4YONB

P-rex1:rac1 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
b'MQAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac excha
publication title The Phosphatidylinositol (3,4,5)-Trisphosphate-dependent Rac Exchanger 1Ras-related C3 Botulinum Toxin Substrate 1 (P-Rex1Rac1) Complex Reveals the Basis of Rac1 Activation in Breast Cancer Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4yonB00
1E9EA 2VIIA 4DWJA 3BJIC 2JLXA 3L8ZA 4M22A 1GL6A 2WJGA 2OZEA 2WWHA 4Q1DA 2ZRGA 4TT3D 1VKJA 3QPWA 1CTQA 2BBTA 2YWHA 4CEIA 1W47A 2QP9X 3NVAA 1U0HC 4F91B 4OI1A 2R6CA 4KFUA 1H8ED 5AJYA 2BOVA 1NLYA 1CIPA 3Q9LA 4LYJA 2D2FA 4JIMA 3RDPA 3TRFA 5HTKA 1II8A 1WQ1R 4PQRA 2B7CA 4EFNA 1NG1A 2G6BA 3B60A 1KI8A 3EA5A 2J3EA 2W2XA 4Z54A 3EZ6A 4LI0A 2XZOA 2VPPA 1YRBA 1GNRA 4Q4AA 1T3SA 1RRCA 3PUXA 2IYXA 4C0LA 4MYUA 2IUUA 2ZPTX 3LH5A 5KTYA 1II9A 5J4LA 2F9LA 3N2IA 1T3LA 1KI6A 2REOA 4B2IA 1Q22A 2ZROA 2PJZA 3LA6A 4TTQA 3BRWD 1W44A 5JEDA 4BECA 2IYUA 1GWNA 4NYIR 4B44A 1FMJA 2GDJA 1TF7A 4WXPA 3RS3A 4O3MA 4DDVA 3GQBA 1L2TA 4X8HA 2FSHA 4F4CA 2J41A 2ZRCA 1RE0A 3ZVLA 2YNMA 3CRQA 5TVKA 1P9NA 3VR1A 1W0JD 2IX3A 1VIAA 1WXQA 1WB9A 3PEUA 3WNDA 2CCGA 1JI0A 3DM5A 4IVPA 1EFUA 4Z1MD 1FW6A 1XWIA 3IPXA 1MKYA 3A1UA 4A8JA 4RD0A 4EPWA 2VSOA 2PEYA 1KSJA 2JA1A 4K46A 4PC1A 5DIFA 3RRMA 1ZUNB 1S3GA 3I32A 4FCWA 2WSMA 5JLJA 4M1OA 4JLAA 1OB5A 3H84A 3IILA 1OH8A 3CPEA 1TNDA 2ZVQX 2DFKB 4PZYA 3CW2A 4PAOA 3B2EA 4Q1BA 1KO8A 1Q3HA 3DZDA 3SHFA 1SXJC 2YJTD 1Z0DA 2HF8A 4G5OA 1EX7A 5HKKA 2Z83A 4N3NA 4C2TA 1RPZA 2A5DA 4HAVA 5LD2C 1UKZA 2VL7A 4XD7A 3EARA 2HT1A 3R7WA 3Q8XB 3OEEA 1UDXA 3TVDA 3T61A 4MUBA 3LXXA 4TMZA 4M1YA 3KKPA 4EPTA 4HSEA 1RRPA 1ZM3A 4XTRA 1CS4C 2W00A 1Z2CA 2H92A 5FOSA 1XJCA 2CE7A 3SYNA 1FUKA 3TJZA 4PPFA 1HEIA 3M1IA 3A8TA 3ADDA 1IN4A 5CYPA 2RAPA 3BXZA 1R0XA 2GEVA 2DY1A 3ADKA 3KXIA 3MLEA 2BMDA 3TW4A 4LHVA 1Q1EA 2FPMA 1KNXA 5C2JB 5E7MA 1L4YA 2QY9A 2A30A 3FYHA 1R5NA 3ZIAD 5HR5A 2HLDD 3CR8A 3CRRA 4JKIA 4BZQA 3AP3A 3IIJA 3U2QA 3CX6A 1JALA 1RVDA 4MRVA 2HEIA 4HUQB 4QJ5A 4Y0VA 3FDIA 3W5JA 1NF3A 4C0BA 3U3RA 4C0QC 2N1BA 1L8QA 3T1VA 3TK1A 4A2QA 2NTYC 4GRAA 3W3AA 5FOXA 1FP6A 4G1UC 3CF6R 3EIHA 1YZQA 3U3OA 1YKSA 1XEWY 5GVSA 2G83A 1TF5A 5FUXA 3TUZC 3A4NA 3LQRA 4LV6A 4IXMA 3GJ7A 2BKEA 1Q44A 4ESHA 2DBYA 3RRYA 3EW9A 2W6ID 3LXRA 3PEVA 1TX4B 2H17A 4PZZA 3X1DA 3AGPA 2ERYA 2GA8A 1BOFA 2RB4A 3FTQA 3NC1C 2WJIA 2KB0A 3MAAC 4KFSA 5CM9C 1COWA 1Z83A 1W2GA 1AZSC 2R8RA 2BCGY 1K6MA 1NN5A 2ANCA 4GP7A 3SU8A 2C9YA 5AJVB 3TQFA 4OI2A 3GLFA 4EPYA 1Z22A 4W5HA 1OLOA 3HP1A 3DEFA 4R2IA 2BJVA 2QAGB 4LPKA 4DCTA 1X1RA 5HE9A 2FU5C 3NEYA 1E2PA 4JT4A 1Z0KA 2QI9C 3CLVA 3CRW1 3I3SR 4HAZA 4RSGA 5FOTA 4D4MA 4CEHB 3A1SA 3CUEF 4RZ3A 1G5RA 3AUYA 2IWRA 3RNLA 2XOKD 1ZMXA 1VDZA 4N0EA 2F1IA 4RCZA 4B75A 4NP6A 1NVVR 1KTVA 3LX5A 4M9SA 1HT2E 1ZBDA 3ETLA 4D81A 3AF2A 3UWKA 1Q57A 3RRZA 5BXQC 4NU0A 1G21E 3WMGA 3ADCA 3W8NA 5F9FA 4W9MC 4L5BA 1A82A 1OSNA 4PC2A 2BKUA 3RSOA 4BFWA 4QL3A 4OK5A 2C04A 4Q9JA 3RLFA 4DT1A 2HCJB 1N5KA 5TB5A 4YXWD 3DKPA 4XWAA 3BB1A 4A8JC 4AURA 1PZNA 4G5RA 2F1RA 1E98A 1W36D 2ZYUX 2PCJA 3F0TA 4XTCS 3Q3JB 4JBWA 2NO9A 1G3RA 4M2LA 2EFCB 2ZJBA 2VEDA 1XMJA 821PA 4DDUA 4PAQA 5K8IA 4FN5A 4MDEA 1S4QA 3HU1A 4D0LB 1HTWA 1Z6GA 1J7KA 2VH5R 3BE4A 1ZD1A 2AD5A 2IYWA 2V8OA 2FFHA 2VBCA 3IGFA 4M21A 3ICQB 1DOAA 5KOYA 2EFHB 2QNRA 5BW8A 2WTUA 2BEKA 2ZSBA 1SGWA 3LD9A 1UEJA 5KSPA 1OFUX 4QC2A 1LVGA 4JJKA 5CDFE 4UXIA 3UWOA 4URXR 4CW7A 1OHHA 1TUIA 2CVHA 4GPTA 521PA 1KK2A 2PCLA 4DJTA 1DE0A 4XD7D 4XJXA 4LCBA 3SHWA 1M7GA 5DYIA 4DVGA 3MUFA 3S1AB 3ZZTA 4B2PA 4DCVA 4OQNA 1OKKA 3NH6A 2BC9A 2G1JA 3MGCA 1SXJE 4H1VA 2D4HA 1E2DA 2NO0A 4V0OA 3M6AA 1YZTA 1HA3A 1GSIA 1TU3A 3VX4A 2NZJA 1M34E 3BD9A 4P4SB 4URYR 2WOJA 1OXXK 1BMFD 1O3YA 2DWQA 3KQNA 4YMTA 5FTKA 5DO9A 2GJ9A 4DLWA 2XNSA 3OE7A 3QUSA 1N5IA 1KI1A 3QKSB 1YZGA 4BFTA 2Q6TA 1F2TB 4N0DA 4HZUA 2P6RA 2ATXA 1AQYA 1XTJA 3L8YA 5FBQB 2GAAA 2Y8EA 2H16A 1N6LA 3RAPR 1ZD8A 2J46A 4MQBA 5LD2B 4Z51A 1T3HA 5HPYB 3QIAA 4LC0A 2IYSA 1AGPA 1E9BA 2GZDA 1L7VC 2VP9A 4Q1AA 3AVYA 4MH0R 2V4ZA 1QDEA 2C9OA 2NO7A 1AA9A 2GK7A 1IXRC 1KIMA 2PZGA 3OAAA 4KU4A 4CIDA 3GLIE 1MT0A 2OXRA 4L9WA 5AUNB 1S1CA 4OBEA 4DLTA 1DG3A 2NQ2C 1NMXA 4JL6A 1JECA 4OHYA 4LJ7A 1ZU4A 2IS2A 4YDSA 4MITA 5C4MA 2ORVA 4BZPA 1TU4A 2F6RA 5AUPB 3QE0A 1JR6A 3GJXC 4DEYA 3K0CA 4ACAA 4Q47A 3BBPA 3EZFA 3SOPA 1B0UA 3A4LA 4B3CA 3U4QB 4HLUA 4PSKA 3GLIB 2RHDA 3AVQA 3L0IB 2O0HA 3DMNA 1E2QA 4UKDA 1SKYB 1COWD 5IRCD 3OZXA 5CLQA 1GITA 3IO5A 4BFVA 1E9RA 1GTVA 1E96A 4QJ4A 4JVSB 2FPKA 2A5GA 3H1TA 3RWOA 3BH7A 3VMFA 1EWQA 1SVOA 2WPDA 4ASUD 2R6GA 3JVVA 4UXHA 2WBLC 1E32A 5A5GA 2J0UA 4GOXA 5TMPA 1K5GA 4ARZB 4EPXA 2D7DA 4IEIA 2O8DA 3T5GA 5KDLA 2QTFA 1E79D 2J45A 4R98A 2A78A 1N5JA 1G7TA 3NBFA 2KI5A 1AKYA 1ZAKA 4CVNA 5JSZB 121PA 4H1UA 3WHKA 4PQFA 2P6NA 2WJJA 3WBKA 4AKHA 2ZJZA 1HH4A 2Q3MA 1CR1A 4URWR 2O8CB 1W46A 2P0EA 4DCNA 3QF7A 2RH5A 5EP3A 2ZRMA 1DADA 2CJWA 2GCNA 1IONA 1D8TA 2GCPA 2XZPA 2IWHA 3QI2A 4DCUA 2IS6A 4RKFA 4QBIA 2JLVA 1SVWA 3WBJA 1KO7A 2UZ3A 2IUSA 1UF9A 3AVXA 1ZM7A 3BFVA 1ZIOA 1P9RA 1AGRA 4QFMA 1EX6A 2CCKA 1Q1ZA 4DUGA 1IAQA 4JLNA 3GLHE 2FJUA 1OIXA 1T9HA 4LBWA 2O8FB 1VYTA 1G17A 3QXSA 2QAJA 1MR3F 1N2CE 2L0XA 1XCGB 2OXCA 3THYA 4TLAA 1KKMA 4JT2A 3AV0B 1YR8A 1XF9A 1JQJC 1DAMA 1IN8A 2ATVA 1UKVY 5KDDA 1DEKA 1FP7A 1G8YA 1P6XA 1D6JA 2P65A 3GLHB 1JNYA 1CP2A 4Q4JA 4RD3A 4Q19A 1ZM2A 5ELXA 3X1WA 1BS1A 1VTKA 4RFSB 2H57A 3GJ4A 1J2JA 3EZ9A 4AYXA 1JR3A 2ZI5A 2QMOA 3WYFA 3U3JA 1FUUA 4DLXA 4A8JB 4M4SA 1N0VC 1H8HA 2ZI9A 2JLSA 1XZPA 4PHTA 4KXFB 4UNNA 3CPHA 3KQHA 3SDZA 4CEJA 5DHAA 3DPUA 4PC7A 4M1WA 3DDCA 5BN3A 4GOKA 4A0RA 4RZUA 1P75A 2GVDC 4TZ0A 1LNZA 5FH9A 2NO1A 2F3TA 2IK8A 3JZAA 4WZBE 4JLDA 3P1JA 4C2UA 2WKRA 4YC7A 1FOEB 1ZUIA 3LVRE 2OFOA 3JVUA 3EIQA 2R6FA 2DFNA 3BC1A 2ZRFA 3NH9A 1NVWQ 3QXJA 5JHGB 4K81B 3W90A 4I1VA 1NNEA 3E5HA 4Q9LA 2CLSA 5KDOA 1D9XA 4NZYA 1E1QA 3AKEA 2P67A 2R6DA 4HDOB 2QRNA 2X8AA 4YMVA 4GL2A 1OYYA 4TTRA 5AWFC 3W9YA 4AC9A 2F7SA 3OIWA 4LDJA 4EFMA 5KYKA 1QG2A 3VR4A 1CU1A 2RMKA 1G4UR 4EIWA 4TT3A 2QT1A 1RFLA 1N0UA 1G6OA 1P9WA 4Q9HA 3FGNA 3TAUA 2CE2X 1H8EA 4HLUC 4EUNA 4LJAA 3R9XA 2AKYA 4UNRA 4Q4LA 3NHBA 3Q85A 2IXFA 2O8EA 1NLFA 4BASA 2IT1A 3Q7PA 2I4IA 2PMDA 5J5CA 1W1WA 4QHTA 3U44A 4A9AA 4PPNA 2JLUA 2FPLA 3AM1A 5EXTA 4QGAA 3DZ8A 2DYKA 4XSGA 1MABA 1U90A 2PEZA 2AXNA 2VP6A 1RRGA 2YOHA 4R9UC 3C41J 4B33A 3LBIA 1WMSA 3KTAB 3ICEA 3GEIA 4RJLA 5KSOA 3ADBA 4Z8XA 1DTSA 1HYQA 1OF1A 1ZCAA 1Z0AA 2GESA 3GJ6A 3QBTA 3GLFE 3NXSA 1X3SA 2RGAA 3B13B 3O8RA 1RW4A 1N6IA 1NJGA 2XAUA 1E2HA 4KSBA 5FTMA 1MV5A 3SJCA 5FFMA 3T15A 1UFQA 4W7SA 5JI2E 1R8SA 1ANKA 4G3XA 3SBEA 1SVIA 1OXSC 5IK2D 4I99A 4MYHA 3CZQA 3QY0A 4LYAA 1W0JA 3I4LA 1U9IC 1VECA 2ZSEA 1ZC3A 4I81A 1OXVA 2CK3D 2OCAA 2V1UA 1IN5A 1UBEA 1XMIA 4FW9A 4XH9B 4Z1MA 3ZYCA 3CX7A 1WA5A 3RHFA 5K8TA 1F2UA 4R7ZA 2WIBA 5KNDA 4B3BA 1P2TA 4A0FA 4JJZA 1SULA 3QPUA 5C1BA 2WZQA 3TSWA 1G1MA 2GCOA 4BGDA 4WA7A 2CNWD 1I2MA 1ZIPA 4QBHA 2F55A 2QPAA 1N0WA 2ZE8A 3K0FA 3IBGA 5IHPA 1NY5A 3P26A 4MRNA 2HJGA 2R65A 3L2OB 1JXOA 2I1QA 2WKPA 1AS2A 2PT7A 4NL4H 1EFCA 1TQ2A 4QHSA 5K8UA 4D4JA 1KYIA 1X86B 5JJKA 2FZLA 5FI0B 1UBGA 2V7QD 1XEWX 4GBMA 2AD1A 2C96A 3A1WA 5CLLA 4DLRA 3JZMA 1XXHA 4JVMA 1VMAA 2D74A 3AP1A 1R2QA 3HPRA 3X2SA 2K5UA 5KU1A 2ZVPX 2IW3A 1ZW6A 5P21A 3U3KA 5B58C 2F43B 2JLWA 1F60A 1W4BA 3B1XA 1T0JB 1D2NA 2ZS7A 2C2HA 3K0AB 5L3RA 3F3YA 4MRPA 2OO7A 1E9FA 3K8YA 1CJKC 1TQDA 1W0KD 3P20A 3SI7A 1CJUC 1TAGA 2OBMA 3UPUA 1G7RA 2FSFA 1GKIA 3ZGXA 1XTKA 4IHQA 4LBYA 3FFAA 4BFZA 4DLVA 1HUQA 2BHRA 2OEPA 3HR8A 2XB2A 5G3YA 5GVRA 1CJVC 4L15A 1KJWA 3EZ2A 2DCUA 3TNFA 4ZKDA 3ZIAA 4DRZA 1QHYA 2E9SA 4JLVA 4V0NA 2HLDA 4D2IA 2XSZD 1KI9A 4AIIA 4EPVA 1LS6A 1M8PA 3TKLA 1CXZA 3TUJC 4D25A 4L4UA 2BIFA 2G0TA 1Z28A 4OQLA 4KYUA 1RZ3A 4WOPA 3SR0A 1J8MF 1RJ9A 4OQMA 2XTZA 5FL3A 1NMYA 1JPNA 3Q7QA 3W6PA 1EGAA 4B34A 2O0JA 5BWMA 1CJTC 3IHWA 4NYJR 4Q01A 3T34A 4DIEA 2OUKA 4PZLA 4DB4A 4BFXA 1XEXA 1GZSA 4DKXA 4NONA 3TE6A 1YZNA 5FUVA 3W5IA 1DELA 1N6RA 1US8B 2QMHA 3TR5A 4D4LA 5FPKA 2W6IA 2FE4A 1MO4A 1G16A 3ZVNA 2QENA 1G8FA 1BKDR 4DEXA 5JWOA 2LKDA 1DPFA 5FUYA 4XSHA 5J4VA 4Q9IA 2R62A 4AYTA 1DARA 3QXHA 4HAUA 4QGGA 1E69A 2HV8A 2QP4A 3PUYA 4QXAA 1NVXQ 3C4JA 4NYIQ 2ZS9A 4V03A 4C3ZA 4OI0A 4JLPA 5EE5B 2ONKA 4PSAA 4MA4A 1JPJA 1E2IA 3AF4A 3K70B 2H5EA 5B2ZA 3GJ0A 4PHFA 3PV0A 2JASA 4LOAA 1VYVA 4TQUS 3QOFA 3IEUA 4RZ2A 3T12A 3HYTA 3QXXA 2WV9A 1QZXA 4HZIA 2XOKA 2IHYA 3LY5A 4LYFA 4YMUA 4JZKA 4TMWA 4DLUA 1KNQA 2Q9CA 2B8WA 1IXZA 1E9DA 4TQ9A 2OM2A 5CB8A 1UJ2A 3PXGA 3LX8A 4C0KA 5J4HA 3I62A 3B1WA 3EZ7A 4B6EA 2KWIA 3UMFA 2WMOB 1UPTA 4PANA 2WM9B 4GOJA 2XXAA 4KJZA 1NN1A 5AJZA 4YXWA 1U81A 1ZNYA 4PO9A 1UADA 1XPUA 5FTNA 4I1UA 1DAHA 4DSNA 1PLKA 3GLGA 5EE1A 3LAWA 4IJMA 2CL6X 4PFSA 3NDPA 1XX6A 1OIWA 1GP2A 3RSLA 2FFAA 4TWZA 1KAGA 3Q72A 4DDTA 1NP6A 3SZRA 3TQCA 1WP9A 4RCYA 1J99A 3VHLB 2GJSA 3PIRA 2ODNA 4HI0E 1WRBA 3FKSA 3IEVA 2P3SA 2J87A 4YQFA 3OF5A 2BCJQ 2YV5A 3QKRA 1DAFA 3CBQA 2ZRJA 5D3QA 5J4KA 3DKVA 1RC8A 3QEJA 2HJVA 5K8LA 2JATA 3THXA 2ZRIA 4TYQA 2Z43A 1TL7C 4P0TA 3CH5A 1ELOA 4V02A 3AKYA 4JS0A 5G41A 3SYKA 1VG9B 3AVPA 5J47A 1HE1C 1P72A 2XNDD 4P33A 5JRJA 2BMJA 2ZR9A 1NJFA 1YR7A 1XD2A 2CLDX 1IJEA 2CHGA 1HY3A 3EPJA 4URZR 3LO5A 2IYLD 2ZE7A 1X8LA 4Q18A 4TL6A 2OCPA 5FOUA 4EAQA 1JR3E 1NRJB 1BMFA 5GJVC 3RC3A 4Q1EA 4C7OA 1OV4A 2RHMA 4HUTA 1FTNA 3ND9A 1QHXA 1NN3A 1W5TA 1YE8A 3TAHA 3SS8A 4A82A 3BB3A 4KFTA 5EXSA 3MWKA 4OQFA 1GAJA 4ACBA 1A1VA 1JXMA 5E7JA 3THWA 2WICA 4ZIRA 1GRQA 3AVTA 1XD8A 5M04A 2QBYB 1NMZA 1BIFA 3IBYA 3PEWA 1G20E 2A3RA 3X1YA 1YRAA 1SZPA 1G41A 2AHOA 4X8LA 3VNUA 4EJSA 3FMOB 2RGEA 4FD2A 3U60B 2BVNA 2JCSA 2J59A 1OFHA 3UK6A 3PFIA 1KDRA 3SQWA 2FA9A 2OFXA 2XB4A 2FF7A 3BH6A 1UAAA 5CB6A 5FBRB 1GDDA 2FEMA 3AF0A 3TGPA 4BUJA 2WIAA 2C95A 2KJQA 5G3ZA 1S3SA 4NPHA 2ZI7A 3C5CA 4EQ6A 2QT0A 3KKMA 3L0OA 5EE3A 2Q21A 2VHCA 5IT5A 5DI3A 3IO3A 1Z3IX 4HB2A 3VKGA 2EWVA 5EXPA 1EFRA 4OQXA 4Q5IA 1OYWA 4R71A 2ZRHA 4LJ4A 1XMVA 1Z07A 4KBGA 4Q4HB 3QBVA 2A9KA 1D5CA 3EPKA 4QNMA 2ZRKA 3SJAA 4B2LA 2J1LA 1Z2AA 2GILA 4V0LA 1Z06A 4MUAA 1IN6A 1E2JA 1KY3A 1KI2A 2C77A 2QU8A 4UXJA 1XNJA 4OYHA 3UG6A 4ASUA 4CZ2A 1LF5A 1NKTA 1T0HB 2A5YB 5F2EA 2QPTA 1KDTA 5AJXA 4I1SA 2P6UA 1E79A 2PZFA 3UXMA 1QHHB 2VQSA 5DHFA 2HUPA 2ZI3A 4GT1A 4JKYA 5DE3A 1O87A 1NIPA 4TMVA 2ZRLA 2XTNA 3RANA 4C0AC 5FTLA 4FWTA 4US2R 2WAYA 1CKEA 1E1RD 2QSZA 2CHVA 2O0KA 2DR3A 1FX0B 4MKIA 5CM8B 2QQ0A 3TIFA 1GL7A 3VU9A 3J81k 5FUWA 1AQUA 1MABB 1NIJA 3FB4A 3C15C 5JRZA 2YWFA 1ZYUA 2R44A 3AF3A 3THOA 1GL9B 1XP8A 4NHOA 3FHTA 5DLQC 4DZZA 3MG9A 1TEXA 3IUYA 5G40A 4A6XA 2OT3B 4KVGA 4GNKA 2JAQA 1VHLA 3LDAA 3QG1A 2HYIC 1OXTA 2FGJA 5LBIA 3L82B 3Q5EA 5SZKB 4NYMR 1A2KC 2EFDB 2RGCA 4KSCA 1YZKA 3RC8A 3FKSD 1D9ZA 4FMCB 4Q66C 4Q7JB 1FMLA 3VR6A 4D80A 4EKDA 1KSGA 2YOGA 4II7A 3KX2A 1IJFA 4OHZA 4TN1A 2FZ4A 5L3SA 2YC2C 1TQ6A 4LJ8A 2JLRA 4B3XA 1I4LD 5L3QB 4LJ5A 3K09A 5D3MA 2G9NA 2O8BA 3I8XA 4LZZA 3A1VA 2QTVB 1T8UA 1FZQA 4RY2A 5FOWA 3VR5A 1G291 5SZHB 1TMKA 2EFEB 3KFVA 3KFXA 1TUEA 2NG1A 1K8RA 3AKCA 4FMBB 2BBOA 4UNSA 1XB2A 4D6PA 1QRAA 1KMHA 3C7KA 5SZIA 5LDDC 3KKQA 1P4SA 1U8AA 3ECCA 3A1TA 4ZCIA 2ZXUA 1TQ4A 5E7IA 2WAXA 2XJ4A 2J7KA 2JJ2D 1YU9A 4JLKA 3MWLA 4IDOA 4TYWA 4PQYA 4RD4A 1DVRA 1VG1A 4LV5B 4QG7A 1P73A 5GADl 1YVDA 4F4IA 1N3BA 3BGWA 1OIVA 3QF4A 4M1SA 2FV8A 3WXMA 4JLJA 1SXJB 3U7GA 4LHZA 4JLBA 3NG1A 3U6KA 2R2AA 5JJIA 4KI0A 4TMKA 1A7JA 1C4OA 2QMEA 2JGNA 1VCMA 2NZ8A 4Q21A 4RFVA 5KNCA 1Q1BA 4AD8A 1OH5A 4OHXA 1JB1A 4ILEA 4HB3A 3QEOA 1CLUA 1Y3AA 4JBYA 3GPLA 3ASYA 3GFPA 2WWWA 1GUAA 2IC5A 1G7CA 3PENA 1G3MA 3GCGA 1OXUA 1CR2A 1XPRA 4ZDIA 4ZDWA 2FX3A 2RGDA 3NEJA 4C9BA 2AWOA 2X77A 1JEDA 4FMDB 1JBKA 1M7HA 3KZ1E 1U94A 4LWZA 3B78A 1EFRD 3U61B 1IXSB 2WWIA 1J8YF 1W48A 1ZP6A 2WHXA 2WWGA 3R7WB 5C46F 5C18A 2O5VA 4B47A 1WE2A 2FWRA 3RABA 3ZDQA 1WCV1 3HU3A 3LLUA 3RS7A 3RWMB 3UMRA 2XJ9A 4URUR 1E2FA 1RRFA 1A4RA 1NI3A 3A4MA 4ABYA 1Y63A 4CEIB 5BN4A 5AR1A 1R4AA 4B48A 1B23P 3LBHA 2ORWA 3LNCA 5DNYB 3VTKA 5FR2A 1LB1B 4GMXA 4DBLC 4Q00A 1KK1A 1MRSA 4IDPA 1G18A 5IK2A 4B3DA 4DCSA 4HYYA 3QXCA 5H1YA 2GJAA 2I1VB 2NOAA 4BLQA 1GKYA 1FNMA 1II8B 4BLTA 3GFTA 4JVLA 5FPTA 2CK3A 4IW3B 4MGIR 3W3ZB 3I61A 3H86A 1KJYA 3B7GA 3L0SA 3GP8A 4LPSA 4Q4AB 2FH5B 2C5LA 1J70A 2D2EA 4ZKEA 1W49A 4MKGA 1W5SA 1GKUB 1OB2A 1M74A 2IHBA 3TSOA 1Q0UA 2CNWA 3VFDA 1YJ5A 4NMMA 1R5BA 1KI6B 2IA5A 4LHYA 1NBMD 2ZAOA 3PVSA 2YVUA 4TLEA 1E2EA 2Q3FA 2J0SA 1N6NA 3GLGE 2XX3A 1E2MA 2KSQA 2AL7A 4LX0A 1OPXA 2GEDA 5EUMA 1YR9A 2ZRPA 1J90A 3K09C 5CIWA 2GZHA 4P32A 5AJWA 3WP0A 2IYVA 3AB3A 1TPZA 3B6EA 4PO8A 2EU8A 5TY0A 3O8DA 2W6JA 2GF9A 1G3IA 4M1TA 5KNBA 2V7QA 2DWOA 4JYBA 1RYFA 4A15A 2JJ1D 3CNLA 4Q02A 3M4YA 4TLDA 1Z5ZA 2AN9A 1T8TA 4WW0A 3R8FA 1HT1E 1KI7A 2PLFA 2X2FA 2ZI4A 1D2MA 5EP2A 2J9RA 2ZIAA 2C99A 3I73A 1CR4A 2IXEA 4C0HA 1LFDB 1I4DD 2OAQ1 4FINA 1W0KA 1L4UA 1R7RA 4KCGA 5AK0A 5KPJA 3NTUA 4KBFA 4BQSA 2WOOA 3AF1A 3KB1A 3A6PC 2FFBA 1M2OB 2J5XA 4I4LA 4AYWA 2RGGA 1OT3A 4TYNA 2PBRA 4KO8A 3OIYA 3AGQA 5FTJA 4IOKA 3SQXA 3V4RA 3SN6A 4CYMA 1ZRHA 3NC0C 1S1MA 2XSZA 1BH2A 3FVQA 1JJVA 5HE8A 3U3MA 2GHIA 3MCAA 4RVCA 3WRYC 2G0NA 2VP0A 4IOJA 2FEOA 4XWKA 1Q12A 4V0KA 2HT6A 2DWPA 2AXPA 4IVQA 4RKEA 3D31A 3GJ5A 2OLJA 2Z4SA 3FFBA 4PXAA 5B57C 4U7DA 4HEJA 1FTSA 4QBGB 1UDWA 1Z6AA 4NCJA 4TYPA 3CF0A 2VF7A 3RVBA 4LGMA 3UATA 2ZYTX 3A36A 1TF2A 3PUVA 1LF0A 2WWXA 4RD2A 4FWIB 1G7SA 4S2EA 4Q9KA 3EWAA 2BV3A 5CIQA 3R9IA 3D7MA 3K0CC 2Z6VA 2O52A 2JLQA 3PQCA 1DBSA 1DG1G 3TH5A 3MWJA 4NCKA 5KUTA 4ZDKA 4AWXA 4BFYA 5EQTA 1I4TD 2FN4A 2QE7D 4C30A 4AKGA 1IQPA 2OHFA 3UANA 5JBQA 2CBZA 2KE5A 5JZVA 2VTKA 3W8RA 3K70D 1FQJA 2RGXA 5C4GB 1NSFA 1M7BA 2QAGA 4XWOA 1II0A 3QSYA 2QMUA 1JEEA 2A2ZA 3L43A 3K9GA 4Q03A 5KSZA 5F9HA 5FL7A 4CEHA 3NKVA 1QVAA 3I8SA 2YYZA 8OHMA 1Q1QA 3ZS8A 3BIFA 3PG5A 3OESA 3EWSA 3WMFA 3U7HB 1XDBA 2ZANA 4DB2A 2PJRA 2WKQA 4O2RA 2QGNA 3MRSA 4NTZA 4PHHA 4TSFA 5JECA 2VHQA 3CRVA 4W5JA 4AG6A 4OK3A 2IYZA 3SJBA 1KSFX 2GK6A 2IYTA 2XTMA 4K8OA 4G01B 4WVFA 4JLMA 4O25A 2CL7X 4XVQA 4NE2A 1E0SA 1F6BA 2IEZA 2LCFA 4GFDA 2WVJA 2V54A 5EXXA 4A1FA 3ASZA 1EXMA 721PA 2FGKA 2IUTA 4M8NE 1TEVA 1GRNA 1KO1A 2XGJA 4ZV4A 3GLFB 2H18A 2ZTSA 2ZSDA 4QBFA 4YDHB 1GM5A 1UM8A 2C03A 3IIKA 4N1AA 3NWJA 2F3RA 1KZGB 1CJMA 2GWHA 2ZR7A 3FPAA 2OLKA 4OKSA 3WMEA 2ZRNA 3AH8A 4Z8YA 4IEEA 1EG7A 4KODA 4V0MA 2YOFA 2PX3A 3ZD7A 621PA 2A7QA 4YMWA 1ZU5A 3ND8A 1Q3TA 1ZJ6A 2VHTA 4Q1FA 4I1OA 1XCPA 1W2HA 3VKHA 2P5TB 3N2EA 2N42A 4POAA 1G3QA 2ZJ5A 4DT1B 2W6JD 4KLZA 3EPLA 2OBLA 3R20A 5AUQA 3SE0A 2OSBA 2P5SA 1JJ7A 3S1AA 2XNDA 2IF2A 2VSXA 3ZH9B 1CF4A 3IQXA 1X8KA 4HDCA 2AX4A 2FG5A 2IYQA 3SYLA 3VKWA 1NN0A 4A2WA 2JIZD 1PUJA 3ZQJA 2X2EA 4E09A 3HDTA 3KJIA 3TW8B 2W2TA 3E1SA 1JQLB 5CDFA 4EPRA 3FKQA 5KSYA 2EFGA 1ZM9A 2WJVA 1VCOA 5CYOA 1ESNA 1E6CA 1SVKA 1XEFA 3SBDA 3T06B 1VG0B 1K5DA 3EA0A 2J7PA 1XBTA 2EQBA 2LKCA 4NYJQ 1Q21A 3REFA 2AKAB 3PITA 5CJPA 4AI6A 2GJ8A 3KQKA 4OL0A 1JAHA 5EP1A 4AY2A 3QKSA 2BM1A 5CK4A 1V5WA 5H8WA 2RCNA 3GMTA 1F2TA 4B32A 3FE2A 4XOIA 4TL7A 4Q48A 4DC9A 3D6TB 3E2IA 4H9GA 1LW7A 1ETUA 4M9XA 1ESMA 1KO4A 2GRJA 1Z29A 2IS4A 2IYYA 4B3FX 2B21A 2LWIA 1IY2A 1YQTA 2H1LA 1CR0A 5H68A 3N70A 1SHKA 1XTSA 2B6HA 2BBSA 4X8OA 3O47A 4DDWA 5AUOB 3C5HA 5JFGA 1ZM4A 2HCBA 3T5DA 4BLSA 4TL9A 3E70C 1X1SA 3SNHA 3W34A 2V55B 3CONA 5A4JA 4B43A 4LUCA 4BRUA 1GOTA 2C9CA 4LRWA 2GAOA 4A0GA 5JCPA 5FBWB 3LFUA 1DAEA 3CNNA 3OEHD 1XTQA 2NIPA 2BEJA 4NCNA 4M1MA 3BERA 3SFVA 4YONB 3U4QA 1VHTA 1P3JA 2NMVA 1AIPA 3KQUA 1NLZA 5FPHA 3VR3A 2ZJ8A 3GLIA 3EXAA 2QAGC 2HXSA 4GDFA 4A36A 4KAXA 4E07A 2PH1A 4JLOA 5FPYA 3EAQA 4HZUB 3DL0A 3ZZUA 2ODBA 2BWJA 1KDPA 4HLCA 1R10A 4WXRA 4AKEA 3F5FA 2VSFA 3SC3A 4JL8A 2ZM5A 4IRUB 4ARZA 4O0MA 5FL7D 5F3WB 2WWYA 1GG2A 1RKBA 3KJGA 3VHXA 2WSSD 4PO1A 1LY1A 1SHZA 1WDTA 1FPMA 2IEYA 2FOLA 5JSZA 1N6HA 4CDGA 2G88A 3CH4B 3MJHA 3C8UA 3P27A 1M1YE 4E5UA 2O8CA 4TSFD 5H70A 3LBNA 1DO2A 4B71A 2VHUA 4MKFA 3BOSA 4JVNA 4S35A 1E1RA 2IBMA 1F3OA 1EK0A 4TMXA 5E4FA 2A5JA 5A0FA 3CNOA 2RGNA 1VCNA 3WP1B 3QKUA 1UBCA 2YZ2A 1KY2A 5TARA 3X1ZA 3QVVA 1TTTA 3MFYA 3P32A 5DSZA 2QTHA 3T1TA 4GZLA 4MYTA 1ZCBA 4QRHA 3GEHA 2O8FA 3N5CA 3B8HA 4JBXA 2OBNA 1E0JA 3CM0A 4HLQB 3FMPB 4W5WA 2FMXA 4B73A 2REBA 4TLCA 2J0UB 4GI7A 2O8DB 3C16C 4QM6A 2VP4A 4U02A 4LY6A 2FFQA 1KI3A 4D0GA 5DGXA 2XITA 3GLHA 4IKEA 1KAOA 3IKJA 3WNBA 3P4YA 1CRQA 2CCJA 4RD1A 4US0R 1T91A 4RFSA 2CJWB 4XVUA 2B8TA 2JDID 2ZITA 4Q7KA 2Z5FA 4L9SA 4ZPXA 1OH6A 4FIDA 4CT5A 2GTPA 2J0QA 2OE2A 2Z4RA 3KB2A 3U7FB 1YZLA 4DHEA 1AM4D 3B9PA 4PC6A 2IXGA 3BFKA 4AK9A 2GF0A 5E3HA 1RIFA 1GFIA 2VF8A 3D3QA 4HAWA 2ZU0C 4HB0A 1S96A 2DPXA 4NKRA 3BAFA 2WMNB 2JJ2A 2CLCX 2QG6A 2UZIR 1P5ZB 4KHZA 1SVSA 4NCIA 5CJ2A 1VG8A 4BLOA 2J7PD 4IOMA 2A5FA 3AP2A 3THYB 3HU2A 1DO0A 2BM0A 4GZMA 5EJEA 1PVOA 4F93B 3ZS9A 1R8QA 3M0EA 1E2GA 4GP6A 3WNCA 1E0KA 1XPOA 1HQCA 1SXJD 3CWZA 1NSTA 1ODFA 4JYCA 3KL4A 3WHLA 1CBUA 1Z6YA 1XU4A 1R0WA 4Q4JB 2QL6A 3Q5DA 1KDOA 4HAXA 1NKSA 1OW3B 3ZVMA 3LWNA 3W6NA 1U8YA 2J0VA 5HCNA 2JJ8A 2GVZC 3RS4A 2ZE5A 5EZ5A 4UNPA 2NPFA 3TR0A 4BLRA 4CT4B 3U6BA 1T5IA 3ZZ0A 4M9QA 5FPSA 1D2EA 2GZAA 4CEJB 3FMIA 1CEEA 1AZTA 1XRJA 4RD6A 2ZRAA 1M6NA 421PA 3NDBB 4UJ3A 3IIMA 2ZJ2A 3GJ3A 3G82C 4OJQA 3OFND 1IM2A 2FSIA 1KK3A 1AN0A 1Z0IA 1ZNWA 4DSUA 3AEZA 4IXNA 1KO5A 3P4XA 3G0HA 3RYTC 1WF3A 2MSCB 1GRRA 3KDSE 4A4DA 1NVVQ 1LS1A 1Z0FA 3DHWC 2ODEA 2HYDA 2TMKA 3KTAA 4G5SA 5JWHA 3H4MA 2VYFA 2GEUA 4MGYR 4Q1CA 4U00A 3PCRB 4IFEA 1F5NA 2ZJYA 1EWRA 1U2RA 3HJNA 1JAIA 4HLDA 3CRMA 1R5OA 2E87A 2VA8A 2MSDB 2RKOA 1MO6A 3QENA 1QHIA 3QG5A 4TQAA 1W4RA 3VR2A 3K9LA 2ZRBA 2MSEB 2VP2A 2KBFA 4TMTA 1N6OA 1U99A 1PV4A 3PUWA 1C9KA 2RGNC 4WAUA 4B76A 1S8FA 4B3GA 4GSYA 3CX8A 1HV8A 1R6BX 4TZ6A 2CXXA 1Z08A 2REXB 1MOZA 4NYMQ 2GNOA 4FXPA 4QGHA 2O8EB 2JLZA 4P4UA 1MO5A 1N5LA 4BEJA 3G5UA 3U44B 1W36C 2QEQA 3VQTA 5JMTA 1N6PA 4XIGS 1Z8FA 4PAMA 4EDHA 3BH0A 1MRNA 1I2DA 3KJHA 3VAAA 1F48A 4UNQA 3WY9A 4LJ9A 3TSZA 1G5PA 3R9WA 2YC4C 4B74A 4KYIB 1UKEA 2QP3A 1E0AA 1NBMA 3H2YA 4BFUA 2BBWA 1AS0A 4F7WA 3NBXX 4M9ZA 1G5TA 3AVOA 4MYCA 1E94E 4KITB 4HB4A 1NY6A 5TV2A 2Q9AA 2F1HA 3OIUA 2MMGA 4QJ3A 5L3VA 1S9HA 3EC2A 3HPQA 2GXSA 2IYRA 4NDZA 2ZI6A 1FFHA 2IL1A 3T1OA 3B9QA 2JJ1A 5DH9A 4FMCF 3KXLA 1G8GA 1QHNA 1WBBA 2F43A 4V0ME 1SQ5A 3K0AA 1P7CA 2G3YA 2UKDA 3SEAA 3QVUA 1F2UB 3D8BA 4G0NA 5EZ6B 1P62B 3WRXC 1FNNA 1E4YA 4QOSA 1UBFA 1XJ0A 4NH0A 3BORA 3TBKA 3DMDA 2GCOB 1ZC4A 1XTRA 2OV2A 4KV9A 1U0JA 2FSGA 2R6AA 3DOEA 3K0FB 1XXHE 3LLMA 3MMPA 4A92A 1TADA 2DHRA 1KGDA 1BYUA 1EFTA 2CL0X 2GJKA 3FWYA 2BMFA 5EE0A 2ZAMA 5HKKD 1XFAA 4A6PA 4ZI3A 1P60A 1E2LA 4FCTA 1GVNB 4D4KA 4ERNA 3OEED 2G1KA 4PPGA 2XZLA 4BWYA 4EJSC 3LV8A 2OILA 1XXHB 2NO6A 4QNRA 4PR0A 4CF7A 3HWSA 3DOFA 1CRPA 5BQ5A 2ZREA 2WJYA 1EFHA 3FHOA 1US8A 1XZQA 3MJRA 3FOZA 4DSOA 3BWDD 1KK0A 4O2LA 2E1RA 3BB4A 2VRWA 3TMKA 3TVTA 3AQ4A 1NG9A 1Z63A 4AG5A 2ZUCA 3B1YA 2ANBA 4LV8B 3WYAA 4CRWB 1XTIA 5DN6A 3TLXA 3QQ5A 2QSYA 2I3BA 1BO6A 2C8VA 1DAGA 1P2VA 3PEYA 4Q7LA 2P2LA 4WZAE 3WYGA 1AJEA 3LW8A 5JEEA 4A2PA 3AVUA 1GILA 2QGZA 1E99A 1BYIA 1W4CA 1YZUA 2QE7A 2GBLA 1IHUA 3K9NA 4EFLA 2ORIA 3F8TA 1T4GA 3CZPA 1ONBA 2B7BA 1RJ9B 3KXKA 2W83A 5B64A 1KI4A 4TL8A 2GXAA 1P2SA 4ZO4A 3AUXA 4U5XA 4C4PA 2UVQA 1RYHA 4ZI2A 4UJ5A 4P31A 4FMDF 5LPNA 1SKYE 5ANRB 4B35A 1XEXB 2Q9BA 3O8CA 1OFTA 1X6VA 2JEOA 3SJZA 4IOLA 1G64A 4C0SA 3IQWA 1G4AE 4DSTA 1IBRA 2GXUA 4MKHA 5F98A 2WWFA 2ZS8A 4UQOA 2D7CA 2D06A 5HCIA 4OK6A 3U7EB 1H65A 2BJWA 3UKDA 3CB4A 5FBLB 4NBSA 3UMSA 1OJLA 3A58B 2YKGA 2NPIA 5BN5A 1QHSA 4HDQB 1AS3A 3DO6A 3DVLA 5J4YA 4AKIA 1Q20A 5DYGA 1ZD9A 4FCVA 3L0PA 5UKDA 1G9XA 3NIBA 4X8MA 1S0UA 1OE0A 3AKDA 1E2KA 1S9DA 4LK2A 3OHMA 1PUIA 2PX0A 3NBYC 2Z0MA 3AVVA 3PJRA 1ZNXA 2HDNB 3IPYA 1N6KA 3KUDA 1KHTA 3ZD6A 3QJYA 1UEIA 1DAKA 3RS2A 4IDHA 4D0NA 2ODWA 1KJZA 1IY1A 3FHCB 2EWWA 4QGFA 1C1YA 2V6JA 1FQKA 3CWQA 1PLJA 2DFTA 3H0KA 5FBVB 5J40A 5EE9A 2G77B 3NBZC 5FI1B 2CEAA 4FI3C 5JCZA 3QNUA 2XXAB 2QPOA 3MWYW 2HF9A 4DLZA 4C0JA 4MGZR 1QVRA 1U9IA 1SVMA 2EYUA 4LSGA 4WIAA 3EG5A 5JI3E 4DIDA 1W7AA 3ZLJA 3NHAA 3LW7A 2ZE6A 2ZU6A 3B1VA 3HR7A 5SZJA 2W0SA 5LB4A 1SVLA 3GLGB 1HQYE 1R0ZA 2JIZA 4MRSA 1W36B 1T6NA 2YINC 1KMQA 5HZKA 1AK2A 3I5XA 2V1XA 2CHQA 4IVRA 2QM7A 2PLRA 2KBEA 4TLBA 2ECKA 3KKNA 1IY0A 1LTQA 3B1ZA 4ZCLA 2W0MA 2EYQA 4E03A 3EX7C 2ZUBA 1VPLA 3QKRB 1EESA 2ZJOA 5BYKA 5JS7A 2ASEA 5B30A 4CGZA 1XD9A 3UIEA 1QHGA 2AK3A 1KKLA 3THXB 4JMPA 1T5LA 2QBYA 2QN6A 1X8JA 4ITRC 4MRRA 2PZEA 1ZNZA 2VLIA 1OHHD 4BLPA 4HUQA 4URVR 1Z6TA 5JWRA 4HAYA 2OCBA 4WBSA 2OFWA 3C14C 3LRPA 4LBZA 1HE8B 4ZCMA 1Z47A 2CMKA 5KO2A 2CDNA 1ZUHA 2PMKA 4J0QA 1AKEA 2V3CC 1A2BA 4US1R 1OKKD 1Z0JA 2AR7A 2VP5A 3GEEA 1XD2B 5GJBA 2DB3A 2GXQA 2X1VA 4L16A 1E4VA 3CPJB 2EW1A 5TDHA 2ERXA 2QQEA 4HATA 1NL3A 3CKLA 4JSYA 5EUQB 2NGRA 2QUZA 5DI9A 2FNAA 3X1XA 3HYRA 5CITA 4BE7B 3OEHA 1VIYA 4PHGA 4DLYA 3OIVA 1V43A 2GBLC 3OE7D 5DN6D 1SKQA 1G8PA 4Q7MB 4C7OB 2YWEA 1MO3A 4R2HA 2QA5A 4KVAA 4YMSA 3RS0A 3K70C 4Q4HA 3LVQE 1OFIA 5G53C 2VHJA 2W2VA 2ZR0A 2ZSFA 5BYJA 2QORA 4PSVA 2SHKA 4BRWA 2IS1A 4RZXA 3THWB 2H8KA 2FDCA 4ZIRB 2OAP1 4OHVA 3V9PA 1W4AA 2GKSA 3KUCA 3AVWA 2N46A 4LJYA 5FOVA 3QPVA 3CO5A 3SFZA 2HXYA 4EJSB 2ZUDA 3T1QA 5JJLA 4E22A 4IFBA 2ONJA 2H7VA 4TYYA 1A5TA 3OAAD 4F38A 2WSSA 1QHHA 2X19A 4D26A 2ZYWX 4BPBA 4F92B 2ZJAA 1P61B 1QBKC 2W58A 3I72A 1S2MA 4PPQA 3GFOA 4QHYA 1G19A 3K0SA 3TUIC 3O8BA 5IDVA 4EQ6B 1KZ7B 2OG2A 1FX0A 2AFIE 2WJHA 3EIEA 2ZQ5A 1OH7A 2ZYVX 2OCYC 5DI3B 1ZINA 2QM8A 3PR1A 4XVRA 1MH1A 2EVWX 2V6IA 4OJKA 3B5JA 2Q0HA 4TTPA 4ON9A 1KOFA 1IN7A 4LC1A 4YLGA 2ZRDA 1XJQA 1YHNA 2PT5A 3BK7A 3W6OA 1DS6A 2RGBA 2WPDD 5HZHA 2D62A 2PL3A 4B6FA 4P4TA 1U8ZA 2XEXA 1U98A 4BFSA 3FMFA 4ESVA 4QM7A 3I92A 2C78A 4GMDA 5KPDA 3VX3A 1GNQA 4KFRA 1NVUQ 4KLNA 1PLLA 1LV7A 1GIAA 3B85A 1E9CA 221PA 4MDFA 5LB2A 5L3QA 3BFXA 5GJWC 3BS4A 4M53A 1G8HA 3UG7A 1G6HA 1U0LA 4IDQA 2C98A 4MGKR 4OI4A 2MMCA 1NBME 5DISB 2QRZA 4LYHA 3ONWA 2JDIA 4G5QA 3CF2A 1E9AA 1QG4A 3KQLA 3ZJYA 3VU9B 4LJ6A 3GD7A 3CR7A 3K0EA 3V00A 1WBDA 1HURA 4DUGD 2ZEJA 5CK5A 2IF0A 1XMSA 5FR1A 3KKOA 4JSTA 4M0LA 4P3YA 1KSHA 1E3MA 6Q21A 2QROA 1G3UA 4F4JA 4P4SA 3K53A 1CULC 1R0YA 4LHXA 4PX9A 2AK2A 1XCMA 2ZETA 4QKQA 1DAIA 5GJCA 3T35A 3K9HA 4M1KA 3MD0A 2BDTA 1UKYA 3U5ZB 2B92A 5L3SB 3MSXA 1VYUA 4A0HA 1P2UA 4DLSA 3QKTA 1SXJA 2BMEA 4OHWA 3EASA 3R8CA 1Z6XA 3EC1A 2O8BB 2GETA 2R9VA 5D3MB 1ZVQA 3KJEA 2DFLA 1E2NA 4G5GA 4NCHA 1JR3D 3IHLA 2V9PA 4PC3A 5JHHB 3PUZA 1GNPA 1H8HD 1PJRA 4WZ6A 2AWNA 2YHSA 5JS8A 3IDQA 3GJ8A 5EP4A 2VO1A 4BEBA 3RRNA 1VCIA 3RS5A 1KMHB 3ZVRA 4BZXA 1N25A 2QZ4A 3B82A 1IOZA 2AFHE 3I5YA 5IF9A 3OFNA 2JLYA 3VNVA 1FL9A 4Y0AA 3I1FA 2OESA 1YR6A 2YWGA 4LBVA 3EPHA 4PTLA 4LHWA 4IDNA 3V4FA 4ZDJA 2Q3HA 5E95A 4JL5A 3DM9B 3A37A 2D3WA 2F9MA 2ZSAA 3REGA 4D82A 4DXAA 5TXGA 2CVFA 3QF4B 5KHOC 3K1JA 3LQQA 3ZQ6A 3CIOA 1QF9A 2F1JA 1E9SA 5L8VA 4L8GA 1E1QD
chains in the Genus database with same CATH superfamily
2GFQA 3NHYA 3BTVA 2JLXA 1C14A 2RH8A 4HG2A 5EVCA 3K31A 5IAKA 2GSWA 2J3KA 2O9JA 1JH8A 1PFQA 3IJPA 4H3KB 4HRYA 5CTJA 4W5RA 2WWHA 3VR4D 4POOA 2AYZA 4QECA 4CEIA 2AA3A 1KVSA 5IZCC 1IUKA 1U0HC 2EDCA 3ZWMA 1KEKA 2FPWA 2R6CA 1H8ED 1POWA 5JCJD 2VN8A 3MEQA 1U2PA 1Z6QA 1SIOA 3AFGA 4HNHA 1QX3A 4E5NA 4BO3A 2A9PA 2HL6A 3H99A 3JQQA 1CY6A 1WJGA 3HI4A 4PZ0A 3RDPA 1VI2A 1M6VB 1V11A 4J0IA 3W7VA 4AMGA 2GJ4A 1RJWA 4PQRA 3RSSA 1NG1A 1MB0A 2BKLA 3EA5A 4LK3A 2B30A 1EP9A 4D3DA 2I2WA 2XZOA 1SB9A 1Y9DA 4MV6A 2I4RA 1GNRA 3DAGA 3IP8A 4KXXA 1RRCA 4BMPB 1XKQA 4AJJA 1ZRNA 2J5BA 2VK8A 4Q9AA 3TB4A 2IYXA 3AJAA 1DEHA 2W93A 3DSRA 1M1YB 2F9LA 2V8BA 3BE6A 1T3LA 2ACKA 2O05A 3ED1A 1O58A 3N2IA 4GKJB 1ECJA 4B2IA 1Q22A 3DMPA 4P82A 1NHWA 2R751 2VWQA 1B4DA 1LLQA 4QATA 4TTQA 3W5BA 5BW6B 3V32A 4QUKA 5JDIC 5JEDA 3C97A 1HEYA 2XYVA 1KU0A 3EEIA 4F6RB 2IYUA 2NT3A 5A4AA 3FRIA 3VYWA 4RK5A 1NBEA 1L5OA 5BN4B 1GEEA 3BL6A 1N92A 2IOQA 4MS1B 4OM7A 1L4BA 1QV9A 4F9EA 4FFLA 2FWNA 2GI4A 1INLA 1XTZA 1Y8QB 3F6PA 1RQLA 1O9HA 2WJAA 3EBLA 4N7BA 3WKCA 2XLCA 3E82A 3EUAA 3GYGA 4C76A 2O1WA 5FWYA 1VL8A 3HZRA 3D4BA 1RYYA 3IBFA 4E5MA 1Y3HA 4FBGA 4QYIB 4ENSA 3ID6C 1WB9A 5DX1A 2FX5A 5DXAA 3TIXB 2JPDA 1JI0A 3O90A 4HMPA 1OZFA 3TRIA 5DWDA 1XWIA 2AG5A 3A1UA 4EOGA 1GQ2A 1M6YA 4J0EA 1QKKA 3BWYA 2PQMA 6REQA 1S3GA 4FCWA 2WSMA 1PJ2A 2B35A 1DQYA 1M2OA 1WSAA 4UAVA 1OB5A 3CPEA 4BP8A 5ALNA 3CVYA 4FYYA 4CM4B 3IT2A 1XK7A 4JEHA 4JASB 4Y1EA 3GGSA 2GBIA 2MSWA 1HXHA 2E49A 4Q1BA 1KO8A 3EA4A 1TTPB 3G8AA 3SHFA 2WD7B 1SXJC 1X1AA 4N0QA 4QEKA 5DP2A 1H2HA 4XXHA 2VNJA 4P84A 4WUTA 2B61A 4Y6LA 5AVVA 3BCRA 3U56A 4XX0B 3OZRA 2VL7A 2P2GA 2QMYA 3EARA 2RGUA 3PL5A 4X00A 4CQMB 1ISGA 1CEQA 3R0JA 2HRDA 4EY7A 1WV1A 2YCLA 4MUBA 4CPDA 1QCCA 3AOGA 3AV3A 1FRVA 4HSEA 1C8BA 1JAYA 1ZM3A 1QYWA 3JZDA 1Q0SA 1C2YA 4G5XA 4O4JF 3D43A 3PRHA 1U2GC 2ZZKA 4PPFA 1MJGA 1XQ9A 1HEIA 2O7QA 3M1IA 3OQNA 2FQYA 2RE8A 5MGNA 1PJ8A 1XDWA 2P9ZA 2ZT8A 3A8TA 4JYAB 3D1VA 2ZYSA 2PLWA 5DSXA 5CB4F 3KXIA 2ZUFA 3ADKA 2BMDA 3GFFA 3GXBA 3TW4A 4L6CA 4LGVA 4MB2A 4N8DA 1LJ8A 4YRCA 3RJ9A 2R8BA 2ODTX 2PPLA 1BWRA 3AR9A 4GP9A 1Q7BA 2A30A 1EUDA 4LZAA 4DC0A 3CNQS 1N2GA 1R5NA 2VHXA 1VL6A 4I08A 4JKIA 3UJCA 4B3SB 4N8EA 3IIJA 3WGZA 4CMCA 3HRKA 5DCYA 1BW9A 1RVDA 4MRVA 1RRVA 4HUQB 2X8JB 3VDRA 5HNKA 4C0BA 5FWAA 2PKCA 5TGDA 1KS9A 3FTEA 1X0XA 3U3RA 1HL3A 4C0QC 1D1PA 4K2AA 5LA6A 4ZYYA 1BMQA 1RZUA 1ZSNA 2COUA 2DJ5A 3JZFA 2BGWA 2NTYC 1A9YA 3W3AA 1SQGA 3CF6R 1UBRS 1XRPA 1YZQA 2L19A 3IBTA 3MTJA 5HXAA 5E1MA 1YKSA 5JBNA 3WAJA 5I47A 1VBFA 4R2XA 2C82A 1VHQA 3NTQA 3R3WA 3EVNA 3G17A 3TUZC 2ZIXA 1NAHA 2QY6A 4I9UA 3L8DA 4LV6A 4KYTA 4DW8A 5DKFA 1YC5A 3QA9A 3RRYA 2ZQYA 2W6ID 3LXRA 3N0VA 4UEJA 3V2HA 3L1IA 1Z36A 3AGPA 3PEFA 1BOFA 1DI0A 3FTQA 4A23A 3NXKA 1KFCB 3I83A 3OUTA 5FNVA 1TYBE 2KB0A 2H1CA 2VRCA 2NACA 3AB7A 4KIGA 1LD3A 1O5IA 5CM9C 1COWA 3CIFA 3IUSA 4IEFB 4OXRA 5JCOA 5P8WA 2P9QA 3V1YA 3D8NA 2NV2B 5ARBA 1AH2A 5AVKA 1IZ8A 4CIXA 3ZC3A 5AJVB 2CXSA 2XMRA 4OI2A 5E6RA 3GLFA 3JY6A 1Z22A 4KPGA 1ABFA 1JWBB 1UBLS 4FWBA 5AXBA 3HP1A 3ER6A 3UJ6A 2ZR8A 4R2IA 4E7OA 4EJMA 4LPKA 4U2GA 1VPDA 1X1RA 4X71A 4QBKA 4R81A 1E2PA 2QX6A 1Z0KA 1GNSA 2IEBA 3T1NA 3W5DA 3TNYA 4I8XA 4RVSA 3CUEF 1RQPA 3USES 2FUCA 3OOEA 1QRUA 2XOKD 1KR5A 2O2SA 3GEDA 1RS0A 1EXDA 4AS3A 1Y8CA 3QMWA 4NP6A 4XYMA 4CTMA 2ZBQA 3V1UA 1JFLA 2WM2A 1HT2E 1A4IA 1T1SA 1AUXA 1NQAO 4OGWA 4P36A 1BGVA 2LW7A 5EMNA 4NU0A 2X41A 3RRZA 4MYSA 4BJ1A 1OC4A 3GLUA 4H35A 4RTPA 1GPNA 4M0CA 2P9GA 3R6DA 1N2BA 4HUJA 2XF8A 4DARA 2C04A 5B1HA 3D4PA 1HMYA 1LI5A 2BELA 3QFSA 3OE1A 5K0NA 3WL7A 3VJRA 5JAZA 3DKPA 1BJTA 5GTDA 4DXDA 3S2FA 2XRMA 1UOQA 2VK4A 3ECAA 5DGDA 1PZNA 1DRUA 1JBEA 3F6BX 1AXEA 2JLBA 1BD3A 2OLEA 3FUVA 4D02A 3T6KA 4YT8A 5JZMA 1V3TA 3RYHB 1D1TA 5A06A 5EJ6A 4P86A 3P97A 4QFCA 5BMVB 2AE2A 3HY4A 1G3RA 3BA6A 5D1HA 2JNWA 3JASA 1KEEB 2ZJBA 1SWWA 3EVDA 3CLTC 3DE5X 4P5EA 1TEHA 1XMJA 2BD0A 5CW2A 1KORA 4JI0B 4FN5A 3TJRA 1Y7TA 1BS2A 1BKYA 3EEFA 3C2QA 3A9TA 4LOHA 1L0BA 3HU1A 3E61A 4D0LB 1Z6GA 1JJAA 1TZMA 1B8VA 1MENA 3BCHA 1ZD1A 2E85A 2AD5A 4V3BA 1OAOA 1MA0A 4BEVA 2J3MA 3DKIA 4V0RA 1VJ1A 4M21A 3LJKA 4COKA 1JPUA 5KOYA 5E9AA 1MHPA 2EFHB 4RHXA 3ZE9A 4FFOA 4UCWA 2BEKA 5BW8A 2WTUA 2VDJA 1OLXB 4MO2A 2B2CA 3LD9A 3D59A 1H85A 1LVGA 1QK5A 1VE6A 2JS7A 4QC2A 5G4LA 4AY4A 5CDFE 1OHHA 4YB8A 1RI4A 3TD9A 4X95A 3VA7A 1NXTA 4YJFB 2P11A 1IL0A 2PCLA 1DE0A 4N9WA 4XD7D 1DEXA 3K6SB 5FX2A 1VFPA 3MUFA 2IIVA 3IEPA 4ARVA 4BB9A 3QTLA 4ESOA 2DZDA 3QW2A 4OQNA 5HDQA 1Q7GA 1PGQA 3M33A 3A9CA 2D4HA 1QIEA 2C4WA 4JN6B 4ZMBA 3TJMA 1UXHA 4CKWB 2NZJA 3ZD8A 2BN4A 4P4SB 4OL9A 1J5XA 3AIMA 2D5AA 2V98A 2G06A 3JQ7A 3KQNA 4DJAA 3ZWPA 2GJ9A 2ZFUA 3OE7A 3ORSA 5BSUA 4G0VA 3ZU5A 3V5NA 4HQKA 1JZSA 1I8TA 1KI1A 4WFIA 1JLLA 4WK6A 5HILA 3OKFA 5IJXA 2I55A 2ZTLA 4FU0A 5L51A 1IJBA 3L8YA 5FBQB 3QLEA 3RAPR 5FO1A 1ZD8A 2J46A 4MQBA 4UAJA 4E2FA 4WSOA 5LLDA 4EZEA 1HT3A 2IYSA 1AGPA 2D1FA 1JA1A 1XA4A 3PE4A 4KRXA 4YCLA 5A4DA 1L7VC 2VP9A 4I55B 4D44A 2KHZA 4MH0R 3AHFA 1JVNA 2EW2A 2QQ5A 4PLCA 4KU4A 5TQ0B 1ISSA 3M5CA 4TVBA 5AJHA 3LKDA 5AUNB 4L0CA 4KB5A 1TO1E 1S1CA 1NVAA 3PXDA 4OBEA 2JARA 4JL6A 3OOHA 3EMKA 1YS7A 1S5PA 3JXEA 3QI7A 3GRZA 4YDSA 5GM1A 2ORVA 4B83A 6NULA 2IS2A 1MDBA 5JCOC 5I9NA 5E4TA 4QYTA 1ZH2A 3K0CA 1DTWA 3LWDA 1QB7A 2WWTA 4Q47A 4FBLA 4QAJA 2FXIA 3U4QB 1NHGA 2IVZA 2XUIA 5DASA 1NFFA 1PG0A 1XZHA 3H5WA 5DTEA 4DADA 4RACA 1C9JA 3VZDA 5EGSA 2O0HA 3DMNA 2PKXA 4AY5A 1NX6A 2OMEA 4WEOA 4GXQA 4HGRA 4Z2YA 2GO7A 3MJTA 1GTVA 1E96A 2OENG 3AWDA 2Y0DA 4PZUA 4XGQA 3PQDA 2FPKA 3VPAA 4NBNA 2XYGA 2A1TS 1Q0QA 2DY0A 2QZZA 3DULA 3VMFA 2OCLA 2WPDA 1X3LA 4TSKA 1BAPA 1RYNA 4ZXFA 3P9NA 4BBAA 5TMPA 2D7DA 2PRYA 1TEZA 1XV5A 2ILTA 2Y4OA 2QTFA 2J45A 2ET6A 3A31A 3PGJA 2Q4TA 4IZIA 1BVUA 3VHXB 1N5JA 1G7TA 1AKYA 4OXXA 2Q5OA 1OZHA 5JSZB 5KS2A 2G5TA 1WULS 3IELA 4H1UA 3WHKA 2XOXA 2W22A 3KWLA 4QXQA 4F2DA 3DEJA 1E59A 4URWR 2O8CB 2XCQA 4CUJA 1HYEA 1SHTX 2NP6A 3IEKA 1J9GA 3KQSA 3IHKA 4ZCQA 2J67A 1DADA 4BQEA 1F7VA 1IONA 2F48A 5I8PA 4KPEC 2IS6A 3ZLTA 1XCJA 3TEMA 4RKFA 3TW0A 5BSTA 3RKSA 4EENA 4FM9A 1PYOA 1SB8A 4WFKA 5HS4A 3OCCA 1SVWA 3OOYA 3WBJA 2ZAGA 1T5DX 2IUSA 2QMZA 1RQGA 2R1TB 3KYDB 1ZM7A 3ZJ4A 1ZFNA 2E4YA 3FTCA 3HXLA 4ER5A 3GRUA 3A2NA 4QFMA 4WGFA 2VPYA 3UY4A 5K2OA 2D0DA 1IAQA 4JLNA 3GLHE 2FJUA 5GGXA 3KE9A 3V34A 3UJNA 1M2HA 5JVDB 1Z73A 2IOYA 3RV4A 2LUOA 2HJWA 2IXTA 1MR3F 5BOSA 2YHBA 1B6RA 1B8OA 1H93A 2BJHA 1FDVA 3O73A 3AV0B 1YR8A 1XF9A 3R5XA 3VR6D 4O4JA 2M6RA 1DEKA 2PZKA 5TLSA 4AMZA 1G8YA 1P6XA 4IIFA 3GLHB 1IEWA 1JNYA 2AOTB 1SIWA 1R8YA 3QUCA 5CB4A 5HVNA 2QPLA 4RD3A 3AOEA 2H7CA 5JASA 1T9CA 2OGZA 4Q19A 2R8PA 1Y1QA 2QW1A 3C6KA 4NHEA 4L85A 5ELXA 2XCSB 1TYEB 2AVDA 3KT3A 3OO0A 1RKVA 1J2JA 3G8BA 1QGOA 2QMOA 4CMEC 1KYTA 1FUUA 1N0VC 2FFJA 1H8HA 1PBTA 5KNCH 5ALXA 4KXFB 2PSJA 3CPHA 4CEJA 2ATCA 5IW8A 2J9GA 3OJEA 1ABEA 3VNBA 4M1WA 3DDCA 4TTTS 3Q41A 4GOKA 2G5PA 3V9AA 2QD4A 5HJ5A 5T6MA 1FU8A 2GVDC 3CW8X 5I7OA 5JNUA 1GRCA 3VOSA 5FH9A 5I7WA 4QX6A 3SZMA 3INYA 4WN9B 4WI1A 2VHVA 1MIOA 3M5WA 2WKRA 4JLDA 5G4KA 4EO7A 5CA1F 4R2MA 1S8NA 3BHIA 5AESA 3T99A 2QDXA 4YRSA 1JQ3A 3WLIA 1D4ZA 3BPSA 1RADA 2R6FA 1FVXA 1BWQA 3LY9A 4M87A 5EJIA 2DFNA 1MC1A 3O9ZA 4Z6KA 4IR7A 4BO4A 4BO9A 2W6CX 2ZRFA 3B9BA 3HFRA 4EY8A 3I0NA 3LP6A 4LIPD 2QW0X 3THSA 5JHGB 1IOLA 4Q9LA 2CLSA 4Q4CA 5JIBA 1D9XA 3QNMA 3AKEA 2VPXA 3NJ4A 1Z0SA 2ON6A 4HDOB 4JVOA 5HQ3A 3RADC 4YMVA 1OYYA 4RVHA 1CK4A 2GPYA 4TTRA 3CSDA 2FMTA 3BILA 3GAMA 3W9YA 2GB4A 3JQAD 4LDJA 3N59A 4W7HA 1YC2A 3UTCA 3S27A 4W5OA 1FMTA 2RGRA 4AROA 1TCAA 4I4NA 2XRYA 4TT3A 3RUPA 3SYMA 2RKBA 2XODA 1Z5NA 3MQ2A 3UWSA 1IMJA 3JWJA 3ZOZA 2H0QA 1P9WA 2LDBA 3FGNA 4WLFA 4Q0MA 1ZK1A 4UHFA 5BYBA 1FJ2A 2C5HA 4QTXA 4FS8A 1K86A 4L08A 4KXNA 4EUNA 4HDMB 3R9XA 3N75A 4Q3CA 1JTFA 4EHKA 4BMZA 3KLBA 1G8AA 3FZQA 3P9IA 2Y93A 4BASA 4PINA 1T8PA 2IT1A 4X1OA 1L5LA 4RIEA 5J5CA 1IZZA 2JLUA 3AM1A 2FPLA 5JANA 3K92A 5TS3A 2FN3A 3TLCA 3Q3EA 3WYCA 3B3QA 3J81A 3OZCA 3OOSA 1V7QA 4N5HX 1NJSA 3LBIA 1WMSA 3OZIA 4RW0A 1U8EA 4BWGA 3GEIA 2UYOA 3HO8A 4AZ0B 4D9IA 3UKOA 5KSOA 3ADBA 1DTSA 1OF1A 1X7XA 2LE0A 3GJ6A 2DUWA 1SPBS 3QBTA 3BRWA 1Z7GA 1BHSA 5HKOA 4X62B 1L8AA 3TM4A 4Y1GA 4B6PA 3NXSA 1MD9A 3GT0A 5LVAA 3B13B 5HUHA 3DZBA 2XKJE 1Q0RA 1NJGA 1HDRA 2XAUA 3T15A 3SJCA 5J43A 3MGGA 2CXRA 3MJSA 1UFQA 4EKYA 5IVHA 1NFQA 2EAUA 1H3FA 4OHOA 2P6PA 3AFMA 3THRA 3RQSA 2BEUB 2I7CA 2PKYX 2QG4A 4ZYUA 1OXSC 4X84A 1CNMA 2YW9A 4O33A 2B69A 3SNKA 2VRNA 4HGZA 4BV3A 3EXIB 3CLRD 1K6XA 4MYHA 3I4LA 4YV0A 1G0NA 1U9IC 1VECA 3P0RA 1ZC3A 3ZV3A 2I1LA 5C7IO 2WKSA 4FW9A 4P3KA 4DIMA 1O8BA 3NV7A 4XH9B 1O0SA 2BFEB 4J1QA 4ZU6X 4R7ZA 1I36A 2PHZA 2WIBA 3H4TA 4HNUA 3G1UA 3KALA 4MV3A 3KYBA 4ZOLB 1MRZA 1OFVA 3WB1A 4BMNA 4HXGA 1YSCA 2GCOA 4GPD1 4G1FA 1ZIPA 3BZUA 5IT0A 4E70A 3LT5A 1N0WA 3U13A 1UMDB 3PGVA 4Q3AA 4FX5A 5IHPA 1UDRA 2DQKA 2HEGA 1JXOA 3S5UA 2FWBA 1BMDA 2OQ2A 2WKPA 1QO0D 1PQWA 1EFCA 3MWDA 4NG4A 2YMQA 4NL4H 1JEOA 4EVRA 1IFXA 4L6IA 3VR0A 4D4JA 1JIXA 3LBFA 1VGRA 1XZDA 3HBNA 2R00A 4J1NA 4XJSA 1DKMA 1ZR4A 1TVKA 2O7RA 3ENKA 5FI0B 1AKWA 5HMMA 4EMBA 5C53B 1XEWX 5A7FA 2ZBFA 2PU7A 3EQ9A 3UK7A 3IQZA 4OAPA 5D85A 1T6YA 1HETA 3LQFA 3HPRA 2OHGA 1FUIA 3DXZA 2FZVA 4EKNB 1ZW6A 4FUTA 3N28A 4Y2HA 5P21A 1QU3A 4LF6B 4F2WA 4H3SA 3JAWA 1YB1A 1VMDA 5CEFA 1AKMA 1LPBB 2ORED 1LQ2A 3K8YA 4P3PA 1IN1A 1X19A 2YFKA 1NRWA 3IPCA 4KG7A 1G7RA 1M8JA 1RRKA 2VPIA 4DLVA 4LBYA 3FFAA 3WB0A 1D6NA 2H1FA 2OEPA 3BM5A 2WW8A 4GBGA 3WYEA 3HR8A 1NYQA 5LFAA 2XB2A 5HK9A 3KWFA 3MJEA 5IKOA 4QRIA 1ZONA 3Q2IA 2DCUA 2C8KA 1QHYA 4IY1A 2X4IA 5EWMB 4D2IA 1XNQB 1MJ5A 5JMPA 1H6BA 3BJRA 5F73A 5ILGA 1M8PA 3QMVA 1YBVA 4RZIA 3DR3A 1W8DA 1C2TA 1XNHA 2G0TA 1GLVA 1DLJA 5ESRA 1X1TA 3LGAA 4WOPA 5FL3A 2JIDA 3VPHA 3PHLA 4B34A 3SPXA 2WF8A 3IHWA 3DJFA 5AOVA 1N0HA 3H9UA 3W2IA 4DIEA 4WY2A 2CN1A 4QTTB 4BFXA 2VXCA 4G67A 1K75A 3DMRA 1XEXA 1RWOA 5IKEA 2BZSA 1YZNA 2QJRA 2R7KA 5LQUA 1DELA 4NPAA 5E3IA 2NU8A 3RTCA 1US8B 3OZFA 1E8MA 4EDFA 1Y4DE 3AK4A 5CNIA 1TZKA 1MEJA 5EJ4A 5DYNA 3ZVNA 4PPYA 3AUKA 3RK1A 1A9RA 1U9CA 4DEXA 5KJ1A 1XRQA 1DTEA 4EUEA 2VJDA 4XSHA 1ADGA 3TXXA 1RCTE 1RPAA 5J4VA 2VWGA 2WJPA 4R8KA 3R76A 4WADA 3QXHA 4AYTA 3E3OA 2O8NA 1EA5A 3EEBA 2FK7A 2MR5A 4HQ0A 4A0SA 1R37A 1EJ6A 4CL3A 1AUQA 4C3ZA 3FHJA 3T3DA 4PSAA 1KZ6A 4DCGA 3AF4A 1E2IA 4N65A 1EYZA 3K70B 3TOZA 5JAPA 1HDXA 3PV0A 3COVA 1MBZA 1TO6A 3ISJA 1VYVA 1Y4AE 4TQUS 1C1DB 2DT8A 1T15A 4RZ2A 1VHWA 2CDRA 2CDBA 1XLVA 3HYTA 3PCTA 2DULA 4RESA 3T12A 2HU5A 4NFYA 1UL1X 2FDRA 3T7JA 4YMUA 2G07A 3Q7SA 4JZKA 3TF5A 1FRZA 3KKZA 1JLHA 3WIDA 1IXZA 1E9DA 1QK4A 2VHZA 2C5AA 2OM2A 3F5MA 4P98A 3N5KA 4H7FA 1PAUA 4TQ9A 2Z3WA 2RIRA 1U1CA 1ODKA 1YCFA 2CLLB 1LK7A 5KWJA 3TS1A 4U39A 1E3DA 3QJ5A 1UM9B 3AY6A 1FTWA 3G2OA 4LOIA 5CBPB 1CZRA 3PA8A 4X6LA 1MAAA 2CHEA 1NN1A 4G07A 1H66A 2QWXA 4YXWA 1CY2A 3IPRA 3W8DA 1UADA 1IIRA 3ZNPA 2ZM6B 2XGSA 4B3TB 3WO1A 1RR6A 3HGQA 3KO8A 3OQVA 3PHCA 4TSFA 4DJEC 1HNWB 2GZ1A 3L05A 4IIGA 2HSEA 1DC7A 4PU0A 3K71B 2O0MA 3L9WA 1RJFA 3O4VA 5EE1A 4YHHB 5TC4A 3ZW7A 1CQPA 4BNDB 3KVNA 1WLSA 1GP2A 3RSLA 4DDTA 1Z7EA 2ZYAA 1NP6A 1TK2A 1G2IA 2OWDA 1WP9A 2HH9A 2WFZA 2AOVA 3OBBA 2OCIA 4CLHA 3HJGA 5AVZA 2C7PA 3VHLB 3OSUA 4GNRA 3HXOA 2BFNA 1LEHA 1M8GA 1KEPA 3FNIA 3QBJA 4HT3B 4YQFA 2EL7A 3IEVA 3QOYA 1T9ZA 2DAPA 2BCJQ 3EF0A 4NPCA 4FE7A 2VATA 1K68A 1VGQA 5DGTA 4DDKA 2P1ZA 4UM7A 3W5HA 1WEKA 1RC8A 2NAFA 3AIIA 3CS3A 2QRGA 5K8LA 4B0OA 1OI4A 3BK2A 3UMGA 3F47A 4U2DA 3ZOKA 1AQ6A 2HHHB 1AHHA 1NULA 1PFKA 1JG2A 5T5QA 1Y5MA 3P19A 4QNNA 1MOSA 5ALOA 4U2KA 5K0GA 5JTUA 1AUVA 4JS0A 1AO0A 1SKUA 2VK1A 4FOPA 1BSVA 3GDWA 5HBGA 4IXWA 5CA1A 1GUZA 5I51A 3WLPA 4W82A 4P33A 5JRJA 4U63A 2BMJA 2OHVA 2CXTA 4C0XA 1U3UA 4J4TA 5EJFA 2BUBA 3H2IA 1AG9A 4QLAA 3R3JA 4FFVA 3EPJA 4RK0A 4EYKA 4TUYB 2IYLD 2IOHA 2NZUG 2HSDA 2HFJA 4DYHA 1UIMA 3VGPA 2GBCA 1K7CA 5FOUA 1YE5A 4EAQA 3S4YA 1JR3E 4I1IA 1O54A 3F6EX 3VRHA 5I3CA 1OV4A 2C2MA 2RHMA 3G0BA 3PXUA 4EHAA 1ITZA 3GGDA 3ZDRA 3OKPA 3NIFB 4OQFA 5KOIA 1WPXA 2HJSA 1JXMA 1FFXA 3FUTA 5E7JA 4ND4A 2I7TA 1NMZA 1WEHA 6GPBA 4ZD6A 3V4VB 3VTFA 5JV5A 1U4NA 3PRKE 1KBOA 1OGIA 3KVOA 3CFYA 3ILYA 3O8OB 5F33A 3FMOB 1C9DB 2VDPB 4TKUA 1GSAA 3U60B 3P0IA 4GOND 1CB7A 3ORRA 8ATCA 1XVIA 1OFHA 3UK6A 3NTVA 2FG7C 3SQWA 2F64A 1GPMA 2AC4A 2FF7A 1ORTA 1CQJA 1VC2A 3QW4B 2YJ6A 3USCS 1BXKA 2O50A 1QUEA 2SNIE 1LLUA 3AF0A 4H17A 2OHIA 2WIAA 3FSGD 3CLUD 2YIJA 4EQ6A 5EPUA 4BVAA 1EAYA 1GN9A 2Q21A 4J2TA 3R74A 2FSUA 2FPOA 3KZNA 3IO3A 4JFRA 2A33A 1NNLA 3U49A 1R6VA 3D7LA 4ZOCA 4CGYA 4IJKA 4FBMA 1Z07A 1JKFA 3GFRA 4D57A 1NMSA 1UDBA 2DOKA 1BFKA 3ORFA 5A04A 5IEBA 4Z3OA 1J5PA 4B2LA 2J1LA 1Z2AA 2GILA 4S3MA 5KAPA 2CJYA 5IS2A 1F12A 1G98A 1Z06A 3DL7A 1LJLA 2C77A 4FZ3A 1CPYA 1ZA2A 1TGYA 4ASUA 1GPWB 2AFIA 3I2JA 5IH3A 3ZV7A 5JCXA 1NKTA 4RH3A 2DEUA 1OBOA 1R6UA 1ZJJA 3FPKA 2DFVA 2ZUVA 1TECE 3I09A 3F46A 3MQ4A 4F86A 6ADHA 2Z6QA 1ENZA 5B7PA 5AJXA 4RTSA 1TZJA 1WHSB 2P6UA 3VBEA 3QUAA 3UXMA 2L2QA 4PNHA 4DMKA 3D7SA 2VQSA 5DHFA 2HUPA 1L5FA 1NVTA 4EM6A 4QPCA 2VZ8A 1L7RA 4DR2B 1NIPA 1NXPA 2ZRLA 4XPZA 3RANA 3LF2A 4OHPA 1AUPA 2YNMC 3ILHA 4KMMA 4US2R 4FWTA 1SCUA 1IBSA 2WAYA 2PGLA 3NT2A 3FIUA 2O0KA 1H22A 4QPPA 4MKIA 5CM8B 2QQ0A 3K8ZA 3J81k 1YXMA 1U0SY 3OHPA 1NIJA 1U2ZA 3D6MA 5E9QA 3VYVA 5JRZA 1YL6A 4YRAA 5DMHA 3UWDA 4R1UA 4CF3A 5CDTA 4BX3A 5BSWA 4NHOA 2C97A 2XCLA 3FLBA 5HJ2A 3MG9A 3E3AA 2Y1OA 4FR2A 2R11A 4GS5A 3T9DA 4KNWA 2QKYA 4GNKA 4WFJA 2AQIA 2A1IA 1TA0A 2R79A 4YI3A 4ED9A 5LBIA 2C7QA 5SZKB 1KETA 5L4LA 3M6MD 3JALA 1NR7A 1RLOA 2CXUA 3AF5A 2E0IA 5TQ2A 2EDAA 2HW8A 4RQBA 3RC8A 1KOGA 1B93A 1D9ZA 3FOCA 4Q66C 4OA8A 2YOGA 5BMVF 5SY4A 1IJFA 2CNOA 4OHZA 3U40A 4FOTA 4MI6A 5K0SA 1FDIA 2JAUA 1Y33E 1OI7A 1ZN9A 4MPTA 2EWMA 5HF6A 3USZA 4B3XA 2P78A 1PBNA 3K09A 2ACVA 2Y6VA 3I8XA 1RVV1 3K15A 3N2ZB 1RZVA 4G8CA 2QTVB 1W1IA 2AS0A 4LZZA 4EB8A 4RPJA 5AP9A 1YJCA 4IGIA 4BAZA 4TZTA 1TMKA 1HDIA 4M6WB 3KFVA 2NG1A 4IGKA 2OM6A 3KYCA 4BNFA 1X14A 3P0HA 3RTGA 1K8RA 1FFWA 1YDFA 2CFCA 1MEEA 3QM1A 4CDRA 1TYCA 3G02A 3OCUA 1UXKA 3FUWA 2BZ1A 2IDZA 3RU2A 3O95A 1QG6A 3D6NB 2D59A 3C4VA 3EUFA 3VTZA 2II6A 4F06A 1UAYA 3CLTD 5KMGA 5I9IA 2DFPA 4Q7QA 4I5FA 2XJ4A 4KV7A 1B41A 3PNYA 5DBOA 3CGWA 4YCAA 2FEKA 1A5ZA 1MZPA 3PU6A 4UTXA 1VG1A 2WAAA 1GGFA 3HEAA 4DAEA 2D6FA 1ZKDA 1IULA 2BM8A 4M38A 4G2TA 4AAYA 1YVDA 2YQZA 4F4IA 1HNXB 5EERA 3QF4A 2PMWB 1KY4A 2QN2A 4HEA6 2FLKA 4KE8A 4R2WA 4HDSA 2V9CA 3DLIA 2AFHA 1FXUA 4IRMA 1BDBA 1ONOA 1ZI9A 3ZV6A 4ZQCB 3IQHX 1CQXA 3NG1A 5KHAA 4EYGA 2IY7A 4CHGA 5LNK6 3U4IA 4TMKA 5FI5A 5FBZA 3G2NA 4LEIA 3K35A 1TRHA 4L2IB 2YFHA 1IHYA 4Q21A 1IVNA 5KNCA 1FJHA 1B16A 3QV2A 4IMJB 4RYLA 1OH5A 1N2HA 1V5EA 4F2GA 4HN9A 3L04A 4BVJA 2YFYA 3ZHUA 5EI5A 1Y3AA 1E58A 2AHRA 3JQDA 3KXDA 3DA8A 4D4IA 5AKEA 4F9FA 4QTYA 1NMQA 1EDEA 1E3QA 2G7ZA 4LCJA 5C5DA 3PX3A 5ELMA 1VFNA 2QRUA 4I55F 1M6VA 3SGLA 1WP4A 4O02B 4YQZA 1N2OA 1QM5A 4CTNA 1XPRA 1KZYC 4AWAA 1JHMA 4GM4A 3SQNA 3CRNA 3GFSA 2CSXA 1ADFA 3DZCA 2PUEA 4J6EA 1JBKA 4Q3BA 9ABPA 3KP1A 1OZAA 2CVZA 2QTAA 1UJ5A 2P4SA 2LPMA 3RODA 3P2JA 3U61B 2W37A 4FSHA 5BV8A 4ZO8A 5M3BA 2BGNA 3VYUB 4ZJYA 2D54A 3F6SA 2WHXA 1ZRSA 3EXEB 1NVGA 1JXAA 1M1YA 4WCFB 5TSDA 5C46F 2QB5A 5IU6A 1I7QB 2V7UA 2FWRA 3BICA 4JUBA 3ZNQA 4CG0A 3HU3A 5E6SB 2K87A 4AQ7A 3DP9A 3AINA 1PQ4A 2P62A 3BCUA 3QVKA 2GTHA 3P45A 4F6RA 4XDHA 2F3QA 3NIDB 2VBGA 1Y63A 2WI8A 3C3JA 1USKA 5BN4A 1PGNA 5KYXB 4MVJM 4MS1A 1I33A 2C57A 3P71T 3HB5X 3PC8C 3A04A 3VTKA 1Y8QA 5K3SA 2RJNA 3R41A 4GMXA 1BE8A 5L53A 1PNOA 2EZ4A 4IDPA 1G18A 1R00A 2J3IA 4B3DA 3Q7RA 4ME6A 2GJAA 3N8KA 1XTPA 3OIFA 2C0QA 4N47A 2OAGA 1DIHA 4QYIA 4BLQA 4P5PA 3JQ8B 3OM0A 3KQPA 2O3UA 4BLTA 1SPXA 4Y6QA 2WF5A 2CK3A 3D81A 1X15A 5K3CA 1E6UA 1RNLA 4K1XA 3H86A 4L8WB 3F49S 3S2YA 1Q2XA 2GF2A 3AR8A 1J22A 1SO8A 2JFOA 3H2ZA 2O59A 4LJSA 3EH1A 1KRXA 4KW7A 3R24A 4NV3A 3NB0A 2R8EA 4MKGA 5EPEA 4KPYA 1GKUB 5FBHA 1OB2A 1LX7A 1Y5LA 1NW9B 1Q0UA 1BX3A 2GT1A 4CM4A 1Z4IA 3PD7A 1I2BA 4S1OA 2R7NA 4LWQA 3VR5H 4AZ3B 1NGSA 2Q3FA 3GIWA 4DEVA 1PCXA 2HRQA 2CFIA 1W0CA 1I2CA 2PGIA 3I2FA 1FFBA 4MIEA 2WD7A 4FEAA 2YYYA 1YR9A 2ZRPA 4QU5A 3K09C 1ZG3A 1BN6A 2GZHA 4YV2A 2O2DA 4KGVA 4P32A 2PL5A 3ICPA 2QX4A 3QLUA 4MIYA 5K0EA 4PO8A 2DKOA 2EU8A 3GQBB 1D03A 4HAOA 1IDOA 4PQGA 5JVDF 2GF9A 2UYCA 4PG6A 2QI9F 1YA8A 3A6FA 4U3JB 4CKZA 2DWOA 4D9HA 1RZRD 5F77A 3IDFA 1CY4A 2HK9A 5CVVA 2PGOA 4ZT3A 2ZCVA 3BDVA 5F78A 4F71A 3CNLA 2H08A 1EVZA 3GLTA 3K9WA 2AN9A 1Z5ZA 2DKFA 1ZL0A 4TLDA 2YZNA 3R8FA 1N2CB 1O6CA 4YNBA 4BVLA 3RIEA 3T7IA 1W5FA 4I9NA 3PUHA 4P81A 5GONB 3SD7A 1XZAA 3V33A 5LP1A 3A2MA 2PAFA 2C99A 2ZIAA 4MWOA 4PRZA 2GOYA 1LFDB 1QV7A 1MU0A 3LL7A 5KPJA 1CG6A 1QTNA 2W8BB 3LPAA 5AOAA 1C29B 5BQFA 1DX6A 1GU0A 2HHLA 3C5WP 4I4LA 4JKOA 3ZLUA 3G9TA 1OT3A 1H5QA 4LVCA 4PG5A 1IRXA 3QUTA 2XD9A 5FTJA 4IOKA 1SUAA 3SN6A 4CYMA 3I45A 3PUIA 4PG7A 2XSZA 1BH2A 1EZ4A 1JJVA 1HGXA 3FTPA 4X93A 2QN3A 4RVCA 2X8JA 2AR9A 3SKVA 1SBNE 1HNNA 4TKZA 4UE2A 3HYLA 1Q12A 1YRLA 1JLRA 2DF8A 1SZJG 3OJWA 1UMCB 4OXNA 4LRYA 4U1RA 3JQPA 3AG6A 3BFPA 4PXAA 1MC5A 5HIIA 4U7DA 2IOFA 3KDPA 3E7WA 1E77A 4GDMA 2WU3A 2FDXA 4NMWA 1TM1E 2PGJA 3EPRA 4NCJA 4RPIA 1NURA 4UM9B 3CF0A 1V5FA 2HQBA 2OBXA 3GLSA 3TM5A 2ZCJA 5ITSA 1SHJA 2IPMA 1N2ZA 3R3SA 1K7YA 1E7MA 2ZYTX 1TF2A 4C07A 1E3JA 4FE3A 2GPAA 3IMCA 3HCRA 1G7SA 4LGCA 3HDQA 2E6UX 1QIHA 4G41A 3R9IA 3D7MA 4EMUA 2A67A 1FNBA 5KTSA 1GGVA 1NF9A 3A6DA 2VLBA 3LQ1A 2I0FA 3MZ0A 1QIMA 4B0PA 4NCKA 1DQNA 2HQ1A 5J4KA 2BGIA 5I9LA 2I78A 5KUTA 1ZIDA 2JK1A 2AMFA 1I4TD 1BDJA 1ESZA 1TIPA 2QE7D 5EQTA 4Y6RA 4EI2A 2O8EA 2QJFA 2R85A 3JZIA 4UU1A 4FZJA 1EFVB 2GZSA 2Q3DA 2JAPA 2V65A 2PGXA 3LLCA 4N6NA 5C4GB 1II0A 5EHIA 3V7NA 4I1YA 1L4LA 1LDGA 2F8MA 3V7FA 3K9GA 4J0CA 4Q03A 3V4LA 3NKVA 2I1WA 1KPHA 1XI2A 2Q41A 1ADJA 1D2RA 1M3SA 1ORVA 1AE1A 3UYKA 3OECA 5DZSA 2EJCA 4O0LA 4YCSA 3PG5A 4KLCA 4KVZA 3CLKA 1ZHFA 4RH0A 3EWSA 3W05A 5EIXA 3SQMA 2WILA 5ALPA 4RELA 1RBZA 3WIOA 2OZVA 4O2RA 1I3KA 3MRSA 4TS9A 4D8VA 4YPVA 4ILKA 5JECA 3CRVA 4GKBA 2B1QA 1XKXA 3PDHA