2LWIA

Solution structure of h-rast35s mutant protein in complex with kobe2601
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords GTPase HRas
publication title In silico discovery of small-molecule Ras inhibitors that display antitumor activity by blocking the Ras-effector interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2lwiA00
2QPOA 2HYIC 1T4GA 3H2YA 4LCBA 1E9RA 2VLIA 2D62A 1ZM2A 2VHJA 2WAXA 3ZJYA 2WM9B 3C7KA 3KUDA 1GG2A 5L8VA 2D2EA 4HB3A 3IO5A 2I4IA 2P6RA 2WZQA 2G83A 2BJVA 2HDNB 1UDWA 2Q9AA 1Z2CA 4E5UA 2FGKA 3WMEA 1CBUA 1J8YF 4EPVA 1G4AE 4YLGA 1X8JA 2WSSD 4OHXA 4C2UA 2WVJA 3JVUA 2V7QD 5EQTA 2O0JA 4HATA 1P60A 2FEMA 4BASA 3LAWA 4HUQA 3NHBA 1JALA 5AUNB 1VYTA 2ORIA 2QE7D 5CJPA 1XX6A 3ZS8A 4ACAA 2IXFA 1UDXA 4YDSA 4IXMA 2OCBA 2QMEA 3LA6A 2ANCA 1R4AA 2GBLC 1BMFD 3EIQA 1MKYA 3GMTA 4BLTA 4C0JA 5JSZA 3ASYA 4JT2A 1EFUA 2O8FA 3A58B 4ZPXA 1U0HC 2VQSA 2VSFA 1U8AA 4YONB 1XWIA 1KO1A 2KBEA 2B21A 4P4SA 1JR3D 3RS4A 3LY5A 3B1XA 1SKYE 4OI4A 2FGJA 2V4ZA 4Q1CA 4KBGA 1JQJC 3ICEA 3EZFA 3TE6A 4CT5A 1Z5ZA 4MKHA 4E22A 3V00A 2WTUA 4NH0A 1YU9A 3RS7A 2ZRCA 2W2TA 1XXHA 1P62B 1QVRA 2F7SA 3QPUA 2ERYA 4NCHA 2IYXA 4PFSA 3BFXA 5GJBA 2F3RA 2XJ9A 4M1TA 1QF9A 3B82A 4LY6A 4B44A 1NVXQ 1E2EA 2H1LA 4GFDA 2RAPA 2ZU6A 3S1AB 1W36D 3AVVA 4XVUA 1GL7A 4DHEA 2QA5A 5GJCA 2QAJA 3AP2A 4W5WA 3CF2A 2YVUA 1GKIA 4DB2A 2B92A 4B2IA 1J2JA 1G7RA 5HE8A 1TQDA 4NZYA 1Q1EA 3ECCA 3AM1A 4RD0A 2WWGA 3U4QB 1UKVY 4LBZA 1ZCAA 1XDBA 2IYLD 3PCRB 3KJEA 3CRRA 2WBLC 3R7WB 3RS5A 3RYTC 2B6HA 4UXIA 4B3BA 3SBEA 1HUQA 1KDPA 3C16C 1Z0JA 4URZR 5DH9A 1NN5A 4JLOA 1KIMA 2R6DA 4KODA 3ADDA 5JJKA 3SC3A 4KSBA 2KSQA 4PO1A 1XTIA 2H57A 5JJLA 3KXKA 4XVRA 1G16A 1G7TA 1WDTA 3BAFA 4IVPA 1UEJA 4C0QC 4BECA 2AWOA 2BV3A 5FUXA 2RGAA 2BJWA 2ZUBA 5FUYA 2AD1A 4PZLA 4B3FX 5KPDA 4DT1B 2OFOA 4DDWA 3BH0A 5G3YA 3QKSA 2ZAOA 3SBDA 4LBWA 4BFVA 3CPJB 3IIJA 3UPUA 5G53C 1E1QA 4FMDB 2V8OA 2GVDC 1VIYA 1KK0A 3TMKA 4M9ZA 1AN0A 2CEAA 1OB5A 2O52A 4MGIR 1HA3A 3I72A 2EWVA 1FW6A 1JEEA 2AHOA 4A0FA 4B6FA 1V43A 1ZBDA 1PLJA 4CEJB 3LXRA 2FMXA 2F55A 4HAYA 2OO7A 3AUXA 2C8VA 3C4JA 1NJGA 4D4KA 3VKWA 4QGFA 1Y3AA 1UADA 3RWOA 2IS6A 1G3RA 2EWWA 2FZLA 4M1KA 3TR0A 3IHLA 1SXJA 4I1UA 1F2TB 2PCLA 4OQMA 2ODNA 1TAGA 1A7JA 3GP8A 3W34A 3IUYA 1NG1A 4IOJA 3KKPA 4DBLC 3AVWA 2YWHA 3ZZ0A 4QRHA 1GZSA 2OV2A 2QP4A 4NTZA 1SHZA 3KJHA 1LF0A 3DKVA 3THWA 4BFZA 2JJ8A 5JCZA 1JR6A 2OAP1 4PC7A 2C2HA 4LHXA 4PC2A 3I5XA 1DG3A 4JMPA 3UG7A 3U7FB 5JRJA 3H1TA 4L5BA 2BM0A 3MCAA 4KVAA 2FE4A 3QG5A 2CHVA 1TUIA 2GNOA 1VHLA 2RKOA 4TQAA 4K8OA 1JR3E 3VHXA 2F43B 1PLLA 4TMZA 2ZJAA 2LCFA 3QBTA 3X1WA 3WYAA 1D5CA 4FCVA 2QI9C 3L0PA 2FDCA 1KJZA 4DLZA 3CKLA 5IK2D 2F1HA 1P9WA 3I8XA 4J0QA 4RSGA 4XD7D 2ZRNA 1DE0A 1GAJA 3A1UA 4HB4A 3SJBA 4B71A 4DDVA 3B60A 4OI1A 1FQJA 4YMTA 2FH5B 4R2IA 1AS2A 2A5DA 4IFBA 2H7VA 1CJUC 2DFTA 1Q1ZA 1NMXA 3DZDA 1GSIA 5FBLB 2NO9A 2F6RA 2REBA 3DVLA 1OT3A 5CIWA 1AQYA 2BWJA 4KAXA 3Q5EA 2CK3A 3Q3JB 4M9XA 4EFMA 2IYWA 3B6EA 1IJEA 4DVGA 2C78A 3AQ4A 1RIFA 2ZRLA 1G291 3GJ4A 1QHSA 1N3BA 3IILA 1QVAA 2NG1A 2IYZA 2Z6VA 5H1YA 4B76A 4DLYA 4DXAA 2J0QA 3QF7A 4D82A 4Q18A 4PR0A 5FOTA 2WIBA 3FYHA 2RGEA 2ONJA 4FCWA 3KFVA 1XB2A 1VECA 3AVQA 3GEIA 3X1XA 3TSOA 3LBHA 3V4FA 1XFAA 3K70C 2ZUDA 4ESHA 2AWNA 3PV0A 4CIDA 4UXHA 4DLTA 2RGCA 2LKDA 2GJSA 1YZQA 2JIZD 3QVVA 4C9BA 2Q3FA 2ZRBA 4KV9A 4XVQA 1G64A 3WY9A 4Q4JB 3ICQB 1KKLA 1DOAA 2JATA 3GLFE 1MR3F 1IN6A 1GDDA 1OIWA 1XD2B 2ZITA 2O5VA 1MABB 1N6NA 1NP6A 2QU8A 4OK5A 4US0R 1TU3A 3MAAC 2NMVA 2OESA 1MRSA 5J40A 1FP6A 3BERA 4D81A 3LLUA 1S9DA 3NHAA 2QBYB 4XOIA 4LYHA 1E9DA 5KNCA 1GL6A 1XU4A 4XSGA 1DAKA 2ZRMA 5IF9A 4H1VA 4Q03A 1H8ED 1OW3B 3SHWA 4WOPA 4B43A 1KSHA 5H70A 4MDEA 4AC9A 4B73A 2AXPA 2XNDD 2OBNA 2VHCA 1P9NA 3PITA 2GXSA 1QZXA 3GD7A 4HAUA 1M7HA 1E3MA 1T9HA 3FHCB 1TU4A 1P3JA 1FL9A 1PJRA 2XSZA 2QM8A 4PQRA 1AK2A 3W8NA 2R6GA 1ZNYA 3MRSA 3P32A 4G1UC 4KHZA 4AWXA 2Z4RA 1Z29A 2G0NA 2JEOA 2W83A 4LX0A 1HV8A 1WA5A 3W5IA 2BIFA 3ZZTA 3U61B 1ZD8A 4D4LA 1UAAA 4ZDIA 1IONA 3KL4A 2WJVA 3DM5A 4KLZA 2IWHA 1VDZA 2ZRAA 1G20E 3AGPA 4Z1MA 3MD0A 4G01B 4M4SA 1K8RA 2VF8A 2VIIA 3HP1A 4PSAA 1BOFA 5L3QB 5DYIA 1G8YA 1GOTA 1E1QD 1Q20A 2GZHA 1WMSA 3K0CC 4OI2A 5JECA 3U3KA 4MH0R 4WZ6A 3AF2A 4A0RA 1G5PA 2ZRJA 1G3UA 1G8GA 2OEPA 2QRZA 2C99A 1Z8FA 4MKGA 1E2DA 5JWOA 3T61A 1KY2A 2QNRA 3BC1A 3A1VA 1E2GA 1X86B 1ETUA 2X2EA 5UKDA 1W36C 1H8HA 1VHTA 4A92A 4AURA 4D80A 3GJXC 3FDIA 4JLPA 2RB4A 1X1SA 3FKSD 4PANA 4ZDWA 3BRWD 4A6XA 4GDFA 2EFDB 4IW3B 4ON9A 1KO5A 4YMVA 4MYTA 3T35A 5L3RA 3SOPA 4A8JA 4NPHA 4Q9JA 5FL7D 2QSZA 1E4VA 1YZUA 4URWR 3FHTA 3QXCA 1XEFA 3H84A 4XWAA 3SS8A 4MGYR 4PO8A 1J8MF 3L8ZA 1FPMA 3TGPA 3BFKA 4XSHA 4YXWA 2WPDA 4JLJA 2ZE7A 3U3OA 3R9XA 2X19A 4PHTA 1D6JA 1I4LD 2JAQA 2OLJA 4KVGA 3A4NA 4RKEA 1CR4A 1OYWA 1JXMA 2H18A 1U9IA 2UVQA 4FXPA 3L0IB 2ZREA 3CNNA 5F3WB 4QM6A 5E7IA 3GLHB 3KKQA 3SI7A 1J7KA 2R6CA 4LJ4A 2QUZA 4HLQB 4OQFA 4DLXA 4DUGD 1T8UA 5FFMA 4M8NE 1G7CA 2BVNA 1SGWA 3NIBA 2IBMA 3DEFA 5B2ZA 1J70A 2J59A 3ADKA 4B2PA 1QDEA 4PPGA 5FBRB 4QFMA 3VR2A 1AKEA 3RRZA 4G5RA 4Q9LA 1I2MA 4HB2A 4F4JA 1XXHE 3MWYW 1ZM7A 1OV4A 2CL0X 2LKCA 3C14C 3VR1A 4LZZA 4R9UC 2ZM5A 1ZW6A 4OYHA 3SFZA 2WWXA 3HDTA 1E1RA 521PA 1NIPA 3FHOA 4B34A 4IKEA 4CDGA 3BOSA 4UXJA 4EKDA 4X8HA 2AD5A 4D0LB 2YKGA 4RD3A 1KZGB 5JS7A 1RVDA 5KU1A 3QIAA 2GA8A 1KJYA 3QJYA 4M1SA 5HKKA 2ZSEA 1KSJA 5CIQA 1KDTA 3B1WA 5DLQC 3D3QA 1HT1E 1NKSA 1NL3A 1GILA 3JZMA 3JVVA 1EGAA 5FUWA 1XMSA 2X1VA 5AJVB 1Z07A 3O47A 3CR7A 3W6PA 4UQOA 2VP4A 1YZGA 2R44A 4EPWA 3B8HA 2VH5R 4PC3A 4X8OA 3C5CA 1S2MA 3RRMA 1G19A 1P4SA 5H8WA 2JJ1D 3KB2A 3UIEA 3S1AA 1UKYA 4FW9A 2GJAA 4KFRA 2VP5A 3TQFA 3DKPA 2REXB 1CJVC 1CR1A 2IT1A 4M1YA 1UKZA 1Q1BA 1R5OA 4JKYA 3B7GA 1TF7A 2ODBA 2JLZA 4D2IA 1QG4A 2J87A 3W8RA 3U4QA 5GJWC 1JJ7A 3FB4A 4JZKA 3R7WA 4OKSA 2IS4A 4B48A 1AJEA 1N6PA 5KDOA 2ZI6A 3PUXA 2CMKA 2DFLA 4PHGA 5FH9A 1G18A 3CWZA 3L8YA 5D3MB 4E03A 1KI7A 4O3MA 5LB2A 2GCOA 4B32A 1N5IA 2BBSA 4Q1FA 1EX7A 1RJ9B 4E07A 1E2FA 3ZD7A 2WSMA 1IOZA 4XH9B 1QRAA 2H5EA 2NGRA 3O8DA 4IDHA 4AYXA 3VFDA 2XSZD 5B58C 1OYYA 4IJMA 1YZKA 3AVYA 4TL6A 3ADBA 3GLIB 4TL9A 3MWJA 3OFNA 1U2RA 5AUPB 1TQ6A 1T3SA 4M1OA 5GVRA 3PIRA 4LJYA 4DT1A 3QXJA 3FPAA 1XZQA 2X8AA 4HDCA 3QI2A 4NKRA 1FUKA 4D4MA 5C46F 5EJEA 3Q7QA 4GP7A 4ZDJA 4Z1MD 3K0SA 4WA7A 2VHUA 4YDHB 3WMGA 3IQWA 3NC1C 4M1MA 3K9GA 2G77B 2ZRIA 4DLSA 4NCIA 5JEDA 2CJWB 2NTYC 3V9PA 2HCJB 5TXGA 1RW4A 3BIFA 1BYIA 1P75A 1VTKA 2F9LA 2J9RA 2QPTA 1YZTA 3BD9A 4FMCF 2DBYA 4ZKDA 4HSEA 2Q3MA 2QG6A 3KZ1E 5ANRB 4CGZA 3I1FA 4CEJA 3KQHA 1HYQA 1P73A 4NE2A 4GBMA 4WZAE 1BO6A 3NEJA 3U6BA 1KHTA 2XZPA 2Z0MA 2D7CA 4LV8B 4JL6A 5CB6A 1P2TA 1E9BA 5DYGA 3B78A 5C1BA 1F2TA 2P6UA 2D3WA 2H16A 3GCGA 1E99A 2CHGA 4M0LA 4RD2A 2C9OA 2IUUA 3GJ0A 1FNNA 3QF4B 1E0JA 4WAUA 3TW8B 2ZS9A 2B7CA 1NSTA 5JS8A 4IDPA 2JLXA 4L9WA 1YJ5A 4KLNA 1GM5A 2FFAA 2ZR9A 3LRPA 4C0HA 4AK9A 2IYVA 1VCIA 4B75A 2HJGA 4KO8A 3NBXX 3AVUA 2W6ID 1R2QA 3KTAB 3UKDA 4Q4AB 1GKUB 3LQRA 3CNLA 1OPXA 3THXA 3C5HA 4PZZA 4DJTA 2F43A 4DDUA 1H65A 1Z28A 1AZSC 1E32A 1A82A 2BBTA 1M1YE 3QEOA 1LVGA 4GT1A 4V0OA 4QHSA 2OCPA 1GRRA 1YE8A 2ANBA 3FKQA 2BHRA 1FMLA 3CBQA 2WIAA 3BORA 3KXIA 5JWHA 3O8RA 2N42A 1Z0DA 5IT5A 2VPPA 2E1RA 1GVNB 2Q21A 2WICA 1VCNA 2AK2A 1AZTA 1TQ4A 2JDIA 3U6KA 4HDQB 4HLUC 3RS3A 1ZIOA 3KXLA 1AGPA 3PEVA 3VX3A 3TVTA 1NF3A 5JHGB 2XB4A 2GILA 2Q6TA 5LB4A 3EIEA 4AYWA 3M0EA 2FU5C 2IS2A 1Y63A 2GKSA 4PPNA 3RC8A 1TTTA 3B2EA 3BB1A 2XXAB 4G5GA 4R7ZA 1JECA 1NLYA 1S1MA 3AV0B 3RC3A 1NLZA 2AX4A 2MSEB 2V9PA 1LW7A 2G6BA 4DEYA 2KJQA 4EJSC 1NMZA 4M22A 5JRZA 4LJ6A 2QORA 3U7EB 2FZ4A 4AIIA 5HPYB 1XRJA 2ZANA 2BKUA 5FOWA 1UJ2A 1GNPA 1KTVA 1UBGA 3BBPA 4LV6A 3TW4A 3ADCA 4PXAA 4M1WA 3K9LA 4G0NA 3VR6A 1DBSA 3X1ZA 3K9HA 1S1CA 2GCNA 1J90A 3ZDQA 5LPNA 4LHWA 1UPTA 2DCUA 3C15C 5FR1A 1VCMA 4KCGA 2V3CC 4GI7A 5C2JB 4Q4JA 2RCNA 4WW0A 1S8FA 1DAIA 4LJ5A 4BLPA 2WKRA 2FX3A 3CRVA 4TYQA 4XJXA 4CEHB 1TEVA 1XD2A 1Q44A 3OESA 1GNQA 1MABA 3CLVA 3SJAA 3DM9B 1TADA 4NMMA 3DMDA 4PPQA 4AI6A 3TQCA 1ESMA 1MO5A 3TUZC 1ESNA 1GIAA 5JFGA 2QBYA 4GL2A 2PJZA 2GRJA 2A5JA 4EDHA 2NO7A 2P5SA 2GETA 3FWYA 2JJ2A 1G1MA 4LYAA 3QQ5A 2QT1A 4TT3A 3ZQ6A 2VA8A 2IYYA 3CF6R 3I8SA 5SZHB 2E9SA 1IN5A 4O2LA 2R6FA 3I73A 4LJ9A 3OE7A 3WRYC 2FA9A 2Z4SA 2NO1A 3LX5A 2QT0A 1UBEA 1WB9A 1KNQA 1ZNXA 3LWNA 4DCVA 1Z0IA 5FL3A 3CH5A 5HZKA 1D9XA 4F93B 1TF2A 3TR5A 4BLRA 2ZJYA 3AP3A 2B7BA 1XMVA 2J0VA 4IRUB 4LHZA 5LDDC 4KBFA 2CCJA 2PCJA 4O25A 2N1BA 3P20A 1OLOA 3U2QA 3EA5A 4P32A 4NU0A 3WBJA 2QTVB 4CVNA 1Q21A 3K09A 2GAAA 4FWTA 1E9SA 1O3YA 5CK4A 2IK8A 4LI0A 3RSOA 5JCPA 1KAOA 1E2KA 3QENA 2XNSA 4D4JA 4KFSA 4F38A 3ZLJA 2QQEA 2ZS7A 4PPFA 3ZVLA 1W49A 3IIMA 4A0GA 4L4UA 5EXTA 1N6OA 3KJIA 2IYSA 3Q8XB 1SKYB 2Q9CA 1IAQA 1GFIA 1KDOA 2IC5A 2J7PD 2O8EB 2F9MA 1W4AA 3CPHA 3CRW1 4KI0A 2R8RA 1E2LA 3TSWA 4BFSA 3G5UA 4U5XA 1R0ZA 1W48A 4LC0A 1OXXK 1XEXB 2F1IA 2WWWA 3L43A 5IDVA 3TRFA 4TYYA 1Z08A 3LVQE 1GTVA 1C1YA 2W0SA 1OKKA 3I62A 2GXUA 3NDBB 3RAPR 2G1JA 4XTCS 4A0HA 5KO2A 3PUZA 4A2PA 2GK6A 1N0VC 1XEWY 3QKRB 1BYUA 4IOLA 3GLHA 3PQCA 5SZJA 4O2RA 1W0KD 4OQXA 3GEHA 5EE5B 5P21A 4QNRA 1E79A 3OZXA 1ZC3A 4D0NA 3RDPA 3W3ZB 4Q47A 2EU8A 3B5JA 2VP2A 1CJTC 2IYRA 4QHTA 1E6CA 2HXSA 5JLJA 1HE1C 2HLDA 2FN4A 2VHTA 4NBSA 2QN6A 4P4TA 4CYMA 2AXNA 3W90A 2PMDA 4M21A 3PEWA 3U60B 2QSYA 3LFUA 2IHYA 3EIHA 2ERXA 1E2MA 1T0HB 1OXUA 2FFBA 4C7OB 2DWPA 1WQ1R 2JDID 2V1XA 5K8LA 2ZRHA 1BKDR 3K0AA 1E96A 3THOA 4RY2A 1CS4C 2ZRPA 3EA0A 3LQQA 4FMCB 3ZGXA 4OHYA 5FPKA 1KYIA 1OFUX 5JJIA 4A8JB 5CYPA 2DB3A 4Z8YA 2P6NA 3FOZA 3X1DA 4YMWA 5FI0B 1W5TA 2ZUCA 4NL4H 3CZPA 4B33A 1IBRA 1HE8B 2RGNA 1KOFA 3GEEA 3IO3A 2YNMA 1OFIA 3GQBA 3K70B 1YVDA 4NYJQ 3CRMA 4OK3A 1ONBA 1W2HA 1FUUA 2EQBA 1T5IA 2O8DB 4JJZA 1NVVR 3THYB 2WWYA 2WKPA 4M2LA 4KFUA 1N5JA 1A4RA 3TK1A 5JI2E 1GWNA 4OHZA 3CH4B 4AG6A 1NKTA 5CM8B 4L9SA 4H9GA 3QSYA 1U9IC 3KDSE 3DO6A 2RGXA 3LLMA 1U98A 1E0AA 5IHPA 2QP9X 2R65A 1XD9A 2F3TA 4QBFA 4II7A 4RFSB 4F4CA 3C41J 3T15A 2GEVA 3LW7A 1II0A 5K8TA 4ARZB 1US8A 4LPKA 5KSPA 2HV8A 1I2DA 4V0MA 3U7HB 2OUKA 3AKEA 2OXCA 1OH8A 4TSFD 3B1ZA 4DC9A 4UNNA 4HAVA 1ZM4A 3REGA 5CLQA 1M7BA 2IYTA 1CR2A 5D3MA 4MA4A 4A82A 1XMIA 2YWGA 2IHBA 1RJ9A 5KOYA 2X77A 2A9KA 1E2HA 1F60A 2VBCA 2XOKA 4MITA 3T5GA 3EZ6A 2ZEJA 1R7RA 2VO1A 2QAGC 2YINC 2CE7A 3B1VA 5KSZA 4I1OA 2QZ4A 2ZIAA 1UFQA 4K81B 5FPSA 4DSOA 1P2UA 4QJ4A 2Q0HA 2BOVA 4QGHA 3JZAA 4DSTA 2EVWX 1MT0A 4KJZA 4Y0VA 1ZP6A 2J41A 1I4TD 1R0WA 4RD4A 4Q1DA 3O8BA 3E5HA 3SU8A 3T1QA 2IW3A 4YC7A 1Q3TA 3TNFA 4NYMQ 2D7DA 1QHHB 2WOOA 1Z6TA 1WXQA 2ZS8A 4UJ3A 4BFXA 2ZU0C 2D74A 2FEOA 2VTKA 5IRCD 4JIMA 3AP1A 3R9IA 1XF9A 3QE0A 1Z6XA 1PV4A 1EX6A 1G8FA 1W36B 3ND8A 4W7SA 1P9RA 3SJZA 3ZIAA 4TLBA 3EZ2A 1R0XA 2BEKA 4Z51A 4FI3C 2ECKA 2FV8A 1VG0B 3SJCA 3GLGE 2GEDA 2C04A 5BWMA 2Z5FA 1WE2A 1SULA 5DN6A 4YQFA 2C9YA 1KSGA 2HXYA 4QGAA 1LS1A 4Q01A 4EPTA 1KGDA 2ZTSA 3UXMA 1A5TA 1W0JA 3NH9A 4U02A 2UZ3A 4D0GA 1S4QA 3KKMA 1Z63A 2HYDA 3GPLA 3QF4A 2R2AA 4PO9A 4PSKA 1GL9B 1ZMXA 5GADl 2ZJ2A 1RYHA 3OIVA 2Z43A 5J5CA 3RLFA 3VU9A 1SVIA 1Q0UA 1L4YA 4Q9HA 3UG6A 4QJ3A 4US2R 5FOUA 2CVHA 2FPLA 3GLFB 1TPZA 4CEIB 1BIFA 3N5CA 3NTUA 1MV5A 2PT5A 3P4YA 4L15A 1W2GA 3KTAA 4RZ2A 1LTQA 5DHAA 1E79D 4Q48A 1G41A 3F8TA 2QMOA 3GJ5A 2A78A 3T1TA 2OFWA 4QOSA 3LX8A 5EUMA 1ZD1A 2DR3A 4A36A 2A7QA 4GZMA 1E69A 2QQ0A 4A2WA 2ORWA 1XPUA 2D06A 2ZR0A 4QG7A 3DDCA 4TYPA 3O8CA 4DCSA 1UBFA 5LD2C 3CNOA 3RWMB 5E7MA 1SVLA 4LJ8A 4M9SA 4QBIA 2GBLA 4Z54A 4EUNA 5DIFA 1M2OB 4Q5IA 5JBQA 4TQUS 3V4RA 2CL6X 4FMBB 2EYQA 3OEHA 4HZUB 5C4MA 5EE1A 1BS1A 3WYFA 5BW8A 2G88A 2CLCX 2MMGA 4GOKA 4BEJA 2D2FA 1BH2A 3KJGA 1KI3A 4LBYA 2IEZA 3QEJA 1CTQA 4JBYA 1OIXA 3FE2A 2ATXA 2FFHA 1OSNA 1SHKA 2YOFA 3C8UA 4B47A 3QBVA 4DEXA 2JLRA 4MYHA 2W2XA 3AF1A 4V0KA 5J4YA 2BMJA 5JEEA 1OXVA 3HU3A 1T91A 1TUEA 2H8KA 2JA1A 3B85A 2R9VA 2JLQA 1QHYA 1F2UB 2O8BB 4DCTA 1QBKC 2FSHA 2ODEA 2YWEA 4URUR 4ZCLA 1DG1G 3HPQA 2B8WA 2JLWA 3EPHA 1ZUIA 2ZYUX 3U3RA 4GRAA 4CEHA 3IEUA 2ZI7A 4IEIA 1E9AA 1X8KA 2IF2A 4YMUA 2C5LA 5A5GA 1GUAA 4PQFA 3A8TA 4C3ZA 5DHFA 1E4YA 2ZJZA 5CK5A 1CEEA 5G40A 4IDQA 2AKYA 1SXJD 4NCJA 4HUQB 1OH6A 2XEXA 3AUYA 4MKIA 3L2OB 5FTMA 1Z6AA 1ZVQA 4MDFA 1YZLA 1UF9A 4KSCA 2QL6A 2OAQ1 1VIAA 4QKQA 1P61B 1VYVA 2WMNB 1HH4A 1S0UA 1MO6A 4B2LA 1XBTA 1AKYA 3OAAA 3TLXA 5JSZB 3QY0A 1FTSA 5FPYA 1KKMA 5KSYA 4U7DA 4CRWB 1E2IA 4B6EA 3AVOA 2OCYC 3VHLB 4A2QA 3NKVA 2FSFA 4TZ0A 4FCTA 4QM7A 1M74A 1SZPA 3Q7PA 3TBKA 1IXZA 3VAAA 1W46A 1EG7A 3IIKA 4BUJA 4TZ6A 4C0LA 3LXXA 4TLEA 1UKEA 3IGFA 1Z6YA 4Z8XA 1AS3A 4QL3A 3CZQA 5E7JA 2FFQA 5FTNA 1LB1B 1S96A 1NBMA 3LV8A 1A2KC 3SHFA 5BN3A 2CBZA 2ZI3A 4AKHA 2NO0A 2IWRA 2JLUA 1VKJA 3RHFA 1N2CE 2I1QA 4NHOA 4PSVA 1VPLA 1G5RA 1IJFA 4RZUA 3B1YA 3RANA 5EP3A 4LYJA 2CK3D 5F98A 1CP2A 4MGZR 5CLLA 3GJ6A 1N0UA 4W9MC 1OHHA 1DAEA 1IY1A 2OXRA 2YC2C 2EFGA 1R8QA 1QHGA 4HAZA 1G8PA 2ZJ5A 3PVSA 2IS1A 4ZIRB 1YZNA 3WBKA 1S3GA 1S9HA 2YHSA 3F5FA 1KO4A 1HY3A 1FP7A 3E1SA 3PUVA 5A4JA 2YOHA 1JI0A 3U3MA 1XJQA 1RKBA 3REFA 1LV7A 3QVUA 5D3QA 3RABA 4EFLA 5EXPA 3WRXC 1ZUNB 1L2TA 1EWRA 4JSTA 4Q02A 3QKRA 4EAQA 1COWA 3OF5A 2MMCA 2CVFA 3DOEA 4JBWA 2JCSA 2FG5A 5KUTA 2GVZC 2OBLA 3ZYCA 4AY2A 2GESA 1XEWX 4TLAA 1G8HA 2CNWA 2PX3A 2C9CA 3BXZA 2CCGA 4MQBA 1P6XA 4HLDA 4QC2A 3OIWA 3EC1A 4LHYA 4R71A 5ELXA 4AKIA 2CCKA 3KQNA 4UNPA 4AKGA 4JLNA 2ZAMA 4OJKA 4BWYA 2N46A 4NCKA 1FTNA 1X1RA 4URXR 2WOJA 2GZAA 1OIVA 4W5HA 4C7OA 3IHWA 3QKTA 2ZXUA 3B13B 1II9A 1NJFA 1DTSA 1ZJ6A 4JBXA 4JSYA 4Q4HB 2GWHA 2DYKA 4JVNA 1D9ZA 1K5DA 3EWAA 1AIPA 4DLVA 3IKJA 2KE5A 3OHMA 2C77A 3TAHA 4MYCA 2PEZA 4EJSB 2G9NA 1AM4D 1AQUA 3Q9LA 4V0ME 4EPXA 2IXEA 1SXJE 2ORVA 2P67A 1JJVA 1KMQA 3ZH9B 2WWHA 2WAYA 4JYBA 1JBKA 1NRJB 3ASZA 4ITRC 4Q4LA 5SZIA 3ZVRA 1M8PA 3MUFA 1XNJA 2XAUA 5AK0A 1G6OA 421PA 3FFAA 1YHNA 4KITB 1MOZA 4F4IA 3WHLA 3THYA 1N6RA 3SYKA 3SNHA 1E0SA 3VNUA 1R10A 4IXNA 3F0TA 3KB1A 2IUSA 2OILA 2J0UB 3DZ8A 3N2EA 4JLMA 1H8HD 1J99A 4DLUA 1T3HA 2DPXA 3TUJC 2RGBA 4GMDA 4RFSA 4TYNA 1ZCBA 2ZROA 5F9FA 2WSSA 3K0EA 2DWOA 5K8UA 2V7QA 1CU1A 3R9WA 1HT2E 1NSFA 1KI2A 5DI3B 5HTKA 3FFBA 1FQKA 3W3AA 4Q7LA 1EK0A 3W5JA 4B3DA 3CW2A 2QE7A 3WP1B 1ZU4A 3HU2A 4HUTA 3SFVA 4IOMA 1G3QA 4D26A 4KFTA 4UNRA 4YXWD 1Z6GA 2WPDD 4JVLA 3VX4A 3UWOA 3CR8A 1EWQA 1BMFA 2NQ2C 1G7SA 3U44B 4IDNA 2PZGA 4Q7KA 2GXAA 4LPSA 5EP4A 1DAGA 3VKHA 4I1SA 3SYLA 1U90A 4TMXA 4JYCA 1JR3A 2XB2A 2BCJQ 5E4FA 4BZPA 1PUJA 3W6OA 4TLDA 3X1YA 1NI3A 4DIDA 4FMDF 1RRPA 1JPJA 3K0CA 1II8B 1JQLB 2G3YA 1QHHA 2GF0A 5DI9A 5CDFA 1G4UR 3MWLA 1NBMD 1LS6A 5EUQB 1YQTA 1KNXA 2WJIA 4MRNA 1N5KA 1SVOA 4WIAA 5KYKA 1B0UA 1KI4A 2BBOA 2C03A 4Q9IA 2D4HA 1E1RD 4NDZA 3KQLA 4POAA 5F9HA 4Q1EA 4Q9KA 3TVDA 5AUOB 4ZCMA 1G5TA 1MRNA 4TTQA 1W44A 3EPJA 4IDOA 1T0JB 2JGNA 1ZYUA 3RS2A 4NYIQ 5EP1A 4TL7A 2Z83A 1NY5A 5HKKD 1YR7A 3LW8A 5KDDA 2OFXA 1W4BA 1ZUHA 4LWZA 1XMJA 1DEKA 4ZKEA 1SXJC 2ZE8A 2DHRA 1KSFX 2AFHE 1E2PA 1C4OA 1RRFA 3AKYA 3U5ZB 1R5BA 3G82C 4MRPA 1NVUQ 3Q5DA 1QHNA 4GOJA 4LK2A 3TH5A 1EFRA 3VR4A 3IPXA 1COWD 5L3SB 1O87A 4Y0AA 2VP0A 3GLFA 3NEYA 2RHDA 1KI9A 3QXXA 1KO8A 4I1VA 2ZJ8A 5B57C 2OG2A 2FSIA 1TF5A 3OIYA 4RZ3A 1K6MA 4B35A 1OB2A 1RFLA 4HDOB 4N1AA 3BK7A 1QHIA 1KZ7B 3QNUA 4P3YA 4B3GA 2OLKA 2AL7A 2A30A 3W6NA 2ZVQX 1E0KA 5JWRA 2QMUA 3FMFA 4BE7B 2V6IA 4DRZA 1L7VC 1R8SA 1OF1A 4FN5A 5BN4A 1TQ2A 3CO5A 2PT7A 4A1FA 3NBYC 1D8TA 1PVOA 3B9QA 3QKUA 4GP6A 1E9FA 4HI0E 3WNDA 4RVCA 3SQWA 2OBMA 3AKDA 3EZ7A 1GKYA 5FOXA 1G17A 3CB4A 4TMTA 5GJVC 2GHIA 1ZRHA 2GZDA 4EIWA 3OFND 3VQTA 2IX3A 1OJLA 4IFEA 2YJTD 3EAQA 2ZSBA 2UZIR 1ELOA 1Z22A 4PHFA 1OFTA 3RS0A 2ZSDA 4X8LA 2ZR7A 3BH7A 3A6PC 4LUCA 1IN4A 1NNEA 4WVFA 2AFIE 1NN0A 1IXRC 1OXTA 5L3QA 4JLVA 4IEEA 3A4MA 1Z83A 2R62A 3R20A 3UANA 1F5NA 4ILEA 4OL0A 2O8BA 1F2UA 3EXAA 3RVBA 3QUSA 1OE0A 4US1R 1VYUA 4DLRA 2ZRKA 3BFVA 4G5QA 5FOVA 3AEZA 2O8CB 2WHXA 4TN1A 1OH7A 2YZ2A 1IN8A 4S2EA 621PA 3WNCA 2RGDA 5FTLA 5IK2A 4BRWA 2XZOA 2ZRFA 3K9NA 4XD7A 2WWIA 2PZEA 4QBGB 4BEBA 1ZD9A 1NBME 2YC4C 4HYYA 5B30A 4WXRA 2ZRDA 3SR0A 3SN6A 1Q22A 3T1OA 2YYZA 721PA 3DOFA 2HT1A 4P31A 5FPTA 2ZQ5A 2ZI5A 3NWJA 4B3CA 2QAGB 1GRQA 2EFEB 2J46A 2F1JA 4LYFA 2XJ4A 5CJ2A 1F6BA 1SVMA 2NOAA 2BM1A 1XP8A 3GFTA 1YRAA 1ZNZA 1OFHA 2ZETA 2ONKA 2BMDA 1Z47A 4RCZA 4P0TA 1DVRA 1KK1A 2MSCB 1CR0A 3VR3A 3BH6A 2PBRA 1KI6B 1RE0A 1W47A 2PH1A 1N6IA 4MGKR 4RJLA 4QGGA 3I4LA 2HCBA 4NP6A 4UNQA 3HU1A 3P26A 4L16A 3D6TB 4PTLA 5J4KA 2JIZA 3CX7A 4LGMA 3EX7C 5KNBA 1OXSC 3MG9A 4EQ6B 5A0FA 2VHQA 5HR5A 5TARA 4URVR 1IY0A 3AVXA 4CZ2A 2NZJA 2IXGA 2LWIA 4RZXA 1A2BA 4QNMA 4JKIA 5G41A 4C2TA 1E2QA 2C95A 3EPKA 3GJ8A 2QTFA 2WWFA 3IDQA 3KQKA 1N5LA 4BZXA 1H8EA 2WJYA 4K46A 4A8JC 4G3XA 3I3SR 4ZIRA 2XNDA 1DAHA 4BGDA 3LBIA 2GCOB 1E9EA 1XJCA 2PZFA 4OBEA 1KI1A 3QXSA 1JAHA 4UKDA 3L0SA 5SZKB 1CLUA 1DAMA 4Q1AA 1P2SA 2KI5A 4G5SA 4QXAA 1EFRD 2OE2A 4DB4A 5G3ZA 2IYUA 1RRGA 5E3HA 1FX0B 1Z06A 3NDPA 3EG5A 4EFNA 3L82B 4MRRA 1E94E 3PUYA 5FUVA 3Q72A 2QGNA 3DPUA 4Q7MB 1XJ0A 3UMSA 4TWZA 4EPRA 2GDJA 4B3XA 3HYRA 2A5GA 5J4HA 3BB3A 1DPFA 2PEYA 3K53A 3MJRA 4TL8A 2QPAA 5LD2B 3AH8A 4FD2A 2ZI9A 2ZE5A 4DCUA 4Q7JB 1W5SA 5HE9A 2JJ2D 2V55B 2WV9A 4HLUA 1DAFA 2J1LA 1W1WA 2QENA 3D8BA 3FMPB 4TT3D 3ZD6A 2QM7A 2PL3A 1LF5A 1SKQA 1X6VA 4Q4HA 3I5YA 1PLKA 3FKSA 1N6KA 3OE7D 2B8TA 1DARA 1P2VA 3PXGA 4ASUA 5AWFC 4HAXA 1TEXA 3H4MA 3GLIA 3A36A 1IHUA 4EJSA 5FL7A 3IQXA 3NH6A 1AGRA 4AKEA 1CKEA 1XCPA 1CXZA 2XTNA 4OK6A 4HEJA 3SYNA 1ZM3A 4BQSA 1V5WA 2CLSA 2FOLA 2EFHB 2GK7A 5FOSA 5EE0A 3KUCA 4I4LA 1Z0AA 4PHHA 2FPMA 1OH5A 2P3SA 4R98A 1X8LA 1DADA 1M34E 3EASA 1NVWQ 4LSGA 3U7GA 1WBDA 2GJKA 2CJWA 2GCPA 3CRQA 3NG1A 4LHVA 4ZI2A 3ZQJA 4DUGA 3GLGB 3A37A 1RRCA 2J0UA 4V02A 3WNBA 3AB3A 3THXB 1KMHB 4U00A 4E09A 1NG9A 3CPEA 4PAMA 4AG5A 3HJNA 4S35A 4DSNA 8OHMA 3HWSA 1CRQA 1XTKA 2BKEA 2GTPA 3SEAA 5CYOA 1E2NA 4LJ7A 3PEYA 1G6HA 1KI8A 5JMTA 5CDFE 1T3LA 2PLRA 1ZIPA 3LH5A 3M4YA 4TMVA 3DHWC 5DI3A 3AF4A 4BFYA 4QBHA 4DZZA 2BDTA 1G21E 4L8GA 4PQYA 2GJ9A 3DMNA 4JVSB 2QGZA 1G3IA 2REOA 2ZSAA 4LV5B 3A1WA 3K1JA 4OHWA 3HR7A 3ND9A 2GF9A 5K8IA 2WKQA 1OKKD 3X2SA 2W6JA 1U8ZA 3IBGA 2BC9A 4RD1A 4JT4A 3U44A 4BLOA 5DO9A 1CRPA 4W5JA 5EXSA 3FTQA 1GRNA 2IEYA 2OCAA 4JVMA 4WZBE 4C4PA 2UKDA 3P1JA 5J4VA 1YKSA 1T5LA 2Q9BA 4Q4AA 3K0FB 4GZLA 4TMWA 5F2EA 1TMKA 1N25A 3GJ3A 3Q85A 4DCNA 4Q1BA 1CJMA 1II8A 2HLDD 1ZM9A 4UNSA 2ODWA 4ACBA 5BXQC 2OSBA 4GOXA 1KK2A 3IBYA 2A5YB 5C18A 221PA 2YOGA 2JJ1A 2WMOB 1GP2A 3EW9A 1PZNA 3LBNA 2ZJBA 5CB8A 3I61A 1WRBA 3MMPA 4GMXA 4XIGS 2EYUA 3SQXA 1HTWA 1P72A 5TY0A 3TSZA 3ONWA 2HEIA 4MUBA 5BYKA 3LNCA 4LRWA 3UMRA 1Z0FA 3FVQA 2ZYTX 2V6JA 4N0EA 5DSZA 4ZCIA 2XXAA 4H1UA 3SDZA 4BFTA 3E70C 4JLDA 3HPRA 1JXOA 5J4LA 2J5XA 4D25A 4MRSA 4OJQA 3CUEF 1S3SA 1FFHA 2ZJOA 3F3YA 4ZV4A 1U99A 1RPZA 2O0KA 1ZINA 2E87A 1XTRA 4A9AA 3RRNA 4C0AC 5FPHA 4RD6A 5JI3E 3ZVNA 1VCOA 3VNVA 3UWKA 1HEIA 5L3SA 1WBBA 4TYWA 5M04A 3RRYA 4URYR 3LDAA 4DSUA 2JLVA 3M6AA 1WP9A 1KK3A 4TTPA 1FNMA 2NIPA 2OM2A 2FJUA 1KO7A 3QOFA 3UMFA 2AR7A 1EFHA 2G0TA 4D6PA 4YMSA 2BEJA 5AUQA 1R0YA 2IUTA 3CWQA 2DFKB 4QHYA 3OIUA 4DIEA 1SVSA 4M9QA 4RCYA 5EZ5A 1Z2AA 3WYGA 2K5UA 5KHOC 5DNYB 4DLWA 1TX4B 3NXSA 5FBQB 3QG1A 4A15A 1RC8A 3DL0A 2HJVA 3A1TA 2BMFA 2Y8EA 2FWRA 4O0MA 4NONA 4AD8A 1AS0A 2VP9A 2XOKD 2W2VA 4HLCA 3PEUA 4LC1A 4N0DA 4ASUD 2R6AA 1NN3A 4XWKA 2O8FB 1LFDB 3CX8A 3I32A 1Z3IX 1W4RA 4NYIR 4P4SB 1QHXA 5BYJA 5JHHB 2FPKA 2QTHA 1DO2A 2PMKA 3N70A 5DE3A 1ZC4A 2W58A 3TKLA 2A2ZA 2A3RA 4Q21A 5TVKA 2ATVA 121PA 2QY9A 3MSXA 1NVVQ 2P5TB 5E95A 1VG8A 3BWDD 1XXHB 3K8YA 3PUWA 4V0NA 2I1VB 3EPLA 3P27A 3H86A 5AJZA 5KDLA 3R8FA 3FMIA 3ZVMA 3PFIA 3ZIAD 4Q66C 3WHKA 3GLHE 5HCIA 3T12A 2W6IA 1M7GA 2DY1A 3OEEA 2NPIA 5FTJA 1F48A 2AN9A 3ZS9A 2OT3B 5AJXA 5DISB 5FBVB 2O8CA 4LDJA 1VMAA 4BZQA 5DN6D 4PC6A 5FBWB 2PX0A 3U3JA 2GEUA 2XZLA 4G5OA 2ZVPX 5TMPA 1B23P 2C98A 1W0JD 1E2JA 4RKFA 821PA 5AJWA 3G0HA 3WMFA 4QJ5A 2O8EA 5EP2A 1KAGA 2XTZA 1NY6A 2JASA 1LNZA 2AK3A 3KQUA 1XEXA 2GAOA 3K0AB 3KX2A 2IYQA 4XWOA 2QAGA 2W6JD 1I4DD 4HB0A 4IHQA 4TQ9A 4JLBA 5C4GB 1CULC 1U8YA 4JLAA 4OQLA 1EESA 3UATA 3IPYA 3HR8A 1UBCA 2H17A 4BPBA 4KXFB 4I81A 1PUIA 1R5NA 2IA5A 1D2MA 5EE3A 1ZNWA 4X8MA 2W00A 3QKSB 3VKGA 1KI6A 4ABYA 2MSDB 4BLQA 4M53A 2H92A 1EXMA 2KWIA 3BB4A 4ESVA 2CXXA 1ANKA 1YRBA 2O0HA 4IVQA 2WJJA 5HCNA 3NBFA 4MKFA 4Q19A 3AVTA 2ZSFA 4PZYA 1YR9A 3AVPA 4PAQA 1DS6A 2VYFA 4EQ6A 3K09C 4MUAA 3MJHA 2RHMA 1NN1A 1X3SA 4GNKA 2VRWA 4B74A 3BE4A 4P4UA 5GVSA 3TJZA 1CF4A 4DWJA 3OEHD 5EXXA 3MWKA 2ZYWX 4KYIB 1US8B 5FTKA 3CIOA 2PJRA 1XTSA 4KYUA 1SXJB 4C30A 2XX3A 1WCV1 4CW7A 4GSYA 2TMKA 2ZI4A 2CE2X 2HF9A 3KKNA 4F91B 1UM8A 1P5ZB 4LBVA 1G3MA 1N0WA 1HQCA 3EARA 1JPNA 2BCGY 2ASEA 4IOKA 3EZ9A 3UK6A 2XGJA 2O8DA 2ZRGA 3THWB 4FINA 4V03A 1VG1A 2HUPA 2QP3A 4ZO4A 3B9PA 2RMKA 1F3OA 2NPFA 4FIDA 4FWIB 1U0LA 3GLIE 3I92A 1FX0A 1XTJA 3GFOA 4BFUA 3MGCA 5KSOA 3CONA 2X2FA 5BN5A 5TV2A 2QMHA 1RZ3A 2KBFA 1ZAKA 2WJGA 1CIPA 2WJHA 1C9KA 1UEIA 2YWFA 3A4LA 2I3BA 4ARZA 1SVWA 3AKCA 5DGXA 2F1RA 4TLCA 2AKAB 4LOAA 1U94A 4IVRA 1WF3A 4BRUA 2DWQA 5CM9C 5L3VA 3AGQA 3WXMA 3NBZC 1IM2A 3AF0A 2VF7A 1GNRA 3ETLA 3FGNA 2W0MA 1T6NA 1G9XA 1NLFA 1JNYA 1KJWA 2VSXA 3VR5A 2QRNA 2GJ8A 2V1UA 4DDTA 1T8TA 5KNDA 3OAAD 1RYFA 5TB5A 2P0EA 4ZI3A 2HT6A 1EFTA 3MFYA 2ZPTX 1XD8A 3LVRE 2GXQA 2ZYVX 1SQ5A 5KTYA 4NCNA 2FNAA 2J7PA 2RGGA 4I99A 4TTRA 1AA9A 1U81A 3IEVA 4JS0A 5HZHA 3PJRA 1ODFA 2OHFA 1N6LA 2RGNC 3NC0C 1CJKC 3H0KA 5EZ6B 1GITA 1JEDA 2ZE6A 4NYJR 4OQNA 2NO6A 5AJYA 1L8QA 4JLKA 5AR1A 5LBIA 3VU9B 1XCGB 4F92B 1W4CA 2IF0A 3L0OA 1LY1A 3HYTA 2CHQA 3EWSA 4A4DA 1W0KA 4BLSA 3QPWA 3EC2A 4C0SA 3NVAA 4P33A 2QROA 3VMFA 3BJIC 2JLSA 4C0BA 3OEED 3D31A 4C0KA 3PR1A 3GLGA 4WXPA 2IL1A 1KMHA 4JL5A 6Q21A 3GFPA 1MO3A 1XCMA 5EE9A 1OHHD 1TL7C 3GJ7A 1IY2A 1E9CA 2EW1A 4F7WA 1K5GA 1Q3HA 4PC1A 3TAUA 2JLYA 3MLEA 1Q57A 2NZ8A 1HURA 2BBWA 3QPVA 3SZRA 3W9YA 4EPYA 1YR8A 4HZIA 2RH5A 4LJAA 2L0XA 2CDNA 4DKXA 1KDRA 2J3EA 1P7CA 5H68A 1Q1QA 3CF0A 2FF7A 2PLFA 4MYUA 1JAIA 3LD9A 3T34A 1L4UA 2C96A 4RFVA 3RSLA 1D2EA 2EFCB 2FSGA 3LO5A 3N2IA 5JZVA 3CX6A 1TNDA 4ERNA 2KB0A 2P65A 3BS4A 1Z0KA 4CEIA 4BFWA 1N6HA 2Q3HA 4TMKA 4KU4A 1IQPA 3T5DA 3K0FA 4PX9A 1KY3A 4R2HA 2CNWD 3T1VA 1MH1A 2XTMA 3ZZUA 3D7MA 1DO0A 2CL7X 5FI1B 3R8CA 4XTRA 4GPTA 5J47A 2HF8A 4HAWA 1MO4A 1QG2A 2SHKA 4A6PA 4NYMR 4WBSA 1XPRA 4Q00A 2XITA 1SVKA 1ZU5A 2A5FA 4V0LA 1U0JA 1FOEB 2J7KA 2QEQA 3KFXA 1HQYE 4JL8A 2VEDA 4ZDKA 5KPJA 3BGWA 1IXSB 1IN7A 3A1SA 4CT4B 4OHVA 5BQ5A 5B64A 4MRVA 3E2IA 3WP0A 4HZUA 3QXHA 3AF3A 3SE0A 2YV5A 1E98A 1FMJA 3CM0A 3T06B 3FMOB 5TDHA 3VTKA 3J81k 1D2NA 2DFNA 4PAOA 4N3NA 5FR2A 1NIJA 3PENA 1Q12A 2OZEA 3P4XA 2CLDX 2J45A 1R6BX 1VG9B 4JJKA 1DELA 3RNLA 4TSFA 4CF7A 1FZQA 2G1KA 3TUIC 1NMYA 1W7AA 4AYTA 3K70D 4UJ5A 5CITA 2VL7A 1A1VA 1JB1A 3M1IA 2V54A 1XZPA 1EFCA 1XTQA 2VP6A 3KKOA 3TIFA 1XPOA 1YR6A 2VSOA 1M6NA 4OI0A 2P2LA 3PG5A 2J0SA 2BMEA
chains in the Genus database with same CATH superfamily
1R88A 5J2TB 3O3OB 2D62A 2WAXA 5HMMA 3ZLUA 5K7SA 1PR6A 1Z5OA 1IQUA 4EZEA 3KUDA 4LQCA 4ME6A 4BGVA 4EVSA 1JXAA 1T5BA 2X42A 2GPTA 3PRKE 1PYOA 1RJDA 4L50A 1E3LA 2W9XA 2HDNB 4EO4A 1UQRA 5LBTA 4RHTA 5EHQA 3NU1A 1Y82A 1MB0A 2WUDA 4JH0A 4XJTA 4BQOA 2D0IA 3DD1A 4C2UA 1XLVA 3H5RA 2NMVA 2V7QD 2NLOA 3P9IA 4P2GA 1GPKA 5U4QA 3AM3A 3UUEA 4AZSA 1MFZA 1P29A 4GQIA 4TRRA 2XMPA 4K03A 3WAKA 3OG9A 2LV8A 2IX3A 2HBRA 3AIIA 3Q7RA 1HL7A 1U3WA 1QB7A 2ZVJA 3FETA 2I6XA 1U8UA 4M0FA 5IAJA 5CJPA 1XLTC 3EPPA 2IXFA 4CNQA 4ES6A 4IZOA 4P86A 1K3FA 4NU6A 1PW5A 1QUFA 3ESCA 2QMEA 2WB4A 3A1NA 1LVUA 2QS9A 3C6QA 1FXUA 4NAHA 3T6KA 2WF5A 2Z5LA 3CXRA 3QYAA 1MKYA 1ZHHA 2CJXA 3EGWA 4JT2A 2DBZA 2A33A 3GFRA 1CUDA 1KY5A 4TQGA 3TLBA 1HM5A 1T2DA 2NZVG 3EVGA 4Q7EA 1U8AA 1XWIA 1Y9AA 4B2YA 3EMKA 2AEEA 1A76A 1TCUA 3LY5A 2JGDA 3WRWA 5E6SB 1SKYE 2OZPA 3OKAA 1T9GR 1SA0A 1LZLA 3WLQA 1VMKA 3ICEA 4MWOA 3M8KA 2I2BA 3VTFA 3WLOA 1ID1A 1T26A 1Z2DA 1TZCA 4LI3X 3V00A 5D6OA 3MJTA 3RS7A 1RZRD 3MERA 4R2KA 3W5UA 1VFNA 1QVRA 2PNFA 3NHFA 3P9QA 4X1IB 2DBVO 4V39A 3EFEA 2YV4A 4KMMA 2BISA 5GJBA 1UAYA 4PLFA 1MLDA 3EXFB 4M1TA 2YV1A 4GOND 1SWVA 5D87A 3IB3A 2Z1MA 4H15A 2UVDA 2F00A 3SYTA 3E9CA 1HQDA 2FQYA 4K6MA 4AMBA 4F11A 3A6HA 1W36D 2LXNA 1GL7A 3GNLA 3HB0A 3HKDB 3U3XA 4DHEA 1R4NA 1RC0A 3B5IA 4FT2A 1EP9A 2FEKA 4R8RA 4E14A 3VKHA 3ESDA 1BH6A 2Y0EA 1USIA 1GQRA 1M2WA 4I8DA 1XRLA 4RDHA 1TQDA 3ECCA 5AVVA 1KJIA 1F0PA 2WWGA 3U4QB 1TM2A 1UKVY 1DXYA 4LBZA 5CCDA 1J0CA 1XDBA 2ORYA 4AUMA 1F8GA 2QVXX 3WOVA 4KFCA 2DETA 1C9DB 1Y3CE 3FVTA 3ZW7A 4NBTA 2GAIA 4RGBA 1QIKA 3NNDA 3NXKA 2O9JA 2OK7A 1QF6A 1DFIA 2BP7B 4DE5A 4JASB 1XTIA 2H57A 5AP9A 5EUCA 4ZGBA 1OLUA 2AMFA 2R5WA 4J03A 5ARDA 1E3WB 2DSTA 5FA5A 1WDTA 5D2CA 5C5EA 2GAFA 3IKLA 3IUQA 3VPHA 3PNPA 1DBRA 3L46A 4CHTA 5I9IA 2RGAA 2D0OB 4XLZA 2BD0A 2YVAA 3KOUA 5EJ9A 4Q9AA 5J63A 4Z4GA 4CFSA 2H5IA 4YCJA 4YPVA 2YWCA 4RZIA 4ZYXA 2Q07A 1E8NA 2Q6IA 4L28A 4JUFA 4WHMA 1NF9A 1T4MA 1X19A 3CPJB 5JZMA 4B7XA 1EFVB 1FXWA 4IICA 3BIWA 3O4IA 1MH9A 2FKAA 5G53C 4YJ2A 4HH1A 2MR5A 4FMDB 5DK6A 1KK0A 1C50A 2CEAA 1WUIS 4QLOA 2P0YA 5L9AA 3WK9A 1OAOC 2EBHX 2JGKA 2XWPA 3MT8A 3I72A 2EWVA 4NBVA 1R9JA 4X1OA 5A4IS 1TVCA 4B6FA 1I6KA 1K7XB 1ZBDA 3PCTA 3KRTA 4B85A 1I6MA 3D8TA 1Y1KE 2FMXA 2F55A 2PUGA 4BC1A 3C3JA 4DJ5X 3AR2A 1MGOA 2FR8C 3MTGA 2REQB 3EF1A 2B4KA 1NUSA 4D46A 3OEYA 5T4HA 4KIUA 3E81A 4EHKA 2BMAA 3HLTA 1UADA 1EJ0A 1NDUA 2FZLA 2POQX 1O2DA 1MTZA 3TR0A 2SBTA 1H22A 4I1UA 4KNYA 1WEHA 2B9EA 3BWEA 4ZAYA 5B36A 2ZIGA 5LZ7A 5AI9A 3KOWA 4PYOA 1XA0A 5KYXB 1GZUA 2FWNA 4OXRA 3GP8A 4DV1B 3IUYA 2FPGB 3PHIA 2G82A 4GHWA 2P69A 1H6DA 3P9RA 1N3IA 4DADA 1VJ5A 1XI2A 3I9MA 3PP8A 3P5BA 3TD6A 2HH9A 2OV2A 1M34B 2QP4A 1SHZA 2RBGA 2SICE 3ASUA 3JQCA 3KJHA 1RXEA 4JQCA 1U2TA 4BFZA 4KREA 4BBPA 2CF6A 2QVYX 1DJLA 3I83A 1ISSA 4MUKA 3AT1A 3RUIA 1A71A 1EUCB 3WQBA 2B99A 3QPDA 5ICSA 2CD7A 5IT0A 3LQ1A 4HWRA 2CHVA 1MMFB 1N7IA 1Q15A 4MUMA 2Z2YA 4TKLA 4AXXA 2P9TA 3CT6A 4RY8A 1ZK1A 2PYDA 1VLZA 5LOVA 1S7GA 3X1WA 1XVVA 4EA8A 1Z6PA 3V80A 3RUEA 3BJEA 4BMSA 2QI9C 3M9XA 4YCSA 1YH3A 4XOUA 1WY5A 3CKLA 4DLZA 2F1HA 1DZIA 1P9WA 3I8XA 4J0QA 2K87A 2PWZA 1UMCB 1DE0A 3L6DA 3A1UA 4XASA 4B71A 5I4KA 3I64A 5EYPB 4YASA 3W9BA 3I05A 2XQGA 4OATA 1F0YA 5K6AA 1WV1A 4FM9A 2DFTA 1KFCB 1K1EA 4O6VA 2CXOA 1OT3A 2G4LA 3CUKA 2OORA 4KAXA 2BWJA 5C53B 4AS1A 1PR3A 1KERA 4FYXA 4C5BA 3LPMA 2UZ1A 2CK3A 5INTA 3OQHA 1PQYA 1X1TA 4MQFB 4TKVA 4X93A 2TECE 1WD5A 1YE3A 2QG4A 4CKBB 4RIIA 5LP6A 4YRMA 4BUZA 3WI7A 5TMDA 2WJWA 1N2XA 2YHBA 4AU1A 1V95A 4WZBB 2QN2A 5DGHA 3RO7A 2HCFA 2ZRLA 1FRZA 1L3BA 1QHSA 3M4ZA 3AUJB 1QVAA 2IYZA 5CYFA 4DXAA 2RGRA 3QF7A 3S7TA 3FDFA 4MKRA 4DLKA 5B7GA 4Q18A 4QT4A 5FOTA 1I14A 2PL5A 3H04A 3KQTA 1EHCA 2QLJA 1VECA 2W6NA 3AVQA 4JBNA 5IKPA 2ZIEA 3O4HA 1NBHA 2FLVA 2GK3A 2GKOA 1MXFA 1NMQA 3RIXA 1PQPA 3T9AA 3OX4A 4NICA 3HCAA 5K01A 1N5RA 3PDIB 1CB7A 1YZQA 3L0ZA 3QVVA 4WN9B 4A23A 4F06A 4LF8B 2H65A 3ZXIA 5DHRA 5KNBD 4AN4A 4FE4A 4C29A 2HFJA 2JCBA 5JZBA 4RTKA 1D5WA 3Q9SA 3ICQB 3WIVA 2BFEB 1FVOA 1Z62A 3G6WA 4A6DA 4U5QA 2COKA 1MR3F 1JR4A 4ZEMA 2P90A 1XD2B 4YHBA 1MABB 3IEIA 2GZRA 5ILQA 1MRSA 4NENB 3MLAA 3MUEA 5E8JA 3RVLA 3ZDRA 5E4YA 2H85A 4HMOA 2XKJE 3E3AA 3OJXA 4RPKA 3OQMA 1DAKA 1FLNA 1Y4AE 3DP7A 2NYAA 2BRUC 2XMQA 2HWXA 4GXNA 3L9WA 1ZI6A 3KSAC 3HL0A 4NZOA 1KFBB 2AFHA 1U2GA 2XWQA 4O4HF 2ZATA 2NP6A 3LK6A 2A94A 2PGLA 3OQ6A 1SZCA 3GD7A 1V11B 3KZVA 3WL8A 1M7HA 1T9HA 3FCEA 4QYXA 3WGVA 1CRZA 1TU4A 5L4LA 3O82A 4PLGA 3PEEA 3FJYA 2WTMA 2LTAA 2QM8A 4DV5B 4PQRA 1U7ZA 1AK2A 2R6GA 3HCEA 2IQIA 3MRSA 3KVOA 4PZCA 4AP5A 2Z4RA 3F6EX 2G0NA 3F3MA 3MWGA 4QTXA 4ZTZB 2BEUA 1CQJA 3FFXA 1GEGA 1H4TA 2GN8A 4J1TC 3BGOS 2Y2VA 4QOGA 5GOTA 3URMA 1WA5A 1ARZA 1VZ2A 3LCRA 2ZWAA 2HF7A 1TK9A 4J6FA 4YRLA 3TLJA 3W1VA 4D4LA 5C8DA 2WJVA 3DM5A 1C7IA 4ZVLA 1VDZA 1J5PA 2ZRAA 4L0CA 4CKEB 3RNOA 2GZ2A 1FFEA 1FTGA 2OBYA 4M4SA 5L3QB 3HP1A 4DUZB 2VIIA 4JV5B 1D6MA 1G8YA 4I4CA 2EBUA 1WMSA 4G86A 3AFHA 4BNGA 5B5SA 1QQAA 1JBQA 3MBKA 2WF6A 1RCUA 1DDGA 3DBVO 3SXUA 1G8GA 2JGEA 4Z6KA 2C99A 3DGFC 4MKGA 4DSZA 3H13A 1S2OA 4CM6A 3NYIA 3JQ7B 4ZO6A 3DE4X 5ICCA 1GU1A 2ZJFA 3GT0A 5DW0A 4AURA 3GJXC 1SG0A 2VJQA 3RQIA 1K97A 4JLPA 3LZDA 4N3CA 5EMLA 1Q2XA 3BICA 3TE7A 2D8MA 4GDFA 4C3OB 3TB6A 3E3MA 2EFDB 4ON9A 2PIAA 1KO5A 1Z4QA 4MYTA 2RC6A 3N74A 4YAEA 3ZE6A 1DJNA 3IP3A 4NPHA 4ROTA 2R8XA 1IBSA 1UJ6A 2QSZA 3OCWA 4R2JA 2Q8NA 1FJ2A 1V7QA 2VQDA 3PPWA 3CX3A 3QU7A 4FHFA 3H84A 4JT9A 4WCFB 4MR8B 3V32A 1A9PA 4QPJC 3QWHA 4MGYR 3DCYA 4ARBA 2HHHB 2GYWA 1YRQA 1L1QA 2OXFA 4JQZA 2I4NA 4AP6A 2H52A 4YXWA 3COYA 3R9XA 1I80A 1M5UA 1QGOA 1WCIB 2B78A 2G9ZA 2AN4A 3HEAA 4MB2A 1BEZA 2B2NA 2JAQA 4WJKB 4ZT3A 4K1XA 3A4NA 4D7AA 4DLLA 1CR4A 2D54A 4Z9BA 3RU2A 4FXPA 5FFNA 2B2CA 2ZREA 2C92A 2QRQA 1T3ZA 1X38A 3GLHB 4U3JB 2VA9A 4QULA 4LJ4A 5HZGA 2O7QA 2FUG6 3AO0B 1W30A 2ZZMA 2BVNA 5I9BA 3L7BA 1UBLS 2C4VA 3IC5A 3NIBA 2IBMA 5GOZA 3OM8A 3DEFA 4MTLA 2ZBRA 5JXHA 4ARCA 5BOSA 1QDEA 1K8QA 1RWXA 3KG2A 4PPGA 5GGXA 3V42A 1X1DA 1IMJA 1E5XA 4QFMA 1U1EA 1XL0A 4RABA 3RRZA 2H11A 2QDXA 2P77A 3HWX1 3K6RA 4HB2A 4ESOA 4F4JA 3ZCUA 1C7JA 1XXHE 3MWYW 3GZJA 3Q3IA 2CL0X 3C14C 3H2KA 3OZEA 3K5WA 4LZZA 4UAGA 2ZM5A 2Q0SA 4CTKA 4B8YA 5TEWA 1WX1A 4C89A 2WWXA 1E1RA 2P9QA 2X5NA 3GJRA 3HBJA 4IWNA 1QHEA 4ZOBA 4J0FA 4FE3A 4IKEA 2CLHB 3BOSA 4XYGA 3ZHQA 1NXVA 4X8HA 2AD5A 4D0LB 1EDEA 4HNQA 4EYSA 4RD3A 2YKGA 5DU2A 3UYLA 3PHBE 1C0EA 1YDGA 3LGAA 4D9NA 4HNHA 4FBMA 2GEBA 3QIAA 4NNJA 4JR0A 4M1SA 1EMDA 1TJYA 3ONEA 4Y2SA 4FMPA 1T4CA 2HNKA 4I5DA 3D6UA 1X0VA 4LDZA 3D3QA 4PZAA 5CIQA 1NKSA 3BHIA 2B1QA 2XGSA 3GD5A 5GZ6A 4BLWA 3KHUA 5E3JA 1JL3A 2HU5A 1YIOA 2QX9A 1XMXA 3E7WA 4DWOA 5C8YA 1JSXA 3NIGB 1DCKA 3EYWA 5AJVB 4DBZA 5IT9A 2B1RA 3LHKA 4QE3A 4JI3B 2Y4OA 4AY5A 3CYFA 1XMOB 1M8KA 3FOAA 2OFFA 2R44A 3MWDA 4EPWA 3B8HA 3WLJA 2Y0DA 2PS0A 1CQWA 1YRLA 4NZMA 1V47A 4X8OA 1PWZA 3L4SO 2GM9A 3Q1KA 5NLLA 1G19A 3G2HA 5TGTA 4G84A 9MHTA 1CNMA 4N82A 4JHXA 3S1AA 5AI8A 1UKYA 3OQIB 4J4HA 4KFRA 2PGOA 2PKXA 4F0JA 2VP5A 3LVFO 2FPWA 3DKPA 2REXB 1CR1A 1GGMA 3GR6A 2ZJ4A 3WMRA 4JEIA 2HMYB 1W5EA 2NSLA 5BQPA 2XMZA 3SKXA 1R5OA 2BELA 1QKIA 5A02A 1TF7A 3OHPA 4NS4A 5AKYA 3EA4A 2J87A 2GZSA 1LSUA 1DBIA 1KVTA 2L17A 5GJWC 1PT7A 3MQ4A 3W8RA 3ZI7A 3MXOA 1Q95A 3Q3GE 4KUGA 3R7WA 3JD4A 1H9AA 1N6PA 3RTCA 5DNUA 2ZI6A 3PUXA 5M5BA 1AMNA 4OHUA 2BDUA 2DFLA 3B1JA 1UODA 3TVYA 1WAMA 2O2DA 3SZUA 4OKIA 4DMRA 5F64A 1KEWA 2I65A 5LB2A 4GIBA 5KX5A 2BFBA 1PF7E 2WF7A 5FV4A 4JYZA 1RJ9B 4D3FA 3D0QA 4XRRA 1N9GB 1E2FA 4MIEA 2OFPA 1QRAA 2NGRA 3NORA 1M75A 3AHFA 3Q1LA 3ACDA 1SU6A 3N6RA 1LPSA 5BV8A 4AYXA 4DA4A 2AMYA 3SLRA 1YZKA 3G2OA 5WRFA 4YRNA 3GLIB 3PT9A 3MWJA 1OLXB 5C8YF 4DUPA 3A9TA 2VTVA 3T3IA 2EZTA 3PFHA 1TQ6A 1T3SA 1O4VA 1ZXLA 5GVRA 1H9CA 3BQNB 4RAOA 7MDHA 2BHLA 1XZQA 2DH5A 4YYEA 4S05A 4XIYA 3OKFA 4B0PA 4M46A 1CY4A 4KTVE 3HXMA 2AIRA 4BTVA 4D4MA 1V1RB 3EGEA 2Z8YA 4H60A 4CODB 4ZDJA 4K0RA 4UEWA 4Z1MD 1JKIA 3U17A 3SC6A 1EWTA 3QWIA 5K3CA 1NKVA 4D3DA 3Q88A 3ZDEA 4NCIA 5I7FA 4E32A 2PSJA 3MRVA 4LECA 4OVKA 4YRJA 2CJWB 2NTYC 3I53A 4UBJA 5JEDA 5DTJA 4RHYA 3WDSA 1IRIA 2J9RA 3IAEA 1BA2A 3TOZA 4ZMSA 3L0DA 2V98A 1KH3A 2CEKA 2QRJA 4ML3A 1KAMA 1FX1A 4OM8A 3HXLA 3I1FA 3V6LA 2DFDA 4DG5A 5KZMB 1MIHA 1P73A 4WZAE 2HX1A 1R66A 3AY7A 4M0UA 4JA2A 2CJYA 2FRVA 2D7CA 2C5EA 3PQ3A 1L4NA 3WLSA 4LV8B 3CG4A 3OKCA 4JL6A 4F45A 1E9BA 4NCXA 4OPMA 5TS2A 3T9CA 3WBBA 2OV4A 4MX8A 3NR2A 2R97A 2D3WA 3ET5A 1WDMA 2H16A 3GCGA 5IJXA 4MHTA 4RD2A 3OE5A 1DT5A 3O1JC 3GJ0A 4WAUA 2XNHA 4LJLA 2UDPA 2R00C 1FK8A 4TZTA 3TW8B 5K4HA 1GGNA 1U8CB 1SOUA 4L9WA 2IY9A 3G5AA 4LRUA 4I9HA 3LRPA 4C0HA 4R5MA 2H1FA 1ZSNA 3GAFA 1CVLA 2IYVA 1VCIA 1WZCA 4X71A 4EO9A 1NXSA 5HQ3A 2WJAA 3FRJA 4B75A 2HJGA 1VE9A 1GL3A 2VOEA 2ZFUA 3BQ9A 3NBXX 3WTBA 3SIPA 3ZU6A 3O84A 4Q4AB 3OZRA 1BDIA 5FWDA 2F43A 3R0XA 2PQ6A 3MMSA 5I8ZA 2PMEA 1NP3A 3L8DA 2XMBA 1M1YE 2YDXA 4GT1A 4ZREA 5A6SB 3VR2D 1LJ8A 3JYLA 4QHSA 2XBMA 4GGOA 3ULKA 2HQRA 1X80A 2IPMA 4IFTA 4TSKA 3WSVA 2ANBA 2EARA 4PVDA 2CB9A 2VAVA 1GU0A 2D2XA 4TKMA 3W8DA 2BHRA 1FMLA 1PI3A 1ZK3A 3BORA 3KXIA 3QM1A 2N42A 1U0OC 2BSXA 3KSRA 3OT1A 3UGTA 2IGBA 3WV5A 4D9JA 3SSMA 1VCNA 4IF4A 1AZTA 4R8KA 1ZIOA 3KXLA 2QNIA 4TPKA 1HC7A 4JC8A 4GBED 3WGGA 5JHGB 2Q6TA 2ARKA 1PU2A 4OMFG 3NHMA 2FU5C 5MN4A 3RUAA 3B2EA 3EFOB 1DQRA 3DWGA 4FFDA 1NLYA 3AV0B 5IANA 3BTUA 1UXGA 2G76A 2MSEB 3KU4A 4DEYA 3A32A 3RC9A 2R7NA 4MW2A 4M22A 4CIVA 4PG8A 1UEXC 4Y2GA 3U7EB 4M0DA 5HPYB 4FGKA 5FOWA 1KTVA 1UBGA 3Q5GA 3ADCA 5ALFA 3PU6A 3W6UA 1JHDA 4RK4A 2XMCA 1DBSA 4O08A 3ZKWA 3HKBA 3Q8MA 1CUJA 5AVQA 1J90A 5K03A 4GECA 2Z6AA 1UPFA 3C15C 1VCMA 3Q3EA 4HNVA 1PZMA 3V1NA 5C2JB 3R7SA 4FGWA 3BKWA 2O2HA 4Q4JA 4RLQA 4WV3A 1L7MA 5KQMA 3O8QA 3D4NA 5IM4A 3Q8WA 5DBIA 3ORSA 5FXMA 1TKAA 1ACMA 5ALGA 1Q44A 4GE3A 3LPLA 3OESA 2IV2X 1GNQA 3CLVA 3SJAA 1VSUA 4NMMA 3ZJ4A 2CT8A 3NBMA 3TQCA 4AG3A 4NBKA 5IZCA 2QRVB 1JKFA 1LK5A 5HS6A 1MO5A 2PL1A 2AQKA 1ESNA 1GIAA 1U0BB 2PJZA 2IEBA 4I5GA 4EMTA 3RHTA 3D7SA 2V7GA 3IPLA 1MDBA 3NHWA 4BNMA 5IN4A 4EDHA 2WT8A 4EFDA 1WMEA 1GG9A 3T41A 1GG5A 2BCEA 3L02A 4LYAA 1HZJA 4K26A 2QT1A 2PUJA 4X66B 3ZG6A 1UOPA 4TUYA 1TECE 4TT3A 9LDBA 1PGNA 4BYMA 2I62A 2YXPX 1AF4A 5EXDA 3EEOA 1U0TA 1XK6A 2WKWA 2E9SA 1V71A 4JBIA 4O2LA 4UM9D 1MAHA 2C8LA 3EJWA 3WRYC 4EUSA 2Z4SA 3DQZA 2QT0A 4JD5A 1QCZA 2XCIA 1DOHA 2IPXA 3LC7O 3B6JA 1ZNXA 4ZMBA 3DP9A 5KI6A 2FYTA 2PUBA 4EQZA 5LXTF 5ICGA 4E1AA 1T8PA 1D9XA 4DPLA 4OGGA 4F93B 3OHSX 1XZIA 3EDOA 5A2GA 4Q1VA 4V3CA 4JI0B 1MNQA 2B7BA 3WNDA 2PQ2A 4GM4A 4LK3A 4LHZA 3ZOKA 3F97A 3ESZA 4RVOA 4TVKA 1E89A 2CCJA 4P4GA 2IP2A 2QZZA 2N1BA 3BHJA 3U2QA 4ZZ2A 4KI7A 3RVNA 3WGTA 2BTQB 2VDWB 4C6TA 1CDOA 2QTVB 3RC7A 1SFRA 1CT9A 2JJYA 4CVNA 5IM4F 2GAAA 2W2MA 3DDHA 2WJPA 4JHLA 4FWTA 1HQKA 1NI4B 1VJDA 3C2QA 3ISJA 5T5QA 1KMCA 3OX3A 5AXDA 2IK8A 3II6X 4CLEA 2P4SA 3U3ZA 3WL6A 4EEXA 3I12A 4ZZIA 1UP6A 1PTJC 4JOSA 4D4JA 3VR5D 4B17A 3ZLJA 3AHHA 1KE2A 2C82A 2LCQA 1SOWA 2ICAA 2B3DA 2WPNA 3ZVLA 3IIMA 1YCHA 3ZKAA 3HYNA 1O8CA 4L4UA 1A3CA 1DWOA 3NEAA 1Q7CA 4DRXB 4EELA 2BSQA 4OY3A 3U31A 3M4JA 1RPJA 1PAUA 3S2FA 2Q9CA 1IAQA 2WIKA 2NTJA 1GFIA 1KDOA 3AM5A 3N0TA 4J90A 3UCEA 4BO9A 4DIKA 2ZBQA 4XR4A 4RHXA 2OV1A 2F9MA 3AU9A 4TUYF 4KI0A 2R8RA 4PAWA 1E2LA 1GPWB 5H5JA 3WFZA 1XRSB 3G5UA 2CBGA 1R0ZA 1I0LA 3W2TA 4LC0A 2QN1A 3D6FA 2F1IA 3P2MA 3L43A 2D5BA 5AW1A 4JP3A 4XX1A 5A7GA 3NDBB 2FW1A 5D1HA 2W42A 1I1QB 1P1RA 4A0HA 2BGGA 5L95A 4U7WA 2DC1A 2KW5A 2QVGA 4UUAA 2H4WA 3PXUA 5ALTA 2JIOA 4A2PA 4AJ2A 2X40A 1XEWY 4X84A 2Q1TA 5K0LA 3KLPX 2P2GA 3KQVA 5KEIA 1TMGE 1MVNA 4FYYA 4Y6SA 5BQ3A 1PL6A 4GZ5A 5CG1A 3BT7A 3G8BA 5AK6A 1FTQA 5LR6A 3O9VA 2JGAA 2YXNA 1E79A 4RK6A 1CZHA 2ODAA 4KWCA 2XMDA 4ZQCB 5EKSA 5JLAA 1KETA 3B5JA 3W3ZB 3T5MA 2VP2A 1YKGA 2B3TA 1ESCA 1NU8A 2IY7A 7ABPA 1HTBA 1VI2A 3B89A 1QTIA 3QVTA 5JLJA 2BZSA 2EQ5A 2FN4A 4NBSA 4WJZA 2D7JA 3NVMB 3JQFA 3W90A 2PMDA 4M21A 2HGZA 2QSYA 3G9QA 3UWDA 4MV7A 6ADHA 3D6HA 1OXUA 3MJ4A 3OZWA 4ZCSA 2FFBA 4CPDA 2DWPA 1WQ1R 2CLKB 3JD3A 4PU0A 4E5YA 4B3TB 1XNRB 5I7VA 2ZRHA 5JAUA 4XQ0A 1BKDR 1JIXA 1R6XA 4HQRA 2A86A 3FOCA 3THOA 4RY2A 3VNBA 1NDQA 4S0XA 3AI7A 2ZRPA 2N1MA 2GB4A 3QWFA 4C06A 3ZGXA 1YB7A 3D5EA 4FKBA 3OURA 5AIAA 1OFUX 1QPZA 4MP6A 2VK4A 4KAAA 5BWOA 1JIVA 1M10A 3IKTA 3X1DA 2WU3A 5FI0B 3GLQA 1W5TA 4NL4H 1EGHA 1SBIA 1H23A 1M83A 4XVHA 4FNGA 4W1SA 1NASA 4EY3A 2DWUA 2RGNA 5FEUA 2H48A 2XYQA 2YNMA 1OFIA 5JJCA 2RBKA 3L4JA 2ZUVA 1YWGO 2VDUE 1SEPA 4OK3A 2H07A 1DKRA 2MSLA 3FD8A 2H00A 3JD2A 5FLYA 2XCSB 5JE8A 3HNPA 2O8DB 2CXUA 4JJZA 5BVHA 2WWYA 3AEXA 2EWMA 4M2LA 4YRIA 4KFUA 1J23A 1N5JA 2R8EA 3TRHA 4UBMA 5JI2E 2GZ1A 2PMWB 1CCWA 3AIKA 3T1NA 4A10A 3E1GA 4L9SA 3QSYA 4ETNA 1U9IC 1W5FA 3ZXUB 2H9YA 3AR4A 3KQOA 4EHHA 3DO6A 3VKVA 2OCDA 2RGXA 3ADOA 4H4CA 2OGZA 4RIFA 4MS1A 1U98A 4M49A 2EZ9A 2R5FA 3WJ7A 4XFJA 4MV1A 4PGHA 4EHIA 5I5GA 3E1KA 2KLHA 3O2JA 1KMNA 1VC2A 4CF6A 1GZ5A 2F3TA 4QBFA 4II7A 4JQSA 3T15A 4MVJA 5BURA 1LPAB 2XWBF 4LPKA 4X20B 1ND6A 3DLCA 3KB8A 4CBVA 3OTQA 2XKKA 2OV8A 2OUKA 3FLMA 4WBXC 3AKEA 2OXCA 3Q12A 1NP7A 3RKRA 4WLEA 4HS4A 4NR0A 1C1HA 2QPLA 3TZHA 1AF7A 2LNDA 3N0WA 3ADPA 3ZIUA 3T8YA 3ZHYA 1ZM4A 2CXSA 2IZ6A 3INTA 1B73A 2KPOA 1M7BA 3H2GA 5TPZA 1FFBA 2F3SA 1JMVA 1LLUA 2I1WA 2IHBA 1REQA 3HVHA 2ECQA 2Z2ZA 5DSTA 2X77A 2VQEB 3B36A 3W2GA 1P39A 4GI2A 1XDUA 2HY7A 5CXXA 5E6UB 3T5GA 1R7RA 1TEZA 3DJYA 2VO1A 2KX7A 1YCDA 2QAGC 1SIWA 1O0CA 3AL2A 5FI3A 1HX7A 4K81B 4BNHA 2W6ZA 2YFHA 5FPSA 2AEFA 3K6KA 4RIGA 1U7TA 1P2UA 4J75A 2JAOA 2NV2B 4N12A 4P5EA 1B93A 3IOEA 3VHRA 5DYTA 3WX0A 5BQXA 1PW7A 4XD2A 4KJZA 4E33A 1ZP6A 2J41A 4UD6A 2KS6A 4INAA 4CKCB 1MEOA 1QPBA 3E5HA 2IW3A 2WA2A 4YC7A 1PR5A 3B52X 3TNFA 4NOKA 5EXEA 2DT8A 3HZRA 1Z6TA 4UVDA 2ZS8A 4X7RA 4O0LA 4YA6A 4BFXA 4FC6A 4EG1A 1EVQA 3MS7A 4KAFA 5CDYA 1T1SA 1OWPA 2FEOA 2VTKA 4H0NA 5LWHA 4RULA 1RQPA 1Y1LA 2A9OA 4RZSA 1S7CA 5L3ZA 3T5CA 1XKLA 2GPWA 1EFPB 2W11A 3R3VA 4NARA 4TS4A 1L5ZA 1P9RA 2WI8A 4ZHQA 2BGWA 1PWXA 2BEKA 1C5KA 4JEHA 4MVJF 5J1TB 3AESB 3TR6A 4FJ2A 1VG0B 2JANA 1M67A 3JCZA 4IHJB 3T95A 3ZBQA 2CNDA 2VDQB 4AJ9A 2RIPA 1SULA 4H7EA 2W93A 2O6HA 3UJ9A 3SVTA 3PC2A 2C9YA 2V7TA 5IABA 1LS1A 4KOAA 1J8QA 1TXGA 1YR2A 3HB7A 3UXMA 3IL2A 1W0JA 3AC0A 1IDOA 1N2BA 3AJAA 3MIIA 4D0GA 2X6QA 1GRCA 3KKMA 4RELA 1EVEA 1XCBA 3K1ZA 1JJFA 2HYDA 4NV3A 2JZCA 3QF4A 4CIYA 1EZ4A 4TXMA 1ZMXA 1I2AA 3LVBA 2ZJ2A 5LZ4A 1IM5A 1RYHA 4R8MA 3BIXA 5KOHA 3TTSA 2Z43A 3STUA 4AF8A 4EUFA 3W7AA 3T3DA 2B5VA 4TMFA 5J5CA 3RLFA 1Q0UA 2LVBA 2X6TA 1QGED 1D4FA 3WGQA 3C3AA 1PJTA 4US2R 2E85A 3STHA 4BCBA 2CVHA 1VPDA 1XQ6A 1GO2A 1TCAA 2O8VA 4HDNA 4HZGA 4BE9A 4ZN6A 3DE3X 2W6MA 1MV5A 1W8DA 4NC9A 4RZ2A 1LTQA 5DNAA 3SVZA 4Q48A 1N3LA 3JQEA 3S5JA 3T54A 2OFWA 3GRCA 4MV0A 2BFCB 3NKFA 2A7QA 3U9LA 2F64A 5K4AA 5M29A 4XIIA 1PBTA 2GI4A 3L07A 2IBSA 4LRTB 2WHQA 3DE1X 1L3CA 2QZJA 4A2WA 4DY4A 1SQ0A 2ZR0A 4HTFA 4QG7A 2VZ8A 3DDCA 1JG1A 3W1EA 4WXHA 1J2RA 4WLVA 2JVKA 1UBFA 2I29A 1CERA 2I76A 2HPAA 2PPVA 3LUHA 3OFKA 3P9XA 3LSYA 5CEJA 5E7MA 2P11A 1XZKA 4J2OA 4JJ6A 4M9SA 4QBIA 3WQQA 4R1MA 1Y98A 2TMYA 5JBQA 3O93A 4ILKA 1IN1A 3V4RA 2JFNA 1T29A 4YB8A 4HZUB 4N01A 2ZBDA 4DS3A 5EE1A 1NI5A 1L8LA 1QAQA 4MYSA 3N6XA 1IATA 4D8TA 4MWSA 4JXZA 1MEJA 2O14A 4GOKA 1G42A 3A4TA 3GDOA 3HN2A 2CFRA 2X9QA 3KJGA 4YRTA 2V0GA 3KD2A 3P9KA 1X7YB 4KB5A 3D7NA 5L4NA 1X8XA 3GQVA 3HA2A 1CTQA 3T0GA 4EGSA 1ISMA 3FE2A 1TZ2A 2ZULA 1OSNA 1U11A 4DEXA 5JZSA 3R5KA 1YQXA 3V2HA 1IE3A 3WK6A 2IH4A 2IUFA 1EI9A 4S0ZA 1O57A 3C7CB 4BHTA 1DJOA 4J0GA 2JA1A 4IKPA 4F1WA 2PH7A 2JLQA 3ILYA 4H1HA 5CVEA 3A6KA 4HVCA 4DCTA 3FR8A 4YO8A 5LIRA 3ORHA 2FSHA 1DG1G 3HPQA 3MT9A 9LDTA 1ZUIA 4YFYA 5DHQA 5ABPA 4UU8A 2OMEA 3U3RA 1HORA 4J9VA 5CW1A 4RX1A 4LHSA 4HADA 2G5CA 1CYEA 4YMUA 1GD1O 1HTTA 2HHAA 3AR7A 3LZ6A 2A9JA 4IUDS 4KBYA 5EWJB 3WLFA 1GUAA 4YRGA 4TVBA 3KM0A 1FIUA 2AQHA 2H1VA 1SIUA 2AW3A 2NACA 5CK5A 2ZCJA 1CEEA 5G40A 3LLVA 2YIJA 4XLLA 4AF7A 4IDQA 3G2MA 2WVGA 9ATCA 3HH8A 1KJ9A 2FAXA 2XYGA 1Y7HA 1T1JA 1U0FA 2WVAA 2YICA 4MKIA 4P53A 4OFBA 1ZVQA 3R0ZA 2DUMA 3NIFB 3H42B 4P83A 2EW2A 3EQZA 3ZWBA 2Y99A 4KIGA 5M34A 2G06A 3E03A 3VC3A 2ZDQA 3NAZA 1Q0RA 3JD1A 1RM3A 4PZDA 5AOCA 5SYMA 1LI7A 4V38A 3TLXA 4BNYA 5FPYA 1JEYA 4F3KA 1E2IA 5DTEA 2FSPA 3IBFA 3V7YA 4B1FA 3OPQA 4B6EA 1SIOA 3AVOA 5REQA 1WVGA 2OCXA 2Q4DA 1BOOA 1CY8A 3UFBA 2JGDB 4BUJA 5CVUA 2AJDA 3VAAA 4ER5A 3IIKA 4TZ6A 3C3XA 4U8GA 5AW4A 4AS3A 1CEXA 3EAGA 1AS3A 4LQLA 4Y1FA 3WK4A 3JATB 1TYCA 2IYFA 5HKBA 5K3FB 2WLTA 5LP1A 1RJFA 4QPDA 5D00A 4LVOA 1SQFA 3Q15C 2AQIA 2P9GA 2RHHA 2HWUA 4X65B 3MB8A 4E70A 4CCYA 3FLEA 3IHTA 1U3FA 3KLMX 4FFNA 3DVQX 1MP0A 3N86A 2IWRA 1M72A 1N2CE 5KAPA 3BE5A 3ZU4A 1G5RA 4RZUA 2ZDHA 3RT7A 1C8BA 3TZQA 4CJXA 2MDTA 4LYJA 1CY0A 3O21A 2CK3D 1EUYA 2BJHA 4TKUB 3I6BA 1CP2A 1A5BB 4JNCA 3GJ6A 3KUKA 1V1MA 1D09A 3ODGA 1OHHA 1KR5A 1IY1A 3H05A 1U28A 2OXRA 2CVQA 1RABA 5BRNA 2C1XA 4A8PA 4I5IA 5EHXA 4DDKA 4HAZA 2PX8A 1G8PA 1T9BA 4WUVA 2ZJ5A 2IHKA 4I9GA 1DKMA 1SU8A 2WZBA 4OGWA 4ZIRB 2ZSKA 2NYVA 3VZQA 2Q50A 2O2JA 4QICA 4XDHA 5JARA 3PXEA 3QA3E 3NBQA 1E3JA 3WOHA 1TTQB 1T4DA 2YHSA 4R41A 4DQVA 4ZT4A 3GJTA 4EA9A 4EQ6A 1EB8A 1SXHA 5EIBD 5IP5A 4O29A 4H6PA 1XJQA 3PFCA 5EJ6A 1NW7A 1P2DA 4IQ4A 3FYSA 3ZXXA 3NTXA 2Z57A 5HA5A 2EX1A 2FY8A 2WM8A 1ZUNB 3WRXC 1CETA 3ZW9A 4JSTA 1SWWA 5E4TA 5AQEA 3T3MB 4D79A 4JBWA 3F67A 3CLUD 3GN1A 4JP5A 3VJLA 2IXDA 1OC4A 4DZRA 3LPNA 2OUIA 1SNYA 2PX4A 4TLAA 1FRQA 3OZGA 1SELA 4X3PA 1BCRA 4N5MA 4M1QA 2PX3A 2C9CA 3TPCA 2IVZA 3BXZA 3IJ5A 3NT5A 4Y9SA 4MQBA 1PJBA 4NBUA 4GXQA 4QC2A 1TO6A 3JQBC 4OD0A 4UDYX 3SC2A 2PU7A 2WYUA 3QXGA 5ELXA 3OQVA 4EO7A 3KZNA 3KQNA 5J2UA 1RZUA 2RAVA 4YV7A 4ZOLA 2Z6UA 4EB3A 4LZLA 1BWQA 2N46A 4B45A 4EZBA 1JIUA 1C2YA 1X1RA 2CSUA 2WOJA 4GO1A 2DQYA 3AOGA 1FDSA 3K5IA 1DWQA 4G24A 4Q82A 3SE7A 2D4AA 3Q0IA 2Q3EA 2GBCA 4QECA 4MUYA 3CLRC 3R0VA 3U4HA 3OTIA 1ZJ6A 4JSYA 1K4YA 3MXTA 4F6RA 1ISRA 2ZLBA 4DREA 4F9TA 1P1IA 3ET4A 1N2EA 1QH1B 2O23A 1D9ZA 4WKGA 2IHJA 4B4DA 4CG1A 4U4AA