2LWIA

Solution structure of h-rast35s mutant protein in complex with kobe2601
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title In silico discovery of small-molecule Ras inhibitors that display antitumor activity by blocking the Ras-effector interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 41
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2lwiA00
3QF7A 4P32A 1ONBA 3LQRA 2BBOA 2C77A 4QM6A 4P4SA 1FZQA 2Q9CA 3JZMA 1GUAA 2MSEB 2ZR9A 3KJHA 2A5FA 4LBYA 1FL9A 4UNPA 2FZ4A 4V0NA 2ZXUA 1PV4A 3U6KA 3AM1A 2IYZA 3IPXA 4IKEA 2ZM5A 4YMWA 4WZBE 2ZRJA 1QHYA 2WSSA 5AUNB 1YZQA 4RVCA 1ESNA 3A37A 4U02A 3FFAA 1ZUHA 5KSOA 1G64A 2HYDA 1QHHA 1SVWA 1ZM2A 2FPMA 2QAGB 2XB2A 3ZVMA 1FP6A 1N25A 2B7CA 2F1IA 2R6GA 2OFWA 3ZVLA 4LV6A 5C1BA 2J0SA 3CR8A 1SKQA 3MGCA 2CJWB 3PCRB 3AB3A 1G3RA 1NNEA 1JEEA 3QXJA 5JCZA 5LD2C 1VCIA 1E1QA 4V03A 3T1OA 2WPDD 4US1R 4AKEA 1T4GA 3NC1C 5BQ5A 3MD0A 2VLIA 4CEIA 1XEXB 4G5GA 2VSFA 2P2LA 3AH8A 1GG2A 3X1ZA 3CKLA 4E09A 4O0MA 4G1UC 4LJ8A 4KBGA 3KQNA 4OQXA 4ZCIA 5HZHA 2ATXA 1U94A 1QHXA 1JAIA 1W5SA 4BZPA 1NRJB 5J5CA 3KUCA 2FU5C 1KDTA 1FW6A 4A8JC 4PO9A 1Z83A 4UNSA 1D9XA 1XPOA 1QG2A 2FGJA 2ZYUX 1M34E 4HI0E 2KI5A 4Q9KA 1EG7A 2OBMA 3AVTA 2WVJA 1R4AA 2P67A 5DISB 2D7DA 1L8QA 2B8TA 3WNDA 1UPTA 2JA1A 2WWGA 1TUEA 4FW9A 4EQ6A 3EZ7A 5EE1A 5JJKA 2WMNB 2FN4A 4EFLA 2XJ4A 1VDZA 4CEHA 3RABA 4CDGA 4JIMA 2B21A 2JJ8A 3GCGA 3B13B 3IO3A 1ETUA 3GEHA 2VP4A 3IHWA 5G41A 2H92A 1E2GA 1QHGA 2NPFA 2FJUA 4LYFA 1W47A 3WYAA 2GZAA 4B73A 1R0YA 4XTCS 4DXAA 3TUZC 3M0EA 4L15A 1ZJ6A 2YYZA 3FHTA 2E9SA 1N6LA 2ONJA 3HU2A 3R7WB 1II8B 3AEZA 4XWAA 5FL3A 3PV0A 4KCGA 3RWMB 1E9BA 1XTIA 1B23P 1C9KA 1JEDA 3NEJA 4DCNA 3LDAA 4KXFB 4LJAA 3U4QA 4TMXA 4J0QA 4QNMA 2ZI5A 1KSFX 3TH5A 5JS7A 1YR7A 2FWRA 2ZJ5A 3IPYA 1OFUX 1GL9B 1QHNA 1VIAA 1YR8A 1YZUA 3Q3JB 2ZITA 5P21A 5EXTA 2P6RA 3AVYA 1NKTA 4QC2A 3NBZC 4U5XA 2CL6X 3T06B 1VYTA 4ESVA 3UMRA 1ESMA 4OL0A 2PMKA 5JFGA 1KO8A 3K9GA 3FMFA 1N6RA 2O0JA 4OI0A 4TL8A 2JIZD 4LJ5A 2QN6A 1QF9A 1QVRA 4XVQA 2VYFA 3MUFA 4JVNA 5CIQA 1VPLA 4GOKA 1E2PA 1YU9A 3DHWC 1AQYA 4QBGB 1MO3A 3FOZA 1UBCA 2F9LA 2QU8A 4PFSA 1E9RA 2IL1A 3ZGXA 2C2HA 3EW9A 1RRFA 2W2VA 3HWSA 1BO6A 1HTWA 4D81A 4DRZA 1IN5A 1WBDA 4XSGA 1TF5A 1G3QA 3AF3A 2XTNA 4NH0A 2RKOA 4HAWA 3RSOA 4JVSB 3QEOA 4EFMA 1CRPA 3NH6A 1N5IA 3I92A 4FN5A 4LWZA 4DSOA 1NY6A 4OHZA 4GOJA 1NG1A 3EPLA 1Z0JA 2R6DA 3TSOA 2JDIA 2I1QA 3SDZA 2VF7A 3SHWA 1YHNA 2F6RA 2D62A 3GMTA 4RKFA 4EPYA 1SVSA 4ZCLA 2QAGA 3X2SA 4MUAA 1WRBA 1E32A 2E1RA 3B5JA 3W8NA 4B6FA 4CYMA 4DKXA 3NXSA 1Q3TA 1HH4A 2GZHA 2IS6A 2A2ZA 2G3YA 4KFUA 1Y3AA 4W9MC 4JLKA 2CJWA 1OKKA 1W1WA 1RW4A 4MRRA 3KKQA 4DB2A 4F4JA 1EFRA 3CRRA 2IXFA 3LLUA 2GEVA 5BN4A 4HLUA 4B34A 1GSIA 1XEXA 2GXUA 4FMBB 3RYTC 5EJEA 1KO1A 4B32A 1CJTC 2F3TA 4PHTA 1E2MA 3RRYA 3V00A 4IVQA 3BH0A 2JLRA 2D2EA 3D31A 5A4JA 4LPSA 3I5YA 2X8AA 3DZ8A 1XWIA 1P9WA 2BEJA 5A5GA 2Q21A 1HE1C 3AGQA 721PA 1GRNA 1OXTA 1KZ7B 2RGBA 5JJLA 1AJEA 3B1ZA 1ZU4A 4NYIR 3CLVA 2WWIA 1DBSA 1E0SA 4ZO4A 1GKUB 3OF5A 1KJZA 2NPIA 2HJVA 3HPQA 1KDRA 4NCNA 1SVKA 3BERA 4M1SA 4US0R 3KKMA 4PSKA 4RSGA 2GEUA 3KFXA 4TYQA 3GLFE 4MA4A 1OYYA 3TUJC 1OXUA 3FMOB 1BYIA 4M2LA 1ZD1A 4C30A 1CEEA 3EPKA 4JLAA 4JLJA 3IILA 4MRSA 1JECA 2OHFA 4D6PA 1V43A 3B82A 4RCYA 4ITRC 4Q1AA 5BXQC 3CZPA 3C4JA 3TK1A 4HAUA 5DHAA 2ZUBA 3R7WA 1II8A 1OW3B 3QBVA 2IK8A 1PLLA 4I1OA 4CW7A 1W36B 4AKHA 4G0NA 2PJRA 4JKIA 3REFA 3AGPA 4DUGA 3K0CA 3GEIA 1DPFA 4L9SA 3X1WA 4Z8YA 5IK2D 3AVUA 5JWRA 1XD8A 4JL5A 1NP6A 1CIPA 1EFCA 3PXGA 1YQTA 2FPKA 1JJ7A 3W6NA 4AYXA 4EUNA 2JLQA 1JJVA 1NLYA 5FTLA 2QAGC 1WF3A 3K0AB 1TPZA 3T34A 3BGWA 3QPUA 3IBGA 3OIWA 3JVUA 4LJ6A 1KYIA 3UK6A 4RD0A 5EUQB 1UBFA 3PEVA 2QEQA 1BH2A 2RGCA 3U7GA 4A15A 1DAEA 1T91A 1OIVA 1E9DA 2DYKA 4S2EA 5GJBA 2H7VA 4HLUC 4QG7A 1YZNA 4C0KA 3AVPA 2JJ2A 4KFRA 1XJ0A 1J2JA 2W2XA 1COWD 1N5JA 4P3YA 1G1MA 4XD7D 3B60A 2EWVA 3TAUA 1MO6A 4M4SA 1KAOA 1NVUQ 2QRNA 2ZJYA 3BAFA 4NYJQ 3UMFA 3VR4A 4EPTA 2HDNB 1KI8A 3K53A 5CM8B 3ZH9B 2VHJA 4GBMA 1GL6A 3H2YA 4LJ9A 3GEEA 4WZ6A 1D5CA 3RRMA 3TUIC 1OE0A 3K09C 1D2NA 1S1CA 3KXIA 1HUQA 4NCJA 4WOPA 3PVSA 4WAUA 1ZIPA 4HLCA 3AVOA 4FI3C 1JB1A 1F3OA 1MABB 4IFEA 4OKSA 4PXAA 2JLYA 3G0HA 2CE7A 4LBWA 1CRQA 3FB4A 3SJCA 1J8YF 4Q7LA 1SULA 2VP5A 4JYCA 2IYVA 4GRAA 2FSIA 3EXAA 4AYWA 2R8RA 2WSSD 5DN6D 1E4VA 2REXB 1KKLA 4HB2A 3B1YA 2CHQA 4A36A 4MRPA 4MDFA 4B35A 1E69A 2OAP1 3MCAA 1JI0A 1X1SA 1M74A 3I5XA 1XEWY 1U0HC 1XU4A 2QMHA 4M1TA 1XTSA 2HT1A 4B3GA 3GD7A 1KSGA 1S9DA 4TL6A 2OCPA 1UF9A 4JMPA 5F9FA 3AKDA 1E1QD 1W0JA 5DO9A 2HJGA 2Q3MA 2NO1A 3LY5A 4TLCA 4PSVA 3L0SA 2H8KA 5FPHA 4RD6A 3WMFA 1Z2CA 2ZRMA 1KO5A 2J46A 1PUIA 4UJ5A 5DYGA 2FE4A 4RZXA 1E4YA 5SZKB 2QTHA 3HR7A 3O8DA 2W0MA 1AM4D 1UBEA 4FCVA 1T5LA 2AXNA 4HAXA 4Q00A 4XH9B 4AKIA 1E2KA 5J40A 3IIKA 1ZAKA 4O25A 5LB4A 2HF9A 2WWXA 1C1YA 2WTUA 4WBSA 1TTTA 2OESA 5ANRB 4N1AA 4BECA 5KPDA 2VP9A 2J0UB 5DI3B 2P5SA 3ND8A 3QPVA 3QOFA 1E2EA 2VRWA 2QP4A 1WXQA 2ZRKA 4Q02A 2NZJA 3VTKA 5FOXA 1U99A 2CK3A 3EA5A 5CYOA 4G3XA 1GVNB 5IDVA 1OFHA 5JRJA 2UKDA 3K0AA 3FDIA 3M4YA 3U2QA 2RGEA 4Q4HB 4U00A 1ZD8A 3VNVA 2EU8A 1R7RA 1WB9A 2Z0MA 4M9XA 3QEJA 4NCHA 4AURA 2VEDA 2X19A 1ZC3A 1G5PA 2D4HA 2QUZA 3ZYCA 2BM1A 4XWKA 3QQ5A 4LV5B 4GMXA 4JT4A 5FI0B 1R5NA 3A1TA 3C5HA 1E2QA 1HYQA 3E1SA 4FWIB 4V0LA 1J8MF 3VAAA 3KQLA 3UATA 1Q22A 3O8RA 2WAYA 1G8YA 5HE8A 1P62B 5LD2B 2NMVA 1L7VC 2ZSBA 3BOSA 3RRZA 2KBEA 4FMCB 5CB6A 1XF9A 2J7PA 1GRRA 3GJ6A 2FFHA 4MGYR 1P9NA 3SYLA 2H57A 3B1WA 3LV8A 5JBQA 1UKZA 2DCUA 2R2AA 4Q66C 2F7SA 4KLNA 5HCIA 1CLUA 4U7DA 1H65A 3SR0A 4G5QA 1UKEA 2IBMA 4ACBA 5J4KA 1GL7A 5H70A 1CTQA 1W4BA 2MSDB 1CR1A 1SHKA 3GQBA 4DLSA 4A8JB 2ZSAA 1XXHB 3FMPB 4BPBA 1ZBDA 4B33A 1MABA 3E2IA 1Z6TA 1ZM4A 1R6BX 4R2HA 1NN3A 4MQBA 3SOPA 2PT5A 5K8TA 5EP2A 3RHFA 3CWZA 1TEVA 1IAQA 3ZZ0A 2JDID 3ZD7A 4DBLC 1NJGA 4D4MA 2YWHA 1K5GA 3GJ0A 5LPNA 3RLFA 5JS8A 4OHYA 3SFZA 3A58B 1P2SA 2D2FA 4B2LA 1W48A 3W3ZB 2RGXA 2J9RA 4M1MA 2V4ZA 3EG5A 3KFVA 2RGGA 1P4SA 2ORIA 1W4AA 2IYTA 4W5WA 3CF2A 4JJZA 1Q1BA 2IYXA 2GK6A 2ZUDA 3L0PA 5DE3A 1UAAA 3SYKA 2LKCA 2BJWA 1JALA 2GJ8A 4BQSA 4XOIA 3A36A 4L9WA 2IA5A 3W9YA 3ECCA 1EX6A 2PJZA 4HSEA 3Q7QA 3AKYA 4MGZR 2IF0A 2Q9BA 5FFMA 3BH7A 3VU9B 2ZRDA 4LHVA 3OEEA 2GHIA 4Q9JA 3BWDD 2ANBA 2GAOA 2BBSA 3GP8A 3JZAA 3LXXA 1YR9A 3UMSA 4FXPA 2PEZA 1YRBA 4EDHA 2W83A 3KB1A 2RGNA 2X2FA 2O0HA 4LZZA 1Q20A 3U6BA 3K0SA 4E5UA 2OXRA 1RC8A 3HU1A 4PSAA 2CMKA 4YLGA 2A5GA 4TMZA 4C7OB 4URWR 1FNMA 3EZ2A 4LOAA 4ARZB 4POAA 2D7CA 2J0UA 5DI3A 3ZQ6A 1Z22A 4HDQB 5EP1A 2GWHA 2G83A 1EFTA 3AP1A 2VQSA 3SEAA 2QE7A 3L8ZA 3U3JA 1CR4A 1D9ZA 2O0KA 4HUTA 2VHQA 1IY0A 1RIFA 1P72A 2XSZD 1FQKA 1G8PA 2KE5A 5FPSA 4Q4HA 5L3SB 1VKJA 4URVR 1KI3A 1NKSA 4QKQA 2GTPA 1CBUA 1JPJA 2OLKA 4OHVA 5EUMA 4DEXA 2MMCA 4PQRA 3FTQA 2CLDX 2IYLD 2VP0A 2BWJA 2PX0A 4TQUS 5TVKA 1Q57A 2PT7A 1MH1A 2OUKA 3B85A 1U90A 2J7KA 4I81A 3RAPR 2XX3A 3EAQA 3FWYA 5FPKA 4EQ6B 1X6VA 1M8PA 1XRJA 4EPRA 4TT3A 1Q0UA 5FI1B 5B57C 2AR7A 4OBEA 2ZJ2A 3L0OA 5JHGB 2KB0A 1EK0A 4MKGA 2ZE5A 4KVAA 4OHWA 3SFVA 4QOSA 1L4YA 1FNNA 1G8HA 1WP9A 4AG6A 3LQQA 3WNCA 3BIFA 2FSFA 3UXMA 1JQJC 1NVVQ 1VG1A 4ASUD 3QE0A 4B76A 1VCMA 2OG2A 5LBIA 5E3HA 2ZEJA 2TMKA 1W7AA 1XJQA 2QSZA 1VCOA 2WZQA 1VHLA 1K5DA 1KI4A 2IS2A 4H9GA 4Z1MA 1W0KD 1XCGB 1ZUIA 5JECA 2WJIA 1XFAA 1ZNYA 2JGNA 3K9LA 1E79A 4A8JA 3BK7A 1XXHA 3A1SA 1XTJA 2C04A 2PBRA 1RPZA 4NE2A 1E2LA 1NIPA 1NN0A 4AG5A 3FE2A 1G6OA 5KDLA 1JNYA 2C78A 1ODFA 1NSFA 3ZVNA 3GJ5A 1DOAA 1E2IA 2N42A 3PJRA 4IOKA 1GP2A 5FR1A 2RCNA 4KFSA 4Q01A 3R20A 1EGAA 4RFVA 2HT6A 2QSYA 5TV2A 4JLVA 1J90A 4GDFA 5JJIA 1Z07A 121PA 1QRAA 1G3UA 1PLKA 3W6OA 2JLXA 2ZE8A 2EYUA 1G17A 1R5OA 1Z0IA 4LJ7A 3B78A 1U8YA 3C41J 3QXCA 4P31A 4US2R 3GLFA 2OBLA 4IOLA 1BKDR 2AL7A 2ZR7A 4GI7A 4HAZA 3D6TB 2GJSA 2ZI4A 2PLRA 3CR7A 1JAHA 3OIYA 4B3CA 1W2HA 5E4FA 5KUTA 2OT3B 3IKJA 4YDHB 4LHXA 1DVRA 4HB0A 1IXSB 4BLPA 1ZUNB 4OI1A 4IOMA 1X86B 1DARA 1FX0A 3VU9A 3WY9A 2ODWA 2Z83A 1PZNA 3NBFA 2GF9A 2ONKA 2QQ0A 4JBXA 2CHVA 1Z06A 4PQYA 4W5HA 2WIAA 1W0JD 2DY1A 1KIMA 4P4TA 3ICEA 1DAKA 4OHXA 2F3RA 1EWRA 2NO6A 2ZRIA 3U3MA 3CNOA 3P4YA 3LH5A 5JEDA 5KPJA 1R0WA 4C0HA 4C7OA 2VP6A 1I4DD 1ZMXA 3KKOA 4ARZA 5C4MA 4KHZA 2QORA 1XMJA 1VG8A 1I2MA 5BN5A 4TZ6A 4RD3A 1IJEA 1A2KC 4ZKEA 1F48A 1LY1A 4KFTA 2VIIA 2LCFA 4LDJA 3X1DA 1KHTA 1E6CA 4JLPA 5JSZB 5L3SA 3KJEA 3QY0A 4NU0A 3OHMA 2PMDA 4LHYA 2O52A 4A0RA 4ZCMA 4RY2A 1UM8A 4ACAA 2FEMA 3BD9A 1EESA 1ZNWA 2GKSA 1W36D 4B6EA 4RD2A 4ABYA 1FMLA 4PC6A 3L8YA 1M6NA 1GITA 2A78A 5DNYB 3HPRA 3EZ9A 3Q7PA 2A5DA 4GZLA 4N3NA 2VHTA 3LW8A 2CK3D 5AJZA 5E7MA 8OHMA 2IEYA 4A6XA 5F9HA 4KSCA 1XTQA 2D3WA 3VKHA 3RRNA 4QNRA 2BOVA 1OYWA 1TF2A 2Q3HA 3EA0A 1OH6A 3SU8A 1FFHA 1G291 1NN1A 1F2UB 2FEOA 2PLFA 4BLQA 1YJ5A 4Z8XA 3BBPA 3L43A 3I1FA 2DFTA 4BGDA 4NZYA 4IHQA 1S2MA 2VTKA 2XEXA 3KZ1E 2BKUA 2FH5B 5E7IA 4DDUA 1CJKC 2W0SA 4AC9A 2GJAA 5FOWA 1R10A 5CDFE 2BBWA 2GXAA 4Q4AB 2RAPA 1U8AA 4PPFA 4YMUA 3QG1A 2REOA 2CVHA 1N0UA 2OILA 3GJ3A 2FA9A 3RSLA 3V9PA 5BWMA 221PA 1UKYA 4AKGA 3TRFA 3A8TA 3FFBA 1DO0A 4R71A 1RRGA 1YKSA 2CL0X 3B7GA 1AA9A 1IQPA 1EFUA 1HY3A 4JJKA 2R6AA 5FPTA 4MUBA 4WW0A 3BXZA 1JR3A 2H17A 2R65A 3AKCA 1BOFA 4A2QA 3SHFA 3KX2A 1H8EA 2GK7A 3AP2A 3UG6A 2N1BA 1QBKC 4ZPXA 4KITB 1IHUA 4DHEA 2C9OA 1KY2A 4MKIA 1CJMA 4DCSA 4JZKA 521PA 2JLUA 1TU3A 1X8JA 2BCGY 2IEZA 3SNHA 3HYRA 1KK3A 3AF0A 1G21E 2ZS9A 2X77A 3TAHA 2C8VA 4JLOA 4BLOA 4FD2A 4R7ZA 1KI2A 4JLBA 1N6HA 5FBLB 3THYB 5D3MB 1Q21A 3I73A 3TGPA 1HV8A 2GNOA 3AP3A 5CJ2A 2ZJBA 2AD5A 4DLYA 5A0FA 3OEHD 2JASA 3CX8A 4QGGA 4MYCA 2Z5FA 3OE7A 4PAQA 4TN1A 1G8GA 5FOUA 1GNPA 1E1RA 4R98A 3KQHA 4HYYA 3THXB 3R8FA 1KY3A 1MO4A 2UZ3A 1OH5A 3EWSA 4M9ZA 4Q18A 3TVTA 1LFDB 1N6NA 2OV2A 3P4XA 4OK5A 4Q4JB 4Q5IA 1IN7A 3PEUA 1OHHA 1G4AE 2GXSA 2ZQ5A 1DTSA 4ZKDA 1A82A 1Z28A 2MSCB 3RNLA 4LY6A 1E9CA 3V4FA 1CR0A 1GM5A 4H1UA 2W6IA 3UIEA 3N5CA 1WBBA 1KI1A 5H1YA 1GTVA 4QGHA 1AGRA 2OFOA 1DS6A 1D2MA 4K46A 1P6XA 5CDFA 4M53A 2A9KA 5KSPA 3BJIC 2XOKD 1KK2A 1ZCBA 1N0VC 5JSZA 3FGNA 4LPKA 4V0KA 1PJRA 2E87A 4JVLA 2SHKA 4G01B 4TSFD 5FBQB 4D0NA 3IIJA 1VTKA 3LA6A 4GL2A 1XBTA 3Q5DA 3OFND 2P0EA 4Q19A 1TAGA 1MRNA 1E9AA 1G3IA 3K9NA 2BC9A 2BMFA 2Z4SA 1RRCA 3LW7A 3CH5A 1AKEA 1OFIA 1S8FA 3OAAA 3K09A 3SZRA 2DR3A 5KNBA 3QKUA 5CK5A 2WJGA 2YINC 3SN6A 1GRQA 4BLRA 4GMDA 1D8TA 2IF2A 3EIHA 2QY9A 2YNMA 4LSGA 4X8LA 3GLIA 2JJ1D 3VQTA 1UDWA 4A0HA 2RHMA 5HZKA 3QUSA 4BWYA 5HKKA 4Q9HA 1TNDA 3TQFA 1F2UA 2QT0A 1I4LD 1TADA 4CT4B 5HE9A 2GCPA 3RS4A 1CJVC 2FZLA 5FBWB 1G41A 2GCNA 3BFKA 3J81k 3N2EA 2QZ4A 3RVBA 1US8B 1N6IA 1Z6GA 1TU4A 4B2PA 2ZYWX 3LXRA 3ZZTA 1W4CA 1NLFA 4AD8A 4TT3D 3CWQA 4OI2A 1OB2A 1XCPA 3N2IA 1HURA 3MWYW 1IXZA 3PUWA 2YVUA 4Q4AA 4QHTA 5UKDA 3O47A 1K8RA 4IDOA 1MV5A 5G53C 4EFNA 1Z5ZA 1YZGA 3IO5A 1HT2E 2PCLA 3F0TA 5TARA 3FKSA 4E07A 4DIDA 1JBKA 3TVDA 5KDOA 3B9QA 1P2UA 1WA5A 3KTAB 1CP2A 3C8UA 3KJIA 1E98A 2C99A 2DBYA 4PPQA 2YZ2A 1QG4A 4TMWA 1ZCAA 4OYHA 2VHUA 4YMVA 4M0LA 4JVMA 1M7GA 4EJSB 3VR5A 5K8LA 1E79D 1WCV1 1BYUA 2GEDA 1AZTA 3EWAA 1F2TB 3HDTA 2ZRHA 4IXNA 1KSJA 3IIMA 4H1VA 4CF7A 3HR8A 2C96A 2H1LA 2HLDD 4PC1A 3THYA 5D3MA 3VFDA 2BBTA 4B3XA 4CEJB 1EWQA 1KMHB 2YOFA 1GFIA 4YXWA 3SE0A 5DH9A 1P7CA 4DDWA 2IX3A 4L5BA 4IFBA 4DEYA 1NVWQ 2YJTD 2ZVQX 1SXJC 2Z43A 4XVUA 2IHBA 2BMDA 1IY1A 1DADA 3OZXA 5J4HA 3THXA 4RZ2A 5D3QA 2RGDA 1OV4A 5EP3A 3L82B 2GRJA 4HZIA 4Q4JA 1SQ5A 3GJXC 2VPPA 2WICA 5TDHA 1GKYA 2FV8A 1RRPA 1IY2A 1P3JA 1Q1QA 2G77B 3NDBB 2AXPA 4NCKA 2ZRGA 4TWZA 4Q7MB 2KSQA 3UANA 1XZQA 2OSBA 4DSNA 4DLWA 4DT1B 4DWJA 2O8CB 3DPUA 2ZJZA 2H5EA 1PVOA 5CM9C 2DWQA 4JSYA 3Q8XB 2EFEB 2OEPA 2ZRLA 3CUEF 4Q1EA 2ZU6A 4NDZA 4Q03A 1DG3A 2KWIA 2IUTA 2NO0A 5F98A 4GOXA 4IDQA 4XSHA 5DYIA 1BMFA 2UZIR 3HJNA 1L2TA 2ZS8A 3B9PA 3TE6A 3NIBA 3NHAA 3KQUA 2J1LA 4DLZA 4M9SA 2GCOB 4ON9A 3QXSA 1IJFA 4URUR 1E9FA 4BEJA 3R8CA 4ZDKA 3MG9A 1Z6YA 2YWEA 4HB3A 4M22A 3WP0A 2BMEA 2WWYA 2WWHA 2FX3A 1WMSA 2HF8A 3FVQA 3H0KA 3UPUA 4BUJA 4K8OA 3I4LA 1BIFA 4L8GA 3K70C 4NTZA 2BV3A 3T1TA 2AKYA 1LS1A 2OXCA 2XAUA 3X1XA 4FMCF 3VHLB 1Z29A 2IW3A 2IYWA 4MYUA 3LLMA 3P32A 2DFNA 2ZUCA 5IRCD 1VYVA 3CNNA 1US8A 3E70C 3BORA 3TSZA 1DELA 3MWLA 4PTLA 2ZIAA 1XPUA 1LS6A 1TQ2A 3H1TA 4QFMA 3NTUA 1OIWA 4TTRA 3EPJA 4PC7A 4PAOA 4LYAA 2IYUA 1G6HA 4QHYA 3H86A 4BFUA 1G18A 2F1HA 2ZI3A 3PUVA 3NC0C 3KTAA 4IJMA 3PQCA 4URZR 2IS4A 1IXRC 1TEXA 3DVLA 4Q1BA 1N2CE 1QHIA 1JQLB 4WA7A 1CR2A 4KO8A 1R0XA 1AS0A 1YVDA 1OXVA 3AVQA 4A1FA 1AZSC 3LX5A 3JVVA 5SZJA 3F5FA 3LNCA 4MH0R 3GPLA 2CL7X 3BFXA 4EJSA 1AGPA 2AX4A 4JL8A 3SBDA 1VIYA 3PG5A 4QBIA 1OIXA 1KNQA 3RS5A 2J59A 1GWNA 2V9PA 2O5VA 1F2TA 4UNQA 1J7KA 2DPXA 3ZS9A 3MJRA 5FTKA 3LX8A 1YRAA 5AR1A 2IT1A 2VP2A 5CYPA 4CEJA 5FTJA 1KMHA 1H8ED 1HE8B 3G82C 3HYTA 4HDCA 4EIWA 2ZANA 5JEEA 2HEIA 4Q48A 3H84A 1XDBA 2ZRNA 1UJ2A 3LFUA 4OJKA 4A2PA 2B8WA 4F4CA 3ZIAA 1VG9B 1MKYA 3MWJA 2ZETA 2QMOA 4ZDJA 2B6HA 4V0ME 4DVGA 4I4LA 1F5NA 5JCPA 4DC9A 3AVVA 4D0LB 2CEAA 6Q21A 2ZRFA 3PEWA 3EIEA 4OI4A 2DWPA 2GETA 5AUOB 4F93B 3IQXA 3C15C 3ASYA 4DT1A 2VL7A 2J45A 2W00A 4G5RA 5GVRA 1NMYA 3I3SR 2O8CA 4O2RA 1Z0AA 1DAGA 4BRUA 5KSZA 2JIZA 2IC5A 1MT0A 1AQUA 2QPAA 4QM7A 1E1RD 2V6IA 4HAVA 4TL7A 4PAMA 5FL7A 3UWOA 2ODEA 3DKPA 2JLZA 2CCKA 1ZNZA 3KJGA 3LVRE 4BFTA 2N46A 2BVNA 4RZ3A 3NEYA 1Z0DA 2IXGA 4IDHA 1XPRA 1OKKD 2GAAA 2Q9AA 2GCOA 3PENA 3LBIA 2QMUA 1EFRD 1IN6A 1YR6A 1ZYUA 1GOTA 1N6OA 2W6ID 3W34A 4TQAA 2ZAMA 2GDJA 2EQBA 4FMDB 5EXXA 5EE5B 5L3VA 3SS8A 4M1OA 5FBVB 3LAWA 1RE0A 1KDPA 3I32A 1II0A 1GNQA 4DLTA 1KJWA 2Q0HA 1FX0B 1GNRA 1G7SA 2HUPA 1AS2A 3GFTA 1M2OB 5CK4A 4B75A 1XXHE 4EJSC 1ZRHA 2OZEA 2ZJ8A 4B3DA 5KNDA 1N0WA 3WHKA 3GLHB 1XNJA 3K9HA 4P0TA 1IM2A 3F3YA 4JBWA 2JEOA 5J4VA 4FWTA 4Q9IA 1U81A 1LTQA 4QHSA 4TZ0A 2FOLA 1YZLA 3U44B 1LF5A 1CS4C 1KZGB 5B64A 1U0JA 1X8LA 1VCNA 1P9RA 3DMDA 5CJPA 3TLXA 4ZI3A 2WBLC 2OBNA 4UXIA 4WXRA 4TYNA 1WDTA 3FHCB 5JHHB 3ZQJA 2ZROA 1C4OA 3VKWA 1KO4A 2VO1A 2RGAA 1E0AA 2ORWA 5JWHA 4V0MA 1VHTA 1G16A 1ZP6A 1V5WA 2JLWA 2O8EA 2ZRPA 1OF1A 5K8IA 1KO7A 1FPMA 3A4LA 4XWOA 1S3SA 2IUUA 1W5TA 4YDSA 2V7QA 1O87A 4QRHA 4QBHA 1GILA 5FUXA 2VF8A 1HA3A 2OAQ1 4UQOA 4Q4LA 1TQDA 1G4UR 2ZSDA 4AIIA 1ZU5A 3WP1B 2QP3A 2FFBA 4DUGD 4LRWA 1OSNA 3QKSB 1NG9A 4QGAA 3TJZA 3WYGA 4NYMR 3Q85A 5FUYA 4DLRA 1Q44A 3FKSD 4PC2A 1DAHA 2AWNA 2AKAB 2ZRBA 2XB4A 3DMNA 1KSHA 3BE4A 3QVVA 4Z51A 3KL4A 4II7A 1R8SA 4LK2A 5L3RA 4BFSA 3ONWA 5J4LA 5H8WA 4WVFA 2H16A 3MRSA 4OJQA 4PO8A 4Q1CA 3QKTA 2GJ9A 2VA8A 1NBME 4M21A 1H8HA 4BFWA 1I4TD 3O8CA 2BHRA 1KMQA 1NVVR 4PX9A 5CLLA 2XZOA 1MOZA 1W4RA 5FH9A 1AK2A 3TNFA 2JJ2D 5KU1A 4KLZA 4FCTA 1S9HA 2ZTSA 2F9MA 3QJYA 4Q21A 2W6JA 2QAJA 1P73A 3SC3A 2A3RA 3VMFA 3Q72A 1XMIA 3KKNA 2C9YA 4CZ2A 5KOYA 1XTKA 3B1VA 4UXJA 1VECA 2NGRA 3WMEA 2PZFA 4IW3B 1YE8A 1UEJA 2AHOA 4TYYA 5SZHB 3S1AB 5TMPA 4YQFA 4OK6A 3HP1A 3SBEA 1Y63A 1E0KA 4D82A 3CB4A 3GLGB 2CNWA 4TQ9A 5GVSA 3V4RA 5C2JB 3CRVA 2PX3A 3NHBA 4QBFA 5AJWA 3U3KA 4DDTA 1UEIA 2CHGA 3SQWA 3H4MA 4XD7A 1OB5A 1OH7A 2I4IA 1VYUA 4IOJA 3WMGA 1W46A 3U7FB 4MYHA 4PR0A 3D8BA 1T6NA 4OQLA 2J3EA 4M8NE 4KSBA 2IS1A 3QKRB 3NWJA 3R9IA 1N6PA 1SGWA 3A6PC 4G5SA 1SKYB 1NMZA 4NL4H 1T8TA 5C4GB 1X1RA 4PPNA 3EX7C 2BM0A 3CF0A 1CJUC 4C4PA 2FSHA 3FKQA 2R62A 1E3MA 3GLHA 1MO5A 3BH6A 4HATA 4TLDA 4NP6A 5E7JA 3U3RA 1XJCA 4MRNA 5IT5A 2JATA 1UADA 2FSGA 3PR1A 4M1KA 1R8QA 1JR3E 4DZZA 1TF7A 5KNCA 3U44A 1A1VA 1NL3A 4EPWA 2F1RA 1NBMA 4A6PA 1RYHA 1TL7C 4I1SA 4JS0A 5FR2A 3QG5A 5DN6A 4LC1A 4KODA 1RYFA 3PUZA 3GLGE 1ZM3A 3LWNA 3VX4A 4E03A 4ESHA 4PPGA 2JLSA 2QTFA 4I99A 1KK0A 4PZLA 4GNKA 1G5TA 2QP9X 2WV9A 1OT3A 4L4UA 5JZVA 5EE0A 4LBVA 4XTRA 2WAXA 2QPTA 4N0DA 1P2VA 5JI2E 2HYIC 3WBJA 1MR3F 3MMPA 3CBQA 3PIRA 2PEYA 1NY5A 3L0IB 3ZLJA 1FMJA 3EC1A 5FUWA 2CLCX 1SXJB 4URXR 4CGZA 3SJZA 3CW2A 1SKYE 4OQMA 3ZD6A 1JXMA 3QKSA 1U0LA 3KB2A 3I61A 2QENA 4MGIR 3G5UA 3CPEA 1YZKA 1HQCA 1SVMA 4B74A 4BFVA 3GLIB 1I2DA 1RFLA 4LBZA 3THWB 4KV9A 4DCUA 4HAYA 4IVRA 1ZM9A 1FOEB 2F43B 3KUDA 3VKGA 2QROA 4X8MA 4TMVA 1R0ZA 3RS2A 4M1YA 4QJ5A 1DAIA 3RS7A 4QXAA 4PQFA 2IYQA 1Z2AA 4RKEA 1P60A 4NPHA 2P6NA 3UWKA 4GP7A 4MKHA 2CVFA 1Z6AA 2WKRA 4URYR 4PZZA 3CRW1 2NZ8A 4YMSA 5C18A 1S4QA 2I3BA 2PCJA 5G40A 4K81B 5DGXA 1XB2A 1SXJE 3FMIA 3QIAA 4JBYA 2J7PD 3IGFA 5KTYA 4RD4A 5KO2A 1E99A 3LBHA 3IBYA 4IDPA 3T12A 1KI6B 3ZIAD 4EKDA 5DSZA 2AN9A 5KDDA 2OCYC 2WKQA 4CVNA 3S1AA 5M04A 2BIFA 2QA5A 4GP6A 5CIWA 3K70B 2RHDA 1G3MA 4G5OA 3TSWA 3GLIE 4KYUA 5SZIA 3T1VA 4F7WA 1NLZA 4B2IA 1W2GA 2NQ2C 4RJLA 4WIAA 2NIPA 3GLGA 4TLEA 1G7RA 1CF4A 1SVIA 1CXZA 4F91B 4EAQA 3T61A 2XITA 1UDXA 3WRYC 3WXMA 4ZDWA 2Q6TA 4PHHA 1IN4A 2C95A 5FTNA 621PA 4Q1DA 3PUYA 4L16A 2L0XA 3B2EA 4HUQB 1FUUA 1TX4B 5FL7D 2JLVA 2GZDA 4D80A 3IEVA 3QKRA 3TW8B 1U98A 4DB4A 3ASZA 4LX0A 4ERNA 2J5XA 4MGKR 5LDDC 4B3BA 3FPAA 5F2EA 2BCJQ 1Z3IX 3BB1A 4BLTA 2YC4C 4LC0A 1J70A 2V8OA 5EZ6B 2V54A 3DM5A 4GZMA 3ADDA 3PEYA 4TLBA 2C03A 2WWFA 3C7KA 3MJHA 4MITA 5AK0A 4LJ4A 3GJ8A 2C98A 3IQWA 3U3OA 4RFSB 3UG7A 3ZJYA 3IDQA 1Z63A 4TYPA 1NN5A 2WJHA 3BS4A 2R9VA 2P6UA 1KGDA 3VR1A 1ELOA 5CITA 3BRWD 3OIUA 1X8KA 3CRMA 2EWWA 1O3YA 1GDDA 1QVAA 3F8TA 3I72A 1OLOA 3EASA 1ZVQA 2IYYA 4Q7KA 3LBNA 5TY0A 4A92A 2Q3FA 3OEED 5GJVC 2CDNA 1T5IA 3K1JA 2EFGA 1NVXQ 2OCBA 1E9EA 3GFPA 3GFOA 5L8VA 3SYNA 1UBGA 2AWOA 2QBYB 1TMKA 3GLFB 2BMJA 3TW4A 1T3HA 1KK1A 2OE2A 3T15A 3K8YA 1N5KA 421PA 5BYKA 4Q1FA 1G19A 1LVGA 2RMKA 2G6BA 1SXJA 2WMOB 1OXSC 4MRVA 3VR3A 3LVQE 3PUXA 3EPHA 2J41A 1LNZA 2CCGA 4F38A 2QE7D 4HDOB 1SVOA 1U9IA 1KI7A 3QI2A 4TMTA 1WQ1R 4C2UA 2XNDA 2QNRA 2ZE6A 3THWA 1N3BA 3D7MA 2FFQA 2V7QD 1D2EA 1KKMA 3W3AA 3AUXA 4F4IA 4BFZA 3WRXC 1RKBA 4DLVA 2F43A 3NH9A 4IDNA 4FCWA 1VMAA 4NYIQ 4MYTA 2ZAOA 2GBLA 1GKIA 5FOTA 1N5LA 2AK3A 2ODBA 2GILA 2XNSA 3VNUA 4BFYA 4WXPA 4DLUA 4TL9A 5EQTA 5IF9A 3K0FB 5LB2A 2XJ9A 3TKLA 1Z8FA 2GA8A 1AIPA 2W2TA 1TQ4A 2QQEA 1G8FA 4X8HA 2ATVA 4D4JA 1WE2A 2O8DB 4GSYA 1AN0A 2QG6A 2WJVA 1S1MA 5EE3A 2YC2C 3AF2A 2HXYA 5TXGA 3QXXA 5BW8A 3IUYA 1UKVY 2XSZA 4B47A 1R5BA 1IN8A 2VSXA 1E94E 2ZRCA 2WHXA 3K0EA 4Y0VA 3NBYC 5BYJA 5HPYB 1H8HD 4MKFA 1TUIA 4NKRA 1MRSA 1PLJA 1KI6A 2IHYA 3U60B 5BN3A 2ZYTX 2OFXA 4PO1A 3ADBA 3AV0B 3QNUA 1CU1A 4LHZA 2BJVA 1A2BA 3LRPA 4R9UC 3R9WA 4JLDA 1KTVA 4LI0A 3CIOA 3RS3A 4Z1MD 2IUSA 3MLEA 4DCVA 1S3GA 4I1UA 1L4UA 5DLQC 4TLAA 1TQ6A 1A7JA 1FQJA 4B3FX 2R44A 2W6JD 5IHPA 4MDEA 3CONA 3AF4A 4IXMA 5FOSA 3MSXA 3R9XA 4C9BA 3TQCA 3I8SA 4Q9LA 4A0FA 1JXOA 2ZR0A 4KI0A 2J0VA 3P26A 1DEKA 1GAJA 4QJ4A 2PZEA 1Q1EA 3KKPA 4W7SA 2XGJA 1RJ9B 4HUQA 3SQXA 4RZUA 4PZYA 1G7CA 2EYQA 1OFTA 4IVPA 4KAXA 4ASUA 3KQKA 4A9AA 4NYJR 5DHFA 4BE7B 1G5RA 2YOGA 3BB3A 2VHCA 4LJYA 2CNWD 2VSOA 2ZREA 4C0JA 4QJ3A 1NSTA 2VH5R 4X8OA 2GESA 1A4RA 1W0KA 1FP7A 4Q47A 1U9IC 4AK9A 4LGMA 2V1XA 2F1JA 4RFSA 4YONB 2CE2X 3W8RA 4XIGS 1T0HB 2IXEA 2QM8A 2YWFA 1ZNXA 3O8BA 4JLMA 5B2ZA 4ZV4A 1E2JA 3AUYA 1Z6XA 4JL6A 2O8FB 3VR6A 2ZRAA 4QL3A 1E0JA 2IYSA 4AWXA 3I8XA 4KJZA 2GBLC 2UVQA 2G0NA 2ZYVX 3A1UA 1B0UA 1IBRA 4HEJA 5G3YA 3RS0A 3PFIA 2EFDB 3E5HA 2HCBA 5FBRB 3A1VA 3WBKA 4ZDIA 4OQNA 3A4NA 2QBYA 4JSTA 4QGFA 4O2LA 3NBXX 3TBKA 2DFKB 1XMVA 1E96A 2GJKA 4UKDA 3SI7A 5H68A 2ERXA 3WNBA 4BASA 4YMTA 5B58C 2NG1A 1G20E 1P75A 3VHXA 2V55B 1XTRA 4XJXA 3EZFA 3SJAA 3ZVRA 1E2HA 2ZSFA 3P27A 4GPTA 4PHFA 4YC7A 1EX7A 1NBMD 4LHWA 3CRQA 5AJVB 4AYTA 2V1UA 5HCNA 1J99A 4B44A 1ZD9A 2FMXA 2XXAB 4WZAE 5KHOC 1N6KA 2QPOA 3B8HA 3W90A 1GZSA 1SHZA 2Z6VA 2ZI9A 4V02A 2HCJB 2MMGA 2YV5A 2GF0A 4D2IA 1XEFA 1ZIOA 1K6MA 5FTMA 4A82A 3WHLA 2WWWA 3K0CC 2YOHA 3DKVA 1T9HA 4JT2A 2Y8EA 3QF4B 4ILEA 3ADKA 3BC1A 1P61B 3EZ6A 4UNRA 3RC8A 4CIDA 4EPVA 2FDCA 2EFCB 2CXXA 3B6EA 3N70A 4R2IA 4Y0AA 4P33A 1KOFA 1T3SA 2QGZA 2BDTA 4O3MA 3K0FA 4C2TA 1ZINA 2HV8A 2REBA 2WIBA 3DO6A 3FYHA 3ICQB 2WPDA 3W5IA 3U7HB 2LKDA 4B71A 4PHGA 1FUKA 3T35A 4PANA 3X1YA 2O8DA 4DJTA 3AVXA 1CULC 2O8EB 1G7TA 2ZU0C 5AUPB 1JR6A 1QHSA 2J87A 2ZSEA 4S35A 5FOVA 1KAGA 3LD9A 1OJLA 3RC3A 2JCSA 3VX3A 4IEEA 1AS3A 1Q3HA 3M6AA 5EXPA 1AKYA 3GJ4A 2VBCA 5CLQA 1ZW6A 5AJXA 3P20A 2ANCA 5HTKA 3GJ7A 4V0OA 4B48A 4D4KA 4TYWA 1XD2B 4KU4A 1A5TA 3TR5A 2WOOA 2ZS7A 5JMTA 1NIJA 5FUVA 1S0UA 4LYJA 3U5ZB 2QI9C 3A4MA 5C46F 2FGKA 2QT1A 2DWOA 4HLDA 4KVGA 4DLXA 2O8BB 2C9CA 4BZQA 2FF7A 3B1XA 2WJJA 2IWRA 4E22A 2H18A 2A7QA 4FMDF 3U7EB 2BKEA 2V6JA 3MFYA 4Z54A 1JR3D 3EARA 2OO7A 2P3SA 4PC3A 1P2TA 2ERYA 2ORVA 3QPWA 4JYBA 2D06A 5K8UA 1RJ9A 4AY2A 2FG5A 1RZ3A 3QBTA 4IEIA 2GXQA 5AJYA 4BEBA 2F55A 5J47A 2WM9B 1E2NA 3IEUA 1U2RA 5GJWC 4C0QC 3RDPA 4NHOA 1XD9A 3ZS8A 4D4LA 2YKGA 4ZIRB 3AQ4A 5GJCA 1XMSA 2V3CC 4N0EA 4D25A 4IRUB 3KXKA 3RANA 3THOA 2QGNA 4HLQB 4UNNA 4NONA 4BRWA 4M1WA 2WOJA 1NI3A 2YHSA 2QRZA 1DG1G 1II9A 3A1WA 2NO9A 1LV7A 3M1IA 4JLNA 2IWHA 2O8FA 2JAQA 3KDSE 3OIVA 1DE0A 4NCIA 1XEWX 2W58A 1FTNA 3OE7D 4A4DA 2C5LA 3AVWA 3ETLA 1P5ZB 5F3WB 4M9QA 1OH8A 1JPNA 1E9SA 1Z0FA 3W6PA 1E2DA 4BFXA 4NMMA 1HEIA 821PA 5L3QB 2FNAA 4C0LA 5TB5A 3TMKA 2DB3A 2PL3A 3QENA 1OHHD 3NKVA 4BZXA 5JLJA 4UXHA 2R6CA 5E95A 2RH5A 3W5JA 1PUJA 3DEFA 4F92B 1IOZA 2CBZA 3OESA 4P4UA 5JI3E 2AD1A 2EVWX 2FPLA 1ZM7A 2IYRA 1RVDA 3MWKA 4DSUA 2G1JA 4KYIB 1X3SA 5J4YA 2A30A 4C3ZA 2XTMA 2XXAA 3FHOA 4OK3A 3ZDQA 1W36C 3OEHA 5EZ5A 3WYFA 4C0BA 3KXLA 4LCBA 2A5JA 1T8UA 1XZPA 2ZVPX 3BB4A 3DZDA 1NF3A 4HZUB 4JKYA 2NTYC 3MAAC 3QF4A 2G1KA 2OM2A 4Q7JB 3VR2A 1T0JB 3C16C 1SXJD 2LWIA 5AUQA 4P4SB 2AFHE 3OAAD 3UKDA 5CB8A 5B30A 1D6JA 4DSTA 1XP8A 2I1VB 2WKPA 2BEKA 3I62A 1DAMA 1DO2A 1Z08A 5FPYA 3DM9B 2ZE7A 2AFIE 4EPXA 2ECKA 2XNDD 2J0QA 2HXSA 1U8ZA 3RWOA 2EW1A 3T1QA 1XX6A 2A5YB 2P5TB 4D0GA 5HKKD 1QHHB 2NOAA 4XVRA 2XZPA 2AK2A 2XOKA 4TTPA 2QL6A 3PITA 1CKEA 2G0TA 4RCZA 4LYHA 1LW7A 2D74A 2PZGA 2XZLA 4TSFA 2OLJA 2XTZA 2FFAA 3NG1A 2X2EA 3OFNA 1YZTA 4C0AC 1VG0B 4TMKA 5GADl 4DCTA 3D3QA 3EIQA 1XD2A 3LO5A 1BS1A 1HT1E 4CEIB 2ASEA 1FTSA 3Q9LA 1Q12A 3GLHE 2JJ1A 3CH4B 4B43A 1ZC4A 2O8BA 1E2FA 3CF6R 1S96A 4FIDA 3C5CA 2NO7A 3CO5A 2WSMA 3NVAA 3CPJB 2OCAA 1KNXA 1LF0A 1EXMA 2PH1A 1M7BA 4A0GA 3K70D 3TR0A 4NYMQ 3HU3A 1M7HA 2ZPTX 1IONA 1KDOA 4A2WA 4D26A 1F60A 4NBSA 4ZIRA 4CEHB 1XCMA 4GT1A 3CZQA 2CCJA 3AKEA 3EC2A 3CM0A 2CLSA 3DOFA 1SVLA 4LUCA 1R2QA 2ZJAA 1UFQA 2RB4A 5IK2A 3QVUA 1KI9A 2DFLA 1QZXA 2DHRA 4FINA 4GFDA 2GVZC 3T5DA 1Z0KA 5KSYA 4YXWD 3QSYA 3DOEA 4AI6A 1LB1B 4KBFA 3ND9A 3NDPA 3L2OB 2R6FA 4DDVA 4LV8B 5HR5A 4RD1A 4I1VA 1W49A 2G88A 4W5JA 3QXHA 5EXSA 3P1JA 3IHLA 1EFHA 4OQFA 3AF1A 3ADCA 3U4QB 5EE9A 3CX7A 5AWFC 3U61B 2KJQA 3BFVA 2ZI6A 1NMXA 3C14C 2B7BA 5L3QA 1SZPA 2Z4RA 2EFHB 3DL0A 4CT5A 4DIEA 5JRZA 5ELXA 1F6BA 1M1YE 2ODNA 1NJFA 4HB4A 4UJ3A 5DIFA 4TTQA 2B92A 1Q1ZA 5DI9A 2QM7A 2YWGA 4BLSA 3DDCA 2GVDC 1Z47A 1DAFA 1COWA 3CNLA 3TIFA 4C0SA 2K5UA 4ZI2A 1OPXA 1W44A 3CPHA 3Q5EA 4CRWB 2QMEA 2RGNC 2HLDA 1KJYA 3REGA 3T5GA 2ZI7A 2X1VA 2G9NA 2WJYA 1T3LA 2P65A 3ZZUA 3CX6A 3SJBA 2KBFA 1GIAA 1QDEA 1OXXK 2ZJOA 1ANKA 1BMFD 1G9XA 5G3ZA 2QTVB 5EP4A 1HQYE 5JWOA 4HZUA 5KYKA
chains in the Genus database with same CATH superfamily
4GVPA 3SXUB 3O4VA 2DPGA 2A57A 1GAEO 1KVSA 3UT6A 3FZNA 4JZYA 4P4SA 5CU7A 1B0ZA 1YDWA 2Q9CA 1O6ZA 2QN7A 2ZR9A 1I3MA 4EHIA 2Y4NA 1XNHA 1SU4A 1JJAA 2WTXA 1UFVA 5I8WA 4Q9AA 2QTWB 4FHCA 3WGKA 2VPYA 3COPA 3EBLA 3DWGA 3B6IA 3TFQA 4IKEA 1TD9A 4WZBE 2ZRJA 1QHYA 5AUNB 2XR1A 1UMBA 1W75A 2C2BA 1JLMA 1B76A 4RVCA 1ESNA 3A37A 4YJFB 3FFAA 1ZUHA 3OLWA 2Z8XA 3M3DA 1A9OA 1SVWA 1ZM2A 5K0NA 2XB2A 1MAAA 2JGAA 1MRZA 3ZVMA 5DHSA 3E03A 3PEEA 2B7CA 3I9V1 2R1TB 4LV6A 4MQFB 4YHHB 3PHLA 2O2DA 4O1HA 3OQJA 5DK6A 1X9GA 1SKQA 3MGCA 2C82A 1G3RA 1J6UA 2IY8A 1XQVA 2LDBA 3R2JA 1MW8X 2A4MA 5FDFA 5KU7A 5JG7A 2IZZA 1E1QA 3T1OA 3S99A 2HGZA 3NHRA 2UUPA 4TKVB 4US1R 1Z6PA 3NC1C 4UUBA 3MD0A 1I7DA 2GZ2A 2VLIA 4NPAA 3EXFB 1VL1A 2V6GA 3MJFA 2P2LA 2PPVA 3KRTA 3X1ZA 2PU5A 1Z0SA 1KBOA 3W2IA 4LJ8A 1Z6ZA 3DR5A 4RVSA 3WHIA 4BQRA 5JH7A 3KQNA 4ZCIA 1FFAA 1X1CA 3EXEB 5KBYA 1QHXA 2J32A 2XYGA 5L7TA 2C4KA 2R5WA 4UNSA 4A8JC 5DM1A 1D9XA 3KZXA 1YCDA 1SUSA 3GL9A 4ZI5A 1NOIA 3WIEA 3PQ5A 2CKMA 4KBYA 4F3NA 2D7DA 1R4AA 1A04A 2BR5A 1BQ3A 1L8QA 2FOXA 2JA1A 4OM7A 1UXHA 9ABPA 4MO2A 1PCXA 1J06A 1OYOA 1VDZA 2AFVA 1JG6A 3E3MA 4WV3A 4Y6QA 5LMNB 1HL3A 1MU0A 3FGZA 2JJ8A 3IUQA 4A5OA 1YGPA 3L0BA 2Q1TA 2K87A 1R1DA 2V5UA 3K0KA 4DL9A 2ZIFA 4X6XA 4KZKA 1UPCA 5LSAA 1QHGA 3WYAA 1UKBA 2P3OA 5HIJA 2GZAA 2VRNA 1V71A 4O4JB 3TDNA 5K6TA 3M0EA 1I7NA 3KZVA 4TKVA 1KAEA 1N6LA 2E9SA 1A77A 1LUAA 3HU2A 3G9XA 2PLAA 3PJFA 4XWAA 1TC1A 3GVXA 1B23P 1FY2A 5FX2A 2LP4Y 1X1EA 3K15A 1CX9B 1FDSA 1LBQA 3LUGA 4LJAA 5FP0A 5BQPA 3I2FA 2AUNA 4WZBA 1RAIA 3G2HA 5HBGA 4YAGA 3TH5A 1D2RA 4UASA 3ZW7A 3IPYA 2PSJA 2VYND 4PLZA 1JBEA 1VIAA 2XOXA 1YZUA 1NKTA 3EQ6A 1FUEA 1VYTA 4Y2TA 2XV1A 2YWJA 1KORA 3H87A 4OL0A 2PMKA 4EW2A 3K9GA 4UARA 3KWMA 3RLIA 1QFJA 3O8QA 4X1YB 5IDXA 2O0JA 2O3QA 5D85A 2XKBA 3NGLA 4TL8A 4R7TA 3RIMA 4OI0A 1O7JA 2O2HA 3PNBA 1M67A 2IGTA 3GMIA 2B69A 5LLTA 3Q7IA 3G02A 3D43A 2VYFA 1J97A 5BSRA 3DHWC 2GNPA 1H9BA 1MO3A 1TO6A 2R4TA 3QUAA 2F9LA 2O2IA 4Q15A 3X1JA 4DJAA 5C1OA 3AUTA 2IP4A 4N5HX 4L8LA 1DX4A 4WFJA 5LWHA 3A2KA 1UWCA 3X1KA 5BVGB 2C2HA 3I6BA 2W2VA 4AP6A 1HTWA 2JIQA 2XEDA 2ZJFA 3OLVA 1IN5A 3ESQA 4MA0A 4WCDA 1WBDA 3NYIA 1WZ2A 1TF5A 3EMVA 2XTNA 3DP9A 2RKOA 2A67A 2CXNA 4HAWA 3RSOA 4FGSA 3OX2A 4WUTA 3OECA 3RR2A 2H2WA 3HU5A 3NH6A 5JADA 3I92A 3PIDA 4FN5A 2JBAB 1Q5PA 3LY9A 2NTVA 3IAXA 3EPLA 1Z0JA 1KPGA 1FF9A 2NQ8A 2C94A 4MR7A 1U6KA 1RAFA 2I1QA 4FT2A 3PR3A 5JNLA 2F6RA 2D62A 3HB9A 4M76B 4BO9A 3R7SA 2Z1NA 3OQPA 3BL8A 4EPYA 2H3EA 2QAGA 3X2SA 4MUAA 2EHJA 5B1DA 1ZWLA 2E1RA 1PFVA 1K8XB 1QH8A 1E0DA 2GZHA 1OTHA 4ER5A 2A2ZA 1I9GA 1QIIA 3PLRA 4AF6A 3CVWA 4JLKA 3CE6A 4ZVOA 3D3WB 1QP4A 3IQGX 1JKXA 1RW4A 4MRRA 2WT8A 1PL6A 3QLJA 5IFLA 5KSWB 3U1BA 4DB2A 4F4JA 2NUBA 4FFRA 3A4VA 1PWYE 2PGAA 3KUXA 3L40A 2B34A 4Y9DA 3BF7A 4LF4B 4C4TA 3HB1A 3GGGA 4B34A 4EZEA 2V6FA 1GSIA 3OPYI 4NJMA 3RYTC 1WZIA 1P81A 1OYVA 1WW8A 1DAOA 1TQ8A 2YTZA 1X80A 2Z58A 4TVOA 4DCJA 1POXA 4EB6B 3VKUA 3EY9A 5T64A 3D1VA 1MA0A 3Q15C 4G0MA 4B32A 4IAOA 5FWAA 1E2MA 2W48A 5HZMA 1YACA 4GGOA 3BH0A 1KETA 2D2EA 3D31A 3FBTA 3OZAA 3FBWA 5A5GA 4QT4A 4UHJA 5IF3A 2XYHA 4YFYA 1PWXA 4JCCA 5AK4A 3DONA 3IOCA 3AGQA 3IULA 4P2GA 2OP1A 2HM7A 4C7XA 5G1NA 5HQTA 4E30A 1O6GA 2CUZA 2RGBA 3TN7A 2CDBA 1L5NA 5JJLA 1AJEA 3B1ZA 1E5TA 1JLHA 1I3OA 3ILVA 2CXRA 4KUHA 2PVSA 4W8GA 2R8EA 1KJZA 1C0EA 2IYFA 4GOMD 4ZCPA 3FW1A 4N18A 5BSGA 4M1SA 4R0MA 3HFGA 4HNQA 3KKMA 2IITA 3DVQX 4TYQA 3WIUA 2OGTA 1KYXA 3HBLA 1R12A 1W9HA 3MLAA 4IHAA 3FMOB 1BYIA 4M2LA 1OI7A 4C30A 2ECFA 1OGJA 2ZG6A 3KJXA 4JLJA 3AEXA 4LWQA 3OPNA 3ZE2B 4A16A 4B5KA 1PEDA 2OHFA 4KRXA 1V43A 2PWPA 2JFOA 5A4DA 2Q3CA 3E8SA 3EVTA 4ITRC 4O2AB 4Q3OA 3CZPA 4JUAA 3NP7A 1RJEA 2XVMA 5AKXA 1H2XA 3TK1A 2LNDA 3O7WA 5KTTA 2IK8A 1PLLA 2JGKA 1H2RS 2AZDA 1T35A 4CW7A 3C7AA 2BEWA 2P9BA 2CHFA 3MTQA 4DV1B 1I5OA 4G0NA 3C39A 1E1CA 3DMTC 3GQVA 4H6PA 3G6KA 4JKIA 4K6CA 4KXQA 3GG9A 2CW5A 4J3NA 3K0CA 3GEIA 1QRUA 4B46A 1XFDA 2IRWA 4OOFA 5JWRA 3PXGA 1CIPA 4HP8A 2X1MA 4AYXA 3ZXYA 3ZHXA 4EO9A 1NLYA 3TIXB 3STHA 1U7DA 1GPUA 2BUBA 3DDHA 1TPZA 5FTLA 3BGWA 1BFDA 2PKCA 3H8WA 3RODA 5KMGA 4P0QB 3JASA 3JVUA 5AVOA 2NTEA 4JEMA 2PTGA 4OX9Y 2BGWA 1RCUA 4IDCA 2X5OA 1HDRA 1XTZA 1E7YA 2CVZA 3HDVA 4E1AA 2V6MA 1DAEA 3UK1A 2QD2A 1OIVA 4I4IA 3TXYA 6YASA 3GNQA 1M2JA 1USKA 6PFKA 4HDMB 1AE1A 3FNGA 1Y7HA 2QTBA 3FCAA 2HHCA 1ADJA 4IO1A 3RU7A 3VGJA 5F7JA 2JI7A 4MPJA 2CFIA 4C0KA 4FZJA 1HG0A 4CF5A 3ELWA 3GRKA 1TA4A 1COWD 1LTHR 1N5JA 1E61A 2JFGA 1G1MA 4P3YA 4DWWA 3OPYA 3BMOA 3LF1A 1T9KA 3H1PA 3VYSB 3CLUD 5G0VA 1RBYA 4DBLE 1WCYA 1ADCA 1KAOA 1NVUQ 2ZJYA 4U9IS 4ZQGA 1RZRA 3LTNC 4EPTA 1N75A 1HSZA 2VHJA 2YFQA 4GBMA 5M34A 1GL6A 4N8DA 3ZZMA 3LQ4A 4JI0B 3GEEA 3RRMA 2PSFA 16PKA 3P2MA 1OE0A 1ZOSA 1QVVA 3LPNA 3OIFA 4MVJD 4EYQA 4L57A 1S1CA 5TR9A 4TRRA 3AUJB 4ENUA 3QITA 1A9XB 4G8DA 1XVIA 1YBFA 4BQEA 1E9VA 4Y9UA 1JHYA 4ER3A 3ZWCA 4DMCA 3WQQA 1RHJA 3AO0B 4KNVA 3WDLA 1FLVA 5C80A 2GN4A 1HMYA 4PXAA 4E51A 3G0HA 1SBZA 2CE7A 1JQ3A 3C45A 5DNWA 4BNUA 1EDEA 1CRQA 3D2CA 1H2WA 1ZGAA 3IDFA 4Q7LA 4IJUA 3GBVA 2FSIA 1IHYA 4N9QA 1JA0A 2R8RA 4LVOA 2VA9A 2VDWB 1N2SA 5DN6D 4IIXA 4QELA 4QGSA 4K9MA 2CZQA 2CHQA 4C4ZA 4OBXA 4UU0A 2G40A 1KR2A 1E69A 4JKOA 3WLTA 5BN1A 4PAWA 5JC1A 2ZXFA 3OFSA 3UAVA 2IFTA 1X1SA 4KO4S 3ZTTA 4BNKA 1ENZA 3IXLA 4JUDX 1XU4A 1M6VB 1Y6JA 2EX0A 2ODPA 4H77A 4M1TA 4X1IB 1RI5A 3K9BA 4B3GA 4ZJPA 1OAOA 4HSGA 3NNNA 2RHHA 3PA6A 1PS0A 4RK7A 5F9FA 1ECJA 2ZT5A 4BZWA 1E1QD 1W0JA 2VSQA 3L8FA 5DO9A 2Z95A 3H4VA 4TLCA 3HV0A 5HNKA 2OXEA 3D6VA 1N2CB 2CYAA 3L0SA 4X92A 3V7YA 1CUVA 1U2ZA 4M98A 3TNDA 1YB4A 4RD6A 1Z2CA 3OCYA 2ZRMA 3IUNA 1DU4A 2XZTA 5DDIP 2PRYA 3HMKA 2J46A 1NXSA 3UHOA 5IASA 3SEFA 4NULA 3DFZA 2FE4A 4RZXA 4U7FA 1FSSA 1U1CA 3TOSA 4BO1A 3OX1A 1E4YA 3HACA 1BTOA 1RKQA 4I9FA 4X6LA 1U3CA 5AM3A 1EVKA 1RVV1 3EA4A 1JAXA 1UBEA 2AXNA 1EDDA 4ZYLA 1TYAE 3EF1A 3OCWA 2IE8A 3ENWA 4MARA 4WK6A 5TC4A 3S8EA 5AK6A 1ZOOA 3GI1A 5A4KA 1U4SA 4DV5B 1KYQA 1RE1A 2WTUA 3H8SA 1LVUA 4JI6B 1FLNA 3AERA 3T5TA 3B2NA 4IIUA 3EYAA 1XHLA 1XZMA 3WLMA 5KPDA 2VP9A 4O63O 3U09A 1BA3A 2J0UB 1JHRA 2FTKE 2VWPA 1MO2A 3U7IA 3ND8A 1DKLA 3QOFA 1WXQA 4HN9A 1XDWA 3NIGB 3LP8A 2CK3A 4G2NA 1KS9A 1H3FA 2P91A 2VDKB 5EEHA 5IDVA 4KREA 2UKDA 1SJ9A 3K0AA 3KSDO 3I9OA 3MWFA 3U2QA 4B6SA 1GGMA 5IKPA 4QXOA 4ODIA 3RASA 4EB0A 4AZ3A 3QLVC 2EU8A 1SQFA 1GCUA 1FFWA 2I2FA 1R7RA 3NWEA 5CA1F 5CG1A 1U5AA 2ZJ6A 2Z0MA 3F90A 1HDIA 4QNNA 3TMAA 4ALIA 2XCTB 2Q4OA 4QU5A 4AKSA 4B2YA 1O94D 1LPNA 4FS8A 2I5PO 1BAPA 3F6PA 4FZRA 4RHYA 5SICE 4JT4A 3VNSA 2C7VA 2EL9A 3STWA 4YT8A 3N2ZB 3NHUA 4ZVSA 2FP4B 5CFRA 1HYQA 3PS9A 2H51A 3HBAA 3FUUA 2M1ZA 3PLNA 4ENWA 1FVXA 1I33A 2VDRB 3IOEA 4OXRA 1AU9A 5KYWB 1DX6A 1T29A 1C1HA 1MTZA 2WZCA 3CRNA 3O8RA 4JBHA 4EOGA 5HE8A 1V11B 2ZQZA 2ZSBA 2GDZA 2J3LA 3BOSA 3UV6A 4CLXA 3P2EA 5CNKA 5CB6A 3IPAA 2PM8A 2J7PA 1GRRA 1FTGA 1PJAA 1SXGA 4QICA 1BVYF 1O95D 2ZSIA 3B1WA 5JBQA 4XFKA 1JQAA 1RPJA 1UKZA 2PX8A 3FZQA 1YFJA 1ZX1A 2P69A 2YIMA 3C8MA 2R2AA 5J3JA 4OV6B 4TRNA 4X97A 3QWAA 2GEFA 2O3UA 3HCAA 1VKNA 4FX5A 2VAWA 3SR0A 2EX4A 1T1EA 1HGXA 2H4JA 1UKEA 4ACBA 2EEPA 1IQRA 3DKRA 1UT5A 3GQBA 4R1PA 3T3EA 4DLSA 5IBCA 4BPBA 1XXHB 1ZBDA 5KWEA 4R3UC 5DP2A 4WVLA 5JJCA 3E2IA 1QH0A 4FR0A 2PS3A 1ZM4A 1QDLB 3PC6A 3SOPA 4EEKA 5K8TA 2BSQA 5EP2A 5TS3A 4TTSA 2W2PA 1L5KA 3U3DA 4EX6A 1SCQA 3BGIA 3ZZ0A 2AW5A 1C41A 1VOTA 1YAHA 2NX2A 5SY9A 4YRTA 2QRJA 2XUAA 4RIIA 5IULC 3ZD7A 1NJGA 3K0HA 1LBEA 3W1EA 4Z6KA 5EQDA 1K5GA 4FYYA 1FP4A 5LPNA 4IJQA 1NHGA 2HZBA 4MLPA 2VOEA 1S02A 2YFYA 4BNFA 1A9PA 3SFZA 1W48A 5E6UB 3W3ZB 1ZHOA 3BDVA 1XA0A 3OKCA 4M1MA 5AKJA 5FKJA 1ESEA 1UDBA 1SK9A 1AY0A 1PQWA 1X1TA 2ORIA 1W4AA 4W5WA 4JJZA 2CHEA 3CVOA 3Q6NA 2IYXA 1GNVA 1T8YA 2XKJE 3L0PA 5DE3A 3GA0A 1SKMA 2V7EA 2C4MA 3VH3A 1T36B 3T9DA 3HVIA 1U7TA 3DV9A 1A4XA 3VR3D 1Q77A 1JZTA 1UBLS 3PDUA 4C4AA 5IAAA 3UOGA 3ZZNA 1FS6A 2C1ZA 4L9WA 4NU5A 3ECCA 5ICEA 4OL9A 2EGUA 1L8XA 4HHEA 4HSEA 4ZFNA 3V3TA 3P8ZA 3VBEA 4MGZR 2IF0A 2R00C 2R4QA 4BV2A 5ILQA 3JATB 2VBIA 5TMDA 4ZO7A 3C3AA 4MVXA 5FO0A 3ZV3A 3B6KA 2I1WA 2OCDA 1TEZA 2ZRDA 4LHVA 3OEEA 5AYVA 4GLLA 1M1NB 3B6ZA 3HY6A 5TMEA 4K5QA 1EVLA 1LLQA 1RS0A 2Z8YA 2B5OA 2BBSA 1JDZA 3LQFA 5ED0A 4C4RA 5AD1A 2ZCJA 5J2UA 4NMLA 3PPXA 3KVOA 4FXPA 1YRBA 4AQYB 1PNTA 3L49A 4PVCA 1RMTA 1UBOS 3AW9A 2PKQO 2J48A 3OEWA 4MIYA 4BPRA 3IR7A 3K0SA 1RC8A 3ZGZA 4Y6RA 5EIOA 2C31A 2WW8A 4NR0A 4PSAA 1W0CA 4KRGA 2OYSA 4MP6A 3OZBA 3RIEA 3F5DA 1NC3A 2XT0A 4TZKA 1V1JA 4POAA 2D7CA 1CQJA 3ZQ6A 3JXEA 1Z22A 4EUEA 3V2IA 3T6KA 1B1AA 2IKQA 3JQRA 3TTXA 4A10A 1O0CA 3U3JA 2DETA 1TT7A 1Y5RA 1RIFA 1D6MA 5F4BA 3ZK8A 1FYEA 3QBEA 4OO3A 4R1UA 3K92A 3IAFA 5AOAA 1DZ3A 4L78A 1J22A 1VKJA 2WP0A 3RJTA 2FZVA 1KI3A 1NKSA 3S27A 1B7GO 3E5MA 3SCZA 4QKQA 1YJXA 2GTPA 1CBUA 3R6TA 1QYIA 5EUMA 4PNHA 1Q7RA 3USCS 3FTQA 4DEXA 3LDUA 3SBXA 4DXDA 5LYJB 4UBKA 5TMBA 1N77A 2BWJA 2PX0A 4KO3S 5CP8A 5EHQA 5TVKA 2FN9A 2FN7A 4RUKA 1KIAA 2HRQA 3O0TA 4P3KA 1CY7A 1RP7A 2VFAA 3FWYA 2ZB3A 3EPRA 5KEIA 4NXNB 1ZKMA 1X6VA 1M8PA 1Y3HA 2H2AA 3RCBA 1XRJA 3A6EA 4UTZA 2PUDA 4OBEA 3MRXA 4W6QA 2UZAA 3ITKA 1N1MA 2AZ4A 3L0OA 3HGMA 3QV2A 4KMSA 4H0CA 4KZPA 4P92A 1EM6A 5C3MA 2ZE5A 4P5EA 4KVAA 1F8XA 4OHWA 5DXJA 4HDNB 5T4FA 3S40A 3FTPA 3V9AA 5K3FB 4Z1OA 1FNNA 1XEAA 2VF5X 1G8HA 3GNSA 3O4IA 4AG6A 2PGNA 4HGRA 3WNCA 2HDWA 3CLTD 1CQXA 2C5HA 5ALWA 1UPUA 1XU7A 5EERA 3ZEAA 1C7ZA 5DK4A 4ASUD 1VKHA 4B76A 1VI2A 3WYEA 4M9CA 3V32A 3L9XA 2CFTA 4NV1A 4WBNB 4M89A 1E8MA 1ULUA 2QSZA 1VCOA 2G63A 3E05A 2GH1A 1CHDA 3KC2A 3VBCA 1YOBA 4ZHQB 1BA2A 2IS2A 4HD8A 2W9XA 2C3PA 1STOA 2P9EA 2HPZA 3TZKA 1HNZB 1P7PA 1WB4A 3JRWA 2XVYA 5JVDF 4ZVUA 3NHJA 1QHFA 3WE7A 4FGUA 1E79A 3BK7A 3R3UA 2CF5A 3GNLA 2OORA 2COEA 3A1SA 3E6AA 3IC5A 2C04A 3KWFA 5TT0A 1QP8A 1NVTA 1H5QA 1RZRD 1G6OA 2QRPA 2YH2A 5KDLA 2C78A 2KQUA 1ODFA 1TLTA 4LRSB 4MB2A 3PUKA 3GJ5A 5JNVA 3A7EA 2N42A 4ROTA 1H23A 3FOEC 1HFEL 1GP2A 2ZIEA 2RCNA 4IOKA 1YJ8A 4N9WA 3RYIB 1UQTA 4CLDA 1B3BA 2HT6A 3JWHA 4GWKA 2H31A 1U4NA 4WOBA 4YP1A 5TV2A 4GDFA 5JJIA 3KSBC 1W1IA 1QRAA 1DBRA 1WVGA 4UTOA 2RHWA 3KZNA 3G2JA 2VJCA 1G3UA 2X8BA 2X8JB 3W6OA 3MTBA 5CFOA 2JLXA 2EW8A 1Y4DE 1G17A 3JRNA 3GEBA 1ZD2P 3H3FA 3LRXA 3OLCX 3CH7A 3AUKA 3QXCA 4LJ7A 4P31A 4S05A 3O95A 3LKZA 4FCCA 5HOEA 4N7JA 2ZR7A 1PJ8A 3MBKA 1D6NA 1O5OA 4RVDA 4W6ZA 4BNIA 5A4AA 1WVIA 2B9EA 5DYYA 2CGEA 4HMOA 2A0YA 4NG4A 5K3SA 3GFSA 4YA6A 5DOVA 4RKWA 5DWQA 1JAHA 4G07A 2BTEA 1W2HA 4ITUA 5E4FA 3FHLA 3RRFA 4WOCA 4B7XA 5KUTA 3LDFA 3UH0A 3OC0A 5AVZA 4TSRA 4S04A 4BLPA 5I47A 1GPDG 1V26A 4U6SA 5JYEA 4B6QA 4EHKA 4IH9A 5H16A 3W8DA 3VU9A 1FMTA 1QKIA 3WY9A 2ODWA 4F96A 2ZYGA 4U0KA 4OXYA 2IDMA 2YICA 4QQFA 1L5GB 5JISA 4Z3OA 1T0UA 1DINA 2VF2A 3IOYA 3OWOA 2ONKA 3OJFA 3F74A 2LBPA 1SIWA 2CHVA 4W5HA 1ZH6A 3A9CA 5B3JC 1W0JD 2VXOA 1OI3A 2PANA 4GX2A 5REQB 3FROA 4ZAZA 3OD5A 3W7VA 3GMDA 2NO6A 1BEUB 4LGVA 3LH5A 4CM7A 2R1ZA 5EMMA 3P5BA 5JEDA 1YZYA 3BMCA 3DT8A 2VP6A 4HWRA 2AJ8A 4MSUA 4ARZA 4IDDA 2DFPA 2I4NA 2R7NA 4KHZA 4PS0A 3WNVA 2QTRA 2Q2WA 2Q5IA 2QORA 5IFKA 4C78A 3CUSA 1VG8A 1R9GA 2QNIA 4GDMA 4ID9A 4RD3A 2C4HA 3HLYA 3PRKE 5HUQA 1F48A 1LY1A 2GK3A 2AC2A 2GO1A 3I9KA 4JVOA 5CNIA 1KHTA 1E6CA 3NM6B 5HFNA 3VU0A 5DEOA 3Q2KA 2BFWA 4NU0A 3OT1B 4WRRA 3ABZA 2CNKA 2HLHA 4P86A 3FM9A 4D8UA 1L7XA 1J1UA 2NUAA 2FEMA 3ET4A 2W2QA 3Q1LA 1FFXA 1W36D 3KR9A 1ZJ5A 2RGUA 1MG5A 3HEAA 1WSBA 2FKAA 5DNYB 3I4CA 2NYRA 4PCLA 3HPRA 1JW9B 1M2VB 2YJGA 4OBWA 4WH0A 3TRHA 4U6NA 4WE3A 2A5DA 4GZLA 4N3NA 4NEQA 2P68A 2CK3D 3FNRA 1EFLA 2IEYA 3IBCA 2D3WA 3PF8A 4LF9B 1I4WA 2BOVA 1NHWA 2DJIA 1OYWA 2CJFA 1Z9BA 3GLSA 3EA0A 1V5IA 1OH6A 5D5PA 3IVGA 2PYZA 4C4XA 1U7UA 4BLQA 1KVRA 4IRXA 3N75A 3SHQA 3ILXA 5HM8A 1G21B 4O4HA 3V8QA 3L43A 3HQ4O 3I1FA 1QJCA 3LLCA 4BGDA 1HNXB 2QI9F 3FXAA 2VTKA 3H9UA 4DQKA 2UVPA 3LUPA 2CLEB 5ES3A 4X7PA 3VYUB 4ENRA 1J24A 1CJKC 1LXCA 1HZZC 5TQVA 2GJ4A 2JFQA 4TXHA 3T5MA 4XGIA 5IXJA 3O9ZA 2ZTMA 4TTTS 5ABPA 2BBWA 1ZCZA 2I1LA 4G0XA 1JJIA 5EJ6A 10MHA 1RJGA 3AHEA 3EPPA 4PPFA 4UVDA 1KZ9A 2C88A 2REOA 4YMUA 2OILA 1DEAA 1JEAA 2J0EA 4WLOA 1W4ZA 1TA0A 1DIRA 2FA9A 4YP6A 4TTIA 3V9PA 1OX4A 1UKYA 3FFBA 3IHTA 4CMCA 5ES4B 5KX5B 3W1VA 4E46A 2UZ4A 3B7GA 2WU8A 1IQPA 4BP8A 2BI8A 1CUZA 5FPTA 1Y9EA 1YWGO 2ZPUA 1JR3A 2E4VA 2H17A 3WYDA 1BOFA 1Z38A 2GK7A 3KEFA 3NPAA 4MUGA 3UG6A 2QN3A 1Y1RA 3UXEA 3L6BA 4B3RB 1YDEA 1KY2A 1VLLA 4DCSA 1JVBA 2IW1A 2VCYA 4AJ4A 3C6YA 1X8JA 2NSHA 2IEZA 3HYRA 1JEJA 4REMA 1KK3A 2IYPA 3KEOA 3L84A 3TQQA 3F96A 1PSZA 1A7UA 1O4VA 4B3HA 1DP4A 1HETA 2BGTA 4RMHA 1Y1KE 1I3LA 4FD2A 3GUYA 2R96A 4E32A 1W34A 1VP9A 3AFOA 5FA5A 2G5PA 1KEEB 4ZEWA 1KZ1A 3I73A 3DLAA 3NCTA 1FLAA 2ZJBA 4OH7A 1EWKA 1Y8ZA 1R4NB 2HSDA 3GUHA 2H00A 3FPGA 5A0FA 3BPSA 4QGGA 3OIDA 1GGEA 1SBTA 1XZHA 2X1HA 4EI7A 4HNGA 2BE9A 5FOUA 2AI3A 3DDOA 3DFMA 2P4SA 3D7RA 2WJPA 2J3DA 1CY8A 1ZZGA 2C5GA 2WEKA 3FRJA 2IZ1A 4HYYA 1P7WA 4XDGA 1T9BA 2QVCA 2UZ3A 2VUSA 1FYXA 1K6JA 1SIUA 3EWSA 4M9ZA 3DPSA 5LP6A 1RSZA 5EYPA 3C43A 2A1UB 2I6UA 1H2AS 2ISCA 4GMHA 3VI4B 1DTSA 5IJ0B 4K86A 3UBMA 2V7PA 4CU2A 1UQUA 2F2TA 1NLUA 2O6LA 4LY6A 1CR0A 1OBHA 4DA7A 3KQYA 3RHTA 4BTLA 1HLDA 1D2MA 3HXMA 1WNTA 4G1EB 1H4VB 4LFBB 4ZRNA 2HA0A 1TZJA 3KQMA 1T2EA 3R3YA 3T7JA 2VT3A 2XOKD 3RBXA 4NBKA 4B9EA 5JSZA 1MENA 4NEGA 2ZT7A 4GIBA 1PJRA 4OFBA 3WLSA 4C6SA 2DM6A 1HQKA 3KB6A 4Q6BA 3C48A 1B41A 1Y6ZA 1UMDB 3PDIA 3KS9A 4WN9B 3IODA 1MRNA 1E9AA 3E4DA 4KWCA 5IP5A 5KNCH 2Z4SA 1VMKA 4NF2A 4FUTA 1AKRA 4J0HA 2DEUA 1ABFA 4BBZA 5FI5A 4WDQA 1Z35A 5KNBA 3DXZA 3IUPA 4ZO8A 2VZEA 2WJGA 3SN6A 1GRQA 1CEQA 2O05A 3BRSA 6NULA 2SECE 4M1ZA 3JWIA 2F64A 3SDBA 2JJ1D 2W8BA 5GTDA 1IIBA 1M6EX 5ELMA 1JFLA 3OF2A 3WGNA 4F2WA 1QQ6A 1UDWA 3D59A 1XZGA 4RJ2A 5TS2A 2AKEA 4UM9D 2Q4DA 1FFBA 3GT3A 2P4EA 3JQ7A 1V6CA 3QUSA 3SKVA 1PGQA 4IJ6A 1YVRA 4KQFA 4ZGGA 1JLRA 1T2FA 2PZBA 4Z0HO 2JGDA 5C4IA 4AJNA 4R3WA 5JPCA 2XQVA 4I50B 1QTNA 3SXJA 1TO2E 4GVLA 5J1SB 2GCPA 4RF5A 2D7JA 1OFGA 5DNDA 4ZU3A 3BFKA 2GCNA 3CSUA 3N39C 4PPYA 1HMPA 3JAKA 1L4HA 3RVBA 1US8B 1PR3A 1HE5A 2X13A 2NACA 3ZZTA 4IJWA 3BCHA 1MOPA 1P1IA 1OB2A 1WD7A 1XCPA 2ODQA 3N2IA 3NANA 3P94A 3QU4A 3PUWA 4KX3A 4S1NA 4C5BA 1FJGB 5FNVA 1WULS 1IZYA 4FFDA 4EFNA 3T7SA 2YBEA 5FT9A 1ZO8A 3ES9A 1BFKA 2ZWMA 4FGLA 2PCLA 4IIFA 5SV2A 3F0TA 3MJEA 4BO5A 5TARA 3U4QA 1DJMA 1K8YB 3T95A 3L1JA 3S7ZA 3B9QA 2PTHA 3TVDA 4BKQA 4CTKA 5EHXA 3ZLUA 5IJZA 2XCOA 3WGZA 4IGEA 3BEOA 3O4GA 4P98A 1E98A 4ZAFA 4ANFA 3KKKA 4FYXA 2WFLA 2B4KA 2DBYA 2G1UA 2XWQA 3R5SA 5BWNA 3OQIA 3N05A 4JJEA 3P9XA 1JG3A 1ZCAA 2FMFA 3QSGA 4UPEA 2GCEA 2VHUA 3R6LA 1SB9A 4PGFA 2RCYA 5AXAA 4M9UA 2FR1A 5BOVA 3D1JA 3QE3A 2AOTB 1ABEA 1H1LA 4MR8B 3VR5A 1YQXA 3UJCA 3L4BC 4C1NA 1E79D 3L5OA 1WCV1 1CQIA 2OHHA 3WLLA 1BYUA 3CMCO 4BVFA 3O1LA 2BGUA 2HQBA 3PEFA 1AZTA 1UANA 4L4XA 1U5CA 1JBQA 2BN4A 4HS9A 4IXNA 4F9TA 1A9RA 3OHPA 2LRHA 3F4LA 3EISA 3HR8A 1G20B 2B2CA 1ISFA 2C96A 2HLDD 1VE1A 2FX5A 3BMNA 4PC1A 3THYA 1Y8QB 2KPOA 1L0BA 3HY3A 4IZIA 4KXVA 3SE0A 3I04A 2IZ5A 5CVVA 4DEYA 2AJCA 1NVWQ 2IZOA 3BTUA 3I64A 3OU7A 3WL7A 4DG5A 4UFPA 3K71B 4BUZA 1OUMA 2IHBA 2C2ZA 4CIWA 4CQLB 2AN1A 3DDZX 3H3JA 4R84A 4YI5A 3N7AA 3OY7A 5BNTA 3ICCA 3VJRA 4N40A 4DLPA 2HFJA 3KLOA 2P27A 1NLMA 1QG0A 2FK8A 2RGDA 5IANA 4OLFA 2OCIA 1SQ5A 5JQGA 2WICA 1QLWA 5TDHA 1AXGA 1NX6A 4H0NA 3NDBB 3DZBA 2PPLA 3NYWA 2C8LA 3K1AB 2AOUA 5GIPE 2HX1A 4TWZA 1LQTA 5D3KA 4L5YA 5JD5A 3C1TA 3OMXA 5T41A 4DSNA 3G2MA 3SHOA 1WCXA 3HXKA 4DT1B 3FNBA 3KVRA 4QREA 2DLCX 4DIOA 1AV6A 1L8AA 1MC1A 1RQLA 1YE5A 2PQ0A 1UFRA 3HWRA 4OHKA 4YJ2B 3ISVA 3RUPA 3SD7A 5CM9C 3MMXA 1S3FA 2DWQA 4JSYA 1X38A 4JB3A 3Q8XB 2EFEB 2OEPA 2UDPA 2ZRLA 3OQBA 4QFDA 1FS5A 3T5BA 3ITNA 3WL5A 3IESA 4C7KA 3SZGA 3TZHA 4U5QA 3DD1A 3F49S 4B0PA 3I6YA 1SAYA 3V33A 1GCGA 5CFQA 1IM8A 4CR6A 3NIBA 1L5QA 1PQYA 2GAIA 2PS1A 3G9TA 4GSLA 1YBHA 2BZ0A 1HRKA 4QOEA 3RRBA 4JYAB 1DKNA 3QE4A 3O2QB 2GX6A 1SCKA 3DYVA 4ZVLA 4DVJA 3UQZA 5IBQA 2MDTA 4BJ6A 1M2WA 4E70A 4QASA 3R3HA 2BFMA 1QQBA 3IRVA 2YWEA 4G8JA 4M22A 1PJLA 3PSHA 2P30A 2WWHA 3VZPA 4CQJA 5K0FA 2WWYA 3VPCA 2HF8A 4UHKA 2EC5A 1TMOA 4DPLA 3F73A 2ECPA 1JV2B 2MWMA 3LY8A 5KKCA 4M0EA 5ADUS 4ISBA 1C3EA 1GPKA 3FPHA 1RXSA 1WF6A 1NR5A 1VLVA 1JHZA 1LS1A 2XAUA 3K0BA 2XMGA 2Z1DA 3HCCA 3X1XA 1MC4A 2I9KA 3FR7A 1Z29A 2G25A 1FU7A 4E4RA 4WT7A 3AL2A 4M87A 3TS1A 4M7WA 6ADHA 4TTAA 3LLMA 2FPRA 1OLSA 3LO8A 1XKLA 5AXCA 2IHTA 3CCCA 1KZ6A 3DO8A 4Z0PA 1YFKA 5IRCD 2JFXA 3E70C 3PKZA 1CE8B 4NZNA 4WEOA 5DEIA 3INNA 1Z4LA 1N2JA 1QJ4A 2B30A 1TM1E 2Y66A 4BNHA 3CZRA 3KKZA 5KQGA 5GONA 1FFGA 5ILOA 1YQQA 4ND2A 2NU9A 2VDPB 5EJGA 4B82A 2XDQA 3DFIA 1OIWA 4TTRA 3VZCA 5J43A 4PAOA 2J85A 3UMJA 4WXMA 5B6PA 2IYUA 1NA5A 1KWGA 1USVA 1ZOPA 3CSSA 2ZI3A 4RZSA 1YVUA 3ZBUA 2XMBA 1K7FB 4XUEA 5M7EA 3BA1A 4IJMA 5BQOA 1TEXA 3EFHA 4Q1BA 1N2CE 1KZYC 1QHIA 2C4UA 5L3ZA 2DHCA 5CB4A 4Z0NA 1CR2A 1EHYA 2WIDA 4NX2A 1AS0A 1U2QA 1OXVA 1U7XA 4C4OA 1J0CA 1DDIA 2IDZA 3DUWA 1YQ9A 3QYPA 3F5FA 1JHXA 4WDRA 3CH6A 4MMXB 1AGPA 4L4RA 4OSPA 1WCIA 4J0EA 4HBZA 1VIYA 1SD1A 3TBFA 3JQAD 3RS5A 1GZVA 3W5CA 1RHKA 3ROFA 4EMSA 4QD3A 3KP1A 4CI0B 3RROA 3F3MA 4UNQA 1JIVA 4PNZA 3IUMA 4OJMX 4XPIB 1V25A 4MS4B 1PFQA 3BDIA 4NARA 4U3JB 3SIXA 2IT1A 4G1MB 1NVMB 5EHGA 1GDTA 3GG2A 3T3IA 1GVHA 4EIWA 5JEEA 1TVMA 1BD3A 1U28A 1EA5A 1Z88A 2ZANA 3Q2OA 4K7JA 3SMQA 1YIOA 4GKKB 4F1KA 4GVXA 4NJOA 4A2PA 5BRJA 3QYAA 2DC1A 4G1BA 4ZC1A 4BAZA 1G38A 3D4LA 1X0XA 2FSVA 5K4HA 1YHYA 3S28A 1MKYA 2ZETA 4Q9DA 1H3EA 2B6HA 4E5NA 3IUEA 1ZXXA 3TKAA 4DVGA 5JCPA 3VR5H 1OU0A 3F1LA 3AVVA 1AG9A 1GGJA 3S2UA 3SYRA 2FZCA 6Q21A 2ZRFA 5BMVB 4R2KA 2OVBA 5CTAA 3QBDA 1C5KA 2JVJA 1WXDA 2DWPA 3KR2A 2GETA 5HILA 3JD0A 2ZJ1A 2W98A 3C15C 3A6JA 1QK3A 1X7WA 4QTTB 4YP7A 4J7XA 2VL7A 3MOSA 4IJ5A 1NMYA 3I3SR 4O2RA 4ZQIA 4IV5A 1O4WA 2APJA 5A7GA 4BRUA 1CPYA 5KSZA 3UUWA 3S7TA 5EKUA 3ZV4A 2OZPA 5JH7F 4W5TA 1RLTA 4RPCA 3SC2B 4TKLA 1YS4A 4PAMA 5J9FA 3U19A 1G8MA 4EX7A 4G09A 4KN9S 1ZH8A 1TM7E 3K05A 4LVUA 5EVJA 2YYAA 3S2ZA 1WSWA 3Q3GE 1T2DA 1Z5PA 3TOCA 4KNYA 1Z0DA 2WY2D