2ZI6A

C4s dck variant of dck in complex with d-da+udp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
241
structure length
217
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 78
structure length 217
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi6A00
2J0UB 1KGDA 3CNLA 1CJKC 3BAFA 3FPAA 4KI0A 3QY0A 1FOEB 3QXXA 3B13B 4NTZA 3O8RA 1OJLA 2V1XA 3CF2A 2A5GA 4E03A 5JZVA 4MQBA 4JLAA 1W48A 3GCGA 3TK1A 3VU9A 1TTTA 2EFEB 4WZBE 4L15A 1Q0UA 2IS6A 1KDTA 1KI4A 5EE0A 4PC1A 5KSZA 3U3RA 2IX3A 4UJ3A 2ZRBA 3U7EB 4BASA 2ZRIA 4O2LA 4DSNA 2ZRPA 4HAWA 3U61B 1E2DA 2D62A 2KJQA 1Z6XA 4N1AA 1GSIA 1LS1A 4JL8A 5FTMA 2YWFA 4ZO4A 4B76A 1WXQA 4D82A 1VCNA 5LD2B 4B73A 4ACBA 1X86B 3IIKA 2JASA 1DARA 1I2DA 1KI3A 4CW7A 1W4RA 5JCZA 2WTUA 5LD2C 2O8EB 1PV4A 4RZ2A 1XZPA 1XPRA 3GJ0A 4AWXA 2QBYB 5GVRA 3KKNA 5EJEA 3U6BA 2CE7A 2WZQA 2ANBA 3JVVA 1CR1A 3OHMA 2ODBA 1E9RA 2WWFA 4PANA 1PLKA 1ZD9A 1QG2A 1CKEA 1TQ6A 3WYGA 2V7QD 3CF6R 2YVUA 1JR6A 3EIQA 2WICA 1GL7A 1CJTC 2H5EA 2C2HA 2L0XA 2Z5FA 3GEIA 3K0CC 3KXLA 2V54A 5EP3A 3PUZA 5LDDC 2J0QA 2O8EA 3PCRB 4KYUA 3K53A 1IN7A 2G9NA 3TH5A 4BWYA 3RS5A 4I1VA 1SKQA 4IDOA 4EQ6A 4XWKA 1CR2A 2KBFA 4LJ7A 1R8QA 2P0EA 3VKGA 1EXMA 1ZU4A 2GK6A 2OFXA 4W5HA 3NC0C 1QHHB 2O5VA 5AK0A 2RCNA 4F92B 2PZEA 1F5NA 3LBHA 1Z3IX 1N6IA 3WBJA 1OSNA 4IEEA 3QPWA 5CDFE 3GEHA 5BQ5A 4LYFA 2PBRA 2MSEB 4LI0A 5EXXA 1NI3A 2I1QA 2QM7A 3SHWA 2AWOA 1EWRA 2IEYA 3GLHE 1XXHB 3NG1A 3R8FA 3T06B 5KHOC 3P32A 2DY1A 3TVTA 3ZVMA 2I1VB 3RS7A 2ONKA 3AF4A 1X3SA 4TN1A 1KJYA 4TTQA 1Z8FA 3QSYA 2WPDA 2G6BA 3GJ5A 3AKYA 4TMZA 1JAIA 2DFTA 4ZPXA 1S9HA 2XSZA 4CT4B 1Z5ZA 2IC5A 3MWJA 2ERXA 3GJ3A 5CYPA 1E9AA 1KOFA 4D4KA 1NBME 4X8MA 2FEOA 3L2OB 1E2IA 2VP4A 4LJ6A 2P6UA 3U5ZB 2CLDX 4RZXA 2ATXA 3BH7A 2XNDA 1GRRA 1TQ4A 1YJ5A 2GJ8A 3BFXA 2QPAA 2VHCA 1E0SA 2BMDA 5IF9A 4L16A 4Q9LA 1Z0IA 5KDDA 221PA 3EPHA 1TU3A 2ZIAA 4DIDA 3T34A 3WNCA 1CBUA 3LQQA 4CVNA 3PR1A 1F2TB 4QG7A 4DSOA 1AN0A 1WBDA 3QPVA 1KTVA 4YMUA 3OEED 2FZ4A 2FV8A 2ZYVX 4EPXA 1R5NA 2ONJA 3AVOA 4Q9JA 2BV3A 3SOPA 3L0PA 4PAOA 1JR3E 4KBGA 4DCVA 3QF7A 5E7IA 3LVRE 2QSZA 4JL5A 3SYLA 2OSBA 2QGZA 2ODEA 2OESA 3B82A 5FOTA 3KFVA 3I3SR 2AHOA 1DEKA 1FZQA 5JWHA 4V0NA 4D80A 1II8B 2A5JA 4Q7MB 2HDNB 2UZ3A 2HEIA 2ZR9A 1IM2A 1GKYA 2ZRCA 3F8TA 2J7KA 4OK5A 1G3QA 1KYIA 3KUCA 2GEUA 4JBXA 4R7ZA 4A15A 1JB1A 1XFAA 3QVVA 2GRJA 2MSDB 1CXZA 3EPLA 2BMJA 3U7FB 3KB2A 1OIWA 3AF2A 1ZUHA 3VX3A 4JLNA 3V9PA 2F9LA 3AP3A 3Q7PA 4NL4H 4CF7A 3RYTC 3RRYA 5BN4A 1NMYA 2AL7A 4GOKA 5TARA 1NSFA 1HV8A 1Z22A 2B8TA 1TF5A 5GJBA 5EP1A 4B2IA 4L5BA 4JZKA 2ZU0C 4MUBA 3SQWA 4Q01A 2GAAA 3A1VA 1XP8A 2IYWA 1QHSA 3CH5A 4OL0A 2UZIR 3BD9A 1N0VC 2BOVA 4KV9A 4BZQA 3A4LA 2O8DB 4JVMA 1GRQA 3DHWC 5B30A 1VHLA 2BBSA 4GI7A 4LX0A 5AR1A 4BFTA 5LBIA 3FMFA 3C4JA 4PAMA 3MMPA 1P61B 4YMSA 4X8HA 4HLDA 4OQXA 3W6OA 3RANA 2W2XA 2QMUA 3C5HA 3EASA 4UKDA 1XCMA 2QBYA 1NIPA 1WBBA 1NKSA 4ZIRB 5FL7D 4BEBA 3DKPA 4H1UA 2BCJQ 3CO5A 3BS4A 5G41A 4ZDIA 4PQYA 1GVNB 2VP6A 1NLYA 3K09A 3NEYA 4RD0A 4Q9IA 4D4MA 3BH6A 1HURA 2H17A 3QG5A 1R0YA 4TLAA 4A6XA 4B34A 3CPJB 1Q44A 2CNWA 3IQXA 3WMFA 2OHFA 1G7SA 2ECKA 1Z2CA 1A2KC 4Q18A 3KL4A 5L3SB 1GAJA 1LS6A 1N5LA 3S1AA 1SXJC 1XMSA 2ORWA 1KNQA 4FD2A 1IXRC 2Y8EA 4IOMA 4EPTA 3VR4A 1KK3A 2BKEA 4IOKA 1KO8A 2ZQ5A 1EG7A 2CHVA 5HPYB 1CRQA 2MMGA 1XXHE 4FN5A 4P31A 2HUPA 1Z0AA 5E3HA 4BFWA 4JLBA 1R0ZA 1G4UR 1SULA 4US0R 1XCGB 4CEHB 4B33A 5EUQB 4A8JB 5GJVC 1RRPA 5L3SA 1SKYE 2HT6A 5C2JB 1G1MA 1UBEA 5C4GB 4B35A 4C0BA 3RRZA 3TAUA 2FX3A 4FWTA 3K70D 3FB4A 4KFTA 2OFOA 4PC7A 4A8JC 5BW8A 3U4QA 3N2EA 3OEHD 1VG0B 2YZ2A 5L8VA 1CIPA 2XX3A 3EIHA 2V7QA 2IYXA 4XD7A 4DLYA 1IXZA 4ERNA 3WP1B 1KDRA 1P7CA 4QHSA 4QOSA 2IF2A 3U3MA 4WBSA 4EAQA 3K09C 3K0FA 4ZDWA 5FR1A 1T91A 3K8YA 1P9WA 1E2LA 2ZSAA 3H0KA 5CJPA 4WIAA 4BFVA 3AM1A 3L8ZA 4DLRA 2IHYA 2C98A 1QHNA 4PFSA 3SS8A 2P5TB 2OBLA 1XTKA 2CEAA 1ZD1A 1H8HD 3NBXX 3C15C 4R9UC 1E2KA 2XJ9A 1Q21A 1E94E 2GK7A 2B92A 4LHWA 1LV7A 4LK2A 4AK9A 3MFYA 2Z4SA 4Z54A 3CONA 3OEHA 4A2WA 4QXAA 3GP8A 1CU1A 3OESA 3EC2A 2QRZA 4RY2A 2DCUA 5C18A 3RC8A 5FL3A 4DCSA 1JECA 2ORVA 2EWVA 5L3VA 1E3MA 4L9WA 4Q19A 4A82A 2OV2A 5CIWA 4MGKR 1C4OA 2Z83A 2YINC 5FBWB 4U5XA 3W8RA 5G3YA 2P65A 1MH1A 1W4BA 4LV5B 4MRSA 3RC3A 2IYQA 3CBQA 1OLOA 2VSFA 2R9VA 2E1RA 1YZQA 3LLUA 4YONB 4JSYA 4NYIR 3HU3A 1KAGA 3GFTA 3DZDA 4URZR 3GLHB 4GMDA 2QP3A 1E2HA 5HCNA 2GKSA 3T1OA 4ASUA 3TLXA 2XXAB 1FTSA 2BBOA 3AKEA 2IXEA 2OAP1 1GM5A 2DFKB 1YZUA 3N2IA 3ADKA 1IBRA 2IL1A 2LWIA 4EDHA 1Q3TA 4K46A 2CHQA 3ZVNA 1P60A 3OIYA 5KYKA 2ZYWX 4DEXA 4QHYA 2WSSD 5TY0A 2JLRA 3W3AA 4NZYA 1Z6TA 4HSEA 5CJ2A 1XCPA 4RFSB 1KSJA 4I1SA 4MGZR 2IYSA 1IXSB 1D2NA 2F43A 1EESA 1KO1A 2QNRA 2JATA 2QM8A 3RHFA 2F1RA 421PA 1KDPA 1MO6A 2HCBA 1TF7A 3IPXA 1QVRA 5J4KA 4DB2A 3BORA 3QKUA 4NONA 2W00A 4FXPA 3VQTA 4DT1B 2R6GA 4TYNA 2F1IA 2IUUA 3KB1A 4URWR 3V00A 2ZR0A 1P9NA 4TQUS 1G3IA 4OQMA 1DO0A 2YC4C 3UXMA 2VP2A 1OIVA 3H1TA 1KSGA 1KJWA 4QBFA 1BYUA 1S8FA 4DCTA 1ZYUA 1RPZA 1IN4A 3IPYA 4JLVA 1KAOA 1DADA 1R5BA 2ZJ2A 5JI2E 1LF0A 1N5JA 1W5TA 5FI1B 3SDZA 1DVRA 1KI7A 4P33A 4A92A 2D2FA 2H92A 1MO4A 4KCGA 3TW8B 3AVVA 3HJNA 1CF4A 1U0LA 5FOSA 1OXSC 2O8BA 3PV0A 1AKYA 1Z6YA 2B7CA 5KSPA 1UBCA 4DLSA 5K8TA 1GKIA 4V03A 1OHHA 1RJ9A 3RNLA 1E1RD 3B1YA 2RGXA 4IDHA 4FMDF 3PXGA 2EW1A 1R8SA 1K8RA 3NBYC 2GXUA 2YOHA 4QBGB 3X1XA 1F2UB 3FKSD 2IYVA 4W7SA 1Z0DA 1OFUX 4FCWA 2GILA 3WY9A 1YE8A 1NRJB 4N0EA 2QA5A 1T8UA 3QQ5A 5JWOA 3CW2A 4KJZA 4PC2A 3B1XA 4N3NA 5L3RA 4DCUA 5JS8A 4MGIR 1ZAKA 3A1UA 4U7DA 2J5XA 2IYTA 3LNCA 2H8KA 3VR6A 2VYFA 5KPJA 2J0SA 2XGJA 1CRPA 2G83A 2XAUA 1Z63A 5B2ZA 3ZQ6A 1VECA 4MA4A 2RHDA 1CTQA 5LPNA 1WF3A 1T5LA 4B6FA 2RGAA 1G8PA 2EVWX 2WKPA 1NVVR 2WWGA 3ADBA 3NH6A 5UKDA 3EG5A 2SHKA 3FMIA 4ZIRA 3JZAA 2W6IA 3WNDA 4OK6A 4QGFA 2DFLA 2BMFA 4XVQA 1SVWA 2GEVA 1YR8A 4PZZA 3I1FA 3NKVA 4C3ZA 1TNDA 5EE1A 2EFDB 3CLVA 1TAGA 4AYWA 4WVFA 3VMFA 1CLUA 2QENA 4OHZA 1V5WA 1YR6A 2XNSA 2KI5A 2ZRGA 1K6MA 5TB5A 3AUXA 3FOZA 3THXA 1M8PA 2ZS7A 2KSQA 4YMWA 5BXQC 4AI6A 3HP1A 1VIYA 3FKSA 3VAAA 2NQ2C 1R5OA 3IUYA 1FQJA 1P5ZB 2A7QA 1X1SA 2F43B 2O0KA 4LPKA 2WWHA 1F60A 1R7RA 2WJGA 2R65A 3D3QA 3GLHA 3TGPA 2ZI7A 3I73A 2CE2X 1JNYA 3BWDD 3TJZA 2ZJAA 3IGFA 4F4IA 3UKDA 4PTLA 4C30A 1XEXA 5J47A 1PVOA 3HR8A 2AXPA 4HDOB 1Q12A 3SHFA 1KDOA 3C8UA 1G21E 5DNYB 5F2EA 4Z8XA 1AKEA 4KLNA 1YR9A 3NC1C 1PLLA 2PX3A 1G3RA 3QEJA 4MYHA 1BH2A 3R8CA 1W1WA 2C99A 2DB3A 1E9FA 2REBA 3AVTA 2W0MA 4M8NE 3TW4A 4QRHA 4RJLA 2J0UA 3FFBA 4GZMA 1Z07A 4HDQB 3I72A 4TT3A 1XEWX 2FA9A 4BLOA 3CRRA 3SYKA 2R6AA 3VX4A 1R2QA 3AVQA 1P4SA 2DBYA 4PPNA 4ILEA 5A4JA 3LXXA 5KNBA 1OFHA 1RJ9B 2MMCA 1G5RA 3KXKA 2QUZA 2GXAA 2PEZA 3TSOA 621PA 3BERA 3FTQA 1ZNWA 3SYNA 4GSYA 5HKKA 3LH5A 5AWFC 3R9IA 3ZVLA 3PJRA 5HTKA 1G7TA 1NLZA 1L7VC 1JR3A 3PUWA 3GLGB 1GZSA 5FTLA 4A2QA 4C0QC 2V8OA 4PQFA 3P4XA 1ZNZA 2FN4A 2GWHA 4PZLA 4Q00A 4URUR 2NO9A 1KMHB 2ZI4A 4LJ8A 5A5GA 4G5GA 2AKAB 3UIEA 2OZEA 5FFMA 2I3BA 4LBZA 1E0KA 3PEVA 4D0LB 1Q1BA 2NOAA 5TDHA 2EQBA 4OI1A 4HZUB 1XTRA 3VR5A 2W6JA 2R6DA 1XJCA 5HE9A 3PUXA 2VHQA 3DM9B 1AJEA 4FW9A 1M7HA 1YZTA 5HE8A 3VKHA 1ZM9A 1O3YA 4CEIA 4TZ0A 2ZXUA 1P2VA 2OBMA 4E5UA 1EFRA 1C9KA 3G5UA 2V6IA 1LNZA 1SHZA 2JLSA 1RYHA 2KB0A 4AYTA 2GNOA 3BBPA 4IVRA 1Z29A 4UXJA 4M21A 1PUIA 4C0AC 3EXAA 4PPFA 4G5SA 1AGRA 2VEDA 1SXJD 1GTVA 2W58A 1KHTA 2ZJBA 3KKOA 5HKKD 1DAFA 1DBSA 2ZRJA 2FZLA 2VPPA 1GNRA 1GL9B 3NHBA 4JSTA 4KXFB 4I4LA 5TV2A 1IJEA 1PLJA 2CL6X 2YC2C 5KPDA 3THYB 1E0JA 2JA1A 3H4MA 2JLQA 1KKLA 4W9MC 4GP7A 4ZDKA 2XB2A 4F4CA 4HB3A 1ETUA 3SC3A 2XITA 2PMKA 1G5TA 4Q1CA 3R20A 4BFYA 3LWNA 2OCBA 2N1BA 2ZJYA 3CR7A 4Q21A 5DH9A 4JBYA 2VTKA 1GL6A 3TAHA 3FGNA 4UXHA 4QHTA 2A5DA 3O8CA 3Q9LA 4ZCMA 3SBDA 5G40A 3L43A 1X8LA 4YMTA 1JXOA 1KO4A 3QKRA 1AZTA 2ZRAA 1NF3A 1G8HA 5AJXA 2IWRA 4BZXA 3ZLJA 4C4PA 1RRCA 4NCKA 3ZD7A 1DE0A 1N6KA 2P2LA 3B7GA 3PUYA 3B85A 3ZQJA 4Q7JB 1U0JA 4Z51A 4PC6A 4JLKA 4MUAA 4OQNA 4CGZA 2JJ1D 4A6PA 1RKBA 1ZM2A 1E32A 2IA5A 3BK7A 4M4SA 3LA6A 4S2EA 5JJLA 1ZM7A 3DOFA 1BKDR 4NDZA 5AUPB 2OM2A 2QQEA 4UNQA 5KDOA 4Q9KA 1LY1A 4DLZA 1TL7C 5BN3A 1G6OA 4P4TA 1ZNYA 4PZYA 4OI0A 2WIAA 2BJWA 2J87A 1ESMA 1UEIA 2HXYA 4IW3B 2RH5A 4D4LA 5M04A 4HLQB 4AC9A 1E2EA 4NYJR 5JECA 1G16A 1N0WA 1YRBA 2ZRMA 2GF0A 1R6BX 2VP9A 1E99A 4JVLA 4US1R 1OH8A 3GLIA 1Z0FA 3CZPA 1YU9A 3EZ9A 3HR7A 4TMWA 2BKUA 4JS0A 3L0SA 1S3SA 4DB4A 5J5CA 5J4VA 2FFHA 3OIVA 3PEWA 4A36A 3GLGA 2P67A 2NIPA 2FNAA 4GMXA 2V4ZA 1EX7A 5KSYA 2ZJ5A 2C04A 3RVBA 4BECA 3K0EA 5KU1A 3B9QA 4TTPA 3N70A 3UWKA 2WWWA 4IOLA 1SXJB 3B6EA 1TADA 1LF5A 1U81A 4BPBA 1RVDA 2XOKD 2ZUCA 3B2EA 4G5QA 4DC9A 4QFMA 5DLQC 4M9XA 2QG6A 1IN5A 1GRNA 3EA5A 2VSOA 1NSTA 1U9IC 4IXMA 4U02A 2JJ2D 2WM9B 4Z1MA 3KTAA 1ZJ6A 2XZPA 3F0TA 2QY9A 4UQOA 2CVHA 2VSXA 3AF0A 4HI0E 4LJ4A 3QEOA 4PPQA 4MKFA 3UMRA 4TL6A 2D7CA 2IEZA 2AFIE 3TSWA 3K70C 2HJVA 5CIQA 3QUSA 1E1RA 2H57A 5SZKB 3SJCA 1K5GA 5FOVA 2F7SA 1NVVQ 4UNPA 4HEJA 3U7HB 2V55B 1DAGA 1EFCA 4MRPA 1W36D 4MH0R 3IIJA 4DXAA 3F5FA 2PX0A 3T1VA 1OXUA 4P3YA 1P75A 1JJVA 1JPNA 4JYCA 4ESVA 4GL2A 3T15A 3WBKA 1OF1A 3ASYA 4EFNA 2OE2A 3DM5A 1COWA 3KJGA 4TYWA 2WBLC 3C5CA 3MLEA 4J0QA 4JKIA 4XWAA 1AS2A 1G41A 3GQBA 1E79D 5J40A 3SU8A 1Z08A 5L3QA 1D6JA 1NN3A 1OH5A 2XEXA 2G1KA 2GETA 2AN9A 3L0IB 5EUMA 4PQRA 5J4HA 3JVUA 4R2HA 2JJ8A 3RWOA 3RSLA 4YDSA 1MO3A 2HCJB 2J1LA 4RKFA 3WXMA 3QKSB 4BLPA 1CEEA 1KNXA 4AY2A 1ODFA 2F1JA 1I2MA 2FFQA 1AM4D 1PZNA 3CIOA 1MOZA 4CDGA 2J9RA 1L4UA 4NP6A 5FR2A 4BZPA 3LRPA 3B1VA 4TQAA 4GT1A 5SZIA 1WMSA 2BEKA 1AIPA 1LB1B 2CCKA 2O8DA 1XD2A 3L8YA 2A2ZA 1E2QA 1FX0B 4YDHB 4V0MA 3M6AA 1VHTA 3D31A 3CWZA 4JT4A 4GDFA 5FBVB 5KTYA 3VR1A 2XJ4A 4IFBA 4V0KA 4KHZA 1II0A 2IW3A 3GLIE 1I4LD 4MRRA 1E4VA 2XSZD 1H8HA 1I4TD 3CX8A 3RWMB 1DAIA 1NBMD 2DHRA 4ZCLA 3I5YA 2ZRNA 3VU9B 2AWNA 1S0UA 2OILA 3TQCA 3GMTA 5FTKA 3QVUA 1OW3B 3HDTA 1V43A 1W0KA 4C0SA 4IVPA 4QJ4A 1YHNA 1QZXA 3OFNA 2WWIA 1UDXA 1KK2A 2EYQA 2VHUA 3E70C 2FPLA 4TMVA 4B71A 5IK2D 2FSHA 3KQHA 1TUEA 2ZREA 3EW9A 2OXRA 4G01B 4GNKA 1JXMA 1P72A 2A5YB 2HXSA 5FUWA 2P6RA 3BFKA 1KY2A 1W0KD 1G8YA 2A5FA 1E2PA 1NY5A 1NN5A 1Y63A 1J99A 2BC9A 3B60A 3OEEA 4ARZB 4TYQA 1Q1EA 5JLJA 2BHRA 4P4SA 5G53C 1SGWA 4Q4HA 3EPJA 2J3EA 4NCNA 1HTWA 4AKHA 2ZI6A 1G64A 4MKIA 3KKMA 3UWOA 3FHOA 2O8BB 4TLEA 2GAOA 4HAVA 3EAQA 2WKQA 4BRUA 5IT5A 5DN6D 2NMVA 4OJKA 3HU2A 1M34E 2WMOB 4US2R 3GJXC 3P20A 3B78A 3M1IA 2CNWD 2QAGC 3SFVA 1YVDA 2XTZA 2WPDD 3LFUA 2JJ2A 5FUVA 4Z1MD 2GXSA 4LC1A 3IHWA 4B44A 1US8A 1LTQA 1W36B 3ZS9A 4HLCA 4C0JA 3AVYA 5EZ5A 4FWIB 2WOJA 4MKGA 1SHKA 2HLDD 4BLRA 4D26A 5TVKA 5JBQA 4P4UA 2ZITA 4LV8B 4E09A 1ZCBA 3QG1A 3AKCA 1EFHA 4D25A 4RD3A 2ZYUX 1GNPA 3RAPR 3UATA 1U9IA 2ZSFA 5EE3A 4CRWB 2D7DA 1IHUA 4LJAA 4MYCA 4D81A 2AR7A 3QF4A 1FW6A 2PCLA 2ZE6A 4EFLA 4EJSC 3ONWA 1TQDA 2WV9A 1L4YA 3KJIA 1S3GA 4ZKDA 5CLQA 1UBFA 1RRGA 3I62A 1XJQA 3PG5A 2GA8A 3ICQB 1TQ2A 3SJZA 1X1RA 3KQKA 4DZZA 5AJVB 1ZD8A 1R0WA 2R6CA 1E2FA 5DYGA 4UJ5A 1XD2B 2RB4A 5TMPA 3QKRB 2RHMA 1NLFA 3NHAA 4S35A 3U44B 2O8CB 3QI2A 4NCIA 2V3CC 4B2PA 5IRCD 5KOYA 2HYDA 1YQTA 4LJ5A 2C95A 1ZU5A 5JRJA 2Z0MA 4DUGA 4Q4AA 4IKEA 1OXXK 4TWZA 1BOFA 5FBRB 2JAQA 2PL3A 3GEEA 3BJIC 4KFRA 4BLTA 4DIEA 1CULC 1XX6A 1VYTA 3MJHA 2Z4RA 3QENA 1XF9A 3KQUA 1A1VA 2IUTA 3RSOA 1GP2A 4GZLA 3DEFA 1IY1A 4B3BA 2YKGA 4CEJB 1KI1A 3NEJA 2J41A 2R44A 2C03A 3E5HA 2IYZA 3TBKA 5P21A 4E22A 3K9HA 1HYQA 1VCIA 3EPKA 4BGDA 5FOXA 4D0GA 5JSZB 2HV8A 4Q47A 4QNRA 1SQ5A 1G8GA 1XMVA 2W83A 2FGJA 4OKSA 1SZPA 4A0HA 1Z06A 2ZE5A 3WRXC 1Q3HA 3C41J 2IYYA 4XJXA 2B7BA 1MT0A 1CJUC 1P2TA 3B9PA 4G1UC 1KKMA 3AVPA 3GFPA 4HATA 3X1DA 4BE7B 4Q1FA 2EFHB 4KSCA 1M1YE 3PEUA 3K0FB 4MGYR 5FOWA 4GRAA 4KYIB 3W3ZB 5JMTA 2WJVA 4C0HA 3ADCA 3SN6A 4NH0A 3GFOA 4EPYA 2ZSDA 2RGDA 4YXWD 2R62A 1E9CA 3WHLA 5JWRA 4LSGA 3NTUA 4TSFA 4ZKEA 3UK6A 1G291 2QTFA 4DDTA 1E2GA 4OJQA 4PXAA 2Q3FA 2KWIA 2FOLA 1O87A 2OT3B 4KSBA 2N42A 1NBMA 2TMKA 2X19A 2ZRFA 3GJ7A 4XSHA 1YZGA 3LO5A 4MRNA 2VA8A 1X6VA 2YHSA 1G8FA 1VG9B 2BMEA 1P2SA 1T6NA 2QMEA 3AB3A 2IT1A 4Q7KA 721PA 2JGNA 4CEHA 5HZKA 4QM6A 4URYR 4K8OA 5CDFA 3I92A 4A0GA 3WMEA 4I1OA 1CR0A 2EWWA 4EPRA 1QHGA 2Q9AA 2QZ4A 1E2MA 4WXRA 3ZS8A 4YLGA 4A9AA 4Q4HB 4OI2A 2XZOA 5TXGA 2WJJA 1G9XA 2JLUA 2FSIA 3EWSA 3MCAA 5E95A 1HT1E 1P62B 2OLKA 2OCPA 2GVZC 2CLSA 3GLFA 1JR3D 2YWEA 1F6BA 3PFIA 4LV6A 4H1VA 3U2QA 4UNNA 2GJKA 2X77A 2QAJA 3IBYA 2BEJA 4LC0A 3K9LA 4RVCA 5C4MA 1A2BA 3AVUA 4AG6A 5EE5B 4OK3A 1X8JA 3BB3A 1DAMA 2FH5B 1UKVY 3PVSA 4M22A 2X2EA 4GPTA 1M7GA 2PEYA 1KIMA 1E69A 1UAAA 3SFZA 3UANA 1D8TA 3BGWA 1N25A 3PQCA 3UMSA 2WSSA 2DYKA 2FGKA 1ONBA 2Q9CA 3ZDQA 4O3MA 4TSFD 2GCOB 1EFUA 4QGAA 1PJRA 4KO8A 4HLUA 4XH9B 2NZ8A 3AGPA 1A5TA 1Z28A 1RE0A 5FUXA 1AZSC 2QMHA 3AKDA 1SVOA 1II9A 2ZS9A 4XSGA 4C0LA 2BCGY 3T35A 1KK1A 4V0LA 5DGXA 1AA9A 5JHGB 3AH8A 2OUKA 3CNNA 3FHTA 4B32A 2GCOA 2GCNA 4PHGA 2OAQ1 6Q21A 2PZGA 3AF3A 3DO6A 4PX9A 3ZZTA 2AK3A 2ASEA 2XOKA 5AUOB 1M74A 5ELXA 1H8EA 2ZUDA 3CB4A 2ZRDA 1FQKA 4RZUA 3THWA 4URVR 4QM7A 1S1CA 2WOOA 1GKUB 3A8TA 4TMTA 2IYRA 2B21A 3MAAC 1IY2A 4KU4A 5CYOA 2VF7A 4B43A 1N0UA 2AD1A 1DAHA 2LKCA 4LZZA 5B64A 3AVXA 1Z2AA 2QP9X 2CL7X 4ZI2A 4LHVA 4C7OB 1FL9A 5F98A 3WYFA 3W6PA 1C1YA 1SXJE 1NJGA 5JJIA 3CX6A 1N3BA 1M2OB 1II8A 2X8AA 2QROA 5A0FA 1CJVC 5AJZA 2QT0A 3THWB 2C8VA 2WSMA 1Z0JA 4OHVA 1VCMA 3VHLB 2PT5A 1KO5A 3H2YA 2QE7A 3IO3A 3QOFA 1SVKA 2G77B 2VO1A 3F3YA 4RCZA 4QJ5A 1WA5A 4BLSA 2B8WA 4JJZA 1WDTA 1H8ED 3QXSA 4IRUB 4NYMR 4LJ9A 2GESA 5DN6A 4V0OA 2CLCX 2J59A 3P1JA 2OCAA 2AK2A 3B1ZA 3THXB 5BN5A 4LWZA 3P4YA 4PHFA 2ZRKA 2VH5R 4KFSA 3RS3A 3BB1A 4FMBB 4C0KA 2YOFA 2D06A 1NG9A 4II7A 4FINA 1QVAA 4DLUA 3IDQA 4IOJA 1W49A 2VF8A 4WW0A 4M53A 5E7MA 1VDZA 4C9BA 5CB8A 4Q1AA 1ZCAA 1T4GA 1NN0A 2GCPA 2NGRA 2WKRA 3BC1A 1U99A 4NE2A 4TTRA 2JJ1A 4EJSA 5EP2A 2FWRA 4G5OA 1E9DA 4IHQA 3U6KA 3C7KA 1UKYA 3IHLA 1N6PA 1US8B 1GITA 4DSUA 1WB9A 1MABA 1F2UA 1UDWA 3EZFA 2R8RA 3AV0B 4LBYA 1YR7A 1R0XA 1OHHD 4Q1EA 1R4AA 3BE4A 1J90A 2EFGA 2GHIA 4WZ6A 4G3XA 4ON9A 2CL0X 1R10A 3PIRA 4BFZA 5FBLB 3CPEA 2IS4A 4JVNA 1OFIA 1F3OA 1ZRHA 3LBIA 2ZJZA 5FL7A 4URXR 1NMXA 1P2UA 1KI6A 2QAGA 3DPUA 3QPUA 3TIFA 3KQNA 5FPSA 1IN6A 5DSZA 3S1AB 3TUZC 1YKSA 4DHEA 1Z6GA 3C14C 1UPTA 2GBLC 2WWYA 4QBHA 4R98A 1BMFD 3RS0A 1HEIA 4XWOA 2MSCB 3OIWA 1VTKA 1W44A 1J70A 1JBKA 3KJEA 3Q5EA 4MYUA 1A7JA 2QMOA 3GD7A 2ZR7A 4DSTA 1RRFA 2W2VA 4WAUA 4DBLC 1FPMA 3IKJA 1W4AA 4F7WA 4M1YA 1UFQA 1X8KA 1T5IA 2A78A 4M2LA 4BQSA 2C9CA 4JJKA 1E9EA 1G7CA 5E7JA 1BS1A 2C96A 3MG9A 4M1WA 1G3UA 3ZZUA 4PC3A 3W8NA 1QG4A 1KSFX 4PSKA 4TYPA 2W6JD 4B2LA 3GPLA 2QSYA 1UBGA 1GFIA 5F3WB 2ZPTX 4X8LA 1VYUA 4L4UA 1E2JA 1YZLA 4FI3C 4HAZA 1E2NA 1G6HA 4NMMA 4ABYA 2OXCA 4PSAA 2YJTD 521PA 3Q7QA 3AEZA 4PPGA 1VKJA 4OI4A 8OHMA 4CYMA 2ZRLA 3OAAD 3NWJA 5KNDA 4OHYA 2IS2A 2ODNA 2Q3HA 4DKXA 2CVFA 2O8CA 3ZYCA 3U60B 2O8FA 2JIZD 5AJYA 4LPSA 1OH6A 1IAQA 3GJ8A 4HUQB 5EZ6B 5DYIA 1MKYA 4B6EA 1U2RA 4Q03A 1L8QA 2QL6A 3LAWA 3I32A 1KMHA 1ZM4A 2GVDC 1DPFA 3T5GA 3N5CA 2AFHE 2GBLA 4GBMA 3WNBA 1XNJA 1H65A 1M6NA 3W5JA 1DOAA 1TU4A 5CM9C 1QHXA 4JLJA 2VBCA 4TLDA 4F4JA 4YMVA 3QIAA 2RAPA 3CPHA 3BB4A 1E0AA 1B23P 4HB2A 1A4RA 2BBWA 3TKLA 4LHXA 4QGHA 3K9GA 4DJTA 3TQFA 1JJ7A 2XZLA 1OXVA 4NYMQ 3KKPA 5KSOA 1ZM3A 3QE0A 4WOPA 3HPQA 4AKEA 1FTNA 1MABB 1NVUQ 4MKHA 3X2SA 1OH7A 3W6NA 1TEVA 4NHOA 3UG6A 1BIFA 3FDIA 3LXRA 1OKKD 4JT2A 5DI9A 4LYHA 4RD1A 4Y0AA 3W5IA 3WHKA 2WIBA 5HZHA 3CUEF 4B3GA 1HH4A 1U98A 4JLMA 2HT1A 1P6XA 1Z0KA 1ZW6A 3LV8A 4OHXA 1IONA 3VHXA 1Q20A 1G20E 2ZVPX 3QBVA 4M1MA 1F48A 1DELA 4CZ2A 3RDPA 5EXPA 2E9SA 1RIFA 3A36A 1JQJC 4DEYA 1BO6A 2ZE8A 4FCVA 1Q57A 2HF8A 4Q5IA 2JCSA 1ZC3A 3KJHA 2O0JA 2REOA 1RC8A 2W0SA 4MRVA 4WA7A 3AF1A 3CRVA 2E87A 4IDQA 2GJSA 2JLVA 3VR3A 1HE1C 4BEJA 3GLIB 5JCPA 4BRWA 3T1QA 2WAYA 1QBKC 1NNEA 5JEEA 1T3HA 4DDUA 5B57C 3K70B 4EKDA 4TYYA 3B8HA 1NY6A 2FFAA 4I99A 4Q66C 5ANRB 1XDBA 1GIAA 1UKEA 2C77A 1OB5A 2LCFA 4GFDA 3SBEA 4BFSA 4O25A 3IEVA 4IEIA 2WHXA 1GG2A 821PA 4RKEA 4LHYA 4PO8A 4X8OA 4DUGD 1XPUA 1W2GA 3KKQA 2NO6A 4PHHA 3H86A 3HPRA 2DWPA 2IYLD 1HUQA 3K9NA 1S2MA 2QPTA 2GTPA 1XEXB 2NO1A 3HWSA 4RZ3A 1U90A 2RGNA 3AVWA 4Q4AB 2Z6VA 3U7GA 3HYRA 4D0NA 2QP4A 3MUFA 2QGNA 1ESNA 2AKYA 5HR5A 4D2IA 3ZZ0A 3K0AA 1I4DD 2NZJA 4FMCB 3H84A 5JEDA 4HUQA 4PO9A 2QRNA 5H68A 2G0NA 3ECCA 1YRAA 3NBZC 3NH9A 2FSFA 3BXZA 4TLCA 3ND9A 4DT1A 1HE8B 4TL7A 4DCNA 2FPKA 2JLZA 2NG1A 3X1YA 3SR0A 4LDJA 3ZD6A 4M9QA 2F6RA 4EPVA 4YQFA 2PLFA 3O8DA 3BIFA 3QXCA 1Q1ZA 2FE4A 3T1TA 1HA3A 3SZRA 2J46A 1YZNA 5EQTA 3FE2A 2GDJA 2V6JA 1UEJA 2R6FA 3KZ1E 1KY3A 2VHTA 1KI8A 4M1SA 4B48A 2ZE7A 2H1LA 5GVSA 3RLFA 4B3XA 4O2RA 3NDBB 2ZUBA 3AP1A 1KK0A 2J7PD 5GADl 1G19A 4A8JA 3TUIC 1DS6A 4DDWA 1BYIA 2VQSA 1T8TA 3ZIAD 3TR0A 2BWJA 2BIFA 4LCBA 4FIDA 1NP6A 3KFXA 1MO5A 4HB0A 2JLYA 2P5SA 4PO1A 4GOJA 1W2HA 4M1KA 4JLOA 1U8ZA 4TL8A 3EZ7A 2BM1A 5DO9A 1OXTA 4QC2A 3D6TB 4KITB 1XRJA 4P32A 1KJZA 5K8IA 1W47A 1Z6AA 1D5CA 1OYYA 4Y0VA 4QL3A 1GOTA 1SXJA 3I8SA 3WRYC 4A0RA 3B1WA 3SNHA 5JFGA 2IHBA 1DTSA 3ZIAA 2GF9A 4A2PA 3CWQA 4Q4JA 1E9BA 4B3FX 1IOZA 1ANKA 4F91B 1WE2A 2IUSA 5FH9A 1HQYE 2CJWA 5FOUA 5EE9A 1VMAA 4HZIA 4M0LA 2UVQA 1XD9A 4ZDJA 5EXSA 4ASUD 1S4QA 1RZ3A 2JIZA 1ZC4A 4LGMA 1OE0A 2VLIA 1W5SA 4FMDB 2K5UA 2GEDA 4JYBA 2DWQA 2O52A 3FFAA 1M7BA 3A37A 4Q02A 4M1TA 3R7WB 2PT7A 1N6RA 1OT3A 1KI6B 2QAGB 3OFND 1U94A 1VG8A 5JS7A 4B3CA 5JRZA 2WJYA 1FMJA 4N0DA 5H8WA 3K0SA 1JALA 1KI2A 1WP9A 2G3YA 2F3TA 3NBFA 1DAKA 4AD8A 2R2AA 5FTJA 1ZNXA 1YZKA 4RFVA 5CM8B 3VFDA 4CEJA 1CS4C 1MRSA 1QF9A 3RRNA 4UNRA 2OLJA 4U00A 2J0VA 2QPOA 3L82B 2BVNA 3NIBA 4P0TA 1XD8A 3R7WA 4IDNA 4BFXA 1GDDA 3LDAA 4C7OA 5GJCA 2WWXA 4HYYA 4FCTA 1Y3AA 2G1JA 3B5JA 4NPHA 3R9XA 1G18A 1XEFA 5CK4A 4NYIQ 4V02A 4M1OA 3U44A 1L2TA 2GZDA 3FKQA 2JEOA 4YC7A 2PJRA 3SJBA 2QQ0A 2Q0HA 3LY5A 2XB4A 1U0HC 5FPHA 4JL6A 4WXPA 1ELOA 2H7VA 4B47A 3O8BA 5BYKA 3KX2A 2IXGA 5DHAA 2NO7A 2YV5A 4RCYA 2XNDD 3DL0A 5FTNA 5J4YA 1KSHA 1N6OA 2ATVA 2BJVA 3A6PC 5JI3E 2ZI3A 1FX0A 1KI9A 5CK5A 2AD5A 1XJ0A 2YNMA 5DHFA 1AS0A 3FHCB 4IJMA 2XTMA 4JKYA 2VRWA 3QBTA 4DLWA 1D2MA 3VNUA 4ACAA 1FP6A 3IBGA 3M0EA 1KZ7B 2QEQA 1ZIOA 1N2CE 1XEWY 3BOSA 1NJFA 3IO5A 3W34A 1DG1G 3CR8A 1AQUA 2ZTSA 3DDCA 3Q85A 1ZP6A 2V9PA 2OO7A 5F9FA 1OPXA 4LYJA 4RD2A 4XVRA 1FMLA 1XMIA 4GP6A 3NDPA 4XTRA 4YXWA 3PEYA 2PLRA 1PUJA 1HQCA 1W4CA 3U3JA 5SZHB 4Q48A 3REFA 3KXIA 4R71A 2H16A 4JMPA 4CT5A 1D9ZA 4MDFA 3A4NA 3CF0A 2D2EA 4LY6A 3THYA 3IEUA 2ZROA 3AUYA 3W90A 2ZRHA 2J45A 4KODA 1W36C 3MRSA 2CDNA 1RW4A 3IILA 1MRNA 3D7MA 3X1WA 2DFNA 2RGGA 2FSGA 1AGPA 1TEXA 2PH1A 4Q4JB 4KVAA 1NN1A 3KUDA 1WRBA 2OG2A 4KAXA 3Q8XB 2YWGA 3Q72A 3HU1A 1FNMA 1DG3A 2D74A 1ZINA 5JHHB 4UXIA 3W9YA 2NPFA 1QHIA 2CCGA 2ZJ8A 4K81B 2QE7D 1ZUIA 2ANCA 4EJSB 1Q1QA 2PCJA 4W5JA 5FBQB 3MSXA 1E9SA 1NL3A 3SQXA 4BUJA 4EIWA 1DO2A 1KMQA 1QHHA 3A4MA 1VPLA 3LD9A 4OYHA 2GXQA 5KUTA 1CR4A 3EA0A 3TNFA 3EZ2A 4POAA 3LBNA 4IFEA 3V4FA 3ASZA 2ZSEA 1D9XA 1P9RA 2JLXA 2IBMA 3CKLA 1JQLB 5L3QB 2X2FA 3J81k 2ORIA 3ZVRA 3CNOA 3RRMA 5FPYA 3OF5A 3P26A 3IQWA 2VP5A 3EX7C 3CH4B 4TL9A 1NIJA 2QT1A 1W46A 3K0CA 1VCOA 2ZVQX 2P6NA 4LJYA 2CJWB 3GJ6A 1U8AA 4W5WA 3DVLA 3MGCA 4DDVA 3FMPB 5BWMA 2ERYA 3E1SA 4PHTA 1TUIA 3CRMA 1E6CA 1JI0A 1RFLA 2X1VA 1EGAA 1VIAA 3X1ZA 4EPWA 4OQFA 5AUQA 4ARZA 1XZQA 2J7PA 2W2TA 1AQYA 1GUAA 1LFDB 4ZCIA 2DWOA 2QN6A 1XTSA 4G0NA 4I81A 2JLWA 3A1WA 3PENA 2HLDA 4Q4LA 2P3SA 2RGCA 1A82A 4QBIA 3CX7A 5IK2A 3RS4A 2KE5A 3I5XA 1E98A 1KZGB 1SVLA 4AG5A 5DI3B 5IDVA 1G7RA 3DOEA 4LOAA 4I1UA 2EFCB 2ZU6A 1K5DA 2FF7A 3QXJA 3LW8A 1XMJA 3TVDA 2RGBA 4QGGA 2DR3A 2IS1A 2A30A 3I8XA 2ZSBA 2RMKA 3A1SA 1ZVQA 1UJ2A 4DVGA 3SI7A 5D3MA 4PR0A 3G82C 1BMFA 4NU0A 2Q21A 5KDLA 4IVQA 1XWIA 3G0HA 1LW7A 1XB2A 3FMOB 4C2TA 5AJWA 1UF9A 2I4IA 1T3SA 3OE7D 4LUCA 3T5DA 4MDEA 1N6HA 1EFTA 5GJWC 2CBZA 4LYAA 1FNNA 4HDCA 1GWNA 1Z47A 2ZJOA 3OZXA 4B3DA 5J4LA 3QNUA 2Q3MA 2D4HA 2CXXA 2NPIA 4R2IA 5KO2A 3OAAA 1AS3A 4XTCS 2CK3A 2VIIA 3DKVA 3U3KA 2A9KA 2FPMA 1G4AE 5D3MB 2C78A 3V4RA 1FUUA 1W0JA 1Z83A 4DLTA 3THOA 1VG1A 4L9SA 4KFUA 3K0AB 2F3RA 2VP0A 3CRW1 5EXTA 5LB2A 1IJFA 1N6LA 4NCJA 4PAQA 1FP7A 4HAXA 2YWHA 1MV5A 1UKZA 3ZGXA 1Q22A 2FJUA 3U3OA 3ADDA 2Q9BA 4D6PA 1NKTA 1COWD 2FMXA 2GJAA 1RYFA 4IXNA 3RS2A 2NO0A 3HYTA 2FG5A 4LHZA 4XVUA 3DMNA 4M9ZA 3Q3JB 3O47A 1IQPA 3KQLA 3DMDA 1W0JD 5AUNB 2FDCA 2N46A 2GZHA 1XU4A 3MWLA 3NVAA 4Q1BA 2JDID 3IIMA 1UM8A 2EU8A 2KBEA 2CK3D 4HAYA 4H9GA 4DLVA 3LX8A 3MJRA 3QKSA 4RSGA 2XTNA 4Z8YA 4LBVA 1CJMA 2Z43A 3AQ4A 1B0UA 4TMKA 3LLMA 3TR5A 4MITA 1EK0A 1FFHA 4CEIB 2FEMA 3LX5A 4NYJQ 1U8YA 2V1UA 2FFBA 4AURA 1SVSA 4NBSA 4TLBA 5BYJA 5KNCA 4JIMA 3RABA 4XIGS 1ZUNB 3FWYA 5F9HA 2ZI5A 2QI9C 4TT3D 5FPTA 3D8BA 4CIDA 3VTKA 1ZBDA 2ZAOA 1NG1A 1OKKA 5FPKA 4V0ME 1J8MF 1GILA 2GZAA 4HAUA 2QTVB 3CRQA 5H1YA 1SVIA 1LVGA 1E1QD 4JVSB 2LKDA 1F2TA 3BRWD 3T12A 3TSZA 4XD7D 3MWKA 1E79A 3BFVA 5LB4A 3TMKA 3WP0A 1E4YA 2IF0A 1ZIPA 1HT2E 4F38A 2WAXA 4AKIA 3I4LA 4BLQA 3PUVA 4F93B 2F55A 1W7AA 2ZS8A 1N5KA 3GJ4A 3SEAA 4UNSA 5B58C 5CB6A 1EX6A 2PZFA 4G5RA 2QORA 1JEDA 4OBEA 2PJZA 5SZJA 2O0HA 4EQ6B 2OCYC 3E2IA 3MWYW 3AGQA 1WQ1R 4B75A 3U4QB 1JEEA 2ODWA 5JJKA 1OYWA 2PMDA 5DIFA 4P4SB 5DISB 3QXHA 4MYTA 4KLZA 4NCHA 2RKOA 2ZANA 3EARA 2EYUA 4AYXA 2G0TA 2WVJA 1J8YF 4ITRC 4Q9HA 4TMXA 3M4YA 3KDSE 3REGA 4EFMA 5JSZA 1XXHA 5E4FA 3T61A 2ZM5A 3NXSA 2QTHA 5DE3A 3DZ8A 2BM0A 3AP2A 4RD4A 5EP4A 3R9WA 1OIXA 3PITA 3A1TA 1N5IA 3FYHA 2NTYC 4Q1DA 3UG7A 2REXB 1XTJA 4D4JA 3FVQA 5CITA 3EWAA 5G3ZA 1EWQA 1T0HB 3WYAA 4HB4A 1TMKA 1WCV1 5IHPA 1OV4A 1IY0A 2W6ID 3LQRA 4OHWA 5FI0B 4ZV4A 2HYIC 1HY3A 1G3MA 4DLXA 1ZMXA 2AX4A 2IXFA 2C9YA 1GNQA 4A4DA 1AK2A 2VHJA 1E1QA 2AXNA 1JAHA 2HF9A 2WJHA 3EIEA 5H70A 2A3RA 4PSVA 1TF2A 1SVMA 2ZYTX 3ND8A 3EZ6A 4HLUC 4KVGA 4ESHA 2OEPA 3WMGA 2Q6TA 4WZAE 1P73A 1E96A 1KO7A 2WJIA 2ZI9A 2H18A 5FUYA 3CM0A 1S1MA 1G5PA 4OQLA 3ZH9B 3GLGE 2QU8A 3P27A 4L8GA 3VR2A 4GOXA 3OIUA 4IDPA 4KBFA 3JZMA 2XXAA 4ZI3A 1OB2A 1NMZA 3I61A 4DWJA 1MR3F 2ZAMA 2YYZA 3OE7A 3TRFA 2C5LA 4NKRA 1VYVA 4FMCF 2D3WA 3ETLA 4E07A 4M9SA 1QDEA 4QKQA 2G88A 1SKYB 3ICEA 1QRAA 2RGEA 2JDIA 3GLFB 5D3QA 4RFSA 4HZUA 4A1FA 1J2JA 2ZETA 5K8LA 4TZ6A 4AKGA 2CMKA 3SE0A 1DAEA 1EFRD 3ZJYA 2YOGA 2IWHA 1TPZA 2OFWA 4C2UA 1T0JB 1UADA 1QHYA 4LBWA 2IYUA 1XTQA 5K8UA 4O0MA 3QKTA 5HCIA 5C46F 4BFUA 3TE6A 4LRWA 4JLDA 5DI3A 3GLFE 2C9OA 2FU5C 3QF4B 4QNMA 1T3LA 1OFTA 3QJYA 1TX4B 3MD0A 4RD6A 3LW7A 1D2EA 2RGNC 3UMFA 1XPOA 1G17A 3LVQE 3TUJC 3C16C 2HJGA 4EUNA 4JLPA 1J7KA 3VNVA 1T9HA 1N6NA 1XTIA 3VKWA 4DRZA 3K1JA 3SJAA 4TQ9A 2IK8A 4B74A 2CCJA 1CP2A 4Q7LA 2VL7A 2WMNB 2GJ9A 1FUKA 3EC1A 2F1HA 1JPJA 3UPUA 3L0OA 4JBWA 1XBTA 3CZQA 1NVWQ 4HUTA 1P3JA 2BBTA 2F9MA 1NVXQ 2ZEJA 2UKDA 1S9DA 2CHGA 3Q5DA 4AIIA 4QJ3A 2BDTA 4XOIA 3KTAB 5CLLA 4A0FA 1S96A 3BH0A 2O8FB 2B6HA 3A58B 1IN8A 5C1BA 2DPXA 2OBNA 121PA
chains in the Genus database with same CATH superfamily
5JNVA 1SUSA 2PVCA 3IDAA 2MINB 2J0UB 2QDKA 2B2NA 2DPHA 1KGDA 4Y6SA 4MWSA 3BAFA 1UBRS 2A9FA 3VH1A 3QXXA 4C08A 4UDNA 4NTZA 4KDCA 5FI5A 2V1XA 2HCTA 3K8OE 2V9ZA 4C78A 1ZRNA 3LX4A 3QTTA 2G4LA 2OZKA 4LIPD 1SIOA 2YJ4A 4MINA 1BHQ1 2AMYA 2FOIA 2HRBA 4L15A 1DJOA 3IXQA 3PL5A 3TFWA 5JAOA 1OXBB 1F20A 2F64A 3BHIA 3SZ3A 3S1SA 1B93A 1C3EA 3U3RA 2IX3A 3EE6A 2FG6C 4HWGA 2VP3A 4DSNA 2ZRPA 4JYZA 1QB8A 4AAYA 1MA3A 1PZGA 2BGRA 2EDCA 3VSAA 2KJQA 4GC5A 2YDYA 1H2HA 1NFQA 2WUGA 1P0FA 3LO8A 3URMA 5FTMA 1GVHA 3QFHA 3ZHCA 3LDHA 4ZO4A 5HRUA 2J3KA 1DBIA 3SVZA 1WXQA 4R05A 4D82A 1VCNA 1RKUA 2ET6A 1R6TA 1VSUA 2VI5A 3OOYA 4ND5A 4W5RA 3PNPA 1Y9JA 4MHSA 2PUBA 2PVPA 1N2IA 2VHWA 3F5QA 2ZATA 1VXRA 3SKXA 1KI3A 3TPZA 2YUIA 4CW7A 2BGUA 3WMWA 4FOTA 1W4RA 4J8PA 5ES4B 5DGCA 2EAUA 5JD6A 1RWMA 3D3NA 4RZ2A 4A27A 4AWXA 5GVRA 5CYFA 2G63A 4FGSA 3TOSA 3PTLA 5CH8A 3MAJA 1AHPA 2ANBA 3G9QA 5JO9A 1RE1A 1IOVA 2J9YB 3OHMA 4H7IA 1I6WA 2CWDA 3F71A 4W7IA 3ZDFA 4F1KA 4PANA 2PH7A 1HDZA 2HA0A 1K1EA 3WYGA 3QVKA 1T43A 5F5NA 2J0EA 1Z2DA 2WICA 3ZXUB 1JR6A 3A2LA 1J2YA 5BSKA 1MRZA 4AJ1A 1R18A 1C1XB 2XE4A 2ECPA 3CNBA 3PKZA 5AQEA 3T3HA 1S4MA 3KLMX 4GMGA 5LDDC 3Q3EA 2O8EA 2DT5A 5IM5A 3KB8A 2G9NA 2AOUB 4EF5A 3RS5A 1K7XB 4MPJA 2W6OA 4D41A 2VJKA 4XWKA 5HF8A 1CR2A 4LJ7A 3TB4A 3VKGA 4IKOA 1EXMA 1CVLA 1UP6A 1PJ3A 4J16C 4Q4DA 3H75A 3LDFA 3OUZA 3H65A 3EGOA 4KQXA 5EZSA 2OYCA 4LS3A 5JDCA 3HJTA 1O95D 2O5VA 4F92B 1DFGA 4WZZA 3WLRA 3SIRA 1Z74A 3V3KA 2EW8A 1Z3IX 2ZKIA 3K8QA 4KDFA 3WBJA 3OJ0A 3AWDA 3QPWA 4BWGA 1WUJS 5CDFE 1FFBA 1SXGA 4BX3A 1O95C 1RWBA 1D2RA 1NMSA 1QK3A 3BWYA 3C43A 3DAFA 4WDQA 2H1FA 4WUTA 5BYBA 2ASVA 3A04A 3WKCA 2JLBA 3GLHE 3ZV6A 4CL8A 4D3SA 1EVYA 1N0IA 1ZX1A 4FVTA 2C4VA 1U2EA 5KAPA 3R8FA 1XKTA 3AW8A 5T8KC 1OZAA 2WD7A 4YAIA 3ZVMA 2C88A 4QREA 4C03A 1HLPA 3TO5A 3PVCA 1SOMA 2C2WA 1BS2A 4BO7A 5BSTA 5BR8B 1Z8NA 1TVEA 2GFHA 4TMZA 5KINB 4NVRA 2TRSB 1JIJA 3BXEA 4ZPXA 1CUXA 3QMVA 4H60A 3U7IA 3MWJA 2IC5A 5IF3A 2FCAA 3QTLA 3GFBA 1SY7A 5IC6A 4LJ6A 1XDDA 3U5ZB 2EKZA 2CLDX 3ZCRA 5TJ9A 3WB9A 5I3ZA 4BO9A 4J0IA 4PFJA 2P0YA 2YJ3A 2XE8A 3FZGA 2GKOA 4EM6A 5AK5A 1GU7A 1SUDA 3KVOA 2VHCA 3I6MA 2HWWA 1E0SA 1EXNA 4FTWA 4EJMA 2HY7A 4QECA 5LQUA 3P9RA 4EL0A 4L16A 1QO0A 4DN6A 4CM4A 2ZTLA 3CO0S 5IF9A 5AW2A 3KS9A 3C3EA 2V7TA 3IP5A 4BIIA 3WNCA 1CBUA 4CE6A 3LQQA 4DSOA 5KI6A 2W4QA 4QG7A 1ODLA 4JUCA 4C4AA 3DQZA 1MAVA 4XRRA 4BP3A 4UDYX 1M5TA 5KTMA 1XDSA 2FZ4A 2AKEA 2FV8A 1NW3A 2ZYVX 4ENSA 1KC3A 2RG7A 2R4QA 4Z49A 4JXJA 1YA4A 1AKUA 4L07A 2TS1A 5FWNA 5K2OA 1WB6A 1ZKMA 3ESXA 3HQ4O 3I9KA 1B0AA 5E38A 2FWNA 3SXUA 4BNZA 4DCVA 3QF7A 4MJ3A 3H3FA 5E7IA 3S81A 2QSZA 3RV3A 5DMHA 1XZIA 5LZ9A 4QPPA 2OESA 3B82A 3E9MA 4EVRA 3I3SR 3M89A 4Y1GA 4AZ0B 1DEKA 5BP7A 4BO8A 1M8JA 4DMMA 4UZEA 4F9FA 4XB6B 1QFYA 2HDNB 5IC4A 3FETA 3L0YA 1ADGA 2D4AA 2J7KA 4IS3A 4MGHA 5CT6A 1KYIA 3KUCA 5G0TA 1PR0A 3VKVA 4F3KA 2ZIFA 1JB1A 3LOQA 4A15A 5I7AA 1NT4A 4D97A 4N8DA 1V95A 1Q6YA 4YRTA 4DXDA 1CXZA 3PIDA 2BMJA 3EPLA 5ADUS 2WF6A 1QH9A 3SIXA 2D1TA 3VX3A 4HYTA 3AP3A 4EI8A 4M86A 2YRFA 5BN4A 1QYCA 5KU7A 1Y5RA 5K4AA 3PX2A 2AL7A 4IG4A 1NSFA 5DGTA 1PX0A 3GC6A 3TQIA 5EIFA 2UUAB 4QTYA 1K8ZB 3L6DA 3SQWA 1MX5A 3LTEA 2GAAA 4Q01A 3A1VA 4QQ8A 3X1JA 5EJ7A 3KOZA 1QHSA 1B76A 1CZKA 2UZIR 3PXCX 2IDMA 1DKOA 1FDSA 3RRBA 1GRQA 3MCTA 2FN9A 1QH1B 4CETA 4BFTA 1X7DA 4TZTA 5LBIA 4PAMA 3WL5A 1P61B 3A1NA 3QYAA 4X8HA 5JCXA 4WZAA 5K1ZA 1T26A 3RANA 4WZBB 3DC2A 4TRNA 1Z7EA 3LKDA 2FQYA 4RX1A 3GARA 4X20B 2ZUFA 1AY0A 4MUHA 4UKDA 1YKGA 3Q6NA 1FZTA 2VZ8A 1Y3CE 4YRFA 1JV2B 3UICA 1WBBA 1ZI9A 1NKSA 4LXQA 3JQ6A 2NU8A 1QOPB 4J1SA 3OKFA 3WNZA 2BCJQ 3CO5A 3WBBA 4HTFA 5KYVA 4ABTA 2X9VA 5WRFA 2NP7A 5LQDA 3OLVA 1JSLA 1TLTA 2VP6A 3NEYA 4RD0A 4Q9IA 2FMIA 3LUGA 3Q7RA 4OMFG 1WV1A 3O74A 2I99A 3NNDA 3G2QA 5K6AC 2XE7A 4LXXA 4QRDA 3D8NA 1Q44A 4MS4B 2NNLD 2DMRA 3ANLA 2ROQA 4ZRDA 5E8RA 3AETA 4MV5A 3ITDA 4Q18A 1A04A 4BATA 3O91A 3R9XB 2OPBA 1GAJA 2XZDA 3A9WA 3S1AA 3UA3A 5JVDA 1ZRMA 2J3QA 1QGDA 4DV7B 3OSZA 3UMBA 3ZY5A 2B4AA 1KNQA 4I3FA 1AO0A 5EGNA 1IXRC 5DASA 3NYRA 2AUTA 2X5NA 3CZ4A 3K1AB 5ALHA 4A91A 3DE5X 5B1HA 2H54A 1KK3A 4HAOA 5FNVA 4YREA 3ZJTA 5L7YA 2Y76A 1EG7A 2VYQA 3WNBA 4ZHQB 1OUMA 4JC8A 2OORA 5AKEA 8GPBA 2V7PA 4GBED 2NU9A 2X7JA 4B7UA 2BONA 4JLBA 3ORRA 4YRJA 2ONYA 3AU9A 4Y67A 1XCGB 3W5JA 4Y6RA 1LDGA 4A8JB 3D8SA 4MMYB 1RRPA 4D57A 4RTOA 5C2JB 1G1MA 1UBEA 1C41A 4C0BA 5ITVA 1WPRA 1CUEA 2XUKA 4UQLA 3K70D 1GEEA 4BVLA 4PC7A 1BJKA 1JZTA 1I36A 1Z0ZA 4A8JC 4HNVA 3OEHD 4ZO7A 2GCIA 1VG0B 1MB4A 3EIHA 2GT1A 2XX3A 2IYXA 1GPMA 5FD8A 1IXZA 2Y6VA 4HPJB 4ERNA 1K75A 5KTPA 4BXOA 3SC2A 3MMXA 4QHSA 4QOSA 5U9CA 2YVAA 4KO3S 2GHQA 4MCAA 4WBSA 4EAQA 3FWZA 3K4HA 2AQHA 3N1UA 3DO5A 3K0FA 4AQDA 5FR1A 5JSUA 1T91A 1MXFA 2Z5GA 3H0KA 2ZSAA 3H97A 3W0LB 4DSZA 3AM1A 3VNRA 4DLRA 5CFPA 5JCJA 1TCCA 3I6QA 3H8SA 1XTKA 1H1LA 2CEAA 3BQNB 3QOXA 4F9GA 1EQAA 3C15C 4D8TA 4DBVO 1IZ7A 2XJ9A 2COUA 1Q21A 2YX1A 3L7AA 2JGIA 2IHTA 4RK4A 3OU6A 3RK4A 2C7RA 2B92A 1BDIA 5EHIA 3FDZA 5ARDA 4AK9A 1LCIA 3GP8A 1QRTA 3FTCA 3M6MD 4QXAA 2Q7XA 4DL9A 3EC2A 5JCOA 2IPMA 1Y9AA 4ZCQA 4DLKA 2O2HA 4NBWA 1QTIA 1FFWA 2FRVA 4YJ3A 3ML1A 3EHDA 1TZJA 3RLIA 2WYOA 1E3MA 5HJ7A 3G5AA 2BUBA 4LVUA 4AF7A 4P53A 2IXTA 4GHWA 2C3MA 1Q7BA 2HQBA 2OV2A 3QV1A 4FDUA 5CIWA 5JYCA 1C4OA 1CV2A 4R81A 5FBWB 4RV5A 2I9PA 2D54A 3Q8WA 1ZISA 1X3LA 1EFPA 4AIRA 1T9DA 2IY8A 3EBLA 3R0ZA 2ESRA 4MIKA 4RPCA 2B5VA 3CXRA 1GQRA 3IELA 3NT5A 5EVCA 1Y7PA 4JSYA 1I9GA 4NYIR 3HU3A 2XKBA 1KAGA 4CM5A 1BD3A 4ECEA 4FKMA 2KMLA 4GMDA 3WOVA 1E2HA 4FCCA 2UYHA 2HRQA 2XUOA 2GKSA 1U02A 2PL1A 4PLYA 5A04A 4FGZA 1FTSA 2CV2A 2BBOA 1R4MA 4K6CA 2C5EA 3IV7A 2Y4OA 4NU6A 1GM5A 3DEJA 3CF4A 1SZDA 2IL1A 3ICWA 1U0EA 1EQ2A 2CUTA 2ZJ3A 1X7YB 2CHQA 4K46A 3H11B 3TINA 4BX9A 1S2GA 2WRZA 1MCZA 2BSXA 3T7CA 2ZYHA 5D3KA 1CY8A 4ZVVA 5AHRA 3WRXA 3CLTC 4PCLA 5EKXA 2VDVE 1WZ2A 3UFXB 3OKCA 3ZU5A 5TGDA 3PT5A 3V8NA 5CJ2A 4KXYA 1KSJA 1Q7CA 2ABWA 5AM3A 2IIVA 1DPGA 4LDPA 1I0ZA 3QU4A 4MGZR 3P97A 4PHCA 5C8YA 3SEQA 3QVWA 4Q37A 4ZYVA 1R9NA 3FVTA 3JZDA 3L46A 2ACWA 2QL7A 3C3KA 4PX2A 1NBOA 3ZCSA 5K0NA 1QB7A 1ZN8A 1CRWG 2QNRA 4NESA 4PS0A 3P9CA 1NQVA 2DCMA 4RVNA 1HX7A 421PA 1G8SA 1JBEA 5FF9A 4NQZA 1DTWB 1F8YA 4DQKA 2VRCD 1WPQA 2IE8A 1MO6A 2DUMA 2DTEA 4UMDA 1H6DA 2HCBA 3TS1A 3QKUA 4LRQA 3FYUA 2GK4A 5COAA 2W00A 1NAHA 2PWAA 5TE9A 1W35A 1FSGA 1XAGA 4UHJA 2F1IA 5TX7A 3RAEC 1E6MA 1P9NA 2GN6A 3TEFA 4TQUS 3HH8A 1C0LA 3KKZA 4OU4A 1SA0A 2YC4C 3UXMA 2FHSA 5GTDA 4WDRA 3RU7A 3V97A 2R6HA 2Q5QA 4E33A 5KWIA 3VR5D 4BB5A 1U28C 4QBFA 5JFOA 1SZCA 1BYUA 2I66A 3FHJA 1RPZA 3IPYA 2JH8A 3W3AH 2GPBA 1R5BA 3AINA 4XJVA 4EUEA 3SDZA 1MO4A 1ML3A 3TW6A 4LSWA 1JHYA 2J32A 2Z1DA 3I04M 5HMMA 3DR3A 3V7UA 1XPOA 1OAAA 4OH7A 1U0LA 1CF9A 2WHPA 3PV0A 3OJXA 3M5PA 1DKRA 3UJCA 2XD4A 4FKBA 4ZRMA 4TWAA 1A7UA 4ZYUA 2B69A 1SKBA 2VDRB 2DPMA 3JYNA 1TT5B 2YZMA 2P2GA 3KR9A 1E1RD 3MTIA 2P4QA 2EJTA 3KZMA 1B41A 1O9GA 3LKZA 3PFBA 2Q5LA 5ILQA 2XE6A 1K8RA 1Y7LA 2JFYA 3G3EA 3WIDA 2GXUA 1USUA 3WYCA 3L4JA 4KQCA 3TE7A 1M76A 3ITEA 1HLFA 1Z0DA 1M6HA 1T6YA 2IX9A 3GJRA 4ZHQA 4EG8A 3WY9A 1L3IA 4U8HA 1KQFA 2FKAA 4DQDA 1NRJB 3FVVA 1K6XA 3GDHA 1TJ5A 2QA5A 1MJHA 5JWOA 3CW2A 1WCWA 4KJZA 3I83A 2GYWA 3B1XA 4N3NA 2R84A 4IDCA 3ROPA 2R00A 1TK9A 4NNPA 4XQ0A 2B1RA 3T0IA 4B7AA 2XNKA 4U7DA 3LNCA 1WETA 5D2CA 3VV3A 3KYBA 2H8KA 2J0SA 3FUXA 1MUUA 1CRPA 4UOQA 5IKPA 2ZYGA 1XZMA 3VPCA 4WOBA 5KHLB 2LGJA 3VPGA 4MA4A 3QUCA 2VQ3A 4BB9A 5LPNA 3UW1A 3PWSA 1T5LA 4CTJA 1D3AA 3PJFA 3PQ7A 1NKVA 1SOUA 1NVVR 1K3FA 2WSLA 3CMMA 3IAM1 3NH6A 4JYMA 5ETJA 3T9DA 5UKDA 4CV1A 1VE1A 2GEBA 4JP1A 4RJJA 3PB3A 3IUPA 3OTIA 3SK0A 5KJ1A 4K6HA 2D0IA 5KVAA 1KPIA 2UVPA 5ELMA 3NM6B 3D1JA 3EMBA 2J6IA 2W6IA 1V47A 4OK6A 4QGFA 4XQCA 1RHRA 1QC5A 1OBCA 2BMFA 1QFSA 1G63A 2E3JA 4LYDA 2CFIA 3NKVA 4K9DA 4QAJA 2NXCA 1AF7A 2EFYA 2PQMA 1GSOA 3I34X 1P4RA 4RXUA 2RC5A 1V5WA 2RC6A 2ZRGA 4DS3A 4V2IA 4REMA 2UXDB 5TB5A 4N76A 3IQDB 3P96A 4DV0B 4K0RA 1OU4A 1ULZA 3F67A 4OSPA 4AMZA 5AXAA 4AI6A 3HKEA 3HP1A 3NGLA 4TV9A 3FKSA 1F2VA 2GBPA 4J4HA 1AHNA 4YA6A 3UHFA 2RGWA 3AB7A 3VAAA 4FYXA 1V3UA 3IUYA 2A7QA 1P5ZB 3QMPA 4KK3A 1YB1A 4LGCA 5FXMA 3UAXA 4AUKA 3AHJA 5KNLA 3WGIA 2OGSA 5C5IA 4TKLA 2AE2A 1OA0A 3GBSA 3KV3O 4RYLA 1VL2A 1N2GA 4L5IA 2WNSA 3O2QB 5FYDA 3IE2A 2FMTA 1YMQA 1YS2X 3D3QA 3HSKA 4WOCA 2YN4A 3GMSA 3S2IA 1EXVA 1ZR2A 1JVSA 3PQ6A 2H00A 3DKIA 2YV3A 2AC4A 5JXGA 1IHXA 1XLWA 4RK5A 5H9WA 5CT4A 3IL2A 5IVPA 4ND7A 1MIOB 4Z53A 1UMDA 1V8PA 1WXWA 2AVNA 2AXPA 4IGEA 4UEKA 4BGEA 1G21E 2FSVC 3DPIA 3OQ1A 4I55F 1V8ZA 4JGIA 4KLNA 4MAMA 1PLLA 1KE1A 5KQMA 3CVXA 3IBTA 2B4TO 3GPDG 3WRVA 4CKZA 2C99A 1QQ6A 3G8CA 1YZ3A 1MOPA 2W0MA 3QA3E 5HWSA 3L0BA 2C3PA 2NVOA 5JTUA 4OB7A 3BKXA 2R4UA 4HDQB 1RM5A 3ZWNA 2C9MA 2HHLA 4G07A 4C6TA 3KIPA 5H3HA 2IUFA 3CRRA 4DPLA 4BV9A 4YJHB 1U7OA 2H11A 4FJ1A 5A4JA 4QFBA 1RJ9B 2MMCA 3BILA 3E9QA 3NOOA 3GUYA 1G5RA 3L7CA 1QYVA 3G13A 3TSOA 5KMGA 3PE4A 1L5WA 3HBLA 4Q15A 4QOHA 5KNBD 1XPJA 3P9QA 2VK8A 2OGTA 1NXXA 2JGLA 4NULA 3VJMA 1JIIA 1G7TA 1GZVA 3WJ2A 5B4VA 1LGYA 1NLZA 3A7DA 3TFQA 4AS2A 5T3YA 3RR2A 3OJOA 1Z4KA 3E22A 3F4BA 2Y3IA 1DIRA 3PCTA 4EUSA 3IUJA 3MJFA 2GWHA 1A8QA 5TEVA 1L5QA 2X76A 4UHDA 4ERXA 5G1NA 2B2XA 1TYAE 1KQNA 5IHXA 2MTBA 2OZEA 3G17A 2D5LA 1YASA 4LBZA 3GD5A 3RAFC 2IYOA 1XTRA 3A32A 3VR5A 4CM6A 3EIWA 3QRWA 4CI9A 1RKQA 1T1JA 3PUXA 1RHKA 3OCYA 4UFNA 4B5KA 3FSGA 1UIMA 4IGAA 4ZVOA 1M7HA 2E5FA 5GIPE 1ZM9A 1UPFA 2XT9A 2OBMA 5ARCA 4ZZ0A 4AJOA 4LJKA 1Y8QA 2HREA 2EKLA 1Q50A 1C9NA 4Y9RA 4W9NC 3G5UA 4G8DA 1TU0A 2V6IA 2JLSA 3D6UA 1RYHA 3J80A 4DYDA 4BMNA 1MV8A 2RIPA 1V41E 4A5OA 4C0AC 4PPFA 5LOVA 4JGGA 1GTVA 2ZJBA 5AM0A 2JKYA 1DBSA 4Y6LA 2FZLA 2VPPA 1LU9A 1R64A 2Q3LA 2CL6X 3I52A 3NCHA 4EABA 2YC2C 3MC1A 2I1LA 4O2BA 1A4UA 1I0IA 3FSEA 4TVOA 1KKLA 4AX8A 2O3JA 2NU8B 4GP7A 4FZJA 1TAQA 2W9XA 1XMQB 2XB2A 1QG6A 4M0EA 4N5MA 4K3VA 3V3TA 1G5TA 3LE8A 4HTFB 4Q1CA 5B3KA 2ZTVA 3LWNA 2OCBA 2ZJYA 4P7JA 1CUUA 5F73A 4U3JB 1IHDA 3N2GB 1XRMA 2VTKA 3TAHA 4BU1A 4UXHA 3O8CA 2A5DA 3Q9LA 1H3NA 3SBDA 3IERA 1X8LA 2DBRA 2D2XA 2WG0A 2XZTA 3B53X 3PD7A 4J0DA 2P27A 4QQFA 4X90A 2QRMA 4BMXA 1ZL2A 4QODA 2ZXFA 1SU7A 1W5FA 3GF4A 5E9JA 4DYVA 4DC0A 1GQOA 3AI1A 1DQZA 2IWRA 5ABPA 3ZLJA 2WF7A 4C4PA 4K9MA 4RHTA 3Q5GA 5BUZA 2EJVA 4HQRA 3UAZA 4BVKA 2P2LA 4QATA 3N8NA 2I4NA 3B85A 5DF1A 3EDRA 3O7MA 3PQ8A 2VAVA 5HKLA 3ZQJA 3HGTA 2J3MA 2X0RA 3G2HA 3G5TA 3JVDA 4JGBA 4JLKA 4MUAA 4OQNA 1WZNA 2JJ1D 1B00A 2OQRA 4M4SA 4S2EA 1D09A 2BLLA 2DSTA 3LA6A 5GIOE 1BVHA 5AKXA 5E3JA 4DBZA 1LBHA 2QSUA 4GLBA 3CV3A 3H8VA 1N34B 5AXBA 3NC4A 1FP1D 1EUDB 4UNQA 5KDOA 4Q9KA 1LY1A 2DQSA 1BE0A 3ZCXA 2QOEA 4DLZA 4N3GA 4F3YA 1XUOA 3WWZA 5BN3A 3VR4D 4Z4IA 3TZEA 2V7EA 2CV1A 1RTKA 1X7HA 4BXOB 4D4LA 4IW3B 2BEUB 3GMDA 4Y2JA 4NYJR 1C0EA 3DMTC 3E53A 1RWPA 4G6ZA 1SG9A 2Z6UA 1VCHA 4L4SA 2NXJA 2GF0A 4W8OA 1C7RA 2IY7A 2O3QA 1E99A 4JVLA 3MINB 3M5DA 2Y1CA 5A3VA 3STHA 5CNKA 2G06A 1O1YA 1VL0A 4W1RA 1ZHHA 1YU9A 3EZ9A 4TMWA 3CVJA 1DRJA 1Z62A 2HO4A 3H9EO 5U4XA 3W8DA 5J4VA 3RYFA 4A36A 4S04A 3GLGA 4QUBA 2EHDA 2P67A 3B2QA 1Z45A 1N8NA 2FCRA 2V4ZA 1V3TA 3P2YA 4HFNA 3TW8A 4JI8B 1IJBA 1RZRA 5CVJA 2PLAA 2C04A 3L9XA 4RLQA 4R2WA 1WW3A 2I4MA 1HG0A 3K0EA 3TM5A 4TTPA 3RYHA 4XGKA 3JRXA 5DU2A 1ODKA 3RG2A 1SXJB 2WA2A 3B6EA 3RYCB 1TADA 2C97A 1OYOA 1T24A 2GPJA 1AKMA 2GN9A 3BMNB 3B2EA 3EUFA 2WSIA 4G5QA 4EHLA 2PA0A 3A3NA 5JOQA 5AW8A 1YCFA 2QG6A 3KU4A 1IN5A 2VSOA 3I2HA 3GPCA 1U9IC 1I3MA 1QQTA 1NOKA 4X97A 4PIVA 2JJ2D 1X42A 2JHAA 3RIYA 1YBFA 3KQWA 4TKUA 5JIBA 2O8VA 2DRIA 4PN3A 2CNLA 4KBYA 2C42A 2IUYA 1XDWA 2QY9A 2CVHA 3QEOA 4JJ4A 5HFAA 1N2SA 2D7CA 1E7QA 1RYEA 4YDRA 2GFIA 3OZRA 4BNJA 2HJVA 1DKUA 1MZPA 3OZCA 1ZHOA 1GYQA 2O14A 1K7EB 1PO7A 2G70A 2H57A 3SR4A 4HGOA 5SZKB 3ZOZA 3DF9A 3RVKA 3GJTA 2I8AA 2F7SA 4K2HA 4LRUA 1U9YA 4L73A 4MYDA 1NVVQ 4UUOA 4UNPA 5H02A 1EFCA 5IJ9B 4MRPA 1DO8A 4L28A 5LC1A 5K09A 3F5FA 3WL8A 4FP9A 3MMNA 2D0OB 2CVZA 4GI3A 1JPNA 1PSZA 2H4XA 2WUEA 2YYAA 1QIHA 2Z2YA 3CGGA 1XROA 1ZK2A 3GEDA 3I2FA 3IRUA 5LYJB 4KFCA 3L6CA 1T8SA 4S1OA 4CHTA 5KX5A 4UTNA 4OUKX 1IWBB 4LC9A 4F56A 2GTHA 4TYWA 1SCAA 1LRKA 3GQBA 5HEKA 5J40A 2P90A 4FJ0A 3ET5A 1D6JA 2VTBB 2XEXA 4QYXA 3C8ZA 3WA7A 4Y18A 2OGUA 3AFHA 4PQRA 3JVUA 5E4JA 5I6DA 4PICA 5J4HA 2C7OA 4R2HA 1GL3A 4ZALA 1MO3A 2J1LA 2NXNA 1TM2A 2JJQA 1O8BA 4X44A 5G4KB 2OXIA 3KB6A 1ZR4A 4BMVA 4Q3EA 3M82A 3BWCA 3JATB 4ER7A 1AM4D 2HSWA 3F97A 2FPSA 4OD0A 2IKSA 4O2BB 3RK0A 3DQPA 5MHTA 4NABA 3LRPA 3KV1A 3B1VA 2IU3A 5IAKA 3SLKA 3N53A 1SUPA 4GT1A 3UOAB 3IKTA 3OOWA 4ZOLB 4BBPA 1AIPA 1QO0D 3CLRD 4ZCRA 1GNSA 4LY0A 1O03A 3KBOA 4X65B 3WR5A 4RF3A 3ZJUA 1K4KA 1AKWA 2NU6B 4ZVMA 3V8BA 1T5TA 1BJTA 3K2QA 4L74A 4BNGA 4JT4A 5JDCC 5TMBA 4GDFA 1PEYA 2TMDA 5DGHA 5KTYA 5JNRA 2QLNA 4UTZA 1Q7GA 3UMJA 4KHPB 3QELA 3LS2A 3ENQA 3DXXA 4RGQA 3GLIE 2JCBA 1I4LD 2QYSA 2Z2XA 2ZDGA 5EMMA 1I51A 1PU2A 1J2EA 2DHRA 3EB9A 2H65A 4JUFA 4PWZA 4BLVA 2XYPA 3VU9B 2OILA 2V59A 3TQCA 3LTNC 3GMTA 5FTKA 5A02A 4Z5XA 1OW3B 2WU1A 3HDTA 4LE0A 4YRCA 1JFLA 1QU3A 3C8DA 4FYWA 4J4TA 4LWPA 3UJ7A 1TLFA 2FW9A 2VYVD 3LBYA 1J9GA 1SCDA 3NETA 3KZKA 4CDMA 1SIWA 3Q9NA 4LX8A 1YVEI 2QL9A 3QLVA 4B71A 2CLLB 1J0CA 5SICE 3DR5A 2JCVA 3E8MA 1E3TA 1SCNE 1RU3A 2ZREA 5E2BA 4G01B 4GNKA 4IRMA 4DV2B 2HXSA 1NRWA 3M4ZA 4EI7A 1W0KD 5CFQA 1G8YA 1DIAA 4JP2A 2A5FA 2C00A 4BO4A 4MVYA 3MB8A 5I3CA 1J99A 2BC9A 4LJLA 3SP1A 3FI9A 4MIOA 4ARZB 4TYQA 1Q1EA 3G7SA 1YO6A 2BHRA 3WK5A 1SGWA 1Z2EA 1QIFA 1Y33E 2V7GA 2WIJA 1TD9A 2WM3A 3OZVA 3IQHX 3AONB 3PGMA 3S27A 4AKHA 3F49S 5JISA 4FYMA 2OHVA 1NM5C 3A3YA 1SD2A 1HEYA 2O7RA 2R8BA 3CMCO 3STYA 4TM7A 5ELLA 4HRVA 2GAOA 3O3OB 3EAQA 4NLLA 1V3QE 3UH1A 4BRUA 2ZB8A 1QQ5A 1DLIA 4WK4B 3SICE 2BRUC 4BX8A 4I46A 2P1DA 5BV2P 1MJGM 4AVYA 3T5TA 3OMXA 2UXCB 3G8DA 1JEJA 4FUTA 5EIAA 2GS9A 4FM9A 4AECA 2E4WA 3D1LA 2ECFA 9ATCA 4KR7A 3FCEA 3GVCA 3OPMA 1I1NA 3KHUA 2R8YA 2XMSA 4EEKA 1HOTA 1KVQA 3DZJA 3LFUA 5LOVF 2ZZNA 3SMVA 5BNTA 3PRHA 4B44A 4IMJB 1TRHA 1AKRA 1US8A 1LTQA 2EQAA 3A9RA 4OHOA 1MX1A 1XZEA 4MQEA 4RDCA 3ZS9A 4HLCA 4E5VA 3PD1A 5CBPB 2GFQA 1DIOB 3TCNA 1AQJA 4KI7A 3D0OA 3G2OA 5CXSA 4L95C 2JGAA 4P3PA 1SHKA 2HLDD 1UXHA 4N5IX 3CXUA 4QDOA 1GXSA 4DPMA 5TVKA 3ZX5A 1C7EA 1X0VA 3I9OA 4HN4B 1WF6A 1ZCBA 1U0RA 3QG1A 3AI3A 4OB8A 4P4UA 2I29A 3KPYA 1JQAA 4HDRB 4REOA 3RAPR 3VH3A 2HTFA 3M4NA 3DGEC 4KH0A 1KU6A 4P3YA 2QG4A 4N7BA 1OI4A 5EE3A 5HUJA 2DLDA 5JAQA 3VGJA 4EJSC 3ONWA 3KSBC 3HDHA 4FNGA 2DXIA 3TTSA 2Y1GA 3VI3B 2Z95A 1RRGA 3QSGA 1XJQA 1GAWA 3PG5A 1KA9H 3WL3A 3NHWA 5EHXA 1YBHA 3C5WP 1LDEA 1TQ2A 4QU0A 1O94A 1PGQA 3OWOA 2ZUEA 4MW6A 3OVMA 1X87A 3EFEA 4H59A 3KKKA 2GKGA 2QJFA 3LK7A 3RU3A 3RIHA 1JG2A 1TZKA 5TMPA 5SY6A 4BZZA 2O57A 4EB8A 2V4UA 4HDNA 3BIOA 3STXA 4MLDA 1MTZA 2OZVA 1ZUWA 2PKXA 2POCA 3R5SA 3R6GA 2I3DA 3FNEA 4NCIA 5EIOA 4JLWA 4X64B 3T7IA 4JJ6A 5KOYA 1EU1A 3UXYA 1P2BA 2D5IA 1M54A 1R88A 1SEVA 1QPGA 4NMWA 1UBOS 3MW8A 3R41A 1OLSA 2DECA 3DCNA 2C1EA 1EK5A 3G88A 3MCUA 4JITA 4D9IA 2O8NA 3BJIC 4MWCA 4KFRA 1V5EA 5E4TA 2O5RA 5GONA 1K66A 4BGIA 4BLTA 2HM7A 4BP1A 4FEGA 2VJAA 4PIPA 3HLTA 4GQBA 1VI6A 3QENA 1E4OA 4FFLA 3KQUA 2X0DA 4F3TA 1GP2A 1I6LA 3NEJA 1Z17A 5G4KA 2R44A 3AZOA 4Q7QA 3NBAA 2IYZA 3UJ6A 1GA4A 1Q11A 2XMCA 2D8MA 5JADA 2D6FA 1QYRA 4Z4CA 3LWZA 4BGDA 5FOXA 2G9QA 2VUIB 4YR7A 2CFRA 2OYRA 4C21A 4RE6A 4YRZA 4Q47A 4HHEA 3HB4X 5CX4A 1SQ5A 2PBLA 1XMVA 4WL0A 4YJ2A 2DQ4A 2G36A 4F6RB 1SZPA 1E64A 1Z06A 4J2OA 1ESZA 3UC5A 2DERA 4KR3A 1P2TA 1NPTO 3B9PA 3QTBA 4G1UC 1KKMA 3GFPA 4N6NA 5ALEA 3KYDA 3NAMA 3VYUB 5BMOA 2EFHB 4N7JA 4KSCA 5A03A 1E20A 2JKZA 1M1YE 1KP9A 3NV7A 1ISMA 4MGYR 4WERA 4W8HA 2WJ4A 3FNQA 2WJVA 5ILGA 4C0HA 3ADCA 3SR3A 3RC1A 3SN6A 1F1JA 1TCVA 3GFOA 2JAUA 2ZSDA 3D3EA 4YXWD 3T7RA 5CB4B 1X8XA 4O2AF 1KFEB 3UJPA 1YBVA 2UYOA 3SQOA 4GPBA 2QLLA 5F33A 2KM1A 4ZKEA 1G291 4W1SA 2HK9A 3UT6A 3S2FA 3WGHA 1B74A 4YT5A 5D87A 3ZXIA 1KBQA 2KWIA 2FOLA 1UEXC 4R2MA 2QN2A 4RW0A 2BFNA 3K6RA 4Q3AA 3TNYA 2TMKA 2ZRFA 5KZMB 2X19A 4XSHA 2NZUG 3S2EA 4Z4QA 2YHSA 4ER3A 2BMEA 1P2SA 2GDZA 2ZB3A 4OHKA 4Q7KA 5HQ3A 4QM6A 1JDBB 1D03A 2JS7A 3H7AA 4L51A 4OQZA 2WW8A 3T9BA 4CQMA 1I2AA 2WK1A 2PNFA 4KXXA 3GLTA 4YMGA 4EPRA 1QHGA 3CUUA 1IMJA 3HJBA 4FBGA 4R2LA 4TTVA 5DNWA 1TI7A 3NV9A 1E66A 4KO1S 4YJKA 3W2EA 2DGDA 4R9RA 5BOSA 4O0LA 1JE0A 5BOVA 1TYBE 4A9AA 4A03A 4Q4HB 4GW3A 3FYCA 3FYDA 2PO7A 1AF4A 4U9IS 2WJJA 3V8QA 5ALKA 1RYMA 2FSIA 1VKZA 2OCKA 3SQMA 1K97A 1P1RA 3IEKA 3IR6A 4PG8A 2Q6OA 2CLSA 5ALLA 3MERA 3ZCVA 4LV6A 1ZJ5A 4C05A 4UNNA 1FTQA 2GJKA 3IBYA 3K9LA 4R1QA 1Y4AE 2FR0A 1JLHA 3GZTB 4LKRA 1SHJA 4ER5A 4J0GA 4OOFA 3F7NA 2OAGA 3ZCUA 4JOQA 3L8GA 5AI0A 1Z3CA 2WUDA 2QUJA 2CLIB 1ULUA 3OWHA 4OGGA 1RDFA 1UKVY 1CERA 3FUTA 2FDRA 3PVSA 4PCAA 3T7KA 1AC5A 2X2EA 3BM5A 3KQTA 2W2KB 1M7GA 4LDRA 4MS1A 4X1KA 4ETIA 3EA4A 3MCZA 5KYUA 3DG9A 4HRXA 3ZLTA 4WQMA 3BGWA 3WKEA 1X70A 3JX9A 2R87A 2H0RA 2CC2A 2EZ9A 2WSSA 1PRYA 5F1KA 2Z9BA 1ONBA 1QZ3A 1M2VB 4WGGA 5HZGA 2F48A 1JS1X 1HKUA 1RS0A 5AK6A 5BMVF 2GCOB 3PBKA 1EFUA 4D99A 4RIFA 4E7OA 1NXSA 2TECE 4JNCA 5KQRA 3AILA 2D8AA 3L5OA 4LOJA 3F5SA 2VDKB 4RLHA 1BQEA 1MVLA 4XH9B 3MTGA 1G2PA 2GOYA 2JC3A 5HFNA 1UP4A 3E2PA 1RE0A 3WAKA 2RH4A 2I3GA 2Q6IA 2VDPB 2OA0A 5IKMA 5NULA 3KAPA 3ABZA 4DQXA 3ZHYA 3AKDA 1W5AA 4UBLA 5GV8A 3T41A 3JQAA 5CR9A 3K9BA 1PNRA 1BG6A 2VQDA 4HYEA 5DGXA 2C8JA 5DW0A 4YXFA 2OUKA 4JQCA 4EJ2A 1WVMA 2H1RA 3GT3A 3HFGA 2GCNA 3Q6IA 2BI4A 4JB2A 3WRWA 6Q21A 1QNLA 2ZAYA 1LJLA 3AF3A 3IUEA 4X60A 5KQSA 5JBQA 3KQKA 3NXKA 5C1OA 1EE1A 3D9QX 4BS9A 3PC8C 2CSUA 2XOKA 1PGOA 1NLUA 2QYTA 3Q3IA 3IRVA 2HK7A 3CB4A 2ZRDA 4C0JA 3ROZA 1NQWA 2JFUA 2WOOA 4FT4A 3A8TA 4IWXA 4R7TA 3GH3A 4TMTA 4RMIA 3T4EA 3F3MA 4MV3A 3KYCB 3P0JA 4BYMA 3CUKA 2CJPA 2R1UA 5CYOA 2A0YA 1YS7A 2HSDA 2LKCA 1N5DA 1GQ2A 2H4YA 4LZZA 2QP9X 3CUTA 3IC5A 1MG0A 1CCWA 3V42A 3B6IA 3I12A 3KXDA 3W6PA 4C7OB 5JJIA 3OLWA 4WE3A 4Q6WA 1K3TA 2A4MA 4QUIA 1FU8A 4YCSA 2X8AA 5A0FA 3A11A 4CCWA 2FPGA 1ECCA 5AJZA 3H2HA 2QT0A 5IXSA 2R8EA 3VHLB 2PT5A 2X5OA 2QE7A 2BD0A 3IO3A 3OZAA 4IHKA 1KJQA 4JIGA 3T99A 4EVSA