2ZI6A

C4s dck variant of dck in complex with d-da+udp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
241
structure length
217
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deoxycytidine kinase
publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 217
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi6A00
4V0OA 3TSWA 1E32A 2BKEA 2DY1A 4YMTA 3U6BA 1CIPA 1TPZA 5DISB 3FMFA 3C16C 2W0SA 3FFBA 2ONJA 3EWAA 4NTZA 4PSVA 2XSZA 5KHOC 2WWFA 4CEIA 1G1MA 5H70A 4FMDF 2F1JA 4A6PA 4DKXA 5KOYA 1KI8A 3GLFA 2PMDA 4MITA 3THWB 1TF5A 5AJZA 2PJZA 4Q4HA 4I1VA 4ON9A 2QG6A 4XIGS 2ZVQX 1NSTA 4CT5A 3S1AB 2XNSA 4F38A 2QTVB 2V1UA 3BD9A 4DBLC 4LHZA 2FG5A 4JLDA 3M6AA 1J99A 1XF9A 1ZINA 2B7BA 3HYRA 4PO8A 2V1XA 1L4UA 1E9EA 1YR8A 2ZR7A 1J7KA 3AB3A 3SHFA 1R7RA 1S4QA 3R8CA 4LDJA 3W90A 4ESHA 3IILA 2JIZD 3MWJA 4D4JA 3CNNA 1RIFA 2WJVA 4BZQA 1AA9A 3K0AB 2GF9A 3GJ5A 4L8GA 4QXAA 1R0YA 4XTRA 4HZUA 2ZJ8A 4DDUA 1KO7A 4TYNA 2WJHA 3NEYA 4D81A 1VDZA 4GOKA 1KY2A 4BEBA 1AGPA 2CK3D 3B1YA 2I1VB 2ZRKA 2OLKA 4QG7A 2DR3A 4UXHA 1ZMXA 3F0TA 2LKCA 2QNRA 5FFMA 3ZQ6A 1ZUNB 3X1ZA 1X8LA 4ACBA 1G5RA 4V0ME 4S35A 2EFDB 2XB4A 1N3BA 4HB4A 4M9QA 3C5HA 4HUTA 1UM8A 3ZD7A 4B43A 3AKDA 1NMXA 2V6IA 4DRZA 1ODFA 1G8FA 1O3YA 2IEZA 4XTCS 4PAMA 5HKKD 5FPHA 1E1QD 3IIJA 3N70A 3HR8A 3QXXA 4JBXA 4PPGA 4QC2A 2GXAA 1HE8B 1W36B 2OBMA 1IAQA 4HAYA 1W5TA 4RJLA 121PA 3UMSA 4ZDJA 2BOVA 3WHKA 2GZAA 1OXSC 3BB3A 4BFZA 4PFSA 4Q19A 3L0OA 2HCBA 4HUQB 5TDHA 2Z4SA 2GXSA 1Q3HA 4NH0A 1OT3A 1M7BA 4JL5A 4W7SA 3U7EB 4C7OB 2OFWA 2KI5A 1E79A 4AG5A 1DEKA 2FSGA 1YE8A 3T15A 2YC4C 2GCOB 1E2EA 2OXCA 2BBTA 2QROA 2R6FA 1VCIA 3Q3JB 4US2R 3U61B 4M0LA 2WWWA 3EIHA 2X77A 2A30A 1BH2A 2KB0A 2QBYA 3NTUA 3IDQA 3T5DA 4HI0E 3NDBB 2OAP1 4QBHA 5KSZA 5LB4A 1UDWA 1HH4A 2FN4A 5CK5A 5BWMA 4V0MA 1ZVQA 4GL2A 3BH6A 4ZI2A 2DFNA 1II8B 2VP4A 2CEAA 2DWPA 4GMXA 1SKYE 1P61B 2O0JA 4QGFA 2J87A 2WIBA 2ATVA 4US1R 2QZ4A 4HDCA 5AJXA 3N5CA 3FE2A 4O0MA 3REFA 1FMJA 4QGHA 2C5LA 1JPNA 1ZD8A 2XTMA 3WMGA 2E1RA 3U3KA 3AVTA 5D3QA 1D2EA 4DLXA 1RYFA 2H18A 3B1WA 3GLIE 1T3LA 3K70C 4M1KA 2IYUA 4GOJA 1OPXA 4LZZA 1PV4A 3AP1A 5DSZA 2WSSD 1NY5A 4LBVA 4ESVA 1N0VC 1Z0JA 3BRWD 4RD2A 4C0SA 4WZBE 1II0A 2HXSA 1OFUX 3CRQA 3NH6A 3RABA 1PZNA 3OF5A 4NHOA 5FPKA 3IEUA 4EFNA 1UBGA 1Z6AA 3MCAA 2ZE5A 4H1VA 4D0GA 2J41A 1YKSA 5JBQA 3JZAA 4MGKR 5M04A 1VCOA 1E2NA 2JLWA 1G7TA 3SE0A 2ZJ2A 3U4QA 1VKJA 2AFHE 3U7HB 2IYWA 3FKSD 5P21A 2X19A 1UKVY 1ZNZA 1F3OA 3PR1A 1PLKA 4CEIB 1MRNA 4A8JB 3GLFB 3D3QA 1GZSA 4HSEA 4Z8YA 1QHYA 2IYYA 2YZ2A 4RSGA 5SZKB 1CR2A 1KI6A 4CW7A 1MH1A 2IYTA 2YWHA 2BIFA 3VAAA 4R71A 5FOUA 3VHXA 2IC5A 3GCGA 4LWZA 3G0HA 1R5OA 3FOZA 1W0JD 1NVWQ 3W5IA 4BLQA 3GLIA 1SVIA 4XVRA 2HT6A 2VA8A 4JLNA 1CRQA 2BCGY 3GQBA 4URYR 2JDIA 4DJTA 3C7KA 3A1WA 3DZ8A 4RD6A 2NZJA 1AQUA 3A1VA 1QVAA 4HAVA 1A4RA 3X1DA 1YJ5A 2LKDA 1DAFA 1ZUHA 1EX7A 2OG2A 4RZ2A 2YV5A 3B7GA 4HZUB 4MRRA 1QHHA 2IT1A 2JJ1A 3TVDA 2VHTA 3P4XA 4TN1A 3OEED 3A4LA 1G3QA 3LV8A 3TQFA 5AJWA 4B76A 4EPXA 3IQXA 2JLXA 2F43A 4D4LA 1L4YA 3G5UA 2VTKA 2ZRAA 3WP0A 3BXZA 3EZFA 4O3MA 1DAIA 1XX6A 1ZC4A 2BVNA 2CCKA 2WMNB 1NY6A 1X1RA 3NC0C 5JRJA 1SHZA 1CLUA 5JWRA 1N25A 4HB0A 1KJZA 2RGGA 2FU5C 1R5BA 3GJ3A 3H84A 3GPLA 1P7CA 1QBKC 3LVRE 4X8LA 1U2RA 2J0QA 5LB2A 5L3SA 2OLJA 5J47A 3QPUA 1DELA 3PEYA 1A1VA 4A82A 1BIFA 2NO6A 2WWXA 1OXXK 1Z6YA 4QGAA 2O8FA 4HB2A 3ND9A 2BMEA 4GOXA 4Q9LA 4AK9A 1BKDR 2G83A 4Q4JA 1JR6A 1NKSA 2RGXA 1E1QA 1RRGA 2EQBA 4G01B 4LYAA 4V0NA 3B6EA 3RLFA 1JECA 2C99A 4ZCLA 1FP6A 2WIAA 1U94A 2F1RA 2WKQA 3QXHA 2R8RA 3NIBA 2G1JA 5GJBA 1N6HA 2QQ0A 1ONBA 2ZRMA 4NCKA 3AVUA 4Q7MB 4Q1BA 2F1HA 2H5EA 3U2QA 1QHIA 2QBYB 1BMFD 1XTJA 3REGA 5BYKA 2FX3A 4TYPA 4DZZA 4PZYA 1W4AA 1H8EA 2G9NA 2JLVA 4UNRA 4DLWA 2RB4A 4P32A 1SVSA 4NP6A 5SZJA 5GJCA 3FHTA 1GDDA 2OHFA 3CF6R 3C5CA 5BN3A 2JLZA 4KLNA 1IJFA 4TL9A 1RVDA 1GSIA 1KNXA 4HDOB 3N2IA 2H8KA 5FUYA 2BMDA 2H7VA 1VPLA 3TNFA 1OW3B 1SVOA 3HPRA 2LWIA 1VIYA 1JXMA 2VP2A 4OHWA 5FI1B 1I4TD 2WOJA 3TRFA 2ZE6A 4NCHA 3ADDA 4LJ7A 3OEHD 4B48A 1A7JA 1ZCAA 2MSCB 1P9RA 1A2KC 1XD2A 4B33A 4XWAA 3VKHA 3P1JA 2K5UA 2JA1A 4NMMA 3W3AA 2BM1A 2V6JA 1CXZA 2GAAA 3CX7A 4BLPA 4Q1AA 1UBCA 3Q85A 2OXRA 1T8TA 1VHTA 1M8PA 2HT1A 2RHMA 3EA0A 4JLMA 1Z83A 5DO9A 3OFND 3T61A 2AWOA 3ZJYA 3LD9A 2O0HA 3L43A 5KSPA 4MRSA 2BJWA 2WSSA 1S96A 4RCYA 1R5NA 3CB4A 1W36D 1YR7A 4EPRA 1CKEA 2C03A 4F7WA 2WWYA 5CLLA 2QP9X 3QEOA 3NEJA 2WSMA 3BB1A 2VP9A 1EGAA 1XP8A 2IXGA 4L4UA 1NIJA 1Z5ZA 3B60A 4K81B 4DEYA 5J4KA 5F3WB 1P5ZB 3ECCA 3TGPA 2J45A 4QHYA 1E98A 3QUSA 5JS8A 5EE3A 3MG9A 3W3ZB 3FKSA 3LFUA 1KI6B 3TUJC 1RKBA 1R8SA 2J1LA 2JLSA 2VP0A 4NU0A 4JBYA 2FF7A 4OJKA 3OE7A 2J7PA 2QAGA 2VHUA 3ICEA 3T5GA 3I3SR 1CULC 2FE4A 3TR5A 2RMKA 2ZS8A 5L3QA 1JAIA 1J8YF 3UATA 4ASUD 3GLIB 4ZCMA 1AS3A 3FKQA 1CJUC 4DB2A 1P2SA 4HLQB 1MO6A 1K5DA 3H1TA 1SXJC 1U81A 3OIUA 3QI2A 5CYPA 4AC9A 4QJ4A 1ZU4A 4UNQA 4Q9JA 5FPTA 4BFUA 1A2BA 5FOVA 1BOFA 1J90A 4URXR 3B1ZA 3T1TA 2YOFA 4JT2A 1KDPA 5DN6D 2I1QA 1F48A 2R62A 3QXSA 5LD2C 2AN9A 2XJ9A 1VHLA 2F43B 4A15A 1ANKA 1G3MA 4YMWA 3GJXC 3DMDA 2IYZA 1KDOA 1CU1A 1R10A 2P67A 4JVSB 3WNCA 5B64A 4HAUA 1GITA 1R4AA 1U8AA 2FDCA 1KAGA 3MSXA 1X86B 4K46A 4TTPA 2EYQA 4KYUA 3CRW1 3EXAA 1X3SA 3RS3A 1FTNA 1T91A 2A7QA 5FTMA 2O8EA 1CP2A 3SZRA 1IY0A 2IYLD 4LYFA 1UPTA 3L82B 1OHHA 1KDRA 5KDLA 4JLAA 3KKPA 3SYLA 5L3SB 1R0WA 5HE8A 3RVBA 1JI0A 2QL6A 2NPIA 1KI3A 2BC9A 3EZ9A 4ZIRA 4V02A 4DHEA 2GK6A 3RC3A 3RHFA 3CPEA 3WNBA 1LB1B 3BK7A 1I2MA 3FMPB 1OXVA 2XSZD 4TTRA 1TQDA 3ZS9A 4FD2A 4EPTA 3AH8A 2A9KA 3B9QA 5CIQA 2XZLA 5BW8A 5J4LA 1HT1E 1II9A 1ZM3A 2JEOA 2FFAA 4WXRA 2ZS9A 3QBVA 4NYJR 3A8TA 4BLSA 2JLUA 3KQKA 1Q44A 5FR2A 1I2DA 4L15A 2X1VA 1P4SA 4KO8A 2PL3A 2RGEA 1P2TA 1F2UA 2QORA 2ZUBA 1VYTA 4BEJA 5K8IA 4P4SA 1FX0A 2ZI7A 4L5BA 2EFCB 3SFVA 2AXNA 1T3HA 4B75A 1E2DA 5FOXA 1GVNB 5F98A 1VYUA 1NIPA 2D06A 2Q3HA 1ETUA 1NMYA 3GFPA 4PSKA 2UZ3A 3B5JA 4Q1EA 1G8HA 3B85A 3MWYW 4K8OA 1XDBA 4NONA 5DH9A 1RC8A 1KSFX 3N2EA 4DLUA 4ZDWA 4EFMA 2ZI3A 4XH9B 1CEEA 1YZKA 1MKYA 4MA4A 4IFEA 2P5SA 4KU4A 1SVKA 2CXXA 3FGNA 3A4NA 4NCIA 3OZXA 3A58B 2J0SA 4M2LA 3GEIA 3TVTA 3Q8XB 1XBTA 3DZDA 4RFSA 4TL7A 5DYIA 3RS4A 621PA 1XTQA 3CH5A 1N6PA 3QVUA 3SHWA 1JQJC 1OFHA 3ADKA 2QE7A 3KB2A 1G16A 4ZO4A 5FUVA 2PT5A 1KYIA 5C4GB 421PA 4ERNA 1Z08A 4Q18A 4OI2A 4MKHA 1G64A 1I4DD 3AUYA 2FSIA 4HATA 1ZAKA 1ZYUA 2XTNA 3Q5DA 1G20E 3H0KA 4A2PA 3LVQE 2L0XA 4RD1A 3Q7PA 4MRNA 4ZDKA 3KJEA 3WYFA 1M34E 3HYTA 4DSOA 1GFIA 1OH6A 1ELOA 3D6TB 4DC9A 1FNMA 2FPKA 3W6PA 5EUMA 3FMOB 4IRUB 4FINA 3U7GA 1G3UA 5LBIA 3BH7A 1IOZA 2GILA 1XZPA 1E79D 3ZVNA 1SZPA 2DFLA 2E87A 1KNQA 2FZ4A 1W44A 4AD8A 3RNLA 1E9AA 4PTLA 2QAGB 4OJQA 2ORIA 4IVRA 4Q00A 4B3XA 5L3QB 2DWOA 1NVVR 2IA5A 5C1BA 5DI9A 3UIEA 2WJIA 3X2SA 3PQCA 2JLQA 1MT0A 4RKEA 1YRBA 1NBME 5GJWC 1E2LA 2GDJA 1G5PA 3H86A 2IBMA 4X8OA 2XITA 5A4JA 1R0XA 1C1YA 1EG7A 3C14C 2AXPA 1N6OA 4M1WA 1AGRA 3KXLA 4LGMA 4ZKDA 1G6OA 2JATA 4KYIB 1Z0KA 1UBFA 3UMRA 4MKFA 2ZANA 2WJJA 1GNQA 1QG2A 4O2RA 4KV9A 2P6RA 2F3RA 1R2QA 4F4CA 1Z63A 1JJVA 1RJ9A 3QKSB 4JLBA 3C4JA 4RY2A 2ZSDA 5KDDA 4B32A 1N2CE 4W9MC 2RGNC 5EE0A 4URWR 3PCRB 4PHHA 4BPBA 1E2QA 3U5ZB 4Q7JB 5B30A 2O8EB 3BWDD 1OJLA 5JZVA 1ZIOA 2FA9A 1OH8A 3K53A 3CZQA 3MMPA 2CDNA 4R9UC 4Q9KA 5BN5A 2A5GA 3RYTC 4X8HA 2D2FA 5SZIA 5JHHB 4PPNA 3W8NA 2WMOB 3ZIAD 3K9HA 2PZEA 3SJAA 4C0JA 3EZ2A 4TMWA 1NVVQ 1BYIA 1YZTA 2C96A 3KKMA 2D7DA 2AX4A 3CIOA 3PIRA 1GL9B 1XNJA 3LBNA 4M8NE 4TLCA 4CEHA 1NBMA 3U60B 2DFKB 1N5LA 1XPUA 4QJ3A 3Q9LA 4D6PA 4WZ6A 2GXUA 2AD5A 4WZAE 3AEZA 1TMKA 4RD4A 1D2MA 3U7FB 4BZPA 5TARA 3LRPA 2Q0HA 2Q3FA 1TF7A 5EP1A 4C0BA 2GVZC 4UJ5A 1NP6A 2G6BA 2WBLC 4FIDA 1Z0DA 5FUXA 1GNPA 3SJBA 2UKDA 3B8HA 2KSQA 4YDSA 1IXRC 4JBWA 1IHUA 1MRSA 3BOSA 2AR7A 3FPAA 4TYYA 1Z2AA 3CNLA 4P3YA 3QXCA 4DCNA 1E96A 5JS7A 4P4SB 1FX0B 4XVQA 4IW3B 3A4MA 4XJXA 2VPPA 2JDID 4C0HA 5C4MA 4A36A 4PC6A 1XD9A 4C9BA 1WF3A 2ZSFA 1U0LA 4O25A 2N1BA 1M7GA 4D4KA 1VG9B 3PEVA 3BAFA 4DSNA 1QHGA 1DS6A 2O8CA 1XTKA 2ZQ5A 4OK3A 3M0EA 2JJ1D 3AF4A 1W47A 3B9PA 2ANBA 2ZYVX 4Y0VA 1IN5A 1EFCA 2IF2A 4IOMA 4MUAA 4AG6A 5G41A 1GIAA 1EFTA 3U3RA 2KJQA 1FNNA 4I1SA 1LF0A 1D8TA 1NN5A 4M22A 2ONKA 1NKTA 4Z8XA 3KXIA 3AF2A 3GFTA 3DDCA 3L2OB 5KO2A 5LPNA 2QUZA 5BQ5A 3TUZC 5CJ2A 1NN1A 4CGZA 1P75A 4PC1A 4EKDA 5F2EA 5JMTA 3TSOA 3K9NA 1W36C 2DHRA 5J40A 3P26A 3NXSA 4N0DA 2UZIR 5FTJA 4JYBA 1AQYA 1ZW6A 4P0TA 1CJTC 2QU8A 3DM5A 3I4LA 2XXAA 2BEKA 4A2WA 3ND8A 1GKYA 1E0AA 4LPKA 2C2HA 3WHLA 4AWXA 4DIDA 2IUSA 3CBQA 1GTVA 5DNYB 2G0NA 1A5TA 3ZGXA 2R65A 5JSZB 2OFXA 1SGWA 4BFSA 1KI4A 5HTKA 3TAUA 2WWIA 3I8XA 1S1CA 1COWA 2GHIA 2AL7A 2O8BB 2PCLA 1MABB 1XTIA 2ZUDA 4Y0AA 1E9FA 2NPFA 3QNUA 1FQJA 3B82A 5H1YA 1EXMA 5KYKA 3RRMA 1XCGB 2GBLC 4TSFA 1OXUA 5H68A 2NO0A 1H8ED 4Q1DA 1W4BA 4FMBB 4DDTA 3PENA 3LY5A 3X1XA 2BMJA 2QMHA 3PITA 4POAA 2P5TB 5EE5B 3CR7A 4MRPA 3PEUA 5GVSA 2BDTA 4RZXA 2GK7A 2BBOA 4JLPA 2PMKA 5JRZA 1BYUA 1ZCBA 2W6JA 3WYGA 1CR4A 4YXWA 2OAQ1 3EPKA 5KSOA 3L8YA 4Z54A 2E9SA 4TL8A 3NBFA 3QBTA 3ZYCA 2GEUA 2IYSA 3LXXA 3DMNA 1HQCA 2P65A 4GT1A 2GJKA 4PO9A 2Q6TA 3QEJA 3OHMA 3BB4A 1WMSA 4B47A 2XJ4A 1F6BA 2J9RA 3QKUA 2FEMA 1QHXA 1NMZA 1RJ9B 2CBZA 4IDNA 3UG6A 2OCBA 2OCAA 4B3GA 1DTSA 4NL4H 3AQ4A 1KMQA 4BRWA 5EP4A 4BECA 1XMJA 4PR0A 3ONWA 5IK2A 1N6IA 1KGDA 3ZQJA 4TT3A 2NIPA 1T9HA 4MQBA 4BFYA 2DYKA 3SBEA 4ILEA 4JL6A 1Q12A 2ZRBA 1EESA 1HURA 4EJSC 1JR3E 2ZAOA 3TH5A 4C0LA 4Q01A 4A8JC 2RGCA 1JEDA 3CH4B 2WWGA 4Z1MA 1GWNA 2B7CA 4WVFA 4QJ5A 4A6XA 3WBJA 2BJVA 3IO5A 3ZIAA 5TVKA 1KSHA 4LPSA 1AZSC 3I72A 3RDPA 1N6RA 4CYMA 5JHGB 4LK2A 3RS2A 1Y63A 2FV8A 1ZD1A 3CNOA 4QBIA 1IONA 3GJ6A 3HJNA 1OSNA 5DLQC 2KBFA 2FFQA 3VHLB 3OE7D 2J7PD 2ASEA 4PXAA 2OBNA 4B34A 2HXYA 3K9GA 4Q4HB 4JVMA 2YOGA 2FGJA 1P3JA 1G8GA 2ZRCA 1KSJA 2ZPTX 3TW8B 1N6NA 3LQQA 2QMUA 2VRWA 4I1OA 1SXJE 4TLBA 3BFVA 2CHVA 2V55B 5GJVC 4AURA 2R9VA 4KSCA 3PUXA 4GZLA 3ASZA 3PUWA 4G5RA 4V0KA 2O8CB 2EFGA 5B2ZA 3CWQA 4KVGA 2CL6X 1M2OB 4PQRA 4TZ0A 3EPHA 1Z29A 5L8VA 2NO9A 1E6CA 5E95A 1JR3A 3SR0A 3CRMA 1F2TA 2PEYA 4E22A 1YZGA 1U98A 2FFBA 4WA7A 5K8LA 4LHXA 4XSGA 2CNWA 3QF4A 1TEXA 3LNCA 4G5GA 3LWNA 4TMXA 3SDZA 5FBWB 3I32A 2ANCA 5CB6A 4URVR 1CS4C 2BBWA 4KHZA 3OESA 4NYMR 4WOPA 1ZBDA 2F7SA 5KU1A 1P2VA 2OCPA 1OHHD 1S3GA 2XEXA 4KFSA 3RC8A 4TMZA 4UNPA 4XVUA 4Q4LA 2XXAB 3L0IB 2Z4RA 3OAAA 1W4RA 3DOEA 4JIMA 2IS1A 3K09C 1N5IA 4UNNA 3SYKA 4CIDA 4CZ2A 1TADA 1XEXA 2VHQA 1SXJA 4ZDIA 1OFTA 3IUYA 1EX6A 4GP7A 2ZJZA 1W7AA 3D8BA 3RWMB 4A92A 1IQPA 4OK6A 3TK1A 5DGXA 3EARA 2R44A 4ZPXA 1XMIA 1P9NA 3GEEA 4HAWA 3UMFA 3ZVMA 1G8PA 2FSHA 5GVRA 4AYWA 3TSZA 4YMSA 1VG1A 4FCVA 4BQSA 1RRCA 4AKGA 2RGDA 1KK3A 4HB3A 1T5IA 2J5XA 3LBIA 2JLRA 5DI3A 1RPZA 5GADl 2J7KA 2NGRA 1E9SA 3KTAA 1D6JA 1AK2A 1G5TA 1G4UR 4PAOA 1XJCA 3F5FA 2BBSA 2XAUA 4NYMQ 2XOKA 2JLYA 2F1IA 4HLCA 2OV2A 5EQTA 2CLCX 3HPQA 1KZGB 1X6VA 3WP1B 3QENA 4QRHA 3BJIC 1TQ6A 2VL7A 3GD7A 1FPMA 2ZR0A 4P31A 3TAHA 3AGPA 3ZVLA 1L8QA 1U8YA 4YMUA 1KI1A 5BN4A 4F91B 1KDTA 1KI9A 1TUEA 2Q3MA 2QRNA 4KFTA 5C18A 3BBPA 4P4UA 1D5CA 3MJRA 5JI2E 4DWJA 3QY0A 4KXFB 4YONB 3RANA 3RS7A 3FB4A 1Q20A 1YZQA 2ORWA 4HZIA 1LS1A 2QE7D 2XZPA 1UJ2A 3ASYA 3X1YA 4QNRA 1MO4A 2GTPA 3UXMA 4DLRA 3AKCA 1HT2E 1US8A 4IDQA 3TE6A 3RRNA 1NL3A 4D0LB 1C4OA 4F92B 5FL3A 2KBEA 1MR3F 2W2TA 1E2IA 1ESMA 2WHXA 4Q48A 4QL3A 2W2XA 2IS2A 2QGZA 3CW2A 2ZYTX 2GZDA 1XD8A 3SFZA 3THYA 4CRWB 2BEJA 2D4HA 5EE1A 3W5JA 2PCJA 1KMHA 4TMTA 1LV7A 2HJGA 2FH5B 1EFRA 1IN6A 2VHJA 3AVOA 2FSFA 5TB5A 1S0UA 2A2ZA 2R6DA 1GRRA 3K0FA 4D2IA 1OFIA 3U4QB 3K0EA 2IYVA 4B2IA 1OIVA 2OUKA 2VSOA 4NCJA 3HU1A 4LV6A 1SKYB 3WBKA 4C0AC 3AP3A 4PPQA 4GZMA 3Q5EA 4FN5A 1KKLA 2C78A 3W34A 5FL7A 3UWKA 2RGAA 5JCPA 2B92A 3HR7A 2ZEJA 1FTSA 4BFXA 1HTWA 1SQ5A 2HDNB 1E9RA 2ZRIA 5CYOA 3VU9A 2WM9B 3V00A 4OQNA 1VG8A 3UK6A 3I1FA 3TBKA 4JL8A 1U0JA 1P2UA 4M1OA 1NVXQ 5EXSA 4R98A 1T5LA 4M1MA 4F4JA 1WB9A 2IYRA 1E1RA 1GP2A 4JLKA 3DO6A 3RWOA 4JLJA 3FMIA 3SJCA 3VR4A 4FWTA 1OKKA 2ZAMA 4ZCIA 4V03A 3IBGA 4FWIB 1F2TB 1ZM4A 3LX8A 1C9KA 4D80A 1KTVA 4JLOA 2ECKA 1QHHB 2AKYA 1G9XA 4BLRA 4D25A 2V7QA 3BC1A 3H4MA 1E9DA 2JGNA 3CWZA 1Q22A 4TTQA 1XJQA 2RKOA 2I4IA 4UXIA 1UF9A 2QMOA 4XSHA 4Q4AA 3O8BA 3P4YA 4DT1A 1CJKC 4LHYA 3LA6A 2PLRA 5G53C 5FTNA 4HLUC 1S9DA 4LCBA 2CJWA 3CONA 1XTRA 4JMPA 4A4DA 4G1UC 2QPTA 1FP7A 4M4SA 3KQHA 2YC2C 2IK8A 2PZFA 4R7ZA 2WPDA 2P6NA 1Z07A 1ZU5A 4HAXA 4ITRC 4IOKA 5TY0A 3VX4A 4C2UA 1KK2A 4TLAA 1SXJB 4NBSA 3GJ0A 1NBMD 1XPOA 1IN7A 1VTKA 3VQTA 3AKYA 4LC0A 1W4CA 2OCYC 5HZHA 4HYYA 1LNZA 4MGYR 4U7DA 2F55A 1JBKA 1ZM9A 2O8FB 1K5GA 2HJVA 2Z43A 2GJ9A 3QKRA 2OE2A 4G3XA 3CKLA 4MYUA 4Q4JB 2JCSA 3KJIA 5EZ5A 3KXKA 1KK1A 2F6RA 3WXMA 5E7IA 3J81k 4DUGD 3U6KA 1M74A 3K0CA 1U90A 1VECA 4A0RA 4KODA 4IKEA 1ZM2A 2GZHA 3LO5A 3MAAC 3O8RA 2G3YA 5G40A 4KSBA 5CLQA 5JLJA 3K70D 2IEYA 4OHXA 1CR0A 2ODEA 3QKTA 2QAJA 1FL9A 3QE0A 3GLGE 2H1LA 2RGNA 2J59A 4URZR 3CF2A 2D3WA 3LLUA 1LS6A 2YKGA 2GETA 3MFYA 3IQWA 1G291 1Z6XA 5DYGA 3AVVA 4N0EA 1K8RA 1LFDB 2CE2X 3C15C 4DLZA 4ACAA 4MYCA 2ZJBA 5FBLB 3EIEA 4YMVA 1J70A 2JJ2A 1JJ7A 3FYHA 1G17A 3NG1A 1QG4A 4IXMA 2ZYWX 1YRAA 1HA3A 1RW4A 2NO7A 1XXHE 2ZJYA 1AKEA 4F93B 1KO1A 2J46A 4LJ4A 1Z6GA 3S1AA 5A0FA 1E9BA 3CPJB 5FPYA 3IPXA 2WV9A 3ETLA 2OM2A 4QKQA 4WBSA 5CJPA 2VQSA 1WA5A 5CM9C 2P6UA 5A5GA 1TU3A 1N5JA 4I99A 1XD2B 2W0MA 2JAQA 2JASA 4JLVA 4P33A 4KCGA 1FFHA 3BERA 4C2TA 3A1SA 4Q03A 3AGQA 1E2MA 1GL6A 1M6NA 2WVJA 2QN6A 3THYB 2QM8A 3UPUA 5J4YA 1RRPA 1G18A 1G7SA 4NYJQ 1XPRA 2NZ8A 1SVWA 4AKHA 1KMHB 1E2FA 1V5WA 3EZ7A 4CVNA 3GLGA 2WTUA 1N6KA 2PEZA 5ELXA 2G0TA 1W46A 2BM0A 5JJIA 1KKMA 1COWD 2R6GA 3V9PA 4E03A 3EPLA 2G1KA 1Q21A 2IL1A 1S1MA 3L8ZA 1RE0A 3RSOA 4AY2A 1XEWX 3AVQA 3RRYA 4Q9IA 5J4VA 1Q1EA 3PFIA 4LJYA 1Z0AA 4Q7LA 2QP4A 721PA 4DLYA 5HPYB 4TQ9A 4U5XA 2YINC 4TSFD 4B3BA 1XXHA 1DAGA 1HQYE 3THXA 1B23P 6Q21A 2FZLA 2VH5R 1Q1QA 1R8QA 2QEQA 3LH5A 4UJ3A 3EPJA 1G19A 2GVDC 2O52A 3MD0A 5FOSA 3T1VA 3VU9B 1JALA 1ESNA 3KJGA 4OQFA 1WBDA 2YHSA 5EXTA 5AUNB 4JJZA 5FTLA 3CX8A 1NF3A 4NZYA 2W6JD 2QMEA 2C98A 4YXWD 3B1VA 2ZU0C 3CRVA 3TQCA 2VYFA 2X2FA 4W5WA 1D2NA 1IJEA 4HEJA 4GPTA 3IIMA 3OIWA 3T34A 4E09A 4H1UA 1X8JA 4JT4A 4QBGB 1XRJA 2DWQA 3MWKA 1YHNA 4U00A 3WNDA 1Z2CA 1MO5A 4HUQA 3KL4A 4PQFA 3V4RA 2GAOA 5EP3A 2W83A 3CF0A 1E99A 1XEWY 1FUUA 4OQMA 1E2PA 3TKLA 2X2EA 4C7OA 1KO5A 4JSYA 8OHMA 3NHAA 1L7VC 5DIFA 5AWFC 4B2LA 2C77A 1WDTA 1Y3AA 4FI3C 1WBBA 1EK0A 2GCOA 1OV4A 1XEFA 4QM7A 1UKYA 1IN8A 3QG5A 4MGIR 5IK2D 3LAWA 3IGFA 2AFIE 2XNDA 4TT3D 4EIWA 2FMXA 1YZUA 4B2PA 4DLVA 4DT1B 1P6XA 2J0UA 4KJZA 1DO0A 3TIFA 2QENA 2ZVPX 2C9CA 3CZPA 2EW1A 4TL6A 4C3ZA 1W49A 3ZZ0A 5KSYA 2OESA 1LF5A 1T4GA 2PH1A 4Z1MD 3GLFE 221PA 4OBEA 4TLEA 3L0PA 1CF4A 1DADA 1T0HB 5E4FA 3U3MA 1ZJ6A 2QPAA 4HLDA 3DKPA 4ZIRB 4AI6A 1NG1A 2ZRGA 3BE4A 1OB5A 3DPUA 4URUR 5JJKA 2OFOA 5C2JB 3QKRB 1X8KA 1EFUA 4C30A 5HZKA 2OEPA 4G5OA 4MUBA 3DVLA 1Q3TA 2CHGA 1U9IC 5KNCA 2V54A 3T35A 3JVUA 3KKQA 1GRQA 1G8YA 1GRNA 2CE7A 2ZSBA 3B78A 4LHVA 1JQLB 3QSYA 2VLIA 4EFLA 2YWGA 4M1TA 3RRZA 1XMSA 2CVFA 2GEDA 3FTQA 1U8ZA 1P62B 2V8OA 4AIIA 4BUJA 5KTYA 1FOEB 4B71A 4OYHA 4RD0A 4DCUA 4TQAA 5B57C 1TTTA 3GLHE 3HU3A 1Z6TA 4DUGA 1F2UB 5KDOA 4L16A 3VR2A 5AUOB 2QSZA 1E2KA 2A5YB 2GKSA 3KQLA 1FQKA 2WICA 5L3VA 2Z0MA 1P72A 1N0UA 2X8AA 1XWIA 2G77B 2R6CA 1JR3D 5G3ZA 3ZS8A 2Y8EA 1W0KA 1T8UA 4RCZA 4D26A 2V4ZA 2UVQA 4JJKA 4EJSA 2ZXUA 1Z06A 2DB3A 1OIWA 2CNWD 4A8JA 1H8HA 3NKVA 3I61A 1VMAA 3AUXA 3SQWA 2GNOA 3AV0B 5AUQA 4LBWA 4R2IA 2QI9C 3V4FA 5EXXA 1Z8FA 3VMFA 5FOTA 4LJAA 4GMDA 4NE2A 3BFXA 2C9YA 4P4TA 1JNYA 2ORVA 2A78A 1CBUA 4II7A 4DSTA 2LCFA 3BGWA 4FCWA 1KZ7B 3T12A 4BZXA 4RFSB 1Z0FA 3EC2A 3SQXA 3AM1A 3O8DA 1CJVC 3R7WA 4OHYA 3LX5A 3SEAA 4AKIA 4US0R 3UKDA 4F4IA 4ZV4A 5JI3E 2GA8A 1E2JA 2BMFA 1PLLA 4IXNA 1E2GA 3MUFA 3OAAD 3EWSA 2Z83A 1KJWA 3A1TA 4UXJA 4IVPA 2A5JA 2PJRA 1JEEA 1NLZA 1SXJD 4B3DA 3GLHA 4XD7A 2BKUA 1E2HA 1P73A 3GLGB 2W00A 2KE5A 3BH0A 1UFQA 5KNBA 1GL7A 4WIAA 3QXJA 3KJHA 4A0HA 4UNSA 3NWJA 1E3MA 1N6LA 1QDEA 5IDVA 3AVXA 2C8VA 2GJ8A 1TEVA 4IVQA 4J0QA 3T06B 1Q0UA 2BHRA 4DXAA 4DCVA 3PVSA 2OILA 2ZROA 4QOSA 1CR1A 4FCTA 4FW9A 4M1SA 4LI0A 2PLFA 2CL0X 2VP6A 2ZJAA 3MLEA 1DAEA 5CM8B 1QRAA 2P2LA 4PANA 3FHCB 4C0QC 1XXHB 1PJRA 1G3RA 2WAYA 4DIEA 3THXB 3CUEF 2RAPA 1TF2A 4LYJA 1KI2A 4LBZA 3WYAA 4I1UA 1XU4A 4TWZA 2XX3A 1ZP6A 2PX3A 1R0ZA 2BWJA 2MSDB 2QGNA 1W48A 4FMCB 3MWLA 2FNAA 4A0GA 2ZI5A 2XOKD 4NYIR 1T6NA 3QJYA 2O8DA 2C9OA 4JYCA 2IYXA 1NI3A 1W2GA 4OL0A 1UKEA 4CF7A 2D7CA 2QTFA 2R6AA 3MGCA 2Q9AA 5KPDA 2Q9CA 2VF8A 1DE0A 2WAXA 4LOAA 2NMVA 2IXEA 3DHWC 4B6FA 4KFRA 4MRVA 2ZSAA 1ZNXA 1EWRA 3K09A 4PPFA 1KO4A 1K6MA 4PC3A 5HCIA 1NVUQ 4G5QA 3NVAA 5FBRB 3SBDA 2ZM5A 2N46A 2QT1A 4B6EA 3IEVA 3KB1A 2HYIC 1OH5A 3SS8A 1ZNYA 3PXGA 5D3MA 1TU4A 2GWHA 4I81A 4IFBA 5EXPA 1GKUB 2J0UB 1W5SA 1YU9A 2HUPA 4D82A 1UBEA 2OT3B 3QVVA 1XTSA 4Q9HA 2GESA 1NNEA 4TYWA 1AJEA 1E0JA 1QHNA 1YVDA 1S2MA 2F9MA 3DKVA 1Z47A 2CVHA 1WCV1 5EUQB 1EFRD 2VSXA 2IS6A 1G7CA 1JPJA 3KKNA 1ZRHA 4BASA 2REXB 1DBSA 2DCUA 2VSFA 1WRBA 2GCNA 1KOFA 3ZVRA 4MKIA 1U99A 4NYIQ 4WXPA 3SU8A 2HLDA 3KZ1E 4JKIA 2A3RA 4TLDA 1AN0A 4CEHB 4HAZA 4LJ9A 3FDIA 4TMKA 5CK4A 3UWOA 3AF1A 4UKDA 3KDSE 5FOWA 4MDEA 5FL7D 1E0SA 4B35A 4LUCA 4BLTA 3OIVA 2DBYA 4B3FX 5LDDC 1RRFA 4JVLA 2FJUA 3WMEA 2V3CC 3BORA 521PA 1NN0A 3K1JA 5HE9A 3G82C 3TMKA 2W58A 1Q1ZA 4LY6A 4Q1CA 3H2YA 4Z51A 2QT0A 3VTKA 1XCPA 1HV8A 1E1RD 2Z6VA 2PX0A 3K70B 1QHSA 2CHQA 2D62A 1OKKD 2ERXA 4BGDA 1IBRA 4EJSB 2GJSA 2VP5A 5E3HA 4NKRA 4PQYA 1H65A 1UADA 5C46F 1JB1A 3PJRA 4A2QA 1O87A 2CCGA 3FVQA 3Q72A 3CRRA 1UDXA 3AVYA 2WOOA 2V7QD 1W2HA 5IT5A 3L0SA 3E5HA 1P9WA 3CLVA 2HV8A 1YR6A 4E5UA 1KO8A 5AR1A 4IJMA 2BCJQ 1DAMA 3VX3A 2IUUA 2H16A 4I4LA 2Q21A 3QPVA 3PV0A 4PZLA 1E9CA 5FH9A 2AKAB 1DG3A 3EW9A 3P20A 3R7WB 3SN6A 3IHWA 1SHKA 5G3YA 2XB2A 2YWFA 1WP9A 2EFEB 2WKPA 2ZRDA 2EWVA 4RKFA 4BFWA 2ODBA 2B21A 4NPHA 2WPDD 5UKDA 1G41A 3LDAA 4RZUA 4D0NA 2WJYA 2ZI9A 3GLHB 3M4YA 1AS2A 3BIFA 4C0KA 1HUQA 3B13B 4D4MA 5IRCD 2AHOA 2V9PA 2ZI4A 4N1AA 2ZI6A 2ZR9A 2JIZA 1XFAA 4QNMA 4GNKA 3FHOA 4BE7B 1AIPA 3EZ6A 1HY3A 4Q21A 4OI1A 4B3CA 3KQUA 3X1WA 4OKSA 4PC7A 4QHSA 4RVCA 4OI0A 3LBHA 4MDFA 2VEDA 3GP8A 2DFTA 4DVGA 2BV3A 2HEIA 5K8UA 2CK3A 3WMFA 3KKOA 1P60A 2HCJB 4G5SA 1KK0A 4OK5A 1OIXA 1LTQA 2ZETA 2G88A 3ICQB 2OZEA 4Q1FA 4IOJA 2WZQA 3K9LA 5AUPB 1OE0A 2TMKA 2NTYC 2VO1A 2IUTA 3BS4A 2O8DB 2RGBA 3B1XA 3FFAA 4MYHA 5KPJA 4PAQA 5DHFA 2FOLA 4GSYA 3QIAA 1RFLA 5JEDA 1QZXA 2RHDA 1PUIA 2VIIA 4KBGA 1D9XA 4HLUA 1J2JA 4XOIA 3T1OA 3VR3A 1XB2A 1LW7A 1GOTA 2JJ2D 2QY9A 3NBZC 4EAQA 4Q7KA 2CCJA 4M9ZA 821PA 5HKKA 1NSFA 2EWWA 2YOHA 1F5NA 2B6HA 1NN3A 2ZE7A 2GF0A 5EP2A 3CM0A 3B2EA 2ATXA 3IHLA 1YR9A 5ANRB 4FMCF 3W6NA 1GG2A 4LV5B 4JS0A 3ADCA 1OB2A 1ZC3A 2C04A 2GRJA 2A5FA 3IIKA 1FMLA 3A36A 5D3MB 1PVOA 3P32A 3AKEA 4AKEA 3SJZA 2ZRJA 1PLJA 3JZMA 3VFDA 3WRXC 3SI7A 3I92A 2FGKA 1B0UA 4B74A 4C4PA 4MKGA 3VR5A 1WE2A 2OO7A 3A37A 3A1UA 3LQRA 3TUIC 5CDFE 2VBCA 4TZ6A 3D7MA 2REOA 4HDQB 1IY1A 2SHKA 1WXQA 1DAHA 1E4VA 5AJVB 1HE1C 3NHBA 2J3EA 1SULA 2ZJOA 4PHTA 5DE3A 3RSLA 2ZRNA 3NH9A 2XZOA 5BYJA 2WWHA 1XCMA 1GAJA 3ZH9B 1U0HC 3A6PC 3U3JA 2MSEB 4QM6A 5F9FA 4KVAA 2W6ID 1ZUIA 4ARZA 4Q5IA 1MV5A 3EAQA 4LC1A 4LHWA 4RFVA 2ZYUX 2R2AA 2EYUA 4OI4A 4Q02A 5SZHB 4BWYA 2IHBA 4DDVA 4V0LA 3U44A 1OF1A 1GNRA 1KSGA 4DLTA 4DEXA 5JECA 4ZKEA 1YQTA 1XMVA 3QG1A 4CEJA 1BO6A 5BXQC 4Q66C 1EFHA 1TX4B 3M1IA 4IEIA 2N42A 2WKRA 3OIYA 5DHAA 1QVRA 3E2IA 3TJZA 4PC2A 4EPVA 1DPFA 4LJ6A 1S3SA 2AD1A 3VKWA 4DLSA 3RS5A 4KITB 1TUIA 4LV8B 3EIQA 1DARA 1GUAA 5CDFA 3HU2A 2J0VA 1D9ZA 3GMTA 4YDHB 3VR6A 1M1YE 1GM5A 3AP2A 4RD3A 1KHTA 2IX3A 3I5XA 3NC1C 3R9WA 4PO1A 4N3NA 3RAPR 3TR0A 1AZTA 4Q47A 2ZE8A 1G6HA 5FBVB 2IWHA 4JSTA 3R20A 3DM9B 5E7MA 3FWYA 2YJTD 4M21A 1KJYA 4QGGA 3GJ7A 4OQXA 3QF4B 2CL7X 5JFGA 2XNDD 4BRUA 5AK0A 1NJFA 5AJYA 4MYTA 4GFDA 4JKYA 4JZKA 5CB8A 1SVLA 5JWHA 1HEIA 1IN4A 1Q1BA 2NQ2C 4M1YA 4TYQA 3SYNA 2EVWX 2D2EA 1DG1G 3EX7C 1XJ0A 1VYVA 4BFTA 1W0JA 1OLOA 4EUNA 4IHQA 5L3RA 4EPYA 1RZ3A 2PT7A 5EJEA 2CMKA 4PZZA 4CT4B 3KUDA 4PHGA 3LLMA 2QP3A 4W5JA 2PZGA 3E1SA 2QTHA 4EDHA 5FR1A 1KI7A 1XEXB 4WAUA 3I8SA 2ZJ5A 5F9HA 3MRSA 2F9LA 3ADBA 4KFUA 1SKQA 3U3OA 2F3TA 3QKSA 3OEEA 2CLSA 2OBLA 3EG5A 1UAAA 5KNDA 4AYXA 5IHPA 2EFHB 3EA5A 1UEJA 4GBMA 4M9SA 1JAHA 5TXGA 5LD2B 3BFKA 1N5KA 4JVNA 3EASA 4YQFA 3W6OA 1RYHA 3CR8A 3PUYA 4FMDB 3PUZA 3LW7A 3F8TA 1CJMA 2MMGA 2HF8A 3CO5A 4OHVA 1X1SA 1OYYA 1XZQA 3ZZTA 5DI3B 3NBYC 2Q9BA 3ZD6A 1QF9A 3QF7A 3ZZUA 1TNDA 4A9AA 1T3SA 4EQ6A 2PBRA 3KTAB 2C95A 3C41J 3E70C 3KFXA 3VKGA 1VIAA 1W0KD 2VF7A 4CDGA 5KUTA 2ZTSA 2QPOA 2EU8A 4H9GA 5H8WA 4IOLA 2YWEA 5IF9A 1H8HD 2RCNA 1EWQA 2HYDA 3ZDQA 3KUCA 5J4HA 2ZU6A 2YNMA 3LW8A 2H57A 3KX2A 4G0NA 1T0JB 4ABYA 1E69A 3K8YA 2QA5A 1ZNWA 2FPLA 5EZ6B 5E7JA 4L9WA 4NCNA 1YZLA 1ZIPA 4X8MA 2FPMA 3THWA 2OSBA 2GJAA 1L2TA 2IHYA 2ZRHA 3VR1A 3LXRA 3HDTA 3GFOA 3QPWA 1M7HA 4GRAA 1U9IA 1ZM7A 3QQ5A 4OHZA 3K0SA 2XTZA 2IF0A 4KBFA 4LRWA 3AVWA 5CIWA 4RZ3A 2A5DA 3GEHA 3F3YA 2IXFA 3PG5A 4GDFA 2YYZA 5FUWA 3KFVA 1US8B 4UQOA 1AS0A 1BMFA 2O0KA 3AVPA 2HF9A 2ZS7A 2GEVA 4XD7D 2AK3A 2I3BA 3CPHA 1KAOA 3HWSA 1GKIA 1V43A 1SVMA 1DO2A 2YVUA 1OH7A 4W5HA 1TAGA 3SC3A 4M53A 1FUKA 2RH5A 2ZRFA 3DL0A 3NBXX 1AKYA 2QRZA 3JVVA 4NDZA 3QOFA 1Z0IA 2Z5FA 3K0AA 1OYWA 2ODNA 3P27A 1KY3A 3R8FA 1FZQA 4GI7A 4KI0A 4OQLA 4LJ8A 1GILA 1NJGA 1MO3A 4MH0R 3K0FB 4ARZB 1E94E 2ERYA 4L9SA 3IKJA 2ZRPA 5EE9A 2QAGC 5J5CA 5FTKA 2KWIA 1UEIA 4FXPA 3IO3A 4TQUS 1AM4D 4XWOA 4A0FA 3UG7A 2VHCA 4LYHA 3U44B 3CX6A 2W6IA 3OEHA 3W9YA 5JWOA 4DCTA 1FW6A 1IXZA 4M9XA 1PUJA 2IW3A 2IYQA 4QBFA 4CEJB 5FI0B 3UANA 3WRYC 4AYTA 1E4YA 2CLDX 3TW4A 3O8CA 2REBA 2AWNA 4IDOA 3DOFA 4LJ5A 4IDPA 4GP6A 1G4AE 3D31A 3R9IA 3OFNA 4R2HA 3VNVA 4O2LA 4DSUA 2GXQA 5JSZA 3VNUA 2W2VA 3T1QA 2IS4A 2FEOA 4B73A 1E0KA 1NG9A 2JJ8A 1NRJB 2H92A 5JEEA 1Z28A 2O5VA 3ZLJA 2P0EA 1VG0B 3R9XA 1DVRA 1OXTA 1IXSB 3GJ4A 2O8BA 3THOA 4B44A 1MABA 2QSYA 1HYQA 4U02A 3TLXA 4XWKA 1S9HA 2D74A 2ZREA 3HP1A 4PHFA 2IWRA 1VCMA 4QFMA 2XGJA 3IBYA 2B8WA 1Z3IX 4DB4A 1DOAA 1TQ2A 3AF3A 3WY9A 2NOAA 1G7RA 1NLFA 4E07A 1CTQA 3SOPA 1G3IA 1LVGA 1Z22A 5CITA 5B58C 3C8UA 2QM7A 1J8MF 4KLZA 2ZSEA 1G21E 4LX0A 4QHTA 4S2EA 3W8RA 2ZITA 1Q57A 1BS1A 4DCSA 2ZRLA 1UKZA 2P3SA 1I4LD 3I73A 2ODWA 4EPWA 1JXOA 4Q4AB 1IY2A 3RS0A 2DPXA 4ASUA 5FPSA 4BLOA 1DAKA 4PX9A 2CJWB 4LSGA 1II8A 1CRPA 1N0WA 1YZNA 2GBLA 3KQNA 3GJ8A 4WW0A 5JCZA 2HLDD 1LY1A 2AK2A 1TQ4A 1TL7C 3K0CC 4LBYA 5TMPA 5HR5A 3I5YA 3AF0A 3MJHA 1S8FA 5DN6A 4MGZR 3IPYA 2FWRA 5FBQB 2ZUCA 5TV2A 1KIMA 1A82A 1NLYA 3SNHA 3PEWA 1R6BX 3DEFA 5JJLA 2B8TA 3PUVA 4YC7A 2MMCA 4IEEA 4ZI3A 3O47A 2NG1A 3Q7QA 1MOZA 3EC1A 4YLGA 2ZIAA 4A1FA 4DDWA 3I62A 2FFHA 4KAXA 2QQEA 4PSAA 3NDPA 2WJGA 1W1WA 5K8TA 1F60A 4EQ6B 4TMVA 2H17A 2NO1A 1IM2A 4IDHA 2GCPA 1WQ1R 4BFVA 1ZD9A 5HCNA 1VCNA
chains in the Genus database with same CATH superfamily
2WNSA 5JDIA 4P7BA 1CIPA 3FFBA 3VSBA 5H0IA 1GZ5A 4KOEC 4UHEA 2FXIA 1JG2A 3URKA 2JRCA 5FWDA 4PSVA 1JZTA 1RJDA 4HDAA 3TLJA 3VPSA 4AB1A 2FX2A 4YREA 4F60A 1EK2A 5C1DA 3FF1A 1G1MA 2Z3VA 3PNVA 5H70A 4XRGA 4A6PA 1V9CA 2C3MA 4LF8B 5KOYA 1KI8A 1PCXA 1GAXA 1BC5A 4JMLA 2VPZA 5IFKA 4AL4A 2DPHA 4WFQA 2O1SA 2V8BA 3W2TA 1NSTA 3F5SA 2CSXA 5A3JA 5CVEA 1GZ3A 2XNSA 3HGQA 4RHFA 2V1UA 1AB5A 4LHZA 4U7GA 1O9HA 4M88A 4PO8A 1BDHA 1IPEA 3RREA 3PPYA 1YR8A 3EQZA 3PXUA 5CA0F 1WZCA 3AB3A 1GUYA 1R7RA 3SHFA 2FW8A 1WVIA 4J8PA 2VWPA 3R8CA 3W90A 4AO6A 4ESHA 1LLUA 2JIZD 2IBTA 1CETA 5LOVA 4DVJA 4D9IA 5DOVA 1SHTX 5JO9A 1V7PC 1RIFA 4BX9A 2WJVA 2CXRA 4EHNA 4N5LA 4P0PB 1AA9A 4NE7A 3RLIA 3K0AB 3PJFA 1Z38A 4F3RA 4DDUA 5BNZA 4DCGA 3A6EA 1ZR4A 3G2QA 3BSFA 4AN1A 1QPZA 2VJQA 2DBZA 2WR8A 3OJFA 1RDFA 4LZJA 3NEYA 4UAUA 4MICA 4YCAA 3RFCA 5IVHA 1VDZA 3DYIA 4GOKA 1KY2A 3M4JA 4BEBA 5C32A 2ZRKA 4I9GA 3TBHA 2V4UA 4QUJA 1KYVA 2GPNA 3D02A 2FSUA 3SMQA 2WD7B 4HXFB 2CUTA 3DW3X 2FXVA 2YCLA 3F0TA 2Q6LA 4I6EA 2LKCA 2DU8A 1UCFA 3HYCA 3PZBA 1RM4A 3U48A 1ZUNB 1CQXA 1X15A 2Z30A 5AHWA 1X8LA 3ZQ6A 2FPOA 3WIOA 1C50A 1ENZA 2Z8ZA 3M9WA 3PL5A 4HQ6A 1UAGA 4S35A 4AIRA 2AVNA 1BCSB 1EUDA 2XB4A 4HB4A 4L2IB 2JI9A 2NU6B 2YQ4A 2XNKA 5CYFA 3VDRA 1W9MA 3DMYA 4OGWA 1TCAA 2VSYA 4OXKA 4B43A 3ZD7A 5FNZA 3LYAA 1OV6A 3AKDA 1QB8A 3PVZA 2V6IA 1XG5A 1UODA 3I2IA 4XDGA 2B3DA 1T8WA 2IEZA 1MJGM 2HRZA 2VXBA 4PAMA 4EI2A 4U2EA 1AMNA 3BGOS 1XDUA 3HA2A 5HKKD 4G0UA 5JS1A 2VNSA 3HR8A 2VBGA 4JBXA 2XMBA 1IAQA 2ZTUA 3JQ6A 1WABA 4NE9A 1V3VA 3INRA 4FBLA 4GX2A 2GZAA 3MMSA 3BB3A 2GASA 4N03A 2QX7A 3ZVKA 3IVXA 3L7NA 1BE6A 5A4IS 4HUQB 2E82A 3O4RA 5TDHA 3TFQA 1DQPA 4A91A 5JPCA 1W34A 4Y2RA 4NH0A 7MDHA 3K9FC 3SX2A 5JYCA 3AR8A 4YQZA 4W7SA 4B7CA 2I2AA 1ULAA 2OFWA 2KI5A 3UTDA 2ARKA 5KNDH 1DBVO 4YCNA 1K7CA 2W2KB 1Y8RB 2FSGA 1NVBA 1PV1A 3PQ5A 1SD5A 1M75A 3T15A 2GCOB 1Q2UA 1Q92A 2RGWA 3O1IC 3Q3JB 4TVBA 5EMJA 4M0LA 4AMYA 4BQPA 4CI9A 5IX8A 3PKIA 1QUFA 2KB0A 2D8AA 2IPXA 3F6BX 4U7JA 4HI0E 3NDBB 1T0PA 5KSZA 5CK5A 4MVJD 4V0MA 1ZVQA 1NF9A 1P0FA 3LUGA 3RHSA 5BR4A 2DFNA 4FZRA 4MQ6A 3AHGA 5D87A 2ZJ4A 2A4KA 5A0VA 2LVBA 1AY0A 1SKYE 3KKEA 1HDGO 1RKQA 4QGFA 1AB6A 3IP6A 2G06A 2F3PA 3ZWQA 1ZISA 1GFSA 3D3EA 3I52A 2EBUA 2VLBA 3JAKB 3GL9A 1PR3A 2BISA 3REFA 1FMJA 1GQOA 4QA9A 3PXEA 1VBFA 3QPAA 2XTMA 2NAPA 3HEAA 3J81A 4XEUA 2QJOA 4EECA 4HQOA 2X76A 3AZOA 2X42A 2H18A 1VL5A 1FJHA 4I3FA 1T3LA 2F17A 3LK6A 4RBNA 5LU9A 1GKLA 1GNTA 2IY8A 2MYUA 5AW1A 3E53A 3L5KA 4GOJA 3PQ4A 2C2YA 4W5OA 3D1JA 3DBHB 3IX7A 1D2RA 1I80A 1YBAA 3HA5A 1NY5A 1Y8CA 2X4IA 5B5SA 1M8KA 4Y3UA 4KQ9A 4R69A 2YDXA 3BRWD 1Y6RA 3AR2A 3B8EA 2HXSA 1BXKA 3GFVA 4K6KA 2BFFB 3CRQA 1J4AA 5I47A 3WRXA 1F38A 2XT9A 2BF7A 3RTBA 3UPTA 4OQEA 1UBGA 2VRCD 3ZWWA 2Y1FA 4LRYA 4MW0A 5LMZA 1RYZA 4N4AA 1FVOA 3AF6A 1ZOPA 3FSEA 3Q8MA 2QTZA 5HJ7A 2R8XA 2GLXA 4C3VA 4Y2YA 2ZXEA 4ZEWA 2ZWOA 2IYWA 3U7HB 3FKSD 4ML3A 2X19A 7MHTA 3H11B 9ABPA 1PLKA 5AKZA 1DEAA 1VBNA 4A8JB 3OLXA 4JI3B 5IWAB 4QTUB 4FI3F 1BD3A 4YECA 4PM4A 3RASA 4YH1A 1P39A 2O2IA 1KI6A 2IYTA 1FJGB 1SCBA 4O4LB 3VAAA 4R71A 5FOUA 1NONA 2IC5A 1C7QA 3MTBA 5CURA 1R5OA 3TRIA 3ADPA 4PZCA 4DQKA 3FOZA 2VSQA 3W5IA 1XKTA 4EZBA 3IAM6 2JGKA 1SVIA 4XVRA 2HT6A 1NBHA 2BCGY 2CXSA 3GQBA 2JDIA 1Q19A 5AKEA 4LFCB 1FSGA 2ZGVA 3BWVA 3OUUA 4KWTA 3RBVA 4FX2A 4L4YA 5BUSA 2NPOA 4KG7A 4FBMA 3E48A 1CUJA 3X1DA 5ALOA 3ZV3A 2PRJA 3PYLA 2QLMA 1MDBA 1EX7A 3K6JA 3NHYA 3QWBA 4RZ2A 2BDEA 4FYPA 5BNFA 4IIDA 1UK8A 2H4HA 2P9GA 3RSCA 3WL8A 5CB4F 1EIZA 3ABZA 3LYUA 4HZUB 3MUEA 4MRRA 4NCBA 1QHHA 1SURA 3CUSA 2VHTA 4TN1A 1DG9A 4UTZA 3TKYA 3SM9A 1RABA 5AJWA 3REQA 3PGA1 3I39X 3IQXA 2WA2A 4B76A 4D4LA 1JDBC 4BVAA 1NGSA 5KJCA 3FRIA 3ZBQA 3AC0A 1RFGE 5KJEA 1CUAA 4RHEA 5ALVA 1T0BA 4WOJA 3MGGA 1RE1A 4D3SA 1ZC4A 2BVNA 3DVAA 1JU4A 1DO8A 2EAUA 1HL7A 1LXCA 4R16A 5JNVA 4YCCA 4KYTA 2HO4A 2AZMA 2UUPA 1KJZA 2G0AA 3CZMA 4PXYA 5ECYA 5IJ0B 3GPLA 1PDWA 3GDFA 1P7CA 2FRXA 2DUMA 5JZOA 1ZHFA 4FJ0A 2VEOA 2EEZA 1RI4A 4WGGA 4FGZA 1KAQA 5LB2A 1RRMA 2B30A 4GZ5A 2CDAA 1IK6A 2RHRA 3D6MA 2I6QA 2RHCA 3QPUA 4G0ZA 5J47A 1JQBA 4W5RA 5KVAA 1YI0A 3M70A 4L5IA 4KPEC 4A82A 5IXJA 4KXQA 3U7IA 4E3WA 3EXEA 4QGAA 5JALA 2VTBA 4GMKA 1DZ3A 1JIUA 3F5MA 1JR6A 3ZJTA 4Q4JA 3UENA 2R7NA 4ZCRA 1JLKA 1WW8A 4TWIA 2PNJA 5SYNA 1F8FA 3RHTA 3U56A 2MTBA 2UYHA 4LYAA 4W9NC 4L8FA 4QUAA 3O7MA 4BIIA 3GWZA 1UOPA 2AJ8A 3NPAA 2WKQA 4R1MA 1P1CA 1AE1A 2C97A 2G1JA 4TVOA 5C1OA 1UWCA 4H3HB 2ZIFA 1ZLXA 5J5AA 2VDNB 2IE0A 1R4MB 2QQ0A 2XVAA 4REMA 5ADWA 1O95A 2X0RA 3AVUA 4IO1A 3HL0A 2F1HA 2H5EA 1QHIA 2QBYB 1N2XA 3RK0A 2ZP1A 3DYVA 4PG5A 1NI4B 2JC3A 2KM1A 1QYRA 4PGMA 2C57A 2ECQA 3BGDA 3BMCA 4L7VA 4PZYA 3S81A 4DA8A 1H8EA 3DTNA 3ZK7A 3E9ZA 1R6VA 5E6RB 1YHZA 2VQDA 4DLWA 3P9XA 4Z4HA 2MR5A 2YJZA 1SVSA 4L8LA 4NP6A 2IIVA 3FHTA 2OHFA 3CF6R 5LXTB 4J43A 3C5CA 1CIVA 3OLWA 3S0JA 1RVDA 2O9JA 3ZGZA 1JKJB 4R3NA 1JDVA 5T7BA 2IKQA 5CVVA 4QYMA 5DLDA 2BMDA 5FA6A 2H7VA 2PUHA 4C08A 1ZUD1 3UMJA 3BXFA 2FEAA 2ZB2A 3JAWB 3H8VA 3PNYA 4RQUA 3UN1A 2TRSB 4KO1S 5HQ3B 2QYSA 1I4TD 5IFLA 2WOJA 3IC5A 5IP5A 1ONNA 4DMLA 1RIIA 1X9GA 3PQ8A 4NCHA 3K1ZA 4LJ7A 3OTIA 1RHKA 2WIGA 4GHWA 1ZCAA 1MV8A 1GTJ1 2AEMA 1WHTA 4YV7A 3IAAA 1R88A 5CCDA 1LPSA 2XR1A 4GH5A 2IGTA 4NMMA 2K5UA 2JA1A 5H81A 1T25A 5KWSA 4DV6B 2BM1A 3QW4B 1YTUA 2GAAA 1XRSB 1SUIA 4GDMA 5LP6F 4HADA 2LV8A 2XDAA 2ETVA 5BOVA 4EI7A 1DRUA 1VHTA 4BN5A 2HT1A 3EA0A 7REQB 2YWRA 1Z83A 1SIWA 3OFND 1XRLA 1QYXA 4LDPA 5GZ1A 1C3OA 5F1KA 3DUWA 2C7PA 1DQZA 4NX2A 3AFOA 2DHDA 1AKTA 3IERA 2TMGA 3ITEA 4JOBA 1R5NA 1W36D 1CKEA 5FRDA 4DR6B 2PUFA 3V97A 2PA3A 3C87A 5EZSA 4CF3A 4EKIA 1EBUA 5JAOA 1EK6A 2VP9A 1ECCA 1UFOA 2FR8C 1I2CA 2I7DA 2IXGA 1ZI6A 2XEDA 5H5JA 1U6IA 3PD1A 2IBSA 2PMEA 3E0XA 2V98A 3B60A 5F3WB 4JNKA 1CE8B 4DZTA 4ZT7A 1JLSA 3H17A 4IWNA 2BHNA 1RC0A 1NBIA 1LVUA 3IP7A 4DR4B 4JR2A 3TGPA 1VKHA 2ID7A 1K0UA 2D1RA 1NI5A 2R00A 3ZZ0A 2PK3A 3PXXA 3DCNA 5EE3A 3T9BA 2LRHA 5K6RA 1KFEB 3C43A 3GA0A 2PUAA 2WFAA 3ZKWB 2R4QA 4UDNA 2J1LA 3VHXB 4B3JA 2K2WA 2Y05A 4JBYA 4OJKA 5BURA 2DECA 3TR5A 2RMKA 4WOBA 1P0MA 4EOGA 5L3QA 3FDZA 1J8YF 3PD0A 4MIOA 4G0YA 5B3KA 1VI2A 3GLIB 2N47A 1BTOA 2UXBB 4G1VA 1VSBA 5AKKA 2YZ7A 3G7SA 1S4MA 1SXJC 5K0EA 5T64A 1Y89A 1E5DA 2Q0XA 2R8ZA 2H65A 2PJDA 5I9TA 3VVCA 1ABEA 4GLJA 4ZAZA 5K4AA 1W2WB 2PQMA 3ZI7A 3KK0A 2J3JA 3KOXA 1BOFA 2BFWA 3IB3A 3B1ZA 3I37X 1E7MA 2Z5LA 1NJ8A 1YB5A 2FSVC 2VNAA 3ILVA 2LCIA 4UAGA 3WDMA 4BV2A 4F5ZA 2XUAA 4FR2A 2XJ9A 3AL3A 5K7SA 2F43B 4A15A 1ANKA 3IHTA 3DG9A 3GJXC 3P52A 4N8SA 5EYPB 1O57A 2FUG6 2CVZA 4EARA 3WK8A 4DAOA 3U9LA 4HH0A 3E84A 3FA2A 4ZTBA 4CMIB 3R7SA 1U7UA 1W76A 1M2JA 4KYUA 1SBYA 1AKMA 1R3UA 3L5OA 4FOLA 3EXAA 3IDSA 3RS3A 4GX0A 1DUIA 5LOVF 1WUIS 3BIWA 3M6IA 1TKCA 1P0QA 2HBQA 1K2VN 5D3KA 4C04A 1Y4AE 3SZRA 1VHDA 4TROA 4KPFC 1ZI9A 2H5IA 3SLRA 2XQVA 1CY2A 3SVLA 2JG3A 1GYRA 1HDYA 9ATCA 3U19A 1CUDA 3OO0A 5C9ZA 3UOWA 3UWPA 2WHPA 2BC9A 2L2QA 2WUDA 3LC1O 4LZAA 4DHEA 3A3KA 5DX1A 2CGEA 5TGTA 3RHFA 3CPEA 5EN4A 5A5VA 3WNBA 2BGGA 2X13A 1I2MA 3NT2A 3HJCA 3QVOA 2XSZD 4ZO8A 3ZS9A 3IKVA 2XMGA 1DJQA 4J1NA 4EY7A 3B9QA 3ECAA 4KH1A 4PIVA 1P2GA 1BZYA 1HT1E 5AW9A 2QRMA 1ZY2A 5M5BA 5LDHA 2NU9A 2V74B 5L7YA 2FFAA 3ZXXA 2GWRA 2QTCA 4YJ3A 4Y1EA 3MGKA 1JN0A 3QBVA 4UHFA 4B6OA 5F77A 2VYCA 4ZZ0A 1OX4A 3KSZO 2C83A 3KQKA 4OFBA 2AZXA 3O94A 1DC4A 4L15A 1C7EA 2O50A 2DULA 1YQWA 4MQEB 2RGEA 1F2UA 1NUAA 2BMVA 2ZUBA 3U1TA 4DQVA 5B7PA 1P17A 4EG4A 1ISSA 2XODA 1R18A 3D3WB 3DDUA 1Y8ZA 2YS7A 2B35A 2LTAA 4FFVA 3E61A 4OATA 1DTWA 1I0IA 1GVNB 1Q0SA 1V3UA 1VYUA 3CJRA 1JLRA 1N2EA 1NIPA 1X7ZB 2Y0CA 4M0DA 4NCAA 3GFPA 4Y6PA 1L8OA 5EEGA 2AXEA 1G8HA 3MWYW 4I14A 3WX0A 1Z2OX 1RC8A 4O6VA 2RC6A 1V96A 4DLUA 5JG7A 3VYWA 2ZI3A 1CUIA 1MC8A 1QVZA 2Q27A 1PL0A 2UZ1B 4XH9B 1DKNA 3D7SA 4MA4A 4IFEA 2BFCB 4C1NA 3EZGA 2XBMA 4QPCA 2J5RA 2B83A 1WCYA 4D3FA 2OV4A 2Q1SA 3I0ZA 4EY6A 1PF7E 1FDIA 1UC4B 3GEIA 3DAOA 2JH9A 5F7JA 3I9V6 1WXFA 2BKVA 3EN0A 3LNTA 4RFSA 1RS0A 1XCLA 3CH5A 4URHA 3P45A 3SHWA 3T7JA 1AF4A 2LXNA 1SIUA 3U4GA 5I7EA 3HFSA 1PR2A 4LZPA 3THWA 4KAAA 3UW1A 2QE7A 5IBPA 1L5KA 421PA 3EZLA 1KYIA 3OF3A 4S12A 4ARAA 5F98A 2JGDB 3QK7A 1Q2XA 5AOAA 4YRAA 5BSGA 2YWCA 1G64A 5LMCA 1BFDA 1S3IA 1KXJA 4LDNA 1M6HA 4R0MA 3IB6A 4L8WB 3GD5A 4KR0A 3Q5DA 1PR5A 4O2BA 2HLHA 2YJNA 2LUOA 4FQ7A 5ALSA 4PVCA 4Q6BA 2L0XA 4H3SA 1CNFA 4RD1A 5JSUA 5DASA 5JY6A 2D0OB 5U4XA 4ZWNA 1L8XA 4MRNA 1MFZA 4Q16A 4XPIB 1EYZA 2JAUA 4Y2SA 3WYFA 3HYTA 3SZMA 2PGIA 3DQQA 4TQGA 4X0EA 3D6TB 1FLNA 2H1VA 2P4EA 4P7FA 3R3WA 2R3SA 4DC9A 2C1ZA 1HGXA 5KTYA 4GKKB 1YWGO 3DAHA 1ZGZA 4FINA 1G3UA 2WG0A 1I30A 2VWGA 1IOZA 3B6ZA 1V41E 4D3YA 3L8MA 4NJEA 4R1QA 4ENUA 4RPHA 4ZYTA 2CFOA 1BVHA 3HVHA 3INGA 3PNMA 1EM6A 1KEKA 1SZPA 1ZGAA 2ES4A 2Z5GA 4LZOA 1KNQA 4NBRA 3AR3A 4IKPA 2CLKB 3R0VA 1O96A 4N5DA 2CBXA 3OC0A 4X45A 3RNLA 3WLOA 4AD8A 4LI3X 1EE9A 3KSUA 1JLLB 1ZCZA 2CN1A 1KVSA 3LCJA 1JJAA 4WLEA 2IHVA 1ND6A 1PWHA 3G8BA 3SHTA 3GNLA 2DWOA 1NVVR 3C8ZA 3R3XA 1VPVA 2PWBA 5I9SA 2AN3A 4L1KA 1IBMB 2QVYX 3EQ8A 1J0AA 1WUTA 2WJIA 2BFNA 2EG5A 1E77A 3BQNB 3WWPA 1NQVA 5BVHA 1NBME 4HPWA 5GJWC 2GDJA 2JK0A 2Y9MB 1G5PA 1RI3A 3C3EA 3E3AA 4NNPA 3COJA 2P90A 1JW9B 1C1YA 3C14C 2MSLA 4KVZA 4R1TA 1AGRA 1JUDA 1YDEA 3BKWA 3GRKA 1G20A 3PUHA 1SCIA 5TQVA 2KQUA 3CE9A 1TMGE 3F98A 5F78A 4V0QA 4LY3A 4ZKDA 1G6OA 1YB6A 3RKRA 1JFFB 3UMRA 2UXDB 4CMAA 4MKFA 4X1IB 4ZVRA 2I78A 1C7RA 1GTRA 1JFVA 4B4OA 1C3JA 2B1RA 4F4CA 4N7RA 2O19A 4ZYLA 3WYNA 3QHPA 3LGXA 4JLBA 1M1YB 1RXEA 1XZGA 3I6YA 4RY2A 4FFRA 4W9MC 4H35A 1XA3A 1E7RA 2QTBA 4KIUA 4KZPA 4QDKA 3WAKA 1DMSA 5KMGB 2HEGA 4UUQA 4ZREA 3WJ1A 2HF2A 2HMTA 4Q7JB 4Y2VA 4AP5A 2PS0A 5I7FA 2O8EB 1Q91A 1OJLA 1RQRA 2FA9A 2IYFA 2QX6A 4UCWA 3ZU2A 4AJOA 1OH8A 2HMAA 4GR4A 3MRTA 2YXDA 2RAUA 3MMPA 1W93A 2CDNA 4R9UC 5BQPA 3RYTC 3V8MA 2OK8A 3G8DA 5SZIA 4K6OA 3EUEA 4B6PA 3PHGA 2J33A 1XELA 4PPNA 5JHHB 4KV7A 3M6FA 1GQSA 2D1FA 3W8NA 1KDYA 5C8VA 1YJAA 4RTOA 1DUSA 3JQAA 4JENA 2F67A 5DM60 3WMRA 2QTNA 1IUOA 1E3WB 3HVIA 2AMYA 4QEZA 2QN2A 2D7DA 3QNMA 1UK9A 3PIRA 4INOA 2Z2JA 1T2CA 4CEHA 1UXHA 1L7QA 3R40A 1YS4A 1KR2A 3BWEA 4GWLA 2DFKB 4QOIA 4LOHA 2B78A 5DU2A 1PFYA 4GG1A 4WZ6A 4D6PA 2IXAA 2DWCA 4ZAYA 3RO7A 4RD4A 1MDFA 3RU2A 3U7FB 1YS1X 5EFZA 3TOVA 5K8CA 2Q0HA 3IMEA 5EP1A 3WTCA 1Y1PA 2GVZC 4RLQA 1L1RA 3ZG6A 4CM4A 2FEWB 4YPFA 1NP6A 2JAPA 1IVYA 3ON5A 4YEDA 4ZRDA 3ZE1B 4FYHA 4HY3A 1GNPA 1E8DA 1LLQA 1PD1A 2UKDA 3DF9A 4WUVA 3VC2A 1NMQA 2HA5A 1IXRC 2XB9A 3LKVA 3MQ4A 3OA2A 3DLBA 1LEHA 3U3ZA 1MRSA 1B4DA 5TEWA 2Q8PA 2Q1YA 3H2SA 1P2FA 2J09A 1JIIA 1RADA 4L7QA 4DCNA 4JD5A 4P4SB 1FX0B 1D09A 4XJXA 3A4MA 1BKSB 2VPPA 5F33A 4C0HA 5A1JA 4JHLA 3VV3A 4M99A 2UUCB 1AKRA 1LC0A 1N2CA 3TW8A 5JADA 1ST2A 5DX0A 5LKAA 4G8CA 4UPVA 4G8JA 4O25A 1R0BA 1M7GA 2CYCA 1VG9B 2Z9CA 1T3TA 5ALDA 2HHLA 2O8CA 4YJ2A 1CY1A 2Q29A 1HLFA 1TM4E 2JJ1D 4CIVA 1F06A 4HXYA 2PT9A 3AM4A 2ANBA 2HK9A 3A6GA 4HX5A 1IN5A 1FFYA 1ZRMA 4CG3A 4BATA 3AXTA 2G7ZA 1S8AA 4AG6A 1UXOA 2L69A 3Q5GA 2F00A 2KJQA 5DCLA 3F71A 1FNNA 1FYXA 1LF0A 3JYQA 5T8KA 1G42A 3BCRA 5FBZA 1Z75A 5CP8A 1BXRB 3VBEA 3LC2O 3VRHA 1NKTA 5LC1A 5THKA 3SX0A 1NV8A 3WB9A 3PC8A 4AWAA 3I30X 3L2OB 3DT8A 1V1MA 2Z04A 3H9GA 2QQ5A 4ITUA 4WK4B 3IDAA 5BQ5A 3UAXA 1BW9B 1Z12A 2RC5A 5DIZA 3TUZC 1P75A 3QOXA 3TSOA 4XQGA 5EWMB 3D0RA 3K9NA 1CQPA 1P5FA 1C30B 2PSEA 4BTVA 1M83A 4DMGA 2C5BA 2JFHA 4O4JF 4PVDA 4N0DA 3CZ4A 2UZIR 4HMQA 2HC9A 4JYBA 4R9SA 4O4IB 1POWA 3DM5A 2BR3A 4JQZA 5F4BA 5K0GA 4EBFA 2XXAA 2BEWB 4LSZA 1LC3A 3ND8A 1E0AA 3S3TA 3CEJA 3KYJB 2OL4A 3WHLA 1I32A 4AWXA 5JSKA 4PYOA 5DNYB 3JWJA 5TF4A 1G59A 3SXJA 1A5TA 3ZGXA 2R65A 1TA4A 1A9TA 1P80A 2GAJA 3ETDA 4B2YA 2O3SA 3RK1A 2P30A 4KRYA 5HTKA 3MIZA 1RBQA 4TTSA 2GPJA 4WASA 2O8BB 4YRGA 1MABB 1ULBA 1OBFO 3RIEA 2IH2A 3SF8B 2VJMA 2B4YA 3LZDA 4DIOA 1Z74A 5BSHA 4ENQA 5H1YA 1TDJA 3GLRA 1EXMA 4XB6B 3T5BA 2DR2A 1TC1A 3KHSA 4TVSA 3PFCA 4AO8A 4FKMA 4OF4A 4Q3KA 4P5EA 5KC8A 5KBYA 1JH9A 3GB9A 3RV3A 4TSFA 1OXUA 3CJTA 5LP6C 5H68A 4GXTA 1Z62A 3W5BA 2CFRA 3FCXA 1PTJC 2XLCA 5DF1A 3IJRA 4ZHQF 4NSNA 2E89A 2IYPA 1VI5A 2CJPA 2C54A 4AWBA 2QMHA 4R8MA 4RSMA 4WHMA 3DE4X 5DW3A 1L4MA 4ZC8A 4IX1A 2H4JA 1IIBA 4YAJA 1YVEI 1A97A 4RJIA 4GWGA 1MOQA 5B6JA 2J3IA 1SCJA 4NS4A 4WACA 1ZCBA 3KBBA 2W6JA 4BNMA 1CR4A 4YXWA 1CUVA 4C4OA 3ZK9A 3DLIA 1TVCA 2OAQ1 4RH0A 3L8YA 2E9SA 4TL8A 4LYDA 4KC0A 2ZBEA 2F48A 4C03A 1HQCA 3AKZA 4EMTA 1HFWA 2GJKA 2HA3A 3B6IA 3OOEA 4IV5A 2V6GA 2BGKA 4E5KA 4M7RA 4D45A 3QA3E 1CUFA 4IIEA 1MOSA 1E6MA 2X4DA 3MJFA 1BX0A 4R05A 3TLEA 4B47A 3QKUA 2FEMA 1U8UA 1RJ9B 3UG6A 2H3HA 1U4SA 2OCAA 2C3OA 1W88A 4KR3A 3BGVA 1EE1A 5LDGA 3NJRA 3W3AD 1DTSA 1QZUA 3AQ4A 3PJDA 1L4NA 5FWAA 3P0FA 4A8HA 3H2HA 2V0NA 4W7HA 5E7QA 3AMVA 1EQUA 2O2DA 3IAEA 4KWHA 4NVRA 4RNDB 3RTAA 4U7HA 5IC5A 3DA8A 4CLEA 4TT3A 2NIPA 3C3MA 3CR3C 1I4EB 2PGXA 2QXTA 4JL6A 1YAJA 4C6TB 5IARA 1Q12A 1LJUA 3TLAA 3TH5A 2OHOA 3FB1A 4EW2A 1G21B 4UU0A 3E9CA 5J43A 4Z1MA 2B1QA 4RSRA 1PYGA 1MUUA 4QJ5A 4BNFA 3AJDA 1UXIA 5C8XA 1JU9A 3HJTA 4YT5A 1BKYA 3K5HA 2Q45A 1PJ8A 1QH8B 3ZIAA 4WKGA 3K2QA 4MXDA 2G04A 5TVKA 1KSHA 3S1SA 4MHTA 1AZSC 1HKHA 3RDPA 1A7UA 4FHDA 3ANMA 3H6KA 2XUFA 3D81A 3I01A 3MNFA 3RS2A 4AZSA 2Z6QA 3ICQB 2FV8A 1AKWA 2DUWA 3JWIA 3DBRA 4MP8A 4D3ZA 1IONA 4DA9A 4KX3A 3GJ6A 3VU3A 4ALJA 2KBFA 4GIBA 2J7PD 3EB9A 1UZAA 1RXIA 3DDSA 3GEDA 1L3CA 1CQJB 2ZDGA 1L7RA 1N2IA 3V55A 1M2VB 3U3XA 4EB3A 1JHRA 3CVWA 4NZOA 2VN8A 3BICA 3O1HB 2G9ZA 3PS9A 2GS9A 3TF5A 5B1DA 4MA0A 2P4SA 2ZPTX 3WGHA 1N0IA 5CIYA 4GE0A 1S2IA 1MP0A 3OT1B 2VRWA 4K6CA 4M0FA 2FQ1A 4AURA 2CHVA 4R41A 5GJVC 4D41A 4EF4A 5K09A 4EKYA 1E3LA 1V8FA 2WF7A 3PUWA 2MCFA 5KHOC 3UAVA 4AS3A 3CWQA 4KVGA 2AC7A 4MJ7A 4PQRA 1DJMA 2C2GA 1XRMA 3EG9B 3C6ZA 3LG2A 2NO9A 3RYFA 3C70A 5ICGA 1QFZA 4YJ3F 4UZSA 5E6SB 5LPNA 2PL5A 4LXTA 4TKUB 2PEYA 1YZGA 4RFLA 3OKCA 1M6EX 4LHXA 1Q1NA 4B87A 4WNCA 3HYLA 4IIJB 2BE7A 2CNWA 2FZGA 3F49S 1TIBA 3BHJA 5TRTA 5SYAA 3EXIB 4L22A 1BHO1 4IDEA 1BMDA 4PCVA 4XWYA 4AUEA 2FQWA 1B1CA 2VHXA 3I32A 3PHLA 1UJ6A 2EG9A 2BW0A 3R5FA 3LUFA 1IEWA 2NXWA 2XCUA 4GQIA 1KEEA 2O0LA 2BBWA 2WP8J 1LPAB 2XRFA 3OMLA 2HFJA 3MINA 2I91A 1O5IA 1FP1D 2WAMA 3UT5A 1P2VA 2YZGA 2OCPA 3O2NA 3LZ6A 1DWPA 1S3GA 3ZWVA 4YO7A 4XFKA 1SKMA 5JXGA 1AUOA 4TMZA 1PWEA 2GPSA 5LQKA 1ULTA 2ZSIA 4PLGA 4OA8A 1SG6A 1F8YA 2XUHA 1NW5A 2JFNA 3L84A 5ADUS 2QOEA 2Z4RA 2DT8A 3GYBA 2W6ZA 1FSSA 2NVUB 4JIMA 4F06A 3JPWA 3K09C 3L18A 3OX3A 4XCVA 5D1NA 3SYKA 3K4QA 3TVYA 4CIDA 1TADA 3FIUA 3UJAA 3ISVA 4GM0A 4Q37A 2JFYA 1P5RA 4ZDIA 1OFTA 4AMGA 3DONA 1NTOA 3K0HA 1YK1A 5JTUA 2CXUA 4BCDA 3ZDBA 3R5TA 1F9EA 1W7AA 5I3ZA 1OI4A 5HJEA 5JXJA 1UDRA 3LY9A 4L0DA 5AVTA 5ELMA 4DQLA 3GGCA 3RF6A 3HA7A 4BNNA 2VCYA 1H2EA 4JYZA 1XMIA 3GEEA 2GN8A 3B5IA 2PHZA 3BJZA 1XVVA 3LUCA 3L7BA 3H5AA 1EB9A 1YE5A 3D6AA 3NOVA 3STTA 4O2BF 3VU8A 4HLNA 1O9BA 3TSZA 3AR9A 3R7LA 3RVDA 5GIOE 3TSYA 1PL7A 1FSPA 1SQFA 1VC2A 4MLDA 3RC2A 4HB3A 2C20A 1DI0A 2Z8YA 3LBIA 1WU8A 1TJ4A 2NGRA 3ODPA 1E9SA 5GADl 3QVTA 2IHTA 3KTAA 1G5TA 4JB3A 4JBHA 4Y6RA 2OHGA 4U7WA 3VO8A 1JWLA 1AF7A 2P2SA 1XJCA 3TPFA 4II2A 4NYMQ 4DIFA 5IT0A 4H7IA 3H5IA 2CLCX 4LWQA 1KZGB 5HZMA 2Y1XA 1Q95A 2FZKA 1U7DA 1AHHA 2OOSA 3BIXA 3JASB 1X14A 2CZCA 1TQ6A 2AEEA 3IUJA 1YVRA 3P2IA 4EHKA 1T2DA 3HACA 4YMUA 5FLXA 5BN4A 4KVFA 4TKVA 3CTPA 1TUEA 1KI9A 4K9OA 1L9XA 5EUCA 3KQMA 5KNCH 4P4UA 3MJRA 2DLDA 1QYVA 3RTCA 3BZUA 3QY0A 3DP9A 2XWSA 3AEUB 4H7FA 3QX9A 3BXPA 1H3FA 2BYTA 3V7YA 1YZQA 5JD3A 3WKEA 4HZIA 1I5OA 1LS1A 2QL7A 2RONA 2LIPA 1PZHA 3KNZA 1DXQA 4FFMA 1QRDA 4ZJUA 4LVUA 4AM8A 1M1XB 2GTPA 4LE1A 2EDCA 1US8A 1ZIDA 4IDQA 4ARSA 2PYDA 5TMDA 2KBEA 1E2IA 1FVFA 3LYHA 5JTTA 1V9SA 3LQ1A 4Q48A 3PUJA 2W2XA 3D4NA 4QL3A 1TVKA 5KTSA 2IS2A 2QGZA 4EUKA 2ZYTX 4GUAA 4G63A 1JAXA 3SFZA 3QKIA 3WLHA 2ZSUA 3E5NA 2AG5A 1QQ6A 3GFFA 3LC0A 2A0UA 2BEJA 1U2SA 1TKAA 2D4HA 3IBFA 1FEZA 3JU3A 1NW3A 3W78A 4BLUA 1M0TA 5C8DA 5CD1A 4QDUA 1I6LA 1A95A 7ADHA 2B3TA 4NJMB 2B1GA 1Y7HA 3BIOA 3GMSA 4AQYB 4PSDA 3K0FA 4B4KA 1GRRA 2BI8A 4GOOD 4P3PA 4DWOA 2CLIB 3NGXA 3ZDYB 3T54A 3TXAA 3FSGA 1B6GA 4TYMA 3A4YA 2IYVA 3L77A 4J16C 1H4TA 1ZLYA 4KQ6A 3HADA 3T38A 1SKYB 2O2EA 2PX2A 3KYCB 3PX3A 4C0AC 3SNKA 1MLDA 2D5BA 3Q5EA 4GM4A 4FN5A 1KKLA 2C78A 2UYQA 3W34A 5BSEA 5FL7A 4CNQA 4NZZA 3H1PA 3A9VA 4FEEA 1EFLA 1GGMA 3LWDA 1FTSA 4CKXA 3PHIA 2OYSA 2P5YA 2ZCUA 3G9TA 1AHIA 3IOYA 3ZCUA 4DMFA 3L79A 3H9CA 1QORA 4IJ6A 3WSVA 1VOTA 4P08A 1CQIA 3V00A 2WQZA 1VG8A 4NEQA 3KFLA 1VZ3A 1QPGA 3WDSA 4TKLA 4JL8A 1GZ6A 1U0JA 1P2UA 2JLCA 4QPZA 5ABPA 4R98A 1M1UA 4I08A 5A05A 5AVSA 3RFXA 5LMUB 3V4SA 3ZHSA 5I4KA 2PXAA 4EKNB 3QRWA 4YR9A 2J4FA 1DWUA 3F90A 3EUAA 4L0MA 3AYZB 1R1DA 3VR4A 1FU8A 4FWTA 2ZAMA 3O31A 1FDSA 4AP9A 4V03A 4ZCIA 3IBGA 4CM5A 4RWEA 1L5NA 2CLEB 5K0FA 2W48A 1H66A 1JT9A 1UBSB 2BP7A 2GYVA 4FQ8A 4EYOA 1L7MA 1PJAA 3A6FA 4JLOA 5I5GA 3W8FA 4HAIA 4BGIA 2AKYA 3PRYA 1Z4KA 4CL2A 3VYSB 4BLRA 4CN8A 2PQ0A 3L04A 1FUEA 2I80A 1N33B 1FE8A 4JFAA 4JXXA 1MT3A 1N5MA 1YQUA 3C5VA 3H4MA 1T1EA 3KE8A 4L95C 1E9DA 5IAEA 4CMJA 1KWKA 4TTQA 1OLSB 1QR6A 2DTXA 4KO2S 1TT5B 3I5AA 4MUIA 5HKOA 3ZH2A 1N7JA 1ZX1A 4UMEA 4UXIA 1TCUA 2IIBA 1HC7A 2QMOA 3DEKA 4XSHA 4YWHA 1QQ7A 2ZW9A 4DUZB 4OGFA 4YJ2F 3M82A 3RBZA 4LHYA 4LISA 3ENQA 1J8FA 5E9QA 4DHWA 3BCHA 5A7FA 2FWBA 3N2NA 2CJWA 5K3OA 3EDCA 5KKNB 3NAZA 4G1UC 2QPTA 3RUFA 2YQ5A 1FUYB 4WN3A 2IK8A 2PD3A 4HVAA 2WPDA 5TY0A 1Z07A 4HAXA 1ICIA 4Z4QA 4YNBA 4BBZA 4DIKA 2WZDA 1WSAA 1KK2A 1SXJB 1JH8A 4FFOA 3GJ0A 1NBMD 3SVZA 1FP4A 1ZITA 2CDRA 1U65A 3DDOA 3HN2A 3PPXA 4Z7JA 4Q93A 3ST7A 5H83A 5I9IA 2P6OA 5JXWA 1P1JA 2FSPA 4JJ6A 3IXQA 4BJ5A 1E3EA 4HYYA 3WK7A 1K5GA 2O8FB 2HJVA 3AEKA 1JJFA 3CBGA 4ZANA 4G3XA 1NW9B 3CKLA 4ZU6X 3L40A 3RJMA 5H82A 1KMNA 2JCSA 3KJIA 1KJ8A 4ND4A 4R6WA 1LCIA 3KXKA 4R31A 3O4GA 3ILHA 3TQSA 3HE3A 3JQGA 5FQNA 1GPH1 4CV1A 4H4EA 4HYQA 2GFQA 2AN5A 1J06A 3QPDA 4A0RA 4KODA 4IKEA 3K7EA 3MAAC 3ZDXB 4KSBA 5JLJA 3SFTA 1IOVA 3HDJA 3LMKA 4J3JA 3SICE 1TKRA 2ODEA 4M8LA 1Z3CA 2QAJA 4IYRA 1XZIA 1FDWA 2RGNA 2V96A 5G0SA 2D3WA 3D2CA 4R51A 1VSTA 3LLUA 4RF4A 4RTLA 2IYNA