3HLYA

Crystal structure of the flavodoxin-like domain from synechococcus sp q5mzp6_synp6 protein. northeast structural genomics consortium target snr135d.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
145
Chain Sequence
SVLIGYLSDYGYSDRLSQAIGRGLVKTGVAVEMVDLRAVDPQELIEAVSSARGIVLGTPPSQPSEAVATALSTIFAAAHNKQAIGLFDSYGGDDEPIDALLAQFRNLGLHTAFPPIRVKDQPTEAIYQQCEESGTDLGQWLTRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavodoxin-like domain
publication title Crystal Structure of the Flavodoxin-like domain from Synechococcus sp. Q5MZP6_SYNP6 protein.
rcsb
source organism Synechococcus elongatus pcc 6301
molecule tags Flavoprotein
total genus 49
structure length 145
sequence length 145
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hlyA00
4N65A 6NULA 1FVXA 3P0RA 1OFVA 2M6SA 3F90A 3ES9A 1D03A 4BMOB 3ESYA 2QMZA 3NHYA 4QOFA 3OJXA 2Q9UA 1AKQA 2OHHA 2A5LA 1E5DA 3K1YA 2V5UA 1YCHA 1JA0A 4ZVKA 4FGJA 4U7FA 3FVWA 1T0IA 4FGLA 3O73A 1B1CA 3B6JA 1ZWLA 4D02A 2HNAA 1J9EA 1XYVA 1NNI1 1BVYF 1TIKA 2FZ5A 1AZLA 4YAFA 4GQIA 4LA4A 3N3AC 3R6WA 2XOEA 1DXOA 1F4PA 3RPEA 3F2VA 1FLVA 4YAUA 4Y7CA 3NHUA 2QR2A 4GI5A 5NULA 4C76A 2FAXA 4NULA 5LMCA 3NHWA 4LTMA 2BMVA 2QX6A 2KQUA 5FA6A 5F4BA 4DILA 5JROA 1KBOA 2R96A 1QRDA 2OHJA 4QOGA 3B6IA 3W7AA 3OX2A 4FGKA 1CZLA 3NHPA 1AKTA 5EA2A 2X2OA 1XI2A 4QOIA 4LAFA 3OVMA 1FLDA 3U7RA 2QX4A 3QE2A 1SQSA 2FDXA 4YALA 3GFRA 3ZHOA 4M0CA 1YRHA 4U7HA 2ZKIA 4CF6A 1QBGA 3NHRA 5LBUA 3QFCA 2QX9A 3NHKA 1ZX1A 4Y9UA 3SVLA 3TE7A 4HEQA 1VMEA 1DXQA 4OXXA 4XDGA 4C0XA 1D04A 2W5UA 3ESXA 3OJWA 3D7NA 2MTBA 4QOHA 1RLIA 4QODA 2HPVA 3KEGA 3NLLA 4H6PA 5TGZA 3UXEA 5LVAA 1AKUA 1J9ZA 4U7GA 4YQEA 2Z98A 3FNIA 1YKGA 4YAOA 2V5VA 2V9CA 5LLDA 5FX2A 1GG5A 3LCMA 1DX9A 1ZWKA 3W78A 4R81A 3HA2A 4H2DA 1OBOA 3HLYA 2AMJA 1TLLA 1C7EA 1J9GA 1WSWA 3KAPA 1J8QA 2OYSA 1I1OA 1AKVA 3S2YA 1YOBA 1JA1A 1T5BA 1BU5A 1RTTA 3OWXA 2ARKA 3QFRA 3UXHA 2FZVA 3TEMA 3W79A 1X77A 4XDHA 3TZBA 3W77A 4HS4A 3OWHA 4C0WA 2X2PA 5ULLA 2XODA 1WSBA 1C7FA 2QX8A 2BF4A 2HNBA 5B3KA 3FJOA 1FLAA 1FUEA 3OX3A 1FX1A 1CZUA 3GFSA 2Z9DA 3ESZA 4YAWA 4PTZA 3L9WA 3N39C 3EYWA 3HR4A 4N82A 4F8YA 2Q62A 1CZHA 3G5MA 4J8PA 4BMPB 2GSWA 2KLBA 3NHSA 1AHNA 1XYYA 2BN4A 4PTYA 1RCFA 4LTNA 4ZVLA 3EDOA 1YCFA 4LTDA 1V4BA 1RLJA 2B3DA 1XT6A 2R97A 2WC1A 2FVXA 3OX1A 1H66A 1YCGA 1OBVA 2FCRA 5LJIA 3NHJA 2FLVA 3K20A 4PU0A 4NLLA 1D4AA 4ICIA 1CZNA 1AKRA 1QHEA 3N3BC 2MT9A 3GFQA 5BUCA 5B3LA 3KAQA 4ZVNA 4QOJA 4CETA 4C14A 1CZOA 5LBTA 4GR9A 1AG9A 2M6RA 4N9QA 4ZVMA 4DIKA 2MWMA 2Z9CA 3GAMA 4QOEA 1FLNA 3NHLA 5EAIA 3B6KA 1YDGA 2F1OA 5F51A 2RG1A 2OHIA 3F6RA 2BZSA 4ESEA 1AKWA 2D5IA 2QMYA 4FX2A 3NHFA 2FX2A 4DY4A 5A4KA 5LJLA 2Z9BA 3FW1A 3O2NA 2QWXA 3L9XA 2MOKA 4S24A 1QR2A 1KBQA 2BPOA 3LT5A 3B6MA 3NFRA 3KLBA 2N1MA 3FX2A 4Y9RA 1CZRA 5F12A 3JSXA 5NLLA 1H69A 3F6SA 1SG0A 1AMOA 5FUQA 2FOXA 5EMNA 1FTGA 3U7IA 1CZKA
chains in the Genus database with same CATH superfamily
4V2IA 5CITA 2GWHA 1EP1B 1N2SA 2YUIA 2BTQB 4AF8A 4RZIA 4JBIA 4RHUA 4Q3AA 3L7AA 3EDYA 3PI6A 2CVZA 3DGEC 4LYDA 1AK1A 2E4YA 4N41A 1JYSA 3AFHA 2XGJA 2XXAB 5JD5A 3W5AA 3C5CA 2WWTA 1P5ZB 4HAWA 3NC4A 1R0SA 4DPLA 1OFVA 4D4KA 5H9WA 1O6CA 1KYZA 2GCGA 3PKZA 3ZPXA 1CY0A 4Y3UA 2P6OA 4HMPA 5ICSA 2FQ1A 5H83A 3N8DA 2XCUA 3FNQA 5GM2A 4E5PA 3F6YA 3NDJA 3DHEA 2XNDA 3F6CA 4OKIA 1G0NA 1J8DA 5JAQA 4BMOB 1GSAA 4AG6A 4Y2PA 1A9XA 3H5VA 4M1EA 1P4HA 1U02A 1UAGA 2O3UA 4J9VA 1U2GA 1D2NA 2FPOA 3JQPA 2FPXA 2A5LA 3AF0A 2Q4DA 1GGKA 3K1YA 4BUCA 5IWAB 1THZA 4PYRA 1HEYA 3ROEA 3RUDA 1L2TA 1N6PA 1NR5A 4OGLA 4S3MA 4YMGA 2G83A 2I1VB 3FGNA 2PE5A 4Q24A 5LD2B 3BMOB 2OA0A 2BC9A 1E32A 1H9AA 3O73A 4EB6B 5CFLA 1VPWA 1RWBA 4WLEA 3ZGYA 1JRLA 2C2GA 3EBOA 5ALTA 7MDHA 1C1HA 4AG3A 2AJ8A 1SUIA 5J5VA 1AU9A 3NVAA 4KYVA 1G2PA 1VKZA 3LSYA 3M5WA 3QVXA 4OKSA 4P4SB 4Y1FA 4Y1EA 4TS9A 3S68A 4H59A 3RU3A 3GJQA 3ZCPA 2J0QA 4RPCA 4QECA 3IUBA 4JUFA 4MQMA 5CVEA 3QUBA 2BIFA 2C2BA 3EQ2A 3R8FA 3QSGA 1NDUA 4LF6B 1P2TA 3FZYA 4NEHB 4UCFA 2OR3A 3W8FA 4B9EA 2DF8A 4AJIA 2YASA 1TTPB 5C52B 5JBIA 3LDUA 5BMVF 1LLCA 3D8BA 4YA6A 2WUDA 1XPJA 4C78A 4JKIA 1DBIA 1N9GA 2ZWMA 2HWYA 4QFDA 3IA7A 1FDVA 3OTOB 2DCMA 2K2QB 2V7PA 2O2SA 1GRCA 1UOPA 2OAP1 5EGNA 2CJPA 3GWGA 3UYLA 1UMCA 4AK9A 3JR3A 1G8HA 4E2ZA 2FXVA 1ZISA 3F71A 4XWYA 5AKEA 2J3EA 2WLTA 3WNBA 5ABPA 1ZD8A 1PQYA 2ZYAA 1U4OA 3JQFC 2YHUA 3GDWA 5E1DA 5L6MB 4LF4B 1K06A 1O5IA 1R9GA 4UMDA 3L2OB 3C3KA 3ZLJA 3HJBA 3VMMA 4CQLA 5JTTA 2DQYA 2UV8A 4IV5A 1AD2A 1BA3A 1KJQA 3GR6A 4LF7B 4MUHA 9ATCA 3R7WB 3LG2A 1WHTA 4MWBA 4MINA 3SX2A 3V4RA 4HX5A 4JVLA 4Q39A 3ZW7A 3F7MA 3T95A 2H06A 4DQXA 1KXZA 2A4KA 2DR2A 2DPYA 3L0SA 1VHLA 1ZLYA 1JTFA 4LY0A 2NXEA 2VT6A 4X6UA 4OHCA 3TNFA 4UPVA 2EATA 5JASA 1M2KA 4ZT7A 3FB1A 1FMJA 4ROTA 2ZJ3A 1WPGA 1SPBS 4FW8A 5F5LA 4CU2A 1PR2A 1YR6A 1TM3E 3E1KA 4X41A 4B6JA 5CCEA 2BKAA 4BY9E 1P72A 3QLTA 4P0PB 2BFFB 4URXR 2B1RA 1HLFA 2FZKA 2NO7A 5A6SB 4AS3A 1JU3A 1M6WA 4ZAGA 3RS8A 5LQDA 2G5PA 4D9JA 3NIWA 1NBOA 4F4DA 2PGAA 2GWRA 3HN2A 2AG5A 2PX4A 3AZOA 2X2OA 3NDIA 3SC2B 5TJ9A 4QOIA 3SHFA 1ISFA 3DDHA 2XQIA 5CM9C 3CCCA 3P9QA 4AJ1A 1JHQA 3AP2A 4KQCA 2PH7A 4WNCA 4ZI2A 2PL1A 3TB4A 3RUEA 4MVJG 3RBXA 3VBCA 2BI7A 2CVQA 1N2CE 4J1QA 3H4VA 3JZIA 1PT5A 1OIXA 2YWCA 3GLRA 4BEVA 1OAOA 4HNSA 4WCFC 2FQWA 3SICE 2JLZA 2QMUA 4KBYA 1MO6A 4H6XA 3BGIA 1J5EB 1QV9A 3I9NA 3AOEC 5KDDA 4IGFA 3VXKA 2PFKA 1Q0LA 2MYNA 3HDYA 2OCIA 3EB9A 3DPIA 1WF3A 2XQVA 1NBAA 4HBGA 2CCKA 3HY4A 3G8DA 2I7DA 2IEIA 4JJGA 4LY9A 4QBHA 5FNVB 2VJNA 4ZQBA 3R7BA 3TOXA 3WSTA 4D1YA 4W9MC 4WRRA 2C1XA 1FZTA 3SVLA 4MAMA 4TTAA 3D31A 3KFXA 4IVRA 4CCAA 1YZUA 1VI2A 4P53A 2Q4BA 1TDJA 1NQUA 1JTVA 1TB4A 4EABA 5IKMA 4U9UA 2CEAA 4I1IA 1Z6PA 4LWPA 1IBMB 2C58A 1KU0A 1T5DX 3UT5B 1EDZA 1MJGA 1LWOA 3VHRA 1PRYA 3IQDB 5JJCA 2XCOA 4LE1A 2C5AA 4MVJM 4KTVE 3UGTA 4AJPA 4PGHA 4CW7A 1P8JA 5CA1B 3WIDA 3WKDA 1R0CA 1RS0A 3ZI0A 3FIJA 1EVQA 4JXKA 1YBVA 4DMRA 2JGDB 1JZTA 3LK6A 4JUDX 5AXAA 3MJHA 3VVMA 5JSZB 4OXRA 3GV0A 2BKUA 3BORA 1Z5OA 3W3AA 5DK4A 4QODA 4UDNA 1DINA 3FNRA 2D5AA 3TPFA 3N0VA 1XMXA 2Q1WA 4PSUA 1SWWA 5DTMA 3CWCA 2R7LA 1J09A 1B0PA 1AKUA 1RAGA 1XZJA 3M83A 3OJ0A 3PNOA 4OYHA 4UUMA 5HF5A 5DNUA 2OD7A 2XQJA 3W5BA 3AKZA 4DC9A 2XY4A 1EYZA 1I94B 1GGHA 4C7OB 2FW0A 3BD7A 4HFNA 1C9JA 2GN0A 3WJ1A 1B23P 3FRJA 3UB4A 4MULA 3CBQA 3AR5A 3OO0A 1EJ2A 2XMDA 3FSGD 4FGSA 4JA2A 1SXJE 1JMVA 2EJVA 2WSIA 3SCZA 2Z5GA 2ZSFA 4LISA 2Q6IA 3D2CA 4LRYA 4LI0A 3EPJA 3MWEB 3ETGA 4K81B 4P32A 4NP6A 4ZYVA 2Z6AA 4DMCA 4AUNA 1EA5A 4OGGA 1Z17A 2FXIA 3KZ1E 2XRYA 3GRRA 3IAFA 3LMKA 3PUZA 1IAQA 3E70C 1K08A 3H5LA 2R751 4E12A 2GN1A 2GXUA 2HJVA 2B7BA 3ETLA 3MWLA 5COAA 3T7AA 5TX7A 5HZKA 2G08A 1MU0A 4BMDA 5KOJB 2ZUBA 3DE7X 4DJAA 4CTMA 4RVOA 1X7XA 1HQYE 2G70A 2ZJ5A 1P7YA 1JLKA 1NJFA 1KZ6A 2OYSA 3QXJA 1XEXB 4FHEA 4BVGA 3OA0A 4GH5A 1Z5GA 2IPMA 2QD2A 1LPAB 2FPSA 5IH3A 3Q7PA 1J56A 1YIDA 2AD5A 2QVXX 4NZNA 1OFGA 5DWDA 4Z4HA 3GNSA 3C3JA 2ZYDA 5KNBH 4U7PB 5E3IA 3ZHUA 1XROA 2ARKA 5JRJA 4JUBA 4Q4CA 3P2IA 1JEYB 2YIDA 2ZUSA 4WY2A 3IUSA 2XMCA 3DEFA 4CKYA 3HDTA 1XVLA 4ECEA 2YY7A 2O7SA 1C14A 1NURA 4BHTA 2FN9A 4NOLA 2H1OA 4AKGA 3A6DA 5IMSA 1I4WA 2Y1DA 2QTNA 1H2WA 3I52A 3OWHA 4O0LA 1UAAA 5AOBA 4OI1A 3SNKA 3PC4A 3AL0C 2DC1A 2PBLA 1HZZA 1UEIA 2F3RA 2PAAA 4HZUB 1TCAA 3Q8MA 1LXCA 3HB0A 1JAIA 4UASA 4EIWA 4PS0A 3IVAA 1NJGA 4XD2A 1Y9EA 4EUKA 3CA8A 1SWVA 1PLJA 4IQFA 2BGIA 2CJXA 4GSKA 4I99A 2V6BA 3TG8A 2I71A 1U9ZA 3OX3A 2I9PA 4AYXA 2CLIB 4DTIA 3SI7A 2UUOA 4H7IA 5EZYA 1F48A 1E4VA 2QVZX 2X4DA 2ZT6A 3NP7A 1H3NA 2LCIA 3INGA 4KUHA 1YR3A 4QTXA 5KOHB 2GPWA 4XWWA 2V45A 3FBGA 4CIWA 1KOFA 1YE8A 4MQUA 1MX9A 4FXOA 5TVKA 2PGOA 4B82A 1RC1A 4LZWA 3O9ZA 1ARZA 5CYGA 4G1UC 2WJ6A 1V45E 4LVNA 3IURA 5IVHA 2ODTX 1T8RA 1JV2B 4YRTA 3QNUA 1GR1A 1KWGA 1L6RA 3B1WA 3OQNA 3EX7C 2Z4TA 2BFBA 1YAHA 2QTCA 3IO3A 3UOGA 1GZ3A 1WY7A 2GHTA 5IAKA 2FU5C 5IG2A 5EMKA 1ZU5A 1ULZA 4F8YA 2O54A 5CJPA 1M54A 3AL3A 3REQB 2R1TA 4QQNA 2AYYA 3ASVA 1BGWA 5A0VA 4O2AB 3FDJA 3P9ZA 1IN5A 4X8OA 4E5NA 2IXGA 2C2WA 1HK7A 2IYTA 3QE0A 1GGVA 3DC7A 4GD3Q 4RHFA 1CUZA 2OBBA 4I50A 4JLJA 1E7QA 3O2JA 4V0SA 4ZVVA 2H4JA 1GQFA 1R3UA 1QK4A 2I6FA 3HN6A 1N2BA 2YNMD 4M9RA 4AY3A 4COOA 3JZMA 3KKEA 4OUKX 4EPVA 4ZHQB 3T3IA 2C29D 3R7FA 3OHSX 1NUSA 4B48A 3L79A 1J8VA 1U9IC 4LTDA 1YDHA 5I47A 1YTLA 2VJMA 4LY6A 3AIOA 3OBIA 3WADA 1XLVA 3JAWA 3BXPA 4L0QA 1RWMA 4Y2SA 2PZJA 4C4OA 2G1PA 3H1FA 4P33A 3BEOA 2FVXA 5LXTF 2GYUA 3P5BA 3I2FA 4OD0A 3A1SA 5EHQA 2OGWA 1U0TA 1OBHA 4LOJA 4NNPA 2DKFA 5JO9A 5BXQC 1G1AA 3ZOKA 2X5JO 2I1QA 2ERCA 2HL6A 3FIUA 2SKEA 1VSUA 2D0OB 2XZOA 4HRXA 2IWHA 2OK7A 1BYIA 1AQIA 1DO8A 1XWIA 3BREA 4LRUA 5BQ5A 3M9WA 4CM8A 2FB9A 1M33A 3H75A 5H3HA 621PA 1F7VA 4IR7A 1EFPB 2PUEA 3EWSA 4PU0A 3U26A 2CLEB 3H3FA 3I9JA 3DWIA 5AVJA 4Z1MD 2G7MC 1D4AA 5FWXA 5HS4A 5LU9A 1RWVA 2HJWA 1XVUA 3JASA 4EY7A 2QM8A 2W22A 2NYVA 5C81A 1T15A 4BVAA 2HRDA 3VPFA 2FPMA 4H7DA 4AO8A 1F9EA 2XGOA 3BB3A 4PG8A 2P11A 1G2IA 5HCNA 3UFXA 221PA 3L8HA 3X1MA 3OAAD 6REQA 4N12A 4TUYB 1DOAA 3OH8A 1JR3A 4I8XA 4AJLA 4XOUA 2C4TA 2FRVA 2F43B 3HSYA 5IJXA 4BQFA 1R4ZA 4FINA 4I8DA 3AYXB 3ZE2B 4GKJB 1LLDA 4B43A 1WBBA 2IQIA 2I66A 4IICA 3GZTB 4JB0A 1YGYA 1W88A 2RHOA 3QI2A 5EUQB 1WMEA 1BCRB 3IUMA 5AI8A 5KJ6A 4RMGA 1QZXA 4FC6A 2P9EA 3LM8A 2HADA 1DDIA 3EEBA 1M1YE 3KKPA 4FKBA 4GIBA 3PEEA 1UFQA 4YP6A 3WLPA 5IWCA 3RODA 5BMOA 1AG9A 1XA3A 2OZPA 4P3XA 2VTBA 1RCUA 2WMNB 5JFGA 2I4OA 2NTVA 2ONCA 3BRQA 1Y7TA 5AVYA 4TMFA 3ZWMA 4KLRA 1WMBA 2Y1GA 2G9NA 4FWBA 5DNCA 4DW8A 1YU6A 1U3CA 2CDAA 2JDIA 3MJTA 5DIFA 4CEJB 1TC2A 1KJYA 2BAGA 1ND6A 4BE4A 3NHLA 5I4BA 2EJTA 2ZIFA 5J9FA 3VA7A 5JPDA 4FJ0A 1K8QA 1BMTA 2AFIE 2JAOA 3O8LA 5AM5A 5G0WA 4UOEA 1T4GA 4ZMBA 1Q0ZA 1UBJS 3UBMA 3NG1A 3I01A 3DZDA 5IFKA 4PXSA 3HKEB 4RPJA 1JFLA 2EYQA 2VTVA 3CEJA 1PJBA 2WD9A 3OLYA 4CR8A 5IDQA 5HBGA 3ZWOA 2HUNA 4Z7NB 5A6VA 4ISCA 1I2AA 1GUYA 2I33A 4RS4A 2IOFK 4WSOA 1X87A 2PZGA 4L02A 2Z5LA 3RK1A 4K9OA 1ZVJA 4FJ1A 3O7MA 3ICCA 4BCDA 5ALKA 2C7OA 4KFUA 4B3MB 1YJXA 3R4VA 4EJFA 5K0NA 3T8YA 5I7AA 2XLBA 3OD5A 4CMAA 4DZZA 3VJKA 1JJBA 1XLUA 2OZVA 3IELA 4YRDA 5DHFA 5ITVA 5KNBA 3K6RA 3KQUA 4RDIA 4C01A 2BEVB 2XMGA 3OU7A 4JY7A 4AKTA 4IXMA 3WJ7A 2NP7A 4KH1A 3RIXA 2AZTA 3BT7A 2N1MA 3B8EA 5HMLA 4L3WA 2IXDA 2QYSA 3C3PA 3G0GA 3USZA 3FOEC 3VO1A 4KNYA 1BCSB 3SVZA 5E4TA 3AJAA 3BZWA 2HT1A 1AKNA 5LQRA 4EHKA 3FHOA 4ENPA 2R4TA 1I7LA 3BFJA 4G1VA 6PFKA 2NTEA 3UKJA 1GTZA 4BVJA 1XIVA 3ME5A 1RADA 5EMLA 5EEHA 3V42A 4L07A 1TFRA 4MUKA 3GEGA 1FNDA 1Z5ZA 3RHTA 4QBIA 1L4LA 2HK8A 3MUFA 1G20B 1Q0SA 1V2GA 4ZZ2A 3V8NA 1MAUA 1TYEB 2IYOA 3VOAA 2DFVA 1WR8A 1I7DA 4P22A 4RM3A 4CNQA 1D6JA 1T35A 2DHCA 3SXJA 1IUOA 2ZUDA 1QRTA 4KPYA 1KOGA 3HXTA 1Y9JA 3BSWA 3HYTA 3QXCA 1GPBA 2NZYA 2PIDA 2ORWA 3CTMA 1OFTA 1Z0DA 1P9RA 2O7RA 2ODAA 1ZKDA 1Q0HA 4MS3A 4QLAA 1PQUA 3WICA 2JGMA 2MR6A 3A0RB 2ANBA 4KQHA 4ERXA 2TMDA 4P0TA 1LVGA 3GP3A 2PV7A 4KU4A 2VUSA 5K99A 3U6BA 4CZ2A 4EQZA 3F5DA 2WVHA 2PFSA 4TTVA 4KYTA 5J2UA 1J8FA 3DTVA 1WO8A 4QXOA 1L7EA 4XRGA 4KR3A 1A4UA 1ZHFA 4BV9A 3IXQA 1C8BA 2Z2ZA 3ZIAA 1JA0A 4DM3A 4U9HS 4DJTA 5I6DA 2D2XA 3RG2A 1HTBA 3I3SR 4A15A 3JYLA 1NE7A 1PDOA 4K6HA 1Q1ZA 1J1ZA 1HDRA 1YK0A 2GX6A 2BHLA 2I76A 1TM4E 3Q10A 4PTLA 5H80A 2J6HA 4UJ3A 4PG4A 1O3YA 3RTEA 2HNAA 3MHPA 1Q6YA 5DM4A 1WDMA 3FETA 1NBIA 1RM3A 1M73E 2JJMA 4O5AA 2JFHA 1AUQA 2X2EA 5E0KB 1W36B 3RUIA 1BFKA 3EXG1 2QTHA 3LQFA 2GZDA 3HBFA 1NQ5A 1MJ5A 3IUNA 1B1AA 1NVEA 1U31A 3EHEA 2QW8A 1ISIA 5KYKA 3H87A 1Z47A 4MUXA 4R2JA 5EJ6A 1XZAA 2FX5A 3FZNA 3V2IA 3QY9A 2HIAA 3WE7A 4F3YA 2NAPA 3OCYA 4IO0A 3AUSA 5DSZA 1Q74A 2B8WA 1KI3A 2PANA 4IHJA 1SCIA 3M4NA 4FSXA 3ZHZA 2IIVA 2MYUA 5CVTA 2R8OA 3GIWA 1JLLB 5E2BA 4D98A 5HKOA 2KJQA 2PSFA 4N7RA 1AS3A 1HGXA 4GOMD 5LDHA 3QUQA 3ORHA 4LDJA 4JC0A 1K6JA 1LK7A 1PUXA 2J87A 4LRXA 4M54A 3QTBA 2V7QD 4Y6QA 1KIAA 3AO0B 5CLJA 4WVLA 4YMWA 4ZKDA 5HFJA 3W3AH 1D2AA 4Q1EA 4GMDA 4IHAA 3FUTA 4Y2GA 1N8SA 4NEQA 4UMFA 4BPBA 1UBEA 3AR4A 2Z3ZA 5AFSA 2WUWE 1QB7A 2X86A 5JPCA 2VZ8A 4ID9A 4ZQEA 5DX1A 3L6BA 5HR5A 1XRNA 1ZJ6A 3CVJA 3D2LA 5IF9A 3RSGA 1VA4A 2DHRA 2X7HA 3O4JA 1FU8A 3NC0C 2VDLB 4NBSA 4WECA 4YMHA 2WOOA 1O95C 2RGGA 1Z4OA 1J07A 2OQ2A 3WNZA 4F6LA 1JG2A 4R8SA 4UBKA 2GCOA 4HOYA 2ZRBA 3NV9A 4HUQA 3S2EA 2I6GA 4NENA 1KRWA 1GNRA 2OHJA 4QOGA 1WCIB 1P7ZA 1TVKA 4K40A 1OX6A 2A0FA 2AS0A 2VNAA 3VR6A 3OTGA 1SNYA 3WGTA 3QRWA 1C7IA 4BFXA 3GLIB 3VPCA 2J3DA 4ARZB 5JMOA 1AUOA 1E9EA 1OCEA 3EC2A 3KHUA 3R77A 2B61A 4ZP1A 5GGXA 1X1TA 1QWOA 3WKBA 1NTRA 5K3SA 5LOVF 3QEBZ 3DE2X 3ZDDA 5BNZA 3KALA 5JD6A 1DBSA 5K8TA 2C7VA 4H7JA 4Q9NA 3IP5A 2DULA 1M1UA 4TV8A 2DPMA 3ZNNA 4AKIA 2XB6A 2BDUA 3L5KA 3LPCA 3I6IA 3CXUA 2IYPA 5CW1A 1SQSA 3M4XA 1VPDA 2FVYA 3W9SA 4B46A 3O8CA 1H1TA 4HT3B 1USKA 3PNLA 2R8PA 4HDQB 4DCVA 4DMFA 1YVEI 4JYZA 1RHQA 2OHGA 4GX5A 2YXEA 2AEMA 1CJCA 3PQ7A 4MQFA 4XYLA 5F7JA 5KOYA 3K5HA 3SHTA 4UUNA 1ZKMA 4C6RA 3KYIB 1OT3A 3Q85A 2ZJ2A 4P86A 1YVDA 4IYJA 4ZOEA 1K2VN 4AICA 1OXUA 4AXBA 5SY4A 2DR3A 2OMEA 4ZV7A 4RESA 1KZ4A 2WPDA 1RPTA 4HEQA 4K87A 5CMLA 2O8VA 1G7RA 1V4VA 4L2IA 421PA 5AVVA 4DWWA 5JR3A 2R60A 4LHSA 2O7VA 2BFMA 4LBWA 1ZMXA 1C80A 4H3SA 4QBFA 1SXJD 1G21E 2ZRPA 1C9YA 1OFUX 3N07A 4ZI7B 5JNLA 4BLWA 3OKCA 2UVDA 1GTRA 3ZBTA 4NH4A 4EY8A 3GOHA 2C4MA 2QRVB 3M6XA 4LF5B 4G4SP 2NUPA 5IS2A 4Q19A 1ZGBA 2RH5A 2H1HA 2A14A 4Y8VA 3VHQA 2BMDA 1NKTA 1VJ1A 4HTAA 1W4AA 2B1IA 1MW8X 1J2EA 2R00A 2DVMA 3H13A 3QZUA 1Y3FE 5JIBA 5EJ5A 1H8EA 1FFDA 3O0DA 3UAGA 4B4WA 4WE3A 2ERXA 3HYRA 3NWBA 5DHSA 3V1UA 4AFNA 4ZYWA 2WJZB 3C85A 3B3JA 2VHXA 5BXYA 1HE2A 1BC5A 3WLAA 5IC4A 1Y7LA 4KWCA 4I7EA 1IIBA 3LC1O 2P9ZA 4WJLA 4G9EA 3IMCA 1PSDA 3GXBA 4M87A 1OC2A 1AGXA 5AM0A 3TZLA 1E8MA 4WK4B 4D46A 1GM5A 1WP9A 3WY9A 2QAGB 5KYTA 4I4CA 2XE4A 5IHXA 3E5HA 3E9RA 2OV1A 3EBLA 4QEZA 4DA4A 4B3GA 5IU6A 3BTUA 1MP0A 2XJ9A 4OQNA 3SZ3A 3DBRB 4CR6A 4XM1A 4N03A 3C6ZA 1C1XA 2JRLA 3OKFA 2V9CA 3KEQA 1PAUA 4NV1A 1U5BB 1U3WA 1D0SA 3G3EA 5C8DA 4CTOA 2NQ2C 4Y6LA 4BNDB 3UJNA 2FDRA 1KYTA 1ZCFA 2DU8A 1HLDA 3ABIA 1P2VA 3K8ZA 1RKVA 4GP7A 4Q66C 3SBXA 1YH3A 2Z1NA 4YMLA 2IQ5A 2WJ3A 4OJQA 5FUYA 1Z06A 4Z4GA 5B1HA 1N2XA 2QX7A 1NNSA 2OFOA 3VVBA 4YV2A 1U3TA 1I30A 2GZ2A 5K2OA 1NLMA 4YBZA 1OY1A 5B53A 4H3HB 3BTOA 3BTVA 4DT1A 2FFAA 5KWJA 1PDVA 5KTTA 1B00A 2NO1A 5ICCA 2M9MA 2P78A 2FHPA 3VU1A 2B9VA 2ZATA 3MJ4A 3CVYA 1A71A 3ZWVA 4D9KA 1Y1SA 2DPLA 2OKGA 4Z49A 3OICA 3IOMA 1JIIA 3K4QA 4C4AA 2JLAA 3V4PB 3V8MA 3JRWA 2EW2A 3DMTC 3F67A 1J9GA 1WSWA 3C3YA 2ZR8A 3OF3A 4KJXA 3RIHA 4AT1A 1AKVA 1U98A 2PQMA 2JF0A 1BEUB 2P9YA 4EB3A 4GZ6A 1WDKA 2EDCA 4RANA 1OU4A 1ISRA 4IIEA 1YQDA 1TW2A 3DMRA 1T5BA 2P7IA 2RK6A 1TQ8A 2DQZA 3F6BX 3OJCA 1OHHA 4HFMA 4MVJP 1TI7A 4ZEVA 5IFLA 1Z15A 5BQFA 2GS9A 5G02A 3Q5EA 1LX7A 3WK5A 2P0AA 1CG6A 4R5HA 1YL6A 2YYYA 5C9ZA 3PA6A 4BDSA 1KEUA 4KO2S 5D51S 2GTHA 5FBZA 2P90A 1A9XB 3GN1A 2CVPA 4JVNA 4EW3A 4KAJA 5E6RA 4A2QA 1VYHA 5JVDF 1MR3F 1KPGA 2HDNB 5JG7A 4EKYA 5JNTA 1EE1A 2CMGA 4QPDA 2VBGA 4RNDB 1KQNA 5F3WB 3AX6A 1J0XO 4D9EA 3G68A 1QZZA 1KBZA 2E6KA 4TL8A 3R7NA 4IKPA 2NLOA 2X40A 4DIBA 4G0YA 1JKIA 3MJRA 1UFKA 4MQ5A 1G2QA 3TVYA 3Q3GE 2EL9A 1JW9B 4M1ZA 2EG9A 3QYJA 1H2BA 3AG5A 1QDLB 2P4EA 2RHHA 4UE2A 3CIFA 3OZCA 5KQGA 1Y8QA 4JR0A 1QH9A 3ETJA 2IELA 4IQGA 1EDDA 4B80A 4EKEA 1MUUA 5K3BA 3GDHA 2TYSB 1Q19A 5KKAA 2ZP1A 2X8WA 1Z83A 1IQPA 4WNIA 3DR3A 4ABTA 1AXGA 1QLWA 1DVRA 3U3XA 4F9TA 2E1RA 2Q6OA 4X1IA 1IC6A 3KKMA 1N9GB 3UUGA 4D92A 1W94A 1JKJA 3PHCA 2XWBF 2PYDA 3R3WA 2EJCA 1HT1E 3EVEA 4UTVA 5AK0A 3KQPA 1EVIA 1UMCB 3C8UA 3QU2A 4EG4A 3Q8WA 2NV6A 2D2FA 5TGDA 2RGUA 4U9IS 3CX6A 2ZUUA 3ZI7A 2IBTA 1FXUA 2B78A 3ZCUA 3JY6A 4KE8A 1Z35A 1BHQ1 3AYZB 1T3HA 4EMTA 2WUFA 4CQLB 2BHSA 2JD1A 3EZ6A 3LA6A 4TSFD 3RM3A 4PG5A 1E2EA 3V9PA 4NARA 2IZ1A 3Q5GA 5ITSA 3T7RA 1WHTB 1SY7A 1CJSA 2HZ7A 2QYHA 3LHKA 5EHZA 1LBQA 2B2NA 1Z7BA 4NATA 1I5RA 4ZVLA 5LB2A 3RRYA 1XCMA 4OLJA 3SQDA 1ZI6A 3MS7A 3D1LA 3EZFA 1VM6A 1CLUA 4QQ8A 3NATA 2RHLA 2H3EA 2EEZA 3I8XA 5FPHA 3K9NA 4IWNA 1IY8A 5FFMA 1OE0A 3K2BA 5JAMA 5BW5A 4YJGA 1KQFA 3WGKA 1SVOA 1BH6A 2WC1A 2SHKA 5KC9A 2VDRB 4UMVA 5A05A 1PR0A 4AZWA 2IW1A 2C4KA 4MMXB 3WL4A 4W63A 2A78A 1GPLA 5KHOC 4NBKA 4YUWA 3ZGXA 1XZLA 2BKXA 2ECFA 2A3RA 2RHCA 3GMIA 4IFTA 3HL0A 1MLDA 4QATA 5LJIA 1MEJA 3PX3A 3U3RA 4A8HA 4CG0A 1DV2A 1K7FB 2HA7A 3EDRA 4TQGA 2BV3A 2HU2A 4E6PA 4D0SA 1TMOA 4MQLA 1NM5A 3QVSA 4BMVA 3NALA 3ITNA 2QT1A 1QX3A 4DC0A 3CSDA 1U1EA 4KFRA 5K3EA 1E9BA 3DMFA 1RRFA 1OTYA 3NFYA 3CGWA 3PTAA 2OG2A 1F2DA 3AC0A 2ZBGA 1E79A 2NSDA 2D1FA 3NDRA 3C4QA 4IDAA 4DAOA 5CBPA 5HVNA 1VLLA 3BJZA 3IALA 3QBDA 2GRUA 5B2EA 3W5CA 1W0CA 3II6X 3O91A 4IH4A 1LV7A 3FPCA 1UPTA 4FE4A 2A58A 2FFHA 1RHRA 4TKMA 3IPLA 2SECE 4JQOA 4WAUA 3VTKA 5DVZA 1EFVA 1KJ9A 4ALKA 2JGNA 2PXHA 3BC1A 3QUAA 4V03A 4AL4A 3KEMA 5HRUA 1SG6A 2EEPA 3FLBA 3H9QA 4O33A 5ECDA 5LYJF 3GGGA 5HQJA 3DFKA 4DR4B 5DBOA 3DF7A 3ENZA 5DXFA 4C4RA 3FCOA 3RRBA 1YFLA 3GRUA 4NAUA 5DBFA 2F48A 3LZ6A 4PCUA 5JNVA 1JEJA 5I7FA 1K7YA 1QCCA 3BWXA 2VL7A 3VU8A 1IL0A 1B76A 2H52A 1Z0AA 2IXFA 1OYWA 5M2QA 4ARIA 2NPOA 3EWAA 5IW8A 1SCBA 3VZDA 3GAMA 2IYVA 4QOEA 2DB3A 5EE5B 1T8SA 1MTZA 4IDNA 4QXMA 3OZVA 5FWAA 5B12A 3AY6A 4BFLA 1Y37A 1YS4A 4HEHA 3U7JA 1M0TA 1I3KA 2EQAA 2XQFA 1V1JA 1LRKA 2XTMA 2YJ3A 3BXEA 3DOHA 3G9UA 3IUJA 2QNRA 2I5PO 3RUHA 1EFRD 2UYCA 2IKQA 2FEKA 4YRAA 3EGIA 2EKPA 2QNBA 2AFHE 1IUPA 2QJRA 3BMXA 3QEKA 5D3QA 2W11A 3TL2A 3VR5D 5C7YA 2C00A 2AG1A 1QVZA 4JLWA 4LC9A 2GYVA 5THKA 3IAXA 4FX2A 2FX2A 4BASA 5BWBA 3T54A 1NVMB 3WKCA 3KU1A 1HDCA 2VS1A 3BKWA 3O4HA 3PQEA 3WDSA 8LDHA 3KD2A 1ZI9A 4HH1A 3IBGA 1U28A 5TMDA 4ZVSA 3WGQA 4OCZA 5KQLA 1EBFA 4X85A 5TB5A 3K0HA 1M10A 1MC1A 4G01B 2JLUA 2NU6A 2VPWA 2I8LA 1PR1A 2GK7A 4NOJA 4U8HA 5ESXA 1FS4A 3HVJA 4S24A 5B7PA 2RHWA 2IZZA 4HNVA 4FZRA 4IH1A 3HWWA 1RKUA 1Z2OX 3WLSA 1FRNA 5TEVA 1H94A 1T29A 2QZZA 1S4QA 2NW6A 3CRMA 4YRRA 4Q3OA 3VGPA 4P92A 2D7DA 1R0YA 2XI4A 2ZRCA 3QE3A 5JZVA 4I6EA 2CY0A 1QHHB 4O1HA 4Z4IA 5F12A 3RU2A 2QTGA 4I9FA 1U2PA 1PR4A 4QFCA 5FLXA 2QTVA 2X8LA 3P4UA 4XR9A 4M3NA 3KVVA 5FCDA 1C3XA 3U6KA 1VLMA 1DZIA 3WRXC 3D7RA 3HU5A 2WHEA 1TYZA 3C5WP 4MV9A 2PS0A 4BTVA 2KBFA 2GN6A 1Z4IA 4S35A 2PL5A 3DKVA 1UDXA 3K9WA 3KS9A 4G0OA 4M1YA 5CIWA 1ZQ9A 3DBIA 3V9AA 3EMVA 2RONA 3GGOA 5ECGC 4KP7A 3CW2A 1SM4A 1QMGA 1ECBA 1X7XB 2EIXA 1W5SA 3A25A 3OU2A 4A82A 7ABPA 4F91B 3CR3C 1BWSA 1X19A 1CUFA 1BXZA 3QK7A 4FP9A 4M76B 2OBNA 4TSRA 3NONA 1ZNZA 2NXWA 1ZSVA 4JJZA 3R1IA 3MINA 1C0KA 1MQAA 2QZ9A 5CFRA 1PJSA 3F90A 4RJIA 3ES9A 5CHYA 5GJBA 3RDPA 3P0FA 1VBFA 3TQCA 2QMZA 2WE7A 2PRJA 4JZYA 1CUUA 2W4MA 1P1BA 2OWDA 3TIIA 2WICA 1T1RA 4A2CA 1DWQA 4Q7JB 3N58A 1U8TA 1P6XA 1QIMA 5JD4A 2DEUA 2H57A 4ZVKA 2PNJA 4ZZIA 1OD6A 1HL7A 2XUJA 5J47A 2Z0MA 1Q22A 2GKOA 1WAMA 3FVWA 4KRXA 1RLOA 4PX3A 1K8XB 2VP0A 3RVLA 2YV2A 2JGEA 2AE2A 1VE3A 4KFSA 2C9ZA 3NJ4A 1B1CA 4M1TA 7REQA 2PK3A 3RSLA 5JDCA 3AINA 3ND8A 1ZD5A 4GL2A 1BVYF 2CHEA 1JXAA 2HF9A 3D6AA 4G5SA 1JDSA 3N2LA 3LUDA 3U4IA 2FPWA 2YY6A 5EZYB 5A7HA 3NIFB 4QZVA 2NIPA 2BUAA 3EC7A 3S1SA 3JD4A 1IXRC 2OFWA 1T5OA 1SD5A 3OMWA 4LNUA 4KQJA 1EK2A 4JP3A 4JI1B 3VKUA 3RT7A 1H4QA 3U3ZA 3K70B 4IIFA 1LJLA 4GPAA 4RTJA 1ZD9A 2EFGA 1BZYA 4Q0MA 1VL1A 3KO8A 5CFZA 3PXAA 3PGJA 4UC0A 5FBWB 4YMVA 1XAHA 4WZAE 1VJ5A 2BFBB 3RROA 1PX2A 3BA6A 3TD9A 1LKZA 3TLJA 3TW4A 3VSAA 1F0KA 1VIDA 4M8KA 2EW8A 3RNOA 5LDDC 3F2VA 4Z8YA 3CPHA 3H97A 4PWYA 1XTIA 2R1TB 3OFSA 1Q15A 4K2HA 4Y9SA 3ROXA 4IIUA 3RYHA 5CPBA 5CIQA 4GBMA 4UKDA 1RQNA 1B2LA 2L42A 1UWVA 3EF3A 4I50B 4CT0A 1AZSC 4BO8A 4HLUC 3GD7A 3PJGA 3DV2A 1WMDA 2QSUA 3KXKA 3ZLTA 2WAYA 2YXDA 2ICAA 1NSYA 3G1TA 5DTEA 5EP2A 2QN3A 4ESHA 4KR7A 3TBFA 4MUFA 4QNMA 1OAAA 1GAWA 1C4XA 1L5RA 4MLPA 1E18A 3EOZA 3BAFA 1J5XA 1ML3A 5AI5A 3BBLA 1N6HA 3LKZA 1DQYA 1VCMA 2VJMB 4XIFA 5IBRA 2UYHA 3BE8A 4A5SA 1CIJA 3JAWB 4M49A 3E1SA 3QYAA 3RJTA 5LP6F 1MAVA 1NNUA 2FMFA 2PH5A 2XVZA 1JDPA 4OXIA 3R4CA 5JHGB 3K5PA 1YONA 1UC8A 4PN7A 1DQZA 2V74B 1ZR2A 1FQWA 3W9UA 1YFZA 2W2KA 1QRDA 4LMAA 3AVTA 2B4QA 2I6UA 3INTA 1S0UA 1VE9A 2QAGC 3DEJA 4MOWA 5HKKD 1ZUWA 3H99A 1JNYA 2YRFA 2ZUCA 4RF5A 3U49A 4GQAA 3FSGA 4CM8B 4YBRA 1Y1RA 1RYDA 5FUVA 2JZCA 2ZI9A 2XHEA 1ZG3A 3UENA 1W2WB 4B6FA 3ZV7A 5G4KA 4E30A 4LJ9A 4NJEA 5FWXB 1LDMA 1R6XA 4R54A 3G5AA 1Z29A 1H2EA 3JASB 1Z5UA 4A1OA 4F06A 5DLYA 3U7EB 2FG5A 1CE8B 3ISTA 1TOAA 4UBLA 1TADA 3I58A 4G5OA 5E7MA 5B58T 3UFXB 3SX4A 2PBFA 1O1YA 3R5KA 5BN3A 2M98A 3F4BA 2FFBA 3F8WA 4U6NA 4A0SA 1HMYA 1ZJWA 4GXTA 1BAPA 4KN9S 4KODA 3AL2A 3GH1A 8AT1A 3NPAA 5A4IS 4C89A 3FFTA 4US2R 5JNRA 4RZHA 2RI0A 3HQ4O 3N8IA 3LHFA 1Z4PX 4KDEA 1UH5A 1W88B 3D5EA 3CUVA 3PT5A 3VNSA 4V0RA 2C8VA 2EJBA 2VDWA 1BX1A 2VP6A 4JLNA 4R8KA 4Y9UA 3COZA 1JH9A 3UK2A 1LPMA 1WXXA 2IODA 2VTBB 1SBYA 3SZGA 5I48A 1B3BA 1KYXA 5A4MS 2ON6A 5KTOA 2FF7A 3OJEA 4GE0A 1X2EA 3LUPA 3G2LA 3MPOA 2ZSBA 2H2GA 4RD6A 2A0YA 1R8SA 3UQZA 3KUDA 4G0QA 2WU0A 1Y98A 3PHGA 3CZRA 2AJBA 3PF8A 4AC9A 1XFDA 1MOZA 2VNHA 3CY6A 3NBQA 2BM1A 2WIKA 3IVMA 4EENA 3CISA 1D5CA 1XQVA 4EG1A 3FCEA 3MTGA 4MA5A 3EG5A 1W2HA 4L0DA 1GCAA 1U2GC 4ZMSA 3GZJA 1EB9A 2ZRQA 1P4JA 4JT2A 3IPRA 1CUDA 4D4GA 4TTIA 3L49A 3VAAA 4JI7B 5HF8A 2YXBA 1UXOA 2SBTA 4QTZA 2VUTA 2W00A 1NMZA 1KTIA 1RXSA 3OI7A 2HJGA 3B53X 4R7GA 3KCNA 4AJOA 4BGVA 4DSOA 1QV6A 2C9YA 3TE6A 3G0CA 2KX7A 3ROPA 3THSA 2OAGA 2WRZA 4IQ8A 2EBUA 4HGNA 4OL0A 1T24A 3NBFA 4PAMA 2QTTA 3LCRA 4C0LA 1JNXX 2IPXA 4MWGA 4RZUA 3EBPA 3GLSA 4EG3A 3M3PA 4KCGA 4G24A 2WU8A 1JDBB 4EJ2A 4FD2A 2EU8A 1K7XB 2A5GA 3ZU5A 2ST1A 1VKOA 3QW4B 1SZPA 3KSUA 1EWQA 5ADWA 3LFHA 1XL0A 4DLKA 1XMJA 4FC7A 4IKEA 3ZWAA 1Z8FA 3KRTA 4QA9A 4DMUB 3E3LA 2VHJA 1PWZA 2H5JA 4FYKA 1E2PA 3VKGA 3NQ41 4NU6A 4HF7A 4OAQA 2I4NA 5IAGA 4Q5IA 3ZG6A 1DZ3A 2C03A 5EKTA 3GEPA 5GZ3A 3BHIA 2DQ4A 1T5TA 2YTZA 1GT91 3AJ8A 3P0EA 2KW5A 5B3JC 3S81A 4OHPA 1TZCA 2GJKA 2ZIEA 3LUHA 3MCVA 3F74A 5MN5A 2VHWA 4XWGA 3OPQA 1KO8A 2JBAA 4FPXA 3SQXA 3AU8A 3DVRX 1TEZA 1S8FA 3BZUA 1M2EA 5HE8A 1SULA 3CZCA 4L08A 2WSLA 2FEOA 2HU5A 3AWDA 1HDZA 1NASA 1X15A 3GDFA 3OFVA 5HK8A 4DEVA 4DPMA 4EB0A 2Z3VA 4W99A 1BHO1 4GMXA 4BP8A 4PBSA 2WE8A 3TLZA 2WT4A 3A10A 1RYMA 1M5UA 3Q9LA 2BGLA 4N5MA 1K5HA 3UOAB 3R41A 4MS3B 2GBIA 3W06A 2VDMB 4FOLA 4FLEA 3AY7A 2JJ2A 1V8PA 1YBAA 2X4LA 3OWXA 3SFZA 2HA5A 4EA6A 2PLFA 2R79A 3Q2IA 3GJ3A 4MROA 2XT9A 3IO5A 4J0FA 2RI1A 1HC7A 4IX9A 4LRTB 1L5VA 3TTYA 4DIMA 1JI3A 1BQ3A 3F1KA 5J2UB 4MHTA 4F6RA 5KJEA 2R6HA 3DTVB 2PUCA 1M8JA 3HR8A 3M3HA 4HS4A 2X0DA 1E9SA 3TUIC 3FZEA 3TKAA 5LQKA 2CMHA 2J08A 1UBTS 2XKBA 2P4HX 3AIMA 4KITB 1Q7EA 2C5FA 3M2PA 2R1ZA 4CI9A 3GFBA 1W8IA 2ZB3A 1A9RA 4LYGA 3V8EA 1U0LA 2GLTA 4HNAA 3QE9Y 3QY0A 1XNGA 2X9QA 4RXTA 4XWKA 2Z30A 2JJYA 1M0SA 1P5FA 1JPVA 2O5VA 2FSPA 3A2NA 3OFJA 4L8WB 4NTZA 1QPGA 2I0FA 4GKVA 3HSSA 4KG7A 3LBAA 2PJRA 3VH4A 1FUEA 3OAAA 3BQMB 4DKJA 1JE0A 2R8RA 3DZGA 4K9DA 3T38A 4BUZA 4P93A 5BV7A 4DCUA 1OAOC 2BBWA 1YFKA 1Z6QA 2GLUA 2HCFA 3JPYA 4O08A 4LYYA 4PZPA 1XK6A 2Q3CA 3W2HA 5EIAA 4EFMA 4TWAA 4D9BA 4LEIA 3LL4A 3LPLA 4ZU3A 4DMHA 4HQKA 2PMDA 4EHHA 1WTAA 5AHWA 3FOFC 4UBNA 1BJTA 3OZWA 3H1TA 4IHJB 2VSOA 4LGMA 4DLTA 2E85A 1TAHA 3DMNA 3R5JA 3ZJYA 3V48A 5KIAA 3DW1X 3IQZA 3FCAA 4FHZA 2D62A 5DV9A 1O9GA 1X9IA 3IR6A 4RK5A 4YJFA 3TXAA 3V97A 2B4TO 3VUFA 3ABSB 3CG0A 4XTCS 5IJAA 3VTFA 1VPLA 3IDFA 3WWCA 2ZR0A 3ZCSA 1A97A 1SC4A 1NUAA 4IINA 2JGRA 2WWRA 3LX4A 3QJGA 4KACA 4QPNA 3IUEA 1SU6A 2J3QA 3W34A 5I9SA 1E6KA 1UJ2A 4AUMA 2PGIA 3FWNA 4AM8A 4CTNA 1KE2A 4C7VA 2YZMA 4JU9A 3UWSA 3K4PA 2ZJFA 4BP1A 1USUA 2O57A 3EDOA 4PF1A 1IRIA 4HG2A 2R85A 2GPBA 3LC0A 5CB8A 5JZSA 2P3SA 2P9BA 1U8FO 4J0EA 1NPDA 4YMTA 1ISMA 1XA0A 2ZSDA 3VZPA 2HGZA 5CVVA 3MCWA 2ZSAA 1CKEA 2QRGA 1O08A 5FA5A 3A28A 3RRFA 5LUAA 1P9OA 2XW6A 2HHAA 2J3IA 1T25A 2ADFA 4ITRC 4WKOA 4GOLD 5JH7F 5JYCA 1H66A 2GCOB 3I83A 3MBIA 4HUQB 4NFHA 1DFIA 1JDJA 4NENB 3QG5A 4OQEA 1SZDA 4YLEA 2HEIA 2R65A 2VFAA 1TVKB 1PKXA 1I7QB 2AJCA 5A04A 2ZWPA 2YOGA 2CK3D 1DHTA 1YB4A 4AZTA 3L1JA 4MW9A 2RH8A 5FUBA 3NGMA 1L7XA 1FYFA 1LQ2A 1Q14A 1VRWA 1M7HA 2GK4A 2VF7A 4UZSA 3AETA 5IDVA 5IVIA 4PYJA 2X1MA 5LWHA 4LQLA 4Q00A 4RAQA 4B3DA 4BBPA 3GJ7A 4TV8B 4IOLA 5ES3A 1SHKA 2PKEA 1KR5A 3EZGA 1QM5A 3H2BA 4XZ3A 1DWUA 3VBEA 4WXMA 4Q4DA 4B6QA 4PN3A 1G59A 2W2XA 1CETA 1VHWA 1PBNA 1MAAA 2JZNA 3ELWA 4C03A 1L3IA 4YAEA 1P0QA 4KKVA 4R51A 2H17A 1N34B 5DJ5A 4W5RA 1JEDA 4X91A 4MQFB 2EZ4A 2FCAA 4AJ2A 5EE0A 4DLAA 2Z57A 4YP9A 3C6XA 3KQHA 1QAMA 3D6FA 3FI9A 4CKXA 4ZO6A 3ER8A 4EHBA 3PWKA 4Y6PA 3AVQA 4AULA 4BTEA 5IDYA 2AFRA 2L19A 3R6DA 4OBEA 3EVTA 4D3SA 4OA5A 4BX3A 1DB3A 3CUYA 3BL6A 3GJ4A 1NG1A 1FQOA 1FJHA 4L2IB 3WO0A 1E3MA 1MOSA 2IGTA 2VYVA 3STWA 3IXMA 4KQ6A 4MVJF 3IT3A 4B4OA 4CG2A 2ZCVA 4DV1B 1CUWA 2Y2UA 4N9QA 4DIKA 4LFAB 2KYRA 4NX2A 4P35A 1U2SA 1QRUA 1VE7A 5IKXA 2YQZA 4DLLA 3TTXA 1FLNA 5C8YF 2NUPB 2ZIXA 3OEED 1GCUA 1YJQA 2QM3A 3OSZA 4I66A 3ADPA 2C5LA 3FI0A 3GAAA 4YGYA 1HLGA 1MFPA 1JB9A 3ICWA 4WBXC 5ENVA 4YQFA 2C98A 3FNHA 3GL9A 2C92A 3VV2A 1KDOA 2FSUA 5TS3A 1OI2A 4J7CA 4B2LA 4UNIA 4ESEA 1SBZA 4D9GA 2WU3A 2HYIC 3VJLA 3ADKA 2IU6A 5BT8A 3HG7A 4YP1A 3EXHA 1PFKA 2WJAA 3B89A 3OZRA 5TQ0A 6Q21A 5T57A 5EMMA 4D3DA 1PP4A 4MTCA 1BXKA 1YB2A 4JN6B 5KAPA 1UBFA 2IYSA 2TMKA 4BWFB 3TOZA 3WK7A 5C32A 1U4NA 3TUZC 4D81A 1OMOA 1G4HA 4V38A 1XG5A 2ZPTX 3T9FA 3V2HA 3GLFE 3EVCA 1NWHA 3WYGA 5DX8A 4WQMA 3Q0IA 4Y6OA 4Q7QA 1Z56C 1K3FA 4ERNA 5ALPA 2FFJA 2IEAA 1JYFA 3LY8A 2BM0A 1C1XB 1RYNA 2R25B 3MOGA 4LZLA 5LUBA 4K26A 1L5SA 3EZXA 2FR0A 1VYTA 2Q3DA 5CJJA 3VOTA 4MUJA 4F1WA 1C8LA 2P1ZA 1X1RA 4EB8A 4EY3A 5TSDA 1Q0PA 1KQ3A 4HRAA 4RNCA 3GRVA 4YP0A 5G41A 3RBVA 2FJUA 3S3TA 4DA8A 1PWHA 5A9SA 3ET4A 1E1CA 3HCRA 4X63A 3OKPA 3X1YA 2IIBA 1LGYA 1HO3A 1XGKA 3GDOA 4WZ6A 3A4NA 4EVQA 5BN4A 4DT1B 1BTOA 3SC4A 1K8YB 2REBA 2ZRNA 3OUZA 5A71A 4E5KA 2V4UA 2ROQA 4QHYA 2V4MA 2Z8ZA 2LDBA 3IHWA 2C9BA 4N7BA 3QLUC 1VSTA 3G6KA 3IEMA 3C6KA 1JGTA 1N5LA 4PPNA 2R0QC 4Z7QB 3OZBA 4KSCA 1GP2A 1GV1A 4MUNA 3WKAA 2H0AA 4QM7A 5AOVA 1ZZGA 2G0TA 2OLKA 2GT1A 5BWNA 1KFCB 2HF7A 1E1DA 2VBIA 3NXSA 3G7SA 4N7MA 4P34A 3FBTA 1H2RS 4RF2A 2R4QA 4UOQA 5CEJA 1VLVA 4HB2A 1DKLA 1QF9A 1V96A 2VAPA 1GEEA 3MJDA 2W58A 3C39A 4LXYA 2IZ5A 3NHYA 3OQJA 1J0CA 4JVMA 2HIMA 3MB8A 4RLQA 1YASA 2WJIA 3PJDA 3OECA 1RYHA 3O0TA 4G0UA 2G3YA 4US1R 4W8HA 5E6RB 4X66B 4K3VA 2ZT8A 2GD1O 2OV6A 4C87A 1FRVA 2J7PA 2IS1A 1QFMA 2IY9A 2FEWB 1IHDA 2NZUG 3BCUA 2YXLA 4J03A 3ZDCA 2DHDA 4TTPA 5IAEA 2VXOA 4MVJI 5MGBA 2HPHA 1YS2X 1IY9A 1INLA 2FOLA 2JJ1A 3FFXA 5IUKC 3V1TC 1KS2A 2JBWA 3ACDA 2APJA 4WXYB 4BTLA 5CG2A 1IONA 1E4OA 3HNPA 4G0VA 1MKYA 1V41E 2CXPA 3M70A 1M1NA 2DGDA 4GC9A 1R9MA 2GYWA 1SUBA 3BOSA 5JU6A 1SCNE 3ZH9B 3JQ7A 4XOIA 5EOVA 1XEFA 4CQNA 1Y8QB 4HLQB 1NVUQ 1SUSA 2ZRKA 2Y66A 1NY6A 1X13A 2QVYX 1WXQA 5DE3A 5LMNB 3N3AC 1URPA 3UUEA 5TPZD 4X1IB 4FYHA 4QUDA 1JKJB 1ZH4A 3ZHTA 4UMEA 2VPTA 5CNIA 4FFOA 3PZBA 2DFLA 1SXJA 3FJ1A 4YCDA 4IS2A 4F85A 1GLNA 4LJAA 2P5YA 4UNQA 1VL0A 3RB8A 1GU0A 2DXIA 2BR3A 2YV3A 3GZNA 1U1GA 2NO4A 3IAUA 4OXKA 3ZCRA 3ED5A 2N47A 3ADCA 3JQAD 4FFSA 1YRWA 3MTEA 1MH1A 3FUXA 3DQZA 4FLMA 4CKBA 1QQ6A 1EMDA 2C54A 2NVUA 2CDCA 4TYNA 1P2SA 5JC8A 2G7ZA 5LMCA 4FLFA 3BCRA 1JT2A 1HXHA 4TYPA 3MT7A 4DIUA 3V34A 1EP9A 4QSMA 4DANA 3S5UA 3NKFA 3WIBA 2IITA 4Q3NA 4HVTA 1F6WA 2PZ8A 2C2ZA 2AV6A 4FCWA 2HH9A 4QULA 3R7LA 3BSFA 3VR2A 2I4IA 4YJGB 1ZXXA 1DAKA 1IBSA 1EEXB 1XR3A 2JASA 3QEMA 5LA6F 3PC8A 3V4LA 1RZRA 3DHVA 2E0IA 2V7UA 4A7PA 4MS4A 2HXGA 4X44A 4JI0B 8ATCA 4Q3BA 3QTTA 4KDRA 3WZ2A 2R96A 4KL8S 4D42A 4PHHA 2A9FA 5B37A 2BF7A 2FETA 3DLHA 2JH8A 4XW2A 4B3CA 1QGZA 1FVHA 2J07A 4AQDA 5L40A 3R6LA 3E2MA 3VHXA 3W8DA 3QPUA 3S2GA 1VI6A 5CH8A 1JLRA 3PQ8A 5JATA 1LPBB 2OCBA 3HNOA 4IQ0A 4O4HF 1JDBC 1T0JB 5FHRA 5HG0A 3SM9A 5AYVA 3IUPA 4JGGA 1CTQA 1X9HA 4JLSA 3S40A 1CEXA 2FWAA 4Q47A 3WGVA 2BCJQ 2G17A 3OOJA 3FH0A 3K8YA 1V7QA 3KZKA 4YLGA 3ZDQA 2JKVA 5AIAA 5LQSA 5CBPB 4GR5A 2WJJA 1D07A 1CJBA 3EEFA 3IILA 4TROA 4X90A 1A82A 1RRMA 3DC2A 1KAGA 2VAXA 2YR0A 3OQPA 3UAVA 4KXVA 3PCTA 3K31A 4I4TA 4EHJA 3DOUA 3O95A 2J45A 3ICEA 3S29A 2IYWA 3T0GA 1XU7A 1QIGA 4J2OA 1EFVB 4CEIA 4B2PA 1CHNA 4X60A 1CJUC 1NONA 1XWWA 5EE1A 1X1QA 4OY3A 4Z53A 1R3DA 1IULA 1LTQA 5AJWA 5CDHA 4E88A 2YFQA 3RW9A 4ARUA 2PH3A 1Z0KA 4MLDA 1C3JA 2GASA 2JI8A 2FWIA 2BR4A 3KJQA 3SFVA 1I7SB 1QYIA 2WIBA 1Z22A 3WHIA 1Z26A 1PQPA 1X1DA 2DFDA 4UBIA 4WLFA 5CFNA 5KOIA 3TNLA 3P9XA 3B9RA 3BE5A 3WB1A 4PLYA 4H4DA 1XD8A 3FCCA 2ALJA 2GHIA 4NYJR 3PDHA 4CLEA 4OVKA 4KEAA 4H08A 2E82A 5TC4A 3ZXIA 3ZHYA 4EGQA 5E3JA 2Q8PA 1ULTA 3VH2A 4DSZA 5A7FA 3UGKA 1N8KA 5D5QA 2IEBA 3FPJA 2Q8QA 3NTUA 5AKXA 1DEOA 5GVSA 3A9TA 4MVJA 3UW3A 3C3AA 1JMKC 1A88A 1SKYB 1UDRA 3VYTB 5BURA 4RLSA 4PHCA 2P2CA 5SY9A 3RYCA 2NNLD 2YZNA 5EC8A 2GCPA 1TZ2A 3R0VA 3S7ZA 4WACA 3H84A 4TQ9A 4OP1A 3T12A 3KEGA 4YJ3F 3ZOZA 1E2QA 1RD4A 4WFQA 3BIFA 1EG7A 5KPDA 3HM9A 1J9ZA 1FFAA 2RHMA 2PBZA 4HAOA 1DQNA 1O9HA 2V6MA 4HDCA 5M3BA 3AZPA 3TF5A 1MB0A 2NU6B 3VH1A 3GA0A 1CQIA 1BEZA 4U0KA 2D4AA 3CVXA 1M6EX 1Z0FA 4Z54A 1OI4A 1ZUIA 2XUIA 5JCJD 3HDVA 2C3UA 2EJWA 2ZBVA 4ZAYA 1BNCA 2ID4A 2OCKA 4ZOLA 5K3CA 5L45A 3BWYA 2CKDA 1UUFA 1YQ9A 3F5SA 1NFQA 1QQ5A 1XWFA 2OGZA 2WM3A 3ON5A 1L8QA 4M7PA 4MKFA 1M2FA 2OB1A 3F6PA 4ZGBA 2EERA 4U2CA 1XQWA 3LDHA 1VECA 5DW0A 3W1EA 3K05A 1GQ2A 3TN7A 2HGSA 2X9VA 3B85A 4Q9KA 2PVPA 4B3FX 1NGSA 5CK4A 4XEUA 2QTVB 4ARAA 1DKQA 1ZGGA 2O1XA 2C2KA 3D6HA 4OG2A 5FNZA 1KJJA 3R8XA 3ZGVA 3RO7A 1UDAA 2Q3HA 1VTKA 2VJBA 4EX6A 4A26A 3COWA 3L8DA 3E7WA 4TSFA 2HREA 3VQTA 3EPLA 2KM1A 2H31A 2XOKD 4IEEA 4OGWA 3MIIA 3EGCA 2ZYWX 4UM8B 2C61A 4HDNA 2GPTA 4R83A 4XARA 2C8LA 4RJTA 2BGRA 4WA8A 3D7SA 4CM5A 3DT8A 1F06A 3B9BA 1ZUNA 1RMTA 2AN9A 1C7EA 2BY4A 4R1PA 3O8BA 4BDTA 4CMCA 4DIOA 3G0BA 4QDTA 2FWPA 4CT5A 1MTOA 4L72A 3KOMA 1JEEA 4RIFA 1NUUA 3EUWA 2YZGA 3CLTD 1P4RA 3FYDA 4XB6B 2O8CA 3ROTA 2K5UA 3C3BA 4M6WA 4RPGA 2AB0A 4TQAA 3F9CA 2PGDA 3GPDG 2SCUA 3ORSA 5JSYA 4DLWA 5EJ8A 2PVCA 1CERA 1M1YA 3MINB 4WFJA 1L5HA 1DAIA 3EMDA 3L1HA 3SS7X 2WWHA 3DFUA 4EGSA 3SF0A 2HSGA 1B6RA 5T8KC 3ZXUB 2IE8A 1S8NA 2HSWA 2GM3A 3WYFA 1SRQA 4D4HA 2B3TA 5DI3A 4RKWA 4OQXA 4LS3A 3HBNA 3TZBA 1U7OA 1CRQA 5CT6A 1NUPA 2IH5A 2WR8A 3MF4A 3E2PA 3WGYA 2WKRA 4GPZA 1KS9A 3W4IA 4X8LA 4L22A 2KSQA 5EJ4A 2W43A 2JHPA 3OCCA 4UHCA 1LI5A 3WRYA 2EWMA 5AI6A 2OXFA 2AFIA 4F4UA 2HBRA 2FUG6 3KVYA 2JATA 2NO9A 1L4BA 3KT8A 4G0NA 4IJ6A 1GVHA 1WG8A 4FHGA 3AUXA 4BFYA 7REQB 4JX9A 2RJOA 3L7CA 4FNOA 5AOAA 3LRPA 1J8MF 1WA5A 4KMOA 2P69A 4A1FA 2BBOA 5EIFA 3E3MA 1XMSA 4GGOA 3TSZA 3R5XA 3ZCVA 3O2QB 2LBPA 4DR3B 4HRYA 4Y2XA 1KU6A 1NN5A 2B6NA 2V9ZA 3B7WA 1L1QA 4JB3A 1EJ6A 4LNUB 1MHPA 2J3KA 4D4LA 4RTOA 5K3OA 1N5RA 1OWOA 2ABWA 2R2GA 1MF7A 2HPAA 3CLUD 3IT1A 3DNMA 3JQBA 3GNLA 4IBOA 2FZGA 3SZMA 5K0GA 1PS0A 3NTLA 4H1WA 2IYXA 2QPAA 2Z56A 3A4MA 4J4TA 4KZPA 1VQ1A 1M1ZA 2XBLA 4MRSA 1X0VA 1EUZA 3ED1A 2CJYA 2DPGA 2VK8A 1I01A 1OSNA 5DBEX 4E22A 2ZVJA 3U09A 2QAIA 2Q62A 3GO4A 1HE4A 3UMCA 1YZTA 4UEOA 3K9QO 1L7VC 3RYHB 2EFYA 3MVEA 5JZMA 1RBYA 4JKOA 3EZNA 1Z8DA 4BKPA 1BHSA 2CNBA 3SM3A 3U4DA 3P71T 3DFMA 4MHOA 3ABRB 1XYYA 2OENG 5EHNA 3KZVA 2PL3A 2ZB4A 4D3FA 1JTEA 1EFRA 2EOAA 3X2EA 4AJHA 3ECSA 3T6KA 3I2GA 3NBAA 3IOBA 2XIJA 4Z0TA 1OH8A 3MTAA 2R00C 5IAAA 1M3SA 5LP1A 2GXSA 1ZH8A 5FBRB 3SC6A 2C20A 1RLUA 3KL4A 4HZIA 3EUFA 2CYAA 1RLJA 2BKLA 2ZULA 3L0CA 4JT9A 4OKNA 4C0HA 3IHKA 3H19A 2J3MA 1KVUA 3GLVA 1S3SA 4LYEA 2ESRA 1UBHS 2ZB7A 3T5GA 4PIVA 2NU7A 5LQAA 5L51A 1B16A 4EELA 1D1SA 2W2KB 5A06A 3AUYA 3WL7A 3HMQA 1IBLB 1CRWG 3TTUA 5JXIA 3SZOA 4DXDA 2FLWA 1CRZA 5KKNB 3IHTA 4N5HX 4M36A 1QIEA 3EVZA 3HU3A 4QLBA 4CG3A 3RKUA 1LDGA 3KXIA 3AEXA 2RFLA 3N8HA 4KXFB 2IUEA 3AERA 3D0RA 4L3VA 5G4KB 5JNSA 3GARA 3I5XA 4L7QA 2C5SA 4NJEB 2HJRA 4OBBA 5ED0A 5FRDA 4W9NA 1KIMA 4GBED 2QEQA 1ZOPA 3HBMA 4LJKA 3KTFA 2QD4A 1VDMA 3I2YX 5ALLA 1QHEA 5F9MA 4U0JA 1MQ9A 3OQMA 1Z39A 3E61A 3ZWDA 2VNJA 3K0CA 3N3BC 4HUTA 2QTLA 3LWNA 4I5DA 4RY9A 5DH9A 4BN5A 5BN3B 3DLTA 4KXYA 1QU2A 5CXSA 4QGHA 5KJCA 2P35A 4H77A 1F5SA 1UC9A 2QF7A 2XUPA 3L06A 2X4IA 4IIXA 1UOEA 2QRUA 4PLFA 4AU1A 5C4MA 3UWKA 1NXSA 4H7KA 1Q12A 4NCHA 3E8MA 3INRA 4ILKA 2VQSA 2WUGA 3PD1A 2VDWB 5EIXA 4QUBA 3RE1A 3WWEA 5E3HA 2Y1LA 1Z0ZA 1Z37A 1GZ7A 1O58A 2AN4A 2IC5A 3EEIA 1ST2A 4NE9A 2M6RA 3DO6A 5JMTA 2GAFA 5EUBA 3KSAC 3CVWA 1N33B 5G0VA 1KEVA 1QGED 3BA1A 3QPWA 5KKCA 3FFBA 1OFUA 1G1MA 4D45A 1SXHA 2MWMA 1JWBB 1EM8A 1U2ZA 3CF6R 5K0FA 3UJBA 1EQAA 1DS6A 2E4XA 3VX3A 3BJIC 1P1JA 1AC5A 4R7TA 2VA8A 5BYKA 3GJZA 3JD0A 4QNRA 4ZTBA 2Q6VA 3DKRA 3DAHA 1YBMA 4FDAA 4LQDA 4E1VA 3EDCA 1OZFA 3R9IA 1UKYA 2JI4A 3U9TA 2VK1A 5JAIA 4EGAA 3ENQA 1VBKA 2AHOA 4RPKA 3ZV6A 3QIAA 1N5OX 2ZRAA 2OCPA 3LCCA 5T7BA 2EKLA 3HCAA 1O97C 3KYDA 1SQGA 4G2NA 3OIDA 1C9NA 3BDIA 4D80A 3RS9A 2DYKA 1O2DA 1X3SA 2RHRA 2W2NA 3AFGA 1U9YA 2CDBA 1S2NA 3LDAA 4WCVA 1V71A 1MRNA 3PJRA 3T1NA 3DS8A 4BJ5A 3AEZA 4Z4CA 1PZFA 1V95A 1GSOA 5JW6A 3IAM6 5EP4A 1JSCA 4GXRA 1KAEA 1PT8A 1R00A 4NZPA 3H8WA 4RKFA 3P9CA 5ECWA 4EF6A 5CEEA 5HZHA 5K0CA 1IQRA 1KC1A 1VMAA 4UNNA 3ZGNA 1IZ9A 1WXIA 4FCCA 4IO1A 3AEUA 1P73A 1ZJ5A 3CR8A 2W2QA 3N0WA 2VSYA 2CB0A 2B7LA 2YHAA 3NRJA 3AWIA 3F3YA 9MHTA 2V8BA 4TL9A 3RFXA 3KQQA 2B5WA 1YCDA 5J5CA 5TF4A 1L1FA 1SOUA 2F3SA 1Y1LA 2G9RA 3AW8A 3H2YA 3G2KA 1IBKB 5H1YA 1TF2A 1P7WA 3QMPA 4CODB 2E4WA 3DM5A 1O94A 3WWPA 3F73A 2WKSA 2X0FA 2H5EA 2MINA 3GG2A 1N3BA 3TRJA 4B40A 5IZCA 4Q9AA 4G56A 2JBAB 2Q9CA 4OQQA 3EQ6A 3O6VA 1YB5A 2F9LA 1R50A 2IU4A 5IDXA 3BERA 3PFFA 1ORTA 3TW8A 3LQQA 3O9VA 1KI1A 3D2BA 1D3AA 4IXWA 1QAQA 4MW4A 4EZEA 4X6XA 4UTPA 3FYSA 3HO1A 2PS9A 1Y4ZA 1TF7A 1X7ZA 4OQDA 4WKNA 3DJYA 3HXOA 5DLPA 1RWOA 1FDTA 2EP5A 4BO6A 3MOSA 1Z2EA 2PRYA 4IG4A 4UJ5A 4B3JA 3SQOA 1Q16A 2AX4A 4O6VA 1KDRA 5I7WA 3K0FA 1R6VA 1GWNA 3DBHA 2IYFA 1KEKA 4WUVA 4F6RB 3PUHA 1KKMA 5JWOA 2GVDC 2ZWOA 4U2DA 5A5VA 1W4ZA 1LTHR 2PPVA 4L95C 4GZLA 2BFCA 3HXQA 5HUQA 2J33A 3BRSA 1NM5C 1NT4A 1HG1A 1PUJA 1Q7GA 1NIJA 1Y48E 3KHSA 5FFNA 3MLBA 5G1PA 4HNAB 3H16A 3R8CA 4A0RA 5IJWA 2F3PA 4ND8A 4UVIA 2V7TA 3WIVA 1N3YA 3B1FA 4FFMA 2PKXA 4BAUA 2AC4A 2I99A 4RIGA 2V5AA 3CYFA 5I01A 3ANTA 2WSSD 2QU7A 1FA9A 3HCEA 2EP7A 4RLFA 3SR3A 4LY3A 2VNIA 3L8EA 1BA2A 3Q6IA 1Q7BA 1DBVO 4Q3DA 4KOEC 4HAYA 4Z2AA 1E98A 3WOHA 4W4TA 3PEFA 3C5VA 1CUBA 4KQXA 5DNDA 4MKGA 3TIXB 4DY6A 4ZCRA 3GJXC 3HKDA 5G1OA 3ZDEA 2YOHA 1Y6GA 1G60A 3HP7A 1NBME 1QFYA 1P33A 4M60A 4BQEA 4OH1A 4EECA 2XOEA 3PZRA 5BR8B 2IOQA 2RAVA 2HF2A 2HJ9A 5HIJA 1RWWA 4DRZA 2W4QA 3FLEA 1Y1PA 4LDRA 4QOSA 4CF5A 3TLYA 1UJBA 3AJRA 1Y6QA 3M89A 1R8JA 3I34X 2LNDA 2WF7A 1V6CA 4O2LA 1DAEA 2XYRA 5JUWA 1DIHA 2JAHA 3P19A 2DQKA 3CEAA 4NZZA 4YJFB 1E9AA 1E7RA 3RHSA 2VTKA 5CLFA 3WLNA 3GOQA 5DFAA 4QIHA 9LDTA 5HRAA 4UE3S 1Q91A 4V3BA 4EUSA 2XNKA 1Z88A 3B9PA 1V0JA 3NGXA 5WRFA 2X6TA 1IZZA 3FF1A 3LD9A 2GCEA 2H16A 4DBLE 3Q8LA 3DBLA 1ZDMA 2QJWA 1CEEA 4RVDA 2YDXA 2B0CA 3MJCA 3PDCA 5JANA 1NDQA 3GQBA 1D9XA 3NASA 1UQRA 1QIHA 4C4YA 4NQZA 1GNQA 5F33A 4DG5A 1E89A 4TLAA 4QJ5A 4OSOA 4P54A 3P27A 3HUUA 1RVDA 4RY2A 4WLUA 2XKKA 4XX1A 3UHFA 1ZC3A 2WHPA 3A1UA 5IK2D 2D13A 2QMQA 4PW0A 3V3KA 1A04A 1GL6A 2IXEA 3PE3A 3QBJA 1C2TA 2Y71A 1ZINA 1U28C 1WULS 3EFBA 3MJVA 3VPSA 1KEEA 3AFOA 5DTQA 4FUTA 3A04A 4BWYA 1KMQA 1KJWA 1S7CA 2DX7A 2F1JA 3ETNA 1CZLA 4B6GA 2DH6A 3KQTA 4ALJA 2YWBA 2FK8A 3A31A 1XLTA 3HV2A 2DAPA 4BN0A 5K3AA 2OGSA 3ZJVA 2WINI 1CEQA 4QSHA 3X44A 4DRXA 1G8YA 3AETB 1M34E 2YYZA 4HCJA 4ZJPA 3EASA 4TWZA 4ZVTA 4YI3A 4MYSA 2Y0DA 3WLFA 1V3QE 2B94A 1BYUA 4O1MA 1XP5A 1CUVA 3WXBA 4AS1A 3IPXA 1BS9A 4FK8A 4KVGA 3NBMA 5FTMA 1GYPA 2RBGA 3IQHX 4KLCA 2ZE6A 4Q48A 4A73A 2FPLA 4AJNA 5E9QA 3I09A 1J90A 3ZW9A 2QI9C 1GTVA 2XUZA 1TA4A 2J32A 3JQDA 3T7JA 2G5CA 1WB5A 2BFEA 3GBVA 3O4IA 4QC2A 1BKSB 3L1UA 4II3A 5CLIA 3G7NA 2FGJA 3BMCA 3GRAA 5JZ9A 4C06A 1IB6A 1QC5A 3NOOA 4RD4A 5LBUA 1I5OA 2I2AA 2HF8A 1BWRA 2PGJA 4DLRA 3JR7A 3ASUA 5EZ6B 2FR8C 3DBVO 1K8ZB 2NVBA 1SVSA 5AW4A 3CX8A 1IQUA 4P80A 3AR6A 5H3LA 1YO6A 2JGFA 4IUYA 4OXXA 2Q2VA 3QMMA 1Z6AA 1U94A 2PX2A 3WA7A 2IOYA 3WMFA 1NOKA 4O4IF 4CIXA 3U7FB 4M9SA 1BSVA 4JWTA 4F3TA 2WILA 3UAXA 5KNDH 1ZQ1A 2IUSA 3UB2A 5EE9A 1K9VF 1V6AA 2B34A 5ILQA 3I6QA 2ZIXB 3C45A 5FI1B 4PZZA 1WLSA 2QN6A 4MX8A 4K3UA 3WNDA 5E9AA 4NFLA 4X8HA 3RS7A 3JQGA 3TZKA 4FYJA 4ZTZB 1GN9A 4N6OA 5DM60 2SICE 1B8VA 1U80A 3UAWA 3MS2A 2MMGA 1GO2A 2XWSA 1DMRA 4HLCA 4MDHA 3P2MA 4QOHA 1Y6ZA 4ZDKA 4DMLA 2G71A 4BNXA 3U7GA 1SVKA 2JHGA 1DTWA 3EXHB 2VSXA 4EF5A 2EHJA 2GZSA 5JALA 1ATIA 3AEQA 4KXMA 1L7AA 1N6LA 3EH2A 1PNOA 4QXRA 5F76A 3MT8A 3NXKA 5JDCC 5J40A 1L5NA 4RMNA 3RUFA 1WDLA 1FRFS 1ZD4A 4OXYA 3TZEA 5AVZA 4DV2B 4IIJA 1YRBA 4U7GA 4UHKA 5IT4A 1H93A 3HUTA 5L8VA 3BHJA 3HVRA 3L8GA 1PR9A 3L77A 2VPXA 3DKKA 3E58A 4MEAA 1TECE 1LA2A 2FEAA 4TM8A 5U1PA 1G6OA 4EY6A 5JC1A 1RWNA 1UL1X 2ODBA 4ZU1X 4WOCA 1PEYA 1FTSA 4FFRA 5FX2A 3Q3EA 1L3CA 3AJ9A 4MW7A 1VJCA 2ZROA 4N9WA 3L6DA 3B1XA 3MGBA 4M9ZA 3ADBA 2H4HA 1G3QA 1PEAA 2SNIE 4GOXA 4Z3DA 5A9SB 1NT2A 7YASA 1BHJA 1E1CB 1AO3A 1U8AA 2ONZA 2GNPA 2WDZA 3LLCA 3VR5H 2WIDA 2GAAA 1Y1TA 5KHAA 1V1RA 1M2VA 1MO3A 2ZJYA 4P2GA 5BN4B 3B6ZA 5AM3A 4JL8A 3LQYA 1A4RA 1JFRA 3UMMA 1TGYA 5I3ZA 3L84A 3O83A 1TLLA 1I6LA 1SQ0A 2LV8A 1ZEMA 2XQGA 4MTLA 3RVRA 4BP9A 1RQ2A 1IZ0A 3IBSA 3OZ7A 3D6TB 2NSJA 3FDFA 4AAYA 2IWRA 4HV4A 1MX3A 2IPAB 4M89A 2X58A 4OXQA 3SJCA 3HZZA 3DG9A 4BNMA 2XCSB 4N76A 3HJGA 3IBFA 1E2MA 2XUHA 4EBBA 1VXOA 5CVJA 3HO8A 1PHRA 1E5QA 4G5XA 1IM2A 2AC2A 3DLAA 1JG4A 4U7JA 4R0VA 1BMFD 1PEKE 3GYBA 2RGBA 4D4MA 1JIXA 1VYVA 3SSNA 3F98A 4K9NA 4EPWA 4EHIA 1ADFA 1WD7A 4O63O 3QFHA 2ECKA 5REQA 1M72A 2FK7A 1P7CA 4I9UA 1Z5VA 1Z63A 1J2UA 2OO5A 2RJ3A 4Y67A 2X2PA 5EY5B 5JE8A 3RNLA 4BN4A 5KVVA 1TU0A 4C4SA 3LUKA 5IX8A 3W5SA 4EYKA 1GN8A 1ZL2A 2FJPA 1OA1A 3PPWA 2OY0A 5D5HA 4ZQFA 4B33A 4TRJA 4DKXA 4HWRA 4KXLA 2WDPA 1ZESA 4C43A 4AMZA 3BFVA 3HKBA 2BGKA 3DEHA 3I9FA 2O3RA 3LGXA 1HI9A 3IEIA 2IOHA 4LZJA 8ADHA 4BNJA 4JUCA 3B12A 1CW2B 1M1NB 5FI0B 3M6IA 1ESZA 1SUCA 2PGLA 1Z28A 3RK4A 3JQ7B 4D97A 2PLNA 5BO5A 4LFCB 2YKGA 4LMBA 5KJ1A 3OURA 3QFFA 5K4AA 2ZSJA 2R84A 1N77A 1MX1A 4TWBA 5SZIA 1W1UA 5TMEA 4LNHA 4B81A 1THMA 4PQRA 2VF8A 3FJYA 4OB8A 4KN6A 4JMPA 3C0KA 1SXJB 2VUUA 4RM2A 3G6WA 3N0TA 5GINE 5AHXA 1Q7TA 1N7IA 4WCFA 1L7RA 1R74A 1U0HC 2FW9A 2L82A 3QLEA 4FQ8A 4JAVC 3GZNB 3WFZA 2RGRA 3K0AB 3LBHA 4LXQA 3O26A 5IJ9A 3OEEA 5DYIA 3DAGA 4LSZA 1GGFA 3CUSA 1GQYA 1Z13A 4J2HA 1DC6A 3DUFA 3WNQA 4CKBB 4D9IA 3PF9A 2NVUB 4CCSA 2AF3C 3Q3JB 2GBGA 3UJ8A 3OZEA 5BNFA 4B09A 4ENTA 3GW8A 1E6EA 1NSFA 2H08A 5P21A 4BGEA 5KBYA 1ZHOA 3B7GA 3JV7A 3WGUA 2Y2VA 3G8CA 3HNRA 4ZQCB 5J5AA 4ZANA 5GONA 2GNAA 2CXQA 4Z7JA 4HO1X 3S1AA 3Q8XB 3A2KA 1QYVA 3ZVKA 5FOTA 1K7CA 4A8TA 1P74A 4IXNA 2QVCA 3ZQ6A 4BUJA 3EK2A 3NOXA 3QEMB 1FBTA 3KOWA 4M46A 4NBLA 4PGAA 4XIGS 1FRZA 3ZHCA 4MS4B 3GCDA 2J8ZA 3DB2A 4TN5A 3G0IA 3WGLA 4B75A 1YCGA 3HGQA 4DABA 1I33A 1PLKA 3VU0A 4FEGA 1IZ7A 5JCZA 1OH5A 1UFRA 1YDEA 1GZ6A 3NHJA 1KK3A 2GEFA 3OOEA 3C3XA 4Q4HA 3VHXB 4FYIA 2X1VA 1DRVA 1NUHA 3BK1A 3QA3E 2DOKA 2FLVA 3T3DA 2XB2A 1M2NA 1VJGA 3T7IA 1V5EA 3I05A 2QQ0A 1TF5A 3LC7O 2ZTUA 2Z2YA 1UBMS 4QFMA 1Y5MA 4I1RA 4WLVA 4F04A 2J3JA 5AK6A 1XVVA 3EZLA 3SZLA 3WO1A 3AV0B 5JSFA 2WKWA 4M22A 1II8A 4CQMA 2VUHB 5HKAA 1SBHA 4DPKA 1XRSB 4ALNA 3B8HA 4N8SA 4J7XA 2ZJOA 4YXWD 4AP9A 5BWCA 4WXHA 2CB9A 3GVIA 2DSNA 2MT9A 3IBCA 5ILOA 5EIBD 1X0XA 4TKZA 3VDQA 2AYZA 4I4TB 1PD1A 1A50B 2B4AA 2VPYA 2Z2KA 4E4YA 2GRAA 1VL6A 1FSPA 1CYDA 2VHTA 1Z6TA 3L8ZA 4IJQA 4NL4H 2DSTA 2YNMC 4FYWA 3OCZA 4CEIB 2VXYA 2QXTA 1L8XA 3Q12A 5CP8A 1OPRA 2JAXA 3H5AA 1ONNA 2CNWD 4NS4A 4INOA 4PHTA 2IS6A 2YHIA 3H9EO 3NTRA 1G98A 1SJ9A 3IIJA 3LK7A 3QA9A 1YS7A 2BGNA 3O9MA 2IE0A 2FRDA 5CYOA 5JSHA 2A9JA 5DHTA 4F1JA 2X5OA 3EY4A 3N74A 4UULA 1J7JA 4REMA 3E53A 4HEJA 3DWFA 5L53A 3O4GA 4HSGA 1K86A 5I9TA 3WFJA 3WQBA 1P1RA 2O2GA 1EDOA 2CDNA 1D2GA 2WSYB 4QD3A 4WZAA 4CNBA 2J6BA 3C14C 5C8YA 1HTTA 2C97A 2C7BA 2PGNA 2FE1A 1W35A 3OPYA 4ZODA 3R3XA 3SHOA 4E3ZA 3RK0A 1JPNA 1GU7A 1QLJA 4JVOA 1BGXT 3A3KA 1UDBA 1OYYA 4ZAWA 4BO7A 2OP0A 3DYVA 4OHMA 1E92A 4OBWA 1A1VA 1YDGA 5IXSA 1NLUA 3IDSA 4DE5A 2GZ3A 1R27A 4RK1A 5T4BA 2J0EA 3PQFA 4POAA 1ISSA 1KYVA 2H4ZA 1W34A 3RYCB 3S8MA 3H86A 5JQWA 1F5NA 1RP1A 2AA3A 1NP6A 3WBBA 2ZYSA 1HR0B 1V5WA 2Q8NA 2GRJA 3CRNA 2AOUA 2GAOA 3DA8A 4RE5A 5F64A 2ZREA 3C3DA 4JS0A 1FNNA 4G5QA 3OT4A 1OXTA 1VL8A 1ZU4A 1C9DB 2FSSA 2PT5A 3DE0X 4H6WA 4ZPXA 4DLBA 4ENQA 1YB1A 3FW1A 2ZAGA 3RAPR 1QH8A 4D0LB 4HWGA 5DP2A 2QSJA 1EM6A 3ZJ4A 1H1DA 2HSEA 2E21A 5BSUA 1KWKA 1RXIA 1CQIB 1HUQA 3KT6A 4PBRA 1H2XA 3GGCA 1ZN9A 3UV7A 4POOA 3FNFA 4L0CA 2P2SA 1ZN7A 3WK8A 4DWVA 1R6AA 2PWZA 4IXDA 4F72A 1WQ3A 1N5MA 4ZOLB 3W7VA 3FWHA 2PCJA 4IMPA 4L5AA 5TPZA 1ADJA 3KQWA 3ZDZB 4DR6B 1IRXA 1DLIA 2FQYA 5EKXA 2NPFA 4DZRA 1VMIA 4FN5A 4J43A 1ODJA 4QAQA 3BYZA 3SKYA 2L17A 4I0WB 1ZO8A 4RGBA 4M8NE 1J5PA 3O8NA 1WUIS 2H1WA 4WASA 4Y0NA 3ANXA 3D4IA 3ESDA 1K0FA 4FD3A 2CVHA 4GPEA 1BD3A 2BFAA 5C4GB 3U17A 3R24A 4A8JC 2FOXA 1XHFA 5B30A 4MDEA 2XVXA 3EEQA 3LGSA 2VIIA 3UHJA 4HDNB 4P1ZA 4BMXA 4BQRA 2FI1A 3W6ZA 1RHUA 3K2IA 2P9QA 3C41J 2E5LB 3NYRA 2C07A 2Q1YA 3Q5DA 4IVQA 1PFWA 1ZUNB 5F35A 3EOAI 5IC6A 4R0MA 5CDTA 3ZU6A 5LIRA 4LECA 1N0HA 4JYCA 1YC2A 1AGRA 6NULA 4AG5A 3DTTA 3F4LA 4PNEA 2HMVA 4DHWA 2ZUWA 1Y5NA 2O8CB 2ZJBA 3MWFA 1DG9A 4HYQA 4OHUA 1NKVA 4M6WB 1NBMD 2CHFA 3WLKX 5K05A 2D6FA 2SCUB 1ZSNA 3LX8A 1L5HB 1M1YB 2JFOA 4X20A 5EJFA 1L5GB 4OQPA 1SBCA 4U7TB 2P9HA 3QKSA 4AYWA 4C2UA 2TMGA 1SCJA 1CBUA 2JLSA 2ZBRA 3KC2A 1CP2A 5I51A 1KHHA 2GEUA 1CIVA 1QHSA 2QV7A 1TE2A 3LZCA 2W93A 3C3WA 4U5XA 3VI4B 1U8EA 4JODA 2JGJA 1K6MA 1SOVA 1UADA 3COVA