZK4A 1GUZA 1EQUA 1UXHA 3JD2A 3Q9UA 1E7WA 5DCUA 2C7VA 3DEYX 4FFPA 1VSUA 4ZQBA 1GQQA 1LLQA 5JY1A 5KVQA 2I65A 1SEVA 2IRWA 1PWZA 4W7HA 2R2GA 2Q1SA 4IDGA 3E8XA 4EJ6A 1MG0A 4BKQA 4U8GA 3VZPA 1DIRA 3JQ7A 1GPJA 3TZCA 2Y66A 4IDBA 5EPOA 1UAYA 2BGKA 2GZ1A 4PN3A 2DTXA 3EDMA 2X0RA 1K6JA 4PIVA 2C07A 3JQFA 1EDZA 1LRKA 5IZ4A 1H93A 1HZJA 2PLAA 3C3XA 3JQAB 3F3SA 2WYWA 1NHGA 1KETA 4RORA 4A73A 3LF2A 3H5NA 4C4OA 2Q1TA 3ZDFA 4BO3A 4XJSA 3VH3A 3O03A 3W8FA 3ONFA 3MJSA 2VHZA 1B16A 1G0NA 1EEHA 2X1HA 5FI3A 2AA3A 3QRWA 3NDJA 3O4RA 1R6DA 3TOXA 5A4DA 2I5PO 1PGJA 1WZEA 4ND5A 5THKA 3E03A 4ALLA 4P38A 4I9NA 3UCXA 1C3VA 3EHEA 3JYPA 1ZJZA 3IKVA 3OFSA 1DXYA 1ENZA 2CVZA 2NU9A 1F8GA 1ML3A 3FRJA 5DP2A 1XU7A 1E6WA 4E21A 4I5GA 4Z3KA 1FDWA 1F12A 1WXDA 1ORRA 3O8QB 5TRTA 2X9GA 3TFQA 1NVTA 3HHPA 3B6ZA 2EP5A 5TT1A 1EUCA 2G5CA 2PD6A 5JMPA 5CDGA 3K5PA 3CINA 1NX6A 3VPHA 4A27A 3RFVA 4TRMA 2YHIA 1EQ2A 3NT5A 2P2SA 5C5IA 2E48A 3ITKA 4MP8A 3WGQA 3ZWYA 1TT5B 3SJ7A 4UVDA 1MA0A 1E1MA 3ANMA 4IMPA 4TWRA 1WMBA 2XF8A 3INTA 3MTJA 1KIFA 4BB5A 3AOEC 2JAPA 4JGBA 2Y68A 1U4OA 3S2IA 4EEXA 5A03A 1Z7BA 3FCOA 2AE1A 1PWXA 3CPSA 3H4VA 5C7IO 4F46A 4FCCA 2RIRA 3MTGA 2Y0EA 4FPXA 4OHUA 2J3JA 4PZCA 1A27A 4OOFA 4RVUA 1NASA 2FZEA 4NNJA 4ALJA 5G4KA 2SCUA 5I8ZA 1ADBA 3GDOA 4WLFA 4NU6A 1PZGA 1U3UA 4J1TA 3QWBA 5H83A 3DAGA 3RC2A 4K9DA 1LNQA 4GMGA 2D5CA 2JFGA 1F17A 2OGUA 4DYVA 3C1OA 3ON5A 2O2YA 5DT9A 3L0DA 3WWZA 5BSGA 2VHVA 1YE3A 1DLJA 1H6AA 1MG5A 4XGIA 1E1KA 4MP3A 3GHYA 3NX4A 3FF4A 4KUGA 5G4LA 1T26A 3LVFO 4CODB 1P74A 1X7DA 4OJNA 4JQCA 1OOEA 1PJSA 1JKJA 3TZKA 3GNTA 5JPIA 4EUFA 4ZRMA 3NDRA 1U3WA 3INGA 4XR4A 4YTEA 1A7KA 3F47A 3GG2A 3PYLA 3WG9A 2I3GA 3OJEA 3N58A 5IDQA 4PLYA 5AQ1A 3PDJA 3VH1A 4BO1A 5I7EA 2EP7A 4XCVA 1E3IA 4MO2A 3VVBA 1NWCA 3AJRA 3BMCB 4JXKA 5JCJD 2B4QA 3OIFA 3BMQA 4JCOA 1LLDA 1VKNA 2HAEA 1YB4A 5HRUA 4PG6A 4DLBA 4BO8A 2J5KA 1U3TA 1Q2XA 4LCJA 4CM8B 1IHXA 5B37A 4U6SA 2BGMA 4FS3A 5FWNA 5ICSA 2CFCA 4R9SA 3ENKA 3PJEA 4IDCA 4AG3A 2W2KB 2DM6A 5DULA 2B83A 3JQBC 3RUEA 2B5VA 2DAPA 1NR1A 1ONPA 2ZIZA 2BLLA 3PGJA 4YACA 3RI3A 2WE8A 3DZGA 2NVUB 2IXAA 4CLDA 4D41A 2V6BA 3JQAD 4B4WA 3DONA 5JCJA 5A5EA 3KXDA 5ITWA 4CLXA 2BMAA 4OQZA 3RC1A 4CQLB 2PR2A 4PLGA 2HMSA 4JX8A 3U49A 5KVSA 3JQ6A 2CUKA 1W0CA 1XCBA 1IPFA 1VLLA 4I9UA 4FB5A 4PFJA 3I9LA 1KC1A 1D1TA 4CM6A 3Q2IA 4AJKA 4YJGB 3ZWBA 2DFVA 3JYLA 5U1PA 4ALKA 1F14A 4LISA 2XXJA 4PVCA 2Z1NA 3OJ0A 4IIVA 4E33A 1A9YA 2AEMA 4QSMA 4WOKA 3GRPA 5JMWA 3RCBA 3LC1O 2IDZA 1NP3A 4YJDA 4O0LA 4K26A 1X0XA 4E5KA 3ADPA 2WE7A 5DBIA 3JCZA 1LDBA 2AQ8A 3ZW9A 4MVJH 1L7DA 1RPNA 5JDIC 1UXKA 3K2EA 3H3FA 4QFDA 4UUNA 3WTBA 4XIYA 5KNLA 4NBVA 4L74A 1BVUA 4Q3DA 1A7AA 1Z75A 4HNGA 1R12A 2JAHA 5CP8A 1NAIA 2VYVA 2GRAA 1J6UA 1PZHA
chains in the Genus database with same CATH superfamily
4FEGA 2EBUA 1JAXA 1LX7A 1PLJA 2AD5A 2YKGA 4IIEA 4DZTA 4J1QA 3DHVA 1QRRA 4OB6A 1JZTA 3AEUA 4I2VA 2Z83A 3AVQA 1Z5UA 2LRHA 3IVAA 4F96A 3CUWA 4IQ4A 3I5UA 1WP9A 5CB8A 1R27A 5ISMA 4RVCA 2Y92A 1GSOA 2P90A 3I6ZA 4YFYA 4GHWA 1NDUA 1W96A 3IUQA 3OLWA 2MINB 4KXNA 1GTSA 3DAPA 2P9YA 2HCRA 3BFVA 3LZCA 2B0JA 4HLQB 2FWAA 4ZI7B 4P4SB 1WXXA 4KZPA 4BNZA 1E7QA 4XCQA 3F7MA 2IW3A 1SG6A 5GONB 4QGHA 3QLVA 3NFRA 1S2IA 4YGYA 3K71B 1JJBA 4PO8A 1TUBB 2QR3A 4OQLA 3KTDA 3WSWA 2XRZA 4TLCA 1GNRA 3G1TA 4KYVA 1I6MA 3OY7A 5IF3A 4AUKA 3U16A 2C4HA 4RSGA 1JDUA 5FNVA 3CUKA 4HAZA 1ODCA 1IEWA 4BV2A 2OBNA 3K3PA 1VXOA 5CYGA 1YVEI 1XJCA 3E22B 1USGA 4DIBA 1UPTA 5DNEA 2WQ6A 1NE2A 3WIBA 4FKBA 1RPTA 4UULA 1BA3A 3NTXA 3CR8A 1RJDA 1PV1A 1VL2A 3A28A 5CT4A 5IC6A 2BTQA 4DABA 4E32A 1HNNA 2KI5A 3HZZA 4M8SA 1XVVA 5LA6F 3B48A 4WESA 3LSYA 1T2UA 1W8DA 2MYNA 3GLRA 3DDUA 2KMLA 3V00A 1A8IA 1MJGA 2C2YA 3VR1A 3ZGLA 5MN6A 1LBSA 1OKKA 4WK6A 4WOJA 2BFCB 1XP8A 2ETVA 2VF8A 3I92A 4G6ZA 4RH0A 1N2CE 1A9ZA 3IESA 1FRZA 1ZNQO 2VKQA 4DDMA 1YI1A 3IQGX 3Q1LA 1MEEA 2YS6A 2QJOA 1PL7A 4JBIA 3TOVA 1PSDA 3M5PA 3PNQA 3DXFA 4X95A 3Q7EA 3WIOA 1EBUA 3GJZA 3QEJA 4BMXA 3U9SA 2X8JA 3SK0A 4YUAA 1BE8A 3D6TB 1QJ4A 1R4AA 2QVCA 3QF4A 4LNUA 3GZNA 3GVHA 3FTNA 3BHMA 4C7BA 1FFXB 4J6EA 4IHQA 5BXQC 3AIMA 4R2WA 4JC8A 3TFWA 1HE3A 2IZ0A 5FLKA 1W88A 5ICFA 1P0PA 2HIGA 4CG1A 2X3YA 1N75A 5SY4A 2EWWA 3MWLA 5B1HA 4DJ5X 1C4XA 1QVRA 2BF7A 1PS0A 4M1WA 3P0JA 2KPOA 4Y2SA 3T9EA 3RC9A 4BX9A 1H23A 5JXWA 2WT8A 4II2A 4NBUA 5IKOA 3E5MA 4UJ3A 3IQWA 2B4KA 4PYKA 1L9XA 4N0MA 3VHRA 3LXRA 1L4YA 1FUYB 2HMYB 3GVPA 1Z4PX 3FOAA 3ZV5A 5EKUA 4BV8A 5JJ5A 1DO0A 3IPYA 5DBGA 3UM9A 3OQNA 3IJ5A 1I1HA 5DGIA 4LYFA 3KKMA 4PG4A 5ECGC 1ZVQA 4QYTA 3JASA 2RJ3A 4IUYA 2IQ5A 2YY5A 3U4AA 5ESRA 2VXCA 1J21A 1FPMA 3WJ7A 1EFVA 5LYJA 2OZPA 4M4SA 5H68A 4Z53A 2PX8A 2GGSA 1UC5B 2WZQA 1FDSA 1ADJA 3MJTA 1M7BA 2PLNA 3ZJUA 1UMDA 2A3NA 2NVUA 1ZN7A 1T2AA 5AKKA 2NO6A 2VZEA 1UJCA 4N5LA 5KOJB 4KUHA 2ZUWA 3IXQA 3SQWA 4HDKA 1QIKA 4QNRA 3A9VA 2CDNA 1KMHB 2F1OA 2EGUA 3G8YA 3ODPA 4MUJA 2H0QA 1E3EA 2RARA 4NK4A 4RTOA 1JJVA 3IPLA 3NRCA 1KQ3A 4M1TA 1Q19A 4Y98A 3QWAA 4CDNA 2HFJA 1YBVA 3T4XA 3DBOB 3E1GA 1KFKB 3HDHA 2D62A 4LF5B 2GM9A 2OORC 5CU7A 3ZCQA 1K92A 3STVA 4V0KA 1S2GA 4G0VA 1QWSA 4YA6A 2DBVO 4B4VA 3E8SA 3CKYA 3PNOA 5C8YB 1RM5A 3VKFA 1DBVO 5GGXA 3CVVA 1WHSA 2QUAA 2C31A 4CMKA 2GN8A 1ABEA 1RAGA 3TLMA 3EBOA 2V7PA 4R9NA 4M55A 4YFVA 5DIFA 3OOSA 5L7YA 1PJQA 2GPTA 4HFRA 1Q3HA 2CXQA 1YS7A 5E8RA 1WCYA 3IUSA 4S1WA 4JI1B 4KH0A 3JVUA 3UB2A 4TLAA 2VPYA 2AX4A 1E2IA 1NJSA 2X0JA 2WYIA 4A92A 1QM5A 2BGJA 4MK4A 4RA6A 4DILA 1QNLA 2JCYA 3DEHA 1R3UA 4MGYR 1OZAA 1P8AA 2E4AA 4TXMA 3OEYA 1X1TA 3TSOA 3ZBQA 2AFIA 3MFQA 1Z4IA 1Z6XA 4BE9A 1YOBA 4F4DA 3ZY2A 5ALNA 5FJJA 2IE8A 1GPAA 3ADOA 5DHFA 1QIGA 1Z2OX 4TN5A 1RRCA 4NY1A 4K1XA 2AG0A 5FI5A 3HJRA 5ED0A 3VOAA 3RS2A 4XVRA 3LT1A 4WNCA 2EJTA 4INJA 1EUQA 1SBZA 2ISCA 3D6VA 2WIFA 2JB9A 2JD0A 3MJDA 5EIFA 4AO8A 2ISQA 2VRBA 1A71A 5TGZA 3SJUA 3Q5DA 5C5EA 3L0PA 2D5BA 1A96A 2BBSA 2P2DA 2GPWA 5NLLA 2QZ9A 3DXZA 1JZQA 2J33A 2V6JA 3P0HA 4KXFB 4XM1A 1A95A 2OD9A 1EDDA 4PLPA 4TQAA 4JLUA 1W9MA 2HA2A 1NW4A 3NHZA 4J9UE 5C1IA 2MINA 1CUGA 3V1KA 3EWSA 4UTOA 3ZV6A 5LSAA 1I14A 1BMTA 1PJ8A 2QRUA 2I99A 3C5EA 1DOHA 2A14A 1U0GA 5F3DA 4YYEA 3WTCA 1L6RA 4C5BA 1A0OA 2QPOA 1NPDA 3INRA 3KKOA 4FIDA 4B3JA 4CMBA 3W7AA 3E35A 1PS8A 4QOEA 1AO0A 1TMYA 5A4KA 3CKLA 4IH4A 2YS7A 4FGJA 2F43A 3HYNA 4D8VA 2ONJA 1MGPA 4PC3A 5JCOA 3R23A 1GRVA 2R00A 1H65A 1QO9A 3OZIA 3VSAA 3DYIA 2WPDD 1JIXA 3QKRB 4FR2A 5HF9A 4FFNA 4YJHA 1XRQA 4M7PA 5JU6A 2CB9A 3E22A 5DWVA 5AK5A 4FZ3A 2BEJA 4CGZA 2OQIA 2YWFA 1O03A 1N1EA 3PUIA 3DAYA 1QO0D 1F2TB 2MDTA 4Q1EA 1L5ZA 3KYDB 4KFSA 4X9XA 1UFOA 4JYAB 1QFYA 1JAYA 4BHTA 1ISJA 1O1YA 5JAZA 1U3DA 3HB0A 1AB6A 1WABA 1WEHA 4DC1A 3ESXA 2QUIA 1USIA 3MHTA 2J9ZB 1E5VA 1VMKA 5F1KA 5IT0A 2BEWB 4URUR 2FMTA 4YBZA 3WK5A 2I4TA 4Y9UA 4LRUA 5FYDA 1JH9A 2OGSA 4F3TA 4N82A 1PW7A 2P67A 1SKUA 3DM5A 3H2BA 3Q15C 2HYDA 2DQ4A 2V6IA 4DAOA 4C04A 4BLOA 2C99A 2YIMA 3H4IA 5JSUA 2HREA 5CA0F 2D8MA 2Y0CA 3N0XA 3PQ7A 1KQOA 4RD2A 5KPDA 1Z6TA 1FFXA 4EG8A 2DY1A 4EGSA 3RNOA 3K20A 1TK2A 3ZWCA 4BX8A 3DM9B 4YPFA 2QZZA 1VJ0A 1IAVA 2I54A 4NESA 2ZM5A 3B5JA 2K7FA 4EO9A 2SCUB 1NUAA 2C8JA 4ZYZA 2XB6A 3CB4A 4OGLA 3VA7A 1MT3A 2HXGA 4BUJA 3JAMA 1VHJA 1OIWA 4DBLE 5FV7A 4F9TA 3OT5A 4N01A 5H3HA 5ERGB 1BHQ1 1L1QA 3QF7A 1MP0A 2RHJA 4HQ6A 2ZRNA 3HMKA 2JHFA 4LECA 4RWZA 3TE6A 1I10A 3AHCA 1W73A 2FPSA 2CLKB 2D0PB 4NZ9A 4WK2B 4CFSA 1C9YA 2XGSA 1IU9A 3BX1A 3KAQA 1X3SA 2H9IA 2ERXA 1N2OA 3IHWA 4H77A 3DV2A 3IXMA 2IUYA 4R0MA 4LJ9A 3X1WA 4MVJA 5EHGA 3QZUA 4WK4B 1CEQA 1Y9EA 2P65A 2ZRFA 3CS3A 4NU0A 5F64A 4AMUA 1EVZA 4KRFA 3H2GA 2Q1UA 3PQ6A 1DAEA 2NO9A 2REBA 4MJ3A 4N3AA 4TUYA 4RTPA 5BW5A 4Y9SA 3GVXA 1EM6A 1ULUA 4MGKR 5ALMA 1JWBB 1JWAB 3MW8A 1CRWG 1E0JA 1JIUA 3AG5A 3WA6A 1A69A 5JXGA 2BHSA 4PZUA 2R1ZA 4DQLA 5BV7A 3QUQA 1KMHA 4QGAA 4Q39A 4RH3A 4EO7A 2FPUA 1PGOA 1XD2B 2HWYA 2PL9A 3D5TA 4ALNA 3H0EA 4HG2A 2O05A 5K6TA 4QDJA 4ZVQA 2QE7A 1D4FA 5HSGA 1BX1A 1L4GA 1UDXA 2A6PA 2E49A 2WU8A 2YW2A 1UF9A 3B60A 3JY6A 4HGQA 4OHBA 4RK7A 5BOVA 4DSZA 2Q1XA 3IP1A 3ZOKA 1OGYA 3FYCA 2CLLB 2EWVA 1F2UB 2PFSA 2QN8A 1V7QA 3QWIA 1DIOB 2WJ4A 1K8XB 2HYIC 2QTAA 1OASA 2PX6A 4IHJB 1S4MA 5KHAA 3ZIUA 3EDRA 4N5DA 4DM3A 1HDZA 3CEJA 2VF5X 5C8YA 3U0BA 2PGJA 1TZ2A 3O21A 3P9RA 4IW3B 5EIBC 3NVAA 3KAKA 3ST7A 3AERB 3UHAA 2IH2A 4FR5A 2R7NA 3OZGA 2ZS8A 1NW6A 3LDHA 4CUJA 4EHAA 3CE9A 4R31A 5CYOA 3IP5A 1UBHS 3EIXA 2J9FB 2WVHA 3D8HA 4J4TA 1JI0A 1T0HB 1ZS9A 2OC4A 4GPTA 1AKVA 2J3HA 4JOBA 1BU8A 5DHRA 3L0YA 3RT7A 2G7MC 1LGYA 3RF6A 5ICMA 1B0UA 2C5EA 3COVA 2GVNA 4WA7A 1XKLA 4Q1BA 2IS1A 3CUEF 1GYPA 1NDQA 4V02A 3SFVA 1U7ZA 1HDGO 2H5JA 2LIVA 4QWWA 3K72B 3L8HA 2OYSA 3CF6R 3UN1A 2JI7A 3PJGA 3GJRA 5FPTA 4J9VA 3C3YA 3ETLA 1K0UA 3IE2A 1U94A 3OWOA 4IMJB 5AKIA 4Z3OA 4L4SA 1DGQA 1DKQA 4Z6KA 4CLEA 4AQYB 2M9MA 3BHJA 4YRRA 3EC1A 1F6BA 1PD0A 1TECE 1GNQA 4LFBB 3MAGA 2J6IA 1CQWA 3KHTA 4LZNA 2KYRA 2NUBA 2Z5GA 5CH8A 1XQ1A 4BNJA 4GE0A 3ETGA 1FEZA 2D4AA 3WO1A 1J23A 3REQB 3KZNA 3PQ5A 5BMVA 1FE8A 2IXGA 4CM4B 4YALA 5H16A 5KX5F 1QZTA 2A67A 4R6XA 1PYDA 4Q05A 2OE2A 5CHEA 2AYZA 1ZK3A 3ZQJA 4W5NA 2ZYTX 1GHTA 2VDRB 2A5LA 2D0IA 2JGKA 3QENA 2P6RA 4M89A 3FJ1A 2FSGA 1YIAA 2JNWA 1HLGA 2Y1EA 3CUVA 1CR6A 2C9DA 3I8SA 1ECBA 1UQRA 1G66A 1VIAA 2I34A 3Q2OA 4NI5A 1HDRA 2HRDA 4MCAA 2PMBA 1H5QA 4QPDA 1VJGA 2ZWAA 3V6MA 1MNAA 1S2LA 2ZEJA 1WM1A 2B5OA 1EQAA 1GUBA 1WTCA 2AOTA 1VGQA 1WCIB 2CXNA 2GNPA 2VF7A 4GF5A 4MRPA 1PLLA 3AHHA 2V7XA 2O57A 3IPCA 2P9JA 5ITZB 4FMDF 1LPSA 5FI1B 3TRDA 1DHRA 3X0DA 2JA2A 3GEMA 1P1HA 4ISBA 4IDDA 2SBTA 3EARA 3KZXA 1EP3B 1XCJA 4WBNF 1QG6A 3KYDA 3VDQA 1E7YA 3WK9A 1KI9A 5K9ZA 4FYPA 4ZV4A 4BPBA 3ZUGA 3ZK9A 4BFZA 4W5OA 5G1PA 1PR5A 4I50F 1RQXA 4E6PA 1SNYA 1G9SA 2X7JA 1JG4A 4CDMA 3NHBA 3QA9A 1CJKC 2CHEA 3LOPA 3LQRA 2OHHA 4RZXA 4A8JC 2VHWA 4KMMA 5JI2E 1JMYA 4N9WA 5A4FS 2BEWA 3D5QA 5DXFA 3L7IA 4WNYA 1C50A 1M2WA 1X38A 3SC6A 2J5XA 2NXWA 2WSIA 2PVSA 3VYWA 1SAYA 2IELA 1BKYA 3RTAA 3T38A 4FYYA 1M1YB 4RZQA 3PXUA 2PGIA 2FWPA 3BXHA 4FWBA 3ZUPA 2XDAA 3SSMA 1RQRA 2ZTLA 4IJMA 4BDTA 4JJZA 2ZVJA 3LKDA 4DLSA 2P2GA 5A04A 5IJ9B 1AXGA 4FYWA 2FN9A 2PTGA 3KO8A 4NZMA 4WVFA 4BWYA 1F0KA 3G2KA 2VTBB 1FS4A 1MT0A 5TQVA 2RGUA 4MKZA 1HYEA 2V4ZA 2G0NA 5EVCA 4BLPA 5C8VA 5DM60 3DEIA 1SXJB 1G8YA 3AR7A 3FHOA 4JZKA 4BVKA 3QYFA 3R2JA 2R5WA 3KHKA 4LJ8A 2C7BA 1SUCA 2IK8A 4DMFA 2H4YA 2CV0A 1VMIA 3SBDA 3FYUA 4G1VA 3R3HA 5JRJA 1VDMA 2CJPA 2JI4A 4F56A 2GPJA 4F06A 5LIRA 1ZNWA 3LWNA 1F1JA 5JZBA 3W5IA 5J40A 2YV5A 1YB1A 4EI9A 1K86A 5GMOA 5CD1A 5ILQA 1JN0A 4C4PA 4IWNA 3HGQA 3DHYA 3T3NA 2O3RA 3O4JA 1CQIA 4L6IA 4IYRA 5IFLA 2ECPA 3X3HA 1U3GA 4IH9A 3TZLA 3C7TA 3WLQA 1US8B 4GKAA 4IMIB 1ADCA 3HMQA 4HI0E 4BY9E 4RKQA 4HVAA 2DQKA 3F4BA 3A1EA 3M9LA 3VU8A 4B7UA 3H87A 2Z8YM 5E95A 4WJZA 4CEIB 2WJ3A 2ZRHA 3DO8A 1S0UA 3GAMA 3QPBA 3N39C 4WZZA 3W05A 3HJGA 1T6NA 1Z07A 1DTSA 4GS5A 4LV5B 2O06A 3REOA 3FNGA 2W6IA 1D2CA 4QLAA 3OJOA 3ZDZB 3QNUA 1QB8A 2HK6A 1EYZA 1MB9A 3F0TA 4KR6A 2W71A 4F5EA 4AZ0B 1IYZA 1XD2A 4XB2A 4GDFA 1QH8B 3AUJB 3MS4A 1AY0A 3PCTA 4IO0A 5LDGA 1LLCA 3HM9A 4MVJP 2RH5A 4LJ5A 1FPQA 2DMRA 2IX9A 4KH1A 2NMVA 1XU9A 1ZD2P 4F5WA 3EEQA 5FOTA 4YS6A 1E9BA 3R77A 4BJ3A 4I5DA 4D0RA 1NZDA 3GEDA 3KHUA 5DTEA 1AQYA 4TQGA 3T9AA 1YI0A 2PRIA 3D3JA 4RLHA 1JIQA 1ZBQA 3BXXA 1JHQA 3WYAA 3ICCA 5CFMA 3FR7A 3STTA 4ZJYA 4TTRA 4DLRA 3AERA 4MW1A 3RSLA 4KDRA 1NXQA 2I2BA 3NJRA 5L53A 4WASA 1M83A 1CUCA 4I6GA 1ZBDA 3B2QA 4N9QA 3RVQA 3N28A 2XBUA 2AEJA 4NMMA 1GQSA 4P3OA 4XYGA 1XD9A 1M6WA 2J9FA 2AMFA 1BEEA 1JQKA 1XAGA 3I3SR 4DWJA 3WAJA 5K0JA 1SC3A 3AONB 2I9PA 5U4QA 1JIKA 3T7AA 1G21B 4BO5A 5ICGA 4HH1A 2NXEA 1PNTA 3ZXUB 3KJFA 5EZ5A 4IV0A 1G2QA 1B3BA 3Q1KA 2RHDA 1MU0A 2AUMA 4IGFA 5EXSA 5T41A 4FD3A 1IVYA 1HDYA 1G5RA 1YZLA 4X8OA 2XUOA 4UU8A 4EGAA 1JG1A 4KGDA 5KIAA 2B61A 3VOBA 1UFRA 2HB6A 1XALA 3RYIB 2EP8A 4QLBA 4KK3A 4DMHA 3C7KA 2DPMA 1B15A 5A9SB 1ST3A 1OTHA 1VIDA 2W2PA 5DHQA 1Y6GA 5LVAA 3OP1A 1OH6A 1I5EA 1LBEA 2RHTA 3BS4A 2RK4A 3D8UA 5FEMA 5ADWA 2A5JA 4Q3LA 2RHMA 4ITVA 2G0TA 2JD2A 1I7NA 2FUNB 3KTAB 4QQ8A 5C3MA 2VYVD 3DTVB 4FS8A 3VPFA 1D5WA 3B5IA 5AVWA 1V25A 1V6AA 2O6LA 3BA1A 4IIJB 6NULA 5TR9A 4CM4A 1L3IA 3A04A 3HUEA 1VMAA 4LBVA 2IKSA 2YWDA 4M7WA 4BZQA 1XQVA 4YP9A 1TCUA 4H1VA 1V4BA 4I1VA 3KQUA 1KKUA 4LVNA 3HQ4O 1JDTA 2YZ2A 4G0OA 1VRWA 2E4VA 2H9AA 1ML4A 1JLRA 2IFTA 3TCNA 1WMSA 5K0FA 2O1SA 2ZRAA 3BXGA 3VR5A 2BDTA 3WLOA 4R68A 1SPXA 2XXAB 4CF3A 2BMVA 2HA4A 3A4TA 4LYDA 5FCDA 2XMCA 3A0UA 2FKAA 1X9HA 2XKAA 3ZYCA 3G5MA 4MB6A 5HILA 2XZDA 3CNQS 4RF5A 2GF0A 1Z33A 4XIFA 2JK1A 1JHZA 4WZAB 2IXTA 2DOKA 2ZIGA 1LCIA 1RWPA 5BQ3A 1TFRA 2EL7A 4BWGA 4JBNA 2RAFA 3I2JA 5J4KA 1WCIA 2Q1YA 3PIDA 2FFHA 2OCXA 1E64A 4A5SA 1K27A 2XZOA 1Y3CE 5P21A 1YIOA 4XVCA 4PTZA 4ZTUB 4B3DA 2OO5C 3GF4A 4YAGA 4QVKA 1LPPA 5JSZA 1XKTA 3JR7A 3SHQA 5HMLA 5EZSA 5IH3A 3LDUA 3PTLA 1GAJA 2E7ZA 3H6GA 2V4MA 4AKSA 1KOLA 1B73A 3BMXA 1UUFA 1Q95A 1U80A 5LP6B 3EPKA 5AW7A 4EUHA 2AHRA 3W3AH 5A5GA 4L5JA 1V5WA 4LJ7A 1E6KA 1UBJS 1XGKA 1VG8A 3FSRA 3HDTA 3LY7A 1UBEA 1SOWA 3N53A 5EKTA 1I9GA 1UXIA 1UEIA 3D0KA 4A15A 2QP4A 4YAJA 1QR6A 1VHTA 3W78A 3D3WB 1IG3A 4MEBA 3U81A 1DX4A 5FOUA 1ONNA 5ECDA 3WIUA 3WK4A 1T3LA 2RE8A 4P4GA 3X1ZA 1JLMA 4BWVA 1EM8B 1AV6A 1GQRA 2QYTA 1GY8A 2OAP1 3ND6A 4N54A 4X84A 4WZBE 3SPXA 5LDDC 4EAQA 1GAQA 5F52A 1GXSA 4WLEA 5IJ9A 1ORTA 1JLKA 1NW9B 1NN0A 1MW8X 1EAYA 521PA 3DVSX 3PENA 5IBRA 3X1JA 5H70A 1W0JA 1VDZA 1VP3A 2IYRA 3PXDA 4OJQA 4ZU3A 4C4RA 5K3OA 2X9QA 1SXJA 4FFRA 4S12A 2X42A 3HA5A 1QCDA 4DSOA 1JNXX 1F0PA 1SXHA 3RV3A 5IJZA 4PX3A 4Z9AA 1IULA 3IDOA 1KYVA 4GOLD 3WL6A 5GY7A 2Z58A 3WY9A 1MOZA 2CD7A 2G9RA 1A5TA 3HDYA 4IYJA 4KTTE 4CMIA 4ZCMA 3CISA 4KOEC 4S2UA 1G8JA 2E55A 1NULA 1B1CA 2Q2NA 2VTKA 1MEJA 2X1LA 1CUEA 3AHIA 1G59A 2WM3A 2D1RA 1DDOA 3AFMA 4S3MA 4R98A 5D3ZA 2ZJ0A 1LI7A 4GWKA 2AB0A 2WVGA 3HFJA 4FZRA 4L9SA 1V96A 4LHZA 1A98A 2QQEA 1RC1A 2YQ4A 3FMPB 1L8AA 3O83A 3RNLA 3U3KA 5KYNA 4U7DA 2OCYC 4B83A 4L8YA 1PNOA 3IIEA 1IJEA 1US8A 2Q41A 2XUQA 2X7HA 2Z8YA 3FPAA 1FFDA 4HUTA 3NQ41 5BNTA 3BG5A 4CEIA 4Q15A 4KQXA 4E2XA 3FBWA 2CDAA 1WDTA 3ZY5A 2W22A 3N6RA 3W5CA 1NG1A 1JQBA 4Q93A 1V7CA 1SD5A 4AZ0A 4DF3A 1QH8A 2G7ZA 3E4DA 1O5OA 4WRRA 4DL9A 2AQHA 4X66B 3FNIA 3ZXSA 4ZCRA 5FFFA 1SIUA 1YZQA 5DTJA 5HS6A 3BWMA 2WTUA 2OOSA 4IMRA 1YC2A 3PVSA 3BXEA 4RPGA 1PKXA 1QLJA 3NYRA 4V0OA 4OB8A 3L92A 1PFYA 4JLSA 2REOA 3D6UA 4CRWB 4D3ZA 4DV0B 3V97A 4Z1MA 2NTVA 3AUAA 4F3YA 5K8TA 1TO6A 1S2DA 1JYFA 5EESA 3TX2A 4DC0A 2E85A 3SXPA 4K5QA 3GCWA 3IAM1 8ADHA 3KAJA 5LOVF 4IDQA 1Q17A 1V47A 2B7BA 3I9V6 4BMSA 1U0HC 3MF4A 2UXDB 2ZI3A 2G9NA 4XW2A 1F3LA 4IZHA 3C3CA 1AU9A 4FYKA 1SU6A 4Z9FA 3BN3A 5IBQA 2IUUA 1TD9A 2X2EA 1G21A 4Y1GA 3HJTA 2MHCA 2MWMA 1J00A 3P2EA 2RHHA 3NM6B 2UZAA 1AS3A 1NVWQ 2GHRA 2IYTA 1TA4A 2QUBA 3GCXA 4FE3A 4ND3A 3SNHA 3ROTA 3TAHA 1NVGA 2C42A 3DEKA 1KDTA 4LUCA 5LB2A 2HSGA 2RGDA 4BUCA 3NBQA 4LDZA 5F33A 1HT1E 2Q07A 4C2AA 3A1VA 2I1WA 3REFA 3OPNA 1V41E 2R25B 2GYUA 2RI0A 3BILA 3Q4GA 4OQEA 4ZREA 3W6PA 5H8WA 4YCAA 1N2IA 4JUDX 2HTFA 2OD2A 3L1HA 3V3KA 2ESRA 2FMUA 3G68A 3GLQA 4E46A 1CX9B 4UUOA 3HN7A 5TT0A 3KTAA 1Y9AA 5AOAA 2I6FA 4MGHA 3EUWA 3KQKA 1P0IA 4IIJA 2WJHA 5PNTA 1YTUA 5FB3A 1X1SA 3DBLB 3PNMA 2PMDA 5T4FA 1NW8A 2V7QA 4QVGA 3PNSA 4NCAA 3QI2A 4DJFC 2JFBA 2W58A 4HXGA 3TNLA 1UBNA 4PGGA 4DKJA 1UMKA 2HK7A 1KZ9A 1YK1A 4MV1A 4HL6A 1P1JA 2XXAA 2V9ZA 4ZZ0A 3TR5A 4G0WA 3B53X 5KJEA 3LUJA 4RMHA 5LZ7A 5GADl 2ORIA 3A37A 2VUIB 4HFMA 2PKYX 2WD8A 3JD0A 4MI3A 4J3FA 5EP1A 4JYZA 4MW5A 3DEFA 4M98A 1AQLA 4Q3AA 4B6PA 5F23A 2VYFA 4U9UA 3ZCPA 1ZI8A 3U1VA 4Y6LA 2WJPA 2VHTA 4QDZA 5JARA 1IDN1 3GBPA 2PD4A 2PLRA 3RW9A 1W46A 3WIEA 1PEKE 1QG0A 4RADA 4XJXA 5JCXA 4JLAA 1CZHA 4J29A 2AV6A 3QITA 2HWUA 2DR0A 2WTBA 3DT8A 4X7BA 4LJAA 3QGMA 1GDTA 5KTPA 1Z22A 4DSUA 4BKPA 1U7HA 4U2FA 4JV5B 2NNLD 1OHHA 1CXZA 1JR4A 1WR8A 3B1FA 1ECJA 4E5VA 5LP6A 3PEWA 1E3TA 1UEXC 2BP7B 4P4NA 3TTVA 2NW6A 1JT9A 2RD2A 3IHLA 4B4UA 3EASA 4FC7A 2BR4A 4KR9A 1Z25A 4FUTA 2ZWVA 3O91A 3LJKA 1THMA 3UIEA 1P80A 3AL3A 4I9HA 2R6HA 1IJKA 3WLRA 2VAVA 1QYDA 2XHZA 3OZUA 1AKTA 3PK0A 4JP8A 2NAFA 2AFIE 3QPVA 2Y1FA 5JTTA 1NN1A 3AJAA 1TYCA 2WTXA 4OLFA 3HWWA 4NVRA 3CZPA 1GU0A 2GILA 3F9CA 1LQUA 1U2TA 4H7JA 4CV2A 3N2YA 3VKGA 1BWPA 3KBBA 1WTAA 4NP6A 3BL6A 4ETMA 2Q6IA 2A5FA 2YBEA 4LA4A 4Q9LA 3C7AA 3GA5A 3FFAA 4MKFA 5B55A 3GFGA 3EH2A 3WB1A 5I51A 4B87A 1QRTA 3P94A 4DPMA 2AXEA 1Q0LA 2DHEA 4F6CA 3VH4A 4PLHA 4N5HX 3NHMA 2XEXA 3GUYA 5DRYA 1JXAA 1MAAA 2XT0A 4CU5A 1BTOA 1NBIA 5AK3A 4FGSA 5LZ2A 3SF0A 1KDOA 1F7VA 5GJCA 4ZYWA 4B82A 3HJHA 2QSZA 4M6WA 1U0SY 5I8PA 2OP0A 3VI3B 3BRQA 2MJLA 1XNQB 1SQGA 1EFUA 2Q2VA 2C98A 3M6MD 4MJ7A 5JZMA 2LGJA 1IVNA 1Q0SA 4G0UA 1W2HA 4Q1AA 1U1FA 2R8PA 3WL3A 2QD1A 1T0PA 4NCJA 2NU8B 1D1PA 1ZJ6A 1OFGA 5DX1A 3UHFA 3CX4A 3Q7PA 16PKA 2QG9A 3NS7A 4G2TA 3NM5A 1R5JA 3MERA 2L19A 3EZYA 2Y1DA 3AEYA 1C4OA 1EB8A 3E7DA 2J87A 4FFOA 5DF1A 5BSWA 1UK6A 3MRXA 1RIIA 3A4VA 4Z0PA 4Q19A 2FW8A 3UXMA 3IOBA 2GJ4A 4LYHA 4X61A 3PDWA 3H3XA 4BB6A 3GD5A 3QQPA 3E05A 3UMBA 5CD9A 1YRWA 3A6GA 3FLEA 3OLZA 4WV3A 3JWPA 4YMGA 1NIJA 3BIWA 1ZXXA 3KWJA 1ODLA 3Q98A 3VKUA 1JALA 3BD6A 4OKNA 2Y1GA 3ZBPA 1QHHB 2NO4A 4CZ2A 4WCFC 4QYXA 2QDXA 3C5VA 5H5JA 2HK8A 5CVJA 4RZ3A 4JMPA 2VS1A 2V9PA 4IJVA 2HU7A 1WY5A 1DWOA 2MSLA 2Q62A 3G2QA 1E6CA 3MTIA 4KRGA 3UWDA 3BE4A 1X87A 3AT1A 3W5UA 4BCBA 3SAJA 5JWRA 3EUEA 1XQWA 4DR2B 1VC2A 2ZBEA 1ZIPA 1RMTA 4J0QA 3V7UA 3UGTA 5ICCA 1HWYA 1T5IA 2Q5LA 2FX2A 4GWGA 3EG9B 1MABB 4RU1A 2DZDA 2NV2B 4M0EA 1JHDA 2D5LA 3EAGA 1DUIA 1FK8A 3NHKA 4XQGA 1ZXBA 1ZOPA 3QVXA 1XR3A 2PWPA 1M5UA 2HIAA 4JGGA 4QG3A 4HNSA 3DE3X 3ECCA 2E21A 2Q4TA 2A8YA 3ZDBA 1L1EA 5IF9A 4K6MA 2P62A 1CUIA 4IG4A 1TMGE 2C4KA 2Q3MA 2EJUA 3AR8A 4QELA 3KR1A 2ASEA 3S5JA 4AJJA 5FUMA 1A2BA 1OBVA 3DFFA 5HUHA 1GSAA 5KYKA 4BVGA 1EUYA 4RDXA 1P4SA 2X4LA 3TZQA 4E07A 3P9QA 2EFYA 4U2DA 2PV7A 5AI6A 3L1KA 4EKDA 3WGGA 3A6HA 3KQHA 3VDXA 4I9GA 2PGAA 4QICA 3EOAI 3KT8A 2BBTA 2F17A 2Q3JA 2VA8A 1G19A 3DZHA 4EY3A 3LXXA 5CDYA 4HEQA 3ZJTA 5A71A 1E7SA 4YV0A 4G5HA 2DFPA 2VZLA 3LBYA 3EIFA 4GMKA 3QVSA 4MVJE 1O5TA 4OQQA 2E0IA 4QUIA 5DNVA 2FE1A 2V7TA 3JZMA 3SHOA 4KFRA 3DBLA 3TTUA 1T36B 1SFRA 1KMNA 3OG9A 1Z5NA 4OBBA 4OU5A 1O96B 5EJEA 5HGXA 2Z30A 3ITNA 3R7AA 3VPGA 3FE2A 3OURA 4UHCA 1WPGA 4GE3A 1CQXA 4TMFA 4RIIA 2TECE 1H2XA 1LW6E 2VP9A 2COKA 2VUUA 3C1TA 3SEQA 3UWSA 2FSPA 4ZO9A 4WI1A 4EY8A 4K9PA 1FSGA 4DR6B 3THOA 4EMUA 1BDBA 4I1IA 3T1HB 1SQ0A 3TUJC 4EUKA 1ZSVA 4LKRA 4XEUA 4CLHA 3HB1A 4MW2A 3D0RA 3K6KA 2VYNA 4ZC1A 2YMPA 2YOFA 3PFGA 4IUBS 4MS4B 1AE1A 1XVTA 4G67A 4M1EA 1QIHA 2OZVA 4UW9A 2BFWA 3ILSA 4X54A 4K9OA 5DCYA 4F7DA 1CHDA 2YZNA 2W37A 3ZE8A 1AOXA 3KFVA 1MX3A 2YIJA 4NDZA 1AQNA 3R9IA 3FD8A 2X6QA 4IEIA 2ZOSA 3ZCUA 5EXPA 2XKKA 1X39A 3ZVKA 2YWCA 1ECGA 1UADA 2BC9A 3GH1A 3IAS1 2RB5A 3CWQA 2HJWA 2XQVA 4IR7A 5HK8A 3TMYA 3WK8A 4CCWA 2QZSA 1XELA 4W4TA 3RSFA 2QK4A 1XEXB 2I4RA 1G8GA 3E9CA 4FOSA 4C05A 1OFIA 4ILEA 1EWRA 1P1BA 1JHOA 4C6RA 4WXYB 3Q3VA 1C4KA 2BP7A 2OCAA 3B6EA 5AVOA 2ATIA 3HKDB 1GWNA 4G0NA 5JXHA 1LDMA 3AI3A 1G20B 3GEBA 1UKAA 3UGKA 5GWXA 4ARZA 4MYRA 4AWBA 3V7YA 3HJUA 3MUOA 4HB4A 2DETA 1S6YA 1X2EA 3MK31 4L1KA 1YBFA 2XUDA 3I0ZA 5AW4A 2JLQA 4C6TA 1AZLA 4YCBA 1X7WA 2GAOA 2C97A 5GM1A 3SHWA 1C8VB 3RUAA 3KU1A 1B00A 4PTLA 2ZJBA 4RQTA 4TSRA 4A3SA 1GRRA 1YIDA 1I2DA 1G5QA 3EVNA 4LMBA 1GG9A 3TKAA 3RKUA 4JSYA 3I5XA 4IIGA 3QFTA 4RZ2A 4Q1DA 4KQHA 3GLFB 4G5SA 3IBSA 1BDMA 1FXUA 5BNFA 3VNUA 3F5FA 3FYTA 2H1OA 4FMBB 4MQUA 3ONVA 2HO4A 3ZXYA 4O4LF 4D3SA 1LKZA 1N1GA 4KXXA 4LRWA 3TG8A 4F2PA 2C92A 1PYGA 3L5OA 2VPPA 5B1IA 1JBKA 3TLXA 1JHYA 2ZT5A 3KQSA 5DGXA 5H81A 5JMOA 3AY3A 2WA2A 3B3QA 1N2XA 4YC7A 2E18A 2HZ7A 1XVAA 3PD1A 3K0EA 3LYUA 3WRXA 4MUKA 3N0RA 3P2MA 4JEIA 4R01A 3WRYA 2EZTA 1BFDA 1F2VA 2MTBA 4IDHA 2I7TA 4N03A 1NSYA 1ND5A 1R4MB 5ETJA 4Y1RA 4QQRA 2OFXA 4B3TB 2P30A 2ZBGA 1N4AA 3MFYA 5KOYA 2XYHA 5AJWA 2AVDA 3LUGA 3ER8A 3RRMA 3JARA 1PGPA 1ODSA 2NU8A 4AWXA 3KOZA 1MEOA 1E4EA 5BSVA 4Z4FA 3B9BA 1RPZA 4Q21A 4Z86A 3RM3A 2YRFA 5FI0B 3W8NA 1NJ6A 3P2OA 1L5GB 4JR2A 4KE7A 2GNOA 4C0KA 4DQ0A 2D1SA 1AA9A 3KVYA 3K9BA 4OHKA 1J2RA 5CFZA 1N77A 3HU1A 1I0IA 1FVXA 2OHVA 4XD2A 1H66A 3EEFA 1UM8A 3T06B 4D7AA 2WDZA 3M9WA 1RAEA 2OT3B 1KR2A 3ER6A 3I42A 3KLOA 4GLFA 3OBIA 1ULSA 3DLCA 2XRFA 3D0OA 4G97A 3TL3A 3W9UA 5L4SA 1HBJA 3GUCA 4IINA 4TMYA 2XNDA 2O3JA 1EFHA 3IAHA 2W6ID 4HQNA 5HDBB 1E6UA 2WAXA 1KDVA 3EEOA 2H7YA 5BMOA 1MTZA 3VOTA 3R5HA 1K97A 4XLZA 3WS7A 3BE8A 4ESHA 2AI2A 4WLOA 5K3BA 3SFZA 1G1AA 3AR2A 4NV3A 3DWIA 5JYEA 1MHTA 4QTUB 1NYTA 2CY0A 5AW0A 3QW2A 1TCVA 1NQTA 1MJ5A 3ZVNA 2Q6LA 2Y4NA 5DDIP 1NLUA 5ERXA 1UBLS 2YNMA 4TWBA 3ZWPA 4D97A 1JA1A 5KREA 1MVNA 4PRKA 3LBAA 2DJIA 3QSYA 5ELXA 4QWMA 1OBOA 3EG9A 3FWNA 4UHJA 4EG1A 3ZWDA 2O8DA 3PC8C 5F2NA 1I80A 3O9ZA 4YRSA 1PGQA 1Z4KA 3H17A 3T4PA 1ENPA 3R9WA 5G0VA 1QQ7A 3G9ZA 2JW5A 3OT4A 5M7EA 4U9HS 2AT1A 4LMAA 3T6KA 2BR5A 3PHCA 3H0CA 5BR8B 4KSCA 2CL0X 3DLPX 4NNPA 5IUNC 3WGHA 1BN6A 5JIBA 4IL5A 1OCEA 3NBZC 2HSEA 2C2ZA 4BMDA 2UXCB 3TLCA 1JG7A 2QTHA 3RSZA 4ZI5A 3KU4A 5CXUA 2DECA 2G25A 5JXJA 1H1TA 3DKKA 1YCHA 2AC7A 4J0IA 1AO3A 4ZD6A 3D6AA 1IMJA 2QVBA 1OWLA 4J75A 1E2HA 4YDRA 1TL7C 1F4PA 1QF6A 2DFNA 4IQ0A 2DY0A 3DMPA 1J09A 1UBSB 5AT1A 3TCKA 1YF3A 1D0IA 2IYWA 4JMLA 5KWIA 1T9KA 5IJ0B 1QF7A 2QHXA 4KFCA 3F67A 4NEGA 2ZYDA 1C0EA 1O96A 2W90A 3K8OE 4HZUB 5BQOA 2PX5A 5C53B 3DO6A 3H75A 4L5BA 1QNFA 1QVWA 4RVSA 3U61B 2PL3A 3HH8A 3JD3A 3OAAA 4QJIA 4BYGA 2ZUUA 2B8NA 1FU4A 3UKJA 1PS9A 1EUDB 1O7JA 1RKUA 3FPLA 1LH0A 5E9WA 4UVHA 5FBKA 2ACVA 3WL5A 1M34A 2DHRA 3KQTA 4Z3DA 4EY5A 3GK3A 4TKVA 2X3FA 4UUQA 3DGEC 2KE5A 3EUFA 3QU5A 3TUZC 2AXNA 4C22A 3DKVA 3TLGB 4E5KA 4ZV7A 1WRBA 4KO1S 4FZVA 1ORDA 2D5IA 2W2QA 4C3UA 2PGLA 4GKVA 4HTFB 4EI2A 3WL4A 4ZU1X 3R40A 3RS5A 1T2NA 4OG2A 1TUEA 4RC9A 3Q40A 3LL4A 3C6YA 1RWVA 3N8GA 1ZVKA 1XDSA 3EZNA 1WLYA 1W59A 1Q1AA 2ZRKA 2B1IA 2GCNA 2BGRA 3CT4A 2C8LA 3GQBB 3OM9A 4GOMD 1CRLA 1Y4SA 3CVUA 1UDCA 1E2BA 1SC6A 1P18A 2NT3A 1P2GA 3RKSA 1XEXA 3CNBA 2G6BA 3FSGA 4Z8XA 4POAA 2F7SA 2X5KO 3R4VA 5ESWA 1UEJA 2OO7A 1GARA 1K3FA 3H1FA 2H48A 4MW7A 4S24A 4YPVA 4ZEVA 3HP7A 1Y33E 2WF6A 4DLLA 5C46F 4FEAA 5I9TA 2AYXA 3HO1A 1G20A 4OIMA 4KQFA 4LYGA 4RPHA 4YVFA 4H3SA 1CJCA 3U3MA 4UQOA 5LCXA 2CD9A 1LU9A 3PXEA 3KQLA