3A7DA

Crystal structures of rat catechol-o-methyltransferase complexed with new bi-substrate type inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
214
structure length
214
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hit to Lead: Comprehensive Strategy of de novo Scaffold Generation by FBDD. Part 2: Ligand Fishing using Mass Spectrometry by Detection of Ligand-Protein Non-Covalent Complex after Matrix Click Chemistry
rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 83
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2009-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3a7dA00
2UYQA 3DMHA 3DXZA 3KR0A 3OFKA 2OPBA 4M38A 5E8RA 4AZSA 5EQJB 3HA7A 5EVJA 3QOWA 1BC5A 3P2EA 5DTMA 2OB2A 4PYOA 4QQNA 4EQZA 2I9KA 3PS9A 2YUIA 3K0BA 4GQBA 5ICFA 3ER9A 4RTNA 2UZ4A 3B5IA 2PX2A 1JQ3A 3FPGA 2HWKA 2PY6A 5E2AA 5ICCA 1H1DA 5E9JA 3CKKA 4DF3A 1D2HA 1KPGA 2HV9A 2ONZA 2XYVA 2ZWAA 3FPHA 3FTFA 2P3QA 1XJ5A 5E1BA 4PCLA 4YUYA 2NNWB 3CJQA 3F4KA 5DT2A 2YR0A 2E5WA 4HGYA 5HILA 1JQDA 1JTFA 2IBSA 1B42A 3ANXA 5B1SA 3G5TA 4MIKA 1VP3A 1EQAA 1VP9A 1Q0SA 3GRYA 1VQ1A 3LDFA 2AOTB 4PYIA 1BOOA 2IP2A 4OX9Y 2B3TA 3EVGA 3T0IA 3EMDA 4FR0A 4ER0A 1QANA 5CCXA 4R8SA 1HNNA 3EVFA 1BHJA 5CVDA 3MHTA 4OBWA 4PYLA 3SSMA 1I9GA 4A6EA 4ER6A 4AZWA 3BGVA 3X0DA 1MJFA 3HA5A 3AXSA 4ISCA 4V0RA 3T7TA 2ZZNA 3C6KA 3OU2A 4OQEA 2PLWA 2OY0A 5C9ZA 4CKEA 5BXYA 3FUTA 2ESRA 2QYOA 3THSA 1G8SA 2PXAA 2Q41A 3MAGA 3P9CA 2IIPA 5E2BA 5F2KA 3A25A 3GGDA 3OCJA 4HG2A 1XCLA 3P8ZA 1RI4A 1QAOA 4CTJA 4MQ4A 3GWZA 2G72A 4HTFB 4QVKA 3TQSA 1D2GA 3BT7A 5DX8A 5EZQA 3HM2A 1UFKA 1XDUA 3I53A 1KPHA 1SQFA 3FYDA 3D2LA 4GOND 5KYGA 2O05A 4RVFA 3G8AA 4NECA 3ID6C 4C07A 2YXLA 4RTJA 3SVZA 3LCVB 4C03A 3AY0A 2BR3A 2JHPA 3RW9A 5GM2A 3LHDA 3ER8A 3OE4A 5BP7A 5M5BA 2PX5A 2GLUA 5EG5A 3HNRA 1ORIA 4PYNA 4HH4A 1KPIA 1O9HA 3LCUA 3FPFA 2AOTA 3BWMA 3FTEA 3NMUF 3A4TA 2B78A 1NV9A 3G8BA 3M4XA 2VZ9A 3P2IA 4BLUA 2IH2A 3TR6A 3U81A 2WK1A 4CTKA 4V0QA 4RTLA 4WVLA 3B7PA 5E1MA 3MB5A 2ONYA 2XVMA 3HVJA 4QDJA 4RX1A 2QE6A 3B3GA 4ATNA 3CC8A 5T64A 3RIEA 1YZ3A 5FHRA 3TFWA 3KQYA 3UWPA 1R8XA 3MTIA 5K05A 5K0BA 2OXTA 2PX8A 2IH5A 3GRUA 2CKDA 4Y30A 4FSXA 3L8DA 3NVKI 4C05A 2Z6UA 3H2BA 3TLJA 3LL7A 3EGEA 5FUBA 1YZHA 5DX1A 2BR5A 5DXJA 4RTPA 3FRHA 3FRIA 5KVAA 4KVZA 2Z6AA 2AZTA 3GIWA 2P8JA 4GC9A 3Q7EA 4OA8A 2HR1A 2P7HA 3BZBA 5HIJA 2EFJA 4Y2HA 5ERGB 5LSAA 1I4WA 2BH2A 1M6YA 5DLYA 4FGZA 4KW7A 2GAFA 1EAMA 1TW2A 4RYLA 2GB4A 1YB2A 3Q87B 5MHTA 1R8YA 1G6Q1 1NKVA 1WZNA 1XCJA 2G70A 3JWJA 2VS1A 1AQJA 3TRKA 4PYKA 1EJ0A 4AUKA 2ZIGA 4M37A 5F2OA 5E9WA 1L3BA 2FCAA 5HOQA 10MHA 2IH4A 2P3LA 4IWNA 5D1NA 2K4MA 4QTTB 3V97A 4QPPA 3KU1A 4GEKA 4E2XA 5D1HA 3JWIA 5FA5A 1NW6A 3HCAA 5K8VA 3GNLA 1RI2A 3MCTA 4CWAA 2UYOA 3DXXA 3UA3A 2JH9A 4B17A 1TPYA 2NXCA 1X1CA 3KHKA 2IGTA 2PSSA 3RODA 1BKYA 4DM3A 4DZRA 3T7SA 1XDZA 1FP1D 3GXOA 1ZHFA 2XYQA 2AOXA 1T43A 3EEOA 2XVAA 1Y8CA 4LWOA 3OPNA 1JSXA 2YVLA 1NW3A 3O31A 3DUWA 3R6TA 1M6EX 3LGAA 4P7JA 3KPVA 3PX3A 4PYQA 4U7PB 1RI3A 5CVUA 5DTQA 1IXKA 2QY6A 4PYMA 4H0NA 5K0EA 2PJDA 5KS2A 3ELYA 3HA3A 5HEKA 5BW4A 4C04A 2IBTA 2NXEA 3GU3A 3BXOA 3TOSA 2OYRA 3BWCA 3NDJA 5LQUA 3BGDA 4MTLA 3UJDA 5GIPE 2P1DA 1WY7A 2CMHA 3GCZA 1WS6A 2OO3A 4E32A 5IKMA 4BP3A 2R6ZA 4RVDA 4G56A 3EVCA 5EMJA 1JG2A 2HTEA 5FHQA 3KKZA 7MHTA 3VC1A 2NYUA 5HFJA 1U2ZA 5EGSA 5IH3A 3UJ9A 2Y1WA 1JG3A 4X61A 3P97A 4RSRA 4HGZA 3B3JA 2OB1A 1L3IA 4RTRA 1ORHA 3KQMA 4HSGA 4QDKA 3KPWA 5E1OA 3GDHA 5HIIA 4GOMD 4ER5A 4YMHA 1JG4A 3C0KA 3ELDA 3PFHA 5T67A 4EKGA 4RTMA 2DULA 4X60A 3IV6A 3UZUA 4YV2A 3LDUA 1UWVA 4IV0A 4OBXA 5H02A 5LQNA 2ZZMA 2FK8A 3HTXA 1WXWA 4GOLD 1L1EA 2H11A 4AZTA 4PIPA 2QRVB 1VL5A 5C1IA 4HC4A 1NBIA 4OQDA 5BW5A 1X1DA 3PTAA 4L7VA 1RJDA 2YXEA 1O9GA 4QTUB 5DRTA 4CKBA 3SSNA 3WSTA 4RTKA 2WA1A 2LD4A 1KIAA 3PB3A 1JSZA 3LECA 4M7RA 2A14A 5EOVA 5GWXA 2ZZKA 4P7GA 3KQOA 4FT4A 3ME5A 1JG1A 2YXDA 3EVAA 5DWQA 2F8LA 3DXYA 3G2OA 3I64A 2YX1A 4IV8A 2B2CA 5P8WA 4DQ0A 5LQJA 5CIYA 2I7CA 4PYJA 3I58A 5CVVA 3FYCA 2ZW9A 5FADA 3IYLW 1JQEA 2WA2A 3LPMA 1RJGA 2ORED 4RWZA 3O7WA 5FWAA 5U4XA 2JHAA 3UJBA 5LQRA 5EHGA 3UBTA 1OR8A 4QQKA 2BM8A 3FTCA 3TKAA 5FULA 4UOEA 1L9KA 3A7EA 3G2QA 1D2CA 1M0EA 1NE2A 4PCAA 4MWZA 3MQ2A 1QAMA 3M6VA 2GH1A 2P3OA 1NBHA 3G89A 4OA5A 3HCCA 1F3LA 4U7TB 5G02A 3BWYA 2PX4A 4E2ZA 4KWCA 4RTOA 3NWEA 1TW3A 3TPZA 5K0CA 3LDGA 3M6XA 1N7IA 5EEGA 2FYTA 1R74A 4JXJA 2PGXA 4MHTA 3BWBA 3EVEA 3FPJA 3REOA 1YF3A 3I9FA 1SKMA 3HCEA 4YUXA 2JH8A 3NVMB 4ER3A 4AZVA 5F2NA 2AOVA 1P1BA 3I5UA 4F86A 1MHTA 5EIFA 4FS8A 3FZGA 3P9IA 2ZTHA 3HVIA 3R9XB 1X1BA 1V39A 2FRXA 3PFGA 3KPJA 4F84A 5DTRA 3R0QA 3E05A 1JTEA 3KQSA 4YUWA 2IDKA 3KQWA 2GA9A 2NP7A 2NP6A 4BLVA 4PGHA 5E9QA 1L3CA 4HRAA 1UIRA 2VP3A 3BKXA 4LECA 5DSTA 4E33A 1N2XA 1PRYA 3O4FA 3MGGA 1NW7A 4PIMA 3AWIA 3DH0A 3OU7A 5EZSA 1YFJA 2O06A 2CMGA 3CJTA 1AF7A 3E8SA 1AV6A 2ERCA 5EEHA 2AN3A 1EJ6A 1FP2A 1DUSA 4X63A 5LQCA 5DX0A 1X1AA 1PJZA 2H00A 5FCDA 9MHTA 2HMYB 5DM1A 1R00A 4DCMA 4GUAA 3QV2A 3FUVA 3DLIA 4RTSA 5JR3A 1Z3CA 3GO4A 4XUEA 5DPMA 4ZTBA 3HP7A 4BP1A 1QYRA 3PVCA 2ZFUA 5EMLA 2QM3A 3HVKA 3G2PA 2GPYA 3SSOA 3TM4A 4YUVA 2ADMA 2FHPA 1NW5A 4KDRA 1R18A 5ICEA 1R6AA 5FQOA 3VC2A 4BLWA 1INLA 3EGVA 2NXNA 2C7RA 1VIDA 1FPQA 3NTVA 3UFBA 5FQNA 2O57A 2OKCA 4DKJA 2ZSUA 1I1NA 3ELUA 3B3FA 2JHCA 4XUDA 3FUXA 3SX0A 4POOA 1G60A 1NW8A 1ZGAA 2AOUA 3KR1A 4KRGA 3VSEA 4E70A 4KDCA 5LR6A 4R8RA 5E1DA 4LWPA 1G8AA 8MHTA 5KQRA 4KIFA 3PLAE 1WXXA 3CJRA 3M6WA 3P71T 2AN4A 3IHTA 4R6XA 4RTQA 2AVNA 1XTPA 2P7IA 1KXZA 1HMYA 3KPYA 3C6MA 2EG5A 2UYCA 1RI1A 1IM8A 3EPPA 4E2YA 2NXJA 4P7KA 1F38A 5KQSA 1FJXA 2ZIFA 5EHIA 3DLCA 3G7UA 5EMMA 3OFJA 4PGGA 2PBFA 1XXLA 4WXHA 5HIMA 2KW5A 3SXJA 5EKUA 5HIKA 2ZBRA 2PT9A 3K6RA 2I6GA 1P91A 3DTNA 1RJFA 5E8JA 3C3PA 4E30A 1AQIA 3JWGA 3AXTA 2BM9A 4X1OA 2UYHA 5K0FA 1O54A 3SGLA 5ICGA 4K6MA 1ZKDA 1VPTA 3T7RA 5JUWA 4PNEA 3BUSA 5DXAA 5GINE 3LSTA 2CL5A 1NT2A 3LKZA 5K0NA 5FTWA 2Y1XA 4KIGA 1FBNA 3QOXA 1EG2A 3E7PA 5CUQA 5DM2A 4YMGA 1QZZA 5CCBA 2ZCJA 1X19A 4RVHA 5EKXA 3CBGA 5EMKA 3GRRA 4XUCA 1VBFA 3V8VA 3OU6A 1NV8A 2EX4A 4E2WA 3OE5A 5CVJA 5DM4A 5T6BA 2O0LA 3LX6A 1KR5A 3NJRA 3G2MA 2JG3A 2G1PA 3M33A 2FPOA 5K09A 2IPXA 3IEIA 4XCXA 1SG9A 4DCGA 1DL5A 3NWBA 3JWHA 3C3YA 3DP7A 1N7JA 3NW9A 3UA4A 4C4AA 4HTFA 3EEYA 3P9KA 4YV1A 2ZBPA 4CXMA 2VDVE 3LBYA 3PX2A 1Q0TA 3AJDA 3B89A 2PXXA 5FWDA 4E31A 4FP9A 3FUWA 2IFTA 2ZVJA 4QPNA 2PWPA 3ERCA 2PWYA 1RI5A 3A26A 3KPUA 3PT9A 2Z6QA 3EMBA 2IDJA 5HZMA 1JR4A 4IKPA 3HCDA 4EK9A 1SUSA 3ORHA 4PWYA 3GJYA 4FZVA 3UJ6A 2JJQA 3FTDA 5EPEA 5GP1A 2V7EA 3KQPA 2BR4A 3DMGA 4A6DA 5DRYA 2I62A 3THRA 4Z2YA 5K0LA 1VLMA 3ELWA 1KHHA 4P7FA 3CCFA 2AR0A 2EJUA 3KQTA 1P1CA 1QAQA 4R6WA 3TKYA 4YUZA 3UJ7A 3KR9A 4C08A 3G5LA 5K03A 3EVDA 3HCFA 2PKWA 3NDIA 3EGIA 3UJCA 2P35A 2G8NA 3LKDA 3LCCA 1P39A 2VDUE 4GF5A 3UJAA 2P41A 1XDSA 5EC8A 5LQAA 5LQKA 3A27A 2ZULA 2FK7A 1KYZA 3HCBA 3M6UA 3OZRA 1VE3A 2CWWA 3R3HA 5DM0A 2ZLBA 3UJ8A 1DCTA 2XBMA 4FSDA 1YFLA 2PXCA 3DULA 1YUBA 2XYRA 5CVEA 3HVHA 4PINA 5K0JA 4X41A 3P2KA 4GC5A 4EVIA 2C7PA 3SR4A 4LG1A 1G55A 4EKIA 2GS9A 1XVAA 2HNKA 2OBFA 5CM2Z 3M70A 3CGGA 2AOWA 2BZGA 3MTEA 1SQGA 2R3SA 2PV0A 2AN5A 5FA8A 2AVDA 1KYWA 2PT6A 2YQZA 2ZWVA 3KR2A 3EVZA 1ZQ9A 1SUIA 1ZG3A 2AS0A 4YV0A 3KQQA 4BY9E 2O07A 2EJTA 2C7OA 4RV9A 1EIZA 2AOUB 3S68A 4FT2A 4R05A 4GOOD 4QVGA 4DMGA 3LBFA 4CKCA 2G71A 2PVCA 5GOZA 1WG8A 2C7QA 3FPEA 5DSXA 4EMSA 1KP9A 2ZIEA 4GBED 3CVOA 3VYWA 4C06A 2B25A 3OZTA 2V74B 1RJEA 3BGIA 3HEMA 3MCZA 5GIOE 3E23A 5CD1A 3BKWA 1IY9A 2N47A 4M36A 3GRVA 5K0GA 3G88A 4AX8A 1ZGJA 3TM5A 3DMFA 3FUUA 3KQVA 5GM1A 3P9NA 1G38A 3R24A 2B9EA 2VDWA 3A7DA 3EVBA 3TMAA 4ER7A 3DR5A 4RVGA 2OZVA 5EIWA 2P40A 4O29A 3SM3A 4PONA 4P58A 4F85A 1SVUA 3GRZA 4DA4A 2DPMA 3SMQA 5C0OE 2H1RA 2QRVA 3MERA 2YTZA 2ZBQA 5K01A 3DOUA 3OZSA
chains in the Genus database with same CATH superfamily
3FD8A 4J90A 5ES3A 3ZZ1A 2G0TA 3RIYA 2A1UA 2FEMA 1Q12A 3P2EA 1E0SA 4KO2S 4GQBA 3SF0A 1ES9A 3TH5A 4DV5B 4YRIA 4UHEA 1EFPA 3ADOA 4TL9A 3LHIA 1OI3A 2HU7A 3WQBA 1U4OA 1KPGA 1NUQA 4US2R 1Y0BA 2JA2A 3QENA 5E1BA 3WTBA 2VHWA 3IQDB 3CF6R 3P0RA 2C9BA 2O2SA 2PZFA 4TN5A 1B42A 1YCGA 3OMXA 1QB7A 4HGNA 5C53B 1E7YA 2VQSA 1KI6B 1PJLA 2YN0A 5D85A 2VRBA 3O9MA 2PO7A 2ZU0C 1HNNA 3M1LA 1TC1A 2A0YA 4PO3X 3R7FA 3EVFA 2D0PB 5CVDA 4CM8B 3MHTA 1XA4A 1QJ4A 2IPLA 3H65A 1N1MA 3TSAA 2QN1A 2V5UA 3TTVA 1VLJA 1EESA 3IB3A 1KZ1A 4X9XA 3K0HA 5HK8A 2IUFA 5B2FA 5E2BA 5AI4A 3R3UA 3MFQA 1GRVA 1NMEA 1BWRA 2VR1A 3A25A 5BSVA 3PEVA 1RI4A 2MYPA 2Q1XA 4KQMA 4ZHSA 1QRTA 1NQUA 3K1JA 4KO3S 3OPVA 4LVOA 4BMOB 4ENRA 2W0MA 2HA5A 2AJLI 3UW1A 3L8GA 5IG2A 1UFKA 5LC1A 1GL6A 7GPBA 1KWGA 2QYTA 3ORRA 4RSHA 5ADVA 1C9EA 2O2DA 4BC0A 1Q1BA 2GN6A 4ZT5A 5C52B 3FJ1A 2QN3A 3I83A 3PNOA 1U1EA 4K2AA 4NBRA 2O50A 5H3HA 1Z17A 3LQFA 3OT1B 5JS7A 2H4WA 2D0OB 3FWZA 4L0DA 1O89A 5E3JA 2FQXA 3TLGB 3S8YA 1AU9A 3G7NA 3HVUA 1RVDA 5K20A 1GPUA 1P4AA 2CN1A 2XZDA 5DBHX 2WUVA 4Q12A 4RF4A 1DINA 1U2DA 4RIIA 5CIWA 5DM70 3NMUF 3FF4A 3GHHA 1T3HA 1IJEA 2A57A 4JOSA 3TR6A 5B30A 5M2QA 2AC2A 3IKMB 5T4FA 3B1YA 1V11B 4RSMA 4EUNA 5BV7A 2H31A 3B3GA 2IU0A 2COEA 1AHNA 5AUQA 5T64A 2CZCA 4TVBA 4M1SA 3UWPA 2J0EA 1TIPA 1ZXBA 4MPRA 2M32A 4OAPA 2NPFA 1K2WA 3FJYA 2IW3A 3MJVA 4D44A 5KIAA 3FMOB 2GK6A 1GNSA 4B4KA 5CXQA 5K05A 2WM8A 2YZGA 3BXXA 1PL6A 1QH8B 4BCCA 2F67A 3IT1A 1U7UA 3HH8A 5DI9A 5EERA 2XUQA 1JPNA 2O5RA 4JJGA 2WTBA 3N75A 4WBSA 4LV6A 4M0CA 4Q1DA 4QNNA 3RM3A 5AM1A 3LL7A 2H1LA 4RS4A 5JPIA 4RK1A 2QP4A 4WAUA 1R0LA 2OL4A 5KSZA 3U1TA 4YRZA 5IAAA 3CLUD 3GMTA 1PFVA 2W5UA 4TL7A 5GMOA 3FOEC 2W2MA 1HQYE 3BBPA 3W06A 3WZLA 4DUZB 4GDFA 1OPRA 2P6UA 3VKHA 2C0PA 2P7HA 3BZBA 5M29A 3DG9A 3N76A 1EK1A 1M6YA 3PEEA 2A0XA 4CLOA 4PSDA 1U0EA 1BU8A 1O2DA 4F46A 3IUJA 1OLUB 5HKOA 2NTEA 4IHJB 1NPYA 3WQHA 3UEOA 3UCFA 3U4AA 2QENA 4PZUA 3BE6A 2JIQA 1UKYA 1LLDA 3AF2A 5F2OA 2GJ9A 4DJTA 1EE2A 2VTBB 2VSXA 3FFAA 2PRJA 1NJGA 5G53C 2BBSA 4DLVA 2E4UA 4UNSA 5IAKA 1K98A 3SXUA 4EI8A 2PANA 2AYZA 3SZ3A 2AK3A 1DQSA 4RPGA 3CV3A 1QTRA 4MB0A 2YN2A 2YW9A 3H5VA 3UGJA 5H8WA 1CCWA 4RH1A 4XOUA 3I9NA 3HADA 1RRVA 2X8AA 4OFZA 4MB2A 4UUOA 2C8KA 5CB4F 1TPYA 4YJHA 4TUYF 3QYJA 3AR8A 3WA6A 1B0AA 4NNOA 2IGTA 2WJZB 1MG0A 1K7YA 3W5AA 2QBYB 1GUAA 3GVIA 1M10A 2B4RO 2AOXA 4OLHA 4Y0AA 4YCAA 3EA4A 3ESCA 4GI5A 3B2EA 1JV2B 3T4PA 3SYTA 1GZ3A 1DDIA 2E9SA 4I55B 4JIGA 5K3EA 3QEBZ 2Y1EA 5FOWA 1A2KC 2CE7A 2IOYA 1U7OA 3L77A 4MWEA 3PK0A 1IOLA 2Z2JA 3D43A 3TIFA 2DFDA 1Z5WA 3HG7A 4MRAA 4DRZA 3ZNOA 2XY4A 4MV6A 5BNWA 2XRYA 3FNQA 1MB0A 1G4AE 3LC1O 4MR9B 3UMVA 1DMRA 1MC8A 2H2DA 2LCIA 3DC7A 3PI7A 4MRNA 1YVDA 2OO3A 3B3QA 3DHNA 4AJJA 4ZYXA 1JDZA 1HRKA 3OEED 1LK7A 1GNPA 4REQB 5ESDA 3U0BA 1QQAA 2OO7A 4G56A 4HZIA 1JG2A 2V6JA 4GVXA 3JRNA 4ILEA 1SB9A 4UVGA 2QTNA 3VNAA 1UODA 4ASUD 4TWRA 1OXBB 2IOHA 4BFXA 1Z28A 4ZPXA 4PG8A 4RTNA 2PUEA 3TVTA 1N8KA 1QYCA 3H3XA 1DRJA 4RZHA 5T67A 1W0JA 2QX8A 4L4RA 3HGTA 2XOKA 2BLLA 3NCHA 4EENA 4ZI2A 1Y7IA 1LPMA 1FTWA 1UWVA 1XAJA 4KQ1A 1V6SA 1GKUB 3TZKA 4BZXA 4ZJYA 1OI7A 1JDNA 1NSFA 3GFOA 1NPTO 3GF4A 2H07A 3QQ5A 3KZNA 4HB0A 5AVQA 4F1JA 4HNUA 3T1TA 4OVKA 3COPA 3GAFA 5F4BA 4F1WA 1CBUA 2XD9A 1GVNB 1T8YA 4R68A 2CNOA 3TRHA 1P7YA 3IODA 2WFLA 1SRQA 1T0BA 3ABSB 3UFXB 1TEZA 2CSXA 1W87A 1J0AA 4PAWA 1V2GA 4JT4A 1KIAA 2R2AA 4KH0A 1NVVR 1XRLA 1U1FA 2AE1A 2R6FA 1CD5A 3E2IA 3KLNA 1KKUA 1ZK2A 4N6NA 1YUNA 2HCBA 3ME5A 3NRCA 2LVBA 2YXDA 3E82A 5JLJA 3ACBA 3C4QA 3OZBA 1AGPA 3W6NA 3SQXA 2GCOB 2I7CA 4UE6A 4UU1A 4C7JA 1AHPA 1JI3A 2ZI5A 4NCAA 2Z8YM 3JSXA 2C5BA 1KH1A 2JVIA 3BERA 4N5DA 5E6SB 5HE9A 4Z7JA 5K99A 2ZUBA 4ZV9A 2O8DB 4JBWA 4L4ZA 4MGIR 5K8JB 5JATA 4Y9UA 4N7BA 1OREA 1M72A 5ALRA 4MDEA 1BGWA 3F97A 3DFKA 4P0QB 3ZWOA 3CUTA 4DSZA 3AESA 2IYEA 1L7OA 4MUKA 1EVJA 3T7EA 2YH2A 1TYDE 2C4KA 4UVHA 2NSDA 2BP7B 1AGYA 1R88A 3BQMB 3PHCA 4YLGA 5G02A 4E2ZA 2GN9A 2I87A 3D4LA 4GPBA 4Q9JA 5BUSA 4CNBA 3WISA 1PWYE 1SIBE 1HLPA 3EVEA 4RA9B 1RAIA 3W2HA 3EHDA 1Z5OA 5JRJA 1WVMA 4LZOA 2YZMA 2DECA 1K0UA 3AKEA 4DC0A 1PX2A 3BOSA 1UBOS 3UXMA 1HE5A 3LW7A 3FVRA 4HAWA 1EWRA 4RLHA 1ZLXA 4A0GA 3ETCA 3VKGA 3LYLA 5CA0F 4FOSA 4M2LA 4RWEA 4D4KA 3JAWA 1Y9JA 3IBSA 4C20A 3D8RA 5C32A 2QLFA 2P90A 4GQAA 3UJPA 3BXHA 1TDJA 3QVUA 5IEJA 4XIIA 1E2MA 1Z9BA 3BKXA 3OAAA 4LECA 3OZ7A 5DSTA 4R0MA 1IY8A 2P4EA 3P4YA 5A3VA 2QRMA 3UH1A 5G41A 3FHTA 2PKYX 3U31A 2AN3A 1KJ8A 3W2TA 5AW5A 1CQZA 4B3GA 1NM5C 4P5DA 1PFKA 4CQJA 4DDHA 3EW9A 4QSHA 3TUZC 2JI6A 1P6UA 4RY8A 2PIDA 3KRTA 1GOTA 4DCMA 1P18A 2B5OA 1MG5A 4FHEA 1XCGB 4E07A 2HMAA 3N0TA 5LMZA 4IIVA 4M6WB 5ALSA 3H87A 1C9YA 3CBQA 4ZAXA 1QH1B 2XKBA 4W9RA 3SP1A 1FLVA 3W8NA 2QM3A 3NT2A 4QOEA 4AO6A 1NHWA 2HA6A 2DVMA 1RLOA 2ECKA 2Q5CA 1Y3FE 2D5IA 4H4CA 1INLA 5C4MA 3DT8A 2C7RA 1E9DA 5H7XA 3PC6A 4NV0A 2H9IA 5EPUA 1RHRA 3L4BC 3N3BC 3GN1A 3PQ4A 4YJKA 1KI2A 4FDUA 1I1NA 4N3GA 3VU0A 2W6IA 4G9GA 1EXVA 1SBHA 1G60A 3V7YA 1YWGO 4P36A 5KSPA 1Q95A 1V5GA 2QTVB 4XXHA 1Z47A 4TXNA 1M34E 3GLRA 4YMTA 5C8XA 5EJAA 3F4LA 4TWJA 1T3TA 2X6TA 5CNMA 3WK8A 3TE7A 3VSDA 1RLJA 3D9QX 4YT2A 2HXSA 3OKAA 2PGNA 4DRXB 1AKRA 4P7KA 4E2YA 1HBJA 2ZIFA 3ZGYA 3SS9X 4XJTA 1YR1A 3WP1B 4BV3A 4DLXA 3VAZA 3WNZA 2OFXA 3NPAA 5DLEA 5ALUA 4L75A 2PT9A 3K6RA 4M1TA 3ADCA 2ATXA 4X95A 2Y27A 3FYHA 3QPCA 1GCOA 3Q12A 4US0R 3RC3A 2VXBA 3HCRA 1Y6RA 3TDMA 3LYHA 5E38A 4LHZA 5AI6A 1BJTA 5JUWA 1X7XB 1Q0UA 4G4SP 2N0SA 3KP1A 1L8XA 2G28A 2X3FA 5DXAA 3KQKA 1XLVA 2CL5A 4HDOB 5F1OA 2OV4A 1G41A 1JWBB 3FX2A 4ETNA 1NN0A 1YJXA 4KK3A 1KSGA 3OX3A 2ZIAA 4CKWB 4BQFA 2AEMA 2XWQA 1XMPA 1QZZA 3IAUA 5JJBA 2BE7A 1XCPA 2XXAA 1W73A 5H5JA 1EFPB 2I3DA 5JSQA 4C9BA 3DLPX 3A37A 1RZVA 1XZBA 2A1IA 4WKOA 5EQDA 5LMCA 3W5VA 3LX6A 4QYMA 2HL6A 3WL7A 5ECDA 2KSQA 3MBOA 3MPUA 2BCEA 2W2LD 4A26A 1GDDA 4GKAA 4M9ZA 3DCYA 4HRYA 4S1NA 4DMMA 1F6DA 2NN3C 4CM9D 1QYDA 3BQ9A 3ISVA 1BGVA 1FOEB 1MLDA 5AM5A 3AH8A 3I37X 1XT6A 3QPBA 4K86A 2RGRA 3QY9A 1XQ9A 2PS1A 1WAMA 3THWA 4XB1A 3T7KA 4TVOA 3OIGA 4N01A 2FE4A 2O8EB 1HYBA 2CBZA 3OT5A 2R86A 4G0YA 5HCNA 2JI9A 1GGVA 1EK2A 4OJKA 4LQLA 4EBBA 4MLZA 3R7NA 3ZQKA 4D0RA 4QGSA 5EPEA 4CQMD 3I76A 3KAJA 1LWNA 1QHSA 2YL2A 3EH2A 4LFCB 4QLBA 2WM9B 3THRA 4Z2YA 4MQEB 4DAOA 3RIGA 4WXMA 5JECA 3E3NA 1U9CA 3NC1C 2I6SA 4GDMA 1VLHA 2AR0A 4X44A 4DYVA 1FFYA 1T29A 2R1TA 1N6NA 4HNAA 4JDUA 3ENZA 1B16A 1L5SA 1YK1A 1I5RA 3IX7A 3MG9A 2PKWA 1NQWA 3TPFA 1XB2A 3I0NA 3UV3A 5EJMA 1EM8B 3IILA 3U3JA 4A4DA 4EZEA 1E96A 4MINA 1JFRA 1RMYA 2V98A 4RFSA 3DONA 4EI2A 2LKCA 4ZZ3A 4ARCA 4V0MA 1WPGA 1TZ2A 3HNPA 1NURA 4OLJA 3QKRB 3FTPA 3R5SA 4YRQA 1QIMA 2IDMA 1JH8A 5J5CA 3T8YA 1U5CA 3WGLA 4E08A 5L3RA 3QJGA 5TIIA 4DCTA 4LHVA 5ENDA 3MGBA 3MTEA 3N59A 4FD2A 3GRFA 1ST3A 5SICE 3GDGA 5TQ2B 1CEXA 4LJSA 1V5EA 2EJTA 1Z6XA 3I5XA 5FBLB 1XZCA 4XD2A 3DOHA 2QPOA 2AOUB 3D3NA 4LISA 1N36B 4G84A 5EIOA 3I2GA 2G40A 2LXNA 3FSGD 1EEXB 4EF6A 3TG2A 2R1UA 4CF6A 1YD7A 1YRYE 2FPRA 2G77B 4HYEA 1WG8A 4JP1A 3DMYA 5A04A 2DXIA 1N8NA 2WC1A 1O58A 2W6NA 2XTAA 2P78A 4G5XA 3BZWA 4MVXA 2VYFA 3USES 3C5CA 1EP3B 5AXBA 3ICCA 3NS7A 4NAHA 3RAPR 1A71A 1ZD9A 2Y6UA 3R24A 4EPWA 2J7PA 4M0MA 4XR9A 1JG7A 4MYSA 2QLMA 2X5KO 4OKSA 5K51A 4DXHA 5IVKA 1KC3A 4P2BA 4RDHA 1LDEA 4L5IA 4DABA 2QRVA 5EIAA 4AN0A 3UV7A 4UAGA 5KKAA 1G5FA 4MV7A 3TLZA 3DOUA 5CRIA 1NC1A 3I6QA 4I55F 4JCOA 3RU3A 1HL7A 2JFXA 1SOVA 4FBGA 1VCOA 1BC5A 5JARA 3PNKA 3RYCB 2IXFA 3N07A 2YUIA 3BXFA 3KLPX 1JQ3A 3NEJA 3R3SA 1ESEA 4EY6A 5GVRA 2GBLA 4Z7OB 4JJAA 1ND5A 1H1DA 4O08A 3W5IA 4TS4A 4RETA 1KFJB 2BFCB 2WYUA 4RANA 5KTKA 1E8NA 3JPWA 3MTAA 4ZTZB 1AUXA 3L6OO 1NJ8A 3WAKA 5JAOA 3PP8A 1UAAA 2VP5A 4DGQA 2JIDA 3DCIA 1FYDA 2R5NA 1ZJZA 3GEIA 3P19A 4HZGA 2B3TA 4QEDA 4X85A 5A03A 2E1RA 1O7JA 2FXIA 2XGJA 1YACA 3NIBA 3SYMA 4A16A 1DTEA 3IMKA 2ZK7A 1UJ6A 2QTRA 4FGJA 2IHBA 4FZJA 1FU4A 3IEPA 4IFBA 5DLQC 2X8WA 3DEAA 5ESXA 3RD5A 3VPFA 1XZMA 1TMYA 1TMOA 3EVTA 2A94A 1UJ4A 2Q9CA 2O0JA 4X90A 4OQEA 4Y67A 3T0GA 3ZKWA 2P6OA 2P75A 4PG7A 2WJHA 3GRPA 3LH5A 5CK5A 1VIAA 3Q3CA 3WLRA 2B9VA 1GRCA 2GYWA 2IYAA 4P82A 2JLBA 5C34B 5JI2E 5L8VA 1UXOA 3PQ7A 1NSTA 1SHKA 3UVEA 4ZDWA 4QVKA 2PD4A 3O4GA 2YIMA 3T7DA 1B1CA 5J5VA 3U3OA 3UT0A 5DLDA 3GXBA 3ADBA 3HO1A 2HZ7A 4GGOA 3E5RA 4ITRC 1XA0A 5DYNA 2CY0A 1M1YA 3I53A 3UUEA 4IOJA 1PWZA 1DQYA 5IZ4A 1OTYA 4AECA 4O4JF 1ZKMA 5AYVA 1F0KA 3REFA 3TDKA 5BPFA 1KFKB 1C1DB 1LI4A 1D9ZA 3AL3A 4K81B 2D2FA 5LIRA 3GVPA 4CIAA 1YL6A 7MDHA 2BR3A 2JFGA 3JQ7B 2D2VA 3ENWA 2CVPA 5HJ5A 3AFGA 4BCBA 1FDSA 3C7CB 7ABPA 1D0IA 2AQKA 2RK3A 3AY7A 3UK0A 1KRWA 3K5WA 1O4VA 9ABPA 3IUNA 2XSZA 4MCHA 4UEWA 4AI6A 2AFRA 3EGOA 2DWQA 1OJ7A 1O9HA 3DHWC 1YR8A 2J3DA 2Z4TA 2ZRPA 2XW6A 3HB7A 2IHNA 3FJOA 5AKYA 5FO1A 3M5WA 3VO2A 3H0EA 3CZ9A 3DDUA 3KJEA 1IXRC 5E1MA 5EIWA 2VA9A 1CUAA 1PZNA 3CC8A 3PYLA 4D9MA 3DEFA 4OU5A 5IWAB 2XMGA 1P7WA 1CQPA 4EARA 2VDKB 1J7KA 3MTIA 5AI8A 3E61A 1IWOA 2BEUA 1TK3A 2CLMB 4GSLA 1EUDA 2PX8A 4UPDA 3DMRA 2JBHA 2Q4BA 2NVUA 3PRHA 4FKBA 1NI3A 3V1LA 3OIWA 3H2BA 5FNZA 1KZ9A 2V7TA 3PKIA 1LPAB 3P9QA 1FMTA 2Z57A 1R0KA 1V48A 3U13A 5DX1A 4MAMA 1W2HA 5CXXA 1KGDA 1YR7A 1L6IA 3A10A 3H5RA 3DBLB 4D9HA 2P8JA 3AUJB 4PLPA 2P5SA 3B52X 2QTMA 4OA8A 4U00A 1Z8NA 2FN9A 4XYEA 5HIJA 1DHTA 1R0RE 2VJOA 2VG8A 3LVRE 4OL0A 2ZATA 4DQUA 1KAQA 3RS9A 5AUOB 4MS3A 5I7SA 1GUBA 2QTWB 3K15A 3E8XA 4ARBA 3ZE0B 4LJ9A 4ND1A 1APBA 3JWJA 4ROSA 4I4NA 2A5JA 2O8FA 1HETA 1QKJA 2ZYAA 3VHXA 4L22A 121PA 1ZD3A 2IPNA 1RP1A 4X0EA 4KBYA 3SJBA 3PUVA 4F06A 4RJIA 1CPYA 1PYGA 5JCJA 3OMWA 3U5TA 4IAOA 4CKBB 4ZK6A 5D1NA 2DU8A 1A5SB 4KVGA 1XTBA 2GASA 1WKCA 1UEIA 3A2NA 5FTLA 1T1EA 1KOJA 2SHKA 4DNPA 5A5GA 3AZPA 1QC5B 4GYWA 1F1JA 3ZS8A 1JDJA 4F9EA 2G3YA 3KVNA 4B17A 5LOVF 2NXCA 1X1CA 2XUAA 4IHJF 2DR0A 1AS3A 1GKLA 3KZCA 3T9DA 1WD5A 1NTRA 1DTWA 1E3EA 1I01A 1R0YA 1BNCA 4FMPA 5GONF 5JYEA 1UZMA 3ABIA 4MUJA 1JJBA 4NMHA 5AW8A 4HPXB 1JHZA 3VNSA 2EBUA 3E7XA 4LWOA 1M2NA 3VPGA 4MA4A 2Z5LA 1TO2E 1MDBA 1AURA 3VZCA 2QY6A 4PYMA 1GPNA 2ZYHA 4JR1A 2B35A 3CH5A 4TZTA 5KTNA 1WU7A 3HA3A 5HEKA 3RS8A 4HK4A 1JYFA 2PWAA 1BE0A 3TOSA 1HFKA 3BWCA 3L4KA 3NDJA 4UPVA 1T2AA 3L7JA 4K87A 2P6PA 2PU5A 2ZIUB 1E4EA 3UJDA 3T3OA 3RTCA 1RE0A 3AEKB 3L93A 1WS6A 5TV2A 1J8MF 3AHHA 3RS7A 1U2TA 1NP7A 4J2HA 2O2EA 2YWDA 3KIPA 1W46A 4OH7A 1T5HX 2VT3A 3RSFA 1YZYA 1PD0A 3ZH9B 2X5XA 2I80A 3MMSA 2GWRA 3K9WA 3W2GA 4TRMA 4TV9F 2PE5A 3J80A 3UZUA 4EHHA 1N2HA 4LXGA 2W42A 3GUYA 4HDRB 3SE7A 4OBXA 4F2DA 3TCNA 2DUNA 4Y7CA 3RVDA 3U7RA 1S1MA 1SY7A 3KB8A 2OHHA 1VL5A 3KUUA 2V4ZA 3LO8A 5C1IA 3AJAA 2OZLB 3QYFA 2C29D 1AUPA 4MWTA 4NKRA 1I6LA 1I7PA 1M2KA 3GLUA 3P2OA 4MW5A 1GGKA 1XTZA 1SC3A 3R7AA 3WSTA 1J24A 1JIUA 4RFLA 5F9HA 3W2EA 1RRFA 4M9QA 2HJHA 1KP2A 2O2IA 4JEUA 1EX9A 3VYUB 4WKPA 3WLOA 3VYSB 1M2OB 1NWCA 4BFYA 5CYGA 2FH5B 5KQLA 4L3VA 1J6UA 4D98A 1M8KA 3U60B 4DKXA 3C3DA 1L1QA 2Q5IA 4IV8A 1WB9A 1IOZA 4R98A 3L0SA 5BPHA 2FMKA 1ICIA 3KVRA 4QJBA 1NRJB 4PG4A 4B82A 1IZYA 5DNDA 3KUKA 1JQEA 4KGXA 1FVXA 1NF3A 4X7BA 1GXSA 1R50A 4KMOA 2VBCA 1ZA2A 2AG1A 2Q07A 3IHWA 1TA4A 1V5IA 2OHJA 2Z95A 4XVHA 3RVSA 2XZPA 3NB0A 3SJCA 2BKXA 3IT2A 1T6YA 2YV1A 4BX8A 2XMDA 5JEDA 2BHRA 5BR8B 1Y82A 1HDOA 1OBHA 2IU4A 5H70A 1EBBA 1ZEJA 4WOCA 2YVAA 3MWDB 3SDBA 3AEUA 2HJWA 1JHYA 2A84A 3DSRA 4OHCA 4UCFA 2O14A 4RTOA 2EFHB 4XE5A 5K0CA 1J06A 1E1LA 4GG1A 5J2TF 2X8JA 1ZBDA 2PZKA 1DUIA 3EJ6A 3IP7A 3MOSA 5DYIA 5FLXA 1D6NA 3HCEA 4IXNA 1FMFA 4XKJA 2QA5A 4AY3A 2G80A 4Z0HO 1RLMA 2VHCA 3L07A 4E13A 5DTIA 3FCOA 1MKYA 3OZDA 2EEPA 3MJ4A 3RFXA 1NXSA 3UQZA 3OQMA 2WSBA 5ARDA 5EXDA 1UFOA 4JL6A 1VSUA 3K0KA 5IYZA 2IYLD 4O1HA 3QFFA 3IUQA 4K9MA 1T4CB 4AG3A 1PJ4A 1OBOA 1QO0A 1IVNA 3MB8A 2Y0CA 3DPSA 3OZWA 1CEQA 1PGQA 4MI9A 3UG7A 5ELMA 5JZVA 1QIJA 2YYZA 1MZPA 1RJWA 3IESA 3B1JA 3NATA 2GXAA 4JSYA 2OHXA 4CEIB 4E33A 1NXWA 1Z5NA 4C6RA 3HDTA 2XH8A 3O4FA 4B6GA 3RYCA 3AVUA 1DEAA 1TM3E 2GLXA 3FA2A 3L1IA 3OU7A 5GY7A 1IH8A 2GPAA 5TQVA 3OX2A 1H2AS 4QPZA 4BKRA 4C4OA 4M0FA 3C7AA 2BFDA 2QXUA 3K4HA 3Q7SA 1OGIA 3DDHA 1FP2A 3KSAC 2C2OA 2C95A 2G76A 2H00A 3DCJA 4L8VA 4P53A 3RYHB 4EATA 5JJLA 2ZRBA 1QKIA 2FG7C 2HTFA 3ONEA 1AO3A 2QF7A 3D1VA 1DAKA 3LUAA 3UV6A 1Y3DE 2Q3JA 1LSSA 2B5WA 3P45A 3SVTA 1AQLA 1B41A 4ZAFA 2VRCD 3O8DA 4W9NA 1IYZA 3KYBA 4YUVA 4OREX 4Z3DA 1K66A 4JA0A 3ROEA 4CMJA 1IPFA 4AKTA 1NQ5A 4BLPA 1U2SA 1P1KA 2D5CA 2VQ6A 5EAIA 3RVLA 1YNOA 1G7CA 1UBUS 2FFHA 3H4MA 4DDTA 3U44B 1JR3D 3OY2A 4GVPA 2IE8A 3FOFC 2B8EA 1IVYA 1XXHB 2YBDA 2ZIZA 4WL0A 3AJ9A 2JZOA 3WAJA 1NVFA 2R8PA 2DPXA 1AS2A 2VYNA 2ZBDA 3AZQA 3QLJA 3X3HA 1IEQA 2EP5A 2AOUA 1OI2A 2RAUA 2RHMA 1OXSC 4E70A 5F98A 1AGRA 4I1VA 4YAJA 3SZUA 4YJGA 4F4JA 4Z1OA 3RHFA 1KRXA 4B6JA 1J49A 1NE7A 3BWEA 3OZEA 1B8VA 4H77A 1WXXA 5EUQB 1YO6A 2I54A 3IHTA 3R3WA 2AI3A 5CDFA 2HHLA 3Q2KA 4WOBA 2X3YA 1JT2A 1V25A 5FYDA 3AGQA 2Y68A 1PNOA 1RI1A 3LQQA 5KQSA 4P4NA 1HH4A 2ZRQA 3W6PA 4CW7A 1XV5A 5K4AA 1IN4A 1GJRA 3JX9A 1KBQA 2ZBRA 2WPDA 1CUJA 1S0UA 4XDGA 3VOTA 5BQOA 5JALA 3CX8A 2CJPA 2XUIA 1MVLA 4Q6WA 3U37A 2OE2A 4NOKA 1X8JA 2YRXA 4I4TF 2AL7A 2VEOA 4I1OA 2H85A 1Z26A 1T6NA 1RWNA 3I72A 1A8PA 1U2GC 1VPTA 5AJHA 1SCNE 2GBCA 1LPPA 3DWIA 3L01A 2P62A 3WDSA 4DTCA 3T5TA 1Z0IA 3HXLA 4BMSA 5FTWA 3YASA 2GCNA 2HHCA 3OIUA 4XFJA 3ZWWA 2VJQA 4D02A 3C5VA 4HVTA 1YIDA 3AKZA 1GR0A 3GC6A 4JI3B 1ML3A 2C5EA 3B1XA 4E5PA 1VBFA 2OECA 4TM8A 3V8VA 3K9FC 3LZ6A 2BZ1A 1G1AA 3GARA 3FUCA 4B79A 2J7PD 3ANMA 2QZSA 4WZAA 3U9SA 1G2OA 1UEJA 1EXNA 1P73A 1UWKA 2GXSA 3UHFA 4GPTA 2BLNA 3WDMA 5KX5F 3DTYA 3WA7A 4LOKA 2D5AA 2WF5A 1AKUA 1LJ8A 4ARZB 1S89A 4R0NA 1L6RA 5HF8A 3DB2A 4MLCA 4HSEA 2OEPA 2XUFA 4UTPA 3WAGA 3M89A 1ZM4A 5FWXB 1CRPA 1ISHA 4NYJQ 1B26A 3IRUA 1RHKA 5EZYA 1SOWA 2HNBA 2W8ZA 3IJRA 2ZKLA 4A2PA 1YA8A 5IM4F 1ZK3A 4BVKA 3DE0X 1JA9A 2AZDA 2IEBA 1NX6A 1JL3A 1F06A 2HB6A 4IH9A 4JSRA 2FZ4A 1OGYA 5DTEA 4CMIA 1QIIA 2R48A 3EGCA 2J9GA 3OQBA 3WMWA 1FF9A 1ECBA 2JI8A 5DRYA 4TWZA 1U2PA 1VLMA 1TEHA 4PQGA 4FB5A 2C42A 2YFKA 1J8QA 2MYTA 2BN4A 4FYXA 3ZCUA 1CUCA 5BQFA 1Z18A 3FI0A 3UJ7A 1GGFA 1BN6A 1M6WA 4EO7A 4HX9A 1B8UA 2H4JA 4MR7A 3TZLA 3UJCA 2PMEA 1SUCA 3AM4A 1QUEA 2WAXA 5EZYF 4DLPA 1HNXB 3ET5A 4UASA 1U7TA 3R5HA 1YCFA 4BMXA 5CDSA 1M2FA 1ZS9A 2XUPA 5CB4A 1BZYA 3QX7A 3W7BA 4BE9A 4TPKA 4ZVOA 2QX7A 3RSCA 1XDDA 2MWMA 3KLOA 5AVJA 4EHKA 3A58B 2MSWA 3O3MB 5EI5A 5K8UA 2QTTA 4LZNA 1CUWA 3LPLA 4O8CA 3RJ5A 1SQGA 2I2CA 2PT6A 3KR2A 4JENA 5FUMA 1VYUA 1LTQA 1HKHA 2O6LA 3GUUA 2J3LA 2WR8A 3ANTA 3I30X 3VH4A 3TLAA 4BMPB 4CV2A 1T0HB 4YV7A 2A30A 2OV2A 1TRHA 1OBFO 2PMKA 3D7KA 4V0KA 5L6LB 4EG0A 1TL7C 2IC5A 1H6BA 1V8PA 2G71A 2RGWA 3L7OA 3HUDA 1RE1A 3RVOA 1PG5A 2DP4E 3GWGA 2KBFA 1S7CA 1N2ZA 3MJHA 4NYIR 1AG9A 5CA1B 1IUNA 4ZALA 3ISTA 1T8PA 3JQ7A 4OHPA 3HEMA 1NMSA 4ZK2A 4L5CA 3PXCX 3DKIA 2WNIA 5E9AA 3GRVA 3OICA 2W2LA 5BMVA 4JXXA 4W5OA 5K7SA 3E22A 4EW1A 5DBIA 4LXXA 4NCJA 3P9NA 1EKXA 2NU8A 2IXEA 2IKQA 4HWKA 4AQ7A 5KQPA 2JIRA 4L0QA 1NIPA 4H6PA 4F85A 3WYBA 1WB4A 2DPMA 2V6IA 4N0QA 4CFSA 1XQ6A 2FLKA 3EIOA 3LQ4A 3GRCA 1J8FA 4MYCA 5JPDA 2C8JA 3KVVA 4L8LA 5TT1A 3OETA 4ZFNA 4A15A 1CLUA 1QGED 3CCBA 4YALA 5HXAA 5GPBA 1G19A 3RAGA 4ALMA 4PM4A 3ZV3A 3D7LA 5AW9A 4OH1A 2OB2A 2C2WA 1XTVA 2AZMA 2W7TA 4IG9A 2ZIVB 4F12A 4MW1A 1W52X 1NXVA 1FDVA 1NONA 1EFKA 4Q1FA 3O8QA 3QRWA 5E9JA 1DXQA 5J4LA 1I7SB 2ONZA 5KX5B 2CLCX 1M5UA 2AG0A 3I6ZA 3ONWA 4WFIA 4YJ2F 1VTKA 2LBPA 3O74A 1YJAA 3RSHA 4WGFA 4OIFA 1BCRB 5B1SA 4WA7A 1Q74A 3MA0A 1VGVA 5DYTA 3ETJA 2VDJA 1SXHA 2B4QA 3SNKA 5IULC 3AF4A 4L0CA 4FUTA 3B1ZA 3GQBA 4J4BA 1IHOA 1DEOA 4BTVA 5KYXA 1QANA 1S2LA 1V9CA 2FVYA 3CEAA 4AURA 4R8SA 4C6SA 3AF1A 4DY4A 4M7WA 4CMHA 1LH0A 2O2XA 1EUYA 1J25A 1IEVA 1E5LA 3ZY5A 2Q3CA 5THXA 3T61A 4CUKA 1FNNA 1C29B 4GMDA 4O2AA 4YFYA 3ZGXA 1G8SA 4RU1A 3EYAA 3UCXA 1CIJA 3CTMA 4L6IA 3DO6A 1JECA 4E5YA 1CJVC 4KWTA 2VDLB 3EDMA 4RHEA 2D8MA 3HBLA 1WQ4A 4DV2B 3NNSA 1K6EA 1SUPA 5DCUA 4AULA 2X1MA 3L6UA 1M1NA 4HF7A 5EZQA 1ACLA 3DHVA 3N2LA 3FIJA 2ZJYA 1ILWA 1CXZA 1KPHA 1NGSA 4JT9A 4I3GA 4Q24A 3UAZA 3GPBA 3FSJX 3FCAA 4X92A 4BNWA 3TFQA 1FRVA 5AW3A 3CVUA 3OLXA 3TX6A 3ZE6A 3AY0A 1W9MA 1QZXA 5HCIA 4J0JA 1E1DA 3GA5A 1UC4B 5FLEX 2A1TS 1E9VA 1RM3A 4A9AA 3ER8A 3TNLA 1JEEA 5FPYA 2WKQA 4WCDA 4QUBA 4Q7LA 3HDQA 2FQ1A 4EPYA 3DKVA 4G4JA 1CF4A 1YHZA 4JDPA 1E5VA 3IMCA 1Y89A 4PZCA 4F9GA 1Q3HA 3U1VA 2EZTA 1GZVA 3CR3C 3L7YA 5KVQA 1YGPA 3B78A 5LZ4A 3W2FA 2A33A 2W2QA 3QWAA 4RW0A 1SQ5A 1UOOA 2WZDA 2PL9A 5IFLA 1YZUA 3V3TA 5LL6P 5DNAA 3RHZA 1XRSB 1XLWA 3FLAA 4NF2A 5AM3A 3L40A 1J8YF 4IJWA 3OEHD 4NS4A 2PRZA 4D82A 2PPLA 1ZJYA 5LOVB 4DV1B 4UTRA 1PLKA 3RVKA 5CA0A 3KZKA 5K8IA 4M0UA 3ZV6A 7REQA 5JNSA 3C45A 2CHVA 1Z2CA 2AT1A 3DUFA 2H3EA 4FCVA 2L82A 2RB4A 2R4TA 5B4VA 3AESB 2JGIA 2BGKA 3PWSA 4JLWA 1JHUA 2YJ4A 2NG1A 1TO6A 4ZIRB 5B6PA 3C74A 1JQJC 4F8EA 1SOAA 2D1QA 1YUMA 2XUKA 3FRHA 4AMGA 3ICQB 4UW9A 4TM7A 2Z6AA 5AHKA 3CN9A 3UUGA 1DQZA 2J9FB 4HAVA 3EZ2A 3B6KA 2E4AA 1O5IA 2GN4A 3O92A 1QGYA 4YP7A 1N5LA 4ZCRA 2PA0A 4PPQA 3OM1A 1VKHA 1GM5A 4QFBA 4ERNA 3OQIA 1XCJA 3K0FA 2PT5A 2Z9DA 4G9EA 3BRQA 3NBUA 4M9SA 4ZVRA 5LDGA 2IXTA 1T8UA 1DKPA 4GD3Q 2ZTUA 1WDMA 3N6XA 5T3UA 4KFCA 3DBIA 3IJ5A 1O1YA 4R1SA 4KN9S 1QX4A 3MQ4A 4QNMA 4E5VA 1KEKA 1FE8A 1WSAA 5JYBA 4AMBA 4CQLB 4G5GA 5BV2P 4MUGA 1S9DA 3I04A 5AM0A 1NN5A 1RQ7A 3LLCA 3MJCA 3OC0A 3UA3A 1GWNA 3GEPA 3HPRA 5IDQA 1ZUWA 1TCUA 3A06A 1IQ0A 1ZNYA 2CNKA 2A7XA 1OD6A 1YL5A 1ODSA 2PUWA 4M49A 3A36A 1PNQA 2NSLA 2UDPA 1F8YA 2ZWOA 3JQGB 3PFBA 3UMBA 4D8TA 1J56A 5DNUA 4QYTA 3L02A 4CE6A 4V2UA 4RUKA 4CMKA 3ICOA 4IHJA 5ALIA 1CY2A 1HFWA 3NBMA 5CVUA 4UNRA 4ZQIA 3DDSA 4OHKA 4X1YA 1VSTA 3TTYA 3R8XA 1W0JD 2OT3B 4B9AA 2GARA 3H19A 3NASA 3RLFA 3I1FA 4AIRA 3G9ZA 4TXLA 2YJ5A 2RBKA 1X9IA 4NI5A 1M6VB 3A6ZA 3S28A 3VKFA 4B8ZA 4N3NA 4RCVA 1CRQA 4S04A 1KI1A 3CXRA 4G24A 1CDOA 1XQYA 3WFJA 4CM6A 5J2UA 3SFTA 3H1PA 3ENKA 5EE3A 3VTZA 1OXUA 3PJFA 5FF9A 1K6IA 1SEVA 3ZIAD 4TS9A 5C1PA 3COWA 3EVCA 1KK1A 1N3YA 3F96A 4UTOA 4W63A 4PE5B 3UB4A 4BNLA 2VK1A 3ROFA 1Q15A 1DC7A 3Q3JB 4TLCA 2J5BA 2V1UA 5DHSA 4FMDF 4OHMA 1J7JA 2WF7A 4HQKA 4XCQA 2Z8XA 3OJCA 4PHGA 2ZRNA 5UKDA 2ATIA 1V1RB 3RDPA 2IP1A 1VIVA 2I1VB 3RWBA 1LPSA 1QZTA 1IB6A 3D7RA 1JR3A 2Q3MA 4QHSA 8OHMA 4II3A 4BVBA 1TQ4A 2KQUA 2HU2A 1NBIA 3PITA 1IVSA 4AAYA 3THYA 3F5DA 1RJDA 2YXEA 1O9GA 5F1YA 3SG0A 4M89A 1ISFA 4YMSA 3SSNA 5EPOA 1NLZA 5REQB 1NF9A 2AKAB 1HE3A 4W7HA 2VJBA 3OT1A 3ZQJA 4UOZA 3N2ZB 4CM4A 2CBXA 1S5PA 2PH7A 3JW8A 4IMRA 3DDNA 4R7ZA 2HQBA 3H5IA 5AVUA 1L4LA 1QQTA 2NSJA 5HJ2A 2C0CA 4D0NA 5IPFA 3A6FA 2VF4X 3K6JA 1VPEA 1D3AA 2MTBA 3B7WA 3JARA 3CNNA 3OE7A 4RGBA 4B73A 1Z38A 4UTNA 2JI4A 4N65A 2K7FA 2YFYA 3HN6A 4JLOA 3IEMA 4UD2A 3T12A 4ZEMA 3K70C 4F2GA 1K8RA 1ZUD1 3GBSA 1BCRA 4LJ7A 4QO8A 4G36A 1DG3A 2ORYA 2XCQA 3LC0A 1TMGE 3FLEA 3FVVA 1LXCA 2BGWA 5J2UF 3K96A 1YHNA 3WIEA 1C4WA 2J3IA 2VPWA 4DHWA 1E3JA 2D2EA 3M6VA 2PGLA 3DZBA 2HO5A 4IGFA 3ZWBA 1QH8A 4MO9A 5KPJA 1XU7A 3G89A 1YMUA 4XVCA 1ATZA 3PNQA 2A58A 1GTL1 1QG0A 1JJ7A 1IDN1 3F4BA 4I4TA 1QRDA 3FCXA 2ZIXB 1C41A 1UKZA 2OCDA 2ILTA 2FYTA 3L7MA 4GBGA 4DG8A 3REQB 1DXHA 4Y2VA 1G16A 4KGDA 1O95A 2BISA 5DYWA 5IJ0B 2X9GA 1UPFA 2YJ3A 1JVSA 4TSFD 5SZIA 4NYMR 1MHTA 4UBMA 4NBKA 5A6SB 1JR3E 3K5PA 1TUGA 2DLCX 4ZANA 2XE4A 3GLKA 5L3QA 3CR8A 1UJMA 4KXNA 2HRZA 2OENG 3R9XB 3EFOB 3JVVA 2P9ZA 2G09A 5LXTF 3AVWA 2HMWA 3OHSX 1V96A 5T4BA 2RAPA 5KYYB 4MS1A 4RLSA 3RT1A 1GHTA 2IDKA 5EWMB 1VJ0A 4EUHA 1SIOA 4O4JA 2IQIA 3WGZA 1F8XA 2CDAA 2PGOA 1KBOA 3JYLA 3M8KA 4J0KA 3SOZA 4HGQA 5K3DA 4BUZA 2DPLA 1PRYA 3LYUA 3O82A 3EEFA 5D7BA 3SD7A 4MYDA 4G8CA 2W2TA 1YFJA 4DREA 3K0AB 4HAOA 3FDZA 3T4UA 1ISIA 1RWBA 1KY5A 4BNXA 1F51E 1EJ6A 2XMQA 5GQSA 3GLIA 1TM2A 5JBNA 2ZB8A 3KJFA 4GO1A 2ZTMA 4OXRA 4RA6B 5KTTA 3A28A 3P0EA 3BXPA 4GUAA 4AJ9A 1C7EA 3COZA 4AJ1A 1YJBA 2QV7A 3HBMA 4NPAA 4HYQA 4PX9A 1SAYA 5BYKA 5FIUA 4CKYA 3GLHA 1CKEA 2BKUA 4OLFA 4XIYA 4WZAB 5BYJA 3A2LA 4KLNA 4KREA 4KG7A 1GKIA 1E2HA 1NW5A 3MK31 5IKXA 2C8VA 4Q3NA 3WMEA 4BLWA 3I01A 3ZDEA 4FB4A 1O5TA 4Q1BA 1JBKA 3MQFA 1YNSA 4BMZA 4QQ8A 3ZNQA 4N3CA 1NVUQ 3B6IA 4EHJA 4RAOA 3QSGA 1CR4A 1IFXA 3JQBA 1YKSA 2J45A 4POOA 1NNUA 1Q6ZA 2PS9A 1GN8A 2PYIA 3EXFA 3L79A 4PZAA 1M5TA 4MGHA 3RC9A 5MGBA 2DR2A 5LM3A 4J6EA 3PR3A 4ZN6A 3RG2A 1XNGA 1QE5A 3CJRA 2V03A 3D0QA 4CQMB 1WMSA 2QPAA 4RJTA 1H9CA 2EG5A 1IM8A 2WMDA 4Q4LA 2B98A 2GKGA 3I04M 4COOA 3UQYS 3MT9A 3SZGA 1YTLA 3C3AA 5ED4A 2DFVA 2MSDB 2PBFA 4WXHA 3S1AB 2FN8A 4EY4A 4GXRA 5H59A 4ID3A 4LGCA 2VWPA 5GADl 4D6YA 3G2LA 1LX7A 4ZEVA 2PQMA 1IBLB 1IY0A 2P9GA 5E8JA 4PHFA 3GQBB 4NDAA 1S2NA 4NCHA 5IAGA 1PAUA 3T7RA 4NY1A 4Y1RB 1P2GA 3O3CA 3FM9A 4J3NA 1Z45A 1GT91 3R0IA 2PV7A 1YQXA 3KCQA 3Q9UA 3WK7A 2PAFA 1UXIA 1QB8A 1IAQA 1RIFA 1CB0A 3A4YA 2RGBA 1TFUA 3EG9A 3FB1A 2OGZA 4OGKA 5BYAA 2NGRA 1QV9A 2EDAA 3IULA 3VNQA 3X1ZA 4E2WA 2V0CA 4OU4A 3S81A 5LU9A 2XJ4A 5T6BA 2IEGA 1B74A 3D3WA 1NOIA 3HJBA 3OJEA 4KAAA 1KAGA 1QORA 2VPPA 4N8SA 2XV1A 3WL4A 3NWOA 1YE8A 2QMUA 3SU8A 2DLDA 2AYYA 2RKBA 1DL5A 4KXMA 3TJRA 2PIAA 5L53A 4JB0A 4KLRA 1DPGA 2HA0A 3DL0A 2XX3A 5A5EA 5BWCA 5C35A 3I23A 3IIMA 2C82A 1SKYE 2QQ0A 4RPHA 2HK7A 1CULC 3RJ9A 5KDOA 5FWDA 3RRXA 1TIKA 1G21B 2JC3A 3CB4A 3NJ8A 1ECLA 1IPEA 4P98A 3P9ZA 4GE0A 3V1NA 4LF5B 1RI5A 4N8EA 3OJ0A 3HCWA 5G40A 2SECE 3EMBA 3KOZA 3LCRA 3K94A 3A11A 2EIHA 2QT0A 1JEYA 2CDRA 2J1LA 4Z4FA 2AV6A 4PWYA 3T7CA 2EQ5A 2Y2UA 1JFLA 3AI3A 3V8NA 5K6TA 2EFYA 2F3TA 4DMLA 1DFIA 1DRWA 3OA2A 1C9DB 3N8KA 2ERYA 3CCFA 4JY7A 4G2NA 4W1SA 2DHQA 3HJNA 3KR9A 3G5LA 4E5UA 4RH3A 2WT4A 3ZUPA 3KSMA 3ND6A 3VSAA 3LKDA 4LHWA 1T25A 3PD7A 1LDBA 1XXHA 1YXMA 1E1KA 3V8RA 3K5HA 2P2NA 1T2DA 1P1IA 4NULA 4OP3A 4BJHB 2VLIA 3M6UA 4B4OA 2SNIE 4I9GA 3M3HA 1U5BA 2I3AA 3UTCA 3VTFA 4N41A 2XYRA 2ZSHA 2ASEA 4KV7A 3UANA 2QRNA 1ZA1A 1PJBA 2WJ4A 2W8BA 4JZKA 1MV5A 3MRSA 4U02A 1DBWA 4D43A 621PA 1BRTA 4GP7A 7YASA 2NIPA 3OESA 1OZHA 2GEBA 3AUKA 4OG2A 4UBJA 4V38A 4WRRA 3ZWKA 4QZVA 1XQWA 2DLNA 1V1JA 2BZGA 4NCXA 3GFSA 2PV0A 4FEYA 4JHXA 4QATA 4BFUA 2YQZA 3PR2B 1THGA 3L82B 1T9AA 1CUSA 4EH1A 2YASA 2Q4OA 2D2XA 4HWOA 5K8CA 1PTKA 1D0VA 2FQYA 1ULHA 1POXA 5AXAA 3VZBA 1XPOA 3WGHA 1UMCA 2FI1A 1NY5A 3WSWA 4AJ2A 5DGCA 2G17A 3PT5A 2KLHA 2J5RA 1US8B 1CR2A 1W30A 5L3SB 1VCHA 3QVOA 3WMXA 2C2YA 3WTCA 1W47A 1A2QA 3Q8KA 2VUIB 3K16A 2XHEA 2VP9A 2VL7A 1DJPA 1RJEA 2AMVA 2OCGA 3ZGVA 2BHSA 5EIHA 3HR4A 3ZGOA 4EY5A 2ZU6A 4WXRA 4F92B 2WJJA 3DB1A 1XMIA 1T4CA 3PNVA 4DLUA 4CLEA 3IV9A 1KAEA 1ZRMA 2DTEA 1PS0A 2LCFA 1YQDA 5H3LA 1IG3A 1R0BA 5JZSA 4HLNA 3TOCA 1LC0A 2GKSA 4HDMA 4WWHA 2Q0QA 4ZHQB 2H1RA 3INRA 1XZKA 2YTZA 2BRUA 1NRIA 3HB9A 5CFQA 3E4CA 1VJCA 5HK9A 5CVCA 4BNKA 2PLAA 2P2GA 3OFKA 4M38A 4ND7A 1I2DA 1KKMA 2H06A 2IGBA 5E8RA 4RIGA 5EQJB 1BJRE 4EGJA 1RQRA 5CFRA 4YRRA 1E8DA 1SHLA 2I4NA 1PJQA 3QXSA 1SG6A 2VWHA 2IHYA 1IATA 3S2UA 1HQKA 5AP9A 1XD2B 2DTDA 2PAAA 5ELXA 2C1ZA 2UVDA 1XN1A 2NNWB 5DT2A 2JLZA 2P2ZA 4V2IA 4GI7A 2F55A 4FNAA 4EGSA 4FILA 1SCIA 3D6AA 4DWJA 2QG4A 2AOTB 1P0IA 4PYIA 5J47A 4OX9Y 1TQ6A 4CXMA 2IKSA 2B20A 2ZAIA 1E79A 3OOJA 1H2WA 4NPCA 1V71A 1GTSA 5B3AA 4HHEA 2JBWA 4TRJA 2HU5A 4YQEA 3PRKE 4DQKA 4GUDA 4DC9A 3MHPA 3LOQA 3NAMA 3RFVA 5BN3A 1ARZA 3ZV4A 1PR6A 5ILOA 1TM1E 3LKVA 3GPDG 3KOXA 4BQIA 1AB5A 5ANRB 3F3KA 1PSDA 4BAZA 1KYTA 4ZQCB 3RHTA 4BFWA 3T6KA 2J30A 3H1TA 3JD2A 3U4IA 4TRRA 2N75A 3TRFA 4WK2B 2PMWB 4TXJA 2W43A 4E5NA 2H16A 1QIEA 3L0DA 4BE7B 3AP1A 3D2LA 5I01A 2A9OA 2P9QA 2P1ZA 1TECE 4NE9A 5CNKA 1JVNA 1C3OB 3MN1A 3VHRA 2LIVA 2QTZA 4TZ6A 4GBMA 1Y33E 4KFUA 2DEUA 2HPVA 3G6KA 2Q8QA 4XA8A 1A9QA 5CHEA 3N70A 2O5CA 1DBSA 5JS2A 1WE2A 2CXHA 3MEQA 1L8LA 1TOAA 4MYTA 3WJ1A 2BMDA 5DCYA 4DA6A 1ORIA 4JAVC 3ZW7A 4F2PA 1E3DA 1S8NA 1YR3A 3VDQA 1Y3CE 3PXBA 3FPFA 5MF6A 1V1MB 2KI5A 5J23A 2PSJA 3VFDA 3MMNA 2ID8A 2FPWA 2REQB 3BD8A 2VZ9A 2JFUA 2PKXA 3PFIA 5E7MA 3UYKA 4Z1MD 3OP1A 4A36A 2BFDB 2PRYA 5ALQA 1QG6A 3AETB 5A0VA 2AE2A 4NICA 1Y5NA 1N6LA 4FNOA 4Z1MA 2GOYA 4ZEWA 4MW0A 4YEDA 1Q91A 3PVZA 4GL2A 4EKEA 3AKCA 5K0BA 3O94A 2AA3A 3F3YA 3ILHA 3RVNA 1YZNA 2IH5A 2AMFA 4IDQA 4RHTA 4Y30A 4LX0A 1A7KA 4FSXA 3L8DA 1EHYA 1V41E 3EVNA 3JSAA 4HNQA 5BRJA 2ZSFA 3C8DA 2YZNA 4ZO4A 2JGFA 2FW0A 1G3QA 5FUBA 3M1YA 4ND8B 3NHPA 2QG9A 3P52A 2QMOA 2PCLA 3BS4A 1DKOA 1FQOA 1XAGA 3ND9A 4MZDA 5ETJA 3QIVA 1RYYA 4D3ZA 5DGIA 5AKHA 4XGIA 3F74A 3P0JA 2IZOA 3PD0A 4N6GA 1PT9A 5IN4A 2NMVA 3AM3A 2C07A 4NVRA 1X0VA 1Y7TA 1LY1A 3UTDA 5JD4A 1GV0A 1JXMA 3OTHA 3DL7A 4WOJA 4RE5A 3WWCA 4EKNB 4L5BA 4MRMB 4BAGA 5IXJA 5MHTA 1GSOA 1GCGA 1NKVA 2WICA 3MJFA 4XPZA 1OA1A 4DA8A 2GEJA 2PUHA 3S5JA 5EFZA 4PYKA 2JFOA 3A8TA 4O6VA 4EHNA 4AUKA 3B7GA 2R96A 2X14A 3N0WA 5ICMA 3L18A 3AFHA 4NDNE 3AEUB 3AYZB 2FCAA 4MUXA 2K2WA 5HOQA 1F4LA 1W94A 2OMKA 3PGVA 5FJIA 1CY8A 3AIIA 1C3LA 5GOTA 2XTZA 1Q19A 5B55A 3HHPA 4PSUA 1P4GA 4X54A 1WXEA 3W3AH 3NHBA 1XNQB 3PE3A 4HWGA 1RPJA 4LXHA 3PDUA 1YS7A 4YASA 4Z8YA 2JS7A 3SJAA 3CZAA 4JB3A 4JC8A 4P8RA 1ZRNA 1ZR4A 4J1NA 3DM5A 1CC1S 5IF9A 1K3UB 1H2EA 1TVCA 2WI8A 4H3VA 4U2GA 2CL7X 4EFDA 4J6FA 2J48A 3FF1A 4O0MA 1RXSA 5LFAA 2H51A 3DOCA 3EJWA 5F21A 2XYQA 2UZAA 1FFGA 4XFKA 1AX9A 1FL9A 1R12A 2D1TA 3VZDA 2QLTA 4WLEA 1W25A 4MPDA 4G1CA 2GRUA 3QWIA 4FZ3A 3R6TA 1JDPA 3GOQA 1USGA 4P7BA 4TWIA 3SICE 5FV4A 3LGSA 3PX3A 4XH9B 1AT1A 2GZ1A 2PG3A 4XJVA 2W4QA 3TLXA 2CVZA 3DF9A 4R83A 4KPFC 1EG7A 4A0SA 4EDFA 1TA0A 2RGNC 2X9LA 2OAGA 1N2CE 5LQUA 2JAXA 2AFHE 2CMHA 1MO2A 1M0SA 3FGNA 4NJEB 4Q66C 3BFKA 2NO6A 4IRUB 4C76A 3G1WA 3IUSA 3WRYA 4KKXB 4WKGA 2ZRAA 3QXGA 5JCZA 2FPSA 2NO7A 2R0QC 2C4WA 1ZSVA 4P2GA 4CRWB 2H17A 5FOTA 2WIDA 1E7SA 1T4DA 1TI7A 4BN4A 3F90A 4E5SA 1WV1A 4GVLA 4KQKA 3NLLA 3QBVA 3L1VA 4FDLA 4RPCA 4HH1A 5E1OA 1IWPB 1RQLA 3O84A 1XMVA 3L8YA 4BXOA 3C85A 5H02A 1KZ7B 1COZA 1W5BA 1G8HA 1XLUA 3AUFA 4X8LA 2G4CA 4MAAA 3S1SA 1ESDA 3UC5A 4EHFA 3AOEA 3OLZA 1ITZA 2FE1A 2QB5A 4G1MB 3SSAA 4E2FA 1K5PA 5I9NA 3GFGA 3N7UA 2MIIA 3D1LA 4MWOA 1X80B 4E6PA 4E5MA 3WKDA 1HSOA 2F1IA 3PB3A 1ICEA 1JSZA 3HP1A 1I6KA 1NN1A 2K2QB 4DUGA 1OWOA 5KAPA 1JG1A 4NOLA 4KNYA 2FVXA 3KDPA 1SO8A 4LYFA 5JSHA 1S9HA 4NFHA 3FHCB 4B6SA 2CMFA 3EFEA 2I66A 1W4AA 3E5NA 4LVUA 2HC9A 2R6CA 3FWKA 4MGEA 2GUWA 5A05A 3ITEA 4F5ZA 2BMAA 2QTFA 3PUYA 5LP1A 4EY7A 3PC3A 4LEIA 3W34A 1JAHA 3JQ9A 3MBIA 3V4VB 1ORVA 1TCVA 5JVDF 4RZXA 4KSBA 4PHCA 3O4HA 3VO1A 4B74A 4N48A 2WUWE 5LKRA 3QX8A 1HZJA 1W5SA 4S1PA 3KBOA 4C1BA 2BMFA 3A7EA 1MCZA 4RY0A 3SEZA 5GONA 2WAAA 3GROA 1Z0ZA 3EBLA 1J9GA 4JQZA 3IAEA 2R1VA 2D1RA 3LV8A 4M60A 4RENA 3LFHA 2IUYA 5IABA 4LGVA 4L74A 2VDRB 3LDGA 3R4VA 3A2MA 5EEGA 1EVKA 3CKYA 1PNRA 1G6OA 4H18A 1PDOA 4RFSB 3E3AA 3I9FA 3B60A 4WBNB 4NMMA 4D80A 1JXAA 13PKA 1T9ZA 1T0PA 4P84A 5JSZB 1ZM9A 4EA6A 2PUGA 4R1OA 2DFNA 3PDJA 4OYLA 1TTQB 3FLBA 4KP7A 2FXVA 3CRZA 3I2HA 5GZ1A 3KPJA 4OX9B 3V7FA 4MRRA 4PPGA 2ZRLA 3MLAA 3WR5A 3R0QA 4IQ4A 4JCCA 2CJFA 2NVUB 3ZWPA 2FW1A 4G4GA 1NBME 4F4FA 2RGDA 2IT1A 4IEFB 1BHQ1 4B84A 1ZMBA 2FOIA 4HUQB 1EUDB 1RXIA 2LIPA 4E11A 5IMSA 3T3PB 2Z43A 5F12A 4JI5B 3BGWA 4KL8S 1ISJA 1C30B 5DTJA 5CDTA 4TZKA 1YZQA 2BD0A 1UC8A 3CJTA 3E8SA 2X2PA 4TQAA 3LBIA 3TXXA 3H0KA 4B2IA 4G67A 3PXUA 4FN4A 1ILEA 3G0CA 2O2GA 3STYA 1BGXT 4N5LA 1OFGA 2INGX 2NZ8A 3VSCA 1LA2A 3TNYA 2YHUA 1NYLA 5JQGA 3WIOA 1E5TA 2E2WA 1VLQA 4Q1EA 4TYPA 5FOQA 4EB3A 4ZAGA 2ZQZA 2FSHA 4ZQBA 1MA0A 4RLFA 3HVKA 4A3SA 2GPYA 4D0LB 2B5VA 4XR4A 2EU8A 2WSSA 3X1KA 1RC0A 4JD5A 5K0TA 3K8YA 1R6AA 4Q1CA 4EGCB 1UP7A 1FSPA 1M2VB 3WK6A 1SG0A 3NOOA 3ZWVA 4XLZA 2FPIA 2HEIA 4Z9YA 1IQUA 1OZAA 1Z2EA 1FY2A 3AKYA 3DWGA 4XSVA 5IAEA 3OTQA 3JVIA 1KDVA 1BYIA 1Q17A 3SX0A 5ESWA 5FLKA 2G0NA 3WV5A 4BFCA 3IAFA 3TBKA 1G9TA 3QMVA 2XGSA 5JC8A 4ZCLA 5H81A 3D7NA 4CZ2A 1KNQA 3I1IA 4JLJA 1TQDA 1QSGA 3F71A 4YNBA 4YRPA 3LC7O 5SZJA 4RTQA 1K27A 1PFUA 2HRCA 1Y9DA 2MDTA 3PXEA 3E0QA 2P7IA 2GERA 4IGKA 5ALTA 4WJKB 3RNOA 3WZMA 2UYCA 3ENNA 4JJIA 2QVLA 4D81A 1QRAA 1F38A 3OPYB 1KZHA 3S2FA 3RUDA 2ZR0A 3RI3A 1Q7RA 1MR3F 4PGGA 1VPVA 2J46A 3CO5A 5LDHA 3LWDA 3CZCA 3VAYA 1UDWA 2A5DA 5EKUA 5AW4A 2C3UA 5FPTA 2QRGA 5U9CA 1JGTA 1W5FA 2G36A 3SLGA 1V8FA 4FX5A 3G02A 4JI4B 4QUGA 5AQ1A 3QEOA 2H4YA 5K0FA 1LNQA 5A3SA 3TAHA 4CU5A 4QG3A 1X70A 4KLAA 2BHLA 721PA 3M3DA 3TVDA 1SXPA 3T52A 2VNSA 1Z74A 2YMPA 4PS0A 1EFDN 1CVRA 2H1FA 3LLUA 3EQ6A 1A97A 1CHDA 3QMWA 3UMCA 2BFCA 1RXCA 2I2FA 3C24A 2JKZA 5DM2A 4AD8A 2G1UA 2BGTA 2VPIA 4CEJA 2QJWA 2II6A 2XQIA 3FTQA 1UF9A 3BFXA 1DWOA 1P0FA 3R0JA 4LE2A 5G0TA 4BWGA 4DSTA 5CAEA 1EINA 2J08A 2OUIA 1TF2A 2ZAYA 3BHNA 5SYAA 2VOEA 5IKPA 3QBJA 1JA0A 1CUFA 2HQRA 4R2WA 1T15A 2ACWA 3UK1A 2J0SA 1AH2A 1YU6A 2RI6A 1S01A 5TPZD 1H5NA 5KZMB 5AD1A 1CB7A 2FRDC 4ZRMA 4DSOA 1TC2A 3LZDA 4GNKA 3K2IA 2F17A 3HKCA 1PT5A 4IOLA 4NH4A 5ALGA 3JWHA 3MS2A 5T4EA 2ZROA 4C4AA 1EX7A 4CMEC 3NHWA 4G4SO 1I4LD 1BDMA 2YY6A 3COVA 2PBRA 3SQLA 4RL6A 4YRSA 3WK4A 1T8WA 4G07A 4NQRA 1MAVA 4HJRA 2EGUA 1TZMA 3CWQA 3QX3A 3F0TA 4GM4A 2GTHA 3FUWA 3G17A 4DIFA 3QPAA 1V35A 3IR7A 2CLEB 4YDQA 1JU3A 1V2HE 2HPZA 4FDMA 2ENWA 2Y92A 3HU3A 4H35A 1Z5GA 4P3NA 5FAXA 3K0CC 3EUEA 1SUSA 4ZMBA 4Q1VA 2W6ZA 3NANA 3GJYA 2WZCA 4L2IA 4M9UA 3TTWA 4ND6A 5JVDA 2J9RA 1CQJA 1UFQA 1XELA 2BR4A 3JQ6A 1KKLA 3RV4A 1GPKA 4A6DA 3CVWA 5AQEA 3JZAA 3DQZA 4CEHA 2IUTA 1SELA 2HZBA 2OBXA 1IC6A 5HM6A 2GWHA 5DHAA 4ZCQA 1QAQA 3TKYA 1P9RA 2JFNA 4G0UA 1DJQA 1X77A 2XCOA 4ER7A 2DETA 1XDSA 3G6WA 1RVV1 5TJ9A 3AR6A 5TC4A 2ZULA 4U3JB 1SZJG 1KQNA 1FVOA 4FHCA 5A1JA 1UZLA 1JEYB 4DXDA 1AZSC 4LC9A 3U40A 5K0JA 3QP9A 4LC1A 3W8RA 1G2PA 4XIFA 4Z3OA 2VCYA 3LA6A 3J7TA 1VPWA 3SC6A 1TU0A 4AY5A 4QBKA 1G55A 4IF6A 3M49A 3PEFA 4WEOA 2BZ0A 3JVUA 2IZ0A 4S05A 5BQ5A 6CHYA 3INYA 1XEAA 2XMPA 2BFBA 1K89A 3H75A 4M1YA 1HDCA 3OC6A 1LBQA 1N2GA 3D6HA 1UM9A 4C2AA 1UDAA 3FOZA 1ESZA 3UK6A 4UCXA 1P4JA 8ABPA 5DOZA 1DC6A 1NNSA 2FJPA 3O73A 4TLEA 4UUQA 3WLIA 4EMSA 1DC3A 2OK7A 1EJ2A 4GKBA 3RRNA 2GESA 2B25A 4G09A 4Q6BA 5IDVA 1PQUA 3GZNB 4OQLA 2ZREA 3DQPA 1P5HA 1QV6A 3UGQA 5K0GA 1QPGA 1EUCA 2WV7A 2P9CA 1HPLA 4FOLA 4DR5B 3B36A 2IHZA 1GO2A 1XZNA 1S2IA 1QQ5A 1ADCA 2W4IA 4CLDA 1X1TA 1U8XX 5JAZA 4IUBS 3D8HA 4X71A 3ZOZA 3NTXA 2FWAA 5K3CA 4QBIA 2DM6A 1PT6A 2WWGA 3QUSA 4KIJA 4UHKA 2JL1A 1UKAA 2KYRA 2IYUA 1C8BA 2GVNA 4Q4HB 4Q01A 2Z56A 1I3MA 1HEIA 3RSOA 4E03A 3CE9A 2AW5A 1QIDA 3OFND 5TGDA 1PJ3A 2P79A 3HA7A 2CLSA 2NXWA 2PX6A 4Q93A 5TMDA 4BIIA 1S2OA 5BN3B 3HXMA 5TMEA 5F2EA 1QQ6A 2CHEA 3ZQ4A 5FNVF 4KUEA 2ZUFA 3A3OA 1PF7E 2GAOA 2C3PA 2Q8NA 3OQHA 3PYXA 5AI9A 2ZR8A 4UU8A 5C5IA 2AD5A 4DF3A 1EGMB 4GI2A 3FTFA 2Q1SA 1CUEA 3ETLA 3NHZA 3F4KA 2A9PA 1Z5PA 5FA6A 3TW4A 4BUJA 1MAAA 2XVXA 2YHIB 4WBNF 3DE7X 2WYOA 4QL3A 2IBSA 2OAEA 1H0KA 4XWOA 2O8DA 2J3QA 1R9NA 4RMGA 2W2OA 3G0BA 1Y81A 3CG0A 3RPEA 4QUAA 1X38A 4US1R 1TVKB 1DCMA 3E4DA 3WQRA 1RD4A 4KGVA 3SHWA 3U48A 5D51S 2BGUA 2PH5A 3LLMA 1ZZGA 5DV9A 3GDOA 2ZUVA 3R5TA 4CODB 2H7CA 3QVVA 3X44A 1XN4A 1I9GA 4ER6A 2XDYA 1EVQA 2EF0A 3BGVA 1V3TA 2PK3A 1W4RA 4GX2A 1K1EA 2A86A 3N53A 4Q16A 5HE8A 1KOLA 1KAOA 4A7PA 2Y2VA 3MIZA 2ZZNA 1AKNA 1ECPA 2NQ8A 3NRBA 4OQQA 3LP8A 2M6KA 3OQ6A 5L3ZA 3ROZA 3C1TA 3GFPA 3P9CA 3P20A 4Q4DA 4MV9A 4UCWA 5I9BA 2QIPA 4IGAA 2BI8A 1QAOA 2KBEA 2QJTA 4KQWA 4MKRA 3GWZA 3NIGB 3BIWA 5KDDA 3TQSA 1DC5A 4BO4A 5EIEA 2OYSA 1IXZA 3SEQA 3EIFA 1NVBA 4C1NA 3BAZA 1AMNA 1BS9A 2VYVD 4E7OA 2X42A 3ZE2B 1V37A 2WIAA 3QNWA 4NECA 4AJHA 2OD2A 2I67A 5DGXA 2VTBA 3TK1A 4WNAB 1QDUA 2F1HA 2I34A 3LCVB 1FQJA 3PDWA 4NRDA 4BRUA 2JHPA 2QPTA 3NHFA 3CF4A 4CM4B 1UEXC 1ZU4A 2IX9A 3HJGA 4Q3AA 5EWMA 5FNVA 3ZDYB 4GECA 4LKOA 1VECA 3CISA 5EG5A 3UICA 1A4IA 1OGJA 1YE5A 3AUUA 1DX6A 2HCTA 2OCIA 3IQWA 3ORFA 4ZEOA 4C4PA 2IS2A 3DE6X 3DOOA 4Q3OA 5EKSA 3HACA 4ZJPA 4A1OA 1QVVA 3V9PA 3DFIA 1PGJA 1TKCA 1QNFA 3BJIC 4QWWA 4D99A 4MJ3A 4BIMA 4EW6A 2CCJA 3FY4A 4IKOA 2GF9A 1E61A 2ZJ5A 3VTAA 1J2JA 2QTLA 2GD0A 2YHAA 3Q9SA 3HJTA 1TE2A 1MXHA 1V1RA 2WUDA 2IY8A 4RMJA 3RTEA 3W0LB 4WNCA 1VC2A 3EASA 2XADA 4ZI5A 3UJNA 1W0KD 3O8QB 1A77A 2QNBA 4XW2A 2JAUA 3LUHA 4AG5A 5FV7A 5C1BA 2QDXA 2H3HA 2PUVA 1G5QA 2IIBA 1RKBA 4C4ZA 1KK0A 3JPYA 4J8PA 3WYNA 5A1TA 5LUAA 4YS6A 2W2VA 4JX8A 5CT8A 5TGZA 3T38A 3SJZA 1DAMA 1NVGA 1C5KA 2CBGA 3M9LA 2ZYWX 4HDCA 3I09A 1JP7A 4I5EA 4PZDA 3W4KA 3QBEA 3WLNA 4DLKA 3MLEA 1P1FA 4OSPA 3WOHA 3WNCA 4HLCA 1YQQA 4B44A 4CL2A 5K6RA 2ZWIA 1CDEA 3VZRA 2HR1A 1JE0A 1Z73A 3KAQA 2EFJA 1B43A 3P5SA 1Y5RA 2CLOB 4M0LA 4XWKA 5C2JB 3VV2A 2BL4A 1GNLA 2AZ4A 3BF8A 1TYCA 2YWEA 1CP3A 1VXOA 3D3QA 4NBTA 4NMWA 1OIVA 3MOGA 1U3UA 3FHJA 1HT1E 1WEHA 1R5OA 3FR7A 4G65A 3NOVA 5DIFA 1P1HA 2E6UX 1ND6A 2I4TA 3AL2A 3NYWA 4GBJA 1MH9A 2GXUA 1KEWA 4ENVA 5I45A 4D1YA 3FKSD 2FUKA 5JXJA 4CIDA 4G0NA 1VHTA 3H5TA 2CB0A 3LBHA 2D62A 2V0NA 1DEHA 1KNXA 2HX1A 2ONCA 1RI2A 2NO0A 2G1KA 4GGMX 1S8AA 4IOKA 3JYQA 3HXKA 4MRSA 2MSNA 4CI9A 4C4XA 1UBEA 1SKAA 3UWDA 1HYHA 4Q05A 1WCXA 4DADA 2C92A 1HO3A 1FP1D 2PUTA 1RTTA 3DF7A 2GHIA 2VJAA 1LNZA 2YVLA 2LZ0A 3LT1A 4L02A 1PZFA 4WZAE 4RPLA 3A70A 2VZ0A 3L6CA 5KS2A 4C01A 4LYHA 4AJKA 1KMQA 2Q50A 2EKBA 1AF4A 4D5EA 2AYXA 2ZSAA 1XJCA 2LWIA 2GF2A 3RAJA 2AJTA 2E37A 3K4QA 4LPKA 4C4YA 1PWHA 4BLOA 1FP7A 4JELA 4E1BA 2VTDA 1MABA 1BTOA 2VTKA 1GT6A 1KMHA 1OU4A 2I4OA 2ORVA 2H5IA 3AP2A 1YGYA 3B3AA 4BNYA 2VQFB 3UMFA 1P0PA 1A1SA 4N76A 2JFWA 5KBYA 5DYGA 2PGAA 4EUEA 1E2PA 1N6HA 2FOXA 1BMFD 4KQJA 2GFHA 2QLJA 4FJ0A 2H08A 4G1UC 2Y71A 1L4FA 1N57A 1P77A 4KV9A 5MFPA 1CY7A 3O8BA 4JSTA 3OTOB 1BCSA 1VFPA 3G5AA 4J49A 4X60A 2IHKA 1Q0ZA 2GEDA 4TLLB 1IAVA 4ADSG 1BX1A 3DLAA 2GYUA