3HLYA

Crystal structure of the flavodoxin-like domain from synechococcus sp q5mzp6_synp6 protein. northeast structural genomics consortium target snr135d.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
145
Chain Sequence
SVLIGYLSDYGYSDRLSQAIGRGLVKTGVAVEMVDLRAVDPQELIEAVSSARGIVLGTPPSQPSEAVATALSTIFAAAHNKQAIGLFDSYGGDDEPIDALLAQFRNLGLHTAFPPIRVKDQPTEAIYQQCEESGTDLGQWLTRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavodoxin-like domain
publication title Crystal Structure of the Flavodoxin-like domain from Synechococcus sp. Q5MZP6_SYNP6 protein.
rcsb
source organism Synechococcus elongatus pcc 6301
molecule tags Flavoprotein
total genus 49
structure length 145
sequence length 145
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hlyA00
3KAQA 4ZVLA 3RPEA 4QOIA 3LCMA 1RCFA 2QMYA 4U7FA 2W5UA 2QMZA 1SG0A 1CZKA 3NHSA 1FX1A 5B3KA 1V4BA 4ICIA 2V9CA 3W77A 1J8QA 4QOGA 4C76A 1CZHA 3FW1A 1C7FA 4DILA 5LBTA 3QFCA 3UXEA 2OHHA 4U7HA 4BMOB 4XDHA 4Y7CA 3K20A 2FLVA 3OWXA 1QRDA 5TGZA 2FZVA 3ESZA 2M6RA 4YAFA 2RG1A 4D02A 3OJXA 5JROA 2BPOA 5F12A 3LT5A 3UXHA 5NLLA 5LBUA 3ESYA 5LLDA 1AZLA 3KLBA 1WSBA 2OHIA 1AHNA 2KLBA 4ESEA 4PTZA 2KQUA 4FGLA 4HEQA 1FLAA 2FVXA 3HLYA 3NHFA 4LTDA 4QOEA 4ZVNA 3FX2A 2F1OA 2Z9DA 1NNI1 2M6SA 3B6IA 3ES9A 3L9WA 1YDGA 4YAUA 2FCRA 5F51A 3SVLA 1OBVA 2N1MA 4Y9UA 2BMVA 4FGKA 1XYVA 4YALA 3HA2A 4LAFA 4FGJA 4NLLA 3OVMA 1AKUA 2FX2A 3G5MA 1CZUA 5LVAA 3OJWA 1X77A 1AKQA 1FLVA 4HS4A 5EAIA 3F6SA 3KEGA 2R97A 3NHRA 4CF6A 4H2DA 1CZLA 2FZ5A 4GQIA 2OYSA 2ZKIA 4XDGA 2X2PA 4CETA 1AMOA 2BZSA 4H6PA 1XI2A 1QR2A 3ZHOA 3O73A 3FJOA 3ESXA 2V5UA 1JA0A 2ARKA 1E5DA 1SQSA 2QX9A 4OXXA 2MT9A 3K1YA 2V5VA 3W79A 4YAWA 1B1CA 1JA1A 2Q9UA 5FX2A 4GI5A 2D5IA 1D04A 4PU0A 3TEMA 1XYYA 1YCGA 4R81A 4C0XA 1FVXA 3NHJA 2BF4A 3OX3A 4C14A 1J9GA 1YRHA 3NHYA 1BVYF 2QX6A 1AKVA 1GG5A 3EDOA 5F4BA 2WC1A 1FLNA 1J9EA 1FUEA 1YCHA 5EMNA 5NULA 1RLIA 1OFVA 3OX2A 2HPVA 5LJLA 1C7EA 3B6KA 4PTYA 3TZBA 2QR2A 3EYWA 3N3BC 3NLLA 5FUQA 1DXQA 1DX9A 2GSWA 2FDXA 2QWXA 3FVWA 2MWMA 2Z98A 3NHUA 1ZWKA 3S2YA 1YKGA 2QX8A 1TIKA 4QOHA 1CZOA 3HR4A 4ZVKA 1VMEA 3FNIA 2HNBA 4Y9RA 2B3DA 3TE7A 4BMPB 3F2VA 1ZX1A 2XOEA 4YAOA 1YCFA 2A5LA 3NHWA 1H66A 1FLDA 4M0CA 4U7GA 3B6MA 2X2OA 3B6JA 4S24A 3W78A 2FOXA 3GFQA 2BN4A 5LJIA 3O2NA 4F8YA 1T0IA 3F6RA 1D03A 3GFRA 5FA6A 1H69A 1CZNA 4NULA 1T5BA 2Q62A 1YOBA 2R96A 3NHPA 1AKWA 1CZRA 4C0WA 3NHKA 3R6WA 1WSWA 2AMJA 1AG9A 5BUCA 4DY4A 3N39C 3N3AC 4N9QA 1KBQA 1AKTA 3OWHA 5LMCA 2Z9BA 4QODA 3GAMA 1ZWLA 3QFRA 3JSXA 1RTTA 1XT6A 1I1OA 4LA4A 4YQEA 4QOJA 3W7AA 2MOKA 3GFSA 4N65A 3F90A 5B3LA 5ULLA 1BU5A 4FX2A 4J8PA 4LTNA 4DIKA 1J9ZA 4GR9A 6NULA 3NFRA 2MTBA 1TLLA 2FAXA 3NHLA 5EA2A 4ZVMA 4LTMA 2OHJA 2HNAA 3D7NA 1KBOA 3KAPA 1QBGA 1FTGA 3L9XA 2XODA 1D4AA 1AKRA 1F4PA 5A4KA 1OBOA 1QHEA 1DXOA 1RLJA 2Z9CA 4QOFA 3P0RA 3OX1A 2QX4A 3QE2A 4N82A 3U7RA 3U7IA
chains in the Genus database with same CATH superfamily
1YS7A 1RI3A 1F0YA 3C4QA 3VPCA 4DCSA 4E5KA 2I87A 1WABA 3ED5A 5EEHA 2JJMA 3GEIA 4TL7A 5HXAA 2JVIA 3ZE9A 1WQ3A 3OICA 3LX6A 1YRAA 5ITWA 3AWDA 1LCIA 3DQZA 1K9VF 3ENQA 4C7XA 1C1HA 1ISMA 3LQRA 1USWA 2I7DA 4KIFA 2HA6A 2AFIE 2AN3A 4QT4A 3H19A 3PICA 4IDNA 4MX8A 5EJ4A 3MJVA 2RHRA 2ZETA 5E7QA 3EPLA 1E62A 2JANA 2A8YA 2PRSA 3FHOA 3NZEA 4UHJA 4GPZA 1W88B 4CIWA 2NP7A 2UZ1B 3NKVA 1ODJA 1WB5A 3NT2A 3QNWA 4ZKEA 1COWA 3NHBA 1PL6A 1C4OA 3GOQA 4GEGA 4DOMA 1NL3A 1QHIA 4MIOA 4TTRA 2J8ZA 2OK7A 4INJA 4IEFB 1DBSA 3WV4A 5ECGC 3AF5A 2R85A 1FDUA 5I3ZA 4IIJA 4WJKB 3D8UA 2AXQA 4BLWA 3ZG6A 4YR9A 5K0EA 1U8EA 2GH1A 1BW9A 2VJCA 4G84A 1UDRA 1DU4A 2G7ZA 2ZSDA 2OCBA 3HMQA 4FN5A 4OKIA 4TQUS 4ZCQA 4KSBA 2XVYA 2E4VA 2GZDA 3GLUA 3D6FA 4ZYXA 2E0IA 5FTMA 1AQ6A 3THYA 4G5OA 4LW8A 2O19A 1OASA 2AFIA 5KYGA 1CVLA 1RRKA 1N33B 3LLSA 3RUEA 3LNCA 1FUIA 3ON5A 4MO2A 5E1MA 5LD2B 2UAGA 4HVTA 3AESB 4E1AA 1R66A 3IUNA 4J1TA 4YMLA 4WBXC 4F5ZA 1RRCA 3RK4A 3TZEA 3I2IA 6AT1A 2XCRB 2FW1A 3ABIA 4YRMA 4A7PA 4U8GA 2I3AA 1N8KA 5JNRA 3L1UA 3MT0A 3AFOA 4ASUD 4PYKA 1DBPA 2QG4A 3N6VA 1WS6A 3IERA 4W1PA 2DSTA 3DL2A 4R71A 1Y63A 1AQLA 1EFVA 1GA4A 3GLGB 4MVWA 5EKTA 1CUJA 1PGNA 2B83A 2Z2ZA 4L8FA 4YX9A 1C9JA 1CB7A 1OLUB 2PANA 2ZSEA 4XIIA 3VNAA 5JDCC 2DUJA 4FZ3A 4XE5A 4YMIA 3M2PA 2B8TA 1W1WA 1Z13A 5LLDA 2B2NA 4NCJA 3VH3A 5BQPA 3BZUA 3T1TA 4YV1A 1IUOA 4NFLA 3STVA 1N5DA 3EQ6A 1DLJA 1EMDA 3I3SR 4JLPA 2KQUA 5EINA 1ZD5A 3A1DA 2W6JD 1FS6A 1LNZA 4HRVA 1JMYA 3RIMA 1J8VA 3PQDA 3D2BA 3VU9A 2DAPA 3OKPA 5LZ2A 2YWCA 3IUYA 1R6XA 4GICA 4XFJA 1M1UA 3V2IA 3I6IA 2FJ0A 4ID3A 3UKJA 3ROPA 4JENA 1F2TA 4GI3A 2CVQA 3KJGA 1FXWF 4BRUA 3U7EB 4CUJA 3H3XA 3VR2A 1IWBB 1MGPA 2EZ4A 5FV7A 3PNKA 4YRJA 2CHQA 2VJDA 1GVHA 1IH8A 1JQEA 3FE2A 3JQRA 4AJOA 4QGSA 4RQAA 3ONNA 4M0LA 3VHLB 3A4NA 2RKOA 1KJQA 1TLFA 1T2DA 2A1UB 2IF2A 2BC9A 2XHZA 3O5AA 521PA 2PU5A 5EKDA 4ZYYA 3LWZA 2EYUA 5DX8A 1IUKA 2BMVA 5BV8A 3A2NA 2ID4A 4JBXA 2WNHA 2WM8A 4HDNB 1K3TA 4FGKA 1CRQA 1XYVA 4R7GA 4ZWNA 3ZHVA 3G88A 4KE6A 1VJTA 5FI5A 1ZU5A 1Q3KA 2FP4A 1T15A 421PA 2IYZA 1YJ5A 3EUFA 2RGYA 4ZKDA 5IYZA 3CXRA 3IQFA 4XQ0A 5FYDA 2TYSB 2FVYA 4MUJA 2IF0A 4MKRA 5HUQA 3SBDA 3C15C 4BRWA 1B73A 3A6FA 4WVFA 1AXGA 5CRIA 2YXEA 1H2BA 2Z1NA 4C3ZA 4UHBA 1SHTX 4U2KA 2D1FA 1RM4A 1H4QA 4JXKA 4M8IA 5B7GA 1Z2PX 3FOEC 2PHZA 1TYCA 1R27A 1W9HA 1U7HA 5LCXA 1SKYB 4JWTA 2UYOA 3IMGA 1JHZA 4LFAB 4COKA 3LVQE 4YT2A 5EMKA 1FLVA 2VK1A 3EK2A 2R2GA 5EAIA 4DCVA 3BERA 2PS0A 4PGGA 4TQ9A 1X8LA 3NATA 3SHWA 3TRJA 1D3AA 2IYOA 2HD4A 2RHTA 3JD1A 1ZMTA 1N3IA 1NW4A 2CEKA 2H4ZA 3F74A 4J43A 4JI3B 1Z37A 2NUTA 1OREA 2VAVA 4BMZA 4ZGWA 3CO5A 3K09C 2OKCA 3JD0A 4GQIA 3MA0A 4X41A 5EUCA 3VRHA 5KNDA 1AHIA 3K8QA 2YVAA 5HHTA 2GNPA 4JROA 5LZ5A 2X2PA 3P2MA 1M5RA 4UOZA 1JAHA 4QEKA 1FYFA 3EIXA 2HT6A 2W4MA 2NPFA 2EEPA 1PV2A 1YC5A 3PXUA 3PX2A 2CD9A 3JWHA 5FULA 4Q3EA 3VAYA 5J4HA 1LJLA 3EAQA 4ZC8A 2PVSA 1JTVA 1USKA 1LDYA 2X19A 3NEJA 4A0RA 4ZI7A 4V1CB 1KO8A 4BNJA 3A3NA 3QE9Y 2PGAA 1GFZA 1ZNYA 4GC9A 3S5UA 1V6SA 1P80A 4TWRA 4BNYA 2AQKA 1U7WA 4TYQA 2GD2A 1YJXA 1JFFA 2J31A 2PNJA 1V0JA 2G77B 2HF9A 2RG7A 4YCCA 5IEBA 2FMTA 3AUXA 3EXIA 4AS3A 1EAYA 1R6VA 2CLEB 3MWDA 3ZLUA 1OH8A 3WMFA 1ZXXA 3PF8A 1RJGA 1RMQA 1UFRA 2UXBB 2RONA 1U8CB 3ZNPA 2PRYA 2WDPA 3SFTA 4CMBA 1NJ5A 1UZAA 4FLFA 4JX8A 4JYPA 4RTSA 1E5TA 4AY6A 3ZLJA 1KYVA 3HVHA 2VPYA 1BE1A 3AHHA 2QVZX 3N2GB 3SZMA 4TZ0A 1JA1A 1J97A 4JVLA 4V0LA 5EKXA 2K7FA 2KM1A 1DUVG 4A5SA 5EFOA 1ENPA 1DWPA 3SOPA 1QJ4A 1CDOA 3AHJA 4I4TF 4KQ9A 2OBMA 4G25A 1GQQA 4GECA 4WZAE 3UAVA 2D1TA 2VC2B 1T9DA 2I33A 3LBFA 3UFXA 1RU3A 1E1LA 2R8BA 1L9XA 3RKSA 3STTA 2CFCA 3M1AA 1U1FA 1E2BA 2BMDA 4MCAA 5FWXB 4ZI3A 2ZVDA 4YN3A 1P0FA 5K3FB 1XWFA 1XAHA 3BK2A 4OPMA 3W9YA 3PRYA 4DYVA 4Y2PA 4C14A 4PXSA 2ZIWB 3AYXB 3HU5A 4D9NA 5E6UA 4BO2A 1RCUA 5IT5A 4FM9A 1JDNA 2YFQA 1PR9A 9MHTA 2XE4A 3MIIA 2HQ1A 1GUAA 1RCTE 5B3JA 2RGWA 1ENYA 2IKSA 2PGXA 2ZAYA 4MVJI 1DC6A 2B8NA 2I67A 4KO2S 3FOZA 5JFGA 2X58A 4DIBA 3ZJTA 4R8SA 1MHPA 1TF5A 2VDKB 3DHVA 3IXQA 5AW6A 2ZTSA 3PF9A 4HTFB 4NE7A 1UIMA 4YRGA 1SIOA 2I3DA 2J9FA 3ZU3A 3ELWA 4N18A 1J9EA 2XH8A 3FGOA 2FK7A 4PC7A 5BV7A 1G5FA 1TMGE 2G07A 3DM9B 1PEKE 1L8QA 4Z7NB 4AF7A 5B36A 1QF6A 2IWRA 1TQ2A 1KY3A 5HA5A 1ZZGA 2INGX 4XVQA 3SIXA 3FWYA 2EP7A 4F1WA 1JUDA 2WHXA 1ARZA 1EINA 1WXWA 4MP3A 4AZTA 3ROEA 5CJJA 1EXMA 1JB9A 2QBYB 4PW0A 4MV1A 1GRVA 3GLVA 3LWNA 4DVGA 3ENWA 2PWZA 4QYIB 4QBIA 3QA3E 1M6WA 1OJ7A 1FQKA 1HRKA 1NXQA 1RM5A 1RC0A 2PR2A 4ALNA 2BGKA 3D1JA 3GJ8A 3QX3A 4CQNA 2FQXA 4EARA 5LZ4A 1V5GA 3SU8A 1NUAA 1FFXB 2FFJA 2X1HA 3DO8A 4O4JB 1EM6A 2W70A 1HZZC 4EAAA 2OXTA 4RPHA 3HFGA 3E7XA 2J7PD 1AK1A 1RYNA 2PY6A 3LY5A 3OF5A 4IDDA 1KRHA 1OBFO 3NIDB 4CDGA 1D07A 1XK7A 5CDHA 2WAOA 4KOEC 2DR2A 3ADOA 1E4OA 2HSDA 2Q1SA 3GXBA 1XROA 3IP3A 5CJPA 2GS9A 1ZISA 1Q83A 3LUGA 3A36A 2IXBA 1ZAKA 2IXTA 3WYEA 4UTOA 2P68A 1MTZA 3HJCA 1XTQA 1ZVMA 3ENKA 5ERGB 1QPGA 2C31A 3LYAA 1KI4A 2XDQA 4RXTA 5AW8A 2VDWB 1EVLA 1VMEA 2ZWIA 1HDZA 3P2KA 4S0ZA 4A2CA 4EX6A 4YPVA 2C7OA 2XRMA 1JAIA 5EMJA 3TMKA 3WO1A 3TZCA 2P0YA 2QK4A 2R1VA 4G63A 3UGKA 5LDDC 3ZE6A 3TE7A 2RAFA 4RZUA 4UXIA 2ZP1A 3KVYA 4C21A 2HNKA 1SUPA 3E6AA 3JZMA 4L57A 4YAOA 4XD2A 4KDRA 1C3JA 3FUUA 4KBFA 2E89A 4HY3A 2AC4A 1OTYA 2ZR7A 1W29A 4TL6A 1KEZA 2PKQP 2VK2A 1RWKA 1QNFA 4WUTA 4Y6SA 4F72A 2V1UA 5AI5A 3E9YA 1A0OA 1UM9B 1X7WB 4CNQA 4CU2A 3RS2A 4POOA 5IFKA 3KWFA 2E5FA 2PMCA 2XA2A 3ROQA 3SLKA 3ZE8A 2PSSA 3MB5A 4ZCSA 4C29A 4PHGA 4G4JA 4W5JA 3UJBA 2WRZA 2F1IA 5TQ0A 3ZX4A 3I6MA 3MW8A 3P2EA 2QPTA 4ZQIA 2IX9A 3DH0A 1DOAA 3GG9A 2FW9A 3CX8A 221PA 1Z0KA 4PHHA 3SXUB 5FNZA 5LQUA 2C4UA 2PWYA 1M1NB 5DHTA 4R9VA 3D59A 4CKCB 3IAUA 1UKYA 2NU9A 3O95A 2MMGA 1G41A 4G26A 5JQGA 4GKJB 1DFHA 1VCNA 3H2KA 1U5AA 3KT0A 3OI7A 1KETA 2FN4A 2D5BA 5AVSA 5D51S 1DQRA 2Q5OA 2ICAA 5E9JA 3UMRA 3WL4A 2QENA 1F20A 3WSWA 3RIHA 3OURA 2RGUA 2WP8J 4YUYA 1CZNA 3QVMA 4B3MB 1IJEA 1YL6A 2G0TA 3MWEB 5JPCA 4LX0A 3PVSA 1R9NA 2V59A 1V2HE 3R9KA 2C9DA 1ULZA 2ATCA 1X42A 3D0OA 1I0IA 4O59O 4CM9D 4UASA 1RQGA 4KQEA 1XAIA 3R6WA 4L51A 5JCJD 4XOUA 3U6KA 3T4EA 1QOPB 5CAEA 5DU2A 1FK8A 1TJ4A 3MJCA 2PZFA 3F3MA 4C6HA 3IILA 4L2IA 1I24A 4AM8A 3KX2A 2MSDB 2BEUA 1SUCA 3SBEA 1AGRA 1TM4E 1JI3A 2X22A 2I80A 4GYWA 3IAAA 3PDIB 2P9CA 4KSCA 3F46A 3KYIB 5EJ7A 2QAGB 2X23A 2PSDA 5JNVA 5DTQA 3AW8A 5KQMA 2JW5A 2FFAA 2VJYA 3F97A 3JYOA 3UPDA 2VA9A 1U0JA 1KHTA 2FR0A 4HEJA 1SBTA 2QIPA 3A4IA 4DLAA 5TPZA 5A0FA 5A1JA 1F51E 4QUKA 4EL0A 3R0ZA 4M1YA 3D4PA 4CTKA 1AU9A 3OM0A 4HEHA 2P9FA 4Y2TA 4DDMA 2FPSA 3OY7A 5LYJF 1U7ZA 2JGFA 4L27A 1F6WA 5LP6B 1VPTA 1GUDA 3H0KA 5HF6A 1Z0DA 4QPDA 2SKEA 2AZTA 4QGGA 2JLUA 4KE8A 4X1KA 1GZSA 3OECA 3HDHA 4G5RA 2JHAA 3H11B 1TO6A 2C92A 4RETA 2B1GA 2DWPA 4D0GA 1NM5A 4I50F 2MOKA 4CM4A 4HKTA 5FCDA 1ESZA 1J0EA 4F4UA 1JEEA 1O8BA 2B20A 2DF8A 2FUG6 3AEZA 2GBFA 2CL7X 3ZOKA 4C07A 3AP2A 1P1BA 3IBCA 3KSUA 1DIOB 3KSAC 3W3AD 4LTNA 1JT2A 5HCIA 6CHYA 5JI2E 4KPUA 4QG7A 3OZAA 1FP7A 4US0R 4GX1A 2VO1A 3ZD7A 1EE2A 2QMEA 4K6MA 3TVYA 4Q4JA 4ZO8A 4MQFB 5KYYA 3F67A 1YGPA 3P9CA 5IHXA 1XNQB 4ALKA 4JCOA 4PZZA 3H6KA 5EJ6A 5D2CA 2H0AA 2OHJA 4BCDA 4C4YA 1MJFA 5M7EA 5DOZA 3V1LA 4UHHA 4O3MA 1JVSA 2VCEA 3CMMA 1XFDA 2YJZA 1RQLA 3LCVB 3U40A 3VNQA 1G5QA 1NI4A 2MJLA 5EJMA 3UGTA 2HK9A 3Q41A 1GNVA 1HLGA 5JSUA 4EPTA 4G0XA 5H3HA 3AJRA 1OBHA 1Y4DE 2Q3LA 4OCZA 5KNDH 2GCOA 2MMCA 4WNIA 3ZZTA 3MSCA 2V7UA 1SBHA 1KMQA 1PDWA 1VMKA 2YIMA 3M1IA 2QJRA 5A2GA 3AR2A 5AM2A 3USZA 2IEIA 1AH2A 3INYA 4BRZA 3KV1A 4JP8A 4M76B 5ERXA 2AYXA 2ZS8A 3SYMA 3QE2A 2X86A 4YUAA 3LQQA 2R00A 2JATA 3U7RA 5AP9A 5JSHA 1ZS9A 1H8EA 5I4IA 1DG1G 4OIMA 3THXB 1MXFA 2G1KA 2P27A 5ITVA 3R9XB 3K4HA 1CFJA 2GARA 3JQQA 1RABA 3BK1A 5TR9A 1JLSA 4PGHA 5HMLA 2Q1UA 2J33A 3IQIX 4JU8A 4F9GA 1GSIA 1R9GA 4U7FA 2PX0A 1KOFA 3NYIA 4FSXA 4ZARA 3RVKA 4TMZA 4AO6A 4B3CA 1KTVA 3L6RA 4S3MA 1VL2A 3WHLA 4CQMB 4U2DA 4LG1A 4BMXA 1C7JA 1WOMA 1DWUA 3CRRA 4I4LA 2UUOA 1JB1A 3DEKA 3V4FA 2DHCA 3PJRA 4KBYA 4BFCA 1YDEA 2FI1A 2AB0A 5HUJA 3RWBA 3GGDA 4R7ZA 4IHKA 2YUIA 2B99A 3JAKA 2JLAA 2VDMB 4KMOA 2IDMA 4N0EA 4XQCA 3SMVA 1Z15A 4AJHA 5LA6F 2UXDB 4RYDA 1G4AE 2WHRA 2AQHA 4XCVA 5FTKA 2GILA 3LKVA 4MZXA 5CLQA 5EPEA 1OROA 2BFEB 2C7BA 2IYYA 1KPIA 4YP5A 4X3CA 2AKYA 3SJBA 2C9ZA 2ZSBA 1GG8A 4RH1A 3WKAA 3RVMA 2PIDA 2ZCJA 3DE3X 4I1VA 4ZYWA 2A9JA 4YH1A 4BWFB 5IF9A 4FJ0A 5M2QA 1YACA 3WDSA 4JP2A 3C5VA 4Y0AA 1GIAA 1UP4A 4E2ZA 1RVV1 5AM0A 1IBMB 2PZAA 5AOCA 4BX2A 3HLTA 3VMMA 5JALA 2IH4A 2Z5VA 1TQ4A 1PFWA 2FLVA 3I5UA 2VYFA 2P30A 5DYIA 4J3NA 3ZWMA 1BDHA 1CQWA 3DZDA 1XMXA 2VNJA 4ZU3A 1KSJA 3QQPA 1ZH6A 3EQ9A 4E31A 2AOUA 4FFWA 3UXYA 1IN4A 5T4HA 1R8XA 2ZTUA 2BKUA 2C1ZA 2D3WA 3PFNA 2RG1A 2QS9A 3GGPA 4YCJA 3HO1A 2HRZA 1PZFA 4AZ0A 1DT5A 1T1IA 4XIJA 4YGXB 5CT9A 2QJTA 1Z82A 3MTAA 1C7QA 1VB3A 2VWGA 5B37A 4DCGA 1UT8A 4L9AA 1J0BA 1O6BA 1B6SA 1E1KA 3M0EA 1QP0A 3EARA 2FOLA 3A3YA 3CF6R 1P3Y1 4MWTA 3FTEA 5JMOA 4C4AA 4DR1B 4BMYA 2DB3A 3KD3A 2ZYAA 3JU3A 4WASA 4MITA 5CX1A 2F8MA 3AR3A 1D1PA 3H5WA 1K75A 5ETJA 2IVZA 2XT9A 1CBUA 2QTLA 1UK7A 2HLPA 2C78A 1Q0QA 4L95C 1KTIA 1YS6A 3IA7A 4DIEA 1QUEA 1WO8A 1Q92A 3BBLA 2X5OA 1IULA 3WFIA 4M9CA 4OLHA 1WE2A 3AFNA 1R4MB 4O4LB 5B58C 1VG1A 3FNGA 3NYQA 4LYDA 4OFXA 4JP3A 1ZA2A 3PFHA 3ZJ4A 4WVLA 1XNGA 1Z18A 4PGAA 4W5RA 2AMLA 1I2MA 3B6IA 4JNKA 3LKBA 3EDRA 2FCRA 3LT0A 1JG2A 1IZYA 2D7JA 2QRUA 1LD3A 3FVRA 4FYXA 4GD3Q 4TKUA 1EFDN 4ZAZA 5L53A 1ISGA 1EFLA 4M8LA 1KKLA 1L7MA 1LTQA 4CCSA 3E2IA 2FWPA 3IULA 1E3JA 3OA0A 3K9LA 5KU1A 4DNPA 3SAJA 4H7JA 2CLHB 1Y3FE 3D3NA 4RZXA 3D8NA 1V3QE 3V3TA 1X1DA 3PUWA 4UHCA 1O7JA 1UJNA 2VSFA 3HYNA 1NMYA 1PR0A 3TGPA 4Z3DA 3M9XA 4J94A 1SG6A 3KQTA 1SUEA 4NICA 5C35A 1TUBB 3WHKA 2VNAA 2QR5A 5ARCA 4BVGA 4DMCA 3FPGA 4LI3X 4OSPA 3L7LA 2DPXA 3BHNA 4P31A 1GDHA 2W00A 4P5PA 5REQA 1VHJA 4AUNA 1U81A 2XTAA 4AS1A 4C1NA 1W34A 4BJ5A 3GV0A 1Y5LA 4DS3A 4GPEA 3I6YA 1R0LA 2PNFA 5CXUA 2AF4C 5JHGB 1T8PA 4MAAA 1RM3A 2ZUCA 4A2PA 2VUUA 1CUDA 3I5AA 3NBZC 5DNAA 1QP4A 1GL9B 1X77A 3RS4A 3VZRA 3KFXA 1XJ0A 2JFGA 3OQHA 3MGCA 4KVFA 1NQTA 5CA0A 1XPRA 2XQJA 4YBRA 1OWOA 2JD2A 2GF9A 3H97A 1SQ0A 3X2FA 4QRDA 1T9BA 3O1LA 4HQFA 1BDJA 3F98A 5AHXA 4YPFA 3SZOA 1EZ1A 2WUDA 5DLEA 3DKIA 3RAJA 1Z6PA 1UJ5A 3QVJA 2OBBA 4QAJA 1T3SA 4RMHA 1RHQA 5B3JC 4IW3B 2FWNA 1I0LA 2PQ2A 3LLMA 4F2PA 3AVTA 1E1CA 3H0CA 1G0NA 4OOFA 3K9FC 2IXDA 3L7KA 4ZYLA 4YREA 2ZRCA 4X1IA 3C8HA 3HO6A 4L72A 2ZRBA 1X7ZB 3U61B 4LYEA 3JQAB 5LXTB 3PRKE 2FW7A 3QJ5A 2FX3A 3BKXA 1ZMRA 3RT9A 4PTLA 4TKLA 3SFZA 1RPAA 2XNDA 2VPWA 4OJNA 1TU3A 3ED1A 3SYNA 3OKFA 3C24A 1QR6A 1GRRA 2C2MA 2H5EA 3MS2A 4YJFB 5FA8A 1J2TA 2NM0A 2AMYA 4TKZA 5D00A 1NC1A 4Z4IA 5HIJA 3W5IA 1KARA 1QORA 5C31A 1GL6A 1NTOA 4FP9A 2ACVA 1G18A 3HSYA 2XXBA 1YDFA 3EFHA 5IAGA 1G0OA 2QRQA 1YS1X 2W6PA 3PNLA 3PQ6A 2JFQA 5IEJA 2ZE5A 1GG2A 1XZQA 2F90A 2OGUA 4ZYZA 1EE9A 4QJ4A 3T9AA 4EMTA 5BVHB 2GFHA 3MT7A 1MO4A 3NIGB 3AERA 4MVJF 3VHXA 1GGEA 4UVDA 4PPYA 4RKQA 1E60A 2EG9A 2YDXA 1P91A 4TLEA 5MFPA 3VNUA 2H8KA 3MXTA 1JU4A 3V6MA 4DJEC 3ZVMA 1JFTA 1UDXA 2P9EA 1TCUA 2P90A 3ZEIA 1EE1A 2AD5A 3O38A 4QDJA 2GF0A 5F7JA 3FLEA 1OH5A 5K4GA 5CD9A 1KK0A 3MC1A 3U48A 2O06A 2EWWA 4PFKA 2EKBA 4QLOA 5IXYA 1CUSA 1JQBA 3AEQB 4UPDA 2FB9A 4EB6B 1OX6A 5AHKA 5CTJA 3ZLBA 4XR9A 3EBPA 5LDGA 1T5TA 3E1GA 1UBUS 1GTJ1 2II6A 2BF4A 2VXYA 3B3QA 4QULA 2L42A 1CNFA 2D0OB 2OO7A 2WW8A 2WJYA 5CBPB 1M67A 1QHNA 3SC2B 1E58A 5HDQA 3L5KA 4OHKA 2EU8A 2UZAA 4AS2A 5BWMA 3KJHA 4PBRA 5TQ2B 4IBOA 1KZ7B 1X0VA 2PE5A 3T1YB 5DN9A 1E4EA 3TSYA 4AG5A 1GU0A 1U0SY 2YV4A 1L4FA 1WZIA 3GA5A 4HH4A 3ETHA 3KJIA 2CC2A 3V8RA 1TYBE 2DRIA 5JRDS 2QTMA 5HDBB 1N34B 3KG2A 5A9SB 4FD3A 1C0LA 1N6HA 3LKZA 5A4AA 3RYCA 3DBLA 2FG6C 3B1ZA 3UA3A 3WOHA 4K87A 5IZ4A 3NP7A 3M6MD 1M2WA 1SCAA 4KUHA 3WX0A 5T57A 4BO6A 3EIUA 4DJAA 2QZZA 1I1HA 3BK7A 1PFVA 3QFHA 4L78A 4BQQA 1RLIA 3LU1A 3V5NA 2DUWA 2PBLA 4G09A 3LVFO 5KAMA 2JVKA 4NCIA 4URYR 2ZUEA 4KYUA 1QGZA 2H48A 2AA3A 3NVDA 2AXNA 4RMIA 4F3RA 3QMMA 4FHZA 4WNCA 4LFCB 1DC3A 1Z2OX 2OO3A 3RRFA 5C8YB 2PBZA 2Z58A 4M53A 4PE5B 3W9BA 1WZNA 1LLCA 1ZU4A 4NYMQ 1ODCA 1P2UA 2BZ1A 2VCHA 2ZR0A 3AZQA 5D8DA 3AH8A 4RD1A 1GGFA 3VC3A 5HSGA 3FVWA 3H6GA 4RGBA 4KUGA 1UP7A 2VTKA 3WDMA 2HXSA 1KY2A 5KWVA 3R09A 4R2XA 3Q4GA 3T5PA 4TTIA 2VDLB 3G8AA 3FYDA 2BGRA 2CJWA 2DT8A 3AK4A 5J40A 1EHCA 5K8CA 2XY4A 1WP9A 1LZKA 4JHXA 4B4VA 4YXFA 2Q4OA 2EJTA 4DDKA 1EVEA 4NYIR 5BPFA 3DBRA 4MGKR 2GLUA 3CWQA 3VHQA 1RPZA 3G49A 1MDFA 4O6VA 1V8PA 4HXFB 2IP1A 3RQSA 1JSRA 2PUCA 4R0NA 1Y34E 4QZVA 2XSZA 3T9DA 3FBWA 3WNVA 2IPOA 3LX8A 2QTHA 3I9V6 3AU8A 4ZVKA 1PV4A 2ZYTX 5GTDA 1YS9A 1U94A 1K0FA 1ZD4A 1EP9A 2PXAA 4N48A 4CMJA 3L7NA 1B0PA 4JBLA 2DETA 1VFNA 5KJ6A 4LF4B 3A1EA 3F2VA 5H3LA 3VKGA 4QG3A 1KMMA 3NXKA 1I7QB 4ITRC 4PQYA 1QS0B 2A5LA 3NTOA 1AQUA 4UDOA 1BTOA 1G2PA 1MQAA 2C42A 3HN6A 3TKLA 3HVUA 4P6VF 1OTHA 2IDJA 4UXJA 3D7RA 3MEQA 1RC1A 1I10A 2ZTMA 1Z35A 4H7IA 4X95A 3T06B 2O8EA 4GP9A 4UU1A 2PX3A 3VH4A 4OIFA 1MH1A 4JNCA 1Y6RA 2RH8A 4XA8A 5HJ5A 3P2OA 3U13A 1BAPA 2F9MA 2PAAA 5F2EA 2XHEA 4RBNA 5ALFA 1L5KA 4BIMA 1PNRA 1JNXX 3PWZA 3SJAA 4JV5B 1AS3A 1I3KA 2M1ZA 1UMCA 1GAXA 3ZE2B 2AX3A 3GVPA 3H9CA 3L7AA 2FEXA 4N47A 2IDKA 2Y1WA 1P75A 1YGYA 4MLPA 2CDAA 1T34A 1UP6A 4OD0A 1IOLA 4HX5A 4DBVO 1FTSA 2PO5A 1QIDA 3PXGA 4KUEA 1CR1A 1EP2B 2JIZD 2RJ3A 3HN7A 3FCAA 2P4SA 3FTCA 2WU1A 3NH6A 5DNYB 3X1DA 3L6OO 3HJHA 4AMYA 4C5BA 4OQ4A 3VZSA 3NAMA 5LIPA 3AIOA 2WMYA 3HYLA 1T2VA 1K8YB 3WRWA 3LUCA 2E18A 5F2NA 3EGEA 4KODA 4CUZA 4D81A 4BQEA 3AVUA 1GILA 1T5BA 1MG0A 5J9FA 4X6XA 5KSZA 2IITA 3L4KA 2FW6A 4B82A 3ZIAA 1QAQA 5KOIA 1ONPA 1ZZEA 3QPBA 2AV6A 1R1DA 1A2KC 1H8HD 1YB2A 1Z6GA 1YK0A 4P54A 4EVSA 4YMGA 1QU2A 3B1VA 3PL1A 2EC5A 2VF4X 4DLSA 3PXCX 4L4SA 3T35A 4YONB 5JPIA 1JSXA 4INPA 1L8XA 3TSAA 2UKDA 1DBIA 5CVUA 3VI4B 4K03A 2YWJA 4KQKA 1XZHA 2YJGA 1Z3CA 4IIJB 1B8NA 3GLFE 1PNOA 1U0FA 5B1SA 2VJAA 3LUKA 1S3FA 2ERCA 2FQYA 4Q3BA 4TT3D 3BXOA 2PU7A 4U9UA 3H04A 2H5LA 1CX9B 3N5KA 3O1IC 3E8MA 4KIJA 3JQPA 1H0RA 1G8SA 2M6KA 3CEJA 2P0EA 1S2MA 2AN5A 5F4ZA 3ESAA 2B4RO 2W8BA 4G2NA 4URVR 4QQFA 2QDKA 4CIXA 1S2LA 2ZSFA 2AFIB 4D3XA 3CSUA 1CW2B 1ML4A 1L7BA 2R00C 1XTUA 3FRJA 1GPBA 4J7XA 4J0CA 4WESB 1UQRA 3PS9A 1IEWA 2FWBA 2WJGA 1E6KA 5BW8A 2GWRA 1I1OA 3H84A 1QHFA 1QIIA 2WWWA 1UK6A 4JBHA 4L4RA 1ODSA 1RXIA 1NI3A 3NQ41 1YHNA 4M1OA 3W2EA 1COWD 2WT8A 3NCTA 1ZGGA 4BKMA 4D41A 1EAMA 4ZO9A 1USVA 1KJNA 2VJNA 3F3YA 4KIWA 2LRHA 2VRBA 3O03A 4P7JA 2O05A 1SK8A 2LDXA 3AR4A 2M2IA 4HNRA 4L4XA 3OQIA 3CH6A 1QV9A 3CRNA 1NXXA 2OZKA 2QTGA 4G07A 3VPBA 4AWBA 2OBXA 2P2GA 4ZN6A 4FFLA 2Q5HA 3CUSA 3F90A 4RK6A 1VL5A 1Y5NA 1OI4A 4I5DA 4RZIA 3COZA 1J1IA 4J8PA 4JVMA 4F5EA 3OHPA 1KP9A 4RVDA 2RD2A 4KWIA 1V37A 3FR7A 2VP0A 4ES6A 3OT4A 4YJGB 1V4NA 1KZ9A 1HE3A 4P35A 4UDYX 4X7BA 4LJLA 1JGTA 3NHLA 1R6UA 4XDZA 4TWZA 2HWXA 1Z38A 1NA5A 2EFGA 2QB5A 1PD0A 4H08A 1U31A 3CC8A 1T8SA 1MZPA 4DLWA 2JIRA 3ENVA 4ZO7A 1JI0A 1VKOA 2C61A 4EKNB 5AVOA 4FILA 2GPBA 4G5HA 5CVEA 4EVIA 1SOAA 2VDJA 3ANLA 2GK6A 5JVDA 4NQRA 3EGDA 2J48A 1L4GA 3Q72A 4KK4A 4KQFA 4WOJA 2NOAA 4H16A 1XQ6A 3CH7A 1DXOA 3E22A 1H2XA 1QVVA 1QFMA 4HFNA 3TBKA 1Z73A 2ZDGA 4WERA 3AW9A 4RS3A 2GM5A 3U3DA 1ZICA 3RKUA 2G70A 1RP7A 3WB1A 4LK3A 4YV2A 1B23P 3PA6A 4BAZA 3HY6A 4R40A 1FYDA 1P6UA 3PI6A 3CU5A 3GCZA 4NOJA 2WILA 2PUEA 3GYBA 4I0WB 4IH1A 2WF5A 3ND8A 1UIRA 2C3UA 5FPPA 1ZCFA 4MKZA 5LQSA 4K6FA 2YIDA 4CL3A 2A9OA 3L02A 1I9CA 1TNDA 3D31A 1V5WA 3QYFA 3I61A 2CT8A 1JFLA 2HIHA 2QRNA 3QK7A 3ERCA 1ISPA 2EKQA 3TCXB 5KTOA 1SG0A 1ULTA 2HMYB 3LT2A 4EKIA 3AEUA 3EMBA 4TTQA 1AKMA 1IQPA 1DRWA 2W42A 5KTNA 1UFKA 3WZ2A 2GN1A 1FP4A 2AFRA 3OMXA 3FRHA 1U0TA 3VR2D 2YVKA 4KXUA 4DCTA 1IL0A 4RGQA 5GZ1A 2G5TA 1DKUA 1OXXK 1LDBA 1E9VA 1KDPA 1SRRA 1ZGCA 2P69A 4EELA 4EFNA 3OQ6A 3ZWOA 2H4FA 5SV2A 1CZHA 5ECYA 4U4AA 3PFCA 1SC3A 1RAEA 1R6TA 1TM1E 2WM3A 3UMGA 1PZNA 3FLAA 5B4TA 5E0OA 4MWGA 1U8AA 2HK6A 1RZRD 4F4JA 1XEAA 2CXOA 4QQKA 3W5UA 4YR7A 3G6WA 4DRXA 2P6PA 3ENNA 3WXMA 2OSBA 4EG5A 5ESWA 3FTFA 1PG2A 1ZR4A 3D6VA 3UXEA 1PEYA 2AZDA 1IEXA 4U7HA 2P2LA 3TW4A 1R15A 3R20A 4BNTA 2WWYA 3QUCA 2YOGA 1N7IA 1R6BX 2BEWA 3BMNA 2GBCA 2EERA 4KWEA 4F8EA 1MFPA 4FC7A 1DINA 5JECA 1N4DA 1RADA 5COQA 1AV6A 3N6RA 4A73A 3IUJA 4Z9YA 1LBEA 1RJFA 1TK9A 1EQ2A 1KMIY 4G8BA 1CY7A 1U0BB 4N6NA 4MWZA 3WZMA 1O95A 1DARA 4RHXA 2EFDB 3KEOA 4WHMA 4YY3B 3MWDB 4JJAA 5F12A 1OOEA 2UZ3A 3OBIA 1XO1A 1IXRC 5TVKA 2XVXA 4OYRA 2O3SA 3ROFA 1L7QA 3THWB 1ONBA 3EVBA 2IXAA 4NZNA 1Z4IA 2G67A 3ZDAA 1YJQA 4XB1A 2WYOA 5KNDD 5KYKA 4PWYA 4BNLA 4D9HA 1TVKB 1F9AA 1PFKA 2P8JA 3T52A 4LXHA 1N5KA 2BFMA 3FUWA 1RBMA 1RP1A 3FMFA 1PZHA 1Y9JA 1KMHB 4BEBA 4YRBA 5CR9A 4L3OA 4J7AA 1D2GA 1LZLA 1OXKB 2DECA 3DZIA 2YMLA 3O47A 4OQFA 2E49A 4OB6A 5T6BA 1PUIA 4Z4FA 2XVMA 3RUCA 4LQLA 3UFXB 1P60A 3Q7IA 2J3IA 2HQRA 1G3RA 3FPKA 4O2BA 1WUTA 2WNIA 3HKEB 3C45A 3FX2A 5DHRA 5EQTA 3SBXA 4NP6A 1KU6A 2FV8A 3PU6A 1VIYA 3T7DA 4YRCA 1L5LA 5DM70 1AUPA 5DX0A 1PJQA 1URPA 4R98A 3A4LA 3T8YA 4TMTA 3UG6A 1CEEA 5C32A 5KC8A 1EHYA 5GZ6A 2A9KA 1HDYA 1K3FA 1ZI9A 2NO9A 1T5HX 3AR6A 3IALA 5HEKA 4NMHA 2ZVPX 1JR6A 3ILSA 3U0BA 1PX0A 3TW0A 3X3HA 3X44A 1VMIA 4NOKA 5A4FS 3QXSA 4HMQA 4XKJA 4L02A 2IZZA 4ZZ1A 4UHEA 3FGZA 1FTWA 2M9MA 3AX6A 3VX3A 4WZAB 2PQMA 3EEOA 1JFRA 3G2MA 1NX9A 4BMDA 3C98A 3IUEA 1X2BA 4OSOA 2VSYA 3KVRA 3WLQA 5FNVB 5JXIA 1FFCA 3RD5A 2CN1A 1D5WA 3VO1A 1XPJA 2Y0EA 1G2IA 1IAVA 3OC0A 4FGJA 4QUHA 3LS2A 1QFZA 1WHSA 2PRIA 2JCYA 2NXCA 5KNBA 4HI0E 4PRYA 3VOAA 3ZS8A 4YHBA 2Y1LA 1GCOA 4NNPA 4PRZA 1S8NA 1BFKA 2I55A 2MYNA 3NALA 4JB8A 4RHEA 3W7BA 2VBCA 5CITA 5C53B 1DQYA 1SY7A 2OXEA 3CF0A 4FFBA 1UFVA 4DIUA 4DEYA 4FCWA 4JI0B 2FWRA 2ACKA 3K7EA 2X6TA 4IUBS 4RKWA 2MINA 4JJEA 4CKZA 2XXAA 4R84A 4HEA1 4PIPA 2E5WA 3F7NA 3TJRA 4ERNA 1H2EA 3EH2A 5LOVF 3OMWA 1HMYA 2LVBA 2P3LA 3O9VA 1GAEO 1P0PA 1P74A 3JQEA 1NFQA 3SZ3A 3AB7A 1RKXA 4X1YB 3UN1A 2ZM6B 2XYGA 1F8FA 2HREA 3BSFA 2PJUA 4FFDA 1LSJA 3IAS1 4PHTA 3BMQB 2X40A 3AUYA 2H1WA 3GGGA 5FJJA 4XYGA 5CB4A 3J81k 1C9MA 2A59A 1UKEA 3L4JA 4ZOLA 2J9XB 3LDFA 3NHMA 3X1MA 1OT3A 2ZJ3A 5HIIA 4DCPA 5C8VA 3UQZA 1BC5A 5TT1A 1MX1A 1PT5A 1UFOA 3BN3A 3ZQJA 2UZ4A 5K3OA 3KLNA 2R65A 3ZGYA 4TMVA 2VEOA 4KO8A 2VF5X 1GU7A 1TK3A 3IAXA 4BNVA 4Z4QA 4NNOA 4YASA 4YWHA 5CCXA 3H4TA 4LZOA 4EB0A 1I14A 1LPNA 3O73A 3LFHA 1WU7A 3FNBA 1FFWA 2QLBA 2WAXA 6LDHA 4MB0A 3S3TA 1XE3A 3MTIA 1K5DA 1N6NA 4LJ9A 1QQ7A 1VSQA 4K1LA 2F1KA 3CZ4A 5AKXA 3II6X 1U3GA 3PUIA 2QKYA 1JALA 4IQFA 1HA3A 4V0SA 3FB4A 1P1RA 1ZPDA 2RAUA 3SLGA 4IFTA 5CM8B 4OYYA 1CJMA 4MPRA 4HGPA 1BMDA 4BMCA 3ICVA 4QUJA 4MEBA 3CPSA 2BZ0A 4OHPA 1WDTA 4X8LA 2PT5A 4BNHA 2G80A 2YWFA 4PZ9A 4DV4B 1JU9A 2Q9UA 2Q07A 3HEMA 2W37A 3A7EA 4UVEA 3KQUA 4BUCA 1HR0B 2WWGA 2BD0A 1JEQB 2RE8A 4CEHA 2XIQA 4K05A 4PC2A 1XDUA 1OAAA 4MDYA 1DWOA 2AVNA 1XTZA 2QW0X 3ZGOA 5J58A 3PR1A 4LJSA 3QBTA 1YC2A 5HILA 5L7YA 3B78A 4FYMA 3EHDA 3RB8A 2Q6OA 4OXNA 3LECA 1FVXA 1VA4A 2V6GA 4TWBA 4HWPA 5AKZA 1Q84A 3OCVA 3LY8A 4UZEA 3RSSA 1SC1A 5DBGA 1B93A 2B82A 3B9PA 1FL9A 4NG5A 4R8VA 1KORA 3EGXA 4KMRA 3U7IA 2FOIA 1T43A 4OL9A 2YBDA 1KOGA 1EFPB 5BT9A 1JQ3A 1SCBA 1H1TA 3E61A 4HYEA 3ACBA 4RVNA 4HNQA 5EZYA 5K7SA 1FZQA 1WSAA 1GUBA 1TKCA 2B4AA 2GM4A 3FMOB 3TOVA 1DKOA 1TT5B 3H2GA 3OF3A 2XOKA 4LYFA 3G8DA 1BVYF 4MV5A 4ETNA 5AI0A 5M5BA 3COVA 3SMQA 2Y1XA 4C4TA 2O7VA 3ACDA 5K0NA 3HJUA 1E0AA 2H1IA 1GG5A 4ZHQA 1R6DA 5KQSA 5KX5A 1G8KA 2JH8A 4F7WA 2A6PA 2NSLA 4CM3A 4RTLA 5FEUA 5M34A 1AOXA 1W6RA 1Q2UA 3LUPA 5F1OA 3T15A 2HRBA 4JGIA 4D3YA 4PLCA 5CFQA 2A0WA 4XD7A 2YIVX 3ANSA 1XMPA 4FIDA 4LYAA 1YI8A 2ANBA 3V4LA 1Y1SA 4FE4A 2XMCA 5EXDA 4JEIA 1DI0A 2ZBRA 1NE7A 3ZW7A 2ZTHA 6ADHA 2AUNA 3K9NA 3CBGA 3UHOA 4CKEA 3PTAA 3C6KA 3W6OA 2RHWA 3EF1A 3KXKA 3NONA 4G8JA 4IZ6A 1QYIA 2W7TA 1K86A 1QAOA 3UWMA 3X1ZA 4AWAA 1TZ2A 1JYSA 3WIBA 1Q7CA 4LDNA 3ROZA 3K70B 4JN6B 1YU6A 4FXPA 4YRIA 2ODTX 4UQLA 1TJYA 1YQXA 1ABEA 2R6HA 1E9DA 3NLLA 2OGZA 4TX1A 5F2KA 4YFYA 4D4IA 4X66B 4TZ6A 3FF1A 2PLAA 5LLTA 1W35A 2VUTA 5TARA 1UK8A 3D8HA 4XJVA 4ZZIA 1W46A 3MJTA 2NZ8A 1SCQA 2QM7A 3L5OA 2KPOA 4WD3A 2IKQA 1TECE 1CJCA 2O0LA 2R60A 3OLVA 1EZ4A 4X1KB 5TMDA 1W0JD 3LW7A 3ML1A 3ZK9A 2O7NA 4CV2A 3NTLA 4IH4A 1K4YA 1JFSA 2QRVB 2NQ2C 3KP1A 4QTXA 2Q3DA 2Q6TA 1S89A 3IRUA 2IE0A 4PAOA 4MUYA 3H2YA 4BAUA 1YKGA 5HIMA 5J43A 1FUKA 1GSAA 5EE1A 5J2UA 1ULHA 4KWTA 1XTVA 3G1UA 5H16A 4IYJA 4MV8A 1T8YA 2P2ZA 3FI9A 5TPZD 1N2HA 1E2DA 4S0XA 1ENZA 4R8RA 4CIAA 5EVCA 1C1DA 5AVKA 1BXRB 3E18A 5E9WA 4Q4JB 2GEUA 3U9TA 4L5CA 3ANTA 5SY9A 1I5RA 4HPWA 3WGUA 3KWLA 5BNZA 4D99A 1D5CA 4O2AB 1NBHA 3WLLA 3DTVB 1QCDA 2G9UA 3QE4A 1A71A 1FU7A 4OI0A 3K0AA 2FSPA 4CV3A 1NP7A 4GYKA 2XCQA 4JXJA 4D80A 2YQZA 3EYAA 1MEOA 1DTEA 1F8XA 4KVGA 2FPPB 1QTNA 4BGVA 3PPYA 3H1PA 3B6JA 2BM1A 3SC4A 2GCOB 3GFQA 4B79A 7MDHA 3W9SA 1NJ1A 3KOWA 3NEAA 3VH1A 5LJIA 2WICA 2Z1MA 2Y0CA 3KR2A 5YASA 3KKPA 4HYTA 1OA1A 1NTRA 2W2PA 3DFKA 2M1XA 2FPIA 1AO0A 4RHTA 1T91A 3TOCA 1RBZA 1KL7A 5DGCA 3CISA 2QHXA 3UJHA 3CR7A 1C0EA 1S9HA 3E35A 4F1JA 3GVHA 4I66A 3GA0A 2HT1A 3YASA 3D1VA 5FOVA 3ICEA 3GFRA 3DTVD 1Z33A 1H69A 2PR7A 3GCDA 4CG2A 4UMEA 3D4BA 4PC6A 2ZW9A 1WLYA 4FBGA 3CA8A 3T12A 4AN0A 4BCCA 4EHIA 4YXWD 2KI5A 3SF8B 4BO5A 5EP3A 1EUZA 4NV0A 1DJNA 4BO7A 5K0TA 2E4UA 1A50B 1Q15A 4MWEA 1RWBA 1L4LA 4RLHA 2C9BA 2GM9A 1IZ8A 3JQBC 2VJQA 3ZNOA 1Y48E 3FBTA 2UUPA 1U65A 2JK1A 3KZCA 3PSHA 2BZGA 1V6AA 1Y4UA 3CRZA 4ZK2A 5BUCA 2LGJA 3W1VA 1K8XB 4N7JA 4QJ3A 3QVGA 5ITSA 1PHRA 1TVEA 3G8YA 2XKKA 1MXHA 1ZUNB 4BAGA 2ZJ5A 3L8ZA 4N9QA 3A31A 3I9OA 4PWZA 3VM6A 3NBXX 2TECE 1O57A 4UZFA 4IQGA 1H8ED 5HCUA 4ZDKA 4IDFA 4NI5A 4YMUA 5CDYA 4UHKA 2IQIA 2ZB4A 2J09A 4DUGD 4ESVA 4C0QC 3QE3A 4M1SA 4F7DA 2WIJA 1GV1A 1LNSA 1XCMA 3CPJB 3MPUA 3W34A 4MUXA 1T1EA 2Y1EA 3OSUA 2GHTA 4KN8A 1KP2A 1N1MA 5BSGA 1OPRA 3IKJA 3EIEA 5F98A 2O50A 1ZJ4A 3RNLA 4WDQA 4NV1A 3V3KA 2ABWA 2WEKA 1MO6A 4R41A 4DCOA 2J6BA 4Z1MD 4RTJA 4RACA 1KEVA 1PJ8A 2OVBA 3E3LA 2JGMA 3HP1A 2YZNA 3NEYA 4FDMA 4BBJA 2UYYA 4MMZB 1U2PA 1DKLA 4YQEA 3PGA1 2AOUB 1QE5A 1ESNA 2JDID 2BELA 2NYUA 4H9GA 4TLCA 4E08A 2GZRA 1I4DD 3H4VA 4MTCA 4BFYA 3QFTA 1MIOA 3IUMA 2VK8A 2JFFA 4UUAA 1U9JA 1ODFA 3NWOA 4AZ0B 2YV2A 4L07A 1VPVA 1LFAA 1M7HA 2HHJA 4P32A 4RMJA 3ZE7A 5KNBH 3ZHXA 3ROTA 3CN9A 4NBNA 4MDHA 2GN8A 5IBQA 4AULA 4X6YA 1EJBA 2ADOA 4PO1A 4A8TA 2GB4A 5KVQA 4YRZA 2RAVA 4P81A 1QRUA 1G4HA 1YB7A 5G0WA 3D0KA 5EPUA 2IYSA 1NU8A 2HA3A 3BJIC 3M1YA 3Q3GE 4LC1A 2FAXA 3LP8A 1FYEA 4H7KA 2ID8A 1T5LA 3DMNA 2VDNB 2XDWA 3Q6MA 4FEYA 3COJA 3RASA 2VVTA 2ZM5A 4LE1A 1QFXA 2F59A 2OV2A 3QOXA 4OM8A 4O1HA 1UJMA 3OBBA 1PYDA 4PG6A 4UATA 3F3KA 2CXQA 5DKFA 3TAUA 3U7QA 5ISMA 1L4BA 4LZLA 3JARA 2MSKA 2Q3BA 2X0EA 5HKAA 2KX7A 3FI0A 4ZGGA 1D6SA 4KQCA 3NB0A 4EG1A 3JALB 4ONEA 2DPLA 3OQOA 3G7UA 1NXTA 1H0KA 2QRLA 3AHDA 3SHTA 1IOWA 2RB5A 3H3FA 1QPBA 4BLQA 2R2AA 1AMUA 1HFWA 5BSHA 2DH5A 2RH4A 4JOCA 4OJMX 2Z4TA 2PXCA 4QEDA 1O96A 3FKSD 4US1R 1U8FO 1IPHA 3AUJB 4X20B 4Y1RA 1QB8A 4PZLA 1BE6A 4BVFA 4RK0A 4EUKA 1ULSA 5HM6A 1O95C 4IDEA 1DDOA 1JQDA 2HGZA 3FUTA 4OHFA 1JHAA 3FTQA 4W5TA 2O23A 4F3CA 3M89A 2BRUC 2VPIA 4MQLA 4ER3A 4LXGA 1M2EA 4AT1A 4D46A 1PV1A 2B3TA 5DM1A 4RZSA 1N4AA 3RC8A 1N7HA 3USCS 5FBQB 1G4UR 1VHWA 2WG2A 3B1JA 1XMIA 3HY3A 1CP2A 1JTFA 5H8WA 3LXXA 4F5YA 2NU7A 2O2DA 3NT5A 5G40A 1I2BA 1JIJA 4J0DA 3Q8KA 1BWSA 5B3KA 3QVTA 2AFVA 3JRWA 3A04A 2N47A 3L84A 2FRDA 1QVRA 2AXPA 3AETB 3DONA 3K0FA 1KAQA 5H02A 4AYWA 1QV7A 4BBPA 1B6GA 2FH5B 1FMJA 1WY5A 4GIBA 5AHWA 5KYXA 2F4VB 3VV3A 3UHAA 3QRWA 3NI2A 4RZHA 2NO6A 3DC2A 2GZ1A 2I4LA 3V9PA 2WTMA 3AIIA 3HN2A 1CRZA 3AIMA 4OHRA 1FFYA 1AV7A 4LNHA 3ER6A 2DPMA 1GZ3A 2B5VA 1KI3A 1OV6A 1JAYA 3H5NA 1T2UA 2CHFA 2FUEA 3DAYA 3LXMA 1TUGA 1FFSA 2C54A 2QTVA 3FDZA 4OH1A 5WRFA 5DNUA 3R74A 5TGTA 4WN9B 3AF1A 1SC4A 3QFCA 4YP7A 1SVNA 5K3AA 1VDMA 3EOAI 1J8FA 1Q1BA 1I2CA 1U2GA 1QO0A 2GAFA 3A1WA 4X1IB 5DTJA 5EP4A 3S1AB 5KC9A 3LKDA 4NZZA 2UVDA 1TJ3A 1EJ0A 3L8HA 2NLOA 3A10A 2A4MA 1GXSA 3G2LA 1Y42X 2WFZA 4GWKA 1I7PA 4J75A 1I4EB 1ATIA 1WUYA 1U28C 2IU3A 3IVMA 4PIVA 4X9XA 4OMDA 3R5FA 3SE7A 5U9CA 1PS9A 3M5PA 1YZGA 3AR9A 1DKQA 2A5GA 3IBGA 3QEMA 3ZQ4A 4AP9A 4DCNA 2FDCA 4BIIA 1SWWA 1AQIA 4A15A 2JKYA 4FINA 1SBQA 1U2DA 1SA0A 3AONB 4FW9A 1QF9A 3LOPA 1XQ9A 2IXEA 4L5AA 3LPLA 4XGNA 5E3IA 1HL7A 1E7RA 5I8PA 4ERXA 1FNBA 1E6UA 3OZGA 4A23A 3CT6A 1G55A 3OZRA 4YRQA 3BRCA 1Z06A 2XQIA 3CMCO 1R5NA 3ESYA 4JLBA 1D2CA 1OX4B 1NQXA 4P58A 3UTDA 3BFPA 3AERB 3OCJA 1J33A 2DOKA 1C14A 3FFAA 3NGMA 3R0IA 5A6VA 1JXAA 5C2JB 2FSIA 3EAFA 2O5CA 1EA7A 1FYXA 1KI8A 2PCJA 2Q45A 4KXYA 4MYDA 4Q5IA 2X5KO 2GEDA 4D9IA 1FLAA 4IOLA 4MVYA 4M38A 5DB4A 4IMJB 4BFTA 3QUSA 2BFCA 3ZCVA 1H42A 3V2HA 2XNDD 2P4HX 2W2KA 2YXDA 1XZLA 4HXGA 1DCTA 3W1EA 4HWSA 1R0XA 3Q87B 4U6NA 4U0KA 4ZVNA 3IDSA 3LT1A 4A03A 1Z45A 2WIFA 3PXBA 5IUKC 1G8GA 1H5UA 2R62A 1E4VA 1YZVA 5COBA 5CIYA 5FFFA 1IJBA 3RRBA 3NBYC 3JTEA 3I8SA 1E2MA 2JI9A 4QQNA 5FF9A 1KH3A 3FG9A 4RTMA 5CIQA 1MW8X 4KTTE 1C29B 4M83A 4QJBA 5HGJA 3T38A 1JE1A 2R4TA 2Q5JA 3L9WA 4GRIA 2GEFA 3HKCA 1YZLA 1H5QA 5AOBA 4EYSA 1W96A 3W2HA 4JBNA 3MTQA 4RVOA 4FU0A 5G4KA 1ZUD1 3GPCA 2BFAA 2AZ4A 3D1LA 3PQ7A 4HNHA 1RVDA 4XGRA 4E51A 3RSLA 3OZ7A 4RA6B 2VBGA 5DPMA 4YYZA 2H52A 2X2FA 1GPYA 3HBFA 5I7UA 1VHQA 5KWJA 4RWEA 5BW6B 4NENB 2D13A 3VV2A 2VQDA 2I34A 3WLJA 1ORRA 2BMWA 2PGOA 3GMTA 4OQEA 5JNUA 1BX1A 4CCYB 2R6R1 4YJDA 4JX9A 5DLYA 1NW6A 1E9AA 4LAFA 1BZYA 3SNHA 4WCDA 2Q5EA 1GP2A 1ZMBA 2QPAA 3ZLTA 1BRTA 1TK2A 1TJPB 3U2QA 2PUWA 1PJTA 4G1EB 1N2SA 3RK1A 3VZCA 2PSJA 3AJ8A 3AYZB 1UOPA 3AKYA 1ZJ5A 1NVVQ 4F84A 5F5XA 4GXTA 1C4KA 2DFPA 4G36A 3ZXUB 1JLMA 2O5VA 5AVYA 1GUYA 1IE3A 3N70A 4WEQA 2C3YA 4S12A 5JIBA 3M8KA 4A0GA 5K0CA 5AI6A 5K8UA 5J2TB 3L1IA 1VDZA 5H1YA 4YQFA 2IZ6A 1EWKA 2O2IA 5TV2A 4E5SA 3BXZA 1TA0A 4BKUA 5BMOA 2OO5A 3HB7A 2GAJA 1NNUA 5IAAA 4KHPB 4DQUA 1U2SA 1V8ZA 3DBHB 3ELDA 2MSCB 4PPFA 4BXOB 2HRRA 3ZV3A 2QMHA 5ECDA 1EDOA 2W2QA 1RS0A 3NDIA 1MMFB 4MPJA 1IN7A 2ZJAA 4WFIA 3U4GA 4O1IA 3AI1A 2BP7B 3H7AA 5DF1A 2WUFA 1XVTA 1D4ZA 1NBMA 2A7QA 1K63A 1ZEJA 1YUMA 9LDBA 1WZ2A 1QLHA 1JL3A 4YYEA 4F9TA 2PPVA 3S2ZA 1N2GA 1JG3A 4QGBA 4CLDA 2B61A 3LUAA 4I7EA 1YUBA 1RKBA 5HKKA 1E1QD 2Q8PA 2C3OA 2BFPA 3SSNA 1ZL0A 3RHFA 5F35A 1YE5A 2JVJA 1G7RA 3IX7A 1ZG3A 2X8JA 3KUCA 2I2XB 3PKIA 4LQCA 3ADPA 3VC7A 5T4EA 1PO7A 3AM1A 3JWEA 4XARA 1CQXA 1KPHA 1WKCA 4CF4A 5K0BA 1U98A 1QHXA 2A9QA 1NF2A 2WTAA 1RW4A 2VBIA 3QZUA 1Q16A 5F7ZA 2C5BA 2FF7A 5KCMA 1IXZA 3DCJA 2FZCA 5TRTA 3K2BA 4Q7KA 1QMPA 3AP1A 3D5EA 4Q3AA 4UNNA 2FHSA 3E0XA 2IYUA 1KDOA 4W63A 3W79A 3BTOA 4EYEA 1I51A 1EYZA 3UOGA 1FXWA 3DAGA 4TYPA 1ZMXA 4BNDA 4DGSA 4Z7OB 2QVCA 5I51A 5SZHB 5TQJA 4G0NA 1BH6A 3F7TA 5C80A 2YOHA 1ECPA 2AT1A 3JASA 4J03A 4AMVA 4BQRA 1CQIA 1E6LA 4LZAA 1D04A 3E5HA 3QG5A 4HDSA 3SQWA 2OLEA 5AJTA 1E5VA 5MDHA 3H99A 4MV0A 5AW2A 1EK0A 5GONB 4YAEA 1N0VC 3C3YA 1P8JA 4YPOA 4IEEA 4K9DA 1TLTA 1QE3A 5DIZA 3EGOA 3VPAA 1N6PA 3WLRA 1YK1A 4QHYA 3G13A 1P4GA 4GWLA 4Y18A 3R7WB 2GM3A 3P71T 4HXYA 5D3MA 3WLAA 4R9NA 3OQNA 1SCKA 1PWYE 3UJ6A 1I32A 2QXYA 2QD2A 4FB4A 4DLRA 3TGLA 3UYLA 2XW6A 2DFVA 3RANA 3S8EA 5CG1A 2XKJE 4XW2A 3HH8A 4AJ9A 3V1KA 3WWYA 2CFTA 2OBYA 3L8MA 1KDZA 3GPLA 2FPGB 1G66A 4MS3B 1BS2A 4C03A 1R0SA 1CJTC 1E5XA 1CERA 5FWDA 2J3HA 3TLXA 1U9CA 5KKNB 2X1VA 4MHSA 1C0KA 4A3SA 4YO8A 1P29A 2HRQA 4RNCA 3SYRA 3VTFA 4BLTA 2AOTA 4Q4AB 2QE7A 1YQWA 2G0AA 1Q1EA 1C3EA 5EJ2A 4JC0A 1JR2A 1P9LA 2LIPA 3SDBA 1RWMA 5DWVA 1Q3TA 1VKZA 5DTMA 1C5KA 1NKTA 4GOMD 4OGFA 4NIMA 5LJLA 2QP9X 1C81A 1C50A 2CZGA 4WKBA 3QU4A 1USUA 4LHWA 5GV7A 5JNLA 4ZEOA 2XQKA 3GLRA 4FC6A 4ZV4A 2QR2A 1ZD1A 4YACA 2WE7A 1UK9A 3C3BA 3OU7A 1J70A 2CEAA 3ZIAD 4W7HA 3WB0A 3MLAA 4BC0A 3SC3A 1N32B 1N2CA 2C77A 2L17A 3JQ6A 3RUFA 2E1PA 1XCJA 1Y7TA 4JLUA 4WCFC 3QKUA 2OWDA 1NXPA 1PNTA 4P0PB 1ZN2A 2HCTA 2Q21A 1WG8A 1YB6A 2B21A 3GIWA 3P9SA 3CJQA 3GJ7A 3LM8A 4AN1A 2PGJA 3ZCSA 2QSZA 3HUUA 4GLBA 3E5MA 4QO8A 4LXYA 3VYTB 2WTNA 1XD8A 4YRKA 4NXMB 3BGOS 3WNBA 2IS6A 3A05A 2WYVA 1ACMA 3D2AA 5AOVA 5AIBA 2WMOB 5BVGB 3A9SA 1NVMB 1E5LA 3J7TA 4KPGA 1CUIA 5DN6D 5J3JA 2QZ9A 4I4TA 4PYQA 4OQLA 3A3KA 3U81A 4BHTA 4ZJYA 1N36B 2RHOA 2XUFA 1SBCA 4G4GA 3L0IB 4QHTA 2G7MC 4S2EA 3V2UA 3V8QA 1UODA 1KS2A 1EDZA 3V34A 3VYUB 3I28A 3JRNA 3QKTA 4LVCA 5CH3A 3X1WA 4ECEA 1V3UA 4I1SA 4YBZA 1RHMA 3PHHA 1QHYA 2BEVA 2J3EA 1MT3A 5AVWA 3IBYA 2GDJA 3KHKA 5EQDA 4N5MA 1A5SB 2H92A 4JB0A 4MW1A 1THZA 4U7GA 5JUWA 1HZJA 5TC4A 5I3CA 4WKGA 3NVKI 2CUTA 2N0SA 3JAWA 3BTUA 4F60A 3TLAA 1K2WA 3KQHA 4DV6B 5SY6A 1RI2A 5G41A 3SQXA 2AI3A 3RR2A 4RM2A 5TIIA 3TAXA 2GERA 4LWQA 2ZRFA 5SZIA 1GPJA 2J9ZB 1AHHA 1NHGA 1ZKMA 3NIBA 1XWIA 2NZWA 2D00A 1T6BY 1YFZA 5AR1A 3KDSE 3IHLA 3QVWA 1CPYA 1CJUC 2H3HA 1F2UB 1RJDA 1YQTA 3H8VA 3OPQA 3PDUA 3R3YA 5A4JA 2SHKA 2B2CA 4U2EA 1SWVA 5LMUB 4FI3F 1Z6XA 3N5CA 2I3BA 3ILXA 3C7KA 2YNMA 3TTWA 2BMFA 1QOQB 4J0FA 5GJWC 4BMSA 4WXHA 3QKSA 2I4MA 1E3TA 1HNXB 5IYZF 4B80A 1WAMA 1Q7BA 2AH5A 2HIGA 2EW8A 2P5TB 4D45A 5C1OA 3SEAA 5EHGA 1ZI8A 2PLRA 3AEUB 3GPBA 1HE1C 4LDPA 3WGMA 3O8NA 3ITEA 4XX0B 5CLHA 5BYAA 1GWNA 3EVNA 3SLRA 2I1WA 3DQPA 1N9ZA 1FP4B 4M1MA 3VYRB 3W6ZA 1AG9A 2X0IA 4NZMA 4RFLA 5DJ5A 2YKGA 2F00A 3N2LA 3BB1A 5DNWA 2I6SA 5F3DA 3RS3A 4A8JC 3T34A 1DX4A 4RO0A 4QWMA 1QK5A 1RR6A 1KZGB 4JLSA 4MPPA 5I7RA 4FMDF 3EY9A 4CGZA 1UWKA 3CR3C 3GCWA 4RHUA 3W7VA 5BSFA 1XNRB 1KMCA 3PQ5A 1ONNA 1ZIOA 3JVVA 1U3TA 4LQ4A 4Q7JB 5F2OA 4XLZA 3KR0A 3BBPA 4PF1A 3B82A 1YOVA 4C4SA 4OM7A 2NG1A 5CA1A 3HMKA 1UC5B 2FEAA 4V1CI 3HM2A 2HW8A 1L7OA 1M3SA 3Q15C 1D2NA 1BCSB 1JDPA 4J76A 4HQ0A 3RG2A 2CMHA 2FEKA 1VKNA 4UBKA 4XJTA 5FR1A 4LSMA 3RIXA 2F48A 3KU4A 4BKRA 3VPSA 5I9TA 3IDAA 4J3JA 4LYGA 3HBNA 3GZTB 3X0DA 3QI2A 4LA4A 4LWPA 2ZITA 4AJKA 5TPWB 1ZGAA 4D6YA 3QVUA 4ZI7F 2O20A 3S55A 1OWLA 1Y7HA 3GOHA 3RU7A 4NX2A 5JXHA 1C8VB 5IC4A 1DMSA 2H4XA 1M6HA 1BHSA 2WTBA 4N6OA 4HN4B 4MWBA 1GNSA 4GI2A 1SGWA 1KXJA 3PHIA 1P1KA 3LC0A 2VI5A 5K2OA 5ILGA 1CS4C 4QFCA 3SQMA 1KQ3A 4RL6A 3C3WA 5EMHA 3A1FA 3V33A 4TLDA 1B26A 5B7NA 4CKWA 4AF6A 2FE4A 3UKOA 1T9HA 3PD0A 1QH8A 4O4IF 4DWWA 1P1FA 1QMGA 2O7QA 3P94A 3IL2A 4POAA 3HI4A 2D54A 1MOZA 3K0CC 4OXIA 4C87A 5JOQA 3ZHCA 3MT8A 4XIYA 2IXGA 2NU6B 4KE7A 2N3ZA 2CLCX 2YIJA 4H3VA 2HMSA 2MTBA 4P38A 3WRYA 1WZCA 4Y6PA 2PYDA 1MB0A 1IHXA 4V0RA 4ZK6A 1P18A 2A1TR 5C18A 2HK8A 3OO1A 1B43A 3A6DA 3DDCA 2FSFA 5JARA 1AGYA 3GU3A 4OHYA 1KBOA 2NYRA 2VG8A 3PGKA 4BO0A 4OMFG 1J8DA 3FNFA 5SYNA 4XOIA 4BS9A 3I1YA 3M1LA 2EJWA 3N8GA 4YDRA 2PIAA 2FXVA 5I7OA 1F4PA 1II0A 1GAQA 3EEFA 1O95D 4FCCA 4Q48A 1RAGA 2Q4BA 1OBOA 3G2HA 2D2VA 1LQUA 2J5XA 3KPWA 1DAEA 5T8KA 2KHZA 3D3QA 1U6IA 3QSYA 3K0SA 1JT9A 1GADO 4LHYA 1P9RA 3TBFA 1A7UA 4M7PA 1E2EA 1MVLA 1IIBA 3H2BA 3MWYW 3QF7A 4TS9A 4S05A 5CCBA 3A26A 1LLDA 3P0RA 4XH9B 3R6TA 1V11B 5F23A 4BL5A 2R5NA 1SFRA 5EKUA 1BDIA 4IMPA 2G17A 1AT1A 4E03A 4PPNA 1XU9A 1H22A 2BSAA 3TD6A 5IUJC 4IS2A 1DGQA 1BJKA 5C81A 4P98A 4WOBA 5IH3A 1CS0B 3OY2A 3IBTA 4YJKA 2QGFA 2NXJA 2I2FA 1IRIA 1FU4A 3M70A 3DL0A 2KS6A 2Z8ZA 1JMVA 4XGIA 2W5UA 1EP1B 1Y9AA 5DLDA 1QU3A 1JLRA 4MI6A 3WVNA 3REQA 3NRJA 3G02A 4IHQA 1SUBA 2VS1A 4B0OA 5LPNA 4X90A 1E7QA 5EG5A 3JZAA 2IYVA 4ARVA 3ADBA 2JGKA 4PAGA 1W25A 4PYRA 2I2DA 5LQJA 5LYJA 5ITZA 4QSHA 2Y9MB 4AURA 3QBJA 1M1YE 4UVGA 1CCWA 1MU0A 4EKEA 4KAJA 4HVAA 1CUHA 1NOIA 4HATA 4NHEA 1YVRA 3C5HA 1AGPA 4BVBA 4XLTA 3C1TA 1RFLA 3G9QA 4F56A 3AINA 4J7CA 3URKA 3VOTA 5C9ZA 2G76A 5JC8A 2BR3A 1K7CA 4Y7DA 3FW1A 4LXTA 4J0KA 3QV1A 4DILA 1Y8AA 1EXDA 4FFMA 4Z2AA 2WSSA 1HXHA 2HV9A 3IH5A 2DU8A 2OC9A 3K2EA 2IUEA 3MBIA 5CFZA 2CL5A 3FYUA 3UGQA 2XJ9A 4AK9A 4C6TA 3ZGZA 3HB0A 3ZH9B 4NK4A 3EWSA 4ABYA 4CDNA 1Z5PA 2EKLA 3KKOA 1Y6FA 1SBZA 3NTUA 4QDKA 3V8PA 3WGKA 1DKMA 3L0DA 4L8YA 3EEYA 4EKYA 5AKYA 2AI2A 4XASA 2OVFA 3BB3A 3GRPA 1GRNA 3GRCA 4FNGA 4LBWA 2ZBEA 5ABPA 5B2EA 1YSCA 3B7GA 4TKVA 2VFAA 5KOJB 2AG6A 2CYBA 2CE7A 2Y0DA 4NH0A 4WFJA 3THWA 4G5GA 3TRFA 1DVRA 4I55F 2AD1A 2JGIA 4JOBA 2EWMA 3MINB 4HDMB 5DCLA 3SXJA 1AMNA 3CW2A 4J91A 3RS7A 2BPOA 5DOVA 4PYOA 3WGTA 3TEFA 2I6TA 1WMFA 1YRQA 2PUBA 5B4VA 2VHEA 2CLLB 3QJGA 1XP5A 5CURA 3PEFA 4BFSA 1ISSA 3UC9A 5I7VA 4GQAA 1RE0A 3PA8A 4HN2A 4LE0A 4TOIA 4U7WA 1GT91 1AHNA 2ZI4A 4OYHA 1Q0UA 1SO8A 4PG7A 5EJAA 4EUHA 2OO5C 3NORA 4EGQA 3R5XA 1WJGA 4N5DA 4PTZA 5HZMA 3QBVA 5IW8A 4Q1FA 3N8HA 3FDFA 4M60A 4AG6A 4Q6BA 1XA4A 2WV9A 4MYSA 3QEKA 4NPCA 3SICE 4XWKA 3D8SA 2QF7A 2E1RA 2WNSA 4NJMA 4BE4A 4CUKA 2ZT8A 3HXMA 5AW9A 2LCFA 3ETNA 2RB4A 1P7PA 1ZK4A 4MB6A 5HFNA 5AW4A 4KO1S 1RI1A 2R7MA 2YW2A 3EWNA 2Z9DA 2IOHA 2FU5C 3MD9A 4AZVA 4BJHB 4D26A 3P2IA 2SCUA 2J6CA 2YX1A 1HO3A 1G3UA 4FT2A 4JI6B 5JQGF 1G6HA 4WOPA 3DHYA 1O87A 3PGMA 4BQNA 4DLTA 1AZWA 1Q95A 4MJ3A 4CM8B 2VNIA 1KR5A 2XUQA 5EJ9A 2X4LA 1QFSA 1SQ6A 4IQ8A 3KWJA 4DQ0A 1FZTA 4BOYA 1A04A 2QZPA 2IA5A 1AA6A 1ILEA 1WR8A 1T4MA 4QU5A 3ZHQA 1OBVA 5EXEA 1NBOA 2N1MA 1VBFA 4V24A 3SY8A 4ENVA 2OZLB 1U8YA 3PQ4A 4ARBA 1ZI6A 1XAGA 4TM7A 5DGHA 4YJ2A 1SVSA 1Z6ZA 4A5OA 1M2FA 1YVUA 1Z26A 1TC1A 4MWOA 5A9TA 3RU9A 4UVHA 5LA6A 5HUHA 4MW2A 4HGYA 4UCQA 2LWIA 3JVUA 1UKVY 2O7RA 3TYXA 3PXDA 4D92A 3UAWA 2HDOA 2WIBA 4YJ3A 5A04A 1IDN1 3HDVA 1UWVA 1KEKA 3KSZO 2OCPA 2XT0A 4XVCA 4N03A 1L5VA 3KPUA 3IPRA 4MYCA 1CZUA 3PUYA 4FUQA 1KFCB 2YXNA 3D6HA 1FXUA 4BUJA 1XZCA 3IESA 4ZANA 3T3PB 3B6EA 4ZDJA 1MOPA 2F43A 5FWNA 3V80A 2PD4A 2XOKD 3NJ8A 3VKFA 4DG8A 4FFRA 1MDBA 2VTBB 1GPMA 4NPHA 4C3VA 4JBGA 4TV9B 4X64B 1TADA 3IBSA 4BBAA 4EW1A 4BLSA 4BO9A 2HPAA 3PWKA 3DUFA 3KCNA 4KFUA 4TS3A 3GXOA 3VC2A 4UW9A 1GGJA 4XD7D 4B3JA 3F73A 1A7KA 4IPTA 3DDNA 4A0SA 2WD7B 1FVFA 4JB2A 4QBKA 3D6UA 2A9RA 4H2DA 1FJHA 3KALA 2FZ5A 1F17A 2C20A 2R8RA 3MCUA 3UJPA 1E1MA 4TMWA 3MWGA 3LOUA 4D6XA 1P4SA 1EXVA 3Q8XB 5TEWA 4CETA 3TUZC 4GKVA 3K8ZA 4C2TA 2VPZA 4RS4A 1I9GA 1PLKA 3ZHOA 1EUQA 4QPJC 4ZCMA 4EHKA 2ET6A 3VU3A 3T7KA 3FJOA 1X1QA 4XM1A 1XLWA 1ZM2A 1NZJA 1UWCA 1A9ZA 2BI7A 1E1RA 2GPWA 2ZBFA 1QKKA 4EFLA 1JIIA 4RZ2A 3RHSA 5ILOA 4Q39A 5DGTA 4CLHA 1A4UA 4HDKB 4GT1A 5L45A 2C1XA 1QDUA 3S44A 4AMZA 4IINA 1K6XA 2OD2A 1J4AA 3FD8A 3SCZA 4FQ5A 4LJKA 1ZD2P 4JZKA 2IY9A 4IDQA 1NMQA 1M72A 1B2LA 3GJYA 2YQ5A 2DBQA 4UFPA 1LUAA 3WB9A 2VRWA 3BJMA 3I32A 3P8ZA 2PL9A 2VZ9A 4B3DA 2QV7A 1P61B 2BHLA 2R8PA 2AJ8A 3FHJA 1LVHA 1P5FA 3QJYA 3ZUGA 1L7PA 1OMOA 5FDFA 4NATA 3VOSA 3DD1A 3WL8A 1UPUA 1MC5A 3NUZA 3PPWA 3TEMA 5AXAA 4XB2A 3HADA 3H86A 5P21A 1GSOA 4I8XA 2IBMA 3SZUA 1GCAA 3UUGA 4AJIA 1VLVA 1OB2A 1XD9A 2FPIB 4MUAA 2D5CA 4R81A 5CXXA 3TO5A 2YVLA 3GUZA 1HDGO 2X14A 3P7MA 1RM0A 4XTCS 1QYWA 4E2XA 5A7HA 4H60A 4G8DA 4JC8A 4Z9AA 4WCFB 2XTNA 4NK5A 4QASA 3W4KA 3DMDA 3JPYA 2O2EA 3NHYA 4P33A 1JPUA 1ZD3A 4GXQA 2XWPA 3QF4A 4DCMA 2GXAA 5I9LA 1EG2A 2WJJA 1JSCA 5KOHA 4GL2A 3FCEA 4ZOQI 3GP5A 1A9TA 4N7BA 2ORIA 2JFUA 2COKA 2N42A 3DV9A 1TKBA 3CVYA 1JKMA 5DX1A 1Y80A 1O5IA 4IJMA 3S5JA 4QVIA 1FUEA 4ZC1A 3QVGB 2CW5A 1P62B 3CLTC 3W3ZB 1YCHA 2E87A 3E53A 4TXNA 1FNMA 1YRYE 1W76A 2PN1A 4RPJA 2REBA 1UUFA 1OYWA 1U0LA 1CY1A 4DARA 3AG5A 3EW9A 5A03A 5FBVB 4HDOB 2NZUG 1L2TA 1VHLA 3LOQA 2R9VA 2YYSA 3QVVA 2REQA 2IU4A 2AVDA 2GTPA 3CZCA 1VHDA 2AG5A 4ZVOA 4ADSG 4CM7A 3PHLA 3FJYA 4CMEC 5L4NA 1XD2A 4HH0A 1FY2A 3EIHA 5DTRA 3Q7PA 4MVJE 5CFOA 2FWAA 2PMFA 1XB2A 2O3QA 3OCZA 5AO9A 4X61A 5FTWA 5BN4B 3ELBA 4H6XA 2EZUA 2LV8A 2IU6A 3D3KA 2FKNA 2WFLA 3BSSA 1TCVA 4YRPA 5K8TA 3C6XA 3DT6A 5C3UA 2IV2X 1E5QA 5JYBA 3M6WA 5G3ZA 2FWMX 1QIEA 2YNMC 1H4SA 3DFUA 3EXHA 4DV5B 1JYFA 4QDTA 5U1PA 2RC6A 1SKMA 2F17A 1GGHA 1C3OA 3F5MA 3OPYB 1BU8A 3K6SA 1AURA 4RIHA 3PKZA 4FNMA 3F5DA 4YGYA 2XRYA 1IY8A 3RGGA 1ZBQA 2YZ2A 2CWDA 2ODPA 2H1LA 4OHUA 4DNXA 4ESHA 1EDEA 2OB1A 2FCAA 3BF7A 2CXTA 5GWXA 1A8PA 2ZIAA 4PO9A 3AI7A 5BYBA 1TYZA 3R76A 1E2HA 1RXWA 4EG6A 1V47A 1PKXA 4N8SA 4K1XA 2CVHA 4COOA 5FKJA 1RXYA 4GLFA 1LLUA 3PG5A 5IH7A 1A4RA 1KJIA 1QG0A 1J99A 3QYPA 4I1RA 3BGVA 1AXRA 1J2RA 3DVLA 4R5MA 3ZZUA 1KVTA 4GAEA 3K30A 3KHUA 4J0IA 5U4QA 1G20A 3UANA 1JEYA 1JILA 3AB8A 4XUEA 2QTTA 1S6YA 3AF0A 3UW3A 3IKMB 2BBSA 1X7GA 3AGPA 4OQXA 2AW5A 2NSYA 4X63A 1C7IA 2IODA 1L4MA 5G1NA 1VIDA 1MQ9A 4FONA 3HXOA 1R0YA 3IRVA 3U7QB 4US2R 4II3A 4MV9A 4A8JB 3D02A 1T3TA 2V7VA 3DO6A 5CPFA 4M55A 3UWSA 1S3SA 3DDZX 4GDMA 2C8KA 4RJTA 3UT5A 3ZZ0A 1UXGA 1N2IA 2R0QC 1WF3A 4TUYB 5E3JA 5DCYA 1X7XA 4WJZA 4FFSA 2RHJA 4OVKA 4PVCA 2NUAB 3SEZA 4G8CA 1MCZA 4LWZA 1E98A 1NR7A 3HY4A 4OXQA 2Q1XA 2A5DA 2ZSUA 1W19A 1ES9A 3EC7A 2XYVA 1VXOA 4Q3DA 4QDOA 4ZCPA 2ZJZA 3ZCTA 4Y1RB 2BH2A 1CTQA 3HNRA 3AO0B 4RVHA 1SC9A 2Q7DA 3D3EA 3U7JA 5B30A 4D9JA 1LQ2A 1ZITA 3GGCA 3U17A 4A6PA 5BQ3A 5EWJA 1Q44A 2FPXA 3W2FA 1GPUA 3IQZA 4DDTA 1S3IA 3BA1A 3HP4A 3PJEA 2GYUA 4NR0A 3TX2A 1NDUA 4A1OA 4YRLA 4YEDA 3I1FA 2ZPTX 5ILQA 2NTEA 5BW4A 1P2GA 4XJSA 1K5PA 2ZYIA 2I4TA 4HQKA 2O8BA 3BFJA 1J2JA 4EPYA 4IGIA 3RFVA 1TW3A 1O4VA 1Z25A 3DVRX 3LJKA 3R5JA 4IDBA 4C06A 1IBLB 4H1HA 4FR5A 4PN7A 1IY2A 3TD9A 3LHKA 3STXA 1MABA 1OFGA 1P7ZA 5U4XA 5DTIA 5JSYA 4QWWA 2OCGA 1ZM9A 3SGLA 5KYXB 4WK2B 3NS7A 1GFWA 4L4UA 5CA0F 1KIAA 2IHYA 3B12A 3KJNA 5ADVA 5KOYA 1Y7IA 1KBQA 4IG4A 4CF7A 4B34A 5C7IO 5T8KC 1VE1A 4H4CA 3PQCA 3UUEA 4KWHA 5AD1A 1ZWLA 2UVPA 4XYEA 3U44B 3HVJA 3KYBA 2DQKA 2Z6VA 4A91A 2EBWA 2QTVB 4PR3A 1EIWA 1RIIA 1XLTA 3LRXA 3RIEA 1RYDA 1ORWA 5CNMA 1EI9A 1JR3E 1SUSA 3LAWA 1NHWA 1NW7A 1DPGA 3DDHA 4BQFA 1UADA 5B6JA 5CD1A 3J7AC 4BX3A 1FFBA 2YZ7A 2G36A 5T5QA 1PZXA 4WK0B 1Z22A 2OC4A 3NIFB 3EVGA 5BW5A 2DE0X 4NMLA 3EJ6A 5AVQA 2JFXA 3OOWA 4Q16A 4B46A 2UYHA 4H1VA 1A9OA 2D3TA 3DZJA 1W47A 4JYMA 4FWTA 4I9NA 4DHEA 3TTTA 2W8ZA 2H1VA 2IYXA 1NAHA 2NO7A 2EW2A 3CRMA 5EJEA 3NYWA 1R12A 4YP0A 4F8JA 1DEHA 1PJ2A 1Z8DA 2QNIA 3IIIA 3I9MA 3RRNA 4B7UA 3MRVA 2GZ3A 2NQTA 4E3ZA 3FCYA 1JPVA 5KQRA 4EGCB 4U6QA 4HB3A 4M1TA 2C94A 2G9RA 4AO7A 1IHOA 3KO8A 5C8XA 3EG9B 4FX2A 1BIFA 2YJ5A 1J9ZA 1XEXB 2YHUA 2JI4A 2VJLA 4EZBA 3AKZA 4B87A 4XWTA 2H1OA 3OQMA 2FA9A 4G81A 1QO0D 1ZNWA 1S8OA 1LY1A 2H0QA 4R2IA 4ZVMA 4BU0A 2YZMA 4LTMA 1KF0A 1SU4A 1JU3A 2C84A 4GXNA 1KP3A 1YIOA 3EXG2 3RI3A 4PO3X 3CY6A 3MFQA 1DOHA 1W581 3LUHA 3W5BA 4PEVA 4IKEA 1M66A 2G4VA 2NTJA 5IAKA 1PHPA 1YNOA 3KFVA 1YTUA 3FYUC 3MIZA 3TXAA 5C51B 1RD4A 1FXSA 2EVWX 3WRVA 4Y6QA 1MP0A 4O4JF 1G6OA 1J00A 4KKVA 4RSMA 4DLLA 3DYBA 4P82A 1PWXA 2R7LA 2F6RA 3QKRB 4GQBA 3WLOA 3QUTA 4MK4A 3ZCRA 1L9KA 1MV8A 4HOYA 3LIPA 4RY8A 5H9WA 2RBGA 1GQFA 4G89A 3IAM1 3ZK7A 4CM5A 3HGMA 3HXPA 3TDNA 4LCEA 5ER9A 5AJVB 5K05A 2JHPA 4G6ZA 3HXKA 3KAQA 5L9AA 4L5YA 1P3JA 2OCIA 2P1DA 3E1KA 5DLPA 2OSVA 4DM4A 2PWPA 3A9CA 3PBKA 1TZMA 1U0RA 1ZK2A 3OFNA 3VPDA 4HDRA 4D8TA 2BKEA 2AN1A 1FF9A 1LWOA 4AP5A 3ZDDA 1NXSA 2DJIA 4IDHA 5KYUB 3HCOA 1D6JA 1VKRA 2A5YB 2E4ZA 4E6PA 3LNTA 1GL3A