2ZI6A

C4s dck variant of dck in complex with d-da+udp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
241
structure length
217
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Deoxycytidine kinase
publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 217
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi6A00
2R44A 4WAUA 1Q22A 1E0JA 3HJNA 4MUAA 1CRQA 1F48A 4X8MA 5EXTA 2FMXA 5AWFC 4W5WA 1G3MA 2F1JA 4JYBA 4LJ7A 4EFNA 1Q21A 1OHHD 2C99A 4QG7A 3P32A 1OT3A 4WZ6A 2ZANA 5DNYB 2EYQA 2QE7D 4LSGA 2IWHA 2ONJA 3P20A 4PAMA 4QHSA 1US8B 4RD0A 1ZUHA 3DL0A 4PQYA 5CLLA 1GL7A 4NCJA 4PC7A 3AP3A 4IW3B 1Z07A 4L15A 1KZ7B 1JNYA 3KB1A 1OB2A 3VNVA 2YZ2A 3R7WA 2ZRKA 1S9HA 2IYVA 4PAOA 2GXSA 5FBWB 3T12A 5FL7D 2E87A 2IUTA 3KTAB 5H70A 1RKBA 3VAAA 5DN6D 1DBSA 2F3TA 2ZEJA 3JVVA 1N0WA 4R2HA 3VHXA 2IC5A 1CJKC 2GESA 4GRAA 2J41A 4DSOA 2XB4A 2CL6X 4CGZA 2G83A 1JB1A 5J4KA 5FI0B 1R8SA 3R8CA 4D4LA 4E09A 2W2TA 2OCAA 3TW4A 2EYUA 5L3QA 5LD2C 5FOSA 4FMDB 3AVOA 4LBYA 4DC9A 3X1WA 3BOSA 5C2JB 3KJGA 3DDCA 3EIQA 3KKOA 1JR3D 1QRAA 4JBYA 1N5KA 4WXRA 2FFQA 5BQ5A 2KJQA 1R8QA 1KAGA 1Q3TA 1KI8A 3MCAA 4TQAA 3RSOA 3EZFA 3C41J 2C77A 1EFRD 2JASA 4BLSA 1P2UA 4YMWA 3CX7A 5IK2A 2WOOA 4RZ3A 1CRPA 1RC8A 2FFBA 3DM5A 4TT3D 2REBA 3IPXA 5HR5A 1VKJA 1KSHA 1W2GA 3Q3JB 3RS0A 4B34A 4FMDF 1MOZA 4DEXA 2G1JA 2WKRA 3EXAA 4Z51A 3EZ9A 2O8DB 4Q1DA 2OT3B 3UXMA 4K46A 1ZU4A 3W3ZB 1IJFA 1P2SA 1QZXA 1Q1BA 5C18A 5JJIA 4UNNA 1FNMA 2X77A 2LKDA 3U7HB 4CW7A 2OCYC 3A1SA 4QXAA 3OEED 1W0KA 2XGJA 1IN8A 2ZPTX 2QN6A 4IKEA 1MRNA 3ZS8A 4YLGA 3B7GA 4AG6A 1AIPA 3SYNA 5D3QA 1UBEA 1NMYA 1R5OA 4ON9A 5EE9A 1H8HA 3TQCA 3MG9A 3UK6A 3N5CA 1SVKA 2JDIA 1F2UB 2RGNC 1L8QA 3OEHA 4RSGA 3KQKA 1XEWY 2J45A 1W47A 1JJVA 2P2LA 1R0YA 3Q72A 4N3NA 4JBXA 3U3RA 1N6IA 3A4NA 3E5HA 4TYQA 4GL2A 4DSNA 4KVGA 4WIAA 4AKGA 1R7RA 1CJUC 3KQNA 1KY3A 1I4TD 3TR5A 1G3RA 1VG0B 1CS4C 2GK7A 5JWRA 2AKAB 2W00A 2BMDA 3LA6A 1JR3E 1E3MA 4IEIA 1NVVR 5FL3A 4MDEA 1NBMD 1WMSA 5LB2A 1A1VA 3TSWA 1OXXK 1KJYA 2P5TB 3LW7A 4CDGA 1TAGA 2H16A 1UEIA 2ZS8A 4KITB 4ACBA 3KUDA 4LJ8A 3ZIAA 2P5SA 3QBVA 1BO6A 4TZ6A 1N6PA 3SZRA 5JMTA 2BBSA 2VF8A 1N5JA 3OE7A 3B8HA 3CONA 1GRQA 2WJVA 3ZVRA 1P62B 2IF2A 3B5JA 3CUEF 1VECA 1IAQA 4TQUS 1UBCA 4QNMA 3MUFA 2XZLA 4C0AC 1YR6A 2KWIA 2WSSD 2ZSAA 2F1RA 4WOPA 2OAP1 1IBRA 2YINC 3GJ4A 2FDCA 2O8FA 1XPRA 2O0HA 1XTJA 3LWNA 1E4YA 4PPQA 4C7OB 2IYUA 3K09A 4L9SA 4IDOA 3LDAA 4Q1BA 3LBIA 5GJBA 4AKHA 3LLMA 3FFAA 3EARA 4YONB 3BS4A 3NC1C 3EZ7A 4GFDA 4HDQB 2H57A 4TLAA 4FN5A 1UPTA 4M4SA 2BIFA 4OI0A 4GMDA 1LFDB 3ICEA 2CHQA 3TSOA 1G8YA 3K0AA 4C0BA 4MRRA 1P73A 2ZROA 2NTYC 1U8AA 4Q4LA 2J5XA 2H8KA 2JLSA 3BAFA 3HR7A 2X2FA 3P26A 4OHWA 4BWYA 5AUNB 2PZFA 1U8YA 1XZPA 2BM1A 1YKSA 3BH7A 5KO2A 4LJYA 1DAMA 2GVDC 1E79D 1NVWQ 1XNJA 3WYAA 2IUSA 1RYFA 2OLKA 2XOKA 5FOWA 1UJ2A 5JFGA 4MYTA 4LHYA 4XD7D 4CZ2A 2ZUBA 4FCTA 2KI5A 4ZI3A 2MSDB 4BFYA 5AJYA 5FBQB 1G6HA 2YJTD 3BJIC 4OKSA 2ZVQX 4TYNA 5EUQB 3RANA 3HPQA 5G3ZA 2AK3A 1ZINA 4G0NA 4ZDJA 2QAGB 2BDTA 3NHAA 5TY0A 3GLGE 2YOGA 1D6JA 2WBLC 3PITA 2PCLA 4ARZA 4PFSA 1WE2A 4P4SA 3EPKA 4AYXA 1NY5A 1GDDA 4V02A 3FHOA 4C2TA 3LAWA 4Q4JB 2BEJA 1E2DA 1Q3HA 3VX4A 3MMPA 4KYUA 5CK5A 1ZIOA 2AXNA 3NG1A 2OBLA 1XMSA 1WQ1R 4Z8YA 1HY3A 4BASA 3AKEA 2WWHA 2QA5A 4PZYA 3NC0C 2GEVA 1EFHA 4MITA 4TL8A 4BLRA 4PHGA 2XTZA 1F5NA 4BUJA 5JSZB 1Y63A 4JJZA 1NJGA 3MWKA 1XMVA 1YZLA 5DN6A 4JZKA 4JIMA 2XSZD 4TLDA 5K8TA 3DMDA 1QHHB 4MDFA 3UMSA 4QGGA 1ZJ6A 1RE0A 1RW4A 2F1IA 4LK2A 4CYMA 4ZCIA 5FBVB 1W2HA 1CF4A 4ZCMA 1O3YA 1G21E 1AA9A 3OFND 2MMCA 3PUYA 4V0NA 4KBFA 4HZUB 4Q9JA 1E0AA 1H65A 1JAIA 4RY2A 2FNAA 1PLKA 3PFIA 4YMUA 4URUR 2KBEA 1JI0A 3ADBA 2PT5A 1L4YA 3BB4A 3EZ2A 3FOZA 5DI3B 2REXB 3B1ZA 1G8HA 1JR3A 2ZSEA 3MJHA 2XAUA 5DHAA 3SQWA 1CU1A 3GLHE 4G5GA 4U00A 1QHYA 2Z5FA 3V00A 2LKCA 4M9SA 521PA 4Q66C 1FUKA 4EPRA 2W0SA 3AGPA 2XZOA 1WRBA 2J3EA 5AJWA 3P4YA 2HEIA 2JJ1D 2FPMA 3ZVLA 1NG9A 1Z2CA 1Z29A 2Y8EA 3EAQA 4H9GA 1NN5A 2Q9AA 3NBYC 1K5DA 1MABA 1YR8A 4YXWD 3P1JA 3AV0B 4ZDWA 2OLJA 1JQLB 2EW1A 2QP3A 4Q00A 2QI9C 3TMKA 2IW3A 3RC8A 4RD1A 1GKYA 4LBZA 2ZRMA 5FR2A 4U5XA 3QKRA 3I73A 1P4SA 1KI2A 1SQ5A 3TAHA 5KUTA 3L2OB 2B7BA 2Q3MA 4EJSB 4ERNA 2PL3A 1KO5A 1ZVQA 3OEEA 2NQ2C 4B6EA 2WZQA 1R0ZA 1KSJA 3BXZA 1KJZA 4B71A 2BCJQ 2QORA 5JHHB 1T6NA 5FTKA 2GXUA 1EWRA 2BWJA 3LBHA 3EPHA 1PJRA 3LW8A 2WVJA 2ZXUA 1X8JA 2ZJYA 3BK7A 1VYTA 1S0UA 1Z0JA 1GRNA 1HT1E 2CVFA 3G5UA 1I2MA 2NPIA 1OJLA 1LTQA 4NYIQ 4NL4H 5DYGA 3ND9A 2PMDA 3DVLA 1NKSA 3CPEA 2G6BA 1EGAA 1ZBDA 2VIIA 2WICA 2X8AA 3BWDD 2PMKA 3CNNA 3ONWA 4KAXA 3WP1B 2QGZA 3PJRA 2ASEA 2C98A 1Y3AA 3IUYA 2O8CB 1E6CA 2YC2C 4J0QA 4UJ3A 4AIIA 1E32A 2F43A 4PC2A 1D9ZA 2HDNB 4DLRA 4MRVA 5KNDA 1YRAA 1CEEA 3BB1A 1YE8A 2IXFA 2WWGA 2GWHA 2GCPA 4V0KA 4TQ9A 3GLGA 3B2EA 3EC1A 4XIGS 2VBCA 1RJ9A 3AEZA 4CEJB 1ZMXA 1E98A 1FMJA 3UMFA 3VKHA 1KK0A 1DADA 1T0JB 3K0CA 5K8LA 4R71A 4BFWA 4BQSA 3KQLA 3THXA 4TWZA 4LC0A 3OIWA 5A0FA 2DWPA 1OH6A 2DWQA 1PVOA 1IOZA 1II9A 2QAGC 1AZSC 2EU8A 4IVQA 1IY0A 1F3OA 3IHLA 3NVAA 2C9YA 2WSSA 2RAPA 4OQFA 2AWOA 5AR1A 4TMWA 1T8TA 5LDDC 1G291 5FBLB 2FE4A 3BRWD 1LB1B 4PSVA 1M74A 2XJ4A 1Z08A 4M1KA 3CZPA 3T1QA 4MQBA 2BCGY 3CB4A 4QGFA 4A2QA 3K8YA 2VTKA 721PA 4KHZA 4AWXA 3TH5A 2GJ9A 1AS3A 4A0FA 5FBRB 2GK6A 3AF4A 2NO0A 3OF5A 1I4LD 5BN5A 1QBKC 4NE2A 2Q9CA 1KAOA 4NKRA 1HQCA 2FH5B 3KFVA 3VNUA 4GBMA 1XCGB 4RD4A 4LV5B 2G77B 4TL9A 4HAYA 1GL9B 1PUIA 3UG7A 3EPLA 1M8PA 2ZRNA 1Z47A 5IF9A 3NDBB 3GLHA 5TARA 3B60A 3M1IA 2YC4C 4DT1B 2QTHA 1T3SA 4JKIA 1PUJA 5CYPA 5EE3A 2WJIA 4M53A 4A8JA 2ZRLA 3LQQA 4F38A 4PR0A 1GKUB 4PC1A 4MYHA 1TQ6A 2WIBA 5HZKA 3I8SA 3SE0A 3ZLJA 1Z3IX 3FKQA 2BKUA 4B43A 3QXSA 1HEIA 1KMQA 4Q19A 1E99A 2W2VA 2XNDD 1W0JD 4L8GA 3TAUA 2BMEA 2P3SA 2HF8A 1X86B 3ZGXA 3QY0A 1X3SA 3AP1A 3SBDA 1TMKA 1TL7C 3K9HA 5KSPA 1TADA 4UQOA 3ZQJA 4BE7B 4IDQA 2CL0X 2CXXA 4PTLA 1R5BA 3RS3A 2QT0A 3RRYA 4C0LA 1EESA 1HH4A 2F9LA 4A82A 4DCTA 4BRUA 4RKFA 2FSIA 2O5VA 2QSYA 3B9PA 4PPGA 1NSFA 3VR2A 5GJCA 4Q01A 3IQWA 1MV5A 4LBWA 4PZZA 4FD2A 4DRZA 1II8A 2W58A 3U61B 2HUPA 4A36A 2XITA 4QGAA 3TBKA 1VPLA 1W1WA 2E1RA 4HI0E 3QF4B 4OJKA 2XSZA 5A4JA 5TDHA 4W7SA 3KQHA 3CIOA 4YMSA 4I81A 1W4BA 1DAHA 2ZE5A 4II7A 2QZ4A 1QF9A 3Q7QA 4NH0A 2GCOA 1ONBA 1U99A 2D7DA 4TTQA 5BWMA 4L9WA 1Z6TA 1SKYE 3L0OA 1XEFA 4EJSC 3ZVMA 2PT7A 3WYGA 3BE4A 3IILA 5JWOA 1GSIA 2ZR0A 3CNLA 1SULA 4XSHA 5KNCA 3CLVA 4JLBA 5DISB 3QI2A 4ZV4A 5J5CA 1QG2A 2J46A 1E94E 2JJ8A 3PR1A 4PHFA 4US1R 4DLWA 3UWKA 4IOJA 3K0SA 2XB2A 4PX9A 2ZRPA 3NWJA 4UXHA 5HE8A 2AN9A 2YV5A 1WBDA 1P72A 3UMRA 1G8PA 4XTCS 4R7ZA 2YWEA 1Z8FA 3AKCA 2FPKA 1XBTA 1MR3F 4XWOA 1BMFD 2AR7A 3H84A 4ESVA 2OO7A 2N46A 1KTVA 1NF3A 3SR0A 2JJ1A 1XJ0A 3CNOA 2RGDA 4JL5A 1NIPA 3QF7A 4BZQA 3E1SA 3S1AB 1NJFA 3C7KA 4IRUB 3ZJYA 2IYYA 3U4QA 2ZYVX 3FWYA 2OBNA 4F91B 2XTMA 1OFTA 4YXWA 1OIVA 4OBEA 1UFQA 3PUXA 4AC9A 1QHGA 1XMIA 3B1VA 3EWAA 2DFLA 4HAWA 4JSTA 2ZI5A 2FOLA 3CF2A 4MRPA 2R6CA 3TJZA 2OFOA 2BV3A 2EVWX 1KI7A 3HYTA 3QKSA 1M34E 1KK1A 2IBMA 3QEOA 1HE1C 2IX3A 1CR1A 2CLSA 2V55B 4Y0VA 5BW8A 4CF7A 3FHCB 2NO1A 2QRNA 3D6TB 4Q7MB 4EDHA 4PSAA 4ABYA 2O8EB 1ZYUA 3MLEA 4KFTA 4AG5A 3FVQA 5CB6A 1NG1A 2IYTA 3EASA 4F4JA 2XJ9A 4RZUA 4IOLA 4NU0A 1OF1A 4LYAA 4ZPXA 5FPSA 4ILEA 2CDNA 5EUMA 3AKYA 2RHMA 1FFHA 3TK1A 5IHPA 2I1QA 2AX4A 2V8OA 4NPHA 2ZRFA 4BFVA 2JLZA 2F7SA 4G5OA 1E0SA 1ETUA 2CLDX 4OK6A 4DVGA 1HT2E 4JKYA 2ZRDA 3B85A 1WA5A 3SHFA 5FUXA 3G82C 4OQNA 5EXSA 3AM1A 2R2AA 4C2UA 2VHTA 1KZGB 5HTKA 3CF0A 1OH5A 5FH9A 1HE8B 2QPTA 3NXSA 1E1RD 4KBGA 3CW2A 4ZDKA 4Y0AA 4I1UA 4PSKA 1KI6B 4JLKA 3Q85A 1LS6A 1FP7A 5E7JA 1NSTA 2AFHE 1OFHA 1D9XA 1NMXA 1UF9A 1W46A 1Z28A 3QENA 4V03A 3KDSE 5JHGB 1XTRA 3CRQA 2IXEA 2ZE7A 1P61B 4HDOB 1E1QD 4P4UA 1LVGA 4IHQA 3RHFA 1YQTA 5K8UA 2QTFA 4WZBE 1UDWA 5FTNA 4GDFA 1BIFA 3QOFA 1VTKA 2KB0A 2C96A 1O87A 4LJ6A 3NEJA 2FU5C 4M9QA 2VL7A 2WKPA 1JQJC 5AJXA 1UKZA 5FOVA 5EZ6B 5P21A 4DIEA 1AK2A 4O0MA 3FB4A 3WBJA 1T4GA 2C95A 3V4FA 1T3LA 2FV8A 1BYIA 3IQXA 3LV8A 4A0HA 5JECA 3DM9B 4HLUC 4OK5A 3BFKA 3RAPR 2AWNA 1OH7A 1E9RA 4LRWA 1W5TA 2VHJA 2I4IA 4L5BA 4TMTA 2VHUA 3T5GA 3OESA 1N6NA 4ASUD 3Q8XB 1DO0A 1SXJE 5AK0A 5G40A 3EIEA 2G0NA 4M8NE 1EFCA 2OSBA 3VFDA 1BKDR 1XRJA 1AS2A 2WM9B 3AB3A 2EFDB 4IEEA 4DJTA 4NP6A 1G7CA 2JIZD 3QXHA 3SU8A 4DUGD 2K5UA 2BEKA 2OG2A 1T0HB 1E2FA 3HYRA 1SKYB 1S9DA 2ZS7A 4IDPA 5F2EA 5HE9A 5AUPB 5F98A 3CRVA 1KKMA 2GVZC 4I1SA 3R7WB 1W0JA 4Q47A 1XXHE 5FPYA 1VIYA 4JVMA 3GJ5A 2GZDA 3GFTA 3G0HA 1VCMA 1CJVC 4ZKDA 5G53C 1I2DA 1NN1A 1PLJA 2FZLA 2YYZA 3CRW1 3FTQA 1Z0IA 1TEXA 2QY9A 4WZAE 1DAEA 3GEHA 3RS4A 5KPDA 2UKDA 1EWQA 2PJZA 4GZLA 4B2IA 3W6PA 1JBKA 1TU3A 4AYWA 1TF2A 3A36A 2P65A 5L3QB 3QXXA 4G5RA 2NGRA 4AURA 3LVQE 2FGKA 1MT0A 1NP6A 2R6GA 3WNCA 3IIJA 2R6AA 3IIMA 1QHXA 3PEUA 1KDTA 2KSQA 1M7BA 2CHGA 2RGBA 3R9IA 4JLDA 5AUOB 4DLYA 5EQTA 1T5IA 3RRNA 1SHZA 2VP4A 1D2MA 3QE0A 4PO1A 3N70A 3B1WA 3WRXC 4NYMQ 3U3KA 1FX0A 1YZKA 4FMBB 4F7WA 3CF6R 4B32A 1IY2A 1XTSA 3WBKA 4Q1CA 1S3GA 1U2RA 2GA8A 3IEUA 4C0SA 1AN0A 1YVDA 2G88A 1IXZA 4D2IA 2QMOA 2QBYA 5FTMA 4R98A 4TYYA 3KXLA 1P2VA 3ADCA 4LV8B 1FOEB 3REGA 4OJQA 2IS4A 3WNBA 2WHXA 2VSFA 1VDZA 4Z54A 2AHOA 2OFWA 1G1MA 5KPJA 3ZH9B 3K70B 1SVWA 4QJ5A 1AS0A 1BMFA 4LUCA 2CJWA 2P6UA 3UG6A 1GNRA 3GFOA 4GI7A 4HAZA 5GJVC 3IEVA 4HLDA 1XZQA 2V9PA 3TVDA 1Z83A 3WMFA 5F9FA 1OLOA 4PAQA 2PH1A 2YWGA 3VMFA 2QBYB 1OFIA 3RRZA 4H1VA 1UKEA 2V1UA 3GJ0A 1QHIA 2QSZA 3I32A 4G3XA 3SJBA 4D0NA 3HR8A 2EWWA 2X2EA 1CBUA 4HLQB 1C9KA 1P9WA 1I4DD 3EA5A 3X2SA 4DXAA 1KO8A 2NO9A 4DSTA 2VLIA 4DDTA 1KI4A 1G9XA 2OM2A 2OCBA 1X1SA 5C46F 5KDOA 1ESMA 1KO4A 2ERXA 5FPHA 5GVSA 1SXJA 2QG6A 2GJAA 1A7JA 1YJ5A 2ZU6A 3OIYA 3QPVA 5JSZA 1H8ED 1CXZA 4KFRA 3A1UA 3WNDA 4DLSA 3ZZUA 3AUYA 3SYLA 2GJ8A 2J0VA 4NMMA 1Z6GA 4BZPA 4BECA 4OQLA 5JJLA 3L0SA 2YWFA 1GG2A 1Z63A 1G5PA 1RIFA 1ZCBA 1CKEA 4OI2A 4OHYA 2FN4A 1N0VC 3GLFE 3CO5A 3KXKA 2FZ4A 1JXOA 1XD2A 4FW9A 3QSYA 1Q0UA 2IEYA 1XXHA 1E96A 2TMKA 4W9MC 4CEHA 1DTSA 2JLUA 2GNOA 2AL7A 4CRWB 5DE3A 5JJKA 2HV8A 1WDTA 3Q7PA 5KSZA 3M0EA 1KDPA 4RCZA 5SZHB 2RH5A 1FUUA 4QNRA 2O8FB 5EP1A 5M04A 1N2CE 1R0XA 2AKYA 3BB3A 4MYCA 2IUUA 4KV9A 1GIAA 5FOTA 5FTJA 4B74A 1LS1A 2HJVA 2FJUA 1S8FA 5HPYB 1TQ4A 1E1QA 3CM0A 4M0LA 1GNQA 1EK0A 2XNSA 3RS7A 1GUAA 3H2YA 2PLRA 4FWIB 1ZNZA 5JRZA 2R9VA 3FMFA 5IRCD 2Q0HA 3TUJC 4Q4AA 3K0AB 1XD8A 2JLWA 3OAAD 1E0KA 2C04A 1OHHA 2C5LA 3RS2A 3RC3A 4Q48A 1NBME 3CX8A 1WP9A 4UXJA 2C78A 1DG1G 1KI9A 4GSYA 3MD0A 4MKFA 5D3MA 3IDQA 2QE7A 4XSGA 1XB2A 4AKEA 5FFMA 2GBLA 3U6BA 4JT4A 1E9EA 4F4CA 1ZW6A 1E9DA 1T5LA 2DBYA 2QM7A 3KUCA 4PZLA 3ZZTA 4AK9A 2ZAMA 2J9RA 4PO9A 3SQXA 3B1XA 1S2MA 1W5SA 1VIAA 2PEYA 5CJ2A 5FL7A 5HZHA 2CMKA 3GEIA 3SS8A 1AJEA 2W6ID 3GJ8A 1X8LA 4NHOA 4XWKA 3DEFA 4TMVA 2ZSBA 4DDUA 5K8IA 5CK4A 4HZIA 4ARZB 3NEYA 3HP1A 4IVPA 4JLMA 1VG1A 2N42A 4P4SB 3WMGA 2FSGA 2G1KA 1ZU5A 2P6RA 4DB2A 4DUGA 4WBSA 4OQXA 3L0IB 3HDTA 1G7RA 4MKIA 2V7QD 1OXVA 1E4VA 5L3SA 3FPAA 1KGDA 4KLZA 2CE2X 5KU1A 1G18A 3ICQB 3LQRA 3TLXA 5CB8A 1ZC3A 3BFVA 4TZ0A 1KMHA 3PIRA 5EXXA 2PBRA 1ZM2A 2OZEA 1D2EA 2E9SA 2J0UA 2ZI7A 4ZIRA 5A5GA 2OESA 1T91A 5JRJA 1J90A 1GKIA 5LB4A 3FKSD 4LC1A 3AP2A 3K70C 4HB4A 3VR3A 4XH9B 3AF1A 4C30A 4DLXA 2DPXA 1EFRA 2MSCB 2NOAA 1DEKA 2ORIA 1NVVQ 5CM9C 3TGPA 1MH1A 4TYWA 1W48A 2R62A 2Q21A 1XEWX 4HLCA 2ZM5A 3E2IA 2RGXA 2ZRJA 3NDPA 4TT3A 1G4AE 2GZHA 1M6NA 1X1RA 2OXCA 5L3VA 3ZVNA 2GEUA 1U9IA 1XTKA 3QG5A 4IJMA 2GXAA 4B73A 2JJ2D 2DFTA 1E9FA 2J0SA 3MWJA 4A0RA 3CPJB 1KO7A 1NN3A 2UVQA 1NL3A 4PQFA 1XX6A 4Q9KA 1QHSA 3DKVA 3H1TA 3OIVA 4MKHA 4GZMA 4A15A 3TSZA 1W36B 3BD9A 1JEDA 1DAFA 4XVQA 3UWOA 2QMEA 3EX7C 3VR1A 2B8WA 4KLNA 3GLFA 1AGRA 2R6DA 4URVR 121PA 1E2LA 4JL6A 1MABB 4TTPA 1GVNB 2W6JD 1JPJA 1P9NA 1IXRC 2HLDD 2NO7A 4IXMA 4Q5IA 3LXXA 2DHRA 4GMXA 2C9CA 2XXAA 3FMOB 3LXRA 4US2R 3T5DA 2F55A 2GZAA 2FG5A 1FTNA 3AH8A 3QKRB 3A1VA 4P3YA 2FFAA 2ODEA 2SHKA 5TB5A 2IYZA 3LRPA 4JBWA 3CWQA 4G5SA 1U94A 3UATA 2C8VA 2D2EA 3AF3A 4QHTA 2JLVA 4KFSA 2FA9A 3GLFB 3NBFA 1EX6A 2R8RA 2QTVB 4BFUA 2BJWA 4ZKEA 4M21A 1TPZA 3BERA 3U3JA 1E2PA 3FMIA 3WHLA 5HKKD 2BHRA 1DO2A 1NBMA 4NYJR 1T3HA 1Q12A 2O0JA 2FWRA 4LJ4A 5BN4A 2O8BA 4OYHA 1CR4A 3K09C 4TMZA 4A2WA 2IYLD 1AQYA 3LVRE 4MGIR 3SC3A 1GAJA 1DARA 1QHNA 2GDJA 2ZTSA 1FTSA 4TMKA 4MGYR 4Q9HA 3TW8B 3KKNA 5J4YA 2VA8A 3I1FA 4P4TA 1GOTA 4EKDA 2FEOA 4EPYA 4LHZA 4TLBA 4UNSA 5JWHA 1AKYA 2PZGA 5BXQC 1TUIA 1ANKA 2F43B 4A2PA 2QMUA 3KKMA 3OIUA 1H8EA 4JVNA 3GLGB 1XPOA 4JVSB 2NMVA 1RJ9B 3A4LA 1LF5A 2WWXA 3B13B 2WIAA 2YHSA 4Q1FA 1YZUA 1ZM7A 4ESHA 4N0EA 3AVVA 1GILA 4A6PA 1XJCA 3U44A 4TYPA 5E4FA 2ZSFA 1X6VA 1Z0FA 3JVUA 3L82B 3THXB 1OIWA 1WBBA 2IT1A 4U02A 4Q7LA 5L8VA 1R0WA 2YKGA 3KX2A 5E95A 3THYA 1VG8A 4D81A 1E2KA 2RKOA 5EP2A 4GOJA 1HURA 3HWSA 2ZJAA 1D2NA 3QBTA 2J1LA 1XMJA 3WY9A 2FPLA 1RRGA 4WW0A 4EPVA 4EPXA 4GOKA 4FINA 1YR9A 3CX6A 621PA 4A0GA 4KFUA 5FPTA 1S3SA 5F3WB 3UANA 2GF9A 3BORA 2V4ZA 4B3XA 1E79A 1G4UR 1NLFA 3AKDA 5GVRA 4D25A 1Q1QA 2DFKB 2EWVA 3PEYA 1MO4A 3A1TA 2XZPA 3SJCA 1QVRA 4DCSA 3K9NA 4XD7A 5KTYA 2QROA 4LCBA 1G7TA 3GLIE 2OBMA 2QEQA 1G5TA 5BYJA 4URXR 2V3CC 4N1AA 4B6FA 1E2NA 1E2IA 1NLYA 1Z2AA 2FSFA 4F4IA 3VR4A 4QRHA 1OIXA 5FOUA 1IXSB 1E9SA 4TL6A 1CJTC 3OZXA 4C0HA 5KSOA 4CT5A 3GLHB 3QVUA 5CITA 1MKYA 2A5DA 4URZR 4A8JB 1G16A 1FPMA 1Z0KA 4BLQA 2ZITA 5DLQC 3QIAA 5DO9A 1IN6A 2Z83A 3TR0A 4AD8A 1UKYA 4QHYA 4CEIA 1ZP6A 3C5CA 3IKJA 1GTVA 3LBNA 3I61A 3T06B 4JL8A 3N2IA 1XCMA 2BBTA 4A4DA 3LO5A 3Q5DA 3AVYA 2D06A 3KZ1E 2VF7A 4Q18A 1XP8A 4EFMA 3AVXA 2H1LA 2O52A 5KOYA 4WVFA 5EE5B 2ZUDA 2WAYA 1W36C 1DS6A 4M1MA 1LF0A 2ODWA 1B23P 2BMFA 4BFXA 4EPWA 3OFNA 4M2LA 4HUQA 2V7QA 1Z5ZA 3C15C 3KFXA 1E2MA 2FSHA 3DHWC 1FZQA 3W5JA 1B0UA 1OV4A 4JSYA 2V6IA 3A37A 1SVLA 4M22A 4RD3A 1II8B 1NY6A 4IDNA 2GRJA 4DBLC 4H1UA 4MUBA 1IN4A 4LJ9A 3VQTA 1DPFA 4B47A 1JR6A 5FOXA 3U3OA 4DDVA 3FKSA 2RGGA 4TTRA 2ERYA 3HU2A 3P4XA 4P33A 2HYDA 2B6HA 2GCOB 4OL0A 1VG9B 2A5JA 3IGFA 5B2ZA 5G3YA 2D4HA 3K9LA 2OUKA 4MH0R 4RFSA 5TV2A 2JLQA 2KE5A 2VHQA 2ZR9A 2ZJ5A 3FE2A 3VR5A 2XTNA 1V43A 1XJQA 2J7KA 3QVVA 4FMCB 2IL1A 3EWSA 2F3RA 2JJ2A 1H8HD 3K0EA 1W7AA 2HCJB 3NIBA 1L2TA 2ZJZA 1RRPA 3K0FA 3LNCA 4URYR 1J7KA 3GCGA 4UKDA 4B3BA 3RWOA 1Z0AA 1OSNA 3WYFA 2DYKA 2REOA 4ACAA 5LBIA 2GJKA 4IFBA 2ODBA 1VMAA 1KO1A 4IXNA 1CULC 1EX7A 2V6JA 4FXPA 2EFGA 4PPNA 4C0JA 1N6OA 1JPNA 1YZNA 3I62A 5JCPA 1UM8A 4BLTA 5KNBA 1G8FA 1KSGA 2VHCA 4NCHA 2B92A 3U4QB 3W3AA 1OKKD 2GJSA 3W6NA 4GT1A 2W6JA 1QG4A 1OW3B 3IPYA 4LYJA 2VP2A 3VKWA 5ELXA 2HLDA 1MO5A 1XU4A 2BC9A 3T1VA 4D82A 1M1YE 4OHVA 1TQDA 4Q4HA 1XTIA 2ECKA 2RGNA 3THWA 3TVTA 3U7FB 3K0CC 3ZIAD 1JJ7A 1HYQA 1IHUA 3QKSB 4ZI2A 2ZUCA 3SJAA 4NCIA 3OE7D 3JZAA 2J7PD 4MGZR 3L43A 1N6LA 5CLQA 3GLIA 2VP9A 2CCGA 1K6MA 5JBQA 3R20A 1FP6A 3ECCA 2A9KA 1W4RA 4B35A 3KL4A 3C14C 4W5HA 2XX3A 5JEEA 2XEXA 1II0A 1C4OA 3DOEA 4R9UC 2PX3A 1K8RA 1KDOA 1T8UA 3VKGA 3AQ4A 5SZIA 2P67A 1TQ2A 2UZIR 1M7GA 4TN1A 1CR0A 4URWR 1N25A 5ANRB 1MO3A 4EUNA 1ZNWA 5CDFE 3O8RA 1FMLA 1E9BA 3CWZA 1ZD8A 2OV2A 3MFYA 3W34A 4DKXA 3TUIC 2B7CA 4YC7A 1W44A 5JCZA 4JYCA 4LOAA 1HA3A 4HDCA 3A8TA 2VSXA 2WWFA 4JLNA 3SFVA 4AI6A 5DH9A 2YOFA 2PJRA 2QM8A 4TLEA 1HUQA 3GQBA 3ASZA 1L7VC 2GEDA 4US0R 4EFLA 2IEZA 4A8JC 1X8KA 3KKPA 2WJGA 1N6RA 2NIPA 2G9NA 1KYIA 3RYTC 4EQ6A 1US8A 5JZVA 1IM2A 2IYRA 1Z22A 4WA7A 1E2HA 1KJWA 4M1YA 2D7CA 2XOKD 2BVNA 3MGCA 1EXMA 3GPLA 3LX8A 2ZE6A 2BBWA 2CVHA 3I92A 3KTAA 3SJZA 5LPNA 4FCVA 1A4RA 1KNQA 3QG1A 1UBFA 5F9HA 2WSMA 4JLAA 4V0ME 1RPZA 3VX3A 4EQ6B 1CLUA 1SVIA 3KKQA 5AUQA 4Z1MD 2JGNA 3GFPA 3IBYA 2D62A 5G41A 3F3YA 4JT2A 2ZREA 4P0TA 1ZUIA 4BFSA 4RVCA 8OHMA 2JLYA 2JCSA 3DKPA 2ZRIA 2XNDA 4Z8XA 4Q02A 3W8RA 1G8GA 3QJYA 5C4MA 4RJLA 2VQSA 4LZZA 5B64A 4W5JA 3GJXC 2BOVA 4K81B 4G1UC 1MRSA 1KK3A 4M9ZA 4V0LA 5H1YA 3RNLA 4XVUA 3KJEA 4Q9IA 2ZQ5A 2DB3A 3REFA 4C9BA 2R6FA 2VP0A 3L8YA 2I3BA 1KY2A 5KDDA 2ATXA 3I3SR 4GPTA 5EXPA 2FX3A 2J87A 4IOMA 2NO6A 1U98A 4Q9LA 1TTTA 5FTLA 3PV0A 4QL3A 1Q1ZA 5CYOA 2NPFA 3F5FA 2Q6TA 2GCNA 3B9QA 2IS6A 2DY1A 1Q57A 2CEAA 4M1OA 3D8BA 4PQRA 2V1XA 2VSOA 4PXAA 4UJ5A 3UPUA 1GNPA 5J4VA 1DAGA 2O8DA 1TUEA 3BGWA 3BH6A 1G5RA 4L4UA 5KSYA 1NNEA 2IYXA 2DWOA 2AK2A 3NKVA 3TRFA 4F92B 4KO8A 4LHWA 1W36D 2EFCB 2IHYA 4RD6A 3ZZ0A 2HT1A 3EZ6A 1F2TA 2IWRA 3H0KA 2RGAA 3X1DA 4B33A 3PUWA 1TNDA 3DO6A 3GP8A 1UDXA 4IVRA 2GETA 4A92A 4HUTA 1VCIA 1G17A 1M7HA 1TF7A 1ESNA 4GP6A 3RVBA 1RZ3A 2H7VA 1FNNA 4CVNA 1F2UA 1GFIA 1G3QA 1SVSA 3FYHA 5GJWC 1RRFA 4KU4A 4L16A 3ETLA 4BZXA 3QNUA 3QXJA 4LWZA 2IYWA 2OFXA 5CJPA 4TL7A 3D3QA 1SVMA 3EW9A 2QENA 4I1VA 5CDFA 5JI2E 2GAOA 2Q3HA 1W4AA 1E69A 2QUZA 1F2TB 1FX0B 5C1BA 2ZJOA 3U6KA 3M6AA 2DFNA 5J47A 4U7DA 3I5YA 2OCPA 4MYUA 2L0XA 2KBFA 4TSFD 2WMNB 2GILA 1U0LA 3BC1A 3QEJA 3TUZC 2ZJ2A 1SZPA 1ZC4A 2HXYA 4XJXA 2ANBA 3LLUA 4RCYA 5IDVA 1XFAA 3GJ6A 4NBSA 2C2HA 5DI9A 3OHMA 2FFHA 1OXUA 1J70A 2JLXA 1NIJA 3AVPA 2WKQA 2C9OA 4A6XA 3AF2A 1S1CA 5H8WA 2GXQA 5EJEA 1U0HC 2A5GA 4DHEA 3B1YA 2CJWB 2WJYA 2BM0A 4DB4A 4EAQA 2WWIA 1R10A 2OEPA 5H68A 2J59A 1OKKA 2WPDD 1G20E 2IS1A 3CR8A 5KHOC 4B3FX 1P2TA 3AUXA 4JLVA 1NN0A 2Q9BA 3LH5A 1U0JA 3C16C 3PVSA 5FUVA 2ZETA 3X1YA 2GAAA 1HV8A 1HQYE 5JEDA 4KCGA 5JLJA 4C7OA 3GJ3A 4V0MA 1NRJB 3QKTA 3SHWA 5TXGA 2WWWA 1E2JA 1EFUA 2X19A 1R4AA 4HATA 3B78A 1WB9A 2RCNA 2J7PA 4B3GA 2UZ3A 1N5IA 2IHBA 4Q1EA 5IT5A 1E2EA 3MWYW 2FEMA 2YWHA 1RRCA 4LDJA 1NLZA 1ZM4A 1ELOA 2LWIA 1OPXA 3PG5A 1E1RA 2W2XA 1SXJB 1KDRA 5CM8B 1G3UA 4E07A 3O47A 3C5HA 3MJRA 1TF5A 3F0TA 4G01B 4BEJA 1S4QA 1F6BA 4BFTA 5J40A 3THOA 2QAJA 3ZQ6A 2ZR7A 3DZDA 4QOSA 5CIQA 3T34A 3WHKA 2HYIC 2ZSDA 1P6XA 2IF0A 3GJ7A 1UKVY 1YZTA 4QFMA 3DZ8A 3K1JA 4V0OA 2PX0A 3HPRA 2H18A 3CRRA 4DLTA 1EFTA 3UKDA 1XD2B 1IONA 1GL6A 2A5FA 2QT1A 4I1OA 1IY1A 1MO6A 1P75A 1ZNYA 2QAGA 4NYIR 1JALA 1XXHB 4OHXA 1ZUNB 4CEHB 1LY1A 1OYWA 5E7MA 4BPBA 4D4MA 3RRMA 1A2KC 3BFXA 3FDIA 1OE0A 2F1HA 3QXCA 1GRRA 4KJZA 4M9XA 1DELA 5B30A 1KSFX 3DMNA 4O2LA 1VYUA 4Q4JA 3TE6A 1AM4D 2RMKA 4F93B 3NH6A 5HCNA 1OH8A 4HAVA 3CH4B 1J99A 5DGXA 4BGDA 4MGKR 4DCNA 4JLOA 3KJIA 2W83A 4R2IA 1PZNA 4BLOA 1NKTA 4D26A 4LPSA 3SBEA 4GOXA 4HB3A 1G7SA 1ZM3A 3SYKA 2HT6A 3VTKA 1KNXA 3SFZA 4B3DA 1GP2A 4CIDA 1W49A 2VO1A 1XEXA 2AD1A 2DR3A 2NZJA 3LX5A 2VYFA 2AXPA 1FQJA 3X1ZA 1JAHA 4LJ5A 4Q4AB 1CIPA 4WXPA 3ZS9A 3MAAC 3T61A 4ASUA 3SNHA 4MKGA 3T35A 1QHHA 2YVUA 1VYVA 3N2EA 2N1BA 1G19A 1KI3A 4LYHA 1XWIA 2VP6A 1COWD 221PA 2JAQA 5E3HA 2J0QA 2JIZA 5D3MB 4Z1MA 1G64A 2ZRGA 3WXMA 3A1WA 4HZUA 1BH2A 1PV4A 1N3BA 4Q03A 2CK3D 3ADKA 1TU4A 2MMGA 2A7QA 2ZJ8A 3L8ZA 5BYKA 3QQ5A 3R9WA 3JZMA 1AZTA 4IFEA 5FUWA 1E9CA 5DI3A 4YDHB 1XEXB 1OXSC 1Q44A 4FIDA 2ZU0C 2PLFA 4OQMA 3DPUA 3RDPA 3EC2A 1JEEA 2HCBA 1SGWA 1XPUA 5SZKB 1N0UA 2G3YA 3I8XA 1KHTA 2QU8A 1CJMA 4KXFB 5DIFA 2GHIA 3VR6A 5FPKA 4DWJA 2NG1A 5L3SB 3QPUA 4DDWA 2D74A 3SOPA 1XD9A 2BBOA 5BN3A 3H86A 4D6PA 4DLZA 3CRMA 1L4UA 1KMHB 2ZI9A 4E5UA 1GITA 1Z6XA 5AJZA 2R65A 1N6KA 2J0UB 1R5NA 4ZIRB 3PUZA 2EQBA 4POAA 2V54A 1TEVA 3WRYC 3DOFA 4PC3A 4B76A 1KIMA 4LI0A 3RLFA 3RWMB 2JA1A 2VP5A 3ZYCA 1NI3A 4EIWA 4PHTA 3LFUA 4HSEA 4EJSA 3BIFA 4YDSA 3ZDQA 4QGHA 2P0EA 3W8NA 1AQUA 1JXMA 2QQ0A 3D31A 1R6BX 5SZJA 3RSLA 3TKLA 4FWTA 1G3IA 2ZJBA 2IYQA 3CPHA 1R2QA 1DVRA 3K9GA 1SKQA 1YR7A 1FL9A 3KB2A 3O8BA 3QPWA 5DHFA 1IJEA 3GMTA 4KYIB 421PA 1E2GA 2CNWD 5DSZA 3T1TA 4IDHA 3SN6A 4B44A 1A2BA 4D4KA 2OAQ1 1XCPA 1WF3A 4D80A 2QPAA 1VCOA 2A5YB 1EG7A 2OILA 4LX0A 1IN5A 3LY5A 4S2EA 4JLJA 2WJHA 3P27A 2O8CA 2QQEA 1V5WA 3AF0A 3CBQA 4RKEA 2A3RA 2Z0MA 1SHKA 2O0KA 2ATVA 4TSFA 4AY2A 2B21A 2CBZA 1SXJC 4X8LA 3TNFA 4OI4A 4DCUA 1K5GA 821PA 4B2LA 4O3MA 1DE0A 1OXTA 2EFHB 1RYHA 2YNMA 3GEEA 3U60B 4CEJA 2ZRHA 2CL7X 2XXAB 4BRWA 1U81A 3C4JA 1ZD9A 4HYYA 2QNRA 2ZYWX 5CIWA 2EFEB 2ONKA 4QBHA 4C3ZA 4X8OA 3ADDA 4CT4B 4QM6A 5HCIA 5JS8A 3PCRB 5J4HA 3Q5EA 1UAAA 2W0MA 3CR7A 3GD7A 1GM5A 1Z6AA 2I1VB 3Q9LA 3V9PA 5EP4A 4NCKA 4PANA 5JI3E 2WPDA 5E7IA 2Z43A 3NHBA 4C4PA 4M1SA 3PEVA 2FGJA 4QBFA 1VHTA 3WMEA 2JLRA 1S96A 1UADA 2A30A 3NH9A 1OYYA 3RABA 4E03A 5TMPA 1LNZA 1KOFA 1GZSA 4FI3C 3C8UA 5KYKA 4XVRA 3PEWA 2O8BB 1CTQA 4QBGB 1DAKA 3CKLA 4LV6A 4MRSA 2A2ZA 2MSEB 1WXQA 1ODFA 4QJ4A 4OHZA 4UXIA 3RS5A 4P31A 1QVAA 2QRZA 4XTRA 5EP3A 1UEJA 2AD5A 4A9AA 4D0GA 3W9YA 4O2RA 2WWYA 1VCNA 2Z4SA 2QPOA 3BH0A 3A6PC 4TLCA 3TQFA 4TMXA 1P60A 4UNRA 3A4MA 4DLVA 1PLLA 3B6EA 3MSXA 4DT1A 4C0KA 1ZD1A 3W6OA 3LD9A 3H4MA 2ZRAA 1ZAKA 1XF9A 3NBXX 4KODA 2CCKA 1KK2A 2F6RA 2GBLC 4HAXA 2DCUA 4QKQA 2HXSA 4Q7JB 2F9MA 1P5ZB 1LW7A 1YZQA 1D5CA 3L0PA 3SEAA 3U44B 3HU1A 3NBZC 4BFZA 1BS1A 2ZE8A 2Z4RA 2ORWA 1DOAA 1W4CA 5TVKA 3AVTA 1RVDA 2ZRBA 1IN7A 2LCFA 1ZRHA 4IOKA 3THYB 4M1TA 2NZ8A 4QJ3A 2GF0A 2OXRA 2ZYTX 2CHVA 2WAXA 3OAAA 4X8HA 4EPTA 1AGPA 4I4LA 5B57C 4UNPA 2HF9A 1Z0DA 2QP9X 3CH5A 2ZIAA 4LHVA 3SI7A 4RFVA 3QUSA 4QBIA 1T9HA 1DAIA 2VH5R 3U7GA 4I99A 1Q20A 2RB4A 3PQCA 4LPKA 1ZM9A 4JLPA 3T1OA 3O8CA 1UBGA 2G0TA 1YRBA 1NMZA 2VPPA 4JVLA 4HLUA 4B75A 1OB5A 3B82A 3PUVA 1M2OB 3WP0A 4B2PA 3FFBA 4QC2A 5EE0A 3BBPA 2BJVA 1Z06A 2WOJA 3QF4A 2IK8A 3U5ZB 3J81k 2W6IA 2ZS9A 2IYSA 1N6HA 4E22A 1BOFA 3IO3A 4HB0A 3UIEA 5EZ5A 2D3WA 4K8OA 4AKIA 4LJAA 4PPFA 4D0LB 1COWA 2H92A 2ZRCA 3I4LA 4LGMA 4DSUA 4XOIA 3A58B 5IK2D 2CLCX 2JATA 2CK3A 3W90A 3ZD7A 3PENA 1VHLA 4ZO4A 4JMPA 5EE1A 1A5TA 4NDZA 4RZ2A 3D7MA 3O8DA 1C1YA 2IA5A 3EA0A 2QGNA 2GTPA 1U8ZA 5AJVB 1U9IC 3HU3A 1SVOA 2VRWA 4KSBA 4YMVA 1E9AA 1QDEA 4CEIB 1LV7A 4N0DA 3NTUA 4GP7A 4A1FA 5FR1A 1TX4B 2PZEA 4AYTA 1CP2A 4ZCLA 1BYUA 2H5EA 1OFUX 4DZZA 2RHDA 4G5QA 3ZD6A 2B8TA 3SDZA 3K70D 2PCJA 1FQKA 4ZDIA 5L3RA 4JS0A 3PXGA 4PO8A 4D4JA 2CE7A 3ND8A 4DEYA 3I72A 2ZVPX 6Q21A 2ZI3A 4HUQB 3S1AA 3TIFA 3AVQA 2Q3FA 1W0KD 3M4YA 4NYJQ 1J8MF 1YHNA 4XWAA 1IQPA 2X1VA 3FHTA 5LD2B 2PEZA 3VHLB 4Q21A 4BLPA 4BEBA 3KQUA 3CZQA 4RD2A 1S1MA 2ZAOA 2JDID 2OHFA 1WCV1 2QMHA 2QL6A 3OEHD 4KSCA 1A82A 2CCJA 3EIHA 2WMOB 5UKDA 4DLUA 2JEOA 1J8YF 3I5XA 4C0QC 2A78A 3IHWA 4GNKA 2H17A 3IO5A 1YZGA 4B3CA 4RFSB 2Z6VA 1D8TA 4LHXA 3U2QA 3ASYA 2O8EA 1KI1A 5FUYA 1GWNA 3KJHA 5DYIA 3MWLA 4HEJA 4KVAA 5JS7A 1Z6YA 1E2QA 5GADl 4YQFA 4LY6A 1CR2A 4FMCF 4NONA 3K0FB 3QKUA 2CNWA 4HB2A 3U3MA 1N5LA 1ZCAA 2D2FA 1KKLA 2ODNA 4UNQA 1P9RA 1RFLA 3IIKA 4NZYA 2BMJA 2GKSA 3KXIA 4DIDA 2ZI4A 1ZIPA 2VEDA 3T15A 5KDLA 3W5IA 2FF7A 4PHHA 4S35A 4M1WA 1J2JA 1XTQA 2WJJA 4B48A 1SXJD 4NYMR 3VU9A 2P6NA 2AFIE 4LYFA 5J4LA 2HJGA 1KI6A 1FW6A 1JECA 5HKKA 1YU9A 2YOHA 3R9XA 3IBGA 4Q4HB 3FMPB 2RGEA 3R8FA 4Q7KA 3THWB 4RZXA 5C4GB 1F60A 1HTWA 3U7EB 1NVXQ 3E70C 1G6OA 4MRNA 4NCNA 4Q1AA 4QM7A 4NTZA 1ZNXA 1DG3A 2RGCA 2OE2A 3EPJA 2ANCA 2ORVA 3GLIB 3FGNA 4HAUA 2ZI6A 1U90A 3AVWA 4PC6A 4YMTA 4MA4A 3VU9B 3V4RA 3MRSA 4JJKA 3K53A 1XDBA 2QP4A 2BKEA 1Q1EA 3EG5A 3F8TA 4ITRC 4OI1A 1P3JA 5B58C 1G41A 4DCVA 2IXGA 4KI0A 5FI1B 3AGQA 1AKEA 2C03A 3X1XA 4OK3A 3AVUA 2ZYUX 4LBVA 1NVUQ 4P32A 2WV9A 2IS2A 1P7CA 4FCWA 4O25A 2WTUA
chains in the Genus database with same CATH superfamily
3LC7O 1E0JA 4X65B 2ZJ1A 3E9DA 4MUAA 3N87A 3H5AA 2H0QA 3B6MA 4JYBA 3JWPA 4EFNA 3ZBTA 1Q21A 4CMEC 2C99A 2C4MA 3LX4A 3PGVA 3DF9A 1ZH4A 1RWQA 2FG7C 3OY7A 3G23A 5CVDA 3GQBB 4UVDA 4NZ9A 4OJMX 3RTEA 4R81A 3P2EA 2NZYA 5CPBA 1ARZA 2EYQA 5DNYB 4MI1A 5ALGA 1TMYA 4R2LA 4CG0A 4F2WA 2AJ8A 1WKCA 2IWHA 3P45A 2ACKA 3S4YA 3OOJA 5KOJB 2XIQA 1ZUHA 4LRUA 4PQYA 4AUNA 1GL7A 2YCBA 3QOWA 4MW1A 3M5WA 5ALLA 3AP3A 3DEYX 3I3OA 3B6KA 1KZ7B 1BXKA 3KB1A 5FBHA 1E59A 3RC2A 2ZRKA 1QIFA 2GN6A 3LA8A 2MINA 5K2OA 3GFQA 3N8DA 5E4YA 5FBWB 1RAIA 4JU8A 1NE7A 2WP0A 2O3UA 1GAQA 3FN4A 2JG3A 3GGOA 2ICAA 4JH0A 3TIIA 5AVRA 2F3TA 2ZEJA 1A2OA 5REQB 2FWPA 1JV2B 4J0KA 3D0KA 3P0HA 2ID8A 3QE2A 2VJPA 3V4VB 1X1QA 1LWNA 2IC5A 2VDOB 2FRDA 3HBNA 2H5LA 3M5DA 2Q3BA 3O90A 3FNHA 5K8CA 2L82A 2CL6X 1OWMA 3LPCA 1UK8A 4V2IA 1V3QE 1P2DA 3LRTA 4LXHA 3PL5A 3T7TA 3H5VA 1M9NA 1R8SA 1SKAA 1N2GA 1NXOA 1T13A 3N0RA 2H7XA 2W2TA 4ANFA 2H59A 1KOJA 4ZREA 5AW7A 5HZMA 1E3WA 2BFAA 5IT9A 3MJEA 1NV8A 3HFSA 4FR2A 1YU6A 4QYWA 4DSOA 1GU0A 2GUWA 3MCZA 4J1SA 1DV2A 4LBYA 3X1WA 4NZOA 3KJGA 4JBHA 4MHOA 4ARSA 5KTRA 5H0IA 2PFSA 1JR3D 4JBYA 4WKNA 4WXRA 4G0UA 3SQLA 3I6BA 3VSDA 1FXWA 2AEFA 1R8QA 2C7QA 1F9EA 4XVHA 4QODA 1K98A 3H9EO 3N58A 4JJ6A 3LOUA 3VR3D 1WIWA 3IVMA 3M9XA 1A7AA 1EFRD 1Q6YA 2AR9A 3BYZA 3FNRA 4BLSA 5HRUA 2DLCX 5IK2A 3MERA 1I1NA 3RFTA 4KAFA 4RE6A 1WMAA 1C9YA 2W71A 5C9ZA 2BFFA 5LYJB 1KSHA 1DB3A 1NATA 2YYSA 3RS0A 1JKIA 1U8FO 3KR0A 2VYVA 1QH1B 1ATZA 1P19A 5ISMA 1Z6QA 1HMPA 4DEXA 1KC3A 3H8JA 3PS9A 3ISVA 4MW4A 3SIPA 1KF0A 3BJZA 3EZ9A 3E61A 1LDNA 1KZYC 2WFLA 2C42A 3S7TA 3UCXA 2OT3B 5DRYA 1SO8A 1DIAA 1H1LA 3DOOA 1NAHA 1ZU4A 4R69A 1LH0A 1KL7A 3UC5A 4BIIA 4C1NA 4AJ9A 1Y8CA 1Q1BA 3E9RA 4EHNA 1BX1A 1XZCA 2O7NA 1HNNA 5B6IA 1TZJA 4OHFA 2PRZA 5AM2A 4J0EA 1A72A 2LKDA 1WEKA 1R88A 4NMHA 4EY3A 1ZMOA 1ZSNA 1CR6A 2C3OA 4NG5A 4YAFA 3VV2A 1SUWA 5IWCA 4GKKB 2OUIA 4CMGA 1VE5A 2HBYA 4B6OA 2XGJA 1IN8A 2IU3A 2K2WA 2ZPTX 5ARCA 5TQJA 2PMBA 4MZDA 1K2VN 1YK0A 1MJ5A 3ZS8A 4XQ0A 1AIPA 1ENOA 1WP4A 2GRUA 3DXXA 5D3QA 1SD2A 5LYJF 2G76A 3AJ9A 4F6CA 4UFOA 4LYGA 4RLHA 5EKXA 1R5OA 4ON9A 1H8HA 5B1YA 1KZ9A 4OMFG 1F2UB 1X92A 4HL6A 1NVEA 1JDTA 2IXAA 2RGNC 1PK7A 1YQGA 1VCHA 2QL5A 1CQPA 2SICE 1W47A 3JD1A 4FFLA 3NWPA 3Q72A 1EJ6A 1FDIA 2H2AA 2M32A 3HY6A 4JBXA 4N3NA 3MVEA 2EZ4A 1N6IA 4FDLA 3A4NA 4UD6A 4WINA 1YQUA 1QORA 1VIVA 3FUVA 4KGZA 4LXXA 2XVXA 3QWFA 4FE4A 2W8BB 4DSNA 4RTKA 4AKGA 1R7RA 3KQNA 4BCCA 2ADOA 1UC4B 2ZUWA 4FK8A 1IBLB 3TR5A 3MGAA 3O1JC 1T15A 2ATEA 3ND7A 3NRBA 5JASA 2CYAA 2GK7A 3W2IA 1E5VA 4BU1A 1E3MA 2OL4A 4BS9A 4EUEA 2C2WA 1UWLA 1NVVR 4TRNA 5DYWA 3DFIA 4XWTA 4W5NA 4JFRA 2VJQA 1HG0A 1NBMD 4L27A 4NHEA 5F5NA 5LB2A 3V6LA 3TSWA 1N3YA 1KJYA 2P5TB 1Q1NA 1YFZA 2H16A 1UEIA 3MFQA 4WEOA 5EMKA 3BZUA 1WCXA 4C89A 3RVJA 3KUDA 4YRRA 5ELMA 3ZIAA 1H2ZA 5A3QA 2O2XA 4ALKA 3L7YA 5JCJD 3WIBA 4TZ6A 1IJKA 2J6CA 4GP9A 5CFRA 5KMGB 3WL3A 1JPVA 4HEA1 3CONA 2WJVA 3N2NA 4HS4A 1L7QA 2IPNA 1OC2A 1P62B 3B5JA 5I8WA 1P1KA 1VECA 5T41A 1SZCA 1UBCA 4GH5A 3U49A 4M0DA 1L7XA 3GGSA 4OSOA 2GPAA 4PX3A 2XUDA 4C0AC 1FLVA 3K73O 2WSSD 4DBLE 4EFDA 2F1RA 3CJRA 4HFNA 4WOPA 3GJ4A 1IBRA 3JAWB 1WXWA 3JD0A 1HL3A 4A1OA 2FDCA 4WLVA 2O8FA 4N01A 4ZZIA 5C37A 3EGDB 3MWEB 5K0NA 5AVUA 3D6AA 1XTJA 3LWNA 3JQ8B 3UO8B 2Q4DA 2IYUA 3K09A 4DR3B 3AR5A 4Q1BA 4BOYA 3A2NA 2OQIA 4J6FA 3KDPA 3EG9B 3LLMA 4TKMA 1ZITA 1LJUA 3Q10A 3G88A 3BS4A 3NC1C 4L5CA 1NQ5A 2ZSKA 4FN5A 2BIFA 3MOGA 4GMDA 1LFDB 5LZ2A 3GYBA 5SICE 3ICEA 2OV8A 3SJ7A 1LDBA 1RHKA 3K0AA 1PJTA 4F2HA 3VXKA 5IC6A 3IAAA 1U8AA 2PLWA 2J5XA 5DYTA 2JLSA 3RV4A 1GFWA 3C3WA 4Y9TA 3WQHA 1QAOA 1YMQA 2X0RA 3HR7A 3P26A 4FGLA 4N8EA 4KH1A 4RADA 3RBZA 3I45A 1NDUA 2BM1A 1EZ4A 2VJMA 4LZNA 3C8DA 3ET5A 1ATIA 4X45A 4LJYA 4B85A 1DAMA 4I0WB 1T8WA 2GVDC 1E79D 1NVWQ 1B43A 1XNJA 3UBMA 1FDTA 3PEEA 4F1KA 1RYFA 1X7YB 4TRRA 3UXYA 1JEYB 1BWRA 1EX9A 1CUXA 1FNSA 3HO6A 3UAYA 3WL4A 2VDKB 5HWSA 1I24A 5JFGA 4LHYA 2MSDB 4RV4A 5TT1A 1C2YA 4F2PA 1G6HA 4G85A 4OKSA 2F2TA 2ZVQX 5ICEA 4TYNA 3PWTA 3FZGA 4PWYA 3G13A 3HPQA 2Q3DA 4E5MA 3O5AA 2NADA 3VSCA 4G0NA 1JMYA 3C98A 5TY0A 2BDTA 3NHAA 3VR4D 1V8DA 2YOGA 1D6JA 2WBLC 2Z8YM 3PITA 3WLLA 1I2ZA 3ZZNA 3HYSA 1WE2A 2QF7A 2O1EA 1U02A 1AKMA 3H9GA 1W85B 1Y6ZA 2BEJA 4YYZA 4BFLA 3I2HA 1E2DA 3N5KA 3EVNA 1QTQA 1S2DA 2QD2A 4JFAA 4PLYA 3BM5A 1Z0ZA 1PSDA 3R6GA 4KYUA 4DCJA 1S2IA 3SMVA 2AXNA 2YIVX 1ADCA 3U09A 3HWWA 4MROA 2HQ1A 2WWHA 2QA5A 3DD1A 3PPYA 1GSOA 2GEVA 1IVNA 4MITA 4BLRA 4PHGA 1E1CB 4LDQA 1RYYA 4N6GA 3ABRB 4MJLA 4XJSA 3ZR4B 3MWKA 2EKLA 2XADA 1EBBA 1YZLA 3EXG1 4RKRA 4JZKA 5DN6A 3G79A 2XSZD 3C2QA 1GU1A 3P2JA 5F21A 4B1FA 4D6YA 3UUFA 4BP1A 4EOGA 2QTMA 4QGGA 4IJVA 2J0EA 1ODLA 4MDFA 1J09A 4EI8A 3H83A 3DYBA 1QQ7A 1RW4A 2VTBA 1X1BA 4CYMA 4ZCIA 2GWRA 5FBVB 1C4XA 2PZBA 4O4IA 3I64A 1T0PA 3U4AA 1AA9A 2AOUA 4FJ0A 4X1YA 3Q3EA 1E0AA 3NWOA 3W5CA 4ZAZA 2P40A 3PFIA 2VBIA 3FWHA 4RK1A 1SCJA 3PXCX 4URUR 5D3ZA 1DJPA 4F5WA 3Q87B 3PD0A 4G9GA 3FOZA 4HOYA 3N7UA 9LDBA 2REXB 1ZSVA 5JROA 3MJHA 1ZCFA 2H4FA 4MVJA 5DHAA 2IODA 4LECA 3OF2A 3CEMA 4XPIB 1E8DA 2Z5FA 4AAYA 521PA 1I5OA 1S2GA 3G1WA 4EPRA 5HKAA 4QPPA 4K6KA 4PNPA 5KTSA 3QUQA 4MHSA 4CKEA 1F12A 2O3JA 3EC7A 4AZ3B 3PGMA 3A6FA 3COVA 5CBKA 5HKBA 1NG9A 3HK2A 3KYIB 1FXSA 4H9GA 3TLBA 1V1RB 3NBYC 3LECA 2O2ZA 4YXWD 5BN3B 1RAAA 4TGLA 1L4MA 4ZDWA 2X4DA 1YHYA 2HMSA 3TTUA 1G20B 2EW1A 5HQTA 3TMKA 1M73E 1DDIA 2Z2YA 3LLVA 1VIDA 4WV3A 4ERXA 4RD1A 4C5CA 4LTNA 3W2EA 4LBZA 1CE8B 3ZDCA 2F67A 2RHGB 2BZGA 1X74A 1Y9JA 2UVPB 1RC0A 4LJKA 3I73A 5E9JA 3ZNNA 5CDHA 3DCIA 2BI7A 5A05A 2QUKA 2AZ4A 4MWCA 3RUFA 4YAJA 2Q3MA 3OZDA 4L0QA 2PL3A 4CKCB 3G6WA 3GAMA 1Q7EA 3BXZA 4O0LA 3W3AD 2I2DA 3RK0A 2QORA 4R7TA 2HX1A 4FFBB 3CQ9A 2GXUA 3LBHA 4RANA 4RMJA 3IYLW 4NABA 3IBFA 1P5RA 2JCYA 4MDYA 2ZJYA 1A5BB 3PPVA 1CZRA 1H5NA 1Z0JA 2IBSA 2XY4A 1TLLA 1I2MA 4H77A 1OJLA 1M8FA 3IUMA 3K5HA 3CZ9A 4HG2A 2OWDA 4YP6A 4JZYA 4CQLA 3PL1A 3OP4A 3WWCA 1QRUA 3TW8A 2V74B 3HJAA 2PMDA 4R01A 1BOOA 5HBGA 3DAHA 2X8AA 1EEXB 3CNNA 2N0SA 2VIIA 3ONWA 4HFJA 2IPOA 4DTCA 4OSEA 4S0ZA 4X20A 5KNBH 3ZTYA 3IUYA 1Y3AA 2O8CB 2C7PA 3LJKA 2LIPA 1NVAA 4AIIA 2YFKA 3PWSA 4ZWNA 1PT8A 3H2GA 3F96A 4X61A 5KKNB 2WJPA 2YASA 1Q15A 1CEEA 5JVDB 3HKBB 1Z6PA 2GCPA 3BICA 4V0KA 3NQ41 2LCQA 5JDIA 2QWXA 3EC1A 2NXEA 4XIGS 2C3PA 3DNFA 1ZMXA 3L4SO 4HFRA 4WLNA 4DZTA 2Z98A 1P6QA 3HZRA 3L6CA 2W2OA 4LFAB 3WLIA 2OO3A 1HQDA 2C9BA 2W70A 5ES3A 3TGWA 3HI6A 3G0IA 5DSXA 3HTXA 1I8TA 3C70A 2ONYA 3JR7A 4R71A 3HQ4O 1GYRA 4TWZA 1Q7BA 3QKIA 3GFBA 1YWGO 4X3OA 4EGSA 2QJWA 3I9OA 3KYCB 4NVRA 1QGUB 2WQ6A 1OBHA 1OH6A 1H3FA 2DWQA 1PVOA 1IOZA 3JQ9C 4JUDX 1BKSB 3WLQA 1AZSC 2EU8A 6LDHA 3M2TA 1A4XA 4B3SB 3K96A 3QMMA 3NVAA 3VKFA 2P7IA 2UXCB 4Q3OA 1ODIA 5FYQA 4RPHA 1QOQB 2RAPA 3MJ4A 2HZBA 4MV9A 3R9KA 3S68A 1N32B 3I6ZA 3CKMA 1TCVA 5BO5A 5JVDF 5E8JA 3FNEA 5L7TA 3IJRA 1LB1B 3JPWA 1JA0A 1NMSA 4PSVA 3WQRA 1OQAA 1PS0A 1OYVA 4FSXA 1Z08A 4WWHA 4UBJA 5FV4A 1U04A 1UQRA 3EVAA 5DWDA 3REQA 3FCSB 2BCGY 5BPHA 3K8YA 3QBJA 4CHGA 4R4JA 1DAPA 1IBCA 1XYVA 1MJGM 1I4LD 5E1MA 2Q9CA 3CUTA 1WXXA 4NKRA 1HDCA 1PK9A 4XGNA 1OZAA 4DABA 4JP5A 3VNUA 4Z9YA 2NU7A 4WKBA 4EYKA 5K3AA 1GZVA 2BZ1A 4HAYA 4LVUA 1EG2A 1PUIA 1A76A 2JBWA 3V2HA 4BVJA 1AKWA 4EA7A 2ZAGA 2HM7A 5BSGA 2ZRNA 4FOLA 3ES9A 4C04A 3NDBB 5DCYA 3TJMA 4MI9A 4NZMA 4XGKA 2QTHA 4F2DA 4FW8A 4QUGA 5CYPA 3ROEA 3P2IA 3G9ZA 2GEJA 4M53A 4E4TA 1KKUA 1LX6A 3EVGA 3DWFA 4R1TA 2ZRLA 2BLLA 2I29A 1PJCA 2HWWA 1GKUB 1QFMA 1W94A 3U0BA 3A05A 4HLNA 1JWAB 2WIBA 2IEGA 3I30X 5H83A 4B8YA 3I8SA 2I8AA 2J4CA 2C31A 3SE0A 3HKEB 4FB4A 4LF4B 3C87A 3SC2A 2WD7A 2X13A 1JEQA 3NI2A 1CZHA 5CIYA 1CY0A 1KMQA 2IDMA 5AI6A 4GVPA 4BMNA 3DR3A 2HIAA 3JZIA 2XNDD 2BFCA 1W0JD 2OHXA 4L8GA 3VDQA 5L9AA 4UBLA 4UVEA 3MCWA 3PC7A 1DWPA 4GOND 2B9EA 4N76A 1TGYA 1V71A 2H8GA 2II6A 4M0EA 5E4TA 5FXMA 5D51S 1DC7A 3U7JA 1BVRA 1SOVA 4W4TA 4MLCA 4XAQA 1NQUA 2BPOA 4GX1A 4ZARA 2QT0A 3UFXB 1Y4SA 3DLBA 3NOXA 1HH4A 4YAWA 3RSZA 4HGYA 3R3VA 1JR4A 4I4IA 1PR9A 2KLBA 1X7WA 2FSIA 4RKFA 1N3IA 2QRHA 5CXSA 3W06A 5EWLB 2ISQA 4M3NA 5GJCA 4Q01A 3IQWA 3PKJA 3NHKA 2O0MA 1S2NA 2IHZA 4XUDA 1MORA 1LC0A 2BE7A 1WAMA 2FUG1 5KSWB 2W58A 3ED5A 3KB6A 4C20A 1J8VA 3CCCA 2QRGA 3DWGA 4WKGA 5CT4A 3ORQA 2F64A 3HJGA 2E1RA 1DRWA 1L7PA 5A4JA 5TDHA 3KQHA 4YMSA 3OUUA 3NATA 4MXDA 1TUBB 4EWLA 3Q7QA 1PR5A 4K5QA 4YECA 2D7DA 2IUEA 5AKKA 5BWMA 3CF4A 1BXGB 4EJSC 1T9BA 2Q46A 3OH8A 5JWOA 3IILA 5FJIA 3ND5A 2CC2A 3JAKB 3K16A 2ZR0A 3FPBA 4FTWA 4ZU1X 1SBQA 3QQPA 3N74A 5BOSA 5KNCA 1HLDA 3MUEA 4TTVA 1RJEA 5DISB 1NLMA 2V0CA 3QY9A 3E18A 3P52A 1RLJA 1QG2A 1QGDA 1E94E 2JJ8A 4PHFA 1WF6A 2DRIA 1RM4A 4R68A 1K5HA 1POWA 4HH3C 1CF9A 4ZQGA 4YLEA 3I37X 3JQEA 1TJPB 2GTHA 1I30A 3K0SA 5GV7A 4ZHSA 2XB2A 2J3JA 1NQVA 2RFLA 4PX9A 3HVRA 1PWXA 5FPQA 5ESWA 1P29A 1SELA 2YS7A 1G8PA 4UMDA 5G1PA 2YWEA 1Z8FA 1K6IA 1ND6A 3I52A 2FPKA 3WLSA 5EJ6A 2R84A 1L8XA 1BMFD 1X3LA 1XAIA 3ACBA 3A1CA 3ABQB 3HCRA 3IEIA 2N46A 3T9EA 4AKTA 4ESVA 1Y1TA 2JJ1A 4W5OA 4ONEA 5CX4A 2RI1A 1VJRA 4JL5A 5AVJA 3E1SA 1NJFA 4QQ8A 1LLCA 4UQPA 4ZEXA 4NEQA 3DTTA 4XYEA 3QVXA 3S5JA 4CQJA 4ER5A 3DZKA 1UFQA 4AC9A 4K6OA 2ETXA 5IS2A 1QHGA 1ODKA 4GI2A 2YNMC 5LDGA 2FDRA 4JSTA 5C3UA 3WGZA 3L7OA 4G0QA 3NUGA 1A4UA 1HTTA 2P9QA 4MRPA 3ENVA 2JHFA 3KYDA 3S8EA 2RG7A 2QN1A 1L3BA 1UBJS 2G9RA 1M34E 3ZD8A 1KK1A 2HO5A 2GPSA 5LP1A 3U1VA 3LCMA 2CLSA 5D7BA 1EQAA 2Y1DA 4CF7A 3MGGA 3FHCB 4XIYA 2NO1A 3HCDA 4DVJA 3E22B 3GCDA 3EBPA 2CFRA 4DCGA 4JN6B 1T1IA 4IMRA 1JDPA 2TRSB 2X2OA 1HE2A 1A50B 4PSAA 4ABYA 4OH7A 3Q6NA 2HA4A 3G2OA 3MLEA 1EFPA 1M1XB 4KFTA 5T4BA 3FVQA 4AP9A 1EUYA 2IYTA 4F4JA 4DC0A 1MN6A 3O95A 3BT7A 4YALA 1MVNA 4YXFA 4IOLA 2I2BA 2Q3LA 2H2GA 1USGA 4RH1A 5BV7A 4OFBA 1M1UA 4JEHA 3C5WP 1V26A 3K6JA 1EVIA 2IX9A 5EFOA 3K05A 2AX4A 1UJ5A 4G84A 3K32A 4PIPA 2D0OB 2JFGA 1V37A 3IMEA 3W5AA 1ETUA 3PEFA 3RM3A 4FGUA 3IB6A 1IXYA 4MAMA 1YUNA 2NUPB 3JZDA 1KYYA 4GX0A 1D2GA 1PNOA 3TNJA 3ACDA 3FJOA 3RLIA 3CMCO 2RH4A 3RVDA 4C2UA 1Y42X 5CFZA 2W37A 1BDMA 3CF0A 5FH9A 1HE8B 1OH5A 4EHLA 2VSNA 3M82A 3O2SB 1HSOA 4ZDKA 4GMHA 1WSAA 3EZNA 2OOSA 4Y2JA 3ORSA 5G0SA 4DR6B 5E7JA 2AFHE 3BJEA 2R68A 1D9XA 1YS9A 3HB7A 3QH4A 1W46A 3CO0S 1W6RA 3HA5A 4MGEA 1MP0A 1ZN7A 1NQOA 1B73A 5EI5A 2IXEA 4FYIA 2ZE7A 4HDOB 4P4UA 5CG1A 3K2IA 1LVGA 1CUUA 3T9CA 1YQTA 2NYAA 2ZUFA 2BUBA 5C31A 3Q5GA 5FTNA 4MEBA 4XB2A 4F9TA 5DNWA 3TL2A 1J2TA 1RMYA 4F4FA 1KFBB 5I47A 3UJ3X 3EUAA 2OZPA 3G1TA 1L7AA 4LJ6A 1YQQA 3JATA 4M7PA 2WT8A 1CNMA 2RHCA 5FOVA 4GD3Q 2RHTA 3PC2A 3IURA 4ND8B 3V8EA 3K0KA 2DT8A 5K51A 4C08A 2IUFA 4AO7A 3FB4A 4UATA 5LQMA 3PEWA 3WBJA 1Y3CE 2C95A 1JFRA 3R1IA 2C1XA 3WK4A 4ENQA 5DULA 2HUNA 5I7UA 4ZODA 3RLFA 2GOYA 1JLHA 4TWRA 3VTFA 5KI6A 3PNQA 3MTAA 5A2QA 1HX7A 4H6VA 3G2HA 4FR0A 5F5LA 1AOXA 1JIXA 5AXDA 3IR6A 3WGLA 2AWNA 1D1QA 1JAXA 1L7BA 3CRNA 5KTMA 1OH7A 5CVTA 1I7NA 5ALNA 4ZOLA 2XW6A 2JANA 3OESA 5FA6A 3BMNA 4ZQEA 1FP4A 2RH9B 2RDMA 1RDFA 1G6Q1 4IJ6A 5AK0A 2VDPB 2G0NA 3H05A 5HG0A 3BGDA 3JQFA 1Y4DE 1EFCA 2GM3A 2OSBA 1HDGO 4LYYA 3WKBA 4CWAA 3EXFA 4D9HA 4M9RA 3SU8A 2JIZD 3ZNPA 4CF4A 2K5UA 5IAEA 4HVTA 1K7CA 4G4SP 2OG2A 4BB5A 1T0HB 4BNZA 4YRNA 7ADHA 3MPOA 3LQFA 1E2FA 4GQAA 1GPJA 3AOGA 5F2EA 3TRKA 3HB5X 4HAOA 2CV2A 3WGVA 1EWTA 2PGOA 3SJUA 3EXG2 3DDUA 3KBBA 4FT2A 2MINB 5JQWA 4Q47A 2C5GA 1UAYA 2X1LA 1SXIA 1QCYA 2D2XA 3ZBPA 3N8NA 2J3LA 4C07A 2Q2OA 4C4OA 1I80A 2CFSA 5IULC 3FMGA 3KWMA 1VGQA 2BJHA 2VBGA 4KXUA 5LU8A 5K3OA 1CJVC 2E82A 4LX8A 2HHJA 1RWXA 1I2DA 5JNRA 1PLJA 5ITWA 2H6EA 3CRW1 4IILA 1V9SA 3TQRA 4DPKA 5H3LA 3EDMA 2P2ZA 2FR8C 3A70A 1N2HA 3P7MA 4K6GA 4J7XA 4WZAE 1JILA 1P8JA 5B3JA 3IQDB 3MRXA 6YASA 4YY3B 1RHUA 4PZPA 1F17A 1AO0A 2P65A 3JSXA 2NT3A 1E3WB 3JS5A 2ZIFA 4OM7A 2FGKA 2R6GA 3DMGA 4AG6A 1P0MA 2WWRA 1QV9A 4HVLA 4LOLA 3CVVA 3AJEA 4X95A 1PR1A 1J8FA 2VK2A 1KDTA 2AJBA 4RGBA 3FROA 1AE1A 4JLDA 1CT9A 3FVTA 1NJ5A 1Q2XA 1M1NA 1T5IA 3BE5A 5A03A 3ILHA 5JHGB 3QI7A 3MT8A 3QE0A 2YV3A 1P6UA 4BUZA 2FPPA 3N70A 4N3CA 4PO1A 3RF6A 1CF2O 3B1WA 3N7AA 2QV0A 3RJTA 4ZYWA 4X3PA 1F1JA 4DMUB 2FPIA 1K6EA 5KX5A 3EH2A 3CF6R 5COBA 4B32A 2JGIA 3N1UA 4LSMA 3UQYS 4NU5A 4PYJA 1M0WA 1K86A 4K3VA 1ZJ4A 4MLDA 1NI4A 2BFFB 4BLWA 3CVWA 5DTRA 2GA8A 2IZ0A 3IEUA 2XUGA 1AN0A 3LT2A 3OKAA 1IXZA 2OBBA 3F7NA 9MHTA 2O0LA 3L7IA 4CM9A 5KQGA 1Q84A 3I6QA 4HWSA 4I3GA 3OD1A 4TYYA 5LKAA 3ADCA 3INNA 1NNSA 2RSLA 2JAHA 4OJQA 6PFKA 3PVZA 1GGVA 1SUDA 1LVHA 5DX8A 3L06A 1W75A 1GQSA 1H1LB 2YWCA 1JRLA 2AHOA 3BQ9A 3TQHA 4Z54A 3FCOA 1G1MA 1V45E 1CUGA 3DMRA 4C6TA 5KPJA 1C3VA 1WB5A 4JWTA 1PJQA 3OQ1A 1XLUA 4P8RA 1SUSA 1Z4QA 3C1OA 3FWNA 3H2ZA 3TPFA 4WZBA 3ESYA 3BSSA 1T1EA 3WYBA 3QU5A 3F3MA 3NV7A 4AZSA 2V9PA 1WDWB 3TVDA 5CH5A 1RACA 3D7KA 3WMFA 5F9FA 2IUYA 1DLJA 4PAQA 1WZIA 2WC1A 2QBYB 4D5GA 4HN4B 3FWKA 4Z9BA 3RRZA 3T1HB 3QU7A 1KOGA 3LYAA 2V1UA 1KP9A 2HA0A 2XT0A 1FC0A 2QSZA 4KK3A 1NF8A 3RKSA 3JZFA 3PT9A 3UJDA 4BNDB 4LISA 4Z3OA 2X2EA 2VSYA 1HWYA 1R6VA 1I4DD 5DHPA 1JZSA 1UXKA 2NO9A 1GR1A 4DSTA 5EMNA 1WMEA 1YJBA 1EDDA 4Y67A 4Q05A 3SPXA 1HYGA 4ZI5A 4WE3A 1GA1A 2DLDA 4C43A 1FU4A 1UFOA 4L2IA 2WDPA 5FPHA 3KO8A 3HU5A 2VZLA 3W9BA 4Q34A 3C8HA 4PNEA 1EH5A 1SXJA 2GJAA 1YJ5A 3O1LA 4P58A 2X0IA 1H8ED 4XQ9A 1CXZA 2VS1A 3A1UA 4DLSA 1PUXA 1YJQA 3AW9A 5IP5A 2W2LD 3AUYA 3UH1A 3ZZUA 5F5XA 2J0VA 3H7IA 1E1YA 3ZJVA 1DXQA 3IULA 3UW1A 4BZPA 4BECA 2XMBA 1U7WA 3X1MA 1GG2A 1JGTA 1G5PA 3PT5A 1YBFA 2DPLA 2VWPA 4ZYLA 2O4CA 1N0VC 1UCFA 3T1NA 2FZ4A 4U39A 1XD2A 1HZZC 4BO9A 1UK9A 1WPGA 5FRDA 3LCJA 1XXHA 5I01A 3GAZA 4W9MC 4FSHA 1LLFA 4CEHA 3CX4A 2AL7A 5KQLA 1E6EA 5DE3A 1X7ZA 3QNMA 4YREA 1Z8DA 2ZUSA 2PZKA 3CKYA 1KRHA 4NCXA 5CDUA 4WI1A 1P7PA 2PO7A 4RGYA 2AG1A 5K20A 4QNRA 3OM8A 2PIAA 4YCSA 5EP1A 2O8FB 3VISA 1N2CE 3L1HA 2WG0A 1T8PA 2VCEA 1AG9A 1X7XB 3BB3A 2O50A 3OPMA 4KDEA 4RZQA 2YZGA 3WWEA 3KVYA 1S8FA 1KOLA 5HPYB 3SK0A 2IU6A 4QEDA 1IQ0A 1F8YA 2XYPA 1MRZA 4WFQA 5IVDA 1GNQA 1W76A 2GT1A 2LXNA 4NOMA 4DDHA 3K5PA 2V7GA 2Z8YA 3H2YA 1IULA 3RS7A 2UUBB 3TDKA 5JRZA 1ZNZA 2PKCA 2R9VA 5CJJA 3BA6A 4IIFA 5BWCA 3QV1A 5IRCD 3QMWA 3SVTA 2FVXA 5B7QA 2DJ5A 2Q0HA 1ZH6A 3PNKA 3K0AB 1XD8A 3RIXA 3OAAD 1E0KA 1PHPA 2EBHX 2O2JA 2POQX 1NW7A 4NBLA 3L8HA 2ZAIA 3RODA 2JFYA 1XLTA 5ENZA 5CBPB 3WDLA 2EHJA 1QCZA 1VJ1A 3PQ8A 2IV7A 3MD0A 3QVSA 5EZYA 4IIXA 2VJMB 5D3MA 3KSAC 3IDQA 1T4CA 2XIJA 4N8DA 2IYOA 4QIHA 2G04A 3NWEA 1K0UA 3HN7A 1SBYA 3U3XA 1H42A 2DUUA 2YXDA 4F4CA 1ZW6A 2WJAA 3NU1A 2AEEA 3KUCA 4WACA 4PZLA 2Y05A 1NM5A 1OOEA 1PQYA 2D1TA 1RQPA 2ZAMA 2J9RA 4H08A 4I4NA 4H4CA 3WVNA 1S2MA 5IZCA 4BKPA 3GDGA 3HP7A 2JVJA 2J3MA 5ILGA 4EG1A 1GNVA 5FL7A 3C3DA 5KWEA 2BL4A 2FW8A 4AJIA 1AJEA 1P80A 2UVDA 1R64A 5DEIA 4NHOA 1Y6QA 4R1PA 2EFJA 3D4OA 4RSMA 3ZKAA 3OC0A 3LY7A 2I2CA 2DXIA 2FZEA 1RYDA 3MJCA 4JLMA 5DM1A 2B4QA 1BE1A 1ZU5A 3L8GA 2O6LA 1N9ZA 3NFYA 3R6LA 1W5EA 4GHWA 4I5GA 4WBSA 3DQQA 1TEHA 2PSJA 2V7QD 4MKIA 1DBIA 1T35A 1KGDA 5FEUA 2B1JA 2Q2VA 2HADA 3I34X 1L9KA 2YR0A 1TZMA 1M6WA 3LQRA 3TLXA 3SEFA 3VNAA 4TZ0A 3PYXA 3WADA 1H6BA 2A9QA 4WY2A 3A0RB 3A28A 3BIWA 4TKUA 3PIRA 3F1KA 3GUVA 1CY4A 1F8XA 2ZI7A 5AD1A 3GCWA 1GKIA 3FRHA 3AP2A 1J2YA 4O63O 4Q93A 3CZRA 4DWOA 4HB4A 3G8AA 2VTBB 3CEAA 4XH9B 1B3BA 3AF1A 4KR0A 4O4IB 2NOAA 1J9ZA 4QDTA 2AOUB 3L40A 1OZ0A 4X1YB 5DDIP 2DGDA 5AI5A 5A3VA 3OZVA 1W48A 2ZM5A 3OE1A 3E2IA 3VR5D 4Z5XA 1JDVA 1SB8A 1GUFA 2SCUA 4HH0A 4TT3A 5SY6A 3ZU3A 1OI2A 2GZHA 5A9RA 3AJ8A 1FTGA 4E3ZA 1U9IA 4NR0A 4ZVRA 4GC9A 3DAYA 4PX2A 4B73A 2DFTA 3DV9A 2H06A 5JXHA 3N6RA 4A0RA 5J2UA 1Z16A 2IP1A 2ALJA 2YFHA 4PQFA 3VO8A 3INTA 1XX6A 1UC9A 4IS2A 4WY5A 5HKOA 2PM8A 1VI5A 4HRYA 5DU2A 3UT6A 3WOVA 2Q1WA 4KN6A 2ZR8A 4MKHA 4GZMA 3R7BA 1MT3A 1GKKA 1Q50A 3GUYA 4MOWA 3COJA 4HQFA 3BD9A 4WGGA 3IEKA 3T5TA 3DS8A 3EXHA 2RGRA 4CKEB 3LL7A 4UEJA 2V5AA 4KLNA 2C4NA 1Y3HA 5I9LA 2ZYGA 5BW4A 1E3SA 4IMPA 1E2LA 1LLDA 2FW9A 4NS1A 2W6JD 1NZJA 1P9NA 3K1YA 3IJEB 1PFKA 2W6QA 4IXMA 3A9VA 4QQFA 3RHZA 2JIMA 2IIPA 3UMGA 3BD7A 3NNNA 1M2KA 4GR9A 3HCNA 4HN9A 1Z2OX 1ZIYA 2O3TA 5E9AA 3R41A 4MVJF 1GAEO 1OWLA 2CNLA 2DFDA 3KUKA 1AKUA 2V4UA 2FN9A 2FFAA 4ENWA 5JYBA 2R4UA 2YQ5A 3PC4A 4Q4CA 1OBVA 2J08A 3EDCA 2V7TA 1Q0ZA 3H3JA 3OEWA 3CKKA 1F2DA 1HSZA 4QHTA 5KYUA 4QFBA 5J63A 4LVOA 2HJSA 5JCOA 4DMGA 2R8RA 3JVEA 1KPIA 1CETA 1A95A 4ZKEA 3R0QA 3B36A 4UUQA 3U3JA 2O1XA 3ISTA 3SM3A 2K7FA 3EGEA 4MJ3A 5HKKD 4JCCA 2BHRA 1QIKA 1XDWA 2EWMA 4MV8A 3NYIA 2W6OA 4M6WA 4LJ4A 1FYEA 4FHDA 4YA6A 1J0AA 2WYOA 3F4KA 5KOIA 2XV1A 5DIZA 2IYLD 3PC3A 2RAVA 4MGIR 4CQLB 1YE3A 3RC1A 4ES6A 1Y3FE 1DARA 1QHNA 1WUHS 3ZX5A 1FTSA 3PI6A 4Q9HA 1VMDA 4WLUA 3TW8B 2YX1A 2LUOA 1SCKA 2YYAA 2MT9A 2VA8A 2IELA 2YJ5A 4HDSA 4OBWA 2FEOA 4P4TA 4EKDA 2V65A 3O0TA 4TLBA 4UNSA 4X20B 3KHUA 4QOGA 1IIRA 3JV7A 2VT6A 2PZGA 5BXQC 2E7ZA 3W5BA 5DLYA 1BSVA 3JALA 5ALEA 1VBNA 2ZXFA 1ANKA 4GKVA 4WECA 1I36A 1H2YA 1VP3A 1NR5A 4U3JA 5AICA 2MYPA 2QMUA 2IZ5A 2RHWA 1SR8A 2QTBA 1VPDA 1H9BA 2OQRA 4JVNA 1MJGA 1U0TA 3BD8A 2NMVA 5KZMB 2GR9A 3FPGA 3A4LA 1LF5A 2WWXA 4I8IA 4BNHA 5K01A 1CQWA 3DKKA 2P1RA 2YHSA 1U0EA 2ZBGA 3NPMA 4N0EA 4ESHA 3FPFA 1O94C 4B3RB 1E20A 1P2BA 1KJNA 1XJCA 4R83A 4F9GA 5E4FA 3KQTA 2ZSFA 1X6VA 3L82B 4G4IA 3ETGA 1MG5A 4B0OA 3FSEA 4BJHB 2IT1A 4EX6A 4P5PA 1R0WA 2FPGA 3W2HA 3DE6X 3H04A 2AKEA 2XUFA 4DJAA 2Z2XA 5EP2A 1ZWLA 3A26A 4A16A 2O59A 4I19A 1U2DA 1ISFA 3HWSA 1D2NA 1U2GC 1H93A 1VKZA 1XP5A 4TMYA 2FMFA 3OQJA 4UMFA 1XMJA 3O83A 1D2HA 2BHNA 4BY9E 1JU9A 5BQPA 4EPXA 4GOKA 1DKOA 1F0PA 3ZE9A 2O4UX 1JHPA 4KFUA 5F3WB 4JJAA 2MSNA 3BORA 3REQB 4YMLA 2JB9A 2O3QA 2GKGA 2IOQA 4TMFA 3TB6A 2HBRA 1NLFA 3MHPA 1EHCA 5GVRA 4D25A 2G0AA 3WFZA 3VA7A 1N2BA 3MILA 1AKTA 2ATIA 3EW7A 5KTYA 1HE5A 2IIVA 2QEQA 1G5TA 2NU7B 5EJ5A 1I7DA 5AOVA 2D1RA 4PN7A 5IFKA 1EJBA 4JR1A 2XZDA 2WU3A 2E55A 3H8VA 3D9QX 4XEHA 4CMEA 4B80A 1IXSB 1ZK2A 4G41A 1T6YA 3OZXA 4TL6A 1DAOA 4HP8A 2BF4A 1S8NA 2Z2ZA 4XR9A 3HA2A 1UXGA 2Q4TA 5H9WA 1UPFA 3DBRA 1Y6JA 1LX7A 1MKYA 1QGYA 4XLZA 3BRCA 1SBIA 3F2IA 3SP1A 4URZR 1FX1A 1VLHA 2DHQA 3ELDA 4I2VA 5HRAA 2A1UA 3SM9A 1EK5A 1ZLXA 2ZITA 3QIAA 4JBGA 2E4UA 2R1VA 3RPEA 4HNHA 1IN6A 3NV9A