2LWIA

Solution structure of h-rast35s mutant protein in complex with kobe2601
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In silico discovery of small-molecule Ras inhibitors that display antitumor activity by blocking the Ras-effector interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords GTPase HRas
total genus 41
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2lwiA00
1UADA 3RRNA 2IT1A 4TMVA 2ZU0C 3VNVA 1Z0AA 1Z0KA 1YZGA 3MMPA 3PEVA 1QDEA 2SHKA 1K6MA 3BH7A 2WWYA 4PANA 3PEUA 1GAJA 5H68A 3FKQA 2IYWA 2WIAA 1YRAA 1E2DA 4R2IA 5DYGA 3WHLA 4AURA 1P61B 1W5TA 3MJHA 2HYIC 4PHGA 1RRPA 3K9NA 1OYYA 3PG5A 4KHZA 1VYUA 4M9QA 1S4QA 1YHNA 2O8EA 3REGA 1HURA 1ODFA 1XEWY 3FFBA 4N3NA 4TLCA 3SI7A 5IDVA 4P4TA 1KMQA 1OFTA 1Q21A 4P31A 1OW3B 2R65A 2Q9BA 2YZ2A 2ZS9A 2RHMA 3MG9A 4P3YA 3RVBA 3SQWA 4XH9B 2VHTA 2R6CA 4MDFA 4B3GA 3BH6A 2O8BB 1G1MA 1JEEA 4LYFA 2C2HA 4P4SA 3NXSA 4DB4A 5JECA 1OKKD 3LV8A 3AEZA 2W00A 1ZM4A 1FOEB 1ZD1A 4JLDA 2CK3D 5J40A 1ZC4A 3K70D 4OK6A 3WYGA 2QL6A 1KO8A 4NCNA 3I92A 3R7WB 3ZZ0A 1Z0FA 1LVGA 2F1HA 3QG5A 4LJ7A 3CF2A 4RZXA 5L3SB 4CEHA 4CEIA 3K09A 3QKUA 3RRZA 3S1AA 2GZDA 3T1TA 2MMGA 2A3RA 4Q7LA 2NPFA 2QMOA 3M6AA 4IOLA 4BFYA 3NHAA 3FOZA 1DVRA 2QU8A 2ZSFA 3WY9A 1WP9A 1OIVA 4LYAA 2QQEA 1E9BA 2WPDD 3WMEA 2ZJ8A 5CK4A 3U2QA 3KKQA 1MH1A 1PZNA 3ZH9B 3ADDA 4PHFA 5HZKA 1GILA 4C0QC 4GNKA 2JIZA 1TU4A 4C3ZA 3ADKA 2OV2A 3KKNA 5KU1A 1G3IA 2CVFA 1E99A 4FXPA 3OZXA 4OQNA 2WWGA 1DG3A 4Q48A 2NIPA 5JFGA 1Z8FA 1LNZA 4GZMA 3RC3A 1OE0A 4HAUA 2ZJZA 1C9KA 4LUCA 2GXUA 4B35A 1XEXB 4EPYA 5K8IA 1T5LA 4KO8A 2NPIA 4AKGA 1L8QA 1GWNA 1SHZA 4US0R 4FD2A 3B9PA 3EPHA 3GJ3A 1NRJB 4OQMA 1LF5A 5FUXA 2QROA 2QT1A 2AKAB 3BS4A 3LVRE 4WOPA 5LB4A 1TAGA 3G0HA 2JLYA 1W46A 3CLVA 1AS3A 3T15A 1BYUA 4DT1A 4E07A 3GLIE 2ZAOA 3U7GA 1YU9A 2WICA 3P27A 3VNUA 1M8PA 3CF0A 4OI1A 4QBIA 3GP8A 1G6HA 2X1VA 4EDHA 3AV0B 3RYTC 3LXRA 3CIOA 5TMPA 1S0UA 4XVQA 2XTNA 4LJ4A 1W36D 2XJ9A 1JR3D 4HAVA 4ZDKA 4DC9A 3LWNA 5BXQC 2ZM5A 4RD1A 2QBYA 1N6OA 1E1QA 4MKIA 4W5HA 3FGNA 2PMKA 4ZPXA 2A78A 1VYTA 4KFTA 1DTSA 4LCBA 2RGEA 2ZI9A 4BRWA 3SEAA 2R8RA 4LZZA 4C7OA 5EE5B 2X8AA 4PSKA 4HDOB 1E96A 3ADCA 2GF0A 1AJEA 3IQXA 4LHZA 1XDBA 1AQYA 3RS0A 2JLWA 2W6JD 2RKOA 2RHDA 4M9ZA 2FFAA 2RB4A 1EXMA 4JT4A 2GA8A 2X2FA 4LWZA 4TMTA 1YZNA 3QKTA 1VYVA 4OL0A 1G7CA 1EFCA 1XBTA 3TR0A 1Q57A 1F60A 1SXJE 4JSYA 4GDFA 4XWKA 2IA5A 2DFNA 4AKIA 2RGGA 2P67A 2A2ZA 2IBMA 3OAAA 1G20E 3RAPR 2AXPA 4JS0A 3MJRA 4DBLC 1ZC3A 4KODA 5ANRB 1IBRA 2OFOA 2WHXA 1TQ6A 4TLDA 2KI5A 4KFRA 3U3OA 2EWVA 1KNXA 4Q1DA 3QXJA 2D2EA 2GAAA 1Z6TA 3U4QB 4Y0VA 4DDUA 1BO6A 3I3SR 4CDGA 5CIWA 3R8CA 1CBUA 3CNLA 2CL0X 3GQBA 1CR4A 1SVOA 2OESA 1VG1A 4N0EA 3LW7A 4BZQA 3FMIA 2D06A 2VLIA 5KDOA 5HTKA 4HB4A 4YDSA 4N1AA 1W36C 1TQ2A 5E7MA 3TSOA 3QXSA 3F5FA 4Q9LA 3THYA 3AVOA 1EFHA 5JCPA 2JLXA 1KNQA 4JLNA 3KQLA 2I1QA 3K1JA 1IN8A 1QHHB 4ESHA 1VHLA 1E2HA 3OEEA 3EX7C 3BWDD 3EWAA 1DAEA 3IKJA 1YR9A 3CF6R 2KJQA 1S1CA 4QOSA 2AFIE 1UKEA 4L9WA 1KAOA 1XNJA 1IXRC 4O2RA 5KDLA 2FMXA 3Q85A 3A1SA 2AR7A 2OE2A 2C03A 2ZI4A 1VMAA 2YWFA 2BEKA 2J0UB 2J46A 3HP1A 4Q21A 2ZE8A 3EW9A 2QAJA 1Z6AA 4RJLA 1EFUA 2JJ2D 2J45A 3AF1A 4Q5IA 3DZ8A 3IEVA 2JDIA 4LC1A 2J7KA 2JLUA 1GM5A 2NO0A 2W2VA 4URZR 1NL3A 1Z5ZA 5FPYA 2OFWA 2EFDB 5FTKA 2F9MA 5FBVB 2ECKA 1N0VC 2BVNA 5DI3B 3X2SA 4LV5B 1WF3A 1DG1G 3T1QA 4GP7A 4EQ6B 3THOA 1GUAA 2ZETA 2CLSA 3CRW1 4KJZA 1E0SA 2G77B 4A1FA 2IYUA 1E1QD 1LS1A 4V02A 4M4SA 4G5QA 1BYIA 3D3QA 4MRPA 5LPNA 1DS6A 5TDHA 3FMPB 2XX3A 3THWB 5CM9C 5FL7A 3PUVA 5L8VA 1R5NA 1MV5A 2UVQA 1GRRA 3ZLJA 1CJVC 3PUYA 2H18A 4XTRA 4KU4A 1ZMXA 3KXKA 4A8JC 3TRFA 2NMVA 5JRJA 5AUQA 3Q72A 4URVR 2HF8A 4HSEA 2A5JA 2FWRA 4ZO4A 1CR1A 1PLKA 2QTVB 4KXFB 4DHEA 5F9FA 3W3ZB 1DARA 3K8YA 2GEUA 3IO5A 3DPUA 3IDQA 1NMYA 2FZLA 2GILA 4M2LA 1RW4A 2H8KA 4IRUB 3R8FA 5IT5A 4YMUA 2C99A 4QHTA 1DAHA 3NTUA 3BB3A 4HAZA 3IQWA 4U02A 1KI7A 2V3CC 2KSQA 3DVLA 1XJ0A 1OPXA 4X8HA 1M1YE 2WZQA 3A6PC 3LX5A 4KBGA 1AM4D 4PPNA 4NP6A 4BGDA 1COWD 1ZUNB 1ZIOA 2VSOA 3BXZA 3TR5A 2J9RA 4QJ5A 4F91B 3A1TA 4U00A 1P9RA 2OCPA 1F2UA 3EPLA 1N0WA 3QY0A 1JR3E 2BC9A 2Z43A 3SQXA 3E2IA 3QG1A 4LX0A 4A0GA 2JLQA 4EJSB 1D8TA 4C0SA 2N1BA 1Y3AA 3OE7D 4TLEA 1Q12A 1PJRA 2O0JA 4Q4AB 4B2IA 2GEVA 4ZKEA 1HY3A 3VX4A 3I5XA 3FVQA 4JBYA 3W6NA 2ZR7A 5DYIA 2ODNA 2IL1A 2WKQA 3C7KA 2ZANA 221PA 2QENA 3LQRA 2ONKA 3EZ6A 5AJYA 2Q3MA 2QGNA 1R7RA 5FPSA 1P2TA 2O8EB 1Z0DA 4IDHA 1NJFA 4Z1MA 4OBEA 1SVIA 4QHYA 5JI2E 3FTQA 2IS2A 1KY2A 2IXFA 3BC1A 4MQBA 4PC7A 5P21A 3U6KA 2P5TB 4Q4HA 2HV8A 3T1VA 5KDDA 2FA9A 3NVAA 1WCV1 1Z0IA 3RC8A 3U3MA 4DLUA 2AD1A 3O8RA 1FMLA 5BQ5A 3LW8A 3DOEA 4LBWA 3TAUA 1E0KA 1KI3A 4DXAA 1MR3F 2G1KA 4NCJA 4Z51A 1IOZA 1MKYA 1XX6A 1Q1ZA 3BIFA 4RFSB 4GBMA 2B8TA 4OQXA 4S35A 4QM6A 3VR3A 1I2MA 3TQFA 1VDZA 2WV9A 3NKVA 4D4JA 5H8WA 5BYJA 1B23P 2JCSA 5BYKA 2ZAMA 3ZD6A 4OHWA 3A4MA 2NG1A 5EZ5A 1Z28A 1X3SA 2FJUA 5TVKA 4A15A 4OK5A 4F93B 2L0XA 4DDVA 2ZRIA 3BK7A 1QHSA 1JPNA 2IYXA 4Q7MB 4A6PA 1TQDA 1TQ4A 4BLOA 2FPMA 2BWJA 1A2KC 1S1MA 3BE4A 4YDHB 1HH4A 2ERYA 1M74A 2H5EA 1XTSA 4QNRA 1FL9A 5IRCD 2YV5A 2O8BA 4NZYA 2GVDC 1U8YA 1NBMA 1BIFA 4B47A 1N6NA 2FGKA 4UQOA 4B33A 4Q9HA 3UG7A 2WKRA 1NLFA 8OHMA 3ZVNA 1OV4A 2EQBA 4D0LB 4DVGA 3LQQA 2WKPA 3AVXA 3IIJA 2XGJA 4BFVA 4IVRA 4TMZA 1FZQA 3FMFA 2JJ2A 3HU1A 3GLGA 1IN4A 1DBSA 2J0SA 4P4UA 3RSLA 1EESA 1CS4C 2VH5R 1CU1A 2JLRA 2TMKA 3KFXA 4BLPA 1OB2A 3IEUA 1I4DD 3VR2A 5H70A 4ILEA 3R9IA 3AP3A 1BS1A 2JATA 4LHWA 2C5LA 1KDOA 3T35A 3AH8A 5L3RA 2BKUA 3W8NA 4GMXA 1P4SA 1MOZA 4LBVA 1OFUX 4PPFA 4S2EA 2GNOA 4H1UA 2DFKB 3FHOA 2QQ0A 3GJ5A 2QN6A 1DPFA 4EUNA 4D26A 4KSBA 2VSXA 3Q7QA 2J59A 1IY0A 1EK0A 5HE9A 4TSFD 4HLCA 2WBLC 1FX0B 3FFAA 3BB1A 3VKHA 4KAXA 4IVPA 1ZM3A 1TPZA 1E9EA 4KLZA 2XXAB 1WE2A 2IF2A 1BMFD 2O8CA 4LI0A 1E2FA 2WIBA 5LD2B 2XNDD 3SBDA 1E2NA 3QKRA 3ZIAD 1D2NA 3RS2A 4MYUA 3Q5EA 3QOFA 4NBSA 2KB0A 5CLQA 3TUZC 2IYRA 2A7QA 3DKPA 5DHFA 5F2EA 5A5GA 2VF8A 2BHRA 5CB6A 2FH5B 2GCOA 1KI2A 4CVNA 4BWYA 2WWIA 3SJZA 2O52A 2CNWD 6Q21A 1KMHA 4WA7A 3V4FA 2FPLA 1UBEA 3C5CA 1AS0A 4UJ5A 4TQ9A 1IXZA 2WTUA 5JJIA 2Q6TA 4AG5A 5BW8A 5E95A 1XB2A 3ZVRA 3BRWD 2J0QA 2DWPA 3K53A 4ERNA 1R0YA 2IUUA 4NMMA 4JYCA 3HPRA 1S3GA 1U9IA 3B85A 4EJSC 1WB9A 2PH1A 1NBME 1OXTA 4POAA 1H65A 4ASUD 1H8HA 2Q21A 3MWKA 1KSHA 2FFQA 1E9SA 1FX0A 1E2JA 1XTJA 3BGWA 3RRYA 1XJCA 3DL0A 3TGPA 3J81k 4MKFA 4KYIB 1KO5A 1SVLA 3AVQA 4Q9KA 1GVNB 2GF9A 1ZU5A 4JBXA 1QRAA 2XOKD 3PCRB 1E0AA 3PEWA 4RCYA 1JQJC 4NYMR 1X6VA 3G82C 2FDCA 4C2UA 1E1RD 2GWHA 1EFRD 4XWAA 1XCMA 5SZKB 3F0TA 3JVUA 5JWHA 1G5RA 2VHUA 1FW6A 1I4TD 3AP1A 1D2EA 4BECA 4ARZB 2BKEA 4IDNA 4PSVA 2CHQA 5JMTA 4M1KA 1R5BA 4YLGA 1M7BA 3B8HA 4B3CA 1RPZA 2DB3A 2RAPA 4Z8YA 4PFSA 3T1OA 3AVPA 3KKMA 4F92B 2V55B 3B13B 3OEHD 1ZCAA 4Q03A 3SFVA 4KBFA 4C0HA 4M1YA 1YZQA 1G6OA 1R10A 4QNMA 4TSFA 5KYKA 3QSYA 1SXJC 4H9GA 1VG8A 3FHTA 4EPTA 1BKDR 2F3RA 5CYPA 3BD9A 4LPKA 4GL2A 3I8SA 3VQTA 1ZCBA 2OSBA 4PO9A 4JYBA 1E94E 5SZHB 1NY6A 521PA 3KQHA 1N6RA 3A58B 3I73A 3NH9A 4DIDA 4QJ3A 1B0UA 2CL6X 1GIAA 4BRUA 1J8MF 1R8SA 3EPJA 1N6LA 2AWNA 3CPEA 1OXSC 1KI8A 3D7MA 4Q7KA 4V0NA 4I81A 2AD5A 2FSGA 3A37A 5EP4A 2DFTA 4AWXA 1CR0A 4MYTA 2ZTSA 1I4LD 1OXXK 2QBYB 1T3SA 2YOHA 5IF9A 4I1VA 3PEYA 1QVRA 5CB8A 4E03A 2EW1A 4A8JA 3GJ4A 2B21A 1Z6XA 1G5PA 1P7CA 3KQNA 3P32A 1RYFA 2ZJBA 3K9HA 1Z07A 3T5DA 3HWSA 4UKDA 4OI0A 1G3UA 1WXQA 2D62A 1Z22A 1KMHB 1LB1B 4IW3B 4JL6A 4QL3A 621PA 2PLRA 1E79D 1FQKA 2GHIA 4TMWA 1U8ZA 1Q20A 1XEWX 2WWHA 4JLJA 4O3MA 2FOLA 3GD7A 4QGFA 2YKGA 2WAYA 2F1IA 2QY9A 5JSZB 2OCBA 4WIAA 2WAXA 4EFLA 3LVQE 1P72A 1G21E 2QMHA 5E4FA 5IK2D 4PAMA 2FSIA 1E2IA 1XRJA 1J7KA 2ZVPX 4IDQA 4LK2A 3VR1A 4CZ2A 2PBRA 5K8UA 2BM0A 3CNOA 2DWOA 3O8BA 2YHSA 3R9XA 2YOGA 1N2CE 4QRHA 2NOAA 3CNNA 5CIQA 5FPTA 3AUXA 3GLIA 3FKSD 1TTTA 3LBIA 2X2EA 3BH0A 3ZS9A 4C0JA 5J4YA 3TW4A 4C0LA 2AN9A 1VPLA 4QJ4A 1SKYE 2QP3A 1DAIA 2KBFA 1RFLA 1Z83A 3EIQA 1ZM2A 1NLYA 4YMWA 1NF3A 3EXAA 2XZOA 4M0LA 3SJBA 4C0BA 2F43B 4PC3A 1GSIA 4MRVA 4PQYA 4CEIB 2V8OA 1N25A 1CJKC 4AYWA 4IXMA 4IKEA 4BQSA 2P6UA 2BV3A 1EX6A 2HEIA 1F6BA 3VFDA 3AVTA 1AKEA 2GETA 2ZU6A 1G41A 2ZE6A 2H92A 3I32A 1T0HB 2FSHA 1ZUHA 2XEXA 5L3SA 1MRNA 4TWZA 4AYXA 4BLQA 2JLZA 2VHCA 3ZGXA 2QEQA 1WBDA 2GJAA 3I8XA 3OHMA 1RVDA 1W4RA 3H2YA 2JJ1A 1XMSA 1ZNZA 2BDTA 2J7PD 2NO1A 5FOSA 1G7SA 2CMKA 4DIEA 1N6PA 2IYYA 3WRXC 2IYTA 4WBSA 1NVWQ 1ZW6A 1RJ9A 1E6CA 1ZAKA 3N70A 1GL9B 5IK2A 2REBA 1E4VA 2VBCA 5KNBA 4BFWA 1G64A 2EWWA 4TL8A 1XPOA 2P6NA 4TYQA 4BFTA 1AZTA 4QFMA 1D9ZA 2ZJ2A 3FKSA 1S9DA 3E1SA 4LGMA 1DO2A 1K8RA 4EQ6A 1U94A 1SHKA 4WZAE 4RD6A 5BN5A 3UATA 1U0LA 4IEEA 1YQTA 4NTZA 2G1JA 4AIIA 5GJBA 1W0KD 3T12A 4B74A 3D31A 4YXWD 4RD0A 1TF5A 1X8KA 1SXJD 1VIYA 1XD8A 3FYHA 3LY5A 2HDNB 3C8UA 1GKIA 4AKEA 2HT1A 2QGZA 2H1LA 2HLDA 3CRMA 3TQCA 2W58A 1CXZA 3C15C 2BMDA 1XJQA 2CLDX 4L15A 5EE3A 2NO6A 2J0UA 4KVGA 4NDZA 2W0MA 3AF0A 3GPLA 4FMBB 1G19A 1PLLA 2OZEA 4TYYA 4NYJQ 3TKLA 1KO7A 2OUKA 5FOWA 4B34A 4HDCA 4RZ2A 3ZZUA 3PENA 5TXGA 4ZCMA 1G3RA 2QNRA 3IPYA 2IUTA 3TW8B 1XMJA 2AHOA 4HI0E 1HV8A 1OFHA 3EWSA 3L8ZA 3PIRA 4M9XA 2ZRNA 1LS6A 3VX3A 1T8TA 1NSFA 2A30A 4QC2A 3X1WA 5B57C 4X8MA 1E2LA 1RKBA 1XWIA 1GL7A 3L0OA 1KK3A 5JSZA 1G3MA 5FBQB 4MYCA 5FR2A 1OIWA 2DCUA 4II7A 4MDEA 4L9SA 3W5IA 2QSYA 2O8FA 3MLEA 3THWA 4W9MC 1N5LA 5C1BA 5JJLA 4LPSA 1ZNYA 1YZLA 2IS4A 2W0SA 3KUDA 4LYJA 5EP1A 4YMVA 3SZRA 1NSTA 5JJKA 2IK8A 1DADA 1YZTA 1JPJA 2VP9A 5FBLB 4P32A 2WMOB 1W0KA 1G17A 1NKTA 2OHFA 3F8TA 2W83A 4HLQB 5G53C 2RH5A 2J87A 4YXWA 3U61B 4D4MA 1DAKA 4JT2A 5KNCA 2QORA 5CJ2A 1NG9A 3K9GA 3B1XA 2QTHA 3X1DA 4D0GA 3VU9B 1BOFA 2FG5A 1N0UA 3U7HB 1AZSC 4ZV4A 5AUNB 2V7QA 4KITB 1XXHB 2EFCB 4CRWB 3G5UA 5J4LA 3VHXA 1G8FA 2CCJA 3OFND 4PTLA 2Q0HA 4L16A 3NHBA 4LBZA 1OIXA 4W7SA 2RMKA 2X77A 5J4VA 5JS7A 3LNCA 2AL7A 4Z54A 4ZDJA 5J4HA 1NKSA 2C04A 5HCIA 1XD9A 4LHYA 3RHFA 3ZVMA 4DLYA 3TBKA 5G3YA 1P62B 4B44A 3AGQA 2ZRLA 1NJGA 1HQYE 2WMNB 2RGAA 5AJZA 4V03A 4A36A 2VYFA 1E2KA 1XD2B 4PC1A 5FOVA 1UAAA 1YR8A 4C4PA 3GLFA 5DIFA 3SDZA 4ZDIA 1L7VC 3KJEA 3PQCA 2CE7A 4Q4HB 4TT3D 4DCUA 1E98A 1NLZA 5FBRB 1ESMA 3U7FB 1KHTA 1KDPA 5A4JA 3LA6A 1SXJB 4JLMA 1SKQA 1KJZA 3EC2A 3NEYA 5KNDA 4B2PA 3WMGA 4ACAA 4HLUA 3CONA 5L3QA 4B43A 3RSOA 3BB4A 4Q1CA 5FUVA 2N46A 3GJ0A 5C2JB 4IEIA 3QIAA 2ODBA 4F4CA 1Z06A 2Z83A 4B32A 2MSCB 4M1MA 2ATVA 3VMFA 5DI3A 2IHYA 4A0HA 4IHQA 1EG7A 2GBLA 1H8HD 3MSXA 3LBNA 1IN5A 2WJIA 3IUYA 3HYTA 3U5ZB 3ICQB 4M1WA 4MITA 4QHSA 1W5SA 2JIZD 1IAQA 1DO0A 4O2LA 2ZI5A 3IGFA 5LDDC 1OFIA 3EAQA 5FL3A 3OIUA 4AC9A 4RD2A 1P5ZB 4TYNA 4GOXA 2K5UA 1HE8B 2GXQA 1NIJA 2R6FA 3AF4A 2HCJB 1E4YA 2A5YB 1GG2A 3V00A 1GFIA 1NI3A 4G5OA 1E69A 4MA4A 2HUPA 2BBOA 3TVTA 2OAQ1 2ZVQX 3HR7A 3GLHE 3UPUA 4FCWA 3PUXA 2GEDA 4O25A 4PPGA 1NVVQ 4Q66C 2FEOA 1KI9A 3LLMA 3PITA 1OH6A 4GOKA 1SKYB 4OHYA 1UEJA 4NPHA 1S3SA 3PUZA 1UF9A 4KV9A 2A5DA 2KBEA 4K46A 4A0FA 2RGCA 5LD2C 4QGHA 4M1OA 2IC5A 1E0JA 1T4GA 1AIPA 5GVRA 4DLVA 2FFHA 3WXMA 2GBLC 2YC2C 5EE0A 2RGNC 3ZS8A 1QHIA 3KKOA 4TL9A 1NNEA 2J1LA 4G1UC 2ATXA 3FE2A 2I3BA 2IYSA 1F2TA 3U6BA 4KVAA 1U99A 3RABA 3MAAC 1KY3A 2CE2X 3CX8A 4GOJA 1G291 4AG6A 5KUTA 2OLKA 2F1JA 3K0FB 4HZUA 3IHWA 3REFA 1MABA 1T91A 3SFZA 3X1YA 3CBQA 4OI4A 4Q9IA 3I61A 2OCYC 3DDCA 3W90A 4R2HA 4UXIA 3ZVLA 4Q1FA 4NH0A 4BFZA 2ZS7A 4NCKA 1GP2A 2CHGA 3QPWA 3RS5A 2GDJA 1P3JA 2HYDA 2B6HA 4A0RA 3NDPA 5FUWA 4JSTA 3Q9LA 1AN0A 1II8A 4HLDA 1CEEA 1KK1A 4C30A 3AM1A 1KKLA 1NVUQ 2BBTA 2GTPA 3N5CA 3QPUA 4ACBA 3EIEA 3Q3JB 3PFIA 3QQ5A 2E87A 4TT3A 3K0SA 2JLSA 3ZQJA 1KGDA 1II8B 2IEZA 2WWXA 1FP6A 3LDAA 4UNRA 1Z47A 2VP6A 2QAGC 1NN0A 5EE1A 4NONA 2ANCA 3U60B 2LKCA 2O0HA 3WP1B 3K0EA 3QNUA 1UJ2A 1UBCA 4LJ8A 2NO9A 4TTRA 3GJ6A 2F9LA 4JVMA 4NL4H 2HF9A 5DI9A 1G16A 4M9SA 2FNAA 2IWHA 3UWKA 1I2DA 2P5SA 3QBVA 1KZ7B 2FU5C 2ZRBA 3SBEA 2VIIA 2ZYWX 2V1XA 1TX4B 2BMEA 2IEYA 2Z4SA 3QXCA 1KZGB 4AY2A 4LC0A 2GCPA 1GRQA 3WMFA 4PXAA 2PJZA 3FWYA 1CKEA 1JNYA 2V54A 1YVDA 5TY0A 1MABB 1N5IA 2AX4A 4W5JA 4BEBA 3CPJB 3IBGA 3W9YA 1N3BA 2VEDA 1RRFA 4B71A 3KJHA 2REXB 1SZPA 4URYR 1NBMD 3ADBA 1IJEA 1C4OA 3B1WA 3NBZC 1XTQA 2D3WA 4IXNA 4M1SA 3U3JA 3THXA 3AGPA 4EJSA 2BCGY 4IFEA 1G18A 2CJWA 1DE0A 1ZNWA 2BEJA 2HXYA 3FMOB 3NH6A 4IJMA 2B8WA 2PZEA 4C7OB 1T0JB 5FI1B 1X8JA 3QE0A 4ZKDA 1KK2A 3QKSA 1IY1A 2G83A 5EZ6B 4HAWA 4TLBA 1UEIA 4YONB 3DMDA 1SQ5A 2P3SA 3L2OB 1IY2A 4CEJA 1NN5A 3ECCA 2ZE5A 2JA1A 4G01B 4R98A 1XTIA 1ZINA 2WJVA 2YC4C 3GLHA 4MGYR 1BH2A 5G41A 4RVCA 5FFMA 2ZRCA 1LF0A 3AVUA 3U3KA 1YR7A 3CO5A 4HZIA 2ZJ5A 4OHXA 3QPVA 3VU9A 2ONJA 1ZM7A 1SVKA 2G0TA 2OXRA 4IOMA 2J5XA 3K0CC 1XXHE 3P1JA 1M34E 1FUUA 1NVXQ 2OT3B 2QMUA 1HA3A 3CKLA 1UDWA 3CRQA 4W5WA 3PVSA 4M8NE 4ON9A 4PZYA 3KTAB 1UDXA 3KUCA 4I1OA 3OESA 2JLVA 2VRWA 4FW9A 2V1UA 1CIPA 2OBLA 3B7GA 2IXGA 2VP2A 2ZROA 3VAAA 2ZRAA 2GKSA 3AF2A 1TEXA 1Z0JA 1GZSA 4XOIA 1LV7A 1G8YA 2IYVA 1IXSB 2Q9CA 1RRGA 2DBYA 4WXPA 2W2TA 1G4UR 1OLOA 4NE2A 4UNNA 4IDOA 4DZZA 1X86B 1F3OA 5FTJA 1P2VA 2GXSA 5JEEA 1VG9B 1NY5A 4JLPA 2GRJA 1W4AA 1FNMA 3DMNA 2XSZA 3KTAA 4AKHA 2EYQA 2GK7A 1G9XA 2QPTA 2WSMA 2O5VA 2CXXA 4HAXA 5GJWC 3L43A 4Z8XA 1TNDA 1QHNA 5FPHA 1SXJA 2I4IA 5G3ZA 2FV8A 3U7EB 3IHLA 4BLSA 1XCGB 5ELXA 2RGXA 5EXSA 3QUSA 1CTQA 2PLFA 2GK6A 2VHJA 4ZI3A 5L3QB 2NZ8A 3R9WA 4HEJA 1DEKA 3QI2A 1W0JA 5CK5A 1M7GA 2Y8EA 4JL5A 3BBPA 2A5GA 4ZI2A 4A4DA 1NP6A 2GAOA 2ZPTX 1VECA 5K8TA 3TE6A 4I1UA 4R9UC 3RS3A 2LKDA 3E5HA 4A8JB 4A82A 3OF5A 4JVLA 1KI6B 2NO7A 4CT4B 3LO5A 4WZBE 3K09C 5G40A 3PR1A 4HB3A 1D2MA 3EZ7A 1QG2A 1SVWA 4NYIQ 1TMKA 3P20A 1N6IA 4MH0R 3OIYA 4DEYA 1HT1E 2B92A 1DELA 2GJ9A 3HJNA 3T5GA 4C0AC 4LJ5A 3LBHA 5TV2A 3S1AB 3C5HA 3QXHA 1TU3A 4UJ3A 3TMKA 2CL7X 2KWIA 4Z1MD 1G4AE 4LY6A 2ZRDA 3GJXC 1KO1A 3LFUA 4XVUA 1ZP6A 2GXAA 3LLUA 1ZM9A 5CDFE 4UNPA 4PR0A 5FI0B 3OIWA 3UMSA 1E1RA 2RGBA 1UBFA 4FWIB 2YINC 1WA5A 3SN6A 3SU8A 1OXVA 1S8FA 4LJYA 4RZ3A 1XPRA 4HLUC 3GLFE 2FX3A 4G0NA 4M53A 2IXEA 3R7WA 1JXMA 4BLRA 3SYNA 4NKRA 1ONBA 1IONA 3SJCA 3U44A 5KSYA 2JEOA 2HXSA 1P75A 2ORIA 2X19A 2ZUBA 2WVJA 4DSNA 3A1WA 3DZDA 3I1FA 4JLKA 3C41J 4HAYA 4TQAA 1Z63A 1XEXA 1R4AA 2C8VA 3FPAA 1F2TB 4XD7A 1VCNA 4KSCA 4DLSA 1US8A 1W0JD 4RFVA 1UPTA 2V7QD 4DCTA 3GEHA 2ZJOA 3NDBB 4TL7A 4PO8A 1V43A 5GADl 4QBGB 4MRSA 1UKYA 2EFHB 3WRYC 1YZUA 3EA0A 5C46F 2Q9AA 2EFEB 5EQTA 2BMJA 2HJVA 2QSZA 1CRPA 1C1YA 1T9HA 2LWIA 2QPOA 3GEIA 4PC2A 3DHWC 1O3YA 2PEYA 1A1VA 4DLTA 2CVHA 4DLZA 1F2UB 1FTSA 2W6JA 4YC7A 4YMSA 5JWOA 3AP2A 4FMCB 4PO1A 3TLXA 3CW2A 4PQRA 1US8B 2N42A 3T61A 1Z6GA 3KXIA 4TN1A 5KHOC 2QM8A 1OHHD 3A36A 4OK3A 1EX7A 2F43A 2QTFA 1LW7A 4B6EA 3FDIA 2ZR0A 721PA 2V4ZA 1KSFX 2MSDB 1H8EA 1FTNA 1AKYA 3BOSA 1A4RA 3PXGA 3CX6A 2ZITA 3L8YA 5GJVC 1HYQA 3WNBA 4FWTA 3C4JA 2ZRJA 3KJIA 4MKGA 3U44B 4Q7JB 4D2IA 1AQUA 2VP0A 2ZRKA 2G6BA 4C2TA 1U81A 1DAFA 2WPDA 4X8LA 1MO3A 4Q4JA 4DB2A 3IO3A 1IN6A 3TK1A 5EUMA 4Q02A 4F7WA 3GMTA 4PZLA 3VR5A 3NC1C 4JVNA 1JAHA 4LV8B 2EVWX 1MO6A 1ZIPA 4JKYA 3W5JA 1GITA 2JGNA 2GJSA 2QE7A 4L5BA 1NN3A 2PJRA 4HATA 4ABYA 1BMFA 3ZQ6A 4WW0A 4JL8A 2QT0A 4JLVA 3DO6A 3TSZA 5FTLA 2C96A 4JKIA 3TUIC 4OKSA 3VKGA 2UZ3A 3B60A 5GJCA 5K8LA 4DSTA 2QRZA 1KIMA 3B2EA 1W47A 3HU3A 4EPRA 1OHHA 2BOVA 5AJXA 4OHZA 3TSWA 5KO2A 3GFPA 5SZJA 3VKWA 2XSZD 3KB2A 2W6ID 3KQKA 1XPUA 4D81A 3DM5A 1S2MA 3NIBA 1FUKA 4D25A 1WRBA 5JRZA 2AK2A 1QHHA 5IHPA 1D5CA 5DO9A 2JDID 2YNMA 3THYB 4CEHB 3V9PA 3KZ1E 3M0EA 5E7JA 5LB2A 4FINA 1YRBA 3CUEF 5DH9A 2D7DA 1R0ZA 4A2QA 1KI6A 1KI4A 4DCNA 2YVUA 2IWRA 3N2IA 1S96A 1JR3A 4B76A 2O8FB 4V0MA 3N2EA 3RS4A 3K0AA 1HE1C 1D6JA 3TIFA 1E9FA 4P4SB 1JQLB 4QBHA 4BPBA 4D6PA 3O47A 4R71A 4OI2A 4BLTA 1J90A 3H86A 1CJTC 4B6FA 3OEED 3UK6A 1J8YF 3EZFA 2E9SA 4L8GA 4LYHA 1DOAA 2OBMA 2BMFA 2QE7D 2ZIAA 4EPVA 4AI6A 2QZ4A 2FSFA 1Q1BA 4XJXA 4B3DA 1IN7A 1F48A 2FF7A 4NCIA 3ZDQA 1WBBA 3ICEA 3QJYA 1XMVA 1XTKA 2DWQA 4M1TA 3ND9A 5AK0A 4HZUB 1ETUA 4ZIRA 4FIDA 3BFXA 3GFOA 4P0TA 3V4RA 2NTYC 1H8ED 3MWJA 2XZLA 2F7SA 1II9A 4TTQA 4JVSB 4B48A 1GNRA 1W48A 2AWOA 1XZQA 2QG6A 3MWLA 4CT5A 5EE9A 1U90A 2QAGA 1EWQA 4TYPA 4DCSA 1W49A 1XXHA 3D6TB 5F9HA 1E3MA 4MUBA 2BJVA 4LV6A 4JJZA 2XB2A 3PV0A 3EIHA 4OYHA 4YMTA 1HT2E 4G3XA 3B82A 2QP4A 4FN5A 5B2ZA 2ZRFA 1HUQA 4GP6A 3VR4A 3QVVA 5L3VA 4D80A 1P9WA 1P9NA 1QHYA 2R9VA 2GCOB 3LAWA 3P4XA 1DAMA 1R6BX 5FPKA 3B1VA 4HUQB 2C98A 2BBWA 1OXUA 2V9PA 2P6RA 4EAQA 4ZIRB 3RLFA 4C9BA 5JLJA 4GZLA 3ZIAA 5AUOB 2REOA 2R62A 4RY2A 4PHTA 1OKKA 1ZD8A 3QKRB 2XOKA 2BM1A 3B78A 3SS8A 5JHHB 3IIKA 2DFLA 2QM7A 4GPTA 1E9AA 1FNNA 1L4UA 2D2FA 3CZPA 5AWFC 5CM8B 5B64A 4Q1BA 1MRSA 4Q4LA 5HZHA 3UWOA 5DGXA 4DLWA 2IS6A 1JJVA 2OXCA 3ASYA 3X1ZA 1R5OA 3MWYW 3JZMA 5BWMA 3PUWA 4B3FX 4TMKA 1T5IA 3Q8XB 1JB1A 4V0ME 1OF1A 4Y0AA 5E7IA 2WM9B 2ZREA 5DSZA 3CX7A 2JJ8A 4IDPA 5KPJA 1OYWA 3MD0A 3UXMA 3K70B 4IOJA 2C95A 2Z4RA 1YJ5A 2BBSA 2LCFA 2DPXA 4DDWA 2CCGA 3WBJA 1YKSA 2ODWA 3K0CA 3AVVA 2R44A 3BORA 3D8BA 2H16A 3I72A 1KI1A 5SZIA 3OE7A 4JMPA 4TLAA 3SYLA 1PVOA 1XEFA 3BAFA 4DEXA 4OQFA 3LRPA 1E2GA 5DE3A 1KK0A 3OEHA 1JAIA 5C4GB 4KFUA 3KJGA 1CULC 1A5TA 1OSNA 2EYUA 3A4LA 1SGWA 5CYOA 1SVSA 1U9IC 2ZYUX 4AD8A 3QEOA 1ESNA 3L0IB 3P26A 4HYYA 2ZI7A 2AKYA 3KL4A 5DHAA 1NMZA 3X1XA 5AJWA 1IQPA 3NC0C 4GRAA 4A2PA 1PUJA 3T06B 4FCTA 4Q1EA 1NIPA 4MRNA 4F4IA 1U0HC 2WSSD 3Q7PA 2VSFA 4US1R 1UFQA 2CLCX 3UIEA 3EG5A 1FQJA 2OEPA 4D82A 1YR6A 1IJFA 2IW3A 3ZD7A 1CJUC 5CJPA 4FMDB 2VA8A 1HEIA 2V6IA 4TMXA 1N5JA 2J41A 2CDNA 4KYUA 2WJGA 3HDTA 3RANA 4AYTA 2PT5A 1NN1A 5LBIA 2OO7A 3QXXA 4PSAA 3UG6A 1QHXA 3AKYA 5EXPA 4DSOA 4MYHA 2QUZA 4U5XA 3W8RA 3B9QA 3IPXA 4HDQB 5BN3A 1TUEA 4BE7B 4EIWA 3U3RA 2HCBA 4JZKA 2ZR9A 4I99A 4TZ0A 1GDDA 1EGAA 4JLBA 1KDRA 1JJ7A 2CCKA 5KTYA 1N6HA 1W4CA 2ODEA 3IIMA 3SE0A 5BN4A 2ASEA 3E70C 4UXHA 5H1YA 5DISB 4CF7A 3VHLB 1LTQA 5B30A 5HKKD 2AXNA 3R20A 3K9LA 2Q3FA 3WNDA 1Z2AA 3BJIC 3CR7A 4KCGA 4A2WA 5JI3E 5TARA 4KLNA 1R0XA 3HPQA 1M2OB 1WQ1R 2PZFA 1XZPA 3NBXX 1PLJA 3F3YA 3M4YA 2G0NA 1EWRA 2GCNA 4GSYA 3OAAD 1KOFA 4XSGA 2W2XA 4BZXA 1AGRA 3CM0A 2VTKA 2OCAA 2PCJA 3NEJA 4JIMA 3THXB 3BFKA 3SHFA 4TTPA 3NG1A 2OAP1 1JBKA 2ZI3A 2WJJA 4IVQA 1DAGA 4YQFA 4DUGA 1JR6A 1RIFA 5JBQA 4B73A 1P2SA 2OILA 2ZEJA 3NWJA 5EJEA 3AKDA 4XD7D 3EZ2A 5AR1A 4MRRA 421PA 2XTZA 1E2PA 1KTVA 1ANKA 2YWGA 3AF3A 1A82A 2FN4A 3CH5A 2BCJQ 1KYIA 3KKPA 3RS7A 3AQ4A 3ZJYA 3O8CA 3FHCB 5JWRA 4ASUA 3NBFA 1VCOA 4KFSA 5CITA 2CEAA 1VCMA 1W4BA 2ORWA 1Q22A 4Q47A 3W6PA 1JEDA 1Z29A 2F3TA 2ANBA 2VQSA 4Q00A 2QAGB 1X8LA 3TAHA 1Z08A 3DKVA 3L0PA 3QF4A 4GFDA 5KPDA 4X8OA 1XU4A 5JEDA 4D4KA 2PMDA 2QP9X 3KX2A 1CJMA 1S9HA 1R8QA 1K5GA 2O8DB 4MGZR 1UKZA 1VKJA 2C78A 2CJWB 2XNSA 4HB2A 4NHOA 1W2GA 3KDSE 1NMXA 4XTCS 1L2TA 4OJKA 3L0SA 2ZYVX 5D3QA 1G5TA 2Z5FA 4TQUS 2D7CA 4J0QA 3EC1A 121PA 2C9YA 2ZE7A 3GLHB 4AK9A 1Q0UA 1ZJ6A 3B6EA 3VTKA 5JHGB 2MMCA 4QBFA 2R6GA 3LH5A 5EXXA 1UBGA 1U8AA 2C9OA 2HJGA 2XAUA 2IF0A 4FMCF 4MGKR 3WNCA 5F98A 4LDJA 2F1RA 2ZUCA 3ND8A 3GEEA 1G8HA 2QRNA 1WMSA 2GJ8A 1P2UA 1NVVR 4DT1B 2F55A 1RC8A 1T3LA 3CZQA 1OT3A 1KAGA 3LXXA 3BFVA 4JBWA 4WAUA 3TVDA 1PV4A 2ZSDA 4P33A 4Q19A 2YWEA 3H84A 2ZSEA 4OQLA 1E9CA 4RD4A 4BFSA 4ARZA 5DNYB 2YOFA 1RRCA 5J4KA 2XNDA 3VR6A 4RKFA 4A92A 5DN6A 2PT7A 2R6DA 4DWJA 4MKHA 3KXLA 1FFHA 3RRMA 1NG1A 5JCZA 4JLAA 2RGNA 1T3HA 2C9CA 2OFXA 4URWR 1ZRHA 4LRWA 2D74A 4LOAA 4MUAA 4PQFA 3A8TA 5FOXA 5KSPA 4IFBA 5CDFA 1OH8A 2O8CB 1MO5A 3M1IA 3HYRA 1QZXA 4PC6A 1QG4A 1J99A 3JVVA 5FBWB 2Z6VA 4JLOA 2ZS8A 3LX8A 5FOTA 3I62A 3UANA 1LFDB 1ZU4A 2VO1A 2G3YA 1KJYA 2XITA 3W34A 5JZVA 4GMDA 2FE4A 3AKEA 3QKSB 4UXJA 4UNSA 2QPAA 3CRVA 3EARA 4Q01A 3SOPA 3HU2A 4LJAA 2AK3A 4OHVA 4E09A 5D3MA 3HR8A 2XB4A 4D0NA 5J47A 2XTMA 2FFBA 2VPPA 4LBYA 4BASA 1K5DA 2PEZA 1T8UA 3U4QA 3MUFA 3MGCA 4RD3A 3AVYA 2BJWA 1TEVA 1SULA 5HKKA 1GOTA 1XP8A 3RNLA 2OBNA 2NQ2C 4UNQA 1OH5A 1XTRA 1JECA 3JZAA 2FPKA 2O0KA 1O87A 3KB1A 4BZPA 2DYKA 3MRSA 1E2MA 4M21A 2FGJA 4DRZA 3CB4A 1OH7A 5KSZA 1YE8A 2ZRGA 4RSGA 4EFNA 5JS8A 1ZBDA 1KSJA 2ZUDA 3NBYC 1E9RA 2FEMA 3QF7A 2UZIR 4JJKA 4PPQA 2P0EA 3DEFA 1E2EA 1ELOA 3GJ8A 2GZAA 4OJQA 3RWMB 1X1SA 2ZRPA 3QVUA 3I4LA 1TF2A 2V6JA 2O8DA 1AS2A 2GJKA 2IYQA 1KKMA 2VF7A 3EZ9A 4H1VA 4K8OA 4XVRA 1KSGA 1JI0A 4DUGD 1Z6YA 4GI7A 3AKCA 2A9KA 4ITRC 3QBTA 2R6AA 4V0KA 2FZ4A 2E1RA 1X1RA 1XMIA 4CGZA 1VTKA 3TUJC 4D4LA 5KSOA 2IX3A 4QGAA 4C0KA 4WZ6A 4XIGS 4DCVA 4CW7A 5F3WB 3SR0A 4NU0A 3TH5A 1LY1A 3AVWA 1E9DA 4CYMA 2UKDA 2VP4A 4PAQA 5C4MA 2ZQ5A 1E79A 4MGIR 2KE5A 2OM2A 2P2LA 5FTMA 4DLRA 3UMFA 3B1YA 1KJWA 1Q3TA 3QF4B 1UKVY 3ETLA 5HE8A 5HCNA 4F4JA 4NCHA 1AGPA 1J70A 2JJ1D 4K81B 4FCVA 4B2LA 2XZPA 821PA 2J7PA 1VHTA 2YWHA 1E32A 1W44A 1MO4A 1TUIA 3GJ7A 5DN6D 1A7JA 1AK2A 4U7DA 1XF9A 1GKYA 1AA9A 3WHKA 3UMRA 1D9XA 3CRRA 3Q5DA 4LHVA 5A0FA 4IOKA 3C14C 3WYFA 4QG7A 1ZYUA 5M04A 2PL3A 4EKDA 4PX9A 5EUQB 3GLGB 1G8PA 2RGDA 2I1VB 3EPKA 3P4YA 1CLUA 3LD9A 1CR2A 1XD2A 1HTWA 4LHXA 3H0KA 4B3BA 1U98A 4XWOA 2VL7A 4HUQA 4ZDWA 5HR5A 3C16C 2H17A 2MSEB 2JAQA 5AJVB 2ZJYA 2AFHE 1R2QA 4E22A 3MFYA 4DKXA 3K0FA 5FR1A 1OB5A 5FOUA 5EP3A 3CPHA 4TYWA 2GZHA 3MCAA 3QENA 1A2BA 1II0A 1RJ9B 2ORVA 2ZSBA 1L4YA 2NZJA 2OG2A 1Z2CA 1KO4A 4F38A 2H57A 1V5WA 2IYLD 2XJ4A 1JALA 1TF7A 1ZUIA 2CHVA 2G88A 1IM2A 1ZVQA 5J5CA 3WP0A 1VCIA 3OIVA 3KFVA 4DLXA 3EASA 3CH4B 2ZYTX 4LJ9A 1JXOA 3ZZTA 4RKEA 4DJTA 4LSGA 3SYKA 4RFSA 4O0MA 4B3XA 2VP5A 3A4NA 3PJRA 2OLJA 4G5GA 2IUSA 3CWQA 1G3QA 4G5RA 4LJ6A 4US2R 1QF9A 3B5JA 2QMEA 2ZSAA 3L82B 4CEJB 4QM7A 1Z3IX 1XCPA 3DM9B 1CF4A 4BFXA 2WSSA 2EU8A 3GCGA 2WOJA 4GT1A 5E3HA 4DSUA 2CK3A 4A9AA 4QKQA 2HT6A 3H1TA 4I1SA 3SHWA 1PUIA 1KDTA 1W1WA 2F6RA 3ONWA 4I4LA 3ZYCA 4EPWA 4URXR 1G8GA 2CNWA 2YJTD 5EP2A 3W6OA 3K0AB 1RZ3A 1W2HA 1HQCA 2J0VA 1FMJA 2HLDD 2GVZC 4PAOA 5FUYA 3WYAA 1GL6A 4R7ZA 1IHUA 3GLFB 5TB5A 4HUTA 3AUYA 2BIFA 2DR3A 4QXAA 4CIDA 4KI0A 1ZD9A 1P6XA 4Q1AA 2IHBA 3TNFA 1Q3HA 1VIAA 1EFTA 1SVMA 1CP2A 4Q4AA 2VHQA 1J2JA 1MT0A 3AB3A 3DOFA 2PX0A 2QI9C 3GFTA 4PHHA 5FL7D 2A5FA 2WWFA 4FMDF 3BERA 4QGGA 2XXAA 2B7CA 4A6XA 5KOYA 3OFNA 4V0OA 2IS1A 3KQUA 1T6NA 1U0JA 2QA5A 4TL6A 4WXRA 4WVFA 1G7RA 3UKDA 4BEJA 3O8DA 1F5NA 4NYJR 1GTVA 3IBYA 2YYZA 5UKDA 3W3AA 1EFRA 4M22A 2PZGA 4XSHA 5AUPB 3CR8A 3GLGE 1Q1EA 2ERXA 2PX3A 3B1ZA 2GESA 2W6IA 1E2QA 1N6KA 1Q1QA 4EFMA 1ZNXA 4URUR 4RCZA 1Y63A 1W7AA 1GKUB 2WOOA 2B7BA 3FB4A 1UM8A 3WBKA 2WJHA 1Q44A 2ZRHA 3SC3A 3RDPA 1P60A 5CLLA 1YZKA 3SJAA 4ZCIA 5B58C 1COWA 2J3EA 2Z0MA 5C18A 2Q3HA 2H7VA 4E5UA 2D4HA 1N5KA 1P73A 2ZJAA 2RCNA 3CWZA 1M7HA 2P65A 2DHRA 4EPXA 3A1VA 5D3MB 2G9NA 1TL7C 2C77A 3H4MA 4RZUA 4V0LA 4TZ6A 2WWWA 4B75A 4L4UA 4ESVA 2ZRMA 3SNHA 1QHGA 5FTNA 3I5YA 2EFGA 1XFAA 2DY1A 3RWOA 4Q9JA 1R0WA 3T34A 5EXTA 2WJYA 4HB0A 4PZZA 1G7TA 3TJZA 2ZXUA 4BUJA 5HPYB 4G5SA 1RE0A 3QEJA 1FP7A 3EA5A 1TADA 4Q4JB 1OJLA 4DDTA 4BFUA 4N0DA 3K70C 1CRQA 1WDTA 1FPMA 1U2RA 4ZCLA 1GNPA 1M6NA 1GRNA 1QVAA 3IILA 4NYIR 4Q18A 2PCLA 2JASA 2IYZA 4NYMQ 2ZI6A 2CBZA 3ASZA 4FI3C 1GNQA 2NGRA 2R2AA 1QBKC 1VG0B 3A1UA 5DLQC 5FH9A 5GVSA 1W36B 3GLIB 1RYHA
chains in the Genus database with same CATH superfamily
3IKMB 2VG8A 1YB5A 2PMCA 2VJLA 2BZSA 1C3OA 4TMVA 4E88A 3C2QA 1WF6A 4W7IA 4HFNA 2EGHA 1QDEA 3P9IA 1R88A 5GZ6A 3BH7A 3BJZA 4PANA 2WWYA 5DYNA 3HUEA 5H68A 1YS7A 5ITWA 2JZCA 3EIWA 4R2IA 4D8YA 2PXXA 3WHLA 3VM6A 1P61B 4JR2A 3K72B 2HYIC 1MU0A 4QU8A 1RRPA 5YASA 4CKEA 4KHZA 5ED0A 2RE8A 5CB4A 1L7DA 2HD4A 4M9QA 2YNMC 2QTCA 2O8EA 5CCDA 3SJUA 4H7JA 1ZONA 2FF5A 2G04A 3AR8A 3REGA 3ZHCA 4N3NA 5KTNA 4TLCA 1GKKA 2EDCA 1O0BA 5I9BA 3GBSA 5DMHA 5IDVA 1TMOA 3P7MA 3EBLA 5AI8A 3L7IA 4PW0A 2A1UB 3D64A 2WD7A 1GRVA 4OJMX 2Q9BA 4TXHA 1PEKE 1JJBA 3C4VA 4P3YA 3OWOA 3WGGA 3SQWA 1L5SA 4XH9B 2Y2VA 1UT5A 4MDFA 2VXCA 3DXZA 4L7VA 1G1MA 4KR0A 4YAOA 3WQBA 4P4SA 2BTEA 1Z6PA 1OKKD 3GRZA 4XFDA 2OVFA 2P27A 3AILA 3D4OA 4OO3A 2VWQA 2Z5LA 1FOEB 2CK3D 4EVSA 1ZC4A 2FKAA 1J0DA 4K3VA 1ACJA 2C2ZA 1V1RA 3KLNA 1UZAA 3PYLA 2XQIA 2QL6A 1Z4MA 3QELB 3QVXA 3RVLA 3WYGA 1BKSB 1KO8A 2I6SA 3I92A 3IVCA 5D3ZA 2M6KA 3RFFA 2PDAA 3TDMA 3W6UA 3AG5A 2F1HA 3DBOB 1E64A 4LJ7A 5L3SB 2WUWE 3FAKA 3RTAA 3QKUA 3S1AA 1MMFB 1TQ8A 5L6MB 2ATEA 4F86A 4Q7LA 3AERB 4N5DA 3M6AA 4MO2A 5E9AA 1O58A 4FYKA 1X7YB 3FOZA 2AJCA 3L1KA 4K88A 4KJXA 4QYTA 1XE3A 2QU8A 3KXDA 3L7KA 3EFBA 3WY9A 3BICA 3NUGA 2QQEA 3D0OA 1E9BA 4R4JA 2R48A 4RSHA 3VGJA 1KQNA 2Y9MB 5G4KB 1PQWA 1VMEA 2QLJA 4DLAA 3KKQA 4Z2AA 4PHFA 4OQPA 1AO0A 4C3ZA 2GUWA 3KKNA 3RTDA 1G3IA 4ZOQI 2ET6A 2YV3A 2FE1A 3FPFA 1NW6A 3QU9A 4KPEC 4O4LA 1L4BA 5BN1A 3GRRA 4CLRB 2Q6LA 2C0QA 3OX1A 1EAYA 4WACA 5A2GA 2J3LA 4M1QA 3IE1A 2D2IA 1C9KA 1QG6A 3H87A 5DM0A 3ZE9A 4R8VA 5K8IA 4Y2GA 3D0RA 3PBKA 3FYTA 4KO8A 1L5GB 2BDEA 1L8QA 1GWNA 4US0R 4CR8A 4FD2A 4R01A 5ULLA 3E05A 1MOPA 2JFUA 3ETNA 1DXYA 1E9VA 1MPXA 1ORHA 1T13A 1TM5E 3GJ3A 3MIZA 2QROA 4NULA 4IIHA 5JASA 1IZ8A 1BC5A 1JQ5A 3BS4A 3IT0A 3LVRE 5BMOA 1VCHA 4HWGA 2P2NA 5LB4A 1VFNA 3GYGA 4LI3X 2QYHA 4CKWB 1YRQA 5FV7A 1U2DA 1JBQA 4L8YA 2JLYA 1W46A 4MLCA 4Q3KA 4UVIA 3LUJA 4MV9A 4TRNA 5EAIA 1IG3A 1ADCA 2Q5JA 3FLMA 2VHEA 3TQSA 3V8MA 4DT1A 1EBBA 1QYDA 1V41E 2QLFA 3BREA 3M5DA 4FDUA 4AJ9A 5I8PA 1DBIA 3VNUA 1VLJA 4RENA 1JHYA 2FVXA 2HQRA 4OI1A 2AE2A 5DVZA 4IDEA 3AMVA 4ALIA 1G6HA 1WPQA 1MEJA 2PGLA 4ARIA 4GLLA 4ZCTA 4I19A 1S0UA 1Y8RB 2G70A 1W36D 2XJ9A 2QZJA 3PUHA 4W9NC 4DC9A 1XDZA 3AHEA 1VOTA 4RD1A 5IJXA 1N6OA 4DCMA 2ZM5A 3NATA 1H9CA 1O0SA 1OBCA 2PH7A 4KTTE 3WGVA 4OSPA 1EHIA 2V6FA 3OQPA 1WJGA 3CJQA 1C30A 2P2ZA 5MDHA 1DTSA 1ZY2A 4C7OA 2Q6VA 4PSKA 4Q3CA 3W9SA 4C29A 2WYWA 4GOND 2RBEA 3I76A 2QX6A 3SBOA 4LHZA 3S4YA 3T6KA 1XK6A 3L1JA 4DMKA 3RS0A 2W6JD 1QR2A 2RHDA 4M9ZA 4LRQA 1ZRSA 3S28A 4NICA 4FOOA 2X2FA 4TMTA 1YZNA 3ETCA 4GPD1 2DECA 3O8OA 3CEMA 4OX9B 4OL0A 4L0MA 4NJEB 1O4WA 4LNAA 2V5VA 3RVPA 3NHFA 1Q57A 1P39A 1M2GA 1NJ2A 2DT8A 2BZ0A 3HYLA 1SXJE 3O3MB 4RK5A 3GQBB 3INNA 2JA2A 4RF4A 5DTRA 5C9ZA 4AKIA 5LQSA 1FNCA 1PGNA 3VPDA 5DGTA 4KIUA 4LJKA 3PQDA 3TAXA 1NYRA 4JJGA 4LQDA 3FCSB 5FO1A 3CGWA 3RAPR 1C50A 3UA3A 4B6QA 4EL5A 3TNYA 1QYCA 1VA5A 4KODA 5LA6F 2HHJA 2BZ1A 4TLDA 4CT0A 1WLYA 3RT9A 1E6WA 4ERXA 3QU5A 2H06A 3BMOA 4BMOB 1AGNA 1GZ5A 4IO0A 2Y1OA 5FJIA 3DVQX 3HY3A 4N3CA 2GAAA 2OHXA 3U4QB 1XP5A 3HJAA 1RRKA 1B1AA 4Y0VA 1BO6A 2RKWA 1NJ8A 4RXMA 2Y1KA 4WLEA 4Y6RA 3E3NA 4CDGA 2PLAA 4INOA 4ZT4A 5I9SA 1SVOA 2RH4A 2RHLA 5CVDA 1Y6ZA 3BKWA 3LDFA 3R7BA 1ONOA 3CY6A 1BS9A 1Q11A 4BZQA 2YYSA 4INPA 1BGWA 2X1LA 1SBHA 4YV1A 1XA0A 5E7MA 3PX3A 3T9BA 4Q9LA 4EB3A 5JCPA 1EIWA 3NIFB 2FX5A 2I1QA 4WXEA 3M6MD 3NAGA 4M37A 3TIXB 1PAUA 2P3QA 3ZKAA 3EX7C 3AZQA 2MCFA 1QIHA 2QX4A 3EWAA 2VTBA 3UW3A 3N7TA 4LOJA 3DOIA 5G1NA 3TXXA 2AFIE 4YI3A 4RTNA 4O2RA 1KAOA 1XNJA 3P0EA 4QAJA 2EERA 4DA9A 4EITA 1OY1A 1IAVA 3Q85A 3A1SA 3HG7A 2HHHB 4G26A 2VJQA 3R0ZA 2I62A 4KNWA 2P77A 1I3NA 3FCCA 2J0UB 4Q21A 4GS5A 2EKQA 2ZE8A 3DWFA 3IX7A 3BWYA 2IVZA 4BJ1A 3V7UA 1EFUA 1SXHA 2AFVA 3AF1A 1FCJA 2Q2NA 3VUEA 3CKMA 2EC5A 4UUNA 2JDIA 4LC1A 2JLUA 3IEVA 5GPBA 4JELA 4W82A 1NL3A 1Z5ZA 2IV3A 1NUAA 4KQIA 4XD2A 4BMDA 2EFDB 1T0PA 2NXEA 1CDDA 1XZ8A 3CF4A 1ECLA 1YMQA 2F9MA 2VEOA 2ECKA 3OU6A 1WF3A 4HN2A 4QD3A 5HMLA 3EIOA 4OG2A 3T1QA 3THOA 1QZUA 4B3MB 1ILEA 3GRKA 1GUAA 1TO2E 2CLSA 2WT4A 4KJZA 1E0SA 5EQDA 4HO1X 5FP0A 3DAYA 1E1QD 4AZSA 4BRZA 2IY9A 4CIVA 1IRIA 4FFNA 4DJFC 2BGRA 2NYVA 4Y2XA 3DFUA 1U0FA 3L49A 4MRPA 3OP1A 3HVUA 5ICEA 1L7NA 2IHVA 2XX3A 1LVHA 4ESOA 5CM9C 5FL7A 3PUVA 5SY6A 5IH7A 2JVIA 3THWB 1MV5A 3I2GA 2NVBA 1GRRA 2Q2VA 2YR0A 5CMLA 1ACLA 3UGQA 3PUYA 4XTRA 3SK0A 2YFYA 1Y5MA 3V1UA 1EE9A 4YRTA 1WXFA 4HFMA 1X92A 3IALA 5AUQA 4EUKA 2FWRA 2WD7B 3QMPA 5BSWA 5KQGA 2QTVB 5I4BA 4XJSA 3FOBA 4WESA 2R79A 3L06A 2OZKA 4LOLA 5DGIA 1X2EA 2Z4TA 5F9FA 1C7QA 5AIBA 3WWPA 3AQIA 1NNI1 3IO5A 5LQMA 3ENKA 5KOIA 4M2LA 1NMYA 2GILA 3CR3C 3T8YA 2H8KA 1N2XA 3GUCA 5IT5A 2VTVA 1KH2A 4MULA 4QHTA 1DAHA 1WLSA 4OBWA 4TROA 1H1DA 3NMUF 4CMIB 2P1ZA 3FMGA 2O7VA 5TEVA 3DVLA 1OU0A 3DE0X 5B6JA 1OPXA 2P79A 4NZPA 3ZR4B 4BXOA 3ZEAA 4X8HA 1M1YE 3UPTA 2WZQA 3CVJA 1OXKB 4XCVA 2D0PB 1AM4D 1M1UA 3BIOA 1C9YA 1COWD 4QXMA 5FWXA 5CXQA 2B61A 1ZIOA 2VSOA 3KELA 4WNIA 2VQEB 2J9RA 4QJ5A 1CNEA 1FFCA 3DW3X 1P9RA 4ALNA 5LZ9A 4ND7A 4LA4A 1DUVG 3EPLA 2XUFA 3R2JA 3QY0A 1JR3E 1F9EA 4M6WB 3C3DA 4YJ2F 3RUAA 3E2IA 1FRZA 5F52A 4BNMA 2VPIA 4N8EA 5BR7A 2ILVA 2JLQA 4C0SA 2N1BA 4OXRA 3OE7D 4TLEA 3GEBA 3VOSA 1PJRA 1QGUA 5B6IA 3I5XA 4LXQA 1HY3A 2RHBA 4WE3A 3FVQA 1O89A 5DYIA 3TRIA 2IL1A 2WKQA 1AUOA 3GMSA 3KM0A 1K7XB 2R6HA 3BJMA 3W5AA 2MOKA 5JNSA 4A27A 3SJ7A 5BSKA 1Z12A 3NHZA 4XLTA 4IYRA 2E55A 2ONKA 1GXSB 3RUCA 3EZ6A 4HFRA 1MQSA 2Q3MA 2XR1A 1JMYA 2BR5A 2MINB 2O8EB 5LLDA 2X15A 5KWEA 3ROQA 1Z0DA 5CTAA 1SVIA 3BXEA 3GPCA 3O95A 2P2CA 1KMMA 3WMRA 2IXFA 3KWMA 2O14A 2AXEA 2HV8A 5EJ4A 4A7PA 1C3JA 1D4AA 1WCV1 3TS1A 3GU3A 4DLUA 3ZIUA 3GLSA 1NPDA 4IGIA 1FMLA 1IU9A 3TAUA 3ESZA 3F6CA 1MJNA 5A3QA 1E0KA 2M6LA 1HFWA 5KWIA 2G1KA 1KYTA 2V6MA 4NCJA 4HNTA 3EISA 4YQYA 4IDAA 3RYIA 5CX4A 1OVGA 4RFSB 1PR5A 4GBMA 4OQXA 3I9KA 2P1DA 3NTXA 1IRXA 1CUFA 4B83A 4ZD6A 4F11A 4FQ7A 2H1RA 3HV0A 3ELDA 4IUYA 1DDIA 3ZD6A 1SCBA 4KQCA 2BFMA 2NG1A 5TVKA 2V59A 3IVXA 5AOAA 4LW8A 1G60A 3OZGA 3ZHZA 2D8MA 2Q8NA 1QHSA 1J8FA 2YJ4A 3BK7A 3E0XA 4X60A 5F35A 3U1BA 2IEDA 2E4XA 2VJYA 2XYQA 3NWEA 4OP1A 4Q7MB 4YIHA 3KR2A 5LYJF 2PANA 1CE8A 1VLZA 1OLUA 1X7YA 4Y9UA 3FOEC 4YDHB 2ERYA 3SAJA 2CDAA 4Z4IA 1CP3A 1DJPA 3SR3A 3C7DB 3TPFA 4JJAA 3L18A 1EP2B 1MOQA 3CUTA 5F5LA 4CIYA 1RKUA 4MWTA 5EHZA 2A6PA 3HB9A 3I0NA 1KYVA 1T2FA 1D2AA 5IP5A 3T38A 1WO8A 1SBTA 4HMOA 4B33A 4E3ZA 1JPUA 1Z37A 2VF5X 3AJEA 1QH0A 3JR7A 2HIGA 1FSSA 4E2ZA 4KMOA 3ZIDA 3ZTWA 3WO1A 2EQBA 2H1FA 3PRHA 1GTG1 4PAGA 4DA0A 4ZQIA 5D1NA 3HXLA 3IPRA 1ML3A 3ZHXA 2F9FA 3OZSA 4IVRA 5J23A 1Q74A 5CVTA 5EJMA 2A8YA 3TTWA 5ADWA 1IN4A 3PZRA 3GLGA 1VIMA 2JBAA 1DBSA 1GZHB 2IZ1A 4KWTA 4PWYA 3BKXA 3LVFO 3ORFA 3V97A 1CU1A 1PU2A 2A4MA 3MRTA 3S2FA 5CA1A 3R9IA 4BQRA 2OUIA 4XIJA 3AP3A 3T35A 4R2KA 1XZNA 4E11A 3BM5A 3AH8A 3VNQA 1LQ2A 1LDBA 2GHTA 3CUUA 3EF0A 1MB3A 3C4QA 4GMXA 4KQFA 5ALXA 1P4SA 2WM3A 5I9NA 4ZK2A 1MOZA 2MYPA 3WQSB 3KEQA 1HDCA 3EGCA 4L02A 1RJGA 1V37A 3C3WA 2GNOA 5BO5A 2VXYA 3RUHA 2QQ0A 3PUKA 2M1XA 3GJ5A 2O06A 2VJBA 3NX4A 1DPFA 4MLDA 4NXMB 3PQ5A 2AN4A 3OLCX 4MW4A 3AUFA 5BQ3A 4K2AA 4U3JB 4AP9A 4IQGA 4RE5A 3VKHA 3D7KA 2I2BA 3G2OA 2GAIA 2OO3A 3EEYA 1TTPB 4PG7A 1ESZA 4IVPA 4JT9A 2XXAB 2PL5A 2V8BA 1WY5A 4GYJA 3U37A 1Z7WA 5FNZA 1LWNA 2J6HA 1I5RA 3OOWA 4JB2A 2PO5A 3QKRA 4HDAA 1CZKA 3N6XA 2QF7A 3F1LA 2WE8A 2P78A 4RS4A 2X9VA 1C7JA 1EK6A 2GBPA 1ETHA 2KB0A 3S1LA 4URXR 4BC1A 2FVYA 3KQOA 2J9GA 4RLHA 2A7QA 1LLUA 5DHFA 2WIKA 3OF3A 4R2JA 5A5GA 4TVOA 4G1FA 4L27A 4CG3A 1AHNA 4WZAB 1B6SA 4FHFA 3UENA 2VAVA 5CB6A 4XCXA 1KI2A 1V45E 2XYVA 4CVNA 5T41A 4BWYA 1X1AA 3A7EA 2WWIA 5BN3B 1TAUA 2CNWD 1GQQA 2EBUA 3WZ2A 5H3CA 2AQIA 3LKVA 2WVHA 1O7JA 1G20B 4TXLA 3T9DA 3C5CA 1AS0A 1C3XA 4UMFA 1IXZA 5JVDA 1PEAA 2Q6TA 3KVYA 3H3FA 1E2UA 4MW7A 3Q98A 4X94A 5K03A 3OQOA 3MPUA 3N76A 4MAAA 2XD4A 2ZBQA 1IVYA 1NGSA 1P1CA 3BIJA 4NMMA 1U9IA 3CSUA 2Q3LA 4P7KA 4OLHA 4EJSC 1WB9A 1EBUA 1NBME 1OXTA 2PS1A 1FDWA 2IDJA 3UMGA 4ASUD 1CUGA 4FNOA 2Q21A 4BNHA 1NX9A 1AQ6A 1QX4A 5JCJD 3COVA 3N1UA 4GWLA 1BVHA 1GT6A 3AEQA 1E4EB 3OPYA 1XTJA 1BDIA 1XJCA 1JG7A 1Y5LA 3DL0A 3MJVA 4GKBA 1SVLA 1E1KA 3G5AA 4PR3A 3ZV6A 4DQUA 4Q9KA 3ZU3A 1A8IA 1MVOA 3O0TA 5FNVB 1QQAA 2CJPA 2GF9A 2A0FA 4M7WA 4NBLA 1VSQA 2VPYA 2G8NA 3AEQB 2G5PA 3PCRB 5U4QA 3TQOA 3UWDA 1E0AA 1LBHA 1KY5A 1JQJC 2FEAA 4W99A 2I1WA 4FGZA 4OHKA 4ZT5A 3WR5A 4F8JA 2FDCA 2LIVA 3IJRA 2GWHA 3B89A 3SLRA 4I1YA 1LUAA 5SZKB 4IV0A 1Y1LA 4HH4A 3WLJA 2AJDA 2OORA 2ZYHA 3JVUA 3I2FA 3NTQA 4PG4A 2BF4A 5NULA 1G5RA 4ZYYA 2PUTA 2RI6A 2X8JA 4OIFA 1JHMA 1FDIA 1Q5PA 3HB1A 4ARZB 4BECA 2I4LA 4D57A 4TXNA 4BO2A 1CDOA 4ZZ1A 4JI0B 1D4ZA 4UM7A 5DP1A 1UWLA 2HXGA 5HOQA 1CQPA 1D6SA 4M0EA 4M1KA 4YLGA 4B3CA 5JMTA 2V7WA 1FNDA 2FW1A 3B70A 2RAPA 3IR5A 3CEPB 2JIRA 3AG6A 5FEMA 4PBTA 2Y0PA 1VSVA 4NNJA 4F92B 3B13B 2F4VB 1X9IA 3VTAA 1YV9A 1G6OA 1LTKA 1R10A 2PQMA 2JC3A 2WF5A 4QNMA 3WGJA 2TYSB 5ILOA 4P0QB 2HMSA 4E0BA 3RJ5A 4H9GA 1ODTC 1VJTA 3G7UA 1IY8A 4GL2A 4IMIB 2BHSA 1ZCBA 3KD2A 3EGDA 4KO3S 2HLHA 4PLCA 1E94E 1WP4A 1YONA 2NZ2A 1HOTA 1PYDA 1WCWA 3Q2IA 2IYNA 4CQNA 4GYKA 2WYUA 4Y1FA 1Z8DA 2DULA 2I76A 3I73A 4CLHA 1ID8A 3NH9A 5JQWA 3JXEA 1GIAA 1J8MF 3K5IA 1EP9A 1ZX1A 1P8AA 4KYVA 3TKAA 2AWNA 4KWHA 1IUOA 1JH8A 1BH6A 1KI8A 2Z95A 5AQEA 5AXBA 1U1FA 5KIAA 3C6ZA 4PFKA 2OR3A 2FSGA 3OT4A 4Q3LA 3JRNA 3UAXA 1B42A 3LSYA 4KNYA 4XGKA 1GYQA 5EHQA 3UKOA 4ZI7A 4AWXA 3K15A 3ZVKA 1SZJG 4FZRA 1L7BA 4HEA1 3J7TA 4R54A 1A8QA 1I4LD 2XUJA 3BIWA 4MWZA 1T3SA 1S7GA 5FFFA 4I1VA 1GPDG 1D2HA 1QVRA 2UYGA 3M6VA 4LX8A 5CB8A 4E03A 4X1IA 2EW1A 4E5YA 1E61A 2IPMA 3GJ4A 1S2IA 3RB8A 1V5FA 2PD4A 4H4CA 1U2PA 3QUCA 3K9HA 4F60A 4JB3A 1J2RA 1Z22A 2D62A 1FU7A 1KMHB 1LB1B 2ZVDA 1FTWA 4IW3B 4J9UE 4V0QA 2B4QA 4O5AA 3HABA 4QL3A 4E31A 1JSZA 4F84A 3AF5A 3NJ8A 3UT6A 3U7IA 5MF6A 3FRHA 3I9MA 4NX2A 1FJXA 1XEWX 2FPPB 1QOQB 4DXDA 4YP1A 5KQRA 4O3MA 2FOLA 2PIAA 3OZ7A 1Z62A 2F1IA 3R0XA 4IIXA 5JSZB 2O57A 4WIAA 1OI7A 4FS8A 3TN7A 3QX8A 3IMCA 2EOAA 4ENWA 2FQWA 3WOVA 1G21E 1G5QA 5IK2D 1NF9A 1EFVA 2FSIA 2ZVPX 3AY7A 4NFHA 2I7TA 2XQJA 1BFUA 3VR1A 2WW8A 2Q5CA 4RY8A 2AQ8A 4QDKA 1EX1A 3O8BA 2O2CA 1WSWA 3ESCA 3CA8A 1N2CE 2NOAA 3R3ZA 1LU9A 5CIQA 1U5CA 3ZLUA 1DEHA 1UBMS 2GA9A 2QVCA 3SR4A 2WKWA 3AYZB 4GZ6A 3ZWMA 4AS2A 3B7PA 3H1AA 4JEHA 3ZW7A 1QKIA 5AK5A 1SKYE 3PFCA 3ELYA 2HA2A 4JBIA 1QCZA 5FIUA 5KHAA 3UOGA 2XHZA 3ZY6A 4M0LA 4AJ2A 4D6XA 4C0BA 3L3BA 4PC3A 5DLYA 2FR8A 3JARA 1JTVA 4N40A 1T1JA 4G0WA 1PWZA 4IKEA 2P6UA 1PO7A 1T2UA 4PGAA 1YA8A 2CB9A 3DMGA 1NNLA 2GETA 2HPVA 1CUDA 2ZTVA 1G41A 3BMNA 3SICE 3UN1A 5HZMA 4D79A 3DB1A 2XT6A 1R5JA 2A14A 4AJNA 1P1BA 2XEXA 4ZDKA 4YJ2A 1QWSA 1E7YA 4NZ9A 1N7GA 3QNWA 3ZNOA 4AYXA 4JCCA 3O2JA 3ZGXA 3EN0A 2R1VB 4MB6A 2B2XA 3KQVA 1FA9A 5EIBC 5TGZA 1RVDA 1W4RA 5KU7A 2JAXA 3AU8A 2PD6A 1J56A 2PXCA 3ECAA 2BDTA 1BDJA 3OZVA 2R5FA 4FSHA 4JQZA 4E2WA 4UBIA 1G7SA 1ICIA 4AZ3B 1RWBA 2CMKA 2I6QA 3SQLA 3QEAZ 2V0GA 1WULS 4WBSA 1ZW6A 1ZK4A 3D6MA 3ZWKA 2IHNA 1G8AA 3DAOA 1E4VA 1BXRB 1FXUA 2VBCA 4LGYA 1QONA 2AUTA 1EUDB 1LBIA 1KPGA 5KNBA 1VE3A 2EWWA 5F2NA 1XPOA 2P6NA 3P0HA 1BWSA 1WAMA 2YXNA 5HJ7A 3RVKA 4NRDA 4JN6B 4QFMA 1D9ZA 2BYTA 3FKSA 3HCDA 2H9YA 3OJXA 3W2FA 3WWCA 4LMAA 2GN0A 3E1SA 4I9FA 4LGMA 1DO2A 4MP3A 5BOVA 2NO5A 2YVLA 3IPLA 4MO9A 3OSZA 5EZYA 3UATA 1U0LA 5IAEA 1SC9A 5JSFA 1K66A 3QPDA 1TZMA 2G1JA 3A4IA 1NXSA 2H2WA 3T12A 3V1MA 4AIIA 1JVSA 5GJBA 5TEWA 3VOAA 2IU3A 3CHYA 2PMWB 4F72A 3BCSA 1Y6QA 2XYHA 1XD8A 3FYHA 4JQOA 1ZUNA 1PQPA 3A6KA 3C8UA 1GKIA 3F9IA 1M34B 3EFOB 2H1LA 4CM5A 2GZSA 1L7EA 2OHHA 3ED5A 1F0NA 2P9CA 1GPYA 3CMMA 3IV9A 3G8YA 5BSFA 1JYSA 3ZI4A 4L15A 1Z2NX 4KVGA 2NO4A 1JBEA 2JFVA 4PGHA 2M2IA 4XGIA 1ZJ5A 1M1NB 2OZEA 4DLNA 5JADA 4NYJQ 3GPLA 3MQFA 2OUKA 2YXLA 3H17A 4ZP1A 4LF4B 3QU4A 3ZZUA 3HCEA 3L79A 3PHCA 2N1MA 4DA4A 4OBXA 1R12A 4YPOA 4WBNA 5JH7B 4LXGA 5COAA 3SQNA 3TW8B 3H83A 1AMNA 2AHOA 5H16A 1OFHA 2ZB3A 3EWSA 3PIRA 4RF3A 3WWEA 2HC9A 3HBJA 3PVZA 3QP9A 1YOVA 2GK3A 3K2QA 1ZQ9A 3JYNA 3OWHA 3UOAB 4QC2A 3X1WA 2ZLBA 2NUAA 5CW1A 1UJ5A 4X8MA 4IWXA 1RKBA 3QNMA 4ZA2A 4ZVKA 2Z9BA 1GQRA 3OTGA 4GQAA 1KK3A 4CM6A 4MYCA 2JH8A 1Y7IA 4F4DA 5BRAA 2EFYA 1XQVA 1SUEA 3BL8A 3C6KA 3OIGA 3W3AD 2O8FA 4W9MC 4MI1A 1BW9A 1EXWA 5C1BA 1GD1O 1RI1A 4TSRA 5TQ2A 4WBXC 4LPSA 4MI3A 3JQ9C 3V1TC 3I9NA 2GZ3A 3H2SA 4YV0A 3M1LA 2IS4A 2W0SA 2W48A 1OGJA 3KUDA 5EP1A 4CU5A 1T0IA 4W6QA 5JJKA 1UAYA 3NHMA 4BUZA 4EF6A 2IK8A 4KN9S 1Q7EA 1YZTA 5CBPA 5INTA 5EI5A 3OICA 5HQ3B 3OFSA 2C57A 2FSPA 1W0KA 1ZGAA 1VKZA 3O1JC 1AZLA 4I3GA 5G53C 5CLJA 3FWZA 2J09A 2ZG6A 3FYUC 2VDQB 3BMCA 4Q3BA 3EEFA 5AKLA 2GZ1A 4F3KA 2P68A 4OHPA 2A88A 4K9RA 3SEZA 1DWUA 2QORA 3A4YA 3IVAA 3QYAA 4NFYA 2W8ZA 3IQHX 4R1NA 2WF6A 3K9GA 2QTHA 5EKSA 4F9EA 1P7ZA 1C0KA 1N0UA 3LGAA 2Q0QA 4WT7A 2V7QA 3OM0A 1Z88A 3DHYA 2VDWA 3HI4A 3NASA 4L0QA 4OQDA 3IKTA 4CRWB 2Q2WA 3MZ0A 4QYXA 4V1CB 2V5AA 3ABSB 3K2EA 2QTBA 3HU5A 1EB8A 3CEHA 1DEAA 1UZUA 1ZK3A 4M55A 1I36A 4LBZA 1OIXA 3AINA 4ND8A 3TWOA 5J4VA 1BFDA 2D3TA 1DMRA 1Z7GA 2X77A 3HZOA 3LNCA 4IUDS 3LZDA 4HX5A 4Y1GA 5JS7A 1PZXA 4Q15A 3ORSA 5CGZA 4ZDJA 2M9MA 3N7UA 1NKSA 2C04A 3VKFA 1M2NA 3CZMA 1MORA 2JI6A 4LHYA 2DT5A 3AY6A 3RKRA 1TD1A 4DLYA 2RH8A 1LKZA 5KJCA 5M34A 4HDNB 5G3YA 4BV3A 3W4KA 4B44A 5EXDA 5LLSA 4MP6A 4JBGA 3T3IA 2I4TA 1F3LA 1HQYE 2YJ3A 3DE3X 2RGAA 5EL0A 5AJZA 1GFSA 3SM9A 5BVGB 3FYUA 1IBLB 4GKKB 4YRFA 4EDFA 1E2KA 4PC1A 5A4KA 1O9GA 1YR8A 3GLFA 5DIFA 2FFRA 1M6HA 1TO1E 3I9V1 4W1PA 5ALRA 4BE4A 5JDIA 1X13A 1XZKA 5G0VA 3A9UA 3C8DA 3AXTA 3LA6A 5B3JC 1SXJB 1GSAA 3OX2A 3L1IA 3NEYA 3PS9A 3ZWVA 5KNDA 4GGOA 1EHYA 1YL7A 4LXTA 3FRJA 5GOZA 4HLUA 4FGWA 4J94A 3BTSA 5DMXA 1XCOA 5A06A 2OCXA 2BL4A 1SQSA 5L3ZA 1P77A 1UMDA 3QIAA 5AIAA 4EHJA 1X70A 1QVZA 4M1MA 2ATVA 3VMFA 7GPBA 2IHYA 1EG7A 1H8HD 3EDOA 2X0JA 3MSXA 5ALIA 3LBNA 2WJIA 3IUYA 5EHXA 1IXYA 4YT2A 3HYTA 1ZSYA 4QHSA 2K7ZA 5REQB 3G7NA 1KJ8A 2VHYA 2ZI5A 2I5PO 4G8DA 5A4FS 3EAQA 5JAPA 4GD3Q 2PLNA 3OIUA 5DCUA 3DGFC 2CL5A 2C4NA 1F38A 4FNMA 4P83A 3T7JA 4AC9A 2OFFA 2K5UA 4OOFA 4XM1A 3WJ1A 1EUYA 2HCJB 1BX0A 1WHTA 3KG2A 3ONVA 3QLUC 5CFOA 3FM9A 5KJEA 5KNBD 1ZN7A 2BBOA 1S3FA 3LC0A 2C31A 2OAQ1 3PYMA 4NSNA 2PUJA 5WRFA 2PNJA 2DU8A 1JAYA 1RBQA 1RYZA 3GLHE 3KQMA 4FCWA 2SCUB 4IJKA 4MYRA 4QQ8A 3ZNPA 4CLRA 3B36A 2FLWA 1PQUA 1USIA 1PFKA 2CXUA 3LLMA 4HQKA 5EYPB 1E3TA 1UJCA 4M8SA 4PNEA 1ZR4A 1UEJA 4PE5B 1Y3DE 3HY4A 1RQXA 3AIOA 3KHUA 3L7CA 3S3TA 2RGCA 1U0NA 2Y68A 4QGHA 4TTAA 4Z9FA 5H3HA 5LZ8A 1PZGA 3EH1A 2FFHA 1FSZA 1ZFNA 4OQYA 1JN0A 1U9JA 3VDXA 4G6ZA 2OCIA 2OD7A 2XNKA 1YJ8A 1MTOA 2J1LA 3LNTA 3O2QB 4TL9A 4I66A 4AJEA 4UFOA 2SICE 4WD3A 1DBPA 2PT6A 1F2TA 2Z57A 4KVAA 4LXHA 3I5AA 4MZXA 5IBRA 4TKVA 1V2HE 3CINA 5ALJA 3RABA 5JANA 4BNDB 1NW3A 3PRJA 5K0SA 1KY3A 1PJLA 2CE2X 3PF8A 4KGDA 4P54A 4AG6A 3RJZA 3CX4A 2F1JA 3K0FB 3R75A 4RABA 3K4PA 2CD7A 2NUPB 4YRKA 2DZDA 1XLTA 3DL7A 1C1HA 3OA2A 5EKTA 3I61A 4NAHA 5DHRA 1NC1A 2CY0A 2OCYC 3UHOA 4NH0A 4M0FA 3GP3A 1P9LA 1XTUA 1YS1X 4HEA6 3PT9A 4ZYVA 4B4WA 2I7CA 3HA2A 3OPNA 3U13A 1BEZA 3AR3A 5FUWA 3Q9LA 1NFQA 1T15A 1MNAA 4WCFA 3EG9B 4ZVPA 1CEYA 3D2CA 3GFBA 3ZJTA 1U28A 2YIVX 3AVVA 2F8TA 1C3OB 1CZRA 3N5CA 1R6VA 2G72A 1FTYA 2C5FA 1GADO 2J0EA 3EOAI 3PFIA 3QQ5A 4EUSA 3B6MA 4YMGA 5MFPA 1NFRA 4R83A 4TT3A 1N2EA 5CRIA 5DRTA 1O94A 4KAAA 3K0SA 1KGDA 3QHPA 4M6WA 2PUCA 3ELUA 1VLQA 4W8OA 3AM5A 4MIKA 4DLPA 4NONA 2GLXA 4B8WA 3GDWA 3BXPA 5DTEA 3WP1B 1BQ4A 3KRTA 2FEXA 1UJ2A 2ZSIA 2WJWA 2NO9A 2V7XA 1NOKA 1Z45A 3GJ6A 3QWIA 2F9LA 1HF3A 3EFOA 4EUEA 2YBDA 4RYDA 3V4ZA 3WDLA 3WNQA 3RADC 5C3UA 2R1ZA 2VN8A 2W4QA 4E5SA 4OMFG 2YWXA 4W5TA 3V2HA 4DR1B 4BV8A 1J0XO 2JRCA 2FU5C 3UFBA 1PNVA 3SBEA 5JALA 2CDCA 1EVIA 3EGXA 1H4VB 1TX4B 4NBVA 2Z4SA 1S8OA 4LC0A 1TW2A 2GCPA 3ZCVA 5L40A 1GRQA 1YMVA 4GI5A 4HV4A 3VU8A 1TOAA 1QYWA 1U4OA 1GO2A 4IDCA 4QREA 4EPRA 1WM1A 1RPAA 3PXEA 1YVDA 4OFBA 3LF1A 5M3BA 1JSRA 5AVXA 2VDMB 3ITKA 4OYRA 2QYSA 3KLPX 3A11A 4E7OA 2HI0A 1WABA 1MEEA 1XR3A 1LPBB 1U2SA 1E4OA 2DC1A 2REXB 2WVAA 4URYR 4FNGA 2A9QA 1IOLA 1FJ2A 3ZD8A 5T4BA 1YJCA 2OFPA 1NM5A 1M1YA 3LPDA 3THXA 1JJFA 2JF0A 4IFEA 1HLPA 3U19A 1G18A 3DVAB 2CJWA 4F5WA 4K6CA 2QTLA 2Q41A 1FRFS 1ZNWA 3OZEA 3NH6A 1JHZA 2GZ2A 1ZGZA 4QATA 3REQA 4JI2B 2C59A 3O84A 2B8WA 3RM3A 2BONA 2PO7A 4C7OB 2HK9A 3N8KA 3KWFA 1KK2A 1Z2PX 1HORA 2J9XB 4HAWA 4TLBA 1UEIA 1N5OX 3DMDA 1IYZA 1TFRA 2JFOA 1SQ5A 3BTVA 3L2OB 4IGKA 1QH8A 3GUHA 5CVVA 4CF5A 4QZVA 4FFBB 4FT2A 2LRHA 4LCEA 5K6AC 4EHFA 1O9BA 4OXKA 4R98A 3GN1A 4LOIA 3SSAA 2PZ8A 2FPOA 4UE2A 3WGHA 3AI1A 5B37A 3IAS1 3DEAA 4MEJA 2BGJA 1XTZA 3AVUA 3O8OB 1YR7A 4RDCA 5ALSA 1Q1AA 3L6RA 3FBGA 2DBQA 4KDRA 4D0SA 1JIUA 2J5XA 3IUMA 3M89A 3P1JA 1L5FA 1FUUA 1NVXQ 2YICA 3CKLA 5HA5A 2B1IA 2JAWA 2HUNA 5E2BA 5ALEA 2FPGB 3V7YA 2G0AA 2GEKA 4ON9A 1RM0A 2X0IA 3OC0A 5CFNA 1XOIA 3KUCA 4I1OA 3GG2A 1NKVA 3O1HB 3VJMA 3N0XA 2ALJA 5D00A 2JLVA 1AB6A 2WILA 3B7GA 4BGUA 5L7YA 8GPBA 3TTTA 1YASA 2GKSA 4D74A 2VQFB 1YVPA 4FGSA 1QAOA 1TEXA 1CVRA 2I91A 3I01A 3PXCX 3MUOA 3MWDA 3SF0A 3M4JA 5JOQA 4RU1A 1G4UR 5TT0A 1Q7RA 4MROA 4UNNA 1N2JA 4PSDA 3SQDA 4JXJA 1EP1B 5BSGA 2YY7A 4WKPA 4JLPA 4UMEA 1PRYA 4XUDA 3F71A 4DY4A 4QPZA 4C6TA 3MMNA 1DBQA 2HA0A 2HJ9A 1VE6A 2XSZA 3KTAA 4NZZA 4C08A 2JJMA 2EL9A 1OZFA 2GK7A 2EYQA 2JGIA 2O2ZA 2WSMA 3IQDB 3MWGA 2VWHA 2H0QA 5LBTA 5BOSA 1ZD4A 4BGIA 2O5VA 2VAXA 4DR5B 3WZLA 2WWTA 2H11A 1O96A 2FOXA 1TNDA 4PAWA 2FPXA 1SXJA 2XXJA 2I4IA 4Y8VA 3IHLA 3KQPA 2WE7A 3CFYA 4ZREA 2RGXA 5ELXA 1M76A 3QUAA 3QUSA 3K6KA 2PLFA 3ANMA 1YBVA 4Y6OA 4ZI3A 4EF5A 1EXDA 1SB9A 2NZ8A 1YB7A 4HEJA 1YRHA 2IU0A 1GGEA 2OPHA 4K9MA 3TZCA 2OBYA 3BVPA 2HR1A 2NU6A 4RIGA 1RZUA 4G4SP 2CV1A 1V9LA 3ZBTA 2AJ8A 3HVKA 5K8TA 3TE6A 1YI1A 4R9UC 1OI2A 1UDAA 1KI6B 4L76A 3DEYX 4NFSA 4BOYA 3LO5A 5A9SB 1E8NA 3K09C 4XIFA 4QQRA 4FDVA 4HB3A 4EZBA 3R41A 3W6ZA 1SVWA 3L4JA 1R9GA 3BWXA 4I4IA 1TMKA 1BVUA 4GRDA 5BY2A 1BWRA 4DEYA 4EBBA 3HJNA 1YNSA 3DBHB 3GH1A 5ARBA 5K99A 3C43A 3EBPA 4ZYTA 1WUKS 4M99A