2LWIA

Solution structure of h-rast35s mutant protein in complex with kobe2601
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In silico discovery of small-molecule Ras inhibitors that display antitumor activity by blocking the Ras-effector interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords GTPase HRas
total genus 41
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2lwiA00
3BFVA 4RKEA 2H5EA 3FE2A 1ZAKA 1Z06A 4AD8A 1JAIA 1XWIA 2CLSA 1OV4A 1UKVY 2VP0A 3OAAD 1ZU4A 4JSTA 3WNDA 4TLDA 3F8TA 1G6OA 3WRYC 4MDFA 3GLGA 2RGNA 3BFKA 3OE7A 3D8BA 4V0NA 1XP8A 5BN5A 1E2JA 5LD2B 5KUTA 4RVCA 3KKQA 4B33A 2SHKA 521PA 1OYYA 3F3YA 3U6KA 4ZI3A 3FKSD 3AVTA 1YQTA 2MSCB 1R5OA 4JLOA 1ZU5A 2I1QA 4KU4A 5GJVC 2FOLA 2EYQA 4URVR 5KPDA 1ZP6A 1G3UA 4W7SA 4DC9A 4A36A 4DB2A 1RVDA 2BDTA 2ZRLA 1NJGA 3IUYA 4PFSA 4ACAA 1WDTA 4URWR 4AG6A 5AJZA 1NN3A 5AUPB 5BN4A 3N70A 3SJZA 2HLDA 4G3XA 4W5WA 2P5TB 4M22A 2FPLA 4GMXA 4URZR 5EXTA 1IN6A 1FUUA 2CNWA 4CIDA 1GL9B 2G0NA 2B6HA 4P33A 4O25A 3OIYA 5FPYA 1MO3A 1DTSA 2BBSA 1H8HD 3CKLA 5LDDC 2Q9CA 5LD2C 5D3MA 4DCNA 4D2IA 3OFNA 1GRQA 2IS6A 2W58A 5J4YA 2J0SA 1ZNZA 2WWHA 4GP6A 4HYYA 5C4GB 1XXHA 1DEKA 3B7GA 2AKYA 4KVAA 4Q5IA 1A82A 2BIFA 3TH5A 3TW8B 1MABA 5DI3B 1MV5A 1CJUC 5FUWA 1ZC4A 3KB1A 4TQUS 2O5VA 4WVFA 3VX4A 1UEIA 5GVSA 2IS4A 4WXRA 3N2IA 5CB8A 4F7WA 1VIAA 2PZFA 4HAYA 5B58C 4PHGA 3V4RA 2KWIA 4M1YA 2G1JA 4I1VA 1CR0A 1ETUA 1E0KA 2ZSFA 4HDCA 3REGA 2ZUCA 4US1R 3K70B 1LTQA 2ZI7A 4WA7A 1CS4C 3B2EA 4Q9IA 4Q18A 4US0R 1NMXA 5EE1A 3BB1A 4RY2A 1GKIA 3BB3A 3QPVA 4EPVA 2A5YB 1E2LA 1GG2A 4L16A 4F93B 2WMOB 4ZKDA 4PC1A 5L3QA 3KL4A 4Q9LA 2V54A 4F92B 5DO9A 1E79D 3OAAA 1K5GA 2DWPA 1Q44A 1R5NA 5HKKA 3GEEA 1TAGA 2AXNA 5AJVB 1EK0A 3ZYCA 2JJ2D 2RGXA 4R2IA 2JA1A 5HZHA 1W5TA 1E32A 2W6ID 3OIWA 1A5TA 4AKHA 4BFUA 1VIYA 1NIJA 4TLBA 1RJ9B 2K5UA 1G1MA 3C8UA 2HUPA 1SVSA 2VSFA 1Z0AA 2C98A 1MRSA 1S96A 4Z1MA 1KHTA 3DKVA 1ESMA 3I73A 2ORVA 1YZUA 3U7GA 2VP4A 2WJJA 3Q8XB 2AN9A 4WW0A 1CJVC 4MKIA 3O8RA 2A30A 4A2QA 2VIIA 3IO5A 2QN6A 1VTKA 1XFAA 3BERA 3U6BA 4LDJA 2RGDA 2Z5FA 4GOKA 2E1RA 3AP1A 3R20A 2QE7A 3NXSA 3I72A 2XSZD 3ZIAA 2V4ZA 4RD3A 1QHYA 3CW2A 2GKSA 4HEJA 4NH0A 5DI9A 1NI3A 4TT3D 5G3YA 3GLIB 4OL0A 2GZDA 3OEHD 4RFSB 5AJYA 1RE0A 1GILA 2OV2A 4A9AA 4BEBA 4HLCA 4ZDIA 4V0MA 3EPKA 2WMNB 5IK2D 4DLTA 1NG9A 4A82A 1KO8A 4EUNA 1FTSA 1RZ3A 4R9UC 1OPXA 2OESA 4CEHB 2FEMA 3BRWD 2A5FA 1BH2A 3IBYA 1CR1A 3ASZA 4JBYA 2QGZA 4AKEA 1G4UR 1Z2CA 1KK0A 4Z54A 1QVAA 3IKJA 4K46A 2XXAA 2OFOA 4ON9A 5K8TA 1OLOA 4RZ2A 5LBIA 1M34E 1G4AE 1NBMA 2JDID 4JT2A 4P4TA 1XD2B 1Z6AA 4GP7A 4KLNA 5A0FA 1VYUA 4D4LA 3KB2A 2DCUA 1SKQA 2R6GA 1DELA 4UXHA 2CE2X 5H1YA 4DDTA 3LAWA 2NIPA 1ZBDA 1QHIA 1IXRC 1JBKA 3AF0A 3QNUA 4N3NA 2O0JA 4EAQA 3H4MA 4AG5A 1KGDA 4NCNA 5SZHB 2F1RA 2W6IA 1KAOA 1E2KA 1TNDA 5CYPA 4JVNA 3GFPA 1G8YA 3HPRA 4JKIA 3QE0A 5CLLA 1IN5A 4H9GA 5HKKD 5JCZA 2QRNA 1QHNA 4ITRC 1OF1A 1Q1ZA 4B3GA 3WP0A 1AKYA 2UZ3A 3K9LA 3P4XA 3I4LA 4EIWA 5J4HA 1OKKD 2PT5A 1J2JA 3UMRA 4RD0A 4B32A 4L5BA 4F38A 3L2OB 3HR7A 3A58B 1F2UA 4ARZB 1KKLA 2D3WA 5FR1A 4FI3C 2PMDA 2IYUA 3U44B 3RS4A 3KQHA 1RRGA 1P73A 1VCNA 3I5XA 3CWZA 1RRFA 3AH8A 1G3IA 3CZPA 4D81A 2IL1A 1M6NA 3SYNA 3EARA 1R8SA 4G5OA 3BOSA 4MYUA 2PJZA 1XB2A 2I1VB 1ODFA 4HAVA 4DT1B 4TL6A 2X2FA 2ZI4A 4QNMA 2FPKA 2CHQA 4GPTA 1UBGA 5CM8B 2L0XA 1KK2A 2BM0A 1NSTA 1E2PA 1YR8A 2YOFA 4BFYA 2FH5B 4JZKA 3QJYA 3RANA 1A7JA 1AGRA 1XCPA 2P3SA 1Z6GA 3Q9LA 1VYTA 1KO1A 1SQ5A 3EPLA 2PEZA 4TMTA 3K0FB 1R5BA 3C5CA 1S3GA 3EPJA 3LV8A 3W9YA 1ZIOA 4TTRA 1E99A 2IS1A 3P1JA 4TLCA 4DZZA 3M4YA 4TYNA 1FW6A 1QHHA 4WZAE 2JIZA 1X8LA 5E7IA 2XB2A 4A0RA 4MYCA 1ZJ6A 1KK3A 2PT7A 4JLBA 4PXAA 3NDBB 3GJ4A 3W34A 3M0EA 1KI4A 2BKUA 3AKEA 2MSDB 3LNCA 2O0KA 4URXR 3FMFA 3BS4A 2EWWA 3VR6A 2HJVA 3IDQA 2BBTA 2PBRA 2EFEB 2XITA 1F3OA 2QM7A 5E3HA 4E09A 2IK8A 1JR3A 5EUMA 3K53A 4CT4B 2G1KA 5L3QB 2RGEA 4NMMA 1XTIA 2GXQA 1MOZA 1P62B 1TQ6A 4A6XA 4D4MA 1NRJB 1T5IA 3IQWA 4UNRA 1US8A 1JR3D 2GAOA 2JJ1D 4NKRA 1XNJA 1PJRA 4TMVA 1N6IA 4YMWA 5DIFA 1T4GA 5TDHA 2AD5A 4BZQA 4A0HA 5KU1A 1YKSA 4PAOA 3WHLA 2WJGA 4DCUA 4C7OB 3WYGA 3FPAA 2BCJQ 2IYYA 4PHHA 2XGJA 4PQYA 4UNPA 2BJWA 2RHMA 3W8NA 2IUTA 1X1SA 2GTPA 1OH5A 1P3JA 3IPYA 1E69A 5AJWA 5BW8A 4DLWA 1AK2A 4KBFA 4N1AA 3PEYA 2Q0HA 3BB4A 1X1RA 4D0NA 1SHZA 2R44A 5CK5A 1F60A 2B7CA 1G17A 4Q01A 2AL7A 2YC2C 5AUQA 1R10A 1E2GA 3QBVA 1M7BA 4LSGA 2VHUA 3IEVA 3T06B 1J90A 2QSYA 4U7DA 4IFBA 4YONB 2GCOB 3T12A 3U3OA 4ZO4A 5F98A 2V1XA 3HR8A 4BLSA 2DB3A 4EPTA 4Q1DA 4LUCA 2GK7A 4KXFB 3X1WA 4XWOA 4OHZA 3CX8A 3VR3A 1P2TA 4G5GA 1E4VA 4P4SB 1TF7A 1ZCAA 3KKOA 4X8HA 3JZMA 2GRJA 3Q5DA 1II8A 2ZRMA 1GRRA 2AWNA 1LFDB 1NLZA 1P5ZB 4HB3A 4UJ5A 5SZKB 2ZE6A 1OIWA 4JLDA 4IEIA 1YZTA 4N0DA 2NOAA 4OQXA 1UBEA 3C14C 3SZRA 1JR3E 3EZ7A 2QSZA 4LYJA 5GJCA 3TE6A 4CDGA 3LX5A 1G19A 2VPPA 3NH6A 1XXHE 4O3MA 2UKDA 3ZVMA 3SE0A 3FGNA 2WWYA 4NHOA 1OB5A 2YWHA 4JL5A 3RVBA 2ZROA 3SFZA 1LS1A 1KJZA 1J70A 3CR8A 1FMJA 5C2JB 5L3SA 4H1UA 3K09C 1E9SA 5C18A 3EIEA 1U94A 4LC0A 3KJEA 2NO9A 2WJHA 4JKYA 1ZRHA 4U5XA 4XD7D 1ZUHA 2Z83A 1W2HA 3CNNA 4NCHA 1A2KC 1E1QA 2YOHA 1JXOA 3NBYC 3PFIA 4MKHA 5FTLA 2GEVA 4OHVA 5LB4A 4CEIA 3GJ3A 4Q7MB 1LV7A 1OXXK 3D3QA 3EC2A 4XVRA 3PEVA 1BO6A 1BYUA 1M2OB 2Z0MA 4G0NA 1E2MA 5J47A 4OI1A 4EPWA 1TQDA 3R9WA 1EFHA 1UBFA 1DAMA 2GBLC 1XTKA 4MRSA 4JSYA 4Q7LA 1CJTC 3P27A 1EWQA 5FOSA 5F3WB 3SNHA 6Q21A 2EFCB 5SZIA 1Z5ZA 2QBYA 2ZRBA 3NC0C 1MO4A 1GL6A 2HF8A 3CX7A 3QXXA 4JVLA 4X8LA 4KFTA 5E4FA 1ZINA 3M6AA 4N0EA 1G5PA 3TSOA 1K8RA 4TMXA 4YMUA 4A8JA 3AV0B 2N1BA 2OEPA 5GADl 1XBTA 5FUVA 3AGPA 1SHKA 3DM5A 2GJ9A 5J5CA 4QRHA 5KNBA 221PA 1W7AA 1W36B 3SS8A 1GKUB 2YHSA 1CULC 2IXEA 2ZYVX 1WQ1R 1SZPA 3GJ0A 4OYHA 2JIZD 3U5ZB 1U8ZA 4B3XA 2PLRA 3DM9B 5KSYA 2OAP1 2W83A 3JVUA 4C4PA 2ONJA 4BZPA 4YDHB 1C4OA 3GJ7A 4F4CA 1KTVA 2FWRA 4LJAA 4NE2A 4F4IA 4TQAA 1JQJC 1UADA 3B78A 1N5LA 3S1AB 4YDSA 1IOZA 1GNPA 5AR1A 1QHGA 1BS1A 1MR3F 1UM8A 4TMWA 1YVDA 4B73A 2PZEA 4PQFA 4QBGB 5EE9A 2D7DA 1NN5A 1E4YA 3NHBA 1Q0UA 4OQMA 1CR2A 1PVOA 5AWFC 4GMDA 1E0JA 1ZMXA 2ZI9A 4U02A 3ICEA 2J0VA 1HE1C 1DO2A 2JJ2A 5DHAA 4UNNA 2V7QD 5JJIA 4PAMA 1SXJE 4AYTA 5EQTA 1G20E 3PEWA 1E9EA 4ZCIA 4M21A 1CTQA 2RKOA 4NU0A 4CEIB 1UEJA 4HAWA 4ZIRB 4DDVA 1TL7C 3TQCA 1PLJA 3K0AA 2NO0A 5BWMA 5JHGB 3VU9B 3DDCA 3QEJA 3GCGA 3GD7A 2YINC 1BKDR 1LB1B 1Q1QA 3OEEA 2IHYA 4KODA 4E07A 4J0QA 2ZANA 3PUWA 1F48A 4JYCA 1KI6B 2DWOA 1QHSA 2EFDB 5KDOA 4TZ0A 2QT1A 2CVFA 3CNLA 4MRPA 1E3MA 5CJ2A 2C2HA 4DDUA 1KK1A 3A1UA 1AQUA 4LJ7A 3TBKA 2HT6A 2J0QA 3R7WA 4TMZA 2LWIA 3SFVA 3SBDA 1IXZA 5JRZA 3PG5A 2C9YA 2WOJA 5AJXA 2BHRA 4B48A 3TAUA 3TVTA 3KX2A 2QUZA 3GLIA 2GCOA 4KSBA 5BYJA 4GZLA 1KYIA 1KO5A 4DUGA 5GVRA 1G7TA 1BMFA 4B35A 1MH1A 4B44A 1CKEA 3GMTA 4PO1A 3MRSA 3VMFA 1W47A 2R6DA 5FUXA 1TF5A 1KNQA 4E22A 1IBRA 4B74A 4TYWA 4JLAA 3FWYA 3CPEA 1IXSB 1GIAA 2NO6A 3C15C 2YKGA 2J0UA 1SXJB 1NVVQ 2NO7A 3ONWA 2WVJA 4PZYA 1RPZA 1DAEA 2DFKB 2ZETA 2JATA 4Q1CA 2ZR9A 1FX0A 1TMKA 3SJAA 5G40A 2F1HA 1TQ4A 2G6BA 4M9QA 2NPFA 2ZRHA 4PQRA 3E1SA 4KHZA 4LV6A 3VTKA 4QM6A 4OQNA 3GLGE 1KI9A 4IVPA 1Z3IX 4V03A 3MLEA 4LWZA 3AVXA 1XEWY 2C77A 4ERNA 5LPNA 1TX4B 1WRBA 2Q9BA 2ZRNA 2QTHA 3ECCA 1OHHA 1M7HA 2GAAA 5G3ZA 1G64A 1PUJA 2QQEA 5JS7A 4ACBA 2ZJ2A 3RS7A 3CNOA 3UXMA 2GXUA 2GEUA 3ADCA 5FI1B 4GI7A 2VYFA 3CRVA 4QFMA 3JZAA 4UNSA 1RIFA 4MYTA 3B1XA 4NCJA 3KQKA 2DFTA 3Q85A 3UK6A 2PH1A 1D8TA 2D62A 3C4JA 3A8TA 2P6UA 3THOA 3UKDA 3W5JA 2UVQA 4Q03A 2ZTSA 3ND8A 4IDNA 2P6RA 1NKSA 4JLVA 2BVNA 5D3MB 1Z22A 3WP1B 2X2EA 4G1UC 3KQNA 1XZPA 3FHTA 3GEIA 3MWLA 4C3ZA 3SR0A 3OESA 3E2IA 1II0A 3WYFA 2GJSA 3L43A 4BFWA 3FFBA 3OZXA 1SVOA 1FOEB 1W46A 1JNYA 2O8FA 2G0TA 5DH9A 1Q20A 3BC1A 1MABB 5FOUA 4JJZA 2GJAA 2EQBA 5CJPA 4XIGS 4DCVA 3IHLA 2ZUBA 4BLOA 2WIBA 4NYMR 5K8UA 1KMQA 3PEUA 4QG7A 2GHIA 3G0HA 4YMVA 3HU1A 1C1YA 4B3CA 1RYHA 3RRMA 3X1YA 3HWSA 4RCZA 3SU8A 3UWKA 1UDWA 1Q1EA 4R2HA 4IHQA 4GNKA 4QBIA 3O47A 3AQ4A 4QNRA 3KXIA 4Q02A 1EFTA 3GLGB 4JBWA 5A5GA 3DPUA 2J41A 1NY6A 2WJVA 2CHGA 1J8YF 3TK1A 1AM4D 3FHCB 2CMKA 4II7A 1WB9A 3AM1A 3EW9A 2FFBA 3FYHA 1G3RA 4PHFA 1VDZA 1VG1A 2ODNA 1CP2A 2FF7A 3KFXA 4AKGA 4JLJA 4OKSA 1D2NA 1KNXA 1KI8A 1VCIA 3W3AA 1QF9A 1US8B 1Z08A 3ZD7A 4ZI2A 1P9RA 1YZKA 4URUR 2FZLA 5DYGA 4FMCF 1NF3A 2QMUA 1F2TA 3RS5A 2P2LA 1E2IA 1QDEA 3CLVA 3LH5A 4BRUA 5KNCA 5F9FA 4LHXA 4GSYA 1XEFA 4B6FA 3OFND 3LBIA 2IYWA 1Z6YA 2ZS8A 4ZDJA 2RHDA 2EFHB 4GL2A 4RD6A 1SXJD 3UG6A 3DOFA 1IQPA 1Y3AA 4OI4A 3T1OA 2ORWA 2WAXA 4NYJR 3L8ZA 5ANRB 3T15A 4L15A 4CVNA 4YMTA 5JMTA 1KSFX 3DMNA 2OBNA 1LNZA 4HUQA 4M8NE 1WF3A 5CM9C 2VQSA 2NG1A 3CB4A 1G16A 3WMEA 4XWAA 4TN1A 2WKRA 2W0MA 2J7PD 1HQYE 1HYQA 5B2ZA 3TAHA 4DBLC 1VMAA 721PA 1N3BA 2P0EA 1T5LA 2C96A 2X77A 2CJWB 3ZZUA 2ZRKA 1C9KA 2QRZA 1G6HA 3G5UA 4D25A 1UDXA 3LD9A 2A78A 3SHFA 4QHTA 4LJ9A 1ZW6A 1JPJA 2CE7A 3DZDA 5FTMA 4QBFA 3IILA 4POAA 4C2TA 4BGDA 3I5YA 5HR5A 4A2PA 2OM2A 3K0FA 4Q4LA 1E94E 4MGZR 1EX7A 4LRWA 3A4MA 1N6LA 1XTJA 3CONA 4QL3A 4LY6A 1E79A 1XU4A 2A3RA 4OI0A 4UQOA 4A4DA 3KKNA 2JLYA 2YNMA 3HP1A 3C41J 3NG1A 5H8WA 4IKEA 2OAQ1 3KTAA 3PR1A 3X1DA 1EFRD 1NMYA 4HZUA 1G18A 2FX3A 4R71A 5EJEA 1EXMA 3THYB 3AF4A 1KI2A 3IQXA 3NBXX 2XTNA 1E6CA 4KBGA 4WZ6A 1NP6A 3EC1A 3FVQA 5IF9A 2OCYC 1OFIA 3PIRA 4MUBA 3GLHA 4D4KA 2VF7A 4DVGA 4HUTA 1QHXA 3H1TA 2WWXA 2ZAOA 4FMDF 2BKEA 2NZJA 2QT0A 4Q1EA 3NHAA 1G3QA 1OKKA 1FQJA 2XAUA 4AIIA 1XF9A 3CPHA 5L3RA 4QC2A 1DVRA 2C5LA 1ZM4A 2A9KA 1FMLA 1SVKA 4Q1AA 5FL7D 1L4UA 1Y63A 2XOKD 4HZIA 2ZE7A 2VF8A 4OK6A 1P7CA 1DADA 2VP5A 3U61B 3K0AB 3LFUA 3CM0A 3FKQA 5FL7A 2ZRPA 3B8HA 2ZRCA 2REXB 2WPDA 2OSBA 2ODEA 2O8EB 3ASYA 4ZV4A 2KBEA 3ZLJA 3BH0A 4KJZA 4UJ3A 3ZJYA 3MJHA 2OCAA 2WSSA 3E5HA 2ANBA 2AR7A 2XZLA 3CH5A 2JGNA 2C78A 4YLGA 1J99A 1YZQA 4FCVA 1IY2A 2CLCX 3CH4B 3CIOA 2EWVA 3A4LA 4FMCB 3W6OA 3TUZC 1KJYA 3P32A 2F7SA 3MFYA 3EZ2A 5EUQB 5C1BA 4RFSA 3LW7A 2CCJA 3EASA 2ZRIA 1I2DA 4HAUA 3MCAA 4B3BA 1KI7A 3K8YA 4KSCA 3X1XA 3U4QB 2VTKA 2OBMA 4TMKA 1W0KA 1W36C 3K9GA 2ANCA 4HLUC 1DAGA 4AY2A 4PC3A 2O8FB 1S2MA 4B34A 2O0HA 2GK6A 4E5UA 4TQ9A 2NO1A 2ZSBA 1QHHB 3B13B 4NYJQ 1G7SA 3HYRA 1W0KD 5DNYB 3RRYA 3VKHA 4IFEA 1QBKC 1H8ED 4P32A 4BQSA 1E98A 2RB4A 4LHYA 3RAPR 4MH0R 4JVSB 1OYWA 2QGNA 5FTKA 1EESA 5JCPA 4H1VA 4HLQB 2W00A 2FJUA 2OCPA 3CO5A 3FMPB 3RWOA 3TIFA 4FXPA 2ZI6A 1ANKA 1JEDA 3MWJA 2MMCA 2ATVA 1A2BA 1EFRA 1SGWA 2AFHE 1JEEA 1EX6A 1ZNWA 3D7MA 4EQ6B 1S4QA 1UBCA 4HB2A 5FPHA 3QXJA 2HLDD 4LYFA 1G5TA 1P6XA 1WP9A 3THXA 2OHFA 3CF0A 5JFGA 2RGCA 3MG9A 5H68A 4LV8B 1PLLA 4D82A 4IOKA 2IS2A 1YRBA 1TQ2A 1CR4A 4C7OA 2WPDD 3QPWA 3A1TA 2A5DA 1P4SA 2V9PA 3L0SA 4M1OA 3UMFA 4DCTA 4Q66C 2I4IA 2XOKA 2H7VA 3IBGA 1IM2A 1NN1A 1FTNA 2B8WA 2VHQA 4FD2A 2ZQ5A 1F2TB 1E9DA 2JASA 5EE0A 1VHLA 1FNMA 3U3KA 5HCIA 1IHUA 3WY9A 1UAAA 1GFIA 3CRRA 4YQFA 2QL6A 1E9CA 1NVXQ 2EU8A 1T0HB 4LGMA 4M1SA 1U9IC 3QKSB 1RC8A 2V1UA 3PXGA 4C0HA 2VHCA 1IJEA 2WIAA 2JDIA 4GOXA 1T3HA 2OLKA 3PUYA 4LJ5A 4Q7KA 4A92A 1E2DA 2FSIA 2Y8EA 1U8AA 4A8JC 5ELXA 5KDDA 4CGZA 2QPOA 4MYHA 5F2EA 3K1JA 4O2RA 1OIXA 1N6NA 3QVUA 4P4SA 3ZGXA 5M04A 2BMJA 2VP9A 3CWQA 1YZGA 2AK3A 4OQFA 4PC2A 4C0QC 1U90A 3BH6A 1OH8A 5JWHA 2F3RA 1VKJA 1NN0A 2GBLA 1ZM2A 2YWEA 3BFXA 3O8BA 5UKDA 2OE2A 4BRWA 1KO4A 4D4JA 2O8CB 5DHFA 3PVSA 4CEHA 2A7QA 2FZ4A 1KSGA 4IDQA 1GITA 1ZUNB 3ZZ0A 2V7QA 1H8EA 3F5FA 3QEOA 4DB4A 5EXPA 5FBQB 3ZS9A 5KOYA 3IEUA 1Z47A 1S0UA 5AK0A 1T8UA 4Q9KA 1X3SA 2IA5A 4X8OA 1HUQA 2FE4A 2PEYA 3RC8A 5IT5A 1KI1A 2GA8A 2OBLA 1AZSC 2WBLC 3VQTA 5CYOA 5DYIA 3MWYW 2O52A 5FTNA 2WWFA 2P6NA 3QI2A 1QG4A 2FU5C 4W9MC 4Q21A 5JEEA 3DOEA 2G83A 4GBMA 2BMFA 2IWHA 2F55A 3I62A 4G5SA 5KSOA 1S1MA 1TTTA 1M7GA 4GOJA 3EXAA 4HB0A 3G82C 2HDNB 4OI2A 1XD9A 2JLVA 1E2HA 3VFDA 5FI0B 1XTSA 5GJWC 3X2SA 1NBME 1Z2AA 4OHXA 4Z51A 4LJ8A 1DAKA 1SKYB 5L3SB 2YV5A 3UG7A 2FGKA 2GXSA 3NEYA 5AUNB 4B43A 2PL3A 4B47A 4DHEA 1XEXB 3EA5A 5FUYA 1DAIA 3Q7PA 1GVNB 1YE8A 1XEXA 3HPQA 1NLYA 1JB1A 1W0JD 4LBVA 2ZE5A 4V0ME 4QGGA 2GCNA 1HT2E 1TADA 2ZRFA 1NBMD 2JLRA 3AB3A 1JAHA 4NCKA 1NMZA 4PX9A 5FOXA 3PUVA 3VNUA 1D2EA 4IVQA 4BFSA 1HY3A 2AHOA 4KYUA 3TSZA 3U60B 1EFUA 3B85A 3U7HB 1P60A 2W2TA 3PV0A 2FA9A 2BJVA 4DIEA 1WA5A 2VL7A 3SBEA 1BOFA 1Q57A 4JIMA 5FL3A 5FPKA 4U00A 3NVAA 4LHZA 1LW7A 3A1WA 1XMSA 3FFAA 2D2EA 2BWJA 4BLRA 3THYA 2XXAB 3V4FA 4EQ6A 4A8JB 3K0EA 2ERXA 5EZ5A 1T9HA 1XMVA 2ZVQX 1L4YA 1UJ2A 2GESA 4XD7A 1I4DD 5FPTA 2QMOA 3GFTA 3VX3A 1ZIPA 2ZYWX 1CJKC 1ZD1A 3CRW1 4EFLA 2EW1A 2H1LA 1G5RA 3SI7A 2DR3A 4QJ3A 1NY5A 1OHHD 4JVMA 4HZUB 2CCGA 5JHHB 5AUOB 3A37A 3TVDA 2H57A 4M1KA 1QZXA 4EJSC 1EFCA 2C04A 4FCWA 3PCRB 2ZJOA 3MSXA 3WBKA 2HCBA 4BFVA 2O8BA 1KOFA 2XX3A 2QEQA 3Q72A 1HTWA 2JLZA 1G8GA 2V8OA 1OXTA 2ZUDA 4HLUA 4RD1A 1GRNA 3KKMA 2IWRA 1N0VC 3RRNA 2RH5A 3U7EB 4TT3A 1Z29A 4QGAA 4WAUA 1J7KA 2BCGY 2A5JA 1P9WA 2QQ0A 4FW9A 1U98A 3TW4A 2XJ9A 3PUXA 3KDSE 4M4SA 2BBWA 5FR2A 1UKYA 2Q3FA 2KSQA 2ZU0C 1N6OA 2HXYA 4EFNA 3SDZA 3K0SA 1W0JA 2GF9A 2ODWA 3HYTA 3R8FA 5CB6A 2ZS9A 3QG1A 1M74A 1FPMA 2VH5R 1GSIA 4Z8XA 5FOVA 3MJRA 4B2IA 4OK5A 1HV8A 1D2MA 3ND9A 3VR1A 1OFTA 2MMGA 1MT0A 2FGJA 4HI0E 3SYLA 4LCBA 1W4AA 4G01B 2BOVA 4HDOB 2J46A 1T8TA 3T35A 1OJLA 4MUAA 3MMPA 3I32A 1JR6A 2IYSA 4LJYA 3QKRB 4NYIQ 3THWA 4JS0A 1NVUQ 2ZJYA 4ZCMA 4AURA 4KO8A 2F6RA 2FSFA 2IEZA 3B6EA 2OXRA 3OIVA 1N0UA 1ZM7A 2F1IA 5JRJA 1GDDA 3BBPA 4Q4JA 1W49A 2B7BA 1WCV1 3KTAB 4C2UA 2Q9AA 3D31A 1W44A 2FFAA 2G88A 2C03A 5EP3A 4AKIA 1P61B 1SKYE 4Z1MD 2PCLA 3SQXA 2IBMA 3IIMA 4KFSA 4M9XA 1G7RA 2DPXA 3CX6A 3DO6A 4K8OA 2O8CA 2ZEJA 2OUKA 3H86A 3V9PA 2ZM5A 1TUEA 3AVPA 4KAXA 2QY9A 3K09A 4NL4H 4Q4JB 5DN6D 1TU4A 4EKDA 4NCIA 3WMGA 1E2FA 2AK2A 4CZ2A 1JECA 1O87A 3LQRA 1N2CE 1XTQA 4GZMA 3CF6R 2ZJ8A 1X8JA 2QE7D 4B76A 1PV4A 4MGKR 1D6JA 3MWKA 4MKFA 4A6PA 4Q4AB 3W6PA 2YJTD 3DEFA 3CRMA 4DSUA 2X19A 3CZQA 1YR7A 2O8EA 4DWJA 1YU9A 1ONBA 2ZAMA 2FPMA 3WXMA 4D80A 3PENA 2P65A 2YZ2A 4IDHA 3RSLA 4QXAA 5TARA 4DLXA 3NWJA 3Q5EA 2F43A 1RKBA 3LVRE 2F43B 2H18A 2HV8A 2WICA 3VR4A 2NMVA 5KDLA 1R7RA 1DO0A 1DG1G 2Z43A 4A15A 1DG3A 3AP3A 1OH6A 1Q12A 3ZVLA 1NL3A 1N6RA 2QG6A 1M8PA 3CBQA 3BXZA 2RGBA 4M0LA 2XNDD 2O8DA 4RZUA 2O8DB 2LKCA 3BH7A 4P4UA 1JPNA 2QAGC 1FQKA 2E87A 3FKSA 4EPRA 4B75A 4I81A 3Q3JB 3TQFA 1WXQA 1KKMA 5DSZA 3QXSA 1XCMA 1R0ZA 4C30A 1X8KA 4NTZA 2JLUA 1E0AA 2BV3A 4KFUA 4DDWA 2QU8A 3U3JA 3ZS8A 1E2EA 2QORA 3H84A 4PSKA 1XEWX 1L2TA 1GAJA 2BC9A 4M1TA 3BGWA 3QOFA 1E0SA 5EXSA 4PPNA 1E96A 4OHWA 2GVDC 3U4QA 1Q21A 2BBOA 4UXJA 1PUIA 1GL7A 4DSNA 1XTRA 3TR0A 2IHBA 1F5NA 1XXHB 3L8YA 2D4HA 4BASA 5BYKA 3U7FB 5KSPA 1HQCA 4NDZA 5J40A 1AIPA 5F9HA 3OEHA 1VG9B 2Q3MA 5BXQC 4DEXA 1W36D 2IYQA 3QF7A 3ZDQA 4DCSA 3ZIAD 1XRJA 3B9QA 4TWZA 4LHWA 3EG5A 1P2VA 5IK2A 2OZEA 2V6JA 1UFQA 2FMXA 4DLYA 4A2WA 4EJSA 4PZZA 2RMKA 2ZU6A 1ZYUA 1S9DA 3FHOA 1ELOA 2QTFA 4QHYA 3SYKA 4ESHA 2Z4SA 1GTVA 1LF0A 3O8DA 1Z07A 4LBWA 2R6CA 1FUKA 1XJCA 2OT3B 3VR5A 3FTQA 1VCOA 2H8KA 2JLQA 1GNRA 3DKPA 2ODBA 2GWHA 2IYXA 2XEXA 2RGAA 2IYLD 1Z6TA 4FIDA 2TMKA 2XNDA 4D6PA 4P31A 3QKRA 3K70D 2CBZA 3ZZTA 2FN4A 1L8QA 2R2AA 5CLQA 3W3ZB 1ZCBA 3LBHA 3JVVA 3OHMA 4RD4A 1RRCA 2IC5A 4TLEA 4PAQA 3AVYA 5DI3A 2GEDA 2WM9B 3MGCA 4HUQB 4ZKEA 4B2PA 1UKEA 2NTYC 3ZD6A 1KSHA 4ASUA 2RGNC 1JALA 1YZNA 2GNOA 2BMEA 3KZ1E 3MAAC 1WE2A 1P75A 3BIFA 2CHVA 1OXUA 1Z0KA 5CDFA 2JJ1A 1DOAA 4DXAA 1JI0A 4NP6A 3SEAA 4OBEA 4CEJB 2WHXA 5KO2A 3B1VA 1A1VA 1HT1E 2ZYTX 5P21A 2WKQA 1NJFA 4JL6A 1TU3A 4D26A 4KFRA 4MITA 1ZNXA 4O2LA 5HE8A 4GRAA 5FFMA 1CU1A 4PR0A 4D0GA 1DAFA 1XDBA 2MSEB 2PCJA 4LJ6A 4AC9A 5L3VA 4LK2A 1CRPA 2J45A 3KUCA 2PX0A 4JLNA 5KPJA 1G3MA 5TY0A 2DWQA 1S9HA 1OXVA 2YC4C 1E9BA 1KMHA 2WSSD 4O0MA 3C5HA 3X1ZA 1Q1BA 4ZPXA 3QF4B 5EP2A 1P72A 3QKUA 3QPUA 4QKQA 2R62A 1LS6A 1R6BX 3AKCA 2WSMA 3CF2A 3BD9A 1E9AA 3RS3A 1GUAA 1N5KA 1OH7A 1OFHA 4DRZA 2V55B 3GEHA 3GLFB 2OCBA 1IN4A 4IXNA 2ZPTX 2VEDA 4R7ZA 5EXXA 4C0AC 4JJKA 2JAQA 2G9NA 3VR2A 1AS3A 1HURA 4LHVA 1XX6A 1VG0B 3RS2A 3AVOA 3UANA 2FFQA 2P5SA 3O8CA 1Z0DA 5CIWA 5IHPA 3QSYA 1AQYA 4HB4A 3WBJA 2XZPA 1RRPA 2V6IA 3GJ8A 2FSHA 4PO8A 4Q7JB 1Z63A 2DBYA 1SXJC 5DGXA 3PITA 3LDAA 3I61A 1XZQA 2QZ4A 3QBTA 3GQBA 3I8SA 4JL8A 3T61A 1G9XA 2GVZC 2WKPA 3OIUA 2NPIA 1U2RA 2XTZA 5SZJA 4R98A 1FNNA 1FX0B 2XNSA 2KI5A 1KDTA 3R8CA 3VHLB 4NZYA 3QXHA 3T1VA 3LY5A 1S1CA 3L0OA 2CLDX 4Q4HB 5JJKA 1KSJA 4PANA 5FTJA 2AX4A 5JLJA 2J87A 2J9RA 2H17A 4HDQB 5B30A 1KZ7B 3C7KA 1UKZA 1KIMA 2CL6X 2YWFA 2VO1A 2ZJBA 4XVQA 3EAQA 3K9HA 3BORA 4C0BA 2PX3A 5K8IA 1V43A 1T3SA 2RCNA 3TR5A 3ICQB 4DLVA 5JSZB 1DBSA 3T1TA 1R0XA 2ZREA 4HATA 4L4UA 2ZE8A 1RW4A 4PHTA 2IYTA 1F6BA 4Q4AA 2BMDA 4F4JA 3GJ6A 3S1AA 1YZLA 2R6FA 2QPAA 3CRQA 3IIJA 3U3RA 2VP2A 2W2XA 5E95A 3LLMA 1BMFD 2ZRJA 3I3SR 3QUSA 4I99A 1P2SA 4FN5A 4KVGA 4ARZA 4CYMA 3RWMB 4EJSB 2QP4A 2REBA 1U8YA 5BQ5A 2QP9X 1CXZA 2BM1A 3GLHE 1U81A 2J1LA 2WAYA 3QENA 1U9IA 4V0KA 4BEJA 3NC1C 2GCPA 1Q22A 5E7JA 5KTYA 1ZNYA 2W0SA 5KYKA 2QP3A 3QKSA 4MGIR 3EX7C 2GJKA 3GLIE 3WRXC 3N5CA 3VU9A 4JT4A 4QJ4A 1TF2A 3F0TA 4EFMA 4FWIB 2JLWA 3ZVNA 2D74A 3RNLA 2GZHA 2IXGA 4IOJA 4M9ZA 1B0UA 1NVVR 4L9WA 3QKTA 3R7WB 4AK9A 5JI3E 5JWOA 4G5RA 3BK7A 3UMSA 5J4KA 1F2UB 1LVGA 4TYPA 3WNCA 2HF9A 1N6KA 4TZ6A 1KDOA 4B3DA 1VPLA 1YHNA 3ADKA 1G8HA 2AXPA 3NTUA 4NBSA 5HCNA 3W90A 4DLRA 4LZZA 3HDTA 1MO6A 4PZLA 1TUIA 1SVMA 1YR6A 2QPTA 4RZ3A 1M1YE 3EWAA 1R4AA 1U99A 1ZC3A 3B60A 4WXPA 1GWNA 4OK3A 4JLPA 4C9BA 2H16A 4KI0A 4PPFA 4Z8YA 2J3EA 1COWA 1I4TD 3OEED 2KJQA 3WMFA 3AKYA 3D6TB 3KJGA 1X6VA 4ZDKA 1I4LD 1DS6A 2OLJA 2YWGA 4HLDA 3GJXC 1KY2A 2OO7A 3P20A 4PTLA 4ZIRA 5FOTA 3AUXA 3AVUA 4TTQA 3T34A 3SHWA 4HSEA 2C99A 2ZJZA 4BE7B 1OIVA 2R65A 2ERYA 4BFXA 1SXJA 3TMKA 2GETA 3RABA 1XJQA 1FZQA 4JYBA 1KDPA 4MDEA 5JJLA 1II8B 1AS0A 4Q9HA 1KO7A 1EGAA 4EDHA 1SVIA 3BAFA 2IW3A 4WOPA 2FNAA 3KQLA 4QGFA 4Q00A 2J0UB 2QMHA 2JEOA 2G3YA 3WYAA 3ZH9B 5HTKA 2JLXA 4MQBA 4LYAA 3FMIA 1UF9A 5C46F 3DZ8A 4F91B 1XCGB 4Q1FA 2WTUA 2PMKA 2C8VA 4QJ5A 2RGGA 2DY1A 2PZGA 2JJ8A 4RZXA 1DARA 1RJ9A 2F1JA 2GXAA 3I8XA 1G291 2ECKA 2IF2A 2ZI5A 4RCYA 3QG5A 2GILA 4WIAA 4MRNA 4TL8A 1LF5A 2WOOA 4NYMQ 1KJWA 3A1SA 3OE7D 2WWIA 2XJ4A 3LXRA 4AYWA 1KI3A 4M2LA 4QBHA 3HU3A 3LLUA 1W2GA 3SC3A 4NYIR 4RKFA 1FFHA 2AWOA 4BZXA 2QTVB 5EP1A 4BPBA 1EG7A 1NKTA 2XZOA 4TL9A 4XH9B 1OT3A 2QBYB 4TYYA 5DE3A 4DIDA 1G8FA 3EIHA 3B1ZA 1P9NA 4V0OA 5K8LA 3L82B 3UIEA 5FBWB 2W6JA 2J59A 1MKYA 1HEIA 3TLXA 3NBFA 1NIPA 3FDIA 3B1YA 1TPZA 1U0LA 3SQWA 4Y0VA 4PPGA 5G53C 4KV9A 3QY0A 121PA 1G21E 2QAGB 4S35A 2CCKA 1H8HA 5EP4A 2XSZA 1SULA 2IXFA 3GLHB 1Q3TA 1Z8FA 1WBDA 2CNWD 1II9A 2GDJA 2B92A 4DKXA 5FH9A 2IT1A 3C16C 4D0LB 3AKDA 1JQLB 3DVLA 2IUUA 1R8QA 1W48A 2JLSA 2WJYA 3HJNA 3BJIC 1R0WA 1Z0FA 1YJ5A 1OXSC 2GF0A 3QF4A 2IYZA 3OF5A 1JJ7A 3B9PA 2XTMA 1IN7A 5L8VA 3U2QA 3WNBA 4DLUA 4A1FA 4YC7A 1HE8B 2B21A 3LVQE 3V00A 2D2FA 1K6MA 3RS0A 1Z0IA 4KYIB 1E1RD 5HZKA 4CW7A 1GKYA 1OW3B 4L8GA 2ORIA 1CEEA 2VP6A 4RFVA 4B6EA 1ZD9A 4EPXA 1E2NA 1PZNA 4RSGA 3I1FA 1OB2A 2HYDA 1U0JA 4CF7A 4A0GA 2ZSAA 4KITB 4PC7A 2PLFA 3ZQJA 4IDOA 5JWRA 1AZTA 1JJVA 2IUSA 1CIPA 3VAAA 4M53A 4CRWB 1A4RA 1N5JA 4IRUB 2ASEA 1H65A 1MRNA 3W8RA 3AVVA 2ZRGA 2ZJAA 4BFZA 4OHYA 1IY1A 4C0LA 3QXCA 1QG2A 1R0YA 3K0CC 4RJLA 3EA0A 2ZR0A 3TKLA 5JEDA 1Z0JA 3LW8A 4JLKA 2W6JD 1OFUX 1XPUA 3TUJC 3VNVA 3U44A 2FEOA 2GZAA 1NLFA 1SVWA 1XJ0A 4Q4HA 1IY0A 1AKEA 2VBCA 4M9SA 3RSOA 4IOLA 4BLTA 3HU2A 2KE5A 4FCTA 2PJRA 4TSFD 4W5HA 2LCFA 3BWDD 1O3YA 3Q7QA 1K5DA 1KAGA 1BIFA 1WBBA 4CEJA 1P2UA 2A5GA 3B5JA 3AEZA 2BEKA 3LRPA 3KJHA 4XSHA 4XWKA 1GNQA 3NIBA 5JSZA 3B82A 1CJMA 1KY3A 3P26A 3LQQA 1NSFA 2CVHA 4HAXA 3K0CA 4W5JA 3L0PA 5JS8A 3ETLA 1QRAA 2NQ2C 3TGPA 4IJMA 4IEEA 4M1WA 5GJBA 3K70C 4A0FA 4PC6A 2QMEA 2A2ZA 4LYHA 4V0LA 5C4MA 4JMPA 5JECA 5TXGA 2OXCA 4GDFA 4TL7A 2DHRA 2HYIC 4UKDA 3GFOA 2UZIR 1T6NA 3KFVA 5DISB 4BECA 4CT5A 5D3QA 1W4CA 4ILEA 3RLFA 2ZRDA 4PSVA 5G41A 1IAQA 3ZVRA 3VHXA 3R9XA 3BE4A 4PPQA 1W1WA 1N25A 1SVLA 4FMDB 1G8PA 1KZGB 1T3LA 2D06A 2JCSA 2ZS7A 4URYR 3TJZA 4B71A 2ZITA 5LB2A 1EWRA 3PUZA 4XOIA 1AS2A 4YMSA 5KSZA 1ZM9A 2ZSEA 3H0KA 5CDFE 3MD0A 5FBLB 4PO9A 2FV8A 2J7KA 3R9IA 4KCGA 3FOZA 4BLPA 3UWOA 1NNEA 5CITA 3KKPA 3W6NA 5J4LA 1PLKA 3GLFE 4ESVA 2O8BB 1KMHB 4OQLA 3GP8A 4PSAA 1YRAA 4LC1A 4IXMA 4QHSA 4XSGA 2RAPA 4XTRA 4XTCS 3KQUA 4DLSA 4TYQA 1DPFA 2ZYUX 1N6HA 4TTPA 2I3BA 4LJ4A 3LO5A 2H92A 2V3CC 3ZQ6A 5B64A 2XB4A 1CBUA 3GPLA 1E9FA 2X8AA 4I1SA 2CL7X 3RYTC 3SJCA 2QROA 3LWNA 4QGHA 1IN8A 3EPHA 1MO5A 5H70A 4BFTA 3I92A 1VCMA 3KJIA 3SOPA 4LPSA 5HPYB 1NG1A 2J5XA 4P0TA 5BN3A 5DN6A 2HCJB 1N6PA 1TEXA 4LX0A 3EZFA 1RFLA 2NZ8A 3EZ9A 4MRVA 1GP2A 5TVKA 1R2QA 2X1VA 3NBZC 1GOTA 2WWWA 3QQ5A 3IHWA 4V02A 3TNFA 3UATA 4LBZA 3SN6A 2BEJA 2QI9C 4BUJA 4WZBE 1BYIA 3NH9A 3DHWC 4X8MA 5CK4A 2C95A 4AWXA 1W4BA 4IW3B 3U3MA 4Q1BA 2OG2A 2EVWX 2ZRAA 2VLIA 3QIAA 5JBQA 3AF2A 2IYVA 5CIQA 2CK3D 3KXKA 1T0JB 1CF4A 1E9RA 3LX8A 2LKDA 1AGPA 5EZ6B 2IF0A 3AVQA 4GFDA 2G77B 1XPRA 2Z6VA 1DAHA 1E1RA 2CK3A 4IVRA 1I2MA 2IYRA 2QENA 2J7PA 2VA8A 4GT1A 2ZVPX 4ZDWA 3A1VA 4B2LA 2CDNA 5TMPA 2R9VA 5TV2A 1Z83A 1GZSA 1ESNA 2CXXA 4G5QA 3VKGA 3PJRA 1J8MF 3RC3A 3AVWA 2F3TA 2REOA 4UNQA 1DE0A 2WV9A 1XPOA 1KDRA 4I1UA 2HT1A 1OSNA 3RRZA 5HE9A 1D9XA 1Z6XA 2FSGA 3LXXA 2FFHA 3CR7A 3GLFA 1D9ZA 1V5WA 4BWYA 2OILA 3LBNA 4IOMA 5A4JA 5E7MA 4LI0A 3T1QA 1TEVA 1N5IA 2Z4RA 4DJTA 4DLZA 4M1MA 3AUYA 1IJFA 2EFGA 4MRRA 2CL0X 2QA5A 3IGFA 4ZCLA 1VYVA 1IONA 2VHTA 1VHTA 2GJ8A 3IIKA 4RD2A 2FDCA 5B57C 1N0WA 3FMOB 4IDPA 3IPXA 2KB0A 3DL0A 2HEIA 3K9NA 4B3FX 4LBYA 4Q9JA 1YR9A 3ADDA 1QVRA 5KHOC 2ONKA 1E1QD 4EPYA 3PQCA 2W2VA 4FMBB 3NDPA 1OE0A 2P67A 1S8FA 2DFLA 1X86B 4QOSA 3DMDA 5JZVA 2HXSA 1S3SA 2N42A 4MA4A 1WMSA 4XJXA 5FOWA 5JI2E 3AF1A 4YXWA 2ZIAA 3GJ5A 4Q48A 4Q47A 1E2QA 3RHFA 3WHKA 2VRWA 2B8TA 2WWGA 2QAGA 4JLMA 2QM8A 4YXWD 3VKWA 4JBXA 3E70C 2Q21A 4MGYR 4ABYA 3ADBA 2YOGA 2R6AA 2YYZA 3A36A 3J81k 2KBFA 4OJQA 1RYFA 4S2EA 1D5CA 3QVVA 4I1OA 2AKAB 4FWTA 421PA 2ZR7A 3EWSA 1ZM3A 3TUIC 1G41A 1VG8A 2WJIA 4FINA 4DEYA 1CLUA 1Z28A 3L0IB 3W5IA 8OHMA 1ZVQA 1XD2A 4WBSA 4I4LA 4K81B 621PA 4C0KA 2CEAA 4MKGA 3THXB 1L7VC 3EZ6A 4NPHA 2HJGA 1FP7A 3P4YA 4L9SA 4OJKA 4XVUA 5FPSA 2NGRA 2Q6TA 3T5GA 2IX3A 2YVUA 2VHJA 1T91A 2AFIE 4C0JA 1FP6A 3KXLA 4E03A 2N46A 2ZXUA 2R8RA 1AJEA 3A6PC 4ASUD 3H2YA 821PA 2AD1A 2IEYA 3CUEF 3UPUA 1JXMA 2DYKA 3MUFA 1B23P 3FB4A 1COWD 5IRCD 4QM7A 1AA9A 1XMIA 2C9CA 2ZI3A 1W5SA 4NONA 3THWB 1FL9A 1U0HC 2QAJA 3TSWA 1AN0A 2ZJ5A 4AYXA 3IO3A 1CRQA 1G7CA 1KI6A 2CJWA 4US2R 4TSFA 2F9LA 3NKVA 4Q19A 4LV5B 3AGQA 3T5DA 2F9MA 3KUDA 1NVWQ 2D7CA 3A4NA 4DT1A 1XMJA 5DLQC 4TLAA 2FG5A 2WZQA 4UXIA 4HAZA 3AP2A 3B1WA 3REFA 3NEJA 1HH4A 5IDVA 2EYUA 1VECA 1ZD8A 2Q3HA 2C9OA 3AF3A 4P3YA 5EE3A 3M1IA 2ZSDA 1XD8A 4Y0AA 4KLZA 5FBRB 1UPTA 3SJBA 4DUGD 5KNDA 2E9SA 2OFXA 4LPKA 4LOAA 2ATXA 3RDPA 2VSXA 4AI6A 2QNRA 3LA6A 3N2EA 4BLQA 1ZUIA 3EIQA 5J4VA 5EE5B 4DSOA 1LY1A 1HA3A 1Q3HA 2VSOA 3TRFA 3CPJB 4C0SA 1W4RA 2DFNA 1GM5A 5TB5A 2OFWA 5FBVB 4DSTA
chains in the Genus database with same CATH superfamily
1GR0A 3BFVA 1XXLA 4WY8A 5E9QA 2H5EA 3FE2A 4RL6A 3U0BA 2HIGA 2NU9B 1Z06A 1ZL2A 1CZNA 3DJYA 4M76B 1K3UB 4QDJA 2CLSA 2ONZA 1UKVY 3OKPA 2QJRA 3Q12A 1GUZA 5B55A 2AEJA 3ANSA 1V1JA 1J0BA 3K1AA 1K7SN 4MJLA 2ARKA 3A4TA 4WNAA 4U7FA 1SY7A 2FPIA 1PEYA 1NXVA 1E2JA 5LD2B 4ZYUA 4RVCA 1PR3A 3AETA 3WB0A 4GR5A 3FWPA 1T5BA 3U6KA 4R2KA 4ZI3A 2FR0A 4JLOA 2G80A 3TW0A 4KU4A 3KHSA 3HO8A 2PZ8A 2EYQA 1XOIA 2IIPA 4HEA6 4QICA 5K0ZA 4W7SA 2NAPA 3KOOA 4DC9A 1T6BY 5KWJA 1C0EA 4NCXA 2BDTA 3IUYA 4RMNA 4PFSA 4HWGA 4WK0B 3GI1A 1YHYA 2P2SA 3D7RA 4IINA 4URWR 5CRIA 5AJZA 1NN3A 2Y1FA 4D6YA 4ZAVA 3IDAA 4QREA 4M1QA 2CLIB 1XZDA 2HLDA 1QQBA 4G3XA 1IEWA 4MVCA 3DFUA 1J5XA 2ADFA 3TINA 1OLXA 5DCLA 4BQIA 3SXUA 1IIBA 1OASA 2SCUA 1Q83A 4GMXA 2JH9A 5EXTA 3UAOA 4KQKA 5IS2A 3P7MA 3EZYA 1B15A 2G0NA 2YMQA 2B6HA 4J49A 4LX8A 3RBAA 1PR1A 2HW8A 4WCVA 1P8JA 1H8HD 5BR4A 3RVPA 3SFTA 1T4DA 2D6FA 1TK3A 1GRQA 3CZ4A 4D9JA 3S2FA 3SC2A 5J4YA 1RKVA 1Z6ZA 1WW3A 2XI4A 1BVHA 3OKAA 4FGWA 1B8PA 3AHFA 4UDNA 4RZHA 3C3PA 5C4GB 3W2FA 2NSJA 2AKYA 3O1IC 2VRNA 1A82A 2BIFA 3FNBA 3GUYA 3HCNA 4RHEA 5E2BA 2QTAA 5HMMA 1WXFA 4KUGA 2Q6VA 3D4OA 4IKPA 3W7AA 1CJUC 2REQA 2ERCA 1SQSA 3LMKA 3KQVA 1M2GA 1TLLA 3KB1A 4U2EA 3PCTA 4WVFA 3TLZA 3VUFA 3BMQB 4WXRA 1CZOA 2GUGA 3HYSA 4RVOA 1I4WA 5CB8A 2PZFA 1YS9A 4HAYA 5KTNA 5LP1A 4HXGA 3PSAA 4C07A 5AT1A 2KWIA 4M1YA 3UMMA 2I7VA 4I1VA 3WYBA 2I2WA 5K0GA 3DVAA 4ZA2A 3EEOA 1E0KA 4X7PA 4D9BA 5IN4A 2RH9B 3PC2A 4KWHA 3VZBA 1LTQA 5DF1A 1DAOA 4YAFA 1CS4C 5E6UB 2YZNA 3K70B 4Q18A 5EE1A 4L02A 4RY2A 4YRDA 1GKIA 3ELYA 4V2UA 1CVLA 3V4VB 1TOAA 1E2LA 1GG2A 2A5YB 3A25A 3RARA 2H1FA 3E58A 4X65B 4Y2UA 5LU8A 2Z1NA 4Q9LA 4I5DA 4R2JA 3V5NA 1N4AA 1EK1A 1B7GO 3NT5A 3RSFA 1KYQA 1E79D 3BYZA 1U7WA 1ISIA 1Q44A 1R5NA 1C9NA 2WM2A 4IIVA 3ZYCA 1RXEA 2ID9A 4IY1A 3LHKA 2IHVA 2NU6B 3BCHA 3HKBB 3C6QA 4YMGA 5AVSA 3TZKA 2FUG1 2PBZA 2YJ5A 1UMCA 3I04M 2GEBA 1VIYA 4GQIA 1MEOA 3AHCA 4B0OA 4EG3A 4TLBA 3QNMA 1L5QA 5C37A 4XWYA 3RVQA 3T3HA 1HEYA 1G1MA 1RI3A 3AONB 3UJPA 4YDQA 1SVSA 1Z0AA 2X8LA 1JJFA 4LMBA 3EGXB 3MJTA 3ZZNA 1MEEA 1ESMA 2EJBA 5I5GA 3SWWA 1GPLA 3GDFA 3U7GA 4X0EA 1D0SA 1B6SA 3AEUA 4TYMA 4II2A 1CJVC 1B8VA 2OY0A 4KI7A 4MKIA 1IQUA 3O8RA 2XDQA 1PJQA 4QXPA 4RESA 2FFRA 4OL9A 1SUBA 2VIIA 1QR2A 2R1UA 1JNXX 5B2FA 2JAUA 4GVPA 5LXTB 1FF9A 3PJDA 2PUEA 4E14A 5ECYA 1Y9AA 2Z5FA 3KR2A 5HIMA 1XT6A 1YC2A 3AP1A 5DT2A 5F73A 2ISQA 5GMOA 4CCYB 3E15A 2X9QA 1RWNA 3ZIAA 1QHYA 4E3WA 3A6HA 3CKKA 2G9ZA 5DI9A 1NI3A 1SQ6A 4X71A 4MWTA 4OL0A 3ZCUA 3OEHD 2VJMB 1H2YA 1GN9A 3OECA 1F8FA 3CLSC 1ZDMA 5JXGA 1W9MA 2AR9A 2ZB7A 1P4GA 3LPCA 4H1HA 1UK9A 3FPJA 5FLKA 4KIJA 3QVLA 5FUBA 3V7YA 4EUNA 3G9TA 2OESA 5JC8A 3TXYA 3ZWBA 1R0BA 1BH2A 3IBYA 1WUYA 4AKEA 2QGZA 3HN7A 1G9TA 2OFFA 1IY9A 2D3TA 1PQPA 1QVAA 4OXNA 3KSRA 2OFOA 4IIJA 5FUQA 4PLVA 4RZ2A 5LBIA 3EXG1 3KWFA 1G4AE 2XR1A 3ZJ5A 2PH7A 1Z6AA 1OWNA 5C5CA 5IFLA 1CF9A 3HJTA 4D4LA 5LBUA 3F5QA 2OQVA 5BNTA 1X1BA 2CDAA 1KQFA 1K68A 1L4EA 2BFBB 4KWIA 5F5XA 4ALMA 2CZGA 3G17A 1PV1A 1YBAA 1KGDA 2XMGA 3PQ6A 3Q3GE 2PQ6A 1Q17A 1UWVA 1K0FA 1N1DA 1VRWA 2MIIA 2WUFA 1E2KA 2JFWA 5CYPA 2EG5A 2AZMA 3VO2A 5CBKA 3D4IA 3PE4A 4LFCB 1QOQB 1G8YA 3WQSB 3JQ9A 4B8YA 4JKIA 3LVFO 4H9GA 2YH2A 4YH1A 3VKVA 4BX3A 1U3UA 2FKAA 2P90A 2QRNA 3C7AA 1FLNA 4IUDS 4F1WA 2XLBA 1SZJG 4MPPA 1QIJA 1AG9A 1PFQA 4U7GA 2E4WA 3KB6A 3P5SA 3WP0A 1PI3A 1AKYA 5KWEA 1KARA 2IP2A 2Z09A 2O57A 2Y9MB 3I4LA 4JCOA 1J2JA 4ALKA 3BGVA 4B32A 4OHMA 5I5EA 2C2WA 3K72B 1A96A 4L5BA 2A9OA 5DGCA 3HLYA 1P4JA 3Q1KA 4CFYA 1F2UA 1M6EX 2Z9DA 4FX2A 3KQYA 1P6QA 2IYUA 3DT6A 3RIXA 1TLTA 1RRGA 4F3NA 3ZHOA 4PZDA 5BSVA 1RRFA 1Q6ZA 2H8GA 3KPYA 1NJ5A 4TKUB 1EQAA 1C9EA 1A4IA 1K4YA 4G5OA 4UHHA 2C61A 4PYMA 4MYUA 2P9GA 2PJZA 3WGJA 1XB2A 1PK8A 5I45A 4JLUA 5P8WA 1GG8A 5AW1A 4URHA 3IURA 4QU8A 4TL6A 2TSYB 3BSFA 2FPKA 2GOYA 5IJXA 4X1KA 4GPTA 5L6LB 4CU5A 2L0XA 4PBRA 4DSTA 3NVKI 2QJTA 3QOWA 1KK2A 1NT2A 4UCFA 3IRUA 3USCS 4AJKA 2YOFA 1NF8A 1MIOA 3PUJA 4JZKA 5JQGA 2W2KA 1MAVA 1XCPA 1GU0A 1U02A 2C1XA 3ORSA 1WUIS 3Q9LA 4KX3A 1VYTA 2VTVA 3D8NA 2J85A 2BFCA 3FUVA 1YJQA 5LOVB 2WPNA 3DEJA 3C5CA 3B9RA 4IL5A 4PLWA 4AJ1A 3W9YA 2VS1A 3GAFA 4H17A 1T34A 4EG5A 4TTRA 2JI9A 3GDHA 3MWDB 2Y1GA 3M4YA 5I7FA 4BRSA 2WAMA 2JIZA 2LR0A 1A4XA 4G89A 4LQDA 4FEYA 4MCHA 5E7IA 5CVVA 5JVDB 3E35A 3RU9A 4YRMA 2XB2A 4R68A 1BVYF 2ZZKA 1LDEA 3PDIA 2H2GA 1Y8RB 3KQSA 4HMQA 4IR7A 1WHTB 1EWKA 2ENUA 3LNCA 1F4PA 2O2GA 1ENOA 3FMFA 4YREA 3BSWA 3K1ZA 2EWWA 4HVTA 3EWNA 4KR9A 2W93A 3L8GA 3T5DA 3WRWA 4LN1A 1RACA 4U6NA 4HXYA 1PS0A 4EB3A 3U3DA 5KTKA 1PQ4A 1ZD5A 1DTWA 2FFJA 2P1ZA 3BJMA 1JR3A 1XUOA 3H1PA 5EUMA 4XW2A 5L3QB 1NU6A 1P1CA 1S4MA 4R8SA 2GXQA 5CUQA 5CAEB 1ZPDA 3M34A 1MOZA 2B30A 4AMZA 3DHNA 4A6XA 4BDSA 1OAOC 3IQWA 2CVPA 2YRFA 1V47A 3U9SA 3GGCA 2DQYA 4GL4A 1RJFA 4GVXA 4B4KA 4A6EA 1T4GA 1XZGA 3RM3A 3TJRA 4BZQA 1DBRA 4V24A 5HHTA 4A0HA 2B5WA 3WHLA 2QTRA 2IU0A 3UAWA 4DCUA 2PGDA 4W7IA 1J0XO 1XNQB 1ZQ9A 1VBKA 2ZIXB 4E6EA 2XCRB 5FA6A 4UNPA 5DM1A 1X1SA 2C82A 2Q29A 1GAXA 3AU9A 3VNQA 1HLGA 3OLVA 2C3YA 1E69A 1K3TA 1O5TA 3HK2A 5CU7A 1XNHA 1L4LA 2HQBA 1DIAA 1GGVA 2VNIA 3EODA 3GH1A 4KBFA 2E4XA 2ZG6A 4N1AA 2UUCB 3BB4A 4D0NA 3UK1A 1SHZA 2R44A 2V6FA 5CK5A 2BEWA 4F6RB 2B7CA 3HHPA 5HQJA 1NA5A 2HQ1A 3EULA 4Q01A 3ZJUA 9LDTA 5BV7A 2VUIB 3E18A 3S5UA 1A2OA 2J3IA 2O2XA 3U1BA 2OHHA 1RC0A 4R69A 3Q8LA 5LLTA 1M7BA 2QD2A 3TOZA 4M6WA 2DHEA 2OM6A 3EF1A 3WFZA 3LZDA 1Y1PA 3QPDA 2FPPA 5CDUA 2VQEB 5D85A 2X0JA 3IEVA 3ML1A 2YYSA 1UKBA 2G82A 3ZBQA 4ER3A 1EM8A 3P2OA 1J90A 4LOKA 3T06B 3AT1A 4POOA 1U3DA 4IFBA 5FYDA 1W88A 2HMYB 4U3JB 3ET5A 3ZIUA 4LXIA 4BVBA 1PK9A 1VPVA 2VTDA 4Y7DA 4FGKA 1R8YA 1PSWA 1RRVA 3A9UA 4KL8S 1L7EA 2GK7A 3WQQA 3X1WA 3AOEC 3KO8A 5PNTA 1WX1A 4P4SB 5LR6A 1TF7A 3AIIA 3D4PA 3UGKA 4FZRA 5D5HA 1XZAA 4IJQA 1II8A 4C4SA 2WABA 4G8JA 2WFAA 3EN0A 4XVCA 1XSEA 2XWJI 3D6HA 2PLNA 3TQTA 3ZY6A 4EI8A 4HB3A 3V8QA 2YJGA 2QLBA 4X45A 5SZKB 4PN3A 1QVVA 3RB8A 1P19A 2YYAA 4DJAA 4F46A 4CKWB 4QUDA 1BNCA 2MSLA 2D5CA 4DPMA 3TBHA 5GJCA 4CDGA 4UM5A 2NU9A 1S3IA 1L3IA 4XYMA 2ZAGA 3A2LA 3L1JA 2IHUA 4O3MA 2UKDA 3KQTA 3UB4A 1RHUA 4Z0HO 3SE0A 5KQSA 2UYHA 3U4IA 2R6HA 1UAGA 4NHOA 3LDFA 4OSPA 1OB5A 2YWHA 4JL5A 2GM9A 3RVBA 4LRSB 4TWJA 1W25A 3C5EA 4ZN6A 1KJZA 2QUJA 1U8CB 3CR8A 1U3VA 1Q1NA 4GICA 4A2CA 5C2JB 2V7PA 1YA6A 3GRKA 3BJRA 3K09C 1I8TA 2DTXA 2GASA 3VVBA 1QCYA 5IAEA 4YAJA 1ZUHA 5AKKA 1L5HA 3N3BC 1BHO1 4ZT3A 3OI7A 4EY4A 2FW1A 3HBLA 1DJOA 2C2MA 3NBYC 1QUFA 1IEXA 1NAHA 1NLMA 2MYTA 3PFIA 4GEGA 5CTAA 1YS7A 4CMEC 8LDHA 5F2NA 1DXHA 1I3LA 2CVOA 4Q3CA 3DE2X 5J47A 4G0NA 3O2QB 4WHMA 4KV7A 3T4EA 4YRKA 3R9WA 1NVKA 3OLXA 4MRSA 2B0JA 3P27A 3P2MA 1ST2A 4RV5A 3BTOA 3T1YB 3HZRA 2IU4A 1CG6A 1A9XB 3IUQA 2X76A 5F3WB 5SZIA 3WIDA 1UJ5A 3H5VA 1C3OA 2WIFA 3KM0A 2JCGA 4O4HA 5LNK1 4AZWA 1BE6A 2A6PA 2HF8A 2XYGA 4B45A 4X8LA 4B84A 1ZINA 1FDWA 4N0EA 3ZHUA 1O6CA 2IDKA 5ERGB 1YIDA 4ZXFA 1L6IA 4A8JA 2CZQA 2N1BA 2OEPA 2O2ZA 2P77A 3FLEA 4A10A 3HGTA 3C43A 2AQIA 1EBUA 1NRWA 2XKKA 3DDHA 4QRHA 4ZVMA 5IBQA 1MVOA 3EIOA 3OMXA 1GKUB 1AZLA 2YHSA 3TLKA 3TNYA 4QOEA 5IC6A 1CUEA 5B36A 4JFAA 3VOTA 3WR5A 2DX7A 2ZWVA 1ZI6A 3G59A 5CT9A 4QEDA 5JZ9A 4ZVSA 1EUYA 3GJ0A 3IQZA 3PPYA 2C7PA 3HGMA 3ZCTA 5EXEA 4WERA 5EWLA 2H51A 1GNSA 3V2GA 2I6XA 4YMLA 1G0OA 1YJBA 1BGWA 2K87A 3I76A 4I55B 2GEJA 1C4OA 1E3TA 3MC1A 4KWCA 5EQJB 2FWRA 5FFNA 4F4CA 4KHPB 1VJ5A 1GDTA 3HVKA 4TQAA 4Q3LA 1UADA 2ZZMA 1WHSB 2ICAA 1IMJA 2WSIA 3B2NA 4BJHB 2CLKB 1UC8A 1IOZA 2C5SA 1CVRA 1GNPA 2P9EA 4RVDA 1UM8A 1MR3F 1OBOA 3AIKA 4TMWA 5E7QA 5AR1A 3ZBPA 4B8ZA 1JN0A 1Y89A 2PZEA 3INGA 5EE9A 1NN5A 1E4YA 1PP4A 1QRUA 1Y6ZA 3ZOZA 1IG3A 2FN9A 2XNKA 1U1IA 1CR2A 3EMVA 4FR0A 4OKIA 4OIMA 4OQMA 5AWFC 1PVOA 1FB5A 3V8VA 2ZSIA 2GHTA 3GLUA 3T41A 5DYNA 2R6R1 1NW7A 3PNPA 4AQDA 2HGSA 4WXMA 4AYTA 1VXRA 5EQTA 4AN0A 5LNK6 1E9EA 1U0OC 3FCUB 1OT5A 4NU0A 4CEIB 1UEJA 2FN8A 3IAS1 4HXFB 4N7JA 3EH1A 1R00A 4Z4HA 5CMLA 5BOSB 4DNQA 1OX4A 3AUJB 1QPZA 2VNSA 5GGYA 3QFHA 4V0RA 5BV1A 3W2GA 1F12A 3GCGA 5G4KA 3RUEA 5BYAA 3O83A 3FPFA 1Y9EA 3MTEA 3GCDA 2OO5C 3BJZA 2IHYA 1AA6A 3S68A 4KE6A 4AUKA 2R48A 3DMTC 4ZVOA 3CLUC 3ZY2A 3R41A 4KNYA 1HDGO 4DA8A 3ZKWA 3MFQA 1F48A 4JYCA 2DWOA 2GDZA 4AJHA 5GPBA 2EFDB 3SEZA 1R6AA 1H0RA 2CVFA 4FI3F 1Z36A 1ABBA 3TBKA 1BHSA 2OHIA 2Q4EA 2YIDA 3EZNA 2VZLA 1IVNA 1TUBA 2G28A 4G97A 5DU2A 3SFVA 3H97A 5ETJA 2C9YA 2WE7A 3UENA 2ZIFA 5AJXA 4ZYWA 1E1KA 4U2BA 5KNCH 4BV8A 4ICIA 1ORIA 1L8LA 2QUZA 2FEKA 4IIUA 2FZKA 3ICVA 5F77A 1V7ZA 4BCCA 4U3JA 1JT2A 2HHJA 2Q1WA 3NYWA 5JLAA 2OXIA 1L5VA 1C4WA 1CUDA 2FK7A 5DK4A 3U4GA 3URKA 4C5AA 4HFRA 2RBEA 1G7TA 1MQAA 4RPJA 2JD0A 4B35A 5KYWA 1B76A 5BSTA 2Q2OA 3Q3CA 3NC4A 4II3A 1M6WA 3DCJA 3HG7A 4PU0A 4UEWA 5JQGB 2R6DA 2WEKA 3DONA 4KMRA 1TF5A 1KNQA 1IBRA 2DR0A 4TYWA 4TVOA 2XYHA 4WBXC 7ADHA 1TKCA 2HQOA 3QYPA 1IXSB 4MAFA 3RYIA 1BU8A 4DV4B 4WOJA 1DKMA 4XKJA 2HMAA 3DOUA 2YKGA 1UKAA 3D81A 2Y0EA 4GPBA 5BT8A 3JWGA 4P22A 5CX1A 1JWBB 1TMKA 3KKEA 3DSRA 2G06A 4YN3A 5CB4B 1GYQA 1N2IA 3IBFA 4WX2B 4PQRA 3E1SA 4FFBA 5L7TA 3PX3A 3UJBA 1UFKA 3RRJA 4C4OA 5L4NA 5JD5A 3GLGE 2IITA 3D6FA 3MLEA 2C77A 4EZBA 4ERNA 2CXRA 1QK3A 1UDCA 1V71A 1XAIA 1G5FA 1WB4A 1TX4B 2OO5A 2Q9BA 4S0ZA 3HVJA 2P3QA 3ABOB 5K0SA 1GRVA 1OHHA 4Y9UA 5G3ZA 3BEDA 5FPPA 3ZHQA 5JUWA 1M54A 2QQEA 1I6KA 4D44A 3HTXA 1OLUA 3RS7A 3ED5A 4DY4A 3DUFB 3HO6A 5EOVA 3CNOA 3TI9A 2GBCA 4FDTA 3UHOA 1OGJA 3ADCA 2Y76A 2R751 4QFMA 2D5AA 4PVDA 1F5SA 4WASA 4MYTA 3BZBA 3K96A 1C50A 1XV5A 4IQFA 2HSDA 5HX7A 5HZGA 3AZOA 2DFTA 1A9YA 1RJEA 1U9CA 3Q85A 3ZV7A 2I54A 2VHEA 3OCWA 1QYRA 2QV0A 1PS8A 5J2UB 2NSLA 2C9MA 1PR9A 2H3EA 2UVQA 2ZTSA 4Q03A 3WIEA 4JLVA 4AROA 1Z22A 3NP7A 1GQRA 2N3ZA 3LBYA 3GH3A 4TV8F 5J58A 3ANMA 3GEIA 4C3ZA 3KIPA 3OESA 4MKZA 3RVNA 1CDOA 2GJSA 1M6VB 4NENB 4KPUB 2HRQA 1GTL1 3DD5A 5ADVA 5IH7A 1W46A 4RV9A 3FSJX 4HQ6A 3G88A 3V1YA 3ZYZA 1X7XA 1ADYA 4XIGS 3DV0A 4RAQA 5CLGA 3ZU2A 1GKKA 1HZJA 2IQ5A 3IHLA 4X1KB 4DYDA 3RC7A 4BLOA 3L7NA 3VR0A 4ODIA 1WPQA 1POXA 1KEVA 1KMQA 2ZOSA 3I6ZA 3PEUA 4QG7A 1AUQA 1EA7A 3HU1A 3JYNA 4HDSA 4WLOA 3QA9A 3ZIDA 1AMOA 3AOGA 4B3CA 1JHOA 4UCWA 3HWSA 4KEAA 1SXHA 4RTNA 4TMFA 9MHTA 4RCZA 3K0KA 5BSRA 3UWKA 2R68A 1OY1A 2I1LA 6ABPA 2QR5A 3O47A 2C2ZA 3HKEA 1EFTA 3L01A 4NZOA 4JBWA 1TAQA 3ACDA 1JTFA 4BNFA 2FPGA 4OM8A 5E4YA 3A05A 5JJCA 2NNLD 3FHCB 1KEUA 2D7JA 4H7DA 5DASA 5HQTA 4MXDA 4ALNA 3Q2IA 5EKSA 2CB9A 3LY8A 4F4UA 1DJQA 4YUXA 1AQJA 1KE1A 1XVIA 3SJUA 4BCBA 3G13A 4CV0A 3NHLA 4B79A 4RHYA 4RENA 2QZ9A 2PBFA 2WJ3A 3O73A 4PCUA 3SMVA 4ZI2A 3H11A 1P9RA 3GLQA 3IAM1 4K9KA 2Q07A 1AX9A 4L57A 1SUPA 4ARCA 4TWBA 2AQHA 4DC1A 2QMUA 1ZJ5A 3ED1A 3CLVA 3LH5A 3M9WA 1CUGA 2VDQB 1ZD4A 1PL0A 2BDEA 5HS6A 1XEFA 2GD1O 1GCAA 3OFND 4IHAA 4K6OA 3RJ5A 2Q46A 2ZS8A 1NGSA 1KQ3A 3H9JA 4ZDJA 4GL2A 3W4JA 3WKDA 1K1EA 4OUDA 4ISCA 4ZI7A 1UODA 1W6RA 1VE7A 1NW9B 5ES3A 2VRCA 5ANRB 3T3EA 4CKBB 1M6YA 4YMTA 3OEWA 1KSFX 3DBLA 3DMNA 4CT0A 3I42A 2JHCA 1WF3A 3BSYA 3CB4A 4P2GA 3VI4B 4C5BA 4EY5A 4YROA 3U7QA 1JYEA 4XWAA 4TN1A 4F8JA 1BKSB 1QH0A 2W0MA 2WR8A 3N87A 4CIVA 4EQZA 3O9MA 2H7XA 3FCYA 1YFKA 3WGGA 3FWHA 2BISA 4BNUA 2AMLA 5A3RA 4DBLC 4COKA 4QGBA 1VMAA 3DC2A 3UM9A 4D8XA 5FQOA 3PBKA 2B83A 1TK2A 2X77A 2I8LA 3DB1A 3E82A 3ZZUA 2RD2A 1I80A 1SU8A 4DAEA 4D9MA 1T1JA 1G6HA 1YGYA 4D74A 5JH7B 4O2BF 3LD9A 3ZDEA 3SHFA 3GFVA 1Y37A 3GLTA 4QHTA 3ZD9A 1P74A 1VHWA 1WY7A 3MJDA 4QU0A 4B6PA 4BGDA 2QN1A 1VOTA 5HR5A 3H05A 1MFZA 3K0FA 4Q4LA 3MOGA 2ZT5A 4B3HA 4D3DA 4R31A 1KEPA 3A4MA 2RH4A 3IAM6 1ORWA 1VMKA 3CONA 3F5SA 3P2YA 1FDUA 4QL3A 3C1TA 4LY6A 3FFXA 5EPOA 1LW6E 3REQA 4P7GA 5B7PA 4MV0A 4OGKA 4UQOA 3B36A 1YV9A 2CXHA 4GPD1 4EH1A 1HL3A 2AN4A 2O3JA 5FWNA 1P5RA 3JXEA 3QFSA 2V5VA 3LPMA 5TQ0A 5B3KA 1GEEA 4IKEA 1V5IA 1NW4A 3MK31 2WP0A 2OAQ1 1F7UA 2VNHA 3VYVA 1EFRD 3KR0A 1PL8A 1R27A 2AEMA 3A04A 3C4VA 3MTQA 3O1LA 4JEIA 5D87A 5ALLA 5G2OA 4R71A 3AC0A 4UQLA 3ZWNA 2VJLA 3O84A 3RFUA 3OWXA 2BMWA 5IF9A 3FVQA 4OHPA 4B40A 5TGTA 1J21A 2XWQA 3CINA 1Z7WA 2EOAA 5KMGA 2Z9BA 1K8QA 2ZWOA 4G25A 1MGPA 2ZTUA 1FMFA 4Q1EA 5JH7F 4XYBA 1Q0TA 2JFHA 3O7WA 4F2GA 1HLPA 3TLGB 4BB9A 4FBMA 4U2GA 2QX8A 3OOJA 1Q0RA 4QRDA 4N76A 3A6GA 3KKLA 2FWJA 5K0BA 4KFCA 2LDXA 3AJAA 3S2UA 2CMGA 4E4RA 3KQQA 1L4UA 3PC4A 1ZXLA 4HZIA 4N7RA 3F73A 3MD9A 4Y6LA 4FW8A 2C8JA 1OD6A 1TYZA 3L7AA 1DADA 2CDRA 2GM5A 4E5NA 3CSUA 3BGSA 3KOWA 3GVIA 2C5BA 2WPDA 3K1AB 1M1YB 1DB3A 3ZXYA 5KNDH 1X1AA 1Z5NA 3K5HA 4GWKA 4WRRA 2M2IA 4HTAA 1DL5A 2KBEA 3IE0A 1L8AA 2BEUB 1WLSA 3JYLA 4G5YA 4M60A 4UJ3A 5ECDA 2C00A 4DN6A 4NY1A 1KJ9A 3OY2A 3WGVA 4QUHA 2ANBA 2OQRA 4O8ZA 4C7MA 1KMNA 1CE8B 2JGNA 3QUCA 4P83A 1J99A 5DW3A 3V97A 1IY2A 2CLCX 2WIGA 4E70A 3ZE1B 1KJYA 2P78A 1QMGA 3MFYA 5EUQB 4RFSA 4NCBA 1CQJB 3LW7A 5IJ0A 1HE3A 1MRZA 3EZXA 5KQMA 4B3BA 3ES9A 4LYYA 3K31A 4BN4A 3IV6A 4DRXB 3U4QB 4RHFA 4WKBA 3U7JA 2GARA 2W71A 4TMKA 4YRBA 2HLPA 1JU4A 3K9GA 3MMSA 3AKZA 1DAGA 1W36C 4PC3A 4AY2A 5LBTA 1UMBA 2O0HA 4HBZA 4MRAA 4E5UA 3WV5A 1M1NA 2NO1A 3NV9A 3NALA 1QHHB 4DJFC 5DNYB 2VJQA 3RRYA 1S7CA 5BVHB 4BQSA 2N47A 2IUFA 3RAPR 1T4CB 2QGNA 1YUNA 4Y2QA 3PRHA 1HK7A 5FTKA 1EESA 1HDOA 1SHUX 1VGVA 3AM3A 5A3SA 3HGQA 1Z15A 2OCGA 4FXPA 3MHPA 1PE0A 2D5IA 3PFKA 1U2TA 2P6MA 3OFJA 4YASA 2Q99A 3Q88A 5LXTF 1SGWA 1ULAA 1JEEA 4DIUA 1FVFA 4H7FA 4LOJA 1U1CA 4X94A 1PR6A 2AJDA 1QZ3A 2JBHA 5FPHA 3QXJA 4NFLA 5DNCA 4LYFA 4WFJA 4ILKA 4B46A 1GD1O 5LCXA 2OHFA 3FTFA 1HE2A 1KGSA 2NUPA 1JV2B 2INGX 4IV8A 1QRSA 1PT8A 2A84A 3MG9A 1WW8A 4M9UA 1F0YA 3DE0X 3BE6A 4R2WA 1EEHA 4KE9A 3GU3A 4GOOD 3OPYB 4N6OA 4IEFB 5TC4A 1HG1A 2JZCA 2GMWA 1M5UA 1L5KA 3T1NA 1I3CA 5F1OA 3A1TA 3L4BC 4MDYA 5C3UA 4TT8A 4ZT6A 3M1AA 4UMDA 1ULUA 2Q3BA 2H7VA 2Z8XA 4MIEA 3R6WA 3BIXA 3Q7TA 1GU7A 4WEOA 2ZQ5A 1H3EA 3U3KA 3UGQA 2COUA 1TCBA 2L82A 3DBRA 1PQWA 1RYEA 1ZN9A 2H1VA 3KVOA 4H7KA 1AURA 3CRRA 4DBLE 3NWEA 3E5NA 1T0HB 2GFHA 4KG7A 4FYKA 3SIXA 4Q3BA 5EZYB 1JLSA 1TYBE 2FYTA 4FSXA 1QUEA 3T0FA 3TBFA 1EHYA 3OPYI 1JXAA 1TECE 3OOYA 4MUIA 3ZWWA 2E7ZA 4IF6A 1IJEA 3LQ4A 4Y9TA 1K6EA 5AVYA 1E77A 5A04A 1TO1E 3PC7A 1T3HA 2OLKA 3EGEA 4GOXA 1C8VB 4LJ5A 5JAUA 5JQWA 1TA9A 4A8JC 1U8AA 1VBMA 4H3KB 2CN1A 2AZDA 2W43A 4MUHA 5E1DA 3TAXA 2QPOA 3ZHZA 2PKQO 4LXHA 4CGZA 1VYHA 2X1LA 1IYZA 3PKZA 4WNCA 2G4CA 3G8YA 4U2CA 4G0XA 2PRIA 2WU1A 2ZBRA 3H5WA 4DNPA 3DFFA 4L78A 3KVNA 3ORQA 5IVHA 3BH6A 4O0LA 3GRUA 3N59A 1S8AA 2WINI 2GPNA 2F3RA 3ENWA 3K9BA 3O8BA 1ZM2A 1HFWA 3AERB 5CEFA 1H2HA 4BE4A 4BRWA 4D4JA 2O8CB 1FBNA 1M34A 2A33A 2VUHB 3AY3A 5DTJA 5JXHA 3AI1A 4EOGA 1VM6A 3CHYA 5B1EA 3PGVA 1YD7A 1D3AA 4R2MA 5EXPA 3G0BA 5FBQB 3R3WA 1XN4A 2EJVA 3T5BA 3ILVA 3IEUA 3MJ4A 1U4NA 4J0JA 4BO4A 5AK0A 1T8UA 2ZJ0A 3VKUA 2FE4A 4U2FA 1NJ6A 3M83A 3RC8A 1TVKB 3I12A 4L5JA 2VAVA 1L3CA 4BVEA 2WBLC 5KTRA 4KN5A 1RPNA 2UXDB 1QGUA 5DYIA 4JJFA 1BS2A 1TJ4A 2WWFA 1W52X 3BWCA 3HKBA 3S6JA 4JB8A 3QI2A 4UPEA 2LRHA 3Q8MA 3OA2A 3OZCA 3FCOA 2XB9A 3A3OA 1J09A 2F62A 2H7YA 2QM0A 2QU7A 3H13A 3GEDA 1MG0A 4OGGA 3DOEA 2G83A 4Q21A 3S8MA 4R5HA 5CYGA 2G09A 2VK2A 2YV2A 2NXCA 1RCTE 1CCWA 4E88A 4EBBA 5KS2A 5F3DA 4M7WA 2WRZA 1NQUA 4GOJA 4HB0A 4N0PA 4ND5A 4X3CA 1IHYA 3JD1A 4FGZA 4KAJA 2RI1A 2JLVA 3SQNA 1WM1A 2XZTA 2OVFA 1QPBA 1CUIA 1XTSA 1A3CA 5FI0B 3VFDA 5JNWA 5FEUA 4EA8A 3HVIA 2IPAB 4Z51A 4KLAA 1SKYB 3TCKA 1ZKMA 1XMPA 2YV5A 4RZIA 5EG5A 3I8OA 3KP1A 2IFTA 3OMWA 4B43A 4C4YA 4EKEA 1EVEA 1U2EA 3CLKA 2QHXA 3D8RA 2XVZA 5JR3A 4I2VA 1XEXB 2FJPA 4PEVA 1DAIA 2P2GA 3G1WA 3Q7PA 4X24A 2X22A 3ZU4A 1H85A 4L2IB 2X6QA 1TM1E 4J75A 5AHWA 4V0ME 1M8GA 4QGGA 4FX5A 4GYJA 3GVPA 3BWEA 3RUIA 3SVTA 2UUBB 2JLRA 1JAHA 3TLEA 3LS2A 4FFPA 1NMZA 4IIDA 4PICA 4RV4A 4I9GA 4IVQA 5CHYA 3G8CA 3IP5A 2AHOA 2WHYA 3DE1X 1XVUA 1YL6A 3B85A 4JCCA 3SXUB 3TSZA 5MHTA 5FORA 2FA9A 1K2VN 1WA5A 3SBEA 1Q57A 5TEVA 1ZEJA 4OQEA 5FL3A 3OM1A 4YP5A 3ZWOA 1JXQA 1LW7A 4S1TA 1ZCZA 1WD5A 2BWJA 2WF7A 3FFAA 3PXEA 5THQA 4KOEC 3WSVA 2VI5A 3NRBA 1Y7PA 1T9HA 1E3WA 1XMVA 2FMFA 2G04A 4AW9A 3NIWA 4CM9A 1Y81A 1R0CA 3QU2A 4PX2A 1XRRA 3BKXA 3FUWA 4L74A 2WD9A 2QMOA 3A3NA 2ZYWX 1KXZA 4L72A 3I58A 1B3RA 1P2BA 1G5RA 2DGDA 3CKYA 3SI7A 3I2KA 2BI8A 5DBHX 3F47A 2PMWB 4M88A 4IX1A 3IQEA 1BSVA 1NYRA 3P96A 4N54A 4BMZA 4D8YA 1ZJ4A 5JCJD 3TVDA 2C0CA 3S55A 1Y4AE 1QZXA 4EJSC 5B7QA 4J1NA 2VAXA 4CMHA 2KLHA 1RM0A 3VBCA 3D0OA 1GZ4A 3WBKA 2HCBA 1NI5A 4K9QA 4F97A 3IEMA 2DFDA 1QPGA 2XX3A 3FSGA 3H65A 3OCVA 1N2CA 4EVQA 3C6XA 1N1GA 3R9XB 4Y1FA 1ZN7A 4FT2A 3R0VA 3TB4A 3CMCO 4Y2XA 2IWRA 2VFAA 3CLRD 3O3MB 1ODKA 4WKNA 4QGAA 3HY4A 1UPBA 4WAUA 2BCGY 1EVLA 3I52A 1BHQ1 2YRWA 5A1JA 3A6FA 2XJ9A 3OZFA 1L5OA 4M4SA 1M9NA 3ROGA 1H6AA 4R9VA 5EZYF 1B00A 1ODIA 1X1DA 5JJLA 2KSQA 1IOWA 1NVAA 1N6OA 1NXWA 3UFBA 5KYXB 4IVNA 3OJXA 3ZWYA 3WA7A 2ZTVA 1W0JA 2ODWA 3K0SA 3T7JA 4IM7A 5IH3A 4LDPA 3G7SA 4KE8A 3R5KA 5AIAA 1RFGE 4EECA 1M74A 1M1UA 4JSRA 3E03A 2PWAA 2ZJ3A 1N7JA 5FOVA 3QI7A 2VHYA 5HW0A 1YFLA 2F8TA 5DNEA 4ER5A 4OK5A 1HV8A 2XMBA 3AEXA 2M9MA 4LDZA 5CT8A 1D2MA 5I3CA 1O0CA 1BFUA 4HGPA 4MA5A 3WLJA 2QR2A 4ATNA 2W2PA 2BOVA 4HDOB 3GMDA 5LOVF 1DC3A 2VDUE 3F4KA 4MUAA 2ZWPA 3UXHA 4EUEA 2TYSB 5EJGA 2O9JA 2QVLA 2IYSA 4JJ6A 1MXHA 1R18A 3PR3A 3RJ9A 4Y6QA 3THWA 1QAOA 5B3JA 4JS0A 1MDFA 1W4LA 4A3SA 4ZCMA 5FQNA 3K9WA 3LUAA 4QFDA 2F6RA 4JI8B 3P9YA 2IEZA 2XA1A 3B6EA 3OIVA 5J9FA 2QV7A 3C74A 2ENWA 3TL2A 2A9RA 4RABA 3UK0A 3I64A 1XK7A 3DTVA 3B3FA 4Q4JA 1TJ5A 4LQ4A 4FDMA 5ECWA 4C20A 3DEKA 5JRJA 3NJRA 4RZSA 3GRVA 2BFAA 1EJ6A 4JJAA 3L04A 2GF2A 3ND6A 4Q15A 5H7XA 4DA6A 3D31A 1W44A 2D2IA 2FFAA 2C03A 1GQOA 2UVDA 5LA6B 1ZK1A 2PCLA 1E3SA 4F9GA 4KFSA 3WIBA 3H75A 2O8CA 2B4AA 2E0IA 1ZICA 1VC2A 2OUKA 2ZM5A 1TUEA 3AVPA 3DLCA 4KAXA 5DN6D 4RW0A 5ALZA 4C6HA 5K4HA 4W99A 2BHLA 4NCIA 1E2FA 1MFPA 2HWXA 3AG5A 2PFGA 3WYDA 1HKUA 4ZJUA 2RG7A 1JECA 1DWPA 2EBFX 3F3KA 3OZGA 4FYMA 5TE9A 5TEWA 2X5OA 4GZMA 4HV4A 2QXTA 5KOHB 1X8JA 4M54A 2ATCA 3JQ8B 4B76A 2J5BA 1PV4A 4ECAA 2FCRA 2V9ZA 2BGIA 4C6SA 2BR4A 4GPAA 3VSEA 1A77A 1QTNA 3DBRB 3HDQA 4BUCA 5K3SA 1EMDA 2ZULA 1EFPA 3CZQA 3KXDA 5EHIA 8AT1A 4WKGA