2D7JA

Crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
188
structure length
188
Chain Sequence
MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKVLEHYDEFNVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVEIEIIDEDEIFKGLPKRLKVWESHMDEVKELPPKFKILARSETCPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNFAKLCGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GMP synthase [glutamine-hydrolyzing] subunit A
publication title Crystal structure of glutamine amidotransferase from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 56
structure length 188
sequence length 188
ec nomenclature ec 6.3.5.2: GMP synthase (glutamine-hydrolyzing).
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2d7jA00
4D1YA 3SOZA 1VCOA 3F71A 4PXYA 3UJNA 3GRAA 1G2IA 1JVNA 1T0BA 4RKYA 3R75A 4JQSA 4OJYA 3UOWA 4BFLA 5JZOA 1SOAA 3BHNA 3UGJA 1QF7A 1T36B 4I4NA 4L95C 1KXJA 1OY1A 1P7ZA 3ZJ4A 4L8FA 3P9RA 4B5KA 3TTSA 1GG9A 3EJ6A 2YWJA 3L18A 3PQ6A 4WINA 3P9SA 1T3TA 4MTCA 2V4UA 3FSEA 3CY6A 2RK4A 1GGFA 1PDVA 4Y1EA 3OT1B 3B38A 1VCMA 3CYFA 3WFZA 5DFAA 3R76A 5JZMA 4I46A 4Y0NA 2VDJA 4N0MA 4P36A 3PQ5A 3EN0A 1CE8B 1GGEA 3OT1A 4UZSA 4ENRA 1A9XB 4K2HA 4Y1FA 2YWBA 4UOQA 1KWKA 5K4AA 2FEXA 3P9QA 2ZUUA 4MNTA 4ENUA 4OFWA 2GHRA 2GK3A 2XF2A 4L7QA 4OQ4A 1I7SB 1I1QB 2R1UA 2AB0A 4B40A 2RK6A 1FYEA 1PDWA 1PE0A 2H2WA 4B31A 3PQ4A 3NOVA 3R74A 3PQ8A 2ZUSA 4QYXA 2VKTA 1QVWA 3P9PA 3PQ3A 2ZUTA 4ENTA 5SY4A 1S1MA 3EZGA 2RK3A 3EFEA 1P81A 2WJZB 5SYAA 4BIMA 4MGHA 3TTWA 3TTUA 4QYTA 5E9AA 2NV2B 3EWNA 3F5DA 5SY6A 1M6VB 3PQ2A 4ZDJA 1KA9H 1KWGA 3MGKA 3NORA 1KEEB 1R9GA 3SF8B 2D7JA 1OX6A 4P35A 2NV0A 3UMMA 3VU3A 2ZUWA 1C30B 3ZJ5A 4B7AA 3KKLA 4P34A 4R7GA 3SF8A 1K9VF 4ZGGA 1GGKA 4UOZA 4P5PA 4XLLA 2ABWA 4ZDIA 4L8YA 4AUMA 1C3OB 4AUNA 1OI4A 4OGFA 5LIRA 1FY2A 3CNEA 3N7TA 3PQ7A 1Q7RA 1OX4B 1WL8A 1P80A 3L3BA 1IZYA 1QVZA 1J42A 4Y1RB 4ZDKA 1GPWB 4E08A 3TQIA 2R1TB 4E5VA 3CZAA 1OX4A 2IUFA 2VPIA 3L7NA 4P2GA 3ER6A 2A9VA 4RKWA 4Y1GA 1GPMA 4GE3A 4OGGA 4Y1RA 2R1VB 4UNIA 3ZR4B 1IPHA 1JDBC 2R1TA 1UCFA 1GGHA 1P7YA 1Q2UA 1U9CA 1VHQA 1GGJA 3B3AA 3MIIA 4WXYB 3TTXA 1CF9A 4N12A 3TTVA 2R1VA 3TTTA 3FIJA 1PV2A 1QWSA 3NOOA 5IP5A 4ENPA 2ZUVA 5BV2P 3NOQA 4AJ9A 1N57A 2VRNA 1L9XA 1QVVA 5SY9A 4ADSG 4ENQA 3M3PA 4S0ZA 1SY7A 4HCJA 3UK7A 4I2NA 4L8WB 2W7TA 2YWDA 4ENWA 1BXRB 1VCNA 3BWEA 1IZZA 4LRUA 1I7QB 3NONA 4LGYA 2YWCA 4B2YA 2ISSD 3B36A 4GUDA 4OIFA 2OR3A 2LXNA 1QDLB 4AULA 1P5FA 3RHTA 1OX5A 4BTEA 1ONSA 3L4EA 3NVAA 4UCFA 4ENSA 4GE0A 4L78A 2VXOA 1CS0B 2AD5A 4ENVA 4AUEA 3TTYA 3CZ9A 3D54D 1O1YA
chains in the Genus database with same CATH superfamily
2AN5A 4IIJF 2JJ8A 1P7WA 3TDMA 5JSQA 4RIIA 5ALVA 2WB2A 3DZGA 1VPEA 3RODA 4TKVA 2WICA 1IOVA 1Y7TA 1YS1X 3I2KA 4R31A 2K4MA 1TJNA 5EZYB 5FKJA 3D8HA 3WDMA 1QGOA 1NLMA 2DOKA 3IJEB 3FIUA 3JPWA 3W5DA 1SZPA 4JEMA 1LVUA 4MTCA 4LVNA 3U4MA 1JIXA 1T5LA 1AV6A 3HJTA 3PQDA 1RJ9B 1RXSA 1YR8A 4WPGA 4ME6A 3DAGA 3OT5A 4PWZA 3TW8A 1PJ3A 5KVCA 4JR2A 3FH0A 3OTWA 1TL7C 4GOOD 4KZKA 4KQJA 2ZYRA 1XCOA 3N2NA 4R1SA 1OWPA 5FHRA 2X0DA 1BCRB 5JBQA 4K0KB 1Z7GA 4EOGA 4XCVA 2BGRA 3PHIA 2VOEA 4L7QA 2ZE5A 4JLDA 1NKTA 4HTFA 3L49A 4II7A 4P53A 5CEFA 4DPLA 1ZEMA 4TM8A 5IS2A 4DYVA 2PUDA 2Y9MB 1ID1A 1U28C 3DAYA 3BA1A 3IKJA 3KOMA 4IF4A 3FGPA 2PXXA 3PCXA 4LJRA 5G4KB 3HNPA 4J0HA 1GA6A 2Q49A 1ISPA 3CVJA 3PYMA 2O0LA 4H9GA 4EFMA 1JIQA 4XYLA 5AW9A 2I6TA 3R0XA 4CR7A 1XRMA 5A03A 4R8KA 1SCQA 3LO5A 2VHXA 4V0OA 2NPOA 2P4SA 4P35A 5K99A 1F3LA 3H3FA 5AM0A 3QVSA 4OMCA 3IHTA 4PZEA 3REQA 5IFLA 2Q0SA 3A36A 1SHTX 1E77A 2XNKA 3JAWA 2AOUA 3OCXA 5FTNA 2DBZA 3K0AB 3P4UA 4HOYA 3QU2A 2BGKA 3BSYA 2OXRA 1BJKA 2DERA 4LGMA 4ZARA 1Q0HA 2MYPA 4RMHA 4DJDC 3O8OB 5AVWA 5IT9A 4TRMA 3KAQA 5CIQA 2I3GA 5FBZA 3SZRA 4BEBA 821PA 1K8YB 2VDRB 7MDHA 1F06A 2EHJA 3IAM6 5E6SA 4E08A 4MUFA 1N8TA 1P9OA 2C4TA 2VVTA 3FFTA 4IZHA 4P81A 4X8LA 5FOXA 3T0FA 4C7JA 3IUEA 1WNFA 5E4JA 2ACEA 4QJIA 2WHPA 4B3BA 1I51A 2VJMA 2XJ9A 4NZPA 1WU7A 5KNDA 4HGZA 5J2UB 3UMJA 2MSWA 1Y1QA 1EK2A 3IXLA 1SHUX 3S55A 2J67A 4N5HX 3TXXA 1T29A 5LQCA 2BDEA 2BFEB 3AY6A 3PRYA 1L9XA 3W8EA 1XXHB 4R8RA 1OYOA 3PI6A 4PZPA 3O8NA 5EUBA 5FBQB 3OKAA 1JVBA 4Z6KA 5E3JA 1MO3A 3NV7A 2FMHA 5J5VA 2V7UA 1RTTA 3PD7A 3PR1A 4IS3A 1LC0A 1T5BA 4R3WA 2ACWA 1PZEA 1GPH1 1WCYA 1BXRA 4MVJM 4UUQA 3GDWA 5DEIA 1OU0A 2OVFA 5C7OO 1ZD1A 3VVMA 1FFYA 2QKYA 3JQAD 3SM9A 3U0VA 1PJ4A 4XQ9A 1E20A 5AQEA 1UADA 3PSHA 1ZM2A 4J49A 4M87A 3LA8A 5FJJA 1YMUA 3UA4A 5ALGA 1GDHA 1XXHE 1GHTA 3DVLA 1SOUA 5KJEA 1SXHA 2BJVA 4LRSB 3BE4A 4AJ4A 2DPXA 1DQNA 3ITEA 4UTPA 2P6OA 1FNDA 2DMRA 4F3NA 1ZSYA 4Q1VA 4N8EA 1QQTA 2B99A 2WKPA 3DWEX 5ITWA 4GOND 1FDIA 4N7JA 1KJJA 4YJ3F 4LN1A 1Q1AA 4JA0A 5JXIA 1JR4A 1K0UA 5DM2A 5IPFA 3FPCA 4LG1A 1NNEA 5E6UA 5EZ5A 3TDKA 1FMJA 1O4WA 1XTKA 1I7LA 2PXHA 1U90A 4NIMA 4BX8A 4DM4A 2VPXA 3ICVA 1K5DA 1Y8ZA 4R2LA 5EMNA 2D5IA 3RF7A 3UB4A 1FYEA 1USKA 4Q9AA 1HDEA 2PIAA 1MVLA 3ZHUA 2IY7A 4BVLA 4EDFA 3HJCA 4R3NA 4A73A 1ZKMA 1JDZA 1DI0A 3MLEA 4KO2S 4YRZA 3THWB 3TECE 1MDBA 4BE4A 5GV7A 1VIAA 4M9QA 2B20A 2ZYUX 3ETJA 5L51A 1U9JA 3I53A 3U3DA 1H3NA 4QKQA 3HK2A 5JAZA 1RXWA 4BGIA 3CW9A 2BGNA 2QQFA 3SAJA 3C6YA 5CTJA 5LIPA 4R8SA 2DC1A 4JJ7A 3RSHA 4EO4A 1I1OA 2Y1OA 4UU0A 1KAOA 1XMJA 2VWGA 3DB1A 2F43B 4TWZA 1K6MA 1NP3A 3RANA 5JQGF 4MGYR 1K9VF 3QQPA 4DBZA 2IYSA 4D8YA 1T34A 2OM6A 1YIDA 3G0DA 3K9HA 3T3GA 4ALKA 2ZJ8A 3RFCA 3ROEA 2OHVA 1OYVA 3E58A 3R7AA 3CH6A 3O2SB 4MVJD 4W8HA 1QZ3A 4MEBA 4K7JA 2OZEA 3BK7A 5EY5B 4DE5A 2GAIA 1WCIA 4I4LA 5IM4A 4F6RB 4JXJA 3HJBA 4U6SA 3FKSA 1Q50A 2GN6A 4KVZA 2J46A 1XRPA 3QEAZ 5B1IA 2I6QA 4P2BA 4XA8A 2BHLA 3D6TB 4NJEA 4MTLA 3KXDA 3AP1A 5JVDB 2J6HA 4H0CA 4IP0A 5I45A 4NBWA 3GFPA 4KMSA 1HGXA 1RMTA 1GQYA 4HPJB 5B53A 4D0RA 4B9AA 4HNRA 2QRQA 5EXXA 1Z06A 4OLBA 3V8RA 1PS0A 1PS9A 2VH5R 1XNRB 1NRIA 1VIVA 4TV8F 4TLEA 4W5JA 3D3WB 3VDMA 1CNFA 5DF1A 3PENA 3DQPA 2VHYA 4I14A 2HMWA 2QVYX 2Z58A 3LNCA 3IAUA 3AOGA 4Y0AA 4PPNA 1GGMA 2EF0A 3Q3CA 1PVOA 4ZCTA 1P5FA 1RLUA 4YJ2A 5G3YA 3OKFA 1Z3CA 3DPSA 3RRMA 5AKYA 1DG9A 5LQSA 2QTNA 1WOMA 3NUGA 2OZKA 3SMVA 4LXXA 2CLEB 4MDEA 2QNIA 1AUOA 1FVHA 1AN9A 1HLGA 4TWAA 2EWVA 2Z08A 3A7DA 3KTAA 5E0KB 3FNBA 2JBAA 3PWKA 4JT4A 3FHLA 2Z3ZA 4GI5A 1SJ9A 3NYQA 4NEHB 1K7EB 5BV1A 4MUGA 1A9RA 2RONA 2EQAA 3B1WA 3N0RA 4WFIA 2VPZA 3G88A 3AIIA 1BH6A 2QLNA 4KWCA 3VSEA 1ILEA 5FOQA 1PO7A 3CY6A 3DMDA 1XA3A 3CLSD 2XYHA 3CUSA 1SXQA 4BMYA 1E5TA 4QU5A 1YZLA 4WL0A 4CM1A 3ZWWA 3WWDA 3WL8A 5IRCD 3GJZA 5A06A 1FLDA 5L95A 2VWQA 3AB8A 3L8HA 4GC5A 1AZTA 2F00A 4CMIB 5KC8A 5IANA 4HI0E 2QROA 4CLRA 2WUEA 4O3FA 3ZQUA 2PBZA 4C07A 2RIPA 4EY7A 3TW4A 3NASA 1NN1A 1N3IA 2D13A 4NSNA 3ROXA 1J1ZA 1M7GA 4HEA6 4L1KA 3SYNA 4CQJA 3ZHTA 4HQRA 4ROTA 2ZSBA 3GFTA 4MV8A 5AH0A 4RLQA 5HG0A 2P6MA 2YMQA 1K4KA 4ZVOA 1DADA 4IO0A 4BIMA 1S2GA 5JW6A 2ZWPA 1CUCA 3C8MA 3HKBA 1E99A 3Q7EA 4PC7A 3SS9X 1RWMA 3FNRA 4JI7B 3EWNA 3AUSA 4KMMA 5T4HA 2H8GA 1PNRA 4FWBA 1JEQA 2VG8A 4LZWA 1IOZA 1JPNA 2GHIA 2X5XA 1MW8X 3RD5A 4B82A 4MGIR 3RT1A 3TNYA 5ULLA 1SG9A 1ML3A 2AJTA 2R86A 3P19A 3NV9A 1PYDA 4I9UA 4JX9A 3CKMA 4OJNA 5DT9A 3VJRA 2PH7A 2EP7A 2QMEA 2QEQA 4CJXA 4EGSA 1ACLA 2C5HA 1DAEA 4ZYTA 1OLUB 1QG2A 1YDWA 1GNRA 3FYUB 4LDQA 4I50A 1Z35A 4ZDKA 4CM9A 3HGTA 4L72A 3BTSA 2ZIVB 1OREA 2JAXA 2ILVA 1G9TA 2BFBA 3UEOA 1U3GA 3WKAA 2O0JA 2W2MA 1Q3KA 2Q3MA 4EJSB 4F56A 4F9EA 2PKWA 3G0CA 4MROA 3RUEA 4KPEC 1TC2A 2JJ1A 3E15A 4A5SA 1NUTA 4MZXA 2P3OA 3P5BA 4RF5A 3F8SA 4ZANA 1EVYA 1DE0A 4JB0A 3GRFA 3QHAA 4AJPA 2YX1A 4A8PA 1VOTA 1QE0A 4L3WA 2ZI9A 4UBNA 1XN4A 3KTFA 3OPYB 5H3LA 4BIIA 4ZT7A 4D4GA 4F11A 4PZYA 5JCZA 1XT6A 5DOZA 4OAOA 1D5WA 2V9PA 2R62A 1ZH0A 1P61B 1R5OA 2ZYDA 4HUQA 2P9QA 4LXTA 1M3SA 2JIDA 3LJKA 5AIAA 5BMVB 1EP3B 1JUDA 1FNMA 2DQYA 4GZ6A 1LQTA 3AF2A 4I1RA 3WLNA 1UBNA 1C3XA 3QOWA 3GRKA 7GPBA 2PVSA 3NVAA 2PSHA 4JI2B 1WQ4A 1JW9B 1KJYA 4HYYA 2GXAA 4NZOA 1DJOA 2DF8A 3FD8A 4RPJA 2R8XA 3L7AA 1NLYA 1BRTA 1IHOA 2QMYA 3PFBA 5SZIA 3EOZA 1SPXA 2HLDD 4A8JA 1J2JA 4H1WA 4BO3A 3DAPA 1MGOA 3F1KA 1F2VA 1JEAA 3FSGA 2BR5A 3S68A 1TEZA 2RHOA 2B4KA 3PZBA 2YWJA 3GX1A 1VBNA 4FONA 1T1EA 4MS4A 5IMSA 2DQ4A 2IUSA 1NI4B 2PJZA 3OQOA 3CGWA 5DBGA 4J1QA 3T7KA 5B7NA 5ENZA 4HNUA 1JR2A 4CRWB 5EEGA 1QTNA 5DCWA 9LDBA 3KJIA 2HNBA 2LCQA 3V1YA 3I62A 4A8JC 4YAGA 3PFKA 4DWOA 4HQOA 3C6BA 2ATIA 2EDAA 1G5PA 1IY8A 3DBRB 4XZ3A 2ZBEA 4KJXA 1UC8A 5BPFA 3CX4A 1MH9A 1UEXC 3ZQKA 4IOKA 3V2HA 5A7FA 3U1TA 1DBRA 1ZMBA 1Y5RA 4U6QA 3SVLA 1ADCA 3GGCA 3GCDA 1C9DB 1QKKA 1P4JA 2YS7A 5IULC 1O4VA 1QHFA 3KYDB 3U44B 4CUJA 2B9EA 1KSFX 1QLWA 2I2AA 3OQBA 3PQ3A 4F85A 1XF9A 3DZFA 3BYZA 5HFAA 4YCDA 4RF2A 4Z9XA 1Y3DE 3DUWA 4X24A 4DEXA 1X38A 4C4RA 4C29A 1IBLB 4B3MB 4XQ0A 4JGGA 5DXAA 5SZHB 2VQSA 3DL0A 3AV3A 4WZZA 1TYAE 1CB0A 1KAGA 3H4VA 3DVSX 2VIIA 3TPFA 4R9NA 2EVWX 2C2OA 1QZXA 1V37A 1LS6A 1N9GB 3M6UA 4M89A 5CCDA 4B3DA 2HHLA 2O8CA 5F1OA 4B7AA 4UAVA 2WD8A 1H8HA 1TMYA 2IUYA 2XCIA 4ZXFA 1JQDA 1YQ9A 2YJ3A 1O6GA 3F8TA 4QDXA 4UVIA 5ALKA 4R1LA 1ADFA 1E9EA 1SHJA 4FPXA 3EF1A 4KG7A 3RS5A 4UTNA 2G71A 2CXSA 1I5RA 1NIJA 3PGVA 4FR0A 4GNKA 3A11A 3GCZA 5ALPA 3UH0A 5BOSA 2CLLB 1MEOA 4C2BA 1IUOA 4L2IA 3LL4A 3RS7A 1M0EA 5E9QA 1M54A 2VP3A 1DEKA 3V4FA 1J09A 1N4DA 2W5UA 1S8NA 4OA8A 4US2R 1PLKA 2Z4RA 1YACA 2GM5A 1COWD 1BKDR 4I7EA 3KXIA 3LLCA 3TNFA 3BHMA 2PGLA 3UH1A 4NV3A 4JHXA 5CUQA 4C6HA 1V8DA 5DGCA 4HZUB 1BWPA 1P9WA 3DE6X 1EP9A 4ZO7A 1IFXA 2PZKA 3VHQA 3R6DA 1TZJA 4NY1A 4YUWA 5LQDA 4AFNA 1GAQA 4ZODA 1XVAA 1H05A 3FNEA 4A4DA 2AXEA 3SXUB 3VAYA 3AW9A 1RBMA 1XMVA 4XSHA 3WVNA 1LLFA 4P08A 3N58A 4E46A 5JC8A 1JHQA 4B84A 1V0JA 4CKEB 2H2AA 2C4NA 2H2IA 2AVNA 3VNVA 1Q2XA 3HJHA 2WUVA 4JJ8A 1R9JA 4TMFA 2ZRMA 1QE3A 2IDZA 2L17A 4AJOA 2YV5A 4LOIA 3C7CB 3MT7A 3LE8A 4R1PA 3R1IA 1RYHA 1UPAA 2AXPA 1F2UB 2XB4A 3AFOA 1AXEA 1NW5A 2C1EA 1ZRSA 4N3NA 4YRMA 3A9UA 4TS9A 3W06A 1PN3A 4CG2A 5KYVA 4IDCA 2X3YA 3LAWA 4K9RA 3ZK8A 4IJKA 4F0JA 2VYNA 2WUWE 3O2JA 5EHGA 2EV9A 3ILHA 3WRXA 4CM6A 4ZGBA 1U3DA 2VJDA 2Q62A 2JGIA 4M1OA 5FUMA 8LDHA 1CKEA 2GEKA 1WHTB 2P8SA 4V2UA 2GZSA 3SC2A 1P31A 4CF5A 1VE7A 4WINA 5JWHA 4PWYA 3FSEA 1XAHA 3M5WA 1YR7A 1DFGA 1QHXA 2I4MA 1E8MA 4QE3A 5COAA 2A4KA 4V0SA 1FRZA 2EYQA 2AJDA 4BZPA 1N2JA 5L3SA 4S1TA 4INAA 5SZJA 1QRUA 2VDJA 1C0IA 1CE8B 1UBJS 5HYVA 3FN4A 3STYA 1VB5A 1QBGA 2ODQA 1SVWA 3K53A 3I9LA 2H6EA 4DLKA 3KSUA 2ZXFA 3P0FA 2XXAA 2XMQA 3O8LA 2O2SA 1P9RA 1F1JA 3QVGB 5HBRA 3MJSA 2ZI5A 1YZNA 4HMOA 3RK1A 1TF2A 1PLLA 1CY7A 3L9WA 4LZLA 3RS3A 2IYTA 3JASB 4RZSA 5H3CA 4HD8A 1THZA 1Y9JA 3PS9A 2JHPA 1CR2A 3CZPA 4WBXC 1N1DA 3M9WA 1XLWA 2QYSA 5AK4A 5K8LA 2GDJA 3P52A 3C4QA 1XK6A 5C8XA 4CGYA 4RCZA 1PX0A 2AMVA 3WX0A 1SQ0A 1EUDA 5GINE 4XUCA 4JLSA 2ZYHA 5BUSA 3KXLA 4R2KA 4DV0B 2ZANA 1RYBA 3FHJA 4CT4B 3ZJ5A 4C4PA 3ZI7A 1GGKA 1SVKA 2YR0A 2HRCA 1MMFB 3ICWA 4OMDA 3U7RA 4TZ6A 1JKJB 4AUMA 3AQIA 1R12A 2PA0A 1NYLA 2E7ZA 4GSLA 4NH0A 2PKCA 5TPZA 1C9NA 2AN3A 2NO4A 1A5TA 2W6JA 3MUFA 4K8OA 1Y34E 5AHWA 4Y2VA 5TMPA 1GZ4A 4WLNA 1IY9A 3QKTA 2ZCJA 1DAHA 4S1PA 4X84A 2A9VA 4EW1A 3UMYA 3OCWA 1UMDB 2KWIA 1FTGA 4DG8A 3RM3A 3AFMA 4JNKA 3KYCB 2GN1A 4RC9A 2XEDA 4G23A 1ZCFA 4ZI7B 5B2FA 2TECE 3FLAA 3FGOA 5ALJA 3SZMA 1P62B 1TUBB 1HDZA 4QJBA 5BV2P 4S2EA 3OKCA 4GWGA 1Z36A 4YONB 1TO6A 2FX5A 4R51A 4BU1A 5KYUA 4IXNA 2IP1A 4HJRA 1IDN1 4OQFA 4N6NA 4S0ZA 4OXRA 3NH9A 2P9FA 3SE7A 4C0JA 1AQUA 2W4MA 1P60A 4UUBA 4X1YA 1KORA 5KTMA 3R6TA 4GMXA 4O4HB 5C1DA 2CLCX 1MOPA 1U02A 2E4UA 3T3OA 4OGLA 1NW8A 4GUDA 5CMLA 4X8OA 1EM8B 1U2EA 4H4DA 4JK3A 3WK8A 4E12A 1ISMA 4ARAA 1E2UA 4BX3A 4CN9A 4TYYA 1DFHA 5FBLB 4GIBA 2V7BA 1WLYA 3TE6A 5A4AA 3MCTA 3Q7QA 1CK4A 2P79A 1KJIA 1Z8HA 3CZ9A 1J5EB 3ZZUA 3HEAA 1NNUA 2REBA 3A04A 1MVNA 2HF7A 2R9VA 2QPOA 4OQPA 3GA7A 3L84A 5GONA 4DNQA 2GGSA 4MWZA 4FKBA 2I9PA 3JQGB 4AECA 3ZVKA 13PKA 4A8HA 1XTZA 2J87A 3VTKA 2DFTA 1CEQA 1TCCA 2ZKIA 4H1VA 5AI8A 5I8WA 2I2WA 4BNJA 3LK6A 3K0SA 3KVNA 3CNOA 5KZMB 3QNWA 2AFHB 1ZDMA 3IBTA 1OYYA 1CUXA 3OT1A 2DHRA 4YRJA 4ICIA 4BNTA 2HZBA 2PSSA 4GR5A 1LLUA 3MGAA 4LI0A 4NFLA 1DXYA 2YXDA 5DLYA 5F1KA 3S2GA 5B5SA 4B3RB 4Q47A 3IFSA 2IIQA 4UREA 4BO1A 4OFWA 4OQ4A 2IOQA 3FGNA 4BX0A 2I1WA 3IT0A 4WZ6A 1XPRA 3HEMA 3NBAA 1OWOA 1FL9A 2KW5A 3FF1A 3H19A 1PD1A 2HMTA 4HDSB 3KQTA 4QASA 2AN9A 3W4IA 5JH7B 5LOVB 1DOHA 1TVEA 3PUXA 4W9NA 1VZ3A 1L5WA 4TMYA 5GAJA 1RU3A 4R0NA 3C6MA 2HDWA 2FP4A 2GJ9A 3ZDCA 5JS7A 2GRUA 1QSGA 4XI9A 2QRHA 3HBMA 2AFHE 2VUIB 4TXLA 1O96B 3PB3A 1BMQA 1RHJA 3TTUA 3NHFA 4QQKA 2B1GA 1XCBA 2QRMA 3RC7A 3HGQA 2CFOA 3D0QA 2JFQA 4M8LA 3KQQA 4WBNB 4N6GA 4UU7A 1DOZA 3DE3X 4LEIA 4MQ6A 5AJXA 1AQ6A 3CMCO 1PGNA 3HB9A 4W9NC 3VR4A 4W9MC 1W36B 3UUWA 1KJWA 2R8PA 5TVKA 2AXNA 2PRSA 4CLDA 2G04A 4OLHA 3H9EO 1TUEA 5EA2A 3CVUA 5I9LA 3AVXA 1AGXA 2ZJ2A 2B5OA 2J31A 3ZV4A 3IEMA 5B6IA 3TZBA 5BNTA 3HV2A 1CLUA 5HHTA 3L8FA 1NDUA 3GQVA 2XCSB 1E6CA 4RZ2A 5J5AA 2FPRA 2P2DA 5KU1A 3NAGA 4KN8A 4JIMA 2WF8A 1NMSA 1OBHA 1J42A 2F62A 4PO9A 1ZWKA 1B0ZA 1Z0SA 2N1MA 2P30A 2H52A 2Q4DA 1SVLA 3HSKA 4IJUA 5DBIA 3K15A 421PA 3A1DA 1K06A 3Q72A 2AHRA 2MOKA 4Q4HA 5CDSA 1LPOA 5CG2A 1UL1X 2YS6A 3ANNA 5BR7A 5FBVB 2ZAOA 1CF9A 1KO7A 4M9ZA 1IY1A 3K1TA 2VJNA 3QKRB 4Q9LA 4ILKA 4D41A 2YOFA 1FUUA 3EIQA 3KZXA 4Q9KA 3THOA 3FRIA 4G86A 5DLPA 4O2BB 1IBKB 1UPFA 2ZVQX 4FBLA 1QVVA 3ZXUB 3BMCB 2TSYB 4B35A 1EIZA 2Z6UA 4KFTA 1NR1A 2I7DA 4Z54A 1E8NA 1DWOA 3HBFA 3IPRA 1RLTA 1X7XB 4A2PA 1ZM3A 1IEWA 1T4CA 2ISQA 5CLQA 1H1LB 3FYTA 1WHSA 4QG3A 2TRSB 2YJNA 3QX8A 2D8AA 3L4SO 4LI3X 4R6WA 4X7PA 3MRVA 2WPNA 4KRFA 5G41A 2JCYA 1SOWA 4G5OA 4CMGA 3AY0A 3IP8A 4N0PA 2PZEA 3L41A 3BFVA 4JEHA 1O1YA 4Z86A 4FLMA 2IQ5A 2YQZA 2G07A 2ZSIA 1JFFB 3F71A 3LX6A 5DPMA 1IEVA 4ZO4A 3IILA 4DLXA 4DR2B 2WW8A 4JJIA 2DKOA 2A2ZA 1DCFA 2OXEA 3C3AA 5F3RA 1VL8A 1G3MA 2CD7A 1TGYA 2QRPA 2Z5LA 3DMGA 3TPCA 1DDOA 4B7UA 4G0ZA 4BC0A 4ZMRA 3OO0A 1LTHR 4RA9B 1L4MA 4Q1AA 2CXOA 5A04A 2WB4A 2WHYA 4U2DA 3OCJA 5B1DA 1UXOA 1UXHA 5FWYA 1BX0A 3DP9A 3B51X 5DXJA 1ADBA 3G8CA 2C8JA 3TBKA 3LP5A 2GTPA 4XDYA 4GMKA 2BDTA 1A9XB 4AP9A 4F1JA 4ZV4A 3EXAA 2FR0A 3C7DB 4AJEA 3R24A 2HQ1A 1R27A 5BW8A 4JYPA 1H2EA 1JV2B 2ADOA 3HZZA 5ECYA 1E8DA 4GI3A 5CGQB 2OC4A 3ZGLA 3QPBA 1GKYA 4UDYX 4EEXA 4JZKA 2D6FA 3V1UA 1OMOA 2R4TA 1MV5A 3H9GA 4DV2B 4KO4S 5DGTA 3FYCA 4MW9A 4ESOA 3O8RA 4ESVA 1NVKA 4QJ3A 3NHRA 2QGFA 3BEDA 3I12A 1VA4A 5CJPA 4PGMA 5ADUS 3TO5A 1CC1S 3K6RA 4V2IA 3EGDB 1KA9H 1G18A 4ZCQA 1H23A 5IJ9B 5LDDC 2KE5A 5FNVF 3GRZA 4JI3B 3ES9A 2AF3C 1KOFA 1J8FA 1TQ2A 3OPNA 4FDAA 5BQXA 3LYLA 3FPKA 4BQNA 4WXPA 4JT8A 1Y5MA 3K92A 4AY2A 1C2TA 1DIBA 4R84A 4ZZIA 3DBIA 1SCBA 3PX3A 4QOEA 5K0SA 1QTQA 1FCJA 2DR0A 4HDQB 3FJOA 4NWIA 5J5CA 2ZB7A 2JVIA 2O2YA 3OUZA 3LBNA 4PBRA 4B3CA 1UPUA 3JAMA 3NRBA 5FA6A 3C4JA 3ZEIA 4CCSA 4CIXA 1CPYA 4RZQA 2QSJA 1S8AA 5BW4A 1MJFA 4KXVA 2WG1A 2JZCA 1JG6A 1D0IA 2Z3VA 4G36A 3U9LA 5LP6A 3LUKA 2NO6A 1KMHA 5K0TA 1MH1A 1OR8A 2PDAA 2EJVA 2R1TA 2HYDA 3ETNA 2D7CA 3L01A 3O4VA 1WMAA 2WMOB 2XZTA 1R4AA 1TA9A 1W0CA 3P9IA 3OIWA 4YHBA 4CTJA 1JDSA 1G291 3H9BA 7AT1A 3E35A 2Y6VA 5EWMA 3QY9A 2OYCA 4E1AA 2HPZA 2QAIA 3EJWA 2X0IA 5KOHA 5CVVA 1TNDA 4WGFA 2UXBB 5I4KA 1N7JA 1COZA 3DMTC 3OBBA 4HX2A 4CNBA 1ZP6A 4ZAVA 2JH8A 4E7PA 5E1BA 1PEYA 1ZC3A 5HK8A 1Q1GA 3R9XB 3Q0EA 1UQRA 2V6GA 3O75A 4HDAA 2PZBA 4TMTA 4FFOA 3ZPXA 1NG9A 4M0MA 1YZ3A 4PBSA 1JJ7A 1GCIA 3A6FA 3AUYA 4A6PA 4JLVA 2AOVA 2ZS9A 1SIWA 4GE0A 5ALWA 4CPDA 4EPXA 5LLSA 1Q16A 4PQRA 3HSSA 2HLHA 3B6EA 3HG7A 3OICA 3OO1A 2XWQA 4EMTA 3HCRA 3DZKA 1EJ6A 1OFIA 1DRWA 4BPBA 3P2MA 4E31A 4TKVB 3T8YA 5K0BA 1AK1A 2I2BA 3G3EA 2PRJA 1O2DA 3CLTD 4IDDA 1YA4A 1FTWA 4P98A 3PFHA 3V9AA 4P4SA 3W1WA 5HIKA 3UBTA 1D4AA 3REOA 4RGVA 2QX9A 4P4LA 4ND4A 5H1YA 4UU8A 2XWBF 1Y48E 4DBLC 3VA7A 1MU0A 2XODA 1PK9A 1OC4A 4X7MA 3TW8B 3LXUX 2G9VA 1RQXA 4NZZA 4C2AA 2P78A 2GN8A 1KEWA 3THXA 2RC5A 3IQWA 3K0FA 3E22A 3LDUA 3LUBA 3PHJA 5DHTA 3RIGA 3DMNA 4A7PA 3IELA 5EJ4A 1TMOA 4M0EA 3UCFA 4HTFB 3EXFA 4ER6A 2AZXA 4DVGA 1KQPA 3IVAA 2VR1A 1VG8A 3GBSA 4LPSA 4O08A 3T3PB 3HXQA 5REQA 1H42A 3R5FA 5CHYA 2ZXEA 3RI3A 4LBYA 2B92A 2PZLA 5AT1A 1Y82A 1E5VA 1LK5A 3ECCA 3L0IB 3HN7A 2VJBA 3E05A 2Q46A 3MGGA 2JLWA 4QYXA 3X1JA 4UHDA 3D4OA 5JFGA 1X7WA 4KR6A 1KVUA 3H13A 2QM3A 2TMGA 4V0KA 3UJ3X 1YF3A 1NONA 2X4DA 4KBFA 3FJ1A 5G0VA 4JLKA 1N78A 1Y9ZA 3KUUA 5CPBA 5J4YA 1BCSA 1IHUA 1QYRA 1TYDE 2Y0EA 3F5DA 4MVXA 5DGHA 2EX4A 1VSVA 2D54A 3REQB 4C7OA 3U4CA 1NURA 1ZMRA 2B8JA 3PRKE 1NF8A 3B5IA 3JAWB 2AOUB 3QRWA 2Q8PA 3QV1A 1F0YA 3A25A 1A4IA 3QVXA 5CBKA 3LYUA 4P5PA 2ET6A 2ABWA 4QOGA 3ZVMA 2ATXA 2R96A 1T5HX 4MV3A 4WJKB 1AVTA 1P2BA 4JODA 3SZOA 4PG4A 5KTYA 1NW9B 1G42A 3VSCA 5E6SB 4AO8A 1AK2A 2WEKA 4UJ5A 1CR6A 3BREA 3GLTA 1XDGA 5FDFA 5CH8A 2FX3A 2W43A 1XZKA 2HJVA 4IIUA 4EI7A 2WHPB 1JR3D 2VJMB 3FDXA 1LB1B 3GLVA 1I1NA 2Q6IA 1M74A 2DUMA 1GT91 1K6IA 2CF6A 4D0SA 3INTA 1G0NA 4IVQA 1DL5A 1XRNA 1XZCA 1LSSA 2Z4SA 2ZS8A 1NVTA 3DZHA 3UAWA 3IUNA 1UBKS 1BJTA 4G2NA 2C04A 1MO2A 2NO0A 2QK4A 4TOIA 5K7SA 3A1TA 4W99A 3CU5A 3X1WA 3H42B 5CVDA 3IKLA 2X42A 2YMMA 2GETA 1G2OA 2VSFA 4RFSA 2YIVX 4BTLA 1DC4A 4JBYA 1CU1A 3MCUA 3HXPA 1BXRB 1J8YF 1UK7A 2D4AA 3DVRX 2J9GA 3KAJA 3OOEA 4NATA 6Q21A 3OECA 1ZGCA 4G1MB 4M76B 1JN0A 1A97A 4TKZA 5BSFA 3U60B 3QV2A 5JE8A 1MC8A 3HCAA 3EVZA 3WK4A 2Z5GA 1EVEA 1K7XB 1ZQ1A 4KXUA 1ZR2A 3HL0A 3K1YA 2OCKA 1KEZA 3WKCA 3SD7A 1W4BA 1IB0A 5CP8A 4A15A 3BSSA 3VI3B 4DLBA 1DQSA 3LPAA 2VPWA 4UEJA 3AVTA 1S5PA 1Q83A 4BFLA 4D8VA 1WUYA 1G8YA 1XTSA 2ZRGA 3G79A 4IILA 1OY1A 3SIWA 1G5TA 2C4UA 2KQUA 4ZDWA 3VH3A 3P9RA 3WWOA 4BHTA 1YA6A 3QU4A 4E32A 1CEEA 1CRQA 2WWVD 1O5OA 2GJ8A 3SSMA 1GKUB 2HHAA 3GEDA 1JWBB 4D80A 3ESDA 1YRYE 4G4JA 3IE0A 1B8UA 4L8GA 4Q7QA 4IRMA 4Y2UA 1I33A 5E6UB 1L9KA 3WWCA 3W6NA 2IF2A 3FUUA 1T0IA 5DEOA 1RI3A 1EEXB 2CUTA 5BSRA 4KW7A 1AKYA 5AK3A 3D6UA 4BMVA 4E15A 2IOYA 1UBMS 2WRZA 3CN7A 5A9TA 1XHEA 3P9QA 1X8XA 3NDJA 3J81A 4QRDA 1C2YA 1P5RA 4KZPA 4ZCIA 1EA5A 1ZVKA 3GLUA 4F5EA 2WPDD 3CRVA 3OJXA 2WHRA 4H3VA 4RIGA 4JL8A 1CY0A 1FUIA 1I2AA 3AP3A 3PPWA 4QWWA 5AJHA 5CLFA 1U7DA 2GFHA 3HRHA 1AHNA 4QGGA 1MO6A 3M82A 1GL6A 3E23A 1MX5A 3OE5A 5EMMA 1SIUA 5EMHA 3PNMA 4JGBA 4JI1B 4Z0HO 4BATA 3AZQA 4NRDA 2JFFA 1Z68A 2CLOB 2H07A 3CX7A 3E53A 5FUYA 3L7OA 1ZIDA 5LNK1 3JVVA 3LH5A 1BO6A 4HS4A 4XQEA 4CTOA 1HC7A 3CH4B 2V45A 3GXOA 4AIRA 3G8AA 1XVLA 3TF5A 1YE8A 4HRXA 2ZUWA 1E4EB 1YC5A 4IUCS 4CTNA 2NQTA 2W93A 1MX3A 4RVUA 1TEHA 2EKQA 3UXYA 4DIEA 4UOZA 2H9AA 1MRZA 1BMFD 1DBPA 1NP7A 3PD0A 3QE2A 5JROA 3OZEA 4G5SA 4QRIA 1WCIB 3HXLA 4Q4AA 4WADA 2EQ5A 3H9CA 3BM5A 1JYFA 4DXHA 4FNOA 1VRWA 2OYRA 5FIUA 1H6BA 1CDZA 3QEKA 1KHHA 3EWAA 3VZQA 4NJEB 3AKYA 1U3TA 4UTXA 1EU1A 3W9UA 3ZNPA 1C50A 4J2HA 4MV1A 3GCXA 2PUGA 4LY6A 4A3SA 1WPRA 3I5XA 5TRTA 5AQ1A 4C3VA 5HNKA 5K5EA 2XY4A 1XGKA 1X0XA 4G5RA 4L5BA 3E61A 1BGWA 2E87A 1QVRA 2DLNA 1ULSA 2BHRA 1D09A 1AKVA 5H82A 1CY6A 5AHRA 4EUNA 1EKXA 2X5OA 4E2WA 4RE6A 3NANA 1L5NA 3KZMA 2FUG1 2IYAA 4NPAA 2VXYA 2ZCUA 4YJ2B 2I65A 3OQ1A 4GKVA 4LYDA 2JEOA 3EGXA 3N74A 1DIOB 1OXSC 1V39A 4XM1A 3BXFA 3X1XA 5BT8A 1J06A 3NTQA 4V0MA 1R0XA 3V8MA 5JALA 1E2GA 1QB8A 4IMRA 2G4VA 3N5CA 4JFAA 4KN9S 4NDNE 2J3MA 4QDUA 4ZPXA 1HA3A 5AM5A 4ZKEA 3KTAB 2YJZA 1UMBA 2F3QA 1FX0A 2JBAB 1II9A 2WIFA 4QTZA 3MTDA 2Q2NA 1DDIA 4ER5A 1V1JA 3I5UA 3SOZA 2LGJA 1ZK4A 1N2XA 2ZR8A 4RKYA 2VS1A 3F6CA 5KQSA 1QHYA 1Z45A 2MSCB 1B14A 3WL7A 5KJ6A 1KH1A 1N2IA 1SXJA 2OBBA 4KDRA 5F7XA 5FORA 2R6HA 2QW1A 2ONYA 2YVAA 4I81A 2J0VA 5CTAA 1RRKA 2H65A 2F1KA 5F64A 3N1UA 4DGQA 4Z99A 5MDHA 2DBYA 2Y76A 3STTA 4L51A 3OLVA 3OM1A 2J85A 1Y3AA 4K9SA 2JLCA 1SOMA 1Q7BA 4K2HA 3WK7A 3UXEA 1VRCA 1QV9A 3QX9A 1J8QA 1KFCB 1UBCA 2VXCA 2UYHA 1Z75A 3DV0A 5KKAA 5AKEA 4AMYA 2IS1A 4GSKA 4E11A 1JLMA 1E6KA 1AT1A 3FTPA 1DO0A 3FNIA 4UE6A 3E48A 3PA8A 4V0LA 1LD3A 2P75A 3A4YA 1PJLA 3MXOA 2OXFA 3HKBB 4MLDA 3ZG6A 2Z3WA 2C5LA 3U4AA 4EW6A 2IITA 3B7WA 4PYKA 2CLHB 2I8LA 4G01B 5JJ5A 2QZZA 3N2EA 4YJHA 5K4GA 2J3EA 2RJ3A 4KTTE 5B2EA 1GA1A 2OGZA 2QVCA 3UAXA 4HQ6A 3TLGA 1CUYA 2GCGA 2OZLA 4B6QA 4N47A 2VYVA 1U3WA 3MTEA 4Q3LA 1KSGA 4CL0A 3ROTA 2HSGA 3I76A 3EFOB 4BWYA 4BUJA 3AZOA 4G1EB 2XGJA 2XUIA 4DQXA 2O48X 1PFQA 2GD6A 4P54A 2FHPA 3TM5A 5NLLA 1L8QA 4I50B 4LMRA 3VDXA 1R64A 5GP1A 3I1FA 4ZT2A 3LOQA 3E3NA 4DMMA 2MJLA 4EHFA 2G36A 2BFBB 1GVNB 1T10A 5BMOA 5TARA 2P2CA 1NLZA 1B1AA 2QLFA 3M70A 3QFSA 4FI3F 3RSQA 3DFIA 4BQIA 2ZBRA 2OHFA 4ZCPA 5HF8A 1CUFA 1YAHA 4BLWA 2UXCB 2HL6A 1V3VA 1WBJB 2WDPA 4BVFA 1XLUA 4YAEA 5C7YA 8GPBA 1Q2UA 2QRLA 1W4ZA 2R6R1 3OTGA 4ZU6X 3MLBA 5D3QA 1VFPA 3KLNA 5L45A 4H0FA 1E79D 3H18A 4UXIA 4JLOA 3FCCA 4GEKA 1ZG3A 5EZ6B 3LY5A 2EXXA 5I01A 1UXIA 4LOKA 3D6MA 2XZOA 3HUEA 1OF1A 4HUQB 9LDTA 3QVVA 4RLSA 4AMVA 1J8MF 5MGBA 1I13A 1RLIA 3PKIA 5ALIA 3RVBA 1QRTA 1TA4A 1PNOA 2WNIA 3N9IA 4BNDA 1RWNA 5BWMA 4WVLA 4LGYA 4TRRA 4EG5A 2W2LA 3HLTA 2ATCA 2CD9A 4EI2A 3A6EA 4IDEA 2ZETA 1NRXA 4EI8A 4ZYVA 4UHBA 5B2ZA 1U8UA 2IXTA 1L4YA 4BEWA 1H4VB 1HYGA 2OQRA 4IQFA 1N0IA 1NP6A 1IWOA 3Q10A 1CIPA 4D0LB 3E84A 3F47A 3JYQA 2ZUBA 5BV8A 2B0JA 1D1SA 3MS2A 5AI6A 4A16A 1Q0RA 3ETHA 3D02A 3KV1A 3C15C 3VR3D 2OHGA 2RAUA 4WD3A 1XTQA 2BBSA 3VPXA 1HLDA 1FJ2A 1NR7A 1P1CA 2J6BA 2YIJA 4X62B 4NU6A 3FPGA 4MS4B 5HUHA 4RS4A 1CUBA 1M75A 1XU4A 1KFKB 2QE7A 4IV8A 1ZOIA 3TTSA 2HPHA 4K9OA 2W6IA 1BDBA 2M6RA 1EHCA 3PEEA 1TT7A 3F67A 1AJEA 4P38A 1OD6A 3D3QA 3HP7A 3F3SA 4D43A 4JDPA 5C31A 3GWGA 4H7KA 3WFZA 1R1DA 2PMFA 2HBZA 2ZRJA 3D2LA 3T9BA 3LUDA 4IIBA 2WIGA 2WD7A 4V0QA 2PQMA 4DCPA 1P5HA 4ZO6A 4UZSA 5IXYA 5LDGA 4E09A 1T5SA 1S6YA 3O3NB 2POQX 3UN1A 3Q88A 5JS8A 2GK3A 1HEYA 1XZPA 3I04A 4OHWA 1W6UA 5CVTA 1W0KA 3IJPA 9MHTA 2O8EA 3TZCA 4F2PA 1YZKA 2PMCA 3MPOA 4KQMA 4WECA 1ADJA 2NZXA 3FYHA 1Z5VA 2J3DA 1E5XA 1RPTA 2F9MA 3I4FA 4CXMA 4DLYA 5E8RA 3BJIC 4YRQA 3EDMA 1NY5A 1T6BY 2ID4A 4BWFB 4BZZA 2I3ZA 4TN1A 3ZGZA 4FD3A 3VRHA 4IIJA 1C0KA 4G5HA 3RLIA 5AIBA 3CLRD 3U4QA 5EHZA 1RM5A 2WNHA 3K3PA 4ZOQI 2IZZA 2O8CB 4D45A 1GKKA 3EBLA 3A6JA 3P26A 2D5AA 3GRRA 3NHLA 1SBNE 3EUEA 1EUQA 3KPUA 4EQZA 1ZI8A 2A0FA 2RI6A 2VJLA 1T5IA 1MFZA 3SHQA 3AVYA 2ZT8A 5F98A 4AG6A 3THRA 3SWWA 8ABPA 1YMVA 1JEDA 2WF6A 3BXOA 2B1IA 4L2IB 2HCTA 5CT6A 4DQUA 3PQ7A 5GJVC 2IZ5A 2MSKA 2ON6A 2JIBA 5KWEA 3F7MA 3W77A 1DIAA 2C96A 5K8TA 5DM70 1GNVA 2UDPA 2OO5A 2P9BA 1VB3A 1VJGA 1ZQ9A 3QXSA 4MV7A 5BNFA 3UV3A 3ZLVA 3OEYA 5AESA 2O20A 3GGOA 1W35A 1SHLA 2X15A 2YY7A 1WD7A 2GK6A 3BWVA 3CXRA 4GE3A 5J1TB 1FQOA 1C7FA 1GEGA 1Z2EA 1ZNZA 4G0VA 2H4JA 1B16A 3MIIA 4BMNA 1FDRA 2BTOA 4OHKA 4KXXA 1U8EA 4RCYA 1ORHA 1LBSA 2IYFA 3KSMA 4WEQA 3UMFA 4XUEA 2Q1UA 4PYNA 3HU1A 2VRNA 1A9SA 2YL2A 3TMYA 3ZIAD 4RL6A 4R5HA 4HDRA 1A2BA 3UHFA 3ACCA 5FB3A 1NMZA 3MB8A 5ILGA 2HYIC 4DRXA 1NT2A 3L4BA 2XOKD 2R65A 4OHZA 4J4HA 4O3MA 1FXSA 4UD2A 5AR1A 4CUZA 4EY8A 5FLKA 3NHSA 2FW8A 2ZI7A 3AETA 2N9UA 2QR2A 1L7NA 2O7SA 2H4FA 3VR6H 1MO5A 2Z5VA 1ZJZA 3KUCA 2ZSUA 1MV8A 4U00A 3MWYW 5DT2A 5DCUA 2WTMA 3VZDA 2WKWA 2BZ0A 4LDPA 2ZYVX 1G7SA 3E1KA 3A26A 1NU8A 2AT1A 4J1TA 3OWOA 4RXUA 4CW7A 5G4LA 4J9UE 3NHMA 4DKJA 3L4BC 4JC8A 4OJYA 3FNFA 2UYQA 4D8TA 1GZDA 1G8MA 1FU8A 2ZBVA 3IAHA 3SC2B 3OM9A 1L4BA 5JU6A 3E0XA 4TYQA 1SVUA 5JYDA 4OI4A 5L3SB 2PAFA 2O8FA 4YMVA 5EYPA 1T3HA 1N2SA 1JBQA 3LF1A 3OEED 4YFVA 4PYLA 1PDVA 1Z2DA 4R69A 3R3UA 4Y1EA 3SHWA 4AQ7A 2P6UA 4RSHA 4D74A 1Z63A 4AICA 2J9ZB 4H60A 3AX6A 5T3UA 1MOZA 2BC9A 2F64A 4X94A 3MEQA 3UWDA 2HH9A 3JZAA 3UY4A 1R4NA 4PYIA 2XCLA 9ABPA 2XT9A 2XXAB 3U6BA 4D3SA 2QTBA 3MA0A 4OOFA 3AHIA 4X60A 3HR8A 4K87A 1R37A 1T8PA 1U11A 1DC5A 4P8RA 2OZPA 2NIPA 3WOHA 1RMQA 4QODA 1GAXA 4PYRA 3HVIA 1FYXA 4Q3DA 2GCPA 1AHHA 3KZNA 4UMDA 3QEMA 4D6XA 4M9UA 1LC3A 5TMEA 4F8YA 4ZJYA 4TYPA 4KCGA 3LLMA 3P7MA 3EFEA 1H2HA 3ESYA 4MCAA 3EEBA 5CIWA 2HRQA 4D4HA 3B53X 1AO0A 4JP3A 3RS9A 1HR0B 1EUDB 3ZDDA 3AR8A 5ER6A 4IIVA 4LF6B 5FPKA 1QX3A 1RXIA 3RPEA 5EFZA 4AWXA 5EJ5A 1ODLA 4HWSA 1QGED 2K87A 1DEXA 1XNGA 1SM4A 2FSIA 3KCNA 2A30A 1XG5A 4C5AA 1NTRA 1QO0A 3O9VA 3U1VA 1T5OA 2RI0A 1ZD3A 2R00A 2ZSHA 3ASYA 4GPEA 4KPGA 2CMKA 3E4DA 4UATA 2CUKA 2FSPA 5DN6D 2AYXA 2IYQA 2WP8J 2OCBA 3MWJA 2PWPA 4POAA 1SCUB 1TK9A 3ETCA 2GLTA 3KU4A 1F51E 3C3JA 1C7JA 2C03A 1X94A 4L4ZA 4RZUA 5BUZA 1M2FA 4TQUS 1JQ5A 1NMQA 1JWAB 1E69A 1H66A 3DPUA 4K6MA 3PA6A 1FIUA 1H4QA 3AHDA 3KL2A 1V5GA 1PR6A 2FFHA 4PGAA 4ZZ3A 2BFAA 3ETLA 5LQNA 5ALSA 1EJ0A 1GPMA 2Q6KA 2R00C 4UNIA 1EZ4A 1PT6A 1M2HA 2PWZA 3HFSA 1LW7A 3AM5A 3PUJA 5CM9C 1J07A 3NWEA 5FUVA 1ORIA 2AWOA 5HQTA 1UT5A 2QTVA 3M4NA 3GJQA 3GP5A 5KYUB 1IL0A 3S2EA 3OOSA 1EDEA 3E1SA 3ECSA 4GYYA 3ZU2A 4EG1A 4KVFA 4OPMA 3A27A 4UTRA 2EZ4A 4X1YB 1UFVA 2QTZA 3HN6A 2FVYA 2GASA 1R6DA 3BWYA 4IWXA 3SZLA 1PSWA 1ULTA 2GM3A 4W9RA 1T6ZA 1ZN8A 3GJXC 1J4AA 3H1TA 1H2RS 5ED4A 5IUNC 1E5QA 1Q17A 1M7BA 4XM2A 3A31A 5TS3A 4UBKA 2LR0A 3NPMA 3KQHA 5JQGA 3QE4A 1MAAA 3DEZA 2PSFA 1M8KA 4ACAA 3E9QA 3EA5A 1PUIA 3RF6A 4LXGA 2ZBFA 4TQGA 4EIWA 4F5WA 3BSFA 1D0SA 3IYLW 1U81A 4MCJA 3UJ7A 1UMCA 2D5CA 5KPJA 3L4KA 3ABRB 5C32A 4DYDA 3O4IA 3UJNA 4OB8A 4TXJA 5JYEA 1DTWA 2NXWA 1BU5A 2REXB 3KR2A 4FE4A 1UKZA 1V5IA 1W49A 4WTOA 3TJRA 3FTEA 3A28A 3ED1A 3OX1A 2JKZA 4UE2A 4QXRA 5IDQA 3K2IA 5TEVA 3T1QA 1YV9A 3RARA 2J0QA 3OT1B 3B38A 2ENUA 1B8PA 2IOFK 4DLNA 2B36A 3GLIB 1OT3A 2I3DA 2LE0A 3FCYA 3NALA 3TEMA 2YZ7A 3CEJA 3N6RA 3EXG1 1H1TA 1XTPA 2X2PA 3BTVA 2F3SA 2XWJI 3I3OA 3R3YA 2J9FA 2PSEA 2WFAA 3I6YA 2NVUA 3DLBA 5IABA 2H0AA 2JGJA 4CMBA 1BOOA 2QD2A 5H9WA 4B83A 1MW9X 1JQ3A 2YV2A 3LFUA 5BN5A 1C8VB 2UVPA 4XWYA 3SM3A 3DLHA 3U3RA 2FF7A 1IDOA 2AJCA 3R5HA 4DSNA 2FP4B 4WFKA 4UNRA 2F1OA 1ZH8A 3D3NA 3KKNA 1H1DA 1XZMA 6GPBA 4HWOA 3WYEA 1Y98A 4JSTA 4C0SA 1CRWG 1OH6A 4M86A 3VGJA 3GLIE 4DR4B 1G8KA 1GUYA 3R7SA 4YNBA 4H1TA 3B5JA 3P4YA 3U9TA 2VC2B 3CT6A 3OLWA 1G98A 3UGKA 2H1VA 2L42A 1EVJA 3CT4A 3QTTA 3RAGA 1H0KA 4CU5A 1EWKA 3UAGA 3GEEA 1JWLA 1T2VA 4G0QA 3ZLBA 4PLVA 4FC6A 4IOMA 1JGTA 2D5BA 4MI9A 1Z73A 4PHCA 3L77A 4GQAA 5KYYB 4E30A 1GIAA 3ML1A 2X0JA 4MRPA 1L1EA 1YQDA 3LPDA 3ONWA 1CT9A 4AWAA 5JTUA 1E1RA 4MRMA 2D1YA 3NCTA 1GZ7A 4Q4HB 3CCBA 5AJVB 4E5VA 2P4UA 2A1TS 4FJ0A 3OJCA 2H4HA 2MMGA 4HQKA 3C98A 3EULA 1U3VA 5J2TF 3Q3VA 4B45A 4PZLA 3PNQA 4TTPA 2ZM6B 4UHHA 5EP4A 1JDBB 3RBAA 2PSDA 4BBJA 1K08A 3BGVA 5EHQA 2OGTA 4GO1A 2W2TA 1UC5B 2E4WA 2GZHA 4EG4A 1Z6ZA 5I9TA 1C41A 1N57A 1YZVA 2F1IA 3SQMA 1XKTA 1FFGA 3SYTA 1FFSA 1MX9A 5JAHA 3LC2O 3G5TA 2QW0X 2VI5A 2P5UA 3KKPA 1SUBA 4RKQA 5CYFA 3ZWXA 1T4CB 3FFBA 4BNYA 3IPYA 4OJTA 2IZ0A 1ZIOA 2EDCA 1MFPA 4GGOA 4E1VA 4EW2A 1HMYA 5J63A 3B2EA 3JQBC 2O7RA 4HWTA 4OKIA 1OFTA 2QS9A 4IHJA 1J2TA 4K2AA 3T9AA 3J7AC 3VM6A 1I30A 3CGGA 4YAIA 4P86A 4I08A 1U0JA 2BMFA 4UNPA 1I5OA 2OESA 3NDRA 5LSAA 1XL1A 3MILA 3F4LA 1YBMA 3F6PA 3VNRA 5THXA 1JTEA 1SVNA 2BZSA 2YINC 5EUQB 4BLOA 4C4TA 3EXHA 2OHIA 3F1LA 1FJXA 4BCBA 1M2NA 1V2GA 3H1PA 5KO2A 1JLLA 4J1SA 3HXTA 3ESXA 4DEVA 2JBWA 2PX3A 5U4XA 4Q7LA 3EZ6A 2CXTA 2B1RA 4Q66C 2OBXA 5FWYB 2CNKA 4TN5A 2GT1A 2VQEB 1R8XA 3CN9A 4W6ZA 2CHGA 2G9QA 4NESA 4BP9A 3CRMA 2RK4A 3HFRA 3ZVRA 3LK7A 5HE9A 1G20A 4GXTA 4WCVA 3HB4X 5EIXA 4P7FA 2WSSD 3KOOA 3NEJA 2PT6A 1DRVA 2CE2X 1NN0A 3ILSA 3KSRA 4DMKA 3EXHC 4LYGA 2CW5A 4LDJA 3NR2A 2WWFA 3CONA 1JKFA 2VQDA 4WESB 3W34A 4CFZA 4EKYA 2DLCX 3TSWA 3WGHA 1LJLA 3IVXA 2ZB8A 4G5GA 4B46A 1WVGA 3HQ4O 2FSSA 3WGMA 4OU5A 1NQAO 3UBMA 3LKDA 3EPPA 2I62A 4KITB 3MELA 2IGBA 2D1RA 1XD8A 2C3OA 3AGPA 4I8DA 5TGZA 1ZBQA 4I3GA 4EPVA 1NJSA 4RXTA 4Y2YA 4YBRA 2C8LA 3D4LA 4Z0TA 3P9YA 1XMQB 3OZXA 5KWIA 2M2IA 3RKRA 1H9AA 3K7EA 1VA5A 1XZQA 2FPIB 2ORYA 3H2HA 1PEAA 3MW8A 1XTVA 5DTIA 5JS2A 4ZMSA 2GJSA 2WYOA 2QVXX 1C3VA 3RK4A 3DXYA 1OILA 4HN9A 2QU7A 5IDWA 2JJ2D 2O5EA 1HYHA 5IAKA 3JD4A 2Y68A 3ONFA 2G63A 3IBSA 3T52A 5KX5F 2HQRA 3N5KA 3INRA 3SF0A 4RMNA 4CKCA 3IP7A 1NVFA 4JIGA 5D6NA 2BFDA 1TXGA 4ZVSA 1BH2A 1CZOA 1ZVVA 2ZZNA 3X1ZA 4RPHA 4TLDA 2X0FA 4DV5B 3DO8A 1PFKA 1MC5A 2X1HA 3EODA 4IEIA 3UWKA 3ZW9A 3OE1A 1NAIA 2K5UA 3WSVA 1G1MA 5CX4A 1QX4A 1RDFA 3W3AD 1J2EA 5LP6B 1JP7A 4AY3A 2WHXA 2J8ZA 2W2KB 4A2WA 1KMHB 1QU3A 1R5NA 3TK1A 2X0KA 2R1TB 3OZIA 3V1KA 3GYBA 3AIOA 3MWFA 3CVYA 2DP4E 2I4OA 1LLCA 3L5OA 4MQ5A 2OZVA 3B1YA 3NGXA 3MTGA 5IBQA 5K05A 1AB5A 4PSKA 1PR5A 2HM7A 3S99A 3DDSA 4MPRA 5E6RB 3ZWQA 5FA5A 5EWMB 4OQMA 3PBKA 1G0OA 1SKAA 4Q4DA 2IHYA 4Z8XA 5KOHB 4LY3A 1S3SA 1TQHA 1VCIA 3KZ1E 3KQUA 4HQNA 4BFXA 2PK3A 3T7CA 2X3UA 4XB6B 3VKWA 1P2FA 2Z56A 4RUKA 4X95A 3VO9A 1CR4A 2VQ3A 3SP1A 4JU8A 3AB3A 2QRGA 3Q11A 1BYUA 2HQSA 1ATZA 3ZDZB 1X3LA 3RTEA 1BDJA 3H6GA 4FOPA 2DPYA 2WG0A 1EVQA 1AXRA 1SVOA 1HMPA 2DFKB 2ZAGA 2C9CA 1AUVA 2J41A 4OB7A 4OSOA 2R87A 2GVNA 5TQVA 3IQIX 3T9FA 1NUUA 4KNVA 4Y6SA 3DDZX 3K8OE 4C0HA 2A0WA 3UMMA 3R5KA 2R48A 5IAJA 2UVQA 4WDQA 1GYPA 2O07A 2C2WA 5KEIA 2FPGA 2JARA 4M88A 4FMCB 1XR3A 4MGKR 2CXUA 1TCUA 2J3JA 2J45A 1WP4A 4YAKA 2YUTA 4P4SB 4MRVA 2A67A 3MSXA 3OAAA 4H08A 4NE2A 5D87A 2P77A 5CG1A 4I3HA 3ZCSA 2A0XA 5LDHA 2OB2A 4UD6A 4KE7A 5AJWA 4MKZA 4DUGA 4DBLE 2CVQA 3NAZA 4F97A 1ZA1A 3MWKA 4RCVA 4JXKA 3NG1A 1FOEB 4BXOA 3Q98A 3K0FB 3E22B 4EJFA 3OZDA 1BD3A 1JQKA 4PG7A 3R0IA 4CCYA 1YB1A 2IZ6A 3TFWA 2P2GA 4R1OA 5JZBA 3EXFB 3L40A 3PFCA 1ULAA 4DGSA 2G9NA 1BEZA 3RFTA 2FE4A 3SSNA 4IVRA 2YY5A 5AFSA 3DVAA 3C8UA 3DGFC 4XVHA 2P9GA 3UJ8A 2OK7A 4FGUA 4RELA 5HRCA 1RC0A 2GPWA 1G8GA 3OZAA 4Y6PA 5K1ZA 1TK3A 3U5ZB 3R8FA 1X7WB 3BA6A 2BHSA 3LKZA 3RAJA 1XELA 3CRRA 4LYAA 3JW8A 2VKTA 1G9XA 1BCSB 2P2LA 2GA8A 3AR5A 1OSNA 3U31A 3RYCA 1KAHA 5KHAA 2I2XB 4EY5A 2R79A 2XMPA 4C7OB 3MBKA 2XDQA 4BJ5A 2Q7XA 3ENQA 3QGMA 3EGWA 4J0CA 4YAWA 4C76A 2ENWA 2JG3A 3WDSA 2ZZMA 1DZIA 2Y1EA 2XADA 1WBBA 4FFPA 3BH7A 2ZTMA 1YULA 1BMDA 1NJFA 1Z2NX 3DXZA 3HSYA 1V43A 2WJAA 3NTOA 1UPXA 3LV8A 1O03A 1CNEA 3LTNC 4FKZA 3DG9A 1N32B 3JQAA 4D26A 1U8ZA 3MTIA 3S2UA 1ZEJA 4C78A 5CJJA 4JLUA 4P3KA 1G66A 4M1KA 4X7BA 5U4QA 4L9SA 2MMCA 2IK8A 3IEKA 3SHFA 3R0ZA 1JA9A 2WTBA 3O9MA 1UJ5A 3QA3E 4NBRA 5AK6A 2JCVA 4BB5A 4KDEA 3D5QA 3UWOA 2WU0A 2C3UA 4KR9A 5A02A 5JH7F 4M1SA 1ZW6A 2BBTA 2IQIA 2FR8C 2IPMA 1SVIA 2NOAA 4KAJA 4C4XA 4AQYB 1I01A 2UV8A 3KZKA 2GEUA 3QU9A 1KRWA 3NBYC 2GSWA 4RFSB 5CDUA 2JJQA 5DWVA 1EVLA 4MKFA 1UZMA 4R3UC 4J6EA 2HU5A 2C4MA 2HFKA 3Q3IA 3TAXA 3SX2A 1PFVA 4BAUA 4MDHA 2FEAA 3TUJC 4FYHA 5ENVA 2VPYA 4EYKA 1IXZA 1SA0A 1O6BA 3EC7A 4QNMA 1UPTA 4KV7A 3LWDA 3ORSA 3C3CA 5TF0A 3HB0A 4OAQA 2YBDA 4I5GA 3UHOA 1MAWA 3FOFC 4MUBA 5DGIA 2KX7A 4CM5A 3ZWYA 4L75A 4DMCA 1P1BA 4RM2A 4AROA 4M22A 2YFHA 3VTZA 3GT4A 3G6WA 1ZCZA 5AUPB 4R40A 5HJEA 4K88A 2JHCA 2NZWA 2HEIA 1E2KA 3ENVA 1FFXA 1NXQA 4ARZA 3EPHA 2QAGA 1BROA 2A5GA 4EA8A 5ICGA 3GVHA 1QG4A 1KU0A 4BVJA 5U9CA 1U04A 4XVRA 3RWMB 3UPDA 4HQFA 1O95D 5FOSA 5PGMA 1J39A 4QQRA 1LDMA 4LE0A 1XPJA 2ZWAA 3HNOA 1K98A 1CS4C 2PPVA 1L5MA 3Q41A 4JJZA 3HE3A 4ES6A 1R9NA 3GGJA 4MQFA 4O2BF 3IKVA 4MVJA 4DA9A 3PQ5A 4ZVUA 5HOEA 2H2DA 1UJ4A 2X7HA 1J99A 3TXAA 2NZVG 1KP9A 4QGAA 4ER0A 4MMXB 2XUAA 1NI5A 5A0FA 4PIMA 2FEXA 2WHEA 2HXGA 2ZRBA 3LXRA 2PL1A 3N2YA 3NLLA 1TPZA 4RK4A 5WRFA 1QU2A 4BQEA 1GTRA 4EHIA 2QI9C 4DNFA 2Y4OA 3REGA 5HJ5A 1CVLA 5GIOE 4URWR 2N42A 2WAYA 3GUVA 3QFRA 4JHLA 1ATIA 1UZAA 4JROA 4LJAA 3JSAA 1Z4MA 2Q9AA 3E0QA 3M9XA 5IMBA 3WNVA 3BX1A 1JFVA 1RLJA 2PVPA 3QLEA 4GVXA 1EJBA 3GUCA 4KNWA 4KXYA 3UFXA 3SQXA 2GPNA 4YP0A 1GILA 3EVGA 4HRYA 5GJWC 2RGUA 1C9JA 4ITUA 2FMTA 4URZR 3TTWA 3PWSA 1JDVA 1NM5C 1TAHA 1ZGBA 3OQNA 1QGDA 1WY5A 1Q95A 4UM9D 2X4IA 4URFA 2OD2A 4CMCA 1RYZA 3H7AA 4BZWA 4N0DA 4AZ3A 1BX3A 1OAOC 1WG8A 2PKQO 3H5WA 4H6WA 5ALDA 4LFAB 1QAMA 2C2GA 2XUHA 3AV0B 4R98A 5FWXA 3NWPA 1HM5A 1OV4A 1KQGA 4BO0A 2NTEA 4AK9A 2AK3A 1G16A 3PVZA 2PV7A 5I7FA 2Z98A 3BGOS 1JAZA 4PZDA 1E9SA 1SBYA 4KQ2A 2PANA 5DM0A 4CLOA 5JCXA 1ZPDA 2PZAA 3TKLA 2ZYTX 1LLDA 4OGGA 4XARA 3WGVA 2FPPA 2V5AA 2FSVA 2X1LA 3DW3X 3G5MA 4PLCA 4LCJA 2Q29A 3BEOA 3V8NA 1W5SA 3BTOA 1J24A 2EFDB 3DNFA 1NXTA 2QUIA 3EEFA 1LPMA 4JI6B 5IFKA 4DV4B 3RTBA 3FHOA 1IY2A 2DHEA 1WDWB 3PWZA 4OHUA 2QPAA 3DLTA 4OLFA 2DJ5A 4Y2SA 1LX7A 5B7PA 3QUQA 3RFXA 3HACA 1YB7A 4CI0B 2IIVA 3EGXB 5KVAA 2IH5A 3ELYA 2OA0A 4DMUB 3KJQA 1RAIA 4I9HA 2QX4A 4KN5A 1YL6A 2PX0A 4ZAGA 3ZI4A 3R9WA 3UT5A 5KTOA 5K8IA 1T25A 4P83A 1J7KA 2O2HA 3L7CA 4OIFA 3ZD6A 3WO0A 3K9QO 4NDZA 1UMBB 4HNHA 1FX0B 1OPRA 4HLDA 2G77B 4QXMA 2Q1XA 1DLJA 1UFRA 3T7AA 1K4YA 2ZG6A 1UBGA 4IFEA 1ESCA 1XZDA 2I6GA 4G26A 2AE1A 2GN9A 4L6IA 1X1AA 1Z5OA 3I05A 3GMDA 1ZBDA 3NDPA 2VBIA 4FU0A 4F4FA 4WLEA 4LPKA 4N5DA 5CNKA 3LQ2A 3HLKA 5CLLA 4CHTA 2G6TA 1JVNA 1SXJB 3TB6A 2Z43A 2PZGA 5ICCA 1KU6A 1SC6A 2PCLA 1SOAA 1E0JA 4QD3A 3TL3A 3F3KA 4NBNA 1LH0A 3TVDA 4L95C 4C03A 1V4BA 1WRBA 1X42A 3MINA 3IPCA 4V0ME 4HX5A 2OCAA 1Z62A 3LIIA 5FPQA 2PQ0A 2WJJA 3G82C 2PX8A 2GPJA 2IODA 2O3UA 5F7OA 2QN8A 1J1IA 2OAQ1 4EZBA 5JNSA 3MQFA 4OU4A 2W6CX 3QMMA 4L4YA 2FMUA 3UWPA 2QY9A 1L7DA 1I6WA 3INYA 3ITDA 3QUAA 1P2SA 3OQHA 1NTOA 4HB0A 5AM1A 1A3CA 3ZV6A 3QE0A 1C1HA 3MVEA 4JYBA 1SXJE 2QD4A 3DV0B 1GPKA 5DASA 3WP0A 2R6JA 4OYRA 3TLEA 4C0XA 1E4YA 1YHYA 4GRAA 4RY0A 1SQ6A 4YPVA 2E37A 2XKAA 3EXG2 3IDZA 2PKRA 4BE9A 5G1NA 3SGLA 3EQZA 5LFAA 1SO8A 1EFVA 3ANMA 3N3AC 2YNMD 3PQ4A 2BP7B 5CXXA 3UF0A 1PR0A 1YQEA 3N0VA 1ULHA 3R4CA 1HO3A 1MB0A 5CM2Z 4DFDA 3G1UA 4TZ0A 4RIEA 2FA9A 3CJTA 3LS2A 3O92A 5T8KC 4YJHB 2OWEA 1Q6ZA 4KAFA 3HWRA 2FFAA 3P0HA 3TLGB 1N2GA 3WB9A 1J7JA 3HR7A 2OZLB 1F4PA 1G63A 4ID9A 4PTZA 1VSQA 2P0YA 3WQQA 2O06A 1H9BA 1NJ2A 2I4RA 2K2WA 1UAYA 1ISGA 1NRWA 2Y3IA 4YMSA 3CG0A 4HLCA 2Q5HA 2IU6A 4YUYA 5I4CA 5KNBA 2Z57A 1U5BA 2QX6A 3IC5A 4PF1A 5A7GA 2DBVO 5JAOA 3A4TA 1M2JA 2EGGA 5TPWA 2WUFA 4DLRA 1TZCA 2FG7C 2PR2A 4HEJA 3YASA 3IT1A 2Q0HA 2QN6A 2B5VA 3NJ8A 1T2AA 3M33A 1MJGM 2H2FA 2QMHA 2QR5A 3HKDA 3W5HA 4LISA 2WLSA 3GGGA 3TBFA 1EFUA 1SXPA 3WIDA 4IKEA 3GP8A 2VAXA 3W4KA 4JB8A 5FADA 4N40A 5DM1A 3Q15C 2NVBA 4NCHA 1YK1A 3KXKA 2VTDA 2R7KA 4QHSA 3L6BA 2QL5A 3UHJA 1P2DA 3AMVA 5DULA 1KP2A 5G40A 5EXEA 3CLUD 1M6EX 3LRXA 4KPYA 1GGJA 4W5OA 3H1FA 2OKCA 5BNIA 3N39C 4HH0A 3FB1A 2QTTA 3TIXB 1E64A 4PXAA 3WGKA 4BY9E 3TSZA 4ARVA 1EI9A 3G7NA 3HJNA 2NZJA 1ECLA 3F4BA 3C74A 3WV5A 1WXQA 3C3MA 4QBHA 2C29D 5C3MA 4BNDB 5LKRA 121PA 4MUHA 1J5PA 3FWYA 1SY7A 4UM5A 2CLKB 3T3EA 1SUIA 3M3HA 5BO5A 2ZI3A 5FNVA 1J1UA 1OYWA 3RU3A 2QLJA 2GNPA 4FCCA 4EHNA 4ESHA 1GQ2A 3ETEA 3KLPX 4BCDA 5B1YA 1E6LA 2C07A 2V7GA 3DFUA 5JNUA 2UUAB 2HOQA 2VDUE 3DD5A 3WQHA 2JASA 3ST7A 1Z34A 1EBBA 4ZAZA 1JMYA 3L0CA 4WXMA 5TQJA 3UK0A 1T9GR 3ERCA 1CQIB 2EQBA 3G7UA 3LT2A 1M2WA 2M6KA 3E5NA 3H11A 5HTOA 4BV8A 4RDXA 1QFSA 4Q3OA 3AONB 3R75A 1U2GC 5KQGA 4XWOA 1VYHA 5K0EA 2FHSA 3OQMA 1JSZA 1FLAA 3BULA 2L19A 3ISJA 3CO0S 4Y8VA 1Z0IA 2JIRA 4QLAA 1MENA 3M6WA 5A62A 3GJ7A 1UZUA 5K0LA 2IOHA 3KZOA 6NULA 5L4LA 4EG8A 4Z4QA 3EG5A 3CEAA 1QO9A 1LJUA 1B4DA 2WD7B 4Q18A 2WIAA 1XN1A 3PUZA 1MB2A 4QICA 2R4QA 3ZJTA 5A9RA 4JOSA 4W1PA 2XRMA 3K5WA 2KJQA 3MS7A 5C4MA 2F4NA 1KHTA 1U4OA 1QJ4A 3W5IA 2GD1O 2J08A 2O8EB 1EZZA 4GBGA 4M6WA 3V1MA 1M8FA 2LCFA 1TVCA 3I92A 3EIEA 3LLUA 4U7WA 5BSEA 3FMVA 2C92A 2NT3A 3B20A 2DECA 4JENA 4RSRA 1COWA 5FUBA 3R7NA 4D4JA 5JHGB 1B73A 3QKSA 3WLPA 2ZOSA 1C4KA 3WICA 1NQXA 5HS6A 3SZ3A 3BJEA 1TQ8A 3H0CA 4XD7D 1JPVA 2XVAA 4IIJB 3IMCA 1UIRA 3H1AA 3OZWA 3U4QB 2WAOA 1P81A 3TSCA 5KOIA 3UMCA 1E1MA 1Z5NA 3VMFA 5C81A 4PSDA 2Q4EA 3UQZA 2Z04A 4TWBA 2JGLA 4TSKA 1JHZA 1QHSA 3ZKWA 1KEVA 1QORA 4TTAA 2G0AA 2AXQA 3JQCA 1XFAA 3IUJA 5DXFA 4EF4A 4OGKA 4EM6A 1DP4A 3UAZA 3W4JA 4LDAA 4F3TA 1DKMA 4QM6A 2NT4A 1RAFA 1Q7GA 1TTPB 5JJBA 1C3OB 1HQYE 2NX2A 2WFLA 1WDLA 3H75A 3NETA 4EYOA 3MXTA 3MMPA 5JPCA 1XRJA 1DCTA 2CJYA 4B75A 4HHEA 3W5SA 5JCOA 1OKKA 2WAXA 3H5LA 3NBFA 4R83A 4N82A 3U3ZA 3HA5A 4CGZA 4K9NA 2QXUA 4NFHA 2OG2A 1CUEA 4UFOA 4BUZA 1U1CA 1D0VA 5DLDA 1HE8B 1E2BA 2BEUA 1OXXK 3JZMA 3RO7A 3A9WA 1AU9A 1YO6A 2AX4A 2FEMA 1T5TA 2V9CA 2OD9A 4KQHA 3A58B 3BXXA 2R1VA 1SGWA 4MRNA 3QF4A 1I3CA 3FY4A 1Q1BA 3KVVA 4HDRB 5JCOC 1QC5A 1YU6A 2XGOA 1P1RA 2JI4A 3EDRA 2CDAA 4DRXB 2DUWA 1JJAA 2IV3A 3ZN2A 3GD7A 3JV7A 5AKKA 5HTKA 4FHZA 2H48A 5C7IO 5IKMA 1HFJA 2RCNA 3AETB 221PA 4HYEA 1B41A 2E49A 2XMRA 1Z5GA 1K7YA 1DMSA 1PR3A 2GEFA 4G37A 4LE2A 4O2AF 3T54A 2V3VA 3EWSA 1Z7WA 2Q07A 2XTZA 4XIGS 1VGVA 2HX1A 3A3NA 1HNWB 4XW2A 3K1AA 4IDQA 2K6GA 1QRAA 2Q7DA 1RLMA 3LM8A 1ODJA 1FA9A 3K73O 1UXKA 3Q7TA 3V6LA 5ITVA 4Z49A 3VQTA 2V5UA 3C3PA 1UQTA 3TB4A 4RGYA 2O8FB 1KXJA 5EYPB 2OLKA 3TNDA 4I4IA 3DFFA 2A9KA 1PNTA 1ZK3A 3IP6A 3OG9A 3CPHA 5F12A 1NBEA 1CY2A 4COKA 1XVVA 2BFNA 2P2YA 4DV7B 1G8FA 1W44A 4PCUA 3VH4A 4I99A 2GAJA 1EFRA 1R4NB 1Z8FA 4MVYA 4BN0A 3H8VA 4E1BA 1Z38A 3BIXA 1JDNA 1T4GA 2FKNA 2P9ZA 1DCKA 3L7JA 2X77A 4J16C 5MF6A 4JELA 5FV4A 1AGRA 2GZ1A 2MINA 4F84A 4ARSA 3NOXA 4JVNA 1U3CA 4N65A 1CD5A 2ZVPX 4NYIQ 4FCWA 1TX4B 3QEMB 4GEGA 5GM2A 2NU7A 1PW5A 3GEGA 4WRRA 2XB2A 1FSFA 3W2TA 4WXRA 1HNZB 5KS2A 4AKHA 5H70A 1WDTA 4FMDB 3GEBA 1SD5A 3HHEA 1CJSA 1ZIYA 2DGDA 1LRJA 1D2GA 2Q3HA 3P94A 4IWYA 3WKEA 2ZUCA 4M0CA 1WQ1R 3U16A 1UC4B 4IJ6A 4WUTA 4G0PA 2D1QA 2CXQA 5CVEA 3LKBA 3A6GA 3PUVA 5K51A 3A3KA 5KYTA 3FJYA 1XXLA 4H35A 4EATA 2HHHB 4CEJA 1E2LA 4D92A 2YXLA 5EXTA 3M0EA 3I3SR 4X63A 3VUFA 2B69A 4KE9A 2M1ZA 1ZD4A 4D9KA 4CEIA 2ZRQA 1A95A 2EBUA 4NS1A 4UJ3A 3EW7A 1JX6A 1F8GA 1M6YA 1U7TA 4KUEA 5LBIA 4DBVO 2XVMA 3DM9B 5CFMA 3PFFA 3VTFA 1DOAA 1JALA 2BPOA 4F12A 4RX1A 1LZLA 3OE7D 2IX9A 4UU1A 2J0SA 4ERNA 2EEZA 2XZLA 1V25A 4S1VA 4I66A 1J0CA 2PGOA 1DRUA 1U8TA 4Q9DA 3RTDA 3ZY4A 4JSYA 4ZALA 2KLHA 3CZAA 2IY8A 4YP7A 5CGZA 2QTVB 4BQFA 1AUQA 4HXGA 2FWIA 3DMYA 3L1KA 4RZHA 3WTBA 1P7YA 1ZLYA 2BEVA 2Q3LA 1Z4OA 2ZEJA 1J23A 3HFJA 2BKUA 4PLWA 4XXHA 4FDVA 3KCQA 4G8JA 2NLOA 2XSZA 3H6HA 3TCKA 1CUIA 1MJ5A 2ADFA 4LZNA 4EO9A 1JG1A 1YASA 2DTDA 1GKIA 1V26A 3GZ4A 2WU1A 3FW1A 1Z13A 4DLUA 1E1DA 5SY9A 3TR0A 1UKAA 4NOJA 1I0IA 2Q9UA 2GZDA 1YL5A 1IOLA 4OQEA 3LT5A 4L07A 3TPZA 5JQGB 2QVBA 1RWKA 1BWRA 2B7CA 4D3YA 4S1OA 2PTHA 3OY7A 4K05A 1T9BA 1VL5A 3OURA 1QZZA 1P3Y1 2H06A 4FOTA 2YVQA 4UMVA 2DFLA 2BJHA 5EMLA 1FDUA 3FCSB 1YJQA 1XX6A 1E2NA 5FWAA 2FQYA 4MKIA 1UMCB 4Y2JA 1N3BA 4LWPA 1I3LA 2JEZA 4L5CA 1O5TA 3FTFA 4NFSA 1DTWB 4KGXA 3A10A 3TOVA 4XR9A 4E5UA 4CIYA 2ZI6A 4DIFA 2X86A 3WGTA 5C8ZA 3GY0A 5KJCA 5FH9A 1IHPA 3A2KA 3W6OA 3R4VA 2XCRB 2C78A 5DKFA 4CF6A 1XYGA 3CIOA 3CXUA 4RKRA 3OD1A 3AC0A 3BWMA 3P9ZA 4CR8A 1NAHA 3LPNA 3ZDXB 4XCQA 2PWBA 1DKOA 4PM4A 3B13B 5EE9A 4FSDA 2E85A 2H7XA 4RPCA 2A5LA 3T9DA 2F3UA 1T5DX 4H1HA 1NQOA 4TV8B 2V65A 1UH5A 2XMGA 3K2EA 1RXCA 3BN3A 2GNOA 2J9FB 2PXAA 3IESA 4C06A 1OFUX 5JXGA 2NVUB 1US8A 3ZXSA 1Y8AA 1JR6A 4DIBA 4F2GA 3Q7SA 5BN5B 3T35A 4L0DA 2UVPB 1FRNA 1J90A 3TZ6A 1C3EA 2Y6UA 1NF3A 2HPVA 1T8WA 3C3KA 2AN1A 3PXCX 1YFLA 2Y0DA 3QOXA 3RU7A 1J0BA 2FG5A 2FWRA 2CFCA 3PITA 2GD2A 1CEXA 1WWKA 2F8LA 2FN7A 2ODPA 4KQ6A 2HQBA 2RGNA 4RDHA 2I4IA 3M5DA 3IRVA 4RU1A 1BW9A 2V6FA 1A8PA 3WB2A 1A50B 2WG2A 3JATA 1KVRA 2XLCA 2B4TO 4AS2A 3IQDB 1OZHA 1B2RA 2XOEA 4ZDJA 4PHHA 4CHGA 4IHAA 1L5RA 3FF4A 1ORDA 1XD9A 3MAJA 4QVKA 2WJGA 3BH6A 3DS8A 4R41A 2Q2OA 2P6RA 2FH5B 1P7CA 1H8EA 2ZB3A 4QEKA 1ZGHA 3KQOA 1ZYUA 1E7YA 1G2PA 4JKIA 3X2SA 4BMOB 3KKMA 1AX9A 1NQTA 5B6JA 2AR7A 4MDFA 3GDFA 2P2ZA 4QAJA 4ZU3A 1L7BA 3WNZA 5CLGA 1V71A 2ECOA 2YNMC 4MRMB 3C85A 1HBJA 2D0OB 3U26A 4IKOA 3NT2A 2AJLI 1A04A 2SHKA 3BCUA 4BB0A 1CY1A 4XEUA 1XNQB 5D01A 3EMVA 3R3SA 1A9OA 3T5BA 3GRYA 2ECQA 2D00A 3WO1A 1BN7A 3CX6A 4M1QA 4U1RA 5ABPA 2O59A 1GNQA 1PJQA 3DW1X 4ARUA 1DJPA 3ZR4B 4AF8A 1GQOA 4OYHA 4FFSA 3TLMA 4C5CA 1EIWA 3IBYA 2XT6A 2JFBA 3EVDA 4XUGB 1NZJA 3G02A 4UNNA 5EJFA 4MUYA 1GM5A 1EXDA 4BGEA 1UM8A 3MCVA 1DAGA 2FPWA 2DZDA 4BTVA 4MW0A 1KQFA 1WUTA 4NX2A 1P18A 2AK2A 3F98A 2QSUA 4RM3A 2ROQA 2VK1A 4D98A 4WBSA 1BEUB 2UAGA 4RKFA 2OFWA 1PT8A 2G1UA 2BE7A 5I7HA 4M0DA 1PEKE 3AXSA 4IHJB 4US0R 1GARA 1IJEA 3GMSA 1OIXA 1QJCA 3A8TA 5DX8A 1KNXA 4EPTA 4A27A 1FJHA 4BAZA 5TV2A 3AR6A 5DNEA 1GPJA 4D82A 5L53A 2JA1A 3D9QX 2AFVA 3TS1A 2DVMA 2H0QA 1MHTA 1KH2A 2ZAIA 1TKCA 2O14A 2XZDA 3EXHB 2DY0A 2YQ4A 3LVFO 1FB5A 4MA0A 5DV9A 3W6UA 1JLLB 5FTMA 4COOA 4ZIRA 5C37A 1JQAA 2I4LA 4EG6A 1BCRA 4BNHA 3HTXA 3RC2A 1CFZA 1X77A 2WIBA 2NUBA 3GNQA 1QRDA 4B73A 4Z7QB 4X92A 2CDNA 4QG7A 3PHBE 5EG5A 1G20B 2C7PA 2WJIA 2VK8A 1D07A 1N6HA 3LA6A 1RYDA 4KGDA 4LXHA 1SC9A 3T7IA 4AF7A 1ZGGA 5GQSA 3N05A 5MFZA 1O94A 1U7OA 3I45A 1D5CA 4KSBA 4AKGA 3AW8A 1TIBA 1W47A 3WSTA 4QU8A 2ZPAA 4TRJA 4F3KA 4B7XA 2W8BA 3G13A 3QJYA 4FI3C 4P4GA 3AHFA 2DEUA 1RZ3A 2IU4A 1UR5A 3GOQA 4R2HA 5T6BA 4OOEA 4B6JA 2XF2A 5FOTA 4BNUA 4X6XA 1DKQA 1A4UA 4TTJA 4HC4A 4AO7A 1VJ1A 2DG2A 4CDMA 1G20E 4F4UA 1EWRA 1CY8A 2PJUA 1KDYA 4DNXA 4YO7A 1B15A 2FY8A 3WC4A 1OLSA 4LJ8A 1O94C 1BE6A 1SULA 3ANTA 3P9PA 4IIEA 4WAUA 1HE5A 1E5LA 2UKDA 3T3NA 3DCNA 4CODB 4IJVA 2W48A 4LYHA 3LUCA 1OQAA 3N8IA 2QWXA 3QU7A 4YRGA 2WIDA 1UJCA 4LS3A 4WASA 4DMFA 4ZTBA 4NOMA 3QVJA 1QR6A 2X4GA 5CX1A 1KI9A 2ZIGA 1PWXA 3EYWA 4DC1A 2J9YB 4RPGA 4CKCB 5JZ9A 3GROA 2BFDB 2DUUA 1T9DA 3DL4A 4TSFD 1VPWA 4F8EA 1C3LA 1HDYA 1OFHA 3N75A 5MHTA 3U7FB 3V7UA 3KE8A 2CJXA 1YB4A 3WIEA 2P1RA 1XO1A 3COYA 2CFIA 2Z95A 2Q1YA 3DDWA 3WJ7A 4U0KA 2CWWA 3WGIA 3S4YA 1YRQA 5EGNA 3FOEC 4FILA 3CKKA 3ZE8A 3X1DA 1XD2A 4A0QA 3DONA 3JQFC 3F5FA 4FEGA 4DDKA 5K03A 1CUWA 4YRRA 1I4EB 3GRPA 1YGPA 4OXXA 1YS7A 1MPXA 4V03A 3ZQ4A 2CFSA 4J03A 3TX6A 5HJ7A 3BJZA 2JAOA 4XWWA 2AI3A 4MGZR 1LJ8A 5AHXA 3SHOA 3V1TC 3QMWA 3M83A 3S2FA 3VNBA 5LZ2A 2O0HA 3EUWA 4B8ZA 5AW4A 3ADDA 3AL2A 4AVYA 1Y42X 2NXCA 4O4LF 2HF2A 1RE1A 2JKYA 1I4LD 1L5ZA 1SG6A 4RV9A 4EHJA 5L9AA 3WMEA 1P17A 3HY4A 1RXUA 4L85A 5AVKA 3HVUA 4XIFA 5AUOB 3IPAA 4G65A 5TC4A