2D7JA

Crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
188
structure length
188
Chain Sequence
MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKVLEHYDEFNVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVEIEIIDEDEIFKGLPKRLKVWESHMDEVKELPPKFKILARSETCPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNFAKLCGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords GMP synthase [glutamine-hydrolyzing] subunit A
publication title Crystal structure of glutamine amidotransferase from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 56
structure length 188
sequence length 188
ec nomenclature ec 6.3.5.2: GMP synthase (glutamine-hydrolyzing).
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2d7jA00
4JQSA 3VU3A 1P80A 4L78A 3B3AA 3EFEA 3TTUA 2YWDA 5LIRA 2ZUSA 4AJ9A 3ZJ4A 2YWCA 1I7QB 3TTVA 1QWSA 4B7AA 2ABWA 4ENVA 1KEEB 3RHTA 3P9QA 2ZUWA 1T3TA 3ZR4B 3TTTA 2R1TB 3OT1B 4Y0NA 3UGJA 1U9CA 1QVWA 1VCNA 4L8FA 4RKWA 3TTXA 1GG9A 3GRAA 3EZGA 3TQIA 4ENSA 4P35A 4OGFA 4I2NA 4Y1EA 4Y1GA 3TTYA 1OI4A 1C30B 4AULA 1FY2A 3CY6A 3PQ8A 4P34A 1A9XB 4ZGGA 5IP5A 1KWGA 1QVVA 1BXRB 2GHRA 3MGKA 1T36B 3CZ9A 3D54D 1R9GA 1ONSA 1I7SB 5DFAA 4S0ZA 5JZOA 3TTSA 1JVNA 1PV2A 2RK3A 2XF2A 1CS0B 4K2HA 4L8YA 2VPIA 4ZDJA 4P5PA 4OIFA 3UJNA 4OFWA 4QYTA 3R76A 4ENUA 4L95C 3FSEA 5SY6A 1OY1A 1CF9A 3FIJA 3UK7A 4ZDKA 3SF8B 4AUNA 3NVAA 4Y1FA 3B36A 4D1YA 1IPHA 5BV2P 4BFLA 2V4UA 1VHQA 4RKYA 4WINA 1Q7RA 3R75A 1O1YA 1GGJA 1OX4B 1SOAA 2NV2B 3L18A 4AUEA 1M6VB 5E9AA 1J42A 2VDJA 1N57A 3PQ2A 1Q2UA 2YWJA 3ER6A 2NV0A 1P5FA 3P9RA 3OT1A 4MGHA 3BHNA 4HCJA 3UOWA 4E08A 1CE8B 5SY4A 4BIMA 4OQ4A 3WFZA 4E5VA 4ENQA 3TTWA 2ZUUA 4ENTA 1VCMA 1I1QB 2R1VB 2FEXA 3PQ4A 3R74A 4XLLA 4PXYA 1P81A 4ENPA 3NORA 2R1UA 4LRUA 4GE0A 4P2GA 4N12A 4B31A 1GPMA 1KXJA 1P7ZA 2VXOA 2WJZB 3MIIA 4P36A 1IZYA 2ZUTA 3CZAA 4B5KA 4MNTA 5JZMA 3CNEA 4Y1RB 5K4AA 4B40A 2D7JA 1PE0A 4L7QA 4UZSA 1SY7A 3L4EA 1GGKA 3PQ6A 4OGGA 3F71A 1GGHA 1IZZA 1G2IA 3SF8A 1C3OB 5SYAA 4WXYB 3ZJ5A 1JDBC 2R1TA 1WL8A 1FYEA 2VKTA 4UOZA 3N7TA 3PQ3A 1OX4A 4UCFA 3EN0A 4R7GA 1OX5A 1KA9H 1P7YA 1QF7A 1KWKA 1S1MA 3NOQA 3CYFA 1VCOA 1GGFA 2ISSD 1L9XA 1PDWA 1QDLB 1K9VF 2AD5A 2VRNA 3EWNA 3L7NA 3P9PA 4L8WB 2GK3A 4N0MA 2RK4A 2A9VA 2YWBA 3PQ7A 4I46A 3KKLA 3L3BA 2AB0A 2R1VA 3PQ5A 5SY9A 2OR3A 4OJYA 2W7TA 1T0BA 2ZUVA 4GE3A 2LXNA 1GGEA 3NOVA 4GUDA 4ZDIA 4ADSG 3UMMA 4B2YA 3SOZA 4ENWA 1GPWB 1UCFA 3B38A 3BWEA 4UOQA 4LGYA 4MTCA 3NOOA 3F5DA 4AUMA 2H2WA 2RK6A 4UNIA 3EJ6A 3P9SA 1PDVA 4I4NA 1QVZA 3M3PA 4Y1RA 4ENRA 4QYXA 2IUFA 1OX6A 3NONA 4BTEA
chains in the Genus database with same CATH superfamily
4DDTA 2XZOA 3O5AA 4NECA 3URMA 4ZHQB 1H2RS 4BHTA 3ICCA 4K9SA 2AA3A 1UMCA 1MGOA 1Y9EA 2JFWA 2FX3A 3GHYA 1L5MA 3ABIA 4Y9SA 5ALDA 4EDHA 3ECSA 2XI4A 3SSAA 2E87A 3BE8A 3UXEA 4TWAA 1FXWF 4YWHA 5HK8A 4FIZA 3GRPA 2QZJA 1JSLA 2FN4A 3AIMA 2ID4A 3BQ9A 5EERA 1AIPA 5I5GA 2Q3HA 1PEDA 1J0EA 2DR0A 6AT1A 3BMQB 1WV1A 4QRDA 4MLDA 4RXTA 1ZSYA 2GN0A 3FYSA 4WQMA 2QUIA 5BYJA 5YASA 3TVTA 3VZQA 1FL9A 4DUZB 2BGWA 4M1QA 1OU0A 2IPMA 2O3JA 2QV0A 2ZROA 2A9FA 1QR6A 2HHJA 2IT1A 2XODA 3N74A 4R1MA 5A9TA 5C1OA 5JS6A 3GLRA 3D8UA 4ZEMA 3G68A 1ML4A 1KFJB 4HDQB 3NUGA 2C2MA 4NNJA 3BZUA 5J5AA 5TC4A 1IULA 1EFUA 1ZMTA 2XF2A 4FUQA 1Q0UA 4BU1A 4F5EA 3ED1A 1MJGM 1NOIA 2QGFA 5KTKA 1T15A 4HXYA 2E4VA 3HM2A 4X8HA 2EGHA 1GO2A 5C53B 4EATA 1SAYA 5JCXA 2HF8A 3LWDA 5K3FB 1QGYA 1J0DA 2XMZA 4JXJA 5GZ3A 1M3SA 1M1UA 1M6VB 2QMZA 1BX1A 4G2NA 1RI3A 2IW1A 3GPDG 4R81A 4WWHA 1R37A 3E05A 1E77A 2NSDA 3LKDA 4P80A 4UDNA 3QH4A 5FNZA 3R7NA 5IT0A 1NF9A 3KLNA 3FE2A 4AKEA 4Q4HB 4F1WA 2GN4A 1Z8HA 2GGSA 1Z2OX 2JGDA 4MVJI 5D5HA 4PZZA 1ZD2P 2AUTA 3RSZA 4D74A 1WXWA 2DFDA 4JJ6A 1KO4A 3GT3A 4MB2A 4Y9DA 2BEWA 3V97A 4RAQA 5FULA 2HBYA 3BXXA 4UM8B 3GWGA 4LRUA 4D99A 1NJ8A 2SICE 3D6HA 2WJZB 1NBAA 4V39A 4ZVLA 3BT7A 1FMJA 1HT0A 3ROZA 2HHLA 4EUFA 4C4PA 4KZKA 3LBFA 4MP3A 4ZCRA 4V2IA 4EG3A 1V11A 1HG1A 5C7YA 2WFLA 4FP9A 2AW3A 2H48A 1ABFA 4DNXA 2VDWA 4PYLA 5AVRA 1P2GA 3GFFA 1NV8A 3GNQA 4E13A 2W6QA 3ANXA 3LUKA 2WAMA 1P75A 4MMYB 2I6TA 3BE6A 1O6FA 5THXA 1KJ9A 5D5QA 4FDLA 2DFVA 1N7JA 4TV8B 3DYIA 1SG0A 5KWVA 1P7YA 3IKLA 4G4GA 4YJ2A 5A3QA 1YC5A 1CDEA 5ALOA 1CK4A 4OUDB 2O8EA 1LWOA 1RQPA 1P6UA 4OI4A 1R6DA 3QX3A 2JL1A 3VMFA 1QANA 4KH0A 4H18A 1LY1A 1R12A 4RLSA 1JLHA 3IRVA 4P33A 4D0RA 1WUYA 4U7WA 3TZ6A 2AFIE 1CVRA 1J8DA 2DQYA 2WB4A 4MVJF 1RWXA 3ND7A 4Q0MA 2VTVA 2HU5A 3RKUA 1JPJA 1XN4A 3T5CA 1T5HX 3HN7A 3WGNA 1ZXLA 1JJBA 1C9JA 1T3SA 2MWMA 3NVMB 1LEHA 4I9HA 2TMKA 3ASVA 3VNRA 2FPPA 4I99A 3ROFA 3GDGA 4HZGA 3MS2A 3QNWA 4PR0A 3KWMA 2XIQA 3WGTA 1E9BA 1U0JA 4MROA 3ZHYA 3KYIB 3SE0A 2ICAA 2BR4A 3GGCA 3PXUA 4L4XA 2CNOA 3VOSA 2Z5LA 1XEXB 5KJCA 4BQIA 1QIKA 2PH5A 2NIPA 4GZLA 3OA0A 1MC8A 2HK7A 3C4QA 4ZGBA 2CFOA 1Z7YA 2CCKA 4C6RA 4ZEVA 4MB0A 1Q16A 1OFIA 3DW1X 4BNGA 4Z51A 3HUUA 1F6WA 4HDAA 1GUBA 4CHTA 3Q5DA 2PZMA 4FWBA 4KI0A 1E9CA 2JJ8A 2JKVA 2PQMA 2RH8A 1RZRA 1XO1A 3TJRA 2FPXA 1PZHA 3CZRA 3VR4H 1N6OA 1DFIA 4KIWA 1G8FA 5CHEA 3QW4B 1ZCBA 1B3BA 2YRWA 2GJKA 1WKCA 2IYWA 4B75A 2FFHA 1G41A 3DNMA 4DG5A 2IWHA 2RH9B 4DRZA 4MQ4A 5DXFA 2X14A 4C4TA 1A5ZA 1U0BB 5CU7A 4FGKA 4TYYA 1X70A 4MSUA 3E9DA 5C1IA 3P2OA 3PPXA 1PBNA 2D13A 3FYUC 3HMKA 1Q2XA 4P3OA 2R62A 4TQ9A 2X22A 1TVEA 2HWWA 2WTEA 2CFIA 4OJKA 4L15A 2YJTD 3BSYA 2VWPA 3I0NA 1QRSA 3NJRA 1QLJA 4DMFA 1NNUA 1Y0BA 7ADHA 5KSWB 2NO5A 1IHYA 4JLBA 4I5GA 4ZAXA 3VTKA 5KVAA 3MSXA 3ICWA 1X15A 2ZIXA 3ZIAA 1WZUA 1T13A 3C3YA 3EXFA 3GV0A 2OOSA 3IT1A 5SYNA 3RV4A 4BU0A 3S81A 2GF0A 1KE2A 4GC5A 2PS3A 4A8HA 1I0IA 3GJSA 4GLLA 1RW4A 2ATIA 5E9QA 5DT9A 4RZHA 1GZHB 5IJWA 1CUGA 4AO7A 4KWCA 4HLQB 1EEXB 4O4HB 4DEVA 2X0NA 1FS4A 2QTZA 2R7AA 4D8TA 4XTRA 3CLHA 4IIGA 5BORA 3EXEA 2Q41A 1MGPA 3JV7A 5LYJB 8LDHA 1UZUA 4MW9A 1N9GA 2XGJA 3A3KA 2FPOA 1T29A 4WBNB 2QD5A 4HS4A 4BX2A 5A4FS 2OUIA 4JFAA 4FFVA 4ZD6A 1AZLA 3FDZB 3PRJA 3BZWA 1FCJA 5KQGA 1LPMA 3LDAA 5EQDA 5GZ6A 4FN5A 3H5VA 3CVUA 1GRRA 3ZXYA 1P33A 1Z6QA 4DW8A 3EQ2A 2Q9CA 2X5KO 3V7YA 3HZOA 3WB9A 2ZS7A 4BFWA 1RYNA 2EERA 4NHOA 5JALA 2K5UA 2BHSA 2D6FA 2WYUA 3QE3A 2J41A 3F6RA 5A4KA 1GPYA 1SO8A 1PJ4A 2J30A 1JH9A 4A2WA 1GAWA 1GA4A 3MK31 1Y6FA 2ZT8A 5CH5A 1QUEA 1PG0A 1ZSVA 2LW7A 3AOGA 4KN9S 4LRYA 3T7AA 2IUTA 3LCCA 2I67A 1EFPA 1NW9B 3S1AB 2I7TA 3CVVA 4NG5A 1CS0A 4JC0A 1Y6GA 1UJNA 1TO2E 4X20B 2IPOA 5D7BA 4LRTB 3T3MB 3VHXA 4X41A 4X97A 2K2WA 1OIXA 3H04A 4Z0NA 3P0FA 4JV5B 4TTIA 3MWKA 2PM8A 1UODA 3ASUA 1M72A 4BTEA 1RCFA 1MAAA 1RQLA 1M1YE 2PCLA 2ZKIA 4Q4AB 2WP0A 4OYLA 2E48A 3EVZA 4ONEA 1JEEA 2N9UA 1TYAE 4MR9A 2PUWA 4J4HA 2YYZA 5L3QB 3EHDA 3VPDA 2RBKA 4P4LA 3WYNA 4F91B 1VJGA 4HEHA 3EPKA 4YYEA 2CJWB 2IVZA 1CZRA 2QN1A 2ZYGA 2PEZA 2WKQA 4QTUB 4RLFA 3SQWA 3EVDA 1IRXA 3FUCA 4GKVA 1XCOA 4QXRA 3RUDA 4AJ1A 1WUKS 1ZN8A 2D1QA 3TG8A 5ECWA 1XPOA 4MV3A 3VZSA 1CY7A 1H4SA 3VFDA 3HCRA 3V9AA 2O1WA 3L8YA 3RVLA 5JYBA 1M2GA 2FXIA 2GHRA 3GAAA 4Q9IA 1EESA 4DT1B 1EFTA 3SZLA 1B8PA 2DJ5A 4RE5A 4A6DA 4E46A 2ZI7A 2BH2A 4YMUA 2ACKA 2R8YA 3IIEA 3A6DA 3BE5A 1BQ4A 4WY2A 5J4HA 2EJUA 2EL9A 3IRUA 1PEAA 3KUCA 2G8NA 2C92A 4LK2A 3TPCA 3UJNA 4KFCA 1TEXA 1L1RA 5AHOA 5SZIA 1NJ5A 1LDYA 1ZGZA 2OQVA 2PZEA 2JAQA 3I58A 3W0LB 1N78A 1C4WA 1I3LA 1NNLA 1QG0A 1T0IA 1IDN1 2H1CA 4OH7A 2O0KA 1IC6A 1YKSA 3T7EA 2CB0A 4BMVA 1JV2B 3MZ0A 3KALA 3W79A 2C77A 4DDHA 2XF8A 2XUZA 3KPWA 3LWBA 4FLFA 2FX2A 4XCXA 2NUPA 5L9AA 2EWMA 2VPZA 3CX8A 1KO5A 3HFSA 1JFTA 5BQOA 4ROSA 3ZD7A 2HN9A 3DNFA 3C3EA 1UBJS 3VKUA 1RJWA 4XPZA 4Q18A 4Y2HA 1U3GA 4E5DA 1XTZA 4ITVA 4AWXA 3IVXA 5JCOA 2WIKA 4E4RA 4EK9A 4G26A 4Z7QB 1IFXA 1UM9A 1ZL0A 4XSHA 3MIIA 3DB1A 4ARZA 2C1XA 4AJLA 1AO3A 2FQYA 4IQ4A 3JQFA 1VG0B 4EW2A 2J5RA 4D56A 1LWNA 4ZCLA 1GT6A 1N6NA 4BB9A 5IJ0B 3VU9B 2GLUA 3JWHA 2AEMA 1TUBA 5F7OA 1BZYA 3ZDDA 2PUTA 3O2SB 3ROXA 4FYIA 1SU7A 5KYYB 1TI7A 4CNQA 3WNQA 1JXMA 3QYFA 1JE0A 1BWSA 4AYTA 2HHHB 3QFTA 3BA6A 1LFDB 2YIJA 5G4KB 4AY5A 4AFNA 3F2IA 4CCYB 4NV0A 5BPHA 5I9LA 1D3AA 5F9MA 1KAMA 1QHYA 2MINB 4LXYA 2OFWA 4O3FA 4EJSA 5BUCA 3UOGA 5CDHA 2FW8A 2IYVA 6REQB 5B3KA 4OXNA 3O2QB 4ND8B 2Z3VA 4CTOA 4JC4A 3HP1A 3JVDA 4Z49A 1XD9A 3F7MA 3HYLA 4NONA 2CD9A 2Q6IA 4MAAA 4HF7A 2PMFA 1YFJA 1HC7A 3ETCA 3S1SA 4WDRA 1FTWA 1HDYA 1Q5PA 2GSWA 5HFJA 5IYZF 2A1IA 3GFRA 4YPFA 4K9NA 1VMKA 3NIGB 4KMRA 1YK1A 4OLJA 4PCVA 1UDCA 5K3SA 2RK6A 3AZOA 3S5JA 1TXGA 1D6SA 2B78A 2I8AA 3MMZA 2ERXA 1JSXA 4IO1A 4M1EA 4F4UA 4UULA 2HRBA 7REQB 1KS9A 3NONA 2VVTA 3L0IB 2DEUA 2HLPA 4EYSA 3P9ZA 4DLLA 1TUEA 5AI8A 1KEVA 2IGTA 4GMHA 4UBKA 3TFQA 4AN1A 2LPMA 4RFSB 5TVKA 1BIFA 1JXAA 2GN9A 2RHCA 4K28A 5JROA 1KQGA 3RHTA 4WK4B 1DIAA 2IPXA 5B64A 3BL8A 3N6XA 4DWWA 4IEIA 2WU3A 3FY4A 4MVJG 2WTUA 3COZA 5DOVA 3FFWA 5JH7F 4KBYA 2R6AA 5EJFA 3MWDB 4FYMA 1OXXK 3NT2A 4CIXA 4DZZA 2RONA 3KYCA 4J0DA 5EI5A 4QPZA 3D43A 4MUMA 4I5FA 5GPBA 2IYTA 3FCOA 3GL9A 2B25A 3K92A 4ZGGA 2BGGA 2J1LA 2O3UA 5TX7A 3IV6A 1EHCA 1ZRHA 1H0KA 1YD7A 1TLLA 2HPZA 3HI4A 3A1SA 4MAMA 3AY7A 4OBWA 4WK6A 3VV2A 1LDEA 2CXHA 2X1HA 4KQ2A 3IE0A 4JT4A 2UVPB 5CLLA 4BZXA 3RS4A 3LC1O 2XOKD 1XQ6A 2YVAA 4LOKA 2HLDD 1ILEA 2JDID 1W9MA 1VI2A 2GCOA 3CPEA 4ZEWA 1T2EA 2H5JA 4WXHA 4DLBA 4ETIA 2ZIAA 4QREA 1XZEA 3QSGA 4M6WB 2FQQA 5BN1A 1MA3A 4LRXA 5TRTA 1TKRA 3E8XA 1NXPA 1ODCA 2OYSA 3K0AA 5IWCA 5CVJA 4TWBA 1XA3A 5JAUA 2WJWA 2LCQA 2I54A 2QTTA 4I4TF 3WGZA 2WU1A 2P30A 3AHEA 1V4VA 2WHEA 3R4CA 2PV7A 3EULA 1YR6A 3PC6A 1KIMA 1VRWA 1SPXA 2QZPA 1ZM3A 2BFEA 3MCWA 1XK6A 4MYSA 3QI2A 4XVUA 5C5DA 4JI2B 2I2XB 4JBGA 3R7SA 3O2JA 2IE8A 1WPQA 2JIDA 2CLMB 1GSIA 2X58A 4KWTA 3L0ZA 1AQYA 3D6TB 1R6AA 3QU5A 4MI6A 1UT5A 1GKYA 2OC4A 1UDAA 4REMA 6ADHA 1KXJA 3H1EA 4M38A 3DS8A 5BN5B 1XI2A 4A16A 2DHCA 2B9VA 2REXB 3FXAA 4NPHA 5KX5B 3EB9A 2D7JA 2MU1A 2WVJA 3KUXA 1OGIA 1XZQA 3QE4A 5C7OO 5I7HA 1M7BA 1KAHA 1P4HA 4Q39A 1BE8A 3LK6A 3QTTA 3FPKA 4H31A 3MB5A 4YYZA 1Y8RA 4LOLA 1RFGE 1QMGA 3SG0A 2ZDQA 1J39A 2PSHA 1U8XX 3NX4A 1Z0UA 3EUWA 3O4JA 2OYRA 5IJAA 3H84A 3Q7SA 4PPYA 2YX1A 4DR4B 3MWFA 3KUKA 2WTXA 2EV9A 1GR1A 4IIJA 2X0KA 3Q7PA 4XWKA 3JATA 5KQLA 1FZTA 3ESDA 2QGNA 2CLSA 4A5SA 4YS6A 3BOSA 5JAHA 2W7TA 5K3CA 4LJ6A 1JVSA 3SJBA 3U81A 3H5RA 4EZBA 3VDNB 3UMRA 2FEAA 3FHLA 4MVYA 4W7HA 4F6RA 2IHZA 1DFHA 1NSYA 3F6PA 4GNRA 1UZNA 4JB2A 4PHFA 5DRTA 1U0TA 4Z9FA 2F8LA 3WY9A 5DX0A 4HEA1 3C0KA 5ULLA 1CDOA 2XJ4A 3VYUB 3SQXA 2Q7XA 2QV7A 2P65A 3HABA 2AF3C 3V4OA 4B3DA 3WK4A 1J09A 1GGNA 1I32A 3T1TA 3R7BA 2BH9A 2A4KA 1EFKA 3CS3A 1NVVQ 4MP8A 4CKEA 4NCIA 3S2ZA 2QD1A 4TMTA 1T8PA 4G65A 4NENB 2BKAA 2IXTA 3DDUA 2G6BA 2QWXA 2DRIA 1A8IA 3IOCA 4LCBA 4F6CA 3A06A 2QBYB 3BIWA 1BD3A 2JGDB 2PKQO 2WYIA 3E15A 3T7JA 4BPBA 1USUA 4MITA 1KAGA 4Y98A 1JBKA 1G9XA 4KW7A 4EHNA 4I1PA 5BNTA 5FQNA 1ODKA 2CVFA 4JP3A 3U26A 5HX7A 3QF4B 4NC9A 5LLDA 2YV3A 2Q50A 3PQCA 1EQUA 2B3TA 3RF6A 4E33A 3DL0A 2HQ1A 2O05A 3HCFA 4QFDA 3SD7A 5AW1A 2V55B 4EVRA 5JS2A 2ZRQA 4JQYA 4PTZA 4KKVA 4PPGA 4Z3DA 3TZEA 3K9LA 4ALIA 5LQUA 1HKHA 3FMIA 3GYGA 5K3AA 1IM2A 3RB8A 2QRLA 4BKQA 3FDJA 1WDMA 3IR5A 4IKOA 4K9PA 4JSRA 3QE0A 4UTZA 5DGHA 3PXXA 4CIBA 3KJXA 1C8BA 1C9MA 1SIBE 3INYA 4MUXA 5DLPA 1JR3E 4H7EA 4REQA 3I1JA 3KKOA 2QQFA 1ESCA 2DBZA 1YKFA 4ML3A 3VDQA 3ZTWA 3KJEA 3SZGA 1V35A 1QGUB 1W4AA 2DR3A 2FPGA 1UFOA 2NO4A 1SUEA 3QYPA 5EPUA 5KS2A 4LISA 2P4SA 3E22B 4DUGA 5K1ZA 1A96A 2C7OA 1L5ZA 1XNQB 1BYIA 2C99A 2DFLA 4YXFA 2OD9A 3L79A 2R00A 2XLBA 2OCGA 2I3ZA 3FTNA 3O2NA 2I2AA 4WK0B 4C5AA 1R10A 5JS1A 1Z47A 1ZINA 1E2MA 2MSEB 3CZAA 4ETMA 4S1TA 1JZTA 4RMHA 3FPLA 1G6HA 3CNEA 3PXGA 1DAPA 4PHTA 3AVQA 1UM8A 2G5CA 4BN4A 2QLJA 5ELXA 5JVDF 3SHWA 2JFGA 3K2IA 1MDBA 2OENG 3SI7A 2XGSA 1FF9A 3M5CA 2Q5FA 1TTTA 2FHPA 5F7ZA 1GARA 5TQ0B 4JLAA 1IBCA 3SLKA 4N03A 5BURA 1B00A 1BJKA 1OX4A 1D4OA 1T5OA 3PG5A 4Q93A 3C1UA 3H83A 3UW3A 3WMFA 5DYWA 5JCOC 2GAJA 4E6PA 3Q3HA 3W6ZA 3EFBA 2JJ2D 3ZG6A 3IEPA 3PE6A 3JQFC 2V54A 3WLOA 3VR3A 4URFA 3DGEC 5IT4A 2FTKE 1ACLA 1VSUA 2R79A 1X7HA 3X1YA 5EUQB 4PHGA 1YS1X 1KYXA 4HAWA 3VPHA 1FUUA 3IB3A 2YXDA 1G20A 5M29A 1XTKA 3BD9A 3PJRA 4FOOA 2EBWA 5EUCA 3RRXA 2BGNA 4YY3B 5E1DA 3H2SA 4UOQA 2WNIA 3Q0EA 1G5FA 1EVEA 3T12A 4JCOA 3QLUA 3EAQA 1QLHA 5E4FA 4JOBA 5A7HA 3ADCA 4EJSC 1O5OA 5A9RA 3LZ6A 4L8GA 4LMRA 1QAOA 3J7TA 3VU3A 1VBFA 1B1CA 4L4YA 3STTA 4F9EA 4FB5A 4UBOA 2PUBA 2VAXA 4JIMA 1UADA 2ROQA 4R41A 3NP7A 3MCVA 1HLPA 2YVUA 4ZMBA 2P9FA 1ZJJA 4NULA 4PCUA 5AKYA 4BV8A 5FI0B 2QG6A 3OUUA 4FE4A 1GCIA 1BS1A 1V1JA 1AQ6A 4KPFC 4YAIA 3WWPA 1SUIA 3SQNA 4JQOA 1ONNA 4IIVA 1GRVA 4NWIA 1QRDA 2X41A 4KN8A 4YV0A 2EKLA 3R44A 4L8VA 3E6AA 5EZYB 1EUDA 4YRMA 1EINA 2BRUA 2WAOA 3AL2A 3ZDAA 3EPHA 2FZWA 3G2QA 4IIEA 2XADA 4RGVA 4FUTA 4TKUA 5KYTA 3I2GA 2Y0EA 4YJGB 2CMKA 4JC8A 5AW8A 3FYCA 4JITA 1KH2A 4G5HA 4F97A 2C7PA 2IUUA 2H4HA 2I5PO 5EZQA 1BKDR 1NBHA 3HLYA 4QSMA 4N0DA 4WBNA 4EPYA 2B4QA 1TLFA 1QX4A 1TX4B 5EHIA 1N9GB 5TF0A 1S4QA 2AMVA 4LTNA 3ZCUA 4B2PA 2D8MA 3T5MA 2XYPA 1N6HA 2JAXA 4KR0A 2PL5A 5A05A 2C84A 4CM1A 1L4BA 2NNWB 3BSWA 4D5GA 3QVGB 5EKUA 3O1IC 1Y3AA 4MCHA 2WUEA 5K3DA 1OCEA 3KL2A 1Z4MA 4X95A 1PSWA 3CZMA 4L08A 4HNGA 2QX4A 2HRZA 4NICA 4MWZA 2YASA 3C3DA 2LCFA 4NE9A 3K70C 1BH6A 3EOAI 2HA6A 3SVZA 2IHYA 2Q21A 2G5PA 4F5YA 3CGGA 3EZFA 3GVXA 3TOCA 3W5CA 2WWRA 5E4TA 2XITA 3RSQA 5DGTA 1F8XA 4DL9A 1OKKA 1TYDE 3CEJA 4B79A 4PXYA 1JDTA 2YJNA 4RZIA 1ORTA 3PWTA 1E64A 3LLSA 3I45A 1EI9A 2R1UA 3A10A 3M5PA 4MHOA 4OHVA 2P6OA 5C3MA 5KYWA 1MB3A 1V9LA 4ZT3A 1HXHA 3QXGA 4TWRA 1YZKA 3OE4A 3JQAB 4FMBB 3H4VA 2JAUA 4OBXA 1N32B 2Y2UA 4K26A 4RORA 4UCXA 4WKCA 2X9NA 3ZHVA 4AMYA 3AWIA 3NETA 4LDPA 4PLTA 1V7CA 1YJXA 4ZOQI 5JATA 3HG7A 3OPNA 2J07A 2EYQA 3HACA 4FS8A 3OM9A 4BKOA 4YUZA 4EJMA 3G2NA 1HI9A 2IS2A 2ZYVX 4YJHA 1M8JA 1FYVA 1FX1A 3THXB 4YAOA 1OLOA 1OX5A 2Z08A 3QUTA 1DZIA 1F51E 4HH1A 1SHTX 4WLUA 5L4LA 3A36A 4R2HA 2GS9A 3AF4A 3FOAA 1WXFA 2YV1A 4UM9B 5JIBA 3GCZA 1WMAA 2HC9A 1PR9A 4D3DA 2GN8A 2CEKA 4E70A 5ITVA 5C8XA 1QG4A 4KCGA 1ZJYA 3FLAA 3T9AA 4MYTA 5ESXA 4CLXA 3BN3A 2UVQA 3D2LA 3RCBA 1PWHA 3H17A 5IDXA 1FS5A 3DMGA 1T4GA 3TCXB 2QG4A 1AOXA 3L5KA 1G21B 2XE6A 3T35A 4HDNA 5KSZA 3E81A 1E62A 1SZJG 4HXGA 3ORHA 1T9AA 4OQMA 4MPRA 2DUJA 5EJ8A 1I13A 4GKJB 1W88B 3GFPA 2QLLA 1OI7A 1GZ3A 2GX6A 2ZFUA 5IKEA 2E0IA 4WD3A 1O95A 3AQ4A 3X1KA 4DJAA 1OLXA 3OIGA 3REQA 1VRCA 3IC5A 1MQAA 5B53A 5HM6A 3HKBA 4I9GA 5K0LA 4R1LA 1W581 1EGAA 1S01A 3FMVA 5JPDA 3UBMA 1XD2B 4N65A 2P2YA 1ZLXA 3A37A 3A1DA 3A9CA 4LWZA 1F7VA 4BZWA 4S2EA 1AKRA 4FHEA 4K6CA 1I5OA 3PKIA 3LMKA 4G0VA 5GMOA 2Q29A 2D8AA 1K4YA 1X3SA 2GXSA 3EIOA 4ARZB 4BV2A 2NXJA 2E9SA 2H0QA 2DFTA 2W8BB 3A4IA 2EZ8A 2HV8A 3I09A 3NANA 1H8EA 4J0GA 2AUMA 4P7BA 4TYPA 4DJEC 1Y9ZA 1AQIA 3GB9A 4GYKA 4KJZA 1DBRA 3ZQKA 4DLTA 2B35A 5CB4B 3D4BA 2PR2A 1GAJA 2QMEA 3OEHD 2XNJA 2GPTA 4KX5A 9ATCA 4D9MA 1I3MA 2YWEA 2OZKA 2O4UX 1OB5A 1ZK4A 2CN1A 3PFKA 4QTYA 4N41A 2UV8A 4V0RA 3G9QA 1R66A 1CRLA 1RXEA 3A2LA 3SN6A 1V7ZA 1YO6A 4UHEA 4BIMA 3CT4A 3DG9A 3WFZA 5B7GA 1E3EA 1R0ZA 4IQ0A 4LXGA 4RKFA 1L5HA 4PS0A 3GOHA 3TAUA 3K16A 1E98A 1W1IA 2G72A 3BDIA 3FBGA 2CLCX 3PWSA 4FILA 621PA 721PA 1X7WB 4MQLA 4NCHA 1G60A 1NUTA 4IH9A 1CZKA 2MMCA 3AH8A 1BTOA 4C89A 3TOVA 1UIMA 3KU1A 4HS9A 2XT6A 2O1SA 4B6EA 3PKJA 3H2BA 3WGGA 1TTPB 1NW8A 4B40A 2VLIA 4DV2B 3DBVO 1P9NA 2PR7A 5KCMA 4EYEA 2QVXX 5FI3A 1K06A 3PDUA 1AHPA 2QAGA 3F71A 3ZHSA 1PG5A 2PPLA 3AFHA 3AW8A 4FCWA 1IBKB 3JX9A 1NI4B 2I4NA 4MKXA 4OSPA 1H6CA 4UAGA 4BN0A 1CJMA 3ESYA 2DSTA 2O5RA 1PIWA 4TROA 1ZFNA 3ABRB 3MTQA 4I50B 2R00C 4FC7A 4X6LA 4NDAA 5AKHA 4BO2A 1L6IA 1CQIB 1L9XA 5ALPA 2X0JA 2C9BA 2ZTLA 4J07A 3N0XA 3WXMA 3DOOA 1QVAA 1ADJA 1KDZA 4ZCSA 1ZD8A 1JMKC 4CV0A 4YLEA 3EPRA 2EJVA 1S2IA 1U1EA 3AIOA 4QQNA 1SBYA 3D9QX 2HJVA 2O2SA 4GZ6A 4X60A 3L49A 3CO5A 3K70B 1T9GR 1Q77A 2ODEA 1A2KC 1U5BA 2PFGA 2EG9A 3ZWVA 4KXUA 5EJ9A 4W9NA 2A8YA 1E4VA 3V7NA 5IBQA 1XDDA 4AJIA 4ENRA 3ZLUA 1H0HA 2ZBUA 3E9ZA 4IICA 4YCSA 3LWNA 4FSXA 1P80A 2WWWA 2J9XB 1BHJA 3AETA 3QOYA 4LPSA 4IDEA 5KTRA 1UF9A 4RTRA 2EJBA 5GWXA 3RVDA 2O54A 1YUMA 4ZK6A 5A62A 1HYGA 1KQOA 3EIFA 5HZMA 3WA7A 5F4BA 2HR1A 1NQAO 1P1IA 1DSSG 2OB1A 1XP8A 4CNBA 6LDHA 3EZ7A 3A6LA 1HQCA 4QNMA 3VU0A 4HX9A 5LR6A 5AM2A 3GEMA 4V1CB 5AVXA 3FFXA 3PHLA 3JZFA 2C2GA 1LQ2A 4TVBA 4F2GA 3QLUC 3N2KA 4WZAE 2OV6A 3KZMA 3LT2A 4GSYA 1K0FA 2FETA 3B6JA 4JEUA 4R3UC 5EGNA 5AHWA 2C4UA 3MRTA 5EIBD 3GLGA 2XUDA 4GVLA 1LZKA 3GLQA 4XAQA 3COSA 5DMXA 4UHFA 5K3BA 3W2FA 4AC9A 3OI7A 4YRGA 1E58A 1D0IA 3RVKA 4AY3A 5CYFA 1F4PA 1DDOA 4TM7A 1QC5B 4Y9TA 7AT1A 1TZMA 2VSFA 3AHGA 2MYNA 1U0HC 4ZDWA 1X7XA 1THZA 3ZJYA 4AUNA 1ULHA 1ZRNA 4GYYA 1FIUA 1DX6A 3OLQA 5ERGB 2QVLA 1SXJE 4BFXA 3LQKA 1MO5A 1W5SA 1LSSA 1XBTA 2BRUC 4TN5A 3HA7A 5DP2A 2CL5A 4E2WA 1XLUA 1PFVA 2BN4A 1NJFA 1YCGA 4F2WA 4BQSA 3ZDBA 3T3GA 1R74A 4DDWA 1QH1A 3W5VA 4DV0B 4LS3A 3ZCVA 3HBJA 1ESMA 2OESA 2A57A 4B3JA 3LDGA 2DQSA 5LD2C 4L0CA 4N9QA 1YR3A 2ZPTX 4YI3A 3LRXA 1JLLA 2J9YB 3BE4A 1Y1TA 1M2FA 1XCBA 1UEJA 1YS9A 2UZ0A 4IW3B 5HBGA 5A9SA 2WJ6A 4HUTA 3J81k 3NHMA 4LHYA 4YWJA 2JVIA 2QTVA 4NBWA 1NY5A 1ECGA 2O52A 5AW5A 4BCBA 4B3TB 2DB3A 1BW9B 3OOHA 1VYTA 3ORSA 2V6IA 3NLLA 3B60A 1RJEA 2R60A 5FTWA 4EKEA 3THYB 4NJOA 4IHJF 1IZZA 2Y4NA 4GVXA 4UZFA 1XQWA 3FUXA 5CITA 2ACWA 4UDOA 4UQLA 1PR3A 1Z3CA 2ECOA 5T4FA 2GNPA 3QEAZ 3DDNA 3UIEA 2QENA 4CF6A 2PTGA 1YZLA 3EXIA 5K05A 5DM60 2C3MA 4UFOA 4ZJUA 3O73A 2BFCA 1ZRSA 2VRNA 4AL4A 1NUAA 2G17A 1RXUA 1SOUA 4IFTA 3K9HA 2A9VA 2X42A 3DPIA 1XMQB 3O3CA 3FROA 3W4JA 4RFVA 2I6UA 5KDDA 1D1TA 1NLUA 2FPIA 2IU6A 2NYVA 1L7MA 1ABEA 2PAFA 2JAWA 4Y6SA 3TXXA 3O92A 3DZGA 3ZHZA 2XX3A 5KZMB 4L3WA 2ZYHA 2NPOA 3AFIA 2LKCA 1O89A 3C16C 3GZNA 3JW8A 2XMCA 1W59A 3N75A 1FQKA 3WYGA 5AESA 5BP7A 4YTEA 2PGNA 4KITB 3IMKA 3GLIB 1MRZA 5CA1B 1LB1B 4WZBB 4W5RA 5K03A 3JARB 2R4TA 4FFDA 4NK5A 4NMMA 3ROGA 3CEMA 1Z4OA 4YRZA 4CLHA 2C2XA 3GMIA 5EP4A 1T4CA 4BX3A 3D0QA 2CUKA 2R8RA 4QJIA 4X1IB 1CF4A 5SICE 2NUBA 3Q3VA 3CRVA 5BSKA 1KOGA 2ZWIA 1L8XA 2O0MA 2WT4A 4TV9A 1CE8A 1JGTA 4GGOA 1IXRC 3LKBA 2FEOA 2HJSA 1WDKA 5GV8A 3ZKWB 3DBHA 1N6KA 4Q1FA 1UC4B 4RH1A 2HREA 5EN4A 2Y68A 3LY8A 4YCLA 3DMTA 2RGCA 2FPGB 1E9VA 1K8QA 1M34E 1OLSB 3OTHA 5BSTA 4B85A 2O7VA 2ZSKA 4AULA 3KUUA 3DD1A 4GKKB 4XYMA 1GFZA 1GTRA 1PNVA 2O3RA 1HE5A 3E3NA 2QQGA 1EX1A 3LPLA 1QXSA 1O95C 1YCHA 3DKVA 1I6WA 3SDBA 4KK3A 1GQYA 3GLHB 3JALA 4PLVA 2D5BA 3T06B 4EEZA 1OAKA 4DQUA 4EPXA 2BSQA 3LQRA 1QP0A 1FDSA 4B35A 5TXGA 2ERCA 5IAGA 3W2HA 4MB6A 3FSRA 3LY7A 4G63A 1AKUA 5E6SA 1OX4B 4BCCA 2AFRA 2G1PA 1XZ8A 4B17A 3FHTA 4Q16A 4JI6B 1M2VB 4F3CA 3PFIA 3LGAA 5DTQA 4E21A 1NULA 3ER6A 2NV0A 4LJSA 3GDWA 3BAFA 3L0PA 1VLZA 2QA5A 5BYBA 4REOA 4AJHA 4BMOB 3SFVA 1SU4A 1PKEA 4JJZA 1KK2A 3K9QO 4I8XA 2A0WA 2O48X 3INGA 3PIIA 4YUVA 3T1NA 5EJEA 4QBFA 1T1EA 4J2OA 4LY6A 4HEA6 2Q62A 3N76A 4D6PA 2VUTA 1Z13A 2BBSA 3A58B 3UT5A 4DEXA 5A3JA 2WT8A 4MP6A 2XA2A 3WNDA 5IASA 5L53A 1X14A 2HHAA 1TUGA 1U80A 3FRHA 5BR7A 1TUIA 1I4LD 1WCXA 1C1DA 2I65A 3DEJA 3RYTC 2V6FA 4EVQA 2H1VA 3RHSA 2OTCA 4CZ2A 4GPAA 4KSCA 2PJDA 3B12A 2EFDB 3H6GA 3KEGA 4EHIA 3RFTA 4Y2JA 5IARA 3QWIA 3S0JA 1IU9A 3CZ5A 1OI2A 2C83A 3C6QA 3EISA 2B7CA 4K9KA 3FWZA 5ECYA 2A94A 2UYGA 4IRUB 2IIQA 1WL8A 3K20A 1X80A 4L50A 2QX7A 4YREA 2GKGA 4ETWA 3OP1A 4DMGA 1G3RA 2N46A 3PB3A 2FWPA 2RGEA 4B7ZA 1GXSB 3KK0A 3GRFA 1E3JA 3FOFC 4FHZA 5CVVA 2F4VB 5EE0A 4FJ0A 1I4TD 4NYIQ 4B9EA 2H5EA 3HVKA 4JSYA 4A27A 1M2NA 4I8DA 4MQEB 4XQEA 2C7BA 4MQMA 4YRNA 4JAVC 2JK0A 2BFBA 1UT8A 2QAGC 3EQ7A 3NFRA 3NHLA 3RK1A 1K7CA 1SVIA 3QJGA 4Q3BA 4LNUA 2XUGA 3Q8WA 3SHQA 3TPFA 4A2QA 3T54A 2ZZMA 1DQPA 2I3BA 2MSDB 2ZANA 1JDPA 3DWIA 3GO4A 5LD2B 1MX5A 1CP3A 3LK7A 4RQAA 5LDGA 1Z6TA 2H2WA 3K8YA 3L7LA 3P5BA 3U3OA 1VB3A 2VWHA 3N8KA 4XSVA 3TSZA 5A4MS 1BEEA 4FYXA 1HLGA 4BLQA 2D62A 4FWTA 4PC2A 3WR5A 1KZ6A 5A0VA 2Q28A 4ACBA 1CQJA 5K0ZA 1P31A 3O4FA 1U1GA 4NKRA 4W63A 4LJ9A 3WBKA 4C0QC 4LHSA 2E21A 1NKVA 2BEJA 4IJ6A 4D42A 3KB6A 2B2NA 2EXXA 3C3PA 1QNFA 4TMVA 3M6VA 4F60A 3ELDA 3HBMA 5CJ2A 1OC2A 3V80A 5DNCA 4FQ7A 5F78A 1JDSA 5LYYA 4W9NC 2D0IA 2X9QA 2RG1A 4D4LA 4OGFA 4DMMA 5LLSA 3QSYA 2IDKA 2JGKA 5F7XA 3WK5A 4ECAA 1Q91A 1T6NA 1WMFA 1FMLA 3EVCA 4D98A 3FA2A 2AJCA 3HYTA 1DOZA 3ICQB 3VH3A 1IN7A 4OM8A 2Z4RA 4PZAA 4G0QA 1WQ3A 3KS9A 3PHBE 3DMFA 3RC9A 3WISA 4ER6A 1O0BA 2GK6A 3Q7RA 4IP0A 2O14A 3EGXA 4D4GA 2VDOB 4OI1A 1S9DA 1E5QA 4IJWA 4LHXA 5B7PA 5AVVA 1T4MA 3S2IA 1O58A 1C1XA 1J00A 1YQDA 4DTCA 1MW8X 3UXYA 3IUBA 2VAWA 3P9RA 4NCAA 2D7CA 5ARBA 1LC3A 3E1SA 4HDKA 4D3SA 4JKYA 3KOXA 2RKWA 1SHKA 2VCEA 3L0CA 3RS5A 4A2CA 2O8CB 3O74A 3ZJVA 2B37A 4WA7A 2AZ4A 2A33A 3PGXA 3F6CA 3ZWQA 2PX2A 4L73A 3C3MA 3BHNA 3H11A 5DBGA 5FFMA 2BGLA 3A6ZA 4HQ6A 1YZQA 2HXGA 2XCUA 3D2BA 1KEUA 4L27A 2CYAA 5EWJA 1EP1B 2C59A 3ZOKA 4NZ9A 3DMYA 3E9NA 1DQYA 1YRLA 3K5HA 2OO3A 2Y0CA 3AIIA 1L6RA 1P81A 4H0FA 3WB2A 3U6BA 5IJXA 4KSYA 2ZCJA 4IIDA 2OGZA 1P7ZA 5JNSA 5E1OA 4B81A 5IK2D 2LE0A 2X4DA 1DINA 4MNTA 1ADBA 3T7CA 1T2VA 4M7PA 4HDNB 3PU6A 1TPYA 5AKIA 3RC7A 2O19A 1WDWB 5FBRB 3B6KA 4K9RA 2QQEA 4KLAA 4R5HA 3TVDA 4FT2A 4DKXA 1GFIA 2F90A 1G4UR 3MCTA 1JSCA 2P40A 2WYVA 3G5LA 4B3XA 3X1WA 4QDOA 4XCVA 5PGMA 2DKOA 4M9UA 4X6UA 3RFVA 3RVSA 5H83A 3GNLA 4ID3A 4POAA 4Y2VA 4DLPA 1D2GA 2H85A 4XD2A 3OF5A 1V8OA 1E61A 3KKLA 4X54A 2ZSEA 4Y6RA 3U9LA 1G0NA 4YV7A 3L1KA 1WR8A 3IYLW 4F92B 5I9NA 5ANRB 1IY1A 1MAHA 4XQ0A 3JYLA 4L8FA 3R7DA 1FFEA 5LB2A 2MT9A 1M0TA 5TE9A 2QN8A 1Q7GA 3U6KA 3WHLA 5BNZA 3HY6A 4YJ3F 4XFJA 1IDOA 3WV4A 5JR3A 5CP8A 4CU5A 2FFJA 3ILSA 4RZXA 1PGNA 2EKZA 2B82A 1NA5A 3E4CA 3IERA 3O8DA 3RJZA 5IAOA 3U4DA 2PQ2A 2AQIA 2XA1A 4PVCA 1YJCA 1UKEA 3N8IA 1G5QA 1VECA 2PTHA 1OZGA 4U7HA 2HSEA 1IHPA 1JBQA 3AUSA 3V4VB 4MIKA 1YRHA 4ZTUB 2SECE 1P1BA 1HYEA 2VJPA 5KVQA 4X62B 3OZIA 4W5HA 4WEQA 4DDMA 1L5HB 4CMJA 4JUBA 1Z3IX 2XMSA 5E6UA 4BNKA 1X3LA 1Y9AA 1JMVA 1OD6A 2VXBA 1RJ9B 1C30B 5EMKA 821PA 4A8PA 4EY8A 3E27A 4KI7A 4NMXB 2HQBA 3VJMA 1D2HA 1NQUA 5CNKA 5BYKA 4LA4A 1K4MA 2W37A 1DAIA 2DUUA 1A3CA 4TGLA 5FUBA 2XUKA 1DG9A 2C7QA 2HX1A 2V03A 3W4KA 4LF7B 4B4WA 2REQA 3O9ZA 2PXHA 5I45A 1DC3A 1IBRA 5J9FA 3RASA 4IGAA 1B2RA 4Z3KA 1C2YA 3B13B 1M66A 4JOSA 1JHRA 1XYYA 2BT4A 5T4EA 3N53A 1CY0A 4LTDA 2HMUA 3DMTC 4Y1FA 3EDOA 1ISHA 1Z2PX 4GU5A 1ZIPA 3ROQA 4CHGA 1AKTA 2NSYA 2YWHA 3FFBA 4TLMB 2PO7A 5IMBA 2BC9A 3BCRA 4UHDA 1P73A 4ZO4A 1BMFD 3U4MA 1IEXA 1T91A 2C4NA 1WUJS 4MXDA 1XJCA 3G5UA 1E2FA 3NBKA 3FKSA 2HWUA 5DCWA 1R64A 2W71A 3CLTD 1JU3A 3BD6A 4GI1A 4H27A 3LM8A 3UWKA 3QMMA 2NSHA 2A9QA 4FDMA 2BMAA 3IQGX 4ENTA 3DAGA 3PNMA 3I8SA 3TMKA 2WM8A 3ADDA 2FZEA 2WIGA 4D9IA 4TXMA 3TGWA 1JR3D 2HSWA 4OMCA 5LQMA 1H22A 3H8VA 1YBAA 4EB0A 2PL3A 4V0QA 1XZDA 4N12A 1U5BB 1MAVA 4US1R 4DCMA 2BKXA 3KTDA 3Q1KA 5G0TA 3GRYA 3TSAA 4EJ6A 2WI8A 4UAJA 2HXYA 4BLWA 5K9ZA 4RK0A 4GKAA 4NNOA 3W3ZB 6ABPA 2Q3DA 4XA8A 5D51S 2AJ8A 2B8WA 4EA9A 3E1GA 3KEFA 1UJBA 3KQYA 3OLWA 5I4IA 4QM6A 2ODQA 3RJ5A 2R68A 1C2TA 2X1VA 3AETB 2D0DA 3KAJA 4G5YA 4M8NE 2VDMB 3Q3GE 2ZTSA 4Q00A 4ZVNA 1LRLA 1GA6A 1GSAA 1AKWA 1NUUA 4RPHA 1HH4A 3TIGA 4CM6A 4GQBA 5HDQA 4LVNA 4F3RA 4R0MA 1FJ2A 3HKDB 4K87A 2XQJA 4LYHA 5EWLB 2Q2VA 1YR9A 2G36A 2IODA 2V5VA 2VCHA 4ZJPA 5EPEA 4RDIA 5BR4A 2UXDB 3BEOA 4CL8A 1B6RA 2R7MA 4KOAA 4EI2A 5CBPB 1E2PA 2FPSA 2J0EA 4QHSA 2VXCA 3RSCA 3I9MA 4UHBA 521PA 4IWYA 3N0WA 1C7FA 4WNYA 4OLAA 2RAUA 3PTLA 3WGYA 2VJDA 3M49A 1W2GA 2JB9A 4D45A 1YNOA 5ES4B 2GASA 4Z4GA 1JVBA 2QUJA 1OXTA 2PUJA 3G49A 3ZLTA 3OQIB 1L1EA 1H1TA 1PDVA 3A1TA 4ZJYA 4ZWNA 2W22A 4ARVA 1T3LA 2GPYA 2ZVQX 3QKTA 1NDHA 2SBTA 4UM7A 1IUKA 3K6JA 2QLNA 2Q46A 2VNIA 4QO7A 2BFPA 4HAVA 2AC7A 1YZHA 2JC3A 2Z04A 1W8DA 3HU5A 3VR5H 2EYUA 5C7IO 4JLNA 3R8FA 3FCXA 2B1QA 5E0KB 1IXSB 1W4BA 2R96A 3RAGA 3ES9A 4AZ3A 3FRJA 5EXEA 4ARAA 1I10A 2YCLA 2H1IA 2WV9A 5HRUA 2IHNA 3NAGA 2G0NA 3E9YA 3R2JA 2Y6VA 3IMFA 5EYPA 4DNFA 2WICA 4BGDA 2XCTB 2QGZA 2ZE7A 3HS3A 2NAFA 3MWLA 3GJ6A 4GHWA 4B4DA 4ZI7F 1I7LA 4XWWA 2Q1UA 1RP1A 3GLFB 1XR3A 3PQ8A 5H80A 4S1WA 5SZJA 4IIYA 1UJMA 4D9JA 3R3VA 2VP4A 3F3SA 3C8HA 3AKEA 2I8CA 3WRXA 4GI2A 3LSTA 4F5WA 2BE9A 2ZRHA 4A0HA 4BLVA 1ODFA 4CXMA 2LGJA 1KY5A 1MVLA 3I9NA 4E51A 2Q1YA 2R47A 3AUTA 4G5QA 3DBLB 4TZKA 1GQ2A 2AYYA 2DUMA 5ILQA 4H9GA 5K8IA 2VHQA 2X9VA 1K8YB 3MRSA 4I55A 1S3IA 3H9GA 5AICA 1I0LA 2YZNA 4H7FA 1BA2A 3EGIA 3M70A 1AZWA 1E7RA 2BOVA 3IDFA 3QE9Y 2JFOA 4NH0A 1O97D 1RYMA 3EXIB 5ERYA 4ZT2A 3N86A 3LS2A 3ZVMA 8AT1A 1CVIA 1JHPA 3BTSA 1FDVA 4MUGA 5HZGA 2W2MA 5KJ1A 1USGA 5LFAA 1S3GA 1YU6A 3WLMA 2O2HA 1XQYA 4CKBB 2FPIB 4KYTA 2GLXA 2Q1TA 3HNRA 3KPVA 2B2XA 3KT8A 2HMVA 4FBMA 4EY4A 5IVKA 2GEKA 3CURA 4UNSA 5F5XA 1GITA 1E6WA 1VMAA 4RYDA 3VRHA 4FONA 4AB1A 5JNLA 3ND8A 3K9WA 1AGYA 1TAQA 3DQZA 2HTFA 3K3PA 4RA6A 4RX1A 4U6SA 4Q7QA 1YNSA 1DUIA 4P4GA 2OY0A 5JFTA 1EBFA 4AQYB 1R8QA 1Y1KE 2IIVA 1W36B 1S2DA 2ZU6A 4O63O 1ZC4A 4QGSA 1XHFA 1WXXA 3BXFA 3KSUA 3MW8A 5IW8A 3VR5D 4DA6A 4RTJA 4G5SA 4NL4H 4Q37A 1TF5A 1A2OA 4B5LA 4ZYYA 4EGCB 5AFSA 1NJGA 4JROA 3RC2A 1U1FA 4A8TA 2B4RO 4ZC8A 4L02A 3MTJA 4RSMA 5DTMA 3RROA 4UREA 1E3LA 1XPRA 1RHUA 4M1TA 2OA0A 5JOQA 4RXUA 2EWVA 3KV3O 3QK7A 1EK5A 4CLRB 3QXSA 3Q9LA 4RHUA 2G04A 5TMEA 1A4RA 1LJLA 2AOWA 2JLVA 2YC2C 5KQPA 4KE7A 1KVUA 1FYDA 2W6JD 4MQFA 3B82A 3BWVA 5AK6A 1V8DA 3OFVA 4FEGA 2COEA 2ZEJA 1THMA 3GUCA 4NV3A 2ATXA 4OF4A 4G24A 2PWPA 3UN1A 4FMCF 2FMHA 5H3LA 1XDUA 5DNAA 3KOZA 1Z4PX 2IE0A 1LV7A 5I7VA 1L4LA 2PSJA 3EPPA 4BKUA 5FL3A 1IEWA 4W6QA 4DCCA 1X77A 3AF2A 3TW8B 4TTVA 3FWHA 3O3MB 2R7NA 4YJFB 5J58A 4R8RA 3ZDFA 4DKJA 4GC9A 2WMNB 4OL9A 4U2DA 4XUEA 2NZJA 3MWEB 2J87A 1FMCA 3WIOA 3A7EA 2JAPA 3PRKE 4D0GA 1T4BA 4NFSA 3PUVA 4UBJA 2F9FA 2E7ZA 4EGJA 3KM0A 1IHUA 5D01A 2OHGA 5CCBA 3R1IA 4FEEA 3PR1A 5T6BA 3I39X 4P34A 1KQFA 2Q9BA 2WU0A 1L7AA 2IS1A 1XLWA 3AEYA 4C04A 4KQKA 5J1TB 2NU8B 3UWOA 1JVNA 2PD6A 4EUSA 4G5XA 4I3GA 3EIHA 4XB1A 5TS2A 4M98A 3I2IA 1RP7A 1J2UA 3QKSA 1NPDA 2I6FA 4F2PA 4KV7A 4ZVPA 3MM4A 1S2NA 1QH0A 1ULSA 4WUVA 5KDOA 2YMMA 3V8MA 2AXQA 2PZFA 4OA5A 1KI9A 2L2QA 4ID9A 4YQYA 3DE4X 3ZIUA 2GO1A 3USZA 1LLQA 4ESOA 1I3CA 3FB4A 4PO1A 1H9CA 3F7TA 1GTZA 1QBKC 3E5HA 3M6AA 5C37A 3L8FA 3R0VA 4JU8A 4KBGA 4XIFA 5LPNA 4TT8A 1MJHA 3S8MA 3HXLA 1Y7IA 1IMOA 4HJRA 3ISTA 5FEMA 4MO2A 5IAJA 1E9SA 3RR2A 1DT3A 1JRLA 1KI8A 2VBGA 3MOIA 1IONA 1SM4A 4K05A 4MRSA 2Z6UA 3RVPA 1W0JA 3AVPA 1T2NA 3CMMA 2VRCD 3KUDA 1X7ZB 4MRMB 4TQAA 1CULC 1NVDA 1WDTA 1UUFA 2Y1XA 1NU6A 3D5TA 5EFZA 1UAAA 1NWCA 1J5XA 1SKBA 3DQQA 3PVSA 4ZQHA 3T1OA 4CDGA 4DPLA 3HKEA 3ZNNA 2F3TA 2FX5A 4TPKA 5I48A 3FPJA 5JZVA 4AG6A 4FX5A 3FOZA 1Z74A 1MZPA 2WILA 4Q9DA 4FFBB 3OSZA 1E1CA 1VJCA 3IBTA 3UKOA 1J7KA 2MJLA 3D3QA 2BUBA 1GNLA 5GTDA 2NW6A 4N39A 2FFQA 1U2SA 2O4CA 2GDJA 3MMSA 3BRCA 2PKRA 4XGKA 2AI3A 2BUCA 4MR7A 1XTRA 3HV0A 4NV1A 4PTLA 1ZIXA 2I1WA 1K9VF 1RWWA 1ZEMA 2BI4A 1EFLA 1D09A 2YVQA 4H59A 4LN1A 5KO2A 1YQXA 2DPLA 2FW0A 2JJQA 2O7SA 2XWPA 2FMXA 2ZB4A 3QEMA 5CXQA 2C9CA 3VX3A 3VGJA 1LI7A 5E2BA 4ZZ1A 3RS3A 2YZ7A 5HKBA 4MCAA 1BKYA 1NN3A 2PRJA 2ANBA 3R9KA 3UK1A 1WPGA 1QZXA 3VAZA 4ZI7A 4V02A 1IM8A 1DWPA 5DNYB 1J70A 1XZGA 3MCAA 5AVZA 4WBXC 4WESA 4DQKA 2A1UB 1P19A 1UXGA 3DOCA 4E07A 1PSZA 3GJTA 1KDPA 4I4LA 5BOVA 1C7QA 2JAHA 5LBTA 4DLSA 4KRXA 1NF3A 4PC6A 1B74A 1I6LA 2OD7A 3CG0A 3DOFA 4FZJA 3NJ4A 3BA1A 1W85A 5E1MA 2NUAB 3UJ7A 4DBLC 5JI3E 4QYIB 4JNKA 1TRHA 2PT9A 3F8TA 2XZTA 3K1AA 4DM7A 2A92A 3J81A 3KQLA 2JHPA 3KZVA 1XROA 3N59A 1IBMB 2YRFA 2HIGA 4RK6A 4EF5A 3BMNA 1U9CA 3BGVA 1ESDA 4D57A 4R9RA 5EWJB 4AKTA 5C35A 3MJSA 1G5RA 2ATEA 2DLNA 2PKYX 1O8CA 4I1RA 3OMXA 4JBWA 5CIQA 3WIDA 3JYOA 4WV3A 4CKWA 2HOQA 2BLLA 3F0TA 3IQFA 1DC6A 1P74A 2B7LA 1N4AA 5KNDH 2J0UA 3RYFA 1MLDA 3QHQA 3OJLA 2IGBA 4MWCA 3GA7A 1GTMA 4UU1A 4ZXFA 1AKVA 1NJSA 2H59A 3DCNA 4S0ZA 5KHAA 1S2LA 5TNXA 3IXLA 3PXDA 3WJ7A 5KB3A 1NR1A 4YT8A 2TMDA 2W2KB 4KR6A 4F4DA 2HU7A 1U7DA 1UH5A 1I2AA 3IHTA 4ZDKA 4C3VA 1S8NA 2BGMA 4D41A 1TU3A 4AP9A 3S8EA 1FP4A 1GUAA 5JJBA 1GRQA 1A9ZA 1AA9A 1AT1A 3W8RA 2G83A 3K9GA 1PYOA 3ADPA 2NO9A 4IUBS 5GM2A 3SIXA 2DERA 2J9FB 3WRXC 3EA5A 3Q0TA 3OIWA 3BFJA 5IM4A 3WWEA 4QDKA 4JL5A 3K0FB 3AWDA 5LUBA 2MMGA 4CVNA 1JKXA 1LF0A 1VFPA 3D3EA 1NQXA 3LXUX 4KXFB 2GOYA 2HK6A 4I7EA 4OYHA 4U3JA 4UHKA 4OAOA 3L6UA 3HDTA 3ILHA 3R4VA 2HWXA 1RXSA 4D6XA 4KSBA 4DSZA 2W58A 1TMYA 2IKSA 4XVQA 1E1RA 4XVCA 1UOOA 4J7UA 2ZVPX 4B31A 3LC2O 4B33A 3HVRA 3QFSA 2OBBA 1ESEA 4UNRA 1KOFA 5FNVA 3RIYA 2R4QA 3WKCA 1V39A 9ABPA 2WJYA 2FMUA 3D1JA 5HJ2A 4Y2SA 5HZHA 2WIJA 1AQUA 2J7PD 4LC0A 4BBPA 3IAM1 2CXRA 1X1DA 2XT0A 4WNCA 4EHLA 1U7XA 3LIPA 3CEPB 2GCEA 4LDJA 4BFVA 1T6XA 3KKZA 1A8SA 1FC0A 4NCJA 5AW6A 2GRAA 3H5AA 1OLUB 1PR4A 4INAA 4JI7B 1O4VA 3EFHA 4HB0A 1XQ9A 3BHMA 1ORDA 3V5NA 2DJIA 1DAKA 1F4VA 2QI9C 4BNFA 2J4DA 3JQBA 3HCEA 4XYGA 1DO8A 4GYWA 4ON9A 2C9OA 5IDYA 3RFXA 1QP4A 1LDGA 3GCWA 3PZBA 5BN3A 1GCGA 3BGOS 3RHFA 4A15A 1GT91 2PH7A 4QLBA 2R5WA 1WB4A 1PS9A 5G0SA 2WU4A 2OBNA 1DCKA 2R1VA 2Y2VA 4FU0A 3FTDA 4I66A 3S55A 3SEQA 4IMJB 4DIOA 1SCQA 2BFWA 3TH5A 5KNDD 1XGKA 5JRZA 1J5PA 1EUZA 4D3ZA 4LZZA 5LDHA 4OQEA 5ED4A 1NNEA 2GFQA 1FNDA 2ZQ5A 1CUUA 3AVOA 2TMGA 4ZYUA 1QVRA 1F1JA 5BN4A 3BMCA 3MJ4A 4B3BA 1VL8A 3DE2X 5DF1A 5CA0F 1R0YA 3SAJA 2XCOA 3GZTB 3W6NA 2H8KA 1E9AA 1WHSB 4G36A 4JFRA 5EMJA 2P91A 5AVOA 4G9BA 3IEKA 4EHJA 4OHRA 5HM8A 4EJ2A 3U7FB 5B1EA 3KVYA 4WLFA 3Q8KA 1XAHA 1RAGA 4B43A 5FPYA 5KYNA 3WJ1A 4UTNA 4F5ZA 1D6JA 1GZ7A 3D7SA 1R8JA 3F9CA 4HP8A 3ET5A 4CCAA 1FSZA 2ZUWA 3H2YA 4D9HA 2QNIA 1FW6A 2IS4A 1QCYA 3HN2A 5JFGA 5DBOA 3R6DA 1HA3A 1H94A 2W43A 1WZEA 4LJ8A 4P82A 4RIGA 2EFEB 3M2TA 3C45A 1E5VA 4KIGA 3M1IA 5KSPA 1YQEA 1HBJA 1LPOA 4CL3A 4XFDA 4EHBA 5BVHA 5FBVB 3HXMA 1P39A 2OOKA 4YT4A 1SQGA 3R9XB 2AG6A 2XDAA 1TCUA 1HRDA 2PFSA 1CXZA 4G0OA 4GBGA 3WJAA 5BRJA 5IEJA 2C3PA 1AB5A 3TEMA 3X1JA 4QPPA 3SSMA 4W5NA 5AJUA 4WERA 1GKUB 3OTWA 3ZD9A 1D2EA 2GH1A 3RU3A 4GMDA 3ZD6A 1IY8A 1VKHA 2G9QA 2PK3A 4ZICA 1XNRB 3SEAA 1R7RA 3WLHA 4C4OA 2QE7A 4ZQCB 1P6XA 3LUGA 4Q7MB 4HVLA 4H3VA 2QTRA 4QBTA 4JLUA 4BXOA 5FXMA 1EDBA 2HFJA 3GPCA 1X6VA 2VUSA 1MR3F 1NFQA 2Z0MA 3BWDD 3HCPA 4HD8A 4MS1A 2B4TO 4IJKA 3VDXA 4BVFA 1UZLA 5EHNA 3GEIA 4A0SA 4OATA 4UE6A 4TKVA 2VJKA 4EY3A 1RBQA 3SS8A 1K8RA 1H6AA 2FI1A 1R8XA 2JFFA 2Z1NA 4LPKA 4MYDA 4PBRA 4BFSA 4Z3OA 4JENA 4AQ7A 1Z07A 3BDAA 5HIJA 3GC6A 4A91A 3PGVA 4ENQA 2HKIA 1D4FA 1N2CB 1P4RA 3BCHA 3W5AA 3O93A 2GZHA 4TN1A 2ZWMA 1OVMA 4EEKA 4ZYTA 4O4JF 5K51A 1C0EA 1XJQA 1QGZA 2P3SA 4UMEA 4OP1A 4D6YA 5JFOA 1C81A 2IFTA 4S2UA 5DPMA 5ARDA 1Z0FA 3UK6A 3ZI7A 1KDOA 4KR7A 3PYLA 2DKFA 1RTTA 3KV1A 5JARA 4F56A 2WT9A 3DP9A 4E5MA 3L46A 1IOWA 1DT5A 3CUUA 5C46F 5IKPA 2PSFA 3NPMA 2YJZA 4J49A 5KNBH 2V59A 1LK5A 2PX6A 4L7QA 2HA7A 1Z88A 1NHWA 4Z7NB 4U2BA 3VKHA 4GI7A 3JYQA 5CCDA 1OAOA 3X1DA 3VMMA 2HO5A 5SYAA 2GN6A 3IVCA 4Q9LA 3EQ9A 2BF4A 1J2JA 3TOZA 3RUCA 3Q7TA 3TUJC 3PNOA 4ZQEA 5I01A 1PGOA 2ZIGA 3URKA 1SRRA 1JB1A 4TTJA 4D79A 2BMVA 3W7BA 4AZ3B 2Z2IA 2I3GA 3PGLA 4OFXA 2FV8A 4A23A 3RVBA 3HP7A 1U0LA 5L6MB 5EYPB 1U8TA 1NYQA 2JFVA 1I6KA 4HUQB 2F4NA 4N5HX 2CNWD 4WHMA 3R3WA 1H5QA 1EP3B 2W70A 1SQ6A 4XRGA 1VL0A 2AVDA 3CFYA 5FA8A 5K09A 1UOPA 1WAMA 2Q6TA 1FLNA 2PAAA 2VHWA 4ZTBA 3VYRB 3F96A 3CW2A 4G09A 5BNIA 2QN3A 2PQ6A 2CV0A 2VXYA 4MUJA 1M6WA 2JD1A 4TLCA 1Y33E 3OJ0A 3WMRA 3BTUA 2AJBA 2ILVA 4N18A 3B53X 3EEYA 3CKMA 4M21A 5G41A 4BEJA 5AD1A 1H3NA 1FFAA 3OX4A 1YQGA 1QCDA 3R5FA 1GZDA 1PQ4A 5ALUA 5TVGA 4Q7JB 3G0BA 4D92A 4WT7A 1G21E 1AD2A 2WZCA 2DTEA 4MVCA 4WLVA 2QTGA 4HRVA 5LIRA 1LH0A 1NUQA 1PZGA 1W5BA 2HIMA 2Y1CA 4B7AA 3KZCA 4CQMA 2BKVA 3L8CA 4EMTA 3SZOA 3KBOA 4BRUA 3BILA 3ZR4B 1JXQA 4TLLB 5GGYA 4U7GA 5KOJB 1N1GA 3UWMA 1MO6A 3CZPA 3QFFA 2Q5IA 3KB8A 5JSQA 5E7MA 4TVSA 1SCUB 4B7UA 4MRAA 4PAMA 1Y7LA 3V33A 3PUIA 4ER7A 1KPGA 5CFRA 1VG8A 4RY0A 4C0BA 3ND9A 1Y48E 1SC6A 4S1PA 1JIXA 2EJTA 3G79A 4PLCA 2G06A 1UMDB 5EJ5A 3DLBA 3UCXA 1L4NA 5C8DA 3OIUA 5FUQA 1UWVA 1XUOA 1DVRA 2VTBA 3EZ2A 3TBKA 2VPQA 3ZWPA 1QV6A 1SVSA 3B9PA 3H1FA 3KVNA 4FI3F 4IXMA 4Y67A 3ZEIA 1OFGA 1DBPA 1W5FA 2R6HA 3OTIA 2OM2A 4URXR 4L1KA 2FSVA 2G63A 3K6SB 3TLBA 1MXHA 1IN8A 4YXWA 1QO0D 3P0JA 5H4HA 4FKZA 5HF5A 3RI3A 3E3MA 3P2IA 2KJQA 2CLDX 2TECE 1NMXA 3IL2A 5FA6A 3Q88A 3WLRA 3QITA 1JR4A 1E18A 1QDUA 4G9EA 4AJ4A 1OYWA 4B6QA 1GIAA 2ASEA 3I0ZA 2BD0A 2ZQZA 2JIRA 3B20A 1C0KA 2OAQ1 3PC8A 4K3UA 1E2LA 3HB9A 4OX9B 1YDGA 1XZHA 1A71A 5KINB 5AYVA 3B2NA 2PWYA 4J76A 5ESRA 4D2IA 1G8GA 3EUFA 4K0KB 4MDYA 2NUTA 1B6GA 4EW1A 4EX6A 1KYTA 4OEHA 2O6HA 5I7EA 3FHJA 3IPAA 3GJ0A 1XZMA 4B6PA 1RJFA 2EZTA 4R1UA 4CIAA 1U2EA 3WL5A 4PAQA 1K89A 3VNVA 1R6BX 4JBYA 4DJJA 4U2KA 3FVVA 2ODPA 4JWTA 3UVEA 3ZVKA 4D8XA 4K1XA 3VOAA 3PV0A 1E3SA 4UNQA 3WYBA 5FUWA 3GEGA 4YGXB 5H3HA 1SCIA 2Y1LA 3Q5EA 3ZCTA 1MQ9A 2VPXA 3EGEA 1FYEA 1E96A 3A6FA 4OKNA 5JUWA 2ZP1A 1C8LA 1W49A 3DXXA 3L8ZA 4G4JA 3UK0A 2VL7A 4MX8A 3BFPA 2PYIA 3BZBA 5CDGA 4Z54A 4CKYA 3V8VA 4BBAA 2B4KA 2N1MA 2Z5GA 2J3IA 3M7IA 1E1QD 3CIFA 1UEIA 2R6R1 1IZ7A 3DZCA 3FUTA 5HCNA 4LECA 3WI7A 5HF6A 1T6YA 4RD1A 1K75A 5JQGB 4BOYA 2HJ9A 3BB4A 5BRNA 3PTZA 3X2EA 1N8NA 2B7BA 4BB0A 1CBUA 3WSTA 1GYRA 3NRBA 3U7IA 3HDQA 3GFSA 4WBNF 1AV7A 1M73E 1DV1A 4EUHA 3HVJA 4KQGA 3CQ9A 4KXLA 1UK9A 3UV7A 3II6X 1ARZA 5HNKA 3JQBC 5BSGA 2CFRA 5IKMA 3U49A 4ZZIA 3NRJA 4FFMA 2FE1A 4Y6QA 4BX0A 1Y9DA 2HJGA 3DDWA 1UK7A 3CH5A 3FI9A 4GF5A 4L78A 5HF8A 4HQFA 1Z9BA 1E3WB 1G2PA 2P7IA 2DFPA 3I2KA 2QL9A 2CW5A 3LCUA 4HZUB 2G88A 4IHJB 4ALJA 1U6JA 3EVBA 3OY2A 4BIIA 1WEHA 4RMJA 2HRQA 1E8MA 3C39A 3L0BA 3QBEA 3OQJA 4J0FA 2EBHX 3RT7A 4TRJA 2ZRPA 3V8QA 3WZMA 4WKBA 1IUPA 5AI5A 3IHLA 1SKYB 1IG0A 1GYPA 1E6LA 2FW9A 2ZBEA 3OCYA 1NQWA 3KKPA 3PUJA 4D9KA 4DCTA 4YASA 3B78A 1V3TA 1Z2EA 1ES9A 2P4UA 2G3YA 2X2FA 1G9TA 2OMEA 4O2LA 5F12A 3WB0A 5LLTA 3I04A 3CR7A 4CMEA 1JIQA 1OV4A 3G5MA 2B5WA 2ODTX 2B8JA 3OOEA 4IIXA 2IPAB 4DAEA 1L7QA 3CX3A 1C3XA 3D54D 4L16A 2WJHA 3P27A 4WVFA 1E6UA 3IP3A 1KMQA 1ZHFA 3N2GA 2B8NA 5ADVA 4A8JA 3AR9A 5ELMA 3GX1A 1YJ8A 4OIFA 5DT2A 1HOTA 1Z7EA 3D2CA 3TFOA 1Z16A 4XZ3A 4FGSA 3A1VA 2P78A 3DV0A 1Q21A 3QLJA 3QU9A 4L4SA 2BF7A 3COWA 2OHVA 1DXHA 2XNDA 5CR9A 4C4ZA 4CLOB 1ZBDA 2UZ4A 3FCYA 2HYDA 1IBLB 2CE2X 1GNVA 4XKJA 3VISA 5FWNA 4DIMA 1CRQA 1ZSNA 1Y89A 2ALJA 5CAEA 1YB7A 2BI8A 3O3NB 4PFQA 3LUDA 5B2ZA 4Q9AA 3U2QA 3AT1A 2QU8A 3RSLA 2P1ZA 3LHFA 4R2WA 2HCTA 1E7SA 1QYVA 1X9GA 3I9LA 2PMBA 4EM6A 4PX9A 1C50A 4US0R 3TL3A 1YVDA 3K2BA 3ZU6A 4FYPA 1UBLS 1TU4A 3I9OA 4FLEA 5EUMA 2JI8A 3TMAA 2FWRA 4RV5A 1PUJA 5G0WA 2ZRFA 4ZOLF 3HR8A 3RNOA 4M1YA 4BAUA 3R41A 3ZCRA 4MWGA 4OCZA 5JSHA 4C03A 4UD6A 4BTLA 2PIAA 3DEYX 3CUSA 3OPQA 4TRMA 3F47A 5DHTA 5H5JA 5K2MA 3VU8A 3JQGB 5H0IA 4C7KA 5KNBD 5DK4A 4MWBA 2WZBA 3KAPA 4Y6OA 3EZ9A 3ZJ5A 2ZR9A 2WTMA 1H2XA 3F4KA 4DIEA 2BIFA 4W1QA 1E69A 5FF9A 1QK3A 3V48A 3LVQE 1KDVA 1S1MA 4ABYA 3G13A 4IFEA 5B1YA 3BMNB 5HSGA 2BWJA 2I91A 3WRWA 3EWSA 1G19A 3OCXA 1PWZA 3JQRA 5K3OA 3PL5A 5H3CA 3M6IA 3M9WA 1N1DA 1KP9A 2RHWA 2PH3A 3EPJA 3C3AA 3G0GA 5AK4A 5AI4A 2XSZD 1N7GA 5NULA 4CUKA 1XRLA 2IU3A 1B8OA 3B8HA 4IGIA 1HV8A 5HEKA 3E3AA 5DWVA 1OAOC 3E0XA 2FGKA 1WABA 3RYFB 3NOVA 2NT3A 1ENPA 5I9SA 3G02A 3QUBA 3RVJA 4URYR 1JFLA 1YGYA 3ADOA 1UCFA 4UAVA 4EG5A 2QL6A 3JD4A 4RF4A 4C07A 3Q3IA 2D1RA 3EDRA 3CUTA 3KYDB 4BQNA 4EKNB 5HS4A 1REQB 3CXUA 4KJXA 4K7JA 2Q3LA 1I6MA 4CMIB 3GLIE 4KREA 2N47A 3JAWA 4RJLA 4WZBE 2ZSDA 2JARA 4OQ4A 4W8GA 1HPLA 1KZ1A 1SBHA 2B8EA 4KYVA 4UHHA 4E5UA 3TM5A 4P5DA 2P4QA 3OX3A 5J4KA 5T8KA 3RDPA 1RC0A 4N5LA 1JEYA 4AKHA 2XUOA 1YAJA 4TVKA 1ISRA 1YRYE 1ZIDA 3NR2A 2IEGA 3ZY3A 3PZRA 4D43A 5GP1A 4FW9A 3EF3A 1VG1A 3ETDA 3G0CA 2R1TB 3L6OO 5CYPA 3TUZC 4KYUA 2JLUA 4RF2A 4GP7A 3PEYA 1D5WA 2GJ4A 3E3OA 3QBDA 5BOSA 1NXOA 2Q0XA 4I2NA 1ISSA 2JASA 2NQ8A 1NF2A 1AGXA 1Z12A 2GEDA 2X1MA 2H7CA 3F90A 4B84A 1ANKA 1GFWA 1GHTA 1GL3A 1WSAA 2PS9A 4PR3A 4X3PA 1DAFA 1AF4A 1HMYA 2GUWA 2Z09A 2YY7A 3MUNA 4BO0A 5BO5A 1HYHA 4RD3A 1YDFA 2OGWA 1L1FA 5JC8A 1J9ZA 3C7CB 1AZSC 2ZJ3A 5CK5A 3NUQA 4WY8A 3FOBA 4RD2A 3R7WB 3SHTA 1JDUA 4D8VA 3GLHE 4MYCA 2WPDA 4CJXA 2E49A 3CG4A 1GVNB 3ESAA 4Q6WA 1D9XA 4J94A 1C7JA 3UK7A 1U7UA 4UKDA 1RQRA 1PFKA 3HVIA 4LY3A 2J08A 2JKYA 3EQ6A 4DQ0A 2HDOA 2O5VA 3NPAA 1OHHA 4C2BA 3JPWA 3TRDA 1OPXA 4FNOA 3DKKA 2E4UA 1SVNA 3IB6A 4G37A 4L6CA 4NOKA 4P4NA 4AJOA 3DLHA 1U1IA 2ZI4A 2FJUA 1FQJA 1NLZA 1P9WA 3MPOA 4PLHA 3W8DA 2XQIA 5JCJD 3KHKA 5EA2A 3ICVA 3UOWA 3PBKA 5LQJA 4QODA 2O1EA 4DZRA 1NJ2A 4ZAWA 1NVGA 2R1VB 1I1QB 1LTQA 5DSTA 1SIOA 1VJDA 3VNBA 3U1BA 4RGQA 4OQNA 3BXOA 3WLTA 4KPEC 4PHHA 1BDMA 1RXCA 5ALXA 4XR9A 4CM4A 1L4EA 5COAA 2WG0A 2FSVC 4CTKA 2Z2XA 1QE5A 1MH9A 4QRHA 5BN4B 2DY0A 4P3NA 4CWAA 3EIEA 3RSHA 2IY7A 3CRW1 1ADFA 2H7XA 4UEOA 2V4ZA 2O8DA 4LHEA 4R2KA 5JANA 3OCUA 1JKFA 4IH4A 2JFHA 1NY6A 4YJDA 3PC8C 4RVUA 5BSVA 2XDQB 1GVHA 2R2GA 4LK3A 4RK1A 2XMPA 1DMSA 3DL7A 2AR0A 2FEMA 3MJEA 3CSDA 1RNLA 3E23A 3ZVLA 3AILA 3A9VA 1D2NA 1TQHA 4CDMA 3K6RA 5JZBA 1ZISA 3KOMA 1OBVA 4Q24A 1UP7A 2AR9A 4WW0A 1X8XA 3P9PA 4X92A 3QZUA 4RTLA 3TL2A 2GILA 3NEAA 2WVAA 3U9SA 1IY0A 1LBQA 1QIMA 1J07A 1S9HA 2OZLA 1WNFA 2B94A 4C6SA 4EO4A 4B6RA 3E18A 1SU8A 1ZMXA 3K2QA 1JDBB 3CV3A 3LYUA 4H08A 4ME6A 1XIVA 3NT4A 3GRUA 3NWPA 1UAGA 3WKDA 1R3DA 1R4NB 2ZRDA 2LKDA 3E8MA 3PQFA 5BW6B 5J4VA 1RSZA 1SQ0A 3G2OA 2RH5A 4FLMA 5CFLA 3ZHQA 3TGPA 1TVCA 1F4LA 2GM4A 2GPBA 1QB8A 3ANMA 1O96A 4P83A 4QYXA 5BT8A 2ZI9A 2X2EA 4NHEA 4NH4A 4FMDF 5LQSA 3NH9A 3ZH9B 4C7BA 4S04A 4C1NA 1DIGA 2JIZD 4FYKA 2DT5A 2YHUA 4R9SA 4QGHA 4TKVB 3WKAA 2ABWA 3FVRA 4P4TA 4OB7A 4QGAA 2BTQB 4MVXA 2H52A 2LWIA 4ZYLA 4Z6KA 3NCHA 2A78A 4LZAA 4Q66C 1VI6A 4FKBA 2BM9A 5TPZA 1NFFA 4R8VA 2DPHA 1I51A 3UA3A 4EP1A 1A5AB 1HF3A 3M5WA 5DIFA 1AQNA 2HUPA 1V4NA 4NEGA 5KQMA 1R8SA 4OHBA 5HIKA 4FPXA 2XOEA 5BSFA 5IYZA 2XBMA 3CKYA 3Q7IA 1KJ8A 1BHSA 2DUWA 2JA1A 3CLUC 3KG2A 1VPLA 1NYTA 1T9GS 4JWKA 4KRYA 4EPTA 1JKJA 2POCA 1ZN7A 2QN2A 5CNJA 3ZIDA 3GA5A 5J2TF 5BNFA 4E09A 1FNMA 4QXPA 5MN5A 2V0GA 3GGOA 3Q40A 1LW7A 1FTYA 5JSFA 4GIBA 3CNOA 4W5JA 3F5MA 3QPBA 2VT6A 2VF8A 1RKXA 4K3VA 4D3FA 2BEKA 3L9XA 1AE1A 2P67A 1O94D 1FLAA 4MVJE 5DB4A 4Q21A 1OY1A 3WYEA 2AQKA 5FAKA 3MNFA 2WSYB 4RVDA 5EP3A 1KY3A 3N5CA 5JH7A 1OBOA 1U31A 3OEEA 4MS4B 3UH0A 4U7DA 1FRFS 5DLDA 4WX2B 4M1MA 5A4IS 4CKCA 4CMEC 3U16A 2HF9A 4EB3A 1XQVA 1QRRA 2Q27A 2DC1A 2WAYA 1JWLA 3MXTA 3TQOA 1GPKA 1W29A 3QW2A 5EQJB 5A3SA 3P4UA 1X74A 1BKSB 5CX1A 2WJVA 3KD3A 3O90A 4AX4A 3E2MA 1EXWA 3EGDA 4A8JC 1VL5A 3L40A 4CMGA 1WETA 4DIDA 4M8KA 4ZAVA 4MCJA 2WKPA 2YCBA 1U8EA 3KQVA 3S4YA 5H9WA 3IT3A 2OXTA 2VUIB 4NBUA 1YOVA 2BM8A 2PUEA 3JVEA 1OYYA 3DKRA 1RZVA 1UFQA 1EVJA 3F46A 4G67A 4TRRA 4RPKA 1C0PA 4X1KA 4NNPA 4BB5A 4DN6A 1W0KD 3BTOA 3PEEA 1QO9A 1JE1A 1RRMA 4M54A 4G3XA 4O29A 5EFOA 10MHA 1R15A 1W34A 4ERXA 3NIDB 3AV3A 1E6MA 2DCUA 3EF0A 4I4TA 1Z82A 1QM5A 1K6MA 2R11A 1EFVB 1BRTA 3N3BC 3B7PA 1DWOA 2GBGA 2P9YA 3A3NA 1QQ5A 3G23A 5TMBA 3U1TA 4NP6A 2FSHA 4C3UA 3B85A 4MRVA 3M82A 1LF5A 4KLCA 3H7AA 1JHDA 4V0ME 4QIHA 5CRIA 3CYFA 3RLIA 4V2UA 3RV3A 1XWIA 3QEKA 3RIXA 2JCSA 5LNK1 4GSLA 5LIPA 1C7RA 5AOBA 4M1KA 2MDTA 3TJMA 2X86A 2REOA 3UBTA 4V03A 2XA9A 1AXRA 1RADA 4J2TA 3BH7A 3NHWA 5AOCA 5C80A 1N6RA 3IEUA 1JG4A 4YV2A 5BUQA 1CY1A 2H16A 3KR0A 4OO3A 1RJDA 4WRRA 3D6NB 1CJUC 4G8CA 5ITSA 3U44A 3LT0A 4P86A 3OM0A 1F48A 1UBOS 1BXKA 2ENUA 2OCLA 4DJ5X 5CNIA 2YVLA 3SEFA 16PKA 3ZDEA 1H2HA 2XXAA 2XD4A 1E2BA 5FHQA 1IN4A 4N0PA 1U28A 2AZXA 3QIVA 3NXSA 1B76A 1F2TA 1V37A 5M7EA 1AGRA 1Q1BA 2ZYSA 4UU7A 4L07A 5J59A 4UNPA 4OIMA 1KAQA 3EA0A 3PRHA 4J7AA 1DQZA 3AU9A 3KPUA 3O03A 2Y1OA 1L5OA 4TV8F 5AIAA 3VI3B 4FB4A 1A4IA 5DVZA 4L0MA 4DR3B 4KGDA 5M3BA 5CIYA 4FDAA 4JUAA 5F3DA 3GY0A 3FNGA 1RBMA 4EEXA 5A02A 1EDDA 2VF7A 2NOAA 1W73A 1T1GA 4FOTA 4DMUB 2XTZA 3C6MA 3H1PA 3P94A 4J1TA 4DV3B 2R8XA 3OJEA 4M88A 3DUFA 3V4SA 1O4WA 4NEHB 5TJHA 2QTWB 5T8KC 5K8LA 4TRNA 3OUZA 1V16B 1RWOA 4RAOA 2DFNA 4B83A 1O3YA 3IBSA 3PI6A 1TLTA 1XU9A 3OBIA 2X8BA 4C29A 1L2TA 3TE6A 2JH8A 2H2IA 4AG3A 3JWPA 5CGZA 4DIKA 1OH7A 1X42A 4KNYA 4RA9B 1JIUA 2PQ0A 1KGSA 4FNAA 2P0YA 3B3FA 3O3OB 3HYNA 1O87A 5BXQC 1GGJA 2QD4A 3CR8A 2XYHA 3CE6A 2JBWA 4AS2A 5I4KA 1XMOB 1FDUA 4KBFA 5EVJA 4B3RB 3MT0A 4F2DA 1E94E 5K0FA 2HPHA 1KK1A 3OPMA 3TOSA 3BB3A 3CRMA 3I05A 1TL7C 2HK9A 1YH3A 2B4AA 3PDIA 5I9BA 3RUHA 4Z7OB 2ZJ8A 3WHIA 1YL6A 3LPDA 2FYTA 2XWQA 3AVXA 1JFRA 2AVNA 4CQJA 4EGFA 1A9XA 5JEDA 1IH8A 2ERYA 3B8EA 1OF1A 1DQRA 1QYIA 2VZ9A 3GVPA 2M9MA 3T34A 1EB8A 1GPLA 3TAHA 3ADKA 3PYXA 3DAYA 5TR9A 1TKBA 2IELA 3LC0A 1QZTA 4KPUB 2C9DA 3D7NA 3E5NA 4BLSA 8OHMA 4O3MA 1E89A 1IXZA 1DADA 3HB4X 4E1VA 1DIOB 2G9UA 2JANA 3AYXB 1WP4A 1VYUA 3PC7A 1KH1A 3EVAA 2AN5A 2HDHA 3SHVA 1Q0LA 4XUGB 3WGUA 5HOEA 4Q4JB 4UBLA 4N47A 4DYVA 4IDBA 3R3XA 3SJAA 4NFHA 3ETGA 5JJCA 1JWAB 2QG9A 3D6AA 3G5TA 3OWXA 2QU7A 4FK8A 2FZVA 2Z6VA 2A3RA 2AXNA 1WSWA 3B1YA 3OWOA 1K5PA 2FW7A 3C7DB 1DX9A 4MWSA 3L1VA 1DRVA 4RKRA 3FTFA 1W52X 2AHOA 5T41A 4GXRA 1BQEA 1UAYA 3GAMA 4BJ3A 2ZJ6A 2OR3A 3L6EA 4FBGA 4FGLA 3IP1A 1XLVA 3DJYA 3D6FA 4NARA 4O4IA 5D3MA 4LIPD 5JXHA 2AJTA 4UXJA 1ZOOA 4H60A 4KE9A 5ALYA 1DRUA 2WSSD 4ZA2A 4DGQA 5FX2A 1E2KA 4IIBA 5GVSA 1IUOA 4O4HF 2IQIA 1ISGA 4MRPA 1ADYA 2ZYWX 1JZQA 2FEPA 3AU8A 4R2LA 4CIVA 1Y5LA 5LYJF 2O8BB 4JQSA 4LX8A 2YWDA 1NW5A 4OXQA 1FFDA 3ZNOA 3CR3C 3WQHA 2IXEA 2YWCA 4G0NA 4LBVA 3TIFA 2H1OA 4L9AA 3ZXSA 5CUQA 3ZX5A 3V00A 2G71A 3GAZA 4C76A 4XJSA 1PKXA 4IMIB 2HNBA 2YY5A 2ECPA 5FR2A 2F8TA 3FNRA 4EO7A 3AKYA 4OFBA 4OB8A 5FO1A 3RRFA 4DADA 2YNMD 1C1HA 2AFHA 1YC2A 4A2PA 1WKVA 1C80A 3GLFE 1YJBA 3LPNA 1DBWA 2ZE6A 3C48A 3MGKA 5FWXA 3ZGYA