4YONB

P-rex1:rac1 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
MQAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac excha
publication title The Phosphatidylinositol (3,4,5)-Trisphosphate-dependent Rac Exchanger 1Ras-related C3 Botulinum Toxin Substrate 1 (P-Rex1Rac1) Complex Reveals the Basis of Rac1 Activation in Breast Cancer Cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4yonB00
3RC8A 4A15A 1PJRA 1P75A 3LBIA 4MYHA 1MO4A 3UG6A 4LBWA 2N46A 3I8XA 3GLGB 3T15A 1E94E 1CRQA 3B8HA 4C0QC 4Q9HA 2ZYWX 1MABB 1NN1A 4MUAA 4WXPA 1B23P 1KHTA 1ANKA 3SJAA 2GXSA 3CRRA 2ANBA 1KO5A 2QAGB 4OJKA 4WBSA 4NMMA 5JSZB 4HB3A 3LXXA 4L16A 1IJFA 5FL7A 2F43A 4B3XA 4LJ8A 3MGCA 1T3LA 1HEIA 1TF7A 3B9PA 721PA 4MH0R 4URXR 2JJ1D 2X2FA 1ZMXA 3CWQA 4QBGB 5DYGA 1W7AA 1UKVY 2BEKA 2PEYA 2H57A 3JVVA 1ZC4A 4LJ5A 3MUFA 4HDQB 5L3QA 2CMKA 1DE0A 5SZIA 2DR3A 1LS1A 2OFXA 3KXIA 2FA9A 4D81A 2WJJA 2WKRA 2Z5FA 3TVTA 1M1YE 3EC2A 4F92B 4CEJA 2XNSA 1Z8FA 3ZD6A 1NN0A 2A3RA 2XTZA 1E2QA 4RD3A 3RVBA 4Q1FA 4MGIR 3NG1A 5J47A 1M8PA 2Z43A 3QXHA 4AD8A 3WBJA 2JEOA 1KGDA 4BEBA 4ZDKA 3DPUA 3E5HA 4LZZA 2VH5R 4LUCA 4HUQB 2ZYUX 3U3JA 3DKVA 2RKOA 4Q7MB 4RCZA 4S2EA 1CBUA 5AUQA 3T1VA 3QKUA 4NL4H 4V0LA 1E1QA 1KSJA 2XEXA 3TE6A 3DO6A 1VYTA 2VF8A 4Z8XA 1IN8A 1TADA 1X86B 1GKIA 2ZRMA 3TW8B 2ZJYA 2ZQ5A 2JLSA 5GJWC 1OXTA 1FP6A 4KVGA 4HUTA 3K9NA 2Z4RA 5DH9A 2Z0MA 5CK5A 1AIPA 2PT5A 1VKJA 1NIJA 2GDJA 4TLAA 4OQXA 1GM5A 4US2R 3BC1A 1OKKA 5TB5A 3FKSA 2P5SA 3UANA 4B3FX 3ADCA 4BUJA 1A5TA 2E1RA 1E2PA 4AK9A 4W5WA 5JZVA 2QMUA 2WWFA 3SI7A 4PFSA 3EIEA 2GILA 2F1RA 3CPEA 1BMFD 4FMCB 2OXCA 4FMBB 4QJ3A 1IQPA 1SVWA 2CNWA 2HV8A 4DRZA 3C15C 3K70B 2OESA 3AF0A 5L3SA 3T12A 2JASA 2D2FA 2RHDA 2CK3A 2VEDA 3QE0A 4KLZA 1HT2E 4RZUA 1JEDA 1MABA 3MCAA 1GILA 1WE2A 3HR8A 2W00A 3SHWA 4PXAA 1OW3B 3WNDA 3N2EA 1OT3A 2QAGA 3WP1B 1XEWX 2QQEA 1SXJE 1KZ7B 1S9DA 1U9IA 3RSOA 3JZMA 4URWR 3SJBA 2GZDA 4M9QA 2HF9A 3WRXC 2WJHA 4XWKA 1R0XA 2FG5A 1GL6A 1RRCA 3GLFB 4D2IA 1OIVA 4RZ2A 2QZ4A 4C3ZA 1A2KC 3VKWA 1E2JA 1OF1A 1KI9A 2QNRA 5DNYB 1W1WA 2C95A 4ZCLA 1LVGA 4TYQA 5HE8A 2KI5A 3KZ1E 1TQDA 5JS8A 2FFHA 2VHUA 3EIQA 4DT1A 4AIIA 2QSYA 3F5FA 3R8CA 3GCGA 3L8ZA 4G01B 5BYJA 4HLQB 1HQCA 2QP4A 3C41J 1LNZA 1ETUA 2IEYA 2JCSA 4ASUA 4KLNA 5KNDA 1D2MA 2ORIA 2F7SA 3CF2A 4HB2A 2QTHA 3NXSA 3W34A 4LJ9A 4UNQA 3QKRB 1A4RA 1JALA 2GCNA 4JSYA 1HT1E 4LYJA 1MR3F 1YZLA 3U4QA 1TTTA 4PAOA 4HB4A 4GL2A 2VSFA 1UF9A 1IN4A 1OH7A 2CLCX 4C0LA 5FR1A 3HWSA 3CRW1 4GRAA 2BC9A 5FBVB 3V9PA 3KJIA 5JI3E 1Z08A 3G82C 4BZQA 4YMWA 2JLXA 4GSYA 4JLDA 1H8EA 2Q9AA 4MA4A 2ZVPX 1G17A 2GF9A 4MYTA 1PVOA 3BOSA 2I1VB 4LWZA 4PQFA 2GF0A 3IPXA 3WRYC 2EU8A 3MJRA 1I4TD 3L82B 1YZTA 4AYXA 1PLKA 3CX6A 1W2GA 5JFGA 2JLYA 4C4PA 2N1BA 1KMQA 3BWDD 4B6EA 2WSSA 3KTAB 2ONKA 2X77A 1SKQA 4O25A 4RFSB 4PQYA 2O8FB 3SDZA 2O0HA 2Q9CA 1ESNA 3GJ8A 3MD0A 1G7TA 1MO3A 1YR6A 3A1TA 2G3YA 2J0VA 1S8FA 1G4UR 1XJQA 2RGAA 4HSEA 2ZRDA 3CWZA 1L7VC 1G3MA 1U81A 2ZRNA 1GSIA 1DO2A 3QPWA 2QENA 3A4MA 2BBOA 3W6PA 4E22A 2ZE5A 4C7OA 1J90A 3PVSA 2FOLA 2ZJ2A 4U00A 2GEUA 2WOJA 3TSOA 3FHCB 2QT0A 3GLFA 4P31A 4PHGA 2HT1A 2XJ9A 2C98A 3O8CA 1VIYA 3PUVA 4M1MA 3SNHA 2F1HA 5EE1A 2J3EA 4KAXA 2ASEA 5J4YA 3ZIAD 3I3SR 3AM1A 3SYLA 3W3ZB 3I61A 4RFVA 3MMPA 3ETLA 4ZCIA 2KWIA 1RIFA 4JBWA 1CLUA 5JWRA 3HU2A 2F3RA 4TMTA 4L9WA 1CS4C 3AKDA 4K81B 1YZQA 1WF3A 5KSZA 1NF3A 4LV8B 1L8QA 3AH8A 4ZKDA 4D26A 3HDTA 3QKRA 4UJ3A 1DVRA 2BJWA 1BKDR 1N5IA 1K5DA 1G41A 3VR2A 1HA3A 1KI6B 2R6AA 4M9XA 3AVYA 2Z83A 5E4FA 2ZI5A 4RD1A 3VR6A 3VKGA 3VR4A 2AD5A 4PTLA 1G8PA 3H86A 2B7CA 2CJWA 3AKCA 1Z22A 4M9ZA 2PZFA 1UPTA 4JL5A 5H1YA 3X1DA 1AKYA 5HPYB 3CNNA 2CXXA 2O8EB 4D0LB 4I99A 1Q1EA 1NY6A 2ZRAA 3LX8A 5J4LA 1EX7A 4IDNA 3A58B 4RJLA 2O5VA 5FOUA 2OCPA 3LNCA 4JIMA 5C18A 1R6BX 2FH5B 1GWNA 1TQ4A 3TKLA 3FDIA 5TV2A 2IYVA 1UKYA 1P9WA 3QEJA 2CBZA 2J41A 4DLTA 4QM6A 1GL7A 5CLQA 3WYFA 1VCIA 2ZR7A 4OI4A 4XWAA 4DLXA 2O8FA 1ZM7A 3BRWD 3KJGA 2O8DB 4TYPA 4PSVA 2NOAA 1G19A 2HLDD 4LBZA 2PZGA 1SQ5A 4LI0A 2LCFA 1Q57A 4M4SA 3VR3A 2R65A 4O3MA 1HE8B 2GBLC 3CRMA 3ND9A 3ADDA 3LBHA 2D4HA 4LOAA 3VAAA 3BS4A 1KAOA 5HZKA 2YYZA 4BLPA 4P4TA 2W2TA 4IVRA 4OQFA 5BXQC 5FOVA 1KTVA 1XEWY 2AX4A 3GLIB 4Q4JA 2FNAA 1ZU4A 4MYCA 3LRPA 2QPAA 5HKKA 4PZLA 3L0SA 3IIMA 3WHLA 2PX3A 3UMSA 1FX0B 4BLQA 3P27A 1JR3D 2EWVA 3QBVA 2IUUA 2SHKA 1I2DA 3VR1A 2PT7A 4E5UA 1XMJA 2Q21A 3NDPA 2QE7A 1V5WA 2BM0A 5JWHA 3HR7A 3MWJA 1YVDA 4DDUA 2N42A 3GJ7A 1OB5A 2QQ0A 1OIWA 1KI8A 2WVJA 4ZDIA 1ZP6A 5JJKA 5DN6A 4Q18A 1D5CA 5F98A 3K0FA 3GFOA 4TL7A 5CJ2A 3U60B 4D4JA 2KJQA 3CNLA 2DY1A 3FMPB 2EYUA 5AK0A 2NZ8A 1P6XA 4OI2A 4TL8A 1CJVC 1QVRA 3PXGA 5FTMA 1TAGA 2P0EA 3SBEA 5IK2D 3LDAA 1P2VA 4CEIB 4CYMA 3CX7A 3OEED 3THXB 4DEXA 1OFHA 2Q6TA 1V43A 3DZ8A 1IHUA 4ON9A 1LS6A 1P73A 3B13B 4GOJA 1S4QA 1COWD 4A0HA 2DFKB 5CDFE 4UXIA 2YWEA 4ZKEA 4TT3D 1X8JA 2CCJA 5C2JB 2GCPA 3Q85A 1E1RD 4Q9JA 1XPOA 1XD8A 1E32A 2F1JA 3PENA 4FN5A 4MRRA 2P5TB 4M8NE 5CK4A 1IAQA 3FOZA 3FGNA 1YR7A 4C0JA 3IKJA 1N5JA 4TMZA 1KDPA 4JLVA 5JHHB 2FDCA 1SXJA 1JXMA 5FPYA 2WPDD 4LX0A 2WBLC 2CDNA 2BWJA 3WP0A 1F3OA 1JAIA 1M7HA 4HAZA 3PUXA 2O8CA 2IHYA 3IBYA 3PITA 5EP4A 2RGGA 3CONA 4N3NA 4IXNA 3PIRA 3OAAD 2XAUA 4A6XA 4AKIA 4Q01A 3AF1A 4IJMA 4DB2A 2QROA 2JLRA 4YXWA 1OE0A 2RGXA 3FB4A 2FZ4A 4DUGA 4R98A 2F6RA 1SVMA 1ZUNB 3KJEA 2FZLA 3AVWA 2VP2A 1GKUB 3PEVA 3UKDA 2EQBA 4OK3A 2GETA 2R8RA 3Q5DA 1KK2A 3QQ5A 5DIFA 4C9BA 4RY2A 3SHFA 5LD2B 1W5TA 1QRAA 4OQNA 2QA5A 1DPFA 4GOXA 1ZIPA 5KPJA 1GIAA 1M7GA 3Q9LA 3SE0A 3AVXA 5JMTA 2HYDA 2PH1A 2H8KA 2YZ2A 2R2AA 3BJIC 3DOEA 4B71A 2OAQ1 3QY0A 1W4CA 1XD2A 2A2ZA 5DE3A 3IUYA 2X8AA 1E0JA 4IVQA 3DM5A 5G3ZA 1QBKC 2CHVA 4QC2A 5B2ZA 1X6VA 3QXJA 4DLVA 4TN1A 2PJRA 3B1YA 1CKEA 2CL7X 2IX3A 4ZDJA 5A4JA 5JCZA 1UKZA 5L8VA 2IYUA 2GJ8A 4KU4A 4WW0A 1YJ5A 2JLQA 5BQ5A 1N25A 4LYHA 4DLWA 4OHXA 3X1YA 3ZLJA 1JJVA 2PLRA 2REBA 1XXHB 2IS2A 2X19A 2PZEA 5HE9A 4L8GA 2AWOA 3WBKA 4MDEA 3NIBA 5GJBA 4JLOA 3I62A 4DSTA 2JLUA 2REOA 4S35A 3AV0B 5EZ6B 4FIDA 4PPQA 1FPMA 1M6NA 1VECA 4B3BA 5E3HA 4FD2A 4K46A 1TNDA 1XNJA 1W0KA 3NH9A 4LJ6A 4QGHA 4A2PA 4EFNA 1OB2A 1RC8A 3GQBA 3NVAA 4I1SA 5HCNA 1X3SA 4Z51A 1KJYA 5CYOA 2WMNB 2WV9A 2QP9X 5E7MA 4F4CA 2V9PA 2C9CA 2FPLA 1XZPA 5TVKA 2FF7A 1DS6A 3NC1C 1X8LA 3AVOA 1E2MA 1TQ2A 1ODFA 1N2CE 2J46A 5DHFA 3LLMA 1RW4A 2G0NA 2OCBA 1X1SA 2YC4C 4PPNA 2OCYC 3V00A 4JLJA 4IRUB 3KJHA 3B9QA 4DDWA 1YZUA 1G291 1NMZA 2VTKA 4QBIA 4EFLA 4EKDA 4X8HA 3U44B 3QOFA 2Q3MA 4Q21A 4XTCS 3NHAA 1E2NA 2LWIA 4DCVA 5JECA 1YHNA 4LJ4A 2FV8A 4ZO4A 4I1OA 4NH0A 3OFNA 2W83A 4WZBE 3RANA 1TPZA 1Z6XA 1Z6YA 4HAWA 1M74A 4G1UC 1BYUA 3EPKA 4NYIQ 2OV2A 2ZAMA 4Q9IA 3PUZA 3R9WA 2WWHA 5JS7A 4B48A 3J81k 2IXGA 2J9RA 4BLOA 1HV8A 4OQLA 3WHKA 1Z28A 4JMPA 2RH5A 1W46A 1E2HA 5DISB 3DM9B 1KY2A 4KYIB 4LC1A 4HAYA 2QM8A 3U7EB 3FYHA 4UJ5A 4IKEA 2VP0A 4E07A 3TNFA 2H5EA 3QIAA 2ZE6A 3D7MA 4IVPA 4NPHA 1FL9A 2WJYA 3RYTC 4OK6A 4MKFA 2H16A 5LPNA 3GJ6A 4WIAA 4FCVA 2IC5A 1KI1A 2FSFA 1NVUQ 5GVRA 3ECCA 1NG9A 2G77B 1M7BA 2Z4SA 4EJSB 1GAJA 3UG7A 1DOAA 3CRVA 2BMFA 4JYCA 1GNPA 3LW8A 5A0FA 2F43B 3KXLA 3E2IA 1AQYA 4BE7B 2AD1A 1P9RA 2KBFA 5DGXA 2J7PA 1KDOA 1CIPA 2GWHA 3K0AA 3IDQA 3UPUA 3U3MA 1YR8A 1G64A 2A7QA 3HU3A 4JLPA 2ONJA 2A5DA 4B3GA 5L3QB 1N6HA 2ZJZA 2W6JA 5CLLA 1RYHA 1SVLA 2CVHA 5EP2A 3UWKA 3AGQA 2ZR9A 1R0WA 2RHMA 3FVQA 4PSAA 4CEJB 3VMFA 2PX0A 1EFRA 3BFVA 1NLZA 5UKDA 1GL9B 4A1FA 3F8TA 4TL9A 2JIZD 3NBZC 3H1TA 2REXB 4G5QA 4JLMA 4BGDA 2P6UA 5FH9A 2ODWA 5KO2A 4TQUS 5AR1A 3L2OB 1QHXA 4BWYA 4A8JC 1KK1A 5LB4A 1XEXB 4DXAA 1EX6A 1WQ1R 2BV3A 4ESVA 3A1WA 2F3TA 1VCOA 2HDNB 1CR2A 1NRJB 4XVUA 5BN3A 5TARA 1RPZA 1NBMD 3SFVA 1T0JB 2ERXA 5L3RA 4DHEA 2OBLA 2J7KA 3OIVA 2NO1A 3ND8A 1Z0JA 2I4IA 2QP3A 4MITA 1ZNXA 4DDTA 4GT1A 4L4UA 2XOKD 1GRRA 4F38A 3OIUA 1CP2A 4G5OA 1PZNA 1NLFA 2DFLA 4PHHA 2BMEA 1GTVA 2DPXA 4F4JA 1XPRA 1U8AA 5SZKB 2YWFA 2R6FA 1SHKA 1T8UA 3CF0A 4QM7A 1Z63A 1D8TA 1KO4A 1G3RA 2ZE8A 1E9AA 3CH5A 1R7RA 2A78A 1II8B 3CPJB 1ZNZA 4QGGA 3SJCA 4MUBA 5EUQB 1KK0A 3HPRA 4A2QA 2PMKA 1J70A 1N0WA 2NPIA 2YV5A 1CR0A 4OHYA 4IW3B 2NO7A 3R7WB 2ZRLA 3NEJA 2VSXA 4DJTA 3A6PC 4N0EA 1T8TA 2W0SA 4IOMA 5EXSA 1B0UA 3ZVRA 5FL7D 4ARZA 4N1AA 4MGZR 3KUCA 3K09C 4ZDWA 2IS6A 4Z1MA 1YZNA 4QRHA 4RZXA 2WWWA 4JVLA 5L3SB 4RZ3A 2ZRGA 4URUR 2OHFA 4RD4A 4Q9LA 4P4SA 3U2QA 1Z0KA 2KBEA 3UMRA 3QVVA 2XB2A 2QAGC 3DZDA 1NIPA 4EJSA 1JPJA 2D06A 1QF9A 2E9SA 1XCPA 4H1UA 4BFZA 2HCBA 1BOFA 4FINA 4TMXA 4MRNA 5FBQB 4PO9A 3H2YA 2XB4A 5CIWA 4B47A 2JJ2A 2BBTA 1NKTA 4OKSA 3M4YA 3TW4A 3OEHD 1JR6A 1QHGA 3W6OA 5ELXA 2FEMA 2WM9B 3HYRA 5FOSA 1XWIA 3IO3A 2TMKA 4XD7D 3CW2A 1BO6A 4BECA 3QENA 2EW1A 4DT1B 2VBCA 4GP7A 3RC3A 1E1QD 3DKPA 5FOXA 1CULC 4IDQA 2EFHB 4B2LA 1Q44A 1KO1A 2ZRFA 4W5HA 4ERNA 1ZAKA 1W47A 2ZEJA 4A82A 1UEIA 1KDRA 3ZYCA 1G3IA 1US8A 1XEXA 2QMHA 3LVRE 3IIKA 4A2WA 1FUKA 3T35A 1FUUA 2VP9A 2VRWA 4IDHA 3U4QB 1VYVA 4FMDF 3F3YA 1VCMA 2ANCA 3R20A 3PFIA 1KZGB 3PG5A 4W5JA 2VQSA 5FTLA 1SVSA 1O87A 1S0UA 2GVDC 4YMVA 1JPNA 3CUEF 4NE2A 3CO5A 1NMYA 4DCSA 2WWIA 3TUZC 3T06B 4PQRA 4TMWA 3Q72A 4UXHA 3FKQA 5EP1A 1NP6A 4Q7JB 4QJ4A 3T61A 4CVNA 4B33A 8OHMA 3QKTA 4A36A 3U3KA 2NQ2C 3CB4A 4GBMA 1EK0A 1E2EA 1II8A 1S3SA 1PUIA 5HTKA 3RNLA 4OI1A 2B7BA 4URVR 5D3QA 5FBWB 2WSMA 1P2TA 1GKYA 2QTFA 4F7WA 1KJZA 1XBTA 3R7WA 4M1SA 1UEJA 2AK3A 1NI3A 2OFWA 3RRYA 4U7DA 3RS5A 1A1VA 4ZPXA 3H84A 1JR3E 3K70C 3ZQ6A 4QJ5A 3W9YA 5JHGB 3BFKA 3S1AA 4TMVA 2F55A 2XZLA 3THWB 3ASYA 3X1XA 4R2HA 4QBHA 5CYPA 2ZRIA 2J5XA 1P2UA 2AHOA 4WA7A 3RS2A 3A37A 3MWLA 4YDSA 2XSZA 2BIFA 4Q1CA 3GPLA 1S9HA 5KOYA 1XTQA 2YWHA 5FTKA 1VMAA 4TSFD 1XJ0A 4C7OB 4EPYA 4IDOA 4PSKA 1Z0DA 3BXZA 2C04A 3SQXA 3GEEA 2JDIA 4NU0A 2C9OA 3GFPA 4R9UC 2JA1A 1E9BA 1RJ9A 5GVSA 2IYZA 1TX4B 3U3RA 3VX4A 6Q21A 1GVNB 1G20E 1MKYA 4M53A 4QBFA 3ZS9A 2OBNA 1KO7A 2OEPA 4TZ6A 1E9SA 1D2EA 4U5XA 1XCMA 3BK7A 3KQKA 1N5KA 1DAMA 3SU8A 1Z2AA 4ZV4A 2IXEA 2R6GA 1KO8A 2Q3HA 2OSBA 3HU1A 1AGPA 4RD2A 2YC2C 1ZUIA 1E0SA 1W0JA 3QKSA 4RD6A 4BFYA 3ZH9B 4KFSA 4JKIA 4E03A 3I4LA 5J4VA 3T1TA 2BKEA 5DI3A 4M0LA 3TLXA 4OJQA 4DEYA 1Z0AA 1XZQA 1Z6AA 1VHTA 2VO1A 3T1QA 3OZXA 2NO9A 2ZJAA 3NC0C 1P7CA 1G3QA 1XCGB 3LH5A 3X2SA 1HH4A 2GEDA 3ZZTA 1G8GA 1RZ3A 3EARA 2DYKA 1E9RA 2ZVQX 3AP1A 4RKFA 5FOWA 2CJWB 2R62A 1VPLA 3B60A 3W8NA 1E79D 4DDVA 4POAA 2QBYA 3FMIA 5JRZA 4Q03A 2FPMA 1U2RA 3UWOA 5KTYA 1E3MA 4A0GA 2ZUDA 1W2HA 5IT5A 1FTNA 2CVFA 1VYUA 2O0KA 3K70D 2OLJA 1ZM3A 4BZXA 1XRJA 3G5UA 4E09A 3Q8XB 1E0AA 1G21E 3EG5A 1TUEA 2WMOB 4B73A 1NN5A 3SN6A 1ZVQA 4M1WA 4BFWA 1G3UA 5EXPA 2ZITA 1IY2A 4KV9A 2ZJ8A 2WWGA 3SC3A 1U90A 4A0RA 4OL0A 2ZUBA 2DFTA 1MRSA 1N6KA 3RAPR 1GRNA 1TEVA 2OM2A 5FPKA 2GAAA 3OIYA 4FMDB 2ZYTX 1PLJA 1KKLA 1XB2A 3K8YA 1G5PA 1G7SA 3KQUA 4FWTA 4HI0E 2NPFA 3VHXA 3THWA 5B57C 1W48A 4AKEA 1W36B 3G0HA 5EZ5A 3QJYA 2ZYVX 1E2LA 3E1SA 1NVXQ 1F6BA 5KUTA 5K8UA 2VLIA 2QEQA 4BLRA 1ZD1A 1G9XA 2ERYA 4KBGA 4KI0A 4Q4JB 1F60A 5EE9A 1SVIA 2OXRA 3BORA 2GHIA 2OZEA 4TTPA 4KFUA 3W90A 4P33A 4HLUC 5JWOA 2OILA 4Q19A 1D2NA 4MKHA 2OUKA 4JLKA 1KSGA 621PA 2ZS8A 3QG1A 4HEJA 1X8KA 3P32A 3BBPA 5FPSA 1JQJC 3FHTA 3GJ0A 1KK3A 4QL3A 4GNKA 1SVOA 3VU9A 1G8HA 4JT4A 5FUVA 4TL6A 3B1WA 3P4YA 2YOGA 4L15A 3WXMA 3K0FB 4II7A 1XFAA 3R8FA 1VDZA 3EX7C 4XJXA 5KSPA 1EFTA 4C2TA 2EYQA 2VHJA 5JBQA 1DADA 1OH5A 3SZRA 4C0AC 3FHOA 4TQAA 3KKMA 4B44A 1CJKC 1N3BA 1IXZA 2C9YA 2NO0A 3PUYA 2GXQA 4LPSA 4TLBA 4V03A 1XTRA 3ICQB 1KMHA 1P60A 3MWYW 3B1VA 3DDCA 3GMTA 1FNNA 2NO6A 4TZ0A 1Q1BA 2ZRCA 2P67A 3QF4A 3ZIAA 3U3OA 5FUYA 3DMNA 2GCOA 4TLDA 2XZPA 4MKGA 5EXXA 1IN7A 1DG3A 2MSDB 2OBMA 2W2XA 1NVVQ 3C8UA 3TBKA 4QKQA 4Q9KA 1SZPA 1WRBA 3F0TA 1LF0A 3Q3JB 4LHXA 1XD9A 1SXJB 4GMDA 4C0BA 4EPRA 1UAAA 1Q21A 3EZ7A 3BB1A 3ONWA 2HEIA 3AKEA 2H1LA 4LY6A 1XJCA 3FMOB 2O8CB 2WAYA 1BIFA 4US1R 2QGNA 2C99A 2ZPTX 4JJKA 2P6RA 2A9KA 3AEZA 1XP8A 4PAMA 1W5SA 4UNNA 3EWSA 1F2TA 1UBGA 3PR1A 1DELA 1EFCA 4CT4B 3R9XA 5AUNB 1XTIA 2WTUA 5P21A 4F4IA 1G8YA 1BS1A 2FU5C 5E95A 1WBBA 4QNMA 4BFUA 1ZW6A 5EE3A 2XTMA 2IYXA 5DN6D 2G83A 2D7CA 221PA 5A5GA 3ZVMA 2OO7A 3ZS8A 4OHVA 2G1JA 4M22A 4JYBA 1U0HC 2IHBA 2W6ID 2ZJBA 3CPHA 1XU4A 3MRSA 4LHZA 4NCIA 5FL3A 2IXFA 1S1MA 4PC3A 3CLVA 5K8TA 3X1ZA 3CR7A 2J0QA 1NNEA 1XD2B 4LJ7A 1ZM4A 2ZI6A 4RSGA 1DAEA 4Q47A 2HLDA 2PL3A 3HP1A 4XVRA 4OI0A 1Z29A 3SFZA 3K0CC 5SZHB 1ZM9A 1I4LD 3KFVA 1E99A 4M1YA 1FNMA 4LC0A 4JL6A 4DC9A 3IEUA 2IYRA 2IYQA 3EASA 1SHZA 4PC1A 2ZTSA 3NBXX 1T9HA 4ILEA 3BD9A 2AWNA 1N0UA 3LQRA 4KSCA 3KKPA 3PQCA 1ZJ6A 4LV5B 4QG7A 3ADKA 3DHWC 2W58A 1NBME 4KODA 3EIHA 2IYSA 1LW7A 4HZUA 3V4FA 3VQTA 4PC6A 3OE7D 2YOHA 1W49A 4HZIA 1JR3A 3TMKA 1C1YA 2W0MA 5J40A 3A8TA 2QPTA 4DBLC 1Z07A 1XTJA 1AJEA 3ZQJA 4OHZA 3EAQA 4BQSA 1E2KA 4HB0A 5C46F 4K8OA 1RRGA 2EFGA 3L43A 4HAUA 4GMXA 4Q1EA 4ITRC 1IM2A 2VHCA 4PZYA 4ZIRA 3QI2A 1DAIA 1EGAA 1P5ZB 2FFAA 3EC1A 5CB8A 3U7FB 5EQTA 2ZU6A 4NCHA 5FTJA 5CITA 5JCPA 4LV6A 3TRFA 4XSHA 4OK5A 1T6NA 2YINC 4JSTA 5IK2A 3GLHE 2V1XA 4WZ6A 2WJIA 2BKUA 3OEEA 3ZVLA 5HR5A 1VG0B 4B43A 2ZAOA 1KSHA 4HAXA 5B58C 2A5FA 3EZ9A 3NKVA 4QHYA 1COWA 2RGEA 2IF0A 3THOA 4BLTA 2WICA 2VA8A 2H17A 4P4UA 5BN5A 1GG2A 3K0EA 4LYFA 2NIPA 3AVUA 1LB1B 4TT3A 4DLYA 1E1RA 5LD2C 3M0EA 4QGAA 1TEXA 1HURA 4TQ9A 1KSFX 2FFQA 4XIGS 3WYAA 1MH1A 4XSGA 1U98A 3GFTA 4LYAA 2GBLA 1IXRC 3Q5EA 3TAUA 4NZYA 4X8MA 3X1WA 1N6RA 5IDVA 1S96A 3BB3A 1KI7A 2WPDA 4R71A 1FQJA 1GITA 3RWMB 5J4HA 3V4RA 1Z0FA 5DHAA 1Z47A 1ZNYA 2DBYA 121PA 2BBSA 3LXRA 5F3WB 1RRFA 1E2GA 5KDLA 3OAAA 1AA9A 3A1VA 1YKSA 1KI3A 2ZRJA 3FMFA 5L3VA 2O8BB 4KFTA 4QNRA 4OBEA 3KUDA 3FPAA 4URZR 4EAQA 4JLAA 1RVDA 1AGRA 3GJ4A 5C4MA 5JRJA 5LB2A 1W4RA 3K0AB 3KKNA 4NCNA 4V0NA 1F5NA 3IGFA 3AB3A 2QU8A 1YRAA 2ZI9A 2AKYA 3KKOA 2ZI4A 3AF4A 1KI4A 1A82A 3KKQA 1H8HD 2FSIA 3AVQA 5EJEA 2EFDB 1ZRHA 5SZJA 2XTNA 3EA5A 1XDBA 1N6NA 2X1VA 1Z2CA 5KHOC 2YOFA 1WB9A 4Q1BA 2GJKA 4LPKA 3GLGE 2PEZA 2BCGY 2ZI3A 4YMTA 3PEWA 4IOKA 4EDHA 1ZCBA 2ZETA 2KE5A 1D9ZA 3UIEA 3M1IA 1U99A 2V7QA 2GXAA 1NL3A 4AYTA 5HCIA 2ZM5A 1GNRA 5G41A 3KB1A 5FR2A 3SBDA 3THYB 4DB4A 1JXOA 2WWXA 1T4GA 1E9DA 4JBXA 1CJUC 3ZZ0A 3U7HB 3T34A 5DSZA 1R2QA 3JZAA 1QHHA 3RLFA 2ZRBA 2J0UA 3HJNA 3TGPA 2FSGA 4MGKR 1NN3A 3Q7PA 4TYNA 3MG9A 4NBSA 4BEJA 2NMVA 4M21A 3CZQA 2UVQA 1KY3A 521PA 2BCJQ 3CBQA 1YR9A 2FPKA 3I5XA 1IY0A 1W44A 5FI0B 5AUOB 2HXSA 4XVQA 1N6OA 4KITB 4CRWB 2DB3A 4EPTA 1QHNA 2G0TA 2RGNC 1J99A 2EFCB 1G18A 2RGCA 1KAGA 2PLFA 3TQFA 1JBKA 4C0SA 3QPVA 4ARZB 2ORVA 5LBIA 3GJXC 2CLDX 1GDDA 2FSHA 1SKYB 2NZJA 3PJRA 2XXAB 3RSLA 2FGKA 4P4SB 3B2EA 2W2VA 4Q7LA 2XNDD 4CDGA 1KOFA 4EJSC 2IYYA 2KB0A 3GEHA 3AF3A 5JEDA 4G5RA 3SEAA 3I73A 2RB4A 1J7KA 2O8BA 1EFHA 1N6IA 2D74A 4I1UA 3IHWA 1EFRD 1OHHD 4CT5A 1LTQA 1A7JA 2Q3FA 1G7CA 1G8FA 1P62B 4M9SA 4Y0VA 1E9EA 5FUWA 1TUIA 3A1UA 1P9NA 2XGJA 4FCWA 4D4MA 1MRNA 4YLGA 2B8WA 5DYIA 4D0GA 2B92A 1N6LA 1RKBA 1GRQA 3AKYA 1JNYA 2R44A 3QXXA 2HT6A 2QI9C 4PPFA 1FMJA 1K6MA 4YDHB 4DKXA 3O8RA 5FBLB 4M1KA 1NSTA 1OXUA 1ZM2A 1XF9A 1TF5A 1RFLA 1T5IA 2J45A 4I81A 1US8B 1VHLA 2CCKA 2ZSBA 2H18A 4RCYA 3SYKA 4A4DA 1MT0A 1JEEA 1M34E 2AXNA 3I72A 2BJVA 2VIIA 4D25A 2VHQA 3FFBA 3CX8A 4LCBA 3THYA 1XEFA 4EPXA 4AKHA 2OG2A 3BFXA 3BE4A 3EA0A 3GLFE 2IUSA 1KI2A 4EQ6A 1Z3IX 1J8MF 3QG5A 4Z8YA 2PCJA 1OH6A 2GRJA 2Z6VA 2HJVA 1Q22A 4FMCF 2AR7A 1HTWA 3U6KA 2YVUA 1EG7A 3H4MA 2JIZA 2G9NA 4KCGA 1NVWQ 2QMOA 1CF4A 2ZUCA 4ESHA 4OYHA 1U8ZA 5G3YA 1Q12A 4GZMA 1E2IA 3UXMA 1MO6A 3GP8A 4RD0A 3S1AB 4B34A 5BN4A 2AL7A 4QXAA 4YONB 2XXAA 4JLNA 4Y0AA 4AG5A 5KPDA 1ONBA 4YMUA 4Q4AA 3W3AA 2IF2A 2Y8EA 4JS0A 4XH9B 2D7DA 1ZCAA 1AZSC 1U9IC 1W4AA 1ZIOA 4HLCA 4AURA 4WZAE 2V55B 5CDFA 2XOKA 2PCLA 1WCV1 2A5GA 1E69A 4PPGA 3REGA 1T3HA 3P20A 3KFXA 2BM1A 5KSOA 3RS7A 2IWHA 3NTUA 4Q5IA 2BOVA 1RJ9B 5EUMA 4D82A 1LFDB 2ZS7A 1UBFA 2UZ3A 2X2EA 3RRNA 2QRNA 4BZPA 2CCGA 3K1JA 4UQOA 3U5ZB 1QZXA 2DFNA 2F1IA 2CLSA 5TDHA 1AK2A 2BMJA 4JZKA 1IBRA 3T5GA 2YWGA 1QDEA 3QKSB 1OPXA 4MRPA 3GLHA 4NONA 1EWRA 1GUAA 4NYIR 3EZFA 4XTRA 3FWYA 4TLCA 1IN6A 5DI3B 4AG6A 5AUPB 2Q0HA 4CEHA 5B30A 1N0VC 2ATVA 3LQQA 4WOPA 2VP4A 2G88A 2WJVA 4V0KA 2ZROA 5CM8B 2O0JA 2RGDA 5AJZA 3N5CA 1Z83A 2A30A 1E2FA 3PEUA 4DSOA 1OKKD 3OIWA 3FKSD 5JLJA 5AWFC 1FFHA 1ZBDA 2D62A 2GESA 4PC2A 2JJ1A 3MAAC 4DLSA 3DL0A 3OEHA 2QBYB 1S3GA 4PAQA 4MYUA 5CB6A 1DAHA 1N5LA 4NP6A 2P2LA 5LDDC 2WKQA 1E98A 1YQTA 3BH7A 2YHSA 2CNWD 2AFHE 2ODNA 2WIBA 4JJZA 1IONA 4XD7A 3VHLB 4A8JA 2NG1A 2R6DA 1Z5ZA 4FXPA 2CK3D 2NTYC 1DAGA 4JKYA 1XMIA 1R5BA 3B85A 2KSQA 2XSZD 3LV8A 3RS3A 4F91B 1S1CA 1CTQA 1YZKA 3C14C 3I5YA 1T5LA 1QHSA 1KNQA 2JDID 1X1RA 1PLLA 3CF6R 3L0IB 3TR5A 2EFEB 4QHTA 4W7SA 4B3CA 1EESA 2GNOA 1Z6GA 1Q3HA 3NEYA 3AVVA 3AVTA 1LY1A 1GZSA 2ZSFA 3LD9A 4ACBA 3TUIC 4LHWA 4M2LA 3O8DA 2QAJA 1FMLA 3MWKA 4MQBA 4JBYA 4JT2A 2ZXUA 2HJGA 2ZRPA 1C9KA 4MGYR 2OAP1 1LF5A 4FI3C 1VG8A 1W0JD 2R9VA 1ZD9A 3IILA 3P26A 4ASUD 3K53A 4NDZA 1DEKA 2BVNA 3K09A 3GLGA 3VTKA 3ICEA 3VNUA 5E7JA 2OCAA 3WNBA 2VPPA 5IHPA 3AUYA 4GP6A 3CKLA 1GFIA 2PJZA 5JSZA 2RAPA 3NWJA 1BMFA 4HYYA 4L9SA 5GJVC 4NYMQ 1AS2A 2C2HA 3VU9B 4B74A 4BFVA 4LRWA 4JVNA 4MRVA 1UBEA 1XTKA 1SGWA 2IWRA 2IW3A 4O2LA 3TSZA 3QNUA 1OFTA 4DLUA 4PANA 4B32A 3TSWA 1H8ED 5BYKA 1TU4A 3NBYC 4KHZA 4B6FA 5M04A 1FP7A 3GJ5A 4TSFA 1I4DD 5ANRB 1VG9B 3KQLA 4Z54A 2VHTA 3GLIE 1Z06A 4Q4LA 1AZTA 5KDDA 1FTSA 4H1VA 3PCRB 4P32A 4A9AA 4PX9A 4C2UA 3RRZA 1VTKA 4TTRA 4X8OA 5JJLA 1G4AE 4OHWA 4V0OA 2WSSD 1KYIA 1KMHB 2A5JA 3EW9A 4ZI3A 3L0PA 4DWJA 4HUQA 1LV7A 3QF4B 3NH6A 2CL6X 1KIMA 4P0TA 2V4ZA 1UDXA 3ZVNA 3OESA 2GXUA 3EZ2A 2GCOB 4Q7KA 4G5SA 4PZZA 1OIXA 4DIEA 3ZJYA 1G5TA 3VKHA 5HZHA 3QEOA 1P3JA 4HDOB 4LK2A 3MFYA 5KNBA 1FW6A 2MSCB 5AJXA 3NDBB 1Q1ZA 4NYJQ 3W5IA 1W36C 4G0NA 5FTNA 5KNCA 3K9HA 4IHQA 3Q7QA 421PA 3CR8A 1JB1A 4DSUA 4ZI2A 1HQYE 4PHFA 4UNSA 2WWYA 2ZANA 4YMSA 1F48A 1F2TB 1N6PA 2L0XA 1E79A 1NLYA 1OSNA 4A0FA 2DWOA 3B6EA 2P3SA 3EPLA 4XOIA 2CHQA 3ZZUA 5FBRB 2IT1A 1U0JA 3K9LA 4NHOA 4B76A 4BLSA 5BWMA 2IYLD 2QPOA 3I92A 4LJAA 1NJGA 2V8OA 1ZYUA 3C16C 3SQWA 4NCJA 2IS4A 2GA8A 2MMCA 2GVZC 2IYWA 2P65A 2ORWA 2UKDA 2LKCA 2J59A 3TR0A 4CGZA 4NCKA 1E6CA 3JVUA 4B75A 4TYWA 3WNCA 1L4UA 2C96A 2E87A 4MDFA 2B21A 2ZREA 2MSEB 3LA6A 1D9XA 2FE4A 4JVSB 2QSZA 3D31A 4B2PA 3C7KA 1PUJA 1E4YA 1O3YA 4NTZA 2AFIE 1U94A 3O47A 1XMSA 3QPUA 3ZGXA 3PEYA 2QUZA 2AK2A 3SR0A 2V54A 2DWQA 5GJCA 3W5JA 3WMGA 1OYYA 2P6NA 5E7IA 3QXSA 1UDWA 1ELOA 1D6JA 5TMPA 3R9IA 2AXPA 4M1OA 5JJIA 1R5OA 3EXAA 4G3XA 3TVDA 2OE2A 1CRPA 2GZAA 4WXRA 4JVMA 3ZDQA 1ZUHA 3BH0A 3OF5A 4PC7A 5TXGA 1YU9A 1MV5A 4HZUB 2IK8A 4NKRA 2IBMA 4LHVA 1R8QA 2ZU0C 4A6PA 4TYYA 4BFTA 1NMXA 2VP5A 1DAKA 5K8LA 3IHLA 4Q1AA 2I3BA 3PV0A 5J4KA 2GJAA 5KDOA 3KQNA 1W36D 1UBCA 3U7GA 4AKGA 2UZIR 4EUNA 1OV4A 3BAFA 1P4SA 3UATA 2O52A 2EWWA 2XJ4A 1SXJC 4ZIRB 2C03A 3P4XA 1Q3TA 4IOJA 4FWIB 1XX6A 3D6TB 2IEZA 4IEEA 2WHXA 3RHFA 2ZSEA 3LY5A 3LBNA 1OLOA 5HKKD 2HUPA 1U0LA 1HYQA 1NSFA 3E70C 3EZ6A 3RWOA 3D3QA 4WAUA 4LGMA 3AGPA 4NYMR 3EPJA 1FOEB 4C0HA 1ZNWA 1XXHE 1G1MA 4FCTA 3I32A 3LO5A 2QE7D 3B5JA 3TQCA 1NG1A 2WZQA 4IFEA 2OLKA 3KTAA 4AC9A 3DMDA 4DZZA 4RFSA 5EXTA 5F9HA 2QY9A 2BHRA 3AUXA 1GP2A 2HF8A 3A1SA 5JEEA 2WIAA 5DLQC 3MSXA 4LJYA 5EE5B 5C4GB 4DCTA 2EVWX 3SYNA 3D8BA 4LBYA 4D4KA 5KU1A 2BMDA 2HYIC 1T91A 1CJTC 5EP3A 4B3DA 1UM8A 4U02A 1G6OA 3CZPA 4LHYA 1QG2A 4X8LA 3IO5A 2HXYA 1E4VA 1A2BA 2IA5A 2V6JA 1Z6TA 1TMKA 2CE7A 4MKIA 4C0KA 3QUSA 2JJ8A 4PR0A 1XMVA 1OYWA 1S2MA 2DHRA 3CRQA 2DCUA 1IJEA 4D0NA 1VIAA 2MMGA 4DCUA 4EPWA 3CIOA 5IF9A 5GADl 2IYTA 1ZU5A 4HLUA 4EIWA 4EFMA 1Y63A 4V0ME 4LSGA 4YC7A 1F2UB 3AP3A 3FE2A 3LW7A 4LDJA 3SS8A 2QORA 2NGRA 2F9MA 4NYJR 4C30A 1NY5A 1KJWA 3B82A 3I8SA 1UFQA 3ZD7A 1XTSA 4I1VA 2BBWA 2K5UA 1SXJD 3MJHA 1WBDA 3T5DA 1KDTA 2WOOA 1WXQA 3B7GA 2ATXA 2W6IA 1JQLB 1R0ZA 1KI6A 3TUJC 3FTQA 2QN6A 4IXMA 4TMKA 1SKYE 1ZD8A 3H0KA 4GPTA 5BW8A 4IOLA 2ZSDA 5TY0A 2HCJB 3L0OA 1DAFA 2GEVA 5CIQA 4ACAA 3B1XA 5H70A 4YXWD 2RMKA 1KNXA 1YRBA 4DUGD 1TU3A 3WYGA 4QFMA 4BPBA 2VP6A 2O8EA 1NJFA 4HATA 3W6NA 2GKSA 1WDTA 2ECKA 5IRCD 2D3WA 4L5BA 3B1ZA 4Q48A 2GZHA 1W4BA 5EE0A 1QHHB 3DOFA 1JECA 4URYR 3QVUA 4TWZA 3CNOA 2J0UB 1CXZA 1U8YA 2CE2X 4AYWA 1PV4A 4BFSA 3IBGA 4TTQA 1R0YA 4CW7A 3WMEA 2YNMA 1VG1A 3OE7A 4UNPA 2QGZA 4JLBA 1IXSB 1DG1G 4EPVA 4IEIA 3U6BA 2O8DA 1OXSC 4H9GA 4KVAA 1OXXK 3L8YA 5FI1B 2ZE7A 3KL4A 1CR4A 2DWPA 2XX3A 1AM4D 3QBTA 4W9MC 1DARA 1P72A 4BRUA 3CM0A 5KSYA 5D3MB 1G16A 2ODEA 2OT3B 4KYUA 3K9GA 1ZINA 4FW9A 3RS4A 3VR5A 1UKEA 4US0R 3GLIA 4KXFB 1RRPA 1Q1QA 4AI6A 2PBRA 1E9FA 3PUWA 5DO9A 3EWAA 1Q0UA 5FPTA 1CJMA 1E9CA 2LKDA 2WAXA 3KDSE 2ZJOA 2PMDA 2H7VA 1BH2A 1FX0A 1T3SA 3UMFA 3W8RA 4DCNA 4F93B 1NVVR 2XZOA 5F9FA 1J2JA 1W0KD 2GAOA 2ZRHA 1F2UA 4CZ2A 1L2TA 3U61B 2GK6A 2J0SA 1UADA 2V6IA 3M6AA 3A4LA 4D4LA 2ZI7A 3RABA 5J5CA 1II0A 1ZC3A 1SVKA 4P3YA 5FPHA 2RGBA 1KKMA 5F2EA 1WA5A 4R7ZA 3RS0A 2V3CC 2GTPA 4M1TA 3C5HA 2WJGA 2QT1A 1TF2A 3GJ3A 4PHTA 1R5NA 3K0CA 2V7QD 4Q1DA 1MOZA 1CU1A 1P2SA 2J87A 2RCNA 2BDTA 4UKDA 4B2IA 5H68A 1RYFA 1AS0A 1Z0IA 4CEIA 3IQWA 3HYTA 5FFMA 2C78A 2YJTD 1H65A 3UK6A 5C1BA 3THXA 3BIFA 3LWNA 1OFUX 4D80A 1HY3A 2OFOA 2BEJA 4KBFA 3OFND 5G40A 4Q02A 3I1FA 3T1OA 4TLEA 3AVPA 2A5YB 1MO5A 2ZSAA 1G6HA 3DVLA 3TJZA 1CR1A 2H92A 2G6BA 4UXJA 3LVQE 1HUQA 4BRWA 3WY9A 2FN4A 4O0MA 1AKEA 2ZS9A 3QSYA 3O8BA 4EQ6B 4GZLA 1SULA 5AJWA 4N0DA 5G53C 1AN0A 5H8WA 3N70A 3VNVA 2IL1A 3C5CA 1E0KA 1AQUA 5FUXA 3KQHA 1YE8A 1H8HA 2V1UA 3LAWA 4GI7A 3WMFA 2IS1A 1HE1C 3LFUA 1QHYA 1T0HB 4KFRA 4KSBA 4O2RA 1P61B 5CJPA 3IEVA 3C4JA 1EWQA 1E96A 3RRMA 3MLEA 4HDCA 3REFA 4DLZA 1II9A 1C4OA 5D3MA 4Q4HB 5AJVB 2Q9BA 3IQXA 1UJ2A 3CH4B 3B78A 1VCNA 821PA 2CL0X 2J7PD 1FQKA 4Q66C 3BH6A 4DLRA 3OHMA 4LBVA 4Q4AB 4RKEA 4UNRA 2JATA 4GDFA 2FFBA 3N2IA 2I1QA 2W6JD 3NHBA 2VSOA 3P1JA 4JL8A 4QHSA 1J8YF 4AY2A 3AQ4A 3KB2A 1NKSA 3QXCA 3KXKA 1QG4A 2QTVB 3ASZA 4IDPA 2QG6A 1WP9A 2F9LA 2ZIAA 1OJLA 3RDPA 1TQ6A 2FEOA 1G7RA 3LX5A 4MRSA 4Q00A 5DI9A 1AS3A 1JJ7A 1IN5A 4YQFA 2QMEA 4OQMA 4D6PA 4V02A 4WVFA 1IY1A 2VYFA 2AN9A 1Y3AA 1QHIA 2WKPA 1R4AA 3DEFA 4QOSA 3KX2A 4QGFA 1TL7C 2IUTA 3VX3A 2FMXA 4HLDA 2QL6A 3GLHB 2D2EA 1EXMA 3A4NA 2JLWA 1YZGA 4GFDA 3TIFA 4R2IA 2JLZA 2ZJ5A 5CM9C 2ZRKA 1XXHA 3A36A 1WMSA 2C8VA 4G5GA 4CIDA 2R6CA 2XNDA 4CEHB 2C5LA 5B64A 1K5GA 2J1LA 4IFBA 4J0QA 4PO1A 3SJZA 3SOPA 3QF7A 3BERA 1CEEA 1XPUA 1GNQA 2GJSA 1DBSA 2QM7A 3IPYA 4AWXA 4I4LA 3AF2A 1E2DA 3BB4A 1OHHA 3LLUA 5AJYA 3AP2A 3BGWA 3GEIA 2CHGA 4GOKA 2B6HA 4B35A 1BYIA 4ZCMA 2FWRA 3TH5A 5JI2E 4BFXA 3ADBA 2CEAA 4ABYA 4A92A 4A8JB 1DTSA 2FJUA 4Z1MD 4DVGA 5FOTA 1GOTA 2JLVA 3HPQA 2VL7A 2ZR0A 2YKGA 1ESMA 1JAHA 1L4YA 2VF7A 2C77A 2GK7A 2G1KA 5KYKA 2FGJA 1R10A 2QRZA 1EFUA 4BASA 1M2OB 3IIJA 3TK1A 1K8RA 3U44A 1OH8A 1Q20A 4DSNA 3K0SA 2FX3A 2JAQA 4KO8A 1DO0A 1G5RA 4HAVA 4Q4HA 4V0MA 3TAHA 3VFDA 1JI0A 2JJ2D 1OXVA 2JGNA 4XWOA 4RVCA 1NBMA 4PO8A 2XITA 1RE0A 3EPHA 2ODBA 4DIDA 3GD7A 1R8SA 2B8TA 3NBFA 3FFAA 1OFIA 1FZQA 2GJ9A 4KJZA 1IOZA 1I2MA 2RGNA 1QVAA 5K8IA 4CF7A 2AKAB
chains in the Genus database with same CATH superfamily
4WXMA 1BX3A 3RC8A 2LNDA 2AW5A 4EOGA 2FPWA 2R84A 3LBIA 1YGPA 3E0QA 3I8XA 3C2QA 1B3RA 3JD4A 4DMKA 4A23A 1KQFA 2Z2IA 3LL7A 1IPHA 1CRQA 1E94E 2H3EA 2CJPA 1JLLA 3BSSA 3R4VA 3LP8A 2EKDA 3RD5A 4C0QC 2RHTA 2ZYWX 3PL5A 1MABB 1HXHA 4DWOA 1FYDA 2FMUA 4PLPA 1PFYA 2C5AA 1NN1A 4MUAA 5CX1B 3TNLA 4EF4A 1S2OA 4WFIA 1E8NA 1TUBA 4YLEA 1GG5A 2CDAA 4N8DA 4MI1A 2G9RA 1YBMA 3PIIA 2R4TA 1HEIA 1B74A 1NX9A 1TF7A 2Q3LA 2QXUA 1L5RA 1UWVA 3M6WA 5FNZA 4MH0R 721PA 1J09A 1NW8A 2JJ1D 3DHYA 3DT8A 2YN4A 2C4VA 3CWQA 3T54A 3HACA 4GPBA 2AZDA 4HWOA 2H57A 2B5WA 3JVVA 3NOVA 1ZC4A 1L4EA 1BW9A 4BO4A 3VR4H 4HDQB 5EJGA 3T0GA 4LI3X 1IFXA 1Q7GA 2CMKA 3REQA 4DF3A 3SDBA 3BXGA 1Q0ZA 2DR3A 2OFXA 3GL9A 4D81A 4ZQEA 1R8YA 2QRLA 3EC2A 4HL6A 2ZT6A 1F17A 1JHXA 1Z8FA 2CUTA 2J5KA 1OU0A 2A3RA 2PFKA 2XNSA 2XTZA 3FF4A 3WGMA 5EMKA 4BP3A 4EG1A 1QQAA 3O82A 3H2IA 1X74A 3RVBA 4D56A 2H06A 5LA6A 2VK8A 5HXAA 5IFLA 3T3NA 1QO7A 3DHEA 3OZEA 2AN4A 3OUTA 4P2GA 3O1IC 1KGDA 4HMOA 1I4EB 1NZJA 2AMVA 3E5HA 4OQYA 5GV8A 1YBHA 4D9KA 2WHPA 2VZEA 2L17A 5IEJA 2HF7A 4BV2A 3IS3A 3U3JA 5CCBA 2FMIA 2RKOA 1IEVA 3VSCA 5I8PA 1QE5A 5AUQA 1UOQA 4I1YA 1EFPA 3BKWA 4QEZA 4Z7QB 3RRBA 3L4SO 1VPEA 4DJFC 5KIAA 1E1QA 3TE6A 3ZWDA 2IH4A 2H1VA 2CKDA 3FNRA 3G0DA 1U2ZA 1OTYA 3OZFA 4KR9A 2PLAA 1X86B 1MNQA 3O4VA 4JX8A 1VBMA 1Q83A 2NACA 4QQKA 2ZQ5A 3EFEA 3MGBA 3MGGA 4AJJA 1VJRA 2ZYDA 1ZGBA 4HUTA 4G0WA 4CFYA 2BYTA 1GCIA 2XB6A 3GOQA 2PT5A 1VKJA 1G6Q1 2J4FA 2PZBA 4L7QA 3M9WA 2EG9A 2C4KA 1RMQA 2P90A 3R77A 4N54A 1P5JA 4OQXA 1GM5A 1N3YA 2ONZA 3UANA 2HGZA 2QLLA 2QMQA 1AKTA 1TRKA 3DNPA 4MVJH 3OOWA 4JOSA 3JARB 3I0ZA 3HWRA 3OI7A 2Y0CA 4AJ2A 3G1TA 3BAZA 2WWFA 1JQEA 1WXHA 2X8JA 1NPYA 2B78A 2CL5A 3EIEA 3OD5A 5FBKA 1RXYA 1ONNA 2B4RO 4GGMX 2Q07A 3CPEA 3LUCA 2YWDA 2O05A 2P7HA 3LVBA 4FMCB 4JU9A 4U2DA 4C78A 4MUMA 3OOJA 2BDUA 4IX1A 4GMKA 4NS1A 3MS4A 5AIAA 2XCUA 3AF0A 4AS1A 2QRGA 3PGJA 1P91A 1G63A 1Q91A 3BN3A 4UC0A 3ZXIA 4JI0B 1U8XX 3QMPA 4XB2A 2P2ZA 2CK3A 3T9AA 3ZWVA 4OXKA 2PRZA 3A1NA 3IUBA 4ICIA 4OHKA 4RZUA 3WLRA 4IHJF 3NHLA 5AVUA 1GILA 1WE2A 1CD5A 3HR8A 5DHTA 4PXAA 1M34B 2QAGA 1KRXA 3FSGA 2O57A 4RX1A 1SXJE 1U9IA 1S9DA 4WZZA 3RSOA 1DCTA 1WZ2A 4R4JA 2D8AA 2F17A 3IALA 4M9QA 3W7BA 4BE9A 1MOPA 1Y4ZA 1P0QA 1I2CA 1M10A 1RM0A 2WYOA 2NVUB 1R0XA 4I8XA 4B84A 2IDZA 4EUSA 1BG6A 1JN0A 4JCCA 4ZVSA 3GLFB 1LCIA 5KHLB 1VP3A 1CPYA 2QZ4A 2QZZA 5AW1A 4S3MA 1BWPA 3NYWA 4MLDA 4J0CA 4ZEMA 3HBLA 4AP9A 1OGJA 5CDHA 1J1UA 4NV3A 5DNYB 1UK9A 4RQAA 3L4JA 1W1WA 3TR6A 1T8PA 2VAPA 1N9KA 1WMBA 1TQDA 1K66A 4L4RA 4B80A 2VHUA 1JLSA 1OZAA 2EFJA 3A9VA 4UTOA 5E1DA 2QSYA 1SOAA 3GCGA 3E61A 1RJFA 4HLQB 1AF4A 1LNZA 2IEYA 2JCSA 1PQYA 3N8IA 1K8ZB 4KK4A 5G2OA 3A2KA 4ZOLB 5KNDA 3LPLA 1L5VA 1CC1S 5EJ8A 3CF2A 3OIFA 5KNBD 1FZTA 3NXSA 1ESDA 3N53A 4UNQA 1C1DB 3QKRB 3MQFA 5HGXA 3HJBA 4JITA 16PKA 1O6BA 4OGWA 4KXMA 5C5IA 1ZQ9A 2AR9A 2PX8A 2RC6A 3W0LB 2J6CA 9LDTA 3FX2A 3HCRA 4I4NA 1EM8A 3ZE9A 1A5BB 2J9GA 1QGED 4GL2A 1AHHA 1I3MA 1UF9A 4QUBA 4FXOA 3HVKA 4JB8A 3CRW1 3ND7A 1NYTA 3R23A 3V9PA 1OWNA 5AK4A 2Y1LA 4RESA 5LLDA 3PT9A 1Q15A 3VYTB 2JLXA 4YMWA 4KJXA 5CDSA 1VPTA 2CMDA 3G5LA 4JLDA 3FDFA 1XZFA 3RC1A 3S2IA 2VWPA 2GF9A 2ZVPX 1KDZA 4N0MA 4X65B 1MOSA 4XX1A 1FBNA 4PQFA 1WHSA 4HR7A 4CM8B 3A6FA 4AZ0A 2EU8A 3AY7A 2AJDA 2O3QA 4DR3B 1PLKA 3PHLA 3CX6A 5IMSA 3BIOA 1IXYA 2ZYAA 1KY4A 1YQWA 1PAUA 3EFOA 1D1SA 2PGXA 1V1MA 3L7DA 1ZL0A 3WICA 5I9NA 1U0RA 1G8MA 3IHKA 2WSSA 3KTAB 5EPUA 2ONKA 3IUNA 4YWHA 2X77A 4E7PA 4O25A 4FDAA 4PQYA 2O3TA 2O0HA 5DT9A 1ESNA 5FYDA 1T36A 1N36B 3KTOA 1HDGO 1C9DB 1G7TA 1UPAA 5HJEA 3A1TA 3WV4A 1C1HA 1I5RA 1CNFA 2IV7A 4TV9F 3T5AA 1DINA 1XJQA 3NHMA 4HSEA 2XEDA 4QPCA 5EWMB 3UFXA 3D8NA 4KYVA 1L7VC 1LVUA 1D2GA 1G3MA 1U81A 1NONA 2VK4A 1P5HA 2WF5A 5A9TA 1EE1A 2HIAA 1S6YA 2QENA 3A4MA 3NHYA 4B0PA 2CNDA 3TLMA 3W6PA 4UNIA 2EEPA 1K7CA 3T41A 1SKMA 5EHQA 3PVSA 4EZBA 3OQ1A 4MPRA 4HG2A 1C7QA 1WUYA 2GEUA 2WG2A 1Q2UA 4RPIA 3V1NA 1QIEA 1SAYA 3P0IA 4FTWA 3ZK8A 4KR2A 3PC8C 1EG2A 3C6QA 1HWYA 2MR5A 1GQRA 4V1CI 5E2AA 2G7MC 3R0ZA 1VIYA 1MXFA 2BZSA 2LW7A 2O7SA 3DO5A 4IMPA 1DRWA 3A6HA 5EE1A 1JYFA 1QIJA 3HVUA 5J2UB 3BMXA 1OWLA 3ZE2B 3BFPA 2AJ8A 2L19A 1GJRA 2E4ZA 1IG3A 3C45A 2HZBA 4RFVA 5JFGA 1FRQA 2QTRA 2EJCA 3ETLA 3MMPA 4JXXA 4ZTZB 1E3QA 4MQMA 1CLUA 5JWRA 2Z5GA 4HEQA 3RVJA 1A8SA 4KMRA 2JGDB 1LPMA 3FF1A 3UBMA 1YZQA 2GD6A 3E3LA 2NP7A 5ES3A 1PYDA 3M2PA 4D26A 1LBIA 5HCUA 4UJ3A 3UHAA 1DVRA 2BJWA 4HRVA 1QIMA 1BHSA 3PKZA 1N5IA 2RGYA 3CEMA 4GKAA 4I8DA 5C34B 3NNSA 5ESWA 1HA3A 3L6BA 2R6AA 4K9NA 1VLLA 3FPKA 3AVYA 5MN4A 3D7SA 1YBFA 4RD1A 2CLHB 1JR2A 3RC7A 3UOGA 1X13A 3TTVA 5DW3A 3FCCA 4UBNA 3L05A 1P33A 5IYZF 5JAOA 1XMPA 3X1MA 3M5WA 3RUIA 2VJMA 2LXNA 1CS0A 1Z22A 4LGVA 2PZFA 5ESXA 4U7PB 4WINA 4Y6PA 1Z5PA 3HV2A 5THXA 1L4MA 1M5TA 1GSHA 1Y4UA 5JC1A 3CNNA 2CXXA 5JNLA 5K0CA 2O8EB 4U2KA 2BH2A 1DHTA 4QLAA 2XGSA 1Q1EA 1CIJA 3NR2A 2ZRAA 1AVTA 2P8JA 3LX8A 3P9NA 4LX8A 5T8KC 2O7NA 3U39A 5J4LA 1U9ZA 2OZLB 5BRAA 2NU9A 2W2OA 2I67A 2JLBA 3GPDG 1SKAA 4CCYB 4Z2AA 2IYVA 3MTJA 4FIZA 3QEJA 2QR2A 4GX1A 4MWSA 5IFKA 4DLTA 5ILOA 2HQBA 5KYYB 3I9KA 4NVRA 1VCIA 1LPOA 2XT6A 3F5DA 1E5QA 1DIGA 5CNKA 4PN7A 3QWAA 4GXRA 2PZ8A 4GPEA 3IAUA 4PICA 2JH9A 4LBZA 5E6RA 2M6KA 3DO8A 4G0QA 5D5QA 4LI0A 2LCFA 4M4SA 4GP9A 4O3MA 3PYMA 1XLWA 4IXWA 1PJ2A 3CRMA 4S1WA 1GPLA 4FFBA 4AKTA 5ALNA 2QMZA 3R7NA 1YR1A 3IDAA 3AERA 2R00C 2H3HA 1BE8A 1A8UA 1PQPA 2OQIA 3I2HA 4XJTA 3TB6A 3X1JA 2H5IA 3KB6A 3EVNA 3RAGA 4IVRA 5U4XA 2V7TA 4OQFA 5FOVA 6NULA 4KW7A 4MYCA 2WM3A 4R6WA 3ZI7A 5HKKA 5G0WA 2X3FA 3L0SA 5CBPB 2AI1A 4G0XA 3B70A 3B7WA 3UMSA 3CBGA 4YR9A 2JGKA 4BLQA 4PQEA 3RADC 2HIGA 4P3OA 3K2IA 4TXMA 3DDZX 5F76A 4K9KA 2IUUA 1Q7EA 3VR1A 5I7RA 2Q21A 1D4FA 2BM0A 5JWHA 3C6YA 2AB0A 1RCUA 2X9NA 1QC5B 3M6FA 3EEFA 3KVRA 3EDYA 4KXVA 3PNQA 1MB9A 4ZDIA 3DPSA 3E84A 1X70A 2JHCA 3MWFA 4MPJA 5LZ7A 4AUKA 5DN6A 4ZI7F 1OC4A 5K0SA 1LLFA 2D8MA 2Q1YA 1XCLA 4IHJA 2WF6A 1ZI8A 4NZPA 4BQNA 3K0FA 5CJ2A 2WU3A 4YJ2F 3CIFA 1RWWA 4KP7A 3GP3A 4MQLA 2RI1A 4D4JA 3CNLA 2CXQA 2CBGA 3FMPB 2EYUA 2QVXX 4ENSA 5AK0A 3NM5A 3DLPX 1QVRA 2WKWA 3G8CA 3PXGA 4HQNA 4H7PA 3B36A 4Q34A 5CX4A 4G26A 3G5TA 1P2VA 1MN6A 5HILA 2GTIA 1OFGA 3IURA 2KM1A 2L69A 1QQ6A 1YI8A 4DEXA 1OFHA 1SHUX 2H00A 1IVSA 2DPMA 4EARA 2JFHA 3JQBA 3N7TA 4ON9A 4ER5A 3PPXA 1G5QA 2Z2JA 1WMAA 3HBAA 4B7AA 5JIBA 2DFKB 1P2FA 2DUJA 1LBSA 4UXIA 2WUWE 2RHBA 4TVBA 1KMNA 1CVRA 1E7SA 1X8JA 2CCJA 3HGQA 2LBPA 4C03A 2FETA 4Q9JA 4IZHA 1K6XA 3QLVA 3KYCB 5FO1A 5BV0A 1E32A 3PENA 4MRRA 2E1PA 1VB3A 4JP8A 4NC9A 2BZ0A 2NVBA 5AKGA 2J4CA 2FQWA 4MQFA 3FGNA 2FOXA 1V37A 1C0LA 4C0JA 4EA6A 3ZD9A 5LSAA 1YHYA 1K2VN 3K7EA 4R69A 1SXJA 1W52X 1KDVA 3GEBA 4PLFA 3B9RA 3FUCA 5BP7A 2W11A 4EB6B 1YDMA 3QBDA 5KMGB 3JSXA 5AHRA 1P7WA 4ZV7A 2WC1A 2XRFA 1K89A 1M7HA 2P62A 3TPCA 2O8CA 2QN9A 1Q1NA 5K8CA 3ZCQA 4DV4B 1FSZA 2R751 3PIRA 2G28A 3BREA 3F3SA 3NBMA 5IC4A 5K0BA 5AW2A 1BTOA 1BEUB 3EFHA 5K0FA 1QLWA 3LU1A 4D99A 4I9FA 2O54A 5BR8B 1YNOA 3JWJA 2VWHA 3K6SB 4YXWA 1Z2PX 4CNBA 4Z4IA 2O07A 1W88A 3BXOA 1T8YA 4IIUA 4KQKA 5CGQB 1ZUNB 5ILQA 3AVWA 1GKUB 3N39C 1QMPA 3HY3A 2GAIA 3HBJA 2WF9A 5ELMA 2WU4A 3V1UA 2R8RA 3Q5DA 4C9BA 3GEMA 4RY2A 3F3MA 3SHFA 1W5TA 2FN8A 3H8JA 4P81A 4TVOA 1QAQA 4OQNA 4CMAA 3LOQA 1E2UA 3AYZB 3FYCA 1NP7A 5TEVA 1GIAA 4F9EA 1BOOA 3SE0A 2HDWA 1L5LA 4MW4A 2YZ2A 3F71A 2RHCA 2XUOA 5SV2A 1Q74A 1T29A 2VYQA 3CQ9A 3OQIB 2II6A 4NICA 2AS0A 4P86A 3V46A 3FPHA 5DE3A 4TV9A 3M3PA 2UUOA 2FRVA 2WQZA 4O4LF 2Z1MA 3KHKA 3LMKA 1ZH2A 1CUSA 1E0JA 1AHPA 1QBKC 1F0YA 4KIJA 1E5TA 4QC2A 3QXJA 4DLVA 4KQFA 3HM9A 3H13A 2JARA 1EGMB 2CL7X 2IX3A 5LQAA 2JCGA 3O8QB 5A4JA 3BQMB 3A3YA 1KVQA 2VAMA 4NBLA 4B6PA 1UKZA 2VDOB 1B8OA 2IYUA 2GJ8A 4KU4A 3AEQB 2ZBGA 3GGJA 9ABPA 1EIWA 4EG3A 1OU4A 2PRJA 3PNKA 5DM60 1ZIDA 4CNQA 1YJ5A 2D1QA 3JV7A 1T6XA 1QPZA 4OHXA 3NJRA 1JJVA 2LUOA 2PLRA 2REBA 1XXHB 5TVGA 4D6YA 4N5NA 2CYCA 3CINA 4L8GA 5IKEA 2IS2A 4UW9A 1J8DA 3NIBA 3HR4A 3FTPA 2IUFA 1GA4A 3AESB 3TZCA 4S35A 2I3AA 5EZ6B 3C5VA 4ABTA 3IAXA 4NI5A 4OLFA 1D1TA 4CKCB 3GJSA 1FXUA 3O95A 4I5IA 3UJ9A 5KZMB 3T8YA 1TNDA 1WR8A 1N9GB 4LJ6A 4EFNA 5IN4A 4A2PA 3LWBA 5B7QA 3KLMX 5CYOA 3C3PA 4NNJA 4M37A 5PNTA 3UJ3X 2V9PA 2KMLA 4EBFA 2EL9A 3TMAA 4WK2B 5I01A 5JAUA 1JFLA 3H6GA 5TPZD 4RJTA 2QW0X 3KYIB 3NC1C 4KIGA 4WY8A 2IY7A 4D9GA 1ODFA 1M2JA 3LP6A 5DHFA 2PWYA 3AIKA 4RTLA 2G0NA 1H0HA 3W9UA 4CKWB 1Z4OA 4LJRA 2JFGA 2O5CA 4QYMA 1ODSA 3OP1A 1M8KA 1GQFA 3CU5A 4O0LA 5A3JA 1NTOA 2C2OA 2V74B 3M6MD 4MP6A 3WGJA 4W5QA 1DC6A 2ODAA 1NMZA 2VTKA 4PGFA 4QBIA 3RPEA 4EFLA 4EKDA 4A16A 2C3OA 3ELBA 4EH1A 3U44B 4YV2A 4ND8B 1W581 2VQEB 2LWIA 4EO9A 1A9OA 1YHNA 2ACKA 4LJ4A 3QX9A 4WA8A 4ZO4A 5ADWA 3D54D 3OFNA 3TN7A 1WB6A 3VH4A 5HKBA 1LGYA 3K5WA 4X1KA 3PWKA 2FCRA 4J7UA 5GGXA 3OSZA 5JNVA 1CT9A 4BO0A 1E1CA 4EYEA 3EWNA 5TIIA 5JS7A 2V7GA 3J81k 4K9OA 2IXGA 1QIGA 4EHFA 3VDNB 1U1GA 1NQXA 3KEOA 3FETA 4BJ3A 4GOOD 3UFBA 3RAEC 1E2HA 1S8OA 4G8JA 4MR9B 3FNHA 3CLSC 3EY9A 3S44A 3R5KA 3GDGA 3BL8A 5FWXB 2I3GA 1GARA 2CLLB 3D0QA 4PCLA 2BHSA 4M88A 4HVLA 5EHZA 4FT4A 1BMTA 3TGLA 1MB0A 1WXGA 2PA3A 3DUFA 1NXPA 3AHIA 3LECA 2ZE6A 1LQUA 5AESA 3T7EA 2RAFA 4UD2A 3C4VA 4TS9A 4MKFA 3PDUA 4AMBA 5LPNA 1JLLB 4IMRA 3H3JA 3AUAA 3H18A 3AINA 1XO1A 2ZYSA 1RWNA 3DZCA 3ECCA 1FFWA 3N8GA 1U7HA 1XRQA 1M7BA 2FR0A 3G9UA 1FYXA 5KNDH 1TUBB 3GZTB 3WB0A 5HK9A 2W8ZA 3C4QA 1YK1A 3KXLA 4X93A 3PNLA 2RD2A 5JJCA 1SPXA 2I2WA 2W6ZA 4Y3UA 2J7PA 1KDOA 2GRAA 1RC0A 3K0AA 4XYBA 1DKPA 1QGYA 1BW9B 1SQ0A 1TIBA 2HQOA 2A7QA 1KIAA 4LQCA 2G04A 4UPDA 4UDXX 1O0SA 1N6HA 1ST2A 1WXDA 2GYUA 1RYHA 1SVLA 3JYPA 2IY9A 3REQB 3AGQA 4PE5B 3IXMA 1V2GA 2P5YA 5B6IA 4NOMA 3NWBA 1DKRA 2IOQA 2PX0A 3EVGA 3AXTA 1L7MA 3WX0A 1EFRA 3BFVA 2ECFA 4H4EA 1GL9B 3QTLA 2IP4A 4RTPA 1BWRA 3R5SA 4JKOA 3BCRA 3OC6A 4JLMA 5FI3A 5LA6B 4ZI7A 4BGDA 4LEIA 1FDUA 2ABWA 1E6KA 3A27A 3KCNA 3GYGA 3L2OB 4GVXA 4PVCA 4K2HA 2WHPB 1KJQA 2HMYB 2PL5A 2Q2NA 4DXAA 3JQAA 5BSHA 2VNIA 4NMWA 3EF1A 2F3TA 1VCOA 2HDNB 1FLVA 1CR2A 2YWCA 3MN1A 3DFFA 1EFPB 3LPCA 3UHFA 2PX4A 3MLAA 3UAYA 1T0JB 2P9GA 1BX1A 2IYNA 4DHEA 4C5AA 2OBLA 3M2TA 3MJCA 1ML3A 2NO1A 2QNIA 3QWFA 1NQTA 2NYAA 2QP3A 4G67A 3OQMA 2V0NA 1EX9A 4F38A 1B0ZA 3OPQA 1PZNA 3GDHA 4PHHA 3F96A 1ADBA 2GBIA 3N0TA 4H1HA 4F4JA 3COZA 4MICA 1RWOA 1W9HA 3K6KA 2R6FA 5F9MA 2NADA 4F3KA 1ZJ5A 3AM3A 2GZ1A 1G3RA 1E9AA 3MYYA 2W9XA 2WWRA 3L9XA 5KINB 4MUBA 2F62A 3WWOA 3HPRA 2PMKA 2NNWB 3FZGA 2ROQA 4RBNA 2ZRLA 3R7WB 2X8JB 1CQIA 1WDWB 2QKYA 2H2AA 2HFKA 2VSXA 4M0DA 3EXG1 2Z2ZA 4M1ZA 4MV9A 4DRXA 4N0EA 2W0SA 3R1IA 4N1AA 4DW8A 2FSSA 3TM5A 3OCWA 3OPXA 4ZDWA 2UUAB 1YZNA 1N2XA 1IMJA 1CRZA 1QYWA 3AETA 3JPYA 4RZXA 4A10A 5HFJA 4QO7A 2I91A 3HCCA 4URUR 2WFZA 4Q9LA 4DR4B 5LJIA 1IK6A 5SY4A 3PYLA 2GCIA 4GYYA 4RORA 3UMRA 5I9LA 3TDKA 2XB2A 2PMFA 3DZDA 4AY4A 1KEPA 4EJSA 2D06A 2E9SA 1PZFA 3TD2A 3WZ2A 1WTCA 2H2FA 3H1AA 2XDAA 1BVYF 5JXJA 3KPJA 3GZNA 3JQCA 3OF2A 4B47A 2HRRA 3ER9A 4OBWA 2JJ2A 2ACEA 3SZGA 5I47A 5ARCA 3NM6B 4MW6A 1NKTA 1KVUA 2ONYA 4G1BA 4UTRA 2FQQA 3STWA 2BP7B 3ZDEA 1JR6A 5ELXA 1KDYA 3DTVA 4RLFA 5F7OA 1N2HA 3RYCA 5FOSA 1PWZA 1XWIA 3T7RA 4QGSA 3PFFA 1SB8A 2TMKA 1EWTA 3QEKA 4MMXB 5CMLA 4H7KA 4KVZA 4FC7A 4RDIA 4AMGA 2CUKA 1SUBA 3W2TA 1VPWA 4Y6LA 3CW2A 4ESEA 1MC8A 3QENA 2QDXA 3PQ8A 3DDOA 5BYAA 1S5PA 1BE6A 5LQJA 5FFNA 2HK9A 3OZIA 4C6HA 4O4LA 1N77A 2I55A 3GDFA 1J5XA 1L4GA 4TXHA 4N5LA 2ZEJA 3OOHA 2PGIA 4YO8A 2I0FA 1LWNA 1MGPA 1G3IA 1ZWLA 3TVYA 4X5OA 3FOCA 3H4TA 1PNTA 3QEMA 3PC4A 3EHDA 4BC0A 4GZ5A 4BGUA 4RAQA 3UHOA 2VRWA 4PU0A 2K7ZA 1ID8A 3SWWA 1BU5A 3CTMA 2X0KA 4K9RA 5AM0A 4FMDF 1EM8B 4B7XA 3F3YA 2ANCA 4POOA 4N48A 1NVGA 4KO1S 3H5OA 3KZOA 1YUBA 3PG5A 2VQSA 1S0UA 4FUTA 1A8QA 4YMVA 1A9PA 2FZEA 4P4GA 4PRZA 5MGBA 4B1FA 3TQQA 4YJFA 4UXHA 5GOZA 1DPGA 2WVHA 4INJA 2YFHA 4NMXB 4XRRA 4B33A 5IJZA 3U3KA 1YCFA 1FVOA 2R48A 3C6XA 3CB4A 3OG9A 4GBMA 1E2EA 3HBFA 5EKSA 1NFFA 1PUIA 1S3SA 3FKJA 1Z16A 5HTKA 4OI1A 3UHPA 4JQCA 1WF6A 3LYAA 3MBKA 4AZ0B 3GN2A 3DLCA 4HRAA 5D3QA 1WW2A 4LTDA 3WFZA 5JPDA 1MC5A 1SKBA 5DX0A 3ZY2A 2Z3WA 3EB9A 2PO5A 4C88A 4G97A 4F7WA 3COYA 3EFOB 4OXYA 1V1MB 3P9YA 4NARA 2AK3A 4GWKA 3LC7O 4U7DA 1ZWKA 3RS5A 1A1VA 2EZ9A 2XA1A 4HKTA 1JR3E 5HX7A 2HSEA 4PV7A 3ZTTA 2VTBA 4XIJA 4LOJA 1T36B 3ZJUA 4WI1A 3MWDB 2XZLA 3X1XA 3GBPA 1JIQA 4N12A 1FFEA 4KE9A 5BVGA 4GICA 1PWYE 3UW1A 5JYDA 1N2ZA 5CYPA 3UFXB 3RJMA 4BVEA 5B53A 4CGYA 5BV1A 5JRDS 5EIWA 4K40A 2GNAA 5FORA 2HA0A 1D09A 1PRYA 2P2SA 2XSZA 3OEWA 1VCHA 2H52A 1QKKA 2JIBA 4FOLA 1KXZA 2I2AA 1VMAA 4YRJA 4BNLA 3AB8A 3EGOA 3NJ8A 4IIHA 2Q29A 1YMQA 3H11A 3ONVA 5IMBA 3BXZA 3SQXA 1C7FA 1TLFA 3GEEA 1NJSA 2GAJA 4O1MA 4CLEA 1P3DA 3V8BA 5LQMA 2M32A 1L7PA 2JA1A 5GVSA 4ZVOA 4EYOA 2LV8A 1WXIA 4BBAA 4BQFA 4Q3EA 1PU2A 2IYZA 3D6NB 4PTZA 2GHQA 3MJVA 4A03A 4DGSA 1G20E 1UZAA 3WK9A 3TOZA 4IFIA 1TGYA 1KO7A 2FUG6 4XR4A 3ZQ4A 2FLKA 3OM0A 1CUCA 1KS9A 2QE6A 2X7HA 1XCMA 3VGJA 3IELA 1N5KA 3EGDB 4ZVUA 1Z2AA 3KQKA 1YDFA 1CUVA 1MQ9A 3HU1A 2OSBA 1AGPA 4KSYA 4J1TC 1PBTA 3RODA 1ZUIA 1XRPA 2VXBA 4HTFA 2VBIA 1WCYA 5K0GA 1GSOA 5DNCA 3WWZA 1VSVA 3H5TA 4B4OA 3DLBA 1RI4A 4OJQA 5IT9A 1GCGA 1XZQA 1Z6AA 3ABOB 2AC2A 2ENWA 3DDUA 2VO1A 3GYBA 1NUAA 3IP9A 2WF7A 3NC0C 3T3PB 3AMVA 4C5BA 5EJIA 3WWYA 4GD3Q 4REOA 2BF7A 2GEDA 4EVQA 1G8GA 1WNTA 3EARA 3H17A 4G0MA 4AN4A 2Q5JA 1D2CA 1RKXA 1HEUA 1QYRA 1UBOS 1V4NA 1Z34A 3ND6A 3UNXA 2VJMB 3W8NA 1CS0B 4POAA 1RHJA 4GEGA 3ZBTA 3CA8A 3T94A 2YJZA 4Q03A 5JRZA 3ZWPA 1U2RA 5KTYA 1E3MA 1KMMA 3JASA 2ZUDA 4A0GA 2I5PO 3NONA 1V39A 3BM5A 2O0KA 2WUVA 1T13A 2I6GA 2X0NA 4ER6A 1BDJA 4JHLA 2XVYA 2PUTA 1G21E 2BN4A 2IIQA 2YWBA 2DCMA 1UJBA 3C7TA 2NU9B 1VSUA 4DNPA 1MB3A 5ARBA 2JBAA 2VFAA 3C8HA 3LY8A 1G3UA 1K3FA 4ENWA 5EXPA 3SAJA 1DKMA 1FUIA 7ADHA 3T5CA 2A92A 4L75A 2ZJ8A 4EFDA 1U90A 4D3ZA 1T2DA 2PUCA 2DFTA 3TKAA 1EGHA 4MVCA 1MRSA 4E1VA 1TEVA 4J16C 3PUKA 5FPKA 2PUAA 2OORA 5E6RB 4LZOA 2WZCA 1PLJA 1XB2A 3RU9A 2PN1A 3THWA 3KC2A 1BFKA 5B57C 4RIEA 3DEIA 1RRKA 3VO9A 5JW6A 2C2MA 2XIJA 2LDBA 4OP2A 3RLIA 1PTJC 1H5UA 1Y37A 5E8JA 3SP1A 3AERB 1YVEI 5E9AA 1T5OA 1E2LA 3KJNA 5CJJA 1NVXQ 3LQFA 1Y8QA 3P19A 3HDJA 4BNTA 3UPDA 3GGPA 4GHWA 4BLRA 3HUDA 3DF7A 5BSRA 1NQVA 3T7JA 3TLJA 5EE9A 3L6CA 4OKNA 1FY2A 1WM1A 5FRDA 1HSOA 5CVJA 2F8MA 2YCLA 3T3GA 1EDBA 4KFUA 4N8SA 4TTPA 3BQNB 4P33A 3P5SA 4PLZA 1GV1A 1KQGA 1HX7A 2WMYA 3E0XA 3E9CA 3KWFA 2QLFA 1Z2NX 4IDBA 4BVHA 1CY6A 4MI9A 3ONNA 2CV0A 2RG1A 4MKHA 1RBYA 1KSGA 4JLKA 3QELA 4KXWA 2IHNA 2B99A 3D59A 2ZS8A 1XMXA 2LE0A 2QB5A 4L9AA 4Q3KA 3FHTA 2XCIA 5FEMA 3VR4D 4KN5A 4KQJA 1Z17A 4ZAZA 1UKBA 1KK3A 1Y7PA 2I76A 3HU5A 3HVJA 4JT4A 5JXIA 3B1WA 4IHJB 4L15A 5HIKA 1P29A 4P3XA 2HU2A 3K0FB 3WHPA 3QLEA 4II7A 1XFAA 4BWVA 1PJBA 1VDZA 4G6ZA 2P6OA 4GDMA 1EFTA 1BH6A 4RE5A 4XJXA 5KSPA 3EX7C 1J20A 2OMEA 4C2TA 1N78A 1R4NA 1I1QB 2ZBQA 2I3DA 3FHOA 4LYYA 1KERA 2WUFA 3WFJA 4BB0A 2AFRA 4OOEA 4DFDA 5I7HA 5CCEA 3IQFA 1HE3A 4JHXA 4Q12A 2NO0A 3ENKA 4C04A 3GI1A 2WTBA 3PUYA 1AURA 1RXUA 2HLNA 4LPSA 5CDGA 3OFJA 3EMKA 2C8JA 1XTRA 3MWEA 3PC6A 1UWLA 2CV1A 3SXJA 1C9YA 4QU9A 3D6JA 4IHAA 3MWYW 5KTRA 2QZPA 3ZHUA 1Q1BA 1EVZA 1N5RA 3ZIAA 4U9IS 1MDFA 1EBFA 1PWXA 2YDYA 4F8YA 1BE0A 5F23A 4FZJA 2GCOA 5CW1A 3U81A 2IUEA 1B8PA 5JUWA 4AY6A 5LZ5A 4MQFB 4K86A 3WOVA 3LL4A 2Q0XA 3UJNA 3NV9A 3Q3JB 1LF0A 1B2RA 3CLUD 4GVLA 4L72A 5DNEA 1SXJB 4C0BA 4EPRA 1GYPA 1QF7A 1U3FA 2HHJA 1POXA 1Q21A 2FN9A 3M6VA 5EL0A 4D8TA 4UOEA 3C7AA 1T15A 3AKEA 4MVJD 2RHWA 4EHBA 1XJCA 4BX8A 3FMOB 1DJLA 1DBQA 2Q5IA 5DM2A 4DA8A 2O8CB 4US1R 4ZARA 1EBBA 1NMEA 2C99A 3KKZA 5JMPA 1LK0A 3F5QA 2ETVA 4BQPA 2P6RA 4PAMA 1W5SA 1E7YA 3DF9A 4UNNA 3O4IA 4YRNA 3K0HA 3PR1A 5EOVA 4BCCA 4RL4A 4R3UC 4OHRA 1C4WA 1HNZB 1U3DA 5DBEX 5L51A 1XTIA 2CB0A 2W6CX 2FQ1A 5D6NA 5P21A 2Z2YA 4OX9B 1ZR2A 3N58A 4QYSA 4NR0A 1FYWA 4G36A 1WBBA 1K06A 4BFUA 1KY5A 5TGZA 5JFTA 5CVTA 3DNFA 3LLVA 4X6YA 1TZCA 2O3RA 2D7CA 2DQZA 4L51A 3OF3A 5A5GA 1MV8A 2Y0PA 3ZVMA 4OHVA 5DK6A 4M22A 1DWOA 2PT9A 4MUGA 4CR8A 4LHZA 2IHBA 4M8SA 3MRSA 3CPHA 1KU0A 4KRFA 2XCSB 4E5YA 1RNLA 2X6RA 3K31A 3KR2A 2YIDA 2JGEA 2PVPA 2J0QA 3IQGX 1VHDA 4LJ7A 3FFWA 4TV9B 2QM3A 3TLBA 5I3ZA 3DXFA 2EFYA 1Q7CA 5SZHB 1NJ1A 5DV9A 3W06A 2G5GX 4ATNA 1QCCA 4FKZA 3ANSA 3KUUA 5KKNB 4RH3A 3PXEA 1JZSA 4B4VA 5LKRA 5JU6A 4OYYA 1NPTO 2O4UX 2B83A 2A5LA 1SM4A 2ZWIA 3KT6A 1NVBA 1TZ2A 4LV5B 4PS0A 4ZCRA 2G5PA 3OKAA 4YK7A 4Q4DA 2Z1DA 1Y6RA 1YAHA 5HTOA 1LFAA 2IYSA 4HZUA 4RMJA 4A3SA 3A2MA 4JA0A 1A9SA 2H4HA 1Z4PX 3JD2A 3OE7D 3DE7X 1YS2X 2CVZA 4WLUA 3D7LA 1E58A 1JR3A 4HZIA 2FYTA 3FLMA 1XLTA 3JQFA 3Q41A 3FWZA 2W0MA 3KPWA 5J40A 3A8TA 2QPTA 4W9NC 3LFHA 4DBLC 2WINI 3ZYZA 4O08A 1AJEA 3U3DA 4FBLA 3WI7A 1DDOA 3JQQA 3KKLA 1QG0A 1ECCA 2RBEA 3PJDA 4HB0A 4HQFA 5SICE 2EFGA 4Q1EA 2X6QA 4LE1A 2VHCA 1TCAA 3NJ4A 4GKVA 1YASA 2O20A 1EGAA 3UAGA 3ZGVA 2FFAA 4E46A 3BRCA 3AIIA 3PNYA 4NCHA 2IZ5A 4A8HA 1HL3A 1YJCA 2X5JO 4L5IA 1EFLA 3UW3A 1F6DA 4OK5A 4K88A 1AZWA 2G9ZA 2JKVA 1RAIA 2NWQA 3GLHE 1FS4A 3N6RA 1C9JA 4YI5A 2XE4A 4WZ6A 4RM3A 4XB1A 1V8FA 1G20A 2BKUA 2Q27A 3OEEA 4TSKA 2FPIB 3E05A 3TD6A 2ZAOA 3C3CA 1PL6A 2J0EA 3FCSB 3H6HA 1FMFA 1XHEA 4FFNA 4G5HA 5A4FS 3RK0A 4L74A 4PM4A 2Q49A 3EZ9A 3NKVA 4O1HA 1H22A 4WE3A 4XWWA 3K9FC 1H3EA 2LIVA 4X1KB 4P4UA 1WDKA 4LYFA 2OOSA 4MULA 2VTVA 1E1CB 4KACA 4XGNA 3B9BA 1BVUA 1KSFX 4XIGS 4BVLA 2P9QA 5CDUA 4BO8A 6AT1A 4K6MA 4LYAA 2G72A 2GBLA 1IXRC 4ZYLA 3INTA 2H7YA 3RK4A 3WYCA 4XUDA 1S96A 4AULA 4RA9A 1UAYA 1MCZA 5T64A 3ZHSA 2QQFA 2WPDA 4X1YA 1XZLA 4B4UA 2JFFA 5J5VA 1SQ6A 2Y1GA 4R71A 5HS4A 3CGWA 3FRIA 3RWMB 2QVZX 5AVRA 5ITZA 1DBPA 1HSZA 2EF1A 2XT0A 4IQFA 4NU5A 1ZNYA 4BN4A 1R4ZA 3L3BA 4KMSA 2VDQB 1RRFA 4OSPA 3U49A 1VJ1A 5AVYA 3A1VA 3UEOA 1EDEA 4W5TA 5B6PA 2YQ5A 2ZK7A 3EUAA 5GPBA 1H85A 1VHJA 3KUDA 1DL5A 2Q3EA 4PBSA 4URZR 1IHPA 1UJMA 1N8TA 4KL8S 1RVDA 4QT0A 5LB2A 3I1JA 1W4RA 1Z6PA 3K0AB 1Y6JA 1HDYA 5DT2A 1F5NA 4S0ZA 5IARA 4G8BA 3IGFA 1Z33A 4KQEA 1RXSA 1JBEA 1ZITA 5F64A 4D9HA 4ZT3A 3AF4A 3UAOA 4U7TB 1A82A 4WGGA 1PL0A 2QZ9A 5EJEA 3L06A 1JWBB 2PS1A 3VNSA 4I55F 1WB5A 5A4MS