3RIYA

Sirt5 is an nad-dependent protein lysine demalonylase and desuccinylase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
SFTARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-5
publication title Sirt5 is a NAD-dependent protein lysine demalonylase and desuccinylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 97
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3riyA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3riyA01
1V5FA 4FZ3A 3U31A 4UTRA 2EZ9A 1UPCA 3JR3A 3FSJX 1MCZA 4V1CA 2OORC 4JT8A 5EJAA 1YI0A 4QQ8A 5K2OA 3U3DA 4UTNA 2FR8C 2IHVA 3GLTA 3GLRA 3HWX1 5EJ4A 2JLCA 1OZFA 4JUAA 5K6RA 4R8MA 2VK4A 3JWPA 2UZ1A 3OE1A 2V3WA 2IHUA 2DJIA 2PGOA 1YC5A 3ZGOA 1YHZA 2FRDC 5D7NA 4KXQA 5EJ8A 1OVMA 2WVGA 1YC2A 3RIYA 1Q6ZA 2FN3A 2PANA 5IMSA 3EA4A 2OD9A 1N0HA 1U2GC 4UTZA 3GLSA 1NM5C 1UPBA 5EJMA 1JSCA 1PYDA 1YTLA 4GM4A 4K9NA 1PI3A 1O96B 4RMIA 2W93A 1UPAA 2WVAA 2EZTA 2EZ8A 1HZZC 2EZ4A 4UUBA 4UU7A 2H2DA 2VBGA 5MGNA 4RJKA 2H59A 4D5EA 4GM1A 4Y6LA 5MF6A 5BWOA 4MQ5A 2VBIA 4L3OA 2JI7A 3PDHA 3GLUA 1Z8NA 2Q5QA 2A1UA 3ZGVA 4BUZA 3D4BA 3FZNA 1YBHA 4QPZA 4FEGA 4GM0A 4JU9A 2H4HA 4UTVA 4JUFA 3EYAA 3CF4G 2PGNA 4JD5A 5K3SA 5EJ6A 2VK8A 4MZXA 4I5IA 2Q29A 4BVGA 1PVDA 4TWIA 4V1CB 4QELA 1POXA 4JUCA 4BV2A 2FWNA 1D4OA 3F6EX 4GPEA 2JI8A 4HDAA 4KPUA 5FEMA 2B4YA 4K9OA 5DGTA 2AG1A 3CLUD 4BN4A 3CLTD 2IHTA 2VBFA 1EFPA 4TWJA 4BVFA 3ZG6A 1T9DA 4COKA 4JUBA 4D5GA 4K9PA 5DGDA 2H2GA 2H2HA 4BN5A 2EZUA 1QPBA 1PO7A 4O8ZA 1Q17A 5DEIA 1J8FA 2C31A 1SZCA 2HJHA 4ZZIA 3D7KA 4Y6OA 4BVHA 2VJYA 5EJ9A 2NXWA 1PT9A 4MPPA 4V1CI 1M2NA 2H2IA 4JT9A 5EJ5A 4UU8A 1ZPDA 4JUDX 5BWLA 2JI6A 1SZDA 5AHKA 2BRUC 2H4JA 1BFDA 4F4UA 4ZP1A 4G1CA 4GG1A 5EJ7A 4F56A 2A1TR 1Q14A 1OZGA 4J1TC 1S5PA 4KGDA 1M2KA 1PTJC 4FEEA 4RMJA 4IF6A 2X7JA 2NYRA 4K9KA 3K35A 2FSVC 2H2FA 1ICIA 5MFPA 3PKJA 3IAEA 4C78A 4X3PA 5BWNA 2Q27A 1V5EA 4K9QA 3PKIA 4UTXA 2Q5LA 3EY9A 3CLRD 4MPRA 1EFVA 2UZ1B 3FLMA 4HD8A 4C7BA 4K9MA 4Q9DA 2QQGA 2WVHA 4Y6QA 4RMGA 4BV3A 1PNQA 1U31A 4FVTA 1DJLA 2H4FA 2QQFA 4UUAA 1POWA 2Q28A 2AG0A 1V5GA 3E9YA 3HWWA 1M2GA 4IAOA 1YNOA 1O97D 1YHYA 1XLTC 1T9AA 4J16C 4BVBA 5MFZA 2JLAA 2OD7A 1Y9DA 3RIGA 1U28C 4RJJA 4RJIA 1S7GA 4BVEA 1E3TA 3LQ1A 1M2JA 1M2HA 4MPJA 1T9BA 2JI9A 4L2IA 2VK1A 3CLSD 2Q5OA 2OD2A 1Q1AA 1U2DC 2Q5JA 4X3OA 1OZHA 2JIBA 4JSRA 2OO5C 3D81A 4IG9A 4K9LA 4RMHA 5FYQA 4JU8A 4GP9A 1PNOA 3IAFA 5K6TA 3F6BX 1MA3A 1T9CA 1YI1A
chains in the Genus database with same CATH superfamily
1P81A 1E4EB 3UUFA 1L5HA 3U31A 3BB4A 3EXHB 3A6KA 2CVQA 4ENTA 1XLWA 4X6UA 4KU4A 1YOBA 4I4CA 2ILVA 2I62A 3F5FA 1X1DA 1SUEA 2X0IA 2GJ9A 3IX7A 3QYJA 4TTAA 1CRQA 1Y1LA 3ECSA 1HNWB 1TK9A 4DDHA 4FR0A 1HDXA 3UB3A 4DVJA 2NU9B 1I4EB 4BL5A 4GLOA 3O75A 5EKXA 1BEZA 1VM6A 2W6MA 3WAKA 1DL5A 3TKYA 1WDMA 4AT1A 4OREX 2ZYVX 3SP1A 2Z9CA 3IIEA 4KO8A 5D3QA 1DBIA 4CL3A 1H2YA 2ZBPA 4UOEA 3UFXA 2HRDA 1Q3TA 1TCUA 3EVDA 5BV8A 5JS8A 3E6AA 3HMQA 3CH4B 1XX6A 1V3TA 1DRUA 2Z2JA 4D4HA 2P11A 3AHEA 4B5LA 3RANA 3SKVA 1KNQA 9GPBA 2V7GA 4MUEA 1Y33E 1N57A 1S7CA 3A10A 4M0LA 1FTSA 1C4XA 1P7ZA 3EAQA 1UBCA 4P86A 3T95A 1F0NA 4A1FA 2ISCA 1WDLA 4D56A 3RS2A 1KEWA 2MIIA 4NU8X 1KQGA 3HSKA 4A91A 4JJAA 1XSEA 3GCZA 4M54A 4OXQA 5EP1A 2YHAA 4QUKA 1DDIA 2FPIA 2KE5A 1N5LA 4XGRA 5T4BA 5H4HA 4ZGBA 4RTLA 1ISMA 4CWAA 3SFVA 1KTIA 2SECE 4EY6A 2TMDA 1GCUA 3I30X 4ZAFA 1R8SA 2P1RA 2GPJA 3H2YA 4JI2B 1ZY2A 5F4BA 1A4IA 2PT7A 1V1MA 2QYHA 4JB2A 3F8WA 4YROA 1XCLA 3I2KA 3B3QA 1ORVA 4Y2QA 3QWBA 3U9SA 1HFKA 5K4HA 4ZC1A 2QY9A 3HC7A 4FFPA 3T9CA 2H9YA 1Z0UA 2WDZA 1Z4OA 3V8NA 1GU0A 3F9RA 2PQ0A 2ZTLA 4MYDA 1T2NA 4I4TA 1PSZA 1U98A 5FUYA 1U2TA 3MAGA 1LF0A 5KC9A 2EHDA 2KLHA 2UAGA 1R66A 3QLUA 5DM2A 2DUWA 3TZLA 4F38A 1B73A 1X9GA 2WDPA 2YMMA 4FFDA 2QIPA 4UDYX 4S0XA 5DTQA 2OKCA 1A71A 3C7KA 4JVNA 4N9WA 2GQ0A 4R0NA 1H8EA 3VAZA 3RAPR 4P0QB 3IUMA 3DHVA 1IUKA 4JYCA 3LUJA 4LOHA 1YCFA 1ZZEA 2CFSA 1RYNA 3RLFA 4FZ5A 4MKIA 2P9FA 4CFZA 3KTDA 3TQSA 1FFXA 2EL7A 2E4VA 2Q3DA 1CUDA 4IZ6A 5DM0A 3UHPA 2XLBA 1S89A 2IOHA 1RMQA 2GM3A 3N2NA 3CX6A 1NVVQ 2QLLA 2I2BA 3USCS 4P9NA 3ZV5A 5A0VA 4JBIA 4MQ4A 4LHZA 3RVOA 1T2UA 3PYLA 2C07A 1XJWA 3OTGA 4TTJA 3MHPA 4JFRA 2KI5A 2Q0QA 3OAAA 4YVFA 1OILA 3I0MA 4OXKA 4HDRB 5DK6A 3S2FA 5LFAA 4RMIA 3ZXUB 3HYCA 1Y98A 3NYIA 2SHKA 2XZDA 1GPJA 2Q5CA 1SK9A 5DBEX 1F3OA 3VDNB 5BSFA 4EHIA 1AGRA 2C2BA 2Q9BA 3BILA 3CWQA 4H3VA 5A5EA 5K8VA 4JJEA 3O1JC 1CUHA 1W4RA 1K4YA 1KETA 2F1OA 2GN4A 4IWXA 5TGDA 3OOEA 4YYEA 4E5PA 5L53A 1BX1A 2ACWA 2BEVA 4RIFA 4DA0A 1H5NA 3U49A 4OK3A 5EMMA 3EIFA 2HUPA 4LI0A 1WKBA 2FP4B 2VP0A 3VPSA 5B2FA 4FIDA 3PDCA 2R85A 4MRVA 4O1IA 5EWLB 4YFVA 1SVOA 1VJCA 2HN9A 3HP7A 1EESA 5KQPA 1AS0A 3V8QA 3HBMA 4G1EB 1HE2A 1G6KA 4XA8A 1Q15A 5DASA 3KKOA 5K3CA 4HVLA 2WKSA 2C5AA 2HOQA 4G81A 4DLXA 1ODIA 1TFRA 3ADPA 2R3SA 4DCNA 3DKRA 4JODA 4AO6A 1EE9A 2FZKA 3AFOA 3FOCA 3HYNA 1HQYE 3IIIA 5GPBA 2NYUA 2IK8A 1SUSA 1EZZA 2CMFA 2QRLA 4IIJA 3M6WA 3PIRA 1PQPA 3F5DA 3R8XA 4MR8A 3VUEA 1JDZA 2OCDA 1BMFA 1ZD9A 1PFQA 2J3HA 3WP1B 3PNYA 4K6CA 2JH3A 1X74A 2W90A 4AMZA 1V3QE 4D9IA 2PHZA 1KMIY 1K3FA 1JHUA 2O1WA 2XGSA 5AP9A 3IL2A 1XYVA 3A1SA 3F1LA 2YJZA 4H7KA 3KJHA 1ZC4A 1B14A 3L0IB 4IUDS 3OURA 1MABB 1NUUA 1NVVR 2WJYA 4PBRA 3SM9A 4HDSB 3ZGNA 2QX4A 3S0JA 3QX7A 1CD5A 1G8PA 4A0RA 1XK6A 2Z9DA 3VJKA 1Q2XA 2OQIA 5JCXA 3URMA 4X71A 3KKNA 1XQYA 4CCSA 3OY7A 2A4MA 4BCBA 5DYYA 1RTTA 5H70A 2XUAA 1ISGA 1KU6A 4OQMA 3CUTA 4DDUA 2NU7B 3BZWA 1PJ8A 1TUEA 3TH5A 3W1VA 4D3FA 4R3UC 2BSAA 1CQJA 4I5IA 1FU8A 1P1RA 1ZJ5A 3FWYA 4ZT5A 4ZI7F 3JQ9A 4JJ8A 4V1CB 3I52A 3FCCA 2FWRA 3SIWA 3KQNA 1UFKA 4OJMX 5CLJA 2YV1A 3SHWA 2JASA 4GEGA 1Z25A 3C97A 3O8DA 2K2WA 1D3AA 1H85A 4R8VA 3GCGA 4X1KA 4BMVA 1YIDA 1JAIA 2FUCA 5AKZA 2BR5A 3ROTA 1OA1A 1QFYA 1MN6A 1SBTA 4A16A 3FR8A 1QJCA 3GDHA 1O5OA 4TM7A 2ZZMA 2Q6LA 3OCCA 1S2NA 3IOEA 2WD7B 3LQKA 1PR6A 1KNXA 1Z2PX 3STTA 5JVDA 4CI0B 3KKMA 2LCQA 2UKDA 4OHZA 3WFIA 5BSEA 1TM1E 2C8JA 3ZV7A 1GNPA 1W48A 3EJWA 4W5JA 4GMKA 2QGZA 8ADHA 4O2AB 3VBEA 5LQRA 1DXHA 2DBZA 3KBOA 4ABYA 3CZPA 3WGIA 1AC5A 1P4SA 2DBQA 2GHIA 4B3DA 1SUCA 3ETCA 2QN9A 3P96A 5F1YA 1KMCA 3M70A 4G67A 4EB6A 2HWYA 2VSXA 3PJFA 1FUIA 1S2GA 3K1AA 4Q1FA 4COKA 4D5GA 1ABBA 4J1TA 5T67A 3FNBA 2YBEA 1HUQA 3HB9A 1C1DA 3KJFA 4GSKA 5A1TA 4E88A 1GA1A 4NK4A 3FGOA 3KLNA 1M5UA 1L8AA 1NW6A 1IRIA 4RPIA 5D1HA 2SNIE 3UWDA 4RZSA 1BN7A 3GI1A 1EHCA 4JSYA 2ZE6A 5IKPA 2I6FA 3FVQA 3H97A 4INZA 5GJCA 3U5ZB 3M1LA 3DSRA 2QUIA 3KXKA 3DCIA 4BP3A 4KXLA 5KYVA 1Q21A 3ZOZA 1OQAA 2HJGA 5FR2A 4PYMA 2PUEA 3LRXA 1FYWA 2O2EA 2QD2A 3CLSC 3Q10A 5JXGA 2C4WA 2A58A 3HTXA 3G2LA 4PO3X 3LYLA 4RZUA 3WTCA 5FULA 4FHEA 3F46A 4JLPA 1OBOA 2Y1DA 2A0YA 4C7KA 2PJRA 1E9SA 2O2ZA 1J9ZA 4WK4B 4V0QA 4ND8A 4OP2A 3W4KA 1IXZA 1Q7BA 1ADYA 4JT9A 1P0IA 2Q21A 5T8KC 3QU9A 3LYHA 3ZY4A 1L5KA 5JROA 4GR5A 4K87A 2JIMA 3O0TA 2CDNA 3VPXA 4I50B 2Z3ZA 2JFWA 3O1LA 3K9BA 2D1FA 1BFUA 3C5HA 1N2BA 5FNZA 3GLGA 1KAMA 4MWEA 4NG5A 4UHEA 3FLAA 5A7GA 1GDTA 1SCBA 4KUGA 1KJZA 4BJ5A 1B1AA 1ZO8A 4HNRA 4YP1A 4ZT7A 1H8HD 3OPYA 5KKAA 4QIHA 5C8DA 3RVNA 2JC3A 1THGA 1W36C 3DD1A 2YQZA 3LC0A 2V3CC 1QC5A 4J3NA 1P7CA 4CCYA 4RTSA 1PT6A 3ROXA 1XKLA 2BI8A 3KUDA 1XKXA 4NL4H 5TF0A 4A8JC 1LNSA 3WI7A 1Z2CA 4EF4A 5JV5A 1GLNA 3K0SA 2ZYGA 3GB9A 1HLPA 2YUIA 1UXGA 3ITKA 3RS0A 4BP9A 3LWNA 5FLXA 1XQXA 1UWLA 3GT4A 5JIBA 4AI6A 4GL2A 5LZ5A 3HJUA 5DBGA 2F59A 3WHIA 4YDQA 1M2WA 3HRIA 3LZDA 4NCBA 4NQZA 4DJTA 3DLCA 1NMYA 3KJIA 5BOSA 3NHFA 5JI2E 3V1MA 3EPHA 1X92A 2CSXA 1UZMA 2QXYA 4FSDA 1WU7A 1D9ZA 2PUVA 4MA5A 1PTJC 1GG2A 2CYCA 2QS9A 3MB5A 4BQRA 3PEFA 1QDLB 1RD4A 4GZLA 5EAIA 1PCXA 4R1QA 4Q6WA 1VL1A 1ZHOA 4K9KA 5DPMA 2OFFA 5AW4A 3LSYA 1D8TA 1D6SA 3CLVA 1MDBA 2V9ZA 4YAGA 3LH5A 3AT1A 1SFRA 3T3MB 4OU4A 3E5NA 3WNQA 4A92A 5MHTA 4EPYA 4GOXA 2LP4Y 1WSDA 5GZ1A 3I72A 2JGKA 3K92A 1XZCA 2E7ZA 4TTVA 5IJ9B 4LMBA 3EE6A 1ZJ4A 5DWDA 4LFCB 4EY4A 1W29A 4WWHA 2HF8A 3ZN2A 2VWHA 1AN0A 4J0IA 5JCJA 1FNBA 2CDAA 3LHDA 1AKNA 1GT6A 2W6JA 1WY5A 3DTVA 1CY8A 2LRHA 1VG9B 1EE2A 2X1HA 3F7MA 3TVTA 3VH3A 2PWAA 4Q4CA 5PNTA 1QYXA 3LSTA 4FJ1A 3WLSA 1KWGA 4B33A 1D4FA 4RGVA 1QGZA 2ZYRA 1WF3A 3B1FA 1SG9A 1U8FO 3NPMA 3WGMA 1DIOB 1QTQA 3FZQA 1RI3A 3IQIX 3IR5A 2GO1A 4FD2A 1C8VB 4K6HA 1PN3A 2CXSA 2FUNB 3LU1A 1JLSA 3QMVA 3FRJA 1PR2A 2W0MA 2DFPA 1T5TA 1S8FA 4OFZA 4OHXA 1DV1A 4Y1RA 4CTOA 2X76A 2QN6A 2ZT5A 4R6WA 1EH5A 3VR3D 2WTMA 3PQ5A 4O1HA 5C7YA 2UZ1B 1D2CA 2BKUA 1J07A 2YZKA 1VCOA 1TYEB 3E61A 4GKJB 3C15C 4JI5B 4OAOA 3KKLA 4BMPB 5AI6A 4QU5A 2CKDA 4WHMA 3O31A 4EJ6A 3HU1A 3CS3A 3QF7A 1CQZA 1KQOA 4YJFA 4F93B 1QHIA 2FZLA 1WULS 1K5HA 2DVMA 2OK7A 2GZDA 4M6WA 3VA7A 1AUXA 4HAXA 1YFJA 1MNQA 4EX7A 1GWNA 4TYNA 5J3JA 1K68A 1WCIB 1GQSA 3IEXA 3INTA 2DGDA 1LY1A 5AXCA 2FZWA 4YQEA 5KJEA 3RSQA 2QI9C 1XVTA 2DTDA 3QFCA 3EXHC 4QWWA 2LXNA 1LTKA 1E4OA 2UVPA 3H5VA 1YR9A 3WL8A 2VDWA 3LY9A 3OFND 1NHGA 1XUOA 4Q9JA 4JI3B 4JB8A 5A3SA 1CERA 1S02A 1B8PA 3WYBA 3O8BA 3FKSA 3IQGX 4FN4A 4WXHA 5TC4A 4C3UA 4DA8A 1O95A 1X7XB 4FBLA 1NVAA 2VPIA 2PG3A 5HXAA 1U0BB 4DCPA 2JH8A 1MT3A 5B3LA 2OQVA 1PWHA 4RF3A 4R68A 3A37A 1T4GA 4HGQA 5AW1A 3E7PA 2JLAA 1YZGA 2IZOA 3IODA 5EIXA 3M5PA 3D4IA 5JZVA 4DV6B 1BDMA 4HQ6A 3PT9A 1O8BA 3WL6A 4AG5A 4DEYA 4TVSA 4YCCA 4Z4HA 3FIJA 3L01A 5HR5A 4X65B 4FM9A 1Y9DA 3HCFA 1MIOB 3V55A 3DZFA 5KTNA 3MNFA 3DVLA 4RJIA 1US8A 5F76A 3I5AA 4BX0A 3WRVA 4UNNA 3LQ1A 2J5RA 2A3NA 4WLNA 1V39A 4EEZA 1K7CA 1RHUA 5AVQA 2ZR8A 1U11A 2WTBA 1BVHA 4DLAA 3ESYA 2XGGA 1EK6A 2J7PD 3KYIB 2GD2A 3CVOA 3L05A 2WTUA 1T43A 1DX9A 3MJHA 1FNMA 2C2YA 3CBQA 3RUIA 5I3CA 4ED9A 5FCDA 4H7IA 3A4MA 3EDRA 4TMTA 2V65A 5FAXA 1L1RA 2GK7A 1ZIOA 1I3CA 4AQDA 4XH9B 1IHXA 1H2ZA 4P5EA 1DPGA 2WW8A 5JBIA 2BCEA 2QSUA 5CT5A 3LQQA 1QTNA 3PWZA 5HPYB 5CIYA 2QN1A 1H05A 3JAKA 5G41A 5T3YA 1JEYA 3I8OA 4QFMA 1K7SN 2JCSA 1NT2A 3EPPA 4AMYA 4JLVA 3PC3A 1MH1A 3C2QA 4JLMA 3V7WA 4Q9IA 1NUQA 2YJ5A 1TYDE 3EMKA 3F6RA 3U0BA 2WK1A 1JWBB 1I2CA 1YKSA 4RPKA 4N41A 3E2IA 2MHCA 2B1GA 5HM6A 4M8SA 1J22A 4MJ3A 4X94A 4FGKA 1XPUA 5BURA 4DCGA 1NUSA 4WZBB 3QG5A 4CTJA 4KTVE 2WSSA 3V8MA 4NZPA 4MVJH 3ASUA 3U4QA 1IHPA 1NQVA 2A35A 1PZNA 1BDJA 1XZAA 2RAFA 3VC1A 1U0GA 3LKBA 1E4VA 2XWQA 4KIJA 2EOAA 4X1IB 2RKBA 1KOFA 1VJRA 2GPBA 4HPXB 1E1KA 1NOKA 1OH5A 4O2AF 3M2TA 2PUHA 1WXFA 3AWIA 3TLZA 3OHSX 1C9MA 1YACA 4RF2A 2I80A 1F8UA 1FFHA 2DUUA 2IGTA 3OLQA 2HPVA 2OXIA 5HKLA 4F8YA 2I4LA 2GPYA 3G2PA 3I6IA 4YWHA 3KQMA 5AKKA 2C2HA 3NIBA 1SHKA 1IIBA 1KP9A 2EJTA 2NACA 3BJEA 4LSWA 5DHFA 5JRZA 4OMCA 5FBKA 2BWJA 3KC2A 3M8KA 1YJ5A 3QOWA 5AESA 3DUFA 1XN4A 2WILA 2C9YA 2X0RA 3HG7A 2FE4A 1F51E 3HNRA 1L9KA 5B4VA 3CEHA 5BW4A 3ADBA 1V8BA 1ZHHA 5FAKA 3X1WA 3GWGA 2ZBDA 4NJEB 4K40A 1BGXT 1J99A 1E0SA 3BXZA 2HXYA 1TO1E 3MWDB 3WFJA 1IN7A 2JJMA 3A32A 1OLXA 4D25A 2DCMA 2EERA 2X23A 4GOOD 1WTCA 1ZSYA 2M98A 2W8ZA 2DMRA 4GICA 2B8NA 1S3SA 1MX5A 2RGEA 2ZREA 4ZPXA 4GI7A 3IUQA 4E12A 2AN3A 1A8IA 1VC2A 4WNCA 1J9EA 2J7KA 2QRZA 3D3JA 3KM0A 1GUYA 4QEZA 5FUWA 4N8EA 4JLSA 4MVJE 2EV9A 1BTOA 1LSSA 4F2DA 4FP9A 2Z5GA 3O8OB 2BMFA 1YJQA 5ICCA 1N2CE 1CYDA 4I50F 2XLCA 2YCLA 3HXKA 1YDWA 2MYUA 1TCVA 2EF0A 3L0SA 1EUZA 3ZJUA 2W22A 1G41A 3PD0A 2IZZA 2ZUWA 3Q9UA 3QXHA 4GBJA 4YRTA 4E11A 4CF5A 1E8MA 4M88A 3SDSA 4MYCA 5HUJA 2HT1A 2A86A 3ZW7A 3OM9A 3CO5A 4QJ5A 2BF4A 4ZVLA 4KH1A 2Z2ZA 2W71A 4J94A 5AW8A 4X95A 4FEYA 1JQ3A 1AHNA 2J09A 3L9XA 2UU9B 4TSFD 1BJRE 4BDTA 4G8BA 2JARA 2XYRA 4HH3C 4DBZA 4BZWA 1SU4A 1GFWA 1YR3A 3JQGA 4LC1A 3EWSA 4KWIA 5F64A 1XZBA 4U2BA 4J7XA 4XSGA 2IHYA 3SR0A 3EWIA 1YSCA 2E3JA 3FG9A 2JLYA 2IYRA 3EXFB 3NOXA 2W7TA 4RHTA 5ICGA 2CMHA 3W6OA 5FTKA 4CL2A 5ETJA 5DLDA 3MXOA 5CDSA 1NU8A 1JDSA 2VUTA 4LHXA 4OP1A 4W5WA 5FWXA 1Z35A 2XUZA 5AM1A 3TR0A 4BRWA 3BWXA 1DHTA 1SURA 3U7GA 5CEJA 1QH1B 3IILA 4KFTA 4XUDA 3IP9A 4TMVA 5I3ZA 4UU0A 4ZT3A 1P7VA 2P4QA 4NU0A 3SXJA 5E7MA 4BCDA 3QEOA 3R3UA 5JXIA 4RTNA 3H4VA 3NDIA 4H4CA 4RANA 4F5DA 4R2LA 1TC2A 2B3DA 3CT6A 1DC6A 1I80A 1RIIA 3LQRA 4YLGA 4ZOCA 5HMLA 3H6KA 4GC9A 2ZSHA 2FPGA 3K96A 4X8OA 5EKTA 1KMHA 2CL7X 4ZU6X 2XMQA 4G41A 4CNQA 1K66A 1K98A 1W25A 5F9FA 3JQ8A 1T26A 1SXQA 2HLDA 4DDKA 1HZZC 3R9WA 1CY6A 1LLDA 3ZY6A 3KHKA 2XWJI 3NJ4A 1R0LA 4KKXB 1FP6A 4QAJA 5ERGB 2X3FA 3DCYA 3W1WA 1G3IA 3S44A 1UAYA 4BNNA 4AVYA 2OG1A 2JGDB 3DG9A 3QEMA 1CQXA 1P44A 4N0EA 3TTWA 1RW4A 3KLBA 3WK5A 3NBFA 4ENVA 5ELXA 3NH6A 2YWCA 3EXIA 5FJJA 3RIXA 4YJHA 1GTVA 3INGA 3N75A 3BCUA 4PPQA 3B1ZA 4QYMA 2AZMA 3VPAA 2I3BA 4OLAA 3TYXA 1VKRA 4BQPA 2ZJ5A 2XTNA 5TS3A 2P0YA 4J2TA 4UFNA 2QNRA 3W3ZB 3QYPA 1KOGA 1SKQA 1T10A 3R3JA 3ZCSA 3N2KB 1Y81A 3BTUA 4HLCA 1XZHA 4ZZ0A 1EUCA 1M1ZA 2A5YB 1D2GA 1GPDG 2FSIA 3RV4A 3W5HA 4EYGA 3H5AA 4KWEA 1HF3A 1M2OB 1NPYA 2O0MA 3BSFA 4E07A 1W93A 4FYIA 4OP3A 5LU9A 2DC1A 3TX6A 3UMRA 1P9WA 1ZW1A 3BFXA 3L0BA 4O33A 2AK2A 1E1CB 2JJ1A 2PRJA 2XDQB 3DF9A 3F4LA 4LZAA 3AY0A 5PGMA 3IP5A 1M6YA 2HJSA 1R9JA 3UK0A 2H4HA 1UINA 4P31A 3AF1A 5DXJA 2QP3A 4NJOA 3ADOA 5IASA 1TZCA 3W04A 3MCWA 2QUJA 2PGNA 3BJMA 1JAXA 4FLFA 2ZIZA 1IEVA 3DEIA 1CB7A 4LJLA 1M75A 3QE9Y 4MHOA 1M72A 1YQXA 2YVLA 1G8HA 3SIXA 3WWDA 4D8WA 4YV7A 3GU3A 5CUQA 2VSNA 3LO8A 1M34B 4CKEB 3R7SA 1PR4A 4EO7A 4U7TB 2CXUA 5K6AC 4RL6A 1Z0SA 1N1DA 2YCBA 1A2KC 1DGQA 2G40A 2Q3CA 3F5QA 4KVFA 1ABFA 1K0UA 3BRCA 4ITVA 4P4UA 5B3KA 4J0GA 5L3QB 2HJVA 4FFNA 3RGWS 2R65A 1RPJA 2H31A 5T8KA 5A9TA 1Y89A 4TRMA 5JMWA 2W6ZA 2EW2A 5ED0A 3ICPA 4M8NE 2VDNB 4OATA 1LKZA 3GJ7A 2B1JA 5CPFA 4BNFA 3RAEC 3DBLB 4E2ZA 5JSUA 3M6XA 4N5DA 1UMDA 4Q1BA 1M7GA 2ZS7A 3MBKA 1FUKA 4CQLA 2IYAA 5GVSA 1YJXA 1JSLA 1BJTA 4Q4JB 3QI2A 2I2FA 5I7AA 4EKNB 1FBNA 2B4AA 4JLAA 1UQUA 5IAJA 1JG1A 1SKUA 4NV0A 3TTUA 2OWDA 4XPIB 3BN3A 2W6ID 2A57A 2MSDB 1X8LA 1W52X 3EXAA 2GCOA 1UWKA 4OUKX 3CB2A 1N6HA 4A8JA 1O6CA 1MRZA 3P9NA 4TXLA 1QG4A 1YL6A 1NR5A 2OYRA 3AVWA 1H66A 1I3NA 4U5QA 2F3RA 1P1IA 4IXDA 3ETDA 4HAIA 4M7WA 4TWJA 2AQ8A 1PU2A 3GUHA 3IB3A 3QE0A 3FYTA 4EQ6A 1T9DA 4L72A 4TWBA 1RXSA 1ZCBA 5CFPA 1KI4A 1Q0RA 4ESVA 2QVZX 1TVEA 4ZTUB 2PKQO 1D1TA 1XELA 2B92A 2CDCA 3HB1A 3QZUA 4C08A 2JPDA 3BFVA 1YR7A 2EDAA 4DIKA 3OEHA 4A8PA 1XHEA 4KPFC 3LJKA 1EFUA 3NT5A 2WJGA 2OP0A 2YVAA 4ALLA 2DT5A 4MUFA 4ZI7A 1UQRA 1N32B 5DEIA 1QGDA 1RRVA 2QTWB 2MR5A 2C31A 2PCJA 1H2HA 2ZCJA 1I36A 1RKUA 1RWQA 3AHFA 3JSAA 1MC5A 4RKFA 4UZSA 5EZYA 4Z2YA 3SX2A 1PJCA 4Y6OA 1IFXA 4MIYA 5DWQA 1QYVA 4ZVVA 3TR5A 5BN5A 1GQYA 1Z2NX 5I7HA 1EU1A 5I4BA 2Q9UA 3R9XA 3HSYA 4FHGA 4ND7A 1QX3A 1KK3A 1UBFA 2QZ4A 4U2CA 2BGMA 1KY4A 3R5SA 4I2NA 4JJ6A 2QN7A 3QUCA 5FIUA 1E69A 5DJ5A 3L04A 3UAXA 3VYRB 3W4IA 4A6PA 3PUZA 1NUAA 4FYPA 4MXDA 4AP9A 3VO1A 4JIMA 4MWTA 1DFHA 2PLAA 4RK1A 4UW9A 4DXDA 4QHYA 2I54A 5FO1A 4RDHA 4U3JB 1RBQA 2DUJA 2Z57A 5CNMA 4P4SB 4ZV7A 3SOZA 2WHPA 4XWWA 3C1UA 3S6JA 2PR2A 1RYHA 3IEIA 1FZQA 2EQBA 1Y1QA 3FPBA 4DYHA 4FPXA 1EWVA 2HIHA 1HT3A 2X7HA 4OHKA 4D02A 4C7VA 5HF6A 3JRXA 4CLXA 3ESQA 3S1AA 3HDTA 5BWLA 1GAQA 1H9CA 1QPZA 2ODWA 4OAPA 1DOZA 3CLKA 5EQDA 4BO1A 2RG7A 2JLQA 3VVMA 4AO8A 2ZLBA 1G5TA 3RI3A 3U61B 1MIHA 1G0OA 2OFWA 4F4UA 2E87A 3I1JA 1GCOA 2GDZA 3D3QA 4ZP1A 2AJLI 2ZUDA 5DYIA 1ACJA 4P4NA 1KZ4A 1X7ZB 3PNQA 4U9UA 2JLSA 1QO0D 5GM1A 3UWKA 4DCSA 4HAYA 3A9VA 5BYBA 2YNMD 3TZBA 1OZ0A 2P9YA 3PGLA 4KUEA 1XB2A 3D8TA 4JBGA 3L92A 4WFKA 5KJCA 1HOTA 5GOTA 3U6BA 3QE2A 3MLBA 1XALA 4B2LA 3DHWC 3KZMA 2V98A 4K81B 2B2NA 3IBSA 4X6LA 1P6QA 4W7SA 4QRHA 2X9GA 3S7ZA 1FTGA 3OPNA 2AEMA 1KMNA 1IHYA 2I6TA 5BUCA 1E2QA 3CISA 4JJIA 4ER6A 4LZZA 2A67A 1IJEA 1KBQA 4BBJA 1T6BY 1Y0BA 3MCUA 2BEWA 2QYTA 3AKCA 3MD0A 1UJ4A 3DMPA 2RHWA 4IF6A 3CSDA 2X7JA 2A59A 2SKCA 3RYHB 3LQ2A 3WZLA 4EO9A 2LBPA 2HRBA 3HADA 2AA3A 2P30A 2ZBVA 2P5YA 3EXHA 1O9BA 2W6QA 4TGLA 3WGOA 2UYHA 5DHSA 3FKJA 3FPHA 3U62A 1E8DA 2XQKA 5TMDA 4MVJP 3TBKA 3K9QO 2X40A 3FXAA 1DC5A 5C2JB 3PKJA 3AI3A 2OAP1 1WUJS 2NU9A 1Z5VA 5CFLA 2CV2A 3H8VA 5EFZA 2H4ZA 3LQ4A 1XFDA 2AV6A 2CNWA 3IIMA 4CKZA 4C78A 5B3JC 1S2MA 3LRTA 2JJQA 3EK2A 5CM9C 3FETA 4C9BA 3TUJC 4HWKA 3QFTA 3CNNA 1J09A 4FFVA 3ECAA 4K9QA 3ETGA 1YI8A 4U2FA 2HK9A 5IMBA 1MTZA 4KDFA 3F1KA 4MVWA 1DUSA 1SELA 4TYMA 4OJNA 2JA1A 1Z4MA 3TCKA 1GCAA 3FYDA 2Q6VA 2NNWB 3H2KA 2DKNA 2BLLA 4HPJB 2EJCA 3CEMA 2VWQA 4XDGA 3TINA 4HJRA 1YBVA 4H1UA 1BW9B 4JOQA 4PINA 5K0NA 1XWFA 4X90A 1ID8A 2BHLA 4GT1A 4XOIA 3WRWA 2QLMA 3CBGA 1GG9A 3KQOA 2OBBA 4E94A 3E9ZA 5JS2A 4DV5B 1ACLA 4OY3A 4MS3B 4AYWA 1KO5A 2DFLA 2VYFA 2WVJA 1P5FA 3N28A 2DHDA 4FWIB 4LYFA 3I5XA 2XQJA 1ZUHA 2CHQA 3E27A 4W7IA 5CRIA 3KLMX 3WXBA 3SVLA 5JEEA 3TNJA 2LTAA 5C46F 1O94D 2PKXA 1ZSVA 2P5SA 3P9KA 1W5AA 1MQAA 4HWOA 5KYUB 1FMCA 3SEQA 2YJTD 5I7RA 3OZAA 2AG0A 3VUFA 2RGYA 3BK7A 3LI2A 4YASA 5K45A 2ZS9A 1TO6A 1P29A 3E9YA 3GAAA 4Z4EA 2QUKA 2IL1A 5JFGA 1D7AA 2ET6A 2AR9A 3N05A 4LMPA 3KQLA 2NO0A 3EG9B 2YXLA 5DI9A 3LW8A 3FTDA 1T9AA 3FTEA 4DR2B 5HIKA 3M83A 4OUDB 3FPJA 4ENQA 2JFPA 3N58A 1WWKA 3ZHVA 1GPH1 3OC6A 5K0JA 4FX2A 3K8ZA 4G09A 2VP6A 1Y8ZA 1NX9A 3W4JA 3RBXA 1I01A 2E2WA 3GUUA 3ZHOA 4ARAA 3PC7A 3IBGA 4M21A 3EX7C 4HDRA 1YZFA 1TLTA 4BQOA 3ZDZB 5JZBA 1QP4A 1MV5A 3LVBA 4N3GA 1GPAA 1SNYA 2AE1A 3BGWA 3H5NA 2CKMA 3C8DA 5KNLA 4OHWA 2JCGA 4RFSB 1HTBA 4TVBA 3ETEA 2XWBF 3DEFA 3IAS1 2C84A 1RZRA 3LBYA 3GG9A 3KX2A 2G9RA 2FP4A 4OI1A 1V7PC 2OC4A 3H1GA 3GZJA 2VHCA 1SCDA 1O2DA 2ZM5A 2RHDA 1M6WA 3SPXA 4KFCA 2IW3A 5JAQA 1IPEA 1YU6A 4CG3A 3JARB 5KNCD 1RXIA 3IE0A 1KRWA 4FSHA 5JT1A 3VNAA 2YXBA 1TOAA 3GT3A 4M9ZA 3HE3A 1U6IA 5ILGA 3BL5A 4FU0A 1QKJA 4Q00A 3D3NA 1YIOA 4BJ3A 4YMWA 4B76A 4IWNA 3OKAA 4A82A 2Z8YA 3ZBPA 4HTAA 4LHSA 1LB1B 5D1NA 4S1VA 2PFKA 3GV0A 3JYHA 3HR8A 1MP0A 1IY1A 4NE2A 4P81A 3ZJ4A 1ZLXA 4YN3A 2NUPA 4N4AA 2I8LA 4LWQA 3IAFA 4W8GA 4XFJA 4QLBA 2FOLA 2J30A 1MRNA 2Z43A 3HP4A 2B37A 3K5IA 5F51A 3TIGA 4ER7A 3B3FA 2BZSA 3PHJA 3VISA 3LWDA 3VNSA 3OEEA 2V7EA 1OLSB 4DA7A 4MQLA 1MABA 4UC0A 1E1DA 2BZ1A 1D4AA 4NENB 2BHTA 4HDSA 5FKJA 1NIJA 2H1HA 1OX5A 1THZA 1HQKA 1TQ4A 1W6UA 3GUVA 3JWEA 2PJZA 4PR3A 1QOQB 1AS3A 5J23A 2NZYA 1JU3A 2Q0XA 2FQWA 4A0QA 5DHTA 3PHHA 4TPKA 2HM7A 2N42A 2ONJA 1TVMA 2ATCA 1KDRA 3O90A 3G9QA 3WLNA 2XWPA 3WDLA 5IZCC 1XCBA 1E89A 4D3XA 1GZUA 3FMPB 3PLRA 4HH1A 1YE8A 2J07A 3TGLA 5ITSA 4Q19A 1RP7A 1ISRA 4QNMA 5E1OA 5FPYA 4OLJA 4IZHA 5ADHA 5IAEA 2QBYB 4V1CA 1B74A 1YR6A 1ZJJA 3DE3X 4RTRA 3ER8A 4UNIA 1AB6A 1YHNA 5EJAA 1PK7A 4MEJA 3GVIA 5C4GB 1AQYA 3AL2A 1VL5A 1YRYE 1ZONA 3GR6A 3AKYA 3DDOA 4QWMA 3OM1A 4YQFA 3LBHA 5ES4B 3EZ9A 2BR3A 3ZWPA 3L41A 1PEYA 4D0GA 4DIDA 5REQA 5HQ3B 4PRLA 1GO2A 3KT0A 3N0VA 4FI3F 3L2OB 1DFGA 1XD8A 1YA8A 5HDQA 4FYHA 4UCXA 2DBRA 1R4AA 2AUMA 1P5JA 5KHAA 3COYA 3IO5A 5J5VA 4BZPA 5K6RA 3NW9A 4DG9A 2Q5IA 4W5RA 4LVUA 3L84A 2WD7A 1I7NA 1PJ2A 5EWJA 3PYXA 3QBTA 3ZIDA 4TMWA 5B12A 4NE7A 3D6HA 2FQ1A 4LBWA 5T3UA 4DWVA 3X1JA 1PF7E 3WAGA 4PIVA 1AVTA 1D6NA 3IURA 1HL3A 3DBVO 1Y8QB 4XVQA 3WK7A 3ER9A 1O08A 1CUYA 2QW0X 4BFZA 3WGUA 2HLPA 4MR7B 5KX5F 1W88B 1RCUA 3LC7O 5D7NA 1YMVA 3KCQA 3D8HA 1EFPB 2FMFA 1VHLA 3FFWA 4MV4A 2GYYA 1RKXA 1V6CA 1EQAA 2G9NA 1P3Y1 3ZHSA 2FPLA 2J5XA 3VX4A 4RW0A 1RVV1 2BFBB 5TX7A 3E4CA 1VE3A 3BVPA 5FDFA 4XYBA 4XUGB 3S7TA 3D7LA 2J32A 4E1VA 1E2MA 3BJZA 5AKGA 3ON5A 5I6DA 3L43A 3PC6A 1E6KA 1FNSA 4N82A 4X9XA 2AEJA 2JGAA 1JYSA 4Q02A 1U1CA 1ODLA 1WPRA 3IKJA 4NH0A 3R7FA 1I7QB 2ZI4A 5GINE 5EQTA 3WBJA 3OHPA 4EG7A 3NBYC 4CNBA 5KOHB 2O14A 1J0BA 1UBHS 2CDBA 3IR6A 4UUNA 5HGJA 3WC4A 3TG8A 4UAJA 3R7DA 1F9AA 2PZJA 2D0OB 5AKIA 4CM9D 3UMMA 3EWNA 3FFAA 1NM5C 2VN8A 5GVRA 5K4AA 4B4KA 1ZK2A 5AMXA 2B8WA 3L7JA 4LZOA 1C81A 1LPMA 2H17A 2ABWA 3TTXA 3GK3A 3KYJB 4QUHA 3AR8A 1FPQA 3JVIA 4B5KA 2G1JA 5ESRA 1P0MA 4I50A 3NM6B 4H0NA 4KNWA 1MLDA 4MMZB 3FNEA 3K0AB 4CI9A 2AEEA 4P7BA 1WHSB 4RZ2A 2Y77A 3ETNA 4OK5A 5M3BA 5K6AA 3MPUA 4B80A 4C2UA 1QHNA 3SC2B 4PX3A 4YC7A 2ZRIA 4P58A 4YRJA 5LWQA 4JUIA 2AZTA 3AYZB 5FOQA 4R7GA 3PJDA 1HTWA 3PPIA 1D03A 5CR9A 2ACEA 2GEJA 4AM8A 4WXYB 2XDAA 3X1ZA 1BAPA 3VYWA 1W85A 2VXOA 5KQRA 5LZ9A 3ET5A 3IPCA 1E7RA 3LT5A 3DV9A 1G63A 3TOZA 1SOVA 4MAFA 4YCSA 1RI1A 1LS1A 5IULC 1NF8A 4D45A 4HH0A 2GEBA 5JUWA 1I2BA 2NSDA 3ESBA 3NXSA 2D59A 1J9GA 3VAYA 3NTQA 1NZDA 4FHCA 3NBXX 3HDHA 1K7XB 4TMFA 1XZMA 2EEZA 4YY3B 5M34A 1HE8B 3NP7A 4NX2A 1M7HA 4I46A 5JAOA 1XL1A 1HK7A 3FI0A 4ZIRB 5B57C 4CL8A 4F96A 1RMYA 5K0BA 3TSZA 3ZGVA 3QHAA 2HAEA 5JJLA 4RDIA 2MMGA 3U44B 3O2NA 4FI3C 3GFVA 4U2KA 1C41A 3UV6A 3VHQA 1DQPA 2NZXA 1XBTA 2ZJ0A 4MCIA 1DWPA 2R48A 3CONA 4N7JA 4I5FA 4OIMA 1ZMXA 1Y1KE 2VOEA 2O7QA 2JK1A 1QWOA 4O4JB 1JR4A 2ZIFA 1U9IC 5IJ9A 1NN1A 1WL8A 2A9VA 4ZGGA 1AH2A 4XOUA 3Q8MA 3FZEA 1FDTA 3DMHA 2Z5VA 5JEDA 2PWYA 4EG3A 1GYQA 3RREA 1SZPA 1YJBA 4BO9A 2ZUSA 2I2WA 1B0UA 4WKCA 1DAOA 3B6ZA 3IP1A 4KIWA 4XFDA 4XSHA 3L0CA 1J5PA 4EHLA 4NVRA 3RC8A 1T1IA 2WPDD 2Y92A 4H1HA 4EGSA 3B3JA 3MFYA 1NT4A 4DLUA 4QM7A 1PV4A 1GZVA 1ZH6A 4D0LB 4QELA 3EN0A 5CW2A 1WIWA 3HVJA 2Q8QA 1ZVKA 1ORDA 2WSMA 3IPYA 4UAUA 2XNJA 4EVRA 3KSMA 2P3LA 1UIRA 4WCFB 2VHWA 1P9NA 2N46A 2VQSA 3L0ZA 1C3XA 3C74A 4B3FX 2EGUA 2W2LD 1A98A 3Q3HA 3ZK9A 1D1SA 2ADFA 2DTEA 4Z9YA 5JYCA 3TB4A 1E9BA 3BMXA 1MVOA 2REBA 3FOAA 3PWKA 4TLCA 2XBMA 2V58A 4WOKA 3CZAA 4G5HA 1U7WA 4K9OA 5IUJC 3IPLA 3VH2A 3CH7A 1QF6A 2O5CA 1T2CA 3SSMA 4X7MA 2GF9A 3DWFA 5F21A 1WW2A 1G9SA 1WCIA 2XECA 3NPAA 5K99A 5KJFA 3W5DA 1ST3A 2D1RA 4UUQA 3DEYX 2NPFA 4ZOQI 5HKAA 3P2JA 3FY4A 4EMBA 3GGOA 1U0JA 3PLAE 4IIXA 2ZPTX 2WHEA 4Y2SA 4KN9S 2N3ZA 4BLVA 5B7GA 4FDMA 8AT1A 1EUYA 4I4NA 5LBIA 3NM5A 5JATA 1OFUA 3QPCA 2RD2A 1WV0A 1FXSA 2QU7A 5KDDA 3EUAA 3WIOA 4EB3A 1H9AA 5IP5A 1JE1A 2YIJA 4C0HA 1QIJA 3DOOA 4S05A 1T1EA 1K86A 1CLEA 3VVCA 3VNUA 3JYOA 4LYHA 4O8ZA 3A1DA 2OEPA 2QJTA 1ZICA 2UXDB 1FK8A 3EF3A 4A15A 3PNKA 3VR4H 1GTSA 3EZ7A 2F4VB 3DKKA 1CNFA 2V8BA 5EINA 3G8AA 1WXGA 2G4LA 4HO1X 1BD4A 1WXXA 3LUDA 3DAFA 1L9XA 1VA5A 3IAM1 3KV3O 3P9RA 3NT2A 3Q12A 1YK1A 1CQIB 4RTMA 2FRXA 1GPUA 4DKJA 3TLAA 1FX1A 1X94A 2KQUA 1Y80A 3H86A 3UGKA 4A26A 1T6XA 3D31A 3QJYA 1OFHA 1K7EB 1V8OA 2GPTA 1IZ8A 2VYQA 4PSAA 3IDZA 3R7LA 2XKJE 1Y6ZA 3OZXA 4PRYA 3AJ9A 3ZH9B 3H11B 1BHO1 4M0MA 1FBTA 1YRLA 2VAVA 3EZ6A 4L28A 4JUDX 4GU5A 2C58A 1AURA 3K0FB 1J90A 4X8HA 4XJTA 2H85A 3QTLA 5DM1A 2QR3A 3ONEA 1W5FA 2OA0A 1QUFA 2FPWA 1WSAA 5LDHA 1QP7A 3HDQA 1DAHA 3EUWA 1Z4IA 4JHXA 4ZODA 3IMFA 4MP3A 2I1LA 1JEEA 1ZM9A 3OWOA 4MJLA 4OGWA 5HVNA 5KSWB 1IMJA 1DC3A 1FVHA 1NR7A 4ZWNA 1UAAA 3A1CA 2Y1FA 1SCIA 3LCVB 4MWZA 4D3ZA 2I4TA 3R6LA 5BOVA 4GG1A 3UB2A 1H4TA 3IA2A 3E35A 1T8SA 2A1TR 1A5AB 4KXMA 4DMRA 4RD3A 2WHRA 3RAFC 1ZGAA 1MA0A 3VR6D 1Q14A 4ZEMA 1DC7A 5E1DA 4M1EA 5SY6A 2AHOA 5KJ6A 2AFHE 1FYEA 2MYNA 2IUEA 3T3DA 1CULC 5LMZA 3GJSA 1P74A 1SB9A 2VKQA 1FDRA 4X1IA 4URVR 4P33A 3DKVA 2EU8A 4MI3A 2QX7A 3V2UA 2XZLA 1O57A 2DULA 2OGWA 1H3FA 3N2IA 1NG1A 1OFUX 2VYVA 1CUVA 1HH4A 1PR3A 2A0XA 1MJGA 4N76A 1J6UA 2FN4A 3BORA 1PQUA 5CPBA 5L3VA 3NGXA 2PU5A 2RBKA 4N01A 4MW2A 1XQVA 4H08A 4P5PA 5EPUA 1N2JA 3C4QA 5CAEB 1KA9H 4A23A 2PZBA 1XEXB 2EEPA 5SYNA 1XAIA 1DJOA 1AQ6A 1KYZA 3DDSA 5FWYB 2HRZA 2KSQA 2V0GA 2E1PA 3KTFA 2Y0BA 4JMPA 1ONSA 1VHTA 1SRQA 2JK0A 4EMTA 2V3VA 1QCCA 2NVOA 1YRQA 2PYZA 2WJJA 1VMKA 1RYMA 4MJXA 2FFJA 3U4HA 4LISA 3B1KA 2ZU0C 1NYLA 1T0IA 1RWVA 1ECBA 3BTSA 3F3SA 4JP5A 4MI9A 3A58B 3JSXA 4TXNA 1PD0A 4GS5A 4ZYVA 4S2UA 1PGNA 1Z6GA 1ZG3A 5DYNA 3LLSA 3CEAA 3GLHE 1YBMA 2WUEA 1PAUA 4TV9A 3CPEA 3BIFA 3COSA 4UUMA 4IJKA 2QROA 2LDBA 2Q5LA 5LZ4A 3WMEA 5J5AA 2ODNA 1TYBE 3CT4A 1WXQA 1RU3A 2PYIA 2BKVA 1F2VA 2ZRQA 1IUOA 1R3DA 2Q9AA 3JX9A 2XSZA 2F1IA 2Y0DA 3OPQA 3O8OA 4OSPA 4P7GA 4Y2RA 5D85A 4ZT4A 4W5QA 4IDBA 3HXMA 2EQ5A 4PLTA 1W9HA 3R0JA 4LCEA 3V48A 1YOVA 5EJEA 1WMDA 3ML1A 3WICA 3P97A 1AK2A 2BI7A 1BHSA 1JFFB 1VKNA 3OESA 4QPPA 1FQKA 2FHPA 4ISCA 4JGIA 4WGFA 3PHBE 2D5IA 2AZDA 4LBVA 4DYDA 2NTNA 4UVDA 5KYNA 1AO0A 1T3SA 4M4SA 5DYWA 2C9BA 3GLVA 3UH1A 4BOYA 5ALDA 4BO5A 1RTKA 4K3UA 3TS1A 3DVRX 1KJYA 2VVTA 1B6GA 2VT2A 4MUBA 4RKWA 5AUQA 4CLOB 1E1RA 3NOQA 1POWA 3QVOA 4J9VA 1ZEJA 3ZCQA 4KE6A 3DHYA 4EJFA 2P4UA 1J25A 3EXFA 5IKMA 3MJVA 3ICOA 4RIHA 3HWWA 4GC5A 3AUXA 1Y3BE 3K1TA 3O74A 4QO7A 2WY2D 2AJCA 2X5OA 4ZA2A 1KFCB 2Y8EA 1F2UB 4JP3A 3H2HA 2ZSFA 3A25A 4H9GA 5KWIA 4WV3A 1Z4PX 3RTGA 4IFTA 2WIJA 4GVPA 1QH1A 3IJEB 4IPTA 5LXTA 2B7CA 3ORFA 3AMVA 3E3AA 2QMQA 2XQFA 3EEFA 5HIJA 5F7XA 3P0RA 3AJRA 1FFBA 1JN0A 5GQSA 2XBLA 1P1KA 1OFIA 1R4ZA 4B4VA 4KWCA 4PWZA 3GELA 3P5SA 3UJHA 1U8AA 3ZS8A 3QP9A 3DPIA 4LYAA 4RMNA 1SBCA 3H8WA 4MIKA 3SHFA 1XXHE 2ATEA 3ZE8A 5JWOA 4MQUA 4O4JF 4FXOA 3THOA 1QR2A 4D8YA 4FDLA 2OCYC 3R4VA 4KL8S 1Z15A 2NVWA 1AOXA 1VKJA 3NYQA 4P4GA 2DPMA 3RK0A 3MTIA 2MTBA 3DKIA 4DR6B 2DETA 5DIZA 4Q1AA 1F12A 1PT7A 5B3AA 1AK9A 4KR0A 4TTIA 3L5OA 5JPDA 3PXGA 3T7EA 3AETA 1CR0A 4OQXA 4R5MA 1WKVA 2JGDA 2XYPA 4DA6A 3UOAB 2GRUA 1M76A 4B3BA 1PRYA 3W5BA 2V9CA 2G7ZA 4GNKA 4CKCB 1B8VA 1VE6A 4AKGA 1EX1A 5GMOA 4YBRA 5KSPA 4CR8A 2XOKD 2TYSB 4WY5A 1DBSA 4BC0A 1RKQA 1CNEA 4HB2A 4C4XA 4Z4IA 2XUHA 1OX6A 3ND8A 1M5RA 4O2LA 2VT3A 5JCOA 3IB6A 2IU4A 1CB0A 1AX9A 4E5MA 5ED4A 3O8RA 3N2KA 2CD9A 5TT0A 1FX0B 3G7SA 3Q3CA 1QM5A 4ZAWA 3OKCA 3VJMA 4V0RA 1FMTA 2QPLA 4I66A 2ID8A 1NOJA 3RUCA 3LP5A 1W4CA 2W4IA 3LHFA 4NATA 1XU7A 2EJBA 3PUHA 3AG6A 3QNUA 1L5RA 3IPXA 4I0WB 5TV2A 3S2UA 3ZEIA 2JBWA 3RYCB 2UYCA 3CVXA 2C8VA 4P7FA 2XDQA 1VIMA 3LF2A 2YMPA 3VPHA 4I36A 2OHFA 4XD7A 4F9FA 3WSVA 1RSZA 1TF2A 1WUKS 2BFDA 2CLHB 1ZM2A 4FE7A 1FVOA 4QDXA 1E98A 1XZGA 2O48X 3FZYA 1MAVA 1WDKA 2NXNA 3CF4A 1Z45A 4ZALA 3HR4A 1V96A 4MPTA 3U0VA 3V8PA 3FNHA 2IZ1A 4NMWA 1HE1C 1VE5A 3R5FA 1QHYA 4I1VA 3HDVA 5DYGA 4YP0A 5T5QA 4NKRA 3AHGA 1M34A 1UJBA 3WB0A 4CKEA 5JRJA 5C8ZA 2RIPA 3PL5A 5EE1A 1HT1E 1T0BA 1IMOA 2WJ4A 3DWEX 3C6MA 4LGVA 4DJJA 1KZ7B 2GN6A 1N1EA 4LVNA 4CTKA 4N12A 1ECFA 1NI4B 2I7DA 2QVYX 4DDVA 4KLZA 1BD3A 3ROMA 3JD1A 5KMGB 3AQ4A 3DM5A 2ZZNA 1JNYA 2KYRA 3QKIA 4Q5IA 5IXSA 2I6SA 2AW5A 1L5MA 1N7IA 3CF0A 1NLMA 3IBCA 3JQAB 2WF8A 2VL7A 4B84A 5L3QA 1NM5A 3AF0A 1F8YA 2Y2UA 5KZMB 1TEXA 1Y7HA 5GIPE 1ZN9A 1IN8A 1KI9A 1A0OA 2FR8C 3EODA 2VSYA 1I9CA 2EGGA 1RC8A 3ZQ6A 4V0NA 1ZI9A 5C1PA 4H16A 4H3SA 2OPHA 2XXAA 5EJ4A 2WLTA 2WSIA 2JLCA 3PQ6A 1OZFA 2QXTA 4CIDA 4YJ2B 3WLLA 4CQMD 3B9QA 2BSQA 1NXSA 1EBUA 2P5TB 2QUHA 4Q4JA 1T8UA 3WBBA 4Q9LA 1R0WA 4IIGA 3G0IA 4XPIA 1Y8CA 2HO4A 3EZNA 2I71A 3N0WA 2BVNA 3T1TA 1D0VA 3K0CC 4IH9A 2L69A 1YHZA 1OXUA 4UEOA 3U4DA 1GPBA 2XXBA 2B0CA 3B3GA 1PVOA 1WOMA 1DCKA 1GLGA 1TADA 2RHBA 5DCYA 1QH9A 4E2FA 2QG6A 1RLTA 3WNDA 1Q0ZA 1W0KD 3ZXSA 1K88A 2QPOA 4L02A 5AOVA 5HM8A 4NU5A 1KBZA 2JVJA 4ID3A 1GUBA 4YYZA 4J1SA 4LJ7A 3CZMA 1AKEA 3A1NA 2H57A 4INOA 4KVGA 1DZ3A 4YRGA 1F5NA 1KC1A 2AOTB 1OY1A 4Q05A 5INTA 4W9MC 4YMVA 1ZISA 2PMDA 2XBUA 4BNXA 4AY6A 2YXEA 3NCHA 1DWOA 2PKYX 2VCHA 1MB9A 2P2DA 3QA3E 3QFRA 4NFYA 4FINA 1XYYA 2O23A 3G2NA 1PT5A 5KVQA 2DUNA 3A4YA 3IVXA 4FE4A 5AJHA 4EPVA 1N0IA 3T8YA 1KDZA 2QE7A 1JHXA 1L7AA 1NNI1 1QZTA 2WT9A 4LOKA 1BH6A 3D7SA 3EA4A 4O4IA 2XCRB 1P77A 2NVBA 1EFDN 4IIEA 2QVXX 2W43A 1OX4B 2C20A 2E5LB 2CUTA 1NC1A 3BD6A 5ITWA 4YJ2F 3HCBA 3RSHA 3PF8A 3P71T 1V41E 2FFRA 1UPBA 3GJYA 3BDIA 4U3JA 4H18A 3LFTA 2D8MA 1B0ZA 3EZ2A 4DLLA 4PN7A 4E5VA 4WCFC 2X9QA 3LC2O 4R6XA 3P9CA 5GZ6A 1T9GS 1N5MA 5EZ5A 4PTZA 4JI8B 4HB3A 5AK6A 3HBFA 5FTJA 1HEIA 4BN0A 2IVFA 3W77A 2R1ZA 4DG8A 2BE9A 1LLFA 4RL4A 1KS9A 2EZTA 3DOCA 1WMAA 3A1TA 3EULA 4FR2A 2E4YA 4ME6A 4BGEA 4DR1B 4C5BA 4YRCA 4FYWA 3FWNA 1HNXB 1T4DA 1DQRA 2RHJA 4RULA 1WABA 1ZRSA 2Z2YA 4GM1A 3BA1A 3U4IA 3EVTA 4RKRA 2GYUA 2IPOA 1S1MA 4NBLA 3H9EO 4LFAB 1E62A 2E55A 4LKOA 5EGSA 2FPPB 3EFOB 5IX8A 4GKAA 3EIHA 2PGAA 1Z62A 3ZVRA 1UC9A 4M2LA 1Z0DA 4RO0A 3PL1A 3ZJYA 1ZVJA 2ZTHA 1IBMB 1YS7A 3C4VA 4MB6A 2OE2A 5JCPA 4FDVA 5D5HA 1R12A 5JDCC 3MOIA 3PDHA 3C3DA 4WJKB 4C05A 3I8SA 2ZDQA 1OGJA 2XOXA 3PCRB 1MJHA 1NIPA 4KHPB 1QV6A 3MSXA 4GEKA 5ELLA 5A3JA 2JAXA 4GFDA 2EVWX 3CJRA 5FJIA 5GWXA 1JQKA 3RYHA 3UWMA 3ILHA 4EP1A 1EFCA 1RYFA 4PLYA 4RVFA 2Y0CA 3HGTA 3VO8A 3IDSA 4YHBA 1B8UA 1ZQ1A 4MSUA 4JA0A 1PFYA 3WGHA 4DIUA 4RLHA 2DY1A 2AEFA 4LE1A 4R81A 2VJLA 4UNSA 1FZTA 3R3YA 4FEGA 2G8LA 4GM0A 4BQNA 4DL9A 4ZMBA 4TRJA 1GDDA 3OX3A 3T7SA 3ZVMA 2GXSA 4BPBA 4BGVA 1KVQA 1UH5A 1NWCA 2Z8YM 3O9ZA 1OE0A 5HILA 4CKWB 5A5DA 4DR3B 3KEGA 3IELA 4H4DA 3TDMA 1HDIA 4ZRNA 4YMUA 3K6SB 4AAYA 4EB8A 5I8PA 4KX3A 1Z0JA 4UVHA 1M8PA 3VHRA 4F7DA 1RQLA 2VXBA 2WBLC 3MMZA 5KWEA 4KNYA 5T41A 4I55A 1DB3A 2V9PA 1L4KA 5LD2B 4HDQB 3UV7A 1XKTA 1XTIA 1L5VA 3IPAA 4KRXA 3P9IA 1H5UA 1T29A 3OX1A 3QWHA 2O50A 4P08A 2W2MA 4XKJA 3NCTA 3ZV6A 3ZH2A 3ZCPA 2HMWA 5EMLA 2RGDA 2DP4E 2ODAA 2WB2A 1ZITA 1JILA 1SBHA 1U2QA 2X0NA 3L1JA 3T7DA 1JBEA 3DE0X 4OCZA 3IMKA 4X8LA 5EJGA 5A4DA 3E3NA 2F00A 2XMSA 1G16A 1BW9A 4ZYUA 3F0TA 1OAOA 1RAAA 3QXCA 1K8ZB 1NV8A 3KYCB 1ISSA 4GPZA 2WSLA 1WMFA 4RHXA 4FYKA 3PGXA 4R1NA 3FAZA 1E2UA 1O94C 2ALJA 2H0RA 1XF9A 2W4MA 3ISJA 3PKZA 5CXQA 3M89A 2IS2A 1SQ6A 1X7WB 1UC8A 2Q1WA 4GYWA 3K94A 4G0QA 1MHPA 4O0MA 1AKMA 2C5FA 2QMOA 1QK5A 2C78A 1H1TA 2VJDA 3GDGA 3I1FA 3IJRA 4OMUA 4QOSA 3KQUA 1L4LA 1JHDA 1CIPA 4BN4A 4ZQEA 4DB2A 5I9SA 1Z0AA 1SXJB 2X5NA 4FR5A 4PPFA 3UMYA 4ARIA 4XJXA 4MKHA 3PUIA 4HDMB 4YGXB 5KYUA 3H8SA 5CYFA 4ZO8A 2OV3A 3LM8A 2O2XA 5FNVB 3TE6A 1NJFA 4GD3Q 1ULUA 1NUTA 2Q2WA 1NW8A 3GP5A 5G53C 1KI2A 5CVEA 1Z8FA 1L7EA 1IJFA 4LY6A 1KEKA 1WXEA 3EG9A 3PFFA 3T41A 3A7DA 1ECCA 3OJFA 2H2HA 1SWVA 4MW5A 4PLCA 3VI3B 4DCCA 1RHJA 3RW9A 1REQB 2NT3A 3WGJA 3N8HA 3UKDA 1FDUA 4OUDA 5D8DA 4R84A 4NF2A 1OH8A 2G07A 5A4KA 3V46A 1BRMA 1X8XA 4NZ9A 4K6MA 5IBRA 2I9PA 4M1QA 2ZCUA 2O54A 3F3YA 4CV0A 3G68A 1S8OA 3CMCO 4ETIA 1TM7E 1RRFA 5LL6P 2Q3EA 1E2PA 1V7QA 4QICA 3UJDA 4EB0A 2XKKA 2YS7A 4ZI2A 3KHTA 2O5EA 1O58A 1ZM7A 2SBTA 821PA 3FDXA 4GSLA 1II8B 4HNAA 2CCJA 4JH0A 1C1YA 1A8UA 5K3BA 4HHEA 2M9MA 2QSJA 5M29A 2NU8B 1TIPA 3KQYA 2AI1A 3C6YA 3DQZA 5LR6A 1DTWB 3E81A 4RFSA 1E3JA 4BP8A 1FTWA 4OVKA 1VJDA 3MG9A 4BU1A 4CF7A 2OYSA 2VPXA 4XQ0A 3ZI0A 1OLUB 3A9UA 1TJ5A 3CXRA 4RQBA 2D0DA 3BDVA 1BMTA 3CR7A 4KXVA 1DUIA 2DFVA 4TL7A 5F12A 1QGAA 4XIYA 1VRWA 1EDDA 1Z6TA 2PMKA 3N0RA 4HXFB 1U1FA 2GUWA 1HKHA 1GNSA 5F2EA 2F9MA 3BMCA 4K28A 3LVFO 3JARA 2I67A 1CUJA 5AHKA 5AXBA 1UFVA 1Q7RA 1LK0A 2Q1XA 3AH8A 3R6TA 1KXZA 1XF1A 4HLQB 2R6R1 1QYIA 3QUSA 1XDWA 4QGBA 1QIGA 1WX1A 3COWA 5L8VA 1RXEA 4JGGA 1TAQA 3HYSA 1PZXA 1ULBA 5SY9A 2PT6A 4F56A 1SIOA 2O6LA 4ZVNA 1PJLA 3C5WP 1EM6A 4IV8A 4ZICA 2XHZA 3E22A 4IOJA 4KN5A 1M1YB 1USGA 3LS2A 1OZGA 3PGJA 3PR2B 3QKRB 4OB6A 5DTMA 4G0OA 5EA2A 3L46A 5LA6B 4FONA 3GVHA 4PICA 4Q3EA 3ZHUA 3GNLA 4XWAA 5JPIA 5A06A 5EL0A 1UPXA 4XRGA 3JVEA 4KYVA 4ZT2A 1QLHA 1OLSA 2OO7A 3WMXA 1YS9A 1G20E 1MB2A 1TEHA 1UDCA 3SYNA 4NENA 4XDZA 3W8DA 3WNBA 4PNHA 2I78A 3VR5H 5JMOA 1P2BA 2HCJB 3K6KA 4PXAA 3I8XA 1EGHA 1GKIA 4Q9NA 4L50A 5B1HA 2HJRA 1YUBA 5DT2A 5KX5B 2XD4A 1VIYA 2V7XA 5EJFA 2JJ2D 5CA1B 3ROGA 3OT1B 4F2GA 3JQBA 4GHWA 4M1TA 4XWGA 3BTVA 2JLXA 2GEVA 3E2PA 1I3OA 4C76A 5DO9A 3C70A 3F8SA 1AA9A 2OBFA 3MC1A 2AC7A 1KO4A 4YDHB 4P82A 4JWKA 2AH5A 2AK3A 4ZAVA 3F6PA 1JDUA 2P4EA 1T3HA 1Z0KA 1SGWA 3WMFA 1NVEA 1ABEA 1CHDA 2YL2A 4JXKA 3KJGA 3GNQA 3E0QA 4PHHA 4ZEXA 5LYJB 2XB2A 2NXJA 5HQ3A 2MT9A 3JQPA 1QGUB 3LK7A 2I7XA 3UXEA 4JYZA 2R1TB 4WBXC 5AUOB 4WK2B 4W6QA 2PLFA 3ZR4B 5I4IA 3FCXA 1WMBA 3HLKA 4KO3S 2FZ4A 4X1OA 5H1YA 4FQ8A 4EG5A 3GBPA 1PGQA 2F8TA 2IXGA 3A28A 3CUUA 4GH5A 1LQTA 4I9FA 3UG6A 3UPTA 3SYKA 2DQ4A 1NN5A 2NZJA 3MCAA 2R4QA 1EQ2A 2CF6A 1OV6A 3KG2A 3V2HA 3FCUB 1N25A 2GJKA 4PG5A 2FPRA 3WMGA 4B31A 3LC1O 2KWIA 1Y8QA 2BGTA 2BDUA 1MC4A 3NANA 2X0FA 1W88A 4QU0A 1CJBA 2WUGA 3WG9A 1IM8A 2WA2A 1SXPA 4JLDA 1YH3A 1NR1A 1TRHA 2H1OA 1IBSA 1AXGA 1RI5A 2BFBA 2JKVA 3FCAA 4KQMA 2QPTA 3DCJA 2D54A 2QMZA 2QZPA 2LKDA 2NQTA 4HYTA 4ARBA 2REQB 1XLUA 5HBGA 4E14A 2VT6A 2OM6A 1CG6A 3EA5A 2VF4X 3WR5A 1NSTA 3CKYA 3ZK7A 1E5XA 1ZEMA 2ATIA 4CLRB 1TXGA 1GGFA 2EL9A 1DKNA 4EAQA 4HJXA 3AFIA 4W1QA 3T0GA 4V3CA 3AI7A 3OCXA 3AEKB 2UVDA 1E0JA 2LKCA 3Q87B 4UJ3A 1V9LA 3G2JA 5BNTA 3C7DB 5H3HA 5G1PA 4BE9A 5B6PA 2O3JA 4C3ZA 5KOHA 4MV8A 4EWLA 3GT7A 3Q3EA 4D0SA 4KQIA 1UXOA 2VBCA 3ENWA 1YHYA 3WTBA 4D6PA 2WEKA 3F78A 3PVCA 6NULA 1Q7CA 4Y2XA 1QO7A 1YQDA 3A2MA 1A27A 3GOQA 3ZWCA 3GLFE 4F84A 4N3AA 4PEVA 1YO6A 3HNPA 4QVGA 1TCBA 1D4ZA 1XG5A 4L3WA 4Y1GA 1JDTA 4D42A 1R8QA 1JEJA 3J7TA 4JQYA 2ZYDA 2NV0A 3HP1A 5TPZD 2FWAA 1TX4B 1ZCFA 1HEUA 1I4TD 3OIYA 4OQNA 4A1OA 2FEXA 5CX4A 3K0AA 1X9HA 3A70A 4Q48A 5G0UA 4KXXA 1WHSA 3WKDA 1FS4A 2O20A 4G0PA 4WNAB 1L7PA 3SKYA 2AQIA 3ZQUA 3KIPA 3KZVA 4YLEA 2I2AA 3WAJA 1M2HA 3SC2A 1D6MA 1RPAA 5M04A 4PQYA 1CRLA 1JR3D 1CQPA 1NBHA 3I01A 2D74A 3NHAA 4DF3A 2JIQA 2VO1A 4ZVPA 4O0LA 1GRQA 1NVWQ 2EBHX 1Q1AA 2ODQA 3GAMA 4JHLA 4YR9A 2XAUA 1QLJA 1Z6AA 2BEJA 4Y1EA 3L4EA 3IRUA 4TT3A 2HXGA 4Q1DA 2BFNA 4GX1A 1KOLA 4G1BA 4CIVA 1BN6A 3RABA 1VLZA 1JF8A 1B43A 1RQPA 2CFTA 4I5EA 3SE0A 2GH1A 4PLGA 2WJ3A 5AICA 5AVRA 3R0ZA 4L95C 1XA4A 3PGKA 4JV5B 4AIRA 4GL4A 2FEPA 1T34A 3RG2A 4G5GA 4KRYA 4B3XA 4XVCA 1KYIA 1UF9A 4KHZA 1PKXA 4QBFA 4RH3A 4D74A 5ERXA 3D1VA 1KPIA 1S4QA 1SVKA 1V95A 3K0CA 1WLSA 3MTEA 4XDYA 4KK4A 4ZIRA 4FOLA 4RFLA 3PE4A 4LTNA 2WHYA 2YINC 3QWAA 4OLFA 2WF9A 2R68A 4DW8A 4RJTA 2GCEA 3DZGA 4YRBA 1AQNA 3U44A 4P3YA 1T24A 3PQ4A 2PSSA 2VUIB 2WMYA 1KHTA 2NP7A 1CUAA 1OI7A 3GNTA 5JC8A 1QQAA 3A6EA 5IU6A 1CXZA 1QIDA 2Q6KA 4O4JA 4HGRA 1DG9A 4ND4A 2OCPA 5K8JB 2FWMX 1MGOA 2WWGA 4IFEA 4L8LA 4RV4A 1SBNE 3E7DA 1YI1A 1NJGA 2VHEA 3AIOA 1X70A 3GVPA 3PZBA 5FNVF 1NQUA 2PS3A 2C94A 3C48A 4ZVRA 4RIGA 4NEQA 5DLQC 1GADO 4R1SA 2EZ9A 1ORRA 2W00A 1MO4A 3H13A 3P2IA 1XE3A 4NOKA 3OSZA 3OZSA 2Q2VA 2OP1A 1OBVA 2V74B 5U9CA 3L4BC 4BKRA 4ZVTA 3OQNA 4F2HA 2DERA 1J2YA 5A0FA 1WCWA 1A5SB 1YB4A 4RLQA 2JHPA 2WKRA 3JZDA 3QIVA 3F73A 4JT8A 5F1PA 5IARA 3A9SA 2VP3A 1C2YA 1P1JA 3EFHA 3GFPA 2PZ8A 3IT1A 3PR1A 4A73A 4JAVC 2UUPA 1NA5A 2QX9A 4Q3BA 3U9TA 1JXQA 4BDSA 4WLOA 2IQIA 3G85A 1JEAA 1LJLA 3BE4A 4HDKB 5C1DA 2PVCA 4PNZA 5CXSA 3TCNA 3V4OA 1YA4A 3W2GA 2QZ9A 3P26A 3SIRA 1WQ3A 4DQLA 3CSSA 1VPVA 3IESA 3NO4A 5P8WA 1A88A 2BHNA 4WLUA 4JUAA 2CK3D 3KQQA 1JIJA 4R8MA 4K1XA 1BCRB 4UBJA 3RSCA 3T54A 3EW9A 5F2KA 3IVCA 1ANKA 4Y30A 3STUA 4D4GA 1KSFX 1XEWX 1V11B 3KVYA 3JPWA 1CIJA 3LPNA 2Y0EA 4E5UA 2B8TA 2NG1A 3AONB 2PL1A 1IZYA 1UXIA 1E2LA 1L5YA 4MH0R 1BWQA 2XDYA 3WHLA 2C03A 2KB0A 1TIBA 1U4SA 3BK1A 4HDOB 2O8CB 3S27A 3T3EA 5EJ8A 1AF4A 4JDUA 4G25A 3EOZA 1NKSA 1Q0QA 2A9JA 4X62B 4GOND 3L7CA 3OCUA 2H7YA 5B1IA 5MN6A 5KOYA 2HHCA 2DM6A 3NETA 4FMCB 3SZRA 2ZB4A 5M7EA 1BDIA 1IVNA 3FFBA 5E4TA 3RODA 4BNYA 5L7TA 5JOQA 1X15A 2QWXA 3IYLW 2XPCA 4BASA 4DZRA 2DFNA 1QTIA 5C5DA 5LA6F 1P7YA 2O0KA 3W2IA 4DAOA 5LD2C 3ESAA 2C7PA 3ELUA 3HY4A 4AZVA 5C35A 3PNVA 4LWPA 4LRQA 4KQ2A 3U60B 2CC2A 1E79D 1FYDA 1P2TA 3SR4A 4BWYA 4C4SA 1F2TB 3GF4A 1KVUA 5F7JA 1CQIA 1JECA 1WQ1R 3KZCA 1DTSA 2C9ZA 3WWCA 4BEVA 5JNTA 1JMYA 1M2VB 4YAOA 3BRWD 3UYKA 2QL9A 2PBZA 2WQZA 3LNTA 4ALIA 4D57A 4DPMA 2FEOA 2VOJA 4QYWA 4C6HA 4MQFB 1PYDA 3A7EA 5JYBA 3V1NA 1YJ8A 3TL3A 3GLQA 1OH7A 5KNDD 2AMVA 1N6NA 2P6NA 4DMFA 1TMYA 3SDZA 3K0FA 2ZB8A 3H2GA 3G0DA 3IJ5A 4JBLA 4E22A 4DBLC 5L51A 1LK5A 3WQRA 1YULA 1NE7A 2XT6A 1BXRB 3OJCA 1F1JA 3QPDA 3Q7SA 4O2BF 2HSZA 2IA5A 2H9AA 1NXTA 3TNLA 3S99A 2XJ4A 5LYJF 3M6LA 3KSRA 3LL7A 1SXJC 3K20A 2KX7A 3E3MA 2RC6A 1L7VC 3INNA 1PSWA 1D2AA 2YRXA 4H3HB 5EWMB 4BLPA 4WOCA 1ZGGA 5FI3A 4LSMA 1U8EA 4LXYA 1ZNWA 4HC4A 4ZOLB 1X7YA 5AM2A 2XZTA 3ZGLA 1JAYA 2HA7A 4LJYA 4AK9A 5BWOA 2R00A 3NIWA 4TMZA 1XZIA 1KERA 421PA 2OHHA 5AVKA 4KQ9A 4JY7A 2QSYA 2ZIEA 1A69A 3OQHA 3P2EA 1B1CA 3HPRA 2GZ1A 3JQCA 4AS3A 2QTVB 1SKBA 3BSWA 1V3VA 5AQEA 2R6JA 4NRDA 2I03A 5EXXA 2J3MA 3F8TA 4CU5A 3GLUA 4WZZA 3OBIA 3UTDA 1Z8NA 3CVJA 2ZP1A 3K4PA 3KEOA 2GPWA 1T1GA 2RGBA 3CGWA 2WU0A 5ECWA 2P7IA 4RF5A 4B6JA 2IOQA 1GZ6A 4N0MA 4EI2A 4MTCA 1QV7A 3LPAA 2IOYA 4R2JA 3TD9A 4A4DA 3A6FA 3ANMA 1RJWA 3RNOA 3LT0A 3TBFA 4L8VA 3FYUC 5TB5A 4B9AA 5BORA 5CAEA 1SBQA 3ACDA 2VZ9A 1ZK4A 3KZXA 2AFHB 1PJ3A 1FVXA 3OU6A 4G5SA 4ZCQA 2REOA 3ZQJA 1XEXA 5ADVA 4OJTA 4DRXB 3OZWA 5FWYA 1FF9A 1QS0B 2ZR9A 4GPAA 5J2TB 1WD5A 5CJ2A 3EYAA 3L7YA 2ZBEA 4BMXA 3L02A 1KAEA 3G2IA 3GZTB 3W6PA 1ILEA 2DRIA 3A6LA 1JALA 4PWYA 1GTMA 2HF9A 3OJOA 4GMHA 1N1MA 3LPLA 1TVCA 1QG6A 2AMFA 4MZXA 2WU1A 3R7WB 3KOXA 2Q4DA 1XTTA 1GAJA 2FSSA 4Z7JA 2D2IA 1M0SA 2QRKA 4EW6A 5LQDA 2PQMA 2QRQA 1VGQA 4TWIA 2G1KA 3WL3A 4MWCA 1NRXA 1VL8A 1LRLA 1LPSA 3JALB 1Z7EA 5DB4A 1JHOA 4XWYA 4AURA 3UTCA 1POXA 2PJUA 3IMGA 4QJ4A 1DDOA 2ZFUA 3ZWBA 2M6RA 1LC0A 3U48A 3A3PA 1TAUA 3NV9A 4BB5A 1UZNA 2QRNA 1EX6A 1IDOA 4ESOA 2WI8A 2RHMA 1E32A 1EFVB 2QNBA 4CLDA 3ZGZA 1H0SA 3A4IA 2XTAA 2G4VA 1SQ5A 4LMRA 1JFFA 4CFYA 2FUG1 1MAWA 4KPUA 4PZCA 2QRJA 2FE1A 1U9JA 2P9QA 1Q0PA 4Q1CA 4E70A 5AW0A 1X38A 2Q3LA 2H1IA 4FNOA 2YWEA 1H2EA 1Q16A 3QMWA 1Z13A 1CHNA 2H1CA 1RYZA 3OE7A 4NK5A 4B79A 2W6NA 3MJSA 5FUXA 3TOCA 1SEVA 2YC2C 3CEJA 4CLOA 3WYEA 3OX4A 3G6KA 4MQMA 4NAUA 2OO5A 4E51A 2P0EA 1WTAA 1Y1SA 3CF6R 1PNRA 3C6XA 3DF7A 1MAAA 1BRTA 5JS6A 1BCSB 3E5HA 2C61A 3NTUA 1F2UA 1U7PA 2X58A 1Z4JA 4XX1A 2WYUA 2C59A 3H7AA 3Q5EA 5IJXA 1JXAA 3BQ9A 3P2YA 4GGOA 2VHXA 1K4KA 3VC2A 4EA7A 2Z09A 1ID1A 1U5CA 5IHPA 3QPUA 1UP4A 1W5TA 4RKYA 2W48A 3W6ZA 1Q17A 4RQUA 3AM4A 4C06A 3UEOA 1WZUA 1Q0UA 5KVSA 3N2YA 1JIUA 3ONFA 4UM7A 4MLPA 4U2EA 5LBUA 4EKGA 1UBLS 1N3YA 3FW1A 2WG2A 3R24A 3DP9A 4GUAA 5HE8A 1MO5A 3JQQA 2IV7A 1E3QA 3BXGA 4EFKA 2AXQA 1NVDA 1SC6A 1XZ8A 2BGRA 2XZPA 1X7DA 2D2VA 3CUWA 3FYCA 4J49A 5E8JA 4F3CA 2PK3A 1MJ5A 1N75A 1RBYA 1UJNA 2XRMA 1PT9A 3BICA 4MIEA 3ZKWB 4KXNA 1IWOA 1QYDA 3HYLA 3W5CA 1PV2A 2Y05A 3VDMA 5A4AA 1PE0A 1SC3A 1NW7A 3ZXIA 1C5KA 2BEUB 1TPYA 1BOFA 3BGIA 2R6CA 3H87A 2EARA 4CV3A 1OF1A 4UMFA 3TRFA 2EXXA 3RJ9A 1GTRA 4IRXA 3DE2X 2WNIA 2ZB7A 4CKCA 4LXTA 1T8PA 5KDLA 2QRHA 5IW8A 4HQLA 1VZ2A 1RC1A 1FUYB 2GEFA 1JI3A 3T0FA 1L8LA 3ABIA 3OPXA 1A7UA 1AUQA 3SZMA 3SJUA 2J8ZA 3BMOB 4MVJD 4MINA 3QVWA 4ND3A 1Y5MA 4XEUA 2QDKA 3RVRA 1I5EA 3BYZA 1RXVA 1FX0A 3AHDA 2PX5A 2G9QA 2QD3A 5BRAA 2HA3A 2IPNA 3UZUA 2YW9A 1W9MA 4IIFA 4FYVA 2AVDA 1P1HA 1X1SA 3R3HA 1E9DA 1WXDA 1E1NA 1EVEA 3IFSA 5UKDA 4ESEA 5FOVA 1KKUA 1G6Q1 2XVAA 3RYCA 3E9DA 3K70B 2PMEA 1YMQA 1R8XA 1XYGA 4OH7A 4RSHA 4W6ZA 4JBNA 5CNKA 1UBSB 1M2KA 2HEGA 2VP4A 4N5HX 2XMDA 3NWPA 2PNFA 4KE8A 3AUAA 4YA6A 4HGZA 1BFKA 1UT8A 1E6MA 2JGMA 5CX1A 4C2AA 2FGKA 4K2AA 4DY4A 4B7UA 5K0EA 2N75A 1IM5A 3IOYA 1R5OA 2A1UB 1P17A 5T6BA 3LXRA 2ZWMA 4UQPA 1R10A 2FV8A 2BSXA 1W5SA 3I04A 4OKIA 4OH1A 2IDJA 4K7JA 1KH1A 2IYFA 1QP8A 3V4PB 3QPBA 3A14A 2M6SA 3OT5A 3FLEA 3SQMA 4AF6A 2PWBA 1NI4A 2ZBRA 2WIFA 3HI4A 4FMCF 1LW6E 3EGVA 3LX4A 4LGMA 4B74A 1UIMA 3LKVA 2YVKA 3JQAA 5CH3A 1Y7IA 4JEMA 1IL0A 4QXMA 3TW6A 3CPHA 2R7KA 3BL8A 3BHIA 3RG8A 3ANSA 2FG7C 2MOKA 2AB0A 2AFVA 2WIDA 4FBGA 1JG6A 2F2TA 2P69A 5TXGA 3C98A 3UOGA 4DQVA 2BI4A 4F1JA 4M46A 1G5RA 1M73E 2BGLA 4YJ2A 4Z1MA 3UCEA 4N6OA 4URFA 3L0DA 5G4KB 5CYGA 3EY9A 1E0KA 3WJ7A 2LD4A 2VP5A 1FNDA 1PBTA 4Q47A 1MO6A 2Q9CA 4BC1A 1Q7TA 4M0KA 3I45A 3SZGA 4AYXA 1XL0A 3THYB 1YZ3A 3CUYA 4X6YA 3X43A 3PE6A 1EFRA 1T4BA 4FCWA 3HCWA 4H1VA 4MV6A 4LDRA 4N65A 1C50A 3R3ZA 3QX9A 4NNJA 1QGOA 1OTHA 1U9YA 3LLMA 4PNPA 4JOCA 4N3CA 3RUDA 3VU9B 3II6X 2AGVA 3B6KA 4EFNA 1CYEA 2AYZA 2I1WA 5IKEA 4KXFB 2LCIA 3BKXA 5AYVA 3NVDA 1PW7A 1H4SA 3QKSB 2AOTA 1W47A 2CDRA 2QVGA 2W83A 2WNSA 2XNCA 3RS9A 4DEXA 4D46A 4ZOLF 3EISA 5EE0A 4HDCA 3HXOA 1TQHA 2OCGA 2G3YA 3SEZA 4AG3A 2UZIR 1GA6A 3K6JA 2FFHA 4Y18A 1CY2A 1COZA 3I76A 3STWA 3KNZA 5G4LA 3UPUA 1UEIA 2GA9A 5JAIA 2RHLA 3GBVA 2HJ9A 1LEHA 1ZOOA 2V8OA 2GTIA 1EUDB 1XLTC 4WH0A 4J16C 4JQZA 2OSBA 3WBFA 5TF4A 1KZHA 2AOUB 4PZAA 3DZJA 1IPHA 1SC9A 2Z30A 5HRUA 2RGGA 1YZTA 2MWMA 4IX1A 1RM0A 2BMWA 2JAPA 4EKDA 1OI4A 4RLSA 3SYLA 4DB4A 3L7BA 1ND5A 1U63A 2C97A 1GKYA 2DHRA 3DZ8A 1U28C 5E38A 1EK1A 4TQGA 1YJCA 3RF7A 3BBPA 4LRYA 4BX9A 2DU8A 3THXB 3QWFA 5EE9A 4A3SA 2YVQA 3GPBA 1VPWA 2HQRA 3IUBA 4H59A 1YK0A 5JLJA 4DR4B 3F9IA 2G77B 2Z5FA 1KDOA 1T9HA 2ERYA 2Q6OA 3QPWA 5LIPA 1NI5A 4BCCA 1Z4NA 4U1RA 4D96A 3O94A 4E09A 3FPKA 1THMA 5IJWA 2EFCB 4ITRC 4QFBA 4DCOA 4QG3A 1KI8A 1IAVA 1ONNA 1YASA 4QJ3A 4G0UA 2XTZA 3MOSA 4RY0A 2B6NA 1AQUA 3BCSA 2F43B 1PFGA 5FQNA 2AIRA 2C7GA 4D7AA 1RLMA 1EK2A 5CLFA 5LMCA 1E20A 2R2AA 3D5TA 4IHJB 4TTTS 1NBWB 4JSRA 2JIBA 3FPGA 2FPPA 3EFOA 4QXAA 3ZWMA 5CT6A 2AJBA 3KSDO 5P21A 4GBED 3MIIA 2ZAOA 3ZNPA 4RENA 4PPYA 1CVIA 1PT8A 3AHCA 1JDBB 3LYAA 3FHCB 3AHIA 3WWYA 1GG8A 4K9LA 1RPZA 4AUKA 4BEWA 3R8FA 2VIIA 4E7OA 3K5PA 4C0LA 5ALVA 3BFPA 3OSUA 5E7QA 3GA5A 1J20A 2YFKA 3RASA 2DZDA 4WGGA 1FDWA 4BO2A 1KOJA 2G1UA 1XCOA 3KOZA 1K2VN 4PG7A 2YQ4A 3ASYA 4JVSB 2L2QA 3D7RA 4GP9A 5FADA 4B73A 4CM3A 4DIFA 1BS1A 4RZXA 4UPVA 4KO1S 2R4TA 2XRFA 4LJ9A 2OQ2A 2J4FA 3PITA 5FLKA 2CHFA 3NJRA 4X85A 4QC2A 1CUCA 4FFOA 5BQOA 5I4KA 3EIWA 1MA3A 2QR5A 4LHWA 4WKGA 2WUVA 3QJGA 4GO1A 5DF1A 1DLJA 1BXZA 2OY0A 2XJ9A 3GH3A 2VNHA 3NBMA 3NGLA 5ABPA 2QU8A 4N7BA 2GDJA 3DT6A 1FP7A 1FLDA 3DE7X 4HQOA 4CKWA 1HX7A 5CVDA 4W7HA 2IPAB 4TLEA 3T9DA 5T7BA 1ZINA 2CFIA 3B6MA 3IUNA 3LY8A 2C95A 3CNQS 3LMKA 4KDRA 4D9BA 1Y6JA 3K6SA 4WCVA 3KFVA 2NO5A 4EEXA 4YCBA 2YOHA 4P3OA 2G0NA 5CLHA 3PRHA 2VDOB 1I13A 3WO1A 1LI5A 1XRMA 2KLBA 1QDUA 2WUDA 3NKLA 1P75A 5JXHA 4WT7A 2Y1EA 4KLAA 1FY2A 4EA9A 2KBEA 1U94A 2XB8A 4M0F