2ZI6A

C4s dck variant of dck in complex with d-da+udp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
241
structure length
217
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deoxycytidine kinase
publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 217
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi6A00
1ANKA 2A30A 2ZRAA 3I5XA 5IRCD 2GBLA 2WJIA 4QOSA 2GCPA 4ZO4A 2NO7A 2J0SA 3SS8A 1PV4A 1NRJB 1NKTA 4AG5A 3N70A 1O87A 2F7SA 2LKCA 1QHSA 5JZVA 5AWFC 3QG5A 2ZUDA 3PUZA 3G0HA 1NSFA 2EFGA 2V1UA 2R44A 3BJIC 5TXGA 5L3SB 2QU8A 2ZU0C 5KDLA 3SZRA 4XTRA 4PZYA 3IIMA 5FOXA 5CLLA 5FBWB 3OZXA 4GL2A 3W8RA 2GRJA 5BW8A 5KNCA 1XPUA 1NLFA 3VR1A 4QKQA 2VHQA 2BBTA 2B6HA 4D0LB 2IUTA 3L0SA 3M4YA 3VHLB 3O8RA 2OFWA 2IS6A 1G5PA 3WMGA 3ICQB 1KK0A 3EIHA 2CLCX 4RD0A 1SZPA 1N25A 1GKUB 1WMSA 4O3MA 1AZSC 4MRPA 1XTKA 5F2EA 2OZEA 2GETA 4QG7A 4G5SA 4M1KA 2QQ0A 3A1WA 4BEJA 2N1BA 4Q03A 3K0AB 4LHXA 3FKQA 3GJ8A 1W5SA 3TW4A 5AJWA 1US8B 1ZC3A 2ODBA 1GKYA 2TMKA 1Z0AA 2NO9A 5FTMA 1HT2E 1Z0JA 2I4IA 1UKZA 1KO7A 3FPAA 1CJMA 1AK2A 3LX5A 2DB3A 2KI5A 2AN9A 1COWD 2JLYA 3OF5A 3CR8A 4Q1FA 3AKDA 3D7MA 4DBLC 1HE1C 521PA 1YRBA 4TMVA 3K9GA 5B2ZA 2BBWA 2ZI3A 1ZIPA 1Q12A 1X8JA 5EXTA 2WWHA 1VG0B 5E3HA 2AKAB 3NDPA 1D8TA 2IYTA 2JLUA 5A5GA 5HZHA 4PAMA 1NNEA 2Q9AA 2CDNA 4C9BA 2QMUA 2DWOA 4TMZA 5BWMA 2ZRNA 3C16C 4YXWD 3NBZC 2XSZD 1DAKA 3GLFB 5JCPA 5JECA 2GF0A 4NCHA 4DCSA 1W44A 5EUQB 1I2DA 1OIVA 2DPXA 1E9DA 2A5YB 4NYIQ 4QL3A 3RRMA 4BZQA 1UBEA 1RRFA 1SQ5A 5DI3B 2XTZA 2ZXUA 4ASUD 1VIAA 2C99A 1ZM3A 1W7AA 4IFBA 1LNZA 4Q7LA 3P4XA 1TUIA 4QGAA 4CEJA 1KI1A 1N6NA 2OBMA 2YWGA 3CW2A 1JAIA 4J0QA 5AJZA 1FPMA 2W6ID 3TR5A 1W36C 1G7SA 2O8BA 3EZ6A 5JHGB 4DHEA 4JJKA 4PQFA 2MSDB 1XXHE 2QPAA 2GJ9A 1G291 2FU5C 3CRQA 5AUPB 5C4MA 1G6OA 3TAUA 4DC9A 1RVDA 3UATA 5SZIA 5C18A 2F6RA 1J2JA 4URVR 2H18A 2QG6A 4AWXA 3TSZA 3KFXA 3BERA 4MKGA 2OCAA 2VP9A 4AURA 3O8BA 1NMYA 2IXGA 3SOPA 3GLIE 2QPTA 3LBIA 3ZQ6A 2G1KA 3A4NA 2FJUA 5LD2C 4A15A 3MSXA 4UNNA 4LV5B 4LJ4A 3RAPR 1OH7A 1JQJC 4WOPA 1GWNA 4WXPA 4NU0A 1CBUA 2GK7A 5FR2A 2FPKA 3G5UA 2PEYA 2WJVA 5EP1A 4DT1A 2ODNA 1ZAKA 3SJBA 4PC2A 2HCJB 1KDOA 1E0SA 1D2EA 4FI3C 4TLBA 2GJAA 1KI6B 4WBSA 2JLQA 2GESA 5FTNA 4BFUA 1KAGA 4M9XA 3FKSA 4BFSA 3SR0A 4YONB 2VH5R 4A2PA 4HAZA 3RRZA 4EFMA 1AS3A 4BRUA 3T12A 4AC9A 3MGCA 1VPLA 1SHKA 3SNHA 2CMKA 1XXHB 1NLZA 1JECA 3Q5DA 5CDFA 2Z4SA 4JVNA 1GUAA 2ZSEA 2W6JD 4YMVA 3K1JA 2JAQA 5FUXA 2OG2A 4W5JA 3OAAA 4JLAA 3U2QA 1KJYA 5BN5A 2PCJA 4RCYA 2DFKB 1G64A 2VHTA 3GLIB 3EC2A 1KK1A 2MSCB 2ZQ5A 4DCVA 5AUNB 3CB4A 4GOKA 1W47A 2Z0MA 1HA3A 3LW7A 2OAP1 4NBSA 4CDGA 5FUVA 4LHYA 1OT3A 4B33A 4IDOA 3B8HA 3LNCA 4E5UA 4TQ9A 1DG1G 3AVVA 1QHYA 2DWQA 1DARA 3C7KA 3OIVA 3GEEA 2ZREA 3OIUA 4R98A 4AKEA 4B35A 3B9QA 3B60A 4L4UA 4XD7D 3LO5A 3A4MA 3UK6A 4S2EA 3HWSA 2YV5A 4NYJR 3CRMA 2YOHA 4PPFA 1WRBA 3QKSA 3SN6A 2DCUA 4G1UC 4BFVA 1EFRD 1L2TA 2IA5A 1ZP6A 3B1VA 3VNUA 4JL6A 4TYNA 3PUYA 5JWRA 1XJQA 3IIKA 2WWYA 1GDDA 3QNUA 1I4TD 1G3UA 4EPTA 4NCNA 2V54A 4OQXA 2FN4A 3JZAA 3O8CA 3EA0A 5FFMA 4DDTA 1E69A 4B3FX 3QKRB 1RIFA 2YC4C 1J90A 1II0A 4XTCS 5DISB 4ESHA 1FP6A 4C0HA 3I72A 4JYCA 2FWRA 4URYR 4OYHA 3UXMA 1XB2A 1YZLA 6Q21A 8OHMA 5EQTA 1FUKA 1ZC4A 2Z43A 3JVVA 3QJYA 1A2KC 2IYVA 1G18A 1RKBA 2R6FA 3DMNA 4DLXA 4XWOA 5FI1B 1GRNA 4Q4LA 1KAOA 2F1IA 2X2FA 2JLZA 3THWA 3ZQJA 3KKPA 3VQTA 1OFUX 2ZS9A 3E1SA 4QHTA 3MFYA 3S1AB 3K70B 3K70D 5G3YA 1IOZA 4JT2A 4EDHA 3P4YA 1GNPA 2O8CB 4A4DA 3FMIA 3DOFA 4HB0A 5G3ZA 3HU3A 1IM2A 1XD2A 1GZSA 1DE0A 1QHHA 4OI4A 1GKIA 4KFSA 2KBEA 5HZKA 3BB4A 2PLFA 4Z1MA 4BFTA 2QPOA 3EWAA 5E95A 1EX7A 1XD9A 2FPLA 4G5GA 3TR0A 4CEHB 1G41A 3DM9B 1X6VA 5TMPA 4B3GA 2IK8A 2KJQA 3DKPA 5FOWA 2JGNA 1ELOA 3W5IA 2VP6A 1TU3A 3DHWC 3GPLA 4DIDA 2GJ8A 2QRZA 1Z6YA 2VSOA 4H1UA 3AV0B 4CRWB 2J87A 1KY3A 4C0JA 2IYLD 3SQWA 1P2SA 1Q1QA 4Q4HA 2VA8A 1D2MA 2ZRDA 1E4VA 5E7IA 2HYIC 1BKDR 1C4OA 1UKYA 4V02A 5J4LA 3GJ4A 5KTYA 4EJSC 4PXAA 2H92A 5FBQB 4IHQA 1S0UA 4IXMA 5F9HA 2IHYA 3ZYCA 1II8A 3I8XA 1RZ3A 1YZKA 3K9LA 4NKRA 3VR4A 2QAJA 2GF9A 3ZJYA 1XBTA 3LBHA 4Z51A 1R0ZA 4LBWA 1FTNA 4B75A 2J41A 1E2MA 2WICA 2OV2A 4ARZA 5A4JA 5JRZA 3PEWA 4RZUA 3CX8A 2FGJA 2UZ3A 2ZE8A 3B1XA 1S1MA 1KI3A 5BQ5A 2FZ4A 5D3QA 4EUNA 3KJEA 4GMDA 1OHHA 2G9NA 2WMOB 4DB2A 4ON9A 1XPRA 2R62A 2VTKA 4HAVA 2ZROA 3RYTC 1CR2A 1KSFX 1UKVY 5DO9A 5GJVC 1CU1A 1T5LA 3QBTA 1A82A 4LJYA 3PITA 3C5CA 1JAHA 3EG5A 3M0EA 4UJ5A 3PUWA 2A2ZA 4BE7B 1RPZA 4Q66C 4AKHA 3LAWA 3D8BA 4QM6A 2GZDA 4JZKA 4Q1BA 1W46A 3CLVA 4GFDA 4G0NA 1RRPA 5DHFA 4A9AA 1VCMA 1E98A 5FH9A 3IHLA 1BOFA 2A7QA 3ETLA 3L0PA 2AL7A 3BFXA 4AKIA 2AX4A 3I73A 3K09C 4GMXA 1Z28A 2ZJ5A 4DDWA 3WMFA 1KMQA 2QORA 4R71A 2ZR0A 4UXJA 2QT1A 3AVQA 3PXGA 1MO3A 2P3SA 2ZI6A 1G3QA 2J0UA 5FBRB 5CM8B 1NVVQ 3CF0A 2FX3A 3MWLA 2DFNA 1Z6XA 4UQOA 3PEVA 2IS4A 3RS7A 4MH0R 1CP2A 1E9CA 1Y3AA 2ZRBA 4C4PA 5CYOA 3LV8A 2ZE7A 4B71A 3T35A 2ZPTX 5FPSA 4IRUB 1WQ1R 5CB8A 4QM7A 5TY0A 3GLGB 2IL1A 4QRHA 4G5OA 4TLCA 2B7BA 3U3KA 2QTFA 4M2LA 1KSJA 1Z0IA 2FSGA 2ZJAA 3BE4A 4Q9IA 4KHZA 3WP1B 4F91B 621PA 2OO7A 4Q4JA 4DUGD 3Q7PA 3QG1A 1IN7A 2OHFA 3AUXA 1TQDA 3CO5A 1NY6A 4LI0A 4JBYA 5FOTA 1AJEA 3AP3A 2L0XA 3HDTA 5B58C 1L8QA 3T15A 1U94A 1TADA 2IF2A 1JXOA 2WBLC 3A1UA 4U02A 2ASEA 2FEMA 1GAJA 1D9XA 3WY9A 2QRNA 1VYUA 3CPEA 4P4SB 3CONA 3M6AA 4ZCLA 5DIFA 3ZS9A 1OFHA 1IXSB 1N6HA 4FD2A 1GILA 4OHXA 3TMKA 2CNWD 3ZLJA 3RRYA 2N42A 4CT5A 1R5OA 4MGZR 3MWJA 5TARA 3B1YA 5CIQA 2PBRA 2RB4A 1SKQA 5DE3A 2XXAB 2P67A 1NSTA 1XTRA 3QI2A 4A82A 4CGZA 4B47A 4HUTA 4RFSB 2ONJA 2HT6A 3L8ZA 1QVAA 1P4SA 2QAGB 2G83A 2QSZA 1XTJA 1E1QA 1DAFA 1F60A 1Q20A 2WJJA 4C30A 2MMCA 2H7VA 4PHGA 2J9RA 5FI0B 1A5TA 4F4CA 2JJ2D 2E9SA 2FFAA 2YOFA 1P6XA 3MJHA 4M9QA 1NVWQ 1KSHA 3B85A 2DFTA 1IN8A 2QN6A 1SVSA 4TQUS 1YU9A 4CEIA 2YNMA 5IT5A 3BH7A 1E9EA 1CRQA 2F1JA 1FFHA 2IEYA 4URXR 5EXSA 2QE7D 2PMKA 4ZDKA 1T8TA 2KSQA 1JB1A 4B44A 3RSLA 3N2EA 2KWIA 4D0NA 3O47A 4EFLA 1MABA 1KJWA 2XNDD 3BWDD 4M9ZA 5IF9A 2EU8A 3NH9A 3U6KA 1UADA 2F43B 1IN5A 2FNAA 2VLIA 4HSEA 5AJVB 3SJZA 3VR3A 3B7GA 3P27A 1W4BA 1T0JB 4QJ5A 4GNKA 1RJ9A 4A2QA 1YQTA 2ZJYA 4KLNA 1M1YE 3I4LA 3TJZA 3KXLA 5JBQA 3HYTA 3AKYA 4NH0A 4B3BA 1P73A 2P0EA 1EFCA 4WVFA 3MUFA 5JWHA 1UEJA 5FPYA 3ZD7A 3GCGA 1Q3HA 5H70A 4DLWA 1Q22A 2AKYA 3CKLA 3EPJA 1E79D 3ZD6A 1IBRA 1EX6A 1G5TA 2VSFA 4EQ6B 3U44B 4BLOA 4L9WA 1Z6AA 4BFZA 2F3TA 3H2YA 3V4FA 1ZD9A 2GCOB 2QL6A 3GMTA 2QZ4A 4YMTA 1KK3A 3SI7A 3KQNA 2KE5A 4Q48A 4BLPA 2JDIA 2Q9BA 1M74A 1ZBDA 2QENA 3WNDA 2ATXA 5TB5A 4XWAA 3WHKA 1SVWA 4NP6A 2OXRA 3W8NA 1Z83A 2CEAA 3UG6A 1ETUA 1GFIA 3W34A 1AKYA 1NIJA 3VKHA 4XVUA 2BM0A 2OLKA 1OKKA 4JYBA 4US1R 4WW0A 1ODFA 3ASZA 3A1VA 1Z63A 1W5TA 2OAQ1 3HYRA 4QXAA 3VHXA 1F2TA 4FWTA 2ZSBA 3IILA 3QKTA 1TQ4A 2VBCA 1TPZA 4LJ6A 3RC3A 3AEZA 4BFWA 4RCZA 5E7JA 3TQCA 4E09A 2XJ4A 2IEZA 5D3MA 1QRAA 1XDBA 1KNQA 2OSBA 4LHZA 1S96A 5FL3A 1G5RA 4UXIA 2QT0A 1KI7A 3KZ1E 2BKUA 3GEHA 1Z29A 2O5VA 3T06B 2EWVA 4M4SA 2JIZA 1E2JA 1A2BA 2UZIR 3CX6A 1XEWX 2FF7A 5KYKA 3PQCA 3HR8A 4RD4A 4XH9B 2IXEA 2X8AA 3QPVA 1Z8FA 3NTUA 2OCYC 2OUKA 3TBKA 3OEHA 3K70C 1WP9A 1RYFA 2ANBA 5JRJA 1CEEA 1UKEA 3RLFA 4RZ3A 4TSFA 5F98A 1AS2A 3L82B 4GOXA 4PX9A 1EWQA 2Y8EA 1YR7A 4EAQA 1C1YA 1I4DD 4DDUA 2IC5A 4XSHA 4EQ6A 1MKYA 2VP5A 4FMCB 5F9FA 5GVSA 5FUYA 2REOA 2OILA 1SHZA 3QPUA 4MGIR 4AI6A 4B6FA 1XCMA 2UVQA 3QBVA 3B13B 4OBEA 3SFVA 3B78A 1W1WA 3H0KA 4US0R 1OPXA 3TRFA 2FPMA 1XF9A 2CCKA 4LYAA 2XZPA 3CRVA 4LRWA 4POAA 3AP2A 4L8GA 3ADCA 2RGNC 3Q8XB 2N46A 1P3JA 1JI0A 1X3SA 4M1MA 5KSPA 1BS1A 4G01B 2PZGA 4M9SA 3TVTA 3ZVLA 4S35A 4TTQA 3BIFA 3NXSA 1Q1EA 2WOJA 821PA 2OESA 1YR8A 2ZRIA 2WWGA 1M7HA 2QY9A 3HPRA 5BN4A 3O8DA 4W9MC 2BJWA 4N0EA 2VP4A 3FB4A 4GRAA 1Z2CA 1R4AA 4R2IA 4ZCIA 2X19A 2V6IA 2D7CA 4CEJB 4A0GA 2HXSA 3WHLA 2F1RA 3RSOA 3QXHA 2F9MA 2MSEB 1K6MA 2EFCB 4RJLA 1KDRA 5G40A 3RVBA 2XOKA 3MAAC 4M22A 4MYHA 3EARA 4TWZA 3TUIC 2O8BB 1N6IA 1ESMA 2BMFA 3AGQA 4LC0A 2BCGY 4A92A 1JNYA 4M0LA 2WWWA 5CDFE 4KYIB 1NKSA 1KJZA 1SXJE 1ZIOA 3WBJA 5AUQA 5CK5A 1NJGA 2CK3A 3H84A 3A1TA 2F55A 1GL6A 3AKCA 2EWWA 2BMJA 3VX4A 5IHPA 1OXVA 1WA5A 2IF0A 2R6DA 1P62B 1G7CA 3B2EA 3QXSA 4U00A 3U61B 2NG1A 3IO5A 5EE0A 3GFTA 4PSAA 1CJUC 2HEIA 4TLDA 3RC8A 221PA 2LKDA 3KUCA 3T34A 4DT1B 1Z3IX 3K0SA 3L43A 3NKVA 5TDHA 2GZHA 3BK7A 4P33A 5J4YA 1KGDA 1U8AA 2IWRA 4EIWA 5B30A 1W4RA 2OXCA 2IYQA 4TMWA 2G77B 3CUEF 3TW8B 4RD2A 1YRAA 5DN6A 3GQBA 2CBZA 4C0LA 1ZW6A 3FKSD 2Q3MA 3NVAA 3NC1C 5AK0A 2YHSA 3LLUA 1KTVA 1TAGA 4EPYA 5KPDA 2RGGA 2AD5A 3EC1A 2C04A 1VYTA 1CR0A 1QHIA 2QMEA 1N3BA 3LQRA 4A8JC 3ADBA 2PL3A 1TTTA 4O0MA 5GJBA 2NO1A 4IEEA 4Q00A 2Z5FA 3U7EB 3K9NA 1MO6A 4EPXA 2EFHB 5C46F 5AR1A 3B82A 1L4YA 2GWHA 1II9A 2QROA 3OAAD 2CVHA 4B3DA 5H68A 1SULA 1P72A 4Q7JB 3AVUA 1KKMA 2BEKA 1XU4A 1XEXA 4LPSA 2J1LA 1Q1ZA 4P3YA 3IPXA 3PVSA 1T6NA 4G5QA 4L15A 1T3SA 3AF1A 4KITB 2CJWA 4KBFA 2WIBA 1ZNZA 2PZEA 4ZI3A 3A1SA 1T8UA 2ODEA 1G8FA 4TL8A 1G6HA 4TYYA 4B74A 1E99A 3MCAA 4NE2A 2JLXA 4JLVA 2ZTSA 1QVRA 1XCGB 4IVRA 2YOGA 2WSSA 4D4KA 2GEVA 3BFKA 3ONWA 2KB0A 3U60B 2QAGC 4OHVA 2D74A 4EJSA 1XPOA 1F5NA 3E5HA 4BZPA 1HQCA 3PEYA 3OFNA 4BLSA 1R8SA 3DOEA 2BBSA 2ZSFA 3AF4A 5K8UA 3QKSB 3BGWA 1TL7C 5FR1A 2WJGA 2ZI9A 3SJCA 2YWEA 1U90A 4LX0A 2IYSA 5HCNA 4PZLA 1UBCA 3U7FB 3AF0A 2FSHA 4QNRA 1ZD8A 4YDHB 3SHWA 3QY0A 5DLQC 1Z06A 3NBYC 3KJGA 1ZM9A 4YC7A 2P5TB 4FMDB 4TTRA 4BLTA 3CF2A 5SZHB 1G1MA 2WZQA 3F8TA 4PPGA 5EZ6B 1E9AA 1FTSA 2G1JA 3U6BA 2ZJ8A 2VHJA 2XTMA 2RGXA 3PUXA 4RZXA 1AS0A 1VIYA 1GP2A 4FCVA 4URZR 2AK3A 3MWKA 1QBKC 3U3MA 4LDJA 3X1WA 3TSWA 1MV5A 2WJYA 3FDIA 2I1VB 4X8MA 4ZIRA 5KDOA 2PMDA 1TEXA 2D7DA 1N5IA 1SXJA 2HUPA 4KVAA 4LJAA 3K0CC 4Q19A 3VR2A 3PV0A 2ZS8A 5JS8A 1JALA 4PFSA 4WZAE 1DG3A 1QHGA 3THWB 3K09A 2NO6A 4QBFA 3KB1A 5IDVA 3AF3A 3GJ5A 5ANRB 1E9RA 4ERNA 2ZYVX 5L8VA 1JBKA 2HYDA 5FOSA 1GNRA 1BO6A 1NL3A 1RW4A 4AYWA 2WHXA 2W2TA 3NHAA 3V00A 4LJ9A 1XD2B 4IOKA 4C2UA 2R6CA 1QHHB 2AXPA 1NN5A 5CYPA 4KFTA 3UMSA 2MMGA 4C0KA 1GG2A 3ZH9B 1HTWA 2X1VA 3IEUA 4Z1MD 4NCIA 1M34E 5M04A 2GKSA 4WA7A 3WRYC 4G3XA 1MO4A 3GD7A 4Q9HA 5E4FA 2O0JA 3F5FA 3T5GA 4Q5IA 3ASYA 1XFAA 1Z22A 2QM7A 3EAQA 2WWXA 4GT1A 3LWNA 4LBYA 5KNBA 1E2DA 2CL6X 3IIJA 4ZCMA 1E3MA 1G8HA 3H86A 5DGXA 3X1DA 4Q4HB 2PCLA 2F1HA 3T1QA 4E22A 2ZJOA 4Q9LA 4QGFA 2QP9X 4Q1AA 3X2SA 4TYQA 3QUSA 4FCTA 4HLDA 4FINA 2Z83A 4RKEA 1E4YA 421PA 3SYNA 1KK2A 1II8B 1EG7A 2VYFA 2OFOA 4GI7A 1DOAA 1WE2A 2VO1A 4ARZB 2Q21A 2H1LA 4MDFA 2ZVQX 2CE7A 3BH0A 1LFDB 4YMSA 1OHHD 5CJPA 5KU1A 2XX3A 3DMDA 4HZUA 2GZAA 3HU2A 2QP3A 3R9IA 1XJCA 4A2WA 3HPQA 1H8EA 2C9YA 3CNNA 3GJ7A 2EYQA 4JVSB 3KKOA 1OJLA 2YC2C 3FFBA 4P4TA 1HUQA 3I8SA 2IW3A 4X8HA 3CH4B 3NHBA 5GVRA 1AGRA 3LX8A 5KDDA 4D4JA 2F3RA 1QG4A 2ZIAA 3U5ZB 1F2UA 1KI8A 1E0KA 2BV3A 2VF8A 3ZZUA 1KZ7B 1XX6A 2F9LA 4DEXA 2B92A 3A36A 2P6RA 2ORVA 5EE9A 3NC0C 5C1BA 2WPDA 1XEFA 4NDZA 2FEOA 2XITA 3CNOA 2J0UB 3HP1A 2IXFA 4KFUA 3QPWA 3THXA 3P32A 2I3BA 1R8QA 2WWFA 3KJIA 1UDWA 4C0BA 3GFPA 2X2EA 3AQ4A 5DYIA 4CYMA 1P9NA 1LB1B 1IJEA 2BKEA 3KQHA 1NI3A 2JASA 3PFIA 4AYXA 2NPIA 3AGPA 1Q21A 4KU4A 1JEEA 3C5HA 4Q02A 1E1RA 2EW1A 5J47A 1NBMA 2C9CA 4TL6A 3QXCA 1WCV1 3R20A 3BH6A 2ZETA 1Q1BA 4QGGA 1EXMA 2ZE6A 3H1TA 4D2IA 4Q4JB 2OFXA 3V4RA 3NDBB 5AJYA 3REFA 3ZIAA 3DKVA 2QTVB 4XVRA 3KFVA 3SBDA 4GPTA 2FE4A 3B6EA 4W5WA 2QMHA 2WWIA 2I1QA 4PC6A 1RRGA 3EX7C 2WJHA 2CL7X 1N5JA 2QSYA 4MRSA 5IK2A 3WMEA 3VU9A 2D2EA 1P7CA 1ZNWA 2NOAA 4URUR 1U9IC 1ZNXA 4IOMA 3LVQE 3J81k 5JWOA 4ESVA 2FFHA 4TTPA 1DO0A 4EPWA 4QHYA 4OKSA 5J40A 1CXZA 1S8FA 3EZ9A 5HE9A 1E1QD 1BYIA 1KDTA 3R8FA 3P1JA 4ITRC 4TL9A 3U3RA 4FMCF 1N6LA 2EQBA 2ZYWX 1J7KA 4DDVA 2FH5B 3AKEA 4OK6A 3BB3A 3KTAA 4B2IA 1HYQA 1CJTC 3KXIA 4PAOA 2O8EA 3MRSA 1H8HA 2C96A 1PJRA 4HEJA 5FTKA 1G8PA 4CEIB 3EASA 2ZI5A 4US2R 2E1RA 1KOFA 1U0LA 3R7WA 1NMXA 5CITA 1DELA 1SVKA 1Z07A 5EE1A 1KO8A 2ZR9A 1R2QA 4PZZA 4ABYA 2WKQA 2ZANA 2A5GA 1PVOA 4HAWA 3AF2A 4CZ2A 1W49A 2AD1A 1OW3B 1M7GA 1MABB 2BMDA 3W6NA 2AXNA 3RNLA 3W90A 1MRSA 1OIWA 3NIBA 2Q9CA 5JI3E 5EJEA 5LPNA 5JJLA 4DLUA 3QEJA 1CJKC 1RJ9B 1VCOA 3QVUA 1UDXA 1IJFA 1CRPA 4YMUA 1P5ZB 4NYJQ 4JKYA 2NZJA 5EP3A 1J99A 4A36A 4IVPA 4DSOA 5K8LA 3X1XA 4NONA 4U7DA 4NHOA 4QHSA 2IYRA 2ECKA 1TF5A 2NMVA 1E9BA 3JVUA 1G4UR 5DNYB 2DYKA 4PQYA 4U5XA 1KO5A 4DKXA 5LB2A 4JLBA 2FFBA 1VCIA 2C5LA 1AQYA 3LFUA 2V6JA 4YDSA 5G53C 2NZ8A 2ZRGA 1VG1A 3ECCA 1B23P 2RGNA 1GNQA 3PENA 1Q0UA 1M6NA 4H9GA 5P21A 2C2HA 1NVXQ 3L8YA 4A0HA 2JDID 3IDQA 4L5BA 3EZ7A 2V7QA 3PJRA 2BWJA 4C2TA 1YZUA 5EP2A 1ZYUA 4D25A 1J70A 4JVMA 2SHKA 1T3HA 1JXMA 1UF9A 3SQXA 3TQFA 1PZNA 3GFOA 3ZZ0A 4UNQA 2J46A 4MYCA 4W7SA 4X8OA 1G21E 2ZRMA 4HLCA 2R8RA 3NWJA 4XWKA 1OKKD 4QBHA 2XGJA 3GJ6A 2W2VA 2ZYUX 4Q9JA 1KMHA 1E2HA 3AVTA 4MUAA 1X1RA 1LY1A 1CR4A 3FMOB 1W36D 1F2TB 1W36B 1NF3A 3UWOA 3L0IB 3SHFA 2IYZA 4LYFA 1AN0A 1MR3F 5KHOC 1UBFA 1CR1A 4IOLA 3I5YA 1NP6A 1Q44A 3OIWA 3PG5A 3QVVA 4R7ZA 5D3MB 1OLOA 3DO6A 1IXRC 1GOTA 3BXZA 1VHLA 3DVLA 4A6XA 4I1OA 2PT5A 4MQBA 1W0KA 3U7HB 1JR6A 4YLGA 2DFLA 1G17A 4HI0E 5JI2E 1TQ2A 5LD2B 1NG1A 3H4MA 2JIZD 4GBMA 1Z47A 1YHNA 2CE2X 2PT7A 3KDSE 1VG9B 2QA5A 4G5RA 1AIPA 2RGDA 4XIGS 4B34A 1R5NA 1DAEA 1X86B 2D62A 4TLEA 2Z4RA 1R0XA 3KL4A 1FP7A 4K8OA 3WNCA 3OEHD 4QJ3A 3KKNA 1EFUA 2HF8A 5BN3A 4Z8YA 1LW7A 5L3VA 2DY1A 2XTNA 4TSFD 4PPQA 3U4QA 2O8FA 4PO1A 1FUUA 4LYJA 4PSVA 1EK0A 3GLHE 4KYUA 3TSOA 2H57A 4CT4B 1DO2A 4C7OA 2XAUA 2HCBA 4JKIA 3AVPA 1JJ7A 4AIIA 1G3MA 1P60A 5CIWA 3QIAA 1R0YA 1BMFA 2BCJQ 4I4LA 4A8JA 1Z2AA 2PZFA 1E2QA 4JSTA 3LXRA 2RKOA 4HDOB 3WYFA 5FPTA 5AUOB 2QEQA 4PO8A 1E6CA 2RHDA 1P2TA 4W5HA 3AVXA 1DVRA 5FL7A 1K5DA 2A78A 5EZ5A 2AWNA 5JLJA 1OH5A 4Z54A 1U99A 2G0NA 4WZBE 1DADA 1L4UA 4QNMA 4E07A 4AG6A 1AKEA 2PX3A 3DEFA 2ORIA 4RY2A 4DRZA 4DSTA 2VP0A 4OQLA 4Q7MB 1LV7A 4DLYA 1XMVA 3W3AA 2OCPA 2GA8A 4V0LA 2ZI4A 4ZKDA 1OFTA 1SVIA 1S3GA 1QG2A 3EW9A 1LS1A 3I1FA 1OH6A 4KV9A 1U0JA 4AYTA 1N0UA 1NY5A 4IKEA 1KY2A 2HXYA 2ZSDA 3TKLA 1P75A 2XOKD 4JJZA 4A1FA 4A0RA 4AD8A 4MRNA 5HR5A 1FX0A 4AKGA 4O25A 2BMEA 3FYHA 3B1WA 4B76A 1FW6A 4MYUA 3CF6R 4TLAA 2H8KA 1RRCA 3AP1A 1U8ZA 4LYHA 4MKIA 2B8WA 4MUBA 4ACAA 2OCBA 3EXAA 1GTVA 3QOFA 2ODWA 4MGYR 4NYIR 5KUTA 1WB9A 1ZRHA 2CK3D 2H5EA 2NQ2C 1MT0A 1D2NA 1NIPA 4O2RA 4LUCA 2XZOA 2EFEB 2XB4A 4F4IA 3LRPA 4HDQB 4TT3A 1H65A 1SKYE 4JL8A 4QBGB 4XOIA 2JJ8A 4BPBA 4OHWA 2JCSA 3BBPA 4Q47A 4Y0VA 4DWJA 1I4LD 1U8YA 1SVLA 1J8YF 2JLWA 2OM2A 5EUMA 4UNPA 2VRWA 3GJ0A 1EFHA 2VHUA 5DH9A 4QBIA 3M1IA 5E7MA 3CZQA 3Q5EA 2O8DA 1XCPA 3AVYA 4TQAA 2WM9B 3MG9A 1ZUNB 3BAFA 1W2HA 3CR7A 5GJWC 3KX2A 2GJKA 2JJ1A 3Q72A 5DN6D 2ZM5A 4UXHA 2QBYA 1R10A 3D3QA 4B6EA 4PANA 4Q18A 2AK2A 3TGPA 3EIQA 5G41A 2P65A 5J4KA 4IXNA 4JBWA 1OV4A 4QC2A 4GP7A 2J0QA 3K0CA 3NBXX 1N5KA 1W0JA 2GTPA 4ILEA 4MRVA 3ZS8A 5L3QA 4NYMR 1N0WA 4DJTA 5H8WA 2ZRJA 4IDPA 2A3RA 2VHCA 4LCBA 1EWRA 1E0JA 2CLDX 2FFQA 2ANCA 1PLJA 1QHXA 1U98A 1X8KA 4GZMA 2YYZA 4GDFA 4BUJA 4MDEA 1OB5A 5HPYB 1XEXB 3Q85A 1SKYB 1VYVA 4DCUA 1YR9A 2GCNA 4Q1EA 3ZDQA 3W9YA 4D81A 5KSOA 3K8YA 3DZDA 3MMPA 4V0MA 4B73A 2C03A 1TUEA 4OL0A 4HLUC 2IHBA 3C4JA 3PUVA 1XZPA 2CJWB 5BXQC 5DYGA 2WTUA 3CPJB 4JLMA 4ZV4A 5JCZA 5FPKA 1F6BA 2OLJA 1HQYE 3GLHA 2G0TA 2JATA 1XRJA 3NEYA 3RS0A 1G7TA 3G82C 4BEBA 4F4JA 4BFYA 1CJVC 1XEWY 2DBYA 3TLXA 4JLDA 2WSSD 1JR3A 2WMNB 3IHWA 4K81B 4OK5A 5HCIA 3IUYA 3QF7A 4EJSB 1DAHA 1AM4D 1OYWA 2J59A 2J7PA 3MD0A 4AK9A 3IGFA 3B5JA 3OFND 3QF4A 4C0AC 4EPRA 4YQFA 1DBSA 1LF0A 1JJVA 3JZMA 5HKKA 3VNVA 3EZFA 3K0FA 1IY1A 3A4LA 4HAUA 4HYYA 5C4GB 5EE3A 4IEIA 3FGNA 4HB2A 4GP6A 5FOVA 1PUIA 4A0FA 4RKFA 1ESNA 1IN4A 3GLFE 5JSZB 4JLPA 3N5CA 4TMTA 2J3EA 1G8GA 2HLDA 1B0UA 1FL9A 1GSIA 1JEDA 1YZNA 2GAAA 3THYA 2W83A 2ZJZA 3U3JA 5KO2A 2ZU6A 3LLMA 4JVLA 1AA9A 2ZEJA 4DEYA 4LK2A 2RGEA 1JPJA 4JLKA 4PO9A 1MRNA 4DLSA 5J4HA 1XJ0A 4LPKA 1NG9A 4MKFA 4Q4AA 1G16A 2ZRCA 2BEJA 3IEVA 4ZIRB 3L0OA 1YKSA 4R9UC 4OHYA 1SXJB 1U0HC 1DTSA 1SXJD 2DWPA 3DM5A 4HB4A 3SYLA 1K5GA 3U3OA 2CHGA 2QGZA 3CRRA 1P9WA 4TYPA 4B43A 3PEUA 5LDDC 2CHQA 2XNSA 1NN1A 1GRQA 1P9RA 2UKDA 4MA4A 4B2PA 1G7RA 4DCNA 2JEOA 1G8YA 3BS4A 3T1TA 3AUYA 1FQKA 3K53A 3RS5A 4HAYA 3R9WA 4RD6A 2IUUA 1RC8A 4FW9A 3CIOA 3SEAA 1YE8A 3VX3A 4OI0A 1QDEA 1E2KA 4JL5A 3MJRA 2WIAA 4D4MA 3T1OA 2WVJA 3PCRB 3CM0A 3GJXC 4D4LA 5GADl 4QGHA 2ZSAA 3EPHA 2O52A 2W00A 5JFGA 2FMXA 2NGRA 2FG5A 4WZ6A 5DHAA 4B48A 4TL7A 1N0VC 3T1VA 1NN3A 2HV8A 3SDZA 3UKDA 4TZ6A 4FCWA 4D0GA 2X77A 4LY6A 1OFIA 1TF7A 1KI2A 3WXMA 4D82A 2VP2A 5LB4A 5L3SA 1KO4A 1P61B 4DLRA 4BASA 4M8NE 3T5DA 2VF7A 1XTQA 3CH5A 1EESA 5EE5B 4DLZA 1VG8A 3P20A 1U2RA 3UG7A 4P32A 3RDPA 721PA 5A0FA 3U7GA 2ZAOA 4Q7KA 3V9PA 121PA 2GXAA 1M7BA 3ADKA 3DL0A 2QTHA 4KSBA 5JSZA 1XZQA 4IDQA 1XD8A 1Q3TA 1D9ZA 4FMBB 2YWFA 1NLYA 3K0AA 1ZMXA 1U9IA 3N2IA 4URWR 3PIRA 3IO3A 2HJVA 1IHUA 5JEEA 1US8A 4I1VA 4KFRA 1TEVA 1YZGA 4DSUA 1ZUIA 1ZM7A 2PJZA 5ELXA 3NG1A 4HZUB 4A6PA 2IX3A 4NYMQ 1JQLB 3RS4A 5J4VA 4RFVA 2ORWA 3A37A 3VMFA 1NBME 4L9SA 1COWA 1H8ED 5KOYA 1VCNA 4V0KA 3SJAA 4NCKA 2C95A 5J5CA 2VQSA 5KNDA 1BIFA 1RE0A 4F93B 2GAOA 1UBGA 4OJQA 1VTKA 1U81A 1UFQA 1LVGA 2CXXA 3CX7A 4BLQA 4OJKA 5KSYA 4Y0AA 2OEPA 2QM8A 3SU8A 4JT4A 1WBBA 1DAIA 3ND8A 5CLQA 2YKGA 5DSZA 2A9KA 1LF5A 2QNRA 2G88A 1F2UB 2GDJA 4M1OA 1S2MA 1S1CA 1NJFA 2D06A 3F3YA 1P2UA 4O2LA 4JIMA 2ZRHA 4DVGA 2ZI7A 3VKWA 2V1XA 3HR7A 2GNOA 4YXWA 5CK4A 2VSXA 3VTKA 1GL9B 2P5SA 2XSZA 2PJRA 2WPDD 3KUDA 2Q3FA 4WIAA 3A8TA 3GLFA 3UMRA 1N2CE 1KKLA 4B3XA 4PPNA 3THXB 2ZJ2A 4C3ZA 3NEJA 4OHZA 3CWZA 3FWYA 3BB1A 4F92B 2FOLA 1YVDA 1RYHA 1SVMA 1A4RA 5DI3A 1ZJ6A 4ASUA 2JLVA 2GBLC 1IXZA 1S3SA 2P6NA 1N5LA 4MRRA 5LBIA 3TVDA 1NN0A 2J0VA 2RMKA 1K8RA 3FHTA 2IWHA 4Q1CA 1BH2A 3K0EA 1E1RD 1XNJA 3TAHA 1NBMD 2W6IA 1OF1A 2ZR7A 4KCGA 5KSZA 2B7CA 2V8OA 2NIPA 2QGNA 3RRNA 1WBDA 4HATA 1FNMA 4Z8XA 1CTQA 1N6KA 1NVVR 3ZIAD 3LQQA 4B3CA 4CVNA 5EP4A 1EFTA 1G4AE 2RHMA 4UKDA 5FTLA 3R8CA 1T0HB 3KQUA 3W6OA 3X1ZA 4I1SA 2A5DA 4DCTA 5B57C 2HDNB 2V4ZA 5IK2D 3VU9B 2GXUA 2Q6TA 4LV8B 3HJNA 3HU1A 4LHWA 4QJ4A 5CJ2A 4V03A 2DR3A 2K5UA 3I32A 4RD1A 4D6PA 1ZM2A 3X1YA 2VL7A 2FSIA 1MOZA 3DPUA 3K9HA 3OESA 3TUZC 3C8UA 4QFMA 2ZE5A 2AR7A 4B32A 4N1AA 2PX0A 5C2JB 2W0SA 4LV6A 1KI6A 3UMFA 2NO0A 1XMJA 1OH8A 3KTAB 3Q3JB 1E0AA 2NTYC 1T9HA 2HT1A 2ONKA 3OHMA 4JLOA 2O8EB 3QXJA 4V0NA 1H8HD 4PHTA 4M1SA 1C9KA 3FHOA 1TF2A 5UKDA 3R7WB 1HV8A 1V43A 3LH5A 1NMZA 1E2NA 5HTKA 2IYXA 1XXHA 2PEZA 2J7KA 1D5CA 2IT1A 2W6JA 2Z6VA 3T61A 3VR6A 4TYWA 3UWKA 3IBGA 2R9VA 2RGAA 3KB2A 1FMJA 4RZ2A 4X8LA 4KODA 3ICEA 4JBXA 2G6BA 2W2XA 1VKJA 2CCGA 4LOAA 3GLIA 3MLEA 3IKJA 4EPVA 4OI2A 1GL7A 2BBOA 2H17A 5F3WB 4D26A 2CLSA 5JS7A 1JPNA 1YZTA 4JLNA 2GK6A 1VHTA 2P2LA 3WRXC 5JHHB 4N0DA 1VMAA 4UNRA 3UANA 5JEDA 4LWZA 3RWOA 1N6OA 1W48A 2ZUBA 4YMWA 5FTJA 4NL4H 3GJ3A 2KBFA 3BD9A 3RHFA 2FV8A 1CULC 3B1ZA 4PC1A 5EXPA 2Q0HA 2VIIA 1EGAA 3WYAA 4NZYA 1R5BA 2CVFA 2ZS7A 3L2OB 4TMXA 1OXTA 2BOVA 2REXB 4OQNA 2ATVA 2D2FA 1ZU5A 1ZM4A 1BYUA 1PLLA 1UEIA 2C8VA 4XD7A 1N6RA 4DZZA 1WF3A 1TNDA 1Z0KA 2BC9A 4M21A 2V7QD 2A5JA 2EVWX 2ZRLA 3BORA 1EFRA 4GSYA 2YZ2A 1X1SA 3ZVNA 4MYTA 3P26A 2B8TA 3C14C 4PHFA 1V5WA 1TMKA 4FWIB 3EPKA 5FBVB 4JS0A 1WXQA 3OEED 4LGMA 4KAXA 1OB2A 1GM5A 4RSGA 1SVOA 4ZDIA 1LS6A 4PSKA 2NPFA 4M1YA 1KMHB 2AWOA 2A5FA 3KKQA 3Q7QA 4TZ0A 5BYKA 3QKRA 1QF9A 2OBLA 3KKMA 4ZI2A 2YJTD 5DI9A 4BZXA 4IW3B 3NBFA 3AH8A 2IYWA 4MKHA 4TMKA 3IQWA 1UAAA 1OXUA 3GLGE 1YZQA 1QHNA 2ZUCA 2WSMA 2WKPA 5FBLB 3SC3A 1KSGA 2V3CC 2AHOA 1VDZA 1ZNYA 1E94E 1W4AA 2QP4A 2ZYTX 4C0QC 1M8PA 4GZLA 4TN1A 1IAQA 3BFVA 2BHRA 1W0KD 3FMFA 1T91A 2R6GA 4K46A 3S1AA 1SXJC 5GJCA 4RD3A 3E2IA 4HZIA 1HURA 4OK3A 1OXXK 1XTIA 2GEDA 2V55B 3W3ZB 4DXAA 2O8CA 1M2OB 1ZU4A 2XEXA 1G9XA 4I1UA 4PC7A 4WXRA 4EFNA 2ZRPA 1FNNA 4NTZA 2IUSA 1OSNA 4F38A 4OQFA 1E2PA 1IN6A 1AGPA 4H1VA 4NMMA 1J8MF 1R0WA 4XSGA 1CLUA 3CZPA 4LJ8A 1Z08A 3LXXA 3AB3A 2LCFA 2FDCA 1G20E 1Z0DA 2BVNA 4CEHA 3U4QB 2O8FB 3I61A 4AY2A 4C7OB 2FSFA 3DZ8A 1L7VC 4ACBA 4PQRA 2IYYA 1KO1A 3TH5A 2HF9A 4PC3A 1XWIA 1S4QA 2ZAMA 4IDNA 1NVUQ 5CB6A 1CS4C 2C98A 4IDHA 3VFDA 2O0HA 4ZDWA 2RGCA 1GITA 1BMFD 1HH4A 1KI4A 1UM8A 3FMPB 4MITA 4A8JB 3GP8A 1DAGA 3EZ2A 1ZUHA 2FZLA 3WBKA 4M53A 4KJZA 4LJ7A 3A58B 4KSCA 3AM1A 2P6UA 2ZJBA 5TVKA 1KZGB 3SBEA 2C78A 1Z0FA 2ERYA 3KQLA 2D4HA 5FL7D 4PTLA 3SFZA 4DLVA 3CRW1 1ZCAA 3KXKA 1LTQA 3OEEA 4P31A 1MH1A 5EXXA 1G3RA 3QKUA 4HLUA 4II7A 3Q9LA 3LBNA 3LVRE 2R6AA 1KI9A 4LZZA 4ZDJA 1HE8B 1F3OA 2QMOA 3EIEA 1DPFA 2J45A 4DLTA 3ND9A 1E32A 3KJHA 3EPLA 1Z6TA 1HY3A 1RFLA 1X8LA 1G3IA 2QQEA 1YJ5A 1P2VA 3AVWA 3TK1A 3C41J 3R9XA 3ZGXA 1S9DA 4FXPA 3NH6A 3BOSA 4LC1A 2BM1A 2XZLA 1Z5ZA 1FX0B 4Q1DA 4F7WA 3C15C 1XTSA 1KYIA 4I81A 2IS2A 1ZVQA 4LHVA 3RANA 3TNFA 1E2EA 1T4GA 2B21A 2WAYA 1FOEB 2EYUA 4HAXA 2BJVA 2CL0X 5AJXA 5SZKB 2ERXA 1TX4B 4HUQB 3D31A 3QE0A 4EKDA 1HEIA 5CM9C 3AVOA 1FZQA 4BWYA 3W6PA 2C9OA 4TT3D 1KDPA 3TIFA 3OE7D 1WDTA 5BYJA 2G3YA 5KPJA 1ZD1A 2CHVA 4V0ME 1F48A 1ZINA 2JLSA 4FIDA 1E96A 4V0OA 4XVQA 4BLRA 4KLZA 1IY0A 3IQXA 4C0SA 1KIMA 1R6BX 1GRRA 1OE0A 1XP8A 2R65A 2QUZA 3I92A 3ZVRA 3WNBA 2GXSA 2O8DB 4LBVA 2XB2A 4I99A 1CIPA 1CKEA 1O3YA 3SYKA 4CIDA 1OIXA 2V9PA 4R2HA 2QBYB 2JJ1D 3PR1A 3WP0A 2AFIE 2RCNA 2GILA 3RWMB 2RGBA 4IVQA 2D3WA 1JR3E 4KXFB 1TU4A 1W4CA 4D80A 2JA1A 3THOA 5FOUA 3GLGA 4KO8A 3RS3A 4HDCA 2RH5A 3OIYA 4UJ3A 1SGWA 3RS2A 1W0JD 2BDTA 1E2LA 1Q57A 2VEDA 3BC1A 3FHCB 1E2GA 4WAUA 3UPUA 5L3QB 3A6PC 3VKGA 2BIFA 5JMTA 2C77A 1E2IA 1R7RA 1T3LA 2E87A 3VR5A 3IBYA 1AZTA 2GVZC 3FTQA 4GOJA 4DUGA 3BRWD 3CWQA 3QXXA 4IJMA 3LW8A 4FMDF 3QEOA 4Q01A 3FOZA 4XJXA 2O0KA 2VPPA 5JJIA 3LDAA 4BRWA 4Q9KA 4P4SA 2WAXA 4L16A 5TV2A 2CNWA 2FA9A 1PUJA 3CBQA 3E70C 1OXSC 1XMIA 2GHIA 3FE2A 4CF7A 4FN5A 2XXAA 1A7JA 2ZRFA 3LD9A 2EFDB 2PLRA 4MGKR 4OI1A 4RFSA 2JLRA 1TQ6A 3GLHB 4P4UA 1DS6A 2RAPA 1UPTA 5FUWA 2QAGA 2R2AA 3TUJC 1IONA 4KI0A 4KVGA 2REBA 4DIEA 2JJ2A 5SZJA 1YR6A 3F0TA 1JR3D 4IFEA 1N6PA 4LSGA 1AQUA 3WYGA 4BECA 3QSYA 4BQSA 2FGKA 1MO5A 4HUQA 4PAQA 4NPHA 2J7PD 4LBZA 4B2LA 3EA5A 3QF4B 1GVNB 2CCJA 3CPHA 1FQJA 2J5XA 5K8TA 1FMLA 3OE7A 5HKKD 3K0FB 2GXQA 2QI9C 2QE7A 1CF4A 5H1YA 2GJSA 2IS1A 2W58A 2IBMA 2XJ9A 2WOOA 4BGDA 1W2GA 1E2FA 2XNDA 2YINC 2YVUA 4M1TA 3W5JA 2ZVPX 4P0TA 2DHRA 2F43A 3KQKA 1S9HA 3LA6A 1QZXA 4IOJA 2HLDD 4DSNA 3THYB 2H16A 2OE2A 1KHTA 4JMPA 5FPHA 4LJ5A 1Y63A 3UIEA 2GVDC 2LWIA 3D6TB 4KBGA 3TE6A 1VECA 5JJKA 3EWSA 2ZRKA 4ZPXA 3DDCA 3REGA 1Z6GA 3VAAA 4Q21A 5K8IA 4PR0A 1DEKA 1PLKA 1GIAA 2OBNA 1OYYA 4JSYA 4JLJA 4Q4AB 4RVCA 1HT1E 1T5IA 1A1VA 1UJ2A 1E79A 2PH1A 3QQ5A 5L3RA 4HLQB 3CNLA 5HE8A 1IQPA 1ZCBA 2GEUA 2Q3HA 2OT3B 3SE0A 3U44A 2IYUA 4N3NA 1XMSA 1E9FA 3B9PA 3ADDA 1IY2A 3I3SR 4PHHA 2GCOA 2AFHE 3FFAA 3GEIA 4DB4A 3FVQA 2YWHA 2WKRA 2W0MA 2WV9A 3LY5A 3MWYW 3I62A 3RABA 2ZITA 4UNSA 1G19A 4BFXA 3IPYA 3QENA 1ONBA 1KNXA 4CW7A 1E9SA 3ZVMA 1I2MA 4M1WA 1D6JA 2HJGA 1DAMA 4HB3A 5B64A 4ZKEA 4E03A 4NCJA 3ZZTA 4OQMA
chains in the Genus database with same CATH superfamily
1J8QA 1N4DA 2NAPA 3OA0A 3QEMB 1XWWA 2A30A 3HLTA 4P3KA 2GBLA 4QOSA 3DMRA 4N7RA 3SS8A 1PV4A 1ZCJA 3G2QA 3L01A 3KSDO 4YO8A 2LKCA 1QHSA 4FSDA 4G85A 2C7OA 5AWFC 4LE1A 1OU0A 1Q0QA 5JU6A 1GSHA 2ODQA 3PUZA 2O7QA 4XQEA 1H85A 1NSFA 1IFXA 4FYWA 5K3BA 4B09A 4E2WA 4B40A 1H6CA 3VR6H 5FOXA 3ZIDA 4O2BF 4DA4A 4INAA 5AHWA 4O63O 2BRUA 1Z4NA 1UKCA 2ATEA 2QDXA 5EJ9A 1XPUA 1NLFA 1U0SY 2E5FA 2OCXA 2ZJFA 1T4MA 1PK8A 2FUKA 1RHJA 3GOQA 3O8RA 2QVCA 3KJZA 5DNAA 3SMVA 4RDIA 2YNMC 4OJTA 1KK0A 1PEAA 3CUYA 5E6SB 4KRGA 1YQWA 3R7LA 4KGXA 3E22A 2NXNA 1OC4A 2V96A 5IBRA 1NATA 1IOWA 4B7ZA 3HXOA 1HR0B 1RXCA 4M1KA 3ZY5A 5IDWA 1KVTA 3WA7A 4ENVA 5K1ZA 3FKQA 5ICFA 4E5DA 4B6JA 3DZKA 5AVUA 3PQEA 2XRYA 5CDSA 3NPAA 2C5HA 2ZUSA 5AKJA 2Y0CA 1JXAA 3Q2IA 1MQAA 2NO9A 1MV8A 5G1PA 3U0BA 2RHBA 1A9TA 2BFDB 4YV2A 1GPJA 4AECA 3DO5A 4W5OA 1UBSB 1BW9B 2DRIA 2KI5A 4J2HA 4XUGB 2JHPA 5EIWA 3OLXA 8ATCA 1V5FA 1Y6FA 1J5XA 4EF6A 2N3ZA 3KKKA 4GVPA 3CR8A 3STTA 1P29A 3B7PA 3LPAA 5EFZA 3AKDA 3TD6A 3WKBA 3CZ4A 4R2MA 2FW1A 1OGIA 3LSTA 5HGJA 4D8WA 1TIPA 1HE1C 3FYDA 5A4DA 5KWIA 5AXAA 5DRYA 3Q0TA 2NUTB 1L4NA 3PKIA 3ILVA 2BBWA 2YWXA 2IHJA 2PJRA 3QVMA 2UDPA 4D02A 3AY6A 4HTAA 2J3HA 4Q3DA 2HRRA 1D8TA 4G09A 1PV1A 3QITA 3W8EA 3EQ2A 4PAMA 5KTRA 3UENA 2WDPA 3N7TA 3OM8A 2JJQA 3ZY2A 3ZR4B 4DQUA 4E5NA 4YXWD 5KVVA 2NTNA 5ALPA 5JCPA 3G0DA 4E1AA 1KP2A 2GF0A 2HK7A 4FUQA 3D5TA 5KTNA 1F38A 2V9ZA 1V7ZA 3LQ1A 1Y5LA 2PGAA 2A5YB 3OZRA 4OHRA 4QL3A 2QUKA 1YS4A 5B1DA 1YACA 4K2AA 1QPZA 2BKXA 1FYEA 2H1WA 5DI3B 5H81A 3BXEA 4ASUD 1VIAA 4PQEA 2HJSA 4K9KA 3U26A 1W7AA 1SCUB 1JHRA 1RPJA 3P7MA 2ZR8A 3Q1KA 4Q7LA 3L84A 1CY1A 1TUIA 2BGTA 3MS4A 5CXXA 4NXNB 1N6NA 3IVGA 4NAVA 1RWWA 2OBMA 1J5EB 1A95A 3D43A 4YP0A 1E5TA 1P80A 4QO7A 1MB9A 1FPMA 5AJZA 3SLKA 1RAHA 5J5VA 1VI6A 1L3BA 1PWZA 2I67A 1G7SA 5AOAA 3EZ6A 4EYSA 2WQZA 3MJDA 5FJJA 1BXKA 3BHMA 2MSDB 3A1FA 1XXHE 3G2LA 2GJ9A 1EVKA 4QSMA 1GZUA 2A59A 4HADA 5C4MA 1G6OA 4DC9A 4R2KA 3UATA 5IC4A 3L8HA 2DTXA 4OQZA 2QG6A 5KYXB 3TSZA 3ETHA 1SUDA 4E2YA 3RK4A 3SOPA 3GLIE 1OAAA 3ZQ6A 4RV4A 1H0KA 3H5TA 3IDOA 5LD2C 4Q05A 1EINA 4XFJA 3H18A 3OMWA 4W8GA 3DZCA 5HP4A 5EP1A 4CKCB 2A67A 3DZGA 5IHXA 4BVKA 4HRAA 2HCJB 1KDOA 2C20A 4QJBA 3RR2A 4X63A 5EHIA 3R5TA 2HADA 4DLAA 2L42A 5A4AA 4G0UA 4MUGA 2YY5A 1D2EA 1T5TA 2QZSA 4C22A 1T4DA 3OT1B 4WBSA 4ZAXA 5FTNA 4BNUA 4DN6A 4DLPA 1KAGA 1MENA 1L7RA 3GU3A 2C82A 3MYYA 3P9PA 5LP6C 3ETDA 5IXJA 3K0BA 5JARA 3WB2A 4C5BA 2OAGA 2I8CA 3BFJA 2B98A 3H1AA 3HYSA 3JQ8B 5EMHA 4E08A 1O9GA 4HAZA 1BN6A 2JBAA 3DP7A 2P7IA 3RRZA 4DW8A 4EFMA 1AS3A 3C7AA 3KP1A 4X94A 3T12A 4BRUA 1J7JA 2O2SA 2OHGA 5EKDA 1SHKA 4WLUA 3R8XA 4L6AA 5I7EA 1VRWA 1ZD5A 1NLZA 1JECA 5GONF 5K0FA 4NENA 2B99A 5KI6A 4JVNA 1GUAA 1UPUA 1VHDA 3AUTA 3IJPA 3M4XA 3VR6D 4YMVA 4N49A 2HIHA 3AU9A 2JAQA 3K1JA 3VNSA 4MQ5A 4DR3B 3IKLA 5LBTA 3OAAA 2W98A 3AJDA 4FLEA 1ISJA 1KORA 2DFKB 1K8YB 1WKBA 2VHTA 3KOZA 2DLDA 4R2XA 4XD2A 4BQEA 5K0CA 2ZB7A 3C70A 3KWFA 3DXXA 4BS9A 4AY3A 1P81A 2DUMA 5A9SA 5CBKA 2JCBA 1M6VB 1ZIYA 4BUZA 2XBMA 1NXWA 5AUNB 1HDYA 5JY6A 3PDIB 3IMEA 4YAKA 4D1YA 2ZKLA 4CDGA 4NBSA 2MCFA 1HETA 2VT6A 4FZ3A 1F3LA 1UK9A 4YQZA 3JWGA 5EXDA 5G3ZA 3LC0A 3F2VA 1CVRA 1U7HA 3IVCA 3JSAA 3LNCA 1JIXA 5A0VA 3UM9A 2LD4A 1NBOA 4EG7A 2DWQA 4PE5B 1KQNA 2H06A 1E1MA 3OIVA 4QYIA 3PLAE 2W2KA 3DBIA 4IS3A 4EG0A 3WV4A 3B60A 4C20A 2PGLA 3TN7A 1FVOA 4WLOA 3K9BA 4L4UA 5BUQA 2W4QA 3OQNA 1RI5A 3HZZA 5I7FA 2SBTA 2UZAA 4NU8X 3A4MA 3UK6A 4WSOA 3HWSA 3DLTA 4C4AA 4KBYA 3KR2A 1DRKA 3DUWA 1M3SA 4UZSA 1WRBA 1PT9A 2DCUA 4BFVA 2VBGA 1L2TA 2NO5A 2QD2A 3S8MA 1XNRB 4JL6A 4NFLA 5CXQA 2V7BA 4TV9B 1IBSA 1T35A 1SJ9A 2DSNA 2ADFA 2X8JB 3PUYA 4RKYA 2NU6B 1YB4A 3WAKA 3QNUA 4V24A 4B8YA 5C7LO 2G1PA 3A26A 1HTBA 1OFVA 2HK8A 2PGXA 2V54A 4EW2A 3JZAA 4C4XA 2ZKIA 3NUGA 3O8CA 5JMPA 4S1WA 5EJ6A 3JD2A 1RWXA 2QTLA 1AV6A 2WZBA 1NHGA 2I29A 2CF5A 3KAPA 2E55A 1B2RA 4Y1GA 3UPUA 2F8LA 1FP6A 2PL5A 3D2AA 4JYCA 4RV9A 2XD9A 5ELLA 5K3SA 2ICAA 2J9FA 2TSYB 4G1BA 3WGHA 4KR3A 1ZC4A 1DTWB 3QJYA 1NJ6A 2DQ4A 1VSVA 2IYVA 4B3JA 3VJKA 1QQ5A 1FTWA 2FWNA 2O3JA 2YJ6A 4FDUA 3PC8C 4XWOA 1O03A 2XECA 1GRNA 4Q4LA 3IBSA 5F1YA 4EHFA 3O3OB 5GZ3A 1Y3BE 1N2BA 4MI1A 2VH1A 3ZQJA 2UUCB 1OU4A 2OD2A 2WKSA 3KKPA 5HCUA 3VQTA 4F7DA 1MXFA 2C7RA 4FX5A 5A3QA 3HDGA 4UUOA 3GF4A 4JR0A 4JT2A 2BTOA 2C9ZA 2SKDA 3PGXA 4LWPA 3I09A 5LNK1 1Q19A 3DOFA 2VLBA 1IM2A 1XD2A 4A23A 1DE0A 2AUMA 5EJIA 2IU3A 2YJ3A 1E66A 2C4KA 2KBEA 5HZKA 2XCLA 2WU0A 2PLFA 2V6FA 3PA6A 2QPOA 5GWXA 2XMZA 3ZDEA 1EX7A 2VTDA 4G5GA 4CEHB 2EQAA 5TMPA 5DBIA 1X1EA 2ZBGA 3OCJA 1NBAA 1PG2A 4M88A 1S2IA 4OXYA 4BMZA 4F45A 2UUAB 3FPBA 4U39A 3W5IA 1H3FA 1TU3A 3KLOA 3C7DB 4CMBA 1QONA 3EAGA 2GN6A 1D4ZA 4DIDA 3JQ7B 1PEKE 3HVJA 3TQHA 1ISSA 1CQIA 2AV6A 2XE8A 3CLKA 3JD1A 3V48A 3G9XA 4AKSA 3KWJA 4UTVA 4Q37A 5JQGA 1E4VA 1BKDR 1JFRA 1QH8B 5CW1A 1UKYA 1HG1A 1V7CA 3PF9A 3MT8A 5DBEX 4Y1RA 5IZCA 5J4LA 4Y1FA 1GA6A 4UVGA 2H92A 4A73A 1HT0A 2QV0A 5LXTB 1PZGA 2HMVA 1VGQA 2ZJ0A 4P4NA 4PG6A 4YT2A 5A5FA 2DT5A 2IHYA 3BWMA 1QANA 2ZJ3A 3KOWA 1Z7BA 3K9LA 3ZYCA 4BNLA 3HNRA 1POXA 3M6WA 2GF9A 1AUXA 2Z9BA 5EZSA 3ZJYA 1PUXA 2I6XA 3NANA 1WEHA 5AVQA 4QULA 2AOUA 1EP9A 4OU4A 3RI3A 1GQFA 2J41A 4D3XA 2OV2A 4RORA 3U9LA 5JRZA 3TXAA 4F8JA 2D1YA 4LJLA 4RZUA 5AW5A 1O6FA 1V8BA 2ZE8A 2GEBA 2HA2A 3O2SB 1J0EA 1KMIY 2XMPA 2XYRA 3S1SA 4BMXA 3KJEA 4F3KA 2G9NA 4EMSA 4I50B 3P0JA 3IR5A 2WHPA 2VTKA 3L1HA 1Y3IA 1X9GA 3FPJA 4Y8VA 2GPAA 3RYTC 2VXOA 1CR2A 3BHIA 1NAHA 1SUEA 2XTJA 5DO9A 3R9XB 1CU1A 1O94A 3O3MB 2D3TA 2UZ1B 4P36A 1TM7E 4LJYA 4AZ3B 4DY6A 3K31A 1T5HX 3M0EA 5JNSA 1SUCA 3FOCA 2XXJA 1SA0A 3PUWA 2A2ZA 3A10A 3K4HA 4BE7B 3DQPA 5HS4A 1RPZA 3LAWA 3ID6C 3EFEA 4GD3Q 4TTIA 1ISPA 1Y1KE 4LAFA 1W46A 2ZAIA 3AR2A 2Q3EA 3WTBA 4N4AA 1SHLA 4XIIA 3LUDA 1E98A 4I4TB 1RZUA 4CLEA 3L0PA 2RAFA 2DPGA 3RE1A 3RS9A 2AX4A 4K87A 1JDBB 3BDVA 5C35A 2HGZA 1JDVA 3NYIA 4OB8A 1M2FA 3BXPA 2JANA 3KPWA 2GZ3A 1PO7A 3IKMB 3KEFA 2BGKA 2VPXA 3ENNA 1Y5RA 3OJOA 4YAJA 1T1JA 4DMUB 3I53A 4QNNA 3HABA 3N0RA 1I9GA 4UFOA 3MWEB 4UXJA 4EJ6A 3UJBA 1X1DA 2C7VA 3NAQA 3KSAC 4XIFA 3QNWA 1PRYA 2BZGA 1VP3A 4ND1A 5DBHX 3D8HA 3PXGA 2DGDA 4HQRA 1G3QA 4V1CB 2WPNA 3CISA 4G0MA 1FLAA 3OBBA 5TQ0A 3MWLA 2P62A 2W5UA 1Z26A 3BF7A 4S1NA 2ISCA 4ENSA 1BDIA 2VRNA 4HNRA 1VCHA 1W19A 4W5TA 4X44A 4MH0R 5K0LA 1R00A 4HR7A 4IVNA 3LV8A 4TXHA 5AHXA 4ZOLF 2ZE7A 4RE6A 3UB2A 4JUBA 3T35A 3UOAB 3VVLA 2IYOA 1UWKA 2C8KA 3W0LB 5CB8A 1WIWA 4C0QC 3AM3A 4ZMRA 5KQLA 2P2SA 4UD2A 5I7SA 1AU9A 5TY0A 4TWAA 2XYPA 3ZWYA 5LP1A 3GLGB 4IJVA 4ZVPA 2CXHA 2V45A 3UKJA 4OXQA 3E81A 4TLCA 1RM0A 3HKBB 4E2ZA 3RSSA 1YS9A 1N1MA 4CTNA 3ICPA 2FSGA 1J2EA 2QR3A 4Z0PA 3WP1B 1KRXA 1XRPA 1YL5A 2KPOA 3JWPA 4HWTA 3RYHA 1AKTA 1Z7WA 4MB2A 4N0QA 1M8GA 1A69A 4D3ZA 2OHFA 3AUXA 3KLBA 3Q7TA 1Q6ZA 4GRIA 5FOTA 4H16A 5TGZA 5BSVA 5JE8A 1L8QA 3T15A 3TLJA 4BCDA 2IF2A 4U02A 3A1UA 1JFFA 1Q5PA 2FEAA 2PVPA 1VYUA 2WIFA 3CPEA 4P4SB 4NARA 4PZEA 1IXSB 4FD2A 5DV9A 1SZCA 1L4MA 2CNWD 4G84A 3JQ9A 3ZLJA 1FA9A 3MWJA 5C1IA 3RO7A 3B1YA 1SKQA 1HFEL 4NZOA 5DE3A 5KCMA 4EI8A 1XHFA 2IZ1A 4Z0HO 4DQLA 4HUTA 2NTVA 4RFSB 2ONJA 3G2OA 1RWKA 5KYWB 2O2IA 2IYAA 1SUSA 3VU3A 2EJCA 2G83A 4UBOA 1E1QA 2WJJA 3FR7A 1Q20A 2JH3A 3EVZA 4EY5A 2H7VA 1DC6A 3JQDA 3L07A 3KC2A 3OOHA 4M1EA 1TC1A 3KQPA 4WFJA 3CUTA 1CDDA 3GUZA 5BT8A 3LP5A 5EMJA 4F4CA 1UKBA 9MHTA 4HO1X 2EOAA 2YOFA 1LSJA 1E0DA 3P5SA 1L4GA 2I2FA 2ZBVA 4G5XA 4KWCA 3MJHA 4OD0A 5AOBA 4RC9A 2AI3A 3B85A 3LQFA 4Y9UA 2DFTA 5LOVB 1IN8A 3CCFA 1ZL2A 4TQUS 1YU9A 2VFAA 2YFHA 3DLCA 2JLAA 4B6QA 1GPYA 4C04A 1VQ1A 1E9EA 5IT5A 5KREA 3SXJA 3UHJA 3FETA 2IEYA 5E2AA 3WIOA 2IUYA 5KWJA 1ULBA 3PNSA 4K9PA 1XDDA 1XZJA 4TM7A 1E64A 1L5HA 3R09A 4DSAA 1S8NA 1T8TA 3EMVA 3AB8A 3MQ2A 2KSQA 3NAMA 3HSSA 5DNEA 4A3SA 3RSLA 3N2EA 5KJEA 4HXFB 4BC1A 1JDPA 4DYHA 4OTZA 1MABA 1KJWA 1NQUA 3LKDA 3G2PA 4JFRA 4M9ZA 2FAXA 5G1OA 2YYSA 3PUHA 3VO1A 2QTMA 5JD6A 2F43B 2VLIA 4HSEA 3DMYA 3MT9A 4R4JA 4XCQA 5CPBA 4MKZA 3B7GA 3LS2A 5FB3A 1VFPA 1T0JB 3IQHX 2J30A 2QT9A 1UT8A 4GNKA 1FDWA 4QUEA 3F7MA 4D46A 1M1YE 1CE8A 3AR5A 3GIWA 2BZ1A 3LOPA 1ZSYA 4UCFA 5EGNA 5JBQA 3WLPA 4B3BA 3V7WA 3ZEIA 2P0EA 4WVFA 4LJRA 3FW1A 3GCGA 5K4HA 5IMBA 1TAHA 4J9UE 1DEAA 2RHWA 1LK7A 2WNIA 4UNIA 4BWGA 3EPJA 1CRZA 1D6NA 1ZRMA 1Y37A 5EJ2A 1RZRA 1JEYA 2VWGA 3NWPA 5DTJA 4U6QA 3ZI7A 4EQ6B 1DCMA 1MTZA 1N9GA 2J31A 2QN3A 3E58A 5KU7A 2JL1A 2Q4OA 1Q0HA 3GN2A 4EGFA 1KQOA 2AW5A 3SHQA 1C1DB 1SG0A 1PJTA 3AOGA 3OZ7A 1PQUA 4H60A 1KK3A 4N8DA 4ER6A 4L4XA 4AICA 1K6XA 2Y4OA 3NT4A 4Q48A 4YHHB 2JDIA 3EXEB 1KEWA 1HE2A 5E9QA 2CYAA 2ERCA 1ZBDA 2ADOA 3EDOA 1B6GA 2OO3A 2ATXA 5HBRA 2BYTA 5TB5A 4BC0A 1A9ZA 1CUEA 1RLIA 2D00A 4X61A 2B83A 4RL6A 5C7IO 2I6QA 3FPFA 2OXRA 1Z83A 3UG6A 1I2CA 1ETUA 1H94A 3HO8A 5A2QA 4KP7A 1C9DB 3UGKA 3WV5A 2OLKA 1JA9A 1EUDB 4KQ9A 4G0QA 1GCGA 2AFIB 1T4CB 1KTIA 4AY6A 2XV1A 1CLEA 4Q3KA 1M2EA 3HXLA 2H48A 1XZLA 1ORDA 4R84A 2DR0A 3I6IA 4MTLA 3E7WA 4YTEA 4R81A 3SJUA 3ZHSA 4FWTA 4UM5A 1TK2A 1P4RA 3PC4A 4NAUA 2F90A 1W94A 4RKRA 3ZW7A 1Z5WA 2YXPX 1TQ4A 4R31A 1MGPA 2Y0DA 1VPVA 3AEZA 3AHEA 2JS7A 5A3SA 1QUEA 3WBBA 2EXXA 2P3OA 5PNTA 3DTVB 1QRAA 3C6MA 4ISCA 1TLLA 1S96A 5FL3A 1VMEA 1G5RA 3M70A 4AWAA 5JAPA 3CBGA 2JFHA 2YZKA 2JI8A 4BJ3A 2EWVA 4FQ5A 2AYXA 1O97C 2JIZA 4JQCA 3V8NA 4QEKA 3TZBA 1C9EA 2AYZA 1QKIA 2F2TA 3HJHA 3U9SA 3S5JA 3PQCA 3HR8A 5EI5A 1XIVA 4GMKA 3Q87B 5LLDA 4I14A 4IGAA 2H11A 2PUHA 1D6SA 2O2JA 3K70C 3BXGA 3D3EA 2WYVA 3LIIA 4BX8A 4CIVA 2Q1YA 3ZGYA 4BO8A 1P5FA 2BEWB 3A9UA 5AKXA 3AEYA 3DL7A 3U3DA 1CPYA 2C0PA 2I6SA 4ARAA 3KD2A 4I55F 3OZWA 1EWQA 2Y8EA 1YR7A 4P58A 4YFVA 4HK4A 4TS9A 4GI3A 2H2AA 3AXTA 3TIGA 4E2XA 1O9HA 2P11A 2REOA 4J7CA 2OILA 4BKMA 2VJMB 1P4HA 3HADA 4AI6A 4B6FA 1XCMA 5EZYA 1FFXB 3D5EA 2BUAA 3QBVA 3C1UA 2I4LA 3VNBA 4RMJA 3B78A 1Q14A 2XCIA 3B1KA 4L2IB 1C3JA 1OPXA 2JRLA 4NBKA 2FPMA 1KXJA 1XF9A 3H1EA 1MDBA 3IT2A 3CRVA 3JQEA 4NNOA 3RC7A 1UWVA 2CMFA 2ZB4A 4L8GA 1V2GA 3WO1A 4TTAA 1QUFA 2HT1A 3KKEA 4OQEA 1E1KA 2HL6A 3UH0A 1U2EA 4ALJA 4J49A 2MDTA 2VRCA 4QREA 4Z6KA 4JP1A 3WGIA 4RHFA 3GT7A 1LPNA 4OO3A 1WQ4A 3FZNA 3TVTA 1Q1EA 4YROA 3EPPA 3EAFA 2WWGA 3JPYA 1M7HA 2H63A 1ZKMA 5F33A 3UAYA 3U4AA 5IKXA 4W9MC 4DR7B 4P7JA 1M1YA 3FB4A 4L5IA 3UW3A 1T9AA 4DY4A 1R4AA 4NCXA 4O4LA 1G63A 1QG0A 1DEXA 3HCRA 1T3TA 4E5MA 1QQTA 3HY6A 4CEJB 1MW8X 3SKVA 3OM0A 3D6UA 5AQ1A 1I7LA 5GQSA 1O57A 2MSEB 5TJHA 1BCSA 5IMSA 2WG2A 3DBLB 5G40A 1QFJA 2GI4A 3MAAC 4LGVA 5JVDB 3TUIC 3L7YA 5BSHA 1ZQ9A 4ND8B 2BMFA 2FP4B 2XMCA 2BCGY 4DMHA 4C21A 1JNYA 4W1RA 4CG3A 4OSEA 1PHPA 2WWWA 2B9EA 3PXCX 4CDRA 1A9XA 1BFDA 3GIDA 3E9YA 4KUGA 5FO0A 2SKEA 3UOGA 1M6EX 3PYXA 3N05A 4TV8F 2CB9A 5AUQA 4BLUA 5B7PA 5HZMA 3JD0A 1Q17A 3DMTA 2QX4A 3RT9A 1WULS 1XYYA 4X92A 1GL6A 3ETGA 3OFKA 3GFBA 5EIFA 5GMOA 9LDTA 3UJAA 1V2HE 3LLSA 1WZIA 4U7GA 3WB0A 3AFMA 2C0CA 3GBPA 3U3XA 5F35A 3C3CA 4X66B 4AY4A 3W8FA 1HE5A 1WA5A 4LZWA 4UHCA 5BMOA 1UL1X 1VKHA 2A86A 2GX6A 2ZG6A 3B2EA 4EW3A 5AVZA 3U61B 1WD5A 2FSVC 3GFTA 4P3NA 1CJUC 1U2QA 2E7ZA 5EE0A 1H5UA 4E13A 2CNKA 1Z3IX 3OWOA 3L43A 3G23A 4ID3A 1IPEA 1OFGA 1KE1A 16PKA 1JU9A 5J4YA 1KGDA 2PPVA 5LMUB 2PMWB 2WT9A 4ZT2A 2C8LA 2FCRA 1CEQA 2FW0A 2OXCA 3WKEA 2G77B 2OCKA 4G4SP 2QX7A 3NMUF 1R12A 3ICWA 3MXOA 3CLUC 2X5OA 2CBZA 4NDAA 3FKSD 5DN6A 3EQZA 4C0LA 2IEGA 2Q3MA 3NAGA 3NVAA 4XCXA 4B3IA 3ZLBA 1AB5A 1NXPA 3IQDB 4G1MB 3SX0A 4L22A 1KF0A 5AK0A 5CH3A 3DOUA 1KTVA 4ZU3A 4EUHA 4K0RA 1ES9A 2AI1A 3CGWA 2QN7A 4RK6A 3BD8A 2BSQA 4XB2A 4DCOA 4AW9A 5KOJA 3EC1A 4A0SA 1CR0A 5LKAA 1TTTA 1N3BA 1O8BA 5EQDA 1L4HA 1Q0LA 2PL3A 5GJBA 2OYCA 2WUFA 2WHQA 2NO1A 4DZTA 4P8RA 3V42A 4E5KA 5C46F 1N2OA 3QHPA 2ZIXA 4KXYA 4X84A 5TX7A 5BN5B 4NECA 4B3DA 3WGUA 1YVUA 3JQPA 3M34A 4QVIA 5I8PA 1SULA 2Q8QA 2ZJ7A 4N5IX 1VJ5A 1YQXA 4U3JA 2FKAA 5AK5A 3C5WP 4LPSA 2J33A 4GZ5A 3ZXXA 2HA3A 4AJEA 2CVPA 3QMWA 2CVQA 3FVVA 4P3YA 3PL5A 3O7MA 3UK0A 1CD5A 3PVSA 5A6SB 1T6NA 4V3CA 3WWZA 1L1EA 1CZLA 1RRKA 3O8OB 3VU1A 2ODPA 4J91A 4KBFA 2VUHB 3MNFA 4Y9SA 5BR1A 1UP4A 4FT2A 1FBTA 1XAJA 1T2FA 1JH9A 2RIRA 1XJWA 2ZJ1A 4AJ4A 1G6HA 4ZVQA 5HIMA 3W5UA 4B74A 1E99A 1YA6A 2JAHA 2OTCA 3OD1A 4A5OA 1IBKB 4IVRA 4LTDA 2ID4A 2YOGA 1V25A 3BYZA 5FWXA 3CEAA 3L9WA 4NU5A 1EJBA 1WCYA 2YYAA 5CAEA 2GEVA 2DBVO 4J43A 3BFKA 1KPIA 1QSGA 2KB0A 2QAGC 2YMMA 4JLUA 3U0VA 4EG8A 1OAOA 4ARVA 5KNBD 3E5HA 2A33A 1CYDA 2YICA 5DWQA 2PZJA 4C01A 3PEYA 3OFNA 2IYEA 2Q28A 1G4HA 2DKNA 4QFDA 5HJEA 1FFCA 1R8SA 3FGPA 1SBZA 3PXAA 4AO6A 4XRGA 2ZSFA 2VXYA 3WLJA 3KLMX 3NHPA 5H3HA 1TL7C 2GO1A 2C2KA 2VWPA 2WJGA 5FR1A 1Y6RA 1U90A 4LX0A 1E5XA 2IYSA 5D85A 4PZLA 3OQVA 1NW9B 3DAPA 5ESDA 3UY4A 3U7FB 3GDHA 2FSHA 1NF2A 1SUBA 1TKRA 4KXQA 4MJLA 1A77A 3OCZA 3NBYC 3PGA1 3KJGA 5AVJA 4TVOA 4Z7NB 4LZLA 4ENQA 3CF2A 3VPAA 2WZQA 1D6MA 2XMRA 5EZ6B 2GA9A 1E9AA 2FW8A 4V2IA 3NASA 5I9MA 5TVGA 2FY8A 5YASA 1BX1A 3PUXA 1AS0A 1VIYA 3L7AA 4FCVA 2FDRA 2I80A 1GR1A 1N8KA 2HTEA 5T6MA 5BQFA 2V7GA 4CM9D 3U3MA 2G7ZA 3UUEA 1ECBA 3IVMA 3X1WA 1JR4A 5CVCA 5KYTA 5ALOA 3V2UA 4QT0A 4X8MA 4ZIRA 1DIRA 2GCEA 2GPTA 4F2HA 4RWEA 4WE3A 2NO4A 4Q19A 1JDSA 3RU7A 1OYOA 2VATA 3A28A 1RI2A 4WZAE 3G49A 3CVWA 2NO6A 3Q3EA 1NJ5A 4V0RA 2B1IA 3KB1A 4KR2A 3GJ5A 2C2ZA 4OJMX 4QQRA 4RM2A 2I0FA 5L8VA 3O3NB 5CBPA 1GPAA 1WWKA 4QYTA 3RG2A 3I2HA 5F7XA 5HS6A 1BO6A 1RW4A 3C0KA 2YXBA 1M2HA 2RKBA 2W2TA 3LA8A 1DUIA 2AGVA 1P17A 4LJ9A 4IOKA 4X91A 4C2UA 1CUXA 1NN5A 2Y0PA 2P4QA 1UJMA 4KFTA 1FRQA 1K7YA 4GM0A 1NC1A 2R00A 2X1VA 3I0NA 2Y92A 4DV3B 4C5CA 4Q6WA 4EY4A 2GKSA 5LZ9A 2PLAA 1O95C 2ZUEA 2VJBA 2OK7A 5B5SA 1EZ1A 3HEAA 8GPBA 3PE6A 4MVCA 2RDMA 4Q9HA 4X7BA 3T5GA 4Q16A 4OP1A 2I9PA 4J75A 3ASYA 5B55A 2QM7A 3OO1A 5DOVA 4HNTA 3OKAA 3L5OA 1XQ1A 4LBYA 1QJCA 3MA0A 5KNBA 3DBOB 1EFPB 1G8HA 3G13A 3HKCB 5DGXA 3SYTA 5L51A 3N2KB 1JS1X 1M10A 4WXEA 3I5UA 4FP9A 3T1QA 2I5PO 4DQKA 1HFKA 1OCEA 2ZJOA 1XALA 2QP9X 3I2GA 2HCTA 3QFFA 4GXNA 4RJIA 3K6JA 2W2PA 3VRHA 1RYBA 3X2SA 5LJIA 4BN0A 4FCTA 2HJHA 4ZVVA 2Z83A 1BVHA 421PA 2Z3ZA 2OHJA 3FB1A 1KK2A 3DNMA 2ODTX 1EG7A 1QQ7A 1KEZA 1AMNA 4WCFC 4JU8A 1K5HA 1RJFA 1PFVA 4OBXA 1Q77A 3CKMA 1KGSA 1RT9A 3DAFA 1WE2A 3OZUA 2O50A 3JQQA 1TZBA 2EZTA 4ARZB 2X0RA 4RXMA 2E6KA 5ECGC 4QRDA 4CE6A 4UU1A 2CE7A 2K4MA 2O7SA 2C4MA 3RC9A 3UJ3X 2XKKA 5AKGA 2FUG1 4UW9A 1VL1A 1FQWA 3C24A 4YMGA 1SC9A 5BWOA 1MZPA 5KU1A 4XB6B 1T9BA 2UU9B 1FXUA 3QI7A 2YXNA 2VP3A 2GZAA 3HU2A 1WKVA 4LVCA 2D1TA 1ODJA 3G9TA 3G8BA 1HMPA 2C9YA 4D92A 4HQLA 2Y2UA 2ZZNA 2EYQA 5AM1A 4R8RA 2BUCA 1OJLA 4ZEVA 3T41A 1HUQA 3G5TA 1GT91 2HPZA 4LRQA 5BNWA 3BK2A 3EXIA 4KQKA 1UEXC 2PBLA 4KL8S 1C0IA 3FNEA 3Q7RA 2YV1A 2ZIFA 1EWTA 1JSCA 5GVRA 4YREA 4I9NA 5KDDA 3T7KA 2O06A 4ENUA 3GRFA 4LI3X 1QG4A 2HPHA 1NUSA 3U5ZB 1KI8A 1I36A 4GLBA 1T5BA 2VF8A 3PNYA 4KN6A 4QD3A 5AXCA 3SR3A 4LFBB 2I7TA 1XX6A 4MV1A 2B92A 4S2UA 4DEXA 1IVSA 4MA5A 4FE7A 5K3FA 3QKIA 1S02A 2PKQO 3NC0C 2EKDA 3EEIA 3P97A 4KIWA 1XEFA 5EE9A 3VBEA 2PX8A 1YDMA 5B12A 5K3OA 3LP8A 3JWEA 3HNPA 2J0UB 1KP9A 1NYQA 5IT9A 2A9VA 3THXA 4RH1A 1DMSA 4KACA 4XFKA 4XIYA 3VGPA 2Q1XA 3EGWA 1VXOA 2Z30A 3VH1A 4YUWA 1DRJA 2A8YA 2O19A 5DIZA 2J3JA 4EHNA 1MB3A 3RGGA 1PW5A 3KQHA 1ULSA 2JASA 3DAGA 1SO8A 3BMNA 3E82A 3NVMB 3TKAA 1T43A 2EGUA 2Z56A 2NPIA 3AGPA 3NS7A 1VBKA 4KB5A 5FAXA 1JEEA 2QR2A 4XJVA 4JJIA 4JC5A 1KHHA 5T57A 4ZT7A 5IKEA 5J47A 2C9CA 3OVMA 3QXCA 4W6ZA 1XQ6A 2BGMA 3BH6A 2ZETA 3B52X 3HJBA 4WZAA 1NX9A 3AB7A 1SQFA 3IJEB 1Q7RA 4D2IA 3OQPA 4Q4JB 4YRAA 3N9IA 1IHDA 1QIFA 1QYIA 1QGZA 2D5IA 3DNPA 3F6SA 1F7VA 3JD3A 4IIJA 3E4CA 3NDBB 3OZCA 3FMVA 2XMQA 4GPTA 2XCRB 1P19A 2XVXA 1SD5A 2XI4A 3H9JA 1SKBA 1YI0A 3SDSA 4C06A 2QMHA 4AL4A 3KZVA 1KZ9A 2I1QA 3OLYA 5DEIA 1MQSA 1RRGA 1SIOA 1VIDA 2W2NA 3EX7C 2CL7X 1W73A 3G7SA 4WK2B 5IK2A 1JHXA 4JAVC 1XVUA 1NE2A 1SCKA 4IXWA 3EF3A 4ZI7B 1P7CA 5AK3A 3EJWA 2XCOA 1ZNXA 2E2WA 2BCEA 4IOMA 4MV4A 4K6FA 2XF2A 4YAWA 3J81k 3NB0A 1JSLA 1JZTA 3GJQA 3AHIA 3VAYA 4EPWA 2V65A 5J40A 1ABEA 1JQKA 4BNDB 4DCCA 3KHSA 3WDKA 5HE9A 1QRUA 1KDTA 3R8FA 1XC7A 3ELUA 2X0NA 2VJDA 2N1MA 1J7KA 2ZYWX 3RBVA 5TJ9A 3ZQUA 1JP7A 3RUEA 4YT8A 2VYVD 1Z45A 4RIFA 2ZQYA 3ZY6A 4D9MA 4M83A 4B2IA 1GPNA 1F12A 1GXSB 1VMKA 1G98A 4LGCA 2O8EA 4YJ2F 3BGIA 1ZK2A 2ARKA 2DBRA 5C31A 5BV8A 3O83A 1G8PA 1VKRA 5A9TA 3EASA 2ZI5A 2YNMD 3CNHA 2E1RA 4WCVA 1L1FA 2GCGA 1MRZA 1OZGA 5CITA 1DELA 1TYBE 3GRPA 2J5RA 4DJ5X 2QTZA 4JVOA 4EW6A 2FMKA 3Q4GA 1Y1QA 1KO8A 4HX2A 1R2QA 3OICA 3RIEA 4PZZA 1L7DA 2ORYA 3AF2A 1W49A 3F1LA 3ESXA 5IUNC 1B1AA 2GM4A 1E6KA 4LHEA 4PIVA 1KVUA 1W5BA 3K2QA 1VM6A 5EC8A 1RWMA 2Q9CA 5CEJA 2IY7A 3AR3A 5U1PA 4LDNA 3C8ZA 4QPPA 5EJEA 2DLNA 5LPNA 4LF9B 3QVUA 2O05A 1UDXA 3GI1A 2O59A 1KC1A 2FPWA 1UMKA 1FP4A 3R3ZA 3MGGA 1CRPA 2G4VA 4NBTA 1H42A 1CDEA 4A36A 4LYYA 1V4BA 1VZ2A 4DSOA 5K8LA 2R48A 2ZVDA 3C1OA 1AQ6A 2PD6A 2PH3A 3HWRA 4NONA 4ZQGA 5JPIA 4U7DA 1I6WA 1X2BA 1OLXB 3KXPA 5C9ZA 1QFXA 5DNYB 4PQYA 4ZTUB 4CRWB 3AOEA 3GAMA 4JLBA 4O2AA 1B6RA 2CVOA 1VCIA 2FXVA 2C5LA 5LB2A 3R74A 5J2UF 2NW6A 1ZJ4A 3KWLA 1VG1A 3CX4A 1CT9A 4XYMA 2VYQA 1VE1A 4G2NA 4QWWA 1YNOA 2DP4E 1UWLA 2DPMA 4MHTA 2GFHA 3NDRA 4BB9A 4XGKA 1ST2A 4DC0A 1KU0A 4JB3A 4EZIA 5H02A 3OPMA 5P21A 2B78A 1NVXQ 2G28A 1BE6A 1RI1A 1RCTE 2LV8A 4L5BA 3D7LA 5EWMB 1MHTA 1PL8A 2V7QA 2C2GA 4EBBA 5C8YB 4ZN6A 1RCUA 4P08A 1IVNA 4FFPA 1YZUA 1ZYUA 5MHTA 4L72A 2F62A 2SHKA 1TA4A 1BEUB 5AKZA 4C5AA 1XCJA 5JNUA 4GL4A 3GFOA 4DRYA 3HKDB 3SLRA 2UYHA 5BVGA 2J46A 2PUFA 1EK6A 1AO3A 2WA1A 2ZRMA 5TE9A 1QG6A 3O90A 1XQVA 4XWKA 1CIJA 1H1DA 2W43A 5DLDA 3WGTA 4YDQA 1C14A 1PR2A 4Y98A 4P82A 4COKA 1XRMA 3BGVA 4Q9JA 4ZO8A 3FGOA 3OG9A 3Q6IA 3VYRB 3W9SA 3FUTA 2Q8PA 4MUAA 4OLHA 1X1RA 3FMOB 1MPXA 1RCFA 2AXQA 2IU0A 3PJEA 4XXHA 3UWOA 2YL2A 3C98A 4LYFA 1KEEA 1AN0A 1MR3F 1ZHHA 3PJFA 4KX3A 3J7AC 2VHXA 4OGLA 3PC2A 1VL5A 1XTVA 2H4ZA 4FE3A 4IIGA 5H80A 4RADA 1LPSA 3HDVA 3IAHA 5JJBA 3JALA 1PSZA 2Q0SA 3IAEA 3IOBA 4QDXA 3PG5A 5CLGA 1OLOA 4QDOA 4E46A 4F21A 2EG9A 5KJCA 1MX5A 1S2OA 2NSLA 1W75A 2PT5A 1W0KA 1DWPA 1VPDA 3NWBA 4EGQA 3PUKA 4RGBA 1JR6A 4LISA 4WINA 5JI2E 3R4CA 3AXSA 3I5AA 2A0UA 1NG1A 1DJPA 4GBMA 4EEKA 1YQDA 1K88A 2FXIA