2ZYWX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with pap and p-nitrophenol, obtained by two-step soaking method
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
289
structure length
289
Chain Sequence
DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshot of a Michaelis complex in a sulfuryl transfer reaction: Crystal structure of a mouse sulfotransferase, mSULT1D1, complexed with donor substrate and accepter substrate
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Tyrosine-ester sulfotransferase
total genus 105
structure length 289
sequence length 289
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zywX00
2JAQA 2PZFA 4LGMA 3MWJA 1VHLA 2JJ2D 3EG5A 3AF4A 2IUUA 3TR0A 4BEBA 2XZLA 4QNRA 4YXWD 2F9LA 3T1OA 1R6BX 4DZZA 4ZI3A 3RRYA 4JT2A 1VTKA 2OV2A 2P3SA 2WJVA 3BWDD 1DAIA 5DI3A 2IWHA 1AIPA 4Y0VA 3U3OA 2PL3A 3W3ZB 3WRYC 1Z0JA 2F9MA 2OBMA 4WAUA 2CK3A 4Q4AB 4LI0A 1Z0IA 2O5VA 4K81B 2QE7A 4HLUC 3GMTA 2RGBA 3K0FB 1XD9A 3GLFA 3I61A 2VHCA 3E2IA 3A37A 4JYCA 4ASUA 4DB4A 3THWA 2BMFA 3GLGB 1OF1A 3LXXA 5CB8A 2DB3A 4JKYA 3BGWA 3VU9A 2Z4RA 1XPOA 3ND8A 3EC2A 4QJ4A 1UKEA 2PEYA 5AJVB 4BFXA 4CEHB 3GLIA 3OEED 3D3QA 3FPAA 3I8SA 4PR0A 1GKUB 1E9DA 2ZRDA 3FKSD 4YMWA 1Y63A 2XEXA 2G88A 2IXFA 4A8JA 1Q21A 4KFRA 4Q19A 1A2KC 1DADA 2BM0A 2DWPA 3QG1A 4IOLA 5FL3A 5KO2A 3FMPB 1SZPA 4WZAE 5EXPA 4DB2A 1CEEA 1UKVY 2QM8A 1W36B 3PG5A 4MUAA 3SE0A 1BMFD 3U6BA 4BUJA 3ADBA 3KJGA 2K5UA 2JLXA 2ZRFA 1N0UA 3LVRE 1GIAA 1GUAA 4UNQA 4MYTA 5K8UA 2OESA 1I4LD 1SVSA 1U8ZA 1Z6YA 2ONKA 4LYAA 1G3IA 3MUFA 4XJXA 1U94A 2H7VA 4FMCF 3AH8A 3RAPR 2AX4A 3I3SR 2FSGA 5FBRB 3TMKA 3HU3A 5FBVB 4DWJA 5A0FA 2PCJA 1TQDA 1W2GA 2XXAB 1F2TA 1PUIA 3ZIAD 4D2IA 3RS4A 4DSOA 4N0EA 1MR3F 4KVGA 3A1SA 1IAQA 1P62B 4O2LA 2NZ8A 3WBJA 4DDVA 1W44A 3ZD6A 3RRNA 2CCGA 2WOJA 2YWFA 1K6MA 2RHMA 1KI6B 3RABA 3NBYC 3EWAA 1NG9A 3VHLB 2Q9AA 4LRWA 2IF2A 3VAAA 2AKAB 2KI5A 1VG0B 2WICA 2YOFA 2F1HA 4U7DA 4U5XA 4PSAA 1KK2A 2GRJA 4DLXA 3CRW1 5TY0A 2JDID 3MCAA 3VNUA 5EE9A 2QRNA 3BFKA 2P0EA 5EXTA 2RGCA 2J7PD 3P4YA 2J45A 1G18A 4MRNA 2ZRLA 1IONA 2PX3A 1XEWX 1HTWA 2ANCA 1ZMXA 4NYIR 4I99A 2WJYA 2XOKD 3LAWA 1KJYA 1N2CE 1KI7A 1KIMA 4OJQA 4PZZA 2GK6A 1G16A 2NOAA 2XZPA 2DPXA 2L0XA 5LB2A 4Q4LA 5JSZA 5E3HA 1NI3A 1YR9A 4TT3A 2PEZA 2REXB 4QGHA 3EZ9A 3KB2A 3EX7C 4UXHA 3D7MA 5GVRA 2O0KA 2XNSA 3P26A 4M53A 1D2EA 2YWGA 3CNLA 1AM4D 4CDGA 3BB3A 3IO5A 2GETA 3AP1A 5KOYA 4CIDA 4UNRA 1LNZA 3GJ8A 3DO6A 1XD8A 2GKSA 2O8EA 3LH5A 4JBWA 4JIMA 4X8OA 4LHVA 3A4MA 1Z29A 5CM9C 4D0LB 3NEYA 4LZZA 1ZU4A 3NH9A 5HCNA 1P60A 4CF7A 1JQJC 2XSZD 4TYQA 5BW8A 3TVTA 5IRCD 1XJQA 2UZ3A 1XZPA 1E4VA 1DELA 3FFBA 3JZMA 4KYIB 2ZU0C 3W90A 2OCPA 4DDWA 2O8CA 3WMGA 1E79A 3QF4B 2LKCA 1UEJA 2VBCA 1WXQA 2ANBA 3QKUA 4IDOA 3GEHA 3CONA 2QAGB 1YR7A 4E07A 1M1YE 1TF2A 1B0UA 5EZ6B 1E9SA 3QE0A 5GJWC 1E96A 1MOZA 1RPZA 2YVUA 1Z47A 3K09A 4E03A 2BMEA 2G0TA 4RY2A 2E87A 3PR1A 2ZI7A 2W6JA 4H1UA 2Z4SA 4QJ3A 5JWOA 4DLSA 1G3UA 2ZVPX 2YYZA 1G9XA 3LLUA 4KXFB 1NVVQ 4US1R 4AYXA 4PO1A 4TZ6A 5KNCA 5EP1A 1L4YA 4GFDA 4OI2A 2GA8A 4Q4HA 3EPKA 1L4UA 2PZEA 3UWKA 4FCVA 1EX6A 3UPUA 2G3YA 4PC1A 2G77B 4FI3C 1Z0KA 1R0XA 3A58B 3SJCA 2KSQA 2GILA 4AI6A 1IY1A 4ZDJA 1X6VA 3I4LA 1UPTA 4O2RA 1K5DA 2ZRJA 2ZAMA 3DL0A 2BIFA 4TMKA 3AM1A 1U0HC 1NNEA 3ADKA 621PA 2QP3A 2B92A 3CX8A 1NF3A 3T06B 3CW2A 1MO3A 2DYKA 4DSUA 3TUZC 3LV8A 1ODFA 4IEEA 1ZJ6A 1N5IA 2CJWB 3MFYA 4XSHA 3PEVA 4BE7B 4D26A 1VHTA 3THOA 4JLKA 3NKVA 3M6AA 5KSZA 3GLHA 4GL2A 2RHDA 3JVVA 2BJWA 4MRVA 1QBKC 1FTNA 1H65A 4V02A 5D3QA 1JXOA 5JHGB 4LV5B 5DHAA 4Q9KA 1OXTA 2GXAA 3AQ4A 2QAGA 4XIGS 1Z63A 1V43A 4MUBA 3KQLA 4IDQA 4QNMA 5AUQA 1QHHB 2FE4A 1KMQA 2QPAA 1PJRA 2G83A 1RRPA 2HYDA 1MT0A 3OEHA 2BBTA 3K70C 1XXHE 3CZQA 3H0KA 2YC4C 1N6IA 4PX9A 4RD3A 2CLDX 2J0UA 3HYTA 2W6IA 1OFIA 2PBRA 3TE6A 1IHUA 1PVOA 1ESMA 1P75A 1XTKA 2XTZA 2Z43A 2ZE8A 2ZRBA 3UIEA 2PLRA 4TL8A 3EXAA 4IRUB 4TMXA 1S9DA 1E32A 1M6NA 3Q5EA 4Q4AA 1S3GA 4BWYA 3G5UA 1XD2B 1D6JA 1ZBDA 2CL6X 5EQTA 2FEMA 1XTRA 2ORVA 2IYVA 2WJJA 4A2PA 3BB4A 4C0LA 1JECA 4YDHB 3MMPA 3G0HA 1W0JA 5HCIA 4GBMA 3BH7A 4E09A 1W1WA 1VIAA 3B6EA 4MYCA 1TAGA 4Q7MB 1OH6A 3UKDA 2EWWA 4GI7A 3R20A 4M1SA 4FCTA 1KZGB 3TSOA 4EJSC 1QG4A 2PT5A 2IBMA 2J9RA 3B1WA 3Q9LA 3FHOA 4NYMR 3T1QA 4W5HA 4AKGA 1F3OA 4PC7A 4B3XA 4D81A 5DI3B 2OILA 2V4ZA 4BLRA 1KOFA 1L8QA 3C15C 2HXSA 2AWNA 4B6EA 4Z51A 1G3MA 4JLVA 3CKLA 1XX6A 4L8GA 3LRPA 4ZDIA 5CYPA 1OSNA 3KL4A 4Q4HB 4C0KA 1OYWA 1KDRA 3RVBA 1KDOA 2R6FA 2ASEA 3HR7A 3TW4A 3EC1A 2OT3B 1M7BA 221PA 4NCJA 3BERA 5HPYB 3SYLA 5FPYA 5CDFE 3MD0A 4M9ZA 1SKQA 2XOKA 3VR5A 4X8HA 2Q0HA 5GJCA 3S1AA 2CDNA 4HLUA 4XTCS 5BYJA 4PHGA 4LPKA 2NIPA 4OI0A 5DYGA 2RCNA 4BPBA 1DO0A 1W46A 2VP9A 4UXIA 4ZO4A 3O8BA 1GILA 2W58A 4D0NA 4OHZA 2IYXA 5DLQC 1S2MA 1G17A 3SHFA 2QBYA 2OFOA 1JR6A 1X8LA 3VHXA 4HUQB 4CVNA 3WNCA 3CRRA 2QZ4A 3FYHA 2WPDA 1LTQA 2GJ9A 1XMIA 1FOEB 3AKCA 3T15A 2AL7A 2ONJA 3NXSA 2R6AA 3RHFA 1F2UA 1NN0A 3FKQA 3MWYW 4TYPA 1VYTA 5E7IA 3PV0A 4Q9LA 4XVRA 2N1BA 3B78A 4RFSB 1W36C 3DZ8A 4C7OA 2C9CA 2HUPA 2O0JA 2NO9A 2QPOA 3GEIA 3ZD7A 2AKYA 1AS0A 1N0VC 3NBZC 4KFUA 1B23P 3A8TA 3TKLA 1DAFA 121PA 1XDBA 3KJHA 3FMOB 4Q1DA 1OB5A 2OFWA 2JLSA 1EGAA 1M8PA 4BFWA 2IS2A 3RS2A 2VSXA 4Q5IA 5HTKA 4EFLA 3EZ2A 3R7WA 4BLQA 1N6RA 1TEXA 3AVVA 2R8RA 1R8SA 4Y0AA 3SJAA 1CU1A 2W6JD 2B7BA 3KUCA 1G4UR 1XTJA 1U0JA 1HY3A 1KK1A 1AK2A 3IIJA 2CHQA 3NVAA 1E94E 2QM7A 5B2ZA 2BCJQ 2PH1A 3GPLA 1EG7A 1NIPA 2FV8A 3K9NA 4FD2A 3KFVA 2ZI3A 1ANKA 3AVXA 2HF8A 3AVPA 3TQFA 4P4SA 4DVGA 3BXZA 2ZVQX 3IIKA 4O3MA 2HXYA 4LYHA 1YQTA 2ZYTX 3EPLA 1W47A 4JLOA 1HURA 1XRJA 2EW1A 3O8CA 1KO5A 1E0JA 3AB3A 3ZVMA 1P61B 3CWQA 1IBRA 2FNAA 4I1UA 2R44A 5J47A 3U44B 2CBZA 2C5LA 2JJ8A 1S1CA 5C4MA 1SVWA 3ETLA 1G291 3QNUA 5F98A 2ODWA 2B6HA 1KAGA 2P6UA 3EAQA 4WXRA 3ZLJA 2ZE5A 1JQLB 3C8UA 1F6BA 4XWAA 2GEDA 1CP2A 3CRQA 2QP9X 4OYHA 2W2VA 2XTMA 1PZNA 1GKIA 2BVNA 2XX3A 3CRMA 1XMJA 2O8BA 2RGGA 1NMZA 1U90A 1ZW6A 4B73A 4LV6A 3EZ6A 2H1LA 1G6OA 3WNDA 3FDIA 4F4IA 1IM2A 5JMTA 2GJSA 3UG6A 1H8HA 1H8EA 1RVDA 1E1QD 3AVQA 2PT7A 1UAAA 1FX0B 4QM6A 2WWYA 4ZKEA 1VG8A 2PX0A 3UG7A 2FMXA 4C0QC 5TB5A 2XSZA 4Q1AA 1R0WA 5EE1A 3PENA 2VF8A 4LK2A 3R9XA 2EFEB 2YC2C 3QKRB 4B3CA 3KQNA 2CEAA 1E79D 4NYIQ 4EJSA 4ZV4A 2GK7A 3UANA 1V5WA 3RWOA 1CXZA 2VTKA 4URYR 4RJLA 3WBKA 1ZUIA 3QJYA 4MGKR 4WA7A 4OHVA 4LWZA 5GADl 3B1ZA 4RZUA 4WOPA 5AUOB 1K5GA 1P2SA 2ZYVX 3U7HB 1EESA 1A5TA 1G6HA 4IXNA 1NKTA 2IYUA 3RS7A 3T5DA 1WF3A 1VPLA 5KSPA 4A6PA 4ZIRB 3QPWA 3UMRA 4MA4A 1HEIA 2W2TA 2NPFA 2NO0A 1YHNA 3AF3A 3I92A 4IW3B 1G7CA 1BMFA 4Q7KA 3CWZA 2CL0X 4GOXA 4DLYA 3U5ZB 3NBXX 3LBNA 4QXAA 1QHIA 3QPUA 4PC2A 3U61B 1N6NA 4KFSA 1DS6A 2NO7A 3K0AB 3WRXC 1NLYA 5E7MA 3BIFA 2ZS8A 4NCKA 3UK6A 1U8YA 4NZYA 2QUZA 1T6NA 3WP1B 2XJ9A 1NSFA 3GLFE 2YOHA 3A1TA 1AS3A 2CVHA 1KJZA 2YHSA 1SXJD 1TL7C 3UWOA 1KY3A 2GXQA 4F4CA 3SQXA 3GJ5A 1I4DD 1AQUA 3W8NA 2DFNA 2WIBA 4KAXA 4IDNA 2ZRHA 3ZVLA 1GWNA 1YVDA 2WWWA 5H68A 2GZHA 2V6JA 1Q1EA 4TYWA 2HYIC 4A15A 3PEUA 3SOPA 1FTSA 1ZINA 3H86A 4W7SA 5EZ5A 1KI2A 2CK3D 2ZUDA 3QBTA 4AIIA 3P27A 4XVQA 3BD9A 2WTUA 3DKPA 2QSZA 3LX8A 4KLZA 4AY2A 1COWD 1D9ZA 4DIEA 1DAGA 4M9SA 2W6ID 4KSCA 4RD1A 4ZIRA 2SHKA 3AP3A 4NTZA 2O8BB 2OAP1 4Q4JA 4JLAA 3NH6A 4LHWA 3HPQA 3ADCA 2QMUA 3AVTA 3LA6A 1GL6A 5L3VA 1E2KA 1YKSA 2BEJA 2ZRMA 3EIHA 4GDFA 4PPNA 4URZR 3Q85A 3PUWA 1T0JB 3ZJYA 2PZGA 1ESNA 1QG2A 2AD1A 4QBIA 3A6PC 3EWSA 4K8OA 4HZUA 2RAPA 3QIAA 1E9CA 2A5YB 4TLDA 4FWIB 2JASA 2YWEA 5FTKA 4V0KA 2EFCB 5J4HA 3BB1A 4PO9A 4FMBB 5DSZA 1CULC 2ZRGA 3Q8XB 4DCVA 1FZQA 4NYMQ 4AURA 5G40A 5KPJA 2FG5A 4C4PA 1U9IA 5KDLA 4JL8A 421PA 5JEEA 2QROA 4MRRA 4BASA 1SXJB 1ZRHA 1XCPA 4LJ5A 5CITA 1TF7A 1FL9A 4U00A 5DYIA 2V55B 5FUYA 2B8WA 3SEAA 2H16A 5AJYA 4IOMA 3CLVA 2ZRAA 4MH0R 2YKGA 3DDCA 2EVWX 1G20E 1Z22A 1AZTA 1R4AA 2VP5A 4PPFA 4H1VA 1U81A 1KNQA 1P9RA 3QVUA 1CJUC 4CEHA 2WAYA 2I3BA 1GAJA 3DPUA 3P20A 4TLCA 2FEOA 3C14C 4JLJA 5CM8B 4DCUA 2WSMA 4NCNA 5FOSA 5AWFC 1FNNA 1SXJC 3QXCA 4Z8XA 1FW6A 5JCPA 1L2TA 3KQUA 4KFTA 3CPEA 5FOXA 2ZIAA 4LJ7A 1Z06A 1TEVA 1BYIA 3ZS8A 2ZTSA 1IXSB 4D4LA 4M1OA 5GJBA 3IBYA 4CT4B 2F55A 3FKSA 4GP6A 2RGAA 2FU5C 4Q1EA 4Q1CA 2O8EB 5L3SA 1ZNYA 3REGA 4LJYA 2GXSA 1NRJB 2OFXA 4XD7A 1OYYA 2D3WA 2KWIA 4CYMA 4PAQA 4KBFA 4PZYA 4GMDA 5BWMA 5KNDA 3OEHD 3BS4A 4L5BA 1E2LA 3CR7A 2G6BA 3CPHA 2QI9C 4CZ2A 2X19A 4QGFA 2WKRA 2R9VA 1GRQA 3M1IA 3RRMA 1KSFX 4B2IA 1J99A 3E5HA 3IILA 2BWJA 5TARA 5KSOA 2GTPA 2DY1A 2F7SA 1KKMA 2KBFA 4EIWA 2JLYA 3LQQA 1W49A 1CLUA 5JSZB 3MGCA 2ZAOA 4JJZA 3LX5A 5BN4A 3WXMA 3PUZA 2RB4A 4NBSA 5EP2A 4HLCA 3K9LA 4MDEA 3GFOA 4P0TA 2ZR7A 3C7KA 2IHYA 3BC1A 1Q1ZA 4IKEA 3CIOA 1GRRA 4XH9B 4B43A 1T0HB 1FQKA 1JEEA 2BOVA 2CNWA 2IT1A 3RDPA 1W2HA 4FMDB 2XXAA 3B82A 2ZR0A 2ZUBA 3JVUA 3L0OA 2JJ2A 2QGZA 1AN0A 4TTQA 2QPTA 5JJIA 1F60A 4PC6A 3E70C 3W6NA 3V9PA 4LBYA 2ZITA 3IPXA 3PEWA 4ZCMA 3OE7A 4LJ8A 4M9QA 1X1RA 3B1YA 4AG6A 1VG1A 1E98A 2OXRA 3FWYA 3IUYA 2ZJ5A 5JJLA 5FTJA 3KTAB 3QKRA 2ZR9A 3AF2A 2NZJA 3TIFA 1RJ9A 1XTQA 1JPJA 4DC9A 2ZJ2A 4HAYA 2ZI9A 1A7JA 4M21A 2ECKA 4M1MA 1L7VC 4B48A 2CXXA 4FMCB 5FOWA 1LV7A 4D25A 3EIQA 5G53C 3OIUA 4QHSA 1EFHA 3R8FA 4TL9A 3CNOA 1ZP6A 2V7QA 1ZYUA 3EA0A 2H18A 2FSHA 5CJPA 4AKEA 3KQHA 2QENA 1N0WA 2W0MA 2OG2A 4GSYA 2GCPA 2CCJA 1JPNA 1XEXB 1R0YA 2R6DA 3K9HA 3QQ5A 4JVLA 4XTRA 4DT1B 2XGJA 3C16C 1T5LA 3SJZA 4F7WA 4QKQA 5HE9A 1ZNWA 3U7GA 4HLQB 3T12A 4PZLA 4LY6A 4BQSA 3GJXC 1TQ6A 4ZDWA 2BMDA 1J8YF 4NHOA 3FHTA 5KTYA 2YJTD 3U3MA 1MO6A 1J2JA 1RFLA 1CRQA 2AXNA 2QTHA 4HB2A 3S1AB 1P5ZB 1XMSA 2O8FA 2FSFA 1RKBA 3WY9A 4AWXA 3AF0A 2REOA 4M1KA 1ZUNB 3WHKA 3BK7A 4AD8A 5E7JA 4JZKA 2CE2X 2ZJYA 1TQ2A 2J5XA 4KODA 2C98A 2IX3A 3RWMB 4WZBE 1F48A 3C5HA 3OFNA 2FDCA 1T3LA 1OXSC 3KXKA 4FMDF 2G9NA 4TQUS 4B6FA 3HPRA 2VL7A 5TDHA 3U7FB 4PHHA 1HT1E 1II0A 5L8VA 1PV4A 3VFDA 3MG9A 3QBVA 2VEDA 1PUJA 821PA 2ZPTX 1HQCA 2HV8A 2QMHA 3E1SA 3A1WA 1G8HA 1R2QA 2JDIA 3PVSA 1M2OB 2WJGA 4IDPA 4QBGB 4MYHA 3ZVNA 4IHQA 1DG3A 4K46A 1KKLA 4R9UC 5KPDA 1GG2A 2WKPA 1X8KA 2Q6TA 4DT1A 4S35A 3L43A 1EFRA 3LO5A 1E2DA 4ASUD 3RNLA 3EASA 1KZ7B 2XZOA 1VYVA 2VHUA 1JJ7A 1VIYA 1NIJA 1HT2E 4BLOA 4TT3D 3N2EA 1TU4A 4BZPA 4B2LA 5LDDC 4DDUA 3K0EA 4FWTA 3QUSA 3I5XA 1OB2A 2WVJA 5JJKA 2BJVA 1XZQA 1P4SA 1S4QA 5CJ2A 3U3JA 1TU3A 1Z0DA 2QN6A 1SXJA 2V1XA 1AA9A 4G5OA 4US2R 3ADDA 4W9MC 4BRWA 3SYKA 4HATA 4ACBA 1WRBA 3B13B 2X77A 3GP8A 3GEEA 4IOKA 4A0FA 2WMNB 1NLFA 1WBDA 1OKKD 1SGWA 2ZJ8A 1QHNA 5TMPA 2I1QA 1XNJA 3A36A 3IPYA 3QXXA 3ECCA 3V4FA 3HR8A 4PFSA 3L0PA 2VP6A 1LS6A 1GITA 2GAAA 4C0BA 2DWOA 1T91A 1XB2A 2D2EA 2ZJOA 2QL6A 2IYSA 3EIEA 2R62A 1EWRA 1IOZA 3DM5A 1DO2A 4OQLA 3ZDQA 4A9AA 1XCMA 2JIZD 3OAAD 5FOTA 4KJZA 4B2PA 2V8OA 5FOUA 2RGDA 1E2JA 1FP7A 1OHHA 1XFAA 4GPTA 2ZUCA 4UNNA 1IJEA 5AJXA 3MSXA 1N6LA 2OCYC 3K9GA 1G8GA 3Q72A 5JS7A 1U98A 4BLTA 3GLIE 5IT5A 4KLNA 4LBZA 4LCBA 1OT3A 5J4YA 4OK3A 3QF4A 4ZCLA 1SVMA 4R2HA 2GDJA 1P2VA 1YR8A 3ZZ0A 1ZD9A 3LDAA 2O8CB 1E9EA 2OZEA 3A4NA 3DEFA 2V54A 3EZFA 1KK3A 2OBLA 1UKYA 2QP4A 1LY1A 2F1IA 1KO8A 4D82A 5AUNB 1NKSA 3OZXA 2NO6A 2Q9BA 4V0OA 3ZH9B 4HAXA 1GVNB 4RSGA 3NG1A 4BLSA 2P6RA 3B5JA 1TUEA 4M4SA 4OKSA 3QG5A 1QVRA 3TGPA 2ZJBA 3C5CA 1OIWA 2PJZA 5JECA 1NN1A 1E9BA 2GEVA 5FTNA 3D8BA 3KXLA 1ZCBA 2WKQA 2P65A 1NJFA 1M7HA 2QT1A 3QVVA 3RS0A 1YRAA 4OQMA 4EPWA 4KI0A 1SVOA 5JEDA 5FPTA 3UMSA 1GSIA 1SXJE 4JLNA 3GJ7A 5F9HA 3SDZA 2C95A 3GLGA 4HLDA 4OBEA 2VIIA 2QGNA 1GRNA 2HT1A 2G1JA 2FFHA 2I4IA 2P67A 2AD5A 2J0VA 3BRWD 1P9NA 2J41A 3MWLA 4NYJR 5AUPB 2OLKA 3IKJA 2VSOA 4KSBA 5G41A 5SZIA 4HEJA 2AWOA 3F8TA 3KKQA 2IWRA 3BOSA 4TWZA 2J46A 2J7PA 4RZ2A 3ZZTA 2ZI4A 2HEIA 3QF7A 1YR6A 2ORIA 2ZM5A 2ERYA 4LBWA 4Q03A 5HKKA 3LXRA 2FJUA 3F5FA 3Q7QA 4Z54A 2A2ZA 1GM5A 1IXRC 2JLQA 5ANRB 1YZKA 2D7CA 3JZAA 4LJ6A 4IFEA 5DNYB 4IDHA 3UXMA 1E2EA 3LWNA 4RFSA 1N5JA 2QU8A 4BFSA 4B3BA 4GRAA 4DIDA 1GNRA 4JT4A 3FTQA 4A2WA 4HSEA 5JLJA 2WSSD 1NBME 3D6TB 3FMFA 4UJ3A 5DI9A 1KSJA 1ZD8A 2VHQA 1DAHA 3EW9A 3KXIA 2GCNA 3DZDA 1KK0A 4LHYA 3TAHA 3B85A 3RRZA 4ESVA 2IEZA 2VA8A 4XOIA 1IY0A 2QSYA 2ZSFA 4QG7A 4MDFA 4W5JA 4AC9A 2H57A 3NTUA 1ZIPA 4XSGA 1F5NA 4F38A 2FA9A 1KHTA 4B71A 5H8WA 1JR3A 3ZVRA 3VMFA 4JVNA 2H5EA 4LYFA 2XJ4A 3D31A 5EP3A 1WDTA 5IDVA 4Q02A 4DSNA 2A5DA 2PJRA 2IK8A 2FFQA 4DDTA 3KJEA 1Z3IX 5AJZA 1G3QA 3BH6A 3W5JA 1J7KA 2EWVA 3DOEA 4XWOA 2F3RA 3REFA 4QM7A 1II8B 1N25A 4DCTA 3QSYA 1HYQA 5CDFA 1U99A 4AKIA 2B7CA 3BBPA 1WQ1R 4RFVA 5DE3A 3M0EA 1E0KA 4IVPA 1CR4A 4LYJA 3HDTA 4PTLA 1P7CA 1FP6A 4KV9A 4PANA 4WZ6A 4JVMA 2JCSA 3V4RA 3QKTA 2MSDB 5J4LA 4M1WA 3OHMA 2LWIA 1J8MF 1W36D 4TQ9A 4Q01A 1Q44A 1QHHA 1G5RA 1M34E 4Q21A 1DG1G 4BFZA 3T34A 3B8HA 3SN6A 4PSVA 4LV8B 4QOSA 2J0SA 1NMXA 4L15A 4BFYA 3LNCA 1XU4A 3IQXA 4KU4A 1A2BA 4MKGA 1IN6A 3I32A 4EJSB 4N1AA 3AGPA 5JCZA 5L3QA 1CJVC 1N6OA 1FNMA 1P2TA 3THWB 1BKDR 1YJ5A 3TJZA 2A5FA 1II8A 2NGRA 3CR8A 4NDZA 3K0CC 3U2QA 3KKOA 2GJAA 2PLFA 4QL3A 1FMLA 4EPXA 5AJWA 2GJKA 3DVLA 1J90A 4Q48A 2VPPA 1RW4A 3TLXA 1UADA 1W4BA 3GLHE 1US8A 4YMUA 4YMSA 1U0LA 4UJ5A 4DUGA 3BE4A 5EJEA 5GVSA 2HCBA 5HZHA 2QNRA 1SHZA 1LFDB 3FFAA 3NWJA 4LC0A 4PHTA 2JLZA 1NP6A 3A4LA 3RLFA 3H1TA 5ELXA 3B7GA 2OBNA 2F1JA 2HJGA 2ATXA 3ND9A 5FFMA 3SQWA 4YONB 1IN7A 2ZSEA 4YLGA 1Q0UA 3QKSB 1XBTA 2FPLA 3OEEA 3ICQB 5KDDA 4DLTA 4C0AC 4NCIA 5DGXA 4F93B 4QJ5A 1YU9A 4D4JA 1WP9A 2GF9A 1JR3E 3U60B 3ONWA 1JB1A 3U3KA 4TN1A 2GZDA 2QAGC 4TL6A 3TH5A 1VECA 3TSZA 1N6KA 3SI7A 3TVDA 3PCRB 4PPGA 1COWA 2N46A 3VX3A 2CJWA 3PFIA 2ODNA 2Y8EA 1G8PA 2BEKA 1W48A 3TUIC 3N5CA 1KI3A 3WMEA 2BMJA 4YDSA 1RC8A 2CLCX 1YZUA 3H2YA 3NEJA 4B34A 1VCOA 4KO8A 3KFXA 2CVFA 2X2EA 4BGDA 1I2DA 4Z1MD 4IFBA 3ZIAA 3DMNA 1XF9A 4NP6A 4CGZA 1TF5A 3TSWA 3N70A 2ZI6A 1PLKA 2IUTA 2X2FA 3AUXA 2P5TB 4PXAA 3EA5A 2XB4A 3WMFA 4DCSA 3KKMA 1XPUA 3IEVA 4NYJQ 3IGFA 4LUCA 2DBYA 4ARZA 2GCOA 5KYKA 2BM1A 3DKVA 1CRPA 1MV5A 1OFHA 2EFHB 1Z0AA 4JLMA 4PPQA 4G5QA 4ARZB 1RRGA 2V6IA 3OE7D 2X8AA 1D2MA 4N3NA 5AR1A 3L2OB 2VO1A 2EFDB 4F92B 2JJ1D 4C7OB 2DCUA 1MRSA 2B21A 1P72A 4B44A 1MABA 3SHWA 4YMTA 3OFND 2E9SA 4Q00A 1EFCA 1D8TA 3AGQA 5FI0B 5HKKD 2J0UB 3L8ZA 1E2GA 2C96A 1CJMA 1JEDA 1GP2A 1NBMA 1KJWA 2JGNA 2ZE6A 4JKIA 2F43A 2GVDC 2QA5A 2Q21A 1KO4A 3U7EB 1QZXA 3WP0A 1S3SA 1E2QA 4PQFA 3CX7A 4RKEA 1E2MA 1D2NA 1FUKA 2CHVA 5JI2E 1OFUX 5FTLA 1R5NA 2IHBA 1Z6AA 4Q9IA 5J4KA 4G5GA 5M04A 4A0HA 2D74A 4POAA 4KYUA 1RE0A 3VR6A 8OHMA 1NLZA 1M74A 5SZKB 1QHYA 1T8UA 5LD2C 1NVWQ 3FE2A 2QT0A 2BBSA 4GP7A 2YWHA 1WCV1 4UNPA 5EUQB 4B35A 1KGDA 1WA5A 2A5GA 3VR2A 1Z2CA 2GJ8A 3K0SA 3F0TA 4B33A 1IY2A 1XXHA 3W9YA 2J59A 1W5TA 4TLAA 2RGNC 4PO8A 2AN9A 5LB4A 1X8JA 4Q7LA 3DOFA 3O47A 5IF9A 5CLLA 1GL7A 3T1VA 3HJNA 4OQXA 2OUKA 5DN6A 5C4GB 1P3JA 4DXAA 4TYYA 3NDBB 1N6PA 3GFTA 2ZI5A 1OXXK 5B30A 1CR2A 5FPSA 1YZNA 2AK2A 4IEIA 2WJHA 2OXCA 3X1DA 2J0QA 3VNVA 4PQRA 1G5PA 1OV4A 1VCIA 2OE2A 1ETUA 3W8RA 5EE5B 5UKDA 2GZAA 1MABB 2VRWA 1Y3AA 1IN5A 2QTFA 2RGXA 3SR0A 2CMKA 1UEIA 3SC3A 3I5YA 2JLWA 2MMGA 3KUDA 5EP4A 4TTRA 2ZSDA 4I4LA 4DCNA 3MWKA 4RKFA 1E1QA 2RGNA 1OE0A 4DJTA 1G7TA 1RJ9B 1G5TA 2IW3A 1Z6XA 4EQ6B 2WWIA 3PEYA 4GT1A 2WWXA 1CF4A 3TQCA 1HE1C 1HUQA 1YZGA 2BBOA 2F3TA 4JLDA 5E4FA 1BOFA 3NDPA 1HV8A 5FUXA 1R0ZA 3GFPA 3PUXA 3W3AA 2A7QA 3PJRA 5F3WB 2A30A 2C9YA 3B9PA 3Q5DA 3SS8A 2OEPA 4FN5A 4ZPXA 4M8NE 5FR1A 5FOVA 5DH9A 1X86B 1DE0A 1MRNA 3GJ4A 3R8CA 4I1VA 2VP0A 4Q7JB 2ZU6A 2WZQA 5CK4A 2REBA 2UVQA 3W6PA 4P31A 3KTAA 3K0CA 3IDQA 1CS4C 1IN4A 2D4HA 2OM2A 3GD7A 3P4XA 3T1TA 1QVAA 1E2NA 1Z28A 2HJVA 3OIYA 2A3RA 1KI8A 1S0UA 4MGYR 3GLFB 1ZIOA 2GWHA 2XTNA 2ZS7A 4TZ0A 4HUTA 3TAUA 3CF6R 5FBLB 4M0LA 4Q4JB 1CBUA 3KJIA 3VKHA 3ZYCA 1HQYE 1FMJA 4JYBA 3I1FA 3EPJA 3TUJC 2XAUA 2ZRCA 1E1RD 3KB1A 1XP8A 4A8JC 5BN3A 1RYFA 1TTTA 1UJ2A 2FOLA 2C99A 3AUYA 3O8RA 4YXWA 4HZUB 1OIVA 4CEJB 4P4TA 2W2XA 3BFXA 2IL1A 5BQ5A 1JR3D 1MH1A 3B2EA 1KO1A 1VCNA 4RD0A 3PUYA 4C0HA 3KKNA 2JIZA 1LF5A 3OAAA 3T5GA 4DLVA 4LBVA 5LBIA 1KI6A 4E5UA 3QENA 1DAKA 1UDXA 4EPTA 5FL7D 2V7QD 3BAFA 4I81A 3WYAA 2ATVA 1KI1A 3Q3JB 4NCHA 4TSFD 4Q9JA 2XITA 5CYOA 1I2MA 3UMFA 5A5GA 1KSHA 4V03A 4C9BA 4NKRA 5HZKA 1DAMA 1OH5A 1E2HA 5JFGA 1TNDA 1WB9A 2YOGA 2PMDA 1EXMA 1EX7A 3I62A 3WNBA 1KAOA 3TW8B 3LD9A 1Z2AA 4I1OA 1G4AE 3EARA 5CK5A 3Q7PA 4FW9A 2WAXA 5FI1B 4LDJA 4U02A 1XD2A 4HB4A 1ZVQA 3AVUA 2H8KA 5G3YA 2O8FB 4UXJA 3BFVA 2IS4A 5SZJA 2J3EA 1JAHA 4JL6A 4MGZR 2TMKA 4Q9HA 4JL5A 1EFRD 2KBEA 4LHZA 4RD6A 4O25A 3L8YA 3MJHA 4PC3A 4GMXA 1ZM7A 3SJBA 5B64A 3BJIC 2JA1A 4O0MA 2BHRA 5LD2B 2CNWD 2JEOA 2R2AA 3P32A 4IOJA 4EFNA 4A92A 2YINC 1S8FA 1ZM4A 4IJMA 4HDCA 2Z83A 4EPYA 1LF0A 4P33A 2XNDD 3SFVA 3L0SA 2ZRNA 2Z5FA 3DHWC 1T3HA 2D2FA 4C30A 4NU0A 3LY5A 4B3FX 4PHFA 4DLUA 2D62A 4CW7A 2DFKB 4LJ9A 3SBEA 2ZEJA 4JSYA 2AXPA 4G01B 1UFQA 1Z6GA 2QMOA 2AHOA 2VP2A 2WPDD 1OKKA 4L16A 4LPSA 1DAEA 3TRFA 1IN8A 2IYZA 3PIRA 1UBFA 2VHTA 2WHXA 2AR7A 1SHKA 3AP2A 3LLMA 5FPHA 2RMKA 4OI1A 1LVGA 2AFHE 1RRCA 1Z83A 1ZM3A 5TXGA 5FUWA 3AVYA 1SVLA 1CR0A 4ITRC 3VR1A 1YZLA 4FCWA 3KDSE 3K70D 3VQTA 1TADA 3U4QB 4EDHA 1E3MA 1GL9B 4TL7A 4C0SA 1A82A 3CF2A 1E9AA 1R8QA 1WE2A 1CR1A 4C0JA 2IUSA 1G64A 1W0KA 6Q21A 1JI0A 2JATA 3HU2A 1A4RA 2JLUA 1SVKA 3KQKA 4W5WA 5BN5A 2IC5A 4OQFA 2ZETA 4X8LA 4TMTA 4BEJA 1Q12A 3LBIA 5L3SB 2NTYC 1EK0A 4L9SA 1E2IA 3QI2A 4EKDA 5KDOA 2FPMA 1G3RA 5H70A 3FGNA 3TK1A 2W00A 3AV0B 4JJKA 2FF7A 2J7KA 2ZE7A 2G0NA 3I73A 1TQ4A 2DHRA 4MGIR 2EYUA 1S96A 1XEXA 2FWRA 3NC0C 1CKEA 4A4DA 5JRZA 1E2PA 1DVRA 3QXHA 3FVQA 3RSOA 1BIFA 3QEJA 2DFLA 1Q1BA 3IEUA 4XVUA 2CL7X 2O8DB 3NIBA 2QE7D 3G82C 1KO7A 3AEZA 4JSTA 1YRBA 1IQPA 2ORWA 2IYWA 4OQNA 3T35A 4RVCA 2FPKA 1XWIA 3A1VA 3B9QA 4Q18A 4OI4A 4NE2A 2BKUA 5C1BA 3RYTC 3VR3A 2MMCA 2Q3MA 2ZSAA 4OHXA 4DLWA 3AF1A 1EFUA 5GJVC 3M4YA 1CJTC 2CCKA 2HDNB 1OXVA 3R7WB 2E1RA 2R6GA 5J4VA 1J70A 5K8LA 2EQBA 2BV3A 1SVIA 2AK3A 1XJCA 4M2LA 4YQFA 2MSEB 2WJIA 2YZ2A 3THXA 3CH4B 2ERXA 2C77A 3TR5A 5JBQA 1KI4A 4OL0A 2HLDA 5EXSA 3ZGXA 3C41J 4C2TA 5TV2A 2QQEA 3LBHA 4EQ6A 2A9KA 4X8MA 3CO5A 3OF5A 3ZS9A 1Z5ZA 4QFMA 1RYHA 1VDZA 4RD2A 4D6PA 2Z0MA 2KJQA 4QC2A 4TLBA 4A82A 2ZS9A 2WIAA 3K0FA 4CEIA 4B76A 1OPXA 4KHZA 1UKZA 3IHWA 5H1YA 1R5OA 1NMYA 2DFTA 5CLQA 4URXR 4G3XA 1W4CA 2GAOA 5EXXA 3QPVA 5DN6D 1ZC3A 3VX4A 4BLPA 3WYGA 2WSSA 4JLPA 3LW7A 1GTVA 4TMZA 1GOTA 2GXUA 5D3MB 5E95A 1A1VA 3GJ0A 5KU1A 4EFMA 4DUGD 1EFTA 1VKJA 3I8XA 2VLIA 4TTPA 1ZCAA 2N42A 3FOZA 2GHIA 1N3BA 2WWGA 4B3GA 5IHPA 2OHFA 3BORA 5TVKA 5P21A 4BFUA 4LJ4A 2VP4A 4OK5A 3ASZA 3P1JA 3X1YA 5JS8A 3VTKA 2C8VA 1E2FA 2KB0A 4QGAA 3R9IA 1DTSA 5FH9A 4Q1BA 4BZXA 4XWKA 2H17A 4AYTA 1OHHD 1FPMA 1XEWY 2QY9A 5SZHB 1SULA 4DSTA 2C9OA 1OH7A 721PA 4G0NA 2D7DA 3W6OA 2Q9CA 4HAVA 2ZRPA 1NN3A 4PSKA 4Z1MA 4QGGA 2A5JA 3QXSA 4US0R 5FTMA 3IIMA 3T61A 5JWRA 2ZQ5A 4D4MA 4ZDKA 1ZM9A 4NMMA 5DIFA 1CIPA 3K09C 1PLLA 3CNNA 3EPHA 4LJAA 4ILEA 1S9HA 3K0AA 3K53A 1UBGA 2VF7A 4MQBA 3ZQ6A 1Q1QA 4AYWA 3HP1A 1BO6A 2C03A 1TUIA 2IXGA 4EAQA 1E1RA 3RC3A 1G8FA 2NG1A 4II7A 1EWQA 3RC8A 1Q22A 2F43B 2WM9B 2IYRA 4HAZA 3LVQE 3N2IA 5FBWB 4EPVA 2IEYA 2ZANA 4GZMA 1ZUHA 4HB0A 4BFTA 5F2EA 4B32A 3RS3A 5KNBA 2J1LA 3F3YA 2Q3HA 3PQCA 1DARA 1OJLA 2WWFA 4D80A 4LSGA 3IQWA 4ACAA 1KSGA 4BZQA 4HDQB 3IO3A 1UM8A 1P6XA 4R2IA 5FL7A 2YV5A 1F2UB 4HAWA 4F91B 4TMVA 1C1YA 1G41A 4HB3A 1JNYA 1G21E 2WMOB 3CRVA 3QOFA 4M1YA 4OHWA 4PAMA 4DEYA 1DPFA 2GEUA 1AKYA 3NC1C 5FPKA 3GJ6A 1HH4A 4MRSA 4NL4H 3B1VA 2ZRIA 1E0AA 5AK0A 1AZSC 2WWHA 2BBWA 1T9HA 1ZU5A 1D5CA 2EU8A 1YE8A 4ABYA 3ICEA 2ZXUA 4G5SA 3HWSA 4FIDA 2FFAA 5HR5A 3PUVA 3ZQJA 4CRWB 1AJEA 2IYQA 3U4QA 2B8TA 5CB6A 1O87A 4PAOA 4V0ME 5C18A 2GBLA 4C3ZA 5K8TA 3FHCB 2ZYWX 521PA 1O3YA 1C4OA 4JVSB 3V00A 5C2JB 3THYA 4IVQA 1LS1A 2ZJAA 5L3RA 1TPZA 5L3QB 3K8YA 2NPIA 2GF0A 4JBYA 1SQ5A 4GOJA 3AVOA 4Q47A 4YC7A 4RZXA 1QDEA 1M7GA 4G5RA 2KE5A 4MKIA 2FGJA 2R6CA 3GCGA 5K8IA 2YNMA 4M9XA 4Z8YA 3WHLA 4P3YA 1OFTA 1VYUA 2NMVA 3QY0A 1FQJA 2GESA 4S2EA 3EZ7A 1E4YA 5J5CA 1W4RA 2GCOB 1G7SA 2OO7A 3IBGA 4N0DA 1ZNXA 1X3SA 2R65A 2ZROA 4HAUA 3QXJA 4BECA 2IS6A 4JS0A 4TQAA 4IVRA 4DBLC 2IYLD 4M22A 5C46F 4HI0E 1E69A 1JJVA 1GZSA 1I4TD 2VSFA 3NHAA 4KITB 2Q3FA 2UZIR 4TYNA 1JALA 3AKDA 3DMDA 2OCAA 1NL3A 3VKWA 1E6CA 3L82B 2QRZA 3IHLA 2C2HA 4A2QA 2BC9A 1G8YA 2CLSA 2O0HA 2QQ0A 2FFBA 2BKEA 1OLOA 4R71A 2LCFA 1FX0A 2EYQA 3GLIB 1LW7A 1NSTA 3O8DA 1T4GA 1NBMD 2NQ2C 1Z08A 2ODBA 3GLHB 5EE3A 3GJ3A 3FMIA 1NVVR 2IF0A 4HUQA 4QRHA 1NVUQ 1U2RA 3CUEF 1GDDA 2W0SA 1IXZA 1W0KD 1GNPA 2FZ4A 2OCBA 1Z6TA 4HZIA 4A8JB 1QF9A 4L9WA 1AS2A 2LKDA 2X1VA 3WYFA 4JBXA 4LC1A 3ZZUA 4DHEA 1QHGA 1VMAA 1QHSA 5F9FA 2RH5A 1P9WA 2IS1A 1Q57A 1XXHB 2O52A 5EE0A 2ZJZA 4LHXA 4B47A 4FINA 3OESA 1OIXA 1HE8B 4L4UA 5IK2A 2C78A 2JLRA 1X1SA 3B60A 3HU1A 4WIAA 4CEIB 4HYYA 3LFUA 2ZYUX 2W83A 1MKYA 2VYFA 2VQSA 3H4MA 1XCGB 4R7ZA 1G1MA 4DEXA 1W5SA 1UBEA 1GKYA 2I1VB 1F2TB 1II9A 3X2SA 2ODEA 2QTVB 3OIWA 4RCZA 1UBCA 1U8AA 4AK9A 2DR3A 4MRPA 2UKDA 5FR2A 3CZPA 2AFIE 2JLVA 1VCMA 2MSCB 3NHBA 4NPHA 3SNHA 4JMPA 4LX0A 3SBDA 2PCLA 1RIFA 4M1TA 2OLJA 4I1SA 4DLRA 3DM9B 4P32A 4DLZA 3UATA 2H92A 4XD7D 2GBLC 1K8RA 1KY2A 5LPNA 4UQOA 3A1UA 1JBKA 3MRSA 1N5KA 1R10A 4DRZA 1XMVA 4KBGA 4P4SB 1C9KA 2V1UA 4ERNA 1T5IA 4EUNA 1US8B 3U6KA 3FB4A 1ZD1A 4A6XA 1N5LA 1AGPA 2HLDD 1NY5A 1E99A 2FN4A 3L0IB 3RSLA 4ZCIA 1Z8FA 5KHOC 1QRAA 4URUR 4B3DA 4PQYA 4KCGA 4A36A 1Q3TA 4UKDA 3VR4A 5KUTA 1XTIA 4TMWA 3MJRA 3AKYA 1Z0FA 1JXMA 2FGKA 3HYRA 4LOAA 1HA3A 1XEFA 2V9PA 2RGEA 4MYUA 3U3RA 4JLBA 3K1JA 2QEQA 1AGRA 2F1RA 4B75A 1OW3B 4MKHA 1BH2A 1G19A 1PLJA 1SKYE 1W0JD 1LB1B 3NBFA 1Z07A 3CBQA 3SZRA 2F6RA 1AQYA 3J81k 2C04A 4J0QA 5KSYA 2P6NA 5DO9A 1Q3HA 1ZAKA 5JWHA 3RANA 2QBYB 1ONBA 2IXEA 1FUUA 3CF0A 3TNFA 3X1WA 4A0GA 4P4UA 2IYTA 2IA5A 2QORA 3C4JA 1S1MA 4QHYA 4NH0A 1KMHB 3I72A 3X1XA 1W4AA 1ZM2A 3BH0A 4NONA 4RZ3A 3SFZA 1VG9B 2RKOA 3RS5A 4TLEA 1XPRA 3MAAC 5A4JA 2DWQA 4IXMA 4WW0A 1BS1A 3AKEA 5DISB 4E22A 5JZVA 4V0MA 1OXUA 1GNQA 2A78A 2V3CC 4CEJA 1WBBA 4MITA 2FX3A 4AG5A 5EUMA 4D4KA 5BYKA 1ZC4A 1T3SA 4YMVA 2NO1A 1CTQA 2HT6A 4TSFA 4DKXA 2D06A 3SU8A 1QHXA 2FH5B 3U44A 2XB2A 1N6HA 2EFGA 3TBKA 2J87A 5JI3E 2QMEA 4D0GA 4MKFA 1Q20A 5D3MA 4WXPA 4URVR 1FFHA 1RRFA 1NY6A 3CX6A 4OJKA 2P5SA 1T8TA 1KDTA 1KNXA 1MO4A 1NVXQ 4WVFA 1ZNZA 3H84A 3CH5A 2QAJA 5FUVA 4UNSA 1NN5A 1H8HD 4BRUA 1G7RA 4ZI2A 1AKEA 3CPJB 3CB4A 4KVAA 4Q66C 5IK2D 1P73A 4F4JA 4H9GA 4C2UA 3AVWA 2CE7A 2P2LA 3B1XA 1KDPA 4EPRA 1W7AA 2BDTA 1UF9A 4QBHA 2HF9A 4QHTA 1H8ED 2ZREA 4WBSA 5DHFA 1DOAA 1ELOA 2WBLC 2ZSBA 5G3ZA 3CM0A 1R7RA 3THXB 4RCYA 3MLEA 4GZLA 5J40A 2HCJB 3QEOA 1BYUA 5HE8A 3THYB 4ON9A 2VH5R 1TX4B 3K70B 3LW8A 1E9RA 1TMKA 1NJGA 2OAQ1 4OHYA 3X1ZA 4A1FA 1NG1A 1MO5A 2GNOA 2VHJA 1IJFA 1RZ3A 2XNDA 3KKPA 4GOKA 3W5IA 4A0RA 5BXQC 5JHHB 4QBFA 2FSIA 3PXGA 4HDOB 3KZ1E 2GVZC 2PMKA 4CT5A 3ASYA 3SYNA 5JRJA 1YZTA 2OSBA 2JJ1A 3VKGA 1XJ0A 3VU9B 5CIQA 1DEKA 1KYIA 4GNKA 1YZQA 1UDWA 3OIVA 1DBSA 3R9WA 2FZLA 1SKYB 2IYYA 2ZRKA 4OK6A 2O8DA 4AKHA 1E0SA 1GFIA 4FXPA 1WMSA 4ESHA 2WOOA 4URWR 1KMHA 3KX2A 5CIWA 1XTSA 1E9FA 2QG6A 2Z6VA 4V0LA 4V0NA 5B58C 1D9XA 1CJKC 1P2UA 3GQBA 2G1KA 4R98A 4RD4A 3W34A 1R5BA 3LQRA 4BFVA 1U9IC 5B57C 3GLGE 1OH8A 1KTVA 3PITA 4Q1FA 5FBQB 1KI9A 2CHGA 4B74A 4G1UC 2WV9A 1JAIA 3QKSA 2BCGY 4ZKDA
chains in the Genus database with same CATH superfamily
1XZJA 3KSRA 4XR9A 5CVCA 2PZFA 4LGMA 1UXKA 3MWJA 3H4VA 2CL5A 5D85A 1ZOOA 3AF4A 1T1RA 3TR0A 4BEBA 1V1RA 5DTIA 3VH2A 4BE4A 2AUMA 2R7LA 2F9LA 1KEPA 5HJEA 1PP4A 4DCMA 4XUDA 4QQRA 1G5FA 3OT1B 5ALTA 1N2GA 3EE6A 5DI3A 5DLEA 2IWHA 2FQYA 1VOTA 1G55A 1JYEA 5FAXA 4B4UA 2PL3A 2XUGA 5FD8A 3GHYA 3WRYC 1A9TA 1I01A 2PYDA 4IFTA 2F9MA 2OBMA 3CINA 3FZGA 2CK3A 1JDNA 4Q4AB 1Z0IA 1T35A 5CDUA 3OZVA 1MNAA 2QE7A 4B85A 3VUEA 5F7XA 1A3CA 1GL3A 1SZDA 1DHTA 1E5DA 3KD3A 2PKQP 4JU9A 1YQDA 5EA2A 5TQ0A 3EBOA 4BNXA 2VHCA 3FNEA 3PSAA 4M0MA 5HQTA 2C97A 2C5SA 4ASUA 5HGXA 5L4SA 3THWA 3GJRA 1MJHA 3DUFB 2HFJA 3LXXA 1JQ3A 2WC1A 4B6GA 3F9CA 5F4BA 2PQ2A 2DB3A 3C7AA 1KL7A 3CGGA 2GD6A 3FROA 3CS3A 1ZA2A 4RANA 3UAXA 2DPHA 3L7MA 1RC1A 1ES9A 2NM0A 1I8TA 5CAEB 4CM1A 3GLIA 3I8SA 4ZQIA 2DF8A 1GKUB 3LIIA 3OQNA 1Y6FA 2EZ4A 5E1BA 3FKSD 2AMVA 2V5AA 3H8VA 5AK3A 3ROQA 4OQDA 4KKXB 2BISA 2IXFA 1GU1A 1DCMA 4Q19A 1A2KC 5BQPA 3U39A 3VH3A 2XDQB 2DWPA 2P27A 5H9WA 4HNGA 4ED9A 2UYOA 1CEEA 3FMPB 2QW1A 5KOJB 1HZZA 4HX9A 3RU3A 3VU8A 3WNQA 1YJAA 2LVBA 1Z7YA 3MT8A 3RU2A 2YVKA 4BUJA 3G9ZA 1KFEB 4LY3A 2ZRFA 1GIAA 1IG0A 2B1JA 2WJWA 1I4LD 1SVSA 2ONKA 4WINA 4RIHA 2QLFA 1U94A 2VYVA 4PZPA 4PYMA 4G0VA 4YRQA 2FLVA 1NQXA 4YCJA 3LHSA 1Z17A 2NQ8A 1RVV1 1JHDA 2BHSA 3UAGA 2FSGA 3HBJA 1G20A 5EOVA 2VQ3A 1V8PA 5BT9A 1MX1A 3KWMA 3P0HA 4H7KA 5A0FA 2SNIE 1HDCA 2XXAB 5ESDA 3DLTA 5TJHA 3ZIAD 1ORIA 2EOAA 3ELDA 1YKGA 4KVGA 4FDAA 1A1SA 3A1SA 6ABPA 4TKZA 1WMAA 2NZ8A 1K2WA 1XYVA 3GY0A 4RGBA 3ZQUA 2WUVA 4DDVA 4B5LA 4WN3A 1ZMTA 3WWZA 1UFVA 4K3UA 4ZVKA 1KI6B 1FYWA 3NBYC 3RTDA 1NG9A 4JQSA 2QSJA 2IHNA 1NQ5A 2R00A 1QIFA 1VG0B 4C06A 4XX0A 4U7DA 1TYZA 2E5LB 4RY8A 1KK2A 1VIVA 2NT3A 3PGJA 1BRMA 4MB6A 3TXAA 1J56A 1N2XA 2BFDB 2GRJA 5DXAA 3UZUA 4C0WA 3U4IA 4D9HA 1SB9A 1KU6A 1Q1AA 1WCWA 2JDID 2QYHA 5JMWA 3EGVA 2XB8A 2RGCA 3FHJA 1PE0A 1UXOA 3F6BX 2XD9A 3P4YA 1NUHA 4YJHB 3UNXA 5HM8A 3VVMA 3DMTC 2ANCA 3PDHA 4PVDA 2XOKD 4B6JA 3E1KA 4UUAA 2JEYA 5J3JA 1F06A 1KIMA 1Q15A 1TM3E 1DI0A 4DLKA 1CQIA 1G16A 1PO7A 2OORC 3NJ8A 4KMSA 4I1RA 4KN5A 1U02A 4MAMA 4Q4LA 4F2WA 2RE8A 2A1TS 1NI3A 4TT3A 4RZIA 1GSOA 1YDHA 2MIIA 5C7OO 1O0BA 2ZYGA 2D2VA 1TMGE 2RSLA 2GAJA 3S28A 4AECA 1MVOA 1NYLA 1EJ6A 1WEHA 2QQGA 4Y2VA 3TZCA 1D2EA 3KSMA 2UUBB 4WNYA 4RTRA 1FSFA 1SOVA 5A3VA 2JL1A 3I8OA 1J39A 5EIHA 1J1ZA 3DE4X 1QG0A 3VYTB 4KXLA 5BNIA 2GETA 2PXXA 2WU4A 3AP1A 1ID1A 1UDCA 3ZDDA 5ARBA 4YV0A 3EMDA 2DWCA 3IDOA 3M5CA 1D04A 2A3NA 3MTQA 3O4JA 5A4KA 5KC9A 1Z29A 3MJCA 4MROA 1NPDA 2Q5EA 1WB6A 1XQ1A 4LZZA 5DSTA 4D0LB 5AIBA 1VDMA 3NH9A 5ENZA 4EB8A 1GJRA 1ZHFA 1EVYA 2C5FA 3GAZA 3O31A 4TYQA 4KDFA 3S40A 4DDWA 2AJCA 3UB2A 2IKSA 1NPTO 3FNGA 4UM9B 4NZOA 1WXQA 1Z4KA 1U7OA 2QRHA 2DPMA 5LOVB 2AMFA 2OQ2A 4FOSA 1TIPA 5I01A 3FTPA 5CA1B 4C78A 3KVNA 4YDQA 3SDBA 3N2KB 3GGOA 4C0XA 1A4IA 3P9IA 4DLNA 1RI4A 2FR8A 1CUDA 1MOZA 4M0FA 2YVUA 1Z47A 4IF4A 4JJAA 4WLVA 4E03A 2B83A 3I01A 4N4AA 1GGJA 2BMEA 2G0TA 3PC7A 1KR2A 1OLUA 3K2BA 4TSKA 3PR1A 3W05A 2W6JA 4H1UA 1PQ4A 4ARVA 1M8KA 1SBTA 4DILA 2B37A 1V1JA 2D6FA 2VAPA 5DP1A 5FX2A 2I76A 3BZUA 1KBZA 1H0HA 2YYZA 2ZVPX 3D0RA 3PI6A 4LEIA 1RKUA 4F91B 4O8CA 4KH0A 3I4FA 3KALA 2QVYX 3WKCA 3ZCTA 5KNCA 3QFHA 2A1UB 4GFDA 4IDCA 4OI2A 3AM5A 5ALKA 3GGPA 3UM9A 3K4QA 1EX6A 1JKJA 2JGMA 5JPIA 1FE8A 4OB6A 1B42A 2G3YA 3G5TA 1GZDA 3RKRA 2G77B 4AS2A 3HXTA 1VMKA 1Z45A 2IZ5A 3V3TA 2QUIA 3EFOB 3VBCA 5KWJA 3CW9A 4FILA 3LX6A 4UBJA 1M1XB 1U7DA 2R6R1 3D0OA 1MB0A 2CFIA 1QTRA 4XX0B 1KQNA 1T6YA 5KQRA 4CKBA 4BIMA 1RQLA 5A02A 1GEGA 621PA 1U2SA 3NOOA 1NU6A 1NF3A 3CW2A 3I30X 3TUZC 1JIUA 4H60A 2WYWA 4H7EA 4XSHA 2WSLA 3PEVA 1HE5A 5TSDA 3WTCA 3WYDA 2ON6A 4C7JA 2EP7A 1M1UA 3M6AA 4JEIA 4CMEA 3VYWA 1SXHA 1NOKA 5KSZA 4GL2A 4JP2A 4AUEA 1O96B 3H13A 2AV6A 2VA9A 2YTZA 1MGPA 4ZVQA 3I45A 3G0BA 3A6FA 2ATEA 1NV8A 3PE6A 1QHHB 5CG2A 1A4UA 1FYFA 4C03A 4RZHA 1K2VN 1V5IA 4UHKA 3AJAA 2W6ZA 2BUCA 1GU7A 1KMMA 2FK8A 2R1ZA 4KAAA 1Q1NA 3V32A 3K4HA 1YQEA 2AR0A 2BBTA 3MXTA 2LV8A 4YCBA 3UKJA 4ZO7A 2YC4C 4RVGA 2FWMX 4RD3A 3G2KA 2M1ZA 2WQ7A 2XT0A 1FJGB 1NJ5A 4RHUA 1SHJA 3HYTA 1FA9A 3DUFA 3VPHA 3JD2A 4H15A 1IHUA 1L9KA 2VZLA 2W6NA 4N6OA 2Y4OA 1L5ZA 3GLRA 2GH1A 4JGIA 1USIA 4KBYA 5G0VA 4DWOA 5JH7A 3ZDAA 1UWVA 3TECE 1D2GA 3WRYA 3ZJTA 3NQ41 4PLWA 2H1FA 4IRUB 4TL8A 4U9IS 4Y1GA 3EEQA 4YYZA 3FFTA 1E32A 4Q4AA 3BIOA 3DL2A 5AVJA 1IOLA 4X66B 1C9NA 1XD2B 2FLKA 3I9OA 3PFBA 3PZRA 2WT8A 5EQTA 3RE1A 3PIIA 3V4LA 3U1BA 3HBFA 4MQFB 3KQMA 4A2PA 2BDUA 2F3QA 5IBPA 2D00A 1JECA 4YDHB 5ALIA 1TLFA 3P0RA 2PAFA 3RFXA 3G9TA 3KKZA 4K3VA 4JDPA 1YCDA 3IVCA 2QW0X 2WD7B 3B6EA 4ZPJA 3VPFA 4FLEA 4Q7MB 3E8XA 4EJSC 1KZGB 3DW1X 4OBWA 4WBNA 5JS6A 2J31A 1UK7A 1AURA 4R5MA 1NW7A 4DR6B 4W5HA 3FSGA 5GGXA 4AKGA 1SCNE 3C1OA 4B3XA 1J4AA 2BUAA 1JZSA 3M89A 4IM7A 3U56A 1RBZA 4I50A 1NR7A 3RSSA 4RXMA 4BLRA 3N6XA 1L8QA 1KVRA 4RLSA 2DR2A 4Z51A 2VWPA 1YRQA 1XX6A 2OECA 1KFBB 2R6FA 1NP3A 3RM3A 3MB5A 1JLMA 1K63A 3EC1A 4DJJA 1M7BA 221PA 4GHWA 3A3PA 3AUKA 1XQ9A 4ALMA 4Y98A 1CZKA 2WUDA 3SYLA 5CDFE 3PP8A 1I4EB 1OLXB 3MD0A 4CMHA 2P2GA 5BRNA 5K51A 5GJCA 4C76A 2X4IA 1ECGA 1IE3A 1OLXA 5BYJA 2IBSA 1D8AA 3B2NA 2ECOA 2NIPA 3Q1KA 4V2IA 2D4AA 5KCMA 2PUDA 3ZE7A 4AO6A 4CFYA 3K71B 4OI0A 2EIHA 1WKBA 2B61A 1OJ7A 3ORFA 4G8BA 4KQMA 1S2MA 3SHFA 1JR6A 4BO1A 2V3WA 3P96A 2Y1CA 3IE0A 3RROA 3VHXA 3WL3A 4KIGA 4EATA 5K6AA 2DXIA 1JKMA 3CRRA 4FC6A 2OR3A 3SIPA 1XRMA 4RK4A 4UHBA 2J4FA 3HB1A 2ONJA 3WYNA 1MPXA 4JENA 1SR8A 2Q6OA 2ZBEA 4E12A 4OXIA 1MVNA 1F2UA 4KDEA 2BMVA 3L93A 1L7NA 1VYTA 3N8HA 5C34B 2EJUA 4XIFA 4OHOA 2AF4C 3AWDA 4ZP1A 3WGGA 2LPMA 2RHTA 4NFYA 2NU8A 1XZ8A 3FGZA 1W36C 1BD3A 2O0JA 3GEIA 3O9VA 4HDAA 1WB5A 2Z98A 3NBZC 2J0QA 1UKAA 2AS0A 4GKJB 3PHGA 3PPYA 4A73A 4Z49A 3MMZA 1A8IA 3SS7X 1E58A 2XXJA 4JAVC 1NATA 4MVJF 5LJIA 2OFWA 2PRYA 4F46A 1EGAA 3JQQA 3NBAA 2IS2A 4B84A 2UYYA 1JBEA 2BR4A 5ITWA 2ATCA 4HEQA 2AOTA 3R7WA 5KQLA 2O2YA 1TEXA 4JC8A 1B74A 2BLLA 3PVCA 4KQEA 3PD0A 5DLPA 1BX1A 3RCBA 1D7AA 1FUEA 2XVMA 3ZNNA 1KK1A 4M8KA 1BHQ1 3BGOS 4I1YA 4NFSA 2F8TA 2CHQA 3NVAA 1E94E 5B2ZA 1U1CA 2NN3C 3CNQS 4ARCA 3T8YA 5THXA 3AIMA 2CWWA 2PH1A 5JD6A 1QVWA 4MZDA 3GPLA 4EKYA 1NIPA 3HACA 4KACA 2DFVA 3ETEA 3IP1A 3IXQA 3ZXSA 3TQFA 4P4SA 2J85A 1NVMB 2ZVQX 1FFXB 1J97A 4GLFA 3C3MA 1NQVA 3U4HA 3TRJA 1YQTA 3KK0A 1H0KA 2VUUA 2V9CA 2ZYTX 1FFXA 3VR4D 3JATA 1HURA 1FDTA 4WN9A 4XR4A 3IQZA 3O8CA 2F90A 5KVCA 4OX9Y 2RAVA 3FSEA 1IBRA 3QWHA 4I1UA 1GADO 3T1YB 2C5LA 1QSGA 2G71A 5EKXA 3WJ1A 1E66A 1PNTA 1Y48E 3MXOA 3ETLA 3RASA 3QNUA 1JHOA 3VNRA 4CNQA 3PFKA 1HDYA 4ZYWA 2H1HA 3EAQA 4WXRA 1P9LA 2WM3A 1K6XA 3LHDA 4JWKA 3WADA 4IH1A 4XWAA 5J2TF 3VSBA 4I4TF 1JMYA 3STXA 3Q88A 3TZHA 1P1KA 4X95A 4N3BA 1I4OA 4Q37A 4RF4A 5B1SA 4Y7CA 1Z7GA 4EY3A 4FOOA 3WA6A 4KOEC 1X1EA 1YB7A 3DBLA 1OFVA 4IKOA 4B73A 1EQAA 3TYXA 3BCHA 1QGAA 4E2ZA 4UVIA 5BR4A 2JZNA 2GJSA 3UG6A 1KGSA 5JMTA 5CTJA 1UAAA 2PT7A 1FX0B 4GP9A 4BIIA 3V5NA 1AKQA 1HT0A 3ZV7A 3RG2A 4DSAA 1VG8A 1MEOA 4C0QC 2Z8YA 3L7NA 3OTQA 3A32A 2Q1SA 1V16B 4LK2A 3EUFA 3R9XA 4W5NA 2C82A 3FTFA 2M6KA 3KQNA 5HFAA 2XVXA 2DSNA 4F3TA 1GYPA 4RDHA 4EJSA 4EG3A 1RI3A 2HA2A 1X39A 1RHJA 2WHRA 1CXZA 4RJLA 3WBKA 1C80A 1ZUIA 2YNMD 2YYAA 3JTMA 4MGKR 1RCUA 4UDXX 1JE0A 4M7PA 2GPYA 4MO9A 7REQB 1K5GA 4C6TA 1P2SA 4M0EA 4ZQHA 2ZUUA 2ZUSA 3F90A 3U7HB 1A5TA 1CY2A 1OREA 4GX2A 3UHOA 2ENUA 1RWVA 2OTCA 3BCRA 4CCSA 3NHFA 1ZOLA 2I7VA 3GGJA 3ONNA 4MKXA 1RM5A 1Y7HA 1W73A 2PH3A 3QWBA 4IJ6A 4L5YA 4MA4A 3EGDA 3UMRA 2VT3A 5KEIA 2R6ZA 2NO0A 1SC1A 2JHAA 4UREA 3I92A 5A71A 1G7CA 1BMFA 4BJ6A 2IYPA 2C7RA 1E7RA 4GOXA 4BNDB 1J8VA 1OYOA 2DPYA 4DLYA 2JGDA 1X9HA 3NBXX 1Z13A 3EB9A 1KOLA 3UAZA 3CVWA 4QXAA 3O9ZA 2C4NA 5DIZA 3C70A 4RXTA 3S7ZA 2Y0PA 1SCIA 2P9CA 3L79A 3ZE9A 1EFPA 1VHJA 2NO7A 1XAJA 3WRXC 1EG2A 5E7MA 4NCKA 3IAAA 2W42A 3L3BA 1AUVA 3ZLTA 3AERA 3MGBA 4IP0A 3CG0A 3FPKA 3AJ9A 2IBTA 4HNHA 1P2FA 1EE2A 1FXSA 5D6OA 4EUKA 2BI7A 4EUEA 1DRVA 5HMMA 3LP6A 1EWKA 2PHZA 3TS1A 2YHSA 1EK5A 2NSLA 4IIJB 1KY3A 2QZZA 4R16A 4C3OB 2WQ6A 1I80A 4OH7A 1REQB 2ADMA 3PNQA 2O23A 2P8JA 3W8NA 2JCVA 4FJ2A 2RCYA 2YFHA 2Z30A 1FJXA 1Q0SA 2ZRHA 2WWWA 4MS4A 3HI4A 4G0XA 5IMBA 5JLAA 1LBQA 4TYWA 1E77A 3R9KA 5DGDA 5IAJA 3UENA 1EJ0A 4A15A 3OOSA 1CRWG 3SOPA 1ACLA 1O97D 1OQAA 4I50F 1Y7IA 5EZ5A 1KI2A 1ZVMA 5FUQA 1DAPA 4AIIA 1WCYA 1B2LA 2BEUB 3GN2A 3ORHA 4XVQA 3TTVA 1SBIA 3P97A 2NO4A 2QSZA 3LP8A 4N01A 4MI6A 2NUAB 4AY2A 2CNNA 3UBTA 5REQB 1XLUA 1JDTA 4M9SA 5D51S 2A9RA 3BHNA 4NTZA 1NLMA 4Q4JA 2WF8A 4NWIA 1NVFA 4RMGA 5FRDA 5C8YA 2NSYA 3LGAA 3EIHA 3OURA 4N12A 5JAMA 1KFJB 3IURA 3G68A 5BVGA 1T0JB 3CNBA 3ZJYA 4EJ6A 3IT0A 1ESNA 1WEKA 3KHUA 3WSVA 4D9BA 3A6PC 3H18A 1Z62A 2H00A 2H31A 4QZVA 1L7AA 4JY7A 4DR5B 1P4RA 2FW8A 1KP9A 4IQ4A 2PRSA 3JYOA 4L07A 4TLDA 3B3AA 2YWEA 2BTQA 4FYKA 4X3OA 2UVPA 4ZREA 1JIJA 2LR0A 2X0RA 4WNAA 3RODA 4U2EA 2EKLA 3AYXB 4V0KA 1N8KA 2EZ9A 3NTLA 4FMBB 2XQFA 5E6RB 3FYSA 2AG6A 4NENA 2ETXA 3QK7A 3R40A 4JWTA 2AQIA 2PGOA 1SKMA 3F9IA 2H2IA 2X76A 3I64A 4AURA 2K4MA 4MVJG 4ROTA 4MB0A 5IJWA 2IHVA 1U5AA 1T26A 3MWDB 3AFHA 5JEEA 2HCFA 4BASA 2AQKA 1ZRHA 3PE4A 1TF7A 3IV9A 1YTLA 4FFVA 4RU1A 1XQVA 4JJGA 4TXJA 1GAXA 2B8WA 5EIFA 1T2VA 3GEPA 3D4NA 3KG2A 4LOIA 2G67A 5BNFA 5HFJA 2YKGA 3DDCA 3HN6A 4MVWA 4TUYB 2GEFA 1G20E 2YHIA 4K6MA 4UPVA 2ZJ1A 3QYPA 4LWOA 4JT8A 4GXQA 2YIJA 1ZMBA 2V7XA 2ZLBA 3OQBA 1MJNA 3QVUA 5HKAA 1CJUC 2DBRA 2GERA 2GNAA 2I3BA 2XR1A 3DPUA 3P20A 4TLCA 4JLJA 2NU6A 4YRGA 4NCNA 5FOSA 3G8YA 1H2WA 1P2DA 1Z2PX 3DD1A 1GPYA 2NXCA 3F1KA 3OCWA 4D57A 3KQUA 1Q0TA 3CPEA 3ZS8A 1PBNA 2ZIAA 1Z06A 2J3HA 2AN5A 2W2KB 3L0BA 2ZTSA 2C7OA 3C98A 4D4LA 4EG1A 3Q6IA 4YRJA 5GJBA 4JKOA 3HS3A 1T8WA 2E4ZA 5CH3A 3IVXA 4G0WA 3EH2A 3UY4A 4P5EA 4RK1A 4YXFA 3L40A 1E18A 2UXBB 1P5HA 3NW9A 4Q1CA 1ORRA 2CVZA 2I6FA 3CZ9A 4J1SA 1DEXA 2R5WA 2WVAA 3FETA 2YJZA 4XD7A 3SZOA 2Z56A 4JXZA 2RGUA 4AF6A 5AW4A 2KWIA 3PIDA 1QGYA 4PZYA 5CUQA 2NAPA 1W6UA 4PBTA 5KNDA 3R3UA 3VUFA 3D59A 5FLKA 2RK4A 1M2HA 2X19A 3K0HA 5MGNA 1YE3A 3M1IA 1T10A 3ROTA 1CEYA 4GXNA 3A05A 1H4TA 4B2IA 2DU8A 3E5HA 2BWJA 1D0SA 1YVRA 3S70A 2DPGA 1W6RA 1KKMA 2F7SA 4W8GA 1HDIA 3ZIUA 4EIWA 3LQQA 1VL6A 2HA5A 3CA8A 1X7GA 1R9MA 3O92A 1YQWA 1AD2A 1UBJS 2CZQA 1PV1A 1Z6PA 2ZAOA 3DAFA 3ND5A 2AQHA 4KMOA 4OGWA 4Y67A 1V25A 3AEKA 2RB4A 3PUZA 3TW0A 5EP2A 3NWEA 3WXMA 4HFMA 4DADA 1IQUA 2EGUA 4CF6A 3H2HA 1UQRA 3BC1A 3D6FA 1G9SA 1NZJA 4HQNA 4IKEA 3CIOA 1HE4A 4DQLA 4FJ1A 4JJIA 4XGKA 4B43A 4L4ZA 2OC9A 4CMKA 1BX3A 1MO2A 1KP2A 1TVKB 1UM9B 2CNWA 2Z5VA 2E82A 4LJKA 4FMDB 4ADSG 2XXAA 2WILA 4FD3A 2QGZA 4NQRA 4K8RB 2CUKA 1AN0A 1EP1B 2QPTA 3HBAA 3HNOA 3M9WA 4QPJC 4TTQA 1NWCA 2CJPA 1HX7A 4PC6A 1I7QB 1DKOA 1EBUA 1XKXA 1Z4NA 1T13A 2ROQA 5G0TA 1KYVA 2LGJA 2RONA 3IPXA 4G5YA 3VR3D 3CLRC 1S89A 3EW7A 4D43A 3OJOA 1SOWA 1CUCA 4LJ8A 5ISMA 3RVLA 1VXOA 1VG1A 1YD7A 1E98A 1WMDA 1E1NA 3HUEA 1GGHA 3I2HA 3TOZA 4OSPA 5LMUB 5IVHA 3RRFA 3KTAB 3MJSA 3QKRA 3V2UA 4FEYA 3ICCA 3TIFA 4QLOA 1RJ9A 4HH0A 2WNIA 3K05A 4HDRB 1I9CA 3I6ZA 2ZI9A 1LUAA 1L8LA 3U80A 5IJ9B 4B48A 3EODA 4WK0B 4HDRA 1LV7A 3GJZA 4KK4A 1T4BA 2R4QA 3B1JA 3I6MA 3JYHA 4QHSA 3UTDA 2FW0A 1WHSA 4U2KA 5AR1A 4IHJF 2MYUA 3CNOA 3K94A 2H9IA 1ZYUA 5JAHA 2H18A 1EVZA 2QRUA 2FSHA 3E9YA 3IT2A 1NWHA 5CJPA 2PUHA 4GSYA 4ALLA 1JPNA 1GA4A 2AA3A 1R0YA 3K9HA 4V39A 4DT1B 1F6DA 1TQ8A 3KCQA 3C16C 2C3PA 3OI7A 3ZNOA 4F7WA 3W3AH 4RVOA 1ZNWA 4EG7A 4HLQB 2WDPA 4ZHSA 1BZYA 2FRDC 2AXEA 2O1XA 2PR7A 1TQ6A 4ZDWA 4Z3DA 1KY5A 1YS7A 2ZBDA 2ZBUA 3DP9A 4NHOA 2C4WA 5DWVA 1P0CA 3FHTA 3MVEA 1RFLA 2AXNA 4IJUA 2QTHA 1YB2A 3S1AB 3VZRA 1XMSA 2O8FA 1QANA 1P4AA 1ZUNA 1RKBA 2FSFA 2YCBA 1V1MB 4QUAA 4AWXA 1DIOB 5LP6C 1ZUNB 1TPYA 3ICOA 2QW8A 4LXUA 3KZOA 1QF6A 1K4KA 1DQPA 1EUCA 1TQ2A 2J5QA 1X80A 2I3GA 4KODA 4AJHA 1V3VA 1GGEA 4QOIA 3IERA 2JD2A 2YIVX 2FPPB 3F6PA 3ZY6A 3QGMA 1GFSA 3OFNA 4KQ6A 1JG7A 1V4BA 4QDJA 1T3LA 4X71A 2F4VB 4DJ5X 4BXOA 2G9NA 2VWGA 5G4KA 2OHVA 4JDUA 3QLUA 4BN4A 1YNSA 2VTBA 1JQKA 3HPRA 3G6KA 4QTZA 4ESVA 3OQIB 2GLTA 2MDTA 4PHHA 5CTAA 1ADYA 1II0A 2IFTA 3IKVA 3IMCA 5P8WA 5DBOA 1CG6A 3M5WA 3PK0A 4KPEC 1E62A 3BT7A 2PKQO 2EWMA 3QBVA 3QU5A 5IJAA 1ZN7A 4YASA 1XLTC 3MIIA 3C7DB 3MGKA 3AINA 3QITA 1T6BY 4BV8A 1HQCA 1QAQA 2HV8A 2QMHA 3E1SA 1P2BA 4DRYA 1C9EA 3A1WA 3AMVA 1VFPA 1AE1A 1GAWA 3LG2A 4G9GA 3SZLA 1R2QA 4D9CA 3C6XA 3HYLA 2R7MA 1XVIA 1KXZA 3PVSA 3UK7A 4IHQA 1DG3A 3ZU2A 1KKLA 4R9UC 1Y9EA 2XGMA 4PBSA 2PKEA 3RFVA 1P1CA 4S35A 6YASA 4TXHA 5GM1A 2FEKA 2F8SA 3L43A 5J9FA 5AP9A 3RR2A 4PV7A 1LW6E 5EJMA 5BUZA 2AFHB 1T9BA 5HX7A 3ACDA 1PHRA 3A1FA 1OI4A 2VYCA 1MQ9A 1ISHA 1IUOA 4NARA 3NHMA 1NIJA 2AG0A 5J2TB 3G9XA 3A6GA 4TT3D 4WNAB 4KQWA 4OJTA 4KQFA 2RK6A 4YAKA 1H4SA 2GLUA 2Y1EA 3TXXA 1SY7A 2ESRA 2Q1UA 4BKOA 4EO7A 5HK8A 2QUAA 1DRWA 5EESA 4P7KA 3WFJA 3UMMA 1O9HA 4IY1A 3CEHA 4H7FA 4Y6SA 3AR8A 3BHJA 4S24A 3UK0A 3EIWA 3WV4A 3N53A 5CJ2A 3OF3A 4RGYA 4X61A 4NV1A 5EUBA 3HCWA 3M81A 1LH0A 1VLLA 4M21A 3SYKA 5DRYA 4ZAYA 2JIOA 5FAKA 4HATA 3H6GA 1ULZA 4LXTA 4R1UA 1GTZA 1KIAA 3KT3A 3GEEA 1W8DA 3QVXA 1JHQA 1NBAA 2UVPB 3HLKA 1XRPA 4KAFA 5IP5A 2DT5A 4BNTA 4F8EA 2X0IA 3N2LA 2ZJ8A 1V6CA 5BWLA 1LDGA 5ALOA 4XWTA 5IN4A 1NFFA 2ZYSA 3A36A 2ZGVA 1CUJA 2FWIA 3ECCA 1F9EA 3IPYA 4HAIA 3V4FA 3KZVA 2VP6A 4PSDA 1PEAA 4HNVA 1GITA 2AI2A 4DM7A 4NS1A 5CFOA 2D2EA 2VRCA 2ZJOA 4W7IA 2GFQA 2I8CA 4WJKB 2QL6A 4WTOA 3WL4A 1P7YA 1OYVA 1LPOA 4GPEA 1ISGA 2R62A 1FDOA 1Y9JA 4QLAA 1A88A 2H2AA 2SCUB 2VXYA 4G4JA 1QO7A 2JIZD 1NC1A 3EIOA 3PGLA 1OBOA 4KJZA 1AF7A 2ALJA 2GO7A 3KYBA 4BVJA 1IH8A 1AB5A 2NSHA 2RGDA 1FP7A 3FDZA 3MBOA 4F9EA 2XDYA 1O0SA 1IJEA 4C4RA 3RBAA 3Q72A 4L72A 3T41A 4YCNA 2GAFA 4BLTA 2B82A 4L4RA 3UUGA 3KLBA 1ZXBA 3P7MA 4GE0A 4U3JA 4KXNA 2C8KA 4LCBA 1PW5A 1DDGA 5KVSA 1ZOIA 4LE1A 3STHA 1OT3A 3ED1A 2ENWA 3IKLA 2W22A 4FHEA 4ZMRA 4OK3A 1PX0A 2CMGA 4BVHA 4JJ6A 1ZXXA 2GDJA 1P2VA 3KJFA 2Q2QA 4IUCS 3LDAA 5TE9A 1E9EA 3A4NA 5M7EA 3WB9A 4QUDA 4QJIA 4F9GA 3QH4A 3ZUGA 4NY1A 3UJDA 4BRZA 1LY1A 2YWBA 3LCMA 3FLEA 4LKRA 2VK8A 4RAOA 3K2QA 4QYXA 1NM5C 5C5DA 3EFHA 2C07A 5AI6A 3PR3A 1YI1A 4DFDA 2Q9BA 1UR5A 1ISPA 2OBXA 3ND6A 4RSGA 3BJZA 5KQGA 1FX1A 3TLMA 3PHLA 1ECPA 3CGWA 5FI5A 4LFCB 4PAWA 4WLFA 3K92A 3C5CA 4N5HX 4PNPA 1OIWA 1Q0RA 4OBBA 2PJZA 1QZ3A 4KRYA 4QOGA 4LRXA 2P9JA 2JHFA 3TLGA 1ZCBA 3H5RA 4UHFA 4Z9XA 3ZQ4A 2QT1A 3CXUA 3RS0A 1YRAA 5JAIA 3AEKB 4RENA 4MW2A 2QSUA 4BXOB 1E8NA 4PTYA 5F9HA 1S2OA 2C95A 3I01M 3R0QA 4EENA 5GPBA 3MC1A 1ZK1A 5E6RA 5K8CA 1GRNA 1VFNA 4BMCA 3W5CA 1L5MA 1LRLA 2J0VA 4WA8A 2XOEA 1RCFA 2J41A 2O3RA 4NYJR 5CNKA 1U2DA 3DHEA 3U4AA 3IKJA 5AUPB 5CFLA 2W43A 4UHHA 5EEGA 4KSBA 4EMSA 2CLOB 1Z38A 4I9UA 2Z8YM 2AUNA 1ORDA 3I28A 3OQOA 3BOSA 4II3A 3A9RA 2J7PA 3ZZTA 3OJXA 2HEIA 3CKKA 3ZHBA 5IFKA 2HIMA 3ZV4A 3UFXB 1IBCA 2ERYA 3NEPX 5A7FA 3E9RA 5DFAA 3LXRA 3JARA 1GM5A 5DM1A 2JLQA 1BG6A 4KJXA 5WRFA 3OC6A 4FYHA 4KLRA 4IDHA 2WYIA 3UXMA 4C4SA 5I4BA 3F6EX 5LQAA 1T9KA 1MD9A 2QU8A 4XKJA 4BU0A 3JR7A 5FFFA 2Q3LA 2PRJA 5HUHA 3JAKB 4A2WA 3PX3A 4LOLA 3GBVA 5TQVA 5JLJA 1QRTA 1HE3A 1IYZA 3FIUA 1P19A 4GM4A 1XRSB 5AKEA 1KSJA 1Y3FE 4MMYB 2NUAA 3EW9A 3T52A 2GCNA 3SKYA 4DUPA 3NHSA 3A6JA 3TAHA 4U0KA 2IDMA 5C80A 2ET6A 3B85A 3FGPA 1GVHA 4L4SA 4AF8A 4JJ8A 3HB4X 3RRZA 4XOIA 2VA8A 4QT4A 5JD5A 2QSYA 4WKBA 1DX6A 3F49S 3EAGA 4QG7A 3BTOA 3RAFC 2B5VA 1RADA 1GXSA 4OGGA 4YRDA 3IDZA 5EXEA 1JLHA 1DBPA 1DU4A 1UPBA 5HOEA 1WDWB 2X15A 5TQ2B 1G6Q1 2YWXA 5AW0A 3GGDA 5BOSA 1U80A 4A16A 4KVFA 3O2JA 4ZV7A 4DSNA 4LYFA 1F4PA 2XJ4A 4MUYA 1V11B 4ALNA 4Q02A 2A5DA 2FFQA 2H3HA 4QPPA 3KJEA 4QVGA 1Z3IX 1IZZA 1G3QA 2WE7A 4L57A 4MPTA 4X97A 1RRKA 4FVTA 3QJGA 4F21A 1J7KA 2HAEA 4C08A 1WABA 4XWOA 4B17A 2F3RA 5KNBD 4DMCA 4KQCA 4FC7A 1II8B 1BMQA 3HI6A 5E2IA 3ABOB 2X0FA 4DCTA 1HYQA 4AJEA 3B8EA 5IF3A 1U99A 3CVVA 5DE3A 4KPUB 3PXCX 3WC4A 5AW2A 4EHFA 2GK3A 3HDTA 3HP4A 4KV9A 4O6VA 1ZZGA 4IDDA 1YK0A 2QUBA 4CL8A 4JVMA 1OGIA 5H59A 2JCSA 3ZHRA 4PWYA 4EYKA 2LWIA 1L1EA 1P0PA 4KIFA 4TQ9A 3D7SA 4BMPB 3PC6A 3HGTA 3YASA 1VBNA 4QVIA 3B8HA 4LQLA 3SN6A 3ZU4A 1J07A 3TRIA 5F52A 4CUKA 3S2FA 3PNPA 3JQAD 3M2TA 3R3HA 4BUCA 3M83A 3P5BA 3ASVA 2ISQA 4C7KA 2GSDA 2AJTA 4KU4A 4YTEA 5I51A 3NTXA 1TZJA 3KVYA 4DBZA 4FFSA 4FZVA 4O33A 2ZWPA 3KB8A 4WADA 2I2DA 3AGPA 4FFNA 4JUIA 5L3QA 4FIZA 1N6OA 3V9AA 1FNMA 2WWVD 1YJ5A 5K0TA 1EP2B 2NGRA 2EHDA 3BHIA 4ETIA 2GJAA 2PLFA 4FYJA 1DX9A 4QL3A 2KS6A 4WSOA 4XGIA 2EIXA 5L3ZA 4H3KB 3RNOA 3T7TA 5E9JA 5G02A 1Z0UA 4E2WA 3R7BA 1J2EA 3V1MA 3L8CA 1RW4A 4AZSA 2LD4A 1R6TA 2W6MA 4YMUA 3MK31 3BEDA 3CLTC 3EQ9A 4MJ7A 1NNLA 1TD9A 2C2GA 1PR9A 3BE4A 4QU0A 4UJ5A 1RU3A 5GVSA 1SHZA 3FYUC 2QGFA 4BAGA 2JLZA 2N1MA 3A4LA 1MOSA 4HDMA 3PXXA 5CP8A 3C8HA 1ULBA 2I71A 2PWPA 1U0FA 2F1JA 2HJGA 2ATXA 2WIKA 1GYQA 1MQSA 5LOVF 3VSCA 5AM2A 1IN7A 2QM0A 4R6XA 4YLGA 4BV2A 4ZV9A 1Q0UA 1PR6A 1A9RA 1E7SA 1QGUA 2E3JA 2FPLA 3IBTA 3OEEA 3ICQB 3WAGA 5AOCA 2VK2A 3GL9A 4M0CA 4C0AC 4NCIA 1HDOA 4PG4A 1N7IA 3OUZA 1WP9A 2FP4A 4W9NA 4DA6A 2W93A 5AJHA 3PEEA 4HPXB 3GLTA 2QAGC 1X1CA 1VECA 2H5IA 3SI7A 1COWA 2DCMA 3QVSA 3WKBA 3PFIA 3WL5A 2AF3C 2OA0A 2WTBA 3ESDA 3PZBA 4BQPA 1CUIA 3NVMB 4FHDA 1RWWA 3TUIC 1CE8A 1H5NA 3U4DA 1EFPB 4YB8A 3WMEA 5EJ9A 1YS1X 2FQWA 3GRCA 2G9VA 4G63A 1ZPDA 2ZVDA 4Q3CA 1I32A 3RVNA 4G89A 5I9BA 1V7QA 2IXDA 4FDTA 2VK4A 1DBQA 1D03A 4ZA2A 4CMJA 2Z2IA 4NP6A 4CGZA 3DE2X 1I5OA 4YRFA 1FTWA 2BGUA 2C2WA 2IUTA 3AHEA 3AUXA 2UAGA 1WXEA 5G2OA 3IQEA 2FY8A 3LKBA 3QLVC 1LI4A 5FLYA 5CDGA 3RSFA 2Q0QA 4PXAA 2XB4A 3EOZA 4L78A 3WMFA 2LXNA 1T0UA 1ZX1A 1IWOA 4KQIA 5TS2A 1KQPA 2A92A 4QQFA 4DCSA 1XPUA 2WA1A 2DBYA 1FJ2A 4OXKA 4MTCA 2BM1A 5FEMA 3GDGA 4PFKA 4PZUA 1BC5A 1MV5A 3KPYA 1CP3A 3LY8A 4JLMA 3RV4A 1K5HA 1GU0A 3QOWA 3B20A 4GKKB 1MQAA 3CVJA 4HRXA 2CEKA 2FZEA 4IZHA 4UAGA 4BDTA 1MIOB 1XFDA 3GK3A 1LQ2A 1PJQA 2O8VA 2X9NA 1SUSA 4EITA 4BC0A 3PKIA 1B43A 2B21A 2HWXA 3OPQA 3DFKA 1ABEA 4B44A 2DX7A 1UQUA 3OFND 1ZJ4A 1RM4A 3PKZA 2E9SA 4HYTA 1XKTA 1D8TA 2VP3A 4UHEA 4AN1A 1E2GA 3KM0A 5AI0A 1GP2A 5D5QA 1J06A 1KVSA 3ANLA 5JQWA 1AKWA 2ZE6A 3PU6<