2LWIA

Solution structure of h-rast35s mutant protein in complex with kobe2601
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In silico discovery of small-molecule Ras inhibitors that display antitumor activity by blocking the Ras-effector interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords GTPase HRas
total genus 41
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2lwiA00
4DRZA 3BFKA 4PAQA 4XD7D 1F6BA 4B48A 2ZRFA 2RGDA 1QBKC 3KTAA 4C7OA 3LBNA 4OK6A 1XEXA 2NPIA 4MRRA 1T3HA 1KGDA 2CE7A 4GMDA 1ESNA 1JQJC 2GESA 1SVIA 4PC7A 3VKWA 3OESA 1OYYA 1T5LA 2WIAA 5FOTA 3BWDD 1P5ZB 3CX7A 3LNCA 4UXJA 2EFEB 4B3CA 1CLUA 3CZQA 1E99A 4HUQA 4WA7A 3ZZUA 5JEDA 2QZ4A 4PO1A 1VCMA 1ZUHA 4LHVA 4A6PA 4BZQA 1XD2B 5BW8A 2N42A 3SYLA 3AVTA 4X8HA 3RRMA 3MGCA 5G41A 3LFUA 5DISB 5EZ5A 3KXKA 4MYHA 2NO1A 4PAOA 3VMFA 2BHRA 2ZPTX 2UZ3A 3DHWC 1IN5A 2FSGA 3GD7A 3EA5A 2ZSFA 3UMSA 2EYQA 3OEHD 4HDOB 2VTKA 5EXSA 2F3TA 3WRYC 3VNUA 4KYIB 2KBFA 1S9DA 1ZM9A 3AP3A 3AVQA 4BFYA 2Q3HA 2ORVA 4POAA 3QF7A 4Q47A 4QNMA 3BH6A 5GVRA 5AUOB 4Q1EA 3E5HA 2NIPA 4NYJQ 4RD2A 4QKQA 4WAUA 2WWWA 1N2CE 1ZMXA 5BXQC 2WZQA 2XB4A 4JZKA 1Z2AA 5EE3A 2CNWD 1XCPA 4JLNA 3NIBA 3BIFA 4W5JA 5EUQB 4EDHA 2P5TB 3IBYA 5EE5B 2IYTA 1R7RA 4ON9A 4HDQB 4NE2A 4CVNA 2ASEA 5KNBA 4PHGA 3GLFA 3OE7A 1CF4A 3WMEA 4BWYA 1VIYA 2RGCA 5KDOA 3VR2A 1N5KA 2IX3A 3X1XA 3AUYA 1TADA 3NVAA 1XP8A 4KLNA 2X1VA 4LUCA 5TB5A 3B9QA 5CIQA 3RNLA 2V1UA 2F43A 1W36C 1XTKA 2DY1A 1EK0A 4N0DA 2NPFA 3TBKA 4A4DA 5J4VA 2A5GA 1J99A 4LBYA 3ZD6A 2RGNC 1EWQA 1TNDA 2W2VA 2HLDD 4A0RA 1U2RA 1ZIPA 1UF9A 2B7CA 5H70A 1Z0AA 4QFMA 4IXMA 2VYFA 1XDBA 2VP0A 4XWKA 2D7CA 5JLJA 3RDPA 3KTAB 2O8CA 4A0FA 1US8A 3DZDA 121PA 1OW3B 3PEVA 5H68A 4IOKA 1G8FA 1II0A 2W83A 3PITA 4O0MA 2HUPA 1JNYA 3TLXA 4EQ6B 5FH9A 4US2R 1QHYA 3K9NA 2EFCB 2I4IA 4RVCA 1TQ4A 4IFBA 1MT0A 2PEYA 4QNRA 4TL9A 1GG2A 2GWHA 2OSBA 4KSCA 2XNDD 1EGAA 3H4MA 5HCIA 2IF0A 4LY6A 1D6JA 4Y0AA 4IEIA 2WIBA 1FNNA 2KWIA 4TN1A 2PH1A 1Q20A 3ICQB 1TL7C 3BFVA 3GJ8A 3THYB 2JA1A 2GEUA 4IVQA 2ZU0C 2OUKA 2ZUDA 3X1YA 1L8QA 2REBA 4D6PA 3LD9A 4BFVA 5CDFA 2CHVA 2GCPA 1BYIA 1XMSA 3I32A 3MWLA 4MGZR 4P0TA 4OK3A 5D3MB 5CITA 5CB6A 1R0WA 1GFIA 2ZS9A 4Q02A 2JAQA 3GFPA 5EP2A 4KLZA 4BQSA 1ZW6A 3QPVA 1KSFX 1J2JA 1ONBA 2B6HA 5DN6A 2DFNA 4WZBE 3REGA 3VNVA 1LB1B 3SR0A 4PQRA 3RAPR 5FOSA 3AF2A 1FQKA 1XTRA 4IJMA 1O3YA 2XTMA 1AGPA 3WMGA 2FZ4A 2LKDA 1OFHA 4IDHA 3ZS9A 4AIIA 1B0UA 3KB2A 1RYFA 3KUDA 3L2OB 1AK2A 2QN6A 1Y3AA 5TARA 4G5SA 4EUNA 1NLZA 2F9MA 3BC1A 1KO8A 1WMSA 2GVZC 4E5UA 5B64A 2OXRA 4OHYA 1KO1A 3UATA 4JL5A 2IL1A 1FMJA 3V4FA 4NBSA 3Q7QA 2ONKA 2NOAA 4A82A 1CJKC 2H17A 4IDOA 4EPWA 4LOAA 3B13B 4KU4A 4F4IA 4B3GA 1R8SA 4ZI2A 1YR8A 4CW7A 2ZE8A 5JCZA 4URXR 2RH5A 2QAJA 5FI0B 2RGEA 4LK2A 1KHTA 2ZR9A 2AFIE 3PR1A 4BFUA 1SXJB 1VIAA 1ESMA 3OIVA 3W6OA 1NVVQ 1NVWQ 2HDNB 1XXHB 4C30A 1QHNA 2WICA 1A7JA 3I92A 1FUUA 1VHLA 2Z83A 1FUKA 1W0JD 2NZJA 1BH2A 3VKHA 2QMUA 1P2UA 3Q5EA 1ZNXA 3ZIAA 1JR6A 2JLZA 3TUIC 2NZ8A 5AJVB 4L15A 3U4QA 2W6JD 4Z8YA 2EWWA 2QP9X 2O8DA 3OFND 3QY0A 3EZ9A 2GZDA 4URVR 3A1SA 2VP5A 2WM9B 2XTNA 1P9WA 2B8WA 3EIHA 4HB0A 4HB2A 3IKJA 3KQHA 3DPUA 2P6UA 2RGAA 1II8B 1U8ZA 1Z3IX 2GCOA 3PUWA 3QKSB 1V5WA 2G77B 1D2EA 2ZYUX 3PV0A 4G5RA 1NY5A 1Q0UA 4RD0A 1W5SA 3U2QA 2GJAA 1CULC 4TL6A 3SYNA 5HR5A 2QSZA 1N0VC 2R8RA 1G3QA 4NYMR 4BLPA 2FOLA 4B73A 4JVMA 4HLUC 5HPYB 3NKVA 3M1IA 1WBDA 5BWMA 3BJIC 2QU8A 3VAAA 1E2GA 2J0VA 2BBOA 5EE0A 2GTPA 1U94A 2ZI7A 4JS0A 4JLKA 3FKQA 4WXPA 2IYUA 4QXAA 1TAGA 4HYYA 5LD2B 3AF1A 3EZ7A 2GHIA 1D9XA 3QXXA 4ZV4A 1KIMA 3KQKA 4LBZA 1NN3A 2WAXA 5JHHB 4FXPA 5SZIA 3WP0A 1G8YA 5AJYA 3X1WA 1R0ZA 3PCRB 1HQYE 2ZE7A 4L9WA 4PAMA 3RYTC 2O8EB 3W9YA 2BBSA 5C1BA 3LH5A 1XPRA 2B7BA 1XMIA 3B1VA 4BFXA 3GLGB 1UPTA 1JECA 4TZ6A 3R20A 4PC2A 1I4DD 5IT5A 4TT3A 4Q9IA 3CONA 2YINC 5J4HA 4LHYA 4HEJA 4ZDIA 3IQXA 3A1VA 5GVSA 1OT3A 5JWRA 1Z07A 3AVUA 5BQ5A 5FBQB 3IQWA 1R0YA 5DGXA 3W6NA 2QI9C 4XJXA 4BLOA 3W3AA 2KJQA 4Q7KA 1E9AA 4B3XA 4BFSA 1FPMA 2ZI3A 2GXUA 5F2EA 5GJVC 1SKQA 2XNDA 4ZPXA 2JLXA 2AR7A 3VFDA 3SZRA 3BB1A 4BE7B 5TVKA 1J8MF 2F1RA 1VG1A 4OYHA 4YONB 2WOJA 4IKEA 1VTKA 3UANA 2R2AA 1RIFA 1YZKA 2GF9A 2OBLA 2P2LA 3LXRA 5FPSA 5KDLA 3EPKA 2DFTA 1E3MA 1BO6A 5TMPA 5D3MA 2IHBA 1FOEB 4NKRA 2OZEA 1OB5A 1AA9A 1KNXA 5L8VA 3WHLA 1KK3A 1P75A 4WZAE 1RJ9A 4BRWA 2EFHB 4BGDA 5HE9A 1AKEA 1T3LA 5IRCD 5J5CA 2VHJA 2IF2A 1YZLA 4TYNA 3AVOA 5FBVB 3BAFA 4B2LA 1QHHB 4R98A 2OFOA 4WBSA 2REXB 3FKSD 4MA4A 3HU2A 1G18A 3THOA 3LWNA 2WJVA 3K9GA 1VYUA 1GKYA 4TLAA 3D31A 2IXGA 1US8B 4JYBA 4EPYA 1GL6A 4DDVA 3OEED 1RJ9B 4M1MA 2WMNB 4X8MA 4ZDWA 2XJ4A 4AWXA 3ZZ0A 2WKPA 4QBIA 4O3MA 2W0MA 1WB9A 1E9RA 4TLEA 4D82A 2QM7A 2QQEA 2BVNA 1E2NA 3Q7PA 2DB3A 2FZLA 3SFVA 1KK0A 3AQ4A 5L3RA 1H8ED 4GMXA 4CEIB 4DLSA 5KOYA 2IS4A 2ZJ8A 4JLDA 4D4KA 1S3SA 4M0LA 2DWQA 1NN1A 3E2IA 4FCVA 5KO2A 2HYDA 3DOFA 2GXAA 3PQCA 1HQCA 1G3UA 1YRBA 1UEJA 2FGKA 2KBEA 1DOAA 3DKVA 5JBQA 1T4GA 2ZSAA 4LYJA 2ZRLA 2BKUA 1G6HA 2QGNA 5CYOA 3LA6A 1GNPA 1Q21A 2NG1A 4HZUA 2CLDX 4BLQA 1LF5A 4KBGA 1UBCA 1OXXK 1N0UA 4G1UC 4M8NE 4Q9HA 3T5DA 5L3VA 2FE4A 5TY0A 4XVUA 2ZYVX 1AQYA 1E2IA 1QHXA 1UKVY 4OQNA 1EX6A 1TUEA 3OIYA 4G5QA 4Q01A 1T0HB 4L4UA 2A2ZA 4PPGA 5KNDA 1W47A 5IF9A 2FSHA 1DARA 1HUQA 2FWRA 4DEYA 1G21E 3A6PC 2IS6A 3VTKA 4CIDA 5LPNA 4MKGA 5KNCA 5C18A 1ZD1A 3Q8XB 2QEQA 2B21A 4JT2A 2BEJA 3BRWD 4JMPA 3UPUA 3KKNA 5CK4A 2VF7A 1IONA 2Y8EA 4ZIRA 4BEJA 2YNMA 2JDIA 3QNUA 3SI7A 1P72A 4TLCA 2XB2A 2WWFA 1A5TA 1CJTC 1XTSA 3AKEA 3WBKA 4BRUA 2QRNA 2WSMA 2RB4A 2HJGA 3K53A 5FR1A 5EE9A 3LQRA 3QENA 3THXA 1ZRHA 2PJRA 5FL7A 2R6DA 3K09C 1V43A 2HJVA 1M8PA 3QKSA 2FDCA 2CCGA 3I61A 3ASZA 3TSWA 1KJWA 1Q44A 2GNOA 5EXTA 2CBZA 1NVXQ 4NHOA 2KE5A 4Q19A 4MUBA 3RS5A 4U00A 1H8EA 1YKSA 3ETLA 4CYMA 3T06B 4KVAA 2G0NA 3THXB 2BDTA 4RZ2A 4RZ3A 4ERNA 2BM0A 1RRPA 1E0KA 1T8UA 1Z0IA 4NL4H 1QVRA 2EQBA 1JEDA 1KZ7B 3ND9A 1RC8A 5FOWA 4QHTA 5DHAA 3A1TA 1LTQA 3W3ZB 3FOZA 1G5TA 1XU4A 4GSYA 4L9SA 1WE2A 3C4JA 2BOVA 1ZNYA 1G3IA 4LCBA 2P0EA 3CPEA 4TQUS 3AGQA 2H57A 2H1LA 4BEBA 1U90A 1S9HA 3U61B 3LDAA 4JLJA 2GDJA 2W6JA 3DO6A 1YZNA 4UNPA 3ICEA 2ORWA 4MYUA 4JLBA 2JGNA 1XEWY 2FV8A 3ZDQA 4LC1A 3VHXA 2QT1A 1G4UR 2ZSEA 3KB1A 1F3OA 4NYJR 4B3FX 4ABYA 2QTFA 3ADBA 2NO6A 1TQ2A 1G3MA 2ZRCA 3HDTA 4LJ7A 5IDVA 5FTLA 4DLWA 1KNQA 2BCGY 1P6XA 3SJCA 2GETA 3CF2A 3KX2A 1PV4A 4PC1A 1OH6A 4OJKA 2CVHA 2RCNA 5EXPA 2ATVA 3MCAA 4MGKR 1KMHB 4WZ6A 4BLRA 1C4OA 1XZPA 1Z8FA 2DPXA 3E70C 2E9SA 2J0SA 1DS6A 2PEZA 1QDEA 4LJAA 4PTLA 3DDCA 2ZJBA 4HI0E 4MGYR 3KQUA 1RFLA 2G1JA 1AGRA 3L43A 2MSDB 4B3BA 3TMKA 5AJXA 1R6BX 4DUGA 1QG4A 2IHYA 5GADl 2F6RA 3TUJC 3ZLJA 1TMKA 2GF0A 2FPMA 4JLMA 1RZ3A 5CB8A 4ZDJA 1T6NA 3W34A 2OEPA 1UADA 3KKMA 2AXNA 3CRRA 4I1VA 3IHWA 4J0QA 4DDUA 2ZRDA 3AKCA 4LGMA 2C8VA 1YZTA 3GJ0A 2YC4C 3I1FA 3PUXA 3UK6A 2WWYA 4YMTA 1TU4A 1YJ5A 4NYIQ 2IWHA 2ZRKA 2ZRMA 2J7KA 5E4FA 3FWYA 3EPHA 1UDXA 1W0KD 1EFRA 1P2SA 3NDBB 1N6HA 4DHEA 3HPRA 1N5IA 1HURA 2VP4A 4D0LB 3PG5A 3T1TA 1XZQA 3AF4A 2LWIA 1NSTA 4A9AA 2X8AA 2GBLA 2OM2A 4TMZA 1QRAA 2D74A 3EXAA 3N2EA 4XVRA 3AP1A 2AD5A 4A8JA 1IXZA 1E2QA 3DKPA 1UKYA 4M4SA 2CCKA 3EX7C 5B57C 2BJWA 3QBTA 4Y0VA 1OPXA 3ONWA 4TYYA 3R8FA 2XZLA 2BMDA 4EFNA 3EAQA 4BPBA 3IPXA 1TF2A 4TMXA 3FKSA 4GZLA 3IEVA 3EPLA 4KBFA 1NVUQ 4M53A 4EPXA 1DAMA 3G0HA 1G1MA 2VP2A 2JLYA 2W0SA 2CE2X 5LB4A 4F7WA 1W36B 4M1YA 3TQFA 1G41A 5C4GB 3SBEA 2ZRGA 2BJVA 4XSGA 2ZE5A 4URWR 2QP4A 2ERXA 2GCOB 3F5FA 1B23P 1DAIA 3QG1A 4II7A 4DCVA 4QGHA 1AQUA 1ZM4A 1Z06A 3MWKA 1Z22A 4LJ4A 3B82A 3D6TB 1C1YA 1E9FA 4XIGS 1SVMA 5HKKD 4CZ2A 2C98A 5BYJA 3RS0A 2VSFA 2XZOA 5H1YA 1OJLA 1W2GA 2BBWA 1A4RA 3SJBA 1Z08A 2YWHA 5J40A 2JCSA 3ZVMA 5FPYA 5CYPA 2NQ2C 2PT5A 1X3SA 4M22A 4FMDF 4Q4AA 1Z0JA 4ZCMA 2Q3FA 2JDID 5C46F 4M1SA 1NBMA 3CPHA 4JLOA 1AM4D 1E4YA 2BV3A 1JAIA 2A5DA 2HLDA 3K0CA 2HT1A 3EWSA 4NCJA 2JLWA 5F9HA 1YR7A 4Q66C 2ZQ5A 4GI7A 1ELOA 3RVBA 3IO3A 5E95A 3D3QA 5JWOA 1PZNA 2QE7D 2OLJA 2REOA 2ZJ5A 2V54A 2Q21A 5G53C 1WXQA 3B2EA 4LJYA 4JVNA 4I1SA 4UNNA 4WXRA 1ZD8A 1X1SA 2ECKA 2XITA 2PZGA 4Q1CA 2FA9A 3F3YA 1GKUB 1BMFA 1F2UA 5EZ6B 1U98A 5KU1A 1TQDA 2V6IA 5DYIA 3JVUA 1U0HC 4I81A 1G8PA 4OKSA 4BLTA 3I72A 2I1VB 1TU3A 2DWOA 2OCYC 4GZMA 3SYKA 4BZXA 4AKIA 2AFHE 4TSFD 1L4YA 1F48A 3W90A 4XWOA 4EPTA 3LVRE 1FP7A 1L7VC 3AF0A 1MRSA 4TTRA 3BOSA 1T0JB 1P4SA 4C2TA 4P4UA 3ADDA 1FQJA 4LPKA 1NF3A 3SBDA 5LBIA 1RW4A 1TPZA 1Z6GA 3U60B 4PR0A 2JJ8A 2E87A 3EIQA 3HPQA 4XSHA 4AC9A 2GJSA 2I3BA 4G3XA 4Z1MA 1OKKD 4JBWA 4CRWB 5HKKA 4XH9B 3UIEA 4B33A 4OHXA 4NPHA 4FMCF 4FMDB 3PUVA 2FH5B 1ZM7A 2WMOB 4H1VA 4I1UA 1JEEA 2UZIR 1HY3A 3PJRA 4QGFA 4BFZA 221PA 1UJ2A 1CP2A 1G17A 2RHMA 4BFTA 5BYKA 1N5JA 4N3NA 1SVOA 5KSOA 1CJMA 2IYWA 1D5CA 1JI0A 2G6BA 2H92A 4ZKEA 3SQWA 2JJ2A 3TRFA 5EXXA 4KXFB 3X2SA 1YR6A 1PVOA 3IHLA 5CLQA 3RC3A 5JS8A 2ZJYA 1MO3A 1W46A 4UQOA 2VQSA 5G3ZA 1J90A 1Z47A 3IPYA 1XX6A 1KSJA 5KPDA 3GPLA 1OH7A 3SE0A 1YRAA 4V02A 2V8OA 3CH4B 1ZUNB 2Q3MA 5TXGA 2PX0A 3THWA 3QF4B 3OZXA 3CRMA 2X2EA 3T5GA 1I2MA 4B32A 2BEKA 1RE0A 4A2WA 2ZRAA 2GVDC 4FCWA 3ZIAD 2ZU6A 4NDZA 4B2IA 1E0AA 3LLMA 4XTRA 4CGZA 1XCMA 4I4LA 4MUAA 2XSZA 3DMDA 1MR3F 4Q9KA 3THYA 3K0AB 4C0SA 1ZINA 1KI7A 3EA0A 4Q7LA 2FNAA 5FOXA 2F55A 3Q72A 2FPLA 2QPOA 1NI3A 5EP3A 4FMCB 3M0EA 4UXIA 1S3GA 1BOFA 3IGFA 2O8DB 1P7CA 3A36A 1W4CA 2YKGA 3CWQA 4QBGB 3TW8B 2CEAA 3ZH9B 2R9VA 2VIIA 4MH0R 4C4PA 2L0XA 3TSOA 1Z6TA 2NGRA 4U7DA 3AVYA 2ZJAA 1Q22A 1X1RA 3E1SA 3I8SA 4AK9A 2ZRIA 2ZSDA 3A4MA 3L82B 2ANCA 5FUWA 2ODWA 5KSPA 2FFAA 1WA5A 1E94E 2FJUA 3DZ8A 4A92A 5JS7A 2GAAA 5JRZA 521PA 1XEFA 2HCJB 4F38A 1X86B 4N1AA 1E1RA 1IY2A 3O47A 4P4TA 4GOKA 3DM5A 1W1WA 3CNOA 3BGWA 3LX5A 4QL3A 1Z29A 3EZ6A 1FX0A 4JLPA 5EE1A 1WQ1R 2PLRA 1OV4A 3HJNA 5CM9C 3PEWA 1XNJA 1ZNWA 1M7GA 4JLAA 1S8FA 3UMFA 4GPTA 1ETUA 1OFIA 4TYQA 4KFRA 1NNEA 4Q21A 4LV6A 2EYUA 1KO7A 3RWOA 3JZMA 2OXCA 1YZQA 3AGPA 3CPJB 2GBLC 3SC3A 2RGGA 4OQXA 1MH1A 1SXJE 1T8TA 2IYSA 2A5JA 2YOFA 4TMWA 4YMWA 3CRW1 4QRHA 1P62B 5F9FA 4C9BA 1LNZA 3VX4A 2C9YA 3GLFB 2CL7X 4B35A 1HE8B 1FTNA 5FTMA 3B8HA 4JSTA 2RGBA 3K0AA 4M9SA 4Q9LA 3BS4A 1HEIA 1XJQA 4M1TA 2IYZA 4KVGA 4TL7A 3P20A 2J7PD 5J4YA 1GRNA 4RFSA 1E2HA 1U0JA 4B43A 3RRNA 1N6OA 2QPTA 3NHAA 3H84A 1XEWX 2OCPA 2E1RA 1K5DA 4UKDA 3AV0B 2C95A 3O8DA 5HTKA 2RAPA 1F2TB 1LS6A 1M2OB 3GLHA 2Z6VA 5AUNB 3I5XA 2GK6A 3KQLA 1G7CA 1N6KA 3CX8A 4PHFA 1NBME 2YC2C 1DO2A 1JBKA 1NSFA 2EFDB 4Z8XA 2GCNA 2J5XA 1HTWA 1FZQA 4A0GA 5F98A 1DAHA 1PJRA 1D8TA 1NKSA 4ZCLA 1JXOA 5K8UA 5KDDA 1Z83A 4C7OB 2NO7A 3GLFE 3QI2A 2QTVB 2ZS7A 4IXNA 4TMVA 2VLIA 1U9IA 4L8GA 1CS4C 3QXJA 1HT2E 3TIFA 4XOIA 1EFUA 4FW9A 5CLLA 3TE6A 3GJ5A 4DB2A 4QJ5A 2Q9BA 2NO9A 1U81A 2WAYA 3AB3A 1W4AA 4IOJA 3U6KA 3BE4A 4ACBA 4DEXA 1DAKA 4FWIB 5SZKB 5JSZA 2HXYA 2OLKA 1DG1G 4OBEA 2SHKA 1HA3A 2FFHA 2Q9AA 4K8OA 2P65A 1HV8A 1FFHA 3SHFA 3K70B 2WHXA 3KFVA 4JVSB 2CJWB 5LD2C 4FN5A 4RFSB 1KI9A 1E79A 1F60A 2CXXA 3TAUA 4DJTA 2CL6X 3QEOA 4GBMA 2J3EA 3WXMA 3O8RA 2O8BA 2JASA 2WJYA 1RVDA 4HAWA 3OFNA 8OHMA 2D3WA 4QM7A 2PZEA 4PO8A 2RGNA 3QXCA 1BMFD 4DIDA 4RJLA 3GLIE 2VHQA 2DCUA 1ZP6A 3QVVA 4PZLA 3NDPA 4OHWA 4C3ZA 2OT3B 3GFOA 1VPLA 5FBRB 1CBUA 1NMYA 3RRZA 4UNQA 2AK3A 2J1LA 1IXRC 2AWOA 1P61B 2YJTD 4I99A 4KFTA 5DO9A 2HCBA 2QENA 1OXSC 4R7ZA 3TKLA 1RYHA 1WF3A 4QHSA 2DWPA 1KKMA 1TTTA 5JI2E 3CX6A 4DZZA 1LV7A 3CLVA 3UXMA 3IO5A 5BN3A 2IYXA 1IY1A 4RSGA 3R7WA 1X8LA 2WKQA 1DAFA 1LY1A 4Q7JB 3BH0A 1NY6A 4OL0A 3K09A 1NL3A 3G5UA 5CM8B 2QAGC 1U0LA 1AN0A 4C0LA 3VR4A 1AS0A 3S1AB 1NMZA 2G88A 4M9QA 4WOPA 4Q4HA 3KJHA 2Z0MA 1VKJA 4F4CA 2B92A 4ACAA 2D06A 3AKYA 4IVPA 2GZHA 3AH8A 2ATXA 4EPVA 1SXJD 2OILA 1XD8A 1GM5A 1ZBDA 3P4XA 4LJ6A 5TDHA 4R71A 3H86A 2FEMA 2EVWX 1H65A 1DG3A 1XPOA 1N6IA 3CBQA 3C7KA 2O0JA 4KHZA 3FDIA 4V0NA 3M4YA 4DLVA 4LHWA 1P2VA 4PZZA 1KI4A 3RRYA 4C0KA 1R2QA 4KAXA 4C2UA 1DADA 2UKDA 1E79D 3DMNA 4HAUA 2OV2A 4KV9A 1ANKA 1H8HD 4E03A 2O8FA 1VMAA 3FYHA 3C15C 4UJ3A 4PPNA 3K0CC 1Z6XA 2IEZA 2XXAA 4D25A 2PCJA 1DAEA 1SXJC 3UMRA 2R6FA 5DI3A 4M1OA 3Q85A 4GT1A 2MSCB 1P60A 2YYZA 2ZANA 4E22A 2XNSA 1E9SA 1ZNZA 3NWJA 4HLUA 4FI3C 1KAOA 3IBGA 1KDPA 3U6BA 1OB2A 3SNHA 4AG5A 1KI8A 2H7VA 3LAWA 2FMXA 5SZHB 4IOLA 2ORIA 1A2BA 4EIWA 1ZYUA 2ZTSA 5FOUA 3GLGA 1ZCAA 4RZXA 4V0OA 2GEDA 2GKSA 4GOXA 2VHUA 4DSUA 5TV2A 2JEOA 1DVRA 1XJ0A 4YMUA 1UKEA 5JCPA 3VHLB 3C41J 5JECA 2I1QA 5DLQC 1GRRA 1OIXA 1SVKA 2QT0A 3BFXA 3H0KA 721PA 5DSZA 2B8TA 2GA8A 2JLSA 3MD0A 4OQLA 4OQMA 3ZD7A 1CIPA 1G4AE 1IOZA 1VG8A 1P9RA 1KK2A 5EP4A 4HLDA 1AS2A 1S1CA 2J41A 2V9PA 3KXLA 2V7QD 4NTZA 4EJSA 2PLFA 4NP6A 4U5XA 3O8BA 1E2MA 2PL3A 3TQCA 4DLXA 3RHFA 1T9HA 4RD6A 4A8JC 2O5VA 1W4RA 3AVPA 3NH9A 2OG2A 4GP7A 4MRVA 5CDFE 1JPNA 4CT4B 2YOHA 5DI9A 3U5ZB 1GZSA 2IXFA 1S96A 1Z2CA 5KSYA 1P2TA 3MAAC 3THWB 1COWA 3QG5A 4YMSA 1CRPA 1N5LA 2VO1A 2IYVA 1KSHA 3KKOA 3PEUA 3A4LA 2V55B 4Q1BA 3KDSE 3QE0A 1UM8A 2JJ1D 2C5LA 1UFQA 3TUZC 4D26A 3GFTA 4CEIA 3I4LA 5JI3E 2O8FB 4LPSA 2QROA 4IVRA 2BMEA 2FFQA 1NG1A 2JJ2D 4CEJA 1VHTA 4AKHA 3JZAA 2CVFA 1PUJA 3OE7D 1W0JA 1KY2A 2ZRJA 1L2TA 1CU1A 1AKYA 1YE8A 1E32A 1CR4A 1CTQA 1XXHA 2ZYWX 1XBTA 3HYTA 4X8LA 4P33A 1W49A 2XX3A 2YZ2A 4P32A 2LCFA 4PC6A 3U3RA 3T1OA 1XMVA 3VU9A 5DI3B 4Q03A 4QBHA 4YC7A 5P21A 1XF9A 4LYAA 4ZDKA 4GRAA 1R5OA 1E4VA 3I8XA 3SOPA 1E1QD 3RWMB 4D80A 4IEEA 1SKYB 3KXIA 2FG5A 5DYGA 3MLEA 2PBRA 3ZS8A 3C14C 1P73A 4YXWA 1R8QA 3RS2A 4PPFA 5FPHA 4F92B 2YV5A 5GJCA 4AKEA 1T91A 2J87A 2ZAOA 3BK7A 5C2JB 2ZRBA 3EIEA 1EFHA 3CR8A 2GXSA 2BC9A 1KMQA 1LW7A 1R10A 1M74A 3GJ4A 4B3DA 4IW3B 4LBVA 1NVVR 3TH5A 1EXMA 5FL7D 2WPDA 2WJJA 3GJ6A 1G20E 4Q9JA 1K6MA 1IN4A 2AKAB 5CJPA 3T35A 1NJGA 4GP6A 4P31A 3N5CA 4HUTA 4YMVA 2WSSA 4C0JA 4Q1DA 4PSAA 4MDFA 1GUAA 1YZGA 2Q0HA 3N70A 4HAXA 4NMMA 5FBLB 3K8YA 4RFVA 3KKQA 4M2LA 4D2IA 4A1FA 1NN0A 1CR2A 3SN6A 4C0HA 1NLFA 3D7MA 1GSIA 5JEEA 4JSYA 5FUXA 3KQNA 5EQTA 5FPKA 3V4RA 2A78A 1KDTA 2IYYA 4DDTA 1KJYA 3LW7A 2RHDA 1KSGA 4DCTA 1FX0B 3BXZA 1N6NA 3ZVNA 3FMPB 4HLCA 3H1TA 5B30A 2F1IA 1ZU5A 1JR3A 4R2IA 2CMKA 3QKRA 3ZQ6A 4BECA 4QGAA 1Q3HA 1XJCA 4JBXA 4CEHA 4TYWA 2WBLC 3D8BA 2YWEA 3HU1A 1BIFA 1CR0A 1OFUX 2QBYA 5KTYA 1U99A 1XD9A 3B78A 5IK2D 3ADKA 4H9GA 3FMFA 4TLDA 4YLGA 5AUQA 3MWJA 2LKCA 4OJQA 1KOFA 4RZUA 3CWZA 4ESVA 4C0QC 3P27A 3GJ7A 2RKOA 4AI6A 3OIUA 4HAVA 5IHPA 2JLUA 2D7DA 3AP2A 2BWJA 4RD3A 2HYIC 4ARZB 1VCIA 2G0TA 2W6ID 1G8GA 2OO7A 3HU3A 1OXUA 4LDJA 1E2DA 1HE1C 3A8TA 3QBVA 4HB4A 3X1DA 2PT7A 5AJWA 3F0TA 2C78A 1AIPA 3U7GA 2QGZA 3ASYA 2IK8A 4JKIA 2WVJA 5EUMA 3MSXA 4JLVA 4CDGA 1KMHA 1BYUA 1DBSA 3QEJA 4IFEA 1RRFA 1DAGA 2VPPA 2BIFA 5AK0A 2ZI9A 5FOVA 3EG5A 4OK5A 4G5OA 3U3KA 1OYWA 2PMDA 2O8BB 4E09A 2QL6A 1CJUC 3L0SA 2ONJA 4K46A 1QZXA 4W7SA 2ZAMA 3CM0A 4JBYA 3BORA 2P5SA 4EKDA 4US1R 1XWIA 3FVQA 4WVFA 2YWGA 5SZJA 4KFSA 1GILA 4A8JB 5FBWB 1SGWA 2J0UB 2V7QA 3IIKA 4PX9A 3VX3A 1X8JA 3B1WA 3A1WA 4US0R 1MV5A 3EARA 4KFUA 5B2ZA 3BD9A 1KI6B 3LO5A 4TMTA 5EJEA 1A2KC 2GRJA 1G5PA 2CLCX 4ESHA 4HAZA 2QA5A 4KITB 4OI1A 4PC3A 5J4LA 1LFDB 2YOGA 1KI3A 2CLSA 2DBYA 4DLZA 2XEXA 2GZAA 3RS7A 2YHSA 2DYKA 2ZJ2A 1CRQA 3EZFA 2IS1A 3BB4A 3BH7A 4BUJA 3P1JA 3GLHE 4HAYA 5E7MA 3FHTA 4DKXA 2J46A 2VP9A 1JR3E 4IHQA 2ZXUA 2KB0A 4HZIA 4B75A 621PA 1N6RA 4LJ9A 2ZUBA 3DM9B 3NC1C 2AWNA 4NZYA 2VF8A 4WW0A 2V4ZA 3NBFA 2WJHA 4R2HA 1GAJA 4YXWD 1AZSC 1ZC4A 4OQFA 2G83A 4R9UC 1JALA 3I62A 3GMTA 1S1MA 1G8HA 3NBYC 2QSYA 1IBRA 3KZ1E 1SZPA 2JLQA 3A58B 4NYMQ 3MUFA 4S35A 4F91B 1DTSA 2C04A 3AUXA 4CT5A 5HE8A 2HV8A 3N2IA 1JXMA 5AR1A 6Q21A 1NIPA 1XRJA 4LZZA 4M1KA 5KUTA 1OH5A 1EWRA 4D81A 4V0KA 3A1UA 2BMFA 3GCGA 5LDDC 2DFKB 3WMFA 2ZIAA 5L3QA 1ZM3A 1F2TA 1G3RA 1TX4B 3QF4A 3T1QA 4DIEA 2JLVA 4JJKA 2Q9CA 2QE7A 1G9XA 1QVAA 2FEOA 1TEVA 4DCSA 3TVDA 1XFAA 3GEIA 1T3SA 1AZTA 2DFLA 5AWFC 2X19A 2N46A 2XJ9A 2O8CB 4U02A 2AD1A 3FE2A 4URUR 4QC2A 1I4LD 3FMOB 3BERA 2P67A 4GFDA 2QORA 3KFXA 4AD8A 2Q6TA 3GQBA 2BMJA 1TUIA 4Q1FA 1KZGB 4DSOA 2WSSD 2QMEA 4LV5B 2A3RA 4TYPA 1IN8A 4KCGA 3IUYA 2QMHA 2IYRA 1DPFA 1W2HA 4OI4A 3KJGA 4PFSA 3OF5A 1II9A 1P9NA 4G5GA 3VR1A 3WNBA 5FFMA 1QHSA 5FL3A 2H8KA 1Z63A 4B47A 1VYTA 3PVSA 1VDZA 2H16A 4HATA 2H5EA 4V0MA 4A15A 1VG9B 4YDHB 1Z0FA 1ZCBA 1IN6A 2OCAA 3B85A 4C0BA 2R44A 1W7AA 1W48A 2XZPA 1UBEA 2FSIA 3WRXC 4Z1MD 3U4QB 4IRUB 2GJ9A 5D3QA 2W2XA 2Z4SA 4RD4A 5FUVA 3KUCA 1MO6A 4TLBA 4AYXA 4DT1A 2CDNA 4N0EA 3QKRB 2PZFA 2TMKA 3NG1A 5B58C 3W8RA 1QHHA 2R6CA 4ITRC 3NEJA 1G6OA 2A9KA 4OHZA 2BBTA 1E9EA 3IIJA 1Z0KA 1SXJA 4ZIRB 1SHZA 3HR8A 1OIWA 1OLOA 2WPDD 2K5UA 4EPRA 3HYRA 4A36A 3RSOA 2WJIA 3LBHA 2AN9A 4PPQA 1OXTA 1UAAA 4F4JA 3MJRA 2OBNA 1PLJA 1Z5ZA 2C03A 1IY0A 1ZUIA 4XWAA 1OXVA 4P3YA 1S0UA 3FB4A 4JL6A 1Q1BA 3MG9A 421PA 4AYTA 3K9HA 1G7RA 2QY9A 1EFTA 3HR7A 1CXZA 4BZPA 4OI0A 3SHWA 1NLYA 2ZR0A 5BN5A 1Q3TA 3QXSA 2FN4A 4LV8B 4NCIA 2IYLD 4FIDA 3VU9B 1X8KA 2W00A 4AY2A 4OHVA 1GNRA 1KK1A 2QAGA 2X2FA 1TQ6A 2ZRNA 5DH9A 2D4HA 1MO4A 3QPUA 3SS8A 3R8CA 5JWHA 2Z43A 3BB3A 3IILA 2C77A 1HYQA 2C9CA 2O0KA 1J70A 1KAGA 1D2NA 5KSZA 4W9MC 3SEAA 3C16C 3LBIA 5JJLA 1Q12A 3K0FB 3UWOA 3FPAA 3B7GA 1RRGA 4HDCA 3K0SA 5H8WA 3CRVA 3H2YA 1NRJB 3JVVA 4RKFA 4A6XA 1GNQA 1E9BA 1KY3A 4TQ9A 2D62A 5J47A 1OH8A 1KI1A 3CRQA 4LSGA 5KHOC 3K9LA 2AHOA 3J81k 2IC5A 3PUZA 3EC2A 1G64A 3ZYCA 1SVWA 1OE0A 5FPTA 5L3SA 3K0EA 4AG6A 5CIWA 1KI2A 4DSTA 3S1AA 1YR9A 2ZS8A 4MKFA 3SJAA 3QIAA 1JQLB 5A4JA 1EESA 3U7HB 4DXAA 1R0XA 1IN7A 1SULA 4Z54A 3MJHA 4XVQA 4GOJA 5L3SB 3WHKA 1PLLA 2V6JA 2VH5R 3OEEA 1WBBA 1E0SA 3W5JA 3R7WB 2WWGA 3QSYA 2JJ1A 2C9OA 1MKYA 4NU0A 1R5NA 5FTJA 1FP6A 5JJIA 3CNNA 4S2EA 4PHTA 4LRWA 5DIFA 3ZQJA 3R9XA 1Z6AA 1NIJA 3FHOA 1N0WA 1F5NA 2IT1A 5CK5A 1I2DA 4KI0A 4A2QA 1XXHE 4DUGD 3WNDA 4B2PA 1HH4A 3ZGXA 4URYR 1CJVC 1M1YE 5FI1B 2VL7A 2QNRA 3PXGA 1A82A 821PA 3K70D 1W44A 4OI2A 1N6LA 2FF7A 3CKLA 1XMJA 1GL9B 4P4SB 2ZITA 1OF1A 2OHFA 1BS1A 2MSEB 4BFWA 1NG9A 5BN4A 2OCBA 2IUSA 3C5CA 4B34A 3BBPA 1KTVA 1OKKA 1XTJA 1Q57A 3I5YA 1G7SA 1Q1ZA 4RY2A 3PENA 2ODEA 1JR3D 3WNCA 2A30A 1W0KA 4KYUA 4LBWA 4MRNA 2ZM5A 2QUZA 3TAHA 4DCNA 4URZR 2G1KA 3AM1A 2O8EA 5G40A 5ANRB 3TSZA 2IYQA 4IOMA 2MMGA 4TQAA 1E2JA 3OHMA 2OAQ1 3WP1B 3SFZA 3U7EB 5FTNA 1OIVA 3LW8A 4C0AC 3R9IA 1FMLA 3QOFA 5DNYB 3FFAA 3AVWA 2FGJA 4AKGA 2VHTA 4PO9A 2UVQA 2XGJA 2QMOA 2CHQA 1MOZA 2Z5FA 3PUYA 4PSVA 5JFGA 4MYCA 4LHXA 1M7HA 4Q4AB 3WYFA 5JHGB 1MABB 2GXQA 3ZVRA 3EC1A 1A1VA 4HUQB 5J4KA 1E2PA 2ZE6A 3I3SR 2F43B 1E96A 4Q4JB 5E7JA 4E07A 3KL4A 1YQTA 2ZVQX 3I73A 2ZVPX 4B44A 3NHBA 4Q18A 3KKPA 3NBXX 3QKUA 4KJZA 2AX4A 1KI6A 2QP3A 3P32A 2HT6A 2GILA 3K0FA 2WWHA 1SKYE 4H1UA 1KO4A 3QPWA 1II8A 4FWTA 4QHYA 3CB4A 3RANA 3B1XA 2J45A 5FTKA 3AVVA 2CK3A 3ZJYA 2XSZD 1G19A 2DHRA 4LI0A 3GEHA 3FGNA 5EP1A 2CCJA 3W6PA 3CF0A 4WIAA 1ZC3A 3HP1A 5FR2A 3RLFA 1JJ7A 4BASA 2X77A 4Q7MB 3SDZA 2P3SA 3WBJA 2ZJZA 3U7FB 1NP6A 1ZM2A 4TMKA 2H18A 1Z0DA 2CJWA 2C96A 4M9ZA 3AKDA 3IEUA 1IJFA 2PCLA 3LX8A 1C9KA 1ZVQA 3B60A 4JL8A 2XOKA 1TF5A 1E9CA 4MQBA 3DOEA 4PXAA 3FMIA 1E0JA 1MABA 3VR5A 2D2EA 2EU8A 3TR0A 4DB4A 1RRCA 4LYHA 3LRPA 2IA5A 2N1BA 4DVGA 4NCKA 1LVGA 2HEIA 2OE2A 5K8LA 1K8RA 1SVLA 2FPKA 3TGPA 2JIZD 4ZI3A 4QM6A 2GK7A 1WP9A 2ZI4A 3W5IA 4HSEA 5FUYA 4A0HA 1SHKA 2BKEA 4GL2A 4QOSA 1XB2A 1GITA 2WTUA 4DWJA 3RS3A 1GVNB 3ZVLA 2GJ8A 1ODFA 3REFA 1H8HA 3C8UA 4V03A 4DLRA 4EAQA 1AJEA 3T12A 2ZI5A 1VCOA 4ASUA 1XPUA 2ZI6A 2EFGA 1Y63A 2IBMA 3U44A 2GAOA 5GJWC 2KI5A 4ZCIA 2QBYB 2FU5C 4Q48A 5K8IA 2CHGA 2PX3A 2OBMA 3CIOA 5CJ2A 3ADCA 5GJBA 2R6AA 2A5FA 2VRWA 2VSXA 3L8YA 2W58A 2QTHA 1EFRD 1G5RA 1R5BA 2C99A 2R65A 2V1XA 3P4YA 1IAQA 4JIMA 2ZYTX 3V00A 1RPZA 4TZ0A 4GNKA 4RD1A 1GKIA 1IHUA 2C2HA 3QKTA 4HB3A 2O0HA 2DR3A 1YU9A 2ZEJA 4MGIR 3VQTA 3M6AA 1XTQA 2XAUA 1DELA 3FFBA 4MYTA 1M6NA 3TJZA 3LXXA 2KSQA 3EASA 4ARZA 3RSLA 2QPAA 3T15A 5ELXA 2JATA 1KJZA 2J7PA 4I1OA 4B76A 4Q4LA 4D4JA 5F3WB 1ZD9A 5E3HA 4K81B 2WWXA 4FINA 3QJYA 2F1HA 4O25A 4W5HA 2EWVA 3NH6A 3ECCA 4FMBB 1DEKA 2BCJQ 2WKRA 4QJ4A 4V0LA 5C4MA 2XOKD 2IS2A 4M21A 2OFWA 1YHNA 1GL7A 4Q5IA 4EQ6A 1KKLA 4Q4JA 4X8OA 3RC8A 4XTCS 1E2FA 4HZUB 3CH5A 1Z6YA 4M9XA 4IDQA 3U3MA 3PFIA 4NCNA 3EWAA 1J7KA 1KDRA 2QG6A 2EW1A 4QG7A 4PSKA 2VHCA 4D0GA 3QVUA 1U8YA 4ILEA 1DO0A 1GRQA 1PLKA 3MMPA 2J0UA 4DLUA 1OSNA 4XD7A 1NJFA 2QM8A 1WRBA 5M04A 4LYFA 2J0QA 1G291 5DE3A 4CEHB 3CZPA 1E2LA 5DHFA 2AKYA 2WWIA 3CW2A 1QHIA 2W6IA 3RS4A 2ODBA 4KODA 2OAP1 2ZROA 5KYKA 1EG7A 2ZR7A 1TEXA 2WJGA 4RKEA 2V3CC 3TK1A 4JT4A 4JJZA 3K1JA 1KDOA 3VR6A 1GWNA 4RCZA 3PEYA 1PUIA 1W4BA 2G3YA 1E9DA 1YVDA 1S2MA 2ZSBA 1NMXA 2F1JA 4PANA 3VR3A 1IJEA 2IWRA 4B74A 1QHGA 1SVSA 2QQ0A 1M34E 3AEZA 4DLTA 1LS1A 2IW3A 1JB1A 2IUUA 4MRSA 2A7QA 1XD2A 1DE0A 1OHHD 1E6CA 3ND8A 5UKDA 3AVXA 2NMVA 3CR7A 3NEYA 1CEEA 5JJKA 4FCTA 5A5GA 3UG7A 1WDTA 4HLQB 3LLUA 3CF6R 1VG0B 4NYIR 5K8TA 3UKDA 4KSBA 1EX7A 1M7BA 2BM1A 2CL0X 3KJEA 1Z28A 2F7SA 3T34A 3U44B 4UNRA 2WV9A 1R4AA 3LVQE 5JMTA 4NH0A 2MMCA 4ZO4A 2R6GA 3MRSA 1XEXB 1E69A 4QGGA 4CEJB 1IQPA 3OIWA 1N6PA 3W8NA 4JKYA 2P6RA 4YQFA 1ZAKA 2Z4RA 3GP8A 3OEHA 2RGXA 3R9WA 4TTPA 4LWZA 1E1RD 3B6EA 5HZHA 1LF0A 4TWZA 4QBFA 1E1QA 5KPJA 1W36D 2ZRHA 4DBLC 1VCNA 5HZKA 3NTUA 2AXPA 2FFBA 1UBFA 2G9NA 3WYGA 4DDWA 2XTZA 1FL9A 4P4SA 3L0OA 3VKGA 2ZUCA 4CF7A 1N3BA 4LX0A 5LB2A 1FW6A 3NC0C 1GIAA 3U3JA 4D0NA 4ZKDA 4PHHA 1EFCA 5JZVA 3KJIA 4EJSB 4DT1B 3TW4A 3NBZC 1S4QA 3IIMA 2HF9A 3T1VA 1W5TA 1VECA 1SQ5A 2FX3A 4A2PA 4LJ8A 2HXSA 5JRJA 3OAAD 2WOOA 2A5YB 2QAGB 4O2RA 2CK3D 3MWYW 4L5BA 4MKHA 3TR5A 2P6NA 4TT3D 3GLIA 4Q00A 4AYWA 4NCHA 4RCYA 2F9LA 1UBGA 2HF8A 3SJZA 1VYVA 2D2FA 4LHZA 4MDEA 3F8TA 4NONA 4JVLA 4PQYA 4ASUD 1QG2A 4LJ5A 1F2UB 2IXEA 3SU8A 2F3RA 1E98A 4IDPA 1D2MA 2J9RA 5AJZA 3Q3JB 1I4TD 2AL7A 4BLSA 4QJ3A 3EPJA 1XCGB 3DL0A 3G82C 1KO5A 1E2KA 1MO5A 1GP2A 1K5GA 2ZREA 3B9PA 4DC9A 1HT1E 4LC0A 5E7IA 2ODNA 2JIZA 5HCNA 5IK2A 2CNWA 3LY5A 1AS3A 3B1YA 2ZRPA 5L3QB 4TL8A 3U3OA 3CUEF 1U8AA 1P3JA 1T5IA 3P26A 4B71A 5AUPB 3CO5A 2XXAB 4JYCA 2ERYA 4DSNA 1O87A 1XTIA 2ZETA 3B1ZA 2VEDA 3L8ZA 4O2LA 5DN6D 1J8YF 4Q1AA 1JJVA 3B5JA 1UDWA 1Q1EA 3V9PA 3TVTA 1COWD 4Q4HB 1ZIOA 3UWKA 1G16A 4MKIA 3X1ZA 4PZYA 1GTVA 1OFTA 4UXHA 2YWFA 1UKZA 3GEEA 1N25A 2NTYC 4D4LA 1D9ZA 2J59A 4V0ME 3A4NA 3DEFA 3LQQA 4IDNA 1NN5A 3FTQA 3AF3A 3MFYA 3OAAA 4L16A 1BKDR 4DCUA 1MRNA 3QUSA 2OESA 4MITA 4GDFA 4B6FA 2PJZA 3O8CA 1JAHA 2RMKA 2IUTA 3HWSA 4W5WA 3EZ2A 3L0PA 1IM2A 4UJ5A 4EFMA 3RABA 3GLGE 1CKEA 2FSFA 2VP6A 4TSFA 3Q9LA 3K70C 4M1WA 4DLYA 4Z51A 1ZJ6A 3WY9A 3DVLA 3IDQA 3FHCB 4B6EA 1KYIA 5G3YA 2JLRA 1L4UA 1NKTA 4D4MA 5JSZB 4FD2A 3NXSA 2GEVA 3GJXC 3ZZTA 3GJ3A 3TNFA 2VBCA 1FNMA 3Q5DA 2ANBA 2VA8A 3C5HA 1TF7A 3A37A 1IXSB 2VSOA 3GLHB 3T61A 2OFXA 2O52A 2ZJOA 4G01B 3LV8A 1NBMD 4EJSC 1Q1QA 1FTSA 2YVUA 4KO8A 3SQXA 1YZUA 1GDDA 1GOTA 2AK2A 4F93B 2QRZA 1U9IC 3GLIB 3UG6A 1G7TA 1RKBA 2PMKA 2IEYA 1OHHA 2W2TA 2R62A 3EW9A 2GJKA 1WCV1 4EFLA 1ZU4A 3L0IB 3WYAA 1X6VA 3QXHA 4PQFA 2NO0A 4YDSA 3PIRA 1CR1A 1UEIA 3QQ5A 4UNSA 5A0FA 1JPJA 1E2EA 4G0NA 1QF9A 4MRPA 4AURA 4TTQA 3CNLA
chains in the Genus database with same CATH superfamily
4DRZA 2DQSA 1JP7A 5K03A 1AHHA 5AK3A 3VZDA 4PAQA 1AT1A 2C3PA 4CUZA 1RNLA 1F6BA 3DC7A 4FQ5A 4HWTA 3RBVA 2NAFA 2QYTA 2ZRFA 4MUMA 1QBKC 1R88A 4WSOA 1FE8A 2CW5A 4C7OA 1XEXA 1M67A 2NPIA 4MRRA 2PRSA 2CE7A 2CDRA 1O6ZA 4TX1A 4XI9A 3UW1A 3VH1A 5EJ2A 2GD6A 3RK1A 3HSSA 4WNIA 1MZPA 4BNZA 3LL4A 1V26A 3MJTA 1WW3A 3FCAA 3TRIA 3OESA 3U40A 2EG5A 1T5LA 4ENRA 3F3KA 2C94A 4HBZA 4UXJA 1SC4A 2X6RA 3JARA 4KRFA 3ZS8A 1CLUA 4WA7A 3NBMA 3D8TA 1YZ3A 1F8FA 1NHGA 1VCMA 2YXBA 1U6KA 3KAPA 4MKXA 2VJAA 1I01A 4O4JF 1DKOA 1E3DA 5BW8A 4EW3A 2N42A 4FYYA 1SWWA 2V5AA 4H3VA 3SYLA 3AVTA 2VI5A 2C7BA 3O8NA 5EI5A 1QV7A 5IJWA 5F1YA 4L5IA 5EINA 3IL2A 1PSWA 1Z35A 5EZ5A 3KXKA 5ULLA 4UE3S 5GGXA 4MLPA 2V4UA 3T3DA 2BHRA 2ZPTX 5C8YF 1FYXA 1NVDA 1YDMA 2UZ3A 2HIHA 4M8SA 4JASB 5LZ8A 4EY4A 4R2LA 1F0KA 3GD7A 4V0SA 5FQNA 2ZSFA 2BGRA 3UMSA 1XA3A 4HDOB 4L9AA 3ZCVA 5EXSA 4HY3A 2V7WA 4X54A 1Y5RA 3PZRA 4JWTA 2KBFA 5BQPA 3QX7A 5KQLA 1ZM9A 1WUTA 3AP3A 4FEGA 1CG6A 3KYBA 1DJPA 4FHFA 4POAA 3QF7A 4Q47A 3IAM1 4LDRA 5AHKA 1KE1A 3NAMA 5AUOB 2JHGA 2VJQA 3HJHA 3WQQA 4EQZA 5K20A 2X6TA 2WWWA 3T94A 3TE7A 2H5JA 2WZQA 1XMPA 2MTBA 3CLSD 3DUWA 1ZJZA 2O54A 1Z2AA 5EE3A 1XCPA 4PHCA 2B1GA 4G63A 1KARA 1VLZA 3PXEA 3NIBA 2FX5A 2G8LA 4W5JA 5EUQB 2VNHA 1GGNA 1N2OA 2WC1A 1TO2E 4RH0A 4EDHA 3IBYA 2C2KA 2IYTA 3SSOA 4ON9A 4ROSA 4HDQB 2DX7A 1BE0A 4NE2A 4BWGA 1QAMA 4U2BA 1JHXA 1SXHA 4MV6A 2B5VA 1LNQA 1WUKS 1GKLA 4RMGA 4U1RA 3WMEA 1CF4A 3D6VA 4E30A 2G7MC 4NU6A 1C8VB 4BNDB 1IHOA 2QYSA 2EBWA 1J56A 4BWFB 4TUYF 5CIQA 3RNLA 2DY1A 4DBLE 1FRNA 2W42A 3CXRA 3JTMA 1J99A 4KOAA 3FTFA 1LSSA 2FEWB 1HE2A 1SA0B 2H1HA 1TNDA 4A0RA 3N86A 1ZIPA 5H70A 4QFMA 3F49S 5JLJA 2XMQA 3KLPX 2D7CA 4JEMA 4KGXA 4WNYA 3ESBA 4QYWA 2HI0A 3KTAB 3OBIA 1US8A 5KMGB 3P19A 4FFDA 3D59A 3UMCA 2AZTA 5CH5A 2UZAA 121PA 1OW3B 3PEVA 1S2LA 4U9HS 2WQ7A 2HK6A 1DRUA 4US2R 1QHYA 2EFCB 1P2BA 3IQIX 4PBSA 4ZCRA 4FMPA 1G4HA 4QNRA 1BXZA 1KVTA 1V37A 1ZDMA 4WFIA 1UPFA 3GD5A 3W4JA 4CF3A 2XNDD 5IF3A 4E7PA 4JQOA 4LECA 4R9VA 4JQSA 4K6OA 4R1QA 1D6JA 3T3HA 3DMFA 1O1YA 3I2YX 3LPDA 4LA4A 5CMLA 3WBFA 1Q20A 1Y1QA 3W1VA 3ICQB 2VDVE 3BFVA 4F4UA 3DPSA 3SFTA 1PG5A 2FYTA 2GAFA 3DE0X 2ZUDA 4L8WB 1NU6A 4M55A 5BPFA 5FAKA 5IASA 4WCDA 3RV4A 2HL6A 4FB5A 1RXCA 3OECA 3AIMA 2QT9A 2GPAA 3BCRA 3WISA 2HF2A 4MGZR 4WBNB 2ZB4A 3DLPX 4ROTA 4UREA 2RI0A 3AJEA 5IARA 4DREA 1GTG1 2ZS9A 3C3PA 1QYIA 3GFPA 5A0TA 4WERA 4U7TB 1GFWA 1ONBA 5DN6A 1W73A 2DFNA 3Q1KA 4Y9SA 5T4BA 3SR0A 3WHIA 4PQRA 1KGSA 2E2WA 3IT0A 1M0TA 4KW7A 4S1WA 4L5AA 5IFKA 5FOSA 2C58A 4IJMA 1KZ6A 1O3YA 2YV3A 5CVJA 5GY7A 4IDHA 3VBCA 1X0VA 3ZS9A 1B0UA 1CE8A 3KB2A 3L2OB 2QN6A 4Q24A 1C7RA 4RQBA 5TARA 2WD7B 2F9MA 5C3UA 8ADHA 4NY1A 1FP2A 1S8OA 4YCLA 4P5DA 3E9DA 4BO7A 5B64A 4UC0A 1H23A 2OXRA 4XZ3A 4OB7A 1KO1A 3PC8A 3RV3A 3OO1A 1UIMA 1YULA 2NOAA 3ISVA 4HGYA 4RPCA 3LYLA 4P3OA 5IDYA 4EPWA 4LOAA 4MP3A 4F4IA 2ZUVA 2WSBA 3TW6A 1NW9B 5BSMA 2NPOA 5FKJA 4UTVA 3G88A 2DERA 4TKVB 1T6XA 3TQFA 2JZOA 2QAJA 5DBOA 1AQLA 2RGEA 3SQXA 2YN4A 2ZWVA 5J63A 5IZCA 4BQIA 4KQFA 1HDGO 1VIAA 3W6OA 4CFSA 4PYMA 2DHEA 2HDNB 4QNNA 1Z5NA 5K0BA 3H04A 1HOTA 1K27A 2PMBA 2JAPA 1UMCA 2VRBA 1P1KA 1XQ1A 2JARA 1O8BA 2JAXA 5FF9A 1UBMS 2NZJA 3SLKA 1CQIB 4MVJF 1H85A 1SG6A 4FJ2A 1LSJA 4MEAA 3ZIAA 2QTMA 4C7MA 2JLZA 1V95A 2C4TA 1JR6A 3TUIC 3W3AD 4F1WA 1FRQA 5JALA 3EVDA 2FW0A 2W6JD 5SY6A 5MN5A 2QP9X 4GXTA 4ND3A 4WCFA 4D6YA 3JAKA 2X7HA 3OPYB 5EQDA 1UBLS 1R15A 3TPZA 4I66A 1KWGA 1ECLA 3EZ9A 1MFZA 2FMKA 2IIPA 2PS9A 5CX4A 2YV2A 4CCSA 2C2ZA 3RHSA 2L69A 4JXXA 2P6UA 3Q8KA 1II8B 1QYVA 2P6OA 3PUWA 5T8KA 3VM6A 1M8KA 3MOSA 2G77B 1L5GB 4YJFB 4N0PA 5CCXA 1NY5A 4XASA 1NMQA 4ZFNA 1Q83A 2KLBA 3QLJA 5FLKA 4G5FA 3RVKA 3TXAA 4J2TA 4TL6A 1NZFA 2R8RA 4N40A 2PGDA 3ZE1B 2OCXA 2XNHA 1QFZA 3TG2A 4IGKA 2EX0A 2G4VA 4YGYA 4U9UA 2D1QA 4BX2A 2NZWA 4NLLA 3VAAA 1E2GA 5EIOA 2BBOA 3PZBA 5EE0A 2ZI7A 5ED0A 4JLKA 3FKQA 3SR3A 3VMMA 1SUCA 3D6MA 2M6LA 5I4CA 4MR9A 1Z36A 3OT4A 3QXXA 3OURA 3O8QA 1BCRB 1KIMA 5ECWA 1KQPA 2WAXA 1LRKA 2PU7A 3DR3A 5DM4A 1W76A 3CEHA 3CJQA 1G8YA 1E62A 3DXFA 2JLBA 2YN0A 1ZOSA 3HM9A 2BGWA 1BEZA 1R0ZA 2ZE7A 2O8EB 2J4FA 2QRVA 4C43A 1PT7A 3H1AA 5JASA 2BBSA 4KR7A 4I9NA 5A3QA 4BL5A 3S1SA 3RTEA 1MB9A 3LXUX 3TAXA 1CUVA 3B1VA 3C3AA 5ES4B 5HQ3B 3DV9A 5C1DA 4TZ6A 1U31A 3RWBA 4ND5A 4PC2A 1SXPA 3K6JA 5IT5A 2RJNA 2RK4A 2YXEA 3CONA 4CKBA 3WLJA 4ZYTA 1BWRA 3BN3A 4X7RA 2HMSA 5AM1A 2VFAA 2Z8YA 4LHYA 4CMHA 1L1QA 3CWCA 5JWRA 1ZK1A 3KWFA 4H6VA 5BQ5A 3AVUA 1UINA 1CUXA 2AF3C 2Z57A 3GZNA 4ZVKA 3S81A 2QI9C 4XJXA 5HS4A 4E5NA 4LFAB 1CUIA 2GXUA 1K3FA 3VU3A 1NONA 4CTOA 1PI3A 1RU3A 3G68A 4ZPXA 1J25A 2JLXA 3VFDA 3G3EA 5TVKA 1J8MF 1K8YB 3B6KA 3IUJA 2XDYA 1IC6A 1VG1A 3JSXA 4P4LA 1M8FA 4OYHA 4O4HA 4U7WA 5DCUA 4YONB 2HBQA 1LPNA 4UARA 4R01A 3RO7A 2DGDA 1YB7A 3GPBA 4FE3A 3EPKA 3WSVA 3U17A 2NXCA 4I6GA 2IHBA 1FOEB 3HO8A 1AUOA 1T0IA 1AXEA 4Z1OA 3O90A 2H2FA 2CMDA 1M66A 3AR8A 5LA6A 1SZDA 4RHEA 3K5IA 2R1UA 3OOSA 1QXSA 4WZAE 4BJ1A 1AUXA 3LECA 4BGDA 4LF5B 5HE9A 4D7AA 3GMSA 5JZ9A 5IRCD 5J5CA 1E7QA 1U28C 5SYNA 1P4AA 1ZH4A 4BGEA 2WA1A 3CEJA 2AJCA 1TJYA 4CG0A 3M6UA 1R6VA 4Q15A 1N2ZA 3A9CA 3HU2A 4B7ZA 5IH3A 3P9CA 1WU7A 3SX4A 1JXAA 4F56A 3VDXA 3VYSB 5FORA 1GKYA 4X64B 5JZMA 3WKDA 1US8B 1GL6A 3P9IA 3GYBA 5T41A 2VUTA 3M4NA 4I1YA 4GWGA 2FJPA 2XUKA 2XWBF 1AN9A 4UCWA 5KTOA 1LZLA 4AF8A 2FWNA 4HWRA 4ZDWA 4BVJA 1YF3A 2Q5QA 5TGDA 3G9XA 2WKPA 1ONNA 4QBIA 4QODA 4AWXA 2AEEA 1RRVA 1E9RA 1FJHA 2IE0A 2WNIA 5EEHA 1ARZA 2CLOB 1R9NA 3HTXA 4NHEA 2H7XA 2QM7A 4QARA 5CVVA 5DHRA 2BVNA 5CDTA 1ZH2A 3VBEA 4ENWA 5KYYB 1CFJA 1J8DA 3OZCA 2RBKA 4DUPA 1J2EA 2JJMA 3CTMA 4BN0A 4YJHB 2IS4A 2UXDB 4OBXA 3ENWA 1DCKA 1NJ2A 2ZJ8A 3WJAA 4UTPA 1Q19A 3CRZA 3CINA 1R5JA 2A1TS 4JLDA 4N7MA 4B80A 4D4KA 2C4KA 1S3SA 1Y1PA 1FRVA 1ULZA 3CLTC 5DW3A 2QUIA 1WMDA 5IKOA 4HNAA 5KO2A 1XWWA 3QFTA 1HQCA 3DMTA 1YRBA 2CZQA 3DV2A 1X7DA 1UEJA 5ALYA 1LA2A 4RO0A 1VSUA 2JGKA 5JBQA 3UKJA 1L7BA 3E82A 4WXYB 4D3DA 2WT4A 5AI8A 5I4KA 3CZCA 1XZGA 1JN0A 3N2KA 1D2CA 5I7HA 4AJIA 3RTCA 2RBGA 1SFRA 1Q21A 3JD2A 3OPMA 2HH9A 2Q1UA 4PAGA 5ADWA 5LU8A 1TK9A 2NX2A 1R0KA 1IBKB 1JGTA 3VKFA 4CG2A 3M5DA 2ZYVX 1QHXA 1UKVY 4OQNA 4YT5A 3THRA 2Q1YA 1TUEA 1FX1A 2SECE 1IBMB 1ZGGA 1HO3A 4Q01A 1Z2PX 1KIAA 2WFLA 3QUTA 1XU9A 4GZ5A 1HDCA 1HUQA 4DEYA 1USKA 1RXVA 5JQGA 1CPYA 3M81A 4XFJA 3FZNA 4AP5A 4B1FA 5C18A 1JYFA 1ZD1A 1Y89A 2GGSA 4YAOA 2O2EA 3IPLA 2YL2A 1Z7YA 3PRKE 4FHGA 3MLBA 3FRJA 4AZTA 4JMPA 1G60A 5J2TA 1T3TA 2VF7A 3N0VA 4ZIRA 5LKRA 1Z8HA 2H1CA 2YNMA 4HS4A 3WFJA 4TVSA 4MWOA 2JDIA 3EEBA 1YL6A 4ZV7A 3ZCXA 2Q99A 2RG7A 1CZLA 1N3YA 2H4JA 1XLUA 1QLWA 2WWFA 2IIQA 4LMPA 2C82A 3WYNA 1TA0A 1K08A 3WBKA 3A2NA 1A97A 2QRNA 3MBOA 2ATIA 1T26A 2AOUB 4KXVA 1ZICA 1NQAO 3A31A 3KOWA 3PXXA 4FHCA 3PNKA 1N57A 1RHMA 3ONFA 3IEMA 1A95A 3ESAA 4IFIA 1WOMA 2R6DA 1ZO8A 3F2IA 1V43A 2E0IA 2ZXFA 4IHJA 2YXPX 4EO7A 5L6LB 4FGWA 2CCGA 4MV5A 3TSWA 5BR7A 4I50A 5KYVA 2AX3A 4EA8A 1XO1A 5FPPA 1BRMA 2H4ZA 1Z37A 2J3HA 2V7EA 5GAJA 1G0NA 4NHOA 2KE5A 5ALWA 1DTWB 4EHJA 3PNPA 3QPAA 1HNWB 1DJOA 2PSDA 5HYVA 3ETLA 2VNIA 3W04A 1YVUA 2G0NA 3AIOA 1AG9A 3H1PA 2BDTA 4AF7A 4ERNA 2R6JA 3G0GA 4OXXA 1RRPA 2PZAA 4MUYA 3UT5A 3R9XB 4PS1A 1X1BA 5IWAB 3ASUA 5LBTA 3UJAA 1QVRA 3UT6A 2YR0A 3OFJA 4RJTA 4MB6A 3NORA 5F7OA 3STWA 1P33A 2XMRA 4QHTA 1LTQA 1Z82A 2W48A 3ANLA 4WESA 5KVSA 5MFPA 4IJKA 4GSYA 5EFOA 1GUZA 4QUBA 4CKYA 5LNK1 3C4JA 3KUKA 3TPCA 1KPHA 1RRMA 3PE3A 4LCBA 1JAZA 2P0EA 3IV7A 4HDMA 3B48A 4HDSA 4AMBA 3IHTA 4ISBA 3HZRA 2F3PA 5C1OA 1S9HA 3ONVA 4BMVA 5C7YA 2NLOA 4JLJA 5IUJC 4BP9A 1YZNA 1Q5PA 5BY2A 4DV1B 1NXQA 3EGVA 2BEUB 1BFDA 2ORWA 4MI3A 5FQOA 4IGAA 4MYUA 4OKNA 3KLBA 3ZWMA 4A0SA 4BV3A 1H4TA 4MYSA 1PJTA 1Q7BA 4LC1A 3J80A 1NFRA 4A91A 1G4UR 1GUYA 1XQVA 2JRCA 1S2DA 4MXDA 1BGWA 1M73E 2Y1CA 4B3FX 3T6KA 4E2ZA 1TCUA 3D81A 2QTFA 3ADBA 2NO6A 4L7VA 1G3MA 4GM0A 2CVQA 2GI4A 3IUPA 4HDSB 4N8EA 4YRTA 5IDVA 2BCGY 2C00A 4IIJA 2HWXA 4D3XA 4DS3A 4TRMA 4RIFA 5TPWA 3QEMB 1CY4A 3M6IA 4MGKR 1KMHB 2B7LA 3JYOA 4TV9A 1SMKA 5FOQA 2ADFA 3E70C 5FBZA 2J0SA 3TZCA 1DS6A 2V6BA 1A9QA 1P0PA 5LUAA 1NUTA 4HN4B 4PTLA 3QEBZ 4MGYR 2TMGA 2D54A 2I2CA 4P92A 3KQUA 1PEYA 2R4UA 3L43A 4LK3A 2LCQA 4B3BA 1EUDA 5AJXA 3CJRA 5IHXA 1ULSA 4DUGA 3HB9A 2XUAA 1Z4LA 3LUGA 3ST7A 1RZRA 3TUJC 4JLWA 4XR4A 3KLOA 3G5AA 1ULAA 5AJUA 4XWGA 2FPMA 1UBHS 3D1VA 3DHNA 4CR8A 3KS9A 3PDJA 3HJAA 2PK3A 3F3SA 4DDUA 3KKMA 2AXNA 5AKLA 3RKRA 1MLDA 3ANNA 2X3UA 5A05A 4NK4A 1J00A 4RHTA 1WUIS 3GJ0A 4CLRB 1XJ5A 1F3LA 2DLCX 3NNSA 2A9OA 2FP4B 3C1AA 4H3KB 5EAIA 4ZT6A 4C4XA 3RR2A 2PTGA 3T54A 1YJ5A 3DQZA 4YMTA 1EXVA 1NJ1A 4DR7B 1KVRA 5AVTA 2ZRKA 1NE2A 3IALA 3UQYS 1TLLA 4Q3OA 3PBKA 5K99A 2FPIB 1W0KD 1EFRA 1HZZA 1P2SA 2P1RA 1OLXA 3PWKA 1LFAA 3HPRA 4D0LB 5A5DA 1QIHA 3PG5A 1BMQA 2GX6A 4OMDA 2JFBA 1GSOA 4BB5A 2LWIA 5CLIA 3IIEA 1WVGA 2WJZB 3TLMA 2JIOA 5KNLA 4LJRA 4UM7A 1MJGA 2GBLA 4MSUA 3CU5A 2D74A 3L1IA 3N2EA 3G17A 2IU4A 3BIOA 4Q7EA 1FF9A 5TJHA 2JD2A 1FU7A 1XQ6A 4RM2A 3PYXA 2VWPA 4IIDA 2ECPA 4Y2TA 3UQZA 2AN4A 2D13A 3NEAA 3D8NA 1DOZA 1C2TA 1HWYA 1ATZA 2W43A 1UOPA 2ZOSA 1L3BA 3R8FA 2BMDA 4OL9A 2ZJFA 3E9RA 2XZLA 4IMRA 1NNSA 4GZLA 1VRWA 3T5TA 3IEVA 4KBFA 3G5TA 5I7SA 4ZCPA 3G0HA 1G1MA 2JLYA 1TJPB 2CE2X 2DPHA 2FQ1A 3AOGA 3L6UA 4IYRA 4M1YA 4GI5A 1H2AS 5EY5B 4LOKA 2BJVA 4WOJA 1SKAA 4W8GA 2ERXA 3F5FA 3GZJA 4I1PA 4FYVA 5EIFA 1VYHA 1UBUS 2JAUA 2P2CA 3H5TA 4MA0A 2A6PA 3MWKA 5AW6A 3H4TA 1ZS9A 4HNHA 1Z22A 2Q50A 3VPGA 5YASA 2XCRB 2FCAA 1C1YA 1DEAA 1BHJA 4OTZA 5CFNA 5HKKD 1RMYA 2MU1A 2C98A 4YPVA 1QBGA 5G1PA 2ONCA 2G1PA 5T5QA 1I5EA 1OXKB 4GX0A 1OJLA 1W2GA 4ZZ0A 2E18A 3EDMA 2X0DA 5JNUA 4FYHA 3EHEA 5AXBA 3C3KA 3E1KA 1MDBA 4TM8A 1JZTA 2A4MA 4R40A 1GD1O 4Q0MA 4D5EA 3ZVMA 4IDGA 3GC6A 3UXYA 4HNVA 1WXHA 1ADJA 2FQYA 2IEDA 4KACA 4M22A 4Q4AA 5HA5A 1Z0JA 1QYDA 2Z2ZA 3O9VA 4ZCMA 3OOJA 2EXXA 2JDID 2X9LA 5B3AA 5C46F 4JBGA 3DE6X 3WDSA 1BA2A 4M1SA 2JGAA 1BCSA 3CPHA 4FEAA 1L7MA 1JDNA 2HT1A 2HLDA 1BU8A 3EWSA 3ESZA 3QLEA 4RK4A 5F9HA 1PW7A 3LGSA 1PCXA 4GI7A 2HM7A 4FFOA 4GPZA 3ZK9A 2HDHA 2QE7D 1LUAA 1WXIA 2AMVA 2REOA 2ZJ5A 4GM4A 4FB4A 1A96A 3GUHA 5DX8A 1WXQA 2FUG1 1CHNA 2FOXA 2ZBQA 2R79A 3A1EA 3B2EA 4H18A 4JVNA 4XDYA 3VV2A 3IOMA 3C98A 1X1SA 5DEOA 3ZXUB 2PZGA 3EXFA 2FA9A 1CZRA 1GGVA 1UMBA 4BAGA 5JCXA 5JXIA 3AUJB 3COJA 2IU6A 1OWPA 4JI4B 5AI5A 3WGKA 3JVUA 4KYVA 4E4TA 4I81A 2VCYA 5JNRA 5LIRA 3IDZA 5LU9A 2DKFA 2HTEA 5FBHA 4TT8A 2QX7A 4B40A 4BLTA 1C30A 2QS9A 2I1VB 3RB8A 3SYKA 4KVZA 4AKIA 4B79A 3AB7A 3CMCO 2BYTA 1ESCA 1L4YA 2AN5A 2X2OA 1TCAA 4UUAA 2J3DA 3TZKA 3L8HA 3UGQA 4XWOA 1V47A 2DJ5A 4RIIA 1B8OA 5BMOA 3L8GA 3OCJA 3BOSA 4TTRA 5EYPB 1V8FA 3PB3A 1FSGA 1W9HA 4OM8A 3BHJA 3O73A 2BHTA 3RUCA 1W93A 1RW4A 2PMFA 1EBUA 1HLFA 1R4ZA 1WL8A 4NU5A 4ZVVA 4LNHA 1OBOA 4EHKA 1Z6GA 3U60B 4PR0A 4K6FA 4O08A 2DKNA 2E87A 5A04A 2JH8A 3DBRB 4Z1MA 4G3XA 4CBVA 5F5XA 4GD3Q 3RFVA 2C9ZA 4DIBA 5HKKA 1B0PA 3DYVA 3RSHA 5I9NA 2YMPA 3PT5A 4BGIA 3DHYA 4FMDB 5TC4A 1NLUA 4C89A 4AUKA 3HGMA 2WMOB 4I1UA 4QUGA 1H4SA 4PYKA 4BO6A 4GXQA 2P77A 4M0EA 1JEEA 4C06A 5DGDA 3U4HA 1Y34E 1WV0A 4QGFA 221PA 1TE2A 3DFUA 3ZE0B 1JFTA 3L7JA 2PGXA 1G17A 3C0KA 4DTIA 1CEEA 2FXVA 4IZHA 5K51A 2FMFA 5BYKA 4UUNA 3OLZA 3L7BA 5EMHA 1CJMA 5JSYA 3ROMA 5DP2A 1TM7E 1ISJA 1BG6A 1D5CA 2B8EA 2QRVB 1C0EA 5DB4A 2JJ2A 3TIGA 4RMIA 3UN1A 3SQWA 4L50A 4KXFB 3E3NA 4NH4A 1IVYA 1RCUA 4JQZA 2P9JA 3BEOA 2Y4OA 4LXXA 2F17A 5CLQA 3RC3A 2HHHB 2AN3A 3MS4A 3JQ9C 1RYNA 3RG8A 2QUAA 3ZHXA 3RVOA 4TWBA 1WXXA 3KEFA 1J90A 1Z47A 1CQJA 2GUGA 3A9UA 2H59A 3GUUA 3O1IC 4OAPA 3L7IA 1EA7A 3HYNA 2YWRA 1ZCFA 1OH7A 2GPNA 3ORFA 1Q7RA 4F5DA 1Q77A 2C29D 3CLRC 1JDJA 1ZX1A 5TXGA 1HSOA 2QZ9A 1ECPA 3L06A 3T5GA 4B32A 5JJCA 1DINA 2VUUA 3LC1O 3QSGA 1CT9A 3WJ2A 3NHYA 3VHRA 3X1KA 2XB8A 3G8YA 2ZU6A 1OWNA 2LPMA 3EXG2 3LLMA 4B3MB 2Q4OA 4HDKB 5AW4A 3L7NA 3IKTA 3HXQA 4MUAA 1DRVA 1GA1A 3ZWNA 1IZ9A 5THKA 3WGYA 2IUFA 2VXCA 1JWAB 4PTYA 2NQTA 5JSKA 3WJ7A 3EA0A 2XCSB 3QGMA 4CMIA 3F4BA 4HFRA 2QPOA 1M3SA 5EP3A 4C4TA 1HL7A 1UFVA 4EYOA 1QKJA 2OVFA 3R76A 3V97A 3EUEA 1N92A 3FNGA 1S8AA 3JAKB 4UXIA 4Y9RA 3A36A 3EFBA 3H11B 5EMKA 3CWQA 3JYPA 1UK9A 2JZCA 1NDQA 3TW8B 3ZH9B 1GN9A 5DYNA 3JQQA 2R9VA 3L40A 1TUBA 3LUBA 4FT2A 4J0HA 4MH0R 4C4PA 1N7IA 2CF6A 1DXYA 1TJ5A 1DQNA 4GW3A 3HYCA 4YV0A 3CW9A 3NANA 2NGRA 4D9GA 2AEMA 4JB0A 5TR9A 1CWUA 3DWGA 3U56A 4NZMA 4AK9A 4LXTA 3PQ3A 3RGWS 5INTA 1EQ2A 1Y9AA 1GVHA 2ANCA 2O2GA 3LQKA 5FUWA 5C34B 3IAHA 1QH9A 4KDRA 4PGFA 5A3RA 2GAAA 1BJKA 1ODLA 1R12A 2PGOA 2HCJB 3AEUA 2PKRA 1JLLA 1QO0D 1ADBA 4X45A 1QOQB 3DM5A 1KJ8A 1PJ4A 4KQ2A 2JCVA 3TD6A 3W6ZA 3LOPA 4YN3A 2O8NA 1HG0A 3C2QA 3EZ6A 4FPXA 1Z2OX 4FHDA 5DEIA 1EDOA 4D43A 1ECGA 4QOHA 4DV3B 4EG5A 2PLRA 2FUCA 4P98A 1JHOA 2VZLA 1N5DA 1ZCZA 4BO1A 4B6GA 1T29A 5JIBA 4HDMB 2NZXA 1KDYA 1NNEA 2XLCA 4FLEA 2B4QA 4BMYA 4RVDA 3KNZA 3IA2A 4E1VA 2EYUA 1GCOA 5KTPA 2COEA 1N4AA 3G9UA 4EKGA 4UVIA 4CDNA 2AFRA 4D9NA 3OTHA 1R0RE 2RGGA 1A88A 3HVRA 4K6KA 2M6SA 3EQ2A 2A5JA 1EUCA 2YOFA 1OAOC 1C8KA 1LPMA 3A0UA 4D41A 3LT2A 4B5LA 1EWYA 1T13A 3L01A 3GLFB 2CL7X 1JEAA 3HRHA 1H3NA 3E9CA 4KG7A 4JSTA 3AWDA 3NHUA 1EZZA 4Q9LA 1ECBA 2WABA 3C3DA 1HEIA 3WGTA 4M1TA 3I5UA 4TOIA 4TL7A 4I50B 5JPCA 2GM5A 2J7PD 3OEYA 4B17A 1T0UA 1GAQA 1C81A 1RLMA 1UT5A 4MROA 4PVDA 1GRNA 3HN6A 2JFYA 1C3VA 2YNMD 2ZQZA 3LA8A 3TTSA 4FR5A 4E11A 1QPZA 4QLAA 1UR5A 1K6IA 2D7JA 3F5SA 3FOBA 3OZVA 3AG6A 4D44A 1VHWA 2E1RA 4UKDA 1O57A 4Q3BA 3IV6A 2CFRA 1M2OB 5AUNB 4FDTA 2PRKA 1V0JA 4XM0A 3I5XA 1JJFA 4XDGA 4YPFA 1G7CA 1XDDA 3CT6A 4YCSA 3FUCA 2XHEA 3I2JA 1FXUA 1YFKA 4Z8XA 4DQLA 4LCJA 1NKSA 4FLFA 5K8UA 1PX2A 3FCOA 1BSVA 4DYDA 2UYHA 2P1ZA 3OKCA 1T2DA 1U2QA 3S68A 5DXFA 1CUHA 1MB3A 4BJ6A 3IUMA 4Z9BA 4XWYA 4Z0TA 5B5SA 3QXJA 2G28A 4U6NA 1U1EA 2J6BA 3EVAA 3CG0A 2EFJA 5LM3A 1U81A 3K9QO 1N1MA 1W4AA 4IOJA 1ZI8A 2WFLB 5D7NA 2HHLA 1V6CA 3UZUA 4M76B 1DG1G 3P0JA 5CW1A 3L7DA 1E1NA 3OZIA 5FI5A 4KK4A 2FFHA 5DHQA 3WYBA 3HUDA 1I6LA 1E7WA 1CNEA 4JYMA 1DX4A 2CJWB 4FN5A 4RFSB 4OSOA 1ZEJA 1V35A 4XEUA 2EHJA 3LVFO 2CXXA 1BMTA 4N5DA 3TAUA 3VRHA 2ZUFA 3QEOA 2RHRA 4GBMA 1T5OA 3TJRA 1CZOA 1W4ZA 1NM5C 3MD9A 1YFLA 1WP4A 1RVDA 2WLSA 1L4LA 3PUJA 1Q91A 3PIIA 5FWYB 5KB3A 1FY2A 3H17A 1A2QA 3P9NA 4QM7A 3RVMA 4NECA 3O2NA 4NBLA 1F8GA 4DRXA 1NC1A 2RGNA 3T7KA 4WOCA 5CW2A 3KO8A 2R0QC 1SAYA 1TIBA 3HLTA 4LZWA 3BGOS 2POCA 3WYEA 3KD2A 4ARUA 3CYFA 3K73O 2JJYA 3QUCA 2B5OA 1N2HA 1CBUA 1ZH8A 3SZUA 1F38A 4LF8B 3VJRA 1I7PA 2J1LA 3G2LA 3KWLA 4CIVA 1RKQA 1MC1A 2R96A 4KFTA 4WDRA 1RXIA 4BMZA 3Q12A 4AJNA 2QENA 5BORA 3JZIA 4ZRDA 3GJRA 1COZA 1RYHA 1V2HE 8MHTA 1GQYA 3FCCA 2IY9A 3IT3A 4JEHA 1QOZA 4DZZA 3CLVA 4CU5A 3PHCA 2IYXA 2PT6A 2EKPA 4RSGA 1DCMA 1DKMA 2WTEA 1GPWB 5ERXA 3S6JA 3UOGA 3IV9A 3KZCA 3CEAA 1E6KA 1Y0BA 2I55A 4HUJA 1ZL2A 4QQ8A 4MQ6A 4FOTA 1O97C 3FUVA 1D2HA 3G0CA 1NYTA 3ZY5A 4BATA 1HEYA 2HNBA 4RHYA 1GUFA 3GCZA 2IYNA 3AG5A 4QULA 3Q0TA 4Q4HA 2XQIA 1VKJA 3U3DA 4ACAA 3AKYA 2J30A 4IVPA 2GZHA 2E1PA 3AH8A 4EPVA 1NR5A 1SXJD 1XD8A 2H2GA 4DDHA 5I7OA 5TDHA 4R71A 4AMVA 1GM5A 3FTDA 4DWWA 3C4VA 3H86A 4FDUA 2FW6A 4GSKA 2AKEA 4QTYA 1WX1A 1MP0A 3B7WA 1TVCA 2O0JA 4KHZA 1L1RA 3NHJA 2DBRA 3K4QA 4AJ2A 5ITSA 4PBTA 3BK2A 1P2VA 2ZBEA 4AO6A 1F4PA 4PZZA 1PK9A 5BUCA 4EF5A 5BP7A 1AC5A 3SEFA 1E79D 4HAUA 2E4ZA 3V8NA 4HWGA 1ANKA 1BVYF 1H8HD 1LPBB 2EKDA 4KI7A 2O8FA 4JJGA 5K6TA 4PPNA 2F59A 1PZMA 3K0CC 1C7ZA 2IEZA 4L74A 1YB2A 3M4XA 2BFCA 1DKQA 2XGMA 1DAEA 1H94A 4UCXA 3UMRA 4CI0B 1X94A 3Q85A 4E22A 1X1CA 4KMRA 2XNSA 4L6IA 3UBMA 4WWHA 1N1GA 4FFWA 2JFVA 3YASA 1ZNZA 3GFFA 5LBUA 1SY7A 3CX3A 1C3OA 3SNHA 4AG5A 4CKCB 1A7KA 3VU1A 3L18A 3LAWA 4EO9A 5GM1A 4EIWA 2VTBA 2BEVB 1S2GA 2FZGA 4LKRA 1ZCAA 2PVSA 3PWSA 3ITEA 2VHUA 1EFKA 1MMFB 4H59A 2YXDA 3OOEA 4O2BB 4DSUA 2KX7A 4O4IA 1O6BA 4N5IX 4YMUA 4LZOA 2VJKA 2E6KA 4OJNA 3FPBA 3HA7A 2ARKA 3PC6A 3VHLB 3FPEA 3U09A 5ALDA 2I1QA 1RD4A 1GRRA 2YVAA 2O6HA 3H0KA 1KVUA 4OQLA 3EFOA 4OQMA 2R7AA 5AW2A 2P78A 4ZICA 3PGJA 2GBPA 2JI4A 1G4AE 2A9VA 1K8QA 1VG8A 2I6UA 2I03A 3C6ZA 1S1CA 2V9PA 2CMFA 3CF4A 2V7QD 4KC0A 2PLFA 3X0DA 4FYPA 3Q3VA 4U5XA 3A2KA 3L5KA 2W11A 3T7CA 3O8BA 4DMRA 2QNIA 3RHFA 5FYQA 1GGKA 1T9HA 1X39A 1FYEA 5ELLA 1W6RA 3S0JA 3DAOA 2UDPA 4FC7A 1MNAA 2JFHA 2EIXA 1JPNA 5EHQA 1QFXA 3H2JA 4QGBA 1HE3A 4Y2PA 5JSHA 3KE9A 1RI5A 3A27A 1P2TA 1BW9B 2WUWE 1YNSA 3D6HA 3MAAC 3MJEA 4FP9A 1U3DA 2VO1A 2ZAIA 4IIYA 4P58A 1JTEA 4UTXA 3CZAA 3P0HA 1KSHA 1RHKA 3PEUA 1CVRA 3PJEA 3TI9A 5IX8A 4ND1A 5J59A 4KZPA 5ES3A 4GGMX 1DWUA 3TF5A 3EH2A 4FQ8A 1JHUA 1KAQA 4KXYA 4WKGA 3I0ZA 4N49A 2W2NA 3OPYI 1ODKA 1SBTA 4WCFB 5EIEA 2VQEB 1MA0A 3IMCA 4GBJA 2WYWA 2BZ0A 5JI3E 1XLVA 3D3NA 2QROA 2JJ2D 3ILHA 1VHTA 5C1PA 5KYXA 3JQ8B 4AKHA 2WTMA 1KQ3A 3AL3A 4P36A 1S01A 1GQQA 1W0JA 2NUPA 3O3NB 4NG4A 1HDIA 2CEKA 3WNVA 3ZWXA 3OOYA 2IUYA 5DF1A 3E3MA 2FLKA 1CR4A 1PZFA 5F7XA 3HYTA 4RIEA 2AMYA 1Z26A 2XX3A 4P33A 5GIPE 3COSA 4ZT4A 1BXRB 2LCFA 2WE8A 5CXUA 1DAOA 2QW0X 5DI3B 1YD7A 4Q03A 4V3CA 2WHPB 2WUDA 4JN6B 5P21A 2ZW9A 4RPIA 1R5OA 1E4VA 2A9PA 5KQRA 4I0WB 2XVMA 4HDRB 3Q7RA 2D3TA 3NAQA 3GEPA 4NBUA 4K88A 4CNBA 5LDGA 1HYEA 3K31A 3KXIA 2VNKA 4U8GA 3BILA 3I23A 2H1VA 4OPMA 4X1KA 1P73A 4EHIA 3IXQA 4YXWA 1CV2A 4F92B 4BPRA 4PPFA 4ZT3A 3FDFA 4UHEA 3A9SA 4OM7A 3PPXA 4CTNA 3N8DA 5EIHA 2ZRBA 4A7PA 4ZN6A 2GXSA 1NUHA 4HTAA 2RFLA 1M74A 3L92A 4B3DA 3DBRA 4XR9A 3D8RA 5G2OA 1OZ0A 5SICE 3UHAA 1JEJA 1EXMA 2WPDA 2VJNA 2WJJA 4H2DA 1K6MA 2B6NA 1IN4A 1GZUA 2AKAB 1A9TA 3ZWCA 3ZW9A 4IUDS 4P31A 4U6SA 1JF8A 3ZHUA 4E4RA 4FOSA 4GVPA 3IDAA 4QDUA 4ALNA 4BVLA 4MDFA 1GUAA 1YZGA 5CX1B 4B09A 3JCZA 3N70A 3IX7A 1DC3A 4NMMA 4LY9A 3SAJA 3Q5GA 1PJBA 4D2IA 2JI9A 3TTUA 1LBHA 1CQWA 2P7IA 4QOFA 1JEYB 1NLFA 1YQQA 3BKWA 3GRRA 3PPVA 4JSYA 3ACCA 1RXSA 5G4KA 4AJPA 5T8KC 1RLOA 2IYYA 3A3YA 4LY3A 1PVDA 2LUOA 1KVSA 1UM9B 1FX0B 2D5LA 3P5SA 2FSVC 5AVZA 4QYMA 4TXLA 5K8CA 3ZVNA 1XMXA 1HT0A 1O6GA 1XAJA 3E48A 4LFBB 4HLCA 4NESA 1GARA 1JR3A 4S2UA 4I5GA 3M49A 3TVYA 1A8SA 2ZWIA 4PVCA 2CMKA 3QKRA 3ZQ6A 4CE6A 1M83A 5IKMA