2ZYWX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with pap and p-nitrophenol, obtained by two-step soaking method
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
289
structure length
289
Chain Sequence
DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshot of a Michaelis complex in a sulfuryl transfer reaction: Crystal structure of a mouse sulfotransferase, mSULT1D1, complexed with donor substrate and accepter substrate
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Tyrosine-ester sulfotransferase
total genus 105
structure length 289
sequence length 289
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zywX00
2IYQA 3KJIA 1XJQA 3ZS8A 1GUAA 4TZ0A 4WXRA 1R10A 1W0KA 4RD6A 3IIKA 3PFIA 3A8TA 2QL6A 1F2TA 4NE2A 3MWYW 5KDLA 1NF3A 2C78A 4DSNA 2D2EA 5GJCA 4RZ3A 2EVWX 4OK5A 2FFBA 1IHUA 4F4IA 3VTKA 1TMKA 1Z0JA 2QP9X 4HATA 4AY2A 4XH9B 2W0SA 2AK2A 3EPLA 1XMVA 4PFSA 1ZBDA 1QDEA 1E2DA 3VMFA 3WYGA 4B33A 5F3WB 1ODFA 2GXUA 2REXB 4RVCA 1QF9A 2B8TA 3BB1A 3HYRA 3KXLA 3FHTA 5EZ5A 1XXHA 4WZ6A 4M9ZA 1VG0B 2IWHA 1L7VC 3L43A 2WTUA 4BECA 4M1MA 3RS4A 2ZJOA 1E1QD 4BFXA 2D2FA 3B2EA 4LJ7A 2CHVA 5TVKA 4Q7JB 4XJXA 1GTVA 4KITB 1YZKA 1ZJ6A 4OHZA 2R6DA 3UMFA 3EPJA 3GLIE 1U8ZA 5CJ2A 2F3RA 4DB2A 5FUXA 1JBKA 1GM5A 4EJSB 1CJUC 1GIAA 2HEIA 3L0IB 4MRRA 4LJ8A 1OJLA 5L3RA 1G41A 4D2IA 2DWPA 5CLLA 3WP0A 1JR3E 1XTQA 4ZDJA 1SGWA 2PLFA 5EXPA 4L15A 4CZ2A 3CF2A 3FKQA 2ATXA 3BK7A 3EW9A 4NMMA 1PJRA 1KJYA 2ERYA 2J1LA 3OHMA 4KAXA 3TAUA 4MKFA 3U3JA 1DAIA 4UNNA 4M8NE 4CYMA 2O8CA 3TIFA 1EWQA 1DAGA 3GLGB 4EPVA 3TLXA 1MO5A 4I1OA 3P4XA 2EWVA 4M9SA 4DT1A 3U7HB 2XZLA 1HE1C 2Z83A 3RS5A 3RSLA 3WMEA 5EP1A 4RZUA 5DN6D 5DHAA 4I4LA 3TMKA 1JR3A 5EJEA 3Q5DA 3LH5A 1MO6A 1EFUA 4OI2A 1WE2A 4RD1A 3T5GA 1U81A 3FMFA 5FUWA 2KI5A 4WZBE 2W2TA 2IF0A 1KI6B 4MRNA 4JMPA 1PUIA 4ZPXA 2IA5A 4LJYA 2QT1A 4MQBA 3W6NA 4C0QC 2XGJA 2ZYWX 3H4MA 3KKNA 3PITA 5A0FA 3CPEA 2GAAA 4A36A 1NN3A 2GEVA 1CIPA 2A2ZA 1D2NA 2QZ4A 1F6BA 4B43A 4Q1CA 1XF9A 1DVRA 5AJZA 3NXSA 2ZS8A 4TL9A 1E2PA 1PZNA 3DDCA 3LA6A 3GLFA 1IN4A 1N5LA 2FFAA 4RD4A 4XVUA 2QENA 5CK5A 4PAMA 1UBGA 3X1ZA 2OO7A 3T12A 3KXKA 2GKSA 3MFYA 3BXZA 4QFMA 4QOSA 1N6IA 2CJWA 5KOYA 1G18A 5C4MA 3I8XA 4OQNA 1NP6A 4TLBA 1VECA 2Q3MA 4AKIA 2JASA 5JRZA 3BH0A 5G53C 2OILA 2ZI3A 1P5ZB 4YLGA 5E7MA 3U44B 3AVVA 1EWRA 3O8BA 4IOMA 1IQPA 2H18A 1XDBA 4PC2A 1G7SA 1E2QA 5D3QA 2W6JD 4V0NA 2YVUA 3BH7A 3TUIC 1P2SA 3TQFA 4OQMA 1TF7A 4OI4A 2GHIA 3I5YA 1ZD8A 5K8IA 4R9UC 5FTNA 1F2UB 1TX4B 1XD2B 1ZW6A 4LWZA 4URUR 4URWR 2I1QA 4NYJR 1G7CA 5AJVB 1KIMA 3FGNA 1S3GA 3QNUA 1WA5A 4MYCA 2XB2A 4DIEA 1LF0A 3PIRA 4GZLA 5G40A 3WMGA 3QKUA 3NBYC 5A5GA 5JJLA 3R20A 2FJUA 5CDFA 5K8UA 1YRAA 2QAGC 1E2LA 1X86B 4PQRA 2BBOA 1YZLA 5AJYA 4G5GA 4B6EA 3ZZUA 3SR0A 4CEHB 1US8B 3W34A 2L0XA 4JLDA 1P4SA 4B35A 3THYA 1AGRA 3UKDA 1KTVA 2G77B 4BQSA 1R5OA 4MUAA 2LKDA 2WM9B 2YWHA 2YC4C 1FTSA 2NO1A 4M0LA 3AVUA 1JI0A 1IY2A 3Q7QA 1AZTA 5HE8A 4BFUA 2PT5A 3NKVA 4PQYA 3RWOA 3CWQA 2PCJA 3H1TA 5FBWB 2R65A 2MMCA 3Q3JB 2Z4RA 4FXPA 4M1TA 1NSTA 821PA 2CHQA 2ODWA 2VHUA 1OIWA 2EQBA 2FPKA 2GXAA 5C1BA 1R6BX 2H8KA 2RHMA 5J4VA 4B73A 4ZCMA 1NI3A 3EZFA 3K0CA 1GVNB 2HXYA 3MRSA 4TYQA 1T4GA 5JZVA 4BLQA 2HV8A 4G5OA 2B8WA 3QXHA 2GCPA 2YYZA 4HUTA 4C0BA 1HYQA 2YWGA 2ASEA 3KQLA 2BMJA 1Q3TA 4BFYA 2AFIE 5CB8A 1KI2A 2R8RA 4WAUA 4EFMA 4IDHA 2NGRA 2V54A 2A5JA 3CH5A 2RGNA 1U90A 5EP4A 1WRBA 3LLMA 4IVPA 4A0RA 3RC3A 3K0AA 2G3YA 2ZE6A 2GJSA 2ZUCA 2HT6A 2G6BA 5FR1A 3X1YA 2W2XA 2WPDD 2DY1A 3RNLA 2FPMA 1ELOA 4QGAA 4B74A 2XZPA 2FN4A 2N42A 3KDSE 1F48A 2QRZA 4LYAA 2A5DA 4JLMA 4RFSA 3TSZA 2J3EA 5KUTA 1QHNA 1TF5A 1M2OB 3WNBA 1E9SA 3QKRB 1UBFA 1JR6A 1W1WA 2NO7A 3BWDD 1KAGA 4NYIQ 3SN6A 3PEUA 5C46F 4CF7A 2BJWA 1E9RA 3EIHA 3MUFA 4Q9JA 1GFIA 3AB3A 5CM9C 5GVSA 2R9VA 5JFGA 2HF8A 1VYUA 2BCGY 5P21A 1UJ2A 1QHIA 1OF1A 3THWA 1G3MA 4LYFA 3KTAA 4JYBA 4UNSA 2ZUDA 3NBZC 3K9LA 1FMLA 2B6HA 2QM7A 2IYXA 2IXGA 2YOFA 1Z22A 4ACAA 5B64A 1AGPA 4FMDB 5JI3E 3GJ4A 3CPJB 4MKIA 4DIDA 1NLYA 2GK7A 2GJ9A 5FPHA 5J5CA 5LB2A 3UG7A 2NMVA 1GRNA 4ESHA 5AUNB 1NG1A 2DB3A 1WCV1 4RCZA 3M4YA 5B2ZA 2IXEA 3CB4A 2ZYVX 1G8PA 3CNNA 2HCBA 4OJKA 5DH9A 1A2BA 2ZSFA 1A82A 1UEJA 4JSYA 3B1VA 4Q5IA 2AKYA 2IS4A 4FMDF 5HTKA 3E1SA 1XEXA 2EFCB 2ZYTX 3KJEA 4O2RA 1E94E 4QG7A 4C4PA 2IYYA 3B82A 1E0KA 3GJ7A 3ADKA 5DO9A 3DOFA 3SJZA 1GNPA 3MAAC 1M34E 3RS3A 3BB4A 4Q19A 3QF7A 3B1ZA 4TLDA 2O8CB 2AD1A 1UEIA 5FPSA 3KUDA 4IRUB 2FV8A 4EFLA 4M4SA 2ZUBA 4DT1B 4D25A 2X1VA 1G5TA 2GBLC 4Z8XA 1X8JA 3BJIC 3FVQA 4Q1EA 3GCGA 4AKEA 1UFQA 2QQ0A 4A8JA 3D3QA 1FNMA 1EX7A 1KZ7B 4NYJQ 3ZD6A 5KU1A 3EWAA 4C2UA 1ZU4A 2CCKA 2WICA 3T1OA 1E9FA 4YXWA 1BH2A 4YXWD 3NC0C 1EFHA 1BS1A 2JGNA 4KBGA 1KI3A 3ZIAA 4JKYA 2VRWA 4E22A 3ICEA 3CH4B 3AEZA 4A2PA 4ZO4A 4M21A 2H7VA 1P6XA 1HH4A 4JLPA 1SXJD 2FOLA 4G01B 3G82C 4EQ6B 1G20E 1Q3HA 3E2IA 3NH6A 3HWSA 1R4AA 4B3DA 2JLUA 1Z47A 2OFWA 1W4RA 3P26A 2XJ9A 3CW2A 1OFUX 3F5FA 1OH6A 4IDPA 1SVMA 2AN9A 2GXQA 1XCMA 3FWYA 1JAHA 2ANBA 2ZRJA 2QAJA 1TADA 3I32A 3KQNA 1RIFA 1E99A 1W2GA 4JL6A 5SZJA 1BMFA 5AJXA 4LJ4A 3UANA 4UQOA 2IUSA 1RJ9B 3RRYA 3W90A 5IT5A 4R2IA 5IHPA 4L16A 1HEIA 1N6RA 1N5JA 2BBTA 2AR7A 3ZS9A 3TGPA 4GP6A 4IHQA 1E1RD 3P1JA 1J70A 1Q1QA 2QE7A 4GI7A 1BKDR 3IIMA 1EX6A 1NSFA 1GNQA 2G1KA 2VLIA 3GLHB 2C99A 4XOIA 1DPFA 4Q4JB 4US2R 5F98A 2RGAA 1R0XA 4P0TA 4URZR 4L5BA 1E9BA 1N25A 5FOXA 1HUQA 2DFNA 2P3SA 3TH5A 2ZJZA 4JJZA 2QAGA 1KK3A 2FGJA 4YMSA 4LHYA 1VIAA 3EC1A 1M7BA 4C0LA 1OXVA 2V6JA 3SBEA 4DUGA 2A9KA 4Q9IA 1VHLA 2BDTA 2BKUA 4HDQB 4MITA 5JCPA 4D81A 4EUNA 4PZYA 2CVHA 4ZKDA 3PG5A 1M74A 3GEEA 1KSHA 1J8YF 3LBNA 4CDGA 4O25A 2QPTA 1X6VA 2GZHA 2IUUA 3QBTA 3ZDQA 3MG9A 3THYB 2BEJA 2WJVA 3SE0A 4PC7A 2O8DA 1U9IC 1CJKC 1DELA 2XOKA 3AVOA 4B47A 1UAAA 3AV0B 1CR2A 3K70D 4KBFA 5KPDA 3KJGA 1AKYA 1DADA 4HUQA 1EFRA 1NVVR 1SQ5A 1X8KA 4TL8A 4PSVA 5JEDA 2WIAA 3B13B 2H5EA 4OHXA 2IK8A 4KYIB 4HLDA 1RKBA 1XRJA 1XXHE 1ZD1A 2G0TA 3L8YA 1W2HA 4CEJB 2ZPTX 5BN5A 4W5JA 2ZRBA 1DG3A 2XNDD 4OHWA 3OE7A 4KV9A 3U4QA 1U94A 3L82B 1NMYA 3NG1A 1JEDA 3EWSA 4KFRA 1LNZA 2PT7A 4Q4AA 1JJVA 3B1WA 2R44A 2ZI4A 4Q7LA 3QE0A 3TRFA 4M2LA 3BC1A 4ARZA 5DI9A 4D4JA 2CDNA 3I61A 1CLUA 4I1UA 5E7IA 4FN5A 2PEYA 4DLYA 5JRJA 2F55A 4C7OA 2JIZD 4EDHA 1SVSA 1S9DA 3Q72A 4UNQA 3SBDA 4LZZA 4BFTA 2F1JA 5HKKD 1KK0A 1E9EA 2Q0HA 4DSUA 4TYNA 4JT4A 4JKIA 4I81A 2Y8EA 4KLNA 5FBQB 4FW9A 3RRMA 1W36C 5ELXA 3W8RA 2JAQA 3P4YA 4Z1MD 1FPMA 2R62A 3PUZA 3Q85A 1Y63A 5DYIA 5CJPA 5G3YA 1E0JA 1CBUA 3OESA 3I5XA 1XEFA 1YZNA 4DLUA 4PHGA 4XVRA 1G3RA 3LX5A 2OESA 2YKGA 3QKSA 1YQTA 5C18A 2Z4SA 3C16C 5JS7A 1S3SA 1WP9A 4DWJA 8OHMA 2B21A 5FTMA 1OH5A 3C4JA 1MO4A 4XD7D 4D82A 2C9CA 2ZJ2A 4KFUA 5J47A 3TR5A 5KSOA 2SHKA 3P27A 2FEOA 1XMSA 3IUYA 4JS0A 4NZYA 1II8B 5FL7D 3B6EA 2QQEA 1RYFA 4DC9A 3JZAA 2OLKA 3T15A 3UWKA 4E03A 2JLSA 4ZCIA 3WXMA 4DXAA 2GNOA 2FSFA 3DO6A 4XTRA 3X1DA 3O8CA 3CPHA 3ZZTA 1Z0IA 1ZMXA 4PAQA 4URXR 3ZVLA 4JJKA 2OXRA 1IXRC 3HU1A 4HZIA 4OJQA 2FFQA 2QSYA 4PC3A 2H92A 1G19A 4MRSA 4Y0VA 1FUUA 1JXOA 3RS7A 1XEWX 3K09A 4IKEA 2P6RA 4DZZA 3DL0A 2QP4A 1W46A 3ZGXA 1X3SA 3AQ4A 4PO1A 3FKSA 3QKTA 2V8OA 3KKMA 1OIXA 2DWQA 5FBLB 2ZE8A 2ZRCA 1BMFD 2ATVA 2JLQA 1N6OA 1FMJA 1N6HA 1TAGA 2RB4A 3VFDA 4BLTA 2HUPA 3ZYCA 1YR7A 4PC6A 3QVVA 4YONB 5IRCD 2HJVA 4YDSA 3W6PA 4MDEA 2YHSA 3JVUA 4MRVA 4Q18A 3R9WA 2AHOA 2AKAB 3Q5EA 5JEEA 3B85A 4WA7A 3QJYA 3K9GA 2CNWD 5JECA 1H65A 1GL6A 1TQDA 2IYTA 5ANRB 5HE9A 4Q47A 3X1WA 1XWIA 5GJWC 3KFXA 4NCHA 2EYQA 3LXRA 2OM2A 3QG5A 2YV5A 5E7JA 3AH8A 5GJBA 4KI0A 4DBLC 4L8GA 5BYKA 1IJFA 4UXIA 3CM0A 1KNXA 1UBCA 2NPIA 2ZTSA 3AVYA 5CITA 3TW8B 2J9RA 3R7WA 3AVTA 5FOUA 2YZ2A 1ONBA 1D2EA 4US0R 4NDZA 1FZQA 5B58C 2D4HA 4LK2A 4OKSA 3ZH9B 3QVUA 1GRQA 2XSZD 1SXJC 2YOGA 1QHHB 2D7CA 4HYYA 3WYFA 3LX8A 1S8FA 2WBLC 4C9BA 4PHFA 4DLWA 4M9XA 4QJ5A 1U0JA 1NJFA 1NKSA 1OXXK 4C3ZA 2NIPA 1KAOA 1NY5A 1P9RA 2C9YA 3C14C 3ZJYA 2ZITA 3CX6A 5LPNA 4BEJA 2O8FA 1CKEA 2WKQA 2GXSA 2Q9BA 2IYUA 4P4UA 5L3SA 1ZCBA 2OXCA 1G5RA 5DN6A 1KI4A 3TW4A 3THXA 2QPAA 3KQHA 1HE8B 3B9QA 2OCPA 3VR5A 1CU1A 1G17A 2X2EA 3U3KA 3M0EA 1G7RA 1MV5A 3VX4A 3CX8A 1OYWA 4WIAA 1DBSA 1FUKA 3BD9A 3EXAA 2BMFA 2NO9A 3MMPA 4C0SA 1JALA 4CRWB 3V9PA 2RH5A 1XPRA 4IJMA 2Q21A 1LTQA 3EARA 3UIEA 3CF6R 1UADA 4RZ2A 5KYKA 5TARA 4U00A 2QU8A 3VNUA 3FYHA 1R0WA 3IILA 4O3MA 3K9NA 1OB2A 2BJVA 3PEYA 1KZGB 1GITA 1Q12A 1Q20A 3T61A 3T35A 4AC9A 1EFCA 2F3TA 3OEHD 2VP6A 3OEHA 3WMFA 4XWKA 1S96A 2JJ1A 5UKDA 4D4KA 4Z8YA 4RFSB 3IQWA 1VCIA 4JBWA 4V0ME 2AFHE 3VKWA 3WY9A 1Z0KA 4HZUB 4PO9A 4BGDA 3GQBA 3A4NA 3SJAA 2AXPA 3GFPA 3EIEA 4B3CA 3K8YA 4JLVA 3T06B 3IHLA 2ZSAA 4B2LA 2ZETA 4DB4A 1U2RA 2ZI6A 3BS4A 1OHHD 3EZ7A 3MWLA 2DFKB 5TXGA 3VX3A 2PJRA 1G3IA 1W0JA 3OFNA 4CW7A 1YR9A 4GNKA 4EFNA 2DR3A 3AUYA 4LOAA 1E9AA 4WVFA 4KU4A 3W3AA 2VO1A 4LYJA 3IBGA 1FP6A 1YE8A 1PLLA 1GP2A 3AVPA 3HR7A 1U8YA 2ZRAA 2VYFA 4HAZA 3RWMB 3W6OA 1OKKD 2BVNA 2IX3A 1KJWA 2O5VA 2CCGA 3CRQA 4ZCLA 2VP4A 2PCLA 4IFBA 4AKGA 1E69A 5TY0A 2RGNC 1LVGA 1Z6XA 3B9PA 4LJ5A 2B92A 4FWIB 3EZ2A 5D3MA 3NDBB 3WYAA 2AK3A 2B7CA 4W7SA 2QG6A 1BYIA 5CM8B 1E98A 1M6NA 4GSYA 2QGNA 1T0JB 2QBYB 1C1YA 1JXMA 2F9MA 3MCAA 5KSZA 1NVVQ 3QF4A 1PVOA 1YJ5A 4JLJA 4EIWA 2VH5R 1T5IA 4W5HA 1P60A 1D8TA 1GSIA 4F38A 1A1VA 1N2CE 2GVDC 1K6MA 1RRFA 2WKRA 2I1VB 2YNMA 3FHCB 1G9XA 2NO6A 1E9CA 1OT3A 5FOWA 3RHFA 1UDWA 1COWA 4GMDA 4LC0A 2MMGA 4C0HA 5HZHA 2J46A 4LHZA 4N1AA 2KSQA 2XAUA 1GKIA 1KK2A 4HLUA 3EASA 1OB5A 3LWNA 3BE4A 2AX4A 4LJAA 3FE2A 5GADl 5J4YA 3CR8A 4YDHB 4DLSA 1OXSC 2ZR7A 3WNDA 5L3VA 3K0FB 4G0NA 4ESVA 5KTYA 5FI0B 1CR0A 3VKHA 2HYDA 1E79A 1OHHA 3AF2A 1IN8A 1I4LD 2QN6A 3U6BA 4AD8A 4KHZA 3PUYA 3AP2A 1TEVA 1S1MA 1TTTA 1VMAA 3EPKA 3AP3A 4BE7B 3EPHA 2HDNB 3SI7A 1ESNA 3GMTA 1W36D 3L2OB 3VU9B 2G1JA 4JYCA 3I1FA 2OFXA 4LHVA 2CMKA 1Z6AA 3HU2A 3DPUA 2FU5C 4XTCS 2IW3A 4Q9HA 3SC3A 3QI2A 2ZJ8A 4IW3B 1OV4A 4RD2A 5CDFE 3FMIA 2O8BA 2ORVA 2CHGA 1R0ZA 3UK6A 3SU8A 2G0NA 1EXMA 4HEJA 2FSHA 2JATA 4DLTA 2V1UA 1RVDA 3KFVA 5F9HA 2WWGA 4NCIA 1XTRA 1GG2A 1Z08A 5KDOA 1SXJA 4FD2A 1R2QA 4OHVA 2F1IA 3FB4A 4RCYA 2MSDB 2J59A 3S1AB 5J4HA 1H8HD 1U9IA 4C0KA 1WBBA 2JDIA 2CK3D 3U44A 1CJVC 3TSOA 5DHFA 1W47A 1IN5A 1E3MA 1G16A 2R6FA 2XTNA 3QXXA 3NC1C 4NH0A 5JS8A 5J4LA 5GVRA 5FUVA 4HB2A 3CR7A 2NG1A 1AZSC 1NN0A 4A0HA 4DHEA 4M22A 1NVXQ 1PV4A 1DEKA 4JBYA 4NPHA 4LPKA 4QGFA 1EK0A 1YZTA 1LF5A 3EAQA 2CE7A 4KSBA 2ZI7A 5KNBA 2R6CA 4ZI2A 4B48A 4I1SA 3I62A 1P73A 1DOAA 5B30A 2IL1A 1NN5A 2CL7X 4TQ9A 2OT3B 2JJ2D 4HDCA 4GMXA 1GKYA 3PUXA 1AM4D 1DG1G 1XTJA 2NOAA 3IPXA 4IDQA 5L3QA 4XWOA 1KSFX 4QGHA 4KYUA 4JLBA 4QC2A 1L8QA 2R2AA 1LS6A 3IEUA 3CIOA 5SZHB 1OSNA 4HAUA 2VHQA 2GVZC 4NYIR 2ZRDA 2DWOA 1N6NA 1TPZA 1DE0A 4X8MA 4A8JC 3VHXA 2FG5A 1G8HA 4WZAE 2BBSA 3ASYA 4CT5A 2ZI5A 5CK4A 2KE5A 4A82A 1KY3A 1YHNA 3DM5A 4QM6A 2WZQA 5LDDC 2GZAA 4MYUA 2NTYC 3MGCA 3AUXA 3X1XA 3HYTA 4Q1FA 5BYJA 1CRPA 3K70C 2MSCB 4DLZA 3C5HA 3U4QB 2GK6A 4MUBA 1KMQA 2B7BA 1JJ7A 4LHWA 1UKYA 5FBVB 4N3NA 4P4SB 4RZXA 4E5UA 3D7MA 2Z43A 3OAAD 1ZP6A 4GOKA 2OCYC 2DHRA 1TEXA 1Z0FA 2ZRFA 4EPRA 3E5HA 3PR1A 4BEBA 1OKKA 1W5TA 2ZREA 1C9KA 1W48A 4QJ3A 4Q48A 2O8EA 3ZIAD 2VP2A 2F1HA 4OQFA 1Y3AA 4QXAA 5SZKB 4NCJA 2IS2A 4LRWA 4ERNA 4QBHA 2EFDB 1A4RA 2WWHA 2JIZA 3Q7PA 2ZRPA 2J87A 4MGKR 3U7FB 4A15A 5F9FA 1ZIOA 3GJ0A 4PR0A 3LNCA 1VTKA 3BH6A 2C5LA 4MGYR 3Q8XB 2C2HA 2ZU0C 2IT1A 2XNSA 3CX7A 2GJKA 3V4FA 2F9LA 1Q57A 1IXZA 5LB4A 3SQXA 2C95A 1VHTA 3QSYA 2ZSDA 1IY1A 2D3WA 1NL3A 4D0GA 3UXMA 1W0KD 1XU4A 5E95A 1XJCA 2QE7D 3C7KA 1HQYE 4LBWA 3HP1A 3W9YA 4BZPA 2XEXA 4DLVA 3M6AA 2ZRIA 4GOJA 4NONA 3DOEA 5CLQA 2GWHA 3CRMA 2CXXA 1RRPA 2ORWA 2KJQA 3RS2A 4XD7A 1QVAA 1JAIA 3VR6A 3KB1A 3NDPA 2OE2A 2VHCA 3DMDA 3KTAB 4X8LA 2QORA 4Q1AA 4MA4A 3R8CA 2QMEA 4Q4HA 2WSSD 2OFOA 3O8DA 1KO8A 2E87A 4LHXA 2WJIA 3RANA 3O8RA 3PEWA 1E2MA 4RD3A 3QQ5A 2ZRLA 5FOTA 3QXSA 1YKSA 2BC9A 2QUZA 4HLUC 4QNRA 2GEUA 5FTJA 2RKOA 1PLJA 4PPNA 3TVDA 4WW0A 1Z2AA 1I4DD 5FL3A 4TLAA 3V4RA 4J0QA 3SHFA 3ICQB 2H16A 2X8AA 2OG2A 4HAWA 2A5FA 1QHXA 5KNCA 1XPOA 1DO2A 3AKYA 5LD2B 1UF9A 3U60B 1G6HA 1X8LA 3A58B 1L2TA 1E2JA 2GETA 5JCZA 4XWAA 3D8BA 1FFHA 121PA 1T91A 3CBQA 1XJ0A 4JVNA 5EQTA 1ZCAA 5HPYB 3AKEA 3CRRA 2RCNA 2EU8A 1ZU5A 4Q9LA 4E09A 4GL2A 4QJ4A 1W36B 2ZJAA 3OAAA 2P2LA 4KODA 4D4LA 2ONJA 3VR3A 2XZOA 4H9GA 1IN7A 5TDHA 3WHKA 2O0JA 1AQYA 1XD2A 1F3OA 1H8EA 1R5NA 4JVLA 1LW7A 3DVLA 1TQ6A 1R7RA 2IYVA 2J0UA 4CEIA 2REBA 3NHAA 5JBQA 1EESA 3KQKA 2VSOA 2G9NA 3VU9A 1QHSA 1AN0A 3ZQJA 4FWTA 2YJTD 3Q9LA 2WWXA 1OE0A 2A5GA 4B71A 4TLCA 1P2VA 3T1VA 1T3LA 1DO0A 4C0JA 4UXHA 1IOZA 2IYSA 1OFTA 1P9NA 2OAP1 1MOZA 4DSOA 1GL7A 5FUYA 1AQUA 1Q0UA 1YZGA 4CEHA 1US8A 3PUWA 1HT1E 4US1R 3V00A 4QNMA 3ZQ6A 5JWRA 1T6NA 1YU9A 2N1BA 3BIFA 2VP0A 3LD9A 3GEIA 4BLRA 2CCJA 2A3RA 3MSXA 2CLDX 5JSZA 2VSXA 1EGAA 2OSBA 2OUKA 4LYHA 5DE3A 2QSZA 1D6JA 1Z07A 4PSKA 5M04A 2GA8A 4LSGA 4B32A 3MJRA 4QBIA 1YZQA 2BKEA 3GD7A 2RGBA 1ZAKA 4Q66C 3U3OA 1DAFA 1KO5A 2JCSA 4JVMA 5FBRB 4DLRA 1E0SA 5E3HA 1G3UA 5CIWA 3WBKA 2P0EA 3AKDA 4AIIA 1KI1A 1N0WA 3DZDA 1EG7A 3HU3A 3FFAA 2ZXUA 1J2JA 3THOA 3AVXA 1WDTA 2CBZA 4JL5A 1GKUB 4BFZA 4HSEA 2PX3A 4JIMA 4Q03A 4B76A 4DCUA 1CF4A 1X1SA 2Q9AA 3EG5A 5AUPB 1ZVQA 2NQ2C 1EFTA 3L0OA 4X8OA 1BIFA 1OYYA 4OQLA 1UDXA 2EFHB 1Z2CA 1QZXA 3D6TB 1BOFA 3KJHA 5FPYA 2FX3A 3RRZA 4URVR 5JJIA 1I4TD 1XTIA 4HAXA 5DI3B 1Z83A 3HPRA 4NBSA 4DCVA 3R8FA 4QHTA 4PPFA 2FPLA 4WOPA 3WHLA 4Q1DA 2QMOA 1KJZA 2CL6X 1XXHB 2Q9CA 1G8FA 1WF3A 2BM1A 1KY2A 3I8SA 4O2LA 4AKHA 2V55B 2WSMA 5DSZA 3N5CA 4P3YA 2GEDA 4LX0A 1N6PA 1SKYB 3A1WA 5IF9A 1ZM9A 3RVBA 5FPKA 3BRWD 4MDFA 4XSGA 4GRAA 2YWEA 4EPYA 2QTVB 3H2YA 3KQUA 4F4CA 5G41A 2BEKA 1W7AA 1UPTA 2ORIA 1V5WA 2ERXA 2GESA 3FMOB 4URYR 1OXTA 5F2EA 1T5LA 1TUEA 2PL3A 3QKRA 1G21E 1KHTA 3QOFA 4QBFA 1Q21A 1VCNA 3B1XA 4R71A 4LDJA 3EA5A 3BORA 4LC1A 3BERA 4PSAA 2UKDA 1W44A 4HLCA 2HXSA 1XP8A 2XTMA 2OBNA 1VPLA 4Q7KA 4UJ3A 1QVRA 2D06A 2VP5A 2FMXA 2LWIA 2Z5FA 2JLRA 4IVRA 4QBGB 3TNFA 3F8TA 4BFSA 1K5DA 1YZUA 2EYUA 4ILEA 1CJTC 1KK1A 2CNWA 4DCNA 1DAEA 1ZUIA 2VL7A 4KVGA 3THWB 1HURA 1Z29A 2WMNB 3A1TA 3LFUA 3ZVNA 3EIQA 4Q21A 621PA 3OFND 1II9A 1V43A 2ODNA 4JVSB 2ANCA 2ZEJA 5C4GB 2A5YB 3GJ6A 1KI6A 4MKHA 3FMPB 3AF0A 1R0YA 4C7OB 1FX0B 1G64A 4I1VA 2W2VA 4OI1A 2GF0A 3KXIA 3SFZA 1VKJA 2V9PA 3KB2A 3LV8A 4GBMA 1QG2A 3T1TA 3K0CC 1GNRA 1NKTA 4A0FA 4DJTA 2FSIA 1ESMA 2OCAA 1MKYA 3DHWC 1VYVA 3VR1A 1KO7A 2P5SA 1COWD 5BN4A 3NTUA 2H17A 2QEQA 5DYGA 1KMHB 2JDID 5JLJA 2FWRA 5H1YA 5J4KA 5EUMA 4Z54A 2RMKA 3OIUA 4P4TA 1IONA 2X2FA 2ZRKA 2QI9C 4B3GA 4YMTA 1FP7A 3TQCA 2ZROA 3NWJA 1UKEA 3IIJA 3LVRE 4GDFA 1LY1A 2MSEB 2WMOB 4RFVA 1N5KA 2ODEA 3QUSA 3ND8A 1MRNA 1KGDA 2ZS9A 2W83A 1LV7A 3OEED 4Q1BA 4A8JB 2PZGA 2PBRA 4BZXA 2KBEA 1GDDA 3KKQA 2GAOA 5HR5A 2GCOA 1S9HA 1E79D 3LBHA 2OCBA 2W6IA 4LBZA 4NU0A 3EX7C 4PQFA 1E6CA 3UPUA 1S2MA 2P6NA 2WVJA 3GJXC 1DS6A 3KL4A 2JLVA 3U5ZB 2DYKA 3CNLA 4OK3A 1NG9A 2V1XA 1OH7A 3AF1A 1TL7C 1KKLA 4HAVA 3RSOA 5JI2E 4OQXA 4HB0A 5JJKA 3LVQE 1BYUA 1YR6A 2ZJ5A 1G8GA 2FH5B 3F3YA 1GAJA 4TQUS 1NLZA 3CZQA 1UM8A 2QP3A 1ZM2A 1W5SA 2XB4A 2J45A 1ZYUA 2AWNA 1U0HC 1AK2A 4IDNA 1K8RA 4GOXA 1NBME 1Z8FA 4Q00A 1YR8A 1F60A 3LRPA 3SFVA 1JB1A 4LGMA 4NCKA 2C96A 4B2PA 2WJJA 1MRSA 2ZRMA 2OLJA 3ND9A 4IFEA 3KUCA 3U61B 1G8YA 1NNEA 1LFDB 4GZMA 3P32A 3ADDA 2AXNA 4JLAA 4PXAA 4HLQB 4D0LB 2D74A 1MH1A 1GILA 1Z3IX 4YMVA 1ZRHA 5AUQA 2QT0A 1HY3A 4Q4LA 2V4ZA 1DAHA 1W0JD 3CRVA 1E2GA 3TAHA 3VR2A 4DSTA 1G4UR 4F93B 2HCJB 1Q44A 2I3BA 2GJAA 3PUVA 5L8VA 1RZ3A 3O47A 3W3ZB 3CRW1 2W00A 1ZM4A 4V02A 1E96A 2OBLA 3I4LA 1S4QA 5CB6A 4TYPA 3GLFE 1P7CA 4LV6A 2FNAA 1SXJE 4II7A 4M1OA 2VHJA 2W0MA 1GRRA 2NO0A 2XITA 4JZKA 3TVTA 1I2DA 3ZVMA 1NJGA 1OH8A 4XIGS 1YRBA 3A1VA 1N6LA 4PPGA 5EP3A 4FMBB 1JECA 4TMKA 4K46A 5TMPA 4MYHA 4A2QA 1ZM7A 3B60A 2GF9A 3WP1B 3L8ZA 3PVSA 2IYZA 3SNHA 4QL3A 1E1QA 5EE5B 2QMUA 4LBYA 3T34A 3JVVA 4RKEA 2R6AA 1RPZA 4XVQA 3UATA 1NBMA 1D2MA 1OLOA 4BRWA 4I99A 5EXXA 3RAPR 1R8SA 1KDPA 2JJ8A 4UJ5A 2RAPA 2VPPA 2J7KA 3BFXA 1Q1EA 2GTPA 2O8FB 1LB1B 1ANKA 2IXFA 4F91B 3AVQA 1MT0A 2P65A 5KO2A 1SVOA 2G83A 2H1LA 4P4SA 4V03A 1KI8A 1NVWQ 5G3ZA 2OV2A 2C98A 4KXFB 5FOSA 3QBVA 2BCJQ 3RABA 1EFRD 1GL9B 2IWRA 1KDTA 2BM0A 2HF9A 1G5PA 2O0KA 2WWFA 4A0GA 1KNQA 1QBKC 1RW4A 5FR2A 1XBTA 1SKYE 1KSJA 4TMWA 4ARZB 3SHWA 3QPUA 4EKDA 1AA9A 3H84A 4TMVA 4EPTA 4M1KA 4O0MA 2DBYA 2RHDA 2FGKA 5B57C 2FE4A 3LY5A 3N2EA 521PA 2JLZA 2WIBA 4RSGA 1VCOA 2NPFA 4QHSA 1FNNA 4M53A 4S35A 221PA 3CLVA 4L4UA 3GLFB 1TU3A 1CR1A 4AURA 1UBEA 4F7WA 4ACBA 4WXPA 1VYTA 1N3BA 3HJNA 2RGXA 3B5JA 2CJWB 2ECKA 2PJZA 2F7SA 4Y0AA 4TYYA 1S0UA 3LAWA 1CTQA 1H8HA 3I3SR 4A6PA 1XCPA 4CVNA 5JWOA 4DRZA 4TYWA 4KCGA 3NH9A 4DDUA 3IGFA 2GJ8A 4DCTA 4BFVA 4FMCB 3IKJA 2R6GA 3UMRA 3UMSA 4LPSA 2ZRHA 3GEHA 3QEJA 5BQ5A 3T5DA 3K09C 3C15C 4GT1A 3ZZ0A 4PAOA 2C9OA 5J40A 2XNDA 1M1YE 4L9WA 1G3QA 3HDTA 3TUZC 1VDZA 1E2NA 3BOSA 1WQ1R 4Q4HB 1T3HA 4BLPA 2YC2C 1HQCA 4F92B 2PEZA 4HDOB 1Q1ZA 4OHYA 2GDJA 1TU4A 5D3MB 5FPTA 3B78A 2C77A 4QKQA 3RC8A 4P33A 4TSFD 1ZNYA 4EAQA 1IXSB 3JZMA 4TN1A 3U6KA 4DVGA 2FSGA 2P67A 4TLEA 1IBRA 4DEXA 3QF4B 5TB5A 3RYTC 1OFHA 4L9SA 4C2TA 1XD8A 4PTLA 3DEFA 2WOJA 4EQ6A 1KYIA 2XXAA 3MJHA 4AYXA 4G5QA 4NP6A 1ZNWA 2XOKD 2WSSA 4JSTA 3M1IA 1KMHA 1RRCA 3IBYA 5JHHB 2WV9A 1VG9B 1GWNA 2CL0X 4X8HA 4MYTA 1NLFA 1CRQA 2C8VA 3AF4A 3CUEF 5BWMA 3ZLJA 3FFBA 1DAKA 3TR0A 1B23P 4H1VA 2KWIA 4IXMA 5EE9A 4NYMQ 1E2EA 4TT3D 1XD9A 1U0LA 3I92A 4MKGA 3A36A 3VAAA 2Z6VA 2RGEA 1P9WA 1R8QA 3OE7D 3PXGA 2GCOB 4C30A 3I73A 2VSFA 3LW7A 1CULC 3BBPA 5DIFA 3AGQA 4BASA 1ZD9A 4CEIB 1W4AA 4JL8A 1MABA 3UWOA 4KO8A 1XMIA 3BFKA 1NVUQ 2EFEB 4KJZA 2X77A 3F0TA 3LO5A 4P32A 4V0MA 1IY0A 4CIDA 2AD5A 4JBXA 2FFHA 2VHTA 5CYPA 5JMTA 2ZM5A 1E2FA 2VIIA 3OZXA 3EZ9A 1KI7A 2GILA 5AJWA 5IDVA 1Z0DA 4IEIA 5HCNA 4MGZR 4GP7A 3RS0A 1P3JA 1J90A 3WBJA 5EE0A 5EE1A 1W49A 5JSZB 3LBIA 3K0EA 2ZSBA 2ZI9A 4OI0A 3TBKA 1CXZA 4IEEA 3K0SA 5LD2C 2O8BB 4IOJA 1IJEA 1T9HA 1L4YA 4IDOA 4GPTA 1TF2A 1WBDA 2JJ2A 5E4FA 3GLIB 3K0AB 2JLYA 2BV3A 1CR4A 2IHBA 1L4UA 2VEDA 3A1SA 3MWJA 4TTRA 1KI9A 4BUJA 4NTZA 2ZAOA 4NHOA 4EPWA 3L0SA 5JHGB 1ZIPA 3SYNA 2RGDA 3DMNA 1SXJB 3AF3A 1DAMA 2WWIA 3ADCA 5HKKA 4G5RA 2HLDA 5BN3A 1IM2A 2TMKA 3S1AA 4IOKA 1ZC3A 2ZYUX 1Q1BA 3PEVA 1JPNA 2QM8A 3QXCA 4AWXA 1AJEA 6Q21A 1E2IA 1HTWA 3TE6A 3SOPA 3NEJA 4D4MA 3THXB 1F2TB 3CF0A 3WRXC 2QGZA 1XTSA 2ZRGA 1KSGA 3WRYC 1ZC4A 2V7QA 2V7QD 4B3FX 3ASZA 1FQKA 4CEJA 3IEVA 1AIPA 1J7KA 3ECCA 2IS1A 4ZI3A 5DI3A 4DDVA 3CNOA 3SJCA 1E9DA 2J0VA 3J81k 2F6RA 2IBMA 4LJ9A 4B3BA 4A6XA 4LJ6A 4PPQA 4FIDA 3CONA 1TUIA 4Q4AB 3OIVA 1AS0A 4LBVA 1W4CA 1JQJC 2VA8A 1A2KC 3BFVA 4KFSA 3QXJA 1P62B 1OIVA 4Z1MA 2ZRNA 3IQXA 4AI6A 3D31A 1VG1A 4OYHA 4PZZA 5FL7A 5H8WA 4TTQA 3VHLB 1P2UA 2YOHA 2UZ3A 5DNYB 3SYKA 4Q01A 3FTQA 1G291 1K5GA 2RGGA 4HZUA 4RY2A 4Q9KA 2IUTA 1QG4A 3FOZA 1D5CA 4PHTA 1Z0AA 2NZJA 4EJSA 1P75A 3NEYA 5BXQC 1SHZA 3ETLA 5AR1A 2V6IA 1A5TA 3BGWA 2AL7A 3H86A 4B2IA 1HA3A 3MD0A 3LW8A 1ZUNB 2Q6TA 4A92A 4TMXA 1ZINA 4TL6A 2W58A 3PJRA 4M1SA 1R5BA 5HZKA 2G88A 4DDWA 1CEEA 1W4BA 4B6FA 3H0KA 3QKSB 2QY9A 4V0OA 3GLGA 1XPUA 4JLOA 1XTKA 4ZIRA 4PZLA 1WXQA 1S1CA 2A30A 2GBLA 4ASUA 4B75A 3NVAA 2F43B 5AUOB 4NCNA 4W5WA 3TKLA 1UKVY 4WBSA 1DARA 3ZD7A 4TL7A 1FX0A 3ONWA 2CEAA 4ZDWA 2VF7A 4UKDA 2QBYA 4YQFA 1II8A 4FCTA 1JNYA 5FOVA 4DKXA 5KDDA 2WWYA 1RYHA 3U7GA 721PA 3FKSD 4A1FA 5KNDA 4IXNA 2H57A 1SKQA 1XZPA 5K8LA 4D26A 3RDPA 4QHYA 3CKLA 4OL0A 2FZ4A 2BIFA 2ZVPX 3QEOA 1YVDA 1M8PA 3SS8A 1BO6A 5EE3A 1SVIA 5GJVC 2WAXA 4EJSC 3SYLA 2HLDD 3B8HA 1VIYA 2FA9A 2WPDA 2A7QA 1NIJA 1AS3A 3B1YA 3U3MA 2J41A 3K0FA 2XSZA 2AWOA 3MLEA 1XX6A 5DISB 1HV8A 1OXUA 3GP8A 5CYOA 1Z6GA 2PLRA 4FCWA 3SJBA 1RC8A 3EZ6A 1NRJB 3OEEA 2EWWA 2W6JA 1QHYA 2A78A 1QRAA 2YWFA 3N70A 4ZDIA 4KFTA 4NL4H 3GLHA 3FDIA 3TJZA 5FH9A 5KSYA 1GZSA 2OZEA 2J5XA 4Q4JA 1FTNA 1M7GA 4ZDKA 1MO3A 1KO1A 3DKVA 3A4LA 3IO3A 4ZV4A 2PX0A 1Z28A 2QAGB 1PLKA 2XJ4A 1FQJA 1NN1A 4IVQA 4AYWA 4DEYA 1A7JA 2FEMA 4YC7A 1CJMA 1F2UA 3GJ5A 2ZS7A 2N46A 1N5IA 4GFDA 1NIPA 4ITRC 3U2QA 4ASUD 1Z6TA 5EUQB 3EA0A 2F1RA 1CS4C 2ZJYA 1P61B 2VTKA 2RGCA 3IPYA 3MWKA 2QPOA 5EXSA 5EZ6B 3PV0A 2P5TB 4DUGD 2JLWA 1NY6A 3CZPA 3R7WB 2XXAB 4FI3C 4HB4A 4UNRA 2OHFA 1I2MA 3QPWA 3SEAA 2J7PD 3A1UA 4KLZA 2JEOA 3KKPA 4RJLA 3TK1A 3X2SA 5A4JA 4BLOA 2O8DB 1G4AE 2GRJA 4G3XA 1FOEB 2OEPA 4LV5B 4HUQB 4KSCA 1F5NA 3KX2A 4PC1A 4UXJA 3AM1A 2FDCA 3IHWA 2HJGA 4DDTA 5AWFC 3T1QA 4FMCF 1XCGB 4PO8A 4S2EA 4AG6A 3DKPA 3OIWA 2KB0A 2IEZA 2CLCX 5CIQA 5H70A 5DGXA 2WJGA 1Z06A 3C5CA 3RRNA 2OAQ1 3KKOA 1OPXA 1E32A 1O3YA 2QROA 4K81B 1T8UA 2ODBA 2PMDA 5L3SB 3U7EB 1Q22A 1TNDA 4E07A 3EC2A 4HAYA 4K8OA 3GJ3A 2HT1A 5IK2D 2OBMA 1KKMA 4LUCA 4TZ6A 1AKEA 2Z0MA 4TQAA 1II0A 3ADBA 4XSHA 4ON9A 3PQCA 4YMWA 1T8TA 1M7HA 2JJ1D 1KOFA 2K5UA 2ZVQX 4B3XA 5L3QB 1B0UA 2ZQ5A 4A9AA 3DM9B 2GCNA 3C41J 4W9MC 1XEWY 1HT2E 4KVAA 1JPJA 1QHGA 3NIBA 3GLIA 2WHXA 4BWYA 1SVWA 3VKGA 4HI0E 5FFMA 2J0SA 1RFLA 1T0HB 1D9ZA 4M1YA 4OK6A 1Z63A 1TQ4A 4BPBA 4Z51A 1RRGA 2I4IA 2WAYA 4H1UA 3LXXA 4PANA 4RKFA 2CVFA 3C8UA 4CGZA 3PCRB 4D0NA 2X19A 5BW8A 3DZ8A 1SHKA 3LQRA 4FINA 2WWWA 4RD0A 4TMZA 1JQLB 2WJYA 3A6PC 1UKZA 1NMXA 3K70B 1GOTA 4LCBA 2JA1A 2CK3A 1IN6A 2YINC 2C03A 2ZE7A 4B44A 4AG5A 2W6ID 3LDAA 1G1MA 3SDZA 2DPXA 2QRNA 2WKPA 5FI1B 2BOVA 1MR3F 2PH1A 4BFWA 2IF2A 2P6UA 3GLHE 1XFAA 4JLNA 3VR4A 1KDRA 3QY0A 2V3CC 1Z5ZA 3NBXX 2O8EB 3CO5A 5KHOC 3W5JA 1ZUHA 2ZIAA 3G5UA 2BMDA 3OIYA 1WMSA 3ZVRA 3RLFA 2E1RA 1NBMD 5EXTA 4AK9A 1O87A 2REOA 1XNJA 1E4VA 2EW1A 1JEEA 5KSPA 3LQQA 3GPLA 4Q7MB 1U8AA 4MH0R 1LS1A 4IOLA 3OF5A 2IHYA 4OBEA 2CE2X 3CWZA 4LV8B 2BHRA 2DCUA 2NZ8A 2ZR0A 4NKRA 5FTLA 2KBFA 2LCFA 1C4OA 3BB3A 3REGA 4TT3A 3K1JA 1FL9A 2WOOA 1E0AA 4TWZA 4EPXA 5TV2A 2Q3HA 2ONKA 3R9IA 2CLSA 4TMTA 1DTSA 4G1UC 3K9HA 2D7DA 2VQSA 4C0AC 4B34A 1XEXB 3A37A 3VNVA 5HCIA 3W8NA 1CP2A 4JLKA 2LKCA 2BMEA 1P72A 2IYLD 3AKCA 1J8MF 2XX3A 1JR3D 2ZR9A 1SZPA 2ZSEA 5DLQC 5K8TA 1N0UA 1X1RA 2D62A 3N2IA 2VP9A 3AP1A 4M1WA 4A4DA 3KZ1E 4ZIRB 4BRUA 1RE0A 5IK2A 4U5XA 1ETUA 1SVKA 2JLXA 3K53A 1SULA 2F43A 2ZANA 1E1RA 2GZDA 4D80A 1IAQA 1G7TA 4N0DA 2QTFA 1VG8A 1XB2A 1KDOA 3HR8A 4QRHA 1T3SA 2VF8A 4LY6A 4BZQA 1U99A 1ZNZA 3I72A 3REFA 3R9XA 3GFOA 3AVWA 4G5SA 4BLSA 3QIAA 2ZE5A 4TSFA 2IS6A 3GJ8A 5FTKA 3W5IA 4V0KA 5LBIA 4JT2A 1NMZA 4TTPA 2FZLA 1N6KA 4PHHA 1ZNXA 2UVQA 4ZKEA 4D6PA 4V0LA 4LI0A 4F4JA 3SZRA 1D9XA 1QHHA 1Z6YA 1XZQA 2ZAMA 2QNRA 2FF7A 4ABYA 1VCMA 2J7PA 1FW6A 2QMHA 4QM7A 1PUJA 1TQ2A 3GFTA 3B7GA 1KO4A 3AGPA 4MGIR 4QGGA 2C04A 2WJHA 3UG6A 2ZU6A 2PZFA 2E9SA 2PMKA 2DFLA 4FCVA 2XTZA 3IDQA 4NYMR 3NBFA 1XMJA 1RJ9A 3L0PA 3LLUA 1U98A 3E70C 1G6OA 3BAFA 1WB9A 4U02A 3A4MA 4UNPA 4R7ZA 1MABB 3NHBA 5AK0A 3TSWA 1N0VC 1OW3B 1OFIA 4CT4B 1J99A 4MRPA 1E4YA 2J0UB 3FPAA 2DFTA 2Q3FA 4M9QA 3WNCA 3QPVA 2UZIR 2PZEA 2IYRA 1P2TA 4DCSA 4R2HA 3HPQA 2EFGA 1ZM3A 4YMUA 3G0HA 2HYIC 3U3RA 3QENA 3TUJC 5H68A 1E2KA 2BWJA 4Q02A 4POAA 3PENA 3FHOA 2ZJBA 4N0EA 5C2JB 2J0QA 3IO5A 3QG1A 5EP2A 2QA5A 4AYTA 4U7DA 3P20A 4A2WA 1H8ED 4PX9A 4R98A 2QTHA 5JWHA 2O52A 5SZIA 3VQTA 3GLGE 2VBCA 3SQWA 1E2HA 2O0HA 2IC5A 421PA 1SVLA 4DLXA 5KPJA 4HB3A 2IEYA 2BBWA 2IYWA 4P31A 1AS2A
chains in the Genus database with same CATH superfamily
3UWDA 4J9VA 1YAJA 4HJXA 3RTBA 4NATA 4NMXB 1A9TA 2OHOA 1TW2A 4TZ0A 4BCCA 3D1JA 2YMMA 4HRAA 2IXTA 1NRIA 1U3TA 3IIKA 1F2TA 1VE7A 4CM9A 1FP4B 2FW6A 4KPUA 2BZGA 4AXBA 4Z9YA 2EVWX 2I4RA 2FFBA 4K88A 2DPMA 4H1TA 3V4LA 1H1TA 4PTYA 4HLNA 2QP9X 1Y1RA 4AY2A 2ORED 3S2EA 1CT9A 5KYNA 5HK8A 3T5CA 7ADHA 2HBQA 4COOA 1KJ9A 4UUQA 1JQEA 5LJLA 4L5AA 3U7QB 2HA3A 1OZGA 3A7EA 5IJWA 1E2DA 2LDXA 4B33A 1K0UA 4GPAA 3QEBZ 1LPNA 5DYYA 1ZDMA 3S44A 2C5HA 1NQUA 1N2ZA 3WLNA 2REXB 3N75A 1GRCA 3HYRA 4MQMA 4PZDA 3GOHA 3WK6A 3HRHA 1FBTA 4ML3A 5I9IA 5K0CA 3FHTA 2XOEA 2B4AA 4NEQA 4J76A 2EZ8A 3WE7A 3WGQA 5KC9A 3SVLA 1YQUA 1QGDA 2W9XA 3EGXA 2NX2A 3WWEA 3H9QA 5AVWA 3ZY3A 5LXTF 4UU0A 3B2EA 4RHYA 3VPAA 4M37A 1SB9A 4TTSA 4WXYB 4Q7JB 3RKUA 3T5TA 3ZOZA 4KITB 1YZKA 1ZJ6A 2HTFA 3C85A 3PVCA 4XX0B 5G0SA 4TVBA 3B12A 3P9XA 5CT4A 4K9KA 4F3NA 3EPJA 1TJPB 2VUHB 3P9RA 4CMIA 1U8ZA 3A3YA 2XYPA 2CHFA 3BJRA 3OQIA 3A27A 4DVJA 1JBKA 1GM5A 4I3HA 2WM8A 5J2TA 3I5MA 4EJSB 4E21A 1CJUC 2WFZA 3P0FA 4ZI7F 3KETA 5EQFA 3RVJA 3TL6A 3NGLA 4BCBA 4Q9NA 3C3MA 3E1GA 2J5BA 1IHXA 3M1AA 1JSZA 1HQKA 5EXPA 4RTLA 1VE9A 2C4MA 2GR9A 5AYVA 4U6SA 4BL5A 1B43A 1I01A 2ATXA 1XDUA 4BO3A 5ISMA 2XIQA 4NMMA 4KE8A 3ZWVA 3OHMA 4KAXA 3TAUA 4MKFA 4PLTA 5AI6A 3FR7A 1ULUA 3TIFA 1GQYA 3ZDRA 4E0BA 1DAGA 1MO5A 4M9SA 4IDBA 1IB0A 4DT1A 5CXSA 3VH4A 3FPSA 1HE1C 3AQIA 2XZLA 1I3NA 2HA6A 1X7WB 3X1KA 1YQEA 3IP6A 3MGAA 4RZUA 3DYBA 2ZSHA 4PGGA 5T7BA 1HT0A 3ED1A 1QGED 4FNOA 4OI2A 3RGWS 1WE2A 5I7FA 5DOZA 1DJPA 1S2OA 2KI5A 4LMAA 4WZBE 4REQB 4CTNA 1P9LA 1KI6B 3WQQA 2QX9A 3ESZA 5IPFA 2QW8A 3PBKA 1O89A 3HCOA 1TK2A 3KKNA 3PITA 3VR5H 3ZV5A 4AICA 4G0WA 1XZDA 1YT5A 2PSEA 3GB9A 2GEVA 5KQGA 1XTTA 1D2NA 2PMEA 5EMHA 1WU8A 2OXIA 9LDBA 4G2NA 1V71A 4L8LA 4IMRA 2ZS8A 5AMXA 4AZ3B 2I3DA 3DDCA 3LA6A 4EFKA 5JMWA 1IN4A 3CZRA 4DS3A 1TYZA 4RD4A 4ZP1A 4JB8A 3QU2A 3R7DA 1WPGA 3NIGB 1FFGA 1SG6A 2EBUA 4GW3A 4I4NA 4YAJA 3S29A 4CHGA 3JASA 1XA0A 2GKSA 3MFYA 2ZRQA 2X4GA 4J3FA 4MW7A 4QFMA 1XKLA 5FD8A 1YOVB 1DWQA 1CYDA 1EBUA 1E58A 3I8OA 2W22A 2IP1A 5C4MA 3GPCA 1B8VA 1H2EA 4G8JA 4K1LA 1JAZA 4MR9A 1NUHA 1AUQA 1UOOA 3GLRA 3IAM1 1C2TA 2JASA 3IH5A 2H2HA 3RARA 5I7RA 5G53C 3HV0A 3Q7SA 4P0QB 1P5ZB 2VH1A 5E7MA 1G59A 4E1AA 5A0TA 1MB2A 3O8BA 4J7XA 1VE3A 1G7SA 1C0EA 8ATCA 3LMKA 4GQAA 1WF6A 1QZZA 1E2QA 4UM8B 5D3QA 5FQNA 1DX4A 1EXNA 2EHDA 3D6JA 2YVUA 3KYCB 1BU8A 1PEAA 1WEHA 2AG5A 4MMZB 4YCLA 1FXUA 2YZKA 4PM4A 1P2SA 3TQFA 5CB0A 3PYLA 2P0YA 4GKBA 1KMCA 4L73A 3ZU2A 4BTLA 1OXBB 1RXSA 4M7OA 4EY3A 1CUGA 3MMSA 2OXTA 2OKCA 1F2UB 3FVVA 4JN6B 4DM7A 1XD2B 4LWZA 4URWR 2EEPA 4NYJR 1G7CA 4MW9A 1PJ2A 3PRYA 3QNUA 4FFNA 4LE2A 4F4FA 1CPYA 2AZDA 4WDQA 3PIRA 4GZLA 4XCQA 4Z9BA 5G40A 4BUCA 4P86A 2RK3A 3NBYC 3F6RA 4F3KA 1LC3A 1X74A 4K3UA 5JJLA 4ZHSA 1MX3A 2QAGC 2OGUA 2IX9A 3O84A 5JQWA 3HCCA 3STUA 2G67A 3IA2A 4II3A 3RJ9A 5AP9A 2BBOA 3K3PA 4J0KA 5AJYA 4OLBA 3ZZUA 4CMBA 2HCFA 3IJPA 3G6WA 1K8ZB 4JROA 3SR0A 2CT8A 4CEHB 4DIFA 3W34A 2L0XA 3BREA 3THYA 1QZ3A 3DFUA 3H18A 1WY5A 2JHAA 3DAGA 3MGKA 4KRYA 3SQNA 3JQAA 2IH4A 4ER6A 5GONF 5ALXA 4OLAA 1K8QA 1YS9A 2C4NA 1KTVA 2G77B 1U0EA 2D8AA 4WKBA 1R5OA 3SLKA 4CM8B 3WV4A 3ZXYA 1WZ2A 3ILSA 2PGAA 2Y66A 4M54A 3CU5A 5HEKA 3JYNA 3MTEA 3R41A 3Q7QA 3ZBUA 1AZTA 2MR5A 3O1JC 3NKVA 4Z4EA 3PPIA 2PCJA 1KJQA 4KQKA 4PW0A 1J9GA 5IYZA 3VDXA 1RR6A 4MIEA 3Q3JB 1IVNA 2Z4RA 4Y2UA 2V7PA 3WGJA 2MT9A 5TGDA 2C4UA 2OHJA 2IZ1A 2SCUB 1LPOA 2XRMA 4C3VA 3O38A 3OTWA 2DFVA 1THTA 2HLNA 4R8KA 5IXSA 1ODSA 2FPPB 1ZJWA 2XMGA 4R2WA 4ZCMA 1NI3A 3THSA 1GVNB 2HXYA 3SX2A 1T4GA 4OMDA 5JZVA 1CSEE 3UH0A 1ZI9A 5KBYA 1RKUA 1OGYA 1C14A 5CTAA 3RW9A 3D43A 1BDJA 2IPLA 5IAJA 3U4GA 2J9YB 1WM1A 5L51A 1KF0A 2GK3A 1BXKA 2WB2A 2YWGA 1RBYA 3BDAA 1TC1A 2QD1A 3C6YA 3C6KA 3ZX5A 1TYBE 1KI2A 3FNBA 4NMHA 4KK3A 4TLMB 3ZXXA 5C8YF 4WAUA 3T3OA 3RUFA 3EZLA 3TJMA 3HCEA 2A5JA 1XROA 2ROQA 3CH5A 4ZVUA 4YJHB 3ZW7A 3WGLA 4PXYA 4ZQIA 1KE1A 5FRDA 3FRHA 5HJEA 2QZJA 4AJHA 1SU6A 3EF0A 3W05A 4CG3A 2G3YA 2ZE6A 2GJSA 3L4EA 1ADBA 1BWRA 1DPGA 1QR6A 4PN7A 2P40A 3BGSA 4C0XA 3IT0A 4Z99A 3H5OA 2DY1A 3RNLA 4D57A 4BO2A 3OFKA 2FN4A 2N42A 3MJFA 1NUAA 1U1CA 1M6YA 1F48A 2CVQA 2PKRA 2A5DA 3BE6A 3LCRA 1D2AA 2E4YA 2J3EA 2NZYA 4IZIA 4JLMA 1QHNA 1TF5A 1A9XA 1KPHA 4BHTA 1JR6A 3TW0A 2MR6A 3ORHA 1MVOA 2V7UA 5T6BA 3H13A 3TGLA 5BSVA 3CVWA 3FBGA 4EW6A 3DFFA 2PUHA 3QJ5A 3EMBA 4Z0NA 1FS4A 4BNNA 5DNEA 3MRTA 3EIHA 4JEIA 1GFIA 3B6MA 4HNAB 4YUWA 2BCGY 5KMGB 3PCXA 2AQHA 3GIWA 3HUEA 3MLAA 4N9WA 4ZRDA 4ETIA 1U7XA 4HQKA 3KUXA 5EJ7A 2HWXA 3IVMA 4LYFA 4GXRA 4IIBA 4IF6A 2BE9A 2FWIA 4UNSA 5KYWA 1JIVA 5KZMB 3TZEA 4ACAA 3CEMA 2IYXA 2ZYGA 3OOWA 4UCWA 4P9NA 4XM0A 1H0HA 1XDDA 1MP0A 1RLIA 3GYBA 1DV2A 3R09A 1NLYA 2GJ9A 2CNOA 5FPHA 3VR4D 1RQ7A 2AQIA 2FPXA 5LB2A 3OTHA 3UG7A 2JJYA 4FFDA 3WNVA 2GB4A 3L4JA 3LIPA 4OP2A 5LZ2A 3M4YA 1SFRA 3L8DA 3UXHA 3EH2A 4DY4A 1R37A 1AE1A 3ER6A 4I1IA 2DPHA 4OD0A 2R00A 2YDXA 4ZHQB 2HCBA 5DH9A 1Z4KA 2UV8A 3PPWA 2ZSFA 2F90A 3K8ZA 3WYEA 4HH1A 1RXUA 3H0EA 5K2OA 1BD3A 3M4NA 1KEVA 3HN2A 4DJFC 5KVAA 2A9QA 2RHCA 3KV3O 1SZJG 1TC2A 3U3DA 3VYSB 4QG7A 4D4GA 1C7FA 4M99A 1E0KA 2X0JA 1MH9A 2QUIA 1C8VB 3DLTA 3IAEA 5LQUA 2GF2A 1QO7A 1Q3KA 4WUTA 5ERYA 3EIWA 1GTSA 4Q19A 2I91A 3ZI7A 2O8CB 2AD1A 1UEIA 1KBOA 3KUDA 4ERXA 2P1RA 4M4SA 2ZUBA 1UFVA 3SNKA 4C04A 2LGJA 4HX5A 2OVBA 3A6LA 2FE1A 3FVQA 4GOMD 4Q1EA 5F5NA 5L40A 4A8JA 3NCHA 5AK4A 1L4FA 1UZUA 2R1ZA 1EX7A 3IAM6 4N01A 4EATA 5KU1A 1SQ6A 4FT4A 1SC6A 4FGWA 5D7BA 4C2UA 4J2TA 3KR2A 4FWBA 5JXJA 3AEXA 4EKNB 2Y4OA 5ALNA 4KN6A 4MV3A 3VZDA 4UUMA 1BS1A 3WGMA 1W5EA 3D6FA 4I55F 1CUIA 1WD5A 4QLOA 4RLFA 3EY4A 3ZIAA 3CH4B 5HDBB 4KE6A 4DAEA 2H54A 4KVZA 4PG5A 2XKBA 4A2PA 3GGOA 4JLPA 2IITA 1CY6A 2JFPA 3D6AA 1ZL2A 1ZXXA 1J24A 3G82C 4EQ6B 5AO9A 2I8CA 3KSAC 5T3YA 3SWWA 3AETA 3GGJA 3P26A 5CFQA 1DIHA 1OFUX 1I6MA 1VA5A 1SVMA 1TIPA 2AN9A 3HA7A 1ZGCA 2G1AA 2FW0A 1I94B 1PYOA 2AN5A 3KJQA 1YBHA 4PRLA 4N5IX 1DT3A 1RIFA 3VR6H 1Z0UA 1YUMA 1OZ0A 3JQAD 4LJ4A 3UANA 5ED4A 3RYIA 1B3RA 1IRXA 2WEKA 1GZ3A 4TQGA 4EKIA 5HIKA 3RRYA 1EEXB 1ZRMA 3I76A 5IKMA 1RWOA 2DKFA 1OI2A 2L17A 3PT9A 2AR7A 3TNLA 5A4IS 1U3WA 1E1RD 3WWCA 1FC0A 5LIRA 1J70A 1Q1QA 4FUQA 4KXWA 1BKDR 3BPSA 2QGFA 3NFYA 3SC2B 2VWGA 2JGEA 2VLIA 3GRFA 4LSMA 4XOIA 3E35A 2C7VA 3H9JA 2HZ7A 2AJBA 2W98A 3NAGA 4Q4JB 5F98A 3AHHA 1DKOA 1U3UA 3HBFA 1E3EA 1E9BA 1JJAA 5BVHA 5JSYA 4QVGA 5KTPA 3NR2A 3V3KA 2ZJZA 2YFYA 4YRMA 4D9BA 1VJTA 2E5WA 2ZWVA 4EVRA 2OUIA 1GGHA 1VIAA 3EC1A 5K3CA 4NFHA 1M7BA 1SBCA 2O5RA 2M9MA 4O2AB 5BP7A 1YU6A 3TLYA 3BVPA 1S2NA 1RP1A 1U6KA 3BULA 3E58A 3INRA 5CRIA 1M74A 2WV7A 3T7KA 3QUCA 3ET5A 2QPTA 1X6VA 3GLKA 1H2WA 4EKEA 1GFSA 4OYYA 3MG9A 2XE4A 3L6BA 4RK5A 5LOVB 1C9MA 1LRJA 3USZA 4E94A 1SIOA 2K6GA 4KXQA 5IC4A 3SQMA 3AV0B 2A7XA 1DADA 4HUQA 4D0SA 2CC2A 1EFRA 4UHCA 2PL1A 2QDXA 4CQMB 1Y6GA 3Q2IA 2XDQB 1S2DA 3EHEA 3W9BA 4PSVA 2D2XA 3B13B 4OGFA 4TKUA 3TZHA 4C4ZA 4EUFA 4OLJA 3LYHA 2O3RA 4NARA 3UXYA 4BGEA 4HLDA 1RKBA 2XD4A 2P2CA 1ZD1A 3AG5A 1HNZB 1Z18A 4KBYA 4KWIA 3GFSA 5JXIA 4RM2A 3E6AA 3BWEA 5FNVB 1ST2A 2WAAA 2P9TA 3BIOA 1DG3A 4KZPA 2XVMA 3WGUA 2FN8A 4EECA 5C5EA 4BJ5A 1C9NA 1XV5A 3EWNA 4NS1A 4E70A 2EFJA 1K5PA 3BWVA 3L82B 5DNDA 1NMYA 3NG1A 1JEDA 1TCVA 4IWNA 2I3GA 2PT7A 4Q4AA 3CZ4A 1J33A 4DGSA 5D84A 4YNBA 3WAKA 2ZI4A 4MI1A 1O6CA 2NV0A 4M9UA 4XGIA 2PSSA 3SF8A 3TRFA 4CFYA 3HB9A 1V7PC 2FR8C 4D4JA 5AHOA 4HO1X 1IL0A 1IG3A 2MSWA 3DTVA 4FN5A 4JQOA 3OZAA 2YZMA 4MW6A 2ILVA 5C8YB 2F55A 4EDHA 1SVSA 3NTLA 4YRRA 5PGMA 5JPDA 4BFTA 3U1BA 5IABA 1RQLA 1FW8A 2AG1A 2G28A 3L0ZA 2ADOA 5ICGA 3OJEA 2FPGA 3DMGA 5CLJA 4I81A 4KQ2A 2W2KA 3BGVA 2Q7OE 3BXGA 4L50A 3PQ6A 3RRMA 2VJYA 2V6FA 4EENA 2WA2A 4KDFA 5ESWA 1OU0A 3A6HA 5LYJA 5JNRA 2ZATA 4IXWA 1M8JA 1RBZA 1PZFA 3ELYA 5AJTA 2JAQA 4Z1MD 2HDWA 4ETWA 4CETA 1CZRA 4JYAB 5FO1A 3ZV6A 3PUZA 4FEYA 3H7IA 5DYIA 1T8RA 5CJPA 4C4OA 2Y9PB 4V39A 4HS4A 1E0JA 3ND5A 3OESA 2WF7A 1YZNA 4DLUA 3RYFB 3GZ4A 4AJKA 3HVJA 4PYNA 2ZIVB 1EUDA 1YQTA 1RTKA 2I3AA 2Z4SA 5H80A 3HB4X 3CUSA 1S3SA 3QV1A 4GPIB 1IXKA 1Z68A 4ZT7A 3GROA 1R4MA 4DKJA 5FTMA 1LPAB 2JLCA 1O6ZA 3CO0S 2QQ5A 5GONB 4XD7D 2OLEA 1B3BA 2ZQZA 1P81A 5J47A 2XXBA 2J3KA 3U16A 1ZCZA 3ONFA 2XT9A 2XXJA 3ZV4A 1IHYA 1XNGA 1DLIA 1TAHA 3G9XA 3MFQA 5AIAA 2I1LA 5AOAA 4CKCB 2X58A 4JS0A 5TX7A 1SU8A 1GJRA 4PICA 3SMVA 3B6EA 3GAFA 2DJ5A 3X3HA 4UTPA 3LKDA 1RM3A 1PE0A 4W1QA 3KAJA 4R1OA 3D4IA 5JANA 2W48A 3T15A 3TEFA 1XHFA 3UWKA 3O9VA 1XKQA 2WU4A 3I6ZA 5CVUA 3R5JA 1REQA 2GNOA 4RF2A 1ZZGA 3VVMA 1M0WA 4EOGA 4HVLA 2NUTA 3L7AA 1ZMXA 4URXR 4C07A 4M1EA 2FY8A 5F2KA 3IQIX 1VGQA 1ZIXA 3HU1A 4OJQA 1KARA 1Z5OA 4NBKA 4OTZA 4E12A 2QSYA 3HO1A 1B6SA 4FFBB 4PC3A 4BB6A 2H92A 4B4VA 1HETA 2ATIA 3ET4A 4GR9A 1ZUWA 4YJ2B 1SOVA 3K09A 2P6RA 1LUAA 2ZSIA 3EH1A 3DL0A 4MW5A 4PO1A 4TRMA 1KETA 1R00A 1FMTA 1TGVA 2HWUA 1OXMA 5H59A 1YJAA 1XWWA 2ZE8A 2ZRCA 2JLQA 4WN3A 1EUZA 4DNPA 2VDUE 3DVSX 3JZIA 4BNHA 4BLTA 3VFDA 1Y8RA 4I6GA 5E1BA 3OQJA 1YR7A 3LF1A 2FP4B 4PC6A 4JI8B 2HJVA 5GQSA 4N03A 3RAJA 5LNK6 2G5GX 1QV9A 5JYCA 3ZBTA 2YMQA 3N74A 1I7SB 3O94A 2AHOA 2J6HA 4OYLA 5EHXA 1SK9A 2J9XB 3BD6A 1XQWA 2AQ8A 4FZVA 4JBNA 4II2A 1H65A 1TQDA 3UGJA 4DR1B 3X1WA 3OEYA 3FGOA 4F06A 5IFLA 1KU0A 3KFXA 4EPVA 1GEGA 3MCTA 1MO2A 4TTIA 1NLUA 3LXRA 4MVYA 5DM1A 4BNJA 2AJ8A 2DT8A 3IALA 2YV5A 4JVOA 2HV9A 1XKXA 3AH8A 5E7JA 4DBLC 2NWQA 3RC2A 3PCTA 1IJFA 1H9AA 2HQ1A 3CM0A 4O4HF 2HTEA 1IZ0A 4DNOA 2NPIA 1F8XA 3UK7A 4WCFC 1AKNA 3GT4A 2A9RA 2IU4A 2P0AA 3AVTA 3AC0A 4YR9A 4HGOA 3WQSB 1U9JA 4AO6A 2YZ2A 2UXCB 4MRMA 5K4GA 4NEHB 1ONBA 3IRUA 2C7PA 1FJGB 3MJ4A 3LYUA 2D4HA 2Z9CA 3MTAA 3A7DA 4D3ZA 1AU9A 3QVUA 5A5DA 4XGNA 1XZHA 1Q0TA 4BGIA 2PXAA 2YOGA 2GAFA 2HSJA 3D59A 1I2ZA 4HYYA 4ZVMA 2FZ5A 4C9BA 1JMKC 4DLWA 3D7LA 5A02A 5CA1A 3PWTA 4OFXA 4HDSB 3JYHA 1XXLA 1OXXK 4IGFA 2VK1A 3I6YA 1TJNA 2C9YA 2P3OA 2ZITA 2O8FA 4AM8A 4BEJA 5BUQA 1CKEA 3NX4A 3S1LA 1GARA 2Q9BA 1N9KA 2IYUA 2W4IA 3C1UA 4YPVA 4IDCA 1YTUA 4FIZA 4X1IB 2YCLA 4LF9B 1G5RA 1SUPA 3THXA 3RVQA 2X6QA 4NBWA 4ZAYA 3L1JA 1O6FA 4JLUA 4CKBB 4X91A 5HW0A 3VR5A 2EF0A 3E5RA 4E5NA 5M34A 3TRKA 3QLTA 1V8OA 2X2EA 1CUJA 3U3KA 5H3HA 1GU1A 2WT8A 3M0EA 2H5LA 1MXFA 3CX8A 3UZUA 3VH3A 4ND4A 3JAWA 1NU6A 4IVNA 4OBBA 4G36A 3EXAA 2NO9A 3W4IA 1FPQA 1Y7HA 3BFPA 2NVUA 1B8UA 3V9PA 4CXMA 4BNLA 5DZSA 3R44A 4K6MA 5DP2A 3SDBA 1UJCA 1Q0RA 4DUYB 4M36A 1LTQA 2P9QA 3DLHA 3CISA 1UADA 2D0PB 2QYOA 4RL4A 2Y1DA 2QU8A 3L4KA 3VNUA 3VJRA 3ZQUA 4GPBA 1JA9A 1TECE 1YS4A 4PYKA 3UMYA 3OX4A 1FQOA 2BJVA 1KZGB 3H5NA 1Q20A 1V3QE 1DTEA 2IE0A 1A1SA 1OC2A 2NADA 3CT4A 2F3TA 3OOSA 5LUBA 4AC9A 2PT6A 5A6VA 2BEVB 2VP6A 3DF9A 3I2KA 3TB4A 3HDYA 4RFSB 1H05A 4XDGA 2W7TA 3IQWA 4JBWA 5DLYA 3B2NA 2JI8A 1JT2A 2AE1A 3VKWA 3WY9A 3GQBA 1NX9A 1Q0LA 3A4NA 3GFPA 3L0YA 3EIEA 4HQRA 1VSVA 4JLVA 3VNAA 5EWJA 4W1PA 2RAVA 5IT9A 2GD2A 1QFXA 2BFDA 5E7QA 3BS4A 1JSRA 2DFKB 3VX3A 1NM5A 5DTMA 3Q0IA 3HDQA 4EY4A 1YR9A 4GUDA 3AUYA 1QX3A 3N2KB 1IUOA 3W3AA 3TB6A 4PG6A 3EBPA 1YE8A 3HCBA 2ZRAA 1W96A 2VYFA 5ILQA 4HRYA 3CB2A 3ABSB 3MHTA 4I5FA 4MUGA 4B3MB 5BSEA 3JQ6A 4PV7A 2O5VA 3A6FA 4P5EA 1PR5A 4ZCLA 3FPKA 3W2IA 2VP4A 3I2FA 1TM2A 3WLLA 3FR8A 1ZRNA 1TM5E 4B7XA 1LVGA 4DMRA 4LJ5A 2GJ4A 2B92A 2FWBA 3FROA 3EZ2A 5D3MA 4ZOCA 4KWCA 3TCXB 2AK3A 3HLYA 3K32A 5G0VA 1UT5A 4GQBA 4AX4A 1BYIA 3QZUA 2HIHA 5I7EA 3D4PA 4I4TA 3RV3A 3AR2A 1JVBA 3TSCA 1QQBA 1JXMA 1WHSA 2F9MA 5KSZA 3PGXA 4IAOA 2YHIB 1YDHA 4JUDX 3V2HA 2GPWA 3OQMA 5B3JC 1GPMA 1D8TA 1GPH1 4X3OA 2EKQA 3SKVA 1PFQA 2OECA 1DNPA 4F38A 5A2QA 1A1VA 1CEYA 1LWNA 2NO6A 4WBNA 4FU0A 3AUJB 4ZOLF 4AZ0A 4YYZA 1UXKA 4CM6A 4N8SA 1KYYA 1WVGA 4CQMD 3FFWA 1NQWA 2KSQA 2PK3A 3D7NA 2O2HA 3EXEB 4LC9A 4MVJF 4FMPA 3BE4A 4LJAA 3AEUA 5GADl 1N92A 1H6CA 2OV3A 1D8AA 2GCIA 2QNBA 1X1TA 3CN7A 3ZU4A 1RLMA 4BMXA 4DRYA 4YRAA 4QOJA 4B0PA 1GGNA 2G6TA 5JU6A 1Z56C 1JMYA 2VDWA 5KKAA 3V8VA 3VKHA 3LWBA 1NZFA 3IOCA 2P62A 3CEPB 3PXDA 3VYUB 2XHEA 3N8NA 1KXZA 4RORA 3U49A 4B6GA 3PUYA 1Y9AA 5AHXA 1L5FA 3ZNNA 1WZUA 4LHVA 2Q0XA 4JODA 5D86A 3JXEA 4ZXPA 3LSTA 3SI7A 3ZWWA 1WU7A 5IH7A 1DAOA 1ECBA 2ZPAA 3L2OB 4KI7A 4FN4A 3PC4A 2I9KA 3ZK7A 3G59A 1NVKA 1EWKA 4DR3B 1LD3A 2QLBA 2ONYA 3DPUA 2NUAB 2B1RA 4GQIA 4HZGA 3VKUA 3LDFA 1JVNA 4OAPA 3M4ZA 5F1KA 1OX4B 2CF6A 3TKAA 5CDFE 1JEYA 1QG0A 2YMLA 3EODA 3PYXA 4RD2A 2WTXA 4RWEA 1DRVA 3UK6A 2G0NA 3VNSA 5SY4A 1KVQA 4PYQA 5JAHA 1H2HA 1PD0A 4D9IA 2JATA 3T4UA 5B58T 2V1UA 3KFVA 1VXRA 5K0NA 5F9HA 4AJEA 4QPJC 1GG2A 5KDOA 3OECA 3A6EA 1Y6QA 1JHVA 2H48A 1L4LA 4O3FA 2CKDA 5C8DA 3FB4A 3S1AB 8AT1A 1NXOA 1C1DB 3H5TA 4HFRA 1H8HD 3PFKA 3A1FA 1TEHA 3G88A 2NYRA 5COBA 4F9GA 5G1NA 3U44A 5F1YA 4RVDA 1Z7WA 2I6GA 1N3LA 1I4EB 1XQYA 3VOBA 2R6FA 1RVV1 1RIIA 3QXXA 2L69A 2V7VA 2QD3A 3FAZA 2E5FA 4R5MA 3LQFA 1JQAA 4KACA 3V1UA 4FGUA 2BFBA 5JS8A 3WB2A 1C4WA 5TLSA 1AZSC 3CLTC 3A28A 2IY7A 1GKKA 2PKXA 4I50A 4MYRA 4NE7A 3NM5A 4M22A 2Q4BA 3OHPA 2Y1XA 3DXZA 1WPRA 4QYMA 3KPVA 4O8ZA 1VPWA 1DEKA 3DTYA 4JBYA 2V59A 4LPKA 1CF2O 5C4IA 4J7CA 3W4KA 1XL1A 3OPQA 1PJTA 1YZTA 1LF5A 3KWFA 3EAQA 4H3HB 3AWDA 1L6IA 2ZI7A 3JCZA 4AU1A 5KNBA 2ZZNA 4NC9A 3W2FA 2X4DA 2GN9A 1P73A 4G4JA 4ID3A 5B30A 3L8FA 2YJ3A 4EG6A 4RGYA 3U7JA 1GKYA 4IDQA 1H3NA 2BI7A 3EVAA 1KSFX 3EMVA 1KRHA 4KYUA 4JLBA 1XU7A 4M0CA 1EI9A 4ES6A 3EUFA 2HBRA 2R2AA 4QC2A 4UBLA 4EX7A 5IJ9B 3HEAA 2ZULA 1OSNA 2YXPX 5J23A 1G98A 3A6ZA 3NMUF 4WUVA 3TOXA 1H5UA 4FS3A 3QELA 3LL4A 1NVAA 1TPZA 3RO7A 3DBRB 1T34A 2FG5A 3I2HA 3VHXA 5LXTA 1JIUA 4X60A 1FK8A 5CLGA 3BHMA 4ZEWA 1X7GA 4ZZ3A 2C5EA 3CZAA 5HKLA 3DM5A 3H3JA 4MJ3A 1EWVA 1FYVA 1RWMA 4J43A 2JANA 3E8SA 4EELA 2GZAA 5ECWA 3UC9A 3E3AA 4OY3A 1T15A 4OHMA 4TM8A 5TT0A 5BWOA 5M5BA 4Z9AA 1I2AA 2P68A 1FU7A 5GV8A 2FQXA 4AZSA 4DLZA 1QDLB 3K70C 3U40A 4G07A 1ZJJA 4DV3B 1JJ7A 3CVXA 1OREA 5AOCA 2O0LA 4N3NA 1PZMA 4RZXA 3TD2A 1JWAB 2PU5A 2Z43A 1OMOA 2PUWA 4E5UA 4EJ0A 2CJXA 4QLBA 1TM7E 3M70A 1TCUA 3HN6A 1L7OA 2W6PA 1TEXA 3AI2A 3IEIA 5H7XA 2OHIA 2JFYA 1KC3A 2IW1A 1AQNA 3PR1A 2Y1GA 1OKKA 1W5TA 2QLLA 4NVRA 4D98A 4B5KA 1ZGBA 2FDXA 2YS7A 4Q48A 4TUYB 3ZHZA 4R68A 4M98A 4BLVA 1D6SA 1Y3AA 4ATNA 3MIIA 4LF8B 4YDRA 4F3CA 1ZGZA 1VM6A 3PL5A 1XQ1A 4ERNA 1OI7A 1PG5A 1H22A 2EFDB 2DGDA 2WYIA 3IQDB 2JIZA 4ME6A 3BRWA 5A03A 3DBIA 3EQ7A 4PYJA 4A15A 5F9FA 3FTEA 1I1OA 1U2DA 3G0OA 5CGQB 1VTKA 2X2PA 2C5LA 3SYRA 4CCSA 2GAIA 1DWOA 1QS0B 4MGYR 3Q8XB 4AP6A 1V11A 2AZ4A 2ZU0C 2Q1UA 2XNSA 2XYRA 3KSZO 4L0DA 5DK6A 3V4FA 1GQ2A 2VNJA 5CT5A 3W2TA 1R8XA 5C80A 1O95D 2POCA 1JG4A 4KIUA 3L8CA 5LB4A 4M0PA 1EXWA 2KM1A 1CUFA 2Y0DA 5JASA 4CR7A 4H2DA 2SBTA 4M86A 1H1LA 4EI2A 3HWRA 4DNQA 1ZA1A 5JATA 1JEAA 3IPCA 4XWWA 2BM8A 1BNCA 4EY6A 4N9QA 1ISIA 2VSYA 5B1SA 3A0RB 3RREA 3Q7EA 6GPBA 1VMIA 1YWGO 3WXBA 4BLWA 4PG7A 1GA6A 2GM4A 5ITZA 5ED0A 1XR3A 5KYTA 3F9RA 1L4KA 2AW3A 1QKKA 4B6QA 1TYAE 7MDHA 5FWNA 4ZYUA 3JTEA 4EYQA 2YASA 2YIJA 4UREA 4J91A 1O03A 1DC4A 4DCCA 3PHJA 1GGEA 5I5EA 2RC6A 3DL2A 3N0RA 3EZNA 3NHFA 4CTOA 1Z6ZA 4DTCA 4DCMA 3OF2A 4HBZA 3AFMA 3CG4A 3I1JA 3R8CA 3RSSA 1UBHS 2DTDA 1LRKA 3L06A 3GNTA 3O5AA 3OX3A 4X5OA 4NBRA 4NPAA 4PZEA 1G6Q1 1WX1A 2OFOA 2E87A 4X1KB 5LFAA 3VO9A 3PEWA 2Q5LA 3INYA 1D0IA 5EJMA 4PSCA 3QXSA 1YKSA 3L7DA 2TRSB 4G5YA 4HLUC 2EKLA 3LUKA 1H0KA 4M1QA 2O9JA 2ZWAA 4EB8A 3DNFA 2BCEA 4D44A 5IJXA 1C1XB 3F6YA 1K4MA 3TIIA 1LI5A 4LXUA 3QQPA 2F8TA 4O2AF 1XMOB 2P78A 5CHEA 5BQOA 1QHXA 1ONSA 1VE5A 4C6TA 5A5VA 3AKYA 4JD5A 1UF9A 1XRRA 1ECCA 2ZBVA 2Z5GA 1VP9A 2CNKA 3H6GA 1E2JA 2GETA 1I4OA 4I66A 3FCCA 5JCZA 1L5LA 4RENA 5EKXA 1T91A 5CT6A 1EK2A 1ETHA 4WNAA 2B5WA 1WW2A 1G2QA 5EQTA 4D9JA 2XE6A 1NR7A 5HPYB 4LTNA 3CRRA 2RCNA 2Q4OA 4I4CA 4O4IA 4Q7EA 5HQTA 1UK8A 4HP8A 3SR4A 3ZYZA 4GR5A 2RKWA 2WAOA 5HFAA 4QJ4A 1DLJA 2ZJAA 3OAAA 2PN1A 2B83A 4BX9A 1WEKA 1D1PA 3WKEA 3ITEA 3ESXA 3WA7A 2ONJA 4AJLA 4YAGA 1JFFB 1I36A 1TZBA 3DDOA 4H9GA 2UUPA 3WHKA 1IRIA 1WMBA 4D74A 1OFUA 3FNIA 1H8EA 1PG2A 1R5NA 4MR7A 5BNTA 1LW7A 2Q2VA 3JRWA 2BUCA 3AERA 4BIIA 3EFOB 1QRDA 2JGIA 2VSOA 2FG6C 5F7JA 1AN0A 2YJTD 3RASA 3P2EA 3Q9LA 4P2BA 4QPZA 4B9EA 2A5GA 3T7IA 4ENSA 3OUUA 4WKCA 4PLCA 1T3LA 4C0JA 1IOZA 3O73A 1DC7A 4J6FA 2OAP1 3EISA 1MOZA 1GSOA 3LNTA 4OP1A 4D3SA 5HXAA 1Z6PA 1N33B 1VC2A 4QNMA 2OC4A 3HKBA 4NJMB 4YCDA 3O7WA 1U4NA 3QA9A 2VP0A 3L05A 5U1PA 2A3RA 3F4KA 5JSZA 2VSXA 4FHCA 2OSBA 2EARA 1CQJB 4M60A 1Y8AA 2QSZA 3MINB 4G25A 4YT5A 1D6JA 1ZK4A 1HPLA 2ID9A 4I0WB 5DBEX 1KDYA 3DKKA 2AFHA 2GA8A 2X9LA 4HGRA 1YONA 4LSGA 4B32A 2BF7A 1T6BY 4QBIA 3GJTA 1SQFA 1OU4A 4ZT3A 2MTBA 2XWBF 4A7PA 1KO5A 1E3WA 1W5AA 5FBRB 3TW6A 1VJGA 4DLRA 4N3GA 5FQOA 2CXSA 4A10A 2MYNA 2P0EA 4L7VA 4EGJA 3AKDA 1KE2A 2GBCA 3HU3A 1N0WA 3DZDA 1EG7A 3KJZA 4MQ6A 4X54A 5REQB 2ZXUA 2CNNA 4D4HA 3O4VA 2BGNA 3DF7A 4BFZA 1YMVA 5T67A 3A6GA 2HXGA 3VUFA 4KDRA 2FJ0A 4DCUA 2C0QA 2Q9AA 5JNWA 2M6SA 1M5UA 4TXHA 5CX1B 2NQ2C 3I42A 3ULKA 4L51A 4QE3A 5IAOA 1UDXA 3FNQA 1QZXA 3D6TB 1ZCFA 2V9ZA 3K0BA 3KJHA 3Q7TA 4IHJA 1U04A 4PPYA 3RRZA 4RKRA 3WLSA 3ZWAA 4S04A 4XYLA 3BGDA 3I9KA 4NBSA 2XMSA 4QDKA 4QHTA 4URHA 4WOPA 3JQEA 5KINB 4MS3B 4J49A 2GOYA 1RXWA 4MUXA 3H42B 4M0EA 4RQAA 3GJQA 2XVAA 3I8SA 3LHDA 1KFBB 1RJFA 4QUEA 4HDAA 1KRWA 3GVCA 4V1CI 4GVPA 4ZFNA 5DSZA 3N5CA 1T2EA 4NZOA 3WA6A 2YWRA 2RD2A 4LX0A 1PJQA 1ZM9A 5FPKA 3BRWD 4QASA 1GPYA 1VJ5A 4ZC1A 4GRAA 2XQJA 2PGDA 4OJYA 4XFJA 4F4CA 1R6DA 2HF2A 1OR8A 2BEKA 2MIIA 2WU8A 3CC8A 4M7PA 4FYJA 4LKRA 2GESA 2QTNA 1OXTA 1T5LA 4A2CA 5JNUA 4KOAA 1XHEA 2JBWA 1A9RA 4NQZA 2HU7A 3VRHA 1G21E 3GDGA 4R71A 3B1XA 4DR2B 1RQPA 1RD4A 1RT9A 3JR3A 2ZB7A 3RUDA 2GO1A 3RT1A 4PSAA 4CGYA 3H9CA 4HLCA 3AKZA 2HXSA 5KHAA 1T25A 1C3OB 2O4UX 2GEKA 2BLNA 4BNMA 1YQXA 1X7ZA 2JLRA 4EA6A 1SU7A 4MS1B 4BFSA 1ZUNA 2EYUA 3FYCA 4GM0A 1QF6A 2WNSA 4INJA 1ZUIA 2CUKA 1NNLA 3ANLA 4IDGA 1KQOA 4OMFG 3D8UA 3A1TA 2Q1TA 3ICOA 3HDVA 3ZVNA 2XDYA 2DHEA 3EIQA 1XMPA 621PA 1EVIA 2RHHA 3FUTA 3L6UA 3OFND 4GRIA 4GICA 4LGCA 2ODNA 4LWPA 2WU3A 1O8BA 3HUFA 4OB8A 5ADWA 2ZEJA 1QZUA 4IMPA 1LGYA 2JAXA 4MKHA 4EB3A 1S89A 2ECOA 2ODQA 1ZITA 3FMPB 4YGXB 3ZWPA 4C01A 1C3E<