3RIYA

Sirt5 is an nad-dependent protein lysine demalonylase and desuccinylase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
SFTARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sirt5 is a NAD-dependent protein lysine demalonylase and desuccinylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase sirtuin-5
total genus 97
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3riyA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3riyA01
4V1CI 2PANA 3JWPA 1Q17A 3ZGOA 2VBFA 2UZ1A 2OD2A 2JI7A 4BVBA 2PGOA 3CLSD 4GG1A 1V5FA 1MCZA 1U31A 4K9NA 2JLCA 1EFPA 1T9DA 1UPAA 1M2GA 3U3DA 4K9KA 2Q29A 4BN4A 5DGDA 3GLRA 4C78A 2HJHA 4Y6OA 2JI8A 5MFZA 1U2DC 4JUCA 1M2JA 1Q6ZA 2C31A 3GLTA 1PNOA 2Q5LA 5EJMA 1Z8NA 4K9LA 3D81A 4RJKA 5MF6A 3PKJA 4QQ8A 2H59A 4MPPA 1SZDA 2H4FA 4UTRA 1T9AA 3E9YA 2FSVC 4K9OA 1O96B 1YI1A 4Q9DA 3F6EX 5FYQA 1S5PA 3CF4G 1YC5A 5EJAA 1Q14A 5DGTA 1YHZA 2IHUA 2Q27A 2VBIA 1OZGA 2H2DA 4JUDX 2A1UA 5K2OA 4MZXA 3ZG6A 2H2HA 2H2IA 4BVEA 1PO7A 1YNOA 1PNQA 2EZ9A 2QQFA 1S7GA 3IAFA 1M2NA 4UTNA 2VK1A 5BWLA 4UUBA 1V5GA 2VK4A 2H4HA 4Y6QA 3PDHA 4BVHA 3ZGVA 4BUZA 2A1TR 3U31A 2DJIA 4J1TC 4L3OA 4UUAA 4V1CA 1DJLA 4G1CA 4IG9A 4TWJA 4I5IA 2JLAA 1SZCA 1OZFA 5EJ7A 4RMJA 2WVAA 4V1CB 2EZUA 3CLTD 4KPUA 1ICIA 2QQGA 4FZ3A 4KXQA 1D4OA 4RMGA 2JIBA 2Q5JA 1T9CA 3EY9A 5EJ8A 4C7BA 5DEIA 1V5EA 4BVGA 2H4JA 4FVTA 2WVGA 3EA4A 4JU9A 2NYRA 4BV2A 2AG0A 1HZZC 1J8FA 3RIYA 1PVDA 2FR8C 4J16C 5EJ9A 4X3PA 4BN5A 2JI6A 4BV3A 4IAOA 5BWNA 2IHTA 3CLUD 2VJYA 4R8MA 1YTLA 1NM5C 4QPZA 5EJ5A 4HD8A 4UTZA 3FLMA 2VBGA 5EJ4A 4L2IA 3HWWA 2OO5C 4FEGA 4MPRA 1M2KA 4ZP1A 2Q5OA 1O97D 1QPBA 5BWOA 2OD7A 4RMIA 4Y6LA 4MPJA 4COKA 4UTXA 3GLSA 1MA3A 4GP9A 4K9MA 4X3OA 4K9QA 2OD9A 2JI9A 1M2HA 1PTJC 1JSCA 4HDAA 3OE1A 2H2FA 4TWIA 4JD5A 4JUFA 2VK8A 1UPCA 2WVHA 2OORC 5FEMA 1U2GC 1YHYA 4K9PA 4F56A 2EZ4A 3JR3A 4QELA 4UU8A 4UTVA 1UPBA 3FZNA 1BFDA 3D7KA 4JUBA 3PKIA 2H2GA 4BVFA 2FWNA 1YI0A 1XLTC 3EYAA 3FSJX 4RJIA 4JT8A 3RIGA 4UU7A 2V3WA 4KGDA 3K35A 4JT9A 1EFVA 3IAEA 4JU8A 4GPEA 4D5GA 5D7NA 2Q5QA 1Q1AA 1PYDA 2W93A 3CLRD 4GM1A 5MFPA 2NXWA 2EZTA 1OZHA 4F4UA 2IHVA 5EJ6A 1N0HA 1POXA 4JSRA 4FEEA 1PI3A 3HWX1 1YBHA 4GM0A 5K3SA 4JUAA 1Y9DA 2AG1A 2PGNA 5MGNA 5IMSA 2B4YA 4IF6A 1POWA 1U28C 3F6BX 1OVMA 1PT9A 2EZ8A 2BRUC 3LQ1A 2Q28A 5K6TA 1YC2A 4O8ZA 3GLUA 1ZPDA 4ZZIA 1T9BA 3D4BA 2FRDC 2X7JA 4GM4A 5AHKA 4RMHA 4D5EA 5K6RA 4RJJA 1E3TA 2UZ1B 4MQ5A 2FN3A
chains in the Genus database with same CATH superfamily
4X44A 3PGVA 2FMXA 3EH1A 2PUCA 3NUGA 4D44A 1DIBA 4F3TA 4TTRA 4GGPA 1V1RB 1ZD1A 2EBWA 1MO3A 1T2AA 2MJLA 1BVUA 3JAWA 5A9RA 2NV6A 3EDOA 3M1LA 3Q9SA 5CVCA 3LNTA 1UJMA 4MX8A 3SYKA 4DLYA 1NBAA 3M3HA 1UJ4A 2VDWB 4S1OA 2IS6A 4GZMA 1V7QA 2Z1DA 2RHJA 5DNWA 1OHHD 3BH7A 4Z3OA 4IXNA 3MJEA 1AC5A 5PGMA 4WNAB 1XVTA 2Q49A 4L08A 4AKSA 3O75A 4HO1X 1N2CB 4BRWA 4YRDA 4HMQA 3ZS8A 3LP5A 3AUKA 1P4RA 4D3FA 1YBFA 5FYQA 3NP7A 3LQ2A 5TRTA 4EHAA 1KVTA 2VNHA 4GQBA 5FL7D 1OIXA 3FTPA 2VHZA 2X15A 2FR1A 2A57A 3NBAA 5C1IA 4K8RB 3ZCQA 4JLJA 5EIHA 2QE6A 1KE2A 1OC2A 1U9IC 4K86A 2FMFA 1XF9A 2ZEJA 3EZNA 4MCAA 3LX5A 4XTCS 1JT9A 1BWRA 3SBEA 3IAEA 1H8HA 2ZI5A 3RJ5A 2QZSA 1HLDA 5CA1A 1TECE 2FGJA 3LY5A 4UOEA 3TUIC 2NIPA 5A5GA 4LEIA 4PVDA 2QQEA 3ZV4A 3AEZA 4OGFA 1F4LA 1N9GA 3G2MA 3S1LA 1T3SA 3ZUGA 4BAGA 5HRAA 4TSFD 1U11A 2R3SA 4L28A 4RQUA 1PN3A 2MMCA 3O3OB 3K2EA 1JG6A 4FILA 4U7HA 3E1SA 4ALIA 1WS6A 4JFRA 2AD1A 2WPNA 4RVNA 4CDGA 4FINA 4TYYA 3B20A 4N3CA 4KBFA 1SBZA 1NAIA 5LQMA 2OFPA 3DFFA 4H15A 3OIYA 3TAHA 2Y66A 3WLHA 3CKLA 3O1JC 5CVJA 3AVTA 4NYJR 2R751 1AS2A 2BKUA 4GI3A 4ZT3A 5EE5B 1CPYA 1SKYB 4I81A 3QMWA 4TOIA 4CU2A 2X13A 5IG2A 4LJLA 1TJ5A 1Y42X 3TSZA 3H2JA 1MAAA 4R2LA 1FFAA 5IKOA 1W25A 3KTFA 4LV5B 2GXQA 4J0GA 1E61A 2GF9A 2OCBA 3DVAA 2J9ZB 4OP3A 4BB0A 4C7XA 1L5HB 5D3MB 4UXIA 5BV1A 5EIBD 4PRLA 4DLAA 4G0PA 2ECPA 2OK7A 4IMIB 4WBNA 3F1KA 2CJWA 2HMTA 221PA 2JCGA 3X0DA 4EM6A 4FWIB 2PPVA 1UKVY 1YAJA 3NBXX 5BW5A 5KJCA 2ZUVA 5EMLA 2OZLB 2Q5QA 3U4QB 3VZQA 5JXHA 1I2MA 3AJEA 1NW4A 1SU7A 4M0PA 4NOLA 1G6Q1 2HBRA 2XE8A 1E5LA 2BFDA 3F4LA 4GMXA 2B6NA 4TVKA 4E7OA 2C7VA 5AI6A 2A0XA 2R65A 3DDCA 3EF1A 1KDVA 3SICE 3OU6A 4NFLA 4RGYA 2EEZA 3AR8A 5TLSA 3I6MA 2WDPA 1THMA 3LU1A 4JP3A 2G5PA 3HRKA 4Y2GA 3T52A 1YJXA 1OLSB 2IZ1A 3M5CA 3WDSA 5BUZA 1P2VA 2PE5A 5MHTA 5CEFA 4YDHB 1E2BA 2CW5A 3HCCA 3DVQX 5DT9A 1NW9B 2GK3A 3EW9A 3L1VA 4UAUA 3IAXA 2YQ4A 2QVLA 2JI7A 1TEHA 4HS9A 3EISA 4P31A 3UAYA 4Y1RA 1RJGA 4BQRA 1T9DA 4Y1RB 4P7JA 5REQB 4KR9A 3TN7A 2HDWA 5IAOA 2J9GA 1WXIA 4BKRA 1N6RA 4GLLA 4HYEA 3IS3A 1UH5A 3R74A 2QORA 1VG8A 5F5NA 1Z0IA 4RPJA 1J49A 3KOMA 4RTSA 2OCAA 3H16A 2VP3A 3OKPA 1JXMA 4ZAZA 2Q0SA 1ZHHA 1OLSA 3DJYA 3E22A 521PA 1QV7A 1SHTX 3QFTA 1GRVA 5FBLB 4QDXA 2GHIA 5E8RA 1SR8A 1UKAA 3BICA 3DXXA 3HEBA 4QQRA 2EATA 4NPHA 3KUDA 1FE8A 4IQGA 2GYUA 3TRHA 2C8VA 1AURA 3QNMA 4AF7A 1EE2A 4EJ0A 2JDIA 3FRIA 4GS5A 4RLQA 2MSWA 2QR3A 4TWRA 3G8BA 5G1PA 4DQLA 5A03A 2F59A 3JARB 4UCFA 3RK0A 5L45A 2WYWA 2NP6A 4JLSA 2V65A 4H2DA 4CNBA 3ERCA 1KZ6A 3OOYA 4YAWA 2GD6A 1H94A 4U1RA 1JJIA 3WK6A 5HRCA 3FRJA 2A6PA 4OAQA 4XIJA 3RGWS 4OA5A 5JXJA 1VRCA 1SWVA 1KJZA 3W05A 4LHVA 1ZRMA 3RLFA 1C41A 1SQ6A 4MITA 5LQCA 3DCYA 3V2GA 5CITA 1EFDN 3QUCA 2M1ZA 4N1AA 2QPLA 3T7EA 2VT6A 4EKDA 2FP3A 5KNCH 3WHKA 4OLJA 4K2HA 4AU1A 1G3RA 5DV9A 3O4IA 4QZVA 3W2HA 2AOTB 3BMQA 2AB0A 2CDAA 3CISA 2H2AA 3I1IA 4HNSA 4DLTA 5HF6A 1U7PA 3C5WP 3CRZA 2B5WA 2P5TB 4GHWA 4CW7A 1T1SA 2BLLA 4QGBA 3IILA 4DR2B 3ZU4A 1DZIA 3FKSD 4WXRA 1IUPA 4FHFA 3S2GA 3WTCA 1NU8A 1IOWA 4GZLA 4J76A 4L50A 1W30A 4LMAA 1QC5A 3UXYA 2C2BA 1DB3A 2HFKA 2W2QA 3H99A 4FTWA 3RODA 4KNVA 2D62A 3EPKA 2B1GA 3G8DA 3L0SA 1X1CA 4XM0A 3JR3A 3B1JA 2X9QA 1X9GA 3FZNA 1RYNA 3W1VA 3F6SA 4V0QA 1UOQA 5B4UA 1WUKS 3MJDA 1PJCA 1FVXA 4Q9JA 2OHXA 3IEIA 2LTAA 4WOBA 2I1LA 1NKTA 2JFPA 3IVMA 2XCSB 5D87A 3LRXA 4QFBA 1W85B 4BU0A 5JQGB 2O6LA 3OIDA 3AWDA 1BEUB 1A04A 1FS6A 2R62A 2V55B 4B71A 5TMDA 2FEKA 5U4QA 3AJAA 4FPXA 3KXKA 1NVDA 5FR2A 1LRJA 1V0JA 4DEYA 1ENZA 2BBSA 1YMQA 1O8BA 2P41A 4OHFA 1LTHR 3RROA 3DLIA 2ZSBA 4CI9A 8LDHA 1Z75A 1YC2A 1X0XA 4WNAA 1IHPA 1VCNA 4KWEA 1L4HA 4NMWA 4DRXA 3WL8A 5IMBA 2ZTUA 3WZMA 2P79A 1NRXA 6Q21A 2OVFA 4N5MA 3NKLA 2EJCA 1KI6A 2B21A 3CPJB 3PR1A 4TUYB 5SZIA 5DE3A 3DOIA 3SQXA 3S8YA 2Q99A 2I2AA 1JG2A 3OX3A 4H31A 5B7QA 3GEBA 2GBGA 4JUCA 3WMEA 4P7BA 2Y8EA 2BMFA 2GWHA 4CLEA 3WGLA 2QZ9A 4L0QA 1NDUA 4HPXB 3FPKA 5KX5F 3V2HA 1AU9A 5BSTA 4FQ5A 2C4WA 2ZYGA 1EE1A 4ZYZA 5A4KA 2ZZMA 4YUYA 3AG5A 4YRCA 5AW4A 5K8LA 1RAGA 4WD3A 3VPDA 4UHDA 3BK2A 1QBGA 2PQ0A 3CW2A 3OLWA 1G21A 1HH4A 4L7VA 4JQOA 5EEHA 3VHQA 2DG2A 4R8LA 5FPSA 1G5FA 2E7ZA 4WH0A 5DN6A 5KVVA 5CIQA 2O0LA 4YPFA 3WB9A 3HMQA 2W2MA 2OC4A 2R1VB 3ABSB 1IQRA 5DHUA 1QAMA 3DAPA 4CUZA 3JYPA 3KAJA 2X2FA 3PF9A 5AXCA 2YXPX 1BE8A 5BV7A 2XRMA 1OH7A 2FDCA 4YV7A 4LF5B 4RGBA 3EOZA 5TVKA 1FVOA 1T0UA 1U0FA 1G2IA 1ZM2A 2ZM6B 3PXAA 3NEJA 1X92A 3GWGA 5F2NA 1EP9A 4LZNA 5HYVA 2Q3MA 3T3MB 4A6XA 1KSJA 2ZTHA 3SQOA 1MVOA 1FFXA 4JS0A 3BMNB 4JU9A 1QYCA 3Q7EA 4H16A 4XR9A 5B1SA 5ICCA 4BV2A 4QNMA 1N1MA 2ID8A 3P20A 3RIYA 2XZPA 4GF5A 1H9AA 4V0LA 1GTMA 2GAJA 4A36A 1A4IA 3VA7A 3CLUD 3QKRB 5AW5A 2ZR8A 4DKXA 3VR6A 3H0EA 1P1JA 1L3BA 2BD0A 2Z8YA 3PL5A 4QBHA 5KTKA 1T35A 1H4QA 1NFRA 4IEEA 3BE8A 4EG0A 1Z13A 2XXAB 4B6PA 1B0PA 1GRQA 2ZJBA 2B1JA 2BJHA 4L8FA 5DNEA 1SKMA 2HN9A 1U9ZA 5F1YA 3CUYA 3U17A 4OLAA 1TA4A 3HKBA 1JKMA 1NONA 4BZQA 3FMFA 5D6OA 3M4ZA 5HE8A 5K3CA 4F9EA 1UWKA 3VPSA 1ULAA 2C94A 1XPUA 4BEJA 2O2EA 1GL3A 3E3LA 1EGQA 1JLRA 4RY8A 4BWYA 5JMTA 3COVA 4CQNA 4CMBA 3WG9A 3HKCA 1N2ZA 2WF8A 2ZS7A 1GZ3A 5C81A 4IS3A 5TR9A 2ATCA 2FN7A 3MJVA 5KCZA 2IH4A 3KVNA 1YTUA 5C4MA 2O59A 4DTIA 1E9SA 2AR0A 4FDLA 2HNBA 1W46A 4MIEA 3JR7A 3PPWA 1YBHA 2NU7B 4G85A 1U3TA 2PGNA 2VG8A 2XF2A 2VDPB 1POWA 1SVNA 1C3JA 2HWUA 2IUEA 1VJ0A 2Q6LA 1PHPA 2YHIB 3H4MA 3HN7A 3IERA 2Q1WA 3GEPA 3GO4A 2PRJA 4O1MA 4XX0A 3VC7A 3ELUA 5J5AA 3B1FA 4B75A 1UBHS 1FNNA 2UZ1B 2PS9A 4XSHA 3AEKB 2XVXA 2WG1A 3L0OA 1JNYA 4IIEA 1ZD8A 5KOHA 3LT5A 3UMRA 4AAYA 1GRCA 1FDSA 3DT6A 2RHDA 8ADHA 4NSNA 4MO2A 2W2LA 4FUQA 1KYXA 3FOBA 3ROTA 5EZYB 4XR4A 1VJ5A 4YS6A 2W43A 3DEIA 4TTSA 2WNSA 3T5CA 2FPIA 3RJZA 4BZZA 4ASUD 4Q05A 3HTXA 5EJMA 3TQFA 3AF1A 4KQWA 3MCTA 5CA0F 1NQXA 3K4PA 5FI1B 3KLPX 4TLAA 1OC4A 1OZ0A 4QRHA 2HR1A 1HY3A 2GEJA 3D2AA 4UXJA 2LD4A 1CUCA 4RIHA 2MYPA 2Q2NA 4W5NA 4YJ2F 3O26A 1PS0A 4DMHA 3G17A 5E2IA 2NO6A 2VYND 3NV9A 4BFSA 5KJFA 1A9QA 2ERCA 2GHTA 2KS6A 4K9SA 1G63A 3IAFA 2WF9A 3NONA 4TV9F 2PMEA 3GJ7A 4IRXA 2C1ZA 5F4BA 4BX8A 4EP1A 4BGDA 1I3CA 3PFHA 2FW0A 4EJ6A 2OQ2A 2YNMD 1KMMA 3GBVA 4TMKA 5FFFA 3OZXA 4I5FA 4S1PA 4ZO9A 5EP3A 1FDOA 5AR1A 1D2CA 1KFKB 1KYWA 1N5IA 2ZWPA 4LDJA 4RPKA 4W9NA 5HDBB 5J3JA 3NWBA 3PL1A 2QPOA 1WD7A 2DBVO 3FUTA 5JZ9A 1H2WA 3RUHA 3UXEA 3LDHA 3ELBA 5EXTA 2ONJA 3WWDA 2QVBA 1P7ZA 4UASA 2JCBA 2DWCA 4C4ZA 1ISGA 1GADO 1UDRA 1WDTA 3QWAA 5EERA 3RTGA 5EJ4A 3KZKA 4M6WB 4FMBB 1JYSA 5BV2P 2XMBA 3KQWA 1VA4A 4C0HA 2PFSA 3ZHBA 3N8HA 4IIJF 4UUMA 3U0BA 2QG4A 5KYYA 1PLLA 3PFWO 1AK9A 2OKCA 2P5UA 1QE0A 4HLCA 4DJ5X 3ZW8A 2R5WA 5DXJA 4F11A 2C57A 2IBSA 4R3UC 3OLXA 4L9SA 4LMPA 5JSZA 4DA8A 1XD2B 1BOOA 1RJFA 4JEHA 3U9SA 1VMDA 4K9PA 2JFZA 4NBNA 3R7NA 2CNNA 1E9FA 3OZFA 5DMHA 4X1IB 3ZWMA 3FCEA 2A9QA 1PS8A 4TKUA 1E3IA 3R8XA 1BHO1 3QVXA 4GNRA 3Q87B 1CR6A 4EDFA 2R8ZA 1SBYA 1VIAA 1TQ6A 2GR9A 3FKJA 1ZW6A 4BMDA 3NHFA 4BJHB 1G6HA 1Y3FE 2YW2A 4ND4A 2EFCB 1EQUA 3VYWA 3EASA 4F4UA 4PCVA 3WL6A 1M5TA 5AM1A 2XCIA 3PRHA 3JQ7A 3WFZA 4LRXA 1S1CA 2QSUA 2XLCA 1EWKA 4CQLB 5CG1A 4TTJA 1PT9A 1OZAA 5B53A 3GJZA 1IJFA 4Q0MA 3BGIA 4LHXA 2EP7A 3RSOA 1P0FA 1FW8A 3VSCA 1N8NA 3R4VA 1U02A 3O8CA 1YO6A 2VYNA 3L6BA 4OXIA 1W4BA 1BDBA 4Y9SA 3WIUA 3RD5A 4BBJA 1TIBA 1UOOA 3O8QB 3ZS9A 2J0SA 3V9PA 8AT1A 1T8YA 4MARA 4ER6A 2F3RA 3LKDA 4WASA 3FMPB 1U9JA 4KPEC 2C4VA 4AZTA 2QNRA 2HRZA 1CS0B 2YN2A 4O63O 1CZUA 5DW0A 1OWLA 4EG7A 1JHVA 4WCFB 5LZ7A 3OP1A 1NXPA 2JS7A 5KMGB 2CZGA 5C5IA 1N8KA 2WIKA 3D8HA 3GFVA 4UBOA 1WCWA 1ZVMA 1TDJA 3TBHA 1E6KA 8OHMA 3ZV6A 2WWFA 3WGYA 4E3WA 2FPRA 2Q27A 3IAM6 5A4AA 3WLIA 1U5AA 4FN4A 1DC3A 1Q1ZA 3PHGA 5KQSA 5ADWA 3G49A 4X8LA 4BVEA 1N75A 5AVTA 1YNOA 3M6VA 4JXKA 1NMYA 1UOPA 4Q9AA 4U7DA 3UQYS 3IJRA 2HJGA 3J7AC 1KETA 3ETGA 2RGEA 2P3QA 4HNRA 4Z49A 3THWB 2GCIA 1Z9BA 3H42B 1KK1A 4LZZA 4ETNA 5FV4A 1EBUA 4IHKA 4R9NA 3JQ6A 1OWMA 3PVCA 4DV7B 4IF4A 2B99A 2ALJA 3RRNA 4Z0PA 3BYZA 3NHJA 2FMHA 3DXYA 3FAKA 5JY1A 1P9LA 5CJ2A 1QTIA 5IRCD 2I87A 2XGSA 4EX6A 2RD2A 4M8SA 2WZCA 2PXAA 5EY5B 3ZZ0A 1CUFA 1E4YA 2CD7A 3OECA 2KBFA 3GAZA 4MKFA 1NHWA 4YDSA 1AJEA 1PUIA 3MWEB 4Y2UA 3ZIUA 4EQZA 1ONPA 1EFPB 2TRSB 3ZNOA 4OAOA 2NADA 2VCHA 1TJNA 1MU0A 2O20A 3B3FA 1MNAA 1RXYA 4IIVA 2Q4RA 3WVNA 2OZVA 1N78A 1XZLA 2HA6A 2J5QA 4JWKA 3BRQA 5KYXA 3ESCA 4XDGA 4RV9A 2ZQZA 2CJPA 3TFOA 2QSYA 2ISSD 2FWAA 1IG0A 1FRZA 2BP7B 3JASA 4JUFA 4GEGA 3QLTA 2HSEA 4OQEA 1KDYA 3LBIA 3ASYA 4AB1A 2HTEA 4IVNA 3A06A 2EZ4A 4DRXB 1VLJA 4QPCA 3PQ3A 1V26A 4JUBA 1H3FA 1Z7BA 1HO3A 1AB5A 2CZQA 3G8AA 1AHPA 1LI7A 3N0RA 3NIGB 3QUSA 2B30A 2OB1A 1DC8A 1H8HD 1ST3A 2P9EA 4RM3A 4QVIA 3DE3X 3AR6A 4KZKA 4L5CA 3MF4A 4QDJA 1TA0A 1E9CA 3D8RA 3K1TA 1UMCA 1T6XA 3BM5A 3DYVA 4P9NA 1HNZB 1YCGA 4CKEA 5MGNA 1GUDA 1FMJA 2GO7A 2Y9MB 2PRKA 3EFOA 3O8NA 1P1RA 4PTLA 5AOVA 4TKVB 3WQHA 2BDUA 1XTQA 1T9BA 3OZEA 5ALYA 4RMHA 1CLEA 2PGLA 4AFNA 3NFYA 3C3XA 5B6IA 4NZNA 3RRXA 1W75A 2V9PA 3DGFC 3WL5A 4B4WA 4CEJB 3Q8WA 3ICEA 1F2UB 2QYSA 1VJDA 2B2CA 4MW5A 1U2PA 1FX1A 3LCMA 5JCPA 1DAFA 2HSZA 1L5QA 5JRDS 1W5EA 1SEVA 2B4KA 5JFGA 1NBMD 4YROA 4AKGA 2XWBF 3WLOA 3HBNA 4EA8A 1NLZA 3V48A 5DI3B 4CV2A 2RGAA 1DIOB 3DPSA 2C07A 4MCHA 1BMTA 5C8YB 4E5MA 2Q8QA 3VDXA 4YCDA 4UBMA 1QIFA 1MDBA 2G5TA 3EE6A 3LIIA 1B43A 4GSKA 4JBIA 1J1UA 3VKWA 1JEOA 2A3NA 3UBMA 3KJIA 1SD1A 4R1LA 4YLGA 2ZYUX 3R9XB 2CBZA 3VHXA 3CNLA 3TBFA 2XOXA 3ZIAD 2MT9A 1Z74A 2IZ0A 1KI8A 1BXRA 2XSZD 2EFDB 2R8OA 3F2IA 3NC1C 3ICOA 3HCNA 4LHSA 4EUFA 5JSFA 2JLWA 1ISSA 1PWXA 4GKVA 1RXSA 5EJEA 1RYZA 1GTJ1 4Y2YA 1FTNA 3NOVA 4UQOA 1GEGA 5EXPA 5AUNB 1RLUA 2PUHA 4F1JA 3F47A 2A5LA 1E1NA 1PFQA 2HF7A 2O3SA 2X5JO 1JFLA 2JA1A 1LW6E 2R8EA 3OMWA 2BH9A 3CUKA 4LPKA 3ZQ6A 5HBRA 4EO7A 5FH9A 5CFQA 1IXYA 4E12A 1TCBA 3GYBA 4KBGA 3HA3A 3W77A 4I14A 5JHGB 3IDZA 3DOCA 4M49A 2ODNA 1E1CA 2XVMA 5J5CA 2JLUA 1YVDA 3ZBQA 5EJ8A 2DERA 1FBNA 2NLOA 3CN7A 3HR4A 1J07A 3W5VA 2RBEA 4BO3A 2HFJA 3L84A 1XJ0A 4AZ3B 2ZDGA 3KOWA 1P5JA 4M7OA 4S3MA 4EI8A 1E9EA 2NNWB 2WILA 4PPYA 4QPDA 4YRTA 5J40A 3ZKWB 3Q8KA 3QUQA 2IDKA 4BQOA 2IH2A 4UBJA 4JN6B 4R2MA 3RSHA 3G2IA 1QOQB 2Z5GA 5A1JA 2G71A 4GICA 4PWYA 1WMDA 1H0HA 1YQGA 2V7TA 4I6EA 4EX7A 2NPIA 1MA3A 2WK1A 4GOKA 3I2FA 2ERYA 4R83A 2XE7A 2YOGA 4QYXA 1Z8DA 3ZWXA 5C7LO 5IDWA 3WJ2A 3PA8A 5LQUA 4M7PA 3BAZA 1NVWQ 2UVQA 1DQZA 3C8UA 1DTSA 3FHJA 5DYYA 3UMSA 4V2UA 4PSAA 1A8IA 2IV3A 5B30A 3L8EA 2ZJAA 3VDNB 2Z8XA 1X1AA 1X7HA 3RIXA 3HUDA 1D2RA 3FX2A 3WO0A 4I2VA 1VPLA 1GZHB 1HEIA 1T9GR 2C4MA 3RHTA 2CNKA 3K96A 3O31A 4B0OA 4BJ1A 4CLDA 5EIEA 5J4LA 4MHTA 2ST1A 1Y8CA 2BEUA 2ZAMA 2ZIXA 3Q5DA 2O0HA 5JO0A 3UMMA 1K0FA 4R1TA 1D2AA 3L06A 4EBFA 2XA1A 4I1OA 4J7AA 4I1VA 4C4OA 2BFBB 1SKBA 2FPUA 2A7QA 3OI7A 4YLEA 4F3CA 4PE5B 1DJNA 2CEAA 3QKUA 5ITSA 1K2WA 4B3RB 2HPHA 4EPYA 4EGFA 2FUG1 1IN7A 4I1RA 1N3YA 5T3UA 1X74A 2ZAOA 3VTZA 3VH2A 4ZREA 2BKEA 5BYAA 4QE3A 3NVDA 3Q4GA 5DGHA 5EGNA 1J8DA 2RKOA 3I5YA 3T0FA 4OFZA 1Z7YA 1MKYA 4GYJA 4DJEC 1G9SA 1N5OX 2WJHA 2P4UA 4PX9A 1XYGA 4F1KA 3OOWA 4Q3NA 1WXGA 4A15A 1VSTA 1KK3A 4ERXA 1LQTA 2QLNA 5IVPA 1GZ6A 2ZT7A 3SU8A 2QAGA 1V1JA 1XU7A 3E3NA 5CXSA 3IBFA 1PLJA 1GTG1 4FMCB 2PAAA 1O6CA 1HG0A 2X2PA 4NE9A 4C1BA 4NBKA 3CRW1 4J4HA 4U2KA 5AVVA 4OK3A 1JU4A 2X0KA 3L7JA 1OXUA 4YIKA 3SKXA 1O0SA 4POAA 3A6ZA 4H9GA 1FSSA 1NJGA 2IE8A 3ADOA 4UHEA 4XGQA 5HJEA 5IYZA 1OU4A 5FO0A 1WV0A 4B3CA 5FOUA 3EC1A 1NNEA 4S1VA 1PE0A 4RZXA 1HT2E 1C80A 4BAZA 2B5OA 1W2GA 2R7LA 3EXG2 1LWOA 1KRHA 2R2GA 2HT1A 3P0IA 5F7ZA 3INTA 1SIWA 1CQIA 3ST7A 4OV6B 5C1PA 1EFHA 4RLFA 2QQFA 1JHZA 1S9HA 4QKQA 1E79A 4HB0A 4PC3A 4UM9B 2M9MA 5KSOA 2PBRA 2RI0A 2JFNA 1XN1A 1XLUA 4AKEA 3IMFA 2FPPA 5AVZA 4AYXA 1NC3A 2C1XA 2IELA 2JFHA 4L5AA 4YJHA 1SCIA 2Q5JA 4CR6A 2ZIGA 1OSNA 2B9EA 1GG2A 1AO3A 3KKEA 4WERA 3RUEA 1ORVA 4JGGA 1MT0A 3PJEA 1L8LA 1BD4A 2ZYRA 3MCAA 4AY2A 1ZNZA 1BA2A 1QK4A 4D8TA 2UUCB 1HQYE 1OWNA 4N0EA 3B2QA 4Z86A 1PK7A 1M0SA 1V48A 1CJSA 3EUFA 4ZYTA 1TZKA 5A3SA 3V97A 3G9QA 4F92B 4AMYA 1CUVA 1XK7A 1ZU4A 5LM3A 2QENA 4MRSA 5JNWA 1CZNA 1QO7A 1B23P 2QGFA 1LDMA 3UAVA 5CCEA 3AM1A 3RYTC 5T6BA 3PITA 1NVUQ 1JXAA 1E7RA 3VR4A 4A5SA 1MENA 3SZMA 3IQXA 2DPMA 3SR0A 4X1YA 4BGVA 5KU7A 1QX4A 1GNTA 1WY5A 4JC8A 4L5JA 4F72A 3FNEA 3VU9A 3AVQA 4RH0A 2O54A 3M5PA 1NE2A 4JD5A 4PZUA 3ROGA 3F7MA 3P9RA 3U3OA 1QIDA 4LQ4A 4O8CA 1M74A 1WABA 3WE7A 4O2AF 3KJEA 5EWJA 5B3KA 5HJ7A 1R9MA 4DG5A 3U6KA 3TLMA 2BM9A 2BZ1A 4I8XA 3D7KA 3NVAA 1PW7A 7REQA 3C8ZA 3BCSA 1VB5A 5JLAA 3B6ZA 4IJKA 3AEQA 4LZJA 4RF2A 1RIIA 1S2GA 3ZDRA 3WB1A 3ZXIA 1K7CA 3CF6R 2OV2A 5D1HA 4HAXA 3RVSA 3SX2A 5I7AA 5BOSA 2R2AA 3B1ZA 4FQ8A 4PXYA 3TOSA 4D5GA 2ECOA 4TYNA 4LDZA 4MH0R 4LVCA 2AXEA 2XB2A 2NWQA 2PZEA 4OEHA 4D4IA 4EDHA 5DJ5A 1IM8A 4XA8A 2HEIA 1NLMA 4M9UA 4N49A 1EM8B 1K7EB 3KTAA 2CKMA 3CHYA 2CXXA 3DXFA 1KEEB 4RS3A 5FWXB 5DP2A 4Q6WA 2ZLBA 5BYBA 3UJAA 1L5GB 4D42A 2O8EA 3EOAI 2NSJA 3UOGA 1N25A 3NDIA 5JW6A 4NOKA 3PQ4A 1P0PA 1L7VC 1U7HA 5DX1A 3RB8A 2H08A 3EFBA 1AX9A 3ROZA 3X1MA 1FDWA 1Y5LA 4CM1A 5HQTA 3CE9A 3PZRA 1ZM4A 3GFFA 4IIJA 3J7TA 2FCRA 4Z1OA 3C6YA 3NBYC 4QFMA 5E9QA 1ZUNB 3FTNA 3PCRB 3D4PA 3ADKA 4TV8B 2X23A 2OBYA 1TKAA 3E5MA 4FM9A 3V4LA 3A9TA 3NJRA 4YUZA 3H04A 4CDMA 2JGIA 3GLTA 1PNOA 1PR6A 5AJWA 1GPLA 1YK1A 2HRBA 4ZMSA 3V6LA 4OCZA 2ADFA 4HNAA 3K0AA 2BZGA 4IV8A 4JH0A 1FSGA 3QH4A 5TV2A 4JP1A 2C00A 1GVHA 4D9FA 2I2WA 3VPCA 2J4FA 1F8FA 3CRMA 3DR3A 1Z4JA 2A5DA 2H48A 4KSBA 3UJ8A 1AKEA 1R6VA 2QU8A 4CKWB 5MN4A 3KLOA 1JJFA 1I3LA 2ZU0C 3AHCA 1X3SA 4IIJB 3EDCA 3GLGE 1MRZA 3IFSA 2CL0X 3QTLA 2HIGA 3HKEB 1U1IA 4RK4A 4XWTA 4YNBA 3SJCA 1YB1A 4GBMA 3OPYB 5TGZA 1MPTA 2PPLA 2HMYB 1UEJA 2ZS8A 5KJEA 5DSZA 3SLKA 2Q50A 3PNVA 1YKSA 4MV3A 3UJNA 1JHAA 4YCBA 4Z0NA 2GN1A 1CZLA 2ZSKA 4RDXA 4ZVQA 2VRCA 4KPUA 2VT7A 4GNKA 4AY6A 1F2DA 2FSUA 1Q11A 1T36A 3DDZX 4I3HA 2DFKB 3PE4A 1RRCA 1KQNA 2GJ4A 1XN4A 2NYRA 2Q6IA 4INAA 1LF5A 1Z5GA 3IMCA 4O2RA 3FUCA 5D5HA 5K0GA 3T5DA 1CY4A 3AKEA 4EJFA 2COUA 1QGOA 1R4MB 3E3MA 4TMVA 1DEOA 4WKBA 4N47A 1GXSB 1EI9A 2V7PA 4JBNA 3AEQB 1LPNA 3ZHOA 5F2OA 4Q4LA 4XSGA 1QGAA 3ZVRA 3GG9A 1CRQA 3ZDFA 3H0CA 4KMSA 4KXUA 4CCSA 2DKNA 1GU7A 5KNCD 1F20A 1TM1E 1S4MA 2LV8A 2W4MA 1FQJA 1DXQA 1CD5A 1HRDA 2HMAA 3GJYA 4QGGA 4BP9A 1LTQA 3ZDQA 1KWGA 2HJ9A 1PZGA 3JYLA 1EDEA 2J1LA 1XRJA 2FW6A 2H85A 3VU9B 1A77A 3HYRA 5A3QA 3CLUC 4AY3A 2HDHA 2PR7A 2R7KA 5CCXA 3EIEA 5H3HA 4O59O 4B5KA 1MEOA 3MN1A 2X6TA 3DAGA 3OF5A 1YDFA 2X0DA 3QA3E 4MJ7A 4MUJA 4OOFA 4PBRA 5TQ2A 4PAMA 4BLSA 4QIHA 4IY1A 2HXYA 4M21A 1BYIA 4Q3EA 3NJ4A 2R8XA 4IIGA 2GBLA 3LY8A 4EKNB 4IGFA 4F45A 5LZ9A 3ZWQA 4XQCA 4WA8A 1KC1A 3COJA 4K1XA 1KMHA 1X39A 2TMKA 2IVFA 1I7NA 4MINA 4KOEC 4BLOA 3HWX1 4D45A 2ZYWX 3FR7A 1QNLA 1BHSA 2BFNA 2PAFA 4LMRA 4V0SA 3WGVA 1PEYA 4IF6A 2B7LA 1WLYA 2GJ8A 2XOKD 1ECLA 1Z22A 2EZ8A 3GUUA 3M2PA 4JEMA 1B16A 2GK7A 4ONEA 2CSXA 3LZ6A 4KI7A 4TTTS 4ZAXA 3RC3A 3UMBA 4QICA 3SM9A 1JI3A 3C5CA 3I9FA 4I55F 2XR1A 2VQSA 3IIKA 1SOMA 4HWKA 3WYGA 5KQLA 4MR9B 1R12A 3CO5A 1FYXA 1USGA 4IH4A 4D0LB 1JIIA 1WSBA 2X8JB 4N5IX 4P3OA 3U1BA 2X0RA 3R3ZA 1AQLA 1VJTA 3LDAA 2GTIA 3FBTA 4BECA 4D4JA 4KN5A 1HGXA 1Q44A 2JAOA 2DHRA 4F86A 2G77B 4YAJA 5DULA 2XH8A 3IDFA 2I4NA 1ZLYA 3K8OE 1OXXK 1E3WB 2C5BA 2PRYA 1YGYA 2JRCA 2EX1A 2ZB7A 2G9VA 3V3TA 4ZN6A 2BRUA 1U8CB 1USUA 4X90A 2CXUA 1BGXT 1OOEA 3GUYA 2PMKA 3LBAA 3QXHA 5DCLA 5SYAA 3GLIA 1BROA 4D4LA 4I08A 4M53A 1D2MA 2I1QA 4UCXA 4FFRA 4RHEA 3R7WB 1D0SA 4XCXA 4X62B 1UMDB 2ADOA 3W8EA 4ZYYA 5IKXA 3ZX5A 2Q9BA 4YO7A 4RADA 4W5OA 4KGVA 4KQCA 4MVJM 2OWDA 4GRDA 5A3JA 2ZVDA 1OASA 4LHYA 1Z26A 1EDDA 5K0NA 4GBJA 1JEDA 2XHZA 1NPYA 4A8TA 1TZMA 5HKOA 2VNSA 1EK6A 1K8XB 3LK7A 4O0LA 1ACMA 1ZD4A 4X92A 4ZALA 5HM8A 1ZD9A 2QJWA 2YV5A 3S68A 1PJZA 5CT5A 3TL2A 1LZKA 2AQIA 3E8MA 4E6EA 3H5LA 3JD0A 5A5EA 3AJRA 1R8SA 3NRJA 2B36A 1ZG3A 4Q6BA 3IXMA 3BK7A 1I5EA 3E7WA 5DB4A 3CG0A 4XJXA 3ITKA 1PVDA 5IAKA 2WSSA 4L9RA 4C2BA 2Q4BA 4XGNA 3I23A 4MULA 1RKXA 3V7UA 3KUCA 2YVKA 3ZZ1A 4LBZA 5ALSA 5JR3A 4MLCA 2DOKA 4ZVPA 4QWMA 1E4OA 1JQ3A 1R00A 2B4TO 2YRWA 5MN5A 4LXUA 5HIIA 4MI1A 3TDKA 3N2YA 1QG2A 4AP6A 4CT0A 5JQGF 1A9ZA 1I51A 1QVVA 1UKEA 1XJCA 4RHFA 5TF0A 3KELA 3M9XA 1GA1A 4PPGA 3VOAA 2EIXA 3P5SA 4PAWA 4FQ7A 3S4YA 3ZWDA 3HYNA 1ULSA 1XMIA 3I28A 3MERA 2X0FA 2E82A 3OQVA 4QWWA 3VYRB 2Q2WA 5DXFA 3NB0A 4ZCRA 2GH1A 5DTMA 3OPNA 3PGLA 3VAZA 2XA2A 3S5JA 1GTL1 4NZPA 1E0SA 1AGPA 2WTBA 3CH6A 5E6RA 1O9GA 1VBNA 2G9QA 2HZ7A 2JK1A 2XI4A 3O1HB 4G26A 4IIFA 2AF3C 2QRLA 3HJAA 4R9VA 5L40A 3KYDA 4J91A 3RIGA 3R24A 1R8YA 3UK6A 4DF3A 1FDRA 1PJ2A 1P2DA 3T5GA 2JLYA 2PHZA 4P32A 3GUHA 1MJGA 2A78A 3N2ZB 4H4DA 4UKDA 4A5OA 2XGJA 2WEKA 5L6MB 2NAFA 5AXDA 3NNDA 3BXGA 1RWQA 5IANA 4RF5A 2ZYSA 1EUDB 4MW7A 5JJCA 4QNNA 1F3OA 1JS1X 2G7MC 4DIMA 1O6ZA 1QO9A 4HHEA 3ILSA 2VRNA 5F7OA 1XXHB 4KNWA 2BCGY 4OQYA 4L0DA 4JYPA 1UJNA 3JD1A 4OY3A 2NVWA 5E9AA 1KP9A 4B3JA 4DEVA 2C7QA 4XCQA 4R41A 4IJ5A 2H9AA 4XUEA 2C0QA 2P6NA 3ZOKA 2ZUBA 1U4OA 2CFRA 1YRLA 2EJWA 4FR5A 4XOUA 3LKZA 3S29A 3LT0A 1I1OA 2I0FA 2P9CA 3LXUX 5CH3A 4EATA 4AJ9A 1RNLA 4K9KA 1VG9B 1Y1RA 2BE9A 3ND6A 1T10A 5JROA 4DA0A 1GPNA 3TTUA 5FUQA 1ZXLA 3SZOA 3CS3A 1U2DC 1M8PA 3DFIA 4Q02A 1YRHA 3UY4A 3W1EA 1EIZA 2V03A 1SG6A 3MBOA 1XNRB 1Q1QA 1TVMA 5A4DA 3MB5A 2PKYX 1UBKS 3WGUA 4O08A 5HNKA 2QN7A 1OA0A 4HQRA 3DZDA 3DO5A 1TK9A 1T8SA 1N6NA 1SN7A 4YRKA 5T3YA 1XLTA 3DQPA 3G88A 3NNSA 1AH2A 1Y3DE 4NARA 3IPLA 4A92A 4PHFA 5A4MS 4BJ3A 1HE1C 2ZRIA 3MOSA 3Q0EA 2C9OA 4RWZA 3GQBB 4OBWA 3SG0A 1BG6A 2CUZA 4N5HX 5CB4A 4YDQA 1K5DA 1E99A 3RFTA 4RPCA 4BQIA 4LSGA 4R1SA 2YKGA 2FETA 3QLJA 1IHXA 2VA9A 2OYRA 1LDBA 4V24A 3RVRA 1OZFA 5I7FA 5EPUA 3BMNA 1L4MA 1T4BA 1KKUA 3E8SA 1KMQA 2CHFA 3EZ9A 1X86B 1CDDA 3G79A 3N2LA 1TAUA 3HJUA 3HYLA 4NXMB 1A2OA 1HYQA 5AKXA 1RABA 1P77A 4P4NA 2C5EA 3M5DA 3SDZA 4HH0A 2BTEA 4DY4A 3GA0A 4HEA1 4K88A 3IB6A 4H6XA 4GR9A 4LHZA 1USWA 4LVNA 3PUYA 4K6MA 2W70A 2OLEA 3MCUA 1XEAA 4P4GA 4FE7A 2GK6A 4CDNA 4QUJA 4A0QA 3KSBC 2G80A 1RCFA 2VZ9A 4OP2A 4NDNE 5AMXA 3VZBA 3ZBUA 2EQAA 1YF3A 3DLHA 3T7JA 1QONA 5GWXA 2WMNB 4RKYA 1I2AA 3IQFA 4TSKA 3PC6A 5BN3B 4EUHA 2CMKA 4IDHA 4K0RA 4N5NA 2CNWD 3WIOA 5ALFA 5IUNC 4YAFA 4G0UA 1ZHOA 4XKJA 5JTUA 5I7OA 3TKAA 3M1IA 1QZTA 1XAJA 4HDKA 3MRXA 5AK0A 5JWOA 3JQRA 1CUSA 1LRLA 2QTLA 5EP1A 5CDYA 3WNCA 1QHHA 3WLAA 1KJQA 5FA6A 2FDXA 3HVJA 2X8WA 3AR4A 3GB9A 2XCLA 1ZM9A 3IUEA 3L1IA 1NIJA 3QQ5A 4M99A 3TVYA 3HKEA 4FE3A 4ZJYA 4FGLA 3I32A 2GN9A 3TSAA 2D3TA 5DBEX 3OE7A 4JOSA 6YASA 5EHGA 4IXMA 2BSAA 1E3DA 1UFRA 4UTPA 4URWR 3A1EA 3I5AA 1XX6A 1Z38A 1G2PA 4FKMA 1ESMA 3ZNNA 2AT1A 4LK3A 4JQYA 2A5FA 2IDZA 3COPA 3UFBA 2IXFA 3N28A 3ZHZA 4ZJPA 5TQJA 1ZH4A 2I76A 1GCGA 1XKQA 1LF0A 1CFZA 1TU4A 2NXNA 4CCYA 1RHQA 1UKBA 1ZAKA 4II2A 5AUQA 3FF4A 1G0OA 1V16A 4B17A 3A1DA 2GVZC 3DNPA 5JQGA 3TCNA 1KVUA 1QQTA 2HJHA 3K20A 2GCOB 3AESB 3FYHA 4M76B 3KBOA 3STVA 2K5UA 1KFCB 1ZWKA 2CCGA 5ELXA 2P4EA 3W2TA 3NC4A 4I55B 3O3CA 2I29A 1NZDA 2VQ3A 3TSYA 5I01A 2EJBA 4WCVA 3MILA 4K9OA 1D0IA 1KH3A 1XTUA 2G0AA 1LPBB 3OAAA 4MJ3A 4N82A 2AFVA 3HBJA 4NJEA 1W2HA 1BYUA 4PLHA 2ZIUB 4LF4B 1SVUA 2ZBRA 4LCJA 2ODEA 2PFGA 4LV6A 2Q5HA 3JYOA 4MVJI 3FJ1A 4H7PA 1E98A 3WWOA 2GM4A 4MDFA 3SQDA 1RQRA 3D7NA 2EJTA 3OIUA 2XOEA 1C3XA 1NQWA 1WUTA 2QMHA 3EGXA 4NEHB 1CIJA 4ZD6A 1QMPA 2IC5A 3JWJA 1N3LA 1VI6A 1HEUA 3C7TA 1TEZA 4YRLA 3SJBA 4MLZA 3W4KA 1VJGA 3OBIA 3MYRA 4HEJA 3NORA 3G8YA 1FSZA 1XEWX 2XWQA 1JDVA 5TPWA 4RMGA 2PVCA 2YMMA 2W48A 2FW7A 2ZWAA 4IJUA 3EA4A 1RP7A 4IQ0A 3G5LA 1FUIA 1R8XA 2FUG6 1KIFA 2AIRA 1UWCA 1T4CB 1VKOA 2HJRA 2Q3EA 3LFHA 2AGVA 1R1DA 1G4HA 3JVEA 2AZXA 4R3WA 3WB2A 1VI2A 1N2SA 5LOVB 2GVDC 1X42A 3L0CA 1S2MA 3DMRA 4C20A 3AB7A 3EIQA 4MA5A 1TUEA 5DLQC 4B7UA 3IPRA 1ZJ4A 1VOTA 2X14A 5DASA 2CLSA 3OQIA 3TD9A 4ENQA 3IELA 2J4CA 4Z8YA 1UC5B 5DP1A 1QZZA 1A9RA 1D09A 3WWPA 4J1SA 4OMDA 3VSBA 4XFJA 2FG6C 1TB4A 2P7IA 3MD0A 2J3KA 1RRFA 3FW1A 3OE7D 1J2RA 1EUDA 1L7XA 1BMQA 3PRJA 1HZJA 2C9BA 4AG6A 4MGIR 3WLMA 4AM8A 3EQ9A 1PZXA 5H9VA 4YRMA 3IUSA 3L4BA 5JS8A 2AVDA 4FBGA 3VH3A 2D5AA 2FMKA 2G67A 2I3ZA 3DKPA 4LSWA 2ZUWA 3AV3A 4Q3AA 4QULA 1HYHA 3OKCA 2OCPA 1QFSA 3UXHA 4Q4JA 1IHYA 1G8JA 4HH4A 3UPTA 4HB2A 4BNDB 2C95A 5IK2D 1XCGB 2HLDD 5DK4A 5DVZA 2R4QA 3PCTA 3FNGA 3ABIA 1PV2A 1X14A 2PD3A 2UYYA 1FK8A 2VAWA 2Y1WA 3WOVA 4CR7A 1QYIA 4Q21A 4BQEA 3FPJA 3OJ0A 1DSSG 3LLUA 1XZNA 2PWPA 3QVTA 4LXQA 3D6UA 2UUAB 4YGYA 3KLNA 1DAMA 3DDOA 4ZAWA 3U3RA 3DPIA 1XVAA 2GHQA 4OXNA 2Y1XA 2Q9CA 4N12A 1UMBA 4HFMA 1GFSA 5F4ZA 4IDFA 1QH9A 4OQLA 5JPCA 5AHXA 1YRAA 3ZJUA 4YIHA 1MTOA 1NTOA 1RYDA 3HI4A 2QN3A 3L05A 5J5VA 3WBKA 4K9NA 1BQEA 2V74B 2ZJFA 1RSZA 1SB8A 4BL5A 2Y4NA 3VAAA 5K0CA 2EV9A 4X8OA 3B1KA 2I6FA 1K89A 4ND3A 2F8MA 1ZMXA 1B8UA 1S3IA 1XELA 5B36A 1RZUA 5DIFA 1EWTA 4EL0A 2VYVA 1T0JB 3KT6A 5F3RA 4G0XA 1U80A 3CVUA 4P33A 2O3TA 2JLRA 3GRUA 1CULC 1ZINA 2ZRLA 1KYIA 4GLOA 1BX0A 1EWRA 2XKKA 4LXXA 1T15A 3C6ZA 4P1ZA 4AURA 4DKJA 3WMRA 4RYDA 1FLNA 4M1KA 3E9YA 3VKVA 5EE1A 3OU7A 3KU4A 2YINC 3DVAB 4P54A 4ZHQA 2JBAB 4O02B 4GGOA 3QWFA 4LWQA 3AJ9A 4ZDIA 2B2XA 5FWDA 2ENWA 1DBQA 5LOVA 1YQEA 3EFEA 1P3DA 3I04A 4EUEA 4OX9Y 4QM7A 1GQFA 2I4RA 3G9XA 3ROMA 3JWIA 2H57A 3TCKA 5AVOA 2ZTVA 3TW0A 3V1LA 4ZI7B 4ER5A 5B3JC 2BFPA 2BMAA 3RG2A 1FIUA 4MPPA 1NPTO 3BGSA 3BSFA 4PYQA 4RWEA 2QT0A 4EQ6A 3GLGA 4ZVTA 1KTIA 2IK8A 2TYSB 2A92A 4CETA 3PSAA 3P45A 1NVVR 5JAHA 5KTTA 2EWWA 3SVTA 2QJOA 2HGZA 3RTAA 3OJCA 1A7UA 1YDMA 2KM1A 5M29A 1R4NB 2O5RA 1NX6A 3AZQA 3DFKA 3CIOA 1FVFA 3HO1A 1B0AA 5TJ9A 4ADSG 2NT3A 3WMFA 4MWTA 4E2FA 3O03A 1CQJA 2B92A 3QPWA 1KA9H 2F2TA 3B89A 4NBSA 3CRNA 1DRKA 2VPYA 3DBLA 2ZJZA 3OEYA 4FONA 4K2AA 4LCEA 2JJMA 1T9KA 1T0IA 5KKCA 4QPZA 3NMUF 3COSA 4KXVA 4PSUA 2EF0A 4RQBA 5EIFA 5NLLA 5IJ0A 4MEAA 1FUYB 1P2BA 3L41A 3PEFA 3U7QA 4BLTA 3ASVA 3HEAA 4D46A 4PW0A 3MLBA 2IPMA 1EAYA 4N7RA 3HKBB 2GNPA 4FT4A 4AO8A 5ICFA 3GJ5A 4C4TA 1YH3A 5C8ZA 1ODSA 3Q0IA 3MFYA 4RIIA 1W96A 2FSHA 3D7SA 2V97A 5FEMA 3K1ZA 1E77A 4HMOA 3N2IA 1ZUHA 3L4KA 1WO8A 4DIBA 1XSEA 3KQKA 3OQHA 3OMXA 2QD3A 3BZBA 5BSVA 1R0KA 3TR6A 1DUIA 2QRNA 4REOA 1XVIA 2QJTA 3JQAD 5LP6F 4L4RA 2ZB3A 3HI6A 4YT5A 1HI9A 1DAHA 2YIMA 3TIVA 3A11A 3VO1A 1Z5VA 5BN4B 3LBYA 1K6IA 3HRIA 3QUTA 4QXRA 4P34A 2YW9A 1YCHA 1I5OA 2XWPA 3M6XA 1F8UA 3MS4A 5COBA 1OZHA 4RJ2A 3UT6A 5JEDA 2RJOA 4IGAA 5E1BA 3NALA 3UTDA 4FEEA 3WLSA 1PEAA 2YV1A 3BFKA 3ET5A 2D0PB 3NP9A 2W0MA 5JNLA 1GUZA 4F9FA 4EY7A 1L1FA 4OH1A 5AM2A 2AN1A 1DBPA 4I3GA 1H9CA 1ANKA 1OCEA 2WQ6A 3LHKA 2FN4A 2NU6B 1VYTA 1XRQA 2HIMA 3P4XA 4YBZA 5C7YA 4NFSA 1RJEA 1PJAA 2FFHA 1UP4A 3AR2A 3FDZB 3GC6A 5J59A 3VHXB 1GPWB 1U4NA 1YB7A 3RARA 1DNPA 3CM0A 1M7HA 4GMDA 1UBFA 2FEOA 2PKXA 2BUAA 2XMSA 3ISVA 3QUAA 2GM9A 3OCVA 3MJCA 4L75A 3ICWA 4POOA 1CQWA 2HHHB 3KPWA 3MRSA 4K8OA 4M1OA 4ND1A 2HSGA 4CIDA 1E6UA 2E85A 3IOBA 4G1FA 4QNRA 2ZAYA 1RTTA 3UJ3X 1TQ2A 4DB2A 3BL5A 5I9MA 3EIOA 1ZS9A 1WF3A 3SSAA 2GNOA 4ECAA 2O8FA 1R9JA 1V1MA 2MINA 4M0UA 3X3HA 3IP7A 4AP5A 5GPBA 4M8NE 3UB2A 3W90A 2HT6A 3F78A 2E4UA 1T8UA 5EJIA 4KRYA 1RW4A 4D3ZA 4DA6A 1RXWA 1ETUA 1YU9A 1OREA 2OENG 3EZYA 3RC2A 4CLOA 1YE5A 1VLVA 5A4JA 2JIMA 4RKQA 1TMGE 4CM4B 1NQAO 2I8AA 3FE2A 3PUHA 4QUBA 5G0SA 3W5JA 4A82A 4M7WA 5FNVA 1WXFA 1W52X 5HFAA 1FYEA 1TFUA 4CTJA 4MW1A 1W5SA 2X1MA 4QBTA 1RYMA 2XCOA 4W9RA 3ZWPA 4C88A 2QYOA 1JG7A 1YVEI 1JMYA 2EVWX 2XT6A 4Y6QA 4WKCA 5L7YA 4B6FA 3ML1A 5EN4A 5SY6A 1WJGA 1DQPA 3VKUA 3F74A 1TO2E 3G1WA 1PZNA 1MHPA 3WXBA 4GLJA 4OHXA 4M83A 2H1IA 2IBMA 4KKXB 4MUMA 5AKJA 4OUDA 2XODA 4UE2A 3OSUA 4WFQA 4PLZA 5B3LA 3QLEA 4YRIA 3OM8A 1OW3B 2F9FA 4EL5A 2UDPA 1OFVA 4QDUA 3T94A 1ZEMA 4Z0TA 5HQ3B 1MBZA 5KZMB 1ZH8A 3NT2A 5F21A 3RW9A 5JYEA 4HLUA 2NP7A 3UMGA 1AKUA 3IBYA 4JC4A 2FLKA 3MSXA 2O5EA 4YYZA 2HK6A 1N77A 3L0DA 1MUUA 4LDQA 2Q7XA 2QXYA 2P6OA 3DE6X 3BGVA 3F5MA 1Y7LA 3IOEA 3U7FB 2P6RA 3EIFA 3HC7A 6ABPA 3MWGA 1XZJA 2XHEA 1O87A 5CMLA 1R5NA 1WU7A 1DWUA 4Z54A 3E70C 4MS1B 3BB4A 1NW6A 5AJTA 5GONF 1XTIA 1D2NA 3H13A 1P1HA 3KEFA 5DX0A 4AMUA 1M72A 1WU8A 2I9KA 2KWIA 2FZ5A 3ZIDA 1R3DA 2QF7A 3C14C 5ARBA 1L9XA 3PDIB 4P58A 5AHOA 1QSGA 3UH1A 4Q1FA 4AUEA 4BASA 1WNTA 4N6OA 1ITZA 1ZIDA 1CZRA 2BFEB 2C2MA 3EXHC 3GYGA 3KZNA 1YA4A 2CNOA 4KMMA 4NU8X 4PV7A 4UEOA 3U3MA 5IU6A 1TD1A 3BMQB 3C1OA 1P6QA 1CNFA 1ZIXA 1GYPA 1P4AA 1PWYE 3OE5A 4B3SB 1CZKA 4C2TA 1TF7A 1IDOA 1OKKD 3G0CA 3DLPX 2OCXA 4HBZA 4DA7A 2NTJA 1E6EA 3PNMA 4LYAA 3N2KA 3N76A 3HJRA 4N3GA 4MICA 4DBLC 4ND6A 4L51A 4IDPA 2PFKA 2VDQB 1HYGA 1GN8A 3V1UA 4DAEA 3G0IA 4Z51A 4YAUA 4DNQA 2PGJA 4OHKA 3OZTA 3TKYA 3HH8A 3KKNA 3IKJA 5HOQA 3ZDBA 1ABBA 4CTMA 1W4CA 2ZUFA 2BIFA 1A82A 3JVIA 3EN0A 4M22A 4WJLA 3U60B 1IE3A 3L7NA 2OOSA 3NIBA 1B76A 1W8IA 2BI7A 4LISA 1GZ4A 2VF5X 3KYDB 4AXBA 3FG9A 3CJQA 2J30A 3OFJA 5L9AA 1Z0DA 1GT6A 3P9PA 2GJ9A 1GRNA 2KW5A 2RGDA 5EMNA 2R7MA 1BCSB 5JZSA 2H17A 4C3OB 4EY5A 5BQPA 4Q1AA 2WJVA 3KBBA 3Q98A 4ESOA 4LF9B 2V5AA 5E0KB 4RVGA 4UBIA 4WAUA 3FUUA 3GA5A 3VQTA 2ODBA 1EX6A 1SVSA 2GNAA 3OU2A 2BISA 1QHYA 3IH5A 3PKJA 5DBHX 2VBCA 3HXKA 4W5HA 2WW8A 2GKSA 2WT4A 2J9YB 3HYCA 4DBLE 5EFZA 1ZK1A 2R1ZA 3FNFA 1ES9A 1RJDA 3EGEA 5FBRB 4G25A 2HXGA 4B84A 1WPXA 1T5HX 3TG2A 3N0VA 4OJMX 1GUAA 3TGWA 3FB1A 5ALKA 3PTLA 3VDQA 4TZ6A 2RHTA 3STTA 4ZOCA 1U0SY 4L5BA 3TJZA 3UJBA 4OB7A 3TXYA 1KZGB 3CH5A 2CK3A 2ZE6A 4L4ZA 2BDTA 5AVUA 3BMCA 4PQEA 1VE6A 4FN5A 5DTQA 3VH1A 3H8WA 1Y7HA 4LGCA 3QG5A 1P1FA 1WAMA 3BWDD 4XB6B 5EHIA 1AE1A 4EPVA 1KGDA 1ZHFA 4AQ7A 2DSNA 3EY9A 4KVZA 4DQ0A 1TE2A 3BREA 4JB2A 1CQPA 3VRHA 1VHQA 4Q37A 1FUUA 4OSEA 5BNFA 1UBUS 4FB5A 1RQLA 1DTEA 4GFDA 2YWCA 4WSOA 4EZBA 1CJTC 5FLKA 1AN0A 1I24A 6REQB 2PBFA 2R6FA 4DUGA 3R7WA 2FUCA 4D92A 2VJQA 1IN6A 1JBQA 4NCKA 4ZTZB 2IU4A 3T1QA 1F8GA 2I8LA 4NZZA 3CNBA 5H16A 3CZ5A 2CDCA 3AP1A 4N03A 2AEFA 3WKBA 4CIAA 4WKGA 4Q03A 3E6AA 5JVDB 3FB4A 4KMRA 1UOEA 3T5PA 2GN8A 1M2HA 2W58A 2FLWA 3L7BA 5CDTA 4ZHSA 2Q1TA 4R2JA 2XYPA 3PS9A 3LBFA 3FM9A 4P93A 1XVVA 2PL1A 5CNJA 3ORHA 2G28A 2PH7A 4JCOA 4FS3A 4CN9A 1IXKA 1DXYA 3NOOA 4N3BA 2UYCA 3FZEA 2H5IA 1XZAA 3V8RA 4ZAFA 1TAHA 3VC3A 1TJPB 3ETNA 3P52A 2QPTA 1QFYA 3ISJA 1K7XB 3ZNQA 1O9HA 2Z98A 3TD6A 2BHTA 4R2XA 5C7IO 5D7NA 2V7XA 3NDPA 2HA2A 3M6WA 4XYMA 3OZRA 5TQ0B 3A4TA 1CUEA 1QCYA 2O2SA 3ETHA 3UGQA 2W2TA 2REOA 3HSSA 1P7WA 621PA 4J4BA 2YVAA 1JAYA 5KYWB 3GFGA 3OQNA 5H3LA 1M83A 2CC2A 3K9BA 1SXQA 2FYTA 1JVSA 3OOEA 4AJKA 3BIJA 2GJAA 1SCUB 3AF2A 3S55A 5CBPA 2UKDA 2F3UA 4GW3A 3EG5A 1ZJWA 1KARA 1Y7TA 2I6QA 1Q57A 4MXDA 3V4ZA 3KP1A 4UVIA 5AKHA 5D3ZA 2FPOA 2XUOA 3Q41A 4FUTA 1EYZA 4W1QA 3S28A 3KOXA 3QE0A 3GIDA 4WJKB 4CJXA 4DJFC 1TYCA 3LLMA 1GGNA 2JBWA 3ECCA 2FH5B 2YFQA 3KYIB 3NH6A 2RGRA 1C9DB 1T1EA 4WKOA 4BZXA 3AH8A 3K09A 4U3JA 2IUYA 1TKCA 5LR6A 3RV4A 1SUWA 3NQ41 3G8CA 3P26A 4WBNF 3O0TA 1F48A 2A58A 3N86A 3N5KA 3ZXSA 3BE4A 2ORED 2DGDA 4PO3X 3DXZA 3VZDA 1V1MB 4OREX 3ER8A 4E5YA 1NQOA 5HF5A 4DMCA 2JNWA 2CHGA 3U3JA 1SVWA 3GNTA 3KDSE 1PS9A 2QYTA 4IDAA 3RKUA 2H7VA 2CT8A 1A8SA 2CV2A 3VR6H 3DH0A 3K6KA 1PNTA 5BQ5A 4PNEA 2X9GA 3N8DA 1JDBC 1E2DA 1LC0A 1WCIA 3AI1A 3FCXA 3SC6A 1M6HA 3UANA 1GPKA 4BMPB 2W2NA 1Y4DE 1G2QA 4O33A 3ZR4B 3GJ0A 1A2KC 4QLAA 3OCYA 4MYTA 3HYSA 4KQ1A 2O2YA 1ONOA 3CNEA 4FCCA 4KITB 4ENWA 4BQNA 3D6MA 2VJAA 1MMFB 1SUBA 1Q50A 2OYCA 2OZKA 4US0R 3F49S 1E2PA 1KFJB 4I7EA 4CR8A 4RO0A 5FUBA 3RO7A 2NU6A 3RUDA 1E0DA 3D5EA 2YQ5A 4WHMA 3E4CA 1TJ3A 4YJFB 2Q3LA 2XUZA 3UGJA 1LVHA 4XUDA 1M54A 4MV8A 1N0IA 1PV1A 3QKWA 5BT9A 1L1EA 1BW9B 1XEWY 3H18A 3R3JA 4JT4A 2I03A 4PZYA 1GGFA 3DDNA 3PF8A 2IDJA 4V03A 5IEJA 2Q0QA 3OUZA 1K7SN 3UTCA 4E5KA 1NY5A 3DTVA 4JBYA 5MN6A 4Z53A 1Y6RA 3FLMA 4WN3A 3N7AA 4L2IA 5FOXA 2XXAA 4UQLA 2D00A 5DIZA 2CFCA 1J8MF 4QSHA 2GLTA 1KFBB 2Z3VA 4U00A 4YP6A 2JZOA 2QN8A 3HCOA 3OSZA 5YASA 4N76A 3O95A 4X3CA 2I66A 5DNUA 4QA9A 1UMCB 5DBIA 3EULA 3KPJA 2IHNA 2P4HX 4HNVA 3N7UA 4MYDA 2WC1A 1ZCAA 2B4RO 3HACA 4JBWA 2P90A 4QJ3A 4HLDA 5GTDA 2IL1A 4P0TA 1TO1E 2I6GA 4B31A 3NGLA 2JA2A 4X6UA 2JHGA 4UM8B 4O2BB 1NN0A 1W94A 4B4KA 1TM3E 2YVLA 3HM9A 2GASA 5FWAA 5KPJA 3OTQA 3V2IA 1SKQA 4BNUA 1WEHA 3PU6A 4GYYA 4JL5A 4E1BA 3NUQA 4DLBA 1VPWA 3HXMA 1XG5A 2HEGA 3HXQA 5CIWA 3CEPB 3D4NA 4KQKA 2VJKA 5EKTA 3TTXA 4LIPD 4MKIA 2LKCA 2XOKA 2VQDA 3AI7A 5F73A 2L19A 5LB4A 1C1HA 2DZDA 1FXWF 1G3MA 1NU6A 1U2EA 3JASB 2CF6A 3AL2A 3TLCA 1GPH1 5ERXA 4BGIA 1EQAA 1SM4A 2HIHA 3M70A 4MKRA 2E4VA 1DC5A 4E30A 3BHMA 2P78A 3PXEA 2DBYA 2H1LA 3GLFA 1E92A 2I3GA 2RBGA 4NZ9A 1PR9A 3KE9A 3EZ7A 3V8PA 3PFIA 4ZRDA 4IH1A 5D01A 4L74A 2IIBA 3EVZA 3WLNA 4C4SA 1BHQ1 2X58A 3F7OA 3A9UA 5EWJB 3KJXA 2ZVPX 5K3OA 3TD2A 2O2ZA 4HG2A 2BBWA 1EGVB 1CJBA 2GN2A 1ZI9A 2I55A 5CTJA 1ILEA 2ZZNA 1UPAA 5LLTA 1BOFA 2C98A 4G1VA 1YA8A 1JJVA 3KQHA 3RS2A 3D7LA 3OEEA 3I30X 2X4DA 4U3JB 4C6HA 3GAMA 1QVZA 2P9YA 3A7EA 2VYQA 3QVKA 4GPAA 4ILKA 4R8VA 3K92A 2PH3A 1E96A 4HH1A 1CT9A 2XITA 4KO4S 1QFXA 2WAYA 2CBGA 4NR0A 3VTKA 3H5AA 1CEXA 4TVOA 3OCWA 4KXNA 4W99A 3HVUA 1T3GA 1XDWA 2DT8A 2V8BA 2BEJA 3F6YA 3FR8A 4FOPA 4FGSA 1KO1A 4JWTA 5K6AA 3LJKA 1SFRA 4HGRA 2LDBA 4JJKA 3TEMA 3PBKA 2LKDA 5JS2A 4LVUA 2D1RA 1OIVA 1YS7A 3WA6A 1I32A 2C2WA 1OXBB 2WHYA 4RTLA 1C0LA 1TFRA 5C4IA 5IAAA 2GILA 3QM1A 1QDUA 3R0JA 1XP8A 4PZAA 2JLQA 2XUDA 1JJAA 2WHXA 5KTMA 1UANA 5LYJA 2AJLI 1V95A 1SJ9A 5H4HA 5ENDA 5H82A 4RZQA 1M3SA 1U9CA 3E05A 3R0ZA 4UNRA 5LYJF 3ZGVA 1WOYA 2A0WA 3ZI4A 1T0HB 2QRKA 2A0YA 1V9SA 3B3QA 2R6AA 2YY5A 3ELWA 3HYTA 3NO4A 4HATA 1IONA 3H9UA 3VC1A 3T41A 1Z4OA 2XZOA 3OFNA 3IB3A 4KJZA 1GPAA 1W5AA 5DCYA 1Y1LA 3P97A 7GPBA 2XQJA 2WDZA 3MAAC 2Q9UA 2ZRGA 1HNNA 2V9ZA 1ZFNA 5HUHA 4ZI3A 1KO8A 4JJ6A 5KX5A 2IEYA 1PEKE 4UFPA 1ADFA 3FPGA 1OFGA 1GQ2A 2GAIA 3B6EA 3DMNA 3P9KA 2A9VA 4I5GA 2FU5C 4MQ6A 1RLIA 4TTAA 1ZAYA 2WNIA 3O2SB 1EJ2A 2VYFA 3OF2A 3CPEA 4HFNA 4DCVA 4MRAA 2VUTA 2W00A 1UEIA 3JZDA 3R6WA 4MPJA 2XYGA 3WADA 2ZTLA 5BMVA 2BFDB 3DAHA 1XL1A 3U7EB 2JATA 4F5ZA 1H85A 1SG0A 1VMIA 4TPKA 4DGSA 2NO0A 3K6JA 1X7ZB 1KZHA 4LI3X 1LPMA 3IPXA 1GPUA 2VLIA 3OZSA 2HA5A 4QDTA 3W9UA 1NW8A 3C1TA 1F3LA 4XEHA 4YRNA 4ZHQB 4P5DA 2G40A 2DHQA 4UU7A 3AX6A 2Q6VA 2P8SA 3H5IA 2X6QA 3I42A 3LP8A 1EVIA 1X19A 4EGAA 4ZAGA 2AQHA 1U1EA 3I12A 1U0LA 2JD0A 4L15A 4Q9NA 4ZV7A 1QOPB 1DS6A 3BMOA 5G0WA 1E0KA 2OBFA 1JZQA 4LVOA 2AHRA 3T99A 5AW2A 1RM3A 2ZUSA 2P65A 3GVXA 2G09A 2QXUA 5FQOA 5KWEA 4R3NA 5TX7A 1FQWA 3WZLA 4EHKA 2X3UA 1IBMB 1D1SA 1DU4A 1Z29A 3DLAA 3H2IA 4RFSA 1PJ8A 2X40A 5ALNA 5A4FS 1PV4A 4OX9B 5C5CA 2H1WA 1A5ZA 3E5NA 1JT2A 4TS9A 4CLHA 1SCNE 4TT3D 4DAOA 4MYUA 4AQYB 1A1VA 4R1NA 3R7SA 1QLHA 3RF7A 4DDMA 1R0CA 5A06A 3R20A 3IUQA 5EHNA 5AHWA 1V25A 3TTYA 4IXWA 2WB4A 1YQQA 3KB1A 1TUBA 1U2ZA 4F96A 1L3IA 2I7VA 5AW6A 1AKWA 1FDUA 4N7MA 1BCSA 4P6VF 5CVDA 3CGGA 1UR5A 3EK2A 5JS1A 5F2EA 4CHGA 2QAJA 3ORYA 2MSEB 3TNYA 3WK5A 3B1XA 1E63A 4MQEB 4RQTA 5SV2A 3LCVB 3JAMA 1FYWA 1JIJA 1MRSA 3RUIA 3WL3A 4CN8A 4R9RA 1DCKA 2KB0A 3NWJA 3RTCA 3W5SA 1Z4LA 3DL7A 1G3UA 3C98A 5LLSA 1DE0A 4AZ3A 1RC1A 3HU5A 2ZU6A 3G9ZA 1JHDA 3DE0X 5IZCA 2PT7A 4A23A 3FY4A 3RYCA 3BH6A 2BUBA 4HQ0A 2EWVA 1ABFA 3IOMA 5KWIA 3RADC 3ZJTA 1IATA 4N3NA 1ZK4A 4N54A 4ABTA 4ZCSA 4HDNB 2MYTA 2DUJA 4W5JA 3HBLA 1EDZA 3I6BA 5DNVA 2F1IA 3UIEA 4DSTA 2VPQA 4O1HA 3A6DA 1XZCA 5F35A 2J9FA 4OJYA 1P7YA 4EVQA 4JOCA 4JGIA 4W1PA 3PFBA 3R6TA 3ZWKA 3NAGA 3H5RA 1Z4NA 5AYVA 5J58A 3TTVA 4LFBB 3ZE6A 2ID7A 4QUEA 1MVNA 3M6LA 1II8A 1MW9X 4IOJA 4M37A 2VYVD 1Z0SA 1U8FO 4LJ6A 4Q3LA 1N2XA 4IDDA 4H7EA 1G291 1GZUA 1ARZA 4Z9XA 2ILTA 2B98A 4X8HA 4A10A 3LUKA 4AJEA 4TXLA 4ZZ3A 2FFJA 2PV0A 3Q15C 2ZWOA 3CLTC 2VJYA 1N92A 2OZEA 4EW1A 2N1MA 1PX0A 2WAXA 3KQSA 1Z6ZA 3VPXA 1Q0RA 4WWHA 4HADA 1CUWA 4OHPA 3SC4A 1HC7A 4R6WA 2HSJA 4BFYA 1JLKA 5L51A 4N8EA 3GY0A 3HVIA 4GP6A 3CKMA 3IT3A 4YMGA 1W76A 4QSMA 5JXIA 3C6XA 1O4WA 2QPAA 3E7XA 5AXBA 3RKSA 1XTJA 1THZA 1QZUA 3B8HA 4I6GA 2ARKA 4OFWA 2GTPA 2IWHA 1ML3A 1ADGA 3IAM1 1I33A 4IH9A 2BMVA 5JH7F 2B2NA 4IGEA 1TLFA 3OTWA 4P4UA 4LXYA 1UBMS 4PR3A 3IQZA 3HJNA 2B3DA 4YX9A 4DCUA 2VTBA 3T61A 4Y1GA 2GOYA 1DJQA 3EBOA 2YS7A 3QZUA 2IYEA 5C35A 2G70A 2A5YB 1ZP6A 3PGXA 3SI7A 2V6MA 4F2PA 4F8YA 2PY6A 1PR4A 1JIUA 1E2QA 3GOHA 1MJ5A 1NKSA 3QLUA 2WVJA 5KNBH 4DANA 3E15A 4DY6A 1BKDR 3EFOB 3E3AA 5K3SA 4K6HA 5DYWA 2P11A 3QG1A 1NDQA 4L22A 2VEOA 3HMKA 4O5AA 1TZJA 5IMSA 2VF8A 3C1UA 2HX1A 4R9UC 3P27A 4NK5A 4B4VA 3KQPA 3OQPA 2C2ZA 2O3JA 4UHBA 3SN6A 3GJ8A 5FPKA 2JLZA 4DYHA 3ROFA 3F5DA 2Y67A 1E9VA 3DTVB 3WISA 3AB8A 2VBFA 3KVOA 4BQQA 2C92A 3EMBA 3FPHA 4OJQA 5JSUA 2P3OA 1KEPA 2RAVA 4UMVA 4HQNA 1RMQA 1K92A 4A8JC 4ZK6A 3NATA 3PQFA 5GADl 2QR2A 3KFVA 4F3KA 3T7KA 2YIDA 1VYUA 2IJGX 3HS3A 5EKDA 1TEXA 5T57A 3SXPA 1OU0A 5HCIA 2OECA 2OV1A 1MIHA 3CR3C 5BRAA 2IIQA 4BVJA 1WZ2A 4C08A 5CDSA 3BIXA 3OZ7A 3QPVA 5CT9A 3R75A 4DA9A 4DV0B 2E18A 2CLLB 3GCZA 3RABA 3RVQA 2QM0A 4G09A 1SCKA 5KB3A 3BJRA 1G41A 2JCXA 1JU3A 1SUSA 2FJUA 3EIUA 2QZJA 5DT2A 2RH9B 5ILOA 1DKLA 1TCVA 1Y1PA 1HDOA 3MWEA 1WQ3A 1XDUA 2LCQA 3ZWCA 5FI3A 3RYFB 1N7JA 4Z6KA 4RA9A 1ZVVA 4AJ2A 2A1UA 2IUTA 3G1TA 1LPSA 1NXOA 3AVUA 4MWOA 2A59A 1NG1A 2J7PA 1R0LA 4GZ5A 3RE1A 2FP4B 2HV8A 2G0TA 1MJFA 4BFWA 1QE5A 3H86A 3IBGA 2XDYA 1GKYA 4O4HF 1IY9A 1E6MA 3OLQA 2BGUA 1H3EA 4D4MA 4HGOA 4NAVA 4FWBA 3UC5A 2BGJA 3PUVA 2EBFX 3TMKA 3BE5A 1VIYA 3U9LA 4RXUA 3ZHRA 2ZIWB 4NICA 1W36D 2NQ2C 3OM1A 4PF1A 4E21A 4PZEA 1JAHA 1QV6A 1E3JA 1Z68A 2HMWA 4UUOA 2ZTMA 4WX2B 4B6EA 4DIEA 1K75A 1JIQA 3K0BA 3LHDA 4H0NA 2QA5A 2UVDA 1MD9A 4UVDA 2Y1DA 4F06A 2VHJA 2NXEA 2OMKA 2R9VA 4IKEA 5ERGB 4B4UA 4F2DA 4NPCA 1WKCA 1T4DA 3EAFA 1JLHA 2XMQA 3NIFB 1RXEA 3D5QA 3IESA 4QOGA 5EUBA 2HCTA 4X7PA 1LK7A 2FQWA 2BSXA 3Q5GA 1LBHA 1W1UA 1CEEA 1EXNA 3TH5A 2J32A 1W5TA 1O97D 4TQUS 4TUYF 3OT1B 3GCWA 5KAMA 3VR6D 1JR3E 4CMIA 2N46A 1T1RA 2Z4RA 2ZR9A 4FT2A 1FX0B 1SG9A 3QEJA 2FXIA 3SZ3A 1DKRA 5F5XA 3N0WA 3PR2B 1E2FA 3FLEA 3AY6A 3PXXA 3PLRA 1TU3A 1BGWA 3FVQA 5CAEA 1WA5A 1K7YA 2W90A 3TINA 3TOVA 2PLNA 4NBVA 1JAZA 4TM7A 4S05A 2NTNA 1YSCA 4KQ6A 2QG9A 2QI9F 2YMQA 3AZPA 4RL6A 4W7HA 3GRCA 4DHWA 3EXG1 4L72A 2HNKA 3P9CA 1L5NA 3T9DA 1ZM3A 3QYAA 1GGMA 2AZMA 2H4ZA 1S96A 2WLSA 3M89A 1KNXA 4AWXA 3MQ4A 1DKUA 2E37A 4PG7A 1A4RA 5WRFA 3I1FA 3WGMA 1DIAA 1IBRA 2VZLA 5JWHA 1PBTA 3SYRA 4HNGA 4MDYA 4ZI7A 4CIBA 2IPNA 2ZJYA 4KR7A 3T12A 4HNUA 1DDOA 1QC5B 3FPSA 1I4WA 1PI3A 3GP3A 4MKGA 4RLHA 4HGNA 1XLVA 4TX1A 1VJRA 3O74A 3JQ7B 1Y0BA 1AZLA 2WG2A 1HFKA 2GZDA 2PH5A 2QSZA 2XDQA 3UPUA 1YRQA 2B5VA 1P31A 3M33A 4Z9YA 5L4SA 1R9NA 4BRSA 3IP1A 4OL0A 3Q9LA 4Y2RA 4CIYA 1JQBA 2AOTA 4XD2A 4HNTA 4WPGA 4EIWA 4FD3A 3TIGA 5JNTA 5KJ1A 4XWAA 5KNCA 4ZCQA 1C1XB 1TNDA 3NHSA 4R8RA 1C1XA 2APJA 3CTPA 3GLRA 3UHAA 5AXAA 3RJ9A 3J81k 7ADHA 2I6TA 2XCUA 1CYEA 3HU3A 1IBCA 1UK9A 3BZUA 1S2DA 4KWTA 2G9NA 2YDYA 3C7DB 5HZKA 1QCZA 5GMOA 4W5TA 1VIVA 1LPPA 3CLHA 1I4LD 1TC2A 4I9UA 1SZPA 4NBLA 5IM5A 2QX4A 2QP9X 1UBOS 2JIZD 3BC1A 4ZZ2A 1EJ6A 2WIFA 5JSKA 3WNVA 1YVUA 2FOIA 4I4NA 2GT1A 2FOXA 2WU8A 1ZZGA 2C2YA 1AUVA 1QMGA 3EZXA 4YK7A 4YPOA 2W2OA 5EJ2A 4A8JA 4US2R 5IKMA 1USIA 1V8OA 2BGTA 2G4CA 2VTKA 5E2BA 2ZT8A 4BE4A 1GAXA 2W6NA 2O14A 1LVGA 4XLLA 5FL3A 2WU4A 3WRXA 2QVCA 4D81A 2A4KA 4MVJG 1U8ZA 2VXOA 2PVPA 2ZZKA 3ND7A 2C0PA 1RQ7A 2D7DA 4Y2JA 1F6BA 1U3WA 4LQCA 3UWPA 4B7AA 1IYZA 3K6SA 2BONA 5FNVF 1TQHA 4KQEA 4ZYUA 2MHCA 3UAGA 5I45A 3T1NA 3WWZA 3K0SA 1E1QA 2ICAA 1HZZA 3TZEA 4PLGA 3RAJA 1AVTA 4P82A 4UHCA 3TTWA 3R6LA 1P73A 2R48A 1J8FA 2YNMC 4KO1S 1A8PA 5ALDA 4HT3B 1EFCA 1NGSA 4URFA 4UJ5A 5AVRA 2IYAA 1KDRA 2OO5A 1L4EA 3GJ6A 4Z1MA 1COWD 5KVAA 1JH9A 5B55A 4ACBA 3B1YA 2WSBA 3NHMA 3NBKA 2FPIB 3R09A 5EUMA 4C0KA 1IVNA 4B46A 2IYYA 3O7WA 3RAPR 3DDUA 3C87A 3JQCA 4FLMA 1JECA 3RREA 1T24A 4KV7A 4C7JA 1G5QA 1OJLA 2QMUA 1F6WA 3Q3EA 3W7VA 1LJUA 1N2BA 1DJPA 4FX5A 1FSPA 1YJBA 2J5RA 5IULC 1JG1A 4KDFA 1ETHA 3CH4B 4DCCA 2IBTA 2IXGA 1DHRA 3DVSX 4HQLA 2C5SA 3LTNC 5LQRA 3UGKA 3WGNA 2DWUA 2ZRKA 3BSWA 1KAHA 1QGDA 1V45E 1Z6XA 5KREA 2F1HA 5CD9A 1IK4A 1RE0A 1IQPA 1YBMA 4M9XA 3WGTA 3CVJA 4TRMA 2QLLA 1QH1A 4G1EB 2PUTA 3PWZA 1FJ2A 4L5IA 4YY3B 1ULTA 2J08A 1GKKA 1V7PC 1KVSA 3C3KA 3CTMA 1L1RA 1P3JA 3JZAA 4IVQA 4LOLA 1N9ZA 1PQWA 2WHQA 2QROA 2XGGA 3ETEA 4AI6A 4JNCA 4DXHA 4LJRA 3NEPX 5BPFA 4MS1A 1EUQA 2PX2A 4ZVKA 2ZRHA 5AHKA 4C4RA 1PNRA 3WGJA 2ZSEA 1TYZA 4UMDA 3DEYX 4IHJB 1NBEA 5E7QA 3C6BA 1N4DA 4KAXA 2UZ0A 3FFBA 3LMKA 2WM2A 3P2YA 3TJRA 4BRZA 4DLSA 1V43A 4GG1A 4ICIA 4HQOA 4AUMA 1ZKDA 4AJ4A 1XU9A 4RETA 3ANLA 1K63A 4Y6OA 3F3MA 3RFVA 1E5VA 2Q6OA 2GJSA 3GARA 4TKMA 4RESA 1JV2B 5CFOA 5J2TB 1VIDA 3BTSA 2J6IA 4HFRA 3U0VA 4YCLA 3ABQB 4KLRA 4RMNA 1FX0A 2PKWA 3ZWBA 1R74A 4WY8A 4KVFA 4E2ZA 2R4TA 3S2ZA 3OZAA 4FMCF 3F6PA 3V8BA 4OO3A 2OHJA 2VPXA 4M4SA 1NA5A 4E09A 1NR7A 5EWMA 3O8RA 1VLLA 5EINA 3R5KA 4TLLB 2QTGA 4D9CA 1K08A 4CM4A 3ET4A 5GVSA 4PHHA 2JJQA 2PSHA 1NVFA 3EDRA 4CCWA 3V1KA 2DRIA 2XD9A 3O73A 5D85A 1H2AS 1ZJZA 1OI2A 1RJ9B 4TV9A 4AZWA 1AQYA 1G20A 4CEIA 4L9WA 2F55A 3HHEA 3JRXA 4B73A 4LSMA 1WZIA 5HG0A 3DHYA 1JDNA 4YXWD 3L0IB 4IEIA 2YZNA 1V6CA 3UGTA 1V8DA 1VG0B 1MGOA 1UPXA 4HV4A 1M6EX 1ICIA 1EM8A 3KTAB 4MHOA 4WA7A 5ITWA 2Z6UA 3ROPA 3WR5A 4ZHQF 3GPLA 4PANA 1QGZA 4JQCA 1OFIA 4OG2A 1DKOA 3SP1A 1R4MA 4OIMA 1YDGA 4TYPA 3S27A 2XDAA 1B0UA 4HRXA 5K7SA 2FR8C 1UJ5A 2XQGA 4G24A 4ZQBA 3KT8A 2Z5LA 4QYMA 1SQGA 4JIGA 2GMWA 1GYRA 5B58T 3QU2A 1RWXA 1SU8A 4LGYA 4GX2A 3COWA 4CYMA 1EB9A 2AFIB 4H3KB 4MVCA 1CSEE 3LKBA 5CYFA 3B60A 2X4LA 3AONB 4LZWA 3IVRA 3VPFA 1RC0A 4I36A 1IL0A 2QZZA 4D4HA 1IY2A 1UDXA 2VHEA 1IDN1 1RMYA 2WM8A 2G8NA 2M6KA 5CXQA 5JBQA 3OQMA 4RK7A 4E2YA 5GIPE 1OB2A 1C8VB 3T0GA 3RU3A 4O25A 3PNQA 3MTEA 3V7FA 2B6HA 1Q3KA 2EAUA 2Y2UA 3RVDA 3I2JA 2VP0A 3CSDA 4BNXA 3EXIB 1XYVA 3QBDA 3G2KA 3H8JA 3K31A 3M8KA 4F9GA 4DV4B 4JT8A 4RUKA 1Y3HA 3KEQA 3K8ZA 5JI3E 2J9FB 2FPMA 2QZ4A 4PGAA 1YONA 1KTVA 2WICA 3KQMA 4GPEA 1D4AA 2VN8A 4F4IA 1RYYA 3HJBA 5DHRA 3RSFA 5LFAA 1UBJS 5SICE 4ZC8A 5BWCA 1R2QA 3Q8MA 1RXUA 3TB6A 4C1NA 3QOFA 2HBQA 3U7RA 1ODTC 3AYXB 3C2QA 5IASA 4HZUA 4EG3A 3ZE7A 2HCBA 4L1KA 1Z83A 4U9IS 2P9GA 3TQQA 1E18A 2JW5A 4EVRA 3F5SA 3S7ZA 1Z0ZA 2FWIA 3B12A 1KPHA 4XSVA 1M73E 1JU9A 3LT2A 3V4FA 1BTOA 1L5WA 4IHJA 3DBLB 2ZROA 4BVBA 4D79A 2QYHA 3ZI7A 2BHRA 1B42A 2WV9A 2IP4A 3IO3A 1QOZA 4AW9A 4DL9A 2X8BA 3JTEA 3I5UA 5DM60 1DLIA 1KQPA 2DH5A 4ID9A 3V32A 5JV5A 5C46F 3EGIA 3LM8A 2DMRA 1RKUA 3ADPA 4NCJA 2HI0A 4YRZA 4KQIA 3ZDCA 3NUZA 3QLVA 3ZWVA 1Y8ZA 2BEWB 1RHUA 4CV0A 2O7RA 1PFYA 2JKZA 4NULA 1ZSYA 3B5JA 3B6KA 4JR2A 4MIKA 1U2QA 2O9JA 3M6AA 5A71A 4JGBA 5TS3A 2O2XA 3X1ZA 2QD4A 4MWCA 3ZH9B 4EW3A 1KJ9A 3DBHB 3HZHA 1P45A 2R6CA 1E3QA 2Z9CA 3ZVMA 1NR1A 3AUAA 3L6DA 4QOHA 3ZIAA 4BGUA 1LPAB 2FLVA 1J97A 1S6YA 2ET6A 2QRGA 3IEKA 4I4TB 1QNFA 3USCS 1WG8A 3ILHA 2REQA