4YONB

P-rex1:rac1 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
MQAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac excha
publication title The Phosphatidylinositol (3,4,5)-Trisphosphate-dependent Rac Exchanger 1Ras-related C3 Botulinum Toxin Substrate 1 (P-Rex1Rac1) Complex Reveals the Basis of Rac1 Activation in Breast Cancer Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4yonB00
1S1MA 2OM2A 1E69A 4POAA 1XEWY 1JB1A 1BOFA 2GK6A 4YC7A 4GNKA 1XDBA 2D7DA 4JS0A 1N6RA 3T06B 3CRMA 1OFTA 1XD8A 2QMUA 2WM9B 3AP2A 4TZ6A 1EFRA 2G3YA 4IOKA 4JMPA 3CWQA 4A8JA 1GKYA 1QRAA 1GP2A 2W2VA 1MABB 2Z4SA 4PX9A 1H8EA 1W36C 3MWLA 2W6ID 2R6CA 2PT7A 4C0AC 2J0QA 1OJLA 1Q0UA 2WSMA 5LBIA 4ASUA 4KITB 2Q9BA 1XEWX 1NVVQ 5CIWA 4B34A 1PV4A 4LYHA 2GK7A 2CHVA 4JVLA 1IN8A 1ZINA 2QUZA 3FYHA 2IX3A 4KYUA 2C9CA 4DJTA 2AHOA 1TUIA 2QMOA 3DL0A 4RCZA 1EG7A 1AK2A 4YXWA 4DB2A 3Q7QA 1LVGA 4Q1EA 2CL7X 3E1SA 3OE7D 2JLVA 1VCNA 2RGGA 5KYKA 2ZS7A 5HKKA 3CF6R 3HR8A 3QXCA 2ZVPX 3DDCA 2AFIE 3DMDA 1EFTA 4OQLA 4TMVA 4TLAA 3KXKA 5CLQA 4RD6A 421PA 3CPHA 4S35A 1XXHE 1XTQA 1VG9B 4Q4HB 5KSPA 4JIMA 4KXFB 5CJPA 2B6HA 4S2EA 4C0KA 5JEDA 621PA 1A82A 1AQYA 5C18A 4PHFA 4TYQA 4JVNA 1U9IC 3A6PC 3T61A 2A5JA 2DHRA 3H84A 1PUJA 3NBZC 4QJ5A 1CJMA 4FI3C 2NIPA 4PQYA 1NF3A 2WOJA 3QXJA 4RZ2A 5C46F 3RRZA 4FD2A 4A2PA 1YHNA 4TQ9A 1NI3A 1VG0B 2QN6A 4D4JA 3GJ0A 3REFA 4D25A 2GAOA 5C4MA 4JL8A 4EQ6A 2LKCA 2J9RA 2R62A 2ZRMA 4M53A 5DLQC 121PA 2WKQA 3TUIC 3I4LA 2OFOA 3BAFA 5FBWB 4PTLA 1NMYA 1S8FA 4NTZA 4Q47A 2XNDD 1ZBDA 2O0HA 5TXGA 1E2DA 1CR1A 2QP9X 3ZVLA 2OBMA 4RKEA 5IF9A 2QMEA 1B0UA 4HATA 3I73A 4L8GA 2QI9C 2ZRDA 2ZI9A 1RW4A 1WBDA 4KVGA 1KY3A 3AVQA 4IXNA 4LHXA 3LDAA 2VP4A 1Z0IA 5DHAA 2H8KA 4A0GA 3HP1A 2Q0HA 5AUQA 4A36A 4V02A 1Q1QA 2YNMA 2H92A 1K8RA 3IILA 1W2GA 4NZYA 1TQ2A 3HPQA 4P0TA 1D2NA 1NLYA 2DYKA 4QL3A 3LW8A 5KNDA 2B7BA 4B6FA 5EQTA 3VR2A 1KO4A 1NMZA 3MAAC 3WBJA 1HH4A 1L4YA 3TUJC 4TWZA 5EJEA 4HYYA 1ZP6A 4NYMR 1LV7A 2BBWA 4ZI3A 3S1AA 1A7JA 1E4VA 1OIWA 1P2UA 1R6BX 2J45A 1GOTA 4LJ8A 1IXRC 3NH9A 1OV4A 3IIKA 4V03A 2CLSA 4B3DA 1X1RA 3AEZA 4R9UC 4RY2A 3RAPR 4LJ4A 4B75A 2ZE5A 1N0WA 1SQ5A 2QL6A 2F1RA 4P32A 1CU1A 5IHPA 1XBTA 1CIPA 3MWJA 4C30A 3AGPA 3LAWA 4HB0A 5L3SB 2ODEA 5EE9A 5G3YA 1XMSA 3HDTA 1JQLB 2EFHB 5FTJA 2D62A 3GFPA 4I4LA 3H4MA 4NCJA 2FEOA 4YQFA 2ANBA 2PZFA 1N3BA 4F38A 4HAYA 1DELA 4HAXA 1YR9A 4UKDA 4Q1AA 5FFMA 2OG2A 3Q85A 1ELOA 5H1YA 2FE4A 3PXGA 4EDHA 3GJ8A 1TF2A 2DBYA 1SULA 3MD0A 5KPDA 3QF4A 4DUGD 2WPDA 3M6AA 1SKQA 2Z0MA 4EJSA 2HT1A 3FTQA 4F92B 4RKFA 4BZXA 5EP3A 5JJKA 4UNQA 2G0TA 2FNAA 2FZ4A 3RRNA 5J4VA 4ARZB 2PH1A 1E1QA 1GL7A 2DY1A 1YR8A 2BKUA 1W4AA 3W8NA 1TAGA 2B21A 3P32A 3OESA 3PITA 3QBVA 1W46A 1JXOA 1E9SA 3UIEA 1DAKA 5BXQC 3GJXC 4LV8B 2DFLA 2FFHA 4HLQB 4V0MA 4MITA 1PLLA 4QJ4A 1XRJA 3QBTA 5FPTA 1E79A 2CMKA 2X2FA 1YU9A 4UJ5A 2CVHA 3RS0A 2VLIA 1P60A 4B3CA 1NBME 2MSCB 1F48A 1OXXK 3IIJA 3ASZA 3U4QB 2CK3A 2WAYA 4QFMA 5B57C 4AIIA 1CJUC 2IYVA 4JJKA 4KFRA 2O8DA 3JZMA 1J7KA 5AJYA 2QSZA 1ONBA 3BJIC 2QNRA 4L4UA 4I1SA 4DCNA 2A30A 3RYTC 3QG5A 3FDIA 2IBMA 4HDOB 1ZJ6A 5HR5A 1Q12A 2W2XA 4QJ3A 1CJTC 4PQFA 3RWMB 3D6TB 5CJ2A 1NIJA 1DG1G 2H7VA 4GRAA 2OFXA 1AZSC 2QTVB 2J7PA 2O8FB 3QEJA 2DWPA 4PPFA 4HB3A 4A6PA 2BOVA 1AZTA 1ESNA 1ZUNB 3TJZA 1KSGA 2GKSA 1SVLA 4GPTA 1LY1A 2BM0A 1U94A 2P0EA 4XIGS 1G5RA 4RFSA 1RZ3A 3SZRA 2NO0A 3O8RA 5KTYA 2GEVA 4TL7A 4NYJR 1T0HB 2JGNA 1GRNA 1W0KD 4RZXA 1ZRHA 3VR4A 5CB8A 3R8FA 5E7MA 3U6BA 1PJRA 1P61B 4PXAA 3WNBA 3QOFA 5TMPA 1DVRA 3H86A 4JL6A 3SOPA 3UATA 2ZI6A 3NC0C 2QU8A 1ANKA 5DN6A 2YKGA 1SXJD 2BCGY 5IK2D 3ZQ6A 1RIFA 4RFVA 2ZUBA 2JDIA 5G40A 4QHTA 4ZCIA 1G4AE 1ZW6A 4Q00A 1KSFX 3LH5A 1Z83A 1G19A 3EC2A 4X8LA 3U61B 1W5TA 3DO6A 3LBIA 1XX6A 4TTPA 1JJVA 3MMPA 4AD8A 1GL6A 2GJ8A 3CBQA 4PC1A 3F5FA 1Z0DA 2I3BA 1KAGA 1GUAA 3B82A 3ZZTA 3PIRA 4R7ZA 1A5TA 2JIZD 3SR0A 3EPHA 4AKIA 1KI1A 3PEWA 4R2HA 5KUTA 1KDPA 1G6OA 2PCLA 4M1TA 1GKIA 1CBUA 4F7WA 3UWOA 4HUTA 3A1VA 2ZJBA 2OESA 4A6XA 2GVDC 2QENA 1XTSA 2FSIA 2UVQA 4LY6A 3BK7A 4MRPA 3VQTA 4A15A 4CEHB 1QHNA 3QUSA 2B8TA 2WSSA 3IEUA 4UQOA 3NEYA 1X8LA 1XPUA 3EX7C 2JA1A 3BB3A 1RYFA 1SXJC 2J0VA 1NP6A 1K5GA 2ZYVX 2ASEA 4RD4A 2OE2A 2ERXA 3U7FB 4MDEA 1CEEA 2GVZC 2VL7A 5EXTA 1OIXA 2V6JA 4JSTA 2Z4RA 4UNSA 3TK1A 2IEYA 2R9VA 4RJLA 4B74A 3VKGA 1DPFA 3NVAA 5M04A 1U8AA 2AD5A 1Z0AA 1XMVA 3LLUA 4N1AA 2ODNA 1Q1BA 4K81B 1JALA 4NMMA 4FXPA 4M9XA 1YR6A 1OE0A 1TU3A 2BBTA 2VTKA 1OB5A 3AF0A 3K0CA 3BGWA 4HZUA 4MGZR 2GCNA 2WAXA 3HYRA 4EFLA 3VKWA 1D8TA 3I72A 1W36B 3P26A 1U81A 4OL0A 3NC1C 1OHHA 2ODBA 2YHSA 3PUZA 3R7WB 1COWA 5BN4A 2P67A 4IHQA 1K5DA 3B1YA 3UG6A 1PZNA 4WZAE 2G77B 4NCHA 1KK3A 4N0EA 2ANCA 2IS2A 2QPAA 3ZVRA 4CGZA 2FN4A 4EAQA 3JVVA 4Y0VA 2UKDA 2ZR7A 3LV8A 2ATXA 1N0UA 2NQ2C 2ZUDA 1NSTA 4XH9B 2BCJQ 3B7GA 3DM9B 2JASA 4IDNA 3IBGA 3W3ZB 4DDUA 2J7KA 5KPJA 1XD2A 5FL3A 3ICQB 2O8EB 2J3EA 2ZSDA 1GRRA 3EG5A 2FJUA 2RGXA 2X2EA 3I32A 4AYXA 1I4DD 3EA5A 3KJEA 2PJZA 4C0BA 1KDOA 4G5SA 1E6CA 3TR0A 2C95A 4D81A 4YMUA 2OXCA 5E3HA 3NHAA 3OEHD 1JR3D 3L0PA 1E2MA 3PUYA 5DI3A 3ZVNA 3FGNA 2IYRA 4Q9LA 3UANA 5LD2C 3MWYW 2QBYA 2ZRFA 4HLUA 1E9BA 3CRW1 4W5WA 3SDZA 4DEXA 4LHYA 521PA 2NOAA 4TQUS 5L3VA 1G1MA 1S3GA 1KY2A 3CM0A 1NG9A 2VPPA 2BMJA 2RGDA 1W4BA 3CRQA 2X8AA 2O8BB 3K0EA 4EQ6B 2WWYA 4A92A 4DKXA 3M4YA 1MO3A 4C0HA 3G0HA 2ZJ8A 2GJKA 1UKYA 4TMWA 3A36A 3C5HA 3SBDA 5AJVB 1UKVY 1JJ7A 3P4XA 4BZPA 3THYB 5DYIA 2ZI4A 2ZQ5A 4TTRA 3VR3A 3KKMA 4PHGA 4NH0A 1VG1A 4Q9JA 3SQXA 4EPRA 4GOKA 1VG8A 4IOMA 4IEIA 3B13B 4WVFA 4M1KA 1XU4A 2QMHA 2XJ9A 2IC5A 1NL3A 2MMGA 2B8WA 3TMKA 4AYWA 3K0FB 1U99A 4XOIA 1NN0A 4DRZA 1CRPA 1MO5A 4CDGA 3SNHA 1O87A 2ZSAA 3UWKA 4MYHA 2QEQA 2IF0A 5F98A 4FMDF 1TQ4A 4PAMA 4AK9A 2PX3A 2OZEA 4E22A 4QGFA 5TB5A 2XXAA 3AVPA 2WOOA 1II8B 3AVOA 4JLMA 4MDFA 1ZNWA 3I5YA 1JAIA 1MV5A 3V4RA 4DLZA 1Z6AA 3QKSA 2F9LA 3A8TA 3BXZA 3TNFA 3K0SA 2V6IA 4JT2A 3TQCA 5HE9A 3LBHA 1IJFA 2CJWA 2AWNA 5FUYA 1FPMA 5CM8B 4CZ2A 3W5IA 3QKRA 1IXSB 3HPRA 1KO7A 2QT0A 4W7SA 2E87A 1FOEB 4IFBA 4ZCLA 4TL8A 1AS2A 1MT0A 3LW7A 3T1VA 1YZUA 2C98A 3QKTA 3VHLB 3K70C 1Y63A 3VNVA 4UJ3A 2EFEB 3ADDA 4M9SA 4PFSA 1IN6A 2GA8A 2Q21A 4EJSC 1KI9A 4H1VA 3I5XA 1LS1A 3G82C 1AKYA 5UKDA 1J8MF 2D4HA 1TEVA 4AWXA 3LBNA 4IFEA 3B6EA 2Q3MA 4LOAA 4ZCMA 2HCBA 2WWWA 1IN4A 1VYVA 3RS2A 2FPMA 4V0ME 1XB2A 2IHYA 1YQTA 4EPXA 1S9DA 4ZKEA 2Q9AA 4CYMA 4C2UA 1OIVA 3IPXA 4IEEA 4XSGA 4DSNA 1PUIA 3NBXX 4A4DA 1II0A 3M0EA 1Q44A 4Q18A 3THWA 5L3QB 1IONA 4V0NA 2XZLA 3OIVA 3I61A 4NYMQ 4HB2A 4MYTA 1R8SA 5KSZA 5DHFA 4BQSA 2QTHA 3EPJA 3KQNA 1BKDR 4BFUA 1QG2A 3RABA 4OHYA 2GNOA 1D2MA 2A5DA 3WHLA 2JLQA 3K0AA 4GMDA 4MKHA 1KAOA 3GLFB 4A1FA 4LPSA 4LBYA 1KK2A 5JRZA 4TLDA 3P20A 2JLZA 2QPTA 3GCGA 1KHTA 1ZCBA 1ZD1A 3HJNA 4US1R 3TH5A 4B76A 4ZV4A 5FH9A 3DZDA 2QT1A 2VO1A 3QJYA 4HDQB 5H8WA 1HE8B 2JJ2D 4FWTA 4PPNA 1UEJA 2Z43A 1IHUA 3SJZA 1P2TA 2IWRA 1G18A 3HYTA 1R2QA 4A82A 2N42A 4HUQB 3X1WA 3AB3A 4KFUA 2EFDB 4G0NA 4JT4A 2V4ZA 3FMFA 2A5FA 4ITRC 1OH7A 3WY9A 2JLSA 1JI0A 2IYXA 2QZ4A 3BH0A 2UZIR 1IY1A 3EZFA 4OQFA 4ABYA 4NDZA 5KDDA 3NDBB 4YMSA 2ORIA 1KI6B 3L2OB 4LGMA 1T8TA 2ZSBA 4TN1A 3ZIAA 1FTSA 2V7QD 5KDLA 4KSCA 1GVNB 4HDCA 3FE2A 3FMPB 1GITA 2ZE7A 5FBLB 3N5CA 4L9SA 2FGKA 4W5HA 2ONJA 1G3QA 1UKZA 1SKYE 4LC0A 5FOUA 3CF0A 1NG1A 5LPNA 1W4CA 2X77A 2I1QA 5LDDC 4BLRA 1OFHA 4M21A 4CIDA 1W5SA 2ODWA 3WNCA 4TT3A 1W36D 2PZGA 1TL7C 5HZHA 5L8VA 4LJ9A 5DYGA 4PAOA 2QRNA 4WOPA 2CE7A 5HCNA 1GSIA 2HF9A 4URYR 2NPIA 2W00A 4O0MA 5J40A 2F43A 1AS3A 5FL7A 1R5OA 3B9QA 3SE0A 1UBCA 4TLEA 2RGEA 4A9AA 2FA9A 2XSZA 4NKRA 1QHHB 3PJRA 1NJGA 2NZJA 1A1VA 5IRCD 5GJCA 2BBSA 2HV8A 2IUSA 8OHMA 4C0SA 3ZS9A 1FMLA 2YC4C 3EWAA 3LFUA 4B33A 1UM8A 1WB9A 3B60A 4Q4AB 1Z8FA 5P21A 2ATVA 2CCGA 3ZDQA 3U60B 2DB3A 1EFUA 3AKDA 4EUNA 1NN1A 2R6DA 2JLXA 3NDPA 1FMJA 2QSYA 4NYJQ 1YE8A 3WRXC 1FP7A 3OFND 1FW6A 2J0SA 1YJ5A 1GZSA 4G5OA 2HXYA 3TSZA 4KHZA 1RKBA 2ZI5A 3KKOA 1V43A 1T5LA 2WJIA 3CIOA 1LNZA 3K0CC 2KI5A 2WHXA 2NO7A 3HWSA 4A8JB 2HCJB 1GL9B 2ZR0A 3EIEA 4KSBA 2GZDA 3KQUA 3MUFA 2W0SA 1WQ1R 1W0JD 2WTUA 1UPTA 3PR1A 4XSHA 3BB1A 5K8TA 1ZM7A 3CZPA 1D6JA 1E0SA 4BLPA 3I3SR 1NSFA 2VIIA 4D2IA 1NY5A 1E9AA 2WKPA 1Z6YA 4GI7A 4C0LA 3AKCA 3GJ3A 5EUQB 2ERYA 3GFTA 3K9HA 3LX5A 3P4YA 1ZMXA 3F8TA 4I99A 3X2SA 3OAAA 1KJZA 3REGA 4I81A 1IAQA 1M34E 2AL7A 5SZKB 4CVNA 5JECA 4OI2A 4MKFA 3EAQA 4EIWA 3NKVA 4C9BA 3P27A 2D7CA 4DC9A 3IEVA 5KSYA 1G7TA 1AKEA 5AWFC 4B3XA 1CLUA 1I4TD 1OFIA 2GWHA 2W6JD 1NIPA 2B92A 2IXFA 1HV8A 5EZ6B 4D4LA 2FGJA 3SYKA 2FFBA 1BMFA 3CNOA 2VEDA 1U0JA 1Z28A 4M4SA 3RS5A 5TDHA 2AD1A 1RVDA 2X1VA 2BMDA 4FINA 3I92A 4P4SA 4UNNA 4D4MA 3QY0A 1NVXQ 2EFCB 4Q4HA 2QQ0A 4HAWA 4YDHB 4QBHA 3L8YA 1J2JA 4M1MA 4DCUA 5LD2B 1ZM2A 1Q57A 3ZD6A 1KKLA 1E9EA 4NYIR 4LC1A 4M2LA 4QBFA 1E2EA 4PO8A 3R20A 2OUKA 2OAP1 2XAUA 3BRWD 4E5UA 4DT1A 5AUNB 3WYFA 1S0UA 4JVSB 1KSJA 4PSKA 2RHDA 5FBQB 2J87A 3GD7A 1AQUA 1Z07A 3U44A 3SQWA 2DCUA 2ORVA 4OK5A 3CW2A 1L2TA 1Z6TA 3ZS8A 5EUMA 2ZUCA 1YZQA 4K46A 5FUXA 2J5XA 2GETA 1GDDA 3SHFA 3VMFA 4XWOA 4JLAA 2IF2A 721PA 3TE6A 1N5IA 2CEAA 1UJ2A 4JLNA 1W49A 2LKDA 1Z0KA 4UNPA 3FFAA 3SBEA 4MGIR 4HAZA 1GIAA 3KUDA 2VSOA 2AX4A 1RFLA 2BKEA 2ZRBA 5ELXA 1XTJA 2HUPA 2A9KA 1E9FA 3ADKA 3CRRA 1F2UA 3QIAA 1JR6A 2IK8A 1ETUA 5E7IA 3RC8A 1DEKA 2RCNA 4DCSA 5FUWA 3QI2A 1KNXA 4L15A 2XB2A 2G83A 4GZLA 1E0AA 2BEKA 2ZTSA 3GJ7A 1KTVA 3S1AB 3T1TA 3LY5A 3IIMA 4CT5A 5JJIA 1E94E 1GRQA 2OBNA 4M9ZA 1QZXA 2A5YB 2W58A 2REOA 1E1RD 2QM7A 3GFOA 3W34A 1TNDA 4HAUA 4DSUA 1T4GA 1TU4A 2PBRA 4IJMA 2Z5FA 4HLCA 2NGRA 5SZIA 3T1QA 4TLBA 1Z0JA 3PG5A 1G7RA 1VECA 4JLJA 1AA9A 1ZM3A 2C5LA 5EE0A 3UMFA 4I1OA 5KOYA 2RB4A 1RE0A 3CR8A 4II7A 1CF4A 2VP2A 1ZU5A 2F1HA 5EP2A 1I2MA 3LQRA 2DR3A 2RHMA 4XD7D 2CNWA 4Q1BA 1N25A 1QVRA 3T15A 5H70A 5DNYB 2AXPA 1E9RA 5FOVA 1DADA 4CF7A 1IN7A 1L7VC 3O8BA 3U3JA 1NBMD 2REBA 2ZJYA 3QF4B 4EJSB 5BWMA 3FWYA 1YZGA 4C0QC 1HT1E 2UZ3A 1JEEA 1JBKA 2C77A 4DLSA 3LXXA 1DBSA 2QA5A 1GM5A 3UMSA 4URZR 4BLOA 4YMWA 4G1UC 2HLDA 1G291 1CXZA 2WJGA 2C03A 2FV8A 1E2FA 3WYGA 3OEEA 1Z63A 1JEDA 3RANA 2HJGA 3QXHA 1IN5A 2Z6VA 5JMTA 3GLFE 1OXTA 2ZYWX 2JLRA 1IXZA 2EFGA 3TQFA 2JLWA 2JJ1A 3EWSA 3FOZA 2QAGC 4B3GA 3AF3A 1P2VA 4B32A 2JLUA 4JVMA 2ZEJA 1GG2A 3I62A 2Q9CA 4NCIA 2FDCA 3QEOA 2HDNB 2QG6A 3GLGA 2QROA 2QE7A 1E99A 2AK2A 1XEFA 3JVUA 5FBVB 2YWHA 3LX8A 5HCIA 2ZIAA 1Z06A 3PFIA 2O8DB 4MH0R 1KI8A 1R0YA 1UDXA 2WJYA 5CDFA 2GJSA 2R8RA 2VHUA 3I1FA 4OHXA 5EE3A 1FX0B 2N46A 3AQ4A 1LFDB 2VP9A 4IDPA 5F9HA 3AVTA 4Q19A 5DE3A 5LB2A 2ZROA 2CE2X 2XOKA 4HLDA 3O8CA 4K8OA 4DSOA 1MOZA 3PENA 1E2PA 3T34A 1YVDA 1AN0A 4TQAA 4W5JA 1KMHA 4M1YA 3B9PA 4TMZA 2H57A 4GMXA 1AGPA 4NHOA 1UADA 5A5GA 1J99A 2WIAA 4PO1A 1XZQA 3FKSA 5FOTA 4XJXA 1XPOA 3ASYA 4CEJB 1I4LD 1TF7A 4RFSB 4TSFD 3V9PA 1EWRA 3VNUA 2ZJAA 3Q9LA 1ZNYA 4CEIA 1DAFA 2JEOA 1DAEA 4RSGA 1QG4A 1UF9A 3OIYA 1TEXA 3UPUA 4NCKA 1KZ7B 4QNRA 3CPJB 1ZCAA 2PT5A 2ZRAA 5AR1A 1DAMA 1Z3IX 2R2AA 4LHWA 3AF1A 4C2TA 1UFQA 5F9FA 3A4MA 5AUPB 2ZYUX 1EX6A 1HA3A 5JS8A 1ODFA 2J0UA 4QBIA 4BUJA 4LJ6A 4GP6A 2QP3A 1NN5A 3GLIA 1BYIA 2ZRGA 2FZLA 3DMNA 1TX4B 2KB0A 2FFAA 1EFRD 2OCAA 2G6BA 2WWHA 3NWJA 5JFGA 4G3XA 1PLKA 3IDQA 4ERNA 1E3MA 3U7GA 1H8ED 2GCOA 4A2WA 3CLVA 1Q3HA 4AG6A 3EPLA 1SGWA 3KDSE 3RWOA 3PEYA 1E2LA 1E2HA 2W2TA 2PJRA 4ASUD 3O8DA 3KUCA 3DHWC 1DS6A 3MWKA 2O0JA 1OKKA 3EIHA 1SKYB 4BEBA 2PX0A 1DTSA 3AKEA 1U98A 4YXWD 3CNLA 3FPAA 4Z54A 1XMIA 3B8HA 3GEHA 4JLKA 4BLTA 5A0FA 1CRQA 3GEIA 1RJ9A 5KO2A 2PMKA 5HKKD 3ND9A 3VU9A 2LWIA 2FU5C 1V5WA 821PA 5EP4A 3CZQA 3CB4A 2IUUA 1HURA 1SVWA 4GZMA 5GADl 2XEXA 2QY9A 4EPVA 4JBXA 2V54A 2Q3FA 4B3BA 2VSXA 1IM2A 3PQCA 2NG1A 3TSOA 5EE5B 4QGGA 2ZI7A 1QHIA 2XTZA 2RGNA 3Q7PA 2NTYC 2A2ZA 3TIFA 4AG5A 4A8JC 2FOLA 4LJYA 5LB4A 2H1LA 1LF0A 4TLCA 4L9WA 2VHQA 4Z51A 3BE4A 1XTKA 1MO4A 1ZIOA 1MR3F 4OBEA 4WXRA 4LHZA 5JS7A 4HZUB 1GILA 2YINC 5IDVA 2OLKA 4LV6A 1JXMA 1US8A 2O0KA 2RGAA 2DWOA 3C16C 5JCZA 4BFXA 4G5QA 2K5UA 1W2HA 4Q4JA 4PAQA 3L8ZA 3QPUA 4US0R 2V1UA 3ZZUA 3B1VA 1EFHA 4FMDB 1CR0A 4JBWA 1E2QA 3IUYA 4DLYA 1XP8A 3WYAA 1VDZA 3ZGXA 2YYZA 1F2TA 2IXEA 1A2BA 1Y3AA 1XJQA 1ZM4A 3K9LA 4Q1FA 5GJVC 4LPKA 4M22A 3RDPA 4D80A 3T5GA 1EX7A 1R0XA 3KFXA 5FI0B 2I1VB 2QM8A 1PVOA 3QENA 2QRZA 3KFVA 2AFHE 1ZD9A 3GQBA 4DHEA 1EXMA 4OJQA 2VYFA 2F3RA 2ZPTX 2GILA 2KWIA 5DI3B 3LWNA 2GTPA 4IDQA 1NMXA 1KK1A 3DVLA 3LQQA 2C04A 2V55B 2QBYB 2BMEA 2NZ8A 3ZJYA 3Q8XB 4Q7KA 1M2OB 4GFDA 2VP5A 4Y0AA 3AVVA 1G17A 3KJIA 4RZUA 1B23P 1EFCA 4TMKA 1WA5A 4KBFA 1U9IA 1VCMA 1DAIA 2X19A 2F7SA 1S1CA 2G1JA 3BORA 4HSEA 3U7HB 2WWGA 4O2RA 5DI9A 1DOAA 1G5PA 2W6IA 1XXHA 1YKSA 1OLOA 2WBLC 5BN3A 2BC9A 2REXB 3EC1A 2Q6TA 3AF2A 2ZRHA 3PVSA 4O3MA 4JYBA 1R0WA 4KCGA 3WXMA 2BDTA 5L3RA 4AURA 5JZVA 4L16A 2WV9A 2OHFA 3U3RA 3BH6A 1G3RA 4UXIA 2VHTA 2FSFA 3AF4A 4XVQA 5E7JA 3TSWA 3OE7A 2AKYA 3VAAA 4UNRA 1M7BA 2WPDD 2IWHA 3WNDA 2W83A 2G0NA 5H68A 1UAAA 4FMCF 4R71A 4IVPA 3VX4A 1BIFA 1OT3A 4QNMA 3X1XA 3CNNA 5FPYA 4BLSA 3B1ZA 3RRYA 2XZOA 3L82B 2GHIA 3W5JA 3CX8A 1GAJA 1W1WA 2YZ2A 3C8UA 4AI6A 1Z0FA 4EKDA 4ESVA 1E1QD 3W3AA 4XVUA 5AUOB 5SZHB 2PLFA 2FSHA 2XXAB 1TTTA 5JWRA 4QM6A 2VBCA 1XPRA 5JWOA 3QPVA 3DPUA 1H8HA 2ORWA 2NO1A 1E79D 4D0GA 4KODA 1VHTA 2OSBA 3CH4B 4P33A 1JAHA 1VCOA 4NYIQ 1Q22A 3AVUA 3VKHA 3W90A 2CJWB 4OK3A 2CK3D 3N2IA 2WWFA 2FPLA 2FG5A 3VR5A 1R7RA 1DE0A 4NE2A 3QVVA 3QKRB 3KQLA 1VCIA 1Z6GA 2XNDA 3KKQA 3TGPA 2WWXA 4US2R 3A1TA 4LCBA 1TQDA 2QQEA 4B2LA 2JLYA 1XF9A 5JI3E 1LTQA 3NIBA 3CX7A 5JEEA 4F4IA 1VKJA 2V1XA 2GZAA 2ZSFA 1WDTA 3K53A 1J90A 221PA 4LJ5A 1T9HA 2OLJA 3LVQE 3WBKA 4ESHA 2J7PD 1Z6XA 2R44A 3THXA 3W6OA 5KNBA 2G1KA 4DDTA 4URXR 1R5BA 1HT2E 4WW0A 2IS4A 4DLWA 2GDJA 4IOJA 4Q48A 3K1JA 2IUTA 1F60A 1JPJA 1YZNA 2EU8A 3KXLA 4LK2A 2WMNB 3GLHA 3CF2A 3L0IB 4CW7A 2N1BA 1ZNZA 3W6PA 1T3HA 3DM5A 3THWB 1KDTA 3EXAA 3K09A 3KTAA 2D06A 1XCGB 1OW3B 1NKTA 5CDFE 3OIWA 1VIYA 3GP8A 2GCPA 4JLPA 3WMFA 2QAGB 2XX3A 1T3SA 2ONKA 1GTVA 3EW9A 5DN6D 5TV2A 1C1YA 1CR2A 4OHZA 5B58C 1VIAA 2JDID 1F5NA 2EVWX 5JSZA 2OCYC 3B78A 4ZDIA 5JCPA 3C14C 3K0AB 1GWNA 4ZKDA 3E70C 5IT5A 2D3WA 1OXUA 1W48A 2GJAA 3U3KA 1NKSA 3MG9A 2RGBA 2MSDB 3H2YA 1BO6A 3F3YA 1KKMA 4PPGA 3DKVA 4C7OA 4MKIA 3LO5A 3RSOA 1DO2A 3A1UA 3SU8A 4AKEA 3KQKA 2EW1A 1G41A 1ZVQA 3LNCA 1KMQA 2V8OA 2OCPA 4ZIRB 5HTKA 2C78A 1KJYA 1T0JB 2DFTA 5KSOA 3CRVA 2CHQA 2IYQA 2ZRIA 3BFXA 4NCNA 4P4TA 4DUGA 5CYOA 2XB4A 3TUZC 3B85A 1JNYA 2WSSD 3HU3A 4Q9IA 5FTLA 3GLIE 4X8MA 2OO7A 2EYQA 2BVNA 2D74A 2L0XA 4V0LA 5D3MA 1II9A 3FMIA 4R98A 2OT3B 1MRSA 4LBVA 3PV0A 4JLVA 5DIFA 5J4YA 1WXQA 3IBYA 4M9QA 2OILA 3DZ8A 3E2IA 1TADA 1G9XA 1J70A 2F1JA 4LBWA 4TMXA 2ZRCA 1XEXA 1E4YA 1U8ZA 4D6PA 3AH8A 3OF5A 1OH8A 2VF7A 3EZ9A 4TYPA 3A1WA 4Q9HA 1HE1C 1T91A 2QAJA 4DXAA 4YMTA 4KI0A 1CULC 1A2KC 1OHHD 3U2QA 1COWD 1G8PA 4ZDWA 3QXXA 1TQ6A 4LX0A 4WIAA 2F43B 2TMKA 3BD9A 4E03A 4LZZA 4C0JA 1F6BA 2E9SA 4F4CA 2ZETA 4N3NA 4DBLC 4F93B 5FR2A 1OF1A 1R4AA 2YWEA 4PHHA 2QP4A 4Z8XA 2GBLA 3CKLA 5D3QA 1L8QA 5FOSA 3C5CA 4AYTA 5BYKA 2XTNA 2O8CA 4M1OA 4PHTA 3RS7A 3SFVA 3BB4A 3SJBA 1UBEA 2IS1A 2VA8A 2BJWA 3R9IA 4A0HA 1N6HA 4HAVA 4B71A 3PUWA 2F3TA 2OXRA 1K6MA 2P3SA 2YVUA 2ZSEA 3QNUA 2RGNC 2CL0X 4RD0A 4URVR 1WRBA 4PC7A 2XGJA 5HE8A 4B73A 1XJCA 3DOEA 5FPHA 4PC6A 4B35A 4DDWA 1ESMA 2WJVA 3NG1A 2DWQA 5B2ZA 1W0KA 4ZDKA 1KGDA 4QOSA 4JJZA 1PLJA 1W44A 3CUEF 1WCV1 4C3ZA 1ZUHA 4YMVA 1SXJA 5IK2A 3RVBA 3IPYA 4LV5B 4BFWA 1KO8A 4RZ3A 5B64A 2QGNA 1E2IA 1E2NA 4XWAA 4NBSA 4B3FX 4IRUB 5C1BA 4V0KA 3IHLA 2XTMA 1E0JA 3KKPA 4DZZA 1XTIA 1MABA 4FWIB 4LYAA 5ANRB 1VMAA 4NP6A 4N0DA 4Q1CA 1BH2A 3L0OA 1ZM9A 1C9KA 3NHBA 2JIZA 1Z5ZA 4Q03A 1G21E 2GAAA 3ADBA 1VYUA 5FOWA 6Q21A 2PCJA 2WJHA 3PUVA 3RLFA 1VTKA 5KNCA 1BS1A 2OEPA 2R6FA 4RVCA 2V3CC 4LRWA 3IQWA 1KO1A 1P72A 3NTUA 2GXUA 1CS4C 1IY2A 4TMTA 3SN6A 1SVIA 4Z8YA 2ZAOA 3PEVA 5CK5A 2W0MA 4AY2A 4ZPXA 4DLVA 5FBRB 4FCTA 5FI1B 5FTKA 4HLUC 4UXJA 3C7KA 4H9GA 4PPQA 5G3ZA 2RAPA 5F3WB 5K8IA 3AVXA 4P4SB 3LVRE 4X8OA 4KLNA 3WP0A 2ZJ5A 5FOXA 1UBFA 2H18A 1Z29A 3D3QA 3IO5A 1Q3TA 1KZGB 1HUQA 2LCFA 2FX3A 3QPWA 3EIQA 4MYCA 1C4OA 2WZQA 5DH9A 2BM1A 1HQYE 2IYUA 4IVRA 3T12A 3O47A 1H8HD 4D0LB 4F91B 4DT1B 2YOFA 5CLLA 1VYTA 3CWZA 3AM1A 5TVKA 2PEZA 3IKJA 5CK4A 4BFSA 3U44B 1MRNA 2XJ4A 3Q3JB 4BLQA 2VP0A 3V4FA 3TVDA 3FHTA 4DB4A 1KOFA 1QDEA 2ZE8A 4BPBA 1WP9A 2P5TB 1BYUA 1I2DA 4JLDA 4DSTA 1E98A 2GJ9A 1AJEA 2ZREA 3B1XA 4WAUA 4U00A 5AJWA 1M8PA 5TARA 1E96A 5JHHB 3CONA 4PZZA 4YDSA 2I4IA 3SYLA 4OQXA 2C99A 2KJQA 2F9MA 2ZVQX 2ZRLA 3D8BA 4IKEA 1KDRA 1U8YA 1Z2CA 2A5GA 4O25A 3AKYA 1F2UB 1FFHA 4B2IA 4MKGA 4Q21A 2PMDA 2V9PA 1D2EA 3ZH9B 2PEYA 3BC1A 4IOLA 2ZS9A 3RHFA 4TYNA 1KYIA 3M1IA 1FQKA 2RKOA 3SFZA 4MYUA 4WXPA 1SHZA 4FIDA 3X1DA 5EE1A 1YZLA 1EGAA 1Q20A 3OEHA 1JR3A 1KJWA 3SI7A 1XZPA 4B6EA 2SHKA 1E0KA 5JLJA 3MRSA 4B48A 3KXIA 4LSGA 3KL4A 3AUYA 4EFNA 1LS6A 1S9HA 4RD1A 1XMJA 3A58B 4JKYA 3I8XA 1M7GA 1ZUIA 1E32A 2YOGA 4G5GA 4GOXA 1RRCA 4ZO4A 4ZI2A 3GLHE 2IA5A 4QG7A 2J41A 5L3SA 3EZ2A 2FF7A 4JYCA 3ZVMA 2F6RA 2A7QA 3MGCA 2GEDA 3KB2A 1HTWA 4JBYA 4KO8A 1GNPA 5E4FA 4PQRA 4P3YA 4QRHA 2WVJA 4WZ6A 4M8NE 1G8GA 1QHGA 4HB4A 3A37A 2NO9A 3H0KA 4MA4A 2CL6X 1QHYA 4D26A 1S96A 4HI0E 4TYWA 3N70A 2DFKB 3K09C 2ZR9A 3QKUA 3WMEA 1CR4A 4D82A 2NMVA 2CCKA 4JL5A 4D4KA 2ZU0C 3Q72A 1Z08A 2R6GA 3U5ZB 3K70B 1S2MA 1N5JA 2BJVA 5JRJA 4URUR 3UXMA 2HYIC 1Q1EA 2D2FA 3JZAA 4ARZA 1UBGA 1IY0A 1QF9A 1IBRA 1KK0A 3ZIAD 1XCMA 4PSAA 3GLGB 3C41J 4FN5A 1T8UA 1VHLA 1RYHA 4E07A 2QGZA 5JI2E 1DAHA 2H5EA 2ZJZA 3CR7A 3K9NA 1W7AA 3W8RA 3WRYC 1CJVC 1AGRA 1SZPA 2ZS8A 4OI1A 1G8FA 3W9YA 1GKUB 5EXPA 4TYYA 1JPNA 1P9RA 1R5NA 3UG7A 2IYYA 3GPLA 4BECA 4TT3D 2JAQA 1FNNA 5BQ5A 5BW8A 3T1OA 1RRGA 4DEYA 3U4QA 5JJLA 1P7CA 4Q5IA 4Q66C 4PC3A 1E9CA 2CHGA 1MO6A 2VHCA 5DGXA 5FTNA 3PCRB 1M7HA 1ZNXA 3E5HA 4OI0A 4GOJA 1UEIA 2C9OA 4WBSA 1KMHB 2FPKA 2YJTD 1DAGA 4Z1MA 5FPKA 5FL7D 5CM9C 2IYTA 3X1ZA 1G16A 1FX0A 1TUEA 3EZ6A 4LI0A 2XSZD 1SVKA 1Z2AA 3SC3A 4BFZA 1O3YA 1XJ0A 3L0SA 2OV2A 3U7EB 2MSEB 2BBOA 2IS6A 4OI4A 2O8FA 3HU1A 4CEIB 4P31A 1P75A 4DDVA 3AVWA 2IYWA 1SHKA 4DIEA 4BGDA 3BFVA 1QBKC 4OKSA 2GXAA 3RRMA 2VP6A 2ZAMA 1ZC3A 2IYLD 4LYFA 5EXXA 1NNEA 4OHVA 1OYWA 1QVAA 1WBBA 4EPTA 1Z22A 4CEJA 2QORA 3SJCA 2ZRKA 2J0UB 3UKDA 4NPHA 4A2QA 2A3RA 2VH5R 4GBMA 3GLIB 4WZBE 2ZRNA 4QGAA 3DOFA 2OBLA 1J8YF 2PLRA 2Z83A 3BFKA 1JECA 4BFTA 3HU2A 3CH5A 4Q4LA 2GCOB 2C2HA 3Q5DA 4EFMA 1CKEA 3QXSA 4FCWA 5JBQA 4BRWA 2RGCA 2ECKA 5B30A 3KB1A 3MJRA 3EASA 4J0QA 2RMKA 5FTMA 1X86B 5J4LA 4KU4A 4BFYA 2C9YA 1G20E 1NVVR 1G3MA 3TW4A 4EPYA 3EZ7A 1N6NA 2O5VA 4XTCS 2WJJA 2ZM5A 1GNRA 2ZJ2A 3BS4A 2GBLC 3QG1A 5AJXA 3KJHA 2Q3HA 3TBKA 1R10A 3OAAD 5AJZA 1RJ9B 1AIPA 3WMGA 3CPEA 1KSHA 3BWDD 3VU9B 4GDFA 2GESA 4OYHA 2AR7A 2WIBA 3VR6A 2BMFA 1R8QA 2G88A 2JJ2A 4QM7A 2R65A 3RSLA 1IOZA 4ACBA 1SXJE 3UMRA 4LDJA 1GNQA 1NVUQ 2JJ8A 3I8SA 4CEHA 2IL1A 3LD9A 2VHJA 3BH7A 3FMOB 5K8UA 3RS4A 4W9MC 1BMFD 5AK0A 1SVSA 3VX3A 4MUBA 3U3OA 1VPLA 1KNQA 4P4UA 2GXQA 2H17A 3KKNA 1G5TA 1OFUX 1XWIA 1OH5A 2IW3A 3C4JA 5JWHA 2AK3A 1M6NA 2V7QA 5BYJA 3A1SA 4OJKA 3VR1A 1G8YA 2QPOA 1US8B 1QHXA 1S4QA 1X8JA 3FKQA 4FMCB 4LJ7A 1P3JA 1EESA 2FMXA 4B43A 3AVYA 2FEMA 1P5ZB 4LYJA 4Q4JB 5CYPA 2VRWA 5J47A 3ECCA 3U6KA 1UDWA 2ZYTX 3ZZ0A 4UXHA 1NRJB 4Q02A 2HXSA 1RRPA 4KYIB 4MGYR 1ZYUA 2IYZA 4GP7A 3R7WA 3BIFA 4DLTA 4GSYA 1LF5A 1ZD8A 1F2TB 1XD2B 3NH6A 2WMOB 5EP1A 2WKRA 1NLFA 3B2EA 3MJHA 4PSVA 2HEIA 1HEIA 2ZU6A 1LW7A 1N6PA 4JKIA 1M74A 4HEJA 4KLZA 4TL9A 2BV3A 4QGHA 4XWKA 5KU1A 3NEJA 5GVSA 3FHOA 1N0VC 3R9XA 1OXVA 2ZRPA 4BRUA 1W47A 1FQJA 1A4RA 3PEUA 3KX2A 3MCAA 2O8EA 1SVOA 1W4RA 2F55A 3ETLA 1FP6A 4XVRA 4IDHA 3QQ5A 4DWJA 1N6LA 2KE5A 1HQCA 4MRNA 2JATA 4QXAA 1YRAA 3OFNA 3ZD7A 2RH5A 3EA0A 5HPYB 4JLBA 4PC2A 2XNSA 1TMKA 2ZXUA 4DLRA 4FMBB 5J4KA 4DCTA 1N6IA 3AV0B 3AUXA 3H1TA 2GXSA 2J59A 2OCBA 2XZPA 4L5BA 1N6KA 4CRWB 2J1LA 5C4GB 4ZDJA 3LXRA 1KI2A 5CITA 2Y8EA 1XXHB 3GJ4A 1JQJC 2FH5B 3U3MA 2AXNA 4URWR 1W0JA 4NL4H 2ZITA 2PZEA 1NY6A 4A0FA 1U0HC 1YRBA 3RC3A 2O8BA 1R0ZA 4MRRA 1DARA 2OAQ1 3WHKA 2O52A 3F0TA 4BE7B 1D9XA 1P73A 4ON9A 3IO3A 4V0OA 5FR1A 2C96A 2CNWD 3CO5A 1AM4D 1EK0A 2P6UA 4M0LA 1Q1ZA 1X3SA 2VQSA 3GJ6A 3HR7A 1E9DA 3THYA 4QBGB 2HF8A 5HZKA 2YWFA 1RRFA 1CP2A 1GFIA 1TPZA 1X6VA 5DISB 5J5CA 4QC2A 4LWZA 1MKYA 1E2JA 1JR3E 4Q7MB 4TZ0A 5F2EA 3X1YA 1X1SA 4KFTA 1YZTA 2E1RA 3MSXA 1MH1A 2ZJOA 4KJZA 4DCVA 2HLDD 5FPSA 3ZLJA 2GF9A 2BWJA 3LA6A 3SHWA 3NBFA 2W6JA 1N2CE 3OEED 1P9NA 2CVFA 1N5KA 2D2EA 1G64A 2CXXA 1FZQA 4PZYA 3K0FA 5EZ5A 2P6NA 2GF0A 2JJ1D 4TL6A 5CB6A 3QKSB 1T6NA 4IVQA 3K70D 3L43A 1KIMA 4GT1A 2P2LA 3GEEA 4D0NA 3LRPA 3AP3A 1FUKA 1KI7A 1OYYA 4DLUA 2ZI3A 3V00A 1XCPA 4DLXA 1XTRA 4PO9A 4R2IA 3T35A 2QE7D 3D7MA 3EARA 1HYQA 4X8HA 1FNMA 4O2LA 1II8A 1YR7A 2YOHA 1IJEA 4JSYA 3TLXA 2J46A 4XTRA 2FWRA 4OHWA 3GMTA 1HY3A 2DPXA 3W6NA 1WMSA 3ZYCA 3R9WA 4FW9A 1DG3A 4RCYA 4B44A 5DO9A 1ZC4A 4OQMA 3TRFA 5C2JB 2AKAB 3IQXA 1FL9A 2CLDX 3MFYA 5G53C 2XOKD 2IYSA 5GVRA 5GJWC 3OIUA 3THXB 3FFBA 1EWQA 2FSGA 1OXSC 1AS0A 4PR0A 4Z1MD 1NN3A 4FCVA 3GLGE 3IGFA 1G6HA 3GLHB 4BASA 1SVMA 3FKSD 3T5DA 3QE0A 4Q9KA 1L4UA 4BZQA 1FUUA 3SEAA 4RD2A 1OPXA 5J4HA 2YWGA 3KTAB 3BERA 1G3UA 2P65A 3J81k 3DKPA 4CT4B 3VFDA 3EPKA 2BEJA 3BOSA 3QSYA 1UKEA 5SZJA 2CCJA 1WE2A 3P1JA 1G8HA 3UK6A 2OFWA 4MRSA 3OZXA 5G41A 2VF8A 1N6OA 3AP1A 4BFVA 3D31A 4I1UA 5JSZB 1KI3A 3K8YA 3CX6A 1YZKA 2GEUA 2WICA 3B5JA 4Q7LA 3SS8A 5L3QA 3GJ5A 1ZU4A 5KHOC 1E1RA 4U7DA 1F3OA 2KBEA 1T5IA 3AGQA 4GL2A 3K9GA 2QAGA 3Q5EA 1TF5A 3TAHA 3ND8A 1WF3A 3KZ1E 5GJBA 4Q1DA 2QTFA 5FUVA 3WP1B 1XD9A 1E2GA 4KAXA 4C7OB 4QHYA 2A78A 2EWWA 4F4JA 2AWOA 2F1IA 3GLFA 2CLCX 2NO6A 2ZANA 4A0RA 2ZE6A 2WWIA 1OKKD 4G01B 4XD7A 2HYDA 4E09A 4EPWA 5K8LA 2GRJA 3FHCB 3SJAA 1S3SA 3ONWA 1NBMA 4DVGA 2BIFA 4BWYA 1M1YE 4NONA 1G3IA 1H65A 2YV5A 1P2SA 2MMCA 2IEZA 3N2EA 4LBZA 2P5SA 4MUAA 4YLGA 5BN5A 1CTQA 4KVAA 4KFSA 1ZAKA 3FB4A 3QVUA 4AC9A 3B1WA 5D3MB 1FTNA 4ZIRA 4LJAA 4AKGA 2XITA 1NJFA 3DEFA 3QF7A 4AKHA 1ZIPA 3KQHA 1Q21A 2CDNA 4HUQA 3IHWA 4IXMA 3SYNA 3ADCA 4G5RA 2C8VA 1KI4A 3ICEA 2NPFA 1CJKC 3G5UA 1XEXB 4NU0A 2ZRJA 1RC8A 2JCSA 4QHSA 3NBYC 3PUXA 4BEJA 5JHGB 4ACAA 3RS3A 4I1VA 2DFNA 1KI6A 2EYUA 1G7SA 4QKQA 4ILEA 3NXSA 4M1SA 4Q7JB 4PZLA 5E95A 1XNJA 2AN9A 4WA7A 2IT1A 3LLMA 4B47A 4HZIA 1P6XA 4M1WA 1D9ZA 2G9NA 1U2RA 3THOA 1OH6A 1IQPA 1NVWQ 4B2PA 2GZHA 1DO0A 2BHRA 1NLZA 2EQBA 2EWVA 2VSFA 4DIDA 1U90A 2R6AA 4OK6A 1N5LA 1KO5A 2CBZA 2YC2C 3MLEA 2KBFA 3TVTA 3A4LA 5TY0A 2HT6A 5EXSA 4H1UA 3KJGA 4JZKA 3BBPA 2HJVA 4IW3B 5CIQA 4IDOA 2P6RA 1Z47A 1QHSA 4KBGA 2O8CB 1T3LA 1X8KA 4C4PA 3C15C 5A4JA 1LB1B 1OSNA 3VHXA 3FVQA 2PL3A 1E2KA 3TKLA 2IXGA 1P62B 2FFQA 1P9WA 3ZQJA 1D5CA 3OHMA 1QHHA 5DSZA 2B7CA 2H16A 4OQNA 1P4SA 3R8CA 2KSQA 3A4NA 4RD3A 4TSFA 4JLOA 4MGKR 4MRVA 4YONB 1XFAA 1RPZA 3TR5A 3TAUA 1G7CA 2IHBA 4U5XA 4LHVA 4MQBA 4LUCA 4Q4AA 1U0LA 4TTQA 4KV9A 3VTKA 4PANA 4U02A 3RNLA 1OB2A 4Q01A 5KDOA 3TW8B 1G4UR 1SXJB
chains in the Genus database with same CATH superfamily
1S1MA 1P0QA 1A9PA 4PBRA 4TV8A 3WGKA 1A5ZA 2GK6A 4FE3A 4XDZA 4XM2A 3VJRA 1ZGAA 3VU0A 1N78A 1PX2A 3DGFC 4PO3X 4EATA 5JJBA 2QMUA 2WM9B 4CT0A 2DTXA 4B4WA 3CW8X 4NZZA 1GP2A 2QD3A 4RO0A 1MABB 4DCCA 4PX9A 5GZ3A 1W36C 2W6ID 1IXYA 1IPHA 2JCXA 5KOIA 3RG2A 1XZNA 4P81A 3LUPA 1ECJA 1KZYC 3I01M 1XEWX 5CIWA 5NLLA 4B34A 5DNWA 4LYHA 4JVLA 4E3ZA 1ZINA 2QUZA 2C3UA 3TVYA 4ZANA 4Y6LA 2C9CA 1K3TA 2AHOA 4EHNA 2K7ZA 4BE4A 3GELA 1UQUA 3ZDDA 1ORDA 3Q7QA 4CKYA 1LVGA 4EYEA 2UUBB 5BURA 2JLAA 5AOAA 2JLVA 1XALA 3CY6A 4WKOA 5E4YA 3R0IA 4DV0B 1J0AA 2GUGA 4LDNA 4DOMA 3FSEA 1FC0A 1ULUA 1L8OA 3CLUC 4MULA 5CLQA 4RD6A 5FPPA 1HE3A 4AU1A 4YT4A 4YMLA 1MTZA 3GGJA 3OZBA 4UBMA 1CEYA 3WNVA 1XTQA 1IEXA 1VG9B 4Q4HB 1C3XA 3AHIA 1ZUWA 3K0HA 3W3AD 4BDSA 1OI3A 4JVNA 2V03A 3FPHA 4HPJB 4XR4A 1ZOPA 3T41A 4EVSA 2A5JA 3JWPA 4M0MA 4XFJA 2VDLB 5EEGA 3SZ3A 3VNAA 5I6DA 3VVCA 3AY3A 4AP9A 3I3OA 4BKQA 1P4HA 3A27A 4LECA 4B7CA 5K6AC 4XARA 1T1SA 5G0VA 1A72A 4D44A 3K8QA 4DZRA 3ZWXA 3LYHA 4PINA 3NQ41 2EGHA 2H4JA 4I9UA 1DKUA 2FX2A 1TVKB 2GAOA 3MQFA 4JL8A 2J9RA 4M53A 5DLQC 1K6EA 2WKQA 3TUIC 1EFVB 3I4LA 4Y9SA 1T4CA 3MOIA 3NWBA 1MIHA 3QH4A 3O4FA 4JJ6A 1N7GA 2I03A 2I67A 2RHCA 1J8FA 3LWDA 4OL9A 1OI7A 3A25A 2P2ZA 4PTLA 5F4ZA 1K6IA 1XSEA 3C24A 2NUPB 3OI7A 1F0KA 5IS2A 1T9CA 5E3JA 3RYHB 4H7EA 1JE1A 1WW2A 2BAGA 2OBMA 3WSTA 4DXDA 4BKUA 5FT9A 4HX5A 6LDHA 2GHTA 4TV8F 1OV6A 1DKOA 2C9BA 3IBTA 1SNYA 2P68A 1XMPA 2G7ZA 3OUZA 3SHOA 5JAHA 2CFSA 1Y98A 2QI9C 2QS9A 4NOLA 2ZRDA 2ZI9A 1WBDA 4QWMA 3ZWKA 3P94A 3ASVA 4IXNA 1IC6A 3CSSA 1DRKA 3LDAA 4AUNA 5IM5A 1RHRA 2CLMB 4PRLA 4EG5A 2GN8A 4V02A 3HACA 3D02A 2Z4TA 1DJOA 2BM8A 2QWXA 3GZNB 4D0SA 3HKBB 2YZNA 3CPSA 4P7JA 5TF4A 5LXTB 3OQPA 3UJBA 4UM8B 5D51S 2B7BA 2BFCA 3IAS6 5ULLA 1Z4NA 5EQTA 3VR2A 1OOEA 1NMZA 4CM9D 5I9BA 1USUA 5TQ2B 4KMOA 4UPEA 3QU2A 1CETA 3E9CA 5SYNA 3ZU4A 4HDRA 5KIAA 3ZDCA 3Q40A 2WHPB 1FIUA 3S2YA 2IPMA 1LV7A 2YRXA 1U5AA 1IUKA 3I1YA 4ZI3A 3FNRA 1QIKA 2QTAA 3CF4G 1ZD2P 5FWYA 5NULA 5I9NA 3A28A 5K4HA 1PWXA 1PRYA 4EBFA 3WQBA 1W34A 5AHOA 1IXRC 3DHVA 3NUGA 1OV4A 4N18A 1FRNA 3GI1A 3PPWA 2IGTA 4V03A 2CLSA 2WNSA 5EZQA 4E08A 1BKSB 4YHHB 3AJDA 3RLIA 5A9SB 1WSBA 1J2EA 4GWKA 4LJ4A 1QM5A 4MWOA 2ZE5A 4P32A 1IHXA 1L9XA 1F8XA 5IHPA 4BU1A 1CIPA 2QRUA 2VYNA 3C0KA 2B35A 2ODEA 1X0XA 3AL2A 3OPQA 1TO2E 3HDTA 1JQLB 2EFHB 4G41A 1EM6A 3FBWA 4MX8A 1KRHA 4BNLA 1H85A 4M54A 4NCJA 3H4MA 2FEOA 3B51X 2ANBA 2HNBA 5CCDA 1N3BA 4N7RA 5HEKA 2FX5A 4CM1A 1QIMA 2JI7A 4YO7A 4GX0A 4P58A 1A4IA 4F6RB 1GU0A 3D6AA 4PGFA 2JFWA 3BRCA 3D6UA 3OTWA 4G89A 1I2AA 4Q1AA 7REQA 4ZK2A 1B1CA 3SC2A 3DMPA 3KUKA 4S0XA 2CSXA 1HE5A 4FSHA 3S81A 3ZGOA 3QF4A 4BBPA 3QLEA 4DUGD 1SOMA 3SYMA 4AF6A 1SIUA 1U0GA 2B69A 4D8XA 1RAEA 3LPNA 2X9QA 4F92B 1KTIA 5JVDA 4BNXA 4RS3A 3TLMA 4QARA 3T38A 2KPOA 2PKRA 4WY2A 3RYFB 3B9RA 1FDIA 4R0MA 4RTLA 5CFRA 4MPRA 4QYMA 2FNAA 4X6XA 3WB9A 5LLTA 3JQEA 4MIEA 1C1DA 2I8AA 4ARZB 2D2VA 2PH1A 1WZIA 1GL7A 1BQEA 1YD7A 4ZYTA 4QVGA 4WERA 2PV7A 3P32A 2IITA 2OCKA 3WWZA 5AW2A 3D64A 2C4TA 3RVSA 3JYLA 2C57A 3M3DA 3UIEA 1ZH8A 4ZCQA 4J6FA 2AMYA 5BXQC 2FFHA 3V97A 4PFJA 4KQXA 1XRJA 1V3UA 3L46A 1VJGA 2CMKA 1K0FA 1M2HA 3RS0A 3IAFA 4BKPA 4FHEA 1P31A 3RVDA 1JHRA 4PZCA 2BLLA 2MSCB 2C4UA 3LYUA 3M82A 3P0FA 2Q1WA 3MXTA 4JN6B 5IANA 2C97A 2YXDA 3ASZA 4KUGA 2P9JA 3F96A 4AIIA 1CJUC 4JJKA 5EY5B 5IKPA 1EWVA 2QSZA 3VNQA 1PG5A 3K9FC 3BJIC 3KBBA 2GWRA 2QNRA 2GM5A 4WCFC 4W1RA 3ILXA 3LYLA 1L6IA 3ETGA 4EY5A 4WOJA 1L4NA 3T5MA 1CRWG 1SFRA 4KK3A 4FK8A 1DG1G 2QK4A 3ZEAA 4DCMA 1U6IA 2Z2KA 2QTVB 3ZGLA 4OAPA 3ZHYA 4X44A 2COUA 1Z9BA 4FPXA 3OKFA 1H3FA 5E6UB 2GKSA 5B2FA 4GPTA 3GR6A 3AY0A 3GBSA 2EZ8A 2P79A 2D1QA 2NU8B 2H51A 1YS4A 2P0EA 3CO0S 1MAVA 4HWGA 3UMYA 1TZMA 1G5RA 3M5DA 1REQA 3B3JA 3N58A 1O1YA 1T9GR 4J1TC 4PGHA 4RFSA 4UCWA 3STVA 4EABA 4X66B 3N05A 3X43A 5KTYA 2GEVA 1IQRA 5JU6A 1MJNA 1GRNA 5KMGA 1Y6JA 1XTVA 3R8FA 4TS1A 3OZRA 1PJRA 4PXAA 3VR4H 1CUDA 2K2WA 4U3JA 2JFOA 4BUZA 5DBFA 1VB3A 1IB6A 5DN6A 2QU8A 4FGJA 2YKGA 3WV4A 4TVOA 3IQIX 4BHTA 3E5MA 1V8OA 3FYSA 2JDIA 5T4EA 3B12A 2G5PA 5CU7A 5JDIA 3DA8A 4NOJA 4F85A 1E3JA 4LZNA 4PLCA 3CF4A 3OZWA 4IIBA 3FPEA 1YHYA 2CWWA 3B1KA 3FA2A 2C4KA 1JQKA 3LRXA 5BUCA 5ILOA 2DZDA 2PWBA 1IBSA 2P40A 1HWYA 3NO4A 1ONOA 5CAEA 3OZVA 1HNNA 5HS6A 4JUAA 5LZ4A 1OLXB 2HTEA 3B82A 3QEMA 3WK8A 2O6LA 1PS8A 4CR7A 4YROA 4ND5A 2WYIA 2DVMA 2YBEA 2QTWB 3EPHA 1E6KA 2VAPA 4MHSA 3KAKA 1KI1A 5A4DA 4BJHB 1PFGA 3E7PA 3E9NA 5DBGA 1KDPA 3ZU6A 2VT7A 4RMGA 2X42A 2PFKA 3ITNA 3IQDB 1NX6A 3P4UA 1U6JA 4G1CA 3EGWA 4INPA 5CVVA 3T52A 4HFJA 4HUTA 3A1VA 2QX7A 1OUMA 1XDGA 4DQKA 3I9V1 2UVQA 3WYDA 4PAWA 1G9TA 1S89A 4MRPA 4W8HA 2ZVDA 5I3ZA 5JAPA 2X5JO 2FPPA 4HQFA 2V5UA 3A9UA 3U09A 4YJFA 1VPWA 3LSTA 3RARA 1T2AA 3KTFA 1J06A 3FYDA 3KEMA 4DM7A 1E3DA 1MVNA 4ER5A 1WXGA 3FNQA 1SXJC 4RD4A 3E3NA 4DNQA 3U7FB 2J5QA 2ERXA 2PAAA 1J5PA 2V5AA 3CJQA 4AECA 5DYTA 3EXIB 4CLXA 1FU4A 4DCJA 1OIXA 4OGKA 4KI7A 1NFRA 1GA1A 2DM6A 3A4YA 3TK1A 1PZHA 4FGWA 3JVDA 4GI2A 4JUBA 1Z16A 2ZYGA 4MO9A 4B74A 4NS1A 3W9SA 1DPFA 1FTQA 3N53A 1U8AA 3LT4A 3NVAA 4L0CA 3QUQA 3VSAA 4EG1A 2I2CA 3GLSA 4PXSA 1J24A 3TXYA 3C6BA 4K81B 4CDRA 4FXPA 2PRIA 4M9XA 1X1EA 4N6GA 5AHWA 4ABTA 3QVLA 2OBYA 2W11A 1YJ8A 2PRZA 3K0CA 4MGZR 4HZUA 3ORSA 3ZV6A 2WAXA 2G1PA 4AJNA 7ABPA 5HG0A 1W36B 3B6KA 4WXEA 2AQHA 2Q8PA 3PGLA 2YBDA 3WDSA 1WPXA 4QOEA 5A7GA 5K6RA 1COWA 4R8KA 1K5DA 1UJ4A 3UG6A 3AY7A 2A1UA 3IERA 1PZNA 1JHAA 1X87A 2FUCA 1HO3A 3FHLA 2Z2IA 3MS7A 2ZLBA 1KK3A 4FFBB 3CLSD 1N2HA 5I7EA 2IW1A 2FPGB 3PTLA 1F6WA 5COQA 1PQUA 3FUXA 3ICWA 1AHIA 4JC0A 4MJLA 2NYVA 1KBQA 4R69A 3KC2A 2O2ZA 2IIPA 2WINI 1YDEA 4ZO6A 3LV8A 3EFBA 5AHKA 3V1NA 2BCJQ 3DM9B 4HGZA 2JASA 4DDUA 3IBGA 3TDMA 5AD1A 5KPJA 1XD2A 3AIKA 2F64A 2I65A 5EJ5A 3MLAA 3MIZA 3PNLA 3ZNOA 1YRYE 1O8CA 3G8DA 1GRRA 1JEQB 4LRQA 1HQKA 5DK4A 3V2UA 2VJBA 3M4XA 1SXQA 4I55B 5E38A 3DDWA 1MENA 4QQ8A 1RQLA 5AHRA 1QVVA 4ZYWA 1FB5A 1EFDN 4DABA 4EO7A 1WZ2A 1E6CA 2CFOA 5J9FA 1TKAA 3F6YA 2OXCA 3SAJA 3V46A 3V55A 5E3HA 3ZVNA 3H4TA 3PUYA 5DI3A 3LF1A 2NXCA 1P45A 5F5XA 3FGNA 2V9ZA 4ZC1A 2ZRFA 1CUJA 5REQA 2IPOA 4Q3OA 1E5QA 3AO0B 4RVFA 4DEXA 3NCHA 521PA 2HO4A 1VPVA 3DAPA 1NR7A 5KKCA 1T1EA 3K4HA 5JYBA 1NG9A 1HZZA 1DDGA 2OSVA 2J9GA 1ID8A 3HWWA 3CRQA 1W4BA 4RPIA 5BSTA 3HBFA 4A92A 2HSEA 3I04M 2VZEA 3E2MA 1YO6A 1QRRA 4MP3A 4H31A 3COJA 3WWDA 2UYQA 5EIEA 2ZJ8A 5HIIA 2A86A 3DL7A 1KXJA 1CY1A 1MJGM 3LRTA 3A36A 5F2OA 1OXBB 4TUYA 4PRZA 4HNAB 2PGJA 3THYB 2J33A 4QX6A 1WPQA 1BMTA 1G8SA 2ZQ5A 2EX4A 5ISMA 1BQ3A 4PYQA 2IH2A 3FGZA 2ODPA 2C54A 4Q9JA 3SQXA 1CRLA 3DE4X 3AWIA 4HX9A 3DQZA 3PXAA 2R48A 3D7RA 3G6WA 3HM2A 4U63A 1JS1X 4DV2B 1BA3A 1PNTA 3RI3A 2XMDA 3B13B 4TOIA 1N8NA 5K8TA 1UMBA 1X74A 2G5GX 1QO9A 4M1KA 2VT2A 2XQFA 4NDAA 4LHEA 5BVHA 1Q3KA 2IC5A 3BGOS 5L4NA 1LQUA 4AYWA 4K9RA 3K0FB 4ZWNA 4XOIA 3HY6A 3GWZA 1UPFA 3GAAA 5TGZA 3QLJA 3D5QA 5H80A 4X1IB 4M83A 1OFVA 3GA7A 2X0FA 1O87A 3RFXA 1PDWA 1I7QB 3WWYA 2Q5JA 4E22A 1DWOA 1GSHA 3AVPA 1ODKA 4RTSA 3E22A 1JAIA 1KHHA 2P35A 2P4HX 3RIEA 5FLXA 4YFVA 2G72A 4PN7A 4AXXA 5LR6A 5K0NA 3P9CA 1JU4A 5A2GA 5DIZA 4UM9B 4NMLA 4RACA 2HNAA 3K0SA 3VZBA 1V6SA 2ABWA 1DKLA 1GZ3A 2WC1A 3MTAA 4JBHA 5D5PA 3TQCA 5BSKA 2Z9DA 1XXLA 2APJA 2AWNA 1Q16A 4FFSA 5FUYA 3B2NA 4EKEA 1DQRA 3ABOB 3L4BA 5CM8B 4CZ2A 4O0LA 1ILEA 3KT6A 3W5IA 1IXSB 2GO1A 5IWAB 4PGAA 3LQFA 4IFBA 1MT0A 2FMTA 3VHLB 5D86A 3ZDAA 3ULKA 2H6EA 3BRQA 1FTGA 5AK5A 1EVIA 5EFOA 2G82A 3KZXA 3WMXA 3LKDA 2EFEB 4C4YA 4M9SA 3OZEA 3F90A 1IN6A 2GA8A 2Q21A 4EJSC 1KI9A 4D9FA 4MJXA 3C8HA 1LS1A 3EMDA 4UCQA 2DF8A 5JZOA 4LF7B 1O0SA 2QQ5A 5UKDA 2D4HA 1TEVA 2PVSA 2XUIA 4P8RA 4PLTA 3JPWA 5C8DA 3B6EA 2Q3MA 1O5OA 2TSYB 2BHLA 3DXZA 3BX1A 4G2NA 4KQGA 2FPMA 2IKQA 4V0ME 1YZYA 1KC3A 1U0FA 1YQTA 1P91A 3I2JA 4PYNA 4O5OA 2EBHX 2REQB 2Q9AA 3NOQA 4OQQA 1NOKA 2BFMA 1IHPA 1XKQA 3QVTA 1ZIXA 3U31A 4BC0A 3M2TA 5FWAA 2HDHA 2YHUA 2AI3A 4TRJA 4WESB 2EBUA 1TEHA 4V0RA 1T9ZA 3RUDA 4A4DA 1N0HA 4YRJA 5ABPA 1T1GA 2GQ0A 3RIMA 1M9NA 1TK2A 2X22A 4MS1A 3H18A 4HH3C 1UOEA 4NYMQ 5EJ9A 2FZCA 3C3MA 3D4PA 1WMDA 2E3JA 2BD0A 4CM7A 2FFJA 4MMZB 5JAQA 4LF6B 3SNKA 2DCMA 3SBOA 3EPJA 3KSBC 2BTEA 1JZTA 3KOUA 5JT1A 3RABA 1SA0A 2GNOA 2NUBA 2UVPA 3A1DA 4KPEC 4KIFA 4MAMA 2YJ4A 4ETMA 4KPUA 1DTWB 1PG2A 4KO4S 2HPHA 1T8WA 3BHMA 3ENZA 4G8JA 4LBYA 3KLNA 4TLDA 2NUAB 4DMGA 2X4IA 1BG6A 1MX9A 4MUIA 4ZP1A 3IE1A 3F71A 3PWSA 3NBMA 1DT5A 1ZCBA 3DP9A 2HK6A 3NOVA 3P9RA 5JD6A 1T8RA 4C2AA 2DR2A 2HCFA 3TH5A 2XIJA 3HFJA 1DIOB 4QYSA 1LK0A 4B76A 4CDNA 1SIOA 3B6JA 4X1YA 2HW8A 1XGKA 3CXRA 4IQ8A 2AX3A 5JH7A 4DR1B 5TC4A 3VR6D 4A0SA 5BN5B 3AHGA 2FP4B 4HN9A 4N7BA 1G59A 5D5QA 3WV5A 4J1QA 3SKXA 3I5MA 3UTCA 4YBRA 4UAJA 3TD6A 2Z43A 3E82A 5C1PA 4KPYA 1W94A 2PZKA 1SK8A 2IWRA 4I3HA 3SIWA 1YMVA 3AWDA 3DB1A 1T35A 3AB3A 4KFUA 3INYA 3M1YA 2OV1A 3N8KA 2GRUA 4JT4A 3KLOA 3S2ZA 2JAHA 4IV0A 3FMFA 4ITRC 4C14A 2OAEA 2CXPA 3RTCA 5M29A 1IY1A 3H2IA 5IMSA 4H1HA 4M38A 3L2OB 1U9CA 4LGMA 3ZIAA 4MQMA 1E2BA 4KSCA 1K1EA 2J4FA 4CV3A 2JG3A 3UICA 4I3FA 3A9SA 4C22A 2ZR8A 4Y9UA 4CMCA 4PYIA 4FZ5A 3GV0A 2XKBA 2X5OA 1UKZA 1XCJA 3WLRA 1JRLA 4MV1A 4RHEA 4NZNA 4D6YA 3CEPB 1W1UA 5LIPA 3PUKA 4UPVA 4G97A 1QAQA 4RQBA 1RS0A 3SYRA 3W05A 1UP6A 3LQKA 4W6QA 1M5RA 4HNGA 4KP7A 2B4RO 4L75A 4M0UA 4HK4A 2PZGA 1TL7C 2WP8J 2Y1WA 1NZDA 4INOA 5DYGA 2PIAA 3DFMA 4PAOA 5EJIA 1EK1A 3UZUA 1YIOA 3BE6A 4O29A 5AOVA 4C03A 4AN0A 2MSLA 2AOTA 2NPIA 4URYR 1LJLA 1X9GA 3JD0A 3VHXB 1B14A 3K0BA 4IF4A 1UBCA 3AIIA 3G13A 3SXUA 4A23A 1Q2UA 1ZD3A 4Q34A 1A1SA 4O4JA 2AXQA 1OX4B 5DVZA 4IO0A 4KDEA 1ZVJA 3IEPA 4KXQA 5EWJB 5I8ZA 8OHMA 4TMYA 1FMLA 3EWAA 4LGVA 1YQGA 2JHCA 2NVOA 1CLEA 1FTWA 2WE8A 4JNKA 3M6LA 1UM8A 4JP5A 2O1WA 2XMRA 4Q4AB 3VH3A 4CN8A 1P44A 2ATVA 4YMHA 1WZUA 1JU3A 2G8NA 3N0TA 1Y5MA 1JBQA 1KH2A 2JPDA 3AKDA 4MYDA 5DM2A 2BE9A 1FLAA 5EQJB 1XYYA 4GQIA 3MHTA 4RZSA 4WCDA 5JMOA 2ENUA 2X58A 2HN9A 1T5OA 1FP7A 4ZI5A 5CX1A 5CGQB 5JH7F 1CY4A 2HXYA 2GS9A 3IB3A 2DTEA 2XQJA 3TSZA 2ZI5A 3W06A 4KOEC 1M5TA 4OXKA 2WJIA 1PSWA 3OZIA 2AH5A 3HWSA 2NO7A 4YLGA 3KZMA 3UJPA 1X2EA 2HCJB 3C85A 4N5MA 5AK3A 3RC2A 3U9LA 1XK6A 1KS9A 1D1TA 3EIEA 2L17A 1NATA 1ZUD1 2ISSD 3LG2A 4J7UA 1WQ1R 3IDZA 3IUNA 3K2QA 4IL5A 1UPTA 2PGNA 3ORQA 2X8JA 4OHCA 4XSHA 5H4GA 4Z7OB 2YIJA 4OQYA 2GM3A 1JDPA 4UDXX 5F1YA 1UKCA 1D6JA 2E4ZA 2WJ4A 4DGQA 4Z49A 5BNZA 3RADC 1B76A 3JQBC 1NSFA 2VIIA 1MJHA 1YVRA 1NY5A 3GT7A 2WKPA 3K0KA 4GI7A 4TS9A 4UUOA 5DRTA 3AKCA 3GJ3A 3QFRA 4ETIA 2ERYA 3HDYA 1RDFA 3LX5A 3P4YA 3MTQA 1QJCA 5K5EA 2C20A 3H4IA 3MGGA 4RA6A 4I99A 1SUBA 3A0UA 3OAAA 5E7QA 4FEYA 3KZNA 3UBMA 5JECA 6ABPA 4CVNA 4GOMD 4MQ6A 3NKVA 1R0CA 3LK7A 1SK9A 2G28A 3R2JA 2C29D 2D7CA 2JH8A 3EQ7A 5JE8A 4BJ3A 3IIIA 4QFBA 3C3EA 1AKEA 1ECCA 1GTG1 3VPHA 5A7FA 4LWPA 1YB5A 3VYWA 1CLUA 1I4TD 1YT5A 2GWHA 2Q46A 1UDAA 2W6JD 2OLEA 2XR1A 1AX9A 4U9UA 1USKA 2B92A 1QP7A 3RJ9A 1O94C 4RKRA 1LBHA 4PYRA 5EZ6B 3LHDA 3GOQA 3O82A 4TXMA 3ZY3A 1FDUA 2PH7A 1BMFA 1WHSA 3EMBA 1Z28A 5FFNA 4OV6B 4AP5A 5C4IA 1LSUA 3MWDB 3RVOA 5CA1B 1RVDA 2X1VA 2AOWA 3PHJA 4FINA 4UHEA 4O4JF 3QY0A 3WGOA 1PTJA 2EFCB 3PD7A 4W7HA 4BQNA 4EKNB 2QQ0A 1FNCA 4NV3A 1J33A 3I09A 4YDHB 1M66A 3L8YA 4NFHA 5CFOA 4IF6A 4E11A 1M5UA 1SEPA 5LFAA 1PTKA 1ABBA 5ALFA 2A0YA 3ID6C 4JC8A 2ZTLA 5J2TA 4I6GA 3G2OA 1QP4A 1VE3A 4WX2B 1GCIA 1JYEA 3IAEA 3LVFO 4IUBS 4E5UA 4KZKA 1PCXA 1X9HA 4LNHA 1YUNA 4MAAA 1JDTA 3E8SA 3PVZA 2CNDA 4G84A 4HDMA 1XR3A 3QM1A 4PSKA 2INGX 2JBAA 1DMRA 1HG1A 3QY9A 1W6UA 3U44A 2XOXA 4OK5A 5YASA 3ZS8A 1Z6TA 4WD3A 2JS7A 3G1TA 1QO0D 4HGNA 5FUXA 2GETA 3ZDYB 2Q49A 3VMFA 5BV1A 1FP4B 2GBIA 4JLAA 1CYEA 3ZCSA 1AG9A 1JU9A 1N5IA 1YB4A 2UAGA 4JLNA 1FSPA 3IP8A 3TPFA 3FFAA 4MGIR 3EY9A 4MV8A 4HAZA 2SNIE 2ZIGA 3NYRA 4DARA 2D8MA 4YGYA 2BKEA 5HQ3A 5ELXA 4HQLA 4RVDA 3UUFA 4ZZIA 2QW0X 3FUUA 2ARKA 4KEAA 2ZZMA 1U3UA 1JR6A 5E7IA 1D2AA 1MXFA 3IKMB 1DLIA 4DEVA 4EUHA 3ELBA 4FW8A 2FR1A 1BFDA 4QSHA 5FUWA 2OFFA 3TR6A 3V5NA 4DL9A 1Z5NA 4GZLA 5A6VA 3NHSA 2OVBA 4YRCA 1TYZA 3OZDA 3Q15C 3S1AB 2HJSA 1QNLA 2A9RA 1ECFA 1GRQA 2ZXFA 3QE4A 5CXXA 4OX9B 2W58A 4AXBA 4FLEA 5AH0A 4B5KA 5G1OA 3UHPA 2C5FA 4HAUA 3W34A 1TU4A 1CUWA 3ORHA 3JVIA 2Z5FA 2Y0CA 2FSPA 3HUFA 4IJMA 4IS3A 5CT4A 3TM5A 1Z0JA 5BSWA 3PG5A 4JI1B 4JLJA 2JGJA 5FADA 1V5EA 3JYOA 1AA9A 2X7JA 5KOYA 5EE0A 2IE0A 2XTAA 4I1OA 3RYCB 1I0IA 4EI2A 4X20B 3WLIA 4L3WA 2O2YA 2QYTA 3OOYA 3CR8A 1K98A 3JQ9A 3K92A 3PRKE 3CLTD 3KLPX 4MQ5A 1CF4A 4F3CA 3OX2A 3WK6A 2CZGA 4ENRA 4YJDA 4RKYA 3ZE9A 1A7KA 2DR3A 5HTOA 4QOGA 3TTXA 4XD7D 3GCXA 1P0MA 3JYNA 4CETA 2DXIA 2R8PA 4HJXA 4PLHA 5H70A 5HKBA 1DADA 1CK4A 3Q87B 5FNVF 1NBMD 3MWEB 4G07A 2REBA 2ZJYA 4DQLA 4ZK6A 4M7OA 4EJSB 1OBFO 5BWMA 3FWYA 5J2TF 1XMOB 4WKCA 4JEIA 2FPOA 2RI0A 3FNGA 3PFNA 4M8LA 2C77A 4JA0A 4QTXA 4DLSA 3QBDA 4EBBA 2OGTA 2X0EA 1Y4ZA 2XHZA 3PX3A 2PFSA 3BGVA 5EIXA 3M6VA 4YMWA 2Z1NA 1YB7A 2JGDB 2WJGA 2A1TR 3V1LA 4ZOLB 3ZV4A 2G6TA 3OEEA 3SLGA 5I4KA 1Z63A 2Z1MA 3M5PA 2RK3A 1IULA 1OXTA 2ZYWX 1LJ8A 1RAFA 2IEIA 2EFGA 1I7PA 2JLRA 3FY4A 3LP8A 3EWSA 2QRKA 2MT9A 3PI6A 4K86A 3WYBA 3HN7A 5GMOA 2IYNA 3DUWA 5AKEA 2J3QA 3JWEA 3SXPA 1WB4A 4OMDA 2JLUA 5A03A 1C30B 4KQ1A 5J1SB 3AHJA 4G0ZA 3UAYA 3A6GA 4P5PA 4M6WB 2FDCA 3IT0A 1LW6E 4K6HA 1V26A 3H0CA 2HDNB 5FYQA 1ZGZA 5EXDA 4NULA 2QE7A 5A1TA 3NVDA 5FBVB 1GG9A 2J08A 4XUEA 2HH9A 3LX8A 4GRDA 4P08A 5CT8A 4XQCA 2ZIAA 1Z06A 3Q3IA 5LQAA 2O8DB 1KI8A 1QGDA 5CDFA 2WJYA 1JIUA 3H65A 3W7VA 4BB6A 5EE3A 1BCSB 1H2WA 1R9MA 2QR2A 4OU4A 3PXBA 2Y1CA 1LFDB 3DVRX 2VP9A 1EK2A 4IDPA 1V6CA 3IE0A 2V0NA 2OXIA 4Q19A 5JNRA 2OFPA 4FHFA 5LB2A 2CE2X 2AN1A 2DJIA 2XOKA 3L7BA 2Y05A 4HLDA 5ALNA 4K8OA 5KYTA 3HB5X 4UBKA 2X8LA 4WA8A 2IBSA 3IV6A 1AN0A 1X80A 1WB6A 3EXEB 4O59O 4TQAA 4W5JA 1CG6A 3F78A 4QSMA 3ETHA 4ZPJA 3OT1B 3NMUF 3B9PA 1WLSA 3ISVA 4GMXA 1UADA 4FYKA 4QPDA 5FORA 5JROA 3AINA 1PAUA 5A5GA 3Q3CA 1WOYA 3ZXUB 1HE4A 3KJQA 1HX7A 2GN2A 3QW2A 1PZGA 1XZQA 2IXAA 2RIPA 2FDXA 2SKCA 2FW0A 4PHCA 3EHEA 4TSFD 4Y2VA 3O92A 1CY7A 1EWRA 1TJNA 1WD5A 1NBHA 1SCIA 2GLXA 2PX8A 1ZNYA 1ZD4A 2VC2B 4G36A 5EHIA 4FT2A 1HTBA 4O4LF 1EVEA 1IDOA 2JEOA 2ACKA 3OCJA 2XD9A 3FPBA 2WMDA 1TM4E 4MLZA 2OV6A 1MC8A 1RPJA 1I13A 3A1NA 4YP0A 3VM6A 4JOBA 4QNRA 5GWXA 1GRCA 4EYOA 5KI6A 5AR1A 1LSJA 3OD5A 1DAMA 3OVMA 5F9MA 2TYSB 1RWNA 5AUPB 3B1JA 2ZYUX 1HYEA 1HA3A 1XCBA 4YP9A 3DEAA 4QBIA 4DJJA 1STOA 3DDSA 4BUJA 3NVMB 1NN5A 2EQ5A 1NVKA 1V2HE 1S7CA 2FZLA 2I1LA 2ZRGA 3OPYB 1ODLA 4GKBA 4UE6A 2KB0A 5DNDA 3RIHA 1KFCB 5JNVA 1GFZA 1L5HB 1VFNA 3NWJA 3SVZA 1SC6A 3IDQA 4I19A 3HC7A 1OAAA 3ROZA 2ES4A 3ZNNA 1M2WA 4A2WA 2X9GA 3KYCA 1B8OA 3CLVA 6AT1A 2POQX 1YA4A 1OXMA 3PE3A 3RWOA 3UGKA 2W2TA 2PWAA 1QO7A 1BN7A 4ASUD 3O8DA 4U7TB 2FQ1A 4LXUA 3GIWA 2WVAA 4OM7A 4TLMB 1BXGB 1U2PA 2O0JA 1OKKA 2A0WA 1J1ZA 3EIHA 1YB1A 2PX0A 1U98A 3NOOA 2BHSA 2CXTA 1JWAB 1RAIA 1OC4A 1ZSYA 4DMRA 3CNLA 5ECWA 4BN5A 1XMIA 2EOAA 1YU6A 4JLKA 5ALTA 3AERA 4A3SA 4UD6A 1CRQA 5ENDA 2D5AA 4YWHA 3RRMA 3H8JA 5JY6A 4B40A 4LJKA 4PX5A 3GFSA 1V5WA 1U63A 1BN6A 4FR2A 1Y7LA 4LMPA 3CZQA 3CB4A 2IUUA 4OFZA 1SVWA 4GZMA 2Y1OA 4BRSA 3D1VA 5HUQA 5KJCA 2XEXA 5E2AA 3DTNA 3VOBA 4EO4A 4B4KA 1W30A 1Z8HA 2QSJA 3EVBA 5MFZA 2Q3FA 3TZQA 3PQCA 3OFKA 1I5OA 2NVWA 4C88A 5FV4A 5L3VA 5EE5B 3DT9A 1ZVMA 1VSQA 4QGGA 2GGSA 4OOEA 5GPBA 5TX7A 3TIFA 4DIBA 1POXA 1CUXA 3G0IA 3OU6A 2GD6A 1T43A 4JUCA 4LJYA 1LF0A 1FLDA 4LOHA 4AG3A 2QVYX 2PUVA 4GLBA 4MVJP 4Z51A 5I8PA 1L5GB 4HDNA 1XTKA 2JLBA 1ZIOA 1ZH4A 1K4MA 5DK6A 4MEBA 1FFGA 4GR9A 5JS7A 3DV0B 1P1IA 1NXSA 3DZIA 1LTKA 4JASB 2GK3A 4LV6A 1NONA 3AEQB 1FSSA 2VTVA 1MOSA 2Q0QA 2QLNA 2X0IA 2XDWA 3ADOA 2NXEA 3NETA 4POOA 3F9IA 3WL8A 4F3YA 2K5UA 3SKYA 1EHCA 1W2HA 2RE8A 1RI1A 4PICA 4Q4JA 3OOWA 2CSUA 1E1NA 1WUYA 4M7RA 4US0R 4L22A 4B6GA 3LX6A 3ONVA 3ETNA 5LM3A 1D5WA 1O6BA 2XWSA 1H2EA 3W9BA 1EFHA 1X1QA 4FMDB 1CR0A 3M9XA 2VYQA 2YN2A 2BGJA 4AZ3B 4GUDA 4MCAA 3WYAA 2L42A 1F06A 1U8TA 2YYZA 2OP0A 3OM0A 1IY9A 1Y3AA 2YX1A 1L8LA 1ZCJA 2IPXA 1A98A 1BGWA 1IG0A 2W8ZA 3D54D 4WLNA 4RX1A 3N2KB 2GARA 1ZFNA 4HRXA 4I5GA 2VDQB 3NDJA 5G0TA 1PG0A 1VKNA 5DBIA 5H82A 4X90A 2FHSA 5FI0B 5AKXA 3ANMA 1PVOA 4LF4B 1AKMA 4BWGA 4OFBA 4Y2YA 1U7PA 1FDSA 1T36B 3KFVA 2WF6A 4YYZA 5K0FA 4DHEA 3GQBA 3DD5A 4YEDA 4TMFA 1DQNA 2QVCA 5BOSB 2KWIA 2O05A 3GK3A 4IDQA 1RAHA 2I6SA 2ZUUA 2YHAA 2V55B 4YA6A 3UFXA 3ZJYA 1DAPA 1JDUA 1DRUA 4ZT4A 4GFDA 5IT4A 2MOKA 2QRVB 1G17A 1NXWA 2WDPA 5CEEA 1RPNA 1EFCA 1K5PA 3BWBA 3P0EA 5KVVA 1B23P 3DLCA 5KHLB 2NN3C 4EL5A 3OCZA 4RETA 1U8CB 4X7BA 3R5HA 1JQ5A 3BORA 4BNZA 3W2FA 5JS6A 2WWGA 3GC6A 4BEVA 2ZIEA 4DJDC 1YJCA 3IJ5A 1UC4B 4UD2A 5LYJB 4TTSA 4UHFA 2IU4A 2REXB 4F12A 5TMEA 4AO8A 4ZO9A 3CKMA 3EGEA 3PVSA 4IIJB 4Z6KA 4X64B 4V1CB 1YR3A 3RTDA 4FUQA 4NZPA 2ZCUA 4XR9A 3U56A 3QNWA 3QU9A 4YK7A 2EKDA 2VG8A 1AK1A 3VGJA 4ROSA 4BP9A 4CFZA 2NT3A 3WGYA 3LUKA 3BXFA 3EA4A 2FLKA 3WA7A 3N9IA 4BV2A 4R4JA 4BMPB 2NQ8A 2ID8A 3AF4A 4XVQA 5E7JA 2AJBA 1EUDA 2EKQA 1M7BA 3O73A 2C42A 3O9ZA 4C6SA 1FYWA 1UAAA 2EIHA 3N07A 1GDHA 4IVPA 2PZ8A 4L5JA 2RD2A 1GR0A 1UIMA 1RWQA 3MT0A 2ZDHA 1RC0A 2P9GA 3B1ZA 3CU5A 5EJAA 3UOAB 3CX8A 3EE6A 2X8BA 1D6MA 1W1WA 3A1EA 4UVIA 4P4NA 5FA8A 1Z0FA 5K3BA 3V4VB 4EKDA 3ZHCA 2O2JA 3B89A 4XQ0A 1DO8A 3R6WA 2FZ5A 4YN3A 1ZH6A 4KDFA 5SZHB 2O20A 4RXTA 4HWOA 3K9BA 1IOWA 3ZHXA 3W3AH 2FSHA 1NR1A 4XEUA 4YR9A 4NBLA 1TTTA 3AL0C 3QHAA 1GD1O 5BSFA 1XPRA 1FDTA 2HZBA 3QPVA 3ZY4A 1GQYA 2H1VA 3RIXA 3F49S 2JD0A 3QHQA 4IZIA 4PAGA 4G0QA 4RKWA 1SOVA 4U39A 4B87A 4PCUA 1FS4A 1T2UA 2AEFA 3LUJA 3O1IC 5EHGA 2HQRA 4KODA 2ZWVA 2AGVA 2Z3WA 3AFGA 3CH4B 3HZHA 5DYNA 1BDHA 3GJSA 1Q22A 3AVUA 2CJWB 1FVXA 1U1FA 1IM5A 5CCXA 3DL2A 3JD3A 1G6Q1 2FPLA 2HRCA 5B1DA 1R7RA 3T1YB 4EHAA 2QMQA 3EZYA 3AHCA 5TJHA 2VK4A 3KZCA 4WOBA 1V11A 4NG5A 3ZCVA 1VCIA 2XNDA 2Z8YA 2I91A 4EZEA 2QQFA 4HSGA 4AJ2A 1MIOA 3KKKA 2WWXA 3U62A 1A95A 1E1CB 1ZA2A 1TQDA 1ZONA 4QJBA 2JLYA 1XF9A 3DGEC 3W5VA 1SUSA 3FCAA 2COKA 3CISA 2G9VA 3LKVA 1LTQA 3CX7A 3OZ7A 3DLAA 5JEEA 2ZT6A 1R6DA 2V1XA 3BJRA 4FEEA 4RJ2A 4BNWA 2ZSFA 4N54A 4PRKA 3COPA 3TE7A 2G4CA 3RUCA 1TMYA