3RIYA

Sirt5 is an nad-dependent protein lysine demalonylase and desuccinylase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
b'SFTARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-5
publication title Sirt5 is a NAD-dependent protein lysine demalonylase and desuccinylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 97
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3riyA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3riyA01
4FVTA 2A1UA 2BRUC 1Y9DA 4IG9A 3LQ1A 4BVGA 2Q29A 5IMSA 3JR3A 2Q28A 5EJ9A 4GPEA 1YNOA 5K6TA 4K9NA 4JUFA 3HWWA 1POXA 1T9AA 3GLRA 1ICIA 2DJIA 3EY9A 4MQ5A 3EYAA 2H4FA 3ZGVA 2OO5C 3CF4G 2WVGA 4MPJA 1Q6ZA 2VK4A 5MFZA 5K2OA 2JLCA 2FR8C 2Q5LA 2WVHA 4RMHA 3RIGA 1N0HA 1YHZA 4JU8A 4X3OA 1O97D 4GG1A 1Q17A 4Y6QA 3CLTD 5FEMA 4Y6OA 4BVEA 1OZGA 5EJ5A 4X3PA 3IAEA 2JI7A 4QQ8A 4K9MA 2WVAA 1Q14A 1YC5A 4UTRA 4IF6A 4UTVA 2UZ1A 4GM4A 1V5GA 1V5EA 1QPBA 1E3TA 3U31A 1V5FA 4J1TC 5MF6A 4JSRA 4UU7A 3RIYA 2H2DA 2H59A 4L2IA 2H2IA 1PTJC 2Q5OA 4FEGA 4UU8A 4KPUA 2FSVC 5K3SA 3CLSD 3EA4A 2OORC 3ZGOA 2JI6A 4F4UA 3CLUD 4UUBA 4O8ZA 4JT9A 1O96B 4UTNA 1U28C 1YI0A 2IHVA 4HD8A 4FZ3A 1YTLA 4TWJA 4F56A 1T9DA 3U3DA 4UTZA 2H2FA 1S7GA 4RJJA 4JUBA 4RMJA 4FEEA 3PKIA 3GLUA 3GLSA 2OD9A 4C78A 1POWA 2VK1A 2EZ8A 5BWNA 3CLRD 1PO7A 4BUZA 1OVMA 1UPBA 4K9PA 5EJ8A 4MZXA 1EFPA 2PGNA 4G1CA 4MPRA 4K9QA 1UPAA 4JT8A 5K6RA 2Q5QA 2OD7A 4RJKA 4ZZIA 4D5EA 4V1CB 1PVDA 4KXQA 3JWPA 2FRDC 2VJYA 4K9OA 3K35A 2VBGA 2VK8A 3HWX1 2FWNA 4QPZA 2UZ1B 4BV2A 2C31A 1SZDA 4COKA 4UTXA 1T9CA 2X7JA 2EZ9A 1DJLA 2HJHA 1PT9A 3F6EX 1D4OA 1UPCA 1M2NA 4QELA 1Z8NA 2IHUA 5EJAA 4I5IA 2VBFA 3PDHA 2QQFA 1BFDA 2QQGA 4BN4A 4C7BA 5EJ7A 2H4JA 1U31A 1ZPDA 2EZTA 4K9KA 2B4YA 4L3OA 4BVBA 2IHTA 4V1CI 1HZZC 4GM0A 4GM1A 1PNOA 4J16C 1M2GA 4MPPA 1XLTC 4JUCA 1T9BA 1U2GC 1U2DC 2PANA 1JSCA 1PNQA 3GLTA 3IAFA 4ZP1A 4GP9A 5FYQA 2H2HA 2H2GA 3FZNA 2AG0A 2FN3A 3D81A 5DGDA 1YI1A 4JUDX 5EJ6A 1YHYA 5EJMA 2AG1A 1PYDA 2NYRA 2A1TR 3OE1A 4D5GA 3E9YA 1PI3A 4HDAA 1SZCA 3D4BA 2NXWA 4Q9DA 5DGTA 3FSJX 2W93A 3F6BX 1S5PA 4Y6LA 4BV3A 1MA3A 3FLMA 1NM5C 2EZ4A 4JU9A 2OD2A 2PGOA 4V1CA 1MCZA 1EFVA 5BWOA 4BVFA 4IAOA 5DEIA 1M2HA 2H4HA 2Q27A 4R8MA 4RMIA 2JI9A 2JIBA 4BN5A 5MFPA 1J8FA 4KGDA 2JLAA 5AHKA 4BVHA 2JI8A 4UUAA 1OZFA 4RJIA 1M2KA 3D7KA 1M2JA 4JUAA 4RMGA 4TWIA 4K9LA 2Q5JA 1Q1AA 2EZUA 5EJ4A 2V3WA 1OZHA 3ZG6A 3PKJA 1YBHA 5MGNA 5D7NA 5BWLA 2VBIA 4JD5A 1YC2A
chains in the Genus database with same CATH superfamily
2VRWA 4TV8B 1MENA 4LZAA 1LSUA 3S40A 3GGGA 1VL0A 1ETHA 1NVKA 5B1EA 2HH9A 1NC3A 1B23P 2V7WA 4KL8S 4RTRA 1QE0A 2LV8A 3E84A 3O1IC 1B76A 5TIIA 3DE4X 3IFSA 3LQ1A 3QIAA 5JFOA 1JILA 3UPUA 1KRXA 5LIPA 4QJ3A 1AKNA 1DFIA 5AVWA 2G07A 1F8UA 4BJ6A 3DDSA 1PEKE 2NO5A 2J9ZB 1D5WA 2PWZA 1E3WB 5E2AA 3O93A 3H11B 1GZSA 2E4YA 3FCXA 1APBA 4NJOA 3N8HA 1VE6A 1O3YA 4PYNA 4C7OB 3A2KA 4UHDA 4HBGA 4E1BA 1UH5A 5AK6A 3R3YA 3QFCA 3O1JC 3ISJA 1E2PA 3T5DA 4D02A 4D3FA 2BH9A 1I2ZA 3KB2A 2AS0A 2EFGA 4R2KA 1GPYA 1P2GA 1X1SA 3IDSA 4AF8A 3ETGA 4C0AC 4IHJB 4DJFC 1IJFA 3CRQA 1E4YA 5F33A 3ZGVA 3U4CA 2TMYA 5FEUA 4Q4JA 3D7NA 3AR8A 3H7AA 4L85A 4D9BA 1Z4JA 2X0KA 3JQPA 4YFVA 2WKPA 1ZGGA 4MVYA 4FYYA 2AKAB 1AUVA 3K96A 2BGGA 2A0UA 5A3RA 4GRAA 2GD1O 4TTQA 3U37A 3M9XA 3S5UA 3LFTA 4Q7LA 1NQ5A 4QYMA 4DUGA 4LSMA 1YKSA 2WP8J 3GVPA 1Z16A 1JH9A 1Z0ZA 4UKDA 4OYYA 2V8BA 3LBAA 3WGLA 2R97A 2WIGA 4BP9A 3RADC 1K4MA 1NY6A 1PZNA 4RMHA 1TFRA 1OAKA 4WD3A 3OURA 1EVLA 4URZR 1WSAA 1VGQA 2PUVA 4DM3A 1YZTA 4NK5A 1I0IA 1KY5A 3K31A 2ZETA 3U7IA 4BGVA 2BZGA 3T1NA 1TF5A 3CLTD 1PJAA 1GOTA 5KINB 4Y6OA 3VKFA 3L8EA 1EWYA 1YQWA 2BFWA 3IV9A 5HA5A 5B37A 4LYHA 4HPWA 2ZJ1A 5EJ5A 3NNNA 4IHKA 2ENUA 4X8LA 4KQKA 5JAUA 3DE0X 5AK0A 3AESB 5FADA 3ZBQA 5THQA 3LQ4A 3EGDB 4H6XA 3A2NA 3CRMA 3ZQ4A 4QQ8A 4G1VA 5JASA 2ZJ8A 1XDBA 1YOVA 2W11A 3LGAA 1U3GA 2FI1A 1L6IA 4Z5XA 1RS0A 1QANA 1ES9A 1ZI9A 1WVGA 5HBGA 3I01A 3I2KA 2CJWB 2R00C 5FOTA 3VOAA 4IF4A 4J1SA 1GFIA 1V5GA 5CP8A 2JFBA 4DMCA 3V7UA 4DJTA 4IJQA 3V1KA 3COVA 1CR6A 1VFNA 2CDNA 1EM8A 1QGOA 4CL3A 3IAHA 3ME5A 4UU7A 2BKXA 1W52X 3LZCA 1Z5ZA 3IP6A 3LKDA 5FNVA 1JN0A 4MH0R 5TE9A 4EJ2A 3IEMA 1U3TA 4CKXA 2ECQA 3IEVA 4Q39A 2W6NA 4X1YA 3P9SA 3HM9A 1Z34A 4MR9B 2ARKA 2X4LA 3Q85A 4CUKA 2VRNA 3T1TA 4J0CA 2QRPA 1N0VC 4I7EA 4HQKA 1SCIA 2ONZA 2XDYA 3BQMB 4D6YA 5KJ1A 4FILA 5GINE 1FBNA 4FEGA 1MKYA 3CNBA 3IOCA 1UFVA 4E3ZA 2OFFA 1X70A 4R83A 3R9IA 4QIHA 5IWAB 1Z5WA 4O4LA 1KYQA 3R6LA 1A8IA 3KB6A 3KJZA 5AXAA 2IIBA 2A4KA 2HF2A 1VKZA 3EUFA 3QX7A 3QSGA 4RD1A 4RK4A 1C7QA 3IR7A 1R8XA 4OD0A 3TUZC 4AIIA 4DABA 2XMCA 3LQYA 2BEJA 2W2LA 1KZ1A 2JI6A 3ETEA 4UNQA 5F35A 3CVVA 3Q15C 1Z08A 4GH5A 4E6PA 3OQMA 2Q3EA 1CJMA 2YBDA 1A9ZA 3GDFA 3GEDA 3I0MA 3VU9B 4F86A 2QU7A 3R5SA 4OATA 2ZR7A 3ZE6A 5ALYA 1U7OA 3VC1A 2FCRA 3DT6A 4HLUC 4US2R 3CBQA 3BL6A 3DCNA 1CZNA 1P7CA 3EIFA 1QIMA 4BDSA 4YJ2A 5JWRA 1U28C 2B25A 2VQDA 2Z3WA 3AQIA 1P5JA 5TVKA 3HB7A 3M6WA 2BGWA 2QGFA 4JDPA 4X20A 3ZCUA 5EP1A 4ALJA 3NRJA 5D84A 5KTPA 1EK0A 1KEUA 3ILYA 4RJTA 3IVMA 5HG0A 1Y3FE 4WXRA 4CM4A 5DO9A 3RTGA 1QOQB 4B0OA 2G71A 4RZXA 1BCSA 3DONA 4E4TA 4WHMA 1XLVA 4G9BA 4YS6A 5EY5B 3BEOA 1YI8A 1Z4MA 1IQPA 3OQ6A 1BU8A 1K3FA 4M0UA 4LJSA 1WTCA 4C05A 2P5SA 3UUGA 3JQBC 3OF3A 5CGZA 4YRQA 5EKTA 5F7OA 4Y2UA 2ZWMA 3LUCA 4JBXA 4MRVA 4HN2A 5IG2A 5HE9A 1JNXX 1ZESA 1RPZA 3I0NA 2VF8A 4H1VA 1A9PA 2HSJA 2QA5A 5K51A 1DWPA 1K8XB 1ZVMA 4QGGA 4WQMA 4TL8A 2DWUA 2BSXA 3L4BA 1P1KA 3AM4A 2EZ8A 3OPQA 4F4JA 2JD2A 1MV5A 5IU6A 2MSKA 3ZVMA 4Q7QA 1F0KA 2C5AA 2JG3A 3IYLW 4DZRA 3TPZA 4RW0A 2J59A 2XCQA 5JECA 1KAEA 3PUVA 4ZRDA 2DWQA 4JR1A 5TXGA 1CJTC 1DJNA 1G3QA 2CDCA 3HCBA 3I5UA 2XAUA 3PWZA 1KH3A 1EDDA 4DT1B 1HKHA 4MZXA 4RMNA 3VDNB 2AV6A 1RJEA 1UBRS 2F1IA 3A10A 4ISBA 4JFAA 5ED4A 2SKCA 4ZV4A 2CF6A 3KUKA 1JR3E 3LIIA 1HLDA 4BKPA 1KMHA 2FW0A 4A10A 5H9WA 4LJ8A 1DG1G 2WUFA 4LDAA 5LP1A 4LSWA 1F3LA 3E5HA 4OKSA 4TLAA 2VJBA 1PGOA 1VLZA 1YRBA 3IKTA 3SE0A 4W8OA 5EXSA 3PLAE 2GRAA 3P0EA 5IJZA 1XT6A 1ONPA 3D0RA 4OX9B 4RK5A 1R18A 2O5RA 2F9FA 2FWNA 1E5LA 5A5EA 1ID1A 4WNYA 2MYPA 1H23A 4DCJA 3AF1A 4E3WA 5CFRA 4MULA 3WOVA 2ZCVA 3OX2A 1O58A 4I08A 5I7AA 4DNOA 4ZHQB 4P8RA 3K2QA 2N46A 4W82A 4Y8VA 1KFEB 1AF7A 3PQ3A 2XKJE 2WAMA 4IIDA 2A0XA 3TXXA 2ONKA 3ZXUB 1T9CA 5A6VA 3AB8A 2CF5A 1C0EA 3UATA 1ISPA 1UWKA 2M9MA 2X7JA 4ZVUA 4TMKA 4DTIA 3RLFA 4N65A 1YL5A 4CIBA 4HQ0A 5TJ9A 4JI1B 3ZH9B 1ICEA 3MJ4A 4QLOA 4GPBA 4M8SA 3MRSA 3BRWA 5FR2A 1QZUA 1ESDA 1COWA 5F5NA 5LOVF 3FD8A 4IJKA 3GLIE 1QRDA 1JKJB 1KYYA 2X6TA 4IV5A 4MW1A 2DFTA 4FX5A 3WFJA 2NUTB 1DZ3A 3DBRA 3O3OB 1TZCA 3V8QA 4CKCA 1CG6A 3L8ZA 4LRSB 1TYZA 3B1JA 3OY2A 3TAXA 4YUYA 4BVKA 1QAOA 1TRKA 4IVNA 4C7KA 2IH2A 3U0VA 3OPVA 4RQBA 5BR4A 2REXB 2B8WA 3N0XA 3QKRA 4YC7A 2WSIA 3HBFA 4CLOB 4UVGA 2R0QC 2PMCA 1G41A 1QS0B 3R8FA 1TYBE 3IRUA 4EKNB 1M2NA 1G6KA 1FXWA 1TZMA 1NHWA 1T3GA 3RO7A 3CH5A 2BEVB 2EU8A 5BSUA 1MQ8B 3CFYA 1SHZA 4CLEA 4MVXA 1YZFA 4YCSA 3FSRA 4ZKEA 4ZKDA 2FX2A 3ELWA 4IDAA 3ZVLA 3ZJVA 5K20A 2FRXA 2IU6A 3ICPA 1H5UA 4MOWA 5T5QA 1F17A 1MJNA 1O87A 1W29A 2PT9A 3HA5A 2VSYA 4DLYA 1MIOA 2VDOB 1E6CA 4IH4A 4KQWA 2B9VA 3ZK8A 1JLKA 4KIFA 3RKSA 4AG6A 4EG3A 3DPSA 4WASA 2OAP1 3DZIA 3IVGA 2QY9A 2IYNA 4GMFA 4M22A 2QPLA 4BV9A 1ZPDA 3AB3A 5BNZA 1USVA 4K9KA 3T95A 1E7YA 1QFZA 1U5BA 3T3EA 4A7PA 1IWOA 1IXSB 1UEXC 5AUNB 3BWMA 1ECBA 4BQFA 4GMHA 4OGLA 4YP0A 4TOIA 1RADA 2XB4A 3HG7A 3LP5A 4AKSA 3I72A 4HV4A 1JP7A 1P74A 2AMFA 2FUCA 4BZQA 1L9XA 3EVNA 3GJ7A 4L4SA 4MPPA 4AUEA 1QV9A 3C14C 4C6TB 1KH1A 4TSKA 4B7XA 2B4QA 4EY7A 4ZJPA 5BSWA 4BNHA 3TZQA 4MR7A 4CIYA 1EZ1A 1C0IA 2VJKA 3F9RA 4YRZA 1KAQA 3CPSA 3D6FA 4F92B 2EFEB 2EWWA 1Y82A 4AZWA 2QXUA 1YIOA 2XUFA 3CLRC 3O26A 5EERA 3SJUA 5LJLA 1UBEA 4ZVPA 4NAHA 3STYA 4UDXX 2PYZA 1S9HA 2QWXA 2R5FA 3UY4A 2DC1A 2GBFA 2RKWA 1GPLA 2VNKA 3PNOA 1LQTA 2CLDX 4IIFA 5FV4A 3AJAA 4ZP1A 1ECPA 1SBHA 2WOJA 2H2HA 2ZZNA 2ES4A 1DV2A 1X7WA 3WL5A 2KWIA 1RTKA 3SQMA 3WLAA 2PG3A 5DMHA 1IG0A 2YUTA 4HDKA 4D74A 1QYVA 1NOJA 5JXIA 4Q1EA 1GYRA 2JGEA 4A5SA 5AJTA 2WWYA 4MCJA 1R12A 2G40A 2FN3A 2PXHA 4PX9A 2YWJA 3K0KA 1RXSA 1KJZA 4BLQA 4MK4A 3JV7A 1JDBB 1HYBA 2R44A 2R68A 5LQAA 3TL2A 3FYTA 4ESHA 1LBIA 3CWQA 5EJ6A 1XDGA 1FTYA 3U3ZA 1G60A 2WYHA 3QTTA 1KEEA 3CEJA 4U2GA 2RBEA 4LZNA 4MHOA 2A9VA 4L5IA 1CIVA 1PJLA 4GU5A 3P45A 4J0JA 3OPXA 4NS1A 4KXLA 3LQQA 4UPEA 1OXVA 9ATCA 1GZ7A 3IVRA 3GUYA 3THYB 1LBEA 1T8UA 2EKDA 3ZLTA 3AM1A 1SBQA 2CNWD 2QUBA 1XTSA 2V65A 2ASVA 2VHXA 3I04M 4RGYA 4XGIA 3VVBA 3T7KA 4ESVA 1XNRB 2XW6A 1SIOA 1FLDA 1NBMD 3QY0A 4OJMX 4ZO6A 3AO0B 3D4BA 4UMEA 5DI3B 5EIFA 2QTCA 1C7JA 3TIXB 4EKYA 1A5TA 4LI0A 4U2BA 2W93A 2ACKA 3JYQA 3O7WA 5L4NA 2OGZA 2W8BA 4JELA 4D9GA 1KOFA 1FJ2A 1IG3A 2JFZA 2X58A 4CLRB 4LCJA 3CH7A 1U04A 1XUOA 1YRQA 2KW5A 2VQSA 2WWXA 1QCZA 2WUVA 8ADHA 4DJDC 4U9HS 4LBYA 4IP0A 1L9KA 2ZYHA 3NHFA 2CK3D 2ZSUA 4NFHA 4ZO4A 2WKRA 3PFNA 4RQAA 1JFTA 1M8KA 1T0BA 2BCEA 2V1XA 1A5SB 1Q7TA 3FUUA 2BKUA 3ZUPA 3T5TA 2EJCA 4QUAA 1L8LA 1JX6A 3LMKA 4Z0TA 3IQFA 1MCZA 4UBMA 1EFVA 1LJLA 2A9OA 4AECA 5BWOA 4EUEA 4R41A 2JRLA 2R1TA 1W87A 2PUBA 1ZM4A 2CVOA 2NU7B 1PJBA 3LS2A 3NTQA 4OG2A 3SJBA 4YMLA 1T8TA 3GNSA 1N6RA 5EZ5A 2QG6A 4D9IA 4DLLA 1JYEA 3O4RA 2QD1A 3C6ZA 4ZREA 4H6WA 3OZRA 4C14A 4EB3A 1WB6A 3ACBA 1XTKA 1JG1A 1GXSB 2UV8A 3NWBA 3QF7A 1M1UA 1OGIA 3A3KA 4P38A 3DO8A 1WABA 2AE2A 1C7RA 3D6NB 5L53A 3DR3A 3PCXA 1GPJA 3G2MA 1XZ8A 2V0NA 3F3KA 2HJVA 4UZEA 1E63A 4EG1A 1JPUA 3N2KB 3E7FA 1KP2A 1QSGA 3EY4A 5AHXA 2WKWA 3F73A 4RQUA 1V37A 1JR4A 4B0PA 2Q2QA 3MOIA 4M3NA 5H8WA 4B45A 2DKFA 4Y67A 4C7JA 1LXCA 3PL5A 4ZO9A 1PNTA 3K0FA 3ESCA 1QF7A 3OLWA 4CR7A 2JH9A 1UBSB 2NN3C 2VYCA 1SCJA 4KFTA 2XDWA 3K0AB 1FX1A 4CFZA 4DMGA 5B3KA 1C3XA 16PKA 4RK1A 3HDGA 5E1BA 2G5TA 4BRUA 4DNFA 5EHXA 3RFXA 4OI0A 1RI3A 3A9UA 4DW8A 1YVEI 3ZCPA 1UKEA 5A3JA 2CV2A 5LQKA 1NTRA 3TGLA 3R7NA 1B93A 4DADA 2B8TA 2Q62A 3HHEA 1SQ0A 2BRUA 5K0EA 2HYIC 4OHYA 1PFYA 1RIIA 3PCTA 4ZOEA 4L72A 3OP1A 5A4FS 2JDIA 3SX4A 4I50B 4B8WA 1P2SA 4ZXPA 1CZLA 4NQZA 2V4MA 3FB1A 3GXOA 4ND8B 5C7IO 5KMGA 3EEQA 2XDQA 3ROXA 3O95A 1VMEA 2VG8A 5ITZB 3OMLA 5EMHA 2VAPA 4YJ3A 5D5PA 4M53A 4F4FA 5CFZA 4NL4H 3QPVA 4JB0A 5DDIP 1NMYA 2LPMA 3N75A 3QPAA 4EGFA 1DAOA 1KR5A 5C1OA 3SVZA 4D99A 5M2QA 1OFVA 3CC8A 3KSAC 4WOBA 1Z06A 1YS1X 4QOEA 5ALSA 3RGWS 3RV3A 1IFXA 3IURA 2QVGA 1CC1S 3H8VA 2OHHA 3UMSA 3UG6A 3PXBA 4CEJA 4BLTA 3EXFA 3NHMA 3ABRB 3RAFC 1ZIYA 4GC9A 1H4VB 4BJ1A 3GDOA 1A9YA 1V9LA 3GLFB 4MUYA 3KHTA 1AUXA 4LV5B 3CUKA 3PJFA 3T9DA 1XZAA 5ILOA 2GPBA 1P3JA 1YNOA 3DF9A 4TL9A 3WL6A 4AS1A 2ZJFA 1GKUB 4BCBA 1E60A 2YFKA 2B61A 4GKJB 4KNYA 1EGAA 3GRVA 3ACCA 5JCOC 3O82A 1DO8A 1I9CA 4KSYA 1T5TA 3W5SA 3QHPA 3BMOA 2BR3A 2Q3BA 3OLCX 2YZ2A 3ICVA 3F9IA 1LFDB 3KHUA 4NCKA 2ZJAA 1AK9A 2JLCA 2DGDA 5K0TA 2XSZA 5JSFA 2UZ3A 4Q4LA 1ISRA 2CVZA 4XVRA 4B3CA 1I01A 4LZPA 3AOGA 4YBZA 5K0ZA 2CL5A 2PUTA 4JLPA 4L78A 3FNIA 3FTEA 2EWVA 2BFMA 3JASB 3ORRA 2B7LA 5EIAA 4F8JA 1E2EA 3TQHA 5IH7A 1FP7A 4QTXA 4FUQA 3WY9A 1NMEA 2CDRA 4X41A 2P1RA 1XTJA 2P6UA 1Z0DA 3IGFA 3QWIA 4RTPA 1U0NA 4UDOA 1AQLA 2D3WA 3MGCA 4OBWA 3OG9A 5I4BA 1R8SA 2KMLA 2PS0A 4IOLA 1Y80A 3D2BA 3L8YA 3MINB 3FJYA 5FEMA 5KTKA 5AH0A 4HS4A 1AD2A 5DH9A 2X5JO 2BJWA 3HABA 1OZGA 2GZAA 3D1JA 4QNNA 3NJ8A 3L40A 1OWLA 4PRZA 2OZVA 5AHWA 5E38A 3AEYA 1SVOA 4MVJP 2I2FA 3HVHA 1F0PA 2R8RA 2EBFX 1ODKA 3FOAA 4IS3A 4JMLA 2E48A 4LYJA 5JPDA 1G5TA 2ZQ5A 3T3NA 4RVDA 4QARA 2W2XA 1J8VA 4DV6B 1YC5A 4BO8A 1GG8A 4Q3KA 3RLIA 1EFKA 4UTVA 3IELA 3G2LA 2I62A 2XWJI 3IUSA 4Q7MB 1JL3A 3NTUA 3AK4A 4NU6A 4TM7A 1CU1A 2JASA 4QDOA 3PFHA 1KJ9A 1TTHA 1TUBA 1V5EA 1KDYA 2NVUB 4LXIA 1I5RA 3FPEA 5C4MA 1RVDA 3ZZ1A 1NLZA 1CF9A 2DP4E 1IEXA 3C16C 3VPGA 3NORA 4MKZA 4AJLA 5CEJA 1GP2A 3MWDB 4DCPA 2WIBA 1VC2A 2H2DA 3EDMA 4JOCA 4MAAA 4PC2A 4CTOA 4EGAA 4ENWA 3TBHA 4PZ9A 2XVXA 3JZFA 4ZQHA 5HFNA 1WXWA 1OMOA 3M2TA 3LCMA 4I2NA 4IIJF 1XAIA 4X91A 4YCJA 3R77A 1U0OC 3VR4A 1YB2A 4EJ0A 2HC9A 5JRJA 4E33A 5CXSA 3TVTA 3DMGA 3AH8A 4MQEB 4JHXA 5JSZA 4LJ7A 3LWNA 4Y0NA 1OA1A 2VDQB 3SM9A 4UBLA 3N74A 2JFWA 4CMEA 1Z83A 3GEIA 3O6VA 2C82A 4JB2A 1AKWA 3KKZA 3GRZA 2OORC 5DNCA 2DVMA 2DFKB 1ESMA 1Z8HA 3D2CA 4FQ5A 1PEAA 3K0CA 4OL9A 4FT2A 4AN1A 3WIBA 1UOPA 1O6CA 3E9QA 1MVLA 3QNMA 2XUOA 4BFZA 5DVZA 3HP7A 4C4ZA 4N7BA 5EZYB 4PGMA 1NYTA 4BHTA 3ENZA 4C5AA 4AP5A 1OXSC 4EVRA 5ENZA 2B7BA 2FOLA 1QUEA 2MSEB 5FL7D 3CX7A 3OA2A 2J5RA 3QYPA 4TV9A 3BERA 3RYFA 5FOQA 1K1EA 1WPXA 3OEHA 5H16A 4YCCA 2ZE5A 1ESEA 4FCTA 5CVCA 3A4MA 5B3JA 1NI4A 4C29A 1ISMA 2OLKA 3AY6A 1RPTA 5AI6A 1T5BA 2WUGA 2YHAA 3PZRA 2ZI7A 3KRTA 5KTNA 5KYXA 4XRRA 4J7XA 4RIFA 1PLLA 3EZLA 4FDAA 5DCYA 1CJKC 4ITUA 1H2AS 2B2XA 4LOJA 2IUSA 3RAJA 3IUJA 3UJ7A 1U99A 4LS3A 1ZLYA 2PHZA 5KTTA 3IHLA 4ZJZA 1P2BA 2QYOA 3ZIDA 1DJMA 3TRIA 5B7GA 1Q21A 3I2HA 2ZIWB 4DV7B 1HNNA 4FGJA 1DBSA 3MTQA 3O47A 2RI0A 1T5LA 4O2BA 1ZAYA 2J33A 1S2IA 3Q0TA 3UKOA 1PD0A 1ZW6A 2YTZA 3DVRX 4ZZ0A 1NMXA 1VLQA 2AZTA 2R6R1 3C3PA 3JAWB 3KQTA 3PE3A 5E1OA 5E4YA 3VKWA 4CFYA 4PZUA 2IF0A 1N75A 1WMFA 2EQAA 4C78A 2C8VA 4WGFA 4Y9TA 4F9TA 3ZWDA 2C20A 3WKCA 1CEXA 1PJ3A 1C4WA 4M55A 2X9VA 3FGOA 4HC4A 5BV0A 2UZIR 3ZD6A 3AI2A 2QVXX 4BIIA 1H3FA 1HI9A 1IBSA 3SEAA 4AZ3A 4KQ2A 3ND9A 1FVFA 4MV6A 1T3HA 5IP5A 3VR5A 2L18A 5KWJA 4NMXB 2FUEA 4ZYXA 3HYNA 2HRRA 2QUJA 1LPMA 1OX4A 3GJ8A 2VQ6A 4N7JA 3B8HA 1E2MA 2YQ5A 1R0WA 3L6OO 5BSTA 4F9FA 3VNVA 1N9KA 2PGNA 3ZHOA 3VPXA 1CS0B 2I4LA 3I1YA 5JALA 3L7JA 5LMUB 2W90A 1L7MA 1CXZA 1RSZA 2FEKA 1CY4A 2OV2A 3JQFA 2W58A 4C4AA 2F8TA 1SOAA 4I9GA 1UBKS 3ELBA 3N59A 1I3CA 1FK8A 1ZW1A 4D57A 1QYWA 1YFKA 4H7FA 4LAFA 1VDMA 2NNWB 3CX3A 3LCRA 3OJFA 1GRNA 4YAWA 2WD7A 3EISA 3C3AA 4KR3A 1FMCA 1R6BX 4CV2A 2YJGA 4KAFA 4OUDA 4CMIB 1IN1A 3IQGX 2YFHA 2XITA 3M6XA 1QG6A 3WWEA 4JBLA 1XRSB 5J1TB 1BHJA 3PYLA 1KERA 1B1AA 3CPEA 3A6PC 5H7XA 1W6RA 3G6WA 2O8DB 1A8HA 1EMDA 2RIRA 2B5WA 4CM6A 5JLJA 4HAOA 1CIPA 3IQEA 3WLHA 3UB3A 1UAGA 3HA7A 4ERXA 1XG5A 1R0XA 1IHPA 2B8EA 2NZUG 4UTXA 1KGDA 1P4JA 3EC7A 4OCZA 1ONNA 3GQBB 3VPFA 2C1XA 4AUKA 1KYTA 4EPTA 4H7HA 2AI2A 4IGEA 4MUNA 4RZSA 1A04A 3FGNA 3TQFA 4KYVA 3UTCA 2HGSA 1DRKA 1Y4ZA 3QUQA 2EX0A 4G8JA 2FEMA 5A7FA 4DJJA 3NEPX 2NGRA 1PLKA 4MGZR 1P2DA 2G06A 2H65A 2J4CA 4FSDA 1GTVA 3N87A 4DSNA 1RACA 3U1TA 3SOPA 3MJDA 1UJNA 4O63O 2R6DA 2R1VB 5C81A 1R9MA 4JC8A 5T4FA 3QPCA 3SYKA 3UYKA 3E7DA 4DBLE 2BTOA 5FNZA 1BDBA 3PEUA 5L9AA 4MLPA 1GNQA 4HXGA 2JAPA 1H42A 4OK3A 2GSWA 4HX9A 3W4IA 4CI9A 1LSJA 1YMQA 3KQVA 2OQRA 1Y1KE 1C1XB 2FQQA 4EY4A 2E0IA 4GPAA 2PT6A 2X9QA 1HMYA 1DKQA 4G0ZA 4PYKA 3GB9A 3NCHA 4DAEA 2M1XA 1O95D 3UT5B 1PWHA 4RAQA 2VO1A 1AX9A 2CEKA 4QYWA 3LPCA 1N5IA 3AHFA 3ZXYA 1YR3A 3DUFB 3EC2A 2BMWA 3VHQA 3IKJA 4X63A 3WQRA 5HHTA 4RNDB 2C99A 2ZB2A 1T4MA 2OQVA 3OO0A 1FTSA 1N7JA 1V2HE 5E7MA 4OHVA 3FWNA 5EFOA 1Y9AA 4MIKA 1XL0A 1GNSA 2NU9A 4PQFA 4OMDA 3BH0A 1GZ5A 5B4UA 1F8GA 3H83A 3DDWA 2A9JA 3IA2A 4CGZA 4PPQA 2J45A 4PFSA 4ENQA 3RHFA 4UJ5A 5GV8A 3SKVA 2AR7A 3EARA 1ADYA 1ORIA 2VTDA 4C7BA 4IJ5A 1EGQA 1W35A 1RXUA 4JP3A 3SGLA 1ZK1A 3W5IA 4BNJA 3W8EA 1U2GA 5KTMA 4MLZA 1EZ4A 2R7MA 3H9JA 3D7SA 3NAQA 3GJQA 4TRJA 4L3OA 4B6FA 1Y6RA 2Q3JA 5JDIA 2POCA 3NOOA 4JLUA 5DTQA 1A9XA 3PGVA 3OQ1A 3K6KA 3T61A 1JR3A 5LZ8A 4P4SB 1U4SA 3W05A 3L7CA 2Z3VA 5CA1B 2GTHA 4XTRA 1E18A 1GKYA 3ER8A 4J16C 4DMHA 4EDFA 3FDIA 1WV0A 2F64A 1L5MA 2RH8A 1GPH1 3DBIA 1LLUA 3LQFA 2Q0XA 3JAKB 3UWKA 5JO0A 4L9SA 1U7UA 1KS9A 2N3ZA 4RD6A 3V2GA 3N5CA 3NTOA 3UPTA 1EX7A 2ORVA 1GU0A 3TQIA 3RVRA 3UK7A 2PQMA 3FF4A 3G2KA 4TLBA 4Q7EA 2PLAA 4YPOA 1W85B 1CULC 3TQOA 4KIWA 3SF0A 3VU0A 1RAFA 2OV3A 3P5BA 2YR0A 4HSGA 4NHOA 2EP7A 2PSHA 2SCUB 3VBEA 4R7GA 5A6SA 4TS1A 1YRYE 3QUTA 3M34A 3S2IA 3OEWA 2AFIB 2Z04A 4ONEA 4ZJYA 2X19A 4HFMA 3DH0A 1SWWA 3F90A 1W5BA 2WYOA 3DWIA 5TRTA 4ZI3A 2CY0A 4LC9A 2YMQA 4CF5A 3MXTA 3I09A 3P4UA 3KYIB 2DY0A 4UZFA 5ALOA 4TVOA 4DIDA 1L8OA 1XZNA 1KEVA 1PHRA 1F4VA 1TNDA 5CJ2A 5GPBA 1E62A 4U00A 3FZNA 1MORA 1QRSA 1R8JA 3AR4A 2XBUA 2X8WA 4DLNA 3MCWA 1ECGA 1YI1A 2PYDA 3A7DA 1GDTA 4UXJA 3NFYA 5ISMA 3LQKA 3GG9A 1H8ED 2EYUA 4V0LA 1KETA 2O6HA 2DECA 4OBXA 1A98A 1TIBA 2WINI 1V8BA 3GIDA 4G9GA 1YHYA 4RVHA 4MLCA 1RYNA 4LE1A 4IFBA 5KYGA 4EQZA 4PR3A 4OH1A 2OXFA 1T1IA 3D6VA 4CL0A 1U6KA 1T0IA 2JVIA 1ZOIA 4GKAA 1PZGA 1IXZA 4C89A 1LPOA 4FHCA 2NYRA 4W4TA 5AK5A 3JD3A 2BEUB 3L2OB 3OQPA 2C4KA 4GOXA 4RZIA 3WKAA 3OICA 1DDOA 2I76A 4K2AA 1QONA 3NETA 3B1VA 2WABA 4R9NA 1VI2A 3FHTA 3F7OA 5LCXA 1TB4A 1G7RA 3HKDB 4U39A 3ZCTA 2FJ0A 4MAFA 1VTKA 4MRMB 9LDTA 3FWPA 3IPLA 4DMRA 4P36A 1NAHA 2O3TA 3D6UA 3MPUA 3IMEA 4CMHA 2ODAA 4LDNA 5EIBD 3CJQA 2QJFA 3IAXA 4BLWA 2NXEA 1MA3A 4BN0A 2EDCA 5I5GA 4ILEA 3GI1A 1EVEA 2IA5A 1SHKA 3K1AB 3QKTA 5HCIA 2EZ4A 3DV0A 4MUMA 5KI6A 4HGOA 1JEYB 4HEA6 5TEVA 1Z3CA 4MUXA 1U8XX 3I2IA 1VL6A 4WLOA 4HRVA 4V1CA 3HLTA 2X7XA 4DUGD 2ZYDA 5ALWA 3O9ZA 4EH1A 2HHHB 2FPGB 4BVFA 4PCAA 3UOGA 4EJSC 2L0XA 3PR3A 4ZRMA 4R8MA 4OJYA 5B4VA 1ONOA 5MN6A 4LVCA 5J40A 2BFDB 3PDJA 2OCXA 1SOWA 3G13A 4I4LA 1L4EA 3CZMA 1PL0A 3BMNA 2ZI6A 2GPSA 3AVXA 2X0IA 1DPGA 2V7GA 5G0VA 1EE1A 1P7YA 1JLHA 2BBWA 3JXEA 3LW8A 3B13B 4O4JA 4F9GA 1DAEA 1TKCA 3ZTYA 1MXFA 4S1TA 2O2HA 4LYAA 3PYMA 3WB2A 5CH8A 4IEEA 3DDOA 3T1OA 5AHKA 3VKVA 4P0QB 1OR8A 3KZCA 4Q1FA 1VBNA 2EW1A 1WXQA 2DLDA 2YWCA 3KE9A 2NQ8A 4HAZA 3OH8A 3RGGA 2Q0QA 2XXJA 4UCWA 1G38A 4EZBA 1FOEB 5DXFA 2YJ5A 3I2FA 3EBLA 2Q50A 3CEAA 1KKUA 1E9EA 3NHKA 1Y7HA 4CKEA 2I4IA 4B76A 1FS4A 1UM8A 1VIAA 3AFGA 3OPMA 5CLLA 5FFFA 3FJ1A 3WAGA 3ND6A 4EB8A 3I92A 5C0OE 3P9IA 3LECA 4OYLA 1H2HA 1Z29A 2R7AA 4N5NA 4BX9A 3L8DA 3O8OB 3EPHA 4ER5A 4OA8A 5H4GA 5K4AA 2JAWA 3DXYA 3KX2A 4HAYA 5E7JA 1AA9A 3MMSA 2R48A 1WWKA 4NBVA 4ZYYA 3CMCO 4J76A 4R8RA 4TZ0A 1D4ZA 3GYGA 1JJIA 5JMPA 3HUTA 3B53X 4AJ9A 1W75A 2X42A 3PEEA 4HVTA 1M6WA 4N40A 3SSAA 3UIEA 3RTAA 5ER9A 2WTXA 1XVUA 3OCWA 4HUQA 2HRBA 1KZ9A 3N76A 1SXJE 1PUJA 5F4ZA 3TZEA 5GZ1A 3S2GA 1CZRA 1I6MA 3USCS 1GUYA 4ISCA 1UBJS 3ZV6A 4BASA 4XEUA 2QTNA 1U0RA 2IKSA 3TSCA 1N0IA 2HXSA 4NIMA 4GBMA 1N8TA 4BBPA 2VT6A 3R3SA 3NHJA 2DMRA 3W4JA 2W2LD 4I4TA 3DAOA 2WSLA 3CE6A 4OIFA 5DWVA 4F97A 2QNIA 3ND7A 3ZWPA 2LUOA 3D3EA 4HDMA 3QKSB 4P31A 4JGBA 3DAFA 4R54A 3UH0A 4B85A 4DYDA 2C7PA 1LI5A 2XZLA 4F5YA 1USGA 2O3UA 1F8FA 1JLLA 2JD0A 2TRSB 4GGOA 5CT8A 3LT0A 1W581 4Z3OA 3DWFA 3HBAA 1F0NA 1CEYA 3TMAA 2B0CA 1Z26A 1FTGA 4JUFA 1E6KA 2HDOA 4OUKX 4XIYA 3H4MA 3DGEC 4MV7A 3TRHA 5J4YA 4FWTA 2QYHA 4LXYA 4NEHB 2HL6A 4XTCS 3URKA 1OU0A 1HY3A 1VPWA 3JPWA 3MT0A 4S35A 4MKFA 1N4DA 1L5WA 3COJA 2H4FA 1EP9A 3IO5A 3CF4G 1V8OA 3G88A 3DR5A 4YLGA 2R1ZA 5EQTA 2XKKA 1Z6GA 5K2OA 4HGRA 5B7PA 3KJNA 3WMFA 1MTZA 3ONWA 2D5IA 3DV9A 2Y05A 3FG9A 4PCVA 2WTNA 3V00A 4XQCA 5BV1A 2H08A 2HWKA 2QRUA 1XQ6A 1FX0B 4OXQA 2QZSA 4Q16A 1D1TA 4XGKA 5JAMA 2TS1A 2W43A 4LYEA 3PC6A 1DC3A 4AMYA 2NP6A 3ZVRA 3GA0A 1F2UB 3OFNA 4GL2A 2Z30A 3QE3A 1WDLA 2P9BA 1E1CA 1P8JA 1UZNA 1O97D 2D7JA 3BSYA 3LBYA 3QVWA 4AMVA 2GRUA 2Y71A 4UDNA 2PH1A 2WWTA 4Y2QA 5A9RA 3VTKA 5I8WA 2E4XA 3GFFA 3K16A 1TVKA 1UJ2A 2KX7A 2AHOA 3BFKA 3HSKA 1LC3A 4GWGA 1Z56C 1TCBA 2NVBA 4KQFA 4URUR 1K4KA 4JLMA 5E3HA 5J47A 1D1SA 3U7QB 1XALA 1AGNA 1FFGA 4OHRA 4P9NA 2CNDA 3MWEA 2ZR0A 3HJCA 4C3ZA 2RHRA 4Z0HO 4ETMA 3YASA 4MVJG 4CETA 5LWQA 1ORTA 2FY8A 3DCYA 1X7ZA 2OM6A 3Q9UA 4HDRB 4HJRA 2JJ2A 4IFEA 5HQJA 1RXCA 4OB7A 4PZCA 5FTMA 5C37A 1D0SA 1TIKA 2QX7A 4M9ZA 3ILSA 3CWCA 4OHFA 4MPDA 2UZ1A 1PTJA 5CDYA 5LIRA 1LS6A 1CJUC 2GCGA 3CIOA 3HXQA 1CQIB 4XIGS 1HT1E 2Z3ZA 4LY3A 3D54D 4OP2A 3JVUA 3LV8A 2J5XA 3DF7A 4YWHA 4WERA 5IZ4A 1HRKA 4MUEA 1W5SA 5CG2A 2XIQA 5DWQA 5KU1A 2X15A 3HDTA 4L2IA 1D0VA 2HIGA 1Z28A 2HZ7A 5EWJB 1U1DA 2XCUA 2CWWA 1HETA 1VOTA 3SWWA 1KI1A 5LA6A 1SU8A 4AURA 2F1OA 1JRLA 2EIXA 3PQ2A 3TQSA 5LQRA 5DNVA 2BH2A 3UJPA 4J0EA 3N86A 5EVCA 3WQHA 2XODA 4XM2A 3EXEB 4Z2YA 3VAZA 4OHWA 2XRYA 3B5EA 3BXOA 3DQZA 3SDZA 2KLBA 4JVNA 1L3BA 5KO2A 5C18A 3CISA 5KCZA 2PZGA 1UEIA 2XMSA 4H7KA 1E4VA 3PSAA 5LP6B 1EVIA 1D4FA 1VIDA 3RJZA 1BFUA 1QJ4A 4NU8X 2FZVA 3BRWD 1I3KA 1COWD 3LW7A 4K9SA 1RMYA 3ESYA 2BFCA 2ST1A 4WSOA 3NVMB 2AF4C 5JADA 4ZTUB 5CIQA 2EJBA 3R7DA 3ZDQA 2B0JA 4FBMA 5IUKC 2GGSA 3OZTA 4ZT2A 1Y37A 5LR6A 2XE8A 5LLDA 1N92A 4RF3A 5J2TF 2IOQA 1HL3A 3KAQA 4LTMA 3E1GA 4UMVA 3TX2A 4E09A 2ID7A 4TTSA 3KEOA 1RWNA 2A9QA 1X7HA 4CIAA 1NHGA 5I51A 1NASA 2FG7C 2XB9A 3HI6A 1G4UR 2AOTA 4M4SA 4ZCRA 3RFFA 4E5KA 2NXNA 1Y3CE 3G1WA 4RVCA 1WMEA 4DR5B 5BVHA 1U1GA 3GT4A 3I6ZA 2ACEA 3TL6A 3QU9A 5L4SA 1J0DA 1SBCA 4AQDA 3K9LA 3X1ZA 1F48A 4QVKA 4XLTA 1JQJC 2V4UA 3GUZA 3DKVA 3G9UA 1U2SA 1E92A 1M72A 5B1IA 2LXNA 3KXKA 1TCAA 4ND6A 4K87A 4RPGA 2NZWA 4DVJA 2D5BA 2C58A 2X1LA 2ZOSA 1TTQB 5EQDA 3Q0IA 3A11A 5AKZA 1NP3A 3W1WA 3PGJA 3UJDA 4YV7A 3TJRA 3I4CA 2VSNA 4R2LA 2XECA 2Y0PA 1G2PA 2XUZA 1VZ3A 3AILA 2D54A 4PEVA 4A9AA 4DLSA 2GCPA 1D0IA 3ED5A 5B6JA 1OXXK 1TT7A 4J7UA 4P4LA 2B83A 4PSKA 3VHXA 3TK1A 3NBZC 4BFWA 5KJ6A 2GMWA 2XVZA 4DA8A 4II7A 4RM3A 1KF0A 4JMPA 2BF7A 1P5ZB 1R10A 2AFHE 1QGDA 3VC3A 2D0DA 1XCBA 2OBMA 2QUHA 3GUUA 3MELA 3CRVA 3PC7A 3QA9A 4FPXA 4DREA 2G1PA 4S2UA 1CP2A 1J23A 2GD2A 3VNBA 1VL2A 3AJ9A 2E1RA 1QBGA 2VP0A 4UQLA 5A4MS 2QRNA 4JYBA 4ZZ1A 1UM9B 2CVHA 5HQ3A 4YT5A 2W2OA 4G1MB 1BWPA 1OGYA 2Y4NA 4XEHA 3KLMX 4UU0A 5TSDA 3C3XA 4PW0A 2EBHX 4QG7A 3W5CA 1QGED 2XUGA 3OOSA 1C2YA 2AOWA 2EV9A 2I9PA 3DTNA 3R7FA 3M9LA 5IPFA 3OM9A 3WYEA 1N6OA 2EX4A 4MWCA 2DHRA 5J2TB 3N70A 2W2PA 3LYUA 4ZVKA 3GXBA 5GMOA 3WAJA 1Z9BA 2JFHA 3VNAA 1T5IA 3M49A 4F1JA 1VBFA 3H16A 3D7RA 4DMUB 1JEDA 2QN8A 2PFGA 2Q4BA 3LLCA 2FN8A 3RKRA 5K5EA 2BD0A 5K6AA 1OBCA 5GOTA 3TSWA 3RC8A 3DYIA 4K6OA 1XHFA 5EKSA 1RM3A 5DOZA 1VLMA 4X7MA 3D02A 1DJLA 1YAHA 4IUDS 5C3UA 3FRHA 3K1YA 4JI3B 3UUWA 3D8NA 3P9QA 3R9XB 4EMTA 1JIQA 2V7QA 3IT0A 2IY7A 3DMDA 3MNFA 4LUCA 4NJMA 4XUDA 1VDZA 3KYBA 3TBFA 4E30A 4UM9B 3RQIA 3HGTA 1KO4A 4KE8A 4KH1A 4YP5A 1HK7A 1WVMA 4FFOA 3ZBPA 4EITA 3MLBA 3S2EA 1FLNA 4X61A 5EYPB 3VO2A 4PBRA 2C2MA 2PUGA 3AEXA 3DMRA 1V7CA 1LRKA 1XTTA 2UZAA 2YZMA 5EUMA 4IDOA 3CLSC 1OA0A 4K2HA 4BX8A 1UP7A 3L04A 4P22A 4F3YA 2BSAA 1UT6A 1G7CA 2W2QA 3G0OA 1G5IA 1QFJA 4I4CA 4JXXA 1DUIA 3D4PA 1DEAA 3UJHA 2ZJZA 5IJXA 5HUQA 2RGBA 1PG5A 2XZOA 2F00A 4RHFA 2XYGA 4X62B 2YV3A 2ZM5A 1ZN9A 3WWCA 4I5IA 3E7XA 2IEIA 3QSYA 1E3EA 1ODJA 5CPBA 3BFXA 2ZJ4A 5BPHA 3A58B 1OBFO 2UDPA 2BGRA 3IUBA 1EHCA 3LT1A 4BUJA 2RH9B 2GYYA 1Z0IA 2ALJA 4ALIA 2JB9A 4V2IA 2VSOA 4U2DA 5IK2A 1K88A 2Z4SA 3WLLA 4XWYA 2DSTA 2HV8A 3DO6A 2CVFA 4ENTA 3JATA 3C43A 3T4EA 2MR6A 4PAMA 1JFFB 4QFBA 2MHCA 4IIVA 2J46A 3FNGA 4RPHA 5FR1A 4FONA 1BRMA 3F7MA 4QGHA 5KX5A 1AH2A 1NJSA 2JFNA 1CQXA 4D3SA 3Q7PA 1R1DA 3RRBA 1JXOA 2B4YA 4GZ5A 1XCLA 2G09A 2PDAA 5A9SB 5D00A 3K09C 1U2DA 2ZTLA 3IE2A 4LJ5A 3LWDA 2OMEA 4GYYA 1K6JA 5AM0A 5L3SB 2C4NA 1XHLA 1W2GA 3EUWA 1JXAA 2F3TA 4NCXA 1QV6A 2WT9A 5KSPA 2BMVA 4ZVOA 5JRDS 1KZGB 2RI1A 1Z47A 2X41A 3PV0A 2ZE8A 1JB1A 2WF6A 4L7QA 2DEUA 2O7VA 3J80A 4RIIA 4RYDA 5E6SB 2R751 2D00A 2ZPTX 1CY0A 4O2AA 2FE1A 2BP7A 4DLKA 4RTOA 2XGSA 3VXKA 3E4DA 2JIZA 4FHZA 4OMFG 3V1YA 2WTMA 2P3SA 5C5DA 2JGJA 4GICA 1NLYA 1Y5MA 1ND5A 3IXQA 3H99A 3BM5A 4OF4A 4DC0A 1MTOA 2FN9A 3BORA 1MU0A 1TK9A 2H18A 3H8SA 1CUYA 4EHFA 5T7BA 1TEXA 4S0ZA 1M0WA 3C8HA 4J03A 2JDID 4RWZA 3C4QA 4XB1A 4DY6A 1JNYA 2BKVA 1NQXA 2Q6TA 1IBRA 1KI7A 1BO6A 1QG2A 3PRHA 4HH3C 2Z8XA 1ADFA 2Z5GA 1H6BA 1S8FA 1FU8A 2CYAA 4HPJB 2Y1KA 3VTZA 2VHCA 4QECA 5EUQB 4BO2A 5HGXA 3RSFA 1J1UA 1SCUB 2Q1XA 2RC6A 5SYMA 3AW9A 5D1HA 2UAGA 4KBFA 2GX6A 1YTUA 4DKXA 4FFBA 2C5BA 4IINA 4EVQA 1ZZEA 2QE7D 3GVCA 5E2IA 5EJMA 2GA8A 3R0ZA 4BV8A 4HNUA 3UBTA 2D2XA 4OO3A 3T9FA 5EWMB 4XQ0A 4Q18A 1ZIOA 2B8JA 2C9DA 1SH7A 5T4BA 3TZBA 3NBYC 3PPIA 1MJHA 2PEYA 5TDHA 2PWAA 1R9NA 4TXMA 2NYAA 3PGA1 3RSSA 2BUAA 3OOYA 4BMPB 1I30A 4WN9B 2DFVA 2OV6A 5HRUA 3LL7A 2PZFA 1KVQA 2FEAA 3N0WA 4XJSA 1WZUA 1AKTA 4NSNA 5HGJA 1E9RA 2QL5A 1E3MA 2ZE6A 1B8NA 1ONBA 1PP4A 1GWNA 3EIQA 1F3OA 1RYYA 3DXXA 1OXUA 1X38A 3PR1A 4Y6SA 2EKPA 1F2TB 1NVMB 3W6ZA 4LXTA 4MDFA 2DUMA 1DTWA 3FAZA 4R3NA 3UAXA 3SSOA 3PIIA 2HSWA 4AW9A 4FK8A 4M7RA 3NBAA 3NVDA 3R9KA 2NZ2A 1CYEA 3HXTA 3SFVA 4Y9UA 2CGEA 3DM9B 3GCZA 1FSFA 4B3MB 2PM8A 3CSDA 4HFJA 4REQA 3ROGA 3VHLB 2OGUA 4BAZA 3VRHA 2JVJA 4JKIA 1X7YB 4DB4A 3DMPA 2HRQA 3K9GA 4UUQA 2PGOA 2XSZD 3PQ8A 3MD0A 3VZDA 5M34A 1KGSA 2PE5A 1VM6A 2ZBUA 3S44A 3PS9A 4PZEA 3GY0A 5FBQB 3R3HA 2JZCA 2XH8A 2P4SA 3AI7A 1M2HA 4AX8A 4F2PA 2F4NA 4A03A 4B3JA 1PGQA 1PU2A 4BU1A 4BNGA 4AJIA 4BVLA 1UKBA 3DAGA 2HTFA 3IULA 5ABPA 4YDRA 3E5MA 1UCFA 4EHNA 4HDCA 5IT0A 2PZEA 2QT9A 1JIJA 5HDQA 2XE4A 2PUWA 3Q12A 1Z82A 3PF9A 4OJTA 1DTEA 1SB9A 3F8TA 2W6JA 1E5QA 2NO9A 3GFQA 4UPVA 1XNGA 5I9LA 2BFFB 2FSSA 1XTRA 3BS4A 4U2FA 5F1YA 3W8NA 5AVTA 3OPNA 1L3IA 1XMIA 5G4KB 3WWOA 2I3ZA 3CRRA 2OHXA 4FIZA 1X0XA 2R4UA 2EOAA 1LBQA 2OBXA 3E0QA 1T4CA 2J0SA 1II8A 1JEOA 4HN4B 2WJWA 1RLIA 1IQRA 1EEXB 1HLFA 2WWVD 4G4SP 4YTEA 2V7XA 3E8SA 3A3PA 1JWBB 4JODA 4Z9YA 4M1YA 4QWWA 3W5DA 1T34A 1A88A 4OMUA 5CH3A 3ABIA 3MCTA 4QDUA 5F5LA 3GV0A 2WU4A 1NVVQ 4RHYA 4D81A 2FWJA 3V32A 3EDRA 1PW5A 5HS6A 5ALFA 4W5NA 1P2VA 2EJTA 4BAUA 1A8SA 3KG2A 4JLNA 3I5XA 4P4TA 4GYJA 1AZSC 4PCLA 5CT5A 2ZSDA 1HH4A 1BE6A 4Y2TA 1UXHA 1E1YA 1N1MA 1R4ZA 2PFSA 3A4LA 2CV1A 2MSNA 3NASA 1JFVA 4X60A 3W7AA 1ZL2A 4IVPA 2VSXA 4AF6A 4UAUA 1P4HA 4XUEA 3RAGA 3N1UA 3PXGA 2BHSA 4UOZA 1VECA 2IDZA 2ODNA 1V16A 5JS2A 2LWIA 3R74A 2D4HA 3KPUA 3K70D 3VR4D 1YBHA 5IDYA 2P91A 2ZUEA 1KYWA 2O1XA 2WF9A 1CQJA 4CM1A 3VTFA 1M1YE 2FEOA 1PBTA 2ZRCA 2IEBA 1U8TA 2DAPA 3H2BA 4RL4A 4EYSA 2Z5VA 4IQ0A 2YOFA 4RS4A 1DX9A 3PENA 2BHLA 4UEJA 3SF8B 4BO0A 1QG4A 2CLMB 1LBTA 2IP4A 3B6KA 2XYRA 2GERA 3L1KA 1ZNWA 3A1VA 4BWFB 3DEIA 1C29B 1XJ5A 4WTOA 5HKOA 3BUSA 2P1DA 1UADA 1VE3A 3NYRA 3UOAB 3WNZA 1FTNA 1KQOA 1P6UA 1MJGM 2GDJA 3HBNA 3PHBE 4LCBA 3EZFA 5A3VA 1KK0A 1KQ3A 1EA5A 4QQRA 2Q0SA 3DDCA 3WFZA 1HDGO 2NVWA 1P72A 1V43A 3A14A 1ZKDA 5JJLA 1WQ4A 4ME6A 1IN4A 3L8CA 4JP8A 1U8ZA 3DNFA 3TQQA 5E6RA 1I14A 3PNMA 3CB4A 2WNSA 1YCDA 4BBAA 4J2TA 4BCCA 2FH5B 3F67A 4MRNA 3GF4A 4Q66C 2B92A 2VH2A 3OEHD 1KNXA 1QGYA 2AL7A 3DFKA 3T7JA 4HH0A 2P7HA 3EW9A 2ZWVA 2IY8A 3ZIAD 3NAMA 1YVDA 1LBHA 4MQ5A 3M3DA 1E4OA 5EJ2A 1XFAA 2WVGA 3RQSA 1FL9A 4DE5A 1TM1E 2VJMA 2WYVA 1FP4A 4AKTA 4FYMA 2GCNA 5FLYA 5EESA 2Q7DA 5I48A 4DR2B 1V1JA 1H6CA 1GN9A 3NBFA 4G4JA 2PA3A 3KHSA 2DCUA 1A71A 5AKJA 2PRZA 4GBGA 4BJHB 5BPFA 3KVRA 1ZD9A 4PANA 2BI8A 1SNYA 1P33A 4FZVA 4HN9A 5EHNA 1S3IA 1FQKA 4G97A 4PIVA 5HM8A 1QH8B 5ALMA 4C4XA 2WPDA 3MIZA 4JLKA 1ZN8A 3KK0A 4YMIA 4LWPA 2IOYA 3WXBA 4BMOB 4UHHA 5MN4A 3WHKA 5AD1A 2XE6A 3LE8A 4N9WA 1U3FA 2R5WA 4FGWA 2GPAA 3GD5A 1UFQA 5ED0A 4AWXA 1U9IC 1YJXA 2D1TA 3RTEA 4BX2A 2X76A 4RHXA 1R6XA 4ZVNA 3WIEA 2OCPA 4U0JA 4ARUA 2KS6A 3V8PA 1JWLA 4ZVRA 5KPJA 4GP7A 1KK1A 2B4AA 3GUVA 4PLHA 5DYIA 3EF0A 3UWPA 3VR5D 2H7CA 3IQWA 4FS3A 3V8MA 3KBBA 4PIMA 2Y66A 4DWOA 2JCVA 2BFNA 2HMTA 2O06A 1VE9A 2VWQA 1LU9A 2W2KB 3G7UA 2O54A 1ATIA 3ORYA 3M2PA 3FBWA 3KZKA 3T1QA 3PIDA 1G8GA 3S3TA 2IW3A 4K40A 4MHSA 1V8PA 5BSRA 3R2JA 1JFRA 1HEUA 1DRWA 2VSFA 3IJ5A 4R9UC 3GNQA 4F1WA 2J0UB 1SVNA 2YNMA 4KEAA 4D56A 1A9SA 4MICA 3OM1A 5L6LB 3PQ6A 3QI7A 4MYDA 1UBNA 3COPA 3R7AA 3W2GA 4B3IA 5DNUA 2XVAA 3WISA 3QX3A 1A69A 1IDN1 3A6FA 2VDMB 3B7GA 2B34A 3EGOA 3GCGA 1E8DA 1U1CA 3H6KA 4J1TC 1ZZGA 2QMOA 5HFJA 3HJGA 1OTYA 3C6KA 2GEKA 3N8IA 4FR0A 4LK2A 4OL0A 1K68A 3UOWA 3PVSA 1KR2A 4BO1A 4B43A 4ZQEA 4NZMA 4EJFA 1W5FA 4KIGA 4PR0A 4ZI7F 1FFXA 4JP1A 1Y6GA 3PD0A 4MPTA 3RFVA 2XADA 3AHDA 4F46A 5HWSA 2YYSA 3F6YA 3H0EA 3KZNA 3ONFA 4G25A 1CUAA 1N3BA 1QK5A 1SXJA 1WLSA 2OHVA 1UBMS 3I6YA 1RYMA 2JGRA 2EHJA 4JEHA 2GM4A 1Q12A 3DWEX 1YA4A 2PO5A 1WX1A 3GGJA 5EHZA 5DGCA 3ZXIA 3ZW8A 3UXMA 3KYDB 5AK4A 3O8RA 3X44A 6CHYA 5AW9A 4HQLA 2WIKA 2GD0A 3EZ2A 5CM9C 3E9DA 2GM3A 1U0GA 5F76A 4GEGA 3B85A 4C0SA 3ORHA 1XROA 4BO5A 3EVCA 3AF4A 5FQNA 2KJQA 2EYQA 3TPCA 1NXXA 1MJFA 5C5IA 3F78A 2A57A 2HHLA 1SKQA 2E2WA 3ANSA 5CLIA 3QOWA 1YVUA 5EZQA 1KDVA 3RM3A 2VR1A 4ZVLA 2WHQA 2ZXUA 4MS1B 1WPGA 4DDHA 2AZXA 5HUHA 4TT3A 4EI9A 4MMZB 2F9LA 1H4TA 2PXCA 4H3SA 2XRFA 4FFMA 4ZODA 1GIAA 3NTRA 4JLWA 5COAA 1K4YA 1V6CA 2MSCB 3ECCA 4IPTA 4ZMRA 4I0WB 3BVPA 1R15A 1KBZA 2AN9A 2J9XB 4FKMA 4ML3A 4P3PA 2P79A 2IXTA 4LKRA 5DF1A 3S99A 1KJQA 1UZUA 1FUUA 4BNZA 1TJPB 2EAUA 4K6CA 2XUAA 4ZHSA 1XNQB 1T8PA 4BGUA 1TM2A 3AJDA 4P3XA 1YQQA 3NHSA 1W47A 2OG2A 1E66A 2JRCA 1H0KA 2WDZA 3ACDA 3FPLA 3KJIA 3MMNA 4HMQA 4RC9A 2O8BA 4Y6PA 4DA6A 4TTTS 2Q9UA 3RS0A 5AHOA 3AF0A 2O1SA 3GPLA 3S29A 2I7CA 3FLBA 4LVOA 4PZLA 1QWOA 2IEAA 5DCWA 1CF2O 2IS1A 1NLUA 2P3LA 2REBA 3W5VA 4PG8A 3TE6A 1B6TA 1EDZA 2C1ZA 5K03A 5AI5A 4G36A 4IJMA 4FEEA 4HPXB 5CVJA 2QBYA 3SVTA 4LF9B 3D0KA 3HP1A 4MW2A 2BTQB 4IOKA 4FR2A 3B5IA 4U8HA 2FZ4A 4L8YA 5TS3A 1CERA 1PR9A 3OIGA 3R76A 3A3YA 3Q8MA 4R9SA 3GUHA 3ZW9A 2VK1A 5FJJA 4QM7A 3QLVA 1GTSA 1KEZA 4YMHA 3MG9A 1EX1A 1PS0A 3QJYA 3PUJA 3NIGB 4UMFA 4E7PA 3FOZA 4KRGA 1JR3D 5CDUA 4Q34A 3SIRA 5I7RA 2VAVA 5IF9A 5AI9A 4K9PA 2P5UA 3DEFA 3ZDZB 4PHFA 4V38A 4EI7A 5DEOA 1XRMA 3BDVA 2G4VA 3WL4A 3RVBA 3MWFA 2AN5A 4RCYA 3HV0A 4PFQA 4OPMA 4B74A 2O8EB 1CB7A 4CR8A 1QGUA 1TAGA 3KUDA 5D5HA 4TMVA 1IN8A 3DE7X 1NC1A 4TXNA 5AVVA 3C41J 2E4VA 3R9WA 3LSYA 4R0VA 3JQGB 4RO0A 5IYZB 2YJ3A 1FP1D 1N33B 4E5VA 1O9GA 4MQUA 2A84A 1ZH8A 1N2EA 2WU1A 1C7FA 4AKGA 1QCCA 4H16A 1Y8QB 3J7TA 4MITA 3U19A 2ZT6A 3Q5DA 4M88A 4KI0A 4ZOBA 4YAEA 1XLUA 1UJ6A 2D1RA 3TWOA 4EABA 1GADO 2JFYA 3K35A 4PV7A 1NF2A 3CQ9A 3GRCA 4RV5A 2C04A 2DSNA 1KY3A 3R5KA 1ZSVA 5IHXA 5JVDF 5K8CA 3RC7A 1PX0A 2JHCA 2WJIA 1TDJA 3WZMA 1I3NA 1X14A 3H0CA 4FC7A 4BNLA 5KC9A 3I62A 3RB8A 3QUSA 1DBPA 1SCQA 1V1RA 2VPXA 5ESXA 4CPDA 4H7JA 1DU4A 4C0XA 1YZHA 3KSDO 3JW8A 3EG9A 3MTGA 4EY8A 1KXJA 3TB6A 1GU1A 4BFLA 4PLZA 5CU7A 2NUPB 3JWHA 4LEIA 5AJZA 1W49A 3T3DA 3CZCA 5E6UB 2AXEA 5KPDA 1RAIA 3V4RA 2G9VA 1BOFA 3CF0A 1OREA 1SUWA 3KTOA 1W4CA 3M5DA 3PHLA 4OLJA 5K3BA 1Y9EA 5C4GB 3PX7A 4ARZB 2CFIA 1SM4A 5L3QB 1U7DA 4YRSA 3CMMA 3OEEA 4MVJD 1RJ9B 2SECE 5TT1A 4N0QA 4EJMA 3G0DA 2F3RA 1Q19A 5M7EA 2OEPA 1TK3A 1LC0A 3KKNA 1A27A 3U13A 1DQRA 1MV8A 1XA4A 1KO7A 3T3IA 1KOGA 1Z6XA 1YMVA 4EYKA 1J0AA 3BB4A 3U4IA 3RV4A 1D6SA 3C87A 2IYOA 4G85A 1QJCA 4RK0A 4A0QA 4L0QA 4XYLA 1P1BA 1ZD3A 3G2IA 4GLJA 2O2ZA 3G0IA 3K2BA 2RGNC 2CXRA 4AS2A 4HUTA 2C1EA 3ZE1B 1SKYB 3KR2A 1BE0A 1SUPA 1QV7A 3DZ8A 4XB6B 2XA1A 4JIMA 4CF6A 3IIEA 1PN3A 4JWTA 4OQQA 3NUZA 3FR7A 2DWCA 2CB0A 3OFSA 2MR5A 1N5JA 3WRVA 3FVWA 3AVTA 2QLLA 1VRVA 2ZRKA 3I8OA 1W96A 1V35A 2GSDA 4HXFB 2YMMA 3NC4A 3RVKA 4E5PA 4Z9FA 1O03A 4RANA 1O4WA 5D3KA 3B1FA 2Y1OA 4LNAA 1OI2A 1GO2A 1OXKB 3PTLA 3PXUA 2GLUA 2OBBA 2V7VA 2WG1A 4J6EA 4UXHA 3TRJA 3OTHA 2ZUSA 3A1SA 2Z43A 2OWEA 4F3RA 5AVZA 4BO6A 3GJ3A 4P3OA 3L9XA 1GYPA 4FNMA 1NXPA 2VP2A 1CV2A 1J4AA 1JH8A 4H6PA 4YWJA 1MFPA 1HURA 3BB3A 4P98A 3BXPA 1SU4A 4FLEA 3HRHA 3TRKA 1DVRA 1MHPA 4H08A 2CLLB 3IP3A 2NTVA 1EP1B 2O14A 2OENG 4TMFA 4BMXA 2H51A 1Y3IA 3GCDA 4V1CI 5AJVB 3RG2A 1QAQA 1L5QA 3G9XA 3ZQJA 1M2VA 2ROQA 4TYYA 2AFHA 4F4IA 4GM1A 3K0EA 5FNVF 3KQPA 3E3MA 3IHKA 2UZ0A 3OZAA 1BIFA 2OUIA 1ZEJA 1CJSA 1AURA 3L8HA 3HB4X 4U1RA 4XASA 3F46A 2IYSA 3K5IA 4ADSG 1QQ6A 3L5KA 5I45A 5CM8B 1N1GA 3I52A 4R9RA 1MR3F 4D92A 3EZXA 4FP9A 1AZTA 3C6QA 3ZE0B 5KYWA 5GIOE 4XFJA 4PVDA 4Q4JB 3WA7A 4QASA 5LMNB 2XYHA 1G20E 2EXXA 2AB0A 4O4LF 5I7UA 4XWWA 1R5JA 4DLTA 3H2SA 4WKBA 2ODPA 1YKGA 4JQZA 4HADA 5A9TA 3IAFA 4CTKA 3NWOA 3NAZA 5DP2A 1IHYA 1IONA 2G9QA 3VPAA 5A4JA 3EG5A 1QYDA 4PYMA 5I7SA 4DG9A 4MWOA 1ZH6A 1KP9A 1KPGA 2CHGA 2VT2A 2XF2A 3EDQA 2I6XA 1G2QA 3FPSA 4ZOCA 3L0DA 3EF3A 4GLLA 1G8FA 5EZ6B 3CS3A 1URPA 5CCXA 1ACLA 1JB9A 1NWHA 1KDPA 3TGWA 5BSVA 3WMEA 2P6OA 1NU8A 3B78A 3DLIA 2EATA 3RSGA 3URMA 3EVDA 2QSUA 4NU0A 2H00A 3TD6A 3K7EA 2ZKLA 1P81A 4MJ3A 4NWIA 1RNLA 3VI4B 5GJBA 3BRCA 3MQ4A 1PYDA 3NVKI 4ID9A 3PFWO 1YOVB 2F62A 2YRWA 3KL4A 4R1PA 2A58A 2O5EA 1KZ7B 1TAUA 2BYTA 4G8DA 1E2IA 1QORA 2PKQP 5ULLA 5TMDA 3OZIA 5HK9A 2XLBA 5A0TA 2ZLBA 2NXCA 1SZCA 4AJ4A 1PNRA 3GMIA 4Q9DA 1M34E 3KM0A 3FSJX 2WK1A 4BWGA 1A97A 1EM8B 4GW3A 4O4IA 3UAZA 1Z38A 2ZIUB 5JC1A 1S89A 1O5OA 4QYIA 4TTVA 4ENSA 2PKXA 5FNVB 3CU5A 5LMCA 4ETWA 4X1YB 2H1HA 5NULA 1Q7EA 1N9GA 4QAJA 5DMXA 1G17A 5DHTA 1IOZA 3OWOA 4QU9A 3UHPA 1OFUX 1SQ6A 1LQUA 1RP7A 1J21A 2QLTA 2JGNA 3KLPX 3MBOA 4GBJA 4NCJA 3CLVA 4WZ6A 4JT2A 5LZ9A 5FKJA 1W1WA 1ZOPA 3WJAA 2XWBF 3FGZA 4BX0A 1WQ1R 2NO0A 2AYYA 2WU3A 4WZBE 4B4KA 5A5GA 4O4LB 4AD8A 4AMUA 2ZUUA 1E0KA 3QJ5A 4P33A 5KYTA 2XUDA 4EOGA 4OGFA 2FVYA 2IZZA 1JR6A 2R84A 2WSBA 5JCJA 3OFND 4CNQA 1N3YA 4KQ6A 2IPAB 4H1UA 4D3XA 3SYTA 3GN2A 3PVCA 4B35A 2BJVA 4DY4A 5LQDA 4EB6A 1E0DA 1YGPA 4FYWA 5I7VA 3QFFA 3IDAA 5C8VA 2I66A 2C7BA 4RKRA 1Q0UA 2R8BA 3G8BA 3H1GA 3H5OA 5DBFA 1L7VC 3C3JA 4H18A 2GEFA 4JI8B 2Q1TA 1RYHA 5CMLA 2ODQA 4AF7A 1UBGA 5AVQA 4RTNA 1GHTA 1NXVA 1S3GA 2ETVA 4YJ2B 4P93A 2UUBB 1LEHA 4LNUB 3PPXA 1TFUA 2JGKA 2XKBA 1QR6A 4S24A 4Q9IA 2YRXA 1OFGA 5DNDA 3U39A 2JI8A 3JYHA 4X20B 3U81A 1ZDMA 3KCNA 1Y1LA 3KXIA 3CCFA 2JJ2D 3UA3A 4ARCA 1M2KA 2XPCA 3LPNA 4FQ7A 2JATA 1PGPA 2AXNA 2KBFA 3D6MA 4L3WA 1C3OA 5DIZA 5D01A 1PL7A 3T5GA 3HI4A 3UMJA 5CFLA 1BCSB 1M67A 3E9EA 4K9LA 2XIJA 2Q5JA 3L49A 3GBVA 2AF3C 2PMDA 4UFOA 5G1PA 1B8OA 3FVQA 3DL4A 4RTMA 2O5CA 7GPBA 2JHPA 1S3FA 3JD1A 4JJZA 4Q4CA 4OSPA 1ZCAA 4Q3LA 2BFBA 4EECA 1CUHA 2VF2A 5GIPE 2CXSA 3PHHA 5DTJA 4QQFA 2HA6A 3H5LA 1OFIA 3NWPA 4WRRA 1W4AA 4ZO8A 3HJUA 2Z2KA 1I4EB 5H0IA 3ZG6A 4BQPA 2D7CA 1R6VA 1D1PA 2XUQA 3GT3A 1GLGA 4IMPA 4LF5B 1WD7A 4V0OA 1VSTA 5LYJF 1XRNA 1I6LA 2V4ZA 3O38A 4KYUA 3AR5A 5FWXA 4JD5A 2WNIA 4G0QA 5K3OA 4XVHA 4CCWA 3PT9A 1GQOA 5CFQA 2AEEA 4OI2A 3TE7A 3TTYA 3AM5A 1SVSA 3B48A 4Q19A 3WLMA 3G9ZA 2PKYX 4A0FA 4L74A 5ITSA 4E5MA 3KETA 4HXEB 1V0JA 1V45E 3R3JA 3I6QA 4TKUA 4X97A 2H7YA 4CU5A 1P6QA 3LY5A 4DG5A 4PBTA 1AUOA 4WUTA 3VHRA 1XWWA 5FUQA 4GZMA 2WW8A 1KMHB 3X1DA 2TSYB 3EFHA 5IJ9A 4RDHA 4RPLA 1YDFA 3LDHA 4JITA 2GN6A 2FCAA 4YDHB 4YHHB 2Q28A 4UOEA 2NPIA 5K3FA 3O4GA 2QGNA 2JLZA 1AUQA 2RAFA 4GPEA 4JOQA 4I55F 1H22A 4UNPA 4X8HA 2V7UA 1JDZA 5WRFA 3K9WA 4HTFA 2OBYA 1QIJA 5CTJA 1QIHA 5AW7A 4TYQA 1BKSB 2HD4A 2BUCA 4KX5A 1OLXA 2DPHA 3W5HA 2OCAA 3NC1C 4D4IA 4NECA 2B78A 1K3TA 2WUWE 2ZB3A 3AV3A 1RRCA 1E3IA 1V48A 2R9VA 4ZOLA 5KNDA 5HUJA 3DMNA 1ZFNA 3A36A 4MYUA 4EA8A 3BGWA 3GLQA 2I7VA 1N7HA 1X19A 3Q7EA 1IXKA 3GO4A 5CA0F 2FR8C 4V3CA 3K8ZA 2V8OA 1NRXA 2QRMA 4K26A 3OCYA 4H1TA 4ZT3A 2W2TA 2BLNA 2YXLA 3LOUA 3LFUA 1NAIA 2REOA 3L9WA 3WK4A 2H5JA 4QDTA 3RVMA 1XQXA 3MB5A 2GHRA 3W8RA 3O2NA 1GILA 3SXUA 2FWIA 1O5IA 3EEYA 3PFCA 1Q92A 1YIAA 1NIJA 1YS9A 2QL7A 4PAOA 4ZI5A 5JATA 3DBRB 4CKCB 3E22A 3ZZTA 5BW6B 5LYJB 2BOVA 2QAGA 4G37A 1TX4B 4ZYVA 3ZCRA 1YR8A 2DBRA 2GVDC 3M70A 5B5SA 4HQFA 4MAMA 3SXPA 1N34B 2IYRA 1SJ9A 3QKRB 4EW2A 5M29A 2Z0MA 1Q14A 1G6Q1 4NJEA 3LY8A 3WE7A 1DX4A 3NPAA 1RRMA 5HXAA 1Z4KA 3DKPA 5K8UA 3CA8A 3RG8A 3W3AA 1E2GA 2IBTA 5ECGC 2VXBA 3B2QA 4B6GA 1WF3A 1KWGA 1NN0A 1W36D 3RBVA 5JH7F 2JCYA 3RSHA 2Z5FA 3A9VA 2Q7OE 4Y2GA 3A1WA 3OHMA 2WJAA 4L4ZA 2JD1A 3C5WP 4JDUA 3RUPA 2OV8A 2TMDA 3RIYA 3HU2A 3I04A 4HGQA 2QV7A 4PRKA 3T35A 3V8VA 2VHJA 1MIOB 3SMQA 2DWOA 4X90A 3LHFA 3DAYA 4TVSA 2JEZA 2LCIA 3G2PA 4R51A 2RGAA 3WYCA 3SE7A 5JJKA 1AMOA 2QYTA 2WZCA 4GPIB 2HY7A 2CUNA 2YQZA 1U5BB 2R11A 2P1ZA 4KMMA 4V24A 2VJDA 1JHRA 1E9FA 3HN7A 1C9MA 4RGQA 2ZSBA 3JWGA 5IBCA 2Q41A 4KNVA 3EVEA 4ILKA 2YIVX 2ZRAA 2HFKA 1OROA 2WPNA 4QVIA 3WGVA 2WD8A 1UK8A 3EA4A 5CA0B 4RACA 4DA4A 3H1FA 3TG8A 3WGKA 4YXWA 4UE3S 2YDXA 2FSUA 4J0KA 2HN9A 2BMAA 3D2AA 1JDNA 1MABA 1BD3A 1EBBA 2HLHA 2V7QD 5HTKA 2WY2D 1SBIA 3ROPA 4MW0A 3SYMA 3RFCA 1EZZA 1HEYA 1UMCA 3S27A 5BR7A 1LW6E 2A1TS 1ISGA 1UAAA 3TECE 1QUFA 4F8YA 2ZYVX 3NEJA 3ENQA 3HXPA 3REGA 3DT9A 1LW7A 2PKRA 2O50A 4RNCA 3T12A 1TJ4A 4M0FA 1F6BA 4JYAB 3LYAA 1I94B 2O8FA 3E8XA 1K8RA 1ZRNA 4PZYA 2IEGA 3VZPA 3EPJA 3KSBC 3DOIA 3IRVA 1JYFA 4NEGA 1EFAA 4MJXA 4BO4A 1X7WB 1U8UA 4D25A 1QTRA 3D6AA 4OJNA 3IR6A 3MT9A 1Z2NX 4UAJA 4YH1A 1N0WA 3PX3A 4JA0A 4M1OA 1ZOLA 4TWBA 5A4IS 1WW8A 2CKDA 2FPIA 3CEHA 3MAGA 4V0SA 2PMKA 1HYQA 1M0EA 2ISQA 1P0MA 1E6UA 2C0PA 2JIMA 3KD3A 2IWRA 1Z73A 4INPA 3PUHA 3TD9A 1Z0SA 4TM8A 4JUBA 3FCUB 3P96A 5IK2D 5JH7B 3DHNA 5F9FA 4RSMA 3ZN2A 2H1WA 2G82A 1IZZA 3A9WA 1KEEB 1EFRA 3OC0A 4RZQA 1HQDA 1CS4C 4B3SB 4HLQB 2Y68A 4FMCF 1XDUA 2QQ0A 4IYRA 4TMZA 4M83A 4XB2A 5EEHA 4ZZ2A 3RCBA 2IHNA 1AXEA 5CUQA 2A7QA 3PA6A 3OT1A 5HJEA 3ZJ4A 3PRJA 3JWIA 9ABPA 3CF6R 3U40A 3ZNOA 5L51A 3D2LA 2DT8A 1M5RA 3OJ0A 3S4YA 4B6EA 3HO1A 2ZS9A 1XAHA 4R31A 3ZD7A 3CNEA 4XQGA 3F3MA 2YHSA 3WBJA 1KRWA 2BISA 2W8BB 3T9EA 1EFPA 5HF5A 1XVIA 1T4BA 1DINA 2JFQA 3DE1X 5ALDA 4EYGA 3KWMA 3E58A 1QH9A 3CTPA 2IKQA 3OOJA 5JSHA 3R3WA 1RW4A 4YJ3F 5ESRA 2W71A 5K6RA 5K0LA 2RG1A 1E1RA 2C2XA 5JNWA 4E5NA 4QG3A 3C4VA 3LBIA 4F2HA 5BNWA 2OD7A 3OTWA 2JIZD 3WRYC 4TVKA 4L76A 3UPDA 4KQHA 4NHEA 2CDAA 4D8WA 4DIMA 2H92A 3EEFA 1Q16A 2GKGA 2ZI5A 5AJYA 4CKZA 1A5ZA 4QATA 1WB4A 1N3IA 4MB6A 4X64B 2ZXFA 1EFVB 1Z7BA 2GJSA 2IPXA 2VXOA 2VZ8A 4MKXA 1XD9A 1XJWA 2R1TB 1F60A 2OHIA 2VK8A 3AYXB 3DOOA 2ZULA 4JJ7A 4F5EA 1O0SA 1HV8A 3SJ7A 2EX1A 1PFVA 3DP9A 3L1JA 3LUHA 3Q7TA 4M9XA 1WKBA 5I9MA 4P08A 2VA9A 5TV2A 3PQ7A 5GZ6A 3VR4H 4F2GA 1T8SA 1TVCA 4Q12A 4Q03A 1FB5A 1L4UA 2GKSA 4RD3A 4ZTZB 2LP4Y 3DOHA 4BV2A 2MTBA 1W2HA 1Z6AA 4J8PA 3V5NA 3FPHA 3N7UA 1O1YA 2LZ0A 1BU5A 2VP4A 3IERA 4GE0A 3L7NA 1VSUA 1PKXA 5I8ZA 1CR0A 1LNZA 1NL3A 1D8AA 4YI5A 3GLHE 1OYOA 1FDTA 3FDZA 3ZWVA 1OHHD 2EZ9A 4JGIA 2GUWA 3MTDA 1C9JA 1A7KA 4DJ5X 2AX3A 4NS4A 4BRWA 4BPBA 1W59A 4YN3A 3K0FB 4YGXB 3P26A 1TZKA 5CYPA 1HRDA 4YDQA 1DAHA 1EB9A 2QZ9A 1MO4A 3U3JA 4YAFA 4HFNA 3RUHA 1A1SA 4DYVA 3GT7A 2X3FA 3II6X 4QO7A 1PL8A 5JD3A 3TD2A 4HQ6A 3PTAA 1FBTA 3FVVA 2PQ2A 2XI4A 4N3AA 1A9TA 4PINA 3BX1A 2BF4A 5DTIA 2CUTA 3HDHA 1ZXBA 4N47A 3MERA 1WBJB 4EY3A 1QH0A 4WECA 1NP7A 4BZPA 3H1TA 1MRNA 1VP3A 3UXEA 5LMZA 1ORHA 1RWVA 2P65A 4C3OB 1USKA 4CE6A 3K1ZA 1MB4A 1OC2A 2WHPA 5FWYA 5KMGB 2XDQB 3GAMA 1Q0SA 1A2KC 4L4XA 2XKAA 2AC7A 3AOEC 3LRPA 1NKTA 4M0MA 4RDIA 4YJ3B 2BGMA 4N0PA 5D6NA 1XYYA 1HFJA 1KO5A 4H77A 4WDRA 5FT9A 3U4AA 4XWAA 4V0ME 1KOLA 3KPYA 2FX5A 2PZAA 4JOSA 5BMVF 1LA2A 4NKRA 3WGYA 5BUCA 5TNXA 3U4HA 3N8NA 1M8FA 1O6GA 1OFUA 3IUMA 3HHPA 3SYLA 2VCEA 2QQGA 1V39A 3GWZA 4PTZA 5HP4A 2PK3A 4E11A 2B36A 2O05A 4B7AA 1WHTB 1P8AA 1YB5A 4CEJB 3RS8A 3SXJA 4ER3A 1W4RA 2FX3A 2TECE 2F55A 2HF9A 1RQPA 3LFHA 1NJ8A 3RVLA 3P2IA 1GLNA 1GU7A 1GTZA 2FQ1A 3H3JA 4HQOA 5K01A 4Q3BA 1X86B 5K3CA 3VR5H 1OWNA 4M1WA 5G40A 5IDXA 4JVLA 3S5JA 4YO8A 4G07A 4KITB 3UF0A 2VFAA 5A05A 1M2GA 4KRYA 2R8OA 3SYNA 1OD6A 1WMDA 1UJCA 3CRW1 2RDMA 4JLAA 4JJKA 5HCNA 4HP8A 1P1CA 5KTOA 4PG5A 5DM1A 3SIWA 4I1PA 3QW2A 3KJEA 4RDCA 1GZDA 4W7SA 4D0GA 3EN0A 1JUDA 2PQ6A 5LWHA 4E13A 1MDBA 2XCOA 3H75A 1VYVA 3FJOA 4WY5A 3ZZMA 1G98A 4BO3A 1FYWA 3L05A 4AZTA 3J81k 1H2BA 3G17A 2ZJ0A 4F3CA 4JBGA 1M2WA 2NQTA 2GEUA 2QNBA 2BMJA 3WRXA 5ADVA 5L7TA 2XB2A 1A2QA 1BAPA 1BN6A 4B17A 1ELOA 5BWCA 2CBXA 3FMGA 3HN2A 4QLAA 2YZGA 3N3BC 2HWXA 3TRFA 3QGMA 1Y33E 2VCHA 5K05A 3ML1A 1FXUA 2C5LA 2PBLA 1O08A 2ZRMA 3KDAA 3M6AA 3M4YA 3TZHA 3GDHA 4B3FX 2P2YA 2V6JA 5KHOC 421PA 3PQFA 2HMAA 5G53C 4E5YA 5JNRA 3QWHA 1NYQA 2GARA 2DPXA 1SUIA 1YZUA 3HXKA 4BDTA 5KKCA 4QJ4A 5TC4A 2WU8A 4D6XA 4M98A 2XE7A 4FLFA 4M0KA 3WDLA 2VP3A 4MUGA 1HDRA 4MWEA 2Z9CA 2Q0HA 4LV6A 4P7JA 1NXTA 2WUDA 3ZHCA 4QEZA 4AUMA 3UK6A 3L4JA 7MDHA 2I8CA 3CEPB 1KDRA 1GG9A 4JVOA 5BMVB 5D6OA 2WWHA 3NM5A 4PFJA 1Q57A 4XM1A 4KRFA 3T94A 1N3LA 4OK6A 1MC1A 1Z6ZA 2ZTMA 4V39A 2A1TR 4U4AA 1E9VA 5FPTA 1G8JA 3OHSX 3P0HA 1PI3A 4R0NA 1ZMOA 2HCRA 2DQZA 4G0OA 3INTA 3A1CA 3UMFA 1GKLA 2AG8A 2CMDA 3LBHA 4TQUS 3AONB 4B2PA 1TUBB 4MQFA 1COZA 1IIBA 2G72A 3DFUA 3PUYA 4JBNA 4ZU6X 4D46A 5SZHB 3PU6A 2PGAA 2ZU0C 5EP3A 3CUSA 4FYJA 3TB4A 4BL5A 1LVUA 4V0RA 1NMSA 1XQ9A 1DNPA 2BM9A 1CR4A 4CHTA 3ORQA 1Q0ZA 4OGKA 2AFVA 3N0VA 2FFHA 2ZQYA 4MKRA 4IRMA 2Z6QA 4U7FA 3LAWA 3WNQA 5GADl 2GN2A 4FT4A 3VPBA 2GVNA 4CMCA 4D3ZA 4ZZ3A 2UYOA 1NM5C 1V11A 5KTRA 2X3UA 4WCDA 3K70B 1MZPA 2CUZA 4TLEA 1AOXA 4GOLD 4DHEA 4CIWA 1Z35A 5ELMA 3OMXA 3L6DA 3JQQA 1BWRA 3CVYA 3AVUA 1O8CA 1PT6A 4D7AA 5JSZB 3VR6H 5JEDA 3UENA 4IZIA 2W0MA 1IY2A 1GL6A 3R1IA 5JSKA 1P9WA 4OX9Y 2XXAA 2NTYC 3F4KA 3NEAA 2GNAA 2OB2A 2Z5LA 3INNA 4LRXA 3TOSA 3E9MA 2O0LA 2WPDD 1NUPA 4RMIA 3FGPA 4PC7A 2VF7A 1IE3A 2H9IA 3DHWC 2ACVA 3DFFA 3AJEA 5FFMA 1Q15A 2OP0A 4RA9A 1GCOA 2Y1GA 2VJPA 4YIKA 2C7VA 4M89A 2ZJ6A 1OOEA 2VNIA 4BEBA 4G89A 5CB4A 5MFPA 2P35A 4C0LA 4PLWA 3VI3B 3WBFA 4JJAA 4KGDA 4X8OA 4MUKA 4DUYB 1MC4A 4TV9B 3RYFB 3WBBA 1K66A 2WQ7A 4LK3A 3SIXA 2ZR9A 4MV4A 1IYZA 1G20A 5T8KA 4PYJA 5ICGA 1AQYA 1NI4B 3LBNA 4R7TA 2RK6A 2COKA 1VXRA 1KFBB 2P40A 1AF4A 5KYXB 2FF5A 4DUZB 3HMQA 1LRLA 2QTVA 1YE8A 3GDWA 2XA2A 4LNHA 2AMJA 1ZVJA 4DEXA 2RONA 3KAJA 2B1RA 4F6RA 2GK4A 3AZPA 3ZLUA 1SVIA 3ABOB 2YNMD 2XTZA 4QXAA 1ZONA 3U7GA 4RMGA 2PKCA 2R7LA 4HSEA 1QLWA 4XLLA 4UQOA 1B3BA 1J49A 2FSPA 3WLNA 1VA4A 4F7DA 5HTOA 3W7BA 1Q1AA 3Q6NA 1BE8A 2FSHA 4AY5A 3PE4A 3EQZA 5AOBA 3WGJA 1R00A 3WRWA 4O2BB 3DTVA 1P6XA 2LGJA 4PAWA 5EJ4A 1D04A 3BXFA 3I6BA 2VBCA