3RIYA

Sirt5 is an nad-dependent protein lysine demalonylase and desuccinylase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
SFTARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase sirtuin-5
publication title Sirt5 is a NAD-dependent protein lysine demalonylase and desuccinylase
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3riyA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3riyA01
1YC2A 1T9DA 2H59A 2OD7A 4UU7A 3CLSD 3EY9A 1ZPDA 1Z8NA 3K35A 5AHKA 2WVGA 1O97D 1T9AA 5DGTA 2JI8A 4Y6QA 4K9OA 1NM5C 2AG0A 3GLUA 4JUCA 2UZ1A 1MA3A 4JUBA 5EJ9A 1OZGA 4L2IA 4FEGA 2QQFA 1YC5A 1U2DC 1Q17A 2FN3A 4UUBA 3FZNA 2PGNA 3PKIA 4TWIA 1M2NA 1YI1A 1BFDA 4COKA 1M2GA 1E3TA 3E9YA 1D4OA 1MCZA 4IAOA 4L3OA 1O96B 5EJAA 2JI7A 2IHVA 4I5IA 4JT9A 2V3WA 1M2JA 4K9PA 4RJIA 1YBHA 2IHTA 3CLTD 5D7NA 2VJYA 3HWX1 3ZG6A 2JLCA 2JI6A 1OZHA 5K2OA 1YTLA 2PGOA 4K9MA 2EZ4A 5IMSA 1SZDA 4K9QA 2W93A 5EJ4A 3CLRD 1YI0A 5FEMA 1PT9A 4RMGA 2VBIA 4IG9A 5DGDA 2B4YA 4GPEA 2IHUA 2OD2A 4Q9DA 1XLTC 2JLAA 3PDHA 1N0HA 3GLSA 2Q5OA 1T9BA 5FYQA 4FZ3A 2FRDC 4GM1A 2H4JA 2C31A 1S7GA 5K6TA 1POXA 5EJ6A 4RJKA 1M2KA 4JSRA 2Q5JA 1QPBA 3CF4G 5DEIA 1JSCA 1Y9DA 4C7BA 4UTRA 1S5PA 2EZ8A 1UPCA 4UUAA 4MPRA 3EYAA 4MQ5A 2EZUA 4BUZA 1UPAA 5MFPA 4FVTA 1PTJC 4MZXA 5EJ5A 1OZFA 2JIBA 4J1TC 4RMJA 4UU8A 1YHYA 5EJ8A 4BVBA 4V1CA 5EJMA 1V5EA 3D7KA 2HJHA 1UPBA 2EZ9A 2Q5QA 4X3OA 2FR8C 3EA4A 3HWWA 4GP9A 4ZP1A 2PANA 4JU9A 3IAEA 4KPUA 3U31A 4TWJA 4KGDA 1T9CA 2NXWA 4O8ZA 2FSVC 3JWPA 2DJIA 4F56A 2H4HA 4D5GA 4RMHA 4RJJA 4HD8A 3D81A 4UTNA 3CLUD 1SZCA 2QQGA 2A1UA 4BVEA 3RIYA 4JUAA 1Q1AA 2A1TR 1U2GC 3U3DA 1U28C 3GLRA 3PKJA 2H4FA 2Q5LA 5BWLA 1PYDA 3F6BX 5EJ7A 4MPPA 4UTXA 5MGNA 2Q29A 4BN5A 3LQ1A 1V5FA 4JUDX 4JD5A 2H2GA 4Y6LA 2H2FA 4MPJA 4Y6OA 4IF6A 1PNQA 4K9LA 2VK8A 2Q27A 3IAFA 1POWA 4BV3A 4BVHA 2VBGA 1PVDA 2UZ1B 4JT8A 3GLTA 4GM4A 1M2HA 1EFVA 1PI3A 5MF6A 1J8FA 2VK1A 3JR3A 3D4BA 5K6RA 1YHZA 2NYRA 4C78A 2EZTA 2H2HA 4BVGA 4V1CB 2X7JA 3FSJX 1EFPA 4JUFA 1Q14A 1PO7A 1V5GA 5K3SA 4GG1A 4FEEA 4V1CI 4HDAA 4R8MA 4RMIA 4UTZA 1HZZC 1Q6ZA 3ZGVA 4JU8A 5BWNA 5BWOA 4QQ8A 2OORC 4J16C 4F4UA 2VK4A 4QPZA 4K9KA 4X3PA 2WVHA 4GM0A 4G1CA 3OE1A 1YNOA 2BRUC 2VBFA 4BN4A 3F6EX 4UTVA 4K9NA 1DJLA 2H2IA 1PNOA 4BVFA 1OVMA 2JI9A 3FLMA 1ICIA 4D5EA 3ZGOA 2H2DA 4KXQA 2WVAA 4QELA 2Q28A 4ZZIA 3RIGA 1U31A 2OD9A 2FWNA 2OO5C 5MFZA 4BV2A 2AG1A
chains in the Genus database with same CATH superfamily
3W9BA 1MN6A 2ZQYA 2VFAA 1BCRA 2GK7A 1FEZA 3M5CA 1ML3A 3IT1A 3TOZA 1RTKA 4D9FA 5JRJA 3N74A 3AP1A 2V55B 2NMVA 4FOSA 2GFHA 1JSXA 3ZH2A 1X6VA 4DKXA 1I7NA 2CB0A 2GZ3A 4A26A 3LBAA 3QELA 4KXWA 4KDCA 2ZBVA 4EENA 5JXGA 1ZPDA 3ILXA 1KO4A 2UZ3A 3PFFA 1B2RA 3NU1A 1T0HB 4CXMA 1Z8NA 1LBSA 2RONA 1OV6A 4DA7A 1W5AA 2XNSA 4ENSA 1AY0A 4ZI2A 5CA0F 1V16A 3KJGA 3RCBA 3DZFA 2AF4C 1WQ4A 4PVDA 4TVSA 4MO2A 3MYYA 5K8TA 5GPBA 3KD3A 1X7XA 2JFYA 1HRDA 1UIRA 2OV8A 4DMGA 5KOJA 4Y2RA 5I3ZA 5BPFA 4S05A 1JLSA 1DV2A 3NUZA 4H3VA 1V4NA 4LNUB 2OBMA 4MA4A 4BV9A 1RMTA 1DIOB 4MA5A 1IQPA 4ZCQA 4AUMA 2AN3A 3FYUB 4GLJA 1Z5NA 3ZX5A 1R9JA 3SQOA 1UODA 4BJ3A 3S28A 2PJDA 4KOAA 1T6NA 4NMHA 5LYJA 4RVFA 5GWXA 5IKEA 2WAOA 2GUGA 5E7QA 2VHUA 1RI3A 4RC9A 5HDQA 3L43A 3NRCA 2DSTA 3W79A 3FYCA 4IDCA 4RHTA 3V00A 2NV6A 1USWA 4O02B 5BYAA 5FOXA 4RHUA 1OWMA 4YASA 3L3BA 3ZEIA 3IILA 4DXHA 1TLFA 1Y1SA 3GEGA 4NXMB 2I7XA 1L4HA 1NG9A 3IPYA 5DDIP 1XD2A 1ILWA 3OIGA 3U3JA 1E2GA 2WSIA 5JWRA 2JIDA 4QPCA 4HTFB 5EXTA 5F12A 1U5BA 4B17A 4G2TA 3S2EA 3DHWC 1XJ5A 2EBFX 3AZPA 1OREA 1BMFA 3TRIA 1QGDA 2D7JA 4OB6A 4BLVA 3WIBA 4DM4A 5E1BA 3A4TA 3RH0A 3SYRA 2XI4A 5B7QA 5C7LO 4KXMA 1ZK3A 4JT9A 1FUKA 2GR9A 3G2KA 2Q0SA 3OQPA 3HCWA 3OIFA 1P7WA 3DOEA 4MKHA 4M22A 2O9JA 4RHYA 3DLHA 4TVKA 1NXTA 2IHTA 3CLTD 3FHOA 4KLNA 5D7NA 4LJYA 4Z8YA 3V8RA 5JXWA 3D6AA 1L1EA 2DUNA 5EZYB 3ZS8A 2XDWA 4M9ZA 2R5NA 4NU5A 4RIHA 1W0JD 2IPNA 1Z74A 5HKBA 1JJ7A 2IV7A 3A9RA 2BKAA 4ZCLA 1GPJA 5EQDA 1EDZA 2JGMA 3ESXA 2WWXA 3GGPA 3LFUA 3UG7A 3U6KA 4K6MA 2JVJA 1G5PA 3BSSA 1JDJA 3LC2O 3JD2A 4PHGA 1IXRC 1MQSA 1E3JA 4XD2A 2X7XA 1YDEA 1N3BA 4J76A 2CXUA 3A6ZA 2RHRA 3FVRA 3IJ5A 2PV7A 3MMNA 5SZIA 4I81A 4YRGA 4BWVA 2VKQA 2YINC 3K1TA 2VC2B 1KY5A 5HZGA 4CEJA 1A7JA 4MB0A 2WUEA 4WNCA 1KYIA 2MIIA 1ZUHA 5CCEA 2K7FA 3VU9B 2OBBA 3FFAA 5DWDA 1MFPA 3FZEA 2Y1GA 1PT9A 1SVOA 1XNHA 3Q12A 2H1IA 3Q3HA 4L6AA 1A2QA 4R1TA 2YJGA 4G1UC 4JI3B 3GWZA 4BPRA 3TW6A 2ORYA 5JSZA 4CEHB 2WHQA 1LU9A 4WBXC 1YI8A 4YCAA 3NIFB 2VUHB 4YRTA 1EE9A 3AXSA 2IHUA 3HBLA 5JDIC 3NT4A 3PXAA 1HYEA 1YRAA 1T5IA 2C95A 1RPNA 2WJHA 4IGAA 4RNCA 3PR2B 2W2VA 1D1TA 3B6IA 3BD6A 2YIJA 3BKXA 3BF7A 3SZ3A 3VH2A 4DJAA 1I6WA 3NCHA 3TTWA 3WJAA 3BGIA 3UJNA 2G9RA 3KLNA 3R0JA 1PR5A 3IQEA 5DW0A 1DKMA 1GYQA 4YJFB 3ZJ4A 2FZEA 3KAPA 4GR4A 5BOSB 1GPLA 1IHDA 2ZOSA 4UHDA 3RV4A 3A6KA 2X76A 2QUZA 4N3CA 4NULA 2I4IA 3IBGA 3H8JA 4EO4A 1WBDA 1Z6YA 1N3IA 3DZDA 2QM8A 1QFYA 1MVNA 1Z5ZA 2VK2A 5DM60 2PMFA 5KYXA 2WF6A 1D6SA 2FPXA 1P2VA 5D6NA 1HX7A 5DTRA 4DQDA 4B9EA 5J58A 4YAGA 5FL7A 4LWZA 1QHHA 2EBUA 2HQSA 4RTPA 2B9EA 2Z6VA 4ZCPA 2CYCA 4UD2A 6Q21A 4B35A 1T0JB 1XYVA 5GTDA 2XQJA 4H7JA 1DRWA 2I6UA 2EZ8A 1JF8A 1UMDA 1O4WA 1Y98A 3DE2X 2X15A 5LWQA 5HUHA 2O8BB 3D4LA 3HL4A 2J3QA 4FDUA 2H9IA 4BNYA 3L8HA 3CBQA 3LU1A 3HU5A 2LNDA 4DL9A 2J6IA 3E03A 3T5PA 1DUVG 1QXSA 1J5PA 1GPYA 4U2EA 1KO5A 1SBCA 1T5BA 2HBZA 2J4FA 2NNWB 3M8KA 2E4UA 1O77A 4LMBA 4M76B 5GP1A 5TQ2A 2GYUA 3QHPA 2CXXA 2ZVDA 4P4SA 1HLPA 2ZDGA 3OAAD 5CX4A 2XYQA 1VE9A 3DE1X 1ONNA 4RD6A 1P4AA 4OQXA 3L8GA 4WZAB 3CWZA 3KUKA 4UU1A 1Z0DA 3T52A 1G5IA 3G8YA 1YE8A 3T9EA 2CHQA 3UAZA 4F3KA 1N1DA 1ZD4A 3PE4A 4DY4A 2CF6A 1SCNE 4U4AA 1FNBA 1I1QB 2J08A 4MR8A 4ZVQA 4ZEXA 5EJ8A 1IE3A 3KSUA 1KWKA 4RSGA 3Q3IA 1XL1A 5BMOA 1E9EA 3SWWA 5AW6A 3IUYA 5AJUA 2YDYA 3R4VA 2XWJI 4PPGA 4WEOA 2QZ9A 3QUSA 4HRXA 1N8NA 1IHPA 4HZUA 4NH4A 2J09A 2NUPB 3CUYA 3I6ZA 3WB0A 4IH1A 3ZHYA 4BZPA 1WUTA 3JATB 4HTAA 4J0JA 4OYYA 1WSDA 2CUTA 3NTLA 4PTYA 3V8VA 4HGOA 1KFEB 1W35A 3ZCUA 2CD9A 2HU2A 4DJTA 3D1VA 2VF8A 1KK2A 1XFDA 2I6FA 3AJDA 4TL7A 2JFVA 1UBFA 2W58A 2O8EB 3HSYA 5LZ8A 1C50A 3ULKA 1QF7A 2D5BA 4J75A 1M6WA 1JG2A 2C58A 3PWZA 3LCMA 3M6IA 3PXXA 1TUEA 2O19A 2WWIA 1C0EA 4IPTA 5BSGA 3TPCA 4H3KB 3U9SA 5A4MS 3O8QA 2IF2A 1XJWA 2ALJA 3TNFA 1U8XX 4D4KA 1TZJA 2WZBA 4QICA 5CT4A 1Z2NX 3V7UA 1X74A 2PU7A 3SY8A 3VJRA 4MDYA 4PY2A 2DCMA 1FFXA 2OV2A 1N2XA 4K88A 4QOFA 3V5NA 1JQ5A 3X1KA 3V1LA 2Z8YM 5EIOA 2CXRA 1IULA 3RNLA 1ES9A 3FNHA 3EGWA 2V5AA 4KMOA 3N9IA 1G3QA 4GAEA 4RH3A 1VMDA 5L4LA 2DWPA 5H70A 3DOIA 3H0CA 3I9KA 3NPAA 4D57A 1YKGA 4XWOA 1K5PA 3ZWQA 4WBNA 1FJXA 1Q19A 5HS6A 5REQB 5KNLA 3IUQA 3E9MA 4MKGA 3G17A 3N0TA 2F2TA 5LQJA 3HKEA 2RH4A 3E35A 4G5SA 2XOXA 4GYWA 4PPQA 4QEZA 3ZDEA 4C88A 2FN4A 1NKSA 3DPUA 2FPGA 1FUEA 2I7CA 1UQTA 4M1SA 1VIAA 3TTTA 5U9CA 1AMNA 4W5NA 1Z29A 1DQSA 3TJZA 1NF2A 1YQXA 3PGKA 1NI5A 2A4MA 3RS9A 1BG6A 1KVRA 3F5DA 4LWPA 4PYMA 1H0RA 2QQGA 3VDXA 1O94C 4F9FA 2H3EA 3DP7A 1DCMA 3B8HA 4G4JA 2DKOA 4Q3AA 1PLJA 2REOA 3N2IA 4JNKA 4XDZA 2GEFA 3CRQA 3LRXA 4PYJA 1FZTA 3IVAA 4J6EA 2IY8A 4TMVA 5IK2A 4CLRB 5ARBA 2XGMA 4GGMX 4YMLA 1UBTS 3X44A 4HAVA 4E46A 3F9RA 2C0PA 3C87A 4JJFA 4NJMB 4BRUA 4CKWB 4DWOA 3COYA 1VI5A 1U28A 4QRIA 1U9ZA 3C1AA 3TE6A 4CMKA 1M0EA 2CL6X 3TOCA 1DXYA 4BNLA 1OJ7A 1ZA1A 3I2GA 3SIRA 2QDKA 3IQGX 1JEJA 1M2VB 1MJGA 3PQ6A 1CQJB 3WNBA 4ZKDA 1G4HA 4U7TB 1UDCA 1ISPA 2QTFA 2AN5A 4UDXX 5D7BA 2CJWB 2E89A 5EIFA 1W5BA 4ND3A 5ERYA 1DX9A 4LECA 4XYBA 5H3CA 3AR8A 4E33A 1K1EA 1E4VA 1RPJA 2JA2A 4IDHA 1RXSA 1J1IA 2ILVA 2Q07A 3DTVD 2ZTVA 2GPBA 1XROA 1IVYA 4KEAA 2IPAB 1XQVA 2GRUA 4JUDX 4N3GA 5FPYA 5ALVA 2CEKA 3FUWA 4MB6A 2JPDA 3OKAA 2IOYA 2I4RA 4JOBA 4I3HA 2HFKA 2EFDB 3RYIB 2AG8A 2QX8A 1I80A 2VJPA 5A7HA 2M6LA 3LVRE 3KUUA 5ARCA 1LQUA 2VP5A 4CG1A 2ZRGA 3PITA 4MUGA 3VV3A 4UXJA 1FX0A 4DILA 2BI4A 4DV3B 2NO0A 2PTHA 3HJCA 3W1WA 5KTYA 1GA6A 2TMGA 2IGBA 4MQMA 1HEYA 1TVCA 4S1PA 2J45A 2X8LA 1GCAA 4RWZA 4XVQA 1FOEB 1YOVA 4A5SA 4IIGA 4EJ6A 4F2PA 4RV4A 2I99A 2DFNA 3A8TA 2J8ZA 4NIMA 3BERA 1DNPA 1HRKA 2HO4A 1PT5A 2EG5A 2ROQA 3AG6A 1X9IA 3K9CA 3CINA 4Z0TA 3FCYA 2WHEA 3OLQA 3ONNA 1M2WA 1KOJA 1OWNA 1ZH6A 1ZVKA 3DXFA 2WU1A 1CF9A 2YY7A 4JJ7A 4MOWA 4RCZA 4B80A 3RSGA 2WKSA 4RFVA 2KSQA 1W4CA 2ACWA 1JWAB 3SFVA 1W88B 3ZWDA 4RTOA 3U7QA 3P4XA 3VFDA 5GIPE 1Z0IA 1QGYA 3RSZA 4M6WB 1WKBA 2UZ1B 4EF4A 5BQFA 2XVMA 4R2MA 1LJ8A 1YQGA 2IDJA 3LGAA 2BR3A 1XTPA 4TVBA 3S2GA 3ZVRA 1A2KC 1M2HA 3H84A 4M1YA 1XEXA 2IVZA 1FFBA 4YHBA 4DXAA 5LDDC 2OGZA 2PKCA 3W9UA 1EFVA 4CF5A 3LBFA 3M81A 3N8HA 3GUVA 4G2NA 7MHTA 3A1NA 1NXWA 3P7MA 4AJLA 1Y8QB 1GXSA 4WVLA 3GZTB 2O5RA 3A26A 1CQXA 1GRNA 1TM2A 3V1UA 5HQJA 1U63A 3LECA 3KZMA 4FONA 4IDOA 3TDMA 2WPDA 4ZOAA 1YS6A 3OQVA 3DBLA 4JJ4A 2C3MA 1PX0A 3KJEA 2IFTA 1W44A 3A3PA 2ASVA 4E13A 3WYGA 3ELBA 1OAAA 3LBYA 4HLUA 3KUDA 5FIUA 3C70A 2H2HA 4HOYA 1VLJA 3WGZA 1T9ZA 4PC7A 3EVFA 4QYWA 2OQIA 4K46A 3T06B 3D2CA 1W96A 4ESOA 2QJOA 1OXXK 2ZBEA 3F9IA 2PKQP 3KZNA 1YOBA 1XAGA 1RVDA 3IPLA 4CKCB 2JEYA 1JPJA 1MABA 2FOXA 3SYKA 4FB4A 3RD5A 5IM4F 4OBXA 2C2GA 4HLDA 1I5OA 5AW3A 2QN1A 1W36D 3NHKA 2NAPA 3LZCA 1JBQA 2QDXA 4BGIA 3MK31 3QPVA 2WMDA 1HNNA 2E48A 2QAJA 3TTSA 4LJKA 1DFHA 4ROSA 1YKFA 5AJVB 3HU2A 2J5RA 2E4WA 4B7AA 2XMRA 4KH0A 1DX6A 1GZHB 2OORA 3REFA 4JEHA 3H7IA 2B7BA 4CG2A 2KS6A 4H6XA 1LGYA 1DAKA 4QYMA 1TZ2A 1Z2CA 4X3PA 2AWNA 2W2MA 3IMEA 4ZYLA 3SJUA 3D1JA 2PRSA 5AIAA 1IQRA 1DWUA 1E1KA 5J2TF 4WFIA 4LPKA 1YNOA 2NTNA 3D6NB 5AVWA 2WKQA 5ALDA 4XGQA 2W2QA 1XHFA 4RFSB 3GGDA 3UUFA 5JCPA 2Y9PB 2ZVPX 3CB2A 2VHWA 1DJLA 4IIUA 4CIXA 3ZLUA 2HJVA 5HILA 1C4KA 3L1HA 3V8NA 1ESNA 2VDVE 1OVMA 2B8TA 2XMPA 4RTNA 3V4RA 1C14A 2HJSA 1BHO1 2WYOA 1G17A 5KX5B 4H7PA 3RC1A 1YFLA 2D13A 3QU5A 1G1MA 4OMFG 1G16A 4ENWA 2N9UA 5JC8A 5K01A 1WP9A 3KOWA 2K4MA 1EZZA 2R87A 1IMJA 5DNCA 4MWDA 1H1LB 5KDOA 2TMYA 5J2UA 4FOPA 4HLQB 4XH9B 2A1UB 2X8JB 3IE1A 4LOIA 1CLUA 1ZI6A 1YCGA 5CDHA 4KV7A 3QOXA 4MGYR 1F0NA 5LKRA 1KZ4A 1IOLA 1BMFD 1XAIA 2PUJA 2W2LA 3IVMA 4JBWA 4NFSA 5IC5A 2IUSA 1KF0A 2W5UA 3G2JA 2NVUB 1CBUA 4OLBA 5B6IA 5CEFA 3RLFA 1XR3A 4WRRA 5KTMA 3F6YA 3GJSA 4PN7A 2ERXA 4LTMA 3IA2A 2UAGA 1EVYA 2ZJAA 2XDAA 3FCCA 2DHEA 4PAQA 4NBUA 2OCGA 2PZGA 2VP3A 4XCXA 1QHEA 1QX3A 3JYNA 3O3CA 4L5IA 4XA8A 3NEPX 4LAFA 4BB9A 3H1GA 1P1IA 3BHJA 2CFOA 2ZYDA 4B0OA 4IRXA 4EM6A 4ZI7F 1AZWA 5KJ1A 5C80A 2HDNB 1JYEA 4GYKA 1SG0A 3W2HA 4ZFNA 2JIRA 3INYA 1MOSA 1KBOA 3NFRA 4GX0A 4KHZA 4YP5A 2C7RA 2ZREA 4ZDIA 2ONJA 1CRPA 2B1RA 4K6KA 2MSWA 2R8EA 5COBA 1Q50A 4IKEA 1KYYA 1U98A 3DBHB 3Q7TA 1X1AA 3ZD6A 3THWB 4A8HA 1X3SA 2AZDA 4U9IS 4EABA 1TT7A 4JHLA 2WOOA 2XT9A 4KJXA 1SEVA 1R8SA 2C77A 1NATA 3GLUA 1O03A 2Z3WA 1UT5A 2G28A 2XT6A 5DLDA 5CIYA 4WLUA 4COOA 1V9SA 3IAM1 5TEWA 5D3KA 3GLGE 1JE0A 3OD1A 3KHSA 4F4JA 4MKRA 2ZPAA 3CVUA 3QU9A 2R47A 1C81A 4KQXA 2ZBPA 1G63A 3NKLA 3QMVA 4HAXA 5DX1A 3TAXA 5KYTA 4CMJA 4MINA 2WFZA 1DAFA 3M3HA 3K53A 4FYPA 2PH1A 4QGFA 1DTEA 1TI7A 3B5IA 5EVCA 4R3UC 4Q1AA 4KRXA 2YXBA 4TWIA 4UBJA 3EUEA 2PUGA 1UKEA 1IY1A 1V7QA 4QDOA 4N7MA 5BOVA 4HP8A 4DLBA 4OHPA 3NVKI 1PFYA 4YV7A 4DA8A 1I9CA 1TJ5A 5TMPA 2ZWOA 4MV1A 2GTIA 4PANA 3VYVA 3F7OA 1EWYA 1M2GA 2IX3A 2ATEA 1OZAA 2TRSB 4HBZA 3TIVA 1IYZA 1TKBA 2OXFA 3PEFA 1DBVO 1GAQA 1P17A 4ER7A 4ZGWA 3ON5A 4DLUA 1XTIA 1PUJA 4TN1A 3UXMA 2JGKA 4AN4A 4IV0A 1ZOPA 1O96B 3AERB 4U5XA 1W4AA 1VCNA 3DCIA 4KRYA 2OLEA 4AIIA 4OHRA 2PH5A 1E1QA 1QFJA 2RGAA 4JH0A 4RA9A 4LXHA 2AI2A 2HLHA 4UNQA 1RACA 1O0CA 3MW8A 4KUHA 1BA3A 3TFOA 3BF8A 1LLFA 5FR1A 3VPHA 1Y1PA 4X0EA 3KL4A 1FFWA 3C1UA 3SNKA 5ILQA 3N2YA 2OV3A 3GMTA 3UEOA 4OYLA 4JI7B 1PE0A 3NVAA 3T1TA 4L27A 1IN7A 4GXTA 1PZEA 1X80A 3WDKA 2BJWA 2WP0A 3B1ZA 4L4ZA 4LIPD 3FMGA 3LRPA 4ESEA 3CH7A 2C2OA 3EXG2 4J94A 2GZMA 2HLNA 2ZTUA 2FEOA 3R3XA 4KOEC 3WX0A 3ZCQA 3G85A 4F9EA 5IAGA 3BFJA 2IHBA 3V7YA 2D5IA 4JWTA 2LW7A 3S68A 4LSWA 2GX6A 1O6FA 5LLSA 4RA6B 4BFVA 2BISA 3ROTA 3COVA 1JHAA 5FPTA 1J2TA 1NR5A 3EUFA 3DZHA 5TX7A 4BFSA 2Z6QA 1CZRA 3Q6IA 4LDPA 4EB6A 5HKAA 2VWHA 2FZWA 3U3XA 3PIRA 4CHTA 3LA8A 4TTJA 3MTQA 1TYBE 2BDUA 3H1BA 2WJ4A 3LDFA 3PD7A 3IPXA 4GF5A 3MOGA 2X2PA 3HXKA 1XC7A 4OHFA 2I3GA 3BOSA 5F21A 3STXA 5T41A 1W52X 2CVFA 5SICE 4Z7NB 3W78A 4GXNA 4V0SA 4DG8A 1ZN2A 1XZKA 3D6MA 3WL5A 3HG7A 1XF9A 4J29A 2QRZA 3LZ6A 3BZUA 3SZRA 2NO4A 2NO7A 3FTNA 2MSEB 4QU9A 1YHNA 3AHFA 3E05A 4HYQA 3FVVA 2VRNA 3GLSA 1WZUA 1FPMA 1D8TA 1M74A 2Q3DA 3VC7A 1NNUA 2Z6UA 2M6SA 2ID7A 4J3JA 2WT8A 5FYQA 2ECPA 3LC7O 4L7QA 2GBGA 2BGGA 3WZ2A 1DIRA 1NN1A 4QDKA 4PLZA 4U9UA 4KGZA 5JAQA 4DLNA 3LK7A 4Q66C 1Y1TA 2FK7A 1DKNA 3T99A 5ITZB 1TK3A 3PC6A 4I4CA 4O59O 4BUCA 3FOEC 4N1AA 4ZCMA 3FZYA 3U4AA 3B2NA 1G4UR 3GGGA 3RTGA 1R6UA 1ULUA 3BMNB 1WDLA 2CLKB 3OZXA 4EYEA 1TJPB 3G2MA 4Y2HA 3KB1A 3IVXA 3BIJA 2Q6IA 4G0MA 4QJBA 5DN9A 5C8DA 2Y76A 2ILTA 3CTMA 4YDRA 3T4EA 2ZIEA 5A6SA 1Y9DA 4I50A 4H3HB 4JQYA 2CLMB 4FHFA 4KH1A 4N9QA 3T34A 3TD9A 4DZTA 3IELA 3KBOA 3NBUA 5TIIA 1V71A 4CETA 4HPXB 1AOXA 4Y2GA 1DEXA 1NI4A 3SZOA 4BX0A 1XI2A 3A27A 2QG4A 5EMKA 4OMUA 1XQ9A 4NE2A 4I4TF 2NU7A 3EYAA 2D0IA 2OZLB 3HVHA 3JQGB 2M98A 2I3AA 4CODB 2P79A 4F3NA 2IKQA 2IF0A 2FX2A 2JCXA 1L3BA 1ORRA 4IMPA 4L4YA 4X24A 2AQ8A 5HCNA 3NIWA 2NU8B 4FILA 2V0GA 4RZQA 4GPD1 2A94A 2QR3A 3HVUA 4D1YA 2YL2A 3DMGA 13PKA 3SC2B 5JWHA 4DIFA 1H2HA 2WWTA 2ZSIA 2ZUVA 3DAOA 4XXHA 2JIBA 1DC6A 1Z13A 2QTCA 1I3KA 2CFIA 2GZAA 4OFWA 2VQDA 3CW8X 3KKZA 2PE5A 2M9MA 4OLFA 4XJVA 1NNEA 2AN9A 1U3GA 4Y2VA 2GYWA 1QHSA 1VFPA 1JR2A 4E5VA 3HDQA 3G88A 4G8CA 3VR4D 4RZ2A 3L4BC 3ZTTA 2A67A 1KSJA 4BVBA 2I2BA 3PXBA 3QPUA 2A86A 2HOQA 4RPCA 1CE8A 4Y2PA 1W5TA 2HK9A 1SUFA 3QEAZ 1PL8A 4YS6A 4IDAA 3ETGA 3W5IA 2BMDA 1DBWA 3EVEA 4AF7A 2XAAA 6PFKA 1RAGA 2J9YB 4G41A 1G38A 3P9RA 1CS0A 2OT3B 1CUCA 1M8GA 1HQKA 3PE3A 4LXXA 1FY2A 3LG2A 2C4MA 2ZRKA 2XXBA 2GILA 4IF4A 4OHMA 5J4LA 1I4OA 4GSLA 5DGHA 3JSAA 3IAM6 1HA3A 2JGDB 2FR8C 4QLOA 1HE4A 2POQX 2VDOB 4GP9A 4ETWA 3Q1LA 2OYCA 4QDJA 1JSZA 4MWCA 3STUA 4NEHB 4XCQA 3SEFA 3T3NA 4WX2B 3W5CA 2GN8A 3O8RA 4WKOA 3FB1A 1M1ZA 3I9JA 4ZOLA 2B0JA 4QPPA 4L8GA 2VYNA 4WJZA 4HUTA 2J48A 3O8OA 5AOVA 2YOFA 4K03A 2E4ZA 4HUQA 5KYKA 1ZGHA 4DEYA 1W49A 1CUAA 1L6RA 2JZNA 3COWA 3T54A 2WLTA 1C7EA 3WHLA 1WCYA 4P2GA 4DLKA 2C3OA 3DTTA 2V7XA 1X8LA 1FW8A 4F5WA 5IUNC 2XIQA 2VNKA 3I62A 4ZMRA 1P3Y1 2OGWA 3D6TB 1U1GA 4UMFA 4C0HA 4FZJA 1KZ7B 4EI9A 3D1LA 3TW0A 1YCHA 4IS2A 1CC1S 221PA 3N5CA 3QE4A 3U5ZB 4TLCA 4M8IA 2XGGA 5DF1A 4FBMA 1A0OA 5AKHA 4FX5A 4AKGA 3SU8A 3HA5A 4PYIA 3CH5A 2NT4A 2PLRA 4X93A 5FBWB 4CLOB 1FMCA 4IYRA 3D64A 1TCBA 2NX2A 5H80A 3AV3A 4YLYA 2PKWA 1B4DA 2HQOA 3MERA 1S2IA 1TA9A 1MRZA 5I7VA 2IKSA 5DNYB 5LZ5A 2B4TO 4YRDA 1VE6A 1RDFA 4BIIA 3FRHA 3O8DA 3OOWA 4CL0A 3CKLA 3RLIA 5HA5A 3I1YA 1E58A 5TVKA 5LQMA 3T4XA 1EUCA 4QEDA 1NQOA 3JQAA 4UM8B 3ZY4A 4AXBA 2PZEA 3L7KA 4I55A 5F2EA 1PQUA 2CCKA 3FAZA 3K71B 4UQPA 1QZXA 4F3TA 1VMAA 5HQ3A 3GP8A 1FXSA 1SQGA 2Q9UA 1Z82A 1P9WA 1DO0A 3NGXA 2XGOA 3ROKA 4NEQA 2C7BA 1RYYA 3S70A 4TMXA 3Q10A 1WBBA 1R5NA 1QS0A 3LUJA 1ZISA 4QPDA 5C8YA 3HBNA 3OZBA 2R66A 5EXEA 5DYWA 5EKSA 3ZKWB 4ARVA 1D2MA 2PGLA 1DWQA 2N3ZA 1HFEL 5L7TA 4UEJA 4MAAA 3EIXA 5LUAA 2W2KA 2ZR9A 3A9WA 4IDFA 4CEIB 1NFQA 4MWSA 3BWYA 1FFSA 1XQ1A 2IIVA 3MBOA 3HDTA 2PR7A 1FE8A 1XELA 1N78A 5L4NA 3EH1A 4OOEA 4XEHA 1L5YA 1LDNA 1OJLA 4AULA 2W6QA 4OHKA 4DPKA 1BFKA 4E12A 5C5DA 4LGYA 2CFTA 3NBQA 3WWPA 3GYBA 1L7MA 1MQAA 1KMCA 1TDJA 4LV5B 2RGCA 1WVIA 2PUDA 1YDHA 2O6LA 3ASVA 1PIWA 2R6DA 3LO5A 5LXTA 3ZWVA 2GF2A 2V7EA 3GLHA 1PVOA 3IVRA 1W19A 2NSHA 2I8LA 5FWYB 3HMKA 5FUMA 1MVLA 2ZYHA 4Q0MA 4ZHQB 5D6OA 2X9NA 5IFLA 5G0WA 1ELOA 2WE7A 5A3SA 4GDFA 2W6JA 2Q1UA 2FSHA 3CW2A 1VJ0A 2ATXA 3O9VA 4UC0A 4W8GA 4B43A 4O4LF 4DDMA 3NBXX 4MAMA 4QHSA 1Q0UA 5ITWA 3E1GA 4HDKB 4RBNA 3KWLA 2OZEA 4Q5IA 3SIPA 3UCEA 1UJ2A 1XBTA 1WPGA 4CDNA 4OU4A 3L41A 3VPCA 1IIRA 2LUOA 2VWQA 2C9YA 4BNDA 4ZZ3A 3JAKB 3NDJA 2WT9A 2Y0BA 3CF0A 4YUAA 2R3SA 2H0RA 3WGIA 5K3DA 2JFWA 2AW3A 3AQ4A 3C8HA 3H8WA 2HSJA 4JMLA 3LQQA 4TKUB 5AM4A 1DBSA 5AXDA 4JA2A 1FF9A 3WAKA 4EI8A 3M1AA 3HUFA 4W63A 4RCVA 3DWGA 4JJKA 4LEIA 1FYFA 1KYVA 1MX3A 4JL5A 1GSOA 1N2JA 4PXYA 5IN5A 4RJTA 3QVKA 3BIOA 3UHJA 5IVIA 1YZKA 2PNFA 5JAOA 3E22B 4PVCA 2VP2A 3PUJA 5DTQA 3U39A 1GNRA 1DG3A 1ATZA 1J0BA 4XASA 1GT91 1YGYA 1UJCA 4BVGA 1UJ5A 1QTIA 5DEOA 3RVJA 4DMKA 4HFJA 1QTNA 1YZYA 2AOWA 3CZPA 3OT4A 3T3OA 4UHKA 1L2TA 2GLTA 3KTDA 5TC4A 4E2YA 1EZ1A 1CZLA 3HB0A 4X63A 4NBKA 2PN1A 4GG1A 4QDUA 2P1DA 2ZT8A 5DTMA 3LW7A 3OI7A 3P9ZA 1LV7A 3PUWA 4BNVA 5CLJA 5JAPA 4LHSA 4C04A 4PG8A 1RVV1 3KYIB 1XZIA 4URWR 4XIIA 4AU1A 2R8RA 3LLVA 3HADA 4LC9A 2FG7C 3HKCA 1G3RA 4XKJA 5EGNA 3VQTA 3OTOB 3ZJYA 1UANA 2LDBA 3IGFA 4JX9A 1NVEA 1KORA 3ZGVA 4I9NA 3RVMA 2ODQA 3AW9A 1RQRA 1SCKA 1UKVY 2GZDA 2CHGA 2H92A 2QVLA 2XSZD 3PUZA 4Q24A 3R7DA 2P91A 5CDSA 721PA 5CB4A 1H42A 2G04A 1T3TA 4WGGA 4A0GA 3HZZA 1GSAA 3L7IA 4C3OB 4C7MA 2PRKA 2Y05A 5DIFA 2R1TB 3P97A 4C5CA 1T4DA 1F2TB 1EM6A 1ZJ6A 2BGWA 5B1EA 2FWBA 2YASA 5M2QA 3G9QA 2JLXA 1TQ6A 5ALUA 5CGQB 5AHRA 1GADO 3PA8A 4BU0A 3M6AA 4MW4A 5FDFA 1KGDA 4XLLA 3AINA 5DB4A 1ZH0A 4O2BA 4TQUS 2Y9MB 4MMXB 1RWXA 2VOJA 2O1SA 1PJZA 1YZ3A 4FGUA 4HNAB 1IL0A 1CB0A 4KXQA 1LA2A 1BQ4A 2R8XA 4Q3CA 2YC2C 2OO3A 5EN4A 4ARSA 2PWYA 2IYPA 3RIGA 1RYDA 3ICWA 1TGVA 4YDHB 2CE2X 3IAXA 2A59A 4Q4AB 4QOJA 2OK7A 3O1LA 2IP4A 3C39A 3LXXA 3MOSA 4ZT4A 5AESA 3MVEA 2FWNA 3O92A 3QKTA 2YJ3A 1QDEA 3DC2A 2J41A 4DB2A 3MMSA 3E23A 1VPWA 2CL5A 2FRXA 3KQMA 3VMMA 1HSZA 2OKGA 3Q5DA 2DYKA 4EHAA 3KSRA 2BT4A 4XUGB 3RSOA 4OV6B 5KINB 2FUG6 3ETDA 4B4KA 4TSRA 4GMHA 4QT0A 4YMWA 4F04A 5BV1A 3WNCA 1I4LD 1F0KA 3L18A 4WCDA 5EXDA 4U7WA 5KOHA 1VIYA 4OA8A 3QRWA 1GCUA 1GDHA 1G8PA 2H1WA 5CA1B 1XAJA 2WHRA 4W1SA 5CVVA 1NF8A 5FNVB 1RXYA 2HRQA 2PVSA 3HN7A 3MLBA 3SQLA 5BYKA 2A8YA 2QSUA 1ZIXA 4HJRA 1KQNA 3UJDA 2YWEA 2JFPA 4B2YA 3CRVA 4B09A 4WASA 4OG2A 4KW7A 1BN6A 1U3TA 2VHXA 2CY0A 1WV0A 1DTWB 4D6XA 1ZBQA 2XRYA 4LZJA 4PTZA 2NADA 4J9UE 3PJGA 3A6JA 3UYKA 2KLHA 1ECBA 2L42A 4OYHA 3DDHA 2DH5A 4JL6A 3WIVA 1LTKA 4UQOA 5LP6F 4WH0A 3ZV7A 5FOQA 5IT5A 5JNRA 1DJOA 1TT5B 5CH8A 1ICEA 2VRCD 1YCDA 5BNFA 4XTRA 3FBGA 2WABA 3FPJA 4R68A 5C1OA 3WAJA 1JIKA 3HBAA 3I9OA 4CM8B 1FL9A 3ZZ0A 5HZKA 5CVDA 4A8JA 1Q17A 2PKEA 2LCIA 5G3ZA 4L8VA 5KTNA 3MHTA 3WWZA 3L7BA 1G21A 2VT6A 1O94D 3I23A 3I37X 1JG6A 1C4OA 4RIEA 4CL3A 3FIUA 1RAAA 3VJMA 1TL7C 4QULA 1Y82A 3WBKA 3I5XA 2QD5A 4MP6A 5JDCC 3RVDA 4PSAA 1YZHA 1KMQA 3B6JA 4C76A 3PNKA 3OEYA 4O63O 4HT3B 3WQQA 3JD3A 4WEQA 1Z6ZA 3JZDA 1EX7A 2VO1A 4HCJA 1K08A 5ICGA 1ECGA 1VJDA 4HQ6A 5HE8A 3I6QA 4DT1B 4CTNA 3E9YA 3ZWNA 2GBIA 3HXMA 1GZ4A 1EX9A 1Z28A 1NJSA 2I80A 2BGUA 2ZE8A 3DL0A 3EGIA 5CFMA 1ZIYA 4YAEA 3LVBA 2CSXA 1LVHA 2XQKA 3PYLA 4F5ZA 1R15A 1IZ8A 3Q98A 4J7XA 3S2SA 2V3WA 2B94A 5JCOC 2OMEA 4N5DA 2ZM6B 2CZCA 4D8WA 5JSUA 1VHWA 1T36A 1WULS 2V0CA 3O26A 2C9BA 5M04A 4TXMA 3UJ9A 4E6PA 5IJ0A 3OE7A 3W4JA 3ZIAD 1IN5A 1I9GA 4OREX 4BAGA 2WD9A 4KO2S 3DZBA 2YN4A 4RSMA 5B3KA 3D6VA 4X00A 3D6JA 2FGKA 3R4CA 2XWBF 2HPZA 5AVKA 4CKEB 3H19A 4CLHA 2C8LA 1KSHA 1XK7A 3K15A 2VAXA 1UDXA 2B7CA 4HDMA 4OL9A 1YTLA 3WMEA 5L4SA 4JJZA 3UK1A 1K7SN 2EBHX 1P5RA 3A4MA 4OM7A 3WJ7A 5FI1B 1KEEB 3WSWA 5A5GA 3MWGA 4JP5A 1SU7A 3DPIA 1TIPA 1UM9A 4OGGA 2EGUA 3H2GA 2V7VA 3E58A 4OI0A 1NT4A 2ANBA 3C3JA 2C83A 5EP2A 3GH3A 5ECWA 4DJJA 4EPYA 1YRLA 2EKBA 3NTUA 4K1LA 4OATA 4PXSA 3VU3A 4DLYA 4AG5A 1H85A 1M67A 3DOOA 1LPOA 4CYMA 4E4TA 1EDBA 4KQ2A 3OWOA 4CQMB 2A1IA 5EIHA 4TROA 4O33A 4H27A 10MHA 1ZM3A 4AW9A 4LBZA 1SHJA 2PMDA 2BMFA 1U2QA 3IP3A 1NX6A 2HMSA 2PHZA 2JJ2D 4MUBA 4EX6A 1D4AA 2PAFA 2WG1A 4ERXA 4YCNA 4FS8A 2J9XB 3HRHA 3UMJA 2D0OB 5EA2A 1KH3A 2C00A 5LQKA 4B4UA 5CG1A 3ZE7A 3W2FA 2DQZA 2VVTA 1JQEA 1ST2A 2LV8A 3CN7A 3N2KB 2PTGA 5A5FA 4PPFA 1G9TA 2DECA 3GOQA 4IHJB 5AK4A 5JLJA 2VHYA 3TLGA 1B0ZA 1Z4QA 1ZC3A 1GKKA 2C0QA 2VPQA 5TRTA 1QGZA 2PYZA 1OX5A 1AGXA 1T2CA 1X7YB 3P0EA 1KDZA 5JZOA 4DCCA 2D7DA 1AB6A 4GPZA 2I6SA 1I3OA 4YP1A 3KP1A 1WHSB 2BFAA 5AUOB 3MJ4A 4FXOA 3LNTA 3R44A 4UCXA 1QHXA 2II6A 3DV9A 1EP3B 4M9SA 1V7CA 2JA1A 4Y0VA 2ATVA 1JSCA 3R40A 4M99A 3ESCA 3R6LA 3C41J 2M32A 2B1IA 2R6HA 1S5PA 3STTA 3WLIA 1X7ZA 4ZVTA 4UOZA 1O1YA 4GD3Q 3INGA 6CHYA 1Q12A 3SD7A 3EGDB 1VYUA 2QLJA 4G9BA 1G3MA 2XCLA 4IXNA 5HIJA 3VC2A 3PQDA 4OPMA 5B12A 2JD1A 3SK0A 5K3EA 4Q7JB 1VKHA 4HX5A 3GLIA 3SJBA 2AN4A 2QGNA 2J7KA 4Z9XA 1UBLS 4RVNA 3GVHA 3B8EA 5ES3A 2Q7XA 4L5YA 3U5TA 3LSTA 5FV4A 2QRVA 4RZXA 4DS3A 1J39A 3CZCA 1F8FA 3VDRA 3WDMA 5KYYB 1VL5A 2FCRA 1ZZEA 3B1VA 4MS1A 3UB4A 4EA7A 2XWQA 1CR1A 2P77A 4G5OA 2Y0PA 4JBNA 2MYTA 1QNFA 1PYGA 2ZTSA 4KDRA 4BB5A 1USGA 3A0UA 1BROA 1YHYA 2YJNA 3KTFA 2DBVO 3BMQA 1KR2A 3HVKA 3OPQA 1CUYA 1JDBC 3U44A 2CHEA 1RWNA 1TYAE 2IHNA 1I4WA 2ISCA 2QVYX 1DJNA 1VGRA 1CUFA 4UAJA 3PHGA 4M1KA 1PJRA 4X1YA 3MQ2A 2R85A 4K86A 2QTVB 2GCNA 1E7QA 1GPAA 1BQEA 3H5OA 1AA6A 4BFLA 1EVJA 1GFIA 2HXGA 1PR6A 2X0RA 3CX8A 1JHDA 2KQUA 3IOYA 4PO1A 1JUDA 2VH5R 2VNJA 4OBEA 4HNGA 2VZ0A 3RIHA 2HJHA 2PKXA 2WD7A 3FMVA 3GO4A 5JAMA 4F71A 4D99A 3TB4A 4CM4A 4LRSB 2H51A 1QV9A 5CIWA 2QW1A 1QRDA 4ARZB 5L95A 2VP0A 2LE0A 4JN6B 4ZVNA 5BSTA 2H2WA 2FH5B 3F4BA 2J5XA 3ROFA 1ZCZA 3HXTA 2QRJA 3C43A 1J07A 4PQRA 4TL8A 2DUWA 1CJUC 1A8IA 1HFWA 1UEXC 4QUKA 1VGQA 3QI2A 2H7YA 3TR5A 2QU8A 4JBYA 1L5LA 4P32A 5EWMA 3KZXA 3P45A 4WLOA 3ZHOA 2IBTA 2HWYA 2ZKIA 2UYGA 4M1WA 4HWOA 4DC0A 1EFTA 2W8BB 3DHYA 4E21A 4XVCA 2N46A 3THRA 1C1DA 2BTQA 4PR3A 3MT9A 1UK8A 2LCQA 3L7LA 4BMSA 4UW9A 5A5EA 4D9BA 1XJQA 4JJAA 1O6GA 2CFSA 1HE5A 4M8LA 3Q7SA 3ZZNA 5JYBA 3HABA 4PG7A 3W6PA 2CBZA 1TOAA 1NZFA 3ECCA 3ESYA 4KXUA 5JH7B 2BUBA 1H5UA 4M0FA 2KX7A 5IF3A 2GWRA 4HEQA 4HGPA 4OSOA 5DTJA 3K70B 4WCFA 5IVDA 3GLFE 3UOWA 4WKGA 2JARA 3HWRA 1G8YA 1Z2EA 3FDZA 4DLAA 2HYDA 1GZ5A 3JTMA 5LP6C 1CZKA 3FWNA 4HBGA 2MT9A 2B1JA 3HDHA 1M1YE 3VKGA 2PSHA 1NMQA 1ORHA 3GLGB 1ZJWA 5JIBA 4LJAA 1U9IC 2L69A 3HCFA 4R1NA 4WJKB 4Y9RA 1XLTA 3RFVA 2D1QA 4QASA 2D1SA 1NR7A 1WX1A 1XU4A 3BSWA 4EFLA 4FGWA 2WSMA 5CNJA 1ZOLA 1USVA 4YCBA 3FDJA 3IR6A 2VP9A 5HIIA 4D3XA 2HWUA 4QXOA 3SHQA 5JARA 1RAFA 3L6EA 1YVRA 4MGHA 4LYDA 2I1WA 5ESDA 4EJSA 3OJFA 5KSYA 1FMFA 1TO6A 3EF0A 5B4TA 4N6GA 3UMVA 1GO2A 5CW1A 4DCOA 3O75A 2UXDB 3L6UA 3HEMA 3PNPA 1AK1A 5EQFA 3I83A 4TYMA 2AQHA 3FFWA 3R2JA 4ARAA 3JQ7B 1VECA 3HU1A 3ESDA 4GS5A 3R23A 1KP2A 4PFJA 2FX5A 5ALKA 3RO7A 3WK4A 3OF3A 4WLFA 2WV9A 3RWOA 4B4OA 1PK7A 1NE7A 2JNWA 2Q6VA 3U3KA 2GDJA 2QZSA 2ZDHA 2D2VA 1Y7IA 1NLYA 1DX4A 1KMMA 4BN5A 2A7XA 1OILA 3EPRA 3F6SA 4LTDA 1MGPA 4IJKA 3IOEA 5A1JA 3C1OA 4Q4DA 4BGDA 4KUGA 1JDZA 3PXUA 3KPYA 1XLUA 2ZRAA 4O1IA 4AJPA 1FDTA 1MUUA 2HF8A 1KOFA 2HX1A 4ZO4A 2YJ6A 1N6KA 1H69A 1KJJA 3WLRA 4HN2A 1E9CA 4BKPA 4CV0A 4YXWD 2C97A 4V2IA 5AMXA 3S1AA 1CIPA 3T7CA 3CVYA 3W7AA 3J81A 4GKVA 1UBCA 5FTWA 2BIFA 1SN7A 3LQRA 5EERA 4II2A 1LH0A 1SM4A 2PQ6A 1JMYA 1EFCA 2VCHA 1GQRA 3GBSA 1FDVA 4DV5B 4MLZA 4OUDA 3ENZA 3NHLA 2D3TA 4PLWA 2QVBA 3L01A 3QUAA 1BKSB 4ND7A 4EZEA 1QU3A 4TTSA 1AK9A 4TSKA 3WL8A 1SU6A 4C0KA 1O3YA 5A4IS 4KQKA 1VCIA 3PI6A 1LUAA 3DO5A 4BQFA 1X7HA 4DNPA 3BJRA 3N86A 2NO1A 3MCUA 2OXIA 4KBFA 1DBIA 2SICE 2EWWA 3TI9A 3BGWA 3TQHA 3NWEA 1N2HA 4NWIA 1ZHOA 1S01A 3AFMA 3FYHA 4IY1A 3BFVA 4DMHA 1N0IA 1MP0A 4ZGGA 1W0KA 2XB6A 3C98A 3JQ8A 1N92A 4PZUA 2VXYA 4I9HA 4DSUA 3RARA 2JG3A 2WIBA 3KEGA 4HWTA 4X65B 2WYUA 4JT8A 2VNHA 4MUKA 5K3CA 3ADBA 3H1TA 3L7CA 5JR3A 1H0HA 1U1CA 1DMRA 3H2JA 3NCTA 4QFDA 3HCRA 5FHQA 4HXYA 2NO5A 3T95A 3K92A 5HWSA 5CX1A 2LCFA 2Q46A 3N2NA 1FU8A 1TVKB 2CDRA 4KPGA 4DPLA 1VLZA 4FSHA 2Z1NA 3MPOA 4EJFA 4V39A 2DFPA 4X62B 1ZCAA 4BUJA 2ZU6A 2H0QA 3C7TA 2O3TA 3OG9A 3WI7A 2LWIA 4TYPA 1YH3A 1MX1A 3SX0A 1V9LA 1V1JA 4GPIB 4D74A 1GZ3A 5L6LB 1X70A 3ZDBA 4PAMA 3OX2A 3N0VA 4G0NA 3RJ5A 4AZ0B 4DARA 1O9HA 1ZUNA 5M34A 1ISSA 1VKNA 4LF9B 3BBPA 3R7WA 1VL2A 4FMDF 2AEJA 4P58A 1N9GB 3ZHUA 3NGMA 2R5WA 5A7FA 1Y81A 4Y9DA 2WWVD 3I28A 1V25A 4JAVC 1TB4A 4ZANA 2AV6A 2Q8NA 2R9VA 3RT7A 3SQMA 2GTPA 3TYXA 4OUKX 4G0OA 4N5MA 4BLOA 2FXIA 2DFLA 5EUQB 5E4FA 2KHZA 3B1YA 3C85A 3VR1A 5EUMA 1YRWA 2CHUA 1R16A 3ITKA 3BTUA 2NXNA 2JDID 4XJSA 4C6TB 4QPZA 3H99A 5SZHB 1E77A 4JVLA 3OZFA 1JEQA 1Y6GA 1SCUA 3CSSA 1ARZA 3CRW1 1P0QA 1NPDA 3EBPA 3F1KA 2AFHE 1U0BB 1TUGA 3R3UA 2Y0CA 3GA7A 3H6HA 1NYTA 1Z4IA 2DHCA 4EY4A 4BMDA 4Z1MA 2UUBB 2PYDA 1F9EA 2VBFA 3CRMA 1T0PA 4YAFA 4RF4A 3R3WA 4NBVA 1WMSA 2WTXA 4TYYA 1U0LA 4U2GA 1PNTA 4G24A 4ZU3A 3N8NA 1FSZA 1SHKA 2A88A 2Z5VA 2ZCVA 3PSHA 3QWAA 1ZL0A 3GXBA 1Z0FA 1TK2A 1W6RA 3WYAA 5ALFA 1DVRA 5FEUA 4RKFA 1VCOA 2F6RA 2YWFA 1DEHA 2J3JA 4J90A 4XWKA 1FXUA 5D86A 3EMBA 3TINA 1FUUA 4JVNA 3Q8LA 4DR7B 2C82A 5F98A 4EVRA 4P81A 4XJTA 3T3HA 3ZBUA 1EUYA 1SXJB 4N7JA 1QTRA 1SXJC 1G7CA 1LRKA 1QO9A 3EEFA 4QATA 5HKLA 4R71A 1QM5A 2BM1A 1ZC4A 1WLSA 4OTZA 1PJCA 4PBSA 3ZY5A 2XUJA 4RZUA 2HHAA 4A8PA 4DIMA 2UYYA 5TNXA 2XBLA 3MJCA 3VR5A 3MEQA 3ZY6A 1JFSA 1BH2A 3QX8A 2ZWPA 2QZZA 3P0HA 4KUEA 3S81A 1OWPA 4DRXB 1Y7PA 4BP9A 3JS5A 4TXLA 1P5JA 4PQFA 1KS9A 2BE9A 1P3DA 1ZRNA 3JAWA 1NY5A 3VM6A 2NVBA 3PHBE 4FYJA 3SKYA 4AJOA 4DQLA 5HF9A 1PJTA 4AZSA 3SFTA 3ROZA 2B37A 4AO6A 3HGMA 2ZBGA 4GBED 3SC3A 3WLQA 5JEDA 3THSA 3H13A 4PSKA 1JL3A 3GJQA 5JI3E 4XDHA 1ZEJA 5EQTA 2IHYA 3NTQA 1Q11A 5BRAA 3VYSB 1Q0HA 1OBFO 2QTAA 4UFOA 5JCJA 1JA0A 1LNSA 4H18A 1XTTA 5M29A 3RF7A 2FV8A 4XM1A 2PZMA 3OHPA 1XCBA 4PSDA 4TTVA 2Q3CA 1MNAA 4WZBE 2IS6A 5J5AA 3DFMA 1ZX1A 3GHHA 2XCRB 1O8CA 2GCEA 1YQQA 2WTEA 3CNNA 1JVNA 4LYEA 4CWAA 3V4LA 1HKUA 4L95C 2Y0DA 1H2YA 1CUXA 4NE9A 5NLLA 5FWDA 3FMOB 4Z0HO 2B1QA 3QPBA 1OI2A 1CIVA 2OYRA 3AHCA 5F9MA 3EWNA 1D03A 1XVUA 1CV2A 4MW6A 4C7XA 1ZK2A 3LHDA 1YIDA 2GUWA 1RZUA 3MBIA 4KSYA 4BP3A 1Y6FA 3HNPA 4UXIA 4YTEA 2RIPA 2NTYC 4P1ZA 4U9HS 3T3MB 4A73A 1KQPA 1E5VA 1R12A 4YJHB 3P9PA 1GYRA 4NZZA 1J09A 5D3MA 1KHTA 2DUUA 1VMEA 4W1PA 4Q16A 4BB6A 3BJEA 2QRMA 4RF3A 1JDUA 1QH8B 2VDRB 2J3KA 3E9NA 4GOOD 3BQMB 3SX2A 4DCUA 4AK9A 4QGHA 1YBFA 4QJ4A 4ZJUA 2VTVA 1JHVA 1YI1A 4HH0A 5EZ5A 1JJFA 3ABIA 4BLPA 1DOZA 1L7PA 2IXEA 2XYRA 3HWSA 1YK1A 4P36A 4BXOB 4Y2SA 1LX6A 3H3FA 3V8PA 1C8VB 1YXMA 1D6NA 1OY1A 2JGEA 3ANMA 4LSGA 4IZIA 4Q1CA 2D5LA 2AVNA 1ZIDA 4W5HA 4MYDA 1BN7A 2O2IA 3AVOA 3CGGA 1MHPA 4Q18A 5ALWA 3ECSA 2JLVA 2I7VA 1UH5A 2QP9X 3KYDA 3CEPB 3ASYA 3SC6A 4EVSA 4NDZA 5KNBA 4TM7A 1NP3A 4OSPA 4HDSB 4P92A 1XX6A 3ACCA 2BCJQ 1WXEA 4XFJA 4CCAA 1Y5RA 4GE3A 5JJ5A 2KPOA 1I0LA 1DP4A 5FUWA 3BCSA 4IH4A 2BEUB 4K9PA 3WAGA 1W87A 3AFHA 3OY7A 1JDPA 2B4RO 4WOBA 4DBVO 1OAKA 4M9XA 5JBIA 3P5SA 4EITA 2AE2A 4RD1A 4UEOA 4CCYB 3RF6A 3UJPA 2AHOA 2OB2A 4CMEA 3DXXA 4L1KA 4X92A 4CKXA 3G8DA 4DSTA 1T5SA 3WLLA 2MOKA 2G1PA 3V55A 1W47A 4TT8A 1V48A 4FYYA 3HR8A 4LBYA 3PGLA 4DWJA 4XWWA 1Z35A 1F7VA 1SC3A 1BJTA 2MYPA 5JD5A 3UJ7A 4Z3DA 2D8MA 2VYVA 3PI7A 4Z9FA 4Q4LA 1AQJA 4RSRA 3LQYA 4K6HA 3CT6A 5JQWA 1LWNA 4JP1A 4LXTA 2WJ3A 4RK7A 5IJ9A 1EUZA 2ZZKA 3HCNA 2IS4A 4PLYA 5FPSA 4QD3A 4ENVA 3PJRA 5CITA 5EJ4A 1Z38A 1RRGA 2RGDA 1RI1A 4L72A 2QT1A 3FYSA 3MTEA 1FNCA 2XUKA 2YRFA 2EJBA 4N47A 1TO2E 3CVJA 1L6IA 2DPYA 2VIIA 5CJ2A 1C3OA 1DOHA 3EVAA 2R96A 1NDHA 2RI0A 2J4CA 4D0SA 3MLAA 1XNRB 1XJ0A 5FCDA 2JGJA 4B3MB 1LBQA 1M8JA 2UKDA 3RIEA 1WTCA 1VZ2A 2X4DA 4L3VA 1GCIA 2WWGA 4QYXA 4TSFD 3VUEA 3ZLVA 3TGPA 1VL6A 5K3FA 1O87A 4EKNB 1ADGA 5I7EA 1YU6A 3AWIA 1IM2A 1KY3A 3JYLA 1NVKA 4MJ3A 4NNJA 4JI6B 4DYDA 1SHUX 4MEJA 2H17A 4YUZA 1Z6QA 3K5HA 3WB2A 5LJLA 1O5OA 3WFZA 4EF6A 2IQ5A 1QYCA 1SG6A 4C4PA 4JZYA 1DU4A 1UBUS 3SPXA 1SIOA 4F5EA 1SCBA 2FRDC 1JFTA 3CNBA 1OLXB 3U7JA 1FJHA 1PW7A 4D43A 1SUAA 2ZIXB 2I9PA 3LDUA 3A7DA 3IT3A 1KA9H 2F9MA 1H22A 2XE7A 4M98A 5AHOA 2IZ1A 4B6RA 1FFYA 4RJKA 3T7EA 3FIJA 3W6NA 3CUVA 2OBYA 3TX6A 2C57A 3OZSA 1XNQB 4RU1A 2C03A 1AGNA 1Y48E 4EEKA 5CVTA 2NYUA 4P7GA 5K1ZA 5GONB 5JASA 1YRBA 2FCAA 2RAFA 3OLVA 3AETA 5KWSA 4GLFA 5IS2A 4YQZA 3F97A 3F3SA 3UPUA 1X7WB 3W5DA 1MF7A 4X7RA 4LNUA 1M75A 3GC6A 1QGUB 1YQ9A 1NVDA 1UP7A 2BLNA 2JVIA 3CCFA 3D31A 3DFZA 4RWEA 3A04A 1HLGA 1LC0A 3ZUGA 4DHWA 5L40A 3L79A 4MGKR 3ZE6A 3AF2A 3AVVA 1JDSA 3MMXA 4W7HA 4B6JA 1SKUA 4JXKA 1F1BA 1U5AA 2ZWVA 4J9VA 1THZA 4MEAA 1GR0A 4R2LA 2OWDA 3FWHA 3A9TA 5EC8A 3ZXXA 3QVVA 5L51A 1K92A 1KJQA 4MB2A 3BMXA 3ZPXA 1EE1A 4UU8A 2C5BA 1JHOA 3TIIA 4RVSA 1F60A 5DOVA 3EDQA 4DPMA 3UWSA 4LYFA 1WPQA 3R6TA 5F35A 1BNCA 2GAJA 2WW8A 3BTSA 4RZ3A 1JVSA 2A9QA 1N6HA 2A9PA 3PQ5A 2VDLB 4F12A 1AK2A 1E6UA 1PGJA 4UM5A 3E84A 1HT2E 3R5TA 4ZU1X 3QTLA 1J21A 4ZHSA 5LYJB 4HTFA 4LDZA 4UBLA 3VHQA 3EBOA 1B8UA 3KWJA 1VHTA 5LP1A 2QTMA 1YS1X 3EOZA 2GJ8A 4Q1FA 5DTEA 4W9MC 2EW8A 4KVFA 1LCIA 4JGBA 2P0AA 4QEKA 3RRXA 1YL7A 4BB0A 1Y3AA 5AXAA 4CR8A 4EA6A 3WISA 1KMHB 4IR7A 5IKXA 2YQ4A 3ZI7A 5E7JA 4R7GA 1GLVA 3SYNA 1MOZA 3ZQKA 2GD0A 5H9WA 4NYIQ 1K7XB 3LV8A 1NY6A 2CDBA 2R7MA 3TTYA 2B4AA 3LLMA 2XQFA 5CJJA 1W5EA 2YWCA 3KQSA 4IVQA 2NP7A 1Y7LA 1U5BB 4ZP1A 2NO9A 4WQMA 5EZYA 2DPMA 4JR2A 4Z9YA 1E79D 4INPA 3U1BA 1RLOA 3IAEA 2VJMB 3MCTA 2CVZA 4R9UC 1JHPA 3BRQA 3BXOA 1U2RA 2YWJA 3C3EA 2PWZA 4KGDA 2OPHA 3OLWA 1PWYE 4QARA 1P39A 1TMYA 4LF8B 3X3HA 1E3IA 5G1NA 1RR6A 2FSVC 1IZZA 1J9EA 4URXR 3Q8KA 1ODCA 1DRVA 4HWRA 2AFIA 1WB4A 2G0AA 2IOFK 2HPAA 3IHLA 4YJ3B 3ZEAA 1YA4A 2BUCA 3EH2A 4F56A 3S8EA 4TT3A 2H4HA 2IPLA 3AFIA 4LYGA 4TLMB 3V4PB 1ESDA 2BUAA 3CJTA 4BMXA 1PFQA 3ZW7A 4ND2A 4N39A 4RJJA 1YIOA 1E1DA 4G5RA 3CUKA 2X58A 4HD8A 2X8BA 4URVR 1DTSA 3NYWA 3FJOA 3CC8A 3IO5A 4UTNA 5E2AA 4BNNA 4IYJA 3IALA 3AWDA 4FLMA 4LDAA 2GKGA 3HV0A 2I8AA 3H11A 4CEHA 1W0KD 2CCJA 3QLUA 3QYPA 2A5DA 3BBLA 2QPTA 3LFTA 5E7IA 3Q8WA 4ZK2A 5JDIA 5JNLA 1TC2A 1UOOA 1R18A 3AT1A 2GBFA 4NNPA 2XTMA 3X1ZA 2GERA 4BKUA 4EL5A 2VI5A 4M7RA 5BW4A 5JALA 1XVVA 4R51A 3QXCA 5JS1A 2G08A 4CEJB 1MQ9A 3LL4A 5LMCA 4KYTA 4ROTA 2OP1A 1KFJB 5B57C 1QYDA 4R1PA 1EBBA 3L0BA 4J1QA 2H8GA 1ATIA 4OQ4A 4RVUA 4KITB 3RBVA 3QKIA 3UGQA 4KREA 2JFXA 4MK4A 3L6BA 5BOSA 5CD9A 5JSZB 3A4VA 4P4TA 4QA9A 2AOUA 2ZI5A 3G2HA 3JQ9C 2BDTA 1OPXA 2E21A 1Z8FA 3B9PA 4FGLA 3DE6X 4YFYA 5HJ2A 3SN6A 1YJAA 4S2EA 2A5FA 4EPTA 2Q50A 5A3QA 4FS3A 1URPA 4QDXA 2H29A 4A6PA 1MW9X 1S8FA 3BFXA 5SV2A 1OA0A 3DB1A 2GPWA 3MTDA 2F43B 2Q5CA 4UULA 1E0JA 4D3DA 4QU8A 3LIPA 3OWXA 2QAGB 1SWWA 2JGIA 4XQ9A 1W4BA 3MXOA 5ADVA 1HE1C 4X8HA 2V1UA 5DHTA 3MT7A 1N2EA 4OLJA 4RZIA 4F6LA 5L3QB 1V5FA 2QI9C 4OGLA 2ZSBA 2B69A 3OQBA 5MHTA 1EEHA 1CY0A 3OE4A 1U0OC 4TMFA 5C4MA 3ADOA 1E18A 1Y6ZA 1HDZA 4AECA 1W9MA 2IYYA 2O8BA 1ONSA 1SKYB 5GJVC 3ZE1B 2XYHA 5IHXA 3H5RA 3JWHA 1RQ7A 4Y2QA 3GMIA 4RL6A 3AR5A 3FHTA 4LZLA 4W1RA 1BC5A 3BZBA 1Y8ZA 5A9TA 3SQXA 3QVWA 5AUQA 2CMHA 1LF5A 3WK7A 1JKIA 2WMOB 1QHHB 1JV2B 3IUEA 3VZCA 4AG3A 2XB8A 4OFBA 3SR0A 3PZRA 3TDNA 2P62A 3LQFA 2ZYUX 3CRNA 1HH4A 3KBBA 4PZ0A 3QSGA 1IATA 2CBGA 3ZTYA 5LB4A 4WZAA 2AXNA 3TGLA 3EEBA 3KZOA 1AUVA 2FOLA 1OSNA 4BO1A 3SHOA 4NOMA 1WF6A 1QBGA 5T4BA 2HPHA 4EI2A 3LY5A 5JFOA 4IQGA 2I34A 5BUZA 1Z6GA 5BV8A 2DWQA 4ITRC 1P72A 1E6EA 4ACBA 1WF3A 3NO4A 4JYPA 3GL9A 1VI2A 2VCEA 4EG5A 2B3TA 3KKQA 2JEZA 5AHXA 3QUBA 5BY2A 3TRHA 4GM4A 4JC8A 5KSOA 1UFOA 2HA3A 1K68A 1ACLA 1IUKA 1QKIA 4GYYA 3AZQA 3NHWA 5AK3A 3WGNA 2QPOA 4B6OA 1CJBA 3M6MD 1NL3A 4D97A 4ZREA 2F1OA 2K5UA 3AOGA 4MRVA 1OI3A 1P44A 4XLZA 4N8SA 2QMHA 5AM0A 2BEKA 1IM5A 4S24A 4YO7A 3WIEA 4FW9A 1ENZA 3UGJA 4IKOA 3EQ9A 4H3SA 5IAOA 1JHRA 3FUUA 1E3DA 1Y6JA 1Z5GA 3OH8A 3EBLA 4KAAA 2PT9A 3LXUX 4CM3A 4S1VA 4JL8A 3SHVA 1NJ5A 5IBCA 4ZOEA 1H8HA 2VLIA 1GGJA 1SXIA 3NJ4A 4JLJA 2OVBA 3NYRA 3NHYA 4UZSA 2DC1A 4QAJA 1D3AA 1QFXA 2LP4Y 4DGQA 2QF7A 3R24A 2ZITA 1UCFA 1GL7A 1GTZA 1U8TA 2HMUA 2X42A 4PE5B 4PWZA 4ZT3A 3WVNA 4ENPA 3HRIA 4RMIA 1LDBA 1FSSA 4EHBA 2PMCA 5DNVA 5BVHB 2A0WA 1Y4AE 2C9OA 2QN7A 3IP8A 3BREA 4J1SA 4I4NA 2DWCA 2N75A 5B3JC 1E0KA 4LYHA 4UOQA 1QAMA 1X8XA 2CXSA 2VSXA 2ZYGA 2YYZA 1MPTA 3CZQA 4M0MA 5REQA 4DWVA 5C5EA 3IL2A 5BWNA 2IBSA 1GTJ1 1N6LA 3QTTA 5EUCA 4F4UA 1HKHA 3N8KA 1NP6A 3PFNA 1KY2A 2P90A 3H2HA 2WYHA 2YUTA 4OP1A 5E1OA 1P8AA 2EG9A 1S02A 3PHLA 3R3HA 2V54A 3GJTA 5G02A 3QVUA 4FK8A 4Q1VA 5IDYA 3URMA 5B7GA 2PX5A 3UW3A 2JBAB 3DDSA 2PYIA 1QO0A 3BCUA 2EGGA 4MLCA 4V3BA 2NM0A 4Z9BA 3VTAA 2CLFB 1KK1A 1ZJYA 2I33A 4ICIA 4QRHA 1WW3A 3VZQA 4D0NA 1M3SA 1WL8A 4WBNB 4HVTA 4G5YA 3SBEA 5BMVB 2C4UA 1KDPA 2I2XB 3H9CA 1L8LA 1G64A 1VA5A 2A3RA 2Q49A 2QUIA 3L93A 4I99A 4MTLA 3ZU5A 2YFKA 4DNFA 3GAFA 4NJMA 4Q9KA 1Z8HA 1SY7A 1GGVA 1S4MA 2HLDA 2JI9A 3B82A 3FLMA 1IY2A 2CSUA 3HPRA 3LC0A 3I64A 1UBGA 1T26A 3TRDA 4YRPA 1F5SA 1U0NA 3F47A 2R97A 3PRJA 1D7AA 5ALXA 5HF6A 5FNZA 2C84A 1L4NA 1FX1A 1SQSA 1C8LA 1M2VA 4IMIB 4DJDC 1CQJA 1HK7A 4HH4A 1CPYA 3CH4B 5JJCA 2IXGA 2CJWA 4HS9A 4P54A 4BYGA 3DE5X 1NTOA 2JHFA 4N8DA 1B1CA 4TKLA 3E3NA 1K7EB 3NHUA 1Y3DE 1I7DA 5C8ZA 3GRCA 5KVSA 3QYFA 5FTJA 5IF9A 2WFMA 2WSLA 3R9KA 1UMBB 2OHHA 3DR5A 5JS6A 2E49A 4ZV4A 3HM9A 3RYIA 3U3OA 1K2WA 1PLKA 2V7WA 3S29A 1EQ2A 4X54A 2VPYA 3RUAA 5KHLB 5P8WA 1E99A 3RFTA 5TVGA 2OD7A 4HX9A 3WLKX 3UFBA 1WXHA 4GX5A 2E5FA 4REOA 2ICAA 4N54A 4CT0A 2REXB 3NOQA 2HHHB 3K4PA 5JV5A 2FZVA 3CJQA 3HVRA 4L57A 4CKBB 3VVBA 5KCMA 5T3UA 2NN3C 5ALGA 4RD3A 1G2IA 2WFLA 2G8LA 3I3SR 1JAZA 2C8KA 3AIMA 2AFRA 2FW1A 2QORA 1O97D 1TD9A 5IXJA 1Y1LA 1R9GA 1YVDA 3WGVA 1N9ZA 3F46A 4W1QA 3L06A 3BICA 3IA7A 2JI8A 1T35A 1X3LA 3FTDA 3KKEA 3RTBA 5L53A 4RTLA 2OCXA 4WK4B 5H4HA 5F5XA 5MF6A 5KQRA 1W88A 3OKPA 3PC3A 4GEKA 2ZS8A 4NENB 1X2BA 3UUWA 5HQTA 2ZATA 4C6SA 1TMKA 5MDHA 4GLLA 1LC3A 3RT9A 5ITSA 3HYLA 1YL5A 1ZFNA 4EZIA 2UZ1A 1UR5A 3N6RA 4OFXA 3TCXB 2YJTD 3ZHZA 1G8JA 1QIKA 1ODSA 1J7JA 1SU4A 3NBMA 4QJIA 5KNDH 5AR1A 5DXFA 4PNHA 1QC5A 3DBVO 3RFXA 2R65A 3N1UA 4HLCA 1PZXA 1C30B 4PYOA 5I9TA 1YC5A 1R5BA 2ENWA 3OX3A 4L74A 4U7HA 2DKNA 1A5ZA 4OJYA 4QRDA 4LZOA 1R88A 2VUIB 3V4OA 4XAQA 1Y8QA 3SBOA 3D2AA 2I91A 1ZI9A 2IXDA 2ZRNA 1RWVA 2XUFA 2G8NA 3KZKA 4RVHA 4N3BA 4RKRA 2ZXFA 3KX2A 4C4YA 4BJ5A 3T6KA 5JXIA 4A0QA 2FLKA 2WINI 1BCSB 2HF9A 5KTRA 4C0WA 1SD5A 4FI3C 3OOSA 4CKYA 3GPIA 3LUDA 2FG5A 1H8EA 2I4LA 4Y1FA 2CJYA 2O50A 2OHIA 4JVSB 4XM2A 5JSKA 1EGHA 4P7BA 1OC4A 1D4OA 3OPNA 4J3NA 5CA1F 5C8XA 1XZJA 1EFVB 1R4ZA 3FWPA 5FNVF 1MCZA 1BW9A 1CY2A 5EZSA 4QECA 3ZLJA 1UDBA 1IVNA 2HRDA 4F2DA 2GCIA 3KQOA 1GXSB 5DOZA 4AG6A 4DJEC 3GLKA 2WWYA 1VP3A 5DXJA 3VYUB 4CKCA 2XA9A 3NNDA 2P4EA 4MYHA 3I9V1 2FW0A 4JQCA 4YJDA 2D4HA 4I5IA 4OBBA 2O8DB 4OLAA 1KH1A 3HB1A 1OLUB 3N6VA 2IK8A 5DFAA 1FVXA 5JO9A 5LB2A 3T4PA 2DFKB 1GITA 3F6RA 2H7VA 1OXUA 2GA9A 4J7UA 4UZEA 5GOZA 3ZW8A 1J5EB 1LY1A 3B53X 2C2YA 1KP3A 4DQXA 4IOJA 2GARA 4PW0A 2FUNB 4D6YA 5TARA 4OO3A 5GM2A 5KCZA 1G8MA 1A5SB 4AMZA 3HZHA 2DR0A 1I7SB 3ZV6A 4R3NA 1T4GA 2PUBA 3ORSA 2UUAB 2UUOA 1A4XA 4KXLA 4NTZA 2BHTA 5B1HA 4E7OA 3TZHA 1E2EA 1QVRA 1XDDA 3B20A 1TRKA 3NNNA 5DHPA 2I4TA 1PL6A 1VE1A 3KKOA 3OZVA 1X87A 3I09A 1OKKD 4HKTA 4Q9NA 2V8BA 4AY5A 4J0HA 1V8OA 4KK3A 3AEKB 4U6SA 5HRCA 4GZLA 1O8BA 2RCNA 3IB3A 1DB3A 1N3YA 3JPWA 3PYXA 4W99A 4BWGA 2IYTA 3I12A 1NVGA 2ABWA 4IOLA 5EHNA 1T1JA 4NF2A 3ESQA 4D25A 1NVTA 4WN9A 5KX5A 4WOJA 1GG2A 3RRFA 1L5VA 1QCYA 1U04A 2GHTA 3ZK9A 3DYIA 1XMSA 1UL1X 2PMWB 3GCZA 4WESB 1H1LA 3PNMA 4AMVA 4CMCA 4BLRA 3T0IA 2VL7A 4HRVA 1MIOB 4FNAA 2XDQA 3W2GA 6AT1A 1SBIA 2P2DA 3LT4A 2YH2A 3MAAC 2DBYA 1NDUA 4K87A 4M0UA 2BSQA 1D9ZA 2NVUA 1N32B 4GBMA 4XWYA 3CNOA 4DR4B 2BZ1A 3MN1A 4HRAA 3PPVA 4GOKA 2Q62A 1FBTA 2IXTA 3EF3A 3DKRA 4EO7A 2NT3A 4B84A 3TSAA 2YHIA 1V39A 2AOVA 2VF5X 1FDOA 1OPRA 4B4DA 2R7AA 1RZVA 2R6AA 2VHJA 2JAOA 1NOIA 3SMVA 4K7JA 5J2UB 1SOUA 3DFFA 4BJ6A 1P9LA 4YR7A 2FP4B 4RJLA 1A7UA 4G6ZA 2J33A 4G86A 3ZZTA 3EULA 1ORWA 3CXUA 3EQ7A 1KVQA 1ZY2A 3M5WA 3WC4A 1GA1A 1JU3A 3KVRA 4BCDA 2E4YA 4GI1A 5M3BA 1YA8A 4HYYA 4X97A 3FSGA 4HMOA 4NCXA 3CCBA 3NTRA 1BOOA 3OIUA 5SY9A 2C5EA 1PJ3A 2FWMX 3KOOA 3DBHA 3VAZA 4MROA 1L4BA 3IUMA 3K6KA 3T7KA 2NPOA 5BUQA 1KQGA 3KVNA 2YV2A 4LC1A 3BIFA 4MPRA 4PS1A 2NYAA 2R6R1 3I1FA 4R1MA 1Y9ZA 4YAUA 1JTEA 2HNAA 2RJ3A 3BWXA 3IKJA 5FV7A 3KHTA 1WDTA 1ODTC 4CG3A 1UPAA 3VSCA 3EQ6A 5E95A 5MFPA 4QVKA 2Z2IA 3KXKA 3OP1A 1G41A 4M9RA 4P83A 3UV7A 1KYTA 5ANRB 1QVVA 1V9CA 3EZYA 1KZ6A 1YR9A 2V0NA 4MZXA 4WK6A 3TZBA 4YXFA 2YXLA 3K05A 1T1EA 5KEIA 3ZDDA 1IOVA 1ZM9A 1NBMD 2CNBA 3HJBA 3KD2A 3LOQA 4QO7A 5AOBA 2OA0A 1XZPA 3U62A 3RVQA 1RWKA 1ONBA 2HB6A 1Q2UA 3P9NA 3B9QA 3Q72A 2WKWA 2GNAA 3A0RB 3LUAA 2XA1A 3E4DA 1J2EA 3F4LA 3GWGA 3UC5A 1V2HE 2P41A 4A36A 1C0IA 1D2AA 4I1VA 1GFSA 1PK8A 3V4SA 4IHJF 1A2OA 2R8PA 2WAMA 4F2HA 1MC8A 3RSCA 1G6Q1 2HSEA 3N0RA 1IG3A 1PDOA 1SC9A 2GXQA 3OPYI 4I1UA 5HMLA 2VXOA 3AL2A 3FJYA 3PIDA 5HFAA 2PFKA 1X77A 2QEQA 5EJMA 1E1MA 5U4QA 3QY0A 5E6RA 2I7DA 1V5EA 3AERA 1O96A 4YRRA 1QHIA 3CRZA 2Y99A 1E4YA 5F3DA 1NUTA 4X5OA 1E1RD 1NASA 1U2TA 3H83A 2QZPA 4OK6A 4F72A 6GPBA 5LD2B 2R4UA 2WY2D 4FUTA 2WWRA 4JC0A 3UHFA 3FX2A 4ARUA 5LD2C 1YTUA 3PEYA 2JGAA 5B30A 4X3OA 4WZ6A 1PAUA 4XDGA 1G8KA 1TTQB 1CVLA 3HWWA 3GCGA 1BGVA 1EIZA 4UDOA 5CX1B 3RS7A 4MV6A 5K0CA 2GBLC 2FX3A 3L0SA 3TR6A 1I32A 4EWLA 4BPBA 1UDRA 1DAHA 1TJNA 2Z5FA 4JLPA 4FHEA 3PUVA 4BGEA 3OEEA 2F90A 5CDFA 3UVEA 3FUVA 1HR0B 2ACVA 3DV2A 3GCDA 1YUNA 4R81A 1N7JA 2YHSA 3I01A 5KREA 4EI7A 2IZ7A 1ADCA 4KAJA 2BONA 4FGZA 2CN1A 4F7DA 3PFIA 2Y1DA 4FWTA 1XZGA 4RA6A 1YBVA 4LXUA 4IM7A 1RLMA 2Y93A 2MINB 2D62A 3QF7A 3DM5A 3LF2A 3HNOA 4F84A 1L1QA 4ZIRA 2OGSA 3LPMA 1YACA 4JOQA 5DX0A 1A7KA 1XEAA 2FEKA 1Z4MA 1TM7E 2RK3A 3LBIA 4PQEA 3KRTA 4P4UA 3I9V6 3EIQA 1XALA 4DR2B 3MIIA 3TG8A 1V1RA 1F17A 3CPSA 1A9RA 3KCNA 4II3A 3OVMA 3ZKAA 2QA5A 4OK3A 1SZCA 2VXCA 4WTOA 4UQLA 9ABPA 2C2BA 2OHXA 2ZAOA 4LZPA 3ZWKA 4C2UA 3R7FA 2H48A 3HDGA 3MCVA 3RTEA 3ZBQA 1BOFA 1UJNA 2F1IA 4A10A 5LNK6 2E82A 3M89A 3ONDA 5E9QA 2RK4A 4MARA 4MRMA 4WXYB 1B73A 4CI9A 3JQPA 1T2NA 1ADJA 3DMTC 3GP3A 1RKVA 1ZN7A 2AZXA 5AK5A 4BLTA 4N48A 4EGAA 1U3CA 4S1WA 4B6SA 4OP2A 2QLBA 3BDIA 1PG0A 2M6RA 3VSEA 2MHCA 4BVLA 1CUHA 4H1TA 4X6XA 4MVJP 5K0NA 3IP9A 3VNBA 2EJWA 2EKLA 3HO8A 4HAWA 1MC5A 4WFKA 3W6UA 2QJWA 2H4FA 1BXZA 1GZDA 3G3EA 1QRUA 1JN0A 5BT8A 3P0JA 2PO7A 4DZRA 2B99A 1LLDA 1NVVQ 1U11A 3P0RA 4AM8A 5C52B 1Q44A 1D5WA 2Q29A 3PFKA 4D41A 1ZWLA 4NAHA 3M83A 4ND6A 4M21A 4E31A 2BP7B 4IMJB 3PA6A 3OCZA 3OQOA 1QIDA 4JROA 5L45A 1CZUA 1YAHA 2Y2VA 2ZQZA 3TEMA 2CWWA 2RAUA 4GIBA 1YBAA 1IHOA 4FT2A 1JVBA 4ZQHA 1P62B 1SUDA 3DE7X 4FHZA 3SF8B 1CF2O 3UGTA 4JLNA 3V3KA 3K32A 2H2GA 2ZJ6A 2V96A 3AEYA 1ORDA 1SKMA 2OZLA 4UEKA 3BMCA 1N33B 3JQGA 3RU7A 3LA6A 3Q7IA 1XE3A 2WEKA 3EHEA 3EFBA 2EYUA 2YWGA 4P3NA 2G07A 1Z6AA 4KYUA 3T7JA 2NU8A 2OBLA 4REQA 4C08A 1WNFA 1MLDA 2LD4A 5I47A 4NOLA 5FUYA 5A6SB 2X4IA 4LRXA 4ONEA 4URHA 2HGZA 3QFCA 3TQCA 5T4EA 3V1YA 3IJPA 3U4CA 2NIPA 3ZDRA 1QO0D 5CLHA 1J4AA 2ZWMA 1CNFA 3A4LA 1JG3A 1NI4B 1UK7A 1TW2A 1UDWA 1E0SA 2CD7A 2X1LA 4JB2A 5CDYA 3HKBA 4OHYA 1PVDA 2IZ0A 2ZRHA 3NM6B 1ID8A 1RJDA 1II0A 3L4BA 5SY4A 3I6YA 5B2EA 3M33A 3IMGA 1AU9A 3V1NA 4CKZA 1G18A 3NWPA 2IH4A 2HLDD 4YCDA 3PFBA 2P68A 3O5AA 3CVOA 4R40A 2NLOA 4FHDA 3DAFA 3LTEA 1QIHA 2R48A 4N9WA 5JT1A 1V8PA 3T9DA 5CCBA 1VGVA 1I0ZA 2FPUA 2H1LA 3CF6R 3F74A 1XTVA 4FFNA 4RTKA 2BFMA 1Z7EA 1G0NA 1OU0A 3A9UA 3CE9A 3EXIA 4RLFA 3UPTA 4ENQA 3ICQB 3OZGA 2WHXA 4I0WB 5T8KC 2WE8A 1EP2B 3QFTA 4P31A 3GNLA 4U2FA 3GPLA 1NVFA 4PX3A 1E9RA 2ZUBA 1J2RA 3HCEA 4KP7A 4D8VA 4DGSA 1IDN1 2JGDA 2RGEA 3WHKA 1QQTA 4OA5A 3TQRA 1XD9A 1Z07A 2FWRA 3DNFA 4C78A 2HA7A 5EIWA 4EYKA 1LRJA 2VS1A 3OFVA 2VNSA 2NZJA 1HPLA 3ANYB 3RI3A 1ODFA 1Q74A 2PDAA 3LIIA 5I3CA 1EXVA 1KI6B 4MTCA 5HRUA 3VNUA 2J9GA 3WNZA 1SXPA 4NCNA 1BMTA 5DYTA 5BYBA 4LE1A 4O4HB 2C8JA 1NBOA 1PO7A 1TM5E 4O4IB 1RKUA 1F51E 1VFNA 5DYGA 4GQIA 2WSSD 2I6XA 3SR4A 2EERA 1SA0B 1QQBA 1WUIS 4OXYA 1NN3A 3RREA 1GUFA 2Z08A 1GGMA 1E3WA 2CE7A 1Z83A 2FDXA 3GV0A 4Q3OA 2ZZNA 2N47A 2WUGA 3A4YA 3QLVC 1L7RA 1XQXA 5H0IA 3OKFA 5LN1A 2A9VA 3AKYA 1A8PA 2XNKA 3JVEA 4B6QA 3KOZA 1R0SA 2GCOA 3V2HA 2H1RA 2ZUDA 3MJRA 2ZP1A 3E8SA 2B4KA 2RHOA 1KI9A 3KTAB 3RRZA 2QP4A 3AY6A 1XCOA 2ECQA 5CFZA 3Q9LA 4XIGS 5JRDS 1OZ0A 3ZVKA 1RZRD 1PJQA 1T1GA 1TEHA 2XODA 3MM4A 3NWBA 4H31A 3BXXA 3EUWA 3UAWA 4J0QA 4CT5A 1LFAA 4CLOA 3H3JA 1E2IA 2HSGA 5CM8B 3TNYA 2VYCA 3GQBB 5I6DA 3GIDA 1XFAA 4EYGA 1IHYA 1IU9A 3O2NA 2QYHA 4KIWA 3LD9A 4JLDA 4WPGA 2VWGA 1AURA 4ZCSA 4K9NA 2I3DA 2Z57A 1KYWA 1R0CA 2AL7A 4B8ZA 3G0CA 4MUAA 3O95A 3PG5A 1QAOA 4Z2YA 1AKWA 3H5IA 1U6KA 2VNAA 4FYWA 3N75A 3QWFA 2IDKA 2JBHA 2P11A 4Q05A 1U0EA 4DZZA 4QFCA 3ZGXA 3GJ7A 3OOJA 5K0ZA 3CVXA 2CHVA 3KDAA 1M72A 1VCMA 2X3UA 3AOEC 1C41A 3O4JA 3WK8A 1TE2A 1ODKA 4UBOA 4HXEB 2Z04A 3HP4A 4RE5A 1DXOA 4YGYA 3RUFA 1KFCB 3RPEA 4CIYA 1DDIA 2AOXA 5FBLB 4F1WA 1GU7A 4WERA 1I1OA 1HOXA 2BR4A 4LOKA 3KAQA 3FDXA 3L0CA 3GFQA 3ZKWA 4XX0A 2HRBA 5J1TB 3V4ZA 2GEKA 1EUCB 1VMIA 3IAUA 3JQAB 2VQ6A 4BE7B 4DTCA 4I55B 5E6SA 1M8PA 4HNHA 4ABTA 4IFEA 3UG6A 3ZDZB 2WJZB 2JJ1A 1YS9A 5T67A 3RK0A 1JAYA 4RIFA 3RROA 5LQUA 4EY7A 5F3WB 4L9WA 1ST3A 3IRUA 2NTJA 3BD7A 3FI9A 3TF5A 2CDNA 1MG0A 1I36A 2CW5A 1E66A 1UPXA 3CW9A 5FTNA 5HM6A 3I32A 4GZ6A 4HG2A 4V0ME 3U26A 3BXFA 2DF8A 1NXXA 2EFEB 3DE0X 2JIQA 3I92A 1VA4A 3A3YA 3HVJA 4PEVA 3HI4A 1OX6A 4YRNA 1QK4A 5TPZA 4YT4A 3LUHA 4Y6QA 4U02A 4C43A 3DH0A 1XRRA 3KVYA 3RKSA 5C9ZA 5FWYA 2W2KB 2FQYA 3REQA 3WGYA