4YONB

P-rex1:rac1 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
MQAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Phosphatidylinositol (3,4,5)-Trisphosphate-dependent Rac Exchanger 1Ras-related C3 Botulinum Toxin Substrate 1 (P-Rex1Rac1) Complex Reveals the Basis of Rac1 Activation in Breast Cancer Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac excha
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4yonB00
2FSIA 3QBTA 4RD3A 2NO7A 5JHGB 2NO0A 2WV9A 5E3HA 4FMBB 1FP7A 1FFHA 3CRVA 1XJCA 3LFUA 1TU3A 4M22A 4TLDA 1HYQA 3EARA 4GFDA 1OXXK 1E79A 3CB4A 1KI6A 1TEXA 3PR1A 5IK2D 1MO5A 2W6JD 1OSNA 1U0LA 3K1JA 3THXA 2V8OA 3DM9B 4IKEA 2RHDA 1VYUA 1G7SA 3ZH9B 3OEEA 1MABB 2QG6A 4JJZA 2OXRA 1GL9B 2ZRPA 2YC2C 1N5LA 2Z5FA 5C1BA 5BXQC 3VR1A 4QBIA 5FUWA 2OCYC 1G3QA 4IJMA 5LB2A 1QHXA 4Q18A 5GADl 3B13B 5EXPA 3VKHA 1ZCAA 3L8ZA 2ZXUA 1W7AA 3FPAA 5BN3A 2XNDD 3EAQA 3EC1A 2IYVA 2W6JA 3NC1C 1NN3A 4B71A 1KJYA 4LHWA 1E79D 5B58C 1S0UA 4KFUA 2FFHA 2VHQA 3K9LA 3GLGA 1KMQA 1HT2E 2J1LA 5JWRA 1R6BX 1G7RA 1COWD 1EFUA 3GJ3A 3GLIA 3U5ZB 1U99A 2AXPA 3RC8A 3SYLA 2BHRA 4X8MA 1XMVA 1KAGA 5AR1A 3BRWD 1MR3F 1JXOA 5JLJA 3PEYA 3A4NA 1KY3A 1BMFD 3AH8A 5HE9A 3KZ1E 3T1OA 3NEYA 1GOTA 2KSQA 3BS4A 5SZKB 3R8CA 2QGNA 1V5WA 3UATA 1JJ7A 1KI2A 3R7WA 3SYKA 4ABYA 1XWIA 4WZ6A 3AKCA 5C18A 3A1TA 2GF0A 3VMFA 2NIPA 2WKRA 2N42A 3MUFA 1GNRA 2WWHA 3REGA 1X86B 2Q3FA 3E5HA 1AGRA 4C30A 1KNXA 4EJSC 3X1WA 3RHFA 3DVLA 4LRWA 4DWJA 1U90A 3A6PC 3OESA 3RC3A 2EFHB 2V4ZA 1G3MA 1MO6A 2Y8EA 2DHRA 2HLDD 5L3VA 4I99A 2QL6A 2ZE8A 4DLXA 3V4FA 1Q12A 2FU5C 5L3RA 2VF7A 2VP5A 1P9RA 1XX6A 2FSFA 1BYUA 1K5DA 3TRFA 3V00A 4EPYA 2V54A 3CPHA 4LJ6A 4A9AA 4IFEA 4PZLA 4B2PA 3H2YA 4CEJB 1Z0JA 1HY3A 4IDQA 4B47A 4MKIA 2DWOA 4LOAA 2NPIA 3ADBA 1Z29A 4HB4A 3B85A 2WOOA 4HZIA 5FOVA 1S1CA 2ZPTX 1UEIA 1IM2A 1E99A 1W0KA 2YVUA 1W44A 4JBYA 5DI9A 2XJ9A 3K0EA 4ACAA 2FMXA 121PA 5JCZA 4LJ4A 4RZUA 3W6PA 3CIOA 2D06A 3A1SA 2BBWA 4HUTA 2QBYB 3GEHA 1L4YA 4RD4A 3RRZA 2ZRJA 3DKPA 3QE0A 1TL7C 1XMJA 2J41A 3ZD7A 3LVRE 2JJ2A 4YXWD 5CIQA 1GL6A 1X1SA 5JSZA 1DAGA 4OHXA 5K8TA 5FH9A 2SHKA 4V0MA 2ZSBA 4TYWA 1PZNA 2WKQA 2CLDX 2J0UB 3DHWC 4HSEA 1ZNYA 1FL9A 4LK2A 4D0GA 2CCJA 1A82A 3GFOA 1XFAA 2Q0HA 4G5QA 2OSBA 3AM1A 1P60A 4V0ME 4XVQA 3WNDA 4JLJA 4WZAE 1WBBA 4MGIR 4JVLA 2DFLA 2FFBA 4O0MA 1D2MA 2B7BA 1SVOA 2QTVB 1HA3A 4JLOA 4MKHA 1LS1A 1UPTA 5KUTA 3U7GA 3LXRA 3NBYC 4JSYA 2GTPA 4Q19A 3F3YA 3R9WA 2HJVA 1MRSA 521PA 4BFTA 3B1YA 2C5LA 1W4CA 2CCKA 4Q9HA 3WY9A 1XRJA 1E32A 1K8RA 3KJEA 2ZSFA 4B2IA 1OF1A 2O0HA 4TZ6A 1AK2A 2OEPA 3QG5A 4B6EA 3IEUA 1A5TA 1KI6B 1U0HC 3FDIA 2ANCA 2IF2A 1ODFA 1EK0A 5FI1B 1G8PA 3T5GA 1UJ2A 1TPZA 2WWXA 1MV5A 2DY1A 1CULC 1G20E 1SXJE 2PT7A 1ZVQA 3QKSA 4DT1B 1CR2A 2WIBA 2IXGA 1YR8A 2GDJA 3T1TA 1G17A 4KLNA 1FQKA 5JEEA 1S9HA 2ZJ2A 1H8EA 5TVKA 4JL8A 1IN5A 5KSOA 4ZPXA 4YXWA 5LB4A 2FX3A 2QMOA 1ZIOA 1SKYE 2W6IA 2ZJAA 2WSSA 1MO3A 2WSMA 3OIWA 4Z1MA 4YQFA 4CEIB 3AVXA 1DAMA 3AF3A 3A4LA 4M9ZA 1G291 3CX8A 2GEVA 2Z6VA 4DB4A 4D82A 4WW0A 5FUVA 2O8CA 1UKVY 4U02A 2IS4A 4PX9A 5GJBA 3LXXA 5DN6A 1MT0A 4M1TA 1W0JD 4MDEA 3H86A 4HLCA 2IWRA 2FG5A 2HT1A 3QEJA 4JVSB 4NCHA 3LX5A 4B3DA 1RW4A 2R8RA 5GVSA 3PEVA 4D80A 2LKDA 3K0AA 1W49A 3AEZA 1LS6A 1Q21A 4ZI2A 3GLFA 2VP9A 1N6RA 2A5JA 3MRSA 3NVAA 4LSGA 2IL1A 5EP3A 1OXSC 2ZYTX 3W8RA 5JBQA 3D31A 4BLOA 1NKSA 2ZTSA 1OIVA 1GKUB 3OEHA 4XVRA 1ESNA 2PMKA 4Q1DA 4A8JB 3R7WB 4ZI3A 1TQ4A 1XNJA 3Q3JB 1OW3B 2DPXA 3OEHD 5EE0A 3WP0A 4WXPA 2ZRGA 2ERXA 2R9VA 4AK9A 3VKGA 3DMDA 3FFBA 3CLVA 1MH1A 1XMSA 2MSDB 2GETA 2OCAA 2VP2A 2XTZA 5JJLA 2IS1A 4G1UC 3SI7A 3P1JA 3WXMA 1IN8A 1TMKA 1CLUA 3BB3A 4QJ5A 3ZJYA 2RKOA 4X8LA 5FOWA 1GSIA 1Q22A 2OT3B 2R2AA 3GLHE 1CR4A 3UIEA 1NJGA 3I62A 2O8DA 3FKQA 1NBMD 4MRNA 2GBLC 5L3SA 3SJZA 2QAGA 3CH5A 5DI3A 3E2IA 1E1RA 2PEYA 3SFZA 4US2R 3AVUA 2TMKA 4QJ4A 2PZFA 3TE6A 1L8QA 3RS5A 5CITA 3IHLA 1KGDA 3EZ9A 4DSNA 3PFIA 1W5SA 1HV8A 1X8LA 2JJ8A 4JLPA 4C0KA 2YHSA 4RFVA 1RJ9A 1XTJA 3THWA 1KK1A 3SNHA 3EZ6A 1U2RA 1FUKA 3I32A 2XEXA 2X2FA 3AUYA 1U9IC 4KFSA 4DLSA 4OHZA 4EPRA 5FPKA 5CB6A 1IN4A 1R0WA 2VYFA 2VTKA 3SHWA 4AYXA 3SFVA 1GM5A 1IY1A 2Q9AA 4YMTA 2G9NA 2JATA 4NONA 2ZS8A 4AYWA 2CXXA 1WA5A 1E2IA 4WOPA 4R71A 3W3ZB 5KDOA 2R6GA 4FN5A 2V3CC 1W47A 1RVDA 3IBGA 3BFXA 3MJRA 4FMDF 1OFTA 2AD5A 2GESA 2ODBA 4EUNA 1G21E 2ZAMA 5HE8A 1PJRA 1P7CA 1NMZA 2DYKA 2ORVA 4ZCMA 1T8TA 2ZE6A 3F5FA 2NTYC 1ZD8A 1C9KA 1F2TB 1TF5A 2ZRIA 3LNCA 4WIAA 3AKYA 5EXSA 2IYXA 4JLBA 1L7VC 4QM6A 3WNBA 1EX6A 3FTQA 4DSUA 1Z83A 1P72A 1VCMA 4OK3A 4BLQA 3ND8A 4KVAA 4TLAA 3Q85A 4UKDA 2JCSA 1CRPA 2XZOA 1R0ZA 2D62A 3VAAA 421PA 1FZQA 2V55B 1II8B 2BBSA 2E9SA 1CR0A 3KL4A 4L9SA 3K70C 5J47A 4MYCA 1Z2AA 1QHHB 2ZI3A 2ZJ5A 2G1JA 2REOA 3FVQA 4KODA 2FOLA 5EE1A 1ZCBA 1DEKA 1QDEA 2ZJOA 1RC8A 2AHOA 3AB3A 4TMWA 2ZRNA 1V43A 3OAAA 2FPMA 2GEUA 1QHNA 3GFTA 4QOSA 4DBLC 4H9GA 1KI7A 3N2EA 5JFGA 3CZPA 3WRYC 1TF2A 4AKEA 3BWDD 4DLWA 4MH0R 1ZJ6A 4E22A 3CM0A 3JZAA 5G53C 2XZLA 1OPXA 5AWFC 2WTUA 3HPRA 4QHYA 4YONB 1N0UA 1RFLA 3NIBA 3PITA 3IIMA 1X8KA 4URZR 1KMHB 1VECA 4Q4LA 3CNOA 2BIFA 4BUJA 5AUOB 4GOKA 3AUXA 1P9NA 2ZE5A 1U94A 4KBFA 3B82A 1HH4A 1NLZA 4DLVA 1G19A 2AFIE 2FDCA 1G18A 3CRW1 1KKLA 4O2LA 3OZXA 2B6HA 1QG4A 2AX4A 2RGNC 3PUVA 1RJ9B 2XXAA 1W5TA 5DE3A 3LDAA 2EFDB 2BJVA 1J90A 3CR7A 2JASA 2VEDA 5DHAA 2QA5A 1E2KA 5EP4A 5CDFA 3UMSA 1UBCA 4GMXA 4Q1CA 3DDCA 2P5TB 4DUGD 3VX4A 1JEEA 5E7IA 1WCV1 5FBQB 3G0HA 1UAAA 1RPZA 1ZBDA 2GKSA 2FPKA 1M1YE 5CLQA 2WZQA 5CDFE 1GAJA 2GXSA 5CB8A 3VKWA 3CX7A 1WE2A 3AQ4A 2I1QA 4V03A 5CIWA 4O2RA 3ZD6A 2BMDA 1R5NA 1XMIA 1TTTA 1E2FA 4G01B 3TIFA 1NJFA 4W5HA 1Z0KA 2ZS7A 3U3MA 3FHCB 4R2IA 5KNDA 4HB2A 5ANRB 2W00A 1T4GA 3CZQA 3NBFA 4HI0E 4LCBA 4NCJA 5FTLA 3EX7C 1KDRA 3B60A 4EFLA 4F93B 3KFXA 4QGHA 2W0MA 1XBTA 5F2EA 2C99A 1SXJB 1TADA 3KB1A 1F5NA 1PLLA 5HPYB 3D6TB 2OFOA 3CF2A 2JLZA 2BJWA 1AN0A 2OBLA 2YC4C 1E0SA 4LC0A 4HLUC 5L8VA 4ZDWA 3ZQJA 2OLKA 2J3EA 1YU9A 4PHFA 1TQDA 4ZIRA 1K5GA 3L2OB 4XH9B 1Z6YA 4CDGA 2OFWA 2IUTA 2GXAA 2NO9A 3TUJC 2UZ3A 2QAJA 4Q7MB 2CK3D 1JAIA 3TVDA 1E9FA 4C9BA 1YZGA 2CLSA 3P4YA 4BQSA 2P0EA 2BCJQ 1JALA 2YOHA 3IEVA 4C0QC 4Q9KA 4HATA 5FTKA 3TSOA 3VNVA 1NSTA 4KJZA 2IYYA 1DOAA 1VHLA 3NKVA 4FMCF 5CYOA 2ZJ8A 1VIAA 3SOPA 2RH5A 4G0NA 1ZD1A 4EIWA 4Q48A 4WZBE 4JZKA 2ZJZA 2A3RA 4QBGB 5KNBA 1KO4A 3QPUA 3WMFA 4FD2A 3KTAA 4HZUA 4D2IA 4OQMA 1W46A 3GLGE 2G0TA 4XD7D 4DEXA 4HAYA 2Q6TA 1Q1QA 3ZS9A 5JRJA 4QFMA 3TUIC 1TAGA 4QBHA 5AJYA 3PEWA 1BYIA 1QG2A 3KXLA 4FINA 4M1YA 4BZXA 1S8FA 3SS8A 1DAHA 1ZNZA 4PC3A 3P4XA 4UXJA 4D0NA 4KLZA 2O8CB 3H1TA 2BM0A 1UM8A 1ZC3A 4DCSA 3BC1A 4JS0A 4HDCA 3BJIC 5EE5B 3QKTA 4HUQA 4A0GA 4ZV4A 3EC2A 3QXJA 3RSOA 3KKNA 4YMSA 2J87A 3K0AB 1P75A 5H1YA 1US8B 4PC6A 4B48A 3AKDA 3LX8A 4DCTA 1NSFA 3GJ4A 3A36A 1H8HD 3U2QA 1ZM4A 1M7BA 3FMFA 1Q1EA 4L5BA 3FYHA 3H4MA 1OXUA 1G3UA 2ZROA 5KDDA 1CBUA 1HT1E 1E3MA 4PQRA 1H8HA 4MUAA 4PSAA 2VL7A 2PT5A 2BOVA 4ASUD 3TAUA 1R0YA 5H68A 4C0JA 2W0SA 4OI0A 1RE0A 3QJYA 1JNYA 1NVUQ 4PPFA 4D0LB 3BFKA 3EA5A 3PUYA 2GCOB 1Z6AA 1TNDA 4RD6A 2QENA 2CLCX 2IYZA 3BD9A 3CBQA 4B73A 4RD1A 4ZDIA 3THYA 3BIFA 4LC1A 1AS0A 5F3WB 1EFRA 2QP3A 2C96A 3C4JA 4BGDA 3WRXC 3KQKA 4M53A 2ZRDA 4NH0A 3SN6A 4AG6A 1E94E 1OYYA 3A1UA 4ZIRB 1P2VA 5G3YA 3KFVA 3NHBA 3QSYA 2XTNA 4EFMA 4Q21A 1WRBA 2JDIA 1EG7A 1UBEA 1PLJA 5KSYA 1KSGA 1XEFA 3LA6A 5TXGA 4Q01A 3U3RA 2PBRA 2GZDA 5CK5A 4NYMR 2O8FA 4TN1A 3VU9A 1WDTA 4OHWA 4UXIA 1VYVA 4B74A 2GRJA 4D4JA 2EFGA 1N5IA 4POAA 2RGAA 4TMXA 4URVR 1UDWA 3DOEA 3U4QA 2JIZA 3TAHA 2ZI6A 4NYMQ 6Q21A 1EESA 1W2HA 3MG9A 3QG1A 2ZITA 3L82B 4JYCA 5E4FA 4OHYA 2AWNA 3L0OA 5IHPA 3MLEA 4C0LA 1OXTA 2ONJA 4QKQA 3W5IA 2VLIA 3NBZC 2CL7X 4GZLA 4OL0A 2AKAB 4NE2A 4QHTA 1N6KA 4BLTA 2ZR0A 4LBYA 4R2HA 2CCGA 4IHQA 2WWWA 2CHQA 5KYKA 2NPFA 1JB1A 1KI3A 3WBKA 2HUPA 1Z8FA 2ZRKA 2ZUCA 3IGFA 2REBA 4CVNA 1SVWA 3U60B 2GJ9A 3RRMA 4P4SA 5HZHA 4CGZA 2QT1A 2PCJA 3Q8XB 1SKQA 2AFHE 3G82C 4MRRA 4FIDA 2EVWX 3NWJA 3HR8A 2MSEB 5BN4A 1OH8A 3I5YA 1BOFA 3FMPB 4RKEA 4XSGA 1HE8B 1KI9A 4P33A 1Q1ZA 2NOAA 4QL3A 1YKSA 5A4JA 1QHHA 1NMYA 1OT3A 3KJHA 1P61B 3P32A 1JAHA 1ZNXA 2OM2A 1ZD9A 4K46A 5FL7D 3UG7A 1E1RD 1G41A 3AVYA 4JLNA 4AY2A 4XSHA 3GJ6A 2PZEA 3NDPA 4RD0A 4PZZA 5BQ5A 5DI3B 2E87A 4Q1FA 4OJQA 4A15A 2P3SA 5DSZA 2ATXA 3SHFA 2JLWA 3IHWA 1H65A 4L15A 2HT6A 4US0R 2C9OA 1N2CE 3LRPA 4YMUA 2J0QA 3TK1A 5DHFA 1P62B 4FMCB 2RB4A 1JEDA 4DRZA 1MRNA 4TTPA 1VMAA 1W4RA 3FWYA 2VA8A 2QE7A 3I8SA 3ZQ6A 4LYHA 2OUKA 4TTRA 1SXJA 5L3QA 1FTSA 4TMKA 5BYJA 2WMOB 1FP6A 4M9SA 1XU4A 2YOGA 4MYUA 1O87A 4M9QA 4V0OA 5AJVB 3SBDA 1YZNA 1NVXQ 2FEOA 4CRWB 2PJRA 4LBZA 4RD2A 2CMKA 1Q1BA 4MYHA 2VHUA 1XXHE 3SZRA 4ZKEA 1YJ5A 1Z28A 4AI6A 4ZDJA 3Q5EA 3K53A 3UMRA 2G83A 2ZSDA 1D2NA 3QKRA 4NCIA 3MFYA 1M2OB 1VTKA 1YRBA 4C2UA 3PV0A 1XXHA 1AGPA 3PIRA 1NI3A 1KI4A 1XTQA 2DWPA 4JLAA 3TBKA 4GZMA 1P2TA 2VHCA 2PMDA 3W8NA 1RRFA 3U7FB 3AKEA 4HAWA 3GJ7A 4WXRA 2QTHA 1KDOA 2Q3HA 3CPJB 2H57A 5H70A 1FX0B 3RNLA 1GZSA 3PENA 2ZEJA 4Q9LA 1G9XA 5B30A 3MWKA 4NYIR 2ECKA 4JL6A 5FFMA 5B2ZA 3GLFE 4Q4JA 5CYPA 5K8UA 1OE0A 3PUXA 3L0PA 2I1VB 2WWIA 4TT3A 1KIMA 3W6OA 4L4UA 1QVAA 2AKYA 3FMOB 3HYTA 4IVQA 4R7ZA 4GP6A 5CM8B 1NG9A 4GBMA 4DLZA 3I3SR 2Q21A 1IJFA 5FBVB 2P2LA 1FW6A 4B34A 3KX2A 1LY1A 2J7KA 4TLEA 4BRUA 4PAOA 4XWKA 2YYZA 5FI0B 3AF2A 3ADDA 2NZJA 2VP4A 4GI7A 3K70D 1W4AA 3BB1A 3IKJA 2F1RA 2HEIA 4BRWA 5KPDA 1NRJB 4B35A 4TSFD 1E4VA 1XZPA 1XD2A 3HYRA 2AWOA 3N5CA 5J4VA 4XWAA 1I2DA 2P6UA 4Q00A 4X8HA 1NY5A 2DWQA 2YJTD 1R8QA 3VTKA 4D4KA 5L3SB 2ODNA 2ZRMA 2QNRA 2P67A 5JI3E 3WMEA 5HKKD 1NIPA 4LZZA 1W36C 1EX7A 3GEEA 3O8BA 1VCNA 1G5RA 1ZYUA 4DSOA 1GFIA 2A5GA 3U7HB 3KQHA 2VHJA 3IQXA 1YHNA 5DYIA 3B78A 1G8HA 4NZYA 4BFSA 3ZLJA 4OKSA 4BFXA 5KHOC 3EIQA 3K8YA 3KXIA 1ZUHA 4TL6A 4Z8XA 4URWR 2QY9A 1T0HB 2A5FA 2EU8A 4HDOB 2PLFA 3PVSA 1DS6A 3IPYA 4N0EA 1X8JA 2RGNA 1CIPA 1P73A 4NYJQ 3OEED 3LQRA 1VCIA 4DVGA 2N46A 4DDTA 2F3RA 4GDFA 2PZGA 1Z6XA 4UJ3A 1SHKA 5ELXA 5KNCA 4CW7A 1GKYA 4A82A 1OIXA 2B8TA 2VPPA 1A4RA 4Q4HB 1E1QD 4TMZA 4C7OB 2Z4SA 4MGYR 2O8BA 3TGPA 4IDOA 1L2TA 2IX3A 5C46F 2B8WA 2CJWB 1SQ5A 2QBYA 1RYFA 4M21A 2FGJA 221PA 3DKVA 3Q9LA 3D3QA 5AUPB 4GL2A 1F3OA 5KPJA 5BW8A 4KAXA 5J4KA 3VU9B 4LYJA 1E2QA 1XCPA 3VQTA 1DG3A 1SVLA 1GDDA 1QZXA 3TJZA 3WNCA 2ZR7A 1YZTA 3ZVNA 2C98A 1OHHD 2KJQA 4KSBA 4EKDA 4QJ3A 5E7JA 2FZLA 2ZYVX 1GIAA 4UNQA 4EJSB 2HYIC 1N6HA 2GWHA 3T06B 3TSWA 1XEWY 4A0RA 5IK2A 1YZQA 2UVQA 3CF6R 4V0KA 2WKPA 2V9PA 3PG5A 1Z0AA 1Z3IX 5SZHB 1N6LA 3I4LA 3K09A 1KNQA 1NN1A 1SVKA 3BB4A 4M4SA 1DE0A 4C4PA 2X2EA 4Q4AB 2YZ2A 4DDWA 3OHMA 4JL5A 5AK0A 4MKFA 3AV0B 2ZSEA 2X19A 3MWLA 4I4LA 5TB5A 3QIAA 1E2MA 4S2EA 1IOZA 2IW3A 3EW9A 4HLUA 4XTCS 3REFA 1R7RA 3C14C 1G1MA 1XEXA 3QBVA 4LWZA 5FPYA 4F91B 4M1WA 3KJGA 5FPHA 3UPUA 1D6JA 3U7EB 1TUEA 2R6DA 3EZFA 4D4LA 1XD9A 2F43B 1JECA 2D74A 1SZPA 4F4CA 4BE7B 3L0SA 2A78A 2GZHA 1N6NA 3B9QA 4LBVA 1M7HA 4A2QA 1BO6A 4N3NA 1AQYA 2ZU6A 1KZ7B 2JGNA 4BFZA 5D3MB 1P6XA 3BERA 2QE7D 3QKRB 2C2HA 1KJZA 1P2SA 2ZAOA 5LPNA 4YMVA 2QAGC 5AJZA 2WIAA 4BFYA 2CNWA 2GBLA 1N5JA 3K0CA 1II8A 3M4YA 2JA1A 3ZYCA 3NXSA 4KSCA 1G6OA 2F1IA 4MUBA 4XD7A 5AJXA 2QU8A 1LF0A 3A1VA 1ZM3A 2WVJA 4IDHA 4NP6A 4RFSA 3TLXA 2J9RA 4O3MA 1S1MA 3LH5A 4NDZA 2YWFA 1KKMA 3OE7D 4TYYA 3FKSA 2IC5A 1JR3E 2F6RA 3ZIAA 4PPNA 3ASZA 3TW4A 3ZDQA 3K70B 4GSYA 4C0HA 4BPBA 3VHLB 4G5RA 5JECA 1E2JA 1Z07A 4U00A 2F9MA 2MMGA 2AL7A 4KXFB 1US8A 4TT3D 3AP1A 4NMMA 5F9HA 1AM4D 4RZ2A 3RVBA 5HR5A 2PX3A 5GJVC 1R5BA 1XTSA 2H17A 1CU1A 5DGXA 3LW8A 1OXVA 2OFXA 3QI2A 2YWHA 4KO8A 4TYNA 3O8RA 2JLUA 2RHMA 4W7SA 3GJ5A 4Q1EA 3N70A 3VR5A 4AKGA 1S3SA 4XTRA 1QHYA 1B23P 4ITRC 1OH6A 3ADKA 1OB2A 2AR7A 2QP4A 2JIZD 4P31A 2DB3A 1E0JA 2ZRFA 4E07A 4F4IA 3GP8A 3AVVA 2VP0A 2I4IA 2C03A 3K0FA 4HAVA 4TSFA 5EE3A 3VX3A 3OFND 5KU1A 1WMSA 5FOTA 4CYMA 2GA8A 2IBMA 2V6IA 2C77A 3CH4B 1NBME 3PCRB 3PUWA 2QN6A 4MGKR 2FZ4A 1MKYA 4P4TA 4LJYA 3OFNA 2JDID 1IJEA 1CJUC 5K8LA 2HLDA 1T9HA 4LYAA 1DVRA 2WAYA 4HB3A 1YVDA 4M1SA 1NBMA 4V0NA 2AN9A 4DHEA 3PQCA 5TY0A 1YQTA 2I3BA 3LBIA 4DCUA 1NKTA 1D5CA 3LV8A 4QHSA 2O5VA 2ZSAA 3VFDA 4EPWA 1LVGA 2CJWA 1CJTC 3L0IB 1U8AA 1QBKC 4U7DA 1GUAA 1LFDB 2YKGA 1WP9A 1W0JA 2IEZA 1DO0A 2R44A 2FGKA 1AJEA 5FOUA 1IY2A 2K5UA 4GPTA 4KYIB 1CEEA 3RABA 2IXEA 4BECA 3GLFB 4BEBA 4W9MC 4RZXA 4TLCA 1HQYE 4LJ8A 2YWGA 4DLYA 1GRQA 1E96A 3GJ8A 3J81k 2PJZA 3X1DA 4E09A 3TSZA 1X3SA 3AF4A 1BMFA 1OYWA 4RVCA 2CVHA 5KO2A 2HXYA 2QSYA 4L16A 1Z06A 4JVNA 4EAQA 1WQ1R 3EPHA 4LPKA 1AKYA 2VH5R 4QGAA 1ZAKA 5KSZA 1IAQA 4M1KA 2FSGA 4TYPA 2XNSA 3WYGA 3F8TA 2IYTA 2ERYA 1SXJD 2HV8A 4PPGA 5KSPA 5DN6D 2XB4A 4WA7A 2VQSA 2OILA 3VR2A 4AURA 1F2TA 3GCGA 4DKXA 1M7GA 2ZM5A 1GTVA 4DB2A 2ZANA 1IQPA 1CJMA 2GJKA 4QG7A 2CVFA 1RRGA 1KHTA 2O8BB 3W5JA 4DDUA 1GNPA 1TUIA 2GJSA 4URYR 2GJ8A 5EZ6B 2EWWA 4G5SA 1S2MA 4Q7KA 2ZUDA 1JQLB 1XEXB 4IFBA 1DAKA 1IN6A 3D7MA 2C8VA 5D3QA 3WYFA 2AK3A 1G16A 1N6PA 4AKHA 2BBOA 5HZKA 3HU1A 3EA0A 5P21A 2D7DA 4IEIA 4C0BA 2FFQA 3VR4A 1YR6A 4DIDA 1AQUA 3KJIA 5EP2A 4XWOA 4KHZA 1G4UR 2F1JA 2WWFA 3L43A 4AD8A 5D3MA 1T91A 4S35A 2IYSA 4C0SA 1JXMA 3LVQE 2ZJYA 2HCJB 2ZI9A 4ZCLA 1MABA 3RAPR 2V6JA 5TMPA 4YDSA 3OIUA 3X1ZA 5DO9A 1OFUX 4AWXA 1TU4A 4B44A 5H8WA 2OXCA 3IO3A 2CHGA 4MGZR 2XB2A 4LV8B 3QKUA 3R8FA 2BWJA 1G8FA 4LY6A 2BKEA 3BXZA 3UMFA 4PO1A 1E4YA 4EQ6A 1OH5A 3KXKA 3TR0A 2BMFA 1P2UA 2ZRBA 2ZVPX 5CK4A 1KK2A 5BWMA 1N3BA 3AGPA 3B2EA 2W2TA 1FUUA 3BOSA 2DCUA 1P4SA 2N1BA 1PUIA 3AGQA 1G5PA 1KI8A 1VYTA 1ZRHA 1II9A 2ORWA 2IHBA 1DADA 2YNMA 2VIIA 3TNFA 5KTYA 3FOZA 1J8YF 1KSHA 3IUYA 2RMKA 1HURA 4D25A 1XXHB 1I4TD 4MRPA 4MDFA 3M1IA 3KKQA 4NU0A 4PZYA 2EQBA 1T3LA 3C41J 2ONKA 4B3GA 4L9WA 2BM1A 2PLRA 5GVRA 2KB0A 3MWYW 2ATVA 1ANKA 2YWEA 4RSGA 4JLKA 3SC3A 1Y3AA 3TW8B 5F9FA 5DISB 1HEIA 4J0QA 2RGDA 2FPLA 1IXSB 2LWIA 4Q4JB 3ZGXA 2QQ0A 4HB0A 3T5DA 4EFNA 4N1AA 1XB2A 1U81A 3BE4A 4ESVA 1N0WA 4PC7A 1G3RA 1E9EA 2BVNA 1D8TA 2DFTA 3FGNA 1RKBA 2P65A 3QENA 4HYYA 3EPLA 4KYUA 1GITA 2CEAA 2G6BA 4JBWA 2HF8A 2JAQA 2X1VA 2FH5B 4DUGA 5EXTA 4BZQA 1EWRA 4TMVA 1EGAA 4A6PA 4PHGA 4P4UA 4OI2A 4WBSA 3K0SA 4C2TA 3CO5A 1HE1C 1KI1A 2Q9BA 4BZPA 3D8BA 3ADCA 2WJGA 1HQCA 2XX3A 4CT4B 4ASUA 4M1MA 2WPDA 1TX4B 1E98A 3HU3A 3FHOA 1DELA 4LGMA 1VG1A 3LBHA 3BFVA 3W6NA 4DLRA 2EW1A 3CWQA 4LJ9A 3T15A 4YC7A 3C7KA 4NYJR 3UK6A 2WHXA 3M6AA 1W48A 2A5YB 2C9YA 5HCIA 1G8GA 2C04A 2Q9CA 3IO5A 3LY5A 4LHXA 2G88A 2GILA 4QC2A 1KDTA 1OIWA 2H8KA 2F3TA 4NPHA 1UBFA 1E2GA 4PAMA 4QM7A 3B7GA 1G64A 3O8CA 1T8UA 5A0FA 3O47A 2CE7A 3B1VA 2JLVA 2WJIA 3T12A 2KWIA 2QMUA 4DEYA 3GMTA 5LDDC 2OAP1 3MJHA 4M0LA 2IYRA 1RRPA 2V1XA 1H8ED 1FMJA 1HTWA 2BEKA 2IYLD 3G5UA 3NC0C 1B0UA 3K09C 4HAUA 1KY2A 4QRHA 4UNPA 3FMIA 3W90A 1WB9A 1ZM2A 3B5JA 2H16A 2QPAA 1YE8A 2P6NA 2FWRA 3RRYA 4P4SB 3RS2A 4ERNA 2OHFA 1XD2B 3U61B 1NY6A 1J8MF 3F0TA 2YINC 2GK6A 4LX0A 5B57C 1G5TA 2KE5A 3WBJA 4OQFA 3QXCA 821PA 4KFRA 1Q3HA 4A0FA 2W2VA 2NZ8A 2HF9A 3HPQA 4ILEA 5EUQB 2W83A 2GHIA 3Q7QA 3X1XA 4F4JA 1CKEA 3ICEA 4QNRA 5EXXA 3AF1A 2CHVA 4URXR 3L8YA 5FL3A 1EXMA 4FCVA 4ZKDA 4Q1AA 4Q5IA 1DAEA 2YOFA 3SYNA 4BFUA 2VO1A 5C4GB 4Z51A 3BH6A 3RS7A 1F6BA 4CIDA 2VP6A 1E0AA 3NH9A 1Y63A 2ZJBA 1G8YA 1XTRA 4AIIA 1D9ZA 4DLTA 4LPSA 5FOXA 4E5UA 2BKUA 3DM5A 3AP3A 4Q4AA 1AS3A 4Q4HA 4C7OA 3KQUA 4W5WA 3GD7A 4MYTA 4NTZA 3PUZA 3V9PA 5FTJA 4JYBA 2OZEA 1R8SA 1UBGA 1ZM9A 2RGGA 3ZVLA 5FBRB 2OLJA 2ZRHA 1GG2A 4JLVA 3VHXA 1QHSA 4PO9A 2J5XA 4B3CA 3UANA 3WHKA 1XD8A 1XEWX 8OHMA 1A1VA 2GXQA 1OH7A 4H1UA 4V02A 3DZDA 2QP9X 2D2EA 1LV7A 4A0HA 4L8GA 4K81B 4IXNA 4B32A 2WBLC 3LQQA 1ZIPA 3DPUA 3S1AB 1SKYB 3QQ5A 1R5OA 4B75A 4EPVA 4KITB 4DC9A 1OV4A 5TARA 3CW2A 5G41A 4CEHA 2BCGY 5CJPA 3RYTC 1T5IA 3U4QB 2PEZA 3HJNA 4KFTA 2O8DB 4PANA 1ZW6A 3KB2A 3CKLA 3OF5A 3CRRA 3UWKA 1UF9A 2J59A 4LDJA 2OG2A 1PVOA 3EPKA 4LJ7A 1M6NA 1YR7A 2XOKA 2Z43A 3O8DA 4JKYA 5EE9A 5HCNA 4TYQA 3HP1A 2RGCA 2WJHA 4JMPA 3TH5A 1OFHA 3QF4B 4DCVA 4JBXA 1ZU5A 1WF3A 4WAUA 3AF0A 4RZ3A 3I92A 1X6VA 2XSZA 1XP8A 2JLQA 1CR1A 1KOFA 3IILA 2J7PA 4IOJA 1ZNWA 4UNRA 2IS6A 1X1RA 2FSHA 2GZAA 1CP2A 4BLPA 1AZTA 4IRUB 3K0FB 1A2BA 2OCPA 2GK7A 1GWNA 4Z8YA 2QRNA 1E1QA 2FV8A 4KCGA 3T1QA 1T3HA 3UXMA 1LNZA 1R10A 2J46A 1F60A 3ETLA 4PAQA 3SDZA 1D9XA 3KQLA 1Z22A 2AXNA 3I73A 1ZU4A 2Z4RA 3JZMA 5JCPA 5IRCD 1G3IA 4HLQB 2HJGA 1ONBA 3ZIAD 1KTVA 1G6HA 1P5ZB 2IYWA 3TR5A 2ODEA 1E2PA 2OESA 5DH9A 1DBSA 2BEJA 1XPRA 2J0SA 3QEOA 2GF9A 1J2JA 2IT1A 4OI4A 2OO7A 3EZ7A 5K8IA 1L4UA 4DSTA 1E2NA 3THXB 3S1AA 1COWA 1J70A 2QPTA 5EQTA 3E1SA 3SJCA 4RKFA 721PA 1Z08A 4LBWA 3QVUA 1CTQA 3T1VA 1TQ2A 2NG1A 1G7CA 1OKKD 1EFHA 1R2QA 1ESMA 1KDPA 2R6AA 5HKKA 4PHHA 5L3QB 4FCTA 2EFEB 1CF4A 5EJEA 2QRZA 4Q47A 3SBEA 1S3GA 1U9IA 1SGWA 4NCNA 3ZVMA 2LCFA 1SULA 2ZRLA 4NKRA 4HLDA 4PHTA 5KDLA 1JI0A 2X77A 1RRCA 5HTKA 1QF9A 5SZIA 2WAXA 4US1R 2IEYA 3K9GA 4GNKA 4B3FX 1UDXA 4IVRA 2GCPA 5FTMA 1GKIA 3B6EA 2EYUA 4EPXA 3CUEF 4RY2A 3LBNA 3QVVA 3TKLA 1Q3TA 2JJ1A 3TQFA 1T3SA 2NO1A 1E0KA 2ZU0C 3BBPA 3BK7A 3LAWA 1E9BA 2H1LA 4PC2A 2WMNB 3T35A 2R62A 2GAOA 4B2LA 1KAOA 4I1VA 1JBKA 4BFWA 3JVVA 3NDBB 4YLGA 4KU4A 1XF9A 2QGZA 5LD2B 5C2JB 3MGCA 4LV6A 4FMDB 4MRVA 5JRZA 1FNNA 2D7CA 1BH2A 2FNAA 1BS1A 3C16C 1J99A 2B21A 2A30A 3A8TA 1VG0B 1S4QA 2BV3A 5TDHA 1QHIA 2O0JA 1Z6GA 4B76A 3BAFA 2FJUA 2MSCB 1VCOA 4PC1A 4RCYA 1ZUNB 1AKEA 1OLOA 2ZE7A 3CPEA 3NH6A 2XXAB 4OQNA 4LJ5A 2GEDA 3NEJA 2AK2A 4R98A 1IXZA 1KO5A 4I81A 1U98A 1Z6TA 3MMPA 5FBWB 2ZI4A 1T6NA 1U8YA 2PH1A 2H92A 1BIFA 2OV2A 4MA4A 5C4MA 2A7QA 2D2FA 1W36D 4H1VA 4OQXA 2IHYA 3RSLA 2CE2X 2FF7A 1I4LD 5G3ZA 1EWQA 1UKYA 1F2UB 4I1UA 3EPJA 5JWOA 2H5EA 2QMEA 4GP7A 4I1SA 4N0DA 2QAGB 1A2KC 1U8ZA 4C0AC 2V1UA 1XCMA 5JSZB 4DIEA 4PO8A 2QUZA 1NP6A 2LKCA 3K9NA 4GMDA 4LHZA 5M04A 4A36A 4NCKA 4Q7JB 3KUCA 2FA9A 1PV4A 4B6FA 1ELOA 1KO7A 1N5KA 4M8NE 2D3WA 2RGEA 3GLHA 4JT2A 4TLBA 2A2ZA 1NMXA 3DL0A 4PFSA 1VG8A 4QGGA 1KZGB 4ARZA 4HUQB 3QUSA 5SZJA 2AD1A 2IYUA 2ZRAA 4OQLA 5FUXA 3ZZUA 4AC9A 4LHVA 1JR3D 2HXSA 3Q72A 3GLIE 2NMVA 4JLDA 4HAXA 1CRQA 3ND9A 1VHTA 4JIMA 2G77B 1FNMA 1K6MA 3DO6A 2C95A 1E2HA 5EP1A 3PXGA 3FE2A 4Y0AA 1P3JA 3QF4A 3MAAC 4PSKA 3QXSA 2KBFA 2JJ2D 2YV5A 1P9WA 5IT5A 3I61A 4X8OA 3TQCA 3ZZ0A 2H7VA 4TMTA 3SE0A 1E9DA 2V7QD 2PCLA 1EFCA 3LLMA 3MWJA 3EWAA 2PX0A 4M9XA 1N6OA 2IS2A 2ASEA 1SVIA 1C4OA 3GFPA 2R6FA 3KDSE 1OFIA 1NNEA 2P5SA 3DMNA 1RZ3A 2OAQ1 5B64A 4II7A 2CBZA 2IWHA 2F7SA 2VSXA 5FPTA 2UZIR 1FQJA 4Q9JA 4DCNA 3FB4A 2CNWD 2NQ2C 2KI5A 3EWSA 1Q44A 2QEQA 4HDQB 1S9DA 2WWYA 2JLRA 2QQEA 1QRAA 1KMHA 4CF7A 2OBMA 4OI1A 3GJ0A 5FOSA 4A92A 4JSTA 3LD9A 5CM9C 4OK5A 3FKSD 3RWMB 4R9UC 4KBGA 1LF5A 4GOXA 3C5CA 3IIKA 2IUSA 2Z0MA 2VBCA 1NL3A 3RS3A 1Z0FA 2RCNA 1UADA 3KKOA 3QXXA 2ZYUX 2XTMA 2J0VA 3B1WA 4V0LA 2H18A 2OBNA 3WMGA 4NL4H 4P0TA 4ARZB 5DNYB 2W58A 3X2SA 3I72A 1HUQA 5GJCA 3CRQA 1RYHA 1JQJC 3BH7A 2CL0X 2QSZA 4OBEA 2QI9C 3C5HA 1XZQA 1NN0A 3KTAB 1ETUA 3NTUA 4I1OA 2EYQA 4TQ9A 3BH0A 3THOA 2QORA 4F92B 2XAUA 4M1OA 1XDBA 3QOFA 4Q02A 5AUNB 4PXAA 2PL3A 1IHUA 3R9IA 3SJBA 1E2LA 4CEHB 3R20A 4UNSA 4URUR 2R65A 1KK3A 3NHAA 2OE2A 2X8AA 2ORIA 3K9HA 3NBXX 4O25A 2GCNA 1GILA 2BMEA 2WPDD 5A5GA 3Q7PA 1SVSA 2ANBA 2JJ1D 3MSXA 4KI0A 4HAZA 1YZKA 2QTFA 3I1FA 1SXJC 2FEMA 3IDQA 3QF7A 4PTLA 2GNOA 3SR0A 4C3ZA 1E2EA 1E9SA 4NBSA 2QT0A 1VG9B 2XJ4A 4D26A 2WWGA 1PUJA 2P6RA 2Z83A 1F48A 4MRSA 4QNMA 4UJ5A 2O52A 3CNNA 2C9CA 1LB1B 1IY0A 4CEJA 1FPMA 1KO8A 3T61A 3I5XA 4UQOA 5FR1A 3W3AA 4DXAA 2B7CA 1CJVC 4DZZA 2XITA 2GXUA 1SHZA 3I8XA 1Z0DA 1QHGA 2BDTA 2GCOA 4MKGA 4GOJA 4D6PA 2BBTA 4PQYA 4CT5A 5JMTA 1VPLA 4ON9A 4EDHA 3U3OA 3LLUA 5G40A 1TEVA 4IDNA 1IONA 4IVPA 2B92A 2F9LA 1VDZA 1OHHA 3CX6A 2NO6A 3WYAA 1NVVQ 1E9RA 3UKDA 2EWVA 4F38A 4B3XA 5E7MA 3ASYA 4K8OA 3A37A 4A2WA 4YDHB 2QZ4A 5TV2A 4LYFA 4ESHA 4IEEA 4P3YA 4BWYA 5CJ2A 1S96A 4E03A 4ZDKA 5J4HA 2HCBA 2C78A 1JR3A 3C8UA 3DZ8A 2O8FB 4KVGA 2ZR9A 3EXAA 2FE4A 4Q03A 3PJRA 3MD0A 1XPUA 2J0UA 4JVMA 1FOEB 3M0EA 3NG1A 3W9YA 1WBDA 4OJKA 3SU8A 3U6BA 3LWNA 3THWB 4Y0VA 5FUYA 3RLFA 1DG1G 5KOYA 3EASA 4FW9A 3ICQB 4F7WA 3KQNA 2VSFA 1AZSC 1MOZA 4LI0A 3DEFA 3OIVA 1C1YA 1N0VC 2XSZD 1YRAA 2HYDA 1NF3A 1N25A 4W5JA 2ZRCA 3H84A 5IDVA 3WHLA 5JHHB 4EJSA 1DTSA 4TWZA 2DFNA 2XNDA 3LW7A 4NHOA 5JJIA 4NYIQ 3CWZA 3W34A 3FFAA 1XJ0A 4MITA 1KYIA 3A4MA 1TQ6A 2VSOA 3QXHA 1Z5ZA 1W1WA 2KBEA 3B8HA 1NVWQ 5LBIA 2FN4A 1M8PA 4LJAA 4YMWA 1VKJA 3RS4A 1D2EA 2F1HA 5LD2C 4JT4A 2G3YA 1E9CA 5FPSA 2NGRA 1R4AA 2G0NA 2VHTA 4JJKA 4QGFA 1QVRA 3QPVA 1CJKC 2GVZC 3AVQA 4TQAA 3U3JA 3HU2A 5DLQC 3QNUA 1YZLA 1W36B 2UKDA 3AP2A 4PR0A 4RCZA 5J4YA 1ZC4A 4ACBA 3LO5A 4B43A 3TMKA 1Z47A 3IQWA 4Q1BA 2D4HA 2ZREA 3EZ2A 1WXQA 2ZI5A 2WSSD 5J4LA 3A58B 5CLLA 4PSVA 1O3YA 3B9PA 3X1YA 3SQWA 1GRRA 1M34E 1Z0IA 2RAPA 1MO4A 1UFQA 4BASA 4GT1A 4G5OA 2QM7A 3EG5A 3GEIA 3QY0A 1OJLA 4WVFA 1G7TA 1KSFX 4TZ0A 1E9AA 2JEOA 1DARA 4HEJA 4B33A 1EFTA 1FX0A 1NN5A 2JLSA 2ODWA 2WJJA 2ZS9A 3CNLA 3IPXA 2OCBA 3P20A 1F2UA 2DFKB 5GJWC 4B3BA 1JPJA 2QROA 4D81A 3GPLA 5AUQA 1PLKA 1LTQA 1JPNA 2E1RA 2ZIAA 4IOKA 2JLYA 3AVPA 4OK6A 4A2PA 3E70C 3EIEA 3IIJA 2DBYA 3AVTA 2A9KA 2QPOA 1II0A 4M2LA 4AYTA 3HWSA 3ECCA 4FI3C 2W6ID 4Z1MD 2REXB 2O8EA 2WJYA 5BYKA 3UWOA 3BORA 2IXFA 3IBYA 3OAAD 4LV5B 1NVVR 4G3XA 1ZP6A 2JLXA 4IXMA 1Z2CA 3OIYA 4TL7A 1JJVA 1GP2A 1NIJA 1ZUIA 2GJAA 2MMCA 4IOLA 5UKDA 4BEJA 3THYB 3P26A 1XPOA 2BC9A 4FXPA 3DOFA 1XTIA 5DIFA 5JI2E 5DYGA 2HDNB 1DO2A 1AS2A 1M74A 3KKPA 5FL7A 3ONWA 5J40A 2WJVA 3SQXA 4BLRA 1G4AE 1DPFA 4BFVA 1I2MA 2ZUBA 4MQBA 3EIHA 2QMHA 1GVNB 1XJQA 3HDTA 4GRAA 4UXHA 2ZETA 4UNNA 3T34A 4QXAA 4TL8A 3GQBA 1T0JB 2R6CA 4LHYA 4Z54A 1NG1A 2VF8A 4IOMA 3B1XA 1E6CA 3ZZTA 1A7JA 1UKZA 5JJKA 3TVTA 3VR6A 1DAFA 3A1WA 1YZUA 3RDPA 2L0XA 2EFCB 2VRWA 3FHTA 3PEUA 4BLSA 3MCAA 2DR3A 2IYQA 3RWOA 4A6XA 3JVUA 1I4DD 1CXZA 1NLYA 1OKKA 2CK3A 4RJLA 1JR6A 4DDVA 2F55A 4A4DA 1CS4C 1ZM7A 4EPTA 5JZVA 4XJXA 4A8JC 4ZO4A 3RRNA 1XCGB 2V7QA 5EUMA 1GRNA 1TF7A 2RGXA 1LW7A 4FCWA 1UEJA 4D4MA 5FBLB 4ZCIA 4FWTA 1YR9A 3CF0A 3CONA 4TL9A 3AVWA 3K0CC 2XZPA 3TUZC 4QBFA 1R0XA 2ZYWX 2IUUA 3RS0A 3U44A 5JWHA 1AA9A 1GL7A 4HZUB 1IBRA 1OB5A 5E95A 4AKIA 3WP1B 4P32A 2ZQ5A 1Q20A 3SJAA 4LUCA 3N2IA 3OE7A 1KK0A 4Q9IA 3V4RA 2O8EB 3UG6A 2O0KA 2IA5A 5JEDA 4TQUS 3KKMA 1FMLA 5AJWA 4AG5A 1VIYA 1ZMXA 2BMJA 4IDPA 1XTKA 1FTNA 2CL6X 3CRMA 5J5CA 1U0JA 4XOIA 5JS8A 2WOJA 3GLIB 4CEIA 4DJTA 4FWIB 2J7PD 3H0KA 4EQ6B 3QPWA 2GVDC 1GNQA 3Q5DA 4PQFA 1W0KD 3VR3A 5F98A 1Q57A 4A1FA 2J45A 1N6IA 3BGWA 3VNUA 3AVOA 4XVUA 3R9XA 4Q66C 1E69A 2WM9B 3U6KA 2XOKD 5JS7A 2XGJA 1Q0UA 5BN5A 1ZINA 3QKSB 3HR7A 4OHVA 4DT1A 2RGBA 2WICA 3SEAA 1W4BA 2W2XA 3GJXC 1RIFA 4XIGS 1UKEA 1KJWA 1J7KA 1AIPA 4Q7LA 4RFSB 2GAAA 2FFAA 4A8JA 1KO1A 1Z63A 1BKDR 4JLMA 1IN7A 2IF0A 1E2DA 4U5XA 4IW3B 2ZVQX 5EZ5A 1KSJA 2G1KA 4CZ2A 3GLGB 5FTNA 621PA 1IXRC 3CR8A 2CDNA 2ZI7A 4TTQA 3P27A 3C15C 4JKIA 4PPQA 2Q3MA 1SVMA 5FR2A 3RANA 3ZVRA 3B1ZA 4KV9A 4OYHA 2QM8A 3KUDA 3ZS8A 1DAIA 1W2GA 3U44B 2A5DA 3GLHB 2IK8A 3U3KA 1T5LA 1EFRD 4DLUA 5IF9A 2F43A 4G5GA 1NLFA
chains in the Genus database with same CATH superfamily
1PDWA 3CZ5A 2FSIA 1FDUA 4TV8A 3G9QA 2E4UA 2NO7A 5JHGB 1EM8A 2NO0A 5AVJA 1R6XA 2EJCA 2ZAIA 4GPBA 5E3HA 5KOHA 2PQ6A 3BTVA 4LVUA 2SKEA 1TEZA 2Y66A 3MM4A 1BE6A 1IWOA 4GIBA 4J3NA 1KI6A 3L79A 5K0ZA 3PR1A 3GAMA 4CM4A 2W6JD 1OSNA 3F78A 3NVMB 1U0LA 2MYUA 2N75A 1CQZA 3K1JA 4O4HF 4OMUA 3ZQUA 1LC3A 1KJQA 3VZPA 1CUFA 4YJ2B 3HXQA 1GPLA 3OM0A 1JIQA 5AOCA 5HZMA 3TOXA 4HN9A 4DV1B 3BEDA 4UBOA 1YS7A 5ALLA 2W6ZA 4D97A 2WK1A 3GR6A 2X0JA 1C80A 3ACDA 4CR6A 2ISCA 4X0EA 2GLTA 4QGBA 5LKRA 3DLCA 2PJDA 3BA6A 4Q18A 5GADl 5EXPA 4AZSA 4WL0A 4EB8A 1GZ6A 2G08A 3L8ZA 4BO0A 4D99A 4YRZA 1W7AA 2XNDD 3TR6A 4QJBA 3N8DA 3ZGNA 5ICSA 3EAQA 1SZCA 3NC1C 3TZHA 4B71A 1NN3A 4ND6A 2IEIA 4F6RB 5FWYA 4L07A 1PJLA 1Y8CA 3SX2A 4ZJZA 3QU5A 4LHWA 3R7NA 5BPFA 1E79D 5B58C 2QUJA 3L7KA 3OZWA 4IZOA 4CHGA 4IIJB 1DC7A 1XRMA 2DLNA 4HS4A 4EA6A 1Z39A 1B6TA 1IL0A 2J1LA 3RU2A 3IDZA 4I9FA 1J8DA 3OMXA 1RABA 3QE2A 4HGRA 1EFUA 2P9BA 2W8ZA 3RFVA 2CJFA 4ZI7F 3GLIA 2FX2A 2A7XA 1U99A 3TL6A 4BBAA 3V80A 3NR2A 2AXPA 3SYLA 3GVPA 2W7TA 1BX0A 4ADSG 2CDAA 1JHZA 4OH1A 5KNCD 2CMDA 2G9RA 5THXA 1U04A 1LBQA 3E0QA 1MR3F 5JH7F 5JLJA 4MUXA 5A02A 3PEYA 3LT5A 1GEEA 5CCXA 3DXFA 3PPVA 2HSDA 4NICA 1E1CB 3ZWNA 1Z62A 4YASA 3QYPA 1G9SA 3MCZA 3L0CA 4OP3A 5SZKB 3R8CA 4E70A 4MGEA 1GG8A 1U2TA 1KI2A 3HACA 4M0KA 3CUYA 4O4HA 3HO6A 1C8KA 5ES3A 3ZDDA 1XWIA 2YJ4A 4KWTA 3W8DA 2BFCB 3L93A 3RUIA 1FIUA 4YAGA 5AI6A 4D43A 3SSMA 3RIMA 3REGA 4BY9E 4RSHA 1X86B 4I8DA 5DULA 4EG7A 2Y9MB 4FEYA 4YRNA 3M3PA 2BUCA 3QVLA 1U2SA 4GI5A 4N7MA 3UFXB 4WJKB 4WRRA 1DTWB 2VTBA 1SZDA 4LRWA 4KO1S 4IVNA 3UMVA 2H0RA 1U90A 2RGWA 4JJ4A 5GM1A 4F4FA 3ICCA 4HCJA 1I01A 1G3MA 5CH8A 2DHRA 2FZCA 3H4TA 2ZFUA 1Y42X 3PGLA 4HQRA 3D8SA 4W9NC 4Y9DA 1Q12A 2XY4A 1YULA 3ZW9A 2HGZA 2VP5A 4D44A 2Q5HA 1P9RA 4V1CB 2FSFA 4EPYA 4KKVA 1EE9A 1TYAE 2QVBA 1POXA 3CPHA 4BC0A 3SVZA 5I4KA 4CKBA 2JW5A 5IDXA 5I9IA 1ULZA 2ZIVB 1HY3A 1MB3A 2WG2A 4BBJA 1TO1E 4IDQA 1RJGA 3PTLA 3E61A 4K5QA 4WN9A 2V4MA 4KQHA 2DWOA 4WXMA 1YOBA 4LOAA 2ECFA 4LDRA 4XLTA 3UH1A 5FHRA 1WO8A 4DY4A 1Z29A 3NUZA 4EJ2A 4HB4A 4L5IA 3MHTA 5MF6A 1OAOC 1XDGA 4LYYA 5HJ7A 1S1CA 1P33A 1OZAA 1QIEA 5KJ6A 1L1RA 1Y1TA 2PKCA 1IM2A 3HWX1 5JY1A 1W0KA 2JIBA 3VR3D 4ZCPA 4FR5A 2R1ZA 4HH4A 3TD9A 3WWOA 4FUTA 5BW5A 4RK4A 4LCEA 5CCBA 5JCZA 2QRHA 1IXKA 3TOZA 3Q3VA 4RKQA 1BDIA 2RBGA 3A1SA 3A9RA 3FX2A 3V7UA 5CXSA 1DFIA 1A2OA 3H8VA 4C03A 3RRZA 2OP1A 1L4LA 2IVZA 2YY5A 1S3FA 4NG4A 3EPPA 2F8LA 3J80A 4L1KA 5IDQA 4FU0A 2OO3A 3H3XA 3EQ2A 1CNEA 1PZNA 2CLDX 4OQYA 1G9TA 2JARA 3SMVA 2JFVA 4DC1A 2IRWA 4RJTA 1AMOA 1A82A 4MYRA 3WQRA 1TLTA 5CA1A 4MLDA 3PT9A 4LXYA 4Q93A 1Q15A 1XFAA 3F2IA 4HFRA 3B52X 1L5LA 1NURA 3AM1A 4XVQA 5KNCH 5EMHA 1WBBA 3HKBB 2WV7A 3E53A 1XLUA 3W78A 4O4LF 3OE4A 4D46A 4JVLA 1I1NA 2IDKA 3FCXA 1JR2A 1QAOA 2FQWA 2KLHA 1D2MA 2B7BA 3EHEA 5KYXA 4NJOA 2GHTA 5GY7A 3DXXA 3NTXA 2QTVB 3RUCA 4JLOA 2EV9A 2HK9A 4MKHA 3Q41A 1GFSA 2XF8A 5EEGA 3LGSA 4R31A 4BNTA 1R0CA 3KCNA 3USES 5JTUA 1IH8A 1WUYA 2NVUB 2GTPA 2RCYA 4LZAA 3GLUA 4HD8A 3R9WA 1H1TA 2BFWA 521PA 4YV1A 4UAGA 5AI0A 2C4UA 1V7CA 2CCKA 4MA5A 4Q9HA 4Q6BA 1GU0A 1DSSG 1NE7A 1TAHA 3AVVA 1HZZC 3REQA 1TGVA 2UYYA 3A9SA 3QG5A 5BT9A 3ZHVA 4BWFB 3NANA 4KO3S 2W2OA 1O0SA 1Q0HA 2C0QA 5COQA 5JZOA 1KI6B 4WTOA 4B0OA 4E2XA 1BMDA 1KYWA 5GIOE 5F33A 5ALPA 2VJMB 2C9DA 1EK0A 1JA0A 2D5AA 1J20A 1GNSA 1FS6A 2QOEA 3FRHA 1OWMA 2EZ8A 3IB6A 3M4NA 4R40A 4NHEA 3WG9A 2ZUWA 4TZTA 1TPZA 1UJ4A 3I2JA 4OMCA 2WWXA 4RY0A 4OA5A 4NZ9A 5FFFA 1CULC 1NPYA 1WXGA 3P45A 4CF3A 4CIXA 2D1SA 3RTEA 2BHTA 5CNKA 3OKCA 2IXGA 3Q3CA 4FKMA 3V1UA 3ML1A 1G17A 2QAIA 2ZJ2A 1IN5A 2ZW9A 3VUEA 3KVYA 4ER3A 4ENPA 1OR8A 1T4BA 1ZIOA 3KHTA 3BD7A 5BNFA 2WSSA 3CWCA 3OIWA 2OWDA 4YQFA 3AF3A 4ZT6A 4PYOA 1GKLA 3IQDB 2RIPA 3TZQA 1BD3A 3AR4A 4WW0A 4AY5A 1K1EA 3IQFA 1H6BA 4U02A 2IS4A 3FA2A 4DM7A 1W0JD 4KIJA 3OI7A 3IHTA 4YRBA 4MPJA 4JBGA 3T4XA 4B85A 3VI3B 1HE5A 4NCHA 4HDKB 4B3RB 2FP4A 4C4YA 2PSHA 5K99A 2P1DA 5EQDA 2AJLI 5GVSA 1P31A 4RV9A 2RC5A 4ZOLA 3RF7A 2AGVA 5CTJA 3H97A 4D80A 5CXUA 1NM5C 1QPGA 2YIMA 1W49A 3K0AA 3NKLA 4FILA 4GU5A 4NLLA 3VU0A 5JOQA 1XKTA 4LSGA 3W8RA 3V6LA 2IL1A 5EWLA 1QFZA 3CBGA 4RVGA 1RFGE 1QGZA 2VPTA 1H0SA 1UPXA 4HFNA 4ZJYA 2DQKA 3OOWA 3OEHA 1MOSA 4TKMA 1WVIA 4A8JB 1SEVA 1IOWA 4ZI3A 2OCLA 1XNJA 1FLVA 1Y5LA 3Q88A 4RMHA 4XKJA 5EE0A 5FJJA 4DQLA 2ERXA 5K3SA 4AK9A 3DMDA 1K8QA 4HWPA 4RDXA 2QI9F 1MRZA 2DJ5A 4OQDA 4RA6A 5AW8A 1C2YA 3GFRA 4G0OA 4M98A 1WQ3A 1UBKS 3ETEA 1XLVA 4GLLA 4QLBA 4QWWA 4F3YA 3SI7A 1GXSB 3LSTA 3AW8A 3P1JA 2LBPA 4UCXA 4KQIA 1X7XA 1TMKA 2EGHA 3B70A 3C24A 4LECA 5KAPA 3BB3A 3HLTA 3TL3A 3CVUA 2RKOA 3FSGA 4X8LA 3ZWVA 5ECDA 1FMTA 4F3RA 3GLHE 1CR4A 3JYOA 4L8YA 2O8DA 3ZWKA 1QV6A 2BCEA 1ZMRA 4R6WA 1E8DA 4LQCA 2QAGA 2OHHA 4P5EA 4MIOA 1UJMA 3OD1A 2Q7DA 3DNPA 5ALTA 3W5DA 3RSQA 1EUQA 4BJ1A 2JA2A 3TE6A 1B93A 3RS5A 5K6AC 4J1QA 3WB9A 4D5GA 4JYZA 2B4QA 1L7NA 2OENG 1X8LA 2QRVA 5F64A 4C0KA 1EVJA 2HC9A 4JN6B 1U1CA 1Y8QB 1IXYA 3THWA 4CQLB 3SNHA 2O19A 2NSLA 3CTPA 5EC8A 4PCVA 4CMBA 1VA5A 4FXOA 2BELA 3UOGA 2XDYA 2PK3A 2Q3BA 1O08A 2XEXA 4BNDB 4LHEA 2YN4A 2Q2OA 5HA5A 3ZE7A 2GTHA 4U4AA 4WN9B 4Q3BA 3BRWA 3DCNA 4IPTA 4KFSA 4IGKA 3AU9A 1O5IA 1XU9A 1PQYA 1Z13A 1R0WA 1QQTA 1DEHA 2I3ZA 1FC0A 4IDCA 3DDUA 3LLVA 4MQLA 5ERGB 1CY2A 4CM8A 4ID9A 2G9NA 2AC4A 4MV7A 4NONA 1QC5B 4RQAA 3FY4A 4WY5A 4QTYA 3DPIA 2UXCB 3MWDB 2XXJA 4OOFA 4WOPA 3W3ZB 4RORA 4MCAA 1JJAA 2I8CA 1JIVA 5FULA 4HV4A 2V3CC 1L8LA 3IBGA 2YY7A 2G4VA 3BFXA 3HDJA 2OO5C 2W48A 3OFVA 1OFTA 3PK0A 4GR5A 2GESA 2ODBA 4LMBA 4W63A 5JNUA 2K87A 1EWKA 2ZAMA 3IAHA 2ORVA 4TKVA 4R1NA 1GCGA 4G2TA 4MW2A 2WNSA 4L5AA 1ZD8A 1JIUA 1PNTA 1YZ3A 5ICEA 1QP0A 5IC5A 4RVOA 3WAKA 3Q15C 1P4RA 4YP9A 3MQ2A 1B8UA 3CT4A 4JLBA 3FOWA 1L7VC 3IEKA 2DPHA 5DTMA 1EX6A 1KXZA 3FTQA 3JAKA 3FWHA 3BMQA 1SQFA 1U0GA 1VCMA 4ZYWA 1O5OA 4DJAA 1C3OB 1RBQA 1ZJYA 4KVAA 4CODB 3Q85A 1GAEO 1DJQA 3UHFA 2DAPA 3OQPA 5ALDA 2B1JA 1R0ZA 3KZOA 2IXBA 1FF9A 4WDQA 421PA 1ULTA 1II8B 3BSYA 3EG9A 5EZYF 1QH8B 3O8OA 5CNMA 4B3HA 3IA2A 4UVDA 1FS5A 1AKUA 3CA8A 3A6JA 3I6YA 2BW0A 1X0XA 3PHGA 1D09A 4MYCA 5BN5B 1AHNA 2Q4DA 4HEA6 2BUAA 1K9SA 3PZBA 5B1IA 3QJ5A 1WEKA 4JITA 1JAXA 3QHAA 5BN1A 3M1AA 1A9RA 1RC8A 2QTVA 4I9GA 3OAAA 1C4XA 1NR1A 4FP9A 1N9KA 2GEUA 4FW8A 4N8SA 2GH1A 1D1PA 2Q0SA 1NV9A 1QH0A 4IQGA 4BQEA 4UPEA 1BE1A 5K4HA 4IINA 1YKFA 4H15A 1ZJ6A 3VPAA 3ZTWA 3R5SA 3JZAA 2D1QA 1HFWA 1OPXA 5AWFC 3SP1A 3SXJA 3PHBE 1KJNA 2ZWIA 3NIBA 3O73A 2H7CA 4TTJA 3FGZA 1YVRA 5ADVA 2VZ8A 2JCGA 5LZ5A 3IIMA 1X8KA 4URZR 4LTDA 2BZSA 5FA6A 1VECA 4IYJA 3AF6A 4UTOA 4EJ0A 2P9GA 1QQ7A 3RUDA 4XWWA 2WU8A 5AVQA 2HK8A 4DLVA 2YJ3A 1TYEB 3G68A 5KOHB 3AYXB 5ECYA 4G5FA 5EJIA 1PU2A 4ZQGA 2RHTA 1JKIA 3BSWA 1CB7A 4FDVA 4KPFC 3NTLA 1NUSA 3VO8A 5BNWA 4W5RA 1RRCA 2IZ6A 2RGNC 3A3OA 5KKAA 3UTCA 5L6MB 2GI4A 1ONPA 4FGUA 3KBOA 4R1MA 1GPNA 2G5CA 2HSEA 3KM0A 1O95D 2BJVA 3R7DA 5EP4A 2CXTA 5CDFA 1X1EA 1Y9JA 1UBCA 5M3BA 3DDCA 2JFUA 4C1NA 4YJ2A 5E7IA 1WCV1 4GZ5A 5AVVA 3PKZA 2AQKA 2DERA 4BQRA 1SCUA 3JQAD 1WLYA 2GXSA 1S02A 1Y4UA 2P2DA 4GEKA 3FLMA 4PLFA 1V7QA 1WE2A 4R8VA 5EVJA 1JT2A 3VKWA 4C4RA 3KOWA 1DZ3A 4HF7A 1I3MA 1YKGA 1U6KA 5CIWA 3ONFA 4O2RA 4PHCA 5DGTA 2ZB4A 2RE8A 3ZV7A 2ES4A 3BULA 4G2NA 4G9BA 4OBWA 2PT6A 1AB5A 4G4IA 3D64A 4RACA 3TFWA 5IYZA 2ADFA 4Y6GB 1SOAA 1YWGO 4YAOA 4B6QA 5G0VA 2WSBA 2BTQB 3U3MA 5KJ1A 4QAJA 3WRYA 2H9AA 2QTMA 3PXAA 2VFAA 4Z7NB 2B82A 3O8LA 5ANRB 4ZVNA 2W00A 2MSKA 3ANXA 2WYHA 3R7AA 4LCBA 4C20A 1AKQA 2HPHA 1KDRA 4C4SA 3B60A 4P38A 5A2QA 4QGHA 4X6YA 5EJ2A 2PRZA 3W1EA 4HG2A 1SXJB 1TADA 3KB1A 3LVBA 3FOAA 1ZOSA 2HGSA 3SOZA 3WYBA 1P5FA 3ZE2B 1VGRA 1WIWA 2PR2A 1PRYA 3D4LA 2W2KB 4FE7A 4G6ZA 4FBGA 3K6SA 1NI5A 2WIKA 1XVAA 1TQDA 5AD1A 1K5GA 3I58A 1DV1A 2OQIA 2Q1SA 1DKPA 1GAQA 2B8EA 2G82A 3AR3A 1L7BA 2XUKA 3M5CA 4B6SA 3HB7A 3K0HA 3PUIA 2N9UA 3NOVA 1SD5A 1ZDMA 3HYLA 3LWDA 2CK3D 1YDEA 2EKLA 4Q7MB 2XQVA 5EXEA 2OB1A 3P4YA 4JI5B 4BQSA 2WM2A 4YECA 3ZGOA 4E5YA 3I83A 1M5TA 4UEJA 4DMRA 1JIKA 1GV1A 2HRRA 3FROA 4Q9KA 4HATA 2DSTA 3VNVA 1KTIA 1NPTO 4HKTA 4JEMA 4KJZA 4ZYVA 1EJ0A 4X7MA 2IYYA 3NKVA 1EZZA 2WP0A 2QX6A 1B8NA 2ZJ8A 3RT7A 3F1LA 3G9UA 4BLUA 3PFWO 1YS9A 3NATA 1XQYA 2RH5A 4N5NA 4G0NA 5DNDA 1JLRA 4TLMB 5TRTA 1RWXA 3X2FA 4AKSA 3MA0A 1T8PA 5TEVA 1F4LA 3I2IA 2C7BA 2CLEB 1NWHA 3Q9UA 4FI3F 5K3DA 5KNBA 3IE1A 3T7JA 3WMFA 3VHQA 3AJDA 3KTAA 3W06A 3TF5A 1S3IA 3B3AA 4D2IA 4NBTA 4OQMA 3IQIX 1W85A 1W46A 5B3AA 2G0TA 3GDOA 4P4NA 1BFDA 3HL4A 1BDBA 3EJWA 4XD7D 4K1XA 3WZMA 4DEXA 1Q0RA 5TSDA 3ZS9A 4RVFA 2PGJA 4QBHA 2GNAA 5H0IA 4QUDA 4J0EA 4LRQA 1A04A 1AU9A 4BZXA 1S8FA 1DAHA 1TZCA 5AQ1A 2VQDA 4C7VA 5DLEA 4D0NA 2O8CB 1DMRA 3BC1A 2C7PA 4NH4A 3WRXA 4B7XA 1QO0D 5BORA 1KXJA 4P7BA 3OLXA 2IIVA 1U65A 1P4GA 5EE5B 4NATA 2I55A 2I91A 3JD4A 3KKNA 1LLUA 4EF5A 3ONDA 5AVXA 1US8B 5HSGA 2VKTA 1AQIA 5K2OA 4B48A 1LFAA 1U1IA 4BP3A 2VSNA 4FDUA 2Q5OA 3A36A 1H8HD 2V7TA 3BMOB 5KS2A 1ZM4A 5EWMB 1WW2A 3DV0B 3PDIA 3WGGA 3HUUA 4BVBA 1DXYA 1ZMOA 1E5QA 3HN7A 5AOVA 1Q1EA 3FYHA 2H4HA 3H4MA 1PN3A 1OAAA 2I71A 4CLRB 1CBUA 4C2BA 1XQWA 2VH2A 3G3EA 4G0PA 4MIKA 1P1KA 4OHBA 5C8YA 4J75A 2IH2A 2AN1A 3WWPA 4C0JA 1GZHB 3G5TA 1E60A 4OFWA 1GPMA 4PIMA 4OI0A 3QJYA 5CFLA 1JNYA 1NVUQ 4PPFA 2PPVA 2DWCA 3DYBA 3P5BA 1P5RA 4KW7A 1YJQA 1Z6AA 1TNDA 4RELA 2IXAA 5IASA 1T8RA 2R1TB 5JANA 1V5IA 1RWVA 3BD9A 2IYZA 4ZDIA 1C2TA 4FJ1A 2IGTA 4YP1A 3BIFA 3FM9A 1EFRA 2QP3A 4GPD1 2RC6A 3C4JA 3UHJA 3KQKA 3P9ZA 3UGJA 1USWA 3AFOA 1BXGB 4CMIA 1VI6A 3JSXA 3HS3A 4J1NA 4M7WA 3A1UA 1VLVA 4UFOA 2PL1A 3DEZA 3UWSA 4YUVA 3DXYA 1UIRA 3KFVA 5G3YA 3QSYA 2XTNA 3UWMA 1KMCA 2SCUB 3WB0A 4Q3EA 1SR8A 3MJEA 1C0PA 4UU1A 4KH0A 2QRPA 2JDIA 1BVHA 1UBEA 1PLJA 4UTXA 2O59A 1XEFA 2WF8A 4M8IA 4OM7A 2DEUA 2XB9A 2H1FA 1W19A 2HIHA 2PBRA 2VATA 5D5PA 3G0GA 4NYMR 5CDSA 3LY8A 4NG5A 3GG9A 3ICOA 4O5OA 3ZI0A 5HUQA 2ZBQA 4GX2A 2GRJA 4DANA 4XGKA 2AVNA 5KJFA 4POAA 3LRTA 1J09A 2H4WA 1UDWA 3U4QA 2JIZA 3TAHA 3ETHA 4ZICA 1UPBA 1RXSA 4WK4B 1MW8X 2JJMA 1NFRA 3L82B 1LDEA 3VTAA 2FUG6 3UC5A 3OTWA 5IHPA 1K89A 1ZXXA 3R6DA 4KPYA 4XPIB 3UJ3X 3N07A 4YYZA 2CFCA 1Z4JA 4NAHA 1SKAA 2YXLA 3DHYA 3D7SA 3OQJA 4LG1A 3W5IA 4N0PA 5IKMA 3ZOZA 2CL7X 4OL0A 2UUOA 3HO1A 1N6KA 2BMWA 3ROFA 2VQEB 3PPWA 1EVIA 4Y2UA 1KYYA 3ZIUA 1EM6A 2DBQA 2WWWA 5ADUS 4BBZA 1ZOLA 1JB1A 2HUPA 3IGFA 5F7OA 2ZUCA 5KSWB 4CVNA 1E1LA 3AR7A 2UV8A 4TRNA 3U60B 3GGPA 3WISA 5HZHA 3TEJA 4FWBA 4UATA 1T5OA 4DQVA 2QT1A 2OUIA 5AM0A 1SKQA 4MR9B 3ZU5A 4BP1A 5A0TA 4TVBA 3DNMA 1G0NA 3HJFA 4YNBA 3NGXA 3STXA 5BN4A 2VOEA 4NESA 3HWWA 1LPMA 3D6MA 3FMPB 4CETA 2FSVC 4XSGA 1HE8B 1EZ1A 2Y1XA 1Q1ZA 2JF0A 1H2RS 1G4HA 4ZA2A 1PJAA 1Z4LA 3EXHA 5IDYA 1YKSA 1T24A 5AOAA 3OX3A 1CIVA 1NMYA 1U28C 3L1HA 2XA9A 3A10A 3OPXA 4GD3Q 4K46A 4L5CA 4RZIA 1Y1QA 2NYAA 3A25A 3C5VA 4JAVC 4Q4DA 5JQGA 4AY2A 2PZEA 3EFOA 4RD0A 4MROA 1NR5A 1XCOA 1RM5A 1PQPA 1GYQA 2MOKA 3KV1A 1K2VN 4Q1FA 5CNIA 4HQLA 3KSBC 2ATXA 5DHUA 4ANFA 1H65A 1JSXA 1X1QA 3QELA 2B9VA 4QIHA 5JSUA 4D8YA 4L4ZA 2PT9A 2HT6A 2C9OA 4WFKA 2IEDA 2QVGA 1QFYA 4YMUA 3EXG1 3B38A 4F4HA 1ISGA 1Z4KA 1HM5A 3GEBA 5DHFA 1JEDA 1TE2A 3GRZA 2H63A 4BNDA 2D0PB 2VA8A 3I8SA 1IAVA 3N74A 3DC2A 4TTRA 4QPNA 3AQIA 4WUTA 3GLVA 2XHZA 4IMRA 5H3HA 1VPEA 4IJ5A 1AUOA 1T8SA 4CKCA 5IH7A 4JJFA 1CYDA 1FP6A 2XNCA 4M9SA 4MKXA 1X2BA 3NHWA 4MYUA 1GUZA 3HM9A 5LJIA 1YZNA 1L4KA 4QYTA 1MX1A 4RD2A 1ZJ5A 4JJGA 3K0KA 1WXDA 2HMWA 1EIZA 2X42A 1P1RA 1P4AA 5JU6A 3G5LA 1EQUA 2V7WA 1YB7A 2BR5A 5COAA 1YJ5A 1M2VB 2DUJA 3QP9A 3Q5EA 1AF4A 3DG9A 4PFKA 3OOSA 5LU9A 4ISBA 2EC5A 3FXAA 5JVDB 1EBBA 1V11A 1PT5A 1TA0A 4YLYA 1VTKA 3U4AA 1IYZA 4KMSA 4C2UA 4TSKA 4IYRA 1YDMA 2CMHA 2XCSB 2RK6A 3N8GA 2B34A 2JI4A 2QU7A 1XTQA 1D0VA 3PIRA 1AD2A 4YRGA 2HX1A 2VYVA 1N2GA 3DVSX 4GZMA 3JQ7B 3K6RA 1X42A 3W8NA 2I80A 3E3LA 3GJ7A 1V2HE 2QTHA 1NAHA 2II6A 2RHGB 2V74B 3GLRA 3GT3A 1FX0B 1KL7A 4KYVA 4RKRA 5GZ6A 5BSUA 3EIFA 3TZ6A 4C21A 4EHIA 1TYZA 4NYIR 3ZKAA 2ECKA 3ITEA 3GLFE 4RY9A 5JSKA 3N7AA 2YFKA 3U7QB 4Q4JA 2YMPA 5K8UA 8MHTA 1MAWA 4BU1A 2FZKA 1YBFA 2XMCA 4HFJA 4C4OA 5AVYA 2QTZA 1KIMA 3W6OA 5IT9A 7ABPA 3O90A 1QVAA 3HYTA 2VUSA 3UJ8A 3WGMA 3J81A 5HS4A 3ZDFA 3L3BA 4UEKA 1SUFA 1YMUA 1ETHA 3B8EA 2VT2A 4GBMA 4IQ4A 4ONEA 4DA0A 2X8JB 1SK8A 3CZRA 5BUCA 2Q21A 1HETA 2ZVJA 1FTQA 1FW6A 3CSSA 3NIDB 4RH1A 1VKHA 1L5MA 5CT8A 1LY1A 2J7KA 5BV0A 4BRUA 4PAOA 2GOYA 2HRZA 1UXOA 5DLPA 5HFJA 2OXIA 3AF2A 4GI7A 3K70D 1LK7A 2PBFA 2GR9A 3BB1A 4HMOA 2HEIA 5BR1A 2ZP1A 4B35A 1Q19A 3LQKA 4J29A 3KHSA 2B4KA 1XZPA 3DD5A 3CC8A 2DBVO 3DMFA 3Q87B 4AN0A 4UOQA 3HYRA 4TRJA 2R48A 2MR6A 2XYPA 4NQRA 5J4VA 4MV8A 4XWAA 3Q8KA 1LQTA 1DDGA 1QDLB 2O1WA 2VJCA 3VTKA 4KREA 2X6QA 1M0EA 1KPIA 3WMEA 1L8AA 1WZ2A 1FYEA 3PXCX 1EX7A 4Y2VA 4BP9A 1EM8B 1VCNA 3RSFA 2A5GA 1QYCA 1JFVA 4WASA 1V3QE 1NQVA 4PG5A 4RIGA 1G8HA 2QD3A 1IJKA 4MQ5A 4BFSA 3IKVA 4BFXA 3N8KA 5T64A 3OH8A 3KXIA 2C2WA 4TL6A 1EFPA 1M2OA 2YXBA 3QV1A 1T0HB 3KK0A 2WF6A 3GCZA 4E31A 5KYGA 2OZPA 3OBIA 1XZAA 2V0NA 3PVSA 3L7YA 1DS6A 2C7OA 3O3MB 2OTCA 1CZKA 1C1XA 1X8JA 1P73A 1XTBA 2P2SA 2W6CX 3OCJA 1GGJA 3OEED 3L0ZA 5G0TA 3VO2A 2Z09A 1HMPA 4DVGA 1DOHA 2N46A 1EH5A 2ID8A 3V4PB 3DBRA 1LJUA 4YRFA 1J49A 1FJHA 4AL4A 5HFNA 1Z88A 3QMMA 4MWGA 4A82A 4BNHA 1SUBA 1OIXA 2B8TA 1GA4A 2VPPA 4GKAA 3WKAA 1E1QD 5HIIA 4FGKA 2O8BA 1OWNA 4O4JB 1MUUA 3UBTA 3EODA 3PQ3A 3N28A 1I80A 1IQUA 3N6VA 3JW8A 1RWPA 2HIMA 2SBTA 1F20A 3ETNA 1WXFA 1H6CA 2QD4A 1JSLA 2FGJA 5BV7A 3CHYA 1BDJA 1NQOA 1U7WA 1JFRA 1PW7A 5IPFA 2Q6IA 3DLTA 1F3OA 4H08A 1J06A 2RIRA 4DYHA 5MN5A 4UFPA 4XYGA 4QSHA 2PIAA 4KAXA 2EKQA 3JALA 3SKVA 2XE8A 2R6R1 1CUJA 1SCBA 1XCPA 4PY2A 1R9NA 3VQTA 1DG3A 1SVLA 4X90A 2EZ4A 1ENPA 1GDDA 1GPWB 1MENA 4ZXPA 2FQQA 4YMLA 3TJZA 2CMFA 2CXNA 3UT6A 2KJQA 3OLZA 4JQZA 4RK5A 3I05A 5EL0A 2ZAYA 1ZMBA 2I87A 1U3VA 2PQMA 5EIBD 1J5PA 1NJ8A 1NDUA 1P2DA 2ZYVX 3H87A 4J3FA 4NJEA 4RGBA 4JB8A 4UNQA 2IVFA 4EJSB 2DPLA 2HYIC 4YB8A 3G9XA 2HRCA 1DEXA 5T8KA 5KYXB 1XEWY 5CYGA 1YDHA 5F9MA 2CLLB 3ZBQA 5AVTA 3S1LA 2V9PA 1JL3A 3PG5A 1DLIA 5JD4A 3D3KA 5JT1A 3K09A 3ZWCA 4EUEA 1RM3A 3LP6A 2ZWAA 1W94A 1X87A 1VL6A 4OJTA 1SVKA 2X3YA 4M4SA 1OQAA 4L51A 2A35A 2J3IA 3LS2A 3NTVA 3QLUA 2H54A 4NU5A 2IDMA 4XX1A 4KR6A 3LXUX 1PEDA 4MKFA 4MV3A 3LLSA 3AEQB 1KVUA 3DBRB 1FP4B 1Z15A 3HCEA 4HX2A 5F77A 3K1ZA 4ZHQF 4GL4A 1P18A 1YA6A 1R74A 1Q1NA 5GONF 5I7FA 4HLUA 1WNFA 3WS7A 1YVPA 1WZNA 1RWBA 3NWBA 4AUKA 3RVOA 1B2RA 1G1MA 1XALA 2A0UA 2NTJA 1XEXA 5L4LA 5FPYA 2AUTA 3P5SA 3TW0A 3BFJA 4EF4A 5FWNA 5FNVF 4C3OB 4J43A 1TUEA 4FK8A 3I6IA 1EDBA 1U7ZA 1QCZA 4MQMA 2WM8A 1I7QB 3DCYA 2A78A 4MVJE 5EIWA 1F0NA 4AFNA 1Q14A 4BYMA 1U7PA 5DRTA 4C78A 3EF3A 1HOXA 1RPNA 3LY7A 3S8EA 1TPYA 1Y98A 1KZ7B 3RT9A 4L3OA 2EBFX 1A98A 4K87A 2EBUA 2QE7D 1CW2B 4DNOA 3OZTA 4HK4A 5TPZD 3E7WA 4YP5A 1F0PA 1YB4A 4N12A 1YHZA 3FZEA 3IT3A 1TM4E 2WIAA 4RYDA 4BFYA 1Y89A 4G89A 1N5JA 3PJFA 3LA8A 2Q2VA 3M4YA 3L4BA 3S3TA 3NXSA 3EULA 4O8CA 1G6OA 2A9FA 2F1IA 4MHOA 3QSGA 2WC1A 3AW9A 2H3EA 3SF8B 2XQKA 3QLVC 2GYUA 1F0KA 4JUIA 1CHNA 1WULS 3B20A 3B6MA 3T9CA 1V1RB 1OLSA 3I12A 1IHYA 2A9RA 2IIBA 4IDHA 3LWBA 4F1JA 4Z0NA 4QUEA 2IY9A 3MS2A 4GQIA 3C1TA 1RQ7A 1C3JA 1ULAA 1VE5A 4TYYA 2J9XB 3QVWA 1QB7A 2BISA 5H9WA 3LKDA 4W1RA 3ZIAA 2FE1A 1EA7A 3EDOA 4PPNA 3ZDQA 1YRYE 1SOUA 4FHZA 3TPFA 4GSYA 4HO1X 3ELUA 5E6SB 4CKXA 4LXTA 4BPBA 1JF8A 4RZSA 1L7MA 1E2JA 1Z07A 3TVYA 3GAZA 4RC9A 3OQ1A 3RK0A 3IJEB 5A9RA 1US8A 4FIZA 2DTXA 3WGNA 1UH5A 1VLLA 4J0HA 5F9HA 1IMOA 1M1UA 1CUHA 2FB9A 3BREA 4GMKA 4WY2A 1KEVA 2HK7A 3L7BA 4YMIA 5B6PA 2XQFA 4R41A 1CU1A 4W5NA 4E3WA 1RACA 2G71A 1L5QA 4QUJA 3DH0A 3ZHRA 3O8RA 1Y9EA 2B2XA 2YMMA 4Y7DA 2YCLA 3IL2A 2I78A 4Q1EA 3S81A 4MARA 1LWNA 1YOVB 3RUFA 1PT6A 2VYVD 1YC2A 3L4SO 5HGXA 1B23P 1I4WA 1EFDN 3GZJA 1U0EA 5FI3A 1U0FA 3G0CA 5F3DA 5HP4A 1OH6A 2GPSA 1RAAA 3R0VA 3V7WA 1X1TA 3U31A 4P31A 2DB3A 1E0JA 1XVVA 1TCBA 2O05A 3AL2A 3AR9A 3EWNA 3KB8A 1ZISA 3AU8A 4E07A 1GUYA 3FNRA 2BFBA 4ZJPA 2C03A 1Z5UA 4HAVA 4IJUA 5ALZA 2WB2A 2WYOA 3WQQA 4OMFG 3E4DA 3DVAB 5KU1A 4YJHB 3RJZA 4KBYA 5FOTA 4CYMA 4RULA 2GA8A 1ISRA 1SJ9A 5AHWA 2YWBA 4BWVA 4ZPJA 1T1JA 3T4PA 3BHMA 1QCDA 1ODSA 1S7GA 3EXIA 4ABTA 4RVHA 1RQPA 1Z82A 2W2LD 5CVUA 5AM4A 5K8LA 4EQZA 1T9HA 3CLTC 1NNSA 1SUCA 4V0NA 4JI3B 3V4SA 2AN9A 3UJDA 4REQA 1C3EA 1M76A 1QIKA 3W5HA 2I3BA 4MHTA 3QYJA 2G9UA 3GYBA 1NBIA 2G76A 1PT8A 1QIHA 2PR7A 2XE6A 3LV8A 4LXQA 4WNIA 3R7BA 3SBOA 5KX5A 1LVGA 3AFNA 3WGZA 1BXZA 4W6ZA 3BQNB 4YIHA 3B3JA 4U7DA 4U6NA 1YF3A 1GUAA 1PS0A 4DC0A 1WP9A 1Y4ZA 3ZI7A 3INNA 5FP0A 1DTEA 4PFJA 1RYNA 3NNSA 5FOUA 3H11B 1U4SA 3SZOA 1PJBA 2HMVA 5BWNA 4YDQA 2M6RA 5KYYB 3ULKA 5C5CA 3GLFB 1MEOA 1UDCA 4MXDA 3AZQA 1CY6A 5BUZA 2WYWA 1HQYE 1H2FA 1H85A 2Z08A 3CS3A 5EZSA 2MWMA 4HNTA 3RGGA 4DLYA 2WI8A 1SB8A 2HZ7A 4E09A 3CKMA 4R1QA 5A71A 5AHXA 4B3TB 1BMFA 1Q7BA 4HDRA 3EAFA 1V6AA 2COUA 1T0PA 5KMGB 4FYWA 5KO2A 2R96A 3OOJA 2Q45A 4X84A 4QICA 4BOYA 4U7TB 4AS3A 1F14A 4I2NA 1LSOA 3S2FA 1DCKA 3CUSA 5TE9A 2OQ2A 3UHPA 3JQBC 5SV2A 4NEGA 1DIRA 1IZ9A 1GQOA 4TYPA 3F8TA 1UT6A 5BR8B 3SKXA 4EDFA 4PPGA 5DN6D 3A14A 5CFPA 3B48A 1P17A 3BGSA 4AURA 1XV5A 1F2TA 1YI1A 5AW5A 3T5AA 2EXXA 2D3TA 4YACA 5L51A 2HTEA 1YK0A 4DR7B 3DR5A 4DB2A 2AH5A 1CJMA 4QG7A 1RRGA 1L5KA 5DDIP 1PTJC 4WFJA 4XUGB 4NE7A 1TUIA 1QRUA 4LY3A 4UTPA 3K2IA 4URYR 1DFHA 2GJ8A 2VF5X 2I6UA 3E9MA 1SOWA 2A3NA 2EWWA 1PZFA 1XL0A 2R97A 4RCVA 3QM1A 2DULA 5AKXA 4GOLD 4IP0A 4Z0PA 4K6FA 3K96A 1XEXB 2VDVE 4X63A 5IKOA 3D7MA 3URMA 3WYFA 2C8VA 4E2FA 5JJCA 2AK3A 1PGNA 1J42A 3R6WA 4ARIA 2V6BA 5P21A 4XQEA 2HF2A 1I6LA 4F5ZA 4K1LA 3WYNA 4DIDA 3V8RA 3WGKA 3AB7A 1D4FA 1QORA 2JL1A 3IAM1 4AD8A 1KH1A 2IDZA 3K05A 4OHPA 1TI7A 3FCOA 4GMGA 4EGSA 1Y33E 3SHOA 2V6JA 2CHFA 2CVOA 5DO9A 4HR7A 1TU4A 4WMLA 5CG2A 2ZBUA 1UPUA 4MULA 2XB2A 4JLSA 3UC9A 2Y76A 3MJVA 1EYZA 3ZY5A 5HX7A 1P1FA 5MGBA 2BKEA 1M9NA 2NZ2A 4EQ6A 1YQ9A 3HJCA 4REQB 1EFVB 1OH5A 3WO0A 2BI7A 2XUGA 5AKYA 3C43A 5GPBA 1P2UA 1A5ZA 1ICIA 1KK2A 1QLHA 4OQEA 4DG5A 4F8JA 4IGIA 2Z2KA 2NX2A 4B3SB 4RJIA 3BOSA 8GPBA 3F8WA 1EVYA 2HU8A 4HYEA 1S4MA 2YHIA