2ZI6A

C4s dck variant of dck in complex with d-da+udp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
241
structure length
217
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deoxycytidine kinase
publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 217
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi6A00
4DDWA 2GF9A 4KFRA 4KBFA 4M21A 1CR0A 3ZD7A 2QSYA 3U60B 5FOVA 1XRJA 2FEMA 3LWNA 1BOFA 2A9KA 3TQFA 3U5ZB 5G3YA 4BLSA 2O8FA 1FNNA 2NGRA 2Z4SA 4Q9JA 3J81k 1JR3E 3GD7A 1V43A 4Q02A 3LBNA 3DEFA 1PZNA 4A2WA 2ZRHA 3KJGA 3FFAA 3HR8A 3LD9A 1SXJC 2CNWA 5BW8A 2C9CA 1J8YF 1U2RA 1NVXQ 5A4JA 5DNYB 2QP9X 3CPHA 2VHTA 1K5GA 5AJYA 3U3MA 2CCGA 2X19A 4GPTA 1G8HA 4KLNA 1LFDB 1S8FA 1TADA 4MITA 4Q01A 4BUJA 4EQ6A 1T3SA 1D2MA 4X8OA 4QC2A 4Q9HA 4CGZA 4G5OA 2KJQA 2P5TB 3NBYC 1IXRC 1DAGA 3TMKA 3GLFB 1GAJA 1L8QA 1DAMA 5F3WB 3A4LA 4DJTA 3VR3A 4FW9A 4Q5IA 4EFLA 5J5CA 1IHUA 4GBMA 2QPOA 5CDFE 1M74A 3QEJA 4Q4JA 2ZAMA 4D4JA 2QN6A 3TJZA 3C14C 3QXCA 2LKDA 1S9HA 1ZM3A 1L2TA 3CH4B 4HDOB 1OPXA 1CR4A 2JLQA 2OBNA 3LQRA 1V5WA 2ZJOA 5HKKD 1JAHA 2QY9A 3IPXA 3BB1A 3PUYA 3SR0A 3WYFA 2UZ3A 3P27A 4P4UA 3W6PA 1ZNWA 2WJJA 4KCGA 5JMTA 4DZZA 1YVDA 2FV8A 5K8TA 2ZRPA 1NSTA 3GCGA 2OXCA 1NMZA 4I99A 3WMFA 3U7HB 3FMPB 5FPTA 3CRVA 2GEDA 4B3BA 4Q7MB 2RKOA 3IBYA 1VYVA 2N1BA 3WHKA 4IFEA 4HLUC 1BMFA 4XWAA 1IY0A 3K8YA 1JECA 2AHOA 2GEVA 4TLAA 3ADBA 1GILA 4NYMQ 2O8FB 3EG5A 3BWDD 1E4YA 3H4MA 3M0EA 4FMCF 4C30A 1OXUA 1YRAA 1G7SA 4B6FA 1XJ0A 3GFPA 4G5RA 1ZM9A 1S0UA 4QGHA 1N25A 4R71A 2YV5A 1UKVY 1ZMXA 2MSCB 2P5SA 4BFTA 2QAGA 4FCVA 3QUSA 2ODBA 3FMIA 2BKEA 1DADA 5EZ6B 3AGPA 1IN6A 2YINC 4XD7A 4KODA 4EPTA 4AYXA 2V6IA 2H18A 3FHCB 3UATA 3K9GA 1RYFA 3PUWA 4EPVA 2ZM5A 1E2PA 3IQXA 1IQPA 1JR6A 3G0HA 3LQQA 4V03A 2OAP1 3AKYA 4ZDWA 2V9PA 5FL3A 4GZLA 1G8GA 4ZV4A 2CNWD 5CB8A 1QBKC 3TVTA 1XEFA 5JEEA 3TSOA 1UBFA 4RJLA 1Q1ZA 2HJGA 2X1VA 3KXLA 5LBIA 5FPYA 2ZS8A 4M1OA 1PUIA 3GLFE 3VHXA 1K6MA 1ZAKA 1RIFA 4Q1BA 2PBRA 5CM9C 2N42A 3K0CA 4FIDA 3THXB 2P0EA 1TPZA 3CRMA 2Z4RA 4PTLA 2F43A 1NN0A 2FX3A 3I61A 4Z54A 1W0KD 1OXSC 1RJ9A 5J4KA 3A1SA 1J90A 1SGWA 4KFUA 1LTQA 3O47A 3L0OA 1UEJA 2FF7A 4A6XA 2V54A 4OQMA 4D0NA 4DSNA 1OJLA 2OCBA 4BASA 2J7PD 1C4OA 5EP2A 1M7BA 2EFDB 1DO0A 2W6JA 3OEHA 1Q0UA 3AGQA 5FOTA 2DB3A 4UXHA 4IVQA 1W36B 3MWLA 3FHOA 2OM2A 4MRSA 3DOEA 2B7CA 1YZGA 3B9PA 2XTNA 3ZVNA 1WRBA 3NEJA 1F2UB 1Z22A 4Q19A 3EXAA 4QBFA 2W58A 1N3BA 5FBWB 4WOPA 3C41J 4LJ9A 4F91B 4W5HA 4NCNA 3PEVA 3I8XA 5HZHA 2JLSA 2J0VA 2WPDA 4MGZR 1S3SA 4KAXA 3K53A 1JBKA 3EZ7A 2JLRA 3IILA 1BMFD 5JCZA 3GLIA 3BJIC 2J59A 5K8IA 2C96A 4M1KA 4MQBA 5EJEA 4M4SA 5EP4A 5L3SA 2XNSA 4LI0A 1DAHA 3RDPA 1G64A 2F1HA 1M1YE 3FDIA 2WAXA 1Z83A 1B0UA 2GXSA 4E22A 4KFSA 3VKWA 2GVZC 1KI8A 4C0QC 4GRAA 1X8KA 4C7OA 3BBPA 4O3MA 4BZPA 2OO7A 2O8CB 2FPMA 2FOLA 3GLHA 1UBGA 3PEWA 4QHTA 2ZIAA 4DLXA 1ZUNB 4RSGA 1NN1A 4XD7D 1ZCAA 2BMEA 2VHJA 4B44A 4TMTA 1AQYA 2F55A 4V0KA 4I1SA 1G41A 1GDDA 2R8RA 3CR8A 1XMJA 1Z07A 4TL7A 5FBRB 2YWGA 4JLDA 3BGWA 1NVWQ 2F1JA 4HDCA 2G0NA 3CRQA 4POAA 1SKQA 4DUGA 1P3JA 2VH5R 2ZR7A 2CK3D 1OKKD 2ANBA 5FTMA 1A2BA 2X77A 4TLBA 5JECA 1AKYA 1HE8B 3QG5A 4QGGA 4ZI3A 2O8EB 2DFLA 2QI9C 3QF7A 4UNNA 2WWIA 3QQ5A 4TSFD 4KFTA 3PIRA 2CE7A 1NJFA 2XB2A 1ZBDA 4LWZA 2ZUBA 1E79A 4G5SA 4R9UC 3KFVA 3N5CA 3ZZUA 1Y3AA 4ZKDA 5CIQA 2RMKA 3AM1A 2AXNA 2FN4A 4V0LA 4YMWA 1T3LA 2Z43A 4HUTA 4B34A 3UWOA 4CEHA 4K8OA 4WXRA 4IDPA 5C18A 4LK2A 4OI1A 5FI1B 2W00A 1QDEA 1AS3A 4Z1MD 3K0FA 3FMFA 1U99A 1KJWA 1YKSA 3NH9A 3QPUA 4YMSA 5KOYA 1DTSA 2WZQA 4QOSA 2VHQA 2W6JD 1GL9B 2FWRA 4MH0R 3ZZ0A 2CXXA 3DMNA 1PLLA 1LB1B 4WW0A 4OHYA 3UWKA 5KDLA 4ERNA 4ESVA 3VR1A 3RC3A 3CKLA 3K09A 6Q21A 1KSFX 5H1YA 2ZI6A 2GVDC 2H5EA 1GSIA 1KDRA 4LJYA 3PENA 1KO7A 2P67A 3PUXA 1Z63A 5E4FA 2H1LA 1Z0KA 2WJHA 4TZ0A 2VF7A 1NN3A 1Z6XA 1E2IA 4NYJQ 5JBQA 4HLQB 1F2TB 1K8RA 4CEJA 1E0JA 1FTNA 4OQLA 4A8JC 1LF5A 5FTJA 5JZVA 3U44A 4D4MA 1N6OA 3WNDA 5JI2E 3NC0C 3FFBA 4YMVA 2XSZA 2NMVA 2A2ZA 2B8TA 2OBLA 2QPAA 3Q8XB 1X3SA 1VYTA 1HT2E 2GHIA 1J8MF 4JS0A 3UG6A 5DN6A 4D26A 2IYQA 2XZLA 4JMPA 2D74A 3A36A 1HEIA 4GP7A 1U8AA 1Z0JA 1G8FA 4CF7A 4JKYA 4LDJA 2L0XA 3K70D 1XTKA 2BHRA 2GBLA 1GNRA 2FMXA 2J0UB 1UBCA 1AKEA 1Q21A 1A2KC 2CCKA 3RSOA 3EIEA 1R8QA 3OE7D 1OH6A 4NL4H 3U61B 3CZQA 3CLVA 4GOJA 3IIJA 3MWYW 1EFTA 1E94E 1OSNA 4G0NA 4Z8XA 3THWA 3B78A 4OL0A 2ZR0A 4G1UC 1ZJ6A 4UXIA 4DUGD 4BFXA 2WSMA 2VQSA 1KSGA 4L8GA 1R2QA 4BZXA 5FBLB 1G291 4W9MC 3SNHA 1ZIPA 3LLMA 1XTRA 1Z2CA 1Z0AA 1ZINA 3ND9A 1G16A 3DHWC 4IVPA 3FOZA 1OH8A 1HYQA 2ZRAA 4HAWA 2XGJA 1XMIA 4Q7LA 2W0SA 2QUZA 1QHXA 3V4FA 2V3CC 1IY1A 4B43A 1U0JA 2VIIA 1X8JA 2QPTA 5DI9A 2YVUA 2X2EA 1BKDR 2W2TA 1VDZA 1DAKA 2I4IA 5KDDA 2EFEB 1NNEA 4LPKA 2ZVQX 1E98A 3GEIA 1MABA 4JLJA 3PJRA 2IS6A 2PT5A 4A92A 3K9LA 4LUCA 3QBVA 3TE6A 3B60A 2HYDA 3OIUA 4IHQA 2BOVA 4Q4HA 1KO5A 2BJVA 1VCMA 3U44B 1NY5A 4MRRA 1TQ2A 2UKDA 3FE2A 3KJEA 3WRXC 4RKEA 1R8SA 1G8YA 1H8EA 1RRPA 2F1RA 3DL0A 4LJ4A 5TB5A 3W6OA 5GVSA 1D9ZA 1YR8A 2AK3A 3BE4A 3MLEA 3SOPA 3W3ZB 4D81A 3EA0A 2J1LA 2F3TA 4YONB 3IHWA 4HZUB 121PA 3B1XA 3HYTA 3A37A 1GG2A 1YU9A 3I73A 3IUYA 1VHLA 4JVMA 2QGNA 3ASZA 3V00A 1P2UA 1S4QA 2PH1A 1XZQA 2WICA 4OJKA 3DO6A 2IS2A 2IUUA 4E5UA 2FE4A 1E9RA 5IK2A 4BQSA 1XXHA 1QHIA 2H16A 1KTVA 2QORA 1N6RA 4QJ4A 1NI3A 3D6TB 1KKLA 4JYCA 3KTAB 1R5NA 1SHZA 4QRHA 2XOKA 4QKQA 4B3XA 3TK1A 3C5HA 3HPRA 1TQDA 4BRWA 1N0WA 5GADl 4TT3A 4DLUA 1J7KA 1OFTA 5AJWA 2RCNA 4L9SA 1ZRHA 3ICQB 1UBEA 4CRWB 3HP1A 2WJYA 1TQ4A 4Q7KA 4IFBA 1W48A 3IHLA 5EUMA 1DG1G 3LY5A 1Q1EA 4H9GA 1CRPA 1DAFA 2REOA 4RCZA 4XTRA 3QEOA 1VG1A 3UIEA 1TF7A 4R98A 1XMSA 1NY6A 2JDID 2OHFA 2ZROA 3B6EA 4XOIA 2IYLD 1XFAA 3CZPA 5BN3A 2FFHA 5TMPA 2BCJQ 1W0JA 2CLDX 4TL9A 3GJ3A 1MABB 1ZC3A 1JR3A 2A30A 2IYUA 3E2IA 4GOXA 1KMQA 2IEZA 5FOUA 1A1VA 5EE1A 1ESMA 1WXQA 3T1VA 3QE0A 1Z8FA 3I1FA 5B58C 2GEUA 4TL6A 2AN9A 4N0EA 3FVQA 3MRSA 4OK6A 3E70C 4JVLA 1KMHA 5KNBA 1TF5A 1QHGA 1RPZA 2BDTA 3KKOA 4X8MA 1W44A 1R0YA 1MO5A 3U3KA 3CR7A 4ZIRB 2ZSEA 3LO5A 3AF4A 4LGMA 1XJCA 2FSGA 2GJAA 3PUZA 5JHHB 5AUNB 4NYIR 2J45A 5D3MA 4K81B 2V7QD 2BJWA 5FUYA 3FWYA 3QXXA 4N0DA 2MMCA 2VHCA 2VSXA 4LV5B 4DCSA 4MKFA 3HU2A 1OE0A 3ZIAD 5HPYB 5EQTA 3UXMA 2WOOA 1BO6A 2GILA 2J46A 1DS6A 2QT0A 1QG2A 3LX8A 4C3ZA 2HUPA 3GEHA 1TF2A 4PQYA 1MO3A 2OLKA 2JLYA 4AKIA 3I3SR 2ORVA 2ZRFA 4U5XA 1G7CA 1R0ZA 2FFQA 3QVUA 3W6NA 3FHTA 2ZITA 3P4XA 1ZUHA 3ZVLA 2HDNB 3AVUA 2W6IA 4AG6A 1XZPA 3EZFA 3KQNA 4OHVA 4Q4AA 3WP0A 4PX9A 4G01B 1T0HB 1XDBA 3MFYA 3NIBA 1G5TA 4IXNA 4XH9B 3K0AB 3RLFA 3AEZA 5AK0A 5IK2D 3I92A 3Q5EA 5EE9A 2QE7A 3ZQJA 4TN1A 2QEQA 2R9VA 4NZYA 4Q00A 1KJYA 3EZ2A 5FOXA 5IHPA 4URXR 4MDEA 1HQYE 1UEIA 3JVUA 1EX6A 1T9HA 4TT3D 1Z3IX 1XMVA 2A7QA 3CF0A 4B3CA 3TQCA 2BWJA 2DHRA 1G20E 4IDOA 3BD9A 4BLRA 3VR4A 4D80A 4OHXA 1T4GA 1P2SA 2XJ4A 4WVFA 3KX2A 4OQXA 4DSUA 2B6HA 2ZYVX 1CJKC 1G4AE 1OT3A 2RGAA 1GFIA 1KKMA 4B73A 1JR3D 4GFDA 2C04A 1YQTA 2CHVA 4NMMA 2PX3A 5LB2A 4F92B 2RGNA 2EWWA 2XITA 4FCTA 4F7WA 3I4LA 4LZZA 1E6CA 2GCPA 2Y8EA 4PC2A 2GXQA 4M1TA 2A5DA 2YNMA 4AKGA 3IGFA 5B30A 2IWRA 4LYJA 2C9OA 4DKXA 1N5KA 4L16A 3GJ8A 3GLFA 1LVGA 2FJUA 2VL7A 2G0TA 2Q3MA 3VX4A 5ELXA 2B92A 5CB6A 4M9XA 1N5JA 1XTJA 4HUQA 4EJSC 2CE2X 3W9YA 3FPAA 4LBWA 3SFZA 4NKRA 2GDJA 5JCPA 4A2PA 1KI4A 1X1RA 3KDSE 2BBSA 3IDQA 2ZUCA 5CLQA 2BCGY 3C15C 1F5NA 1VG0B 2BEJA 1Q57A 5AJXA 4NYMR 5B2ZA 4A0GA 5IRCD 4HLUA 3SE0A 3AVVA 2ZE7A 4BFVA 621PA 4DCNA 1TAGA 4AWXA 1PV4A 4EFMA 2W2XA 4CIDA 4QNRA 4CYMA 2A5GA 3RANA 3KJIA 2JASA 3T1QA 2WIBA 2FPKA 4DLVA 2ZJBA 1U81A 3MD0A 1YZLA 1SXJB 3T5GA 3NBZC 1FUKA 1C9KA 1W2GA 2QQEA 3AVYA 1E2NA 2IWHA 5DE3A 3BOSA 2ZREA 5LPNA 4PPFA 4QGFA 2EW1A 2IL1A 3BXZA 4KVAA 2JCSA 2DBYA 1ANKA 1MO4A 3B1WA 4JJKA 2D7CA 4HI0E 3RC8A 4C9BA 2ZJAA 3CPJB 3CX6A 4MRVA 3NDBB 2QMEA 1SVIA 3HWSA 4RD6A 3SBDA 3U6KA 2SHKA 3TGPA 3I72A 1JQJC 2HF9A 4M9ZA 4AKEA 1ZUIA 4Z51A 3CNOA 2ZJYA 1WF3A 2OSBA 1HY3A 1OXVA 2NZ8A 2E1RA 2FGJA 3BFXA 2VP2A 3GEEA 3LA6A 4LSGA 5A0FA 1G18A 1W2HA 2R6FA 3QKSA 4KV9A 1ZM4A 1SQ5A 2DFTA 1TU4A 1XF9A 3KZ1E 4ILEA 4II7A 4JL5A 2VP0A 4ASUD 1E69A 1RVDA 4YXWD 3PXGA 5KSOA 4PHFA 3RRNA 4JL8A 3JZMA 3BS4A 4QBGB 4DHEA 2VRWA 4LC1A 4QBIA 3SU8A 1VHTA 4DDTA 1NLFA 1L4YA 4HUQB 2MMGA 3TAUA 1KIMA 3A1VA 4Q48A 3QY0A 4PSVA 3T34A 4EFNA 3SZRA 2OUKA 1DE0A 4GT1A 4TMZA 4MYUA 1NIJA 1W4BA 3KQKA 4PPGA 3OIWA 2GXUA 5JJIA 5F9FA 1G6OA 3KQLA 2PLFA 3THXA 4DT1B 1S1CA 1YHNA 2EYQA 3BH6A 2B7BA 4DCTA 1DELA 3KL4A 4RFSB 2Z5FA 1HTWA 2IA5A 2WWWA 4PPQA 3TH5A 2DR3A 2QU8A 1XD2A 4JJZA 2QMHA 2YC4C 1DPFA 4A0HA 5H70A 4HAUA 5BYKA 2R6CA 1X6VA 2RHMA 5FL7A 1E99A 2AFHE 5KU1A 3P1JA 4CT4B 3IBGA 1HURA 1NG9A 1FPMA 2D4HA 3KQUA 4A36A 5FTKA 3WP1B 4PO8A 3SJCA 1F2UA 1MRSA 1YZNA 4RZ3A 3THYB 2IYSA 2OEPA 1SXJE 4QJ3A 5SZIA 4ZCMA 2WWFA 1XEXB 1D2EA 3DPUA 1PVOA 2OILA 3RYTC 4DBLC 4FWTA 5JSZA 2JEOA 4JSTA 2IF0A 4H1UA 5HE9A 2AD1A 2EU8A 1U9IC 1VIYA 1HUQA 4AY2A 4PFSA 1P2TA 2YYZA 3DKVA 3QSYA 3QKSB 2GA8A 4HB4A 2ZE5A 3TNFA 1DBSA 3GJXC 4DLSA 1K5DA 2NIPA 3HR7A 3ZD6A 3WRYC 4Q1CA 2JJ2A 3BB4A 2WKQA 1W4AA 1TL7C 4LCBA 2KSQA 3RS2A 3Q85A 1GZSA 1E2QA 4ZCLA 1CIPA 4O2RA 2EVWX 1CKEA 4KLZA 3RSLA 2WWHA 4P4SB 2O8CA 2ZRGA 1IY2A 4HLDA 2CHGA 3SYLA 2WMNB 2IT1A 2V55B 3MUFA 4IJMA 1BIFA 1EK0A 1GITA 1KO4A 2A5FA 1G5RA 4FMDB 4GSYA 2GZHA 2WKRA 4WAUA 3FTQA 1Z6YA 1CJTC 2PMKA 2XTZA 3EIHA 1TMKA 4WZAE 3Q3JB 1UKYA 4URWR 1XEWY 4C0HA 4IDQA 1XD2B 1FOEB 3HYRA 4ITRC 3Q5DA 2NO0A 1TUEA 2O8EA 2IYXA 4B76A 3EIQA 3GFOA 5DYGA 2ECKA 1P7CA 3GJ0A 1TNDA 2ZR9A 4J0QA 4TLCA 4X8HA 2BC9A 1UFQA 1OF1A 5C1BA 1EX7A 1E1QA 8OHMA 2NTYC 4U7DA 2PJZA 2K5UA 1E9CA 2NPIA 3BAFA 1KK2A 1IJFA 4NYJR 5CM8B 3W3AA 1HV8A 1VPLA 1ZIOA 2IXFA 4AURA 3B1VA 3B82A 2HV8A 3T5DA 2AD5A 2ATVA 4NBSA 3T12A 3U4QB 1F60A 2OZEA 4B47A 5FL7D 5GVRA 4C2UA 1T5IA 5JSZB 3QI2A 2ASEA 2E9SA 4PC7A 4A8JA 2Q9CA 1E96A 3H84A 2GESA 4JLNA 4ZDIA 4DWJA 3U6BA 1W36D 2BIFA 1KNXA 1ZYUA 1EGAA 2GJ9A 2JJ8A 4FD2A 2YWEA 3N2IA 1VIAA 4JT4A 4TMXA 3SQXA 2D7DA 5JEDA 2QENA 1IM2A 1E2EA 2OFWA 2GZDA 5KHOC 1ZCBA 4E09A 4C0JA 1F2TA 4LYFA 3VR2A 4LJAA 2XTMA 2F6RA 1LF0A 2BBTA 2HF8A 4JL6A 3GLGB 5JI3E 4NPHA 2QBYB 2P65A 3PVSA 1LNZA 4MKIA 5JRZA 2IS1A 1JNYA 4LY6A 4KO8A 1GTVA 1TEXA 3BB3A 2ZXUA 4I1UA 3REGA 3WBJA 2FNAA 1U0HC 4D4KA 2OCPA 1GM5A 3OFNA 3CF2A 4RD1A 3F8TA 3ZZTA 3OESA 3EA5A 3TUIC 5DYIA 3UG7A 2ONKA 1SVWA 2FU5C 2W0MA 2J0UA 2BBWA 3RS4A 1XU4A 1T8TA 2XEXA 3TKLA 3WBKA 1E2FA 2Z0MA 3SYKA 3L8ZA 1X8LA 3CONA 821PA 2MSEB 1Y63A 2C95A 1KI2A 1H8HA 1MOZA 1ZC4A 3QKRB 2F1IA 1Z06A 5FTNA 4AYWA 1GVNB 4KSCA 4BEBA 1IN4A 1KI1A 4F4JA 4PHGA 1N6IA 4X8LA 2IXGA 3PFIA 4GP6A 4E07A 3I5YA 3WYGA 1GRNA 5AWFC 3TAHA 1NF3A 2G9NA 1FP7A 3O8DA 4G3XA 5M04A 3R8FA 5KO2A 2AKYA 2JATA 1R0XA 5DISB 1S2MA 4PZLA 4A8JB 3OEHD 1CR2A 2FEOA 2P6NA 1E9EA 3OHMA 2WSSA 3LBHA 4BRUA 1ZVQA 1G1MA 1XCGB 3DMDA 3NEYA 2KBEA 3THOA 3NG1A 1M8PA 3L0IB 2GF0A 5P21A 1UJ2A 3DVLA 2IYWA 1KI3A 2EFCB 3S1AB 5TXGA 3QPVA 2OCYC 1OW3B 1DOAA 3EW9A 3I32A 5F9HA 3L2OB 4ZO4A 3VTKA 2WPDD 1E2LA 1E9AA 3RVBA 1G8PA 3UANA 5FPKA 2D06A 2C5LA 2VLIA 4MRNA 3VX3A 5JS7A 4MUAA 1XB2A 3EPJA 2JA1A 4M22A 3A8TA 4P0TA 5CIWA 3DDCA 1S1MA 4MKGA 2GJSA 2DFKB 2FSFA 3IEVA 2ONJA 3NH6A 1R5OA 4YC7A 4HZUA 4TQ9A 1G3QA 2D62A 3GLGE 1BS1A 1Z08A 1VECA 3ETLA 1FL9A 1NKSA 1N6KA 3IO3A 3K70B 3DM9B 1C1YA 4TTQA 2ZU6A 4EIWA 4HAZA 3LRPA 3EC1A 5TVKA 4MA4A 3A4NA 3ADCA 2CHQA 2KE5A 4PO1A 1W47A 2WWGA 3QXSA 3KTAA 5KSZA 1P73A 3W8NA 2YOFA 1R7RA 1ZM7A 3A58B 3OFND 3SHFA 4XVUA 3LVQE 3AUXA 5E3HA 2GKSA 2C9YA 4P33A 1Z6GA 1QHHA 4OKSA 1GP2A 3SYNA 3VU9B 4FN5A 4U00A 3VNVA 2ZRBA 3K70C 4MGIR 2WM9B 1D9XA 4D0LB 1Z2AA 4TLDA 3EC2A 3SC3A 3C8UA 5CK4A 2ZYUX 4I81A 5JWHA 1GWNA 3KXIA 2ZRMA 2FDCA 1E79D 3REFA 2JAQA 2AL7A 2QZ4A 4PXAA 1H8HD 4B6EA 3GFTA 4BLPA 3AKCA 4ZKEA 5J40A 2PZGA 1D6JA 2BMFA 1N6NA 1U94A 3LVRE 2XZOA 4A0RA 1ETUA 3AVWA 2ZI3A 3KUDA 4Y0VA 2PZFA 2HLDA 1GL6A 1OFIA 2CMKA 3K0SA 1EWQA 5GJBA 3ADDA 1P9WA 3SHWA 3O8RA 3ADKA 3AH8A 2JIZA 3ZLJA 3CO5A 1OLOA 3KKPA 4F4CA 1RC8A 3VHLB 2VSFA 3EAQA 3HJNA 1XJQA 2PLRA 4IXMA 1AK2A 1NVVR 2ZJZA 1KK3A 2WSSD 1IAQA 3AVQA 3TLXA 1P9RA 3TW4A 1BH2A 1S9DA 1A5TA 1Z0DA 1IBRA 1XP8A 3PUVA 4UNPA 4ACBA 3RHFA 4ZIRA 2GCOB 2ODWA 4GDFA 1WBDA 1KI9A 1AS2A 5G53C 1DAIA 2ZUDA 4DXAA 4QNMA 1ESNA 4F38A 4BWYA 4OK3A 5SZHB 3B9QA 3VAAA 4LX0A 3UPUA 5HCIA 3IIMA 4EUNA 1EFUA 2J3EA 4V0OA 3ONWA 3VR5A 3ZS9A 2AK2A 2GRJA 3WY9A 3TBKA 1E9BA 1Q3TA 1R5BA 3AKDA 3OF5A 1T0JB 3QF4A 2IYTA 3OAAA 2ZI4A 4PR0A 2I1VB 2RGEA 2XSZD 1M7GA 2CL6X 3BH0A 5J4VA 2JLWA 3RS0A 2I1QA 1YZTA 1CJVC 3TSZA 2WJGA 5DN6D 2NO6A 4JVSB 3SJAA 1QHHB 5BN4A 2ZSAA 4XTCS 3AV0B 2WBLC 4L15A 4LYHA 3RWOA 4JLAA 1GKIA 2P2LA 3BRWD 3K0AA 4Q18A 2IYYA 3NXSA 4JLMA 4KYIB 2AX4A 1U98A 2IHBA 3T06B 1JXOA 4UNRA 5CITA 4AIIA 4TYYA 1E1RA 4PC1A 1FMJA 3D8BA 3TIFA 3LLUA 3X1DA 2ZPTX 1UADA 2WOJA 4GMDA 4URUR 3W5JA 2QTHA 1EG7A 1AJEA 3NVAA 4A6PA 5J4YA 2VF8A 4E03A 4Q9LA 4Q1EA 3QG1A 4ZI2A 1DO2A 1Z5ZA 2H7VA 2ZI5A 2OG2A 2JLVA 1OHHA 1XNJA 2C2HA 1XEWX 3A4MA 4OYHA 3SI7A 3LH5A 1HQCA 3CBQA 2X2FA 3FKSA 3QENA 4CDGA 2F9MA 5CYPA 5C4GB 5JWOA 2GCNA 4KHZA 2D3WA 3ZQ6A 2ZSDA 1CLUA 1NVUQ 2Z83A 4QL3A 2OT3B 4L9WA 1HE1C 4M1SA 2ZANA 1VKJA 4M8NE 3F0TA 2IHYA 1LV7A 1YZQA 2JJ1A 3HU1A 2HLDD 3LBIA 1GKYA 4B75A 1O3YA 2AFIE 1N0VC 2A5YB 4A82A 4HAVA 2ZRDA 3C7KA 3D7MA 4B2PA 2IK8A 1CR1A 4JLVA 2WTUA 2Q3HA 3AP2A 1LY1A 1R0WA 3B13B 4B74A 1XBTA 2PEYA 5TARA 5TDHA 2Q9BA 3KB2A 4YDHB 1JB1A 3QF4B 4LOAA 3T1TA 2V1UA 2JLXA 1P2VA 1O87A 1NSFA 2QSZA 4QGAA 2G1KA 1H8ED 1OFUX 1KK0A 3AVOA 1NP6A 4AD8A 4IW3B 3R7WB 3RWMB 5L3QA 2DY1A 4IOMA 5FH9A 2XNDA 2GETA 1M6NA 3U3JA 1NMYA 1QRAA 4JLOA 1Z28A 4MYCA 3W34A 1JPJA 4TYQA 1J99A 4B3FX 4C0BA 5KPJA 3RRZA 2R44A 4JVNA 2YC2C 2DPXA 3LX5A 4ABYA 4XSGA 1SVLA 5DGXA 3WYAA 3H1TA 2FZ4A 2FFBA 3QVVA 3AVXA 1I4DD 2W2VA 3A1TA 4TWZA 4ZCIA 1VYUA 1G3UA 2XOKD 2ZI7A 2QMOA 3F5FA 3OEEA 5AUPB 4DB4A 2D2FA 4RZUA 1RRCA 1WQ1R 4TYNA 5EP1A 4IRUB 1ZNXA 4MYTA 1TQ6A 3NHBA 4YQFA 4BZQA 2ZRJA 3CNNA 3CWQA 4B2LA 3B7GA 5FBVB 2HT1A 2GTPA 2IYZA 3PR1A 4DLTA 4OHWA 1SXJA 5E7IA 3WMGA 2REXB 2N46A 4W5JA 2WAYA 4JKIA 2YJTD 1NLYA 3P26A 4AK9A 1SKYB 3RRYA 4IOKA 4NH0A 2VP9A 1JI0A 1AZTA 3CH5A 4NU0A 5D3QA 1IJEA 4DLWA 1GRRA 3FGNA 4V02A 1N6HA 1NKTA 1W0JD 2HCJB 4KSBA 5KSYA 4TL8A 3X2SA 2O0JA 1VCIA 3H2YA 1XCPA 1JJVA 4M0LA 3SJBA 3AVTA 2C78A 2BKUA 5B64A 5EUQB 4EJSB 2O8BB 1QG4A 4BLOA 3A1WA 4RVCA 1XTSA 5FOSA 3ZJYA 1DARA 2EWVA 3BFKA 4WZ6A 4FI3C 4LJ6A 4CZ2A 2IXEA 1NRJB 1J2JA 1HA3A 3CNLA 4C0KA 3U7GA 3PG5A 5IT5A 5HZKA 4F4IA 1OIXA 5EP3A 1G3IA 1FW6A 5CLLA 2VSOA 5FUWA 1ZNYA 4DC9A 5L3QB 4I1OA 4QFMA 3GPLA 1OB2A 2CL0X 4ARZB 2P6RA 2XXAB 1G7TA 2NOAA 3K9HA 4MKHA 3AF1A 2J5XA 2XZPA 5JHGB 1ELOA 1W4CA 3PEUA 1CXZA 1OV4A 4FXPA 4BFWA 5G3ZA 2DCUA 1UM8A 1P62B 1WP9A 2F9LA 3KKQA 3ZDQA 2BEKA 2GJ8A 4KU4A 4DT1A 2BVNA 4M1YA 4B2IA 2CLCX 4RFSA 3HU3A 4Q1DA 4DIDA 5KNDA 3IEUA 5BN5A 1I2DA 3QKUA 2YZ2A 4IEEA 1FP6A 2W6ID 2R62A 1CJUC 4MGYR 4UNSA 2WKPA 3CB4A 4EDHA 2NPFA 1CJMA 4BFUA 1OB5A 1SHKA 2O8DB 3TUJC 2CDNA 2CLSA 2QRZA 1AQUA 3TUZC 2ZAOA 4B35A 5JFGA 3QXJA 2OV2A 4BECA 1U9IA 2QE7D 3BC1A 1N5IA 1SVKA 1II8B 4V0ME 1WE2A 3LV8A 1VMAA 3U2QA 1JPNA 2IUSA 2NO1A 3VKHA 3THYA 3G5UA 1BYIA 2NQ2C 2YHSA 3HDTA 3QKTA 3D3QA 3W5IA 4BFSA 2ZRNA 3KXKA 2DFNA 1KZGB 1XEXA 2BMJA 2CVFA 4DCVA 4UQOA 1MV5A 3AF2A 2ODNA 2QG6A 2QP4A 4PC3A 1SKYE 1IN8A 1SXJD 4V0NA 2HXYA 4URZR 2C8VA 2RHDA 2V1XA 4OHZA 3NBFA 3NWJA 2CVHA 1Q1QA 4C0LA 3WHLA 4D82A 1NG1A 4DDUA 1N6LA 4B33A 4BE7B 5K8LA 4LYAA 2J9RA 2PEZA 4RD3A 3LFUA 4HB0A 1OIWA 5DSZA 3MJHA 3WMEA 2PT7A 1E9DA 5BWMA 3QIAA 4I1VA 1YZKA 4P31A 3DOFA 4JZKA 1XPUA 3PQCA 4IVRA 3AB3A 4RKFA 3LDAA 1AZSC 1RW4A 3N70A 2C03A 4GMXA 1XCMA 3ZH9B 5A5GA 5EXPA 4M1WA 4P4SA 3TR5A 1FX0A 1OYYA 4FWIB 3CUEF 1NBME 4M53A 4JLKA 4UJ5A 1WCV1 3KJHA 3RNLA 2OFOA 1Q3HA 4A0FA 5CYOA 4RD4A 2EQBA 4GZMA 5KPDA 3QXHA 3X1ZA 5G41A 3PCRB 3ZYCA 421PA 1T8UA 3KUCA 4OQNA 4Q1AA 4OI0A 4TQAA 2QTFA 5CK5A 1X1SA 3DM5A 1N2CE 2PZEA 4JIMA 2ZI9A 2Q9AA 1W0KA 2ORIA 2RGNC 3SBEA 1KYIA 2RB4A 5AUOB 3B8HA 4DSOA 1G19A 4HDQB 4D25A 1KDPA 3C16C 2VP5A 1EESA 4RFVA 2ATXA 2J7PA 3CF6R 3GJ5A 4PC6A 4Q21A 1ONBA 2IYRA 1JEDA 1Z6AA 3V4RA 3A6PC 1TUIA 3AP3A 3TR0A 1AM4D 1LS1A 2CJWB 4G5GA 4O0MA 1Q44A 1FFHA 1Z0IA 2KBFA 3SS8A 3Q72A 1Q22A 4FINA 3MJRA 3ZS8A 4P4TA 3T61A 3B1ZA 5FTLA 2Q3FA 4A2QA 4QG7A 4L4UA 3U4QA 4PO9A 4CEIB 1IN5A 1G7RA 5H68A 2O52A 2VP6A 4LHVA 2GJKA 2B21A 2WJVA 4PHTA 3LNCA 1G6HA 1PJRA 1FQJA 3BH7A 2OFXA 3CRW1 1EFRA 2CEAA 1MO6A 5C46F 2ZS9A 1N0UA 3MCAA 3U7FB 2Z6VA 2ZRIA 3ZVMA 1E9SA 3X1XA 1KO1A 1Z29A 1GRQA 2ZSFA 3AP1A 1YZUA 4RZ2A 1SVOA 2PL3A 1XWIA 4FMDF 5TY0A 3RS5A 4AKHA 1U8ZA 1FX0B 4US0R 4PQRA 3GLGA 4C4PA 4FMCB 4MUBA 2JLUA 3LXXA 1R10A 2QBYA 3OZXA 2QNRA 4HB2A 4TQUS 1R6BX 2GK7A 5E7JA 3TW8B 4RZXA 1KGDA 4D4LA 4QBHA 4EQ6B 4KITB 4W7SA 1XD9A 4Q9IA 4C2TA 1W5SA 2JLZA 1RFLA 4IOLA 2XJ9A 5ANRB 3M1IA 4IDHA 4BLQA 4XWKA 4QHSA 3JZAA 3FKQA 4N3NA 4O2LA 2CK3A 5H8WA 1OKKA 2AXPA 4ZPXA 4Q4JB 3EPKA 3EPHA 1G21E 4MRPA 1LS6A 5KUTA 4KBGA 4TSFA 1UKZA 3NC1C 1IONA 1EFHA 3KQHA 2DWQA 3RS3A 1IOZA 2XX3A 3U3RA 2FZLA 4QM7A 3QKRA 5FPHA 2GAAA 1P61B 1NMXA 1RKBA 1WA5A 4IKEA 4Q4LA 2BV3A 3IQWA 3QOFA 4NCIA 3V9PA 5KNCA 2WIAA 3ND8A 3GJ6A 3X1YA 4US2R 2PJRA 1E9FA 1UF9A 2R6DA 4WZBE 3AVPA 2ZS7A 4JLPA 1UDXA 4OBEA 4Q9KA 5DIFA 4Z1MA 5J4LA 5GJVC 1QHSA 2WV9A 3R9IA 3L0PA 5DHFA 2MSDB 4PZZA 2GK6A 1KHTA 3EWSA 4RY2A 4LPSA 5EE0A 2R2AA 1ZP6A 4WA7A 3R20A 3CX8A 1D8TA 4EKDA 2ZVPX 5KSPA 2P6UA 1FUUA 1RRFA 4LV6A 3UK6A 5DLQC 4TMVA 4HEJA 1YR7A 4Q7JB 1YJ5A 2B8WA 1EXMA 2FSIA 4IOJA 1JJ7A 3S1AA 2ZRKA 5FOWA 5CJ2A 1E0KA 3PV0A 521PA 4US1R 3FYHA 3P32A 1FZQA 2LKCA 2BBOA 2ZYTX 5FI0B 1TTTA 4DVGA 1J70A 2H8KA 1Z0FA 4HLCA 1COWA 2QAGB 3KKMA 1E2HA 4TYPA 4DSTA 1W36C 4I4LA 5JJLA 1D5CA 3W90A 4M1MA 1XD8A 1XTQA 2D2EA 4C0SA 1EFRD 1UAAA 1P6XA 1US8A 4MGKR 3IIKA 1Q20A 1N5LA 1VG8A 3E5HA 2IS4A 3L43A 4XJXA 2JJ2D 3SJZA 1GKUB 1QZXA 4D0GA 2WVJA 1AGRA 1AA9A 2ZEJA 1PLKA 2RGXA 1SVMA 5JLJA 3JVVA 4URVR 1ZU4A 2X8AA 2R6GA 1E2KA 1OFHA 1L7VC 2QAGC 3QJYA 3B1YA 1CULC 3WNCA 4PAMA 4LHZA 4NONA 5FPSA 2RAPA 3AF3A 3MG9A 4DLZA 2ZE6A 1JALA 2QROA 2ZETA 4LHYA 4LV8B 3WNBA 2GWHA 2FG5A 3EZ6A 2ZRLA 3OE7A 1CRQA 1ZD9A 3B2EA 3QNUA 5C2JB 5IDVA 1OH5A 2AR7A 4Q03A 2UVQA 3IO5A 4EPRA 4ON9A 2HCBA 3VU9A 2F43B 3MMPA 2FFAA 2G83A 2ERYA 1RJ9B 3T15A 4M9SA 4XIGS 4TTRA 4LBYA 1DEKA 5BXQC 4HATA 1SULA 3CM0A 2ZJ5A 4KYUA 2QT1A 4EPXA 5CJPA 5EE5B 3K0CC 3BK7A 3UMRA 4EAQA 2OBMA 4Q47A 3T35A 2EFHB 1OIVA 1E1QD 2Q0HA 2KB0A 5BYJA 3VKGA 2VHUA 1QVRA 1ZD1A 4UNQA 3I62A 2H92A 2RGDA 5HE8A 3M6AA 4NCHA 1CP2A 3BERA 4NCJA 3FB4A 5KTYA 2G1JA 1W7AA 2QM7A 1NIPA 3AKEA 4GOKA 2QQ0A 2UZIR 3L8YA 4LC0A 2IW3A 5BQ5A 2A3RA 2DYKA 3EWAA 4TMKA 4DIEA 4R7ZA 3GLIB 5KYKA 4UJ3A 1WB9A 1CU1A 2J0QA 1US8B 5L3SB 2P3SA 2J41A 2GCOA 4JLBA 1WMSA 1JXMA 1QF9A 2ZJ8A 1YR6A 3GJ4A 4F93B 4B32A 1VCNA 4ESHA 3ASYA 2Q6TA 2H17A 2IC5A 2R6AA 2NG1A 3MGCA 1WDTA 4AC9A 3NBXX 5JRJA 4C7OB 2YOGA 1G17A 5DHAA 1CTQA 1L4UA 3GJ7A 5HCNA 2DWOA 2WWXA 1COWD 4PAQA 1MH1A 3GLHB 3NHAA 2R65A 3U3OA 2FGKA 2EFGA 4HAYA 1YRBA 4NP6A 3NTUA 4KJZA 3SFVA 4HAXA 3VR6A 4YLGA 1HH4A 1T3HA 2YWFA 3LAWA 4L5BA 5AR1A 2QM8A 3AUYA 3Q9LA 4DEXA 4NTZA 1N6PA 1IXSB 4A1FA 2VO1A 3DZDA 3BFVA 3H0KA 4R2HA 3RAPR 1E4VA 1EWRA 1VTKA 2FSHA 5DH9A 2ANCA 4QXAA 4BLTA 3TVDA 1KI7A 4D2IA 1H65A 4XVQA 1GNQA 2ZYWX 1DVRA 1T91A 3GP8A 3K9NA 1M7HA 1QVAA 2FH5B 4OI2A 1E3MA 5GJWC 1MR3F 4UXJA 2VYFA 4W5WA 3RS7A 1RRGA 1Q1BA 3EASA 4DRZA 3VNUA 3CW2A 1E2DA 1ZD8A 3P20A 2FA9A 4WBSA 1T6NA 1W49A 3B5JA 4NHOA 3W8RA 2JDIA 4B3DA 1OXXK 4PPNA 4M9QA 4XSHA 1E0SA 1G3RA 5TV2A 4CEHB 1KI6A 4PAOA 3BIFA 5L8VA 2QRNA 2VBCA 2XB4A 3EX7C 1P75A 2J7KA 2ZJ2A 3CX7A 4HZIA 2G88A 4JBXA 1M34E 1X86B 4MYHA 3K0FB 3SEAA 1P9NA 2BMDA 2ORWA 1P60A 221PA 1UDWA 4DDVA 3IPYA 2TMKA 5GJCA 2C77A 2H57A 5DI3A 5L3VA 2QMUA 4O25A 2XAUA 2I3BA 1P4SA 2G3YA 4H1VA 5FUXA 4BEJA 3DZ8A 1MKYA 2REBA 4JSYA 4LJ5A 1E2MA 1KSHA 1NLZA 1IXZA 1KAGA 1RZ3A 3K0EA 2PX0A 1CEEA 1A82A 1Z47A 1GUAA 4QHYA 2ZRCA 1KDOA 2ZSBA 1WBBA 1OXTA 2W83A 2GNOA 4A9AA 2CCJA 1AIPA 1TX4B 3GLIE 2V7QA 4CEJB 4KI0A 5LDDC 1AGPA 3L82B 3QBTA 3OIVA 2J87A 1RYHA 1XPOA 3I5XA 5AUQA 3N2EA 3UKDA 1ZM2A 2EYUA 1KY2A 4P3YA 3ZIAA 5FR2A 2V8OA 3K09C 3MSXA 5UKDA 3VQTA 1GIAA 4JYBA 4DEYA 2RGCA 2F3RA 4Z8YA 2C98A 4A4DA 4BFYA 3D31A 1SZPA 1TU3A 3R7WA 1JAIA 2KI5A 4PHHA 1BYUA 3I8SA 5HTKA 4OQFA 5EXTA 5SZKB 4RD2A 1KOFA 2WJIA 4HSEA 4Q1FA 4CW7A 3GLHE 2C99A 2YKGA 1GL7A 4LJ8A 4AG5A 2E87A 4EPYA 3C4JA 4B71A 2GZAA 2O0HA 3K1JA 2OESA 5EE3A 4BFZA 4G5QA 3R8CA 1G4UR 1I2MA 2NO9A 2WWYA 2O5VA 3R9WA 3THWB 1II9A 1E2JA 5K8UA 1PUJA 4V0MA 5JJKA 3T1OA 4S2EA 1KI6B 4URYR 1KNQA 2AWNA 2GBLC 1KO8A 3ZVRA 4IEIA 4U02A 1YR9A 2OLJA 1IN7A 2IUTA 4IDNA 4GL2A 1II0A 5JWRA 5IF9A 2YOHA 4NE2A 2ERXA 1S3GA 3Q7PA 1Q12A 2OAQ1 4TZ6A 5DI3B 3EZ9A 2CL7X 3LW8A 3NKVA 5AJZA 3KKNA 3SDZA 4OJQA 1GNPA 1F3OA 2G77B 3DKPA 2WMOB 1OH7A 2FPLA 1ZW6A 1FNMA 2BM1A 4HB3A 2DWPA 3AQ4A 3LW7A 1E32A 3F3YA 4XVRA 3PITA 1FQKA 3R9XA 2PCLA 2JIZD 1JQLB 4NDZA 4EJSA 5J4HA 2O8BA 5JS8A 4UKDA 3CWZA 4GI7A 5E95A 2G6BA 4Q4HB 1CBUA 2RH5A 4BGDA 2LWIA 3UMSA 2O0KA 2ZQ5A 4N1AA 1E0AA 1HT1E 2NO7A 1W46A 1ODFA 3L0SA 1NN5A 1ZNZA 1NBMA 1P72A 2AWOA 4LRWA 4PZYA 4EPWA 3Q7QA 1GOTA 1W1WA 3M4YA 2V6JA 4M2LA 1KJZA 3RRMA 4YMTA 4TLEA 3U7EB 4AI6A 5L3RA 2YWHA 1A4RA 3MWJA 5LD2B 2VA8A 4ARZA 4P32A 3SQWA 2XXAA 5G40A 3NDPA 1M2OB 1RE0A 4K46A 4A15A 1F48A 3FMOB 3MWKA 4FCWA 4LJ7A 721PA 4ZDKA 1DAEA 5LB4A 4ACAA 5KDOA 5CDFA 1U90A 2VP4A 1A7JA 2F7SA 4OI4A 1TEVA 2Q21A 4KXFB 3OAAD 1XXHB 3KFXA 1KK1A 4KVGA 1PLJA 1NVVQ 2HXSA 2QAJA 4RCYA 5LD2C 1Z6TA 4CVNA 2WHXA 4HYYA 4WIAA 1T5LA 1ZU5A 2ZU0C 3GMTA 1AN0A 2IYVA 4TYWA 1MRNA 2O8DA 1U8YA 2J0SA 5EXSA 4D6PA 3C5CA 3A1UA 4LBZA 4LHXA 3O8BA 2QTVB 5FR1A 2QP3A 2ZTSA 4YMUA 2LCFA 1W4RA 3OIYA 1FMLA 1NL3A 1E1RD 1II8A 1F6BA 2NZJA 1D2NA 5E7MA 2PMDA 1S96A 2AKAB 2IBMA 4S35A 4TTPA 1YE8A 4PANA 2V4ZA 3ECCA 3RABA 3EPLA 1P5ZB 3EARA 3HPQA 3KB1A 4Q66C 1OYWA 1SVSA 2KWIA 1G5PA 1G9XA 4PSKA 3GQBA 4QM6A 2RGGA 1VG9B 1OHHD 1KZ7B 3MAAC 1FTSA 2HT6A 2GAOA 4CT5A 1EFCA 2ODEA 4B3GA 3LXRA 2QA5A 3FKSD 5F98A 1MT0A 2A78A 3ZGXA 2BM0A 1AS0A 5AJVB 3SN6A 1KMHB 4JBWA 2PCJA 2QL6A 1CS4C 4ASUA 3CIOA 4YXWA 1NJGA 5HR5A 4MDFA 3QPWA 4PQFA 5J47A 3E1SA 4JT2A 2OXRA 2IX3A 3UMFA 1R4AA 5F2EA 3O8CA 2JJ1D 3IKJA 2ZE8A 3VMFA 1KSJA 4OK5A 5FUVA 5SZJA 1QHYA 1I4TD 2IEYA 4FMBB 2IF2A 4DB2A 5D3MB 4RD0A 1B23P 4LBVA 1XX6A 4DCUA 4YDSA 4BPBA 4B48A 1CF4A 4C0AC 1NBMD 4LHWA 2HJVA 3CRRA 3WXMA 4DLRA 2GXAA 3ICEA 1E2GA 4XWOA 5HKKA 5FBQB 4TMWA 4NCKA 2VTKA 4PSAA 1W5TA 2A5JA 2XNDD 4JBYA 1XTIA 5B57C 5DO9A 1KDTA 1U0LA 2RGBA 1VCOA 1UKEA 3AF0A 1G3MA 1XXHE 4NYIQ 4Q4AB 3TRFA 2VPPA 4R2IA 2VEDA 4GNKA 1JEEA 3PEYA 2HEIA 3TSWA 4DLYA 1XPRA 1LW7A 3CPEA 1QHNA 1KAOA 2CJWA 3G82C 5EXXA 5EZ5A 4ZDJA 3B85A 5FFMA 2HYIC 3OEED 3X1WA 2QGZA 2CBZA 3P4YA 1KY3A 4AYTA 1UPTA 3H86A 4WXPA 3VFDA 4Y0AA 5C4MA 1DG3A 4QJ5A 2OE2A 2JGNA 2OCAA 4CEIA 3BORA 1I4LD
chains in the Genus database with same CATH superfamily
4GKBA 1QSGA 3I6BA 3G8BA 3ZBQA 1FNBA 4KFRA 4KBFA 3WLLA 1CR0A 2FX2A 4EHHA 4CLDA 5FOVA 3R7NA 5IZCC 3NHPA 4M0DA 3EDCA 3LWNA 4UDXX 5C8YA 4C6RA 1ZJ5A 4XUDA 5DYNA 5IBRA 1P44A 3TMAA 2VXOA 3WK4A 4EP1A 2O2JA 3J81k 3QLUA 1GQQA 2OQRA 2V7PA 1JR3E 3KQMA 2P6MA 3Q7IA 4L5AA 3D9QX 4JVOA 4MPRA 3KM0A 3I58A 4F3TA 4YRBA 4TWBA 2AZMA 5IC6A 3ZJUA 1J23A 1L1RA 1SXJC 3Q6MA 1CY0A 2YZ7A 2YVAA 1DAOA 1J8YF 1HNNA 1NVXQ 3P9NA 2CZGA 4HL6A 3RVPA 3IAFA 2VHTA 3PGVA 2P9JA 2I6XA 1X92A 1HZJA 4MX8A 4MV1A 2IPMA 3FI0A 3DKIA 1J0EA 1U1IA 4PIVA 1P4JA 3ET5A 5EAIA 2CCGA 3IR7A 1D0VA 5A0TA 1LFDB 4MITA 4EHLA 4BUJA 4L57A 5JVDA 1D2MA 2XMGA 3MLAA 1MF7A 4Q9HA 4RHUA 4CGZA 4H31A 1T5BA 4IHAA 4DARA 1OLUA 2YX1A 4MMYB 5ICEA 1H2YA 3A4LA 1T9DA 1JS1X 2BSAA 1LBHA 4QT0A 3D8NA 4DIKA 3UW3A 3CXUA 5HMLA 4D0SA 3UGQA 2EZ8A 2QQGA 5JCJA 5CDFE 1M74A 1ZI8A 1V6CA 2PBLA 3OF2A 2YQ4A 2DPYA 3GUUA 3T7AA 3THRA 3B20A 3TPZA 3UWDA 5EJ6A 4FC7A 4X6YA 3QPAA 5JMPA 1NR1A 5CD9A 1OPXA 3EUWA 1LK7A 1A97A 3VNRA 3HEMA 4RK5A 1V5WA 2Q1TA 2ZJOA 4LISA 5HKKD 5JAZA 1NW9B 3IPXA 1E1LA 3SBOA 1CCWA 5KMGB 2DP4E 1CP3A 3WQBA 5LU9A 4A0SA 3WKCA 5KNDD 4KCGA 1D8AA 5AXCA 3T9FA 2SKEA 4QDUA 4PCVA 1G8MA 2QW1A 1GTMA 1PSWA 2WUWE 1NSTA 4IIJB 3GCGA 4J0HA 5HNKA 4H7KA 3ROQA 3BTUA 5IKEA 3OWOA 4PTYA 3WMFA 3C24A 2C5FA 3H05A 3EGWA 3U7HB 1V6SA 2WTMA 2GEDA 1QJCA 4KI7A 1QK3A 3N7AA 2N1BA 3VKUA 4BX3A 4IFEA 3PCTA 3HVUA 5K4GA 3H2BA 5B37A 4WX2B 1CPYA 3R5XA 2GPAA 3ZNPA 1FQOA 1BD4A 2AHOA 4UNIA 4TLAA 2F4VB 5ARDA 4DA6A 2JBWA 4WKGA 4OGKA 2A88A 3D8UA 4PLGA 1CIJA 1PJ8A 1QTRA 2K87A 1PKEA 1E4YA 2ODPA 3H4MA 1ZGZA 3DLTA 3IUNA 3M0EA 2W70A 4FM9A 1B6RA 2EGGA 1G7SA 1Y89A 1L5OA 2I6UA 3GFPA 2Q8PA 3Q0IA 4UU7A 1ABBA 1O6GA 1M1YB 2K6GA 2QLFA 3TD9A 2QR5A 3RBZA 3DDOA 4QGHA 1N25A 3FB1A 3PEFA 4R71A 3RIMA 4C29A 4YDQA 2WEKA 3WJAA 2QAGA 3FYSA 1OTYA 4FFSA 3ANSA 2P6OA 2ODBA 4CN9A 3AGPA 1SQ0A 4KMSA 1N2EA 1QS0B 4XD7A 2V7TA 5FV7A 1Q6YA 1YRQA 3GAFA 4AYXA 2V6IA 4DY6A 3LDUA 4R1PA 3I4CA 4QWWA 3WQQA 1JWBB 2ZM5A 3W2EA 5ECDA 4MGHA 5ENZA 4AF8A 4K9OA 1JR6A 1Y5MA 2JCBA 2RFLA 3LQQA 1R27A 4L73A 4V03A 4EYEA 2V9PA 5A4MS 4GZLA 2Q8NA 3VYTB 3WC4A 1AXEA 5L6LB 3NUGA 1X38A 3TVTA 1BVRA 4KPUB 3Q15C 4QLBA 4ZZ3A 1H4SA 3F7MA 5KQSA 4P3OA 1Q1ZA 1TD1A 1YXMA 5LBIA 1DUVG 2YIMA 1TVCA 2HWYA 4ZOAA 2QN9A 5IHXA 3KSZO 1JKXA 1SM4A 2IHKA 3L8DA 4A2CA 5A9SA 4DUPA 1DKNA 3MA0A 1U3VA 3O9VA 2N42A 4QSHA 3DDZX 4FIDA 1IEWA 1LZKA 3CRMA 3W8DA 2C54A 4BKUA 1OPRA 3L46A 1O4VA 2Z4RA 5DCYA 1BDHA 2GLUA 1VDMA 5GIOE 2F43A 3Q7SA 1E7WA 2YYSA 1UINA 3NB0A 3A1SA 1EWVA 1TCCA 1USIA 1O54A 1J90A 4KFUA 4W82A 3O47A 2ZIVB 3L0OA 2FF7A 4P7JA 5KDOA 2HRCA 2I91A 4IMIB 1OJLA 3OOYA 5I7OA 3HRKA 4MSUA 4FOOA 5IG2A 2EFDB 5DHRA 2PVPA 3TQRA 4GW3A 2QTZA 1Q0UA 2VDRB 4YCJA 3TZLA 4GQBA 3JXEA 1KQFA 1EFKA 2XD9A 1GD1O 4IVQA 4CETA 5G0WA 4IINA 2VJPA 3HC7A 5CG2A 2OM2A 2HA2A 3DOEA 5ULLA 2CZCA 2BHNA 3F67A 3CQ9A 3GFBA 2GQ0A 4JENA 5EKUA 4CIAA 3ISVA 4M38A 1T3TA 3LQYA 2B1RA 2QX8A 3EGXA 3DCIA 3JQBA 2R3SA 3IOBA 5ALZA 4J3FA 3UJ6A 1N3BA 2PX2A 2I5PO 3C41J 4E33A 2BJHA 1JIJA 4B8WA 4YV0A 4NCNA 5HS4A 2WIJA 4ZJUA 3I8XA 4HH0A 5H5JA 3T0FA 5AW9A 3UMYA 4Q34A 1IBCA 1RKUA 1A95A 2GT1A 4FLFA 4KAXA 4NOJA 3O26A 3DAGA 1TM5E 2JLRA 1BMFD 1I7LA 1B74A 4LW8A 3VTZA 2CNBA 1DT5A 3BJIC 3CCCA 2IVZA 2J59A 3OE4A 4CM8A 4EFKA 4CKCB 2H9IA 2C96A 4JT8A 4M1KA 1QGOA 4MQBA 4D5GA 1HF3A 5EJEA 2XNSA 1Q16A 2FF5A 1IC6A 3NHWA 1EINA 3TO5A 2CXOA 4DRXA 1PU2A 2WAXA 3ANMA 1Z7BA 5EXDA 3S99A 4W4TA 5CDUA 3NT4A 5F2NA 2J5QA 3O93A 5G0UA 1WXEA 3NHYA 4M55A 5AOAA 1L5KA 2OCXA 4ZT6A 3T5TA 5IDWA 1Y3HA 2CXUA 3D2BA 4WFKA 5H3CA 2VSQA 3G0IA 4PVCA 2Z6AA 4ND5A 3QVWA 4QHTA 2ZIAA 4DLXA 2B37A 3PA8A 3X2EA 1N92A 1ZCAA 1NMEA 3ZC3A 4TMTA 3RIEA 2CW5A 4EY6A 3CJTA 1MVNA 5AICA 1XZIA 1Q1GA 1G41A 1Y6ZA 1N2BA 5D87A 4MR8A 1Q0PA 1XMJA 2BM9A 3DF9A 4BMPB 5AVXA 3MUNA 4FLEA 4BQOA 1I7QB 4MUGA 4JLDA 4QVGA 4JLWA 4L4ZA 4POAA 5ICCA 3E4CA 4BPRA 3A9TA 1CERA 2VAPA 2VJDA 2AT1A 1P3JA 2ZR7A 5C4IA 1PYGA 3ENQA 4BGIA 2XWPA 1BS2A 4D46A 1ZOPA 1ISIA 5JECA 1AKYA 5H4HA 3QG5A 4AJLA 4ZCTA 2O8EB 2D4AA 4EG4A 3N7TA 4X61A 3Q6NA 3QQ5A 4TSFD 3UM9A 3OD5A 5HFAA 1DMRA 3RVNA 1MB3A 3OO1A 1G8AA 1ZBDA 3BZWA 5IS2A 3OZWA 2C5GA 3BK1A 4L5IA 3N5CA 4GR4A 3JQAB 1DQYA 2NYUA 4LRYA 3ZU6A 4ZKDA 7ADHA 3DHEA 3TPFA 4YK7A 1RIIA 1T3LA 2IHTA 4GC9A 1L4EA 1JAZA 1UL1X 3G6WA 4RZHA 1JR2A 1S4MA 3CGWA 4K8OA 3T99A 4FSHA 3C3BA 3FRHA 5C18A 1FK8A 5FI1B 5AESA 3C1AA 1T2FA 5E3JA 1B42A 4IV8A 1U99A 3R0ZA 4J7CA 3E61A 1ZK3A 3GRCA 3GT3A 4O8ZA 1RJEA 3IOCA 1TJNA 5E6SB 1I0ZA 3DMNA 2SNIE 4HGZA 1LB1B 3FCOA 3B36A 3H0EA 4LXQA 4WW0A 3UWKA 4ERNA 1XLWA 2OHVA 4GHWA 3P9IA 3RC3A 4B6JA 6Q21A 4X63A 1GNLA 2CNDA 2GVDC 3NFRA 2RBKA 4LXHA 1J06A 5INTA 2GEJA 1FNCA 5B6JA 1L3IA 5AP9A 3KCQA 3ZGVA 2NTJA 1SD2A 2O8VA 1MFZA 1Z0KA 2WJHA 4ENWA 5KJFA 1WZUA 4HGOA 1Y8ZA 1AMNA 2Q2WA 1NN3A 1DKOA 3MWGA 4O0LA 1G8KA 1ZRMA 3CZMA 3HA3A 3N07A 1NPDA 4BNFA 1E2IA 1F2TB 1XLUA 1E0JA 1NE7A 2XE8A 4RENA 1O97C 2CHUA 3G59A 4M83A 4A8JC 4FONA 5H0IA 4JI2B 3GLQA 3K1AA 5BSWA 1LF5A 2OG1A 3U44A 4D4MA 1HG1A 3KKEA 4QELA 1U11A 2WT4A 5HGXA 5JI2E 2I54A 3EZNA 1X1DA 1YS4A 3SHVA 1IE3A 2NMVA 3Q8XB 3VV2A 3RUAA 1TGVA 3TI7A 1HT2E 2J30A 4N39A 5IBCA 4I2NA 4D26A 2EGUA 2IYQA 2ONCA 5A3SA 3QVGB 4JMPA 1DFGA 1YDWA 4PCUA 1N7HA 3A36A 1HEIA 3NIGB 4GP7A 3Q4GA 2W2KA 1U8AA 4CF7A 5KQLA 5LXTF 4XJTA 1GZ3A 2BHRA 1D2GA 1GNRA 2J0UB 4UVDA 5AW5A 2ZUEA 1UBCA 1KRXA 1SIOA 4X1KA 2C5SA 2O2YA 3PHGA 4LY0A 4MTLA 4RPLA 2A9VA 2O3RA 1RC1A 3C3DA 3HVHA 1OLSB 3A1NA 3OQVA 3OE7D 3K96A 3QKWA 3P2EA 1G5IA 3IIJA 3KD3A 1EFTA 2B5WA 3PGXA 4G0NA 2OP1A 3C6ZA 3NKLA 4Z8XA 2HR1A 3PFWO 3CTMA 3R5KA 5JIBA 4Y18A 1NOKA 1PT7A 2Q07A 5DVZA 4DUGD 2J6CA 4JEIA 4DJ5X 4CCSA 4BFXA 2X8BA 2ZCVA 2WSMA 1ZX1A 1KSGA 5CCEA 3P2OA 5HOEA 3T1NA 1HYQA 4F3YA 5KSWB 2QUBA 3PBKA 1ISSA 4LEIA 3A1DA 2CT8A 3QHQA 3E8MA 4RVFA 3G1WA 1U0JA 2VTEA 2VIIA 1NX9A 3O1HB 2X41A 1M5TA 3KVNA 2RSLA 2XWSA 1A7UA 4X85A 1MRZA 4DS3A 1COZA 1DAKA 2I4IA 3F5QA 2EFEB 3QRWA 1NNEA 3BMQB 2X13A 4BMNA 2OAEA 4L4SA 2BMVA 2OAGA 3GGDA 1RTKA 3A04A 3HDYA 1JA1A 1X7DA 4A92A 4D3DA 5AVUA 4H0CA 1IVSA 1J8QA 2PFGA 4XRRA 1TK9A 5E6RA 5EKSA 4YQZA 3PR2B 4UQPA 3UFXA 3S70A 1O95C 1EK6A 1VCMA 2AN4A 2W6PA 1QQBA 1VCHA 2FCAA 1EB9A 1DZIA 3K0HA 1TQ2A 4UAGA 1PSDA 3GCWA 1GLGA 4JHXA 4B4UA 3GUHA 2GFQA 1S8OA 5I01A 1R8SA 3HYLA 2NUTB 1XAJA 3W2HA 4MW7A 2F62A 3MLEA 3SOPA 3W3ZB 2INGX 3WGLA 4D81A 5B1YA 1P2BA 4MV3A 1UMBB 3V97A 4OHOA 4IFTA 3MBIA 5I9MA 1YCFA 3CJRA 1YC5A 3ENWA 5ENVA 2PH1A 3NONA 2PJUA 4WBXC 1Z5VA 3T0IA 3JCZA 3UT5B 2IUUA 3JALA 3A7EA 2FE4A 3WWOA 1JR4A 1XXHA 5AVJA 1N6RA 3KOMA 1JJIA 1EWKA 1P1BA 1KKLA 1B8VA 2MYUA 4MB2A 4BO5A 4QRHA 1R5NA 1SHZA 3WJ7A 1Z4PX 3ED1A 3RV4A 4QKQA 5FPQA 5CP8A 4E5DA 1E3WA 3HPRA 1TQDA 4XB1A 4BNIA 4J43A 1HDGO 1XTVA 5HKOA 5GADl 1VKOA 2H48A 2CV0A 1CY1A 3FUUA 1J7KA 1XDWA 3G9ZA 4K05A 4OIFA 4LN1A 5LNK1 7MHTA 4FYYA 2BGRA 1RNLA 1ZNQO 2IEGA 2RCNA 4L9SA 1ZRHA 1I0IA 2O54A 3HP1A 2WJYA 5CEEA 4Q7KA 2Q3BA 3BE8A 2OPHA 3IIIA 3HN7A 4UTNA 1DKRA 1ZL2A 2HSEA 3EJ6A 5EUMA 1Q1EA 4L7VA 5A6VA 1G20B 1DAFA 4RCZA 3HGTA 3QEAZ 2XE4A 4XTRA 2JGDA 3W6UA 4YP7A 1MPXA 1ZGBA 1OWMA 3DE2X 1TF7A 2R2GA 3TLBA 1VL0A 3H16A 4EL0A 2OHFA 1BW9A 4XOIA 1XFAA 5TMPA 2BP7B 2MIIA 4TL9A 3LIPA 5KVVA 1MABB 2O3TA 2OC9A 2IYUA 4IZ6A 1UOQA 3KHUA 4GBGA 4ND2A 3SZLA 4BIIA 2Z1DA 4BO4A 2QY6A 2DVMA 4RIGA 4G25A 5IXSA 4FOPA 3T1VA 2DBRA 1YRYE 2HA3A 3RRXA 2A9PA 1R0SA 3BSFA 4N0EA 4P82A 3JD0A 2O0MA 1JIXA 3MRSA 3VTAA 1E5QA 3E70C 1W88B 3WMXA 5IT4A 1KMHA 5ALJA 3VC7A 1CIVA 5EPOA 3P9KA 5HK8A 1TF5A 3VAYA 1RPZA 4YJ3B 3IP7A 5THQA 1Z6QA 1O8CA 5DHPA 2YN0A 4Z4GA 1K4KA 1N1DA 3U3KA 2XMCA 3EQZA 3I9LA 3ZCQA 1MNQA 3LO5A 5TPWA 3AF4A 3GRUA 4GMGA 1XJCA 1VJ1A 3L01A 4BNNA 2HEGA 1YONA 3ZEIA 4MWBA 1UM9B 4NYIR 2BFOA 3RAJA 1QIDA 3GFRA 1LJUA 2V7QD 4RS4A 1ORHA 4WY2A 3FWYA 3LT5A 1F17A 2O3UA 4OJMX 3TB4A 3ZV6A 2GF2A 2P9QA 1DX9A 1N3IA 2CFSA 4OEHA 2I22A 2I9KA 2Q45A 5HPYB 1LWNA 5EQTA 3UB4A 3UXMA 5KS2A 4I2VA 2RGYA 2OBXA 3N28A 3ZGLA 3ZUPA 3ZLVA 2OK8A 1QG2A 2P9TA 2QN7A 3KYCB 3LX8A 4I8DA 4EG3A 4WA8A 4ZMBA 4RJ2A 1GG8A 1UP7A 2OLKA 3S2IA 3GRAA 3I3SR 1Z4IA 2XA1A 1Y81A 3U9SA 3VHRA 3W77A 1P45A 3O3NB 3FNBA 4GMFA 3W6NA 3REQA 4F4UA 4RORA 5C31A 4JUCA 4E5NA 2QK4A 3P4XA 3FUXA 3BMNA 2KX7A 3O1IC 4EG7A 4MLCA 2HU2A 3NRBA 3L6CA 1EE1A 1EDEA 1KBZA 1A50B 5I47A 1P91A 3ICVA 2WTAA 4G01B 3RWBA 4M1ZA 3NIBA 4IXNA 4XH9B 5BQ3A 3RLFA 3G17A 3AEZA 4WD3A 2O23A 4MPTA 5IK2D 4A1OA 1PZEA 1PR4A 3Q5EA 4AZTA 1O89A 2AB0A 2R9VA 2PL5A 1YI0A 2X7JA 4YIKA 3RM3A 3FOEC 2WIDA 4MWGA 2P9CA 1RHJA 3M3DA 1HQYE 4MDEA 1V45E 3G5AA 3JVUA 5B3JA 4BQFA 2CV2A 1VRCA 4TT3D 1UJBA 2A7QA 4M6WA 1OXKB 3SFTA 1ZA1A 1GDHA 1ZR4A 4ZV9A 1LK0A 3AERB 4KMRA 2NXWA 5COAA 4ADSG 4RSHA 2ZJ1A 3BD9A 1WOMA 3FYTA 4BLRA 2AEFA 3F5DA 2CXSA 5F2KA 1SAYA 1U7UA 4AMZA 5IAEA 4B09A 1ZEMA 1DC6A 1XQ6A 4D80A 3G9UA 5IYZA 5MFZA 1BHJA 5HJ7A 1T4GA 2YV4A 3OT5A 2NUPB 4GXNA 4ZYZA 3A6FA 1BDIA 2RGAA 1IUKA 1KKMA 4J1TA 3QMVA 2CEKA 4QYIA 1U2GC 3T3HA 3ZGNA 1JR3D 1FF9A 4Q0MA 3T4EA 3P9XA 5LB2A 1EFLA 4TWIA 3MPOA 3IVCA 3JZIA 1NASA 3FJYA 3NRCA 5FRDA 2V59A 3GX1A 2YFQA 3UJ3X 4DBVO 1GTG1 3HB9A 3ZDBA 4PC2A 3N3AC 4W1SA 5AXBA 5HQTA 1OFUA 1RHMA 4XDHA 3IGFA 4CLRB 1SU8A 5I5EA 4EBBA 1OGYA 5BRAA 2YXBA 4DKXA 1VE6A 4BXOA 1N5KA 4JB8A 4BN0A 3SMQA 5EGNA 3IOEA 3ZDAA 4ROTA 1RI1A 3Q8LA 2XXJA 1G0NA 2BM8A 2O2HA 2VL7A 4QQ8A 1T2VA 2Q3MA 4OLBA 2W4IA 5CB6A 2I7XA 3QVLA 4M9XA 1N5JA 1XTJA 4ZOLF 5GGYA 4AKSA 1HRDA 5IVHA 1QRSA 3JWJA 1XMPA 3W9YA 4NKRA 4PGHA 3LTNC 1NRXA 4WZAA 5EPUA 2AG8A 3GCDA 3HV0A 3TTUA 3STHA 8LDHA 1JLKA 2BBSA 3IDQA 3JX9A 2ZUCA 1AURA 3C15C 3HJGA 3OQ1A 4OQDA 1VG0B 4N49A 1Q57A 5AJXA 4A0GA 4TSRA 2IOFA 5B2ZA 1VPWA 4UEKA 2AZTA 4OAOA 3SE0A 2IV7A 2QMQA 1BQ3A 4BFVA 5ALKA 1CUZA 4QVIA 4AWXA 3BYZA 3K5PA 5CBPB 3AI3A 3CB2A 5K0SA 1WPQA 1KRHA 1MAAA 3WYEA 1CRLA 1R50A 3H3XA 3LCJA 1KYWA 3RANA 3COWA 1ZA2A 2I33A 3L6DA 3ZWCA 4KFCA 2ZYGA 3A9VA 3EXHB 1ZH6A 2F3QA 3IAEA 1U81A 3F96A 1YZLA 3T5GA 3C3PA 3NBZC 3C3CA 2YW9A 2ON6A 1FFBA 4P0QB 3PNKA 1Z35A 2FLKA 5LPNA 4MXDA 4QGFA 4HQRA 4RTKA 3OTOB 3MW8A 5LWHA 3GLRA 4KVAA 4MS1A 3QOYA 2WDPA 1MO4A 3B1WA 1Q7EA 2MYTA 3N05A 4HI0E 4PYOA 1WXHA 4YJKA 4C9BA 1XZGA 2UVPB 3DOCA 3CPJB 3TJMA 4H7JA 1ND6A 1QMGA 2VI5A 3CX6A 3MINA 4B7AA 3HWSA 4RD6A 4DV5B 2SHKA 4DCPA 2VBFA 3TGPA 5LFAA 4IGEA 1H69A 2HF9A 3ZV7A 4AKEA 1R8YA 3LYHA 3CNOA 3HRIA 2OSBA 3NG1A 2Y66A 1D2CA 1URPA 2FGJA 2H06A 5AKXA 5A0FA 3VU3A 4KIGA 3IT3A 2BW0A 2J3MA 1W2HA 2MOKA 1NMSA 3QKSA 1M2KA 1XHLA 4F9TA 2DFTA 1LQTA 4YUAA 2WLTA 3E22B 4YR7A 4IIEA 2ARKA 4NZNA 3TTVA 4ASUD 4YXWD 4XIFA 2W22A 1PZGA 1NXSA 3RRNA 2WT8A 3KJNA 4JL8A 3TMYA 5LOVA 2NO5A 3N9IA 4KO1S 4MROA 4MPPA 2OYSA 1CT9A 4II2A 1RPNA 4JUAA 3WBFA 4ZFNA 3MF4A 4C01A 1VHTA 1NF2A 2ROQA 4HUQB 1GYQA 4EG0A 4ENSA 1MT3A 1PFVA 2K2WA 2CSXA 3E9EA 5AM5A 5HUJA 4F5EA 3V34A 3AM3A 1N4AA 2B82A 2YZMA 4MJLA 4NXMB 1T8WA 4NWIA 1HSOA 2L17A 2XB9A 3JYQA 1OI2A 4CL2A 4PPGA 3ZDYB 1RXEA 1UFVA 3TL6A 1B93A 1RKVA 2X4GA 5YASA 3UHJA 3N1UA 2VNAA 1G2QA 1S2IA 3IAM6 5CMLA 4DT1B 3OKFA 1YHNA 2IP4A 2XOEA 1BDMA 1GGVA 2B7BA 4DCTA 1DELA 4R8LA 5ALIA 3CHYA 5JPIA 4DV3B 3QNMA 4RFSB 1TTQB 2WWWA 5DLEA 1PGQA 2QU8A 1XD2A 4JJZA 3T38A 2QMHA 5DK6A 5T57A 2OGWA 4EB6A 4A0HA 1MJNA 2BF4A 1DQPA 1KPHA 2OZPA 2WVAA 5HF9A 5HF6A 3OD1A 1JT9A 3HCPA 4KP7A 4AY3A 1JGTA 4KRXA 2J3DA 3HZOA 4G0PA 3RJZA 3P1JA 4DCOA 3J7AC 3F6RA 5LQSA 2OHGA 1HURA 1KR5A 1NG9A 2H1FA 5TQVA 1U3FA 1ZESA 1N36B 3UCFA 2EX4A 2CYBA 2CFOA 1SUEA 2PZAA 3AI2A 2XIJA 3HXLA 4OGLA 4P34A 4ZQFA 1YGPA 2W9XA 1MRSA 3N76A 3THYB 1PJZA 2JFQA 3BRCA 3GLKA 4RZ3A 4Y2RA 4DMRA 3BL8A 3BJEA 3AR9A 3GXBA 5BWLA 2WWFA 1E6UA 1D2EA 2XZTA 1X39A 4PRKA 1GZ7A 2CKMA 3FNFA 4DBLC 1ODLA 3O90A 2BEVA 4OMDA 4F0JA 1C9JA 3A4YA 1AB6A 2HPHA 2JEOA 5DM0A 4WN9B 1RQRA 5LLTA 1Z33A 2NVOA 5TX7A 2AD1A 4DOMA 1IAVA 4PNZA 1PX2A 3RW9A 4CIXA 4AY2A 1P2TA 3DKVA 3HUFA 1VHQA 2DAPA 3SKYA 1CZNA 3HKBB 4OGFA 4EUFA 4MW6A 4DLSA 2NIPA 1Y4DE 5E0KB 3WRYC 1M0WA 3F3KA 2PQMA 3JWGA 4Q1CA 3DS8A 2WKQA 2GWRA 1TKRA 4ARIA 1NRWA 2JIMA 5KVSA 5I51A 1D1PA 1M2NA 2KSQA 3MOSA 4D43A 4ZCLA 1CIPA 2A9JA 2NXEA 4O2RA 2EVWX 2B2CA 2RAVA 4KLZA 1GN9A 1GYPA 3IP6A 3GH3A 3KE9A 4BMVA 2XT6A 5ADVA 4HLDA 1IY2A 3ZCSA 5EVJA 5FDFA 4R7GA 1IULA 5F23A 3SF0A 5KTOA 1O58A 3OZGA 3SSOA 5BPFA 2OB1A 1GITA 1YFJA 3OURA 4KW7A 5C3UA 3L84A 3G2NA 3KJQA 1VB5A 3E0QA 3MN1A 4LECA 3H4TA 3ENKA 3VJLA 4S2UA 4Q3CA 5KJ1A 2Y93A 2ZTHA 4LJRA 4WBNF 4U0JA 2HIAA 1FS4A 3RI3A 1HFWA 2PMKA 3EIHA 1GXSB 3GVIA 4XDYA 5ILOA 1TMKA 4KVFA 1EM6A 2OY0A 1UKYA 4F84A 2RAFA 4GSKA 4C0HA 4IDQA 1FOEB 3QSGA 1N8SA 1OLXA 4UBMA 5A1TA 4QTXA 1CZKA 1TUEA 4UFOA 4ZQGA 2IYXA 1BWSA 3EIQA 4YRNA 2JFYA 5DYGA 3AHJA 3GVHA 2X9LA 2X7XA 3K2EA 3MHPA 1TNDA 1U2SA 2ETVA 3AHEA 1Y9EA 3KJFA 4QYSA 4J0QA 1QZ3A 3E7PA 4X8HA 2BC9A 1FVFA 1KEEA 3OFVA 5BSMA 1EX7A 4PFKA 2HQBA 2DSNA 4R16A 5IUKC 4BU1A 1I0LA 4W6ZA 3RROA 1H1LA 1XVVA 2NPIA 1JG4A 3I2JA 3CZCA 4X1YB 4WJLA 3FNRA 4TZKA 1RYZA 1ZIOA 4AURA 1UUFA 4ZI7F 3B1VA 3CEAA 2JIQA 4JJGA 1VE1A 3U4QB 1C41A 1NZDA 1TVKB 1F60A 2OZEA 3ZEAA 5FL7D 1NJ6A 1T5IA 2SICE 4HTFB 5DNWA 1B8PA 4MYDA 4F45A 4J0EA 2YBEA 1E96A 3H84A 4ZI7B 2GESA 4P3NA 4ZDIA 1W35A 1WDWB 4CWAA 1W36D 3LP6A 1A96A 2EKBA 3L40A 2V0NA 1W6RA 2JAHA 2JJ8A 2JHCA 2DQZA 3EQ8A 3N2IA 4TMXA 4YP1A 2CUTA 1E1DA 1DLIA 2O2ZA 4J16A 3UJ9A 3UHOA 4Q4CA 4HNUA 5ARBA 5JEDA 2D7DA 3S4YA 3B2NA 1IM2A 2F8LA 3O4VA 3I5UA 1RT9A 2NV0A 5COQA 3GDFA 4IDFA 3PF9A 5KNBH 4RH3A 1J8DA 4EARA 2ONZA 4IH1A 1GVHA 2XTMA 3C6BA 2C2XA 4Y6OA 4H27A 5HDBB 3SQLA 3TX2A 5LYJF 3L4SO 1ISHA 4JL6A 2C00A 1VP3A 1IM8A 3H9GA 4YMGA 1UK6A 4UE3S 1DMSA 3BQ9A 3F4BA 1T5OA 3PVSA 2EAUA 1AK1A 2R1VB 3W5DA 4LY6A 3AWIA 4U2FA 3VO8A 4Z7OB 3BGSA 2P2NA 4P7GA 1XEAA 5LYJB 3HZRA 3IL2A 1PVDA 2ZXUA 4N5LA 3REGA 3T4PA 4D4KA 2OCPA 4BVLA 4FZ3A 1P1JA 1H0RA 4MYRA 1QFMA 3EA5A 4UU1A 1N77A 5DYIA 3A14A 2TS1A 3ABOB 4MLDA 3UCEA 2C4NA 3FNEA 4D6YA 5CA0B 1V47A 2W0MA 3VDXA 1BCSA 1AKMA 5A4IS 3O2QB 4P7BA 1BXZA 3WLPA 4Y3UA 3RS4A 1XU4A 2XEXA 1JQKA 3WBKA 1Q7CA 1E2FA 4HYQA 4K9KA 4ZJYA 5AW0A 1X8LA 5CA1F 821PA 1RYEA 3GBSA 1H2XA 5CTJA 2OYRA 1NXQA 2Q3EA 5DBOA 2XXBA 3S3TA 4OX9B 2QSJA 3QKRB 1RM0A 1RXIA 2F1IA 3GT7A 5K3CA 4AYWA 3KPWA 2X3UA 3O92A 4MWEA 1HL3A 5CUQA 3NJ8A 3PFBA 3LY9A 3OY2A 4WXMA 4X8LA 5JTTA 1BOOA 2QRVB 4C3VA 3LC1O 3QM1A 1WSWA 4XGQA 1QGZA 1NF3A 1Y8RB 1JWAB 3B6JA 3JQ9A 4AUEA 1FP7A 1K6EA 3D6MA 2VDPB 4RV9A 5CVJA 3R8FA 4O29A 3S81A 4HRAA 2FQQA 3DBOB 1R0XA 1K66A 1A7KA 1TMYA 2YV1A 4JODA 1FLDA 1HORA 1S2MA 1ZXXA 1GQRA 2Y77A 3F7TA 3L0BA 4AT1A 5L3QB 3V55A 1B73A 1EDDA 3PNPA 1KEVA 3HZHA 3KPYA 5F64A 3RKSA 4BEWA 1UBRS 1JHOA 3KU1A 4WGFA 1TRKA 1VLLA 3EHEA 2IBSA 4OB8A 3MS2A 3WRXA 1UJ2A 2AMLA 4AJ1A 1NJ8A 3WGYA 4DDKA 1EQUA 1LSJA 3WK6A 3J7TA 1CE8B 1OW3B 4JFAA 4BX9A 4DSZA 3I32A 4HV4A 1XA3A 3RVBA 1Y4UA 1G8PA 4UHBA 1F14A 3CLRC 5AH0A 2JCYA 2BEUB 1R8XA 5G2OA 3UANA 3REOA 4FT4A 2C5LA 2FPIA 2VLIA 5MF6A 1TLLA 2QV7A 1CRZA 4MRNA 1ODSA 5ALYA 3TYXA 1F1BA 3WV5A 2WJAA 2ZULA 3ZLBA 4M22A 4G81A 1AUVA 4MZXA 3A8TA 1SU6A 1MV8A 1O9GA 1T0UA 1ZONA 1Z56C 3FROA 3IODA 3LCVB 4MQMA 1S1MA 4BNGA 1J5EB 1MB4A 3V6LA 3IEVA 1SWWA 2C4TA 3NH6A 1R5OA 2I9PA 2WV7A 4J07A 3VTFA 1JRLA 3LF1A 5AKHA 3ABQB 3WGIA 1G3QA 4G4GA 2O2DA 3M2PA 5AYVA 1VECA 1KE1A 1N6KA 4JNKA 3IOYA 3N86A 3UJ7A 1V1RB 3NYRA 3TM5A 2Z9CA 1A1SA 3LRPA 3EC1A 2ACVA 4RA9B 2O4CA 1OX4B 3ADCA 4RJIA 3UUFA 4B4VA 2DR0A 2Z3WA 5D00A 1HQDA 3U4MA 2WWGA 4QTTB 3KTAA 4RA6B 3RO7A 1A69A 1ES9A 1WDMA 4KMOA 1R7RA 1R6TA 3EMKA 3OFND 4JFRA 1A76A 4QYWA 1XU7A 4Y9UA 4P33A 3B12A 1QHHA 4TS3A 3PJGA 2YRWA 3S2SA 4CUKA 1K8XB 3DYIA 3QOWA 4O2AA 1K68A 1NI4B 4GVPA 4GUAA 2JI7A 1FVOA 3LUDA 4KWEA 4O4LA 3ZV4A 4AF6A 3FOFC 4OBXA 5K0NA 4P7FA 4WLEA 1XV5A 3UMVA 4TLDA 2GK4A 1SG6A 1VBNA 3ER8A 2ZYUX 3MT7A 3H19A 5WRFA 1I7PA 4DAOA 4TVSA 1FIUA 3STYA 2G67A 4W9NA 3ZTYA 4BB0A 2Y9PB 4IDCA 2XMBA 1WMDA 2N0SA 3D3EA 2AW5A 3REFA 2AL7A 4PXAA 2IV2X 1YKGA 1LPSA 2H4JA 4NAHA 1VPDA 1WNFA 2A1IA 1D6JA 1HSZA 1KYTA 2BMFA 2Z2XA 2H1SA 2GPNA 2XUKA 2XZOA 2EZUA 4ZQBA 1F8XA 1FMTA 2PN1A 4I50A 4RKRA 4Y0VA 4F6LA 2HLDA 1CNEA 3K0SA 3VUFA 4BVKA 5IP5A 1P9WA 5DTEA 4UBLA 3ADKA 1PR9A 3WLIA 2EBFX 1I3LA 1NQAO 2JIZA 5F12A 2N9UA 1OLOA 3SXUA 1RC8A 4F9EA 1WDLA 4AM8A 1IVYA 3UA4A 1H94A 2JZNA 4EJ2A 1J21A 4JZYA 4KZKA 2ZJZA 3HO6A 4GR5A 1V7QA 5ISMA 2DF8A 1BH2A 1F51E 4PYQA 4JQSA 1IBRA 2R5FA 5HILA 1QFJA 1RR6A 4YX9A 4YAJA 2AV6A 8MHTA 2H4XA 4QRDA 3STUA 1UK9A 2GCOB 2VJMB 2W43A 4KXNA 1X87A 2H1OA 3FWKA 1I3NA 3BGDA 1DAIA 2PWZA 5BVHB 5IJWA 1IATA 3U7QA 1ZK2A 2IEIA 4F38A 4BWYA 2VXBA 4HF7A 4YCAA 5SZHB 2HKIA 4J91A 3UNXA 4ALJA 1T4MA 2J3EA 2OMEA 3ZWNA 4V0OA 3ONWA 1ZW1A 4EENA 4D0RA 2P79A 3ZS9A 5BV2P 1OX5A 2IIBA 1E9BA 1A9SA 1P0PA 2B7LA 4LOLA 4KPFC 4AXBA 4QFDA 3OF5A 2VTBA 1HWYA 2J07A 4HDSA 3OAAA 4PR0A 3IRVA 2PY6A 1GFSA 3HR4A 4FB4A 5IWCA 2XSZD 1IQ0A 1AZLA 1VKHA 1WHSB 4UPVA 4DYVA 2NXNA 4I4TA 3NP7A 4WKOA 3T5CA 1S3IA 2WJGA 4BYGA 5BURA 4OAQA 5GWXA 3GG9A 4URHA 1CZOA 5C37A 1HT3A 2DFDA 3KT0A 4MUKA 3KKKA 5DOVA 4O4IA 4R6XA 3I23A 2XUOA 3F6CA 4N5MA 4WK4B 1WCIB 3A9SA 4XLTA 4YXFA 3RWOA 4E2YA 4GQAA 2WWRA 1P17A 3FPLA 1GKIA 3HVRA 2C1ZA 3FR8A 1R4MB 3EH2A 2LNDA 3NOVA 1XQ1A 1JKJA 1Z3CA 1QC5B 3T7TA 3ZY3A 1ORDA 3RIHA 3T06B 1QK5A 1YFKA 5JAOA 2QM0A 4YJ2A 4GMHA 2E6UX 4AIIA 3C3WA 3D8BA 4TYYA 3A9CA 1ADCA 3A7DA 2QM3A 3ACDA 1IBMB 1HEYA 4PINA 1NPTO 4ND8B 3V2GA 4HGRA 3HA7A 2X0JA 1V8OA 2MYPA 5FORA 1SC4A 6GPBA 3ME5A 4MVWA 4Q1EA 1FJ2A 4DILA 3IPCA 4BX0A 1Z5ZA 3BL5A 3LHSA 1CQIB 4W7IA 2QN8A 5I8ZA 3SI7A 4JOSA 3BA6A 4WNCA 3LH5A 2HN9A 3H17A 3L6BA 4YT2A 3FPKA 3QENA 2ZB7A 1USVA 2BR4A 4MWDA 4Q15A 4YAOA 5I8WA 2E55A 3OFJA 5C4GB 2GCNA 1Z88A 2EW8A 2WMDA 4A23A 2Z83A 2ZZKA 4ODIA 1THTA 4IHJF 4ZCRA 1HE1C 4CQNA 5DBFA 2ZANA 3ETNA 1VKJA 4QX6A 1LPMA 2BFWA 4GWKA 3NM4A 4YLYA 4NBUA 1O96A 3N58A 2R86A 3S2ZA 1KHHA 4OLAA 3WGQA 4PQEA 2GCGA 1FVXA 2BUCA 3I12A 3LFTA 4KXLA 5GPBA 3PHJA 4A82A 2BTQB 3OCJA 4KXVA 2EHJA 5EESA 4R9VA 2Q3HA 1FYVA 4CTNA 3ITEA 3KOXA 3IEMA 1X9HA 5FX2A 1GTSA 1R0WA 3LCUA 1K6XA 1XBTA 1GPAA 4UQLA 2Q9BA 3H9EO 4BUCA 2I7TA 1W1UA 4LOAA 3T1TA 4J7XA 1X7XA 5DCWA 1V39A 2BISA 2RHHA 2VWQA 2QSZA 3G5MA