2LWIA

Solution structure of h-rast35s mutant protein in complex with kobe2601
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title In silico discovery of small-molecule Ras inhibitors that display antitumor activity by blocking the Ras-effector interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 41
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2lwiA00
3LO5A 1GRQA 1IN8A 5C1BA 2Q3HA 4Q7JB 4WXPA 5JEEA 4Q4LA 1G64A 2ZRAA 3VR2A 3LVQE 4O25A 2GEUA 4ZI3A 3IHLA 2F7SA 4Z54A 2BKEA 3H0KA 1KK2A 3QXHA 3SI7A 4FCVA 1E2HA 1M7BA 3SBEA 5E95A 1OHHD 2ZI5A 3QIAA 4QOSA 4Z51A 1M2OB 4DUGA 4EPTA 2XEXA 3NDPA 5CM8B 4ZDJA 3QKRB 3OIUA 2GXSA 1SKQA 1Z8FA 1NLFA 3HPRA 3LY5A 2XNSA 4HLCA 5IF9A 1K8RA 3AVYA 1F2UB 2BCGY 2W58A 4AKHA 2F55A 4XWOA 3GFTA 3QXSA 1F6BA 4RZ2A 4YLGA 4B2PA 4D0NA 4D4MA 3K09A 2QP4A 4BZXA 1G9XA 3DM9B 3DDCA 4GZMA 1OPXA 2C95A 3NC0C 4B6FA 4RY2A 2WWIA 1ZD1A 2CCGA 2FNAA 5CDFA 1DS6A 3EWAA 2VP4A 1EG7A 1NKSA 3NBXX 2CJWA 1Q22A 1UBGA 1OHHA 1XB2A 3N70A 3U3RA 3CF0A 3FMPB 1X1RA 3SC3A 1GL6A 5DI9A 1TAGA 2WMOB 2K5UA 5TVKA 4A8JC 3ZS9A 2QPTA 4NU0A 2NO9A 1XWIA 2VP9A 1U94A 2UZ3A 1TEXA 4KV9A 5TXGA 2QQ0A 3KQHA 5AJZA 4HUTA 1RJ9A 4NP6A 4WW0A 3Q85A 3P1JA 2MSCB 3BE4A 2RB4A 1IJFA 4TMWA 4JLBA 3SE0A 4XVUA 2BKUA 3FTQA 5JSZB 1PUIA 2ZRBA 2GZAA 2GZDA 2F9LA 4MYCA 4OI4A 1TU4A 2PX3A 3GLFB 3I1FA 2JLYA 3IQXA 4PC6A 2J0QA 1W2GA 2J3EA 1JXMA 1MO5A 2FFQA 1Z22A 1ZM7A 3LW8A 4PAOA 1IAQA 1JEEA 4QJ3A 1FTSA 3Q7QA 2ZS7A 2G1JA 5JMTA 2OZEA 1XMJA 4LHVA 3LX8A 1N5IA 2OXCA 1QDEA 1ZNYA 2QAGA 4Q7LA 2GCOB 2QN6A 2B7CA 5HZKA 1TUIA 1AN0A 1F3OA 1S1CA 1SGWA 3MCAA 1Q1BA 1Q3TA 2OCBA 4GMXA 4OL0A 1W46A 4WA7A 2P6UA 2RHDA 3QUSA 1U2RA 2ZE5A 2IK8A 3CF6R 4BQSA 3R8CA 5M04A 2IYUA 2JLZA 1HEIA 1KI1A 2G83A 2YVUA 3T5DA 2GJ8A 1R6BX 2ZRFA 1G8PA 3NKVA 4F4JA 3SHFA 1G5PA 2R9VA 3KQKA 5GJBA 1E6CA 4QC2A 3OE7D 5BN4A 2XTMA 1G21E 4RJLA 3C4JA 4Q03A 3VHXA 4D0GA 1SXJC 1GSIA 2IUTA 2KJQA 3TAUA 3BH7A 4A2PA 4BEJA 2H16A 2GF0A 1QHNA 2BMDA 5EUMA 3CO5A 3ADBA 3SN6A 2D2EA 4TLCA 5KSYA 4D4JA 2IYQA 3K0AB 4A0HA 1G291 2P0EA 2VHJA 2C8VA 1U99A 3CPJB 4Q4JB 3SS8A 4B43A 4BZQA 1CTQA 4LDJA 1GRRA 4QHYA 1MRNA 2IYTA 4IXNA 3OE7A 4X8OA 2ZYVX 4JLMA 2OCAA 5BYJA 2IYRA 4LV8B 1W4CA 3GEIA 3ND9A 2P67A 3S1AB 3MSXA 2ZJ5A 1OXUA 1IY1A 5EZ6B 5TARA 5JHHB 2B8WA 4XIGS 4FXPA 2PMDA 1HURA 3L8YA 3THXA 1YR7A 2HT6A 1W4AA 2Q9AA 2KB0A 4FMBB 4HUQB 3IHWA 4M9ZA 1DAEA 2MMGA 2CDNA 1TMKA 1DAMA 1SHKA 1FUKA 2YHSA 4E22A 1W4BA 2GJSA 1YR8A 4QNRA 4G5RA 3FPAA 3T1QA 4B47A 2JGNA 1JJVA 2WSSD 1VYTA 1Q12A 3AKCA 2OFOA 5EP1A 4AKEA 3C15C 1FPMA 4KFSA 3A8TA 5FUVA 5H70A 4DT1A 2D2FA 4AD8A 5GJCA 3VNVA 1P9RA 3EASA 4FMDF 4BFXA 2BOVA 4C2UA 2QZ4A 3IQWA 1R0XA 3IILA 1CLUA 2ANBA 3LH5A 2CCKA 1OFTA 4XJXA 2EYUA 2J0UA 3QY0A 1T9HA 2HCJB 1J8MF 2ZS9A 2GWHA 2BJWA 4JBXA 5KSOA 1N0UA 3EZ2A 2CLCX 4HB2A 2WWWA 3REGA 1I4TD 2P5TB 1ZNZA 1GIAA 821PA 4NYJR 3L82B 4JMPA 2W0MA 2WSSA 2CLSA 3CBQA 5KTYA 2PZEA 121PA 2BHRA 3A36A 2MSEB 4PPFA 3BFKA 2IS2A 3UWKA 3OIYA 2O8DB 3TW4A 3QSYA 3VR4A 3BBPA 2ZJZA 4NCJA 4PSVA 1KI9A 3B9PA 4FN5A 4XSGA 5H68A 3ZQ6A 5J4KA 1KO8A 4M1WA 1KSJA 3TIFA 4F92B 2Q9BA 4NTZA 3IKJA 1W47A 3M4YA 4IVQA 3G0HA 3I5YA 4F7WA 2V55B 2O8CB 1RPZA 5IT5A 3M1IA 1EX6A 2IW3A 4C0SA 1WDTA 4S35A 2ZUCA 4LJ8A 4BLOA 2IT1A 1UKYA 1EX7A 2OEPA 3I61A 3FDIA 4W5HA 2AD1A 1IM2A 5LB2A 2EFDB 3AF1A 3RS5A 4B3CA 3TK1A 2QRNA 2WKRA 2IF2A 2OBMA 2YOHA 1XRJA 4M1KA 2FX3A 2GEVA 3OF5A 5UKDA 4WOPA 1DOAA 2BEJA 2IUSA 4BLPA 1F2TA 5AJWA 4Z8YA 3CZQA 1WA5A 2WWGA 2I3BA 1E2EA 2QP9X 3BK7A 2O8FA 1PUJA 3HPQA 3PENA 5KPDA 1GNQA 4FWTA 2YC2C 3NTUA 4JLDA 4AG5A 3IEVA 1OXSC 2BMJA 3TSOA 4PC7A 1T0JB 1XMIA 1DELA 3BH6A 4WVFA 2QT0A 2AKAB 1KSFX 1E96A 3EZ6A 4D4LA 2XZLA 3WXMA 2WWXA 2AWOA 1EXMA 1IY0A 3L0SA 5CLLA 1OXVA 1MO4A 1Z6YA 1A1VA 5CB6A 1RVDA 2DCUA 3LNCA 2EFGA 3F8TA 1XXHB 3CR8A 3KTAA 1YJ5A 3JVUA 3C7KA 1NMXA 2IC5A 2G77B 4GOKA 3EW9A 1I4DD 2ZI9A 4KI0A 4MRNA 3U7FB 2WMNB 4Q48A 2DPXA 4B33A 4BLRA 3A1TA 4LY6A 2CL0X 1XTSA 2OBLA 3P4YA 1P3JA 1QHHA 1WQ1R 3R9IA 1XPRA 5IDVA 1YZTA 1XPUA 2XTZA 4ZDIA 1OH7A 1KDPA 4HDCA 2NTYC 2ZU6A 1MABA 2IXGA 4MH0R 4PHGA 3L43A 4MKHA 621PA 4CEIB 4ESVA 1T3HA 1NG9A 1YKSA 1XD8A 2C99A 1KO1A 1ZBDA 3THYB 1OLOA 3NC1C 1GFIA 1ZD8A 4JJKA 4I99A 3WHKA 3JZMA 1NKTA 1XCMA 1MR3F 1D9ZA 2X2FA 2ZPTX 1KYIA 3IO5A 4C0LA 4M22A 4B74A 4E09A 1W7AA 3LLUA 1G5TA 3K53A 1CS4C 2AWNA 2OCPA 4P3YA 3P26A 1T6NA 1ZU4A 3A4NA 1E0AA 1ZP6A 3CONA 4EJSA 4DJTA 1QHSA 3K9HA 1G1MA 2NO0A 5H8WA 1WBDA 1DPFA 3HYRA 5CJPA 2VRWA 1ZCBA 2ZYUX 1JR3E 4LJAA 1CJMA 2AHOA 4C0BA 3CWZA 1CIPA 3LLMA 3Q7PA 4IDHA 1E2QA 5FPYA 1ZM2A 2BM0A 2D4HA 2O8BB 4TTQA 1KGDA 1FQKA 4RD3A 5L3SB 1AZSC 4BEBA 4TZ6A 3KB2A 2QGNA 4XOIA 1Y3AA 3EC2A 1EWQA 3AVQA 1QHYA 1CR4A 1FQJA 1NSTA 3CKLA 2QI9C 1OFIA 3VNUA 1JPJA 2CVHA 4PC1A 3UIEA 3H2YA 3THOA 3RS3A 2ORWA 3BFVA 4X8LA 3H4MA 4WBSA 4EPWA 3SZRA 1HV8A 2KSQA 2RCNA 2BCJQ 5FUWA 2GXQA 1L4UA 3U4QB 1RRFA 4IVPA 5HCNA 1M34E 3PQCA 4P32A 4Q9HA 1ZINA 3VR1A 1DO0A 4TTRA 2F1IA 2F1RA 1US8B 1LF5A 4G5OA 1JQLB 3AKDA 1NG1A 1M7GA 3E2IA 1II9A 1A7JA 3CR7A 3EARA 4ZKEA 3NG1A 1YZQA 3HR7A 2R62A 2NG1A 3MJRA 2QE7D 1DAIA 1ZIOA 4GL2A 3FHTA 2QNRA 3BXZA 5H1YA 3U3MA 1XTKA 1N6NA 1CKEA 1JQJC 4L8GA 5EP2A 4P4SA 2ORIA 1LS1A 3A1UA 3E70C 1D9XA 1R8QA 4B3BA 2BBOA 3NH6A 3T15A 2HEIA 2XGJA 1VECA 1E9EA 4HAVA 2OSBA 1QG4A 1ETUA 3UANA 2WIAA 3UWOA 2HV8A 4HB0A 1H8HD 2ANCA 3OEED 4QKQA 1Q3HA 2A30A 4HYYA 3WRXC 2E87A 1XJCA 2O0KA 2WOJA 3V00A 1JR3D 1GWNA 3B13B 1M8PA 2QE7A 2QBYB 3RHFA 1VMAA 4Q21A 1C9KA 2DY1A 4GBMA 4KCGA 5HCIA 1ZJ6A 1ZMXA 3VX4A 1KK3A 4TMXA 4C0AC 4DLWA 1KAGA 3RSLA 2W2VA 1JAHA 1JALA 2R6FA 2HYIC 1E2IA 3PEVA 4UJ5A 2FJUA 5FPHA 4LYFA 2V3CC 1Q21A 2ZIAA 2O8EA 2B8TA 3TGPA 1WMSA 4KBGA 3B1YA 4LV6A 4CT5A 4Q19A 1KJWA 3ADDA 4GP6A 3VFDA 3I62A 3LFUA 2YC4C 1NLZA 3P20A 1OH6A 4EKDA 3AKYA 4MKGA 1VG1A 2VLIA 4UXHA 3ZYCA 2QTHA 4TZ0A 2OUKA 1H8HA 3OEEA 1R5OA 2N42A 3F5FA 4RD6A 2JJ8A 2ZVQX 2N1BA 3L0PA 2GJAA 4WXRA 4US2R 4OI2A 1XZQA 1JR3A 4PO8A 2EVWX 4BFSA 2OESA 5DLQC 1G16A 3LBIA 1DG3A 3BB1A 1W5SA 2C78A 3QNUA 4DZZA 1E4VA 3LA6A 2G88A 1B0UA 3EPLA 4Q4AA 1KI6A 3EAQA 1KY2A 2H92A 1SULA 4A0RA 4GOJA 3LBHA 5BW8A 2GAOA 1XD2A 1E2NA 1GDDA 1ZC4A 1JB1A 4RD2A 3GJ8A 5DE3A 1SVWA 1J70A 5DGXA 4ZCMA 1A2KC 1ZW6A 5EE5B 4NONA 1AKYA 4CEJA 3P27A 4JVNA 1HY3A 3B60A 4OHXA 2C2HA 1KMHA 3KJHA 4L16A 3K1JA 2ONJA 3EZ7A 4FMCF 2CJWB 3RVBA 4CZ2A 3I5XA 1J8YF 3A1SA 5BXQC 5CIWA 2ZE8A 3WNDA 2B92A 2H18A 4IFEA 2QM7A 5CYPA 3K0SA 2ZRMA 1S2MA 2ONKA 2WJIA 3U2QA 2OAQ1 2JLWA 4A0GA 3EA0A 3Q5EA 3PR1A 2F6RA 4K46A 2V1XA 5GJWC 1W2HA 2NO7A 2DWOA 5B58C 1VCNA 2PCLA 1RJ9B 1G6HA 2HF9A 4DEXA 4ACBA 3RABA 3CPEA 5EE9A 1DTSA 1GP2A 4ZO4A 2YOFA 3X1DA 1G6OA 1ZAKA 3BJIC 4BRWA 1BO6A 4GRAA 4HDQB 2CEAA 3SFVA 4MGYR 2VP6A 2BJVA 1M7HA 4IEIA 2ZAMA 3KKOA 3KZ1E 4OQFA 4M1MA 5GVSA 1COWD 4XSHA 2WKQA 3LV8A 4A6PA 3QE0A 4OI0A 4TSFD 1P4SA 4KBFA 5KSPA 3NXSA 1Z2AA 5C4GB 2Z83A 1EFCA 2XB2A 4A4DA 4ON9A 2PH1A 1G7SA 1NVVR 2FE4A 5B64A 4URUR 1NVXQ 2FOLA 3WMEA 3DM5A 1KI8A 3PG5A 4HAYA 1PLLA 4QBIA 5AUOB 1OE0A 3CX8A 3ASYA 4W5JA 1E2LA 1CRPA 4YMSA 3I73A 5FUXA 1P2VA 2FFHA 1AZTA 4ZDKA 1KJYA 1DG1G 5J4VA 2VHQA 4II7A 4C7OB 1LF0A 3VAAA 2JLSA 1COWA 1OIVA 5FTLA 1Z6AA 4PSAA 4TSFA 1MRSA 2X8AA 4M0LA 4IFBA 3MGCA 4NCKA 3PUZA 1II0A 3U7HB 1Q20A 1ODFA 4MRPA 2FPMA 1LY1A 2VP0A 1O3YA 4XVRA 4NYMQ 4QGGA 4ARZA 5JWHA 3VR6A 1P2TA 4EPYA 3EA5A 3ADKA 3WRYC 2BBWA 3RSOA 4QFMA 2QY9A 1KY3A 1N6KA 5HE9A 4GSYA 1AA9A 1UAAA 3AF4A 1OSNA 3MUFA 4CIDA 5EE1A 1E4YA 3DKVA 1TADA 4QL3A 4BFZA 3GLIE 3THXB 1NY5A 1A4RA 3GJ3A 5AJVB 2XZPA 4V0OA 2H7VA 3K09C 2AX4A 2P6NA 4U00A 1KZGB 5J4LA 2A9KA 4QBGB 3RANA 1JEDA 3AVWA 2QROA 2R44A 2L0XA 4WAUA 2IYYA 221PA 4GNKA 4OJQA 1N3BA 5FTJA 3ZH9B 2JCSA 4PO1A 1T5IA 5IRCD 1WB9A 3DPUA 4Q1CA 4PQYA 1Z29A 4HB4A 3G82C 5A5GA 3FFBA 3NBFA 5D3MA 3E5HA 2WVJA 4DT1B 2WAYA 3R8FA 3THWA 2VHTA 2EFEB 2IF0A 2W6JD 3ZLJA 2BC9A 3RS7A 2JA1A 3VTKA 2A5DA 4NKRA 1P2SA 2J0UB 3M0EA 1EFRD 1UFQA 1Q1QA 4DWJA 5JCPA 3WNCA 2IYWA 4ZV4A 4CGZA 4YDSA 3RRNA 1XD9A 4IRUB 3CZPA 4F38A 2BWJA 2D7CA 2ZYTX 5CM9C 3W34A 1HUQA 3OIVA 4O0MA 4L5BA 3I72A 3CNOA 1JAIA 4NPHA 1E98A 5EXTA 4BRUA 1SVSA 1YRBA 4F4CA 2JDID 1VKJA 2W6JA 3L0IB 3HYTA 3IPXA 1DBSA 4KITB 1RKBA 1G3MA 1EFUA 1KO5A 3W3AA 4ESHA 4TMVA 2QAGC 2IYVA 2PCJA 4PANA 5KNCA 3LQQA 4HAWA 1YZGA 1EFTA 4RZ3A 1EFRA 1K5GA 3LD9A 2Q21A 1SKYE 3LWNA 1ZNWA 1CR0A 2DWPA 1G7RA 2H17A 3ZGXA 4UKDA 3VKHA 4Q9JA 1FZQA 1TF2A 3CB4A 1W5TA 1KKLA 4EAQA 4LBVA 1SQ5A 3O8DA 2JLUA 3RRMA 1NI3A 4GDFA 2BVNA 1Z0KA 4Q02A 2X19A 4EUNA 4B34A 3ADCA 5HR5A 3MFYA 3U3OA 1CJVC 4LPSA 2JDIA 3CNLA 2JJ1D 1CBUA 4U02A 2WJJA 5TMPA 4AKGA 4KLNA 2DR3A 3HP1A 1Y63A 3V4FA 2NPIA 3QKSA 3TH5A 2O8FB 4QXAA 1RFLA 3AB3A 3IO3A 4URWR 5KU1A 2AXPA 2W83A 4HDOB 1Z06A 3T34A 2GILA 2G0TA 2A5GA 4OBEA 4R7ZA 1ZCAA 5JZVA 1II8A 1KOFA 4Q1DA 5FUYA 1NIPA 4JSYA 2JASA 3MMPA 3QBTA 3DL0A 5AWFC 3T1VA 2R65A 3T1TA 1BS1A 4BE7B 3D8BA 1R0WA 4URVR 3LW7A 3GLIA 3F0TA 4Q7MB 1XMSA 3OFND 2PJZA 4MITA 4XWAA 1TUEA 3LRPA 1XEFA 3JZAA 3KQUA 3H84A 2JJ1A 2VP5A 4KU4A 1VYUA 3K0FA 3U3KA 3O8CA 1E99A 4TYWA 2ZI4A 5KNDA 5DN6D 2Z6VA 2GJ9A 4Q1BA 5P21A 5HPYB 3KJIA 3OAAD 1AQYA 2CMKA 2YWGA 2PZFA 4RFVA 2FSFA 3K70C 3SQWA 1D2NA 2PMKA 2Z4SA 3AVOA 2VBCA 4A6XA 3K70D 3BGWA 2ZRPA 1AJEA 1P2UA 2V6JA 1ZUNB 2REOA 1QHHB 2AFHE 4LJ6A 1XNJA 4AYWA 5L3QA 1NP6A 3N2EA 3Q9LA 5HTKA 1UEJA 2EFCB 2WZQA 3QENA 4JBWA 4CRWB 3K8YA 3VU9A 2C9YA 1KJZA 4PAMA 2J87A 1PZNA 3OFNA 1MABB 4ZDWA 5BN3A 4JT2A 1SHZA 2DWQA 3HU1A 1UM8A 2ZI3A 4Q1AA 3DHWC 1Q1ZA 5DN6A 5JBQA 1DO2A 1YZKA 1RYHA 3RRYA 4IOJA 1R4AA 2I4IA 3OAAA 5LBIA 3EWSA 2Q3MA 2JLQA 4V0ME 3UG7A 5IHPA 3Q5DA 2AK3A 3NVAA 3REFA 3QXJA 4JVMA 3BS4A 3QF4A 2KBFA 4EJSB 2HT1A 2GBLA 2UKDA 2DFKB 1BH2A 2X1VA 5FTMA 2ZUDA 2CLDX 4RZUA 1ZU5A 1ZM3A 2FWRA 1E94E 4PX9A 5DI3A 1KDTA 2OAP1 1NN1A 2ZSFA 4K8OA 3I8SA 3WMGA 1AM4D 2W00A 3GJ7A 4BFVA 2B21A 1VIYA 1UDWA 1X86B 4UXJA 2IYXA 1KSGA 2EWWA 1BYUA 1I2MA 1T91A 4C4PA 1KZ7B 3CWQA 1YU9A 1XEXA 2XZOA 1E9RA 1W1WA 1ZUHA 3FVQA 4PC3A 3CRMA 3GD7A 2W0SA 5FOTA 3AEZA 5A4JA 1ONBA 5FOUA 4TLAA 1MH1A 2FFBA 4NMMA 2PLFA 5EQTA 4JLOA 1AGPA 5FTKA 2ZU0C 5DIFA 1EGAA 4AYTA 2IBMA 3B7GA 3T5GA 3GPLA 3KQLA 4IVRA 4XTCS 3RS4A 1RC8A 1E2PA 1Z63A 1AGRA 3KL4A 1J90A 1G7CA 4MUBA 4NYIR 1S8FA 1JNYA 4P33A 2G9NA 4EPVA 1XZPA 6Q21A 4TQAA 1OXTA 4QM7A 1Z28A 2R2AA 2E1RA 2QPAA 3DKPA 4IEEA 1LB1B 1V5WA 3I3SR 4LV5B 4C0QC 3LVRE 1VIAA 3QXCA 5AUNB 8OHMA 4QGHA 1DEKA 4RD0A 4JLAA 3TQFA 3AF2A 2J0SA 2VSFA 4ZCIA 2I1VB 2YKGA 3PFIA 4KHZA 3A4MA 2QT1A 4B75A 2IHYA 2VSXA 4P4SB 1Q44A 3GJXC 5G40A 1B23P 4XH9B 1TL7C 5D3QA 1E9AA 3AM1A 3EIQA 3K9NA 1GRNA 4E03A 4AK9A 3F3YA 1OH5A 2IYSA 3IIMA 3BB4A 4BFWA 2RKOA 1OKKD 4DLYA 1G7TA 1FMJA 3E1SA 4MRSA 3U6BA 3EXAA 5DSZA 1UPTA 2ZJOA 2WIBA 3MAAC 4RCZA 2ERYA 1FX0A 3O47A 1XP8A 2V54A 2EU8A 5EUQB 5JSZA 2F9MA 2PT5A 5CJ2A 2FG5A 2PEZA 3C8UA 2RAPA 5FI0B 2HXSA 2RGEA 4MGZR 4JS0A 4DSOA 3TUZC 2VTKA 2O8EB 4OHVA 1XMVA 4QBHA 1NY6A 4V03A 2DFNA 4V0MA 1WF3A 4POAA 2EYQA 4Q66C 4HAZA 2CXXA 4D26A 1LNZA 3NEYA 4HLUA 3FFAA 1OKKA 4JKYA 2CL7X 1S3SA 2GCOA 2ZRJA 3ICQB 5JHGB 1FNNA 1N0VC 2WBLC 2J1LA 2J5XA 3GLHE 1XTIA 5JFGA 2H5EA 3TMKA 3ZD7A 4RCYA 1XX6A 4CDGA 2XNDD 4D25A 3U7GA 5EP3A 1E0SA 1P61B 2FSIA 4HB3A 4O3MA 1WCV1 4Q4AB 4EJSC 1OT3A 2PZGA 3CRW1 2WPDD 3EIHA 1KSHA 5FOXA 4EFLA 1X8KA 4Q7KA 5FR2A 4IHQA 1G19A 3KDSE 4JLKA 4UJ3A 2C9CA 4JL8A 4DDVA 1IY2A 1AS2A 5KPJA 2A5FA 3SQXA 4MYHA 4ZPXA 4EQ6A 4IDQA 4CEJB 1AK2A 1EK0A 3VX3A 5JWRA 2ZI7A 4GI7A 1P9WA 3LXXA 4FCTA 1E0JA 4BLQA 1P73A 2ATVA 3IBGA 4XTRA 3ZIAD 4H1UA 3GP8A 1VCOA 3PUYA 2HYDA 1R10A 1CXZA 5SZIA 1Z6XA 1LW7A 4BPBA 4M9XA 1YZLA 3TSZA 4PQFA 1DAFA 2XNDA 4FINA 3SJCA 4C2TA 4N0EA 3QKUA 1M1YE 3K0AA 4BWYA 1A2BA 2WPDA 4LX0A 2YWEA 3G5UA 3O8RA 2GESA 2ASEA 1R2QA 2W2XA 2G0NA 4G5GA 3ZJYA 3LXRA 1HT1E 2J9RA 4FI3C 1DARA 1ZVQA 5E7JA 2QTFA 4JZKA 2J46A 3D7MA 4Q4HA 1HQYE 2QMEA 3UG6A 2NGRA 4DC9A 4R71A 3ZIAA 5AUQA 3C41J 5JI3E 3AF0A 5BYKA 1AS0A 3EZFA 3GJ0A 4M1YA 4LJ7A 4A1FA 1MT0A 2AD5A 1NJFA 4MGIR 3FKSD 1P7CA 2J59A 4YMVA 2CHVA 4TMZA 4ZIRA 3ZZUA 1KO7A 1XF9A 1OB2A 1SVIA 4PZLA 4Q9LA 4D4KA 2OT3B 4HI0E 2TMKA 2WJGA 4Z8XA 4E07A 1N25A 1DE0A 1Z5ZA 1ZD9A 3ICEA 4RVCA 4YC7A 2JJ2D 2Q0HA 2ZRNA 3SEAA 5FOVA 3NBYC 3BAFA 3M6AA 2FPKA 1UADA 1Z47A 1S9DA 2A7QA 2D62A 4WIAA 4QNMA 1DADA 4KFTA 1OXXK 3KJGA 4DVGA 3A37A 1X1SA 4US1R 4B71A 3BFXA 3TE6A 5KDLA 5SZHB 1IN6A 3QVVA 2ZROA 1EWRA 5EE3A 3I4LA 1NL3A 2P2LA 4B35A 3QPVA 4K81B 3W3ZB 4DLTA 5CK4A 4LC1A 3FKSA 4BUJA 2FEOA 4KSCA 2RGDA 2V7QD 2NQ2C 2QP3A 1JPNA 3MWYW 2YZ2A 3CF2A 3K9LA 4QHTA 4DDWA 1YHNA 2QM8A 5J47A 1ESMA 1OFHA 3NIBA 3NBZC 4B76A 2VIIA 2FPLA 2J7PD 2XOKD 5E7MA 2F3TA 3EC1A 1E2JA 4HLDA 4PSKA 2VF7A 3RYTC 1E9BA 2FZ4A 3GLHA 2JJ2A 2JEOA 5LB4A 2IS1A 4FWIB 4G5SA 2ZUBA 2EQBA 4P31A 1T0HB 5KDOA 3K9GA 4A2WA 3UATA 2W2TA 3NEJA 4RZXA 5EXSA 2QMUA 1IN7A 4C3ZA 1FW6A 2JLRA 4Q9KA 4D81A 1H8ED 1IHUA 4PAQA 1KDOA 4YXWD 2H8KA 1D2MA 1N0WA 2GVDC 2G3YA 4LBZA 3SFZA 3TW8B 3ZD6A 5FL7D 2V7QA 3PUXA 5FFMA 2G1KA 2ZITA 1FP7A 4Q1EA 1MO3A 3QOFA 3U44A 2JATA 3HU2A 2J7PA 2XOKA 1OYYA 2HLDD 2IEZA 3TLXA 1UEIA 1JXOA 4F4IA 5KSZA 3ZS8A 2ZJ2A 4BZPA 2NO6A 2ZSBA 4L15A 1S0UA 4BASA 1X3SA 3FOZA 2XTNA 1NN0A 2CVFA 1P5ZB 1GUAA 4JSTA 2IS4A 3T61A 4MRRA 1TF5A 2A3RA 2GKSA 1H8EA 4DCUA 3Q3JB 2CL6X 1BKDR 2QSZA 4YXWA 1VHTA 2XAUA 4FD2A 1N2CE 4Q47A 5FL7A 1T8UA 3C14C 4M4SA 3KFVA 1S4QA 1U90A 5JRJA 3SR0A 5D3MB 3CLVA 2F43A 3FYHA 4YONB 1N5LA 2KWIA 5L3RA 3THWB 4WZBE 2QEQA 1CU1A 4BECA 1C4OA 2QAJA 2HLDA 4Q00A 1IBRA 3AP1A 3GEHA 4D2IA 1XDBA 1W4RA 4LZZA 1FL9A 1A82A 1W36C 1A5TA 1G17A 2ZRDA 4FMDB 3VKGA 1W36D 1R7RA 5EJEA 3GLGE 2ZYWX 1GNRA 2OG2A 5FBQB 4B48A 3B8HA 2C03A 2ZJAA 2GXAA 1NVUQ 4NYJQ 2RGNA 3PJRA 2WHXA 2QQEA 3GJ6A 3RAPR 1GNPA 3W6PA 4JYBA 5FTNA 1HYQA 2IUUA 1NIJA 1P72A 1G5RA 1G20E 2WSMA 2BIFA 1HA3A 2NZ8A 2V9PA 4ILEA 4IOLA 4RKEA 2ZSEA 4Y0AA 1X6VA 2QENA 2AXNA 2QTVB 3WBJA 2AR7A 3CH5A 1GZSA 4M9QA 2BDTA 5ANRB 1U0LA 4YMTA 4TL7A 3EG5A 5J4YA 2FF7A 3TJZA 1E9FA 4V0NA 3ZZ0A 3ND8A 4YQFA 3DVLA 4CEIA 3O8BA 4NE2A 1NJGA 2ZTSA 1VYVA 1E69A 3SJZA 1C1YA 2FV8A 2LKCA 2P65A 2IYLD 2QMHA 4DB4A 1M74A 3VKWA 1UKZA 5HZHA 3VHLB 2BEKA 1KI4A 1KAOA 1N6RA 4E5UA 1ZC3A 5E4FA 4I1SA 1E3MA 4MKFA 4Z1MD 1RIFA 1S96A 3C5CA 1GILA 4N1AA 4TL8A 3WBKA 1IJEA 3QEJA 4LPKA 4F91B 4IOMA 4EPXA 4DDUA 3RWMB 4DLUA 4UNPA 2QAGB 1HH4A 4ABYA 5B2ZA 3CX7A 3CNNA 2Z4RA 1N6LA 3B2EA 1Q57A 4AIIA 2CBZA 2J45A 2P3SA 1II8B 2HJVA 1F60A 2XSZD 4M53A 1NMZA 4PZZA 1TNDA 2F3RA 4OI1A 3SYKA 2JLVA 4LI0A 4KVGA 5L3SA 4PHFA 2N46A 3BD9A 4AG6A 1LVGA 2B7BA 3N5CA 1IXRC 2LCFA 2OO7A 3GLIB 2ZVPX 4A82A 5CLQA 4DCSA 721PA 4LYJA 4RFSA 4TYYA 4P4TA 3KUCA 4CYMA 2X77A 1Z07A 2Q3FA 5HKKD 1Q0UA 2F1JA 2FGJA 4OKSA 1CJTC 4PR0A 2R8RA 3D6TB 4TLEA 1VTKA 3K0FB 4KLZA 4NCIA 4CEHA 1CF4A 3GCGA 1IQPA 5FH9A 4PFSA 3RWOA 1NBME 1BOFA 1NN3A 4ITRC 2C98A 2QGZA 5CITA 2ZRCA 5K8TA 4R9UC 3R7WA 2QA5A 2XSZA 3RC8A 3EPHA 3B78A 3IGFA 3EIEA 3FHOA 2V4ZA 5L3QB 2C96A 3DEFA 3AVUA 3DZ8A 5G3YA 4AYXA 1QHIA 3VU9B 3W8RA 3TVTA 5HKKA 3SDZA 4TQUS 3PUVA 5G41A 2ZXUA 3MRSA 4NH0A 1LS6A 1VG9B 3IEUA 4M8NE 4A2QA 3SNHA 4DLZA 3GLGA 5KOYA 1N6OA 1JI0A 2VYFA 1NSFA 5KO2A 4JLPA 3P4XA 4M1OA 4LOAA 2C77A 5FOWA 1F48A 2IWHA 4LBYA 5B30A 3U60B 3SBDA 5AJYA 2WM9B 4GMDA 4LYHA 3EPJA 4QRHA 5G53C 2JIZD 3TBKA 5KNBA 3K70B 4URXR 3W6NA 5AK0A 1OV4A 3QF4B 2QU8A 3K0CA 2RGCA 4W7SA 3B85A 3BERA 521PA 4ACAA 2ZANA 1W0JD 4ZI2A 1P60A 4J0QA 1PLKA 1NVWQ 1YRAA 2YNMA 1L2TA 3BB3A 3IPYA 4LGMA 4OQNA 3ZQJA 2OM2A 4V0KA 4LHWA 4LJ9A 3AQ4A 4UXIA 1SKYB 4CW7A 4RKFA 3FMOB 3FWYA 3W9YA 2HXYA 4EFMA 5FPKA 3DOFA 2IA5A 3KUDA 2YYZA 4JLNA 4P0TA 4UQOA 1XEXB 2DHRA 4C0KA 5E3HA 1IN5A 1MO6A 1XJQA 2IEYA 1ZIPA 3FKQA 4UNNA 4DHEA 2ZSDA 3W5IA 2JIZA 4OK5A 4H9GA 1TF7A 4G0NA 3TUJC 4OK3A 4XVQA 1G41A 3PITA 1E2GA 3SJBA 3P32A 1D5CA 3TAHA 2XXAA 4XWKA 1W0JA 2ODEA 5FBRB 3HJNA 4DCVA 3QJYA 3QPUA 1XJ0A 4TT3D 2ZJYA 2IS6A 1XTRA 3H1TA 1NBMD 3WNBA 1GOTA 4A0FA 3HR8A 3TVDA 1XCPA 4HZUA 1DAKA 4MGKR 4L9WA 5EXXA 1MKYA 4L9SA 1BMFD 1KK0A 2OXRA 5CIQA 2OLKA 3NDBB 4R2IA 5FPTA 5TDHA 2ERXA 2WWFA 3AGPA 2OFWA 5JJLA 4MYUA 5SZJA 1UF9A 1XEWX 1E2KA 5K8UA 1T3LA 2PJRA 3A58B 1I2DA 2NO1A 1UKVY 1PJRA 4RD4A 3RRZA 4LBWA 1SVLA 4R98A 1GL7A 1P62B 3DOEA 3LDAA 4LC0A 1E1QD 1E79D 1TEVA 1SXJE 1S3GA 4QGAA 4R2HA 4TT3A 3UMFA 5KHOC 2RH5A 1NBMA 5KUTA 2FEMA 2FMXA 2WV9A 1WE2A 2VH5R 1FTNA 2NIPA 2VHCA 4JBYA 4PO9A 3B5JA 2ZE6A 3B82A 1J2JA 4B73A 3RLFA 1J99A 2NPFA 3SYLA 4MQBA 3TUIC 5L8VA 1BMFA 2Z43A 2G6BA 5JI2E 1F2TB 3T06B 4TTPA 5FPSA 1K6MA 2W6ID 2PLRA 1FX0B 1G3IA 1Z0IA 4Q5IA 3KXKA 1D8TA 3Q8XB 3ASZA 2IHBA 2WKPA 2REXB 2ECKA 5FBWB 1E1QA 1E79A 4QM6A 1T4GA 1EFHA 4NZYA 4B3FX 2ZJ8A 4LHZA 1N5KA 1XEWY 3T1OA 3GMTA 1Z6GA 4U7DA 1VDZA 4IDNA 3MD0A 2H1LA 1E9SA 2ODNA 2ZRIA 3ETLA 1D2EA 3GJ5A 4TLDA 1YZNA 4A8JA 4JYCA 2ZREA 4DLXA 2QL6A 4KXFB 2ZRLA 2AFIE 3BOSA 4HLQB 4JL5A 4C0JA 3KTAB 2CCJA 2A78A 2JLXA 2FZLA 5DO9A 2AKYA 2W6IA 4QHSA 3GEEA 5CB8A 4PZYA 1U0HC 4UNRA 1GITA 1WRBA 1JECA 2HF8A 1KNXA 1LTQA 2WAXA 4MYTA 4ZCLA 3GQBA 3ONWA 2LKDA 2ZR9A 2GBLC 3AH8A 1LV7A 2O0HA 1NMYA 5EZ5A 4KO8A 4C7OA 1ZM9A 2I1QA 5A0FA 1AKEA 1GKYA 5BN5A 1XPOA 3WHLA 1XU4A 1JR6A 3B1ZA 1ANKA 3CUEF 4EQ6B 4W9MC 1KO4A 1BIFA 2FSHA 3QXXA 5JLJA 4HZIA 2ZEJA 4JJZA 3RS2A 2VSOA 5FOSA 5G3ZA 3UK6A 1SXJD 1GVNB 2GJKA 3DMNA 1Z0DA 3GLFE 2EWVA 3MLEA 3U3JA 2GF9A 4DB2A 2MSDB 2VP2A 3IIKA 3UPUA 1DAGA 1ZYUA 3MWLA 3PCRB 4ZKDA 4DLVA 4DSUA 4P4UA 3TKLA 4FMCB 4JLVA 4AY2A 1N6IA 3H86A 2DFTA 2GA8A 3C5HA 4H1VA 2ATXA 4KFRA 4M9SA 5ELXA 1IXZA 2QUZA 1GKUB 3AGQA 4HAXA 2GRJA 3MG9A 4OHZA 1KNQA 2RGGA 3VMFA 2OLJA 4Y0VA 4NCNA 2FDCA 4URYR 4ASUD 1YR6A 4BLTA 1E9CA 2WOOA 1U8YA 1QVRA 4Q4HB 1NF3A 3V9PA 1E1RD 4LK2A 5CYOA 4BFUA 5L3VA 2SHKA 1SXJA 4LRWA 1N5JA 3VR3A 1QBKC 4PTLA 3SYNA 4IJMA 3MWJA 3CRRA 1OF1A 4JLJA 3WYFA 1CULC 1E0KA 1XCGB 3KQNA 1R5BA 2J41A 1JJ7A 4N0DA 4DDTA 4PHTA 1Z0FA 1U8AA 4ZIRB 4NDZA 5JS7A 2OCYC 4KYUA 1OIXA 3AVXA 2ZE7A 2BBSA 3QG5A 1UBCA 4D80A 1NVVQ 5DHFA 2KE5A 4I81A 2BV3A 4IXMA 4NBSA 4PXAA 3L8ZA 3WY9A 3HWSA 2RHMA 4AURA 1OB5A 4ASUA 5C4MA 3KKPA 3IBYA 2AL7A 2GCNA 4TL9A 1OJLA 1SVOA 2CHGA 3X1ZA 5AUPB 1E1RA 1V43A 3QKRA 2BM1A 1NRJB 5CK5A 2VEDA 2GVZC 2FU5C 1P75A 2ZI6A 4Q18A 2D06A 3N2IA 1F2UA 1OH8A 3BH0A 3LAWA 3TR0A 5AJXA 1VCIA 4PPGA 1QF9A 1TX4B 4W5WA 1U9IC 3EZ9A 1GTVA 1IOZA 1L4YA 1TQDA 3CIOA 3CRVA 4LWZA 4BFYA 1TQ6A 3RDPA 1M6NA 3QEOA 3I32A 5SZKB 1P6XA 3U5ZB 2PBRA 2Q9CA 5FR1A 3RNLA 4B3XA 5F98A 3R9WA 3T35A 3GLHB 5TY0A 3WYAA 5JRZA 1G3UA 1Q1EA 2GTPA 2MMCA 3CPHA 2A5JA 1WP9A 2ZRKA 1R5NA 2GCPA 2YWHA 4HLUC 4AKIA 3U6KA 2NOAA 2O0JA 3A4LA 4MA4A 3KKMA 2PX0A 3AUXA 2GNOA 3NWJA 3TQCA 1U9IA 1GAJA 1YR9A 2CHQA 4TYNA 1H65A 1IONA 3U44B 1TQ2A 3IIJA 2ZRGA 3B1VA 2WJYA 3NH9A 4NCHA 5FBLB 3SOPA 3AVVA 4LYAA 4QJ5A 4DSTA 1FP6A 1FMLA 4C0HA 4CT4B 2HCBA 3J81k 2OFXA 1S1MA 3GLFA 5TV2A 1Z08A 1IXSB 2JAQA 3R20A 4FCWA 3MWKA 3OESA 1JBKA 5JWOA 4AWXA 3TNFA 4BGDA 4TLBA 3I8XA 1NNEA 3AUYA 4TN1A 4C30A 3WP0A 1KDRA 3LBNA 2VL7A 1CEEA 1N6PA 3B6EA 3ZDQA 2GETA 3VQTA 1YQTA 1KI3A 4AI6A 1OYWA 3ECCA 1LFDB 2ZS8A 3ZZTA 2F43B 2ZJBA 5AR1A 1ZM4A 4S2EA 4Q1FA 4FIDA 4RSGA 4X8HA 3BWDD 3TRFA 3PUWA 5GVRA 4OHWA 5FBVB 2WWYA 3DMDA 4NHOA 1NLYA 1KI2A 1KI6B 2J0VA 2GHIA 1UDXA 4IKEA 1W44A 2V6IA 1XD2B 4TYQA 1G8GA 2QG6A 4DXAA 4KJZA 4CVNA 2DBYA 3W8NA 5HE8A 1UBFA 3X1YA 5E7IA 2REBA 4US0R 1RRPA 4I1OA 1Z6TA 2EFHB 2VA8A 2YOGA 4XD7D 1KMHB 3RS0A 4JVLA 3W90A 3IDQA 1WBBA 4MDFA 1R0ZA 4A9AA 3JVVA 3ZVLA 1QG2A 3K0EA 4NYMR 1ZRHA 3BRWD 4G3XA 3PEWA 2PEYA 1U0JA 2FFAA 1AIPA 4OQXA 3CRQA 4URZR 2GK6A 4ERNA 3ZVRA 4EIWA 4M21A 4DCNA 1T5LA 3UMRA 3ZVMA 4Q4JA 3T12A 3OIWA 1OFUX 1UBEA 1CRQA 1HE8B 1AQUA 1PLJA 1G18A 1W36B 4JVSB 1RE0A 1PVOA 1U98A 3S1AA 3CW2A 2IWRA 2D3WA 4XD7A 2YINC 2VO1A 2OHFA 3PIRA 1YZUA 3PVSA 2RGBA 1KKMA 2FA9A 4HUQA 3DZDA 2WICA 4MDEA 2V8OA 4UNSA 1VG8A 1T3SA 3KKQA 4PQRA 1PV4A 1X8JA 2Y8EA 3W5JA 2P5SA 1XXHE 2PL3A 2GK7A 4KSBA 1QZXA 2HDNB 2QPOA 4GPTA 1RYFA 3KKNA 2VPPA 3KX2A 3AVPA 4DSNA 1YE8A 5BWMA 5KDDA 3LX5A 1ESNA 2FGKA 4I1UA 3VR5A 3X1XA 1QHXA 3QI2A 3TR5A 3TSWA 3DO6A 4A15A 1GM5A 4B2IA 2QSYA 3AP3A 5DYGA 4D82A 3FHCB 1K5DA 2R6AA 3BIFA 1W49A 1W48A 4RFSB 3SHWA 1Z0AA 3IUYA 4DIEA 5DHAA 1Z2CA 1RRCA 2ZRHA 4OJKA 1IN4A 5B57C 5LD2B 4CEHB 4GZLA 4HEJA 1P9NA 3EPKA 2P6RA 4DRZA 1EESA 2J7KA 2EW1A 3Q72A 5C2JB 1F5NA 1KHTA 3BORA 2XJ4A 5K8IA 5F2EA 3X2SA 5EP4A 1XTJA 2GEDA 4KAXA 5FI1B 2KI5A 3R7WB 4MUAA 3RC3A 4TL6A 1E2DA 1ZNXA 2O8DA 3GFPA 4ARZB 4PPQA 3OHMA 4M1SA 2R6GA 5F9FA 4DIDA 3QVUA 4Q9IA 3SJAA 5KYKA 5BQ5A 4G01B 2AN9A 3KXIA 4IDPA 4PPNA 2O8CA 3MJHA 4AC9A 1HTWA 5J40A 1S9HA 2PT7A 3GFOA 1Z0JA 2NZJA 5JJIA 3GLGB 2ORVA 2DYKA 2OBNA 2XJ9A 3AV0B 1GG2A 2F1HA 1QRAA 2B6HA 2C9OA 5JS8A 3HDTA 3PV0A 3QBVA 2OE2A 1G4UR 2CE2X 1VHLA 4DCTA 1D6JA 3B9QA 2QRZA 1XBTA 1OW3B 4KYIB 2R6CA 2IX3A 3PXGA 1L8QA 4LHYA 3X1WA 2DB3A 2ZR0A 5DISB 2UZIR 4YMUA 3U61B 1Z3IX 3FMIA 3AVTA 2RGNC 1RZ3A 1DVRA 4JKIA 1TU3A 2CNWD 4NL4H 4LJ4A 1E32A 5GJVC 3SU8A 1J7KA 5K8LA 1TPZA 1YVDA 4X8MA 2WTUA 1U8ZA 2BBTA 3V4RA 3ZVNA 5F9HA 1VG0B 2Q6TA 2C5LA 2OV2A 2D74A 4L4UA 4KFUA 1SZPA 3C16C 2WJHA 4DEYA 4I4LA 4GFDA 1SVKA 3PEYA 2X2EA 4V0LA 2AK2A 5DYIA 2D7DA 2XXAB 5J4HA 3CX6A 4LJ5A 2XITA 1FNMA 1KMQA 3A1VA 4G5QA 1XXHA 4FW9A 4LHXA 1G8FA 1CR2A 4GP7A 4RD1A 5JCZA 2HJGA 2NMVA 1X8LA 5FL3A 2CNWA 1HQCA 2RGXA 2R6DA 4HZUB 5C18A 2GZHA 1KK1A 1VPLA 1HE1C 1L7VC 2QORA 3NHAA 3KXLA 4NYIQ 4PC2A 3UMSA 1CJUC 4HATA 4O2LA 3KFXA 4JIMA 1SVMA 1TTTA 4DBLC 4QGFA 3FMFA 4B3GA 4OQMA 3OEHD 3QPWA 4KVAA 1UKEA 2BMEA 4G1UC 3QKTA 3OZXA 4UNQA 5C46F 1UJ2A 1XTQA 3A6PC 2ZM5A 1R8SA 4V02A 5DH9A 4B6EA 3THYA 3CH4B 4CF7A 4JL6A 5LDDC 3UKDA 4LJYA 1OIWA 1R0YA 4TMTA 4B3DA 4A92A 1W0KD 2FH5B 2YWFA 3FB4A 2CE7A 1O87A 4HAUA 5EXPA 4M2LA 2FSGA 3L2OB 2YJTD 2C04A 3GJ4A 4OYHA 4TYPA 5LD2C 2YV5A 1AS3A 4LSGA 2ZETA 4KODA 4DLRA 3WMFA 421PA 1FUUA 3QKSB 1GL9B 4TQ9A 4B2LA 3OEHA 3L0OA 2V1UA 2ZAOA 1G3RA 1CR1A 3KB1A 2GDJA 2DFLA 2XB4A 4JT4A 1T8TA 1KI7A 4EPRA 4B32A 4IDOA 2QMOA 3I92A 3B1XA 1BYIA 4BFTA 3NHBA 4MRVA 2O8BA 4I1VA 1VCMA 3LQRA 1HT2E 1ZUIA 3BC1A 3KJEA 2LWIA 1W0KA 4WZAE 1G8HA 3CM0A 4IW3B 2O52A 2BMFA 4QBFA 4A8JB 2XX3A 2ZSAA 3AF3A 3FE2A 5LPNA 4Z1MA 4C9BA 2OILA 4TWZA 4EFNA 1G8YA 5CDFE 2VQSA 3W6OA 5JEDA 1G3QA 4OHYA 3QQ5A 4Q01A 4WZ6A 1N6HA 1NN5A 3D3QA 2O5VA 3PEUA 2Z5FA 2IXFA 1CJKC 3FGNA 3U4QA 4B44A 3R9XA 1QHGA 1E2MA 4QG7A 5TB5A 4BLSA 5IK2D 2E9SA 4PHHA 3QF7A 4U5XA 3K0CC 2H57A 1MV5A 4MKIA 4F93B 2RGAA 1US8A 2UVQA 5J5CA 5JECA 2WWHA 1G4AE 1I4LD 4IOKA 5DNYB 3WYGA 2VF8A 3QG1A 1DAHA 1TQ4A 1E9DA 2VHUA 2A5YB 2ODBA 2A2ZA 1FFHA 4OQLA 4LCBA 1KIMA 5F3WB 4N3NA 4GOXA 2IXEA 5EE0A 1Z83A 2CK3D 2GXUA 2GAAA 4EDHA 4OK6A 2IYZA 2Z0MA 4YDHB 1KTVA 4GT1A 1ELOA 2HUPA 4QJ4A 5IK2A 4D6PA 4DLSA 1GKIA 4DKXA 3EX7C 1E2FA 1RW4A 3A1WA 4D0LB 2WJVA 3B1WA 1CP2A 3U7EB 4LUCA 1FOEB 1RRGA 3HU3A 5GADl 4TMKA 5JJKA 4YMWA 2RMKA 4O2RA 2ODWA 5DI3B 1WXQA 2IL1A 4DUGD 1XFAA 4A36A 2QBYA 2CK3A 4HSEA 3WP1B 1MOZA 2KBEA 2FN4A 1U81A 2ZQ5A 1SXJB 4M1TA 3AP2A 3AKEA 3UXMA 2ZR7A 3D31A 1QVAA
chains in the Genus database with same CATH superfamily
5K09A 1CEEA 1GRQA 2A57A 1YR1A 4LZOA 3E4DA 1L4NA 3MK31 4ONEA 4NARA 2EBHX 4Z53A 4GWGA 1G64A 3TI9A 3LVQE 3AUTA 2GEUA 1P33A 1N7GA 3ICWA 4M36A 3U17A 2F7SA 3ROEA 2BKEA 1M73E 2XRFA 3K96A 4MV4A 3C87A 2PANA 4YP0A 1RAGA 1Y5MA 1AK9A 2R5NA 3QXHA 4MGHA 1HX7A 1M7BA 2GEBA 2G67A 4NBUA 5HFAA 3VPAA 2O2DA 5E95A 4ENTA 4Z51A 1M2OB 5BVHA 4EPTA 4NX2A 1NUUA 2XEXA 1I4WA 5F3RA 1TQHA 3CNEA 3OIUA 1SKQA 2EKDA 2Y1WA 4MXDA 3WQQA 4DN6A 3QPCA 3WLNA 1UDBA 5A6SB 3MCVA 3VDQA 4BLWA 1Q7BA 1IJBA 3VPDA 2W58A 4QDZA 4EGAA 3GVXA 3NKLA 4XWOA 4H7JA 2ST1A 1YDHA 4YLGA 4WH0A 1QV7A 1P74A 1IPHA 2B4TO 3GELA 3K09A 4BZXA 5K2MA 1XZAA 1LPPA 2VXCA 3HEMA 4NV3A 4RY2A 1JLSA 1YOVA 2R8OA 3IT1A 3FOCA 3MGAA 5ALOA 3KCQA 3OZCA 4RDHA 3NBXX 2PN1A 4RPHA 1UBGA 3V1TC 1OHHA 1NPDA 3EVNA 4KE8A 1X1RA 2GD0A 3FWPA 4K0RA 5LQAA 5DI9A 2XGMA 3UYLA 3W8DA 3EEOA 5TVKA 5EC8A 2P9HA 1YS6A 2OXEA 2C54A 1W35A 4HWGA 1MQ8B 2HL6A 2R1VA 2QTVA 2V4MA 1B93A 1EGMB 4MR9B 4AMYA 2XE6A 4CTJA 4E1BA 2V7WA 2PZBA 4F2HA 2WE7A 3FOBA 5TXGA 1Z39A 5HNKA 1TW3A 4J49A 1M2JA 4NE9A 4WW0A 4REQB 5DTEA 4LJRA 3VKVA 2J9FB 3MMSA 1NQAO 1XO1A 2Q28A 2Y1OA 4PX3A 4RK5A 2X0DA 4JLBA 3RYFB 5JSZB 1C1DA 1X14A 3N28A 1E58A 4HX2A 5JD5A 1KEKA 3HUDA 1VGQA 1ABBA 1EA7A 5BWNA 1HDYA 1TU4A 1Y6JA 5AJHA 5WRFA 4CTKA 5LQUA 1QKJA 4AFNA 4JZYA 5EHIA 1W2GA 2AOUB 2OC4A 2OO3A 5IT4A 3LW8A 1IAQA 3INRA 1JEEA 4NJEA 1F06A 2BH2A 1KRWA 2ZS7A 3IJ5A 3K9FC 1OXKB 1N5IA 3LWDA 1JR4A 4Q7LA 2GCOB 3S8EA 1DRKA 1O4WA 2B7CA 2QN6A 4MWOA 1TUIA 3MCAA 3ECSA 4E4YA 4U1RA 3N76A 3OX1A 1UJ6A 3EZYA 1ISPA 1NASA 1O0SA 4XAQA 4DMUB 3EGXA 3PEEA 3AV3A 2BISA 3QE9Y 3GAAA 3QUSA 1H2ZA 1VKZA 4WXEA 3CVYA 1BHQ1 2YR0A 1IHPA 1IY9A 4LXHA 4C5AA 3S3TA 4CQMB 5AW1A 2JLZA 4B3MB 3X1MA 2JAXA 4DLNA 2CNOA 3SHFA 2R9VA 2QE6A 1TLFA 2ZZKA 3E35A 3P2OA 1E6CA 2Z3ZA 4LWOA 1V1MA 4DYHA 1WV0A 1M10A 1XG5A 4L0CA 1H2RS 1SIUA 2FRXA 1HNZB 4KO1S 1L5LA 4KPGA 4GUDA 3H8SA 1RI1A 3UUFA 3EEYA 4HC4A 4HPJB 2IUTA 4QGSA 3UHFA 3KV1A 5CNIA 4BDSA 1QWOA 5J2TB 1WMDA 1E1CA 4QTZA 4DR6B 1B8UA 3DE6X 5K4AA 2FW0A 1QHNA 1PV4A 3ADBA 4QU0A 1C8BA 2O2GA 1N0HA 2IYQA 3SYMA 3HUEA 4D4JA 5AVWA 5FKJA 1URPA 1PGNA 4GR4A 1L1FA 4JYZA 2Z6QA 4FS3A 2QR5A 2A59A 3SS8A 1M1XB 2OZVA 4NHEA 4HNGA 4FP9A 2C4KA 2C5GA 3AETA 1MX1A 3NBQA 1QQ6A 4ZHQA 3KG2A 3JTMA 2GZRA 3OFJA 2F59A 2QDXA 4JLMA 5BYJA 2OCAA 5JNRA 3NIFB 1OMOA 1K92A 2CWWA 2M2IA 1P4GA 2QVCA 2LVBA 1W4CA 4U0JA 4AP6A 5REQB 1N2SA 3S1AB 2CVPA 3JYHA 4BNLA 1EP3B 5EZ6B 3AR2A 5ADVA 4XIGS 4BLVA 1G5HA 1I6WA 1HURA 1KBOA 3L8YA 3THXA 3QIVA 1H2WA 3OJFA 2Q9AA 9GPBA 3IHWA 3C3BA 3KOMA 3QNWA 1DUIA 2WTMA 1TMKA 2BGIA 1DAMA 4FKZA 3GLIB 1CFZA 4O2BA 2XUOA 3LWZA 5A2QA 1W4BA 4YMLA 3GD5A 1WZIA 1OROA 3UHPA 2HZ7A 4GM0A 4LNHA 4UTXA 3T7TA 4B47A 1NYQA 2W6QA 1VYTA 2VVTA 4TS4A 1DINA 5F1YA 4GLFA 5E0KB 4KQXA 5FUVA 5H70A 4DT1A 1SZCA 5FV4A 1PR0A 1IATA 1SBNE 4UOQA 1GTL1 3EASA 2ZT6A 4KYTA 5DP1A 2QRLA 5BORA 2FETA 3BULA 3OOYA 5HF9A 1QAQA 1AQJA 3G9XA 3KR1A 1CLUA 5LDGA 1UOQA 1QANA 1A8SA 1T2FA 2J0UA 1ML4A 1T9HA 1WU7A 1J8MF 3WV4A 2GWHA 3AERA 3CLRC 5KSOA 1YTLA 3GFBA 3N8NA 3EZ2A 3CURA 5JAMA 3RTCA 1ZLYA 2XECA 3JQRA 5EMMA 4FFBA 1I4TD 3CCBA 5DWQA 3F78A 3TGWA 4B6QA 5IAGA 2JBAB 2YV4A 2BSAA 3UHAA 2WSSA 1DQZA 3SQNA 5KQSA 2ZJ6A 2MSEB 4PPFA 4WTOA 2FMTA 3QX3A 2QVGA 1O95A 3QSYA 4PYLA 4NCJA 5H68A 1R4MA 2TMGA 3GRVA 1E7QA 5ICGA 1U8XX 2DJ5A 1N8NA 2UXDB 3HA7A 3IKJA 1C2TA 1W47A 2VWQA 5DHTA 2JI8A 4YQEA 3Q87B 1PDOA 4IVQA 3ZK9A 1YFZA 3I5YA 2ZJFA 4M0FA 4F7WA 2YW9A 4YYEA 1LI4A 2G7ZA 3TTXA 1IBCA 3AUAA 3M1IA 3FFTA 4H18A 2E37A 1UBUS 1UP6A 1CC1S 2ZUCA 4LJ8A 3MMXA 4BLOA 1PR6A 3NIDB 3EXFA 5HFJA 2W6ZA 2ZBFA 4PF1A 1RZVA 4JNKA 1LJLA 3N0TA 3MVEA 1VHDA 2EFDB 1K75A 1U3VA 3AI1A 5L6MB 1LJ8A 3TK1A 2RFLA 1P39A 2WU8A 3QM1A 3RAJA 3PC4A 4EKNB 3C74A 3G0GA 2ILTA 1BJRE 4YPFA 3M5WA 2BEJA 1NJ6A 1JX6A 5L45A 3G2QA 2AFHA 3DVAA 3FVRA 4KLCA 5DGCA 4XQGA 3CZQA 1L9XA 4AUEA 1E2EA 1L5GB 4OAPA 1PUJA 2JFQA 2PZKA 4G26A 5KPDA 4FE7A 4FWTA 2AE2A 1XAGA 3U80A 1Y89A 3IEVA 1R9GA 2XVAA 1L7NA 1O54A 1OXSC 1TVEA 2PVCA 1IHXA 1VIVA 1XMIA 1DELA 2YRWA 3Q6NA 4PC7A 2I1WA 1YQXA 1KSFX 1L5HB 3EIWA 1ZY2A 2D6FA 4C14A 3BRQA 5JSUA 2VDLB 1XZJA 3WISA 5KYTA 3BDVA 3UK0A 4WX2B 2AWOA 2OPBA 1D1QA 2IKQA 1VZ3A 2NTJA 4IHJA 5ALUA 2QX9A 1OXVA 1M33A 3ENVA 2PM8A 1W59A 3L06A 3OZVA 4ARSA 2ZIGA 1UK8A 5MFPA 3GRRA 4CV1A 1A1VA 1GQSA 3P9CA 4DUZB 3I04A 1Y7LA 3O7MA 4W1SA 5EPUA 5C8VA 5KINB 2UZ0A 1T3ZA 3L1JA 1NM5A 1JFTA 1EDDA 3KTAA 5KX5A 4PG8A 3JVUA 2XEDA 2F67A 4Z0NA 1X7WA 5FBKA 4NBNA 2JGFA 2YXPX 3GP5A 4GOKA 5AICA 1N5OX 2IOQA 4AX4A 2BYTA 4BO7A 4MRNA 3ZW8A 1K2WA 1DKOA 1ST3A 4EKEA 1Y4DE 5K0LA 1ZXLA 3TXAA 2XXAB 2C5HA 3KQOA 1Y4SA 4HDRB 3OF3A 3DHYA 3A1TA 5IDYA 2ZIVB 2PXAA 2QN2A 1Z7YA 4TN5A 4YAEA 5KJCA 3KB8A 1L7DA 1BROA 4HSGA 1TIKA 1YB6A 3GA0A 3LQYA 2IYAA 2W2NA 1GCOA 3G7UA 2VH1A 3AIKA 4RVNA 3R9IA 3ZDFA 4ZDIA 3DMYA 1J0DA 1CQWA 3FCUB 1KDPA 3S2GA 3DZIA 2NUPB 2DVMA 2ZU6A 4TKVA 1MABA 3A1CA 3LQ1A 3UMYA 3OFSA 4XM2A 4ESVA 1M3SA 1T3HA 2H0RA 1EP1B 1WXGA 2YRXA 1NG9A 1YR3A 3NAQA 3RASA 4FZ3A 4JXXA 3VSEA 3G49A 4YRSA 1DIBA 1GFIA 5LQCA 4JJKA 3AZQA 4G0VA 3UB3A 1F4PA 1XCMA 1MR3F 1G63A 1NUHA 2IPAB 2BM8A 4DJJA 4YIHA 1XJ5A 3LLUA 4HG2A 4UBJA 4V3BA 4MRMB 4O5AA 2RGUA 1ZU4A 5JSHA 4RNDB 3CONA 3N8KA 4PYRA 3T7AA 3W2HA 2OK8A 3I6QA 4DJTA 3LLVA 4MJ3A 2PSJA 1SIWA 2HGZA 3HYRA 4IZOA 3PPVA 1WBDA 2V0NA 1ZCBA 3ER9A 4BV8A 2MSLA 2NU7B 4L76A 4DTIA 1QBGA 1V9CA 5EFZA 2C7PA 3SKVA 2LXNA 4L74A 1WPGA 3S7TA 1WO8A 1JW9B 2E0IA 3JQBA 1ZM2A 4LFBB 2BM0A 2DWCA 1OYOA 2D4HA 3JAWB 1SBZA 3HWRA 4I14A 4OQQA 3BWEA 3LC1O 1YWGO 5ESWA 4IIXA 1AZSC 4BEBA 4CFSA 2FR8C 1ILEA 1XKXA 4IRMA 2JL1A 4TZ6A 5BUSA 3RYHB 3EC2A 4G6ZA 3WYEA 3MT7A 2FN7A 1XZIA 3LYHA 3AVQA 4ZV7A 3RARA 1CR4A 2QI9C 1KU6A 1L4LA 4OB7A 1EQUA 2DPLA 3RCBA 5GINE 4PC1A 2R7KA 1ZWLA 2FK7A 2JCVA 3G5TA 1CEQA 1PJZA 2B2NA 1WW2A 3E1GA 3GF4A 3H4MA 3L7CA 3QUQA 4JYPA 5AK4A 4S0ZA 4DA6A 2RCNA 2HRZA 5FUWA 3R9XB 4FJ1A 2BP7B 4JQZA 4DA0A 2BGMA 4BVHA 1J23A 3SR4A 2XE8A 4RDIA 3O90A 1AVTA 4NCAA 4I8XA 1H2HA 4P3OA 2XR1A 1PFVA 1UR5A 2ASVA 1SCUB 3Q0EA 1K3TA 1I3KA 3O8OB 4HXGA 4MWEA 5EIXA 1EPUA 1N2BA 1H85A 1JQLB 2PFSA 3DO8A 4QOFA 1NG1A 1M7GA 4GBED 4JROA 5JYCA 3RC7A 4G85A 5EJ2A 2AZMA 4MZXA 1I7PA 4C4YA 3WRWA 4DABA 3SZLA 3C3WA 3CT4A 1JVSA 2IOHA 3SZGA 4NBTA 5DWVA 5EVCA 3OZFA 4AZWA 3FHTA 1QO9A 5H1YA 3U3MA 5JYDA 4UAJA 1TZKA 1XTKA 4S1TA 5GIPE 1LLFA 2A0XA 5EP2A 5K0NA 1H1LA 2HJ9A 3QX9A 3PHCA 3U9SA 2EW2A 2PFGA 3VV3A 4Z4GA 5CT9A 4B3BA 1LQUA 3T7KA 2Z9CA 2HQBA 4ZGGA 5LXTB 1VECA 1E9EA 4QBTA 4S05A 3GVHA 3I34X 1WDKA 4O4HA 1QG4A 2IX9A 4HDNB 2CW5A 3LOPA 1CZHA 1NYRA 4BO6A 3OEED 3T0FA 1Z4JA 3QU9A 1EFVB 4HYYA 3DFUA 3NYIA 3VH2A 2AMLA 4S1WA 1SBIA 4X93A 1SIBE 4G9EA 3OQJA 4Z2AA 3P0IA 1M8PA 3TN7A 2QE7A 1J49A 5DXJA 1WDLA 1GU1A 1PDWA 2OGWA 3DZGA 3RHFA 4QOEA 3TLKA 3MTJA 1K7XB 2B5WA 2OBYA 2I6QA 1KAGA 1S8OA 4M0MA 4KGZA 4N18A 1E2IA 3D3WA 1N3YA 4LYFA 3TQQA 1CD5A 3W5CA 4WDRA 4CT5A 1YBVA 3ADDA 4WT7A 4Q19A 5A3VA 1R16A 2QUJA 4GP6A 1KQ3A 2YVQA 2BI8A 3NJRA 3HBFA 3LFUA 4LZLA 4TROA 4BMOB 4PNEA 1Y5NA 1Y4ZA 1EA5A 5AKHA 4PBSA 4BLUA 4QRIA 2ZIFA 1KJ9A 3EYWA 1H8HA 1TKAA 4DMCA 3CLUC 1P0QA 2N1BA 3NHRA 3AJAA 3L41A 5GGXA 2H59A 1JR3A 3JATB 4BQOA 4RSHA 4Z9BA 3IDAA 3VYVA 5CT4A 4BFSA 3S7ZA 3LBIA 1Y8QA 1VQ1A 3I6BA 5LR6A 1W5SA 4G81A 4MA0A 4CKWB 4DZZA 3I45A 3FLBA 2R1ZA 5FOQA 2Y6UA 3KDPA 3D8RA 2C7QA 5KOHB 4OYLA 5JAPA 1KY2A 2YXDA 3C6QA 2AX3A 1EP2B 3FUCA 5DBEX 2HHHB 1XQ6A 4A0RA 2XCOA 1KHHA 1O8BA 3C6MA 3P0JA 2HDOA 4OSEA 1E2NA 4RD2A 4RIIA 1JB1A 2GAFA 2WJ3A 5G4KA 5KYUA 2DSNA 5DE3A 5EL0A 1ADFA 1J70A 2ROQA 4G41A 3H2HA 2H9IA 4KXVA 1DDIA 1Z4NA 5BUQA 1ZW6A 5EJ4A 3VHRA 3K0BA 3V2UA 3B60A 1ZR2A 1OWMA 4BNIA 4E1AA 3H9BA 2CJWB 1GRVA 4Q05A 2X9LA 4U7GA 3G9UA 4TWAA 4DV1B 2ZK7A 5LMNB 3A1SA 1JEOA 4A6EA 5BXQC 4EVQA 1OTXA 1RWQA 2ZE8A 5CIWA 2B92A 2J31A 3VO2A 2FP4A 4YCLA 3O3MB 1M34A 2ZRMA 4BQIA 3C5EA 3R3ZA 1BX1A 2WJIA 4RV9A 1SO8A 4YREA 3U2QA 1U5BA 3FOAA 1LW6E 1T1IA 1XZKA 3ZEIA 1G59A 1E1KA 2PRIA 4R2MA 2AB0A 3RJZA 4K46A 4ROSA 1JEQB 3NR2A 2DWOA 1MA0A 1B26A 2PCLA 3R44A 4RNCA 5FI3A 3C6BA 3P9NA 3RAEC 1FMTA 4WXHA 3CVOA 2BE7A 3CPEA 1QC5A 4KLAA 1J0XO 3CZAA 1PD1A 2YOFA 2O4CA 4HWRA 5G0TA 4YJHB 4KO4S 1NUTA 1XRLA 1ZAKA 5HKLA 1AA6A 1H4TA 3BJIC 2BGWA 3HZZA 5DM1A 3PPIA 4KTVE 5H59A 3ZCVA 2I7CA 4UARA 4KNYA 3ZWNA 2MYNA 2VP6A 3D3KA 1LBSA 4OKIA 4J4HA 3O2NA 4BNUA 2FXIA 4KE9A 4JXKA 4AJKA 4MWBA 3ZE2B 3HDQA 3LQ4A 1DOZA 4A6PA 4OI0A 1JT2A 1ZGZA 1U7HA 1Z2AA 2HHCA 2NZWA 5C4GB 4FI3F 4J1TA 1N8SA 1TYAE 4BMVA 1Q15A 1FFSA 1NVVR 4HRYA 4AMGA 1JILA 1D8AA 1NVXQ 5DBGA 4L9RA 2FOLA 3DDSA 4PX2A 5CVDA 1KI8A 1B8NA 2R1TA 1F17A 3BE8A 4QBIA 4D3YA 5ESXA 2XVMA 5F52A 4MPPA 3AFHA 1TTQB 1OZGA 2RHCA 3PL1A 4BEWA 1ZD4A 2XQIA 4MIYA 3G8CA 4YMSA 2AJTA 3H9GA 3I73A 5FUXA 3L1IA 1ZCFA 2GN6A 2WF7A 2DLCX 2FFHA 3N6XA 2BFDA 2PQ0A 4G5HA 3HZOA 1YB1A 4GEKA 3ZGVA 3E22B 4MVCA 4TM7A 5HS6A 1XRPA 1QQ5A 4GXQA 1COWA 4N3GA 3LDHA 1QRRA 4HFJA 5FTLA 4PSAA 4PRYA 4ZVUA 3R3SA 4M0LA 2Z6UA 3RBXA 1T5HX 1U9JA 3EG9B 2SCUB 3F7TA 4J16C 2QMQA 2K2WA 5A2GA 1F38A 3ZDXB 1DC4A 1ODFA 1WNTA 5DPMA 1FFXA 2FPMA 4DMLA 1LY1A 5BV0A 4GE3A 2VP0A 3AESB 3B1FA 2FZGA 5C35A 1EXVA 2CHUA 3NANA 2JKVA 2A9OA 5EUCA 3PQ4A 2VUSA 1CFJA 4R1UA 3R3UA 3WRYC 4ZVSA 1A77A 1KQOA 1KGSA 2AMVA 1ACJA 4LIPD 5I9IA 3LCMA 4ZYYA 3MWDB 2R7NA 3DTVD 1YJBA 4L6IA 1BVYF 1XDSA 3A32A 3DZBA 1WXIA 3OA0A 3TW8A 4DV4B 4EG1A 2W2LA 2NYAA 4L02A 2WAOA 2ZXEA 1BFKA 3BJZA 1OSNA 4N9QA 3MUFA 3Q40A 1WAMA 2XYRA 4BNFA 2I6TA 1OUMA 1AXEA 2NXCA 1E4YA 3LU1A 5KVVA 4BFZA 4AJPA 2UAGA 1A4RA 2VDWB 4B4DA 5AJVB 2QXYA 4N54A 3VBCA 2BKVA 2H7VA 3CEMA 4YRCA 1AO0A 2IXAA 2P6NA 1G20A 1KZGB 2VHXA 3NJ4A 4QBGB 2IY9A 3WWZA 1CUYA 4RPCA 2C5EA 1EWTA 3GT4A 2UYYA 2WVGA 1REQA 4WAUA 2VK4A 3W6UA 1BHJA 2V7PA 3TAXA 1HNWB 1K5PA 3I0ZA 3EY4A 1ZN2A 2CVOA 2JCSA 1T5IA 4JEUA 3D81A 4PO1A 1C3LA 3ZH9B 2P2NA 5I3CA 3O93A 2QTZA 1WB9A 4FW8A 2EKZA 3DPUA 2H4WA 2ECQA 2PBZA 3C7TA 4PQYA 4Q1CA 4HB4A 1Y98A 3Q98A 3LZCA 1ILWA 3D4NA 3FFBA 4J8PA 3G8BA 3LCCA 2LPMA 3GUCA 3T6KA 2P8JA 2H1HA 1DBPA 1XK6A 2W6JD 4PG6A 2JGEA 1TD9A 3ICCA 3R7DA 3ZLJA 3RS7A 1HG1A 2B1RA 1B6GA 1QIJA 2OV4A 3CSUA 2JGIA 3FVTA 3OVMA 5D5HA 3W3AD 3VTKA 2P2DA 4AZ0B 2BHNA 2H1IA 3ESXA 5KNCD 1K6IA 1SQFA 1V6CA 1DUVG 1P2SA 2FLKA 4GRIA 2H2FA 4TMFA 3TECE 3KWLA 2H0QA 1A8HA 3A9WA 4U7HA 5JD6A 4DWJA 4JI5B 1WEHA 2XRZA 5IM5A 3FGOA 2JKZA 2B7LA 4FDMA 1WPQA 1XZMA 3EE6A 2B0JA 3NALA 1S6YA 2UVPB 3PXXA 4G8JA 4XFKA 4E13A 4F38A 3H6KA 3H87A 4XDZA 2BWJA 2A7XA 4OLHA 5TF4A 2ZYTX 3W34A 3HCPA 1PZEA 5DOZA 4F7DA 3AR7A 4L5BA 4X1OA 5LQJA 4BRUA 1EUDA 3NRBA 4NESA 1QRDA 2CJFA 4FDUA 1LPSA 1NXOA 2X41A 1G60A 4MQEA 2WWRA 1C9MA 2WD8A 5F23A 1T9KA 3HYTA 3CUYA 3BAZA 3IPXA 1G6Q1 1RKBA 5FP0A 4P54A 3ZW7A 2VPZA 2Q4RA 4ESHA 5ICEA 5HILA 1KH3A 1ZISA 3IXMA 1B1CA 1U11A 1RYMA 3K30A 4OM7A 5ES3A 3SMVA 3WIVA 4C7MA 4DJDC 2E3JA 2X3UA 5JAOA 1QLHA 1CR0A 1QRTA 4N8DA 2BFMA 2X0RA 1KJJA 4MWCA 4UUOA 2HX1A 3S8MA 4Z9XA 4IH4A 1G0OA 1G21B 4CMJA 3L6UA 3MUOA 1FZQA 2JIQA 4DA8A 2P2ZA 4HZGA 4QAJA 1XZGA 1W52X 1DAPA 3TO5A 1D0IA 3I30X 2A1UB 1FUYB 1RS0A 2VJMB 2JLUA 1M66A 1CZUA 3P0EA 4EUNA 5JW6A 3ADCA 2JLCA 1Z7BA 3MFYA 4F86A 5HR5A 2JDIA 3CNLA 3HTXA 2IQIA 4QYXA 4U02A 4GPD1 4FFNA 3LZ6A 5TMPA 4KLNA 2DR3A 4MHTA 1K9SA 1Y63A 2FMIA 4AKGA 3V4FA 1P19A 3D5QA 4IBOA 1GSOA 4FX5A 4FSHA 3BG5A 4JOCA 3AB3A 4URWR 4ZTUB 2A9FA 4IIGA 4IZ6A 1UPFA 1FXWA 1QG6A 4ZO6A 4CWAA 1Z06A 5D3ZA 3H5NA 2I3ZA 3HNOA 5F12A 5IXSA 3JQ8A 5ECYA 4R7ZA 2PQ6A 1II8A 1X0VA 4COKA 5CFNA 5LQNA 4KSYA 2J6CA 3ZWDA 2JI4A 1X92A 1NMQA 4R7GA 3DL0A 4BX3A 3C3JA 2R65A 4PWYA 3MN1A 4L5AA 1PR2A 3D8BA 3MRTA 3LW7A 4WNAA 3RHTA 4PSUA 3F0TA 2IEBA 1E5XA 4Q7MB 3IODA 2BMWA 2SECE 1EDZA 2PJZA 5F7OA 5IFKA 3KK0A 3LRPA 3JZAA 3H84A 4FONA 2VP5A 4KU4A 3DLPX 2JFFA 1YRWA 3EXHA 3U3KA 4FFRA 2VAPA 3HFJA 4DJ5X 4TYWA 3NDRA 4REMA 3KXPA 1RTTA 1HLGA 4NATA 3IDFA 2DY0A 2GJ9A 2XIJA 5P21A 1U8FO 4U7WA 5HPYB 4JLUA 1SCAA 3GZTB 3PFFA 3DVSX 3FPBA 1AQYA 3JYQA 3LHFA 2YWGA 1ZCJA 3O95A 5INTA 5JC1A 3K70C 2Z4SA 4PYNA 3AVOA 5JG7A 3ZBTA 1CVIA 4WL0A 4JJAA 1RHKA 5CFRA 4I6GA 1P2UA 4P5EA 1JJBA 2X9VA 4RVUA 1SH7A 3SK0A 3T41A 1QHHB 2AFHE 2IPNA 4WKBA 1UAGA 1V9SA 3D6VA 3CGWA 1DV2A 3Q9LA 3ZNQA 2WZQA 3D3NA 3QENA 4N39A 4RTPA 3Q3GE 4PAMA 2J87A 5JO0A 1MJ5A 4ND8A 2C2KA 2C7GA 4G1EB 3HXPA 5DU2A 4LEIA 4ZDWA 2FWIA 1J06A 4J4BA 2PL1A 2DTDA 2ZBQA 2ZI3A 3WLPA 3JQFA 3D4OA 4CLOA 2OQ2A 3DHWC 1Q1ZA 2ZQYA 1LDGA 5JBQA 2RGRA 4IH1A 1PR5A 3EGOA 1YZKA 5TPWA 4CIYA 5BMVB 1RYHA 3LBAA 3PRKE 3DA8A 5LBIA 3OAAA 1MPXA 5I47A 2KYRA 2Q3MA 2IP1A 3EWSA 4V0ME 3VOBA 4CR7A 5JAZA 5I8PA 1W88B 3NYQA 5DW3A 3MRVA 4GL4A 4KWHA 3QF4A 3IKVA 3NHPA 1ECFA 3P9ZA 5TQ0A 2HT1A 3MRXA 2W2QA 2PAAA 1VA5A 5AVQA 2CLDX 4B8ZA 5ITZA 4JEMA 4YUZA 2VOJA 4MROA 2FWRA 1E94E 4PX9A 3LK7A 4QOGA 3MTDA 5BW5A 3DKRA 1NN1A 1AM4D 4L75A 3HH8A 3PI6A 1U3DA 2IYXA 1OLUA 3G6KA 4HOYA 5EQJB 5BUCA 1KSGA 2VS1A 2R7AA 1K66A 5KKCA 3GGPA 1TFUA 5PGMA 1U3FA 5ILOA 1XLTC 5BXYA 1E6LA 4FPXA 3EH1A 1Y8ZA 1DTWA 1HT0A 1LWOA 3A3KA 3EJ6A 3CRMA 3FVQA 4XB1A 2PKQO 3PLNA 2UZ4A 2W0SA 2P68A 1R27A 5FOTA 3L4KA 1SRRA 2Q46A 4L5IA 4UHEA 2BDEA 5JISA 2HU5A 2C97A 1JHRA 1FQWA 1YTUA 3PHBE 4ZZ1A 4BGUA 5FTKA 2VPTA 2G08A 2O5CA 4EAAA 3OLVA 4GRDA 4NULA 4ENPA 2IEIA 3PHLA 4ARCA 2O5RA 1QCDA 3KIPA 3BIWA 4WLFA 4ZYXA 4KR7A 3KL4A 1NUQA 3DE1X 4HXYA 5BWBA 1SUPA 1J90A 3U4AA 4P33A 4NYIR 3L1HA 1JNYA 4RH3A 2G9NA 1XZPA 1LX6A 3P9RA 1OXTA 5BOSB 4IEEA 2OBBA 3DKPA 3GRAA 1V5WA 4I4CA 4D5GA 1M2EA 3LVRE 5J1TB 5B4UA 4MKRA 1VIAA 8OHMA 2R4QA 3MLBA 4X24A 3VTZA 5IASA 1DEKA 3GT3A 1E3SA 5AI8A 1UOEA 1L5FA 5CVVA 5DCLA 1GPYA 3QSGA 2OV1A 3ZCPA 2J0SA 2VSFA 3KTFA 2I1VB 2XUKA 3PFIA 3DDWA 1PT7A 4RAQA 3MHPA 5FNZA 4P4SB 3BN3A 4V3CA 5FHQA 3LCVB 3H2ZA 5G40A 4S24A 3FETA 2DT8A 5D3QA 1PVDA 2JZCA 2MINB 3SQLA 4NQZA 3D6HA 2O57A 2XB8A 4AK9A 1TZJA 2I8CA 5EYPA 5B3JA 1ND5A 3BB4A 2RBKA 2ONZA 3IIMA 1S89A 3R6GA 4KZPA 4CODB 4S1PA 3DE2X 3C8MA 1UOOA 5AVVA 4GMKA 4ZO8A 3VHQA 1BU5A 1FMJA 3I12A 3I9JA 4MRSA 1MN6A 1X1TA 4C4OA 5ALFA 2ERYA 1KERA 1TA9A 3CXUA 4LTDA 1FX0A 3DMTC 4TLLB 5LLSA 2V54A 2C9ZA 4ZREA 5LM3A 5EUQB 5C5DA 2XCTB 1DJMA 2RAPA 4CLHA 4ZA2A 3M3HA 4DVJA 5CCXA 2BEWB 4KREA 1HKHA 5DMXA 2HQRA 3B3AA 4ZJUA 4DSOA 1TJYA 1LSJA 2Y1CA 3AXTA 4FUQA 2DM6A 1Y6GA 5BY2A 3Q41A 1RCTE 3J80A 1XMVA 2YXEA 5LSAA 5TJ9A 4V03A 3T3MB 4Y6LA 2PU5A 1AXRA 4Q66C 3BTVA 5CFOA 4D26A 1BH6A 3NEYA 4D4HA 5HOEA 3DEIA 5A1TA 5IAOA 3D6AA 4PGHA 1ZG3A 3TTVA 4F11A 1D6MA 2B2CA 4JKYA 4F6LA 3ZCQA 3L7AA 5L7WA 1J5XA 1K6XA 2ZRJA 1T6BY 1WX1A 2EZ4A 4J03A 1FNNA 1N0VC 1QO0A 3GLHE 1XTIA 3IT3A 1SEPA 3V4VB 3ZU5A 1YZVA 3WGOA 2ADOA 1CY4A 3DMTA 3C3CA 4W9RA 3RNOA 4IWNA 4CDGA 1TM2A 4ZYWA 2P4SA 1NX6A 4QUJA 5EP3A 3SLRA 4B9EA 4O3MA 1WCV1 4EJSC 3NTRA 2TECE 1RP7A 3EIHA 1ODJA 3OP4A 1C9YA 1KSHA 1YE5A 1CNEA 3FZYA 2WHPA 4IHQA 5B37A 3KDSE 3UJ8A 2M32A 3NIWA 4AKSA 3DBOB 2HCTA 1QGOA 2C9CA 3C97A 4JL8A 4DDVA 4KRFA 3H04A 3IAM6 3E2PA 2A3NA 2O7QA 4ZPXA 5HCUA 4EJ0A 3SQXA 3FCAA 1ESEA 5TPZD 4CEJB 4HNAB 1XAIA 2VDPB 4RJ2A 5C1DA 4BRWA 4FCTA 1E0JA 2I6SA 4NLLA 2ATVA 1L7EA 4YECA 5TE9A 4H1UA 4O1MA 1VCOA 3OURA 1JZQA 4FYMA 1Z6XA 1LW7A 3IMGA 4JUAA 4O29A 2X7XA 3HR4A 4IIUA 1YZLA 3RUDA 3TSZA 4PQFA 1DAFA 4A2CA 4B4KA 1HI9A 4C2TA 3I8OA 2G7MC 4L3VA 4C4RA 1FIUA 2P7IA 3EVCA 4JT8A 4XJSA 3H5RA 1UZUA 1T9ZA 1X2EA 3UH0A 2A4MA 2Y1FA 9ABPA 2J3HA 2YWEA 2HHLA 3EW7A 3SJ7A 3O8RA 2ZIEA 3NVKI 3BE5A 3PXDA 3S2EA 2DFVA 3BSFA 3SX0A 1B0ZA 1R2QA 2JCBA 2G0NA 4LZJA 3DEKA 3LXRA 3WQBA 3L6EA 4RC9A 2J9RA 4B8WA 2J5KA 1CP3A 4UUBA 3PDIA 4LS3A 3SM3A 1ZVQA 4C89A 3RD5A 5LP1A 4RTJA 1ZITA 1EVLA 1F0PA 2DQYA 4JZKA 2J46A 1MGPA 3R41A 1NVEA 2HWWA 3E5MA 3RHZA 4ZQHA 1HTBA 3BA1A 4XKJA 3C8HA 4DC9A 2PUBA 5F3DA 2P3LA 1IK4A 3AF0A 3HB1A 4IDBA 5K6AA 2P9BA 1AS0A 3EZFA 3LT2A 4UFNA 1K3FA 2UYQA 3C3EA 2Y0BA 4Z1MD 3V9AA 5JFTA 2NNLD 2XXJA 3CN9A 4TMZA 4MQFB 3ZZUA 1KO7A 1SVIA 2X86A 4OBXA 5FEMA 4Q9LA 5FIUA 4YCJA 3KSRA 2OT3B 4Z8XA 2WJGA 1J33A 1YGPA 5J5VA 4CKYA 1D1TA 3VZDA 4YCNA 1E9VA 1P81A 2BZ0A 1DE0A 3JX9A 2FE1A 2EG5A 1A9XA 3SIXA 5IW8A 2PKXA 5FOVA 1WIWA 1CQJB 1Y7PA 1Q91A 3BAFA 3BD8A 1UADA 2ETVA 1LRJA 1S9DA 1BHSA 3A6LA 3OTGA 4Y7DA 3A6DA 4JCCA 1UMBB 5KYVA 2KMLA 4KPFC 2ZCVA 1X1SA 4B71A 3LIPA 3TE6A 3GFFA 3D6FA 4H35A 3V8PA 2D3TA 4JHLA 4B35A 2WM2A 3DL4A 3ZE0B 4AQDA 5AW6A 3B36A 3W3ZB 3ZCRA 3GGDA 4LC1A 1DX9A 5JNWA 3SQOA 1OI4A 1E64A 1VHQA 2B8EA 2FEOA 4ND7A 2V7QD 2Q7DA 2GHQA 3MWYW 2YZ2A 4QHTA 3OPYB 1FDOA 2F1OA 2IZ6A 3PT9A 1K6JA 4QQNA 4ECAA 1CB0A 1OFHA 3OM8A 4YP6A 4BNWA 1O0CA 1UBSB 2VIIA 2RONA 4DCPA 2J7PD 1I0LA 5U1PA 2JAUA 1J22A 3PL5A 5FFNA 3U7QA 2VF7A 2IS1A 2FXVA 1JI3A 2JEOA 2FSSA 2B36A 3ENZA 4E2FA 1UZAA 2ZUBA 5KYYB 2OG1A 1T0HB 2ARKA 3ESBA 3K9GA 4TRRA 1RWMA 1WKCA 3NEJA 4ETIA 4TVBA 5KDOA 2AZDA 3E9MA 1O4VA 2R86A 3OETA 3JAMA 3A9TA 1KDOA 5EWMA 4BMXA 2H8KA 1D2MA 1N0WA 2VSYA 1C0PA 3IQDB 2GVDC 1XMOB 3DDOA 5TC4A 1DBRA 2UYGA 3SICE 1Q19A 2PGNA 4KAJA 5CT6A 3MJ4A 1TAUA 1P45A 4GD3Q 3E1KA 3VSCA 1FP7A 5J2UF 4L4SA 2B94A 2JATA 3HU2A 3G7SA 3EOZA 2JD1A 2IEZA 4N7BA 1JXOA 1K8QA 4LF8B 5KSZA 3KJNA 3OCVA 2I4RA 2NO6A 3IT2A 4WD3A 1MU0A 4L15A 1AF4A 2JCXA 4BASA 3DFIA 3L02A 3EXIA 5BSHA 2PD6A 3RE1A 4EKYA 4WJZA 2XTNA 4EUHA 1JE0A 1NI5A 1NN0A 2CVFA 2OWDA 1IULA 4RIGA 2IS4A 4FILA 1M1YA 5LBTA 2H2AA 3T61A 1TF5A 2BEVB 2GKSA 4RANA 4DCUA 1J5PA 1WPXA 3KSUA 4EMTA 1I7SB 4N3CA 1EIZA 2QSZA 1V95A 2PYIA 4YXWA 4CF4A 3WQHA 4Q47A 2QYOA 3S8YA 2P75A 4Q3EA 4A23A 3ZHQA 2KQUA 5E7QA 5CB4F 3H4VA 1JFFA 1ZGAA 2B82A 4QYIA 2Y0CA 2KWIA 2QDKA 3THWB 1IEXA 2WYIA 2BLNA 4DCGA 3IC5A 4BECA 1C4OA 4MVJH 4I9UA 3ZX4A 4Y2TA 1G5QA 4B87A 4OHCA 4Q7QA 2IPLA 1BXRA 1IBRA 2E55A 3PXUA 3AP1A 4E2WA 2OB1A 4ZXPA 3CXRA 4I55F 3RU2A 4RO0A 3WGZA 2ZPAA 3EFEA 3H9JA 5IWAB 1UFRA 3LECA 3Q3IA 3KB6A 4FMDB 2LCIA 4W1PA 1AHPA 1W36D 1L5SA 2Q27A 2Y05A 2CUZA 5EJEA 4K6CA 4C0WA 2YWXA 4YJ3B 4AULA 5FBQB 3DOJA 4WK2B 3B8HA 2IDMA 4X7RA 2WB2A 2C03A 5C34B 2RGNA 1RWPA 3B2QA 3NKFA 3PJRA 3A1EA 4XA8A 5CLHA 2XE7A 1H5NA 1LVUA 3A9UA 1R15A 2QG4A 3IVXA 1K06A 2FHSA 2V45A 4JYBA 2XUJA 3UT0A 5I01A 3JD4A 4PLVA 2C3YA 2FJPA 2RAFA 1G20E