2ZI6A

C4s dck variant of dck in complex with d-da+udp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
241
structure length
217
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 78
structure length 217
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi6A00
3RS3A 1DG1G 2E1RA 5KDDA 1L4UA 3FKSD 3TQFA 3SU8A 2GHIA 4P4SA 3HR8A 1ZM2A 1TQDA 3AVQA 2FSFA 3BJIC 3X1ZA 4AKEA 2J0UA 3NG1A 3GP8A 5LD2C 2CK3D 2JIZD 4MYUA 1YJ5A 2ZI6A 3AKYA 2EWWA 2R6GA 4EFLA 1WP9A 4YQFA 1SVIA 3QF4A 3AM1A 1I2MA 3W5JA 2ORWA 1U0LA 2ZS8A 3IHWA 4U5XA 2HLDD 3ZS9A 1SXJC 3LBIA 1CR0A 2V1UA 4NCIA 3CW2A 4JLOA 3LV8A 3GLIA 4A6PA 1LB1B 1ZNYA 5EXPA 1AJEA 1W0KD 2ZJ5A 3NDPA 1OLOA 2FFQA 3SI7A 1N6IA 4X8OA 4JJZA 1WQ1R 1TADA 4H1VA 1R4AA 2BCGY 1KI6B 1TU3A 1DE0A 3T1QA 1RRGA 1KJZA 3GEHA 3PG5A 4JVMA 5SZIA 2FEMA 4UNSA 3SJBA 2QMEA 2BDTA 1LNZA 1G3IA 4G3XA 1SZPA 2ODEA 3O8BA 1U2RA 4TTPA 3PENA 2IWHA 2WKQA 1ANKA 4LBWA 2XITA 4L16A 2QP3A 4LYAA 2XZOA 2JJ2D 2ZRBA 4UXIA 2J0SA 2BEJA 4Q02A 3A4MA 2ZREA 4JLAA 3QKRA 2DWOA 3BIFA 1FW6A 3K9LA 1AKYA 2C77A 1E9AA 4RFSA 3UG6A 4D2IA 1XJ0A 4OHZA 3TSZA 3I3SR 4PPGA 3O8RA 4G5RA 4DT1A 1SXJA 5AJWA 5G53C 3SJZA 2ODWA 3Q3JB 1CEEA 1OIVA 3U4QA 1X1SA 2Q3MA 1KO4A 1AA9A 2QAGB 5IK2D 1CS4C 4R71A 2BIFA 1NSFA 3KKMA 4BZXA 1VYUA 4N0EA 1D9ZA 1E0JA 1KOFA 2MSEB 3D8BA 1XXHB 5E7MA 4BLTA 5EP1A 1E1QD 3LAWA 3IQXA 2CLCX 2NO9A 2QL6A 2GDJA 4IDPA 1P2SA 2AX4A 1KDOA 1I4TD 2Z6VA 5FOXA 2E9SA 4IVQA 1X6VA 2VTKA 1XDBA 3CWQA 1OFHA 5DYGA 3TSWA 4QHYA 4QM6A 2QUZA 1EFUA 3K09C 5GJCA 1QHHA 4LPSA 5CB6A 1I4DD 5L3QA 2FFBA 1S9HA 5SZJA 1NVXQ 2QU8A 3I73A 1Q1BA 2FJUA 5EE5B 4N1AA 5DE3A 3PEWA 1KI4A 1NVWQ 4TT3D 3SQXA 1N5LA 2WWGA 2DY1A 3WYAA 4XIGS 2GXAA 3UMSA 4EPYA 3OEED 2V54A 4W5HA 1B23P 1F48A 4HLCA 4AKIA 1TNDA 1ZNZA 1MO3A 2JDIA 3ZVLA 1NBMD 1AS2A 3K70D 4B2PA 1P6XA 4BEBA 5JZVA 5H8WA 3B1YA 4DKXA 1S9DA 3RSLA 1EESA 1M74A 4V02A 3D3QA 4OBEA 2EQBA 1E4VA 1W46A 1U8AA 3CLVA 4HUQA 1DO0A 4AC9A 4C0JA 1G16A 5AUPB 3DVLA 1QHSA 1EFTA 2IYVA 3LQQA 4LHWA 4PX9A 2JLUA 1OXUA 5UKDA 2VH5R 4NMMA 3KQNA 1TX4B 4Q4AB 2FE4A 2GETA 1UFQA 2C95A 2ZM5A 1XJQA 4DJTA 4B34A 1N5IA 4ERNA 4MRVA 3F0TA 3GD7A 4HATA 3THXA 3TJZA 1HURA 3MMPA 4HB3A 3LW7A 3QVUA 1EWQA 3GLGA 2C96A 1G8PA 3M0EA 5J4VA 3K09A 1Z0AA 4WVFA 2EU8A 2VYFA 2WSSA 2F55A 1PZNA 3F8TA 4LZZA 1E9FA 4HLUC 1E99A 2O8EA 2AL7A 1GIAA 2BOVA 2XGJA 1VKJA 2MMGA 4MKIA 2WIAA 4OL0A 1X8JA 3SFZA 2WWIA 1WF3A 2ZRHA 3HP1A 1C9KA 3EPLA 5FR1A 2ZYVX 2BMEA 3DEFA 3Q9LA 1T6NA 1FL9A 4ASUD 4L9WA 1AS0A 5JS8A 3AVOA 2OUKA 2MMCA 2OCPA 1CU1A 4MGZR 4F93B 221PA 2FNAA 2PBRA 1EXMA 2ZJ8A 3CH5A 1J2JA 2WBLC 1T5IA 2IA5A 4CYMA 4ZKDA 2F1IA 4Q1CA 4KHZA 3AVXA 2HXYA 4XWKA 5GADl 5LDDC 4URWR 2ZS7A 3QKSB 4D4LA 1T91A 4WA7A 4UNRA 2ZJYA 2WPDA 1RJ9A 4I81A 4BLPA 4YDHB 4FXPA 2XTNA 1MO5A 4Q1FA 4CT4B 5JSZA 5DYIA 1JJVA 3VHXA 4UNNA 3KQLA 1GNRA 4U02A 2QP9X 4NCHA 2CCGA 1JAIA 3LXXA 1NVUQ 1QVRA 1T3LA 4PC3A 4RSGA 4Q1EA 4C9BA 2ZI7A 5KSZA 3U61B 1N6HA 4JLBA 3ZJYA 1EFCA 3L82B 2XXAB 4ESHA 2N42A 1VECA 1N6LA 2V7QD 1KKLA 3KTAB 2O8FA 2C99A 2C5LA 1EX6A 4ARZB 5JJKA 4HLQB 2AK3A 5TARA 1U90A 1SKYE 2P6UA 2REOA 4TYQA 3NBYC 4FMCB 3EWSA 4OHXA 5AUOB 1T3SA 4DSUA 2HCJB 4DSOA 2F1HA 4IKEA 2H17A 1Z83A 1YRAA 1FUUA 2ECKA 2J7PA 1EGAA 3C16C 3CF6R 3IIKA 4HB2A 2OXCA 1GL6A 1Q21A 3C15C 3V4FA 2EW1A 2A30A 5JECA 2W83A 1XMJA 1W36B 2KSQA 1KI7A 2BMDA 4UNPA 4PO8A 4HLDA 3I62A 3AF0A 1PV4A 4POAA 4MYTA 4TYYA 3LD9A 1Z08A 3P20A 1O3YA 1E1QA 1GL7A 4LPKA 2F3RA 3KKOA 2FWRA 2ZI9A 1T0HB 4DUGD 3KX2A 3AVVA 3VR5A 4DLSA 3CRW1 4KITB 1L8QA 3H86A 1FTSA 2RGNA 1G7RA 1N6RA 3CPHA 5IDVA 3R8CA 3VTKA 4B75A 721PA 3NH9A 3WYGA 1EFRD 3FB4A 1NMXA 4NTZA 1R2QA 1OJLA 2R62A 4A8JC 2RB4A 4DDTA 1CLUA 4RCZA 4P4UA 4UXJA 3W8RA 1IJFA 3GJ6A 3SC3A 2LCFA 1SXJB 2GJKA 3K70B 2WKPA 4BFYA 3ZH9B 4DHEA 4A8JA 4PZLA 3FTQA 4ACAA 1J90A 3HU1A 2I3BA 2VF7A 1CJTC 1EFHA 1YZKA 1KSJA 4JBXA 3AH8A 3SR0A 2IL1A 2BWJA 3RAPR 4FI3C 3FOZA 1E3MA 2ANCA 3B60A 3P4XA 4CW7A 4L5BA 1E1RA 3ZZ0A 2PLRA 1E79D 1SVWA 2JCSA 2WVJA 3ZVNA 4JLNA 1KO7A 2FV8A 3V4RA 4CEJA 2KBFA 4GFDA 3TGPA 3QE0A 2WKRA 4KCGA 5K8TA 4KO8A 1AKEA 1XEFA 3QJYA 5B58C 3AVWA 3TBKA 4OKSA 1H8EA 2B8TA 4LJ5A 4ARZA 3S1AA 4JSYA 1UEJA 4D80A 3A1WA 4IVRA 4OQFA 3CM0A 3O8DA 4JKYA 3B82A 2J0UB 4MH0R 4YONB 4ACBA 2VP2A 1YZNA 2RKOA 1CTQA 2ERYA 1TQ6A 2PCJA 1Q57A 1H8HD 3C4JA 2DFTA 4M9ZA 3PEUA 1TMKA 4EPVA 3KZ1E 2D06A 3B5JA 5DI3A 2D2FA 1UDXA 4TYPA 2PZFA 5FUYA 1XD8A 1Y63A 2H1LA 2ZRDA 2A5FA 2ZRCA 2QRZA 4US1R 1G6OA 2XEXA 1NJGA 1S0UA 4JLJA 4Q21A 3K0SA 4FW9A 4EAQA 2GJSA 1OPXA 2W2VA 1VMAA 4D4JA 3F3YA 2OZEA 1BYUA 2J1LA 2XJ9A 1VYTA 2XSZA 3RS7A 2JLQA 5JJIA 3H4MA 3UKDA 1VCNA 2GAOA 2NPFA 1E2JA 4LUCA 2QP4A 4TL6A 1QRAA 2ONJA 1Q12A 3LQRA 3T12A 4A0RA 1OXXK 1SVKA 3W8NA 4Z1MD 2W2TA 1SHZA 2ZTSA 4RZ2A 4NCNA 1WA5A 5DH9A 2A5GA 5KOYA 2F6RA 3KB2A 4K46A 1E2IA 2IXEA 1RW4A 3VU9A 4D4MA 5JCPA 3GQBA 2VHJA 3BK7A 4QHTA 4JLPA 4AYTA 5GJWC 5JHHB 2G6BA 2O8EB 1G41A 2OXRA 1DELA 2X1VA 3K8YA 1FTNA 5JWHA 2GF0A 2XAUA 4OJKA 1CJMA 1N0UA 4JVLA 5FR2A 1IBRA 3BFXA 2C03A 3KXKA 2Y8EA 1P2UA 1BS1A 2G1KA 2BC9A 5JBQA 1DAHA 1ZRHA 5FL7D 2ZRIA 1E2GA 3CBQA 1W0JA 1CRQA 1G4UR 2CE2X 2FZ4A 2QQEA 5HTKA 2H92A 5BQ5A 4A6XA 3LLMA 1SULA 1P7CA 3X1YA 3C7KA 4A4DA 4DBLC 2O8CB 3VX3A 3CB4A 4F7WA 3TIFA 3BB4A 4P3YA 4TT3A 4FCWA 2D74A 1E4YA 4Q5IA 3TUZC 1PUIA 3EA5A 1OYYA 4XTRA 4GZLA 2VQSA 2HYDA 3CONA 5JHGB 2OT3B 3AF2A 3QXCA 4Z51A 5C4MA 2P2LA 1DAFA 4LC0A 4LY6A 3NH6A 2ZANA 1IN8A 1KGDA 4BEJA 4Y0AA 1QBKC 1XCMA 3KUDA 4EUNA 4BASA 4JVSB 4BZQA 3TQCA 3H0KA 1CBUA 5L3SA 3TVDA 2GTPA 2QROA 4DEYA 4R2IA 2XJ4A 1KSGA 3F5FA 2QENA 1ZM9A 1HH4A 1XEXA 1TUIA 4M1KA 1GITA 1IOZA 2WPDD 4TQUS 2FPMA 2QTHA 2LKDA 5J40A 1OKKA 2W6ID 5A4JA 1BMFD 5FFMA 2NOAA 2PT7A 3FPAA 5KTYA 2PJRA 4JLKA 1RRPA 2W2XA 4J0QA 4JL5A 4Z1MA 3NEYA 2FEOA 4C3ZA 4CEIB 3WNDA 4KFRA 3A6PC 3EIHA 4ZKEA 5CM8B 1G7TA 1VIYA 3KJIA 2GJ8A 1KZ7B 2N46A 2MSDB 4MKGA 1COWA 2OE2A 1GOTA 4FCTA 3MJRA 4HAVA 1MOZA 1M8PA 2YWEA 1XTKA 1US8A 1FZQA 5P21A 2ZS9A 5EE0A 1KDRA 1UBEA 3HU3A 3U44A 2HYIC 1E0KA 2AWNA 4GOKA 4JBYA 2JJ2A 2Q21A 3HU2A 3QG5A 4WIAA 1W2GA 1NG1A 5F9FA 5HZKA 5FUWA 4E07A 3WXMA 4HI0E 5HCNA 4PTLA 5KNCA 5FUXA 1XEWX 2RAPA 3GJ4A 2JAQA 4Q7LA 2VP9A 5G3ZA 1IY2A 1SQ5A 3NIBA 2CNWD 2H57A 2OG2A 1GAJA 3WBJA 4OJQA 5BN5A 2J41A 5LBIA 5FBWB 5C2JB 4TYNA 3TR0A 5K8LA 2VL7A 2HT6A 3C5CA 1QHXA 3AP3A 1TTTA 4Q01A 1EG7A 3UIEA 3W3AA 4O0MA 1G5PA 1S4QA 3AKDA 2VA8A 4BZPA 1IM2A 3FHCB 2ANBA 2J59A 4KI0A 4AG5A 4CVNA 4DIEA 3QXXA 3RS2A 1ESMA 2IUUA 4B3FX 4LDJA 3GLGE 3WRXC 4HDOB 1E0AA 1II8A 3NXSA 4NYJQ 3CX6A 4OI0A 3K0FA 1T8TA 2QMUA 3N70A 3E70C 4KSCA 1LF0A 1VPLA 2Z43A 2HJGA 3OIWA 1XZPA 1D2MA 1NI3A 1MRSA 2VF8A 1GKIA 1IN7A 2ZUBA 2AR7A 4WZBE 4DLTA 3M6AA 1W36C 1AGRA 1M7HA 3PFIA 1U0HC 4MUBA 3T5GA 4C0LA 5JEDA 4NHOA 2H5EA 3WNCA 3N2EA 4Q4JA 3K70C 2ZRPA 2A78A 1ZUIA 5FI0B 1M34E 1OHHA 1R6BX 2HJVA 1JQLB 4PO9A 2NTYC 1HT2E 3KKNA 1GG2A 1WCV1 4M9SA 2ZRLA 1W5SA 2GNOA 4U00A 4ZDWA 3L8YA 2HXSA 5FBRB 1TF2A 3T06B 3EC2A 1YU9A 4TMKA 5KUTA 3UMFA 1JI0A 1GNQA 4DDVA 1H65A 2IYLD 1YHNA 3LBNA 1KAGA 4KXFB 4PANA 4B3XA 2IF2A 5DLQC 1G7CA 4B74A 3VNVA 2AHOA 2W6IA 4EPWA 3C41J 2C78A 1B0UA 2IYWA 2Q3HA 2JA1A 3LY5A 5ANRB 1SVMA 5B57C 2P67A 2IC5A 1NLYA 2Q3FA 1LW7A 1KJWA 4B6EA 4XVUA 1Q0UA 5JI2E 1ZCBA 2ASEA 1LF5A 4QOSA 4MQBA 1HA3A 1ZIOA 5IHPA 5J47A 3ASYA 1MRNA 3FFAA 4PXAA 4TSFA 5HKKA 1QHIA 1NBMA 1WE2A 2R6AA 1IAQA 2B6HA 1DOAA 3BFKA 1TF7A 3KKPA 4KLNA 3SJCA 2WJVA 3DDCA 3MSXA 1RPZA 3WBKA 2B92A 5FPTA 1CR2A 2IHYA 4DRZA 2ZYWX 3GPLA 4IOKA 2GBLA 2FX3A 4IHQA 2LKCA 4O25A 2RGBA 1KDPA 1G6HA 2JATA 4DB4A 3I32A 4YMWA 4KVAA 1RC8A 4BE7B 3DZ8A 5CITA 2FF7A 4A9AA 2ZROA 1XF9A 4JZKA 2O8DA 4DCNA 3A36A 1E96A 2NO7A 1VYVA 5JRJA 5DN6A 4FD2A 4TQ9A 4BWYA 4LV5B 3CRQA 3AF3A 4HZUB 4KSBA 4JS0A 1XD2B 3QXJA 1T0JB 4B3CA 1FX0A 2PMDA 2ZU6A 2YWHA 5KSOA 2V6IA 4PQYA 2C9OA 3VAAA 3TLXA 4NDZA 4A1FA 2J7KA 1K5DA 2BM0A 3MD0A 2DFLA 2O8DB 4HAZA 1Z5ZA 4XJXA 1P72A 3EZ2A 4DCVA 4D0LB 3UK6A 2CNWA 4NU0A 4XVRA 5D3MA 2G0NA 5TV2A 3U3OA 4ASUA 2IWRA 4OHVA 5EUMA 2PJZA 3RYTC 1YZTA 2JIZA 2V3CC 4C2TA 3V00A 1WBBA 3CWZA 2GWHA 1W48A 4G5OA 4LGMA 5FOTA 1JQJC 1CXZA 2ZRAA 1WBDA 1BOFA 1HQYE 3CPEA 4BLQA 1Z2AA 3UANA 2QPAA 3AGQA 4FMBB 2GK6A 3AQ4A 4QJ4A 3U3MA 3T1OA 2QQ0A 4Q9JA 2IUSA 4EPXA 1Q1ZA 4HAUA 5AJXA 1X1RA 2F9LA 1FQJA 1COWD 4AYWA 4NBSA 2FSGA 3AP1A 1N0WA 3NBXX 5TY0A 3PUXA 2NQ2C 1Z63A 2A5JA 2WJYA 3W3ZB 2Q9CA 2ZVQX 3EPKA 1LVGA 1P62B 5LB4A 2OFXA 4B48A 2QY9A 2IYTA 3W34A 4F4JA 5J5CA 1GKYA 3KJEA 1U8ZA 2FSHA 1NVVQ 1P75A 2IF0A 2WM9B 1KO8A 1JXMA 1E98A 3MCAA 4LHZA 1ZVQA 3WYFA 3QVVA 2Z0MA 3THYA 2GJAA 3J81k 4HUTA 2AXNA 2RHDA 3PQCA 5EUQB 1NJFA 5DN6D 5J4LA 3U6BA 3TUJC 3DM5A 3FMOB 4DLYA 3MWJA 2ZETA 1SVSA 2VHQA 3JVVA 1W4CA 4IFEA 1ZW6A 3A4LA 4GBMA 1UF9A 2GBLC 4ITRC 4TTRA 2ZRJA 2O8BA 1R5BA 2KB0A 3K9GA 4R9UC 4Z8XA 2WICA 5BN3A 3KKQA 5EJEA 3B85A 4JKIA 4C0AC 4M1MA 3NC0C 3RRMA 3GLIB 3K0FB 4AYXA 3B1XA 5DHFA 2RGNC 3QIAA 2IX3A 3A58B 3CX8A 5CDFA 1JR3D 2R65A 1SVOA 4LV6A 2CLDX 2O52A 1R5OA 1HUQA 3TKLA 4OI2A 1KIMA 1NKTA 2KE5A 3Q7QA 2PX0A 3ZZTA 4A2WA 3GFPA 3GLFA 4C2UA 3KTAA 1XCGB 2PMKA 4NYMQ 3L0PA 4OYHA 5LPNA 3AEZA 3H1TA 4LX0A 4KODA 3CZQA 4XSGA 4MA4A 1DG3A 1ZNXA 2C9CA 4LJ4A 3QPVA 1FMLA 2GZDA 5IK2A 2NGRA 1W36D 3HJNA 2NZ8A 4IFBA 4B71A 4FMCF 1Q1QA 5L8VA 3WMEA 3QF7A 1BKDR 2EFDB 3ZIAA 4HAWA 1S2MA 1G7SA 2G88A 1W4AA 2ERXA 2J7PD 2ZSBA 2L0XA 3QBVA 1IN5A 3RRNA 2NO0A 1AK2A 4ZIRB 1JR3E 4CGZA 1S1CA 3PIRA 1W4RA 4RJLA 1ZC4A 1N3BA 1P73A 3CO5A 4NKRA 4IEIA 3X2SA 2H16A 1WMSA 4YC7A 2DPXA 4HSEA 4L9SA 4ZPXA 5EE3A 2B7CA 5EQTA 3SJAA 3PUZA 3UXMA 2OSBA 1MABB 4EJSA 4I1UA 1ODFA 5TB5A 4D26A 3X1DA 1P4SA 3CR8A 3DZDA 4EKDA 3ADKA 1SVLA 2RGEA 2VP5A 4B73A 1DAIA 2FFAA 3ND9A 3IO5A 4L4UA 2REBA 1J70A 2KJQA 3U3KA 2WMOB 1T9HA 3KJHA 1XTSA 4LJYA 2XTMA 2WHXA 5CK5A 1OXVA 5C4GB 4D6PA 4DLZA 1GKUB 2Z83A 2Z4SA 4N3NA 2NO1A 3CH4B 1DAEA 5EZ5A 1F5NA 4TQAA 4F38A 4AKHA 2FGKA 3B9PA 1E2MA 4RVCA 1E79A 1WDTA 5KDOA 3K53A 5FTNA 3D6TB 1TAGA 2OAP1 4TMXA 4XVQA 2ZR0A 4QL3A 2R6CA 3MRSA 1ELOA 4TMZA 3BE4A 4Q1DA 4IDOA 4PC2A 4Q00A 2QTVB 3UMRA 3ZDQA 4HAYA 3GJXC 3TUIC 3V9PA 4URUR 2YNMA 4QG7A 5FTJA 3QBTA 1G21E 3EIQA 4TN1A 5H68A 1ZD9A 2HV8A 4IJMA 1KI6A 4BLOA 4F92B 2EYQA 3AB3A 4CF7A 1E2PA 1N2CE 3VX4A 3SEAA 1XD2A 3M4YA 1RE0A 3OFND 1A7JA 5H1YA 1XMVA 1XPUA 1EX7A 4BRWA 2PZEA 1JR3A 4Y0VA 5HPYB 1OHHD 2GCNA 2WWFA 3KB1A 4A82A 3MWLA 4JLMA 4V0OA 5CIQA 2QMOA 3NBFA 4BFXA 4DVGA 3I61A 4BECA 3U5ZB 2J3EA 3WHKA 2BCJQ 2FGJA 3GFOA 3FHOA 3EPHA 1OXTA 4M0LA 2P3SA 2XNDA 3NEJA 4GNKA 4CDGA 4YMUA 1DEKA 5FPKA 3K1JA 1OT3A 5FOSA 1XXHA 2J0VA 3P26A 1D9XA 2G3YA 1OIWA 3U2QA 2P5TB 5HE8A 4QJ3A 2BBOA 3RVBA 3SYLA 2C2HA 1OB2A 3U7HB 3MG9A 1W5TA 5K8UA 1II0A 1IONA 1R5NA 2ZUCA 4RCYA 1F3OA 5FTMA 1G4AE 1VHTA 3AVYA 4DDWA 2B7BA 3NHAA 3UWOA 4GOXA 1YR9A 3CF2A 1IY0A 1HQCA 2FFHA 3WP1B 1Q20A 1KJYA 2YWGA 1NIJA 5TDHA 3E1SA 3NBZC 2XXAA 2BJVA 4A2QA 5JFGA 1M2OB 2V4ZA 2GXQA 1UKEA 1W0JD 5BN4A 1OW3B 1QHNA 2ZPTX 3AKEA 2QT0A 2VP4A 1RKBA 5FL7A 4BLSA 2JJ1D 1YZQA 3RS5A 1JR6A 4AI6A 1U9IC 3DM9B 4BFSA 2I1VB 3ZS8A 2OCYC 4RZUA 2G0TA 2H7VA 3RDPA 4XOIA 4B33A 2RGXA 5C18A 3WRYC 2WSMA 2JLVA 4TMTA 3ADDA 4QBHA 3BRWD 3TW4A 1G64A 2IXGA 2WZQA 3U7GA 2OFWA 1G3RA 2ZI5A 2JEOA 1U9IA 1Z6XA 3B2EA 1TQ2A 4EQ6B 2C04A 3IUYA 3R9WA 3FE2A 2O0KA 1GP2A 2XNSA 1C1YA 1E9CA 2B8WA 4C4PA 2J5XA 5BYKA 2VBCA 5HKKD 4QFMA 2R6FA 1UBFA 2XOKA 2D3WA 3VMFA 1BYIA 4ZI2A 4CIDA 4C0HA 4RKFA 1IHUA 2BJWA 4BRUA 1KYIA 1YZUA 2OCBA 2Z5FA 4M1SA 5AUNB 3A8TA 1KNQA 5KDLA 3SDZA 3QQ5A 1P60A 3EG5A 4I1VA 4B2IA 5LB2A 2CCKA 3OE7A 4QBIA 5FBVB 4TZ6A 1BMFA 1KI2A 4WXPA 3THWB 4QKQA 2MSCB 4Q19A 1XCPA 2VSOA 2XTZA 1XXHE 5FTKA 3THYB 4JMPA 2G9NA 2OM2A 1YR6A 1CULC 5H70A 5LD2B 1E2FA 1JECA 2OESA 4F91B 3L0SA 2V55B 3LH5A 2W6JA 2R2AA 2JJ8A 3REGA 1QVAA 4D0GA 5F98A 2CMKA 1DVRA 2QPTA 4DWJA 2ZVPX 4Z8YA 4CRWB 3SHWA 1KK1A 3D7MA 4G5SA 1G3MA 5J4HA 4FWIB 1G9XA 4AWXA 2D2EA 4IOJA 4KAXA 2IS6A 5KO2A 2BVNA 4LV8B 4JL6A 3PITA 5KPJA 2VP6A 4A0FA 4QNMA 3G82C 4B76A 3BBPA 1T4GA 2V7QA 2A2ZA 3KXLA 4P0TA 1WXQA 3IILA 4BLRA 1US8B 4RY2A 2EFCB 2IYQA 1VIAA 5DO9A 1E1RD 3S1AB 2PX3A 4HDQB 3AVTA 2FSIA 2YHSA 3I4LA 5E95A 1G18A 1YRBA 4LJ9A 1PLJA 1UKYA 1FNMA 3QKUA 3C5HA 4M4SA 4OHYA 1G8FA 1A82A 1KO1A 3RRYA 2BMJA 4ZV4A 3MLEA 2GA8A 4W5JA 1LFDB 5KNBA 1FMJA 2YWFA 3PJRA 1VHLA 2QZ4A 3CKLA 5AJZA 1Z07A 2F1RA 1KMHB 3HR7A 5L3RA 3RSOA 4TLBA 1PJRA 2VSXA 5FPHA 2AK2A 2BMFA 2WOOA 3I8SA 1KI9A 2XZPA 3THWA 2ZU0C 3A1TA 5JRZA 2OBNA 3PEVA 4R98A 3FMFA 4LI0A 2QAGA 3MWYW 2G83A 2W58A 4F4IA 3VKHA 5FH9A 4MUAA 3FWYA 1XBTA 3QKRB 1M7GA 5DI3B 5GVRA 3IEVA 3B9QA 4DLVA 3OF5A 1Z0JA 2ZRFA 4CEHB 2QAGC 3GEIA 1JALA 3A37A 4TLDA 1CR1A 3SQWA 2ZYTX 3EARA 1NBME 3FMIA 4A2PA 1ZU4A 4QHSA 1VG0B 4NYJR 4NH0A 2FU5C 3SE0A 4DLWA 1P9RA 2O8CA 5CJPA 1CJVC 1X8KA 4X8HA 2TMKA 3CRRA 4PAQA 4NPHA 4WOPA 3T35A 4U7DA 2QRNA 1KNXA 2OBLA 3QY0A 3I5XA 4HUQB 1WB9A 1VTKA 4Q7MB 2PL3A 5EXSA 1J8MF 3NC1C 3O47A 1MO6A 1AIPA 2NG1A 2ZRGA 2YJTD 3RRZA 1OV4A 2AFHE 2QG6A 2J46A 3PV0A 2ZE5A 1C4OA 3RHFA 1FP6A 1NY5A 3TMKA 4Q4HA 3TSOA 4AY2A 2KWIA 2QM7A 1ZD8A 3E5HA 1XMSA 4LBVA 3AKCA 4M9XA 1VG9B 2FN4A 4ILEA 3PUWA 3L0OA 4Q1BA 3SN6A 3VU9B 2ZSEA 4RD3A 2DCUA 4EFMA 2R44A 4DB2A 2QE7A 4DSTA 1NN3A 2W0MA 1FP7A 3AV0B 4MKHA 4Q9HA 4X8LA 2VPPA 2O0JA 1K5GA 5JWRA 3FMPB 3VR6A 1XFAA 1X3SA 4KFUA 3AVUA 3LX5A 2KBEA 4ZIRA 1Z06A 4BFUA 1ZUNB 1K8RA 2RH5A 3A4NA 4CEIA 4UJ3A 5C1BA 2GZHA 5CLQA 4XD7D 3IDQA 1W4BA 2GRJA 1E9BA 2RHMA 4LJ8A 3QPWA 1OH7A 2HLDA 1NN5A 4Q4HB 1FFHA 3ZIAD 2WTUA 3U7FB 1XRJA 2A5DA 4TSFD 1GL9B 4GMDA 4KJZA 3Q5DA 3R7WB 1DPFA 5F9HA 3QSYA 4OI1A 1OH5A 3I1FA 3BH0A 3DMDA 1OH8A 1ZYUA 1ZCAA 2YC4C 1IQPA 4I1SA 1WRBA 4K8OA 5FPSA 1KI3A 4M1WA 3LO5A 3QEOA 3SOPA 2HEIA 2X8AA 2NPIA 2GK7A 1OKKD 4PSVA 4E22A 2H18A 3OAAD 1HYQA 821PA 2QT1A 2ZQ5A 3B1VA 4A0HA 4E03A 2D7DA 2IEZA 4C7OA 5L3SB 2FMXA 3GJ0A 1QHYA 4URXR 1GRRA 3MGCA 1HE8B 4V0LA 2FG5A 5E7IA 3H84A 1QG4A 3REFA 3EIEA 3IBGA 4BFTA 3ASZA 3P27A 4QGFA 3IGFA 1PLKA 3B1ZA 5AUQA 4EJSC 1ZM3A 3CRMA 4TL8A 3U60B 3NVAA 4EPRA 1AM4D 1RRFA 1UEIA 4GT1A 1NY6A 3BORA 5HE9A 4C0QC 2QNRA 1VCOA 1J8YF 2F3TA 1NLZA 3L8ZA 1F2UB 4HAXA 1Z6AA 4JT2A 5FPYA 3B7GA 4D25A 2BBTA 1FPMA 2VEDA 121PA 2GEDA 2YVUA 3RLFA 2D4HA 5JWOA 4BGDA 1RVDA 4XTCS 2IYYA 1ONBA 3OZXA 4JL8A 4LYJA 1IXZA 1SHKA 3LX8A 1G17A 3TW8B 3X1WA 1QZXA 3LNCA 4ZI3A 3EC1A 4FMDF 5JEEA 4WAUA 1HEIA 1TEXA 5KPDA 1KHTA 4EIWA 1XX6A 4TTQA 1E2KA 4Q1AA 5JMTA 3FFBA 5B30A 2XNDD 3T5DA 2C98A 1OXSC 3K0EA 2B21A 1DADA 5D3QA 3THOA 2VP0A 4HDCA 2YKGA 2FA9A 3CRVA 1Z29A 3EZFA 3GLFE 3GJ5A 4CEJB 1NN1A 1XU4A 3K0AB 1DAMA 4NL4H 3Q8XB 2R8RA 1II9A 3LRPA 2DWQA 4YMTA 1XTIA 2PLFA 4JJKA 4TLEA 1UADA 1UKVY 5DHAA 1F6BA 2J87A 4BPBA 1HV8A 1HE1C 3VQTA 4URVR 3IPXA 2X2EA 4BFVA 4MDFA 3HWSA 4HYYA 2JLSA 3CR7A 4KV9A 2RGDA 3CUEF 4JLVA 1KAOA 3BFVA 2QN6A 1X8LA 1ZM7A 3TNFA 4TYWA 1ZD1A 1CP2A 3FKSA 1UPTA 1FUKA 3HYRA 1EK0A 2ZJZA 4KLZA 5CK4A 4TMVA 3BAFA 5JS7A 1SXJD 4WZ6A 1P61B 4C0SA 1Q3TA 2AN9A 2QSYA 1AZTA 5EP2A 2P65A 2WIBA 1M1YE 3SBDA 5AJYA 1KKMA 3NTUA 3OFNA 3CNOA 1X86B 2VHTA 2ZRMA 4QC2A 4UQOA 4LHVA 4B47A 4O2RA 4V03A 2PEZA 4XD7A 2X19A 4G0NA 1ZMXA 4AD8A 2Q9BA 3ADBA 2ZYUX 1KK3A 3RNLA 1HTWA 2Q6TA 2R6DA 3UWKA 1VG1A 3I72A 4US0R 2JGNA 4YMVA 1G1MA 4D82A 4ZCMA 1IXRC 2ODBA 1GRQA 1W44A 4MITA 3K0CC 1ZP6A 3B78A 4TLAA 3VHLB 1AN0A 1ZJ6A 4A15A 4PC1A 3VKGA 2IYRA 3LVRE 3SZRA 5FL3A 3IIMA 4IOMA 3RC8A 1E2DA 2CVFA 1U98A 3MAAC 1CJUC 3IBYA 4LOAA 3GLHE 3I8XA 1IJEA 2IEYA 2RGGA 1W0KA 3BB1A 4IDQA 4D0NA 1A4RA 2GXUA 1SXJE 2BM1A 1XP8A 3L43A 3U6KA 5M04A 3JZMA 5CYPA 4GL2A 4A92A 2PT5A 4RD0A 2XB2A 2SHKA 1E2QA 3BOSA 2VLIA 1Z0KA 4KBFA 4D4KA 4M8NE 5DNYB 2G1JA 3M1IA 5FOWA 4AIIA 5DISB 1P9NA 4GPTA 1CIPA 4B3GA 4QXAA 3U4QB 5BXQC 5EE1A 2X77A 3W90A 3CNNA 4TLCA 4TMWA 4AK9A 4UKDA 1AS3A 3Q72A 1UKZA 1XMIA 1XPOA 4P33A 1CR4A 2WJIA 4Z54A 1I4LD 4YXWA 1PVOA 4CZ2A 4Q48A 1E0SA 3ZQJA 1U8YA 4B35A 1L2TA 3NHBA 2I4IA 3EAQA 1PLLA 4Q9LA 2IS1A 1OFIA 3TVTA 3MUFA 2CHQA 1OYWA 1OF1A 5IF9A 2WWWA 2YOFA 3AF4A 4DXAA 3IO3A 1RYFA 1DBSA 1XWIA 2HCBA 2XSZD 4TWZA 1KK0A 1GM5A 1XD9A 2HF9A 1KSHA 2ZJBA 1MO4A 1P2VA 2K5UA 1T8UA 1LS6A 1XPRA 3P1JA 4PZYA 4R7ZA 3R7WA 3BH6A 2HDNB 5FOUA 3QUSA 1G3QA 4HEJA 1QG2A 5FBQB 4OQXA 3X1XA 2AD5A 5SZHB 3ICEA 2BKUA 1S3GA 1MT0A 3RWOA 4RZ3A 2J45A 3QKSA 3VR1A 4Q4AA 1RYHA 2O8BB 1J99A 1H8HA 1RJ9B 4JLDA 3FDIA 4M2LA 4AKGA 1N5JA 1G19A 1NRJB 3B6EA 4E09A 4LCBA 1ZIPA 2BV3A 4QBFA 2DFNA 1Q44A 2QPOA 3SS8A 1Z0FA 1OB5A 3LFUA 4PHHA 3ETLA 4W9MC 1BO6A 1VCIA 1YVDA 1TQ4A 3TR5A 1ETUA 2IK8A 2X2FA 3MJHA 4NCKA 1LTQA 4ZDJA 2OILA 3L0IB 1JBKA 2JDID 4URZR 2WWYA 5CYOA 4QM7A 4B3DA 1KZGB 1DAGA 2QEQA 1KTVA 5BYJA 1TL7C 3LA6A 2IYXA 1JPNA 1XJCA 4GMXA 4PSKA 4I1OA 3KFVA 3LVQE 3T15A 1R0ZA 1OFTA 2AKAB 3TRFA 3WNBA 4HZUA 4B43A 3U44B 4QNRA 4Q4LA 2EFGA 4XWAA 1KMHA 1DARA 2WAYA 4W5WA 3VR2A 3WMGA 1AQUA 2GXSA 4X8MA 3HPRA 4G01B 5AR1A 2QSZA 1O87A 1P5ZB 4EPTA 1IN4A 1RFLA 6Q21A 2VHUA 4FINA 2GKSA 2XX3A 1JNYA 4GI7A 4ZCIA 2QA5A 2O0HA 2ZIAA 1AZSC 1DO2A 1SGWA 4BQSA 1ZNWA 1KMQA 2YYZA 2HF8A 4LYHA 4NZYA 2JLWA 2DB3A 4PZZA 3Q85A 2IYSA 4BFWA 3FGNA 1QHGA 1L4YA 3OAAA 5JLJA 3QEJA 4DLUA 1S1MA 4YXWD 3PXGA 2RCNA 3D31A 4R2HA 3HYTA 4RD2A 2CXXA 3I5YA 1GSIA 2ODNA 3QOFA 4PPFA 4XSHA 3SHFA 1RZ3A 4ZCLA 3CPJB 3Q5EA 4GRAA 2P6NA 5JI3E 4Q7JB 4NYMR 4MYHA 4DCTA 2ZE7A 2QBYB 5TVKA 4IW3B 5BWMA 4B6FA 3DHWC 3MWKA 4DIDA 1JEDA 3MFYA 4PHFA 4MGKR 3FHTA 5GJBA 1A2BA 5KYKA 1MV5A 1RIFA 2RGAA 2Q0HA 1W1WA 2ORIA 1DAKA 3BS4A 3B8HA 3L2OB 4OQLA 1V43A 4DCUA 3WP0A 3LDAA 3OESA 1KO5A 1MABA 1VDZA 3GJ7A 4OK6A 3DKPA 4LBYA 2GVZC 3TK1A 4XWOA 1U94A 2EVWX 3W9YA 2ZI4A 3K9NA 2GJ9A 3Q7PA 1QF9A 4RD4A 3OHMA 1IN6A 4LC1A 3LWNA 4PFSA 2QAJA 2R9VA 1N6PA 3SFVA 2JJ1A 1SKQA 2QORA 2F1JA 2WJGA 2WWXA 4TL9A 1P2TA 3A1SA 4IDHA 1JEEA 5JJLA 5JSZB 3KQUA 1JAHA 3KQHA 3KDSE 2EYUA 4O2LA 4DT1B 4JSTA 1Q3HA 1U81A 2CHVA 5FOVA 1N6NA 1ZINA 4MKFA 2J0QA 1NL3A 3TE6A 3QENA 1AGPA 2GCOA 3EPJA 4RFSB 2C8VA 3EZ6A 4M1YA 3T61A 2CHGA 2GZAA 1ZUHA 3OE7D 2QTFA 3SYNA 4KBGA 4DLRA 2FDCA 1E9SA 4ZDIA 3HPQA 2PH1A 1I2DA 1ZM4A 1J7KA 3NWJA 1II8B 4Q47A 4H9GA 2GCPA 2CDNA 3I92A 1S3SA 1GZSA 3ZYCA 2AD1A 1T3HA 3GCGA 2N1BA 2OO7A 2UZ3A 3DO6A 4GP6A 4M22A 4MRNA 3ZZUA 1F2TA 2D7CA 2YOHA 2CL6X 1E9DA 3PR1A 3EX7C 2VHCA 4W7SA 4NP6A 2H8KA 3VR4A 4MYCA 3VFDA 3AGPA 4Q4JB 2AKYA 4RD1A 4JBWA 4FIDA 3CF0A 1R10A 2V1XA 2RGCA 2WOJA 1E6CA 2JASA 5DIFA 5BW8A 3PUVA 2GILA 1E32A 4YDSA 5CLLA 4CT5A 5FTLA 4LRWA 2BBSA 4I4LA 1R0XA 4A8JB 3ZQ6A 4HB4A 4O3MA 5EXXA 1KDTA 3BH7A 5F3WB 4PAMA 2V6JA 1FX0B 1R7RA 3BD9A 1GUAA 2D62A 4DDUA 3EW9A 1JPJA 5A0FA 2YC2C 2QGZA 1G5TA 4KVGA 1UBCA 1KY2A 3BC1A 3BGWA 4Q9KA 2V8OA 1N0VC 2NMVA 1W2HA 3QG1A 1P9WA 5DI9A 4V0NA 5KU1A 3PEYA 1G8YA 4PC7A 4NCJA 4ABYA 4E5UA 3QKTA 2ORVA 4GZMA 1Z6TA 3CX7A 1UAAA 4QGGA 4IXMA 1E2HA 4B44A 1VCMA 5J4YA 3FKQA 1FOEB 4CEHA 4WBSA 4EDHA 4EFNA 1NLFA 4P4TA 5EP3A 3T34A 4V0MA 4KFSA 4MGYR 1NSTA 1D2EA 3DKVA 3JVUA 4JYBA 5G41A 1TF5A 4C0BA 3OIYA 1D5CA 4PSAA 4HB0A 2ZJOA 3GFTA 4OK3A 1JJ7A 3AVPA 3EA0A 5EXTA 4Q18A 5AWFC 2JLZA 3GLIE 3VNUA 621PA 2ZJAA 3B13B 5JCZA 1GDDA 2ATXA 1NMZA 2JLXA 4AURA 4A0GA 2WJJA 4QRHA 2BHRA 2CL0X 1U99A 3BB3A 2OFOA 4F4CA 2W6JD 3QXSA 1E9RA 4DLXA 8OHMA 1NNEA 3IIJA 3QNUA 3U7EB 1F2TB 1G8HA 2OLKA 3NKVA 1LY1A 2HT1A 1NF3A 5AJVB 5HZHA 3W6PA 3R20A 4JVNA 2YZ2A 1NG9A 3DOEA 1ZC3A 4KYUA 3LXRA 2GAAA 3SYKA 1Z6GA 5E3HA 3KQKA 2CCJA 421PA 3RS0A 3UATA 2LWIA 1CJKC 3GLHA 3TAUA 1Z8FA 2XOKD 4ESVA 2P5SA 4OK5A 1D8TA 3G5UA 521PA 2FZLA 4FWTA 4TZ0A 1BH2A 2OLJA 3QXHA 3U3JA 2JLRA 1Z2CA 2UVQA 2YINC 2IYZA 1YE8A 2F43A 2W0SA 4MRPA 3RC3A 2ZITA 4H1UA 2IT1A 2ZAOA 1FQKA 4OI4A 1Z6YA 3IEUA 2WJHA 2AFIE 2O8FB 3PUYA 1G3UA 1VG8A 2WSSD 3GJ3A 3N5CA 4LJAA 4M1TA 1BIFA 3IHLA 4QJ5A 4ZDKA 3T1TA 5CB8A 4PC6A 2ZEJA 3QF4B 2QE7D 5ELXA 3EXAA 1M7BA 1TUEA 3WHLA 1KSFX 2FPKA 2NIPA 3EZ9A 2A9KA 4V0ME 2REXB 2VO1A 2QGNA 3C14C 1XEXB 2BEKA 2WWHA 1G5RA 2AXPA 1GNPA 2IUTA 1E9EA 2KI5A 3CIOA 4P31A 3IKJA 1XTRA 5KHOC 1OH6A 1LV7A 1UDWA 5KSYA 2YOGA 4L8GA 1NMYA 3ICQB 3QPUA 1E94E 4WXRA 1CF4A 2CE7A 3SBEA 4PQRA 2DYKA 1M6NA 1K6MA 1IXSB 4GOJA 4N0DA 2GESA 4II7A 1NN0A 1G20E 1XB2A 2P0EA 3C8UA 5B2ZA 5A5GA 4LBZA 3LBHA 4P32A 2CL7X 5DSZA 4XH9B 2ZSDA 3K9HA 1A1VA 1L7VC 5IRCD 1F60A 3K0AA 5EP4A 1XEWY 5GVSA 5IT5A 4S2EA 4B32A 2ZR7A 3RWMB 4K81B 2QM8A 4Q9IA 1KY3A 3FVQA 4QGAA 3JZAA 5TXGA 3GLFB 4P4SB 4GSYA 4KYIB 1GWNA 2ZAMA 1Q1EA 4PPQA 3A1VA 2ZJ2A 3WY9A 3BWDD 4PO1A 3K0CA 4GDFA 1EWRA 2WV9A 3IQWA 5EE9A 2VIIA 3PCRB 2CLSA 4PHGA 3EWAA 1PUJA 4PR0A 2OBMA 4S35A 1ZAKA 2DWPA 3ND8A 5FBLB 1E2EA 1GFIA 1A5TA 2PZGA 2GCOB 3CNLA 3DPUA 5CM9C 3B1WA 4IXNA 4M21A 2OAQ1 2GEVA 3KUCA 4NONA 2W00A 2F9MA 4HLUA 2OEPA 1A2KC 1NIPA 5B64A 3N2IA 4DUGA 4C0KA 2A7QA 1Y3AA 2IW3A 1TEVA 2JLYA 2O5VA 4DC9A 4TL7A 4M1OA 4IRUB 5C46F 2OHFA 1JXOA 2A3RA 5CDFE 3CZPA 1MH1A 2CJWB 5HCIA 3OIUA 2EFHB 5FI1B 4DEXA 3T1VA 1MR3F 1NKSA 1KK2A 3ONWA 2ZRNA 3EZ7A 4IOLA 5CIWA 3OIVA 3VR3A 1Z47A 4LWZA 1N6KA 2GVDC 2ZSAA 2XB4A 2WAXA 4LHYA 3KXIA 3OEEA 4M9QA 3R9IA 1U0JA 1YZLA 1Z0DA 2DR3A 1G291 3UPUA 2GEUA 3R9XA 4NYIR 4B2LA 1LS1A 3KJGA 3R8FA 1ZU5A 2ZE8A 2G77B 3AF1A 1KI8A 4HZIA 4BUJA 2EFEB 2PCLA 2FPLA 2ZI3A 4RKEA 1HT1E 1R8SA 1DTSA 3KL4A 4RD6A 3W5IA 3P4YA 1E69A 1E2NA 4US2R 1XTQA 2DFKB 2E87A 4LJ7A 5HR5A 4BFZA 5KSPA 1XTJA 4LJ6A 4IDNA 4V0KA 4EJSB 2ATVA 4LHXA 1T5LA 2CEAA 4DCSA 5DGXA 1Z28A 4OHWA 3VKWA 1XZQA 4MRSA 1QDEA 3P32A 4ZO4A 4Q66C 1D6JA 2NO6A 2A5YB 2ZSFA 3DOFA 1CKEA 3E2IA 2IS2A 4C30A 2ZR9A 5E4FA 1DS6A 3G0HA 1TU4A 3QI2A 4PQFA 3RABA 3GMTA 3ADCA 1CRPA 2EWVA 1S8FA 4JT4A 3AUYA 2Q9AA 1N25A 3OEHA 5G40A 1QHHB 2F7SA 2ONKA 1R0WA 3ZD6A 2CBZA 2IS4A 4I99A 3H2YA 2QMHA 1E2LA 1W7AA 1JB1A 1KI1A 4DSNA 5CJ2A 3O8CA 1RRCA 5G3YA 2CK3A 3BERA 4UJ5A 2YV5A 4LK2A 1F2UA 2GF9A 3LW8A 2Z4RA 3OEHD 4WW0A 1GRNA 5GJVC 2FOLA 1YKSA 4Q03A 5L3QB 5AK0A 2IYUA 4D81A 4DZZA 2IHBA 1Z22A 3EASA 4MRRA 1FNNA 1NVVR 2PEYA 3ZVRA 1AQYA 3HDTA 3TH5A 5K8IA 1GVNB 1SKYB 3ECCA 2VRWA 4LYFA 2CJWA 3NDBB 1Q22A 1R0YA 2I1QA 5SZKB 4L15A 4C7OB 1GILA 3DL0A 4UNQA 3RANA 1ESNA 5L3VA 4NYIQ 1XNJA 3FYHA 3GJ8A 4OQNA 4KFTA 1S96A 3A1UA 4M53A 3GLHB 4FCVA 4RFVA 5EZ6B 3W6OA 2F43B 3ZD7A 5TMPA 2DHRA 4WZAE 4AG6A 2V9PA 4PHTA 1D2NA 1YQTA 1Z3IX 2AWOA 2C9YA 4A36A 1H8ED 4MGIR 1N6OA 1ZBDA 3AP2A 4UXHA 4EQ6A 5J4KA 1OIXA 2QBYA 1YR7A 4JYCA 5FUVA 2OV2A 4LSGA 4FN5A 3GEEA 1OFUX 4PPNA 1W47A 3KFXA 2ZRKA 3GLGB 2UKDA 4GP7A 4FMDB 2P6RA 2BKEA 1UJ2A 3U3RA 2IBMA 3THXB 5F2EA 2ZUDA 4G1UC 1W49A 1OSNA 2NZJA 3BXZA 2CVHA 4NE2A 4YLGA 4G5QA 4QBGB 4JIMA 2OCAA 1G8GA 3ZGXA 5KNDA 3RS4A 2FH5B 1Z0IA 2IXFA 4G5GA 3ZVMA 3DMNA 1UM8A 1YR8A 1V5WA 1OE0A 4IVPA 1YZGA 3PVSA 1MKYA 4B3BA 2RMKA 5D3MB 2DBYA 2J9RA 1HY3A 3AUXA 4OQMA 3LLUA 4QGHA 3WMFA 3UG7A 2WMNB 4ON9A 3TAHA 2ZE6A 2BBWA 4PAOA 2QI9C 1IY1A 2ZXUA 1UBGA 2HUPA 4RZXA 1P3JA 4URYR 1EFRA 4KU4A 1N5KA 3IPYA 4YMSA 4MDEA 2UZIR 1R8QA 1GTVA 2VSFA 4IEEA 1NP6A 3SNHA 1TPZA 5E7JA 3ZLJA 3W6NA 2XZLA 4Q7KA
chains in the Genus database with same CATH superfamily
5H3HA 4R1MA 1Q7EA 3H04A 4K6MA 2CXPA 1DG1G 1ZVMA 2OCKA 4NV3A 3TNLA 5JATA 5KDDA 2VDNB 4EG7A 4YPOA 1HDXA 1WZCA 3U7QA 2WYVA 4DLNA 1TM1E 1TQDA 1ZM2A 2EW2A 3AVQA 3EODA 4M7OA 2PA0A 4RY9A 3NG1A 4U7FA 4XYEA 3NASA 3MELA 1Z8HA 4MYUA 2JGJA 4X20A 4ZP1A 2DQ4A 1SOMA 4CKEA 2JHPA 4JI8B 3CGGA 1Q17A 3QF4A 3VKFA 3AM1A 1EGMB 2Y0CA 3UM9A 3N0XA 2PIAA 5F5NA 2XE6A 3SS9X 2O3RA 3AUFA 3KSBC 1JSCA 1JR2A 1RXCA 1XJWA 1ULTA 2GYYA 3Q7IA 5IKOA 3L06A 4G8JA 4NCIA 2YMQA 1SR8A 3QLTA 4DNQA 4GKBA 4JLOA 1LB1B 2O48X 4WOJA 4YRPA 1L5WA 4CFYA 3L4KA 1OLOA 2R6R1 1V45E 3EY4A 4OHUA 1N6IA 2WMYA 4HNVA 4IUCS 1TADA 1JZSA 4O5AA 1R4AA 1YK0A 2OHVA 3PQ6A 3R23A 1NQWA 4XRGA 3U81A 1S2OA 3T1QA 2YUIA 1PCXA 2GAIA 3CLRD 3GRPA 1P29A 2HA0A 1GO2A 3GJYA 3KPVA 4FDMA 1CB7A 1Y7IA 5IKMA 1FRFS 3RVNA 3Q1LA 2BDTA 2YIMA 1LNZA 3U09A 1RBMA 3E6AA 2UVDA 3D7SA 1SO8A 4JI7B 1QXSA 4NZNA 1U2RA 5GV7A 3TTUA 3HCCA 5U4QA 1PJ3A 2I6SA 2G82A 2WKQA 1DRKA 1PZGA 1YQEA 4L16A 3VDNB 1J0CA 2W4IA 3S28A 3GGDA 3TMYA 3NBQA 3FNQA 2R7KA 4JBHA 1J2UA 1P3DA 4MIKA 4NICA 4P3OA 5I8WA 3LHSA 2J0SA 5B7PA 4Q02A 1S4MA 1KJQA 2JZOA 5LZ7A 2ZIUB 3HFGA 4EAAA 2XAAA 3QKRA 2Q62A 2QR5A 3BIFA 2CNNA 3D3WB 4BDSA 2GF2A 4FIZA 5IARA 4Y67A 5IH3A 3R09A 3MOGA 4D2IA 5ISMA 4PIPA 1T5BA 1HXHA 1WO8A 1XJ0A 2J6CA 4LXQA 5PGMA 2V7TA 3EVFA 3I3SR 4PPGA 5ALSA 2NNLD 2A14A 2DFDA 1SXJA 3R77A 2JFGA 5G53C 1DC8A 3O2JA 3KLBA 3L6EA 4DT1A 3CNBA 3L4BA 3G59A 4N4AA 4M1QA 4C29A 1X1SA 4WJKB 2Q3MA 1TQ8A 1UFRA 2QAGB 1AKVA 1S01A 4ZQBA 3PEYA 1OI7A 3F98A 2YY5A 2IP1A 1KZ1A 3C6XA 3FPKA 3LDHA 1YR2A 4LSWA 1KOFA 1ZOIA 2CLIB 3KM0A 4PE5B 5AW7A 4BLTA 5T8KC 4AKTA 5HWSA 3BG5A 2VNIA 1E1QD 2WJAA 3LAWA 2CLCX 5EP1A 3OM0A 2WM8A 4ZO7A 4NZ9A 4IDPA 1L4NA 1P2SA 2BP7B 5EERA 1JB9A 2G5PA 3NIGB 1ECPA 1KDOA 1CERA 2YWJA 3PBKA 4P7JA 4YT2A 4UPVA 2OWEA 3JAMA 1OI4A 4GZ5A 2H00A 1WL8A 4YV7A 5KNDH 2HRBA 3CWQA 1M2KA 4JQOA 1RAEA 4QXQA 5EIBD 2I71A 2XZTA 4CUZA 5ITSA 3QWAA 4LPSA 1BWRA 4P81A 5CB6A 3WFZA 5L3QA 4X95A 4J0EA 1P39A 1X7YB 4FKMA 1NVXQ 2F3SA 3JSAA 1HOXA 2R6ZA 1LKZA 4LN1A 4NOLA 3ZWAA 2YV3A 4BP8A 3PEWA 2HBRA 2XGMA 2MYTA 4N8SA 3IAHA 2DY1A 3UJ6A 4L4XA 5IYZF 1QGUB 3EWNA 4EPYA 2IE0A 4AKIA 1R0SA 4X7BA 3K70D 1WZEA 1NBMD 1TRHA 1LD3A 2OGZA 1P6XA 3GQBB 3NWPA 3N75A 4KVZA 4UAVA 5EQFA 5NULA 1RM5A 3ZX4A 1XL1A 3AETA 1C3XA 3RYHA 5T6MA 1LSUA 3GD5A 3L0DA 4V02A 4WGGA 2I6XA 1W5EA 3L7CA 4P4GA 3SZUA 2O23A 3RVOA 4C0JA 4AC9A 1QK5A 3GMIA 2PM8A 1PS0A 2WUEA 1K06A 1F1BA 5UKDA 3GN1A 4JCCA 3ZGNA 4C5BA 3L4JA 4WDRA 3O4RA 4D74A 2DLDA 3BWCA 1HYHA 1TM2A 2F8LA 2VCYA 3BTOA 1NI5A 1L8LA 2OCXA 2X8WA 1CW2B 3C3DA 3DBRA 3M6VA 3PCXA 5D5HA 4AJKA 2I7VA 2PPVA 3H75A 4IEFB 4L5JA 1FRVA 3IMGA 3PUJA 4QFCA 4X3OA 4X7MA 2GN2A 2VJMB 2C3OA 4LQLA 4QDKA 4OB7A 1YV9A 1HURA 3RSGA 1K97A 3UB2A 1EWQA 1HL3A 3GLGA 4A1OA 2G72A 3OTHA 4H1WA 5AVOA 3K09A 3TRIA 4CQJA 4EYEA 2E82A 4IO0A 4MW0A 3VTFA 5FO0A 4CM5A 2WSSA 3QOXA 1NNSA 4JYMA 2D0DA 1PZNA 2M1XA 1EM8B 5CM2Z 1KVRA 2AL7A 1GIAA 1H2AS 2XGJA 1XNGA 1Z36A 3DULA 3EGVA 3FW1A 4IZIA 4OL0A 5D84A 4IFTA 4GIBA 2QTZA 4IZ6A 5IYZA 1X8JA 1ZR2A 3GNLA 4QQKA 4UC0A 4F2HA 2WWIA 2AN5A 1WF3A 3K6JA 1LPOA 1TTHA 3LF2A 3VVLA 4D6YA 2CZGA 4AS3A 4RIIA 2X5OA 4F2PA 3VC7A 4PZEA 1T6NA 1EVZA 4DLAA 1UPXA 1KF0A 2Q29A 2ZWMA 1A04A 1LVHA 1AS0A 1ARZA 2DJIA 1RXYA 4JHLA 1MOSA 1IQUA 1M2NA 2DH5A 2XKJE 3CEJA 2WRZA 1ZZEA 4MGZR 4BV8A 4DDKA 5AW3A 1JI3A 221PA 2FNAA 2TECE 4MP8A 4K9QA 3O3NB 1J2JA 1E8DA 1USWA 1HT3A 3LWDA 3P2JA 4XPZA 4ZT5A 3TTTA 3W4JA 1XKTA 5HFJA 1KYXA 4URWR 3QKSB 1ZL0A 2Z09A 3KOWA 1C9DB 2I1LA 2ZDHA 4UNRA 1T3TA 2NXNA 2WPDA 3L18A 2BELA 3NETA 3PHJA 3WIVA 4K9NA 2QRUA 4DARA 1BX3A 2JK1A 1RLIA 5KC8A 1ZWLA 2AMVA 3KQLA 4U02A 2A5LA 1JTVA 1NVUQ 4PC3A 3K32A 1NUPA 2BJHA 5SYNA 1YVRA 5K03A 4DJ5X 1R6AA 6ADHA 3T99A 1EFCA 4PAWA 4ESHA 2CFRA 2N42A 4IM7A 1KKLA 5ELMA 5K5EA 1H4TA 1IXYA 2NYVA 1RYBA 3AY3A 1V16A 5G4KA 4UFOA 4HRVA 4DILA 5FWNA 5JJKA 4YQEA 1N33B 1U90A 1SKYE 2ESRA 2P6UA 5M3BA 4AXXA 4M8LA 4TYQA 4BCCA 1MENA 4DKJA 3MBIA 5AUOB 2WM3A 1HQKA 3LRXA 4IXDA 4CUJA 2HCJB 4DSUA 2F1HA 3OUZA 3PTZA 4HGNA 3ND7A 4K5QA 5BSUA 3JTEA 1VZ2A 3KP1A 3E9EA 4RJTA 1FUUA 2ECKA 1EGAA 1TZMA 3V9AA 5AKJA 3CF6R 4HWKA 2C83A 4BX9A 3EDQA 4WLUA 3FLBA 3C15C 4LOLA 4FZVA 3O0TA 5BXYA 2EW1A 1KEZA 3OCWA 1OPRA 4UNPA 1IUPA 4PO8A 4UDYX 1GXSA 3RUAA 3AF0A 3WKDA 3ZCPA 3G8CA 4POAA 5CA0B 3I62A 2IYPA 2AYYA 4MICA 1E1QA 5EWLA 3UUEA 3HU5A 4DQVA 4DY6A 4L4RA 1ZITA 4DWOA 3M2PA 3AERB 1T0HB 5IUKC 2O4CA 4LMBA 4DUGD 4YRAA 5CB4F 2XF2A 1L5YA 4JU9A 3VR5A 4QNNA 4DWWA 3AQIA 5E6UA 3UTDA 4KITB 5GIPE 1LI4A 1ZA1A 1P9OA 1Z7WA 2RGNA 2VUIB 3CPHA 4H4EA 4MWZA 3RK4A 3VTKA 1E9VA 2AFHB 4QUDA 2DPMA 3PXDA 5EY5B 1EFRD 1OU0A 3FB4A 2BEWB 2XQFA 4RF3A 3DWGA 2V03A 1O54A 1YBVA 4V0SA 1OJLA 2R62A 1NHGA 4A8JC 4PLGA 1ECJA 4DDTA 4DQXA 4P4UA 3ZTTA 4L76A 4UXJA 2A9PA 2FN9A 2PIDA 1IJFA 1WKVA 2R7LA 2ZYGA 3L5OA 4KWEA 4ZA2A 4PNZA 2AH5A 4R0MA 3FCEA 3VC2A 4MAMA 2GJKA 3K70B 3RE1A 4NC9A 3HJTA 3ZH9B 3HHEA 5DLYA 1EUQA 1FXUA 1OFGA 2C2ZA 3EN0A 2HMUA 2I3BA 2VF7A 4P98A 1EFHA 1YZKA 4J3NA 1B73A 3SHQA 1Q0SA 3PLAE 4FI3C 3FOZA 2WTMA 1NC1A 2ANCA 1WEKA 3P4XA 4J9UE 2CNLA 3ZUPA 3DWFA 3HI4A 1U5AA 1DKLA 2Z2YA 4J4TA 1PEDA 2PL9A 2PQ6A 1LLQA 2RGUA 5BW4A 1R6DA 2FV8A 4PRLA 3T7TA 3ORYA 2KBFA 4GFDA 2EIXA 4BATA 3TGPA 1K6IA 4P58A 3UHOA 3VBEA 2G28A 4KCGA 2BKXA 1AKEA 2ZSIA 1QGAA 4WL0A 3GDHA 3QJYA 4I9GA 4X1IA 3SAJA 4CJXA 2C59A 3AEYA 5IDXA 3Q6MA 3BMOA 1QGOA 3EGOA 5DTRA 4V2UA 2EEZA 1UEJA 4UUPA 4IVRA 1F8FA 4OQFA 1L7NA 4XCQA 2A33A 2J4FA 3O8DA 1V3VA 3B82A 4GYWA 4JKYA 4ACBA 2QRKA 2RKOA 1TQ6A 1Q57A 4M9ZA 4POOA 2CT8A 4RLQA 2C57A 2H31A 3ZHQA 4ND8B 3G9ZA 1UDXA 3BCRA 2ST1A 3HRIA 3P5BA 4FP9A 4MWSA 4TYPA 4ALIA 5BWLA 1Y63A 3AV3A 4MW9A 5A71A 2IZ7A 1HYEA 3HKEB 2QRZA 2ZP1A 2JFUA 4US1R 1E1CB 1SU8A 4JLJA 1P5JA 1P5RA 3K0SA 4FW9A 4EAQA 3FOWA 4CR7A 3PP8A 3UPTA 4EB3A 4XQ0A 3F3YA 4RADA 2OZEA 1BYUA 1YS1X 2BZSA 2HQ1A 4FB5A 1VYTA 4LF8B 2ZPAA 5MDHA 2ADFA 2R3SA 5EQDA 3KE8A 2C3YA 2IOFA 4WMLA 3MZ0A 2GAOA 1E77A 3SZ3A 1R6UA 3UKDA 4DL9A 1DDIA 4WHMA 4LUCA 4PW0A 4JUAA 5BSTA 5I7UA 3VO9A 1A96A 1Q12A 1P18A 3H83A 3H9CA 3WJ7A 3KLOA 1GARA 3CLUC 4Z9XA 4JITA 3X1XA 4YV2A 1BD4A 1OXXK 1C7QA 1GR0A 2XYPA 4Z1MD 2ZTSA 1UUFA 1VP9A 4RZ2A 4UU1A 3KB2A 1Q0LA 2CWWA 1E2IA 1I7PA 2IXEA 3QVLA 4ZOCA 4D4MA 3WGKA 3GQBA 1EWVA 3KAJA 1EFLA 1V8FA 3W06A 3K6SB 2Y67A 4JLPA 2CNDA 2FPPA 5BR8B 3K94A 1W25A 5KYTA 1N2SA 2I2XB 3BJZA 1FK8A 2H5LA 3PKIA 2G6BA 3KO8A 1UAYA 3NW9A 5GJWC 1RLJA 4ZYXA 4A5SA 1IPEA 2XAUA 1WDLA 4CMEA 5JADA 3KYCA 4EY5A 3KR1A 2BFEB 3BFXA 3U56A 2G1KA 2BC9A 2HF2A 4KPGA 3MPUA 5FL7D 3UXEA 3K2BA 1KDYA 3UXHA 2QMYA 3TKAA 1UJMA 4WCVA 1W0JA 2QVXX 3QZUA 4BP1A 4QATA 1C7FA 1P7CA 2YYSA 2PY6A 4A4DA 4BFLA 4FFMA 1N5MA 1GDTA 1OCEA 4BC1A 3ESZA 5GV8A 3TIFA 3ZXSA 3BB4A 4F4DA 3EXHC 5LUAA 2XRFA 2ZOSA 4HEQA 4IUDS 2VG8A 2XTAA 3EA5A 4MHOA 3W5BA 1U28C 2XUJA 1NX6A 3KNZA 4YASA 1WABA 5JHGB 3G2PA 1Z4PX 1C9YA 2GJ4A 3QXCA 5D87A 3K2IA 4Z51A 1QRSA 2K87A 2VDVE 2P2LA 4L74A 2RONA 2FR8A 5DIZA 1GZ5A 2A6PA 2ZB3A 4P0PB 1IN8A 1KGDA 4MS1B 4R9SA 4OU5A 3TQCA 1U4NA 3H0KA 1O58A 3L0ZA 3A9VA 2FDXA 3TVDA 3N8KA 4RVHA 1GA4A 1DBWA 3ZXIA 3PSAA 1PTJA 4IV0A 1H4VB 2P7IA 1XEXA 2IYAA 4M1KA 1IOZA 4WZAB 2YZGA 2H54A 2QTHA 4HS4A 5J40A 4BMYA 5A4JA 1DKUA 4B45A 1U04A 4KQ6A 4G6ZA 2PT7A 1BHO1 3CT4A 3U4MA 4OM8A 4JL5A 4CQNA 3R0JA 2H4ZA 2FEOA 1VIMA 3IP3A 5ALZA 4BNZA 4D9HA 3I09A 4X7RA 3CU5A 3SXJA 1JKMA 3INNA 3O1JC 5KWSA 4CEIB 4L8LA 4FJ1A 2FAXA 3LPAA 3F7NA 1EFPB 1ZMOA 2GJ8A 2K4MA 5E6RB 4ECAA 2MSDB 3MA0A 3CZ4A 3UAXA 4EY8A 1MC5A 1Z35A 2J8ZA 3ZLVA 1MOZA 1YVEI 2DUMA 2YWEA 1H1DA 5F12A 1XTKA 1US8A 2WAOA 4YCCA 1IBLB 3DFMA 3U7QB 1QH1A 4U0KA 2JH3A 4ZODA 1R8YA 4EKGA 5D85A 4B1FA 3E03A 4NMLA 1UBEA 1YFZA 1Y98A 1E0KA 4ND4A 3K9BA 4GX5A 4JBYA 2JJ2A 2Q21A 3WHPA 4WIAA 4FU0A 1NG1A 5FUWA 4HI0E 4L3VA 5J43A 2C7QA 3GZNA 4DG8A 2EW8A 4NLLA 1CUIA 5G3ZA 1V11A 2VP9A 3AY6A 2YL2A 5JO9A 3M5CA 3FBTA 4MZDA 1GAJA 1WKCA 1Y81A 4ZVTA 4BMVA 5LBIA 1ZN2A 4YROA 3D8NA 5FBWB 2Z2ZA 4YJ2F 5K6AA 5DASA 2CLHB 4TYNA 2GN0A 3JQAA 5ECWA 3SSMA 3TDMA 1C1DA 3EZLA 3FR8A 3I3OA 3ICOA 3NDRA 1L5ZA 2JCYA 3AP3A 5B6IA 1TTTA 4Q01A 1OWNA 2HCRA 5DRTA 4EJFA 5C1IA 3UIEA 1NYTA 4AJ9A 4FSXA 4TKUA 2AFVA 5D7NA 1YMVA 4H7HA 2VA8A 3OTIA 3RBXA 4BZPA 5IJ0B 2FYTA 2J59A 2QTAA 3NAQA 2PS0A 2V8BA 3AOEC 5ARDA 4AG5A 4CVNA 1RMQA 1ESMA 2CLEB 2IUUA 3K20A 3PQ3A 4LDJA 3BWYA 3RJZA 1P1JA 1II8A 4RAQA 4YA6A 1Y5NA 3E70C 3FPJA 1PJAA 1RJFA 1Z74A 4WKNA 1WMFA 4BNUA 4UQLA 1ZPDA 4CQMA 2PUFA 1LF0A 3KG2A 1YF3A 1XZPA 1D2MA 1CUHA 1VJGA 1EUCA 3NUZA 1GKIA 2CB0A 1IN7A 2P4HX 4ZAZA 3WIEA 4WZBE 2GZSA 2LCQA 2WYIA 3B1KA 1AGRA 1M7HA 3IBFA 1U0HC 5GWXA 5EXDA 1W36C 3CHYA 5AKHA 1HEUA 2VPZA 2VZLA 5ALKA 1KDVA 4BTEA 1ACJA 1QE3A 4ABTA 4PFKA 4Q4JA 1BGWA 1Z5VA 3PR3A 1I5OA 1YRLA 2SECE 4GG1A 4JXJA 4N7MA 4G2NA 1AY0A 2Q2OA 3PS9A 4Q4CA 1ZUIA 3P9NA 2COEA 3L1HA 1BXRA 2HPAA 4FILA 3RROA 3VHQA 1PJ8A 2BEVB 1OHHA 1CVLA 3B5IA 1R6BX 3UKOA 2YV1A 3O1IC 1Z6QA 3VH4A 1SH7A 2QW0X 4NAHA 1I51A 1NJ1A 2CKDA 2CGEA 2DPLA 2ZWPA 3BIXA 3KKNA 4NS1A 3OC0A 4OSEA 3DCIA 2GNOA 2XH8A 4TUYF 3GWGA 1THTA 4Y9RA 4ALNA 4S1VA 1R4NA 4F9GA 3A6DA 3EC2A 4UHBA 1QFYA 4X1IB 5KUTA 1JI0A 1R66A 1HG1A 4B3XA 3LBNA 1KAGA 2IF2A 4QUJA 5EJIA 1KVUA 4GUAA 3VM6A 4B74A 2JI8A 3C41J 2IYWA 3LY5A 4MQUA 2GD0A 1TPYA 2JA1A 3KOYA 3ZHBA 4CR6A 1LVUA 3G8DA 3KLMX 1NLYA 2Q3FA 4ID3A 4MS4A 1IZ8A 2YJ3A 3OUTA 5CGZA 4B6EA 4HV4A 4XVUA 3FFTA 3LPDA 4AZ0B 2FXVA 1A9YA 4QOSA 2P2YA 1ZIOA 3GZNB 2P6MA 3EH1A 1RYYA 5IH7A 1UANA 2WVHA 4ENPA 2HK8A 1VLMA 2NADA 1N2JA 5K99A 3FFAA 1NXPA 5HKKA 2XQVA 4EG5A 1NBMA 1WE2A 4ZVRA 3WGNA 4ZI7F 1DOAA 3MVEA 3ICCA 3KKPA 4N7BA 3IULA 2Y93A 4EELA 3MCWA 3KV3O 3V4SA 3THRA 5AH0A 3WBKA 2B92A 1QH0A 2FPOA 3GPLA 2J3KA 3KEMA 3MS7A 4WVLA 3HB9A 5DHRA 2I80A 2LKCA 4B79A 1PUXA 2JATA 2MYPA 2B4TO 3I32A 5HILA 4OB8A 1HGXA 5A3RA 1Z25A 4RZQA 2YN4A 5JH7B 1KDZA 5CA1F 4A9AA 3BRWA 1YZ3A 1YS2X 1X1CA 3V97A 1L1RA 5JZBA 3AIOA 4FGUA 3VO2A 1ZK0A 3AUUA 1FVHA 3A36A 3NM4A 3I39X 1E96A 1BXRB 4HDSB 2RAFA 4JJFA 4FD2A 4IL5A 1JAYA 4K9LA 4OYYA 2WU1A 5CLGA 3SVLA 2HU5A 3RFUA 4JS0A 4BAZA 3F49S 3QXJA 1UJ5A 4N0PA 4H0FA 2EF0A 1DFHA 5C5CA 1CE8B 1UKCA 1CDZA 4YRBA 1LDBA 2C20A 1X7YA 4A1FA 3P8ZA 4ZJUA 1L9XA 2P2GA 3LG2A 4MRMB 2GO7A 3W7AA 3C2QA 2DFLA 4TM7A 3U7RA 2GHQA 1Y4AE 3EVEA 3NVMB 4MGEA 4HAZA 3UC9A 2OA0A 2O8DB 4M98A 2Q4RA 1B6SA 5KWIA 4IXWA 3IKMB 2CNWA 4V3BA 2YW9A 5D3MA 2B3DA 2EBFX 3N2ZB 1PRYA 2IWRA 4R8RA 1CQJB 1YZTA 2X3UA 5DHUA 1FYVA 1W48A 4LGMA 1XVIA 2PRYA 3QW4B 1JQJC 1FVFA 5T6BA 3NHPA 1W5BA 2HKIA 5KINB 3CPEA 3JAWA 5AYVA 5SYAA 3UANA 1WZ2A 3AGQA 4QJ4A 3AQ4A 1WSAA 4D56A 4AJOA 2W2MA 3L0YA 1ZONA 1IHPA 3DT9A 3SX4A 2QX9A 3ZV4A 3EF0A 4MO9A 2IUSA 5D01A 4C14A 4EPXA 1I94B 1MVOA 4MPDA 3NHUA 1Q1ZA 3QWIA 1ZXXA 1FQJA 2VXYA 3ISTA 1O9BA 4IIEA 3WYEA 2JIQA 3P9XA 4NBSA 5IBCA 2PZBA 1N0WA 5TY0A 3WISA 1SBCA 1ST3A 1AA6A 2WJYA 4KACA 4QYIA 4BCDA 4F8YA 2OZLB 3S2EA 2BTQA 1A7AA 1QE0A 1W19A 1MG5A 1JU9A 1P1CA 3DE3X 1LVGA 3KVNA 3K71B 1HSOA 3EPKA 2GD2A 1GCOA 2QY9A 5KMGB 2IYTA 3W34A 2QVZX 5G0VA 1J23A 1SRRA 3KJFA 1SZJG 2GT1A 4FQ8A 2IPOA 2NSHA 2WHRA 3E5NA 3O3CA 4WN9B 2GGSA 3ABSB 2WM9B 1XLVA 1KO8A 1JXMA 5IYZB 5CTJA 3PC8C 2ADOA 3OLXA 1RWBA 3WGZA 2PS3A 1ZVQA 2CBGA 4XDHA 3EVGA 3THYA 2L19A 1YDEA 2RHHA 5EJ8A 3BVPA 4M38A 2RHDA 3I6BA 3PQCA 2D5CA 3P0JA 3HUUA 1RAHA 3PRHA 3FMOB 1W85A 4XGQA 4RVOA 3T7RA 3G0IA 4Y9TA 2XUKA 5CVVA 2BR3A 1SVSA 2AJ8A 4X1OA 1MFZA 3HJGA 1E6WA 2CDBA 2ORYA 1PW7A 3QVXA 1R50A 4TGLA 3KQPA 5SYMA 3VRHA 5FPKA 1CUBA 1Z37A 2G04A 1B8NA 2P2SA 3KPJA 4AJ4A 2KB0A 3DUWA 4R9UC 2O8BA 2FG6C 5A9RA 1QVVA 4GX2A 4M89A 4FSDA 4FXOA 4C6RA 5EJEA 1M2GA 2BGMA 1BFDA 2D00A 3OQJA 4JNKA 1L4FA 5G0TA 4CKCB 2QUBA 5JS2A 4J7CA 1YB7A 3TG8A 1P1FA 3K0FB 4AYXA 1AVTA 1KGSA 3B1XA 1LRJA 2GLTA 3QIAA 3A58B 4R6XA 2IX3A 2G36A 2XRZA 4UQPA 3HB1A 1P80A 2XE8A 2WU4A 3I37X 4Y3UA 3WHIA 4D5GA 4Z53A 1R3DA 1HUQA 4YRQA 4OI2A 2D1SA 5FPPA 3GLFA 4RHTA 1CWUA 5BUSA 2GPBA 5DGIA 2PMKA 3DBLA 3O8LA 3QTBA 2JHGA 2PUVA 1GN9A 3AEZA 2VJOA 4OAQA 2I7DA 5AOBA 3LVBA 4GGPA 3CZQA 3EEBA 3SHOA 2QN9A 4NJOA 4LGYA 1ZJWA 1J9ZA 2C9CA 4LJ4A 4FFLA 4ECEA 4WK4B 4GSLA 5BR4A 1W36D 3VC1A 3AHFA 3HJNA 1RE1A 1AV7A 1Q1GA 3GEGA 4HNRA 4RKYA 2XI4A 3F6YA 1Y3FE 5EMHA 4QYIB 3CURA 3ZIAA 4U5QA 1G7SA 5IDWA 3UV7A 3BAZA 4PX3A 1W4AA 3NOVA 1PNQA 2ERXA 3COPA 2Z8YA 1L7EA 4RANA 4DR5B 1EFKA 4F46A 1WD5A 3TD2A 3TD9A 2B3TA 1OGIA 1EJBA 4QSHA 2Z8ZA 2JCXA 2BKLA 2O14A 3FTCA 2YJ6A 3OPNA 3Q87B 3PIRA 4NJEA 4DYHA 4WJLA 2H65A 5A4KA 1ZK2A 1XMOB 1GPKA 4RJLA 3OCZA 1P73A 3C70A 1NI4A 4P7FA 4GVXA 4MVWA 1NE2A 4CM9D 1FE8A 2E4WA 2DPXA 4L9SA 5EE3A 3GJRA 5I4KA 5K0JA 4FE4A 1MABB 4EJSA 2DHDA 1T8PA 2AMFA 3BXGA 4EKDA 3PUKA 3ETHA 2B36A 4B73A 1R18A 2FFAA 2HJWA 3AEQA 4DMRA 4ZCTA 4FUQA 3U3KA 4YRTA 1EDBA 3P7MA 1A76A 5JVDB 3W9SA 1DQYA 4IP0A 2IHVA 2WHXA 4QECA 5CK5A 4OGKA 3VUEA 2JEYA 2Z83A 1JLHA 4XLLA 3LQFA 4BXOA 5ES3A 1P2GA 2C7PA 3FPHA 1F5NA 2RHOA 3E05A 2PX4A 4BIMA 1P7WA 1M2WA 3B9PA 1G60A 3KLPX 1KTIA 4NR0A 1GT6A 1WDTA 2XT0A 2OBXA 1WXFA 4JYPA 1L8AA 3R5SA 5IVHA 1KBQA 4GPIB 1RYNA 2R6CA 2JBHA 1VMDA 3M6FA 4YAEA 4TMZA 1OLSB 2XNKA 2QY6A 4Q1DA 4CQLA 1DT3A 1JHUA 2ZJ3A 3DL7A 1PQYA 2Y2UA 3A28A 1JQEA 1J7JA 3PNKA 4DMMA 5K1ZA 1MHTA 3BCSA 3BSYA 3WGLA 2O1WA 4CE6A 3V55A 1XMPA 2ZUVA 4G5XA 4BMCA 4X7PA 4XXHA 3ZJ5A 1RTTA 3QX7A 1DRJA 2W22A 3VDRA 4S0XA 2EJCA 3VX4A 4DTCA 1Q15A 3TZCA 4JDPA 5GQSA 3IERA 4UTXA 4OD0A 5LN1A 2NZWA 4L0CA 1KZHA 3OFND 3RM3A 2W6NA 3X1KA 4BGIA 3LL7A 3RGWS 4KR3A 4W1PA 4Y18A 1QPGA 3IP9A 4ND5A 1EX7A 1C30A 1Y4DE 1WVIA 5AHOA 3I0NA 3WLAA 2Z08A 3L6CA 2ZJFA 1JR3A 4YRMA 3VVCA 3QMWA 3KB1A 3LUKA 4JLMA 4OB6A 4JEHA 2RJOA 4OA5A 4R2XA 2J3EA 2JHFA 3BGSA 4J94A 4LIPD 4MA5A 1IVSA 5HOEA 2BCJQ 4LOHA 2OZPA 2HRZA 3PRYA 1Q91A 2QQ5A 4EHKA 3ENVA 1RZRA 1CUXA 2G4LA 4FSHA 1QRUA 1DEKA 3L0BA 4RKWA 1K7CA 3SEQA 1OT3A 1RP1A 1K7SN 3N5KA 1XYYA 2H1CA 2A0WA 1QWOA 2IU3A 4WPGA 3UJNA 1A9ZA 2G3YA 3CQ9A 1JHOA 3I83A 3G88A 2PO5A 3GFGA 2JKVA 3HGQA 3R6TA 4RO0A 5EMNA 4NBLA 2BBOA 2BGUA 2JCBA 4RWZA 1SG9A 3H8SA 3ZHYA 3UWPA 3LBFA 8MHTA 2DUNA 1R5NA 4M8IA 1I3KA 2A59A 3L6DA 4RCYA 2OGSA 4QQ8A 2Z5LA 1VHTA 5CW2A 4Y6PA 3V3KA 5KTMA 2ABWA 5CFOA 2X14A 2B7BA 2IHZA 4GOXA 4KUEA 4M9UA 1Y33E 3T3DA 1BDJA 1HQCA 2Q8PA 1U2QA 4HGRA 4Q7EA 5KQGA 4OG2A 3ZBTA 2YWGA 5AW1A 5A3JA 1M2OB 1WCYA 4I4TB 4ROSA 1GHTA 5BN4A 2CWDA 1EAYA 1GTG1 2QT0A 2VRCD 4JB8A 2VP4A 4CI0B 1CFZA 3DKIA 1YZQA 3R44A 8ADHA 3GBPA 4AI6A 2FP4A 4I2NA 1A5AB 2I1VB 1T13A 1VKOA 2OCYC 5IUNC 4RZUA 1WUJS 4Y1GA 4UAJA 4COKA 5KU7A 2WSMA 3EVBA 1DI0A 1NJ2A 3TW4A 3O84A 1QIKA 1M6YA 1TD1A 1OD6A 3CEMA 3EQZA 3HDHA 4DEVA 3U7GA 1CYEA 1G5QA 2PFKA 1Z6XA 3FTPA 4LTDA 4R0NA 1CZLA 2C04A 3F3KA 3IUYA 4EGQA 1XELA 4BNIA 2O0KA 2QX8A 4DM3A 1AD2A 2HWXA 3R9WA 3FZGA 1E59A 2YDXA 3PC2A 4MB6A 5BYKA 2J5XA 3DF7A 2VBCA 4L4ZA 4LYEA 5HKKD 4FOLA 3ACCA 3OLVA 4L4YA 1W6UA 1D2GA 4I3GA 4ZO6A 4O33A 4ZI2A 3QU9A 3FCOA 4RKFA 2HQRA 4WK0B 4E3WA 4GMHA 1U1GA 1WLSA 1RCFA 3WK9A 4GXRA 4ARVA 4RK7A 2Q0QA 5AUNB 5EMMA 1PJ4A 3SDZA 3ROGA 4CKCA 1I2CA 4QDZA 4Y2PA 2XMDA 5LLTA 4I1VA 3ZY2A 1U31A 5LBUA 3ZJUA 2WINI 4N3GA 3ZU6A 7YASA 1V26A 5FBVB 4QBIA 3RHSA 4EH1A 1BMFA 1DEXA 1EFPA 3ANLA 3X43A 1P0PA 1Q7CA 2MSCB 1TIBA 2WUFA 5E2IA 3MJTA 5C80A 2D8AA 4MWEA 5AOCA 1YS6A 3JXEA 3MD9A 4EVIA 3KEQA 5C8ZA 3VR6D 5H70A 3CNHA 5BORA 2FETA 3CJTA 5CT4A 1C1DB 4C07A 1QVAA 2GRAA 4PLPA 5F98A 5HA5A 4ESOA 2H1HA 3V4ZA 3AFMA 3S27A 3ZW7A 2YZMA 3MAJA 3CUYA 4FGKA 4NARA 4CKXA 3M82A 2IEIA 4MCJA 4G9GA 2GFQA 4KZKA 3WRYA 4KYVA 1VE7A 5HK9A 2WF6A 5IXSA 1SAYA 1G9XA 2D2EA 1THZA 2FPGA 2Y77A 3RU9A 2CDAA 5KO2A 4HXEB 3T7CA 5CX4A 4A0FA 1JFLA 4RA9A 3SMVA 1J0EA 1ISSA 4K8RB 2VZEA 4LOJA 4YWJA 2V7QA 4AIRA 3HVRA 5DX8A 3IILA 3LI2A 1US8B 4X84A 2VP3A 1IK4A 3BXXA 3G79A 1OAOC 1AT1A 1REQB 3GT3A 1U80A 2AXQA 2ETXA 1NJ5A 1XHFA 1G18A 2JH8A 4PCVA 3C39A 2SCUB 4RBNA 1Z5WA 4P2BA 1GL3A 3PHCA 3C5HA 3EUFA 2GSWA 1G8FA 2BMJA 2IFTA 2H6EA 1YUBA 4HN9A 3EEFA 3DNFA 1NBHA 2PH7A 1X7XA 4U2GA 2YY6A 4W5JA 1YB1A 5JAUA 1DTEA 1VL0A 2A94A 5J5VA 4YALA 5LWQA 1VHLA 2ODQA 1UP7A 3H2KA 5AJZA 4YCSA 5L3RA 3RSOA 5IBQA 4TLBA 1PJRA 4ZQHA 2HOQA 3A7DA 1W1UA 2WOOA 4JC8A 1Z7EA 1KI9A 2XZPA 3I8SA 4KQIA 1YO6A 3GNQA 1S7CA 4KQGA 2XV1A 3A1TA 3R7FA 4NAVA 3G13A 3GRZA 2FOXA 2X1LA 3RFCA 3QK7A 4E08A 4R98A 2QAGA 1QK4A 1OQAA 5K9ZA 2NP7A 1UIRA 2G83A 2W58A 4F4IA 4ZOEA 5BWBA 1V9SA 5FH9A 2Z3WA 3X1MA 3UCFA 1ZHOA 1JG7A 3BX1A 5KTSA 1IBSA 2GAFA 3B9QA 4UM8B 1B1CA 2PX6A 4U0JA 4YMHA 1Q95A 4D3YA 2XB6A 1TVMA 3U13A 3ZHOA 1M76A 1E6KA 3A37A 5LZ8A 4G1FA 2ZYTX 1H94A 4WACA 3W9UA 4RL6A 3JWEA 1NVKA 1FDVA 5I7RA 4QHSA 1FA9A 3EVZA 4NYJR 3HSYA 2G4VA 4UVGA 4DLWA 4Z4HA 4AUNA 3ZBUA 3QFFA 1A8PA 1UT8A 1VJTA 2TMKA 2OV6A 3BE5A 3CRRA 2H5JA 3GRRA 3ONEA 4ZV7A 3RUIA 4CKBA 4WOPA 4U7DA 1YIAA 3D7LA 1XDDA 2GLXA 3IJRA 4ZAGA 1FFBA 2B69A 5K3AA 3RWBA 3SEFA 3V7WA 4MJ3A 2FFJA 1V1MA 3B7WA 4D9JA 4D9IA 1WB9A 4OMDA 1GYQA 1H6AA 1U0OC 4ZYLA 1LV8A 4JX8A 3HO8A 3U62A 4MV3A 1FU8A 1SC4A 2BSQA 2AFHE 1KEEA 5AW5A 1C4OA 3OF3A 2AZ4A 4ZCQA 3ZWKA 4BNYA 4NMXB 4O6VA 4ZYUA 1XMSA 3VR4H 4FFOA 4J1SA 4LBVA 1VG9B 3PUWA 3L0OA 3L7NA 4HGOA 3SN6A 1LDNA 2ZSEA 3TCKA 4GAEA 1D5WA 1M3SA 3JWJA 1QU3A 4EFMA 2R44A 3T4UA 4DB2A 1ODJA 1W85B 2FPPB 1NN3A 5TQVA 3E9QA 4DA7A 2BN4A 4ISBA 2VPPA 1SKBA 4PZAA 3FD8A 3QWFA 1N3YA 2PUHA 1XQ1A 5F3RA 1J1UA 2GOYA 1X7HA 3CLKA 1X3SA 4R0VA 1S89A 4P34A 1P19A 4DQUA 4WXMA 5TPZD 3IOEA 2KBEA 1W7AA 1B15A 4MSUA 3UAWA 3URKA 4RMGA 2ZGVA 4ZIRA 1Z06A 4ICIA 1UZLA 4M7RA 3AUAA 3DXFA 3I12A 1MHPA 4GH5A 5H5JA 2PGLA 3PU6A 4YJ2A 4UJ3A 5C1BA 2GZHA 4DE5A 4MCAA 2GRJA 2GM9A 1DJPA 3PE6A 3ANXA 4OGWA 5LP6B 4Q4HB 3ZIAD 5BSHA 2VK1A 3U7FB 4QVGA 1OILA 4RCVA 2B8JA 4XQ9A 3IT0A 2X4GA 1PJQA 2O2EA 2WAAA 4KJZA 1KQNA 2PH3A 2GM4A 2PZ8A 1J8FA 4U1RA 3DMRA 4L6AA 1C7RA 1PZFA 3I1FA 3BH0A 2E49A 4EHDA 5GAJA 2YVKA 1LTKA 4NBTA 3F4BA 3HVKA 4L0MA 4CIXA 1P8AA 1BAPA 5FPSA 1KI3A 2I33A 3LO5A 4M1WA 2QX4A 1ODKA 1NV8A 3UT5A 2GK7A 1OKKD 3KSAC 3ER8A 2H18A 3EVNA 4XJVA 3SKYA 3UGTA 2NTJA 1WV1A 3B1VA 2A1UB 4Z4IA 2XGGA 3NAZA 1XFDA 1QJCA 1XO1A 1XVUA 2O2ZA 3U0VA 3NCTA 4C7OA 1ESDA 1Z5OA 2A88A 4R8MA 2PGIA 4UTNA 3GHYA 3KYJB