3A7DA

Crystal structures of rat catechol-o-methyltransferase complexed with new bi-substrate type inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
214
structure length
214
Chain Sequence
b'GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Hit to Lead: Comprehensive Strategy of de novo Scaffold Generation by FBDD. Part 2: Ligand Fishing using Mass Spectrometry by Detection of Ligand-Protein Non-Covalent Complex after Matrix Click Chemistry
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 83
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2009-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3a7dA00
3FTFA 4PYOA 2AOTB 3NVKI 4C07A 4PWYA 4QDJA 4KDRA 4YUWA 5FWDA 2Y1XA 3KQOA 9MHTA 1BHJA 1F3LA 1WG8A 2BM8A 2GPYA 2LD4A 1D2HA 4RSRA 4A6EA 1WXXA 1P1CA 2PX4A 4F84A 4QQNA 1JSZA 4X63A 1F38A 1XDUA 3LDGA 1NW5A 2ZIEA 2NNWB 1MJFA 1KXZA 4R6WA 2NYUA 2NXJA 3FRIA 3ORHA 4MTLA 2ERCA 1FPQA 5DX1A 5BW5A 5BXYA 5ICEA 2G1PA 3CC8A 4LECA 5DPMA 2VS1A 2PLWA 2AVNA 2PWYA 4OA8A 4PCAA 3TOSA 4CKCA 4ER6A 2G71A 4E31A 3HVHA 1KPIA 1M6EX 3BKWA 4AZSA 1QAMA 5HZMA 3LDUA 5EKXA 3A25A 3KR9A 4KIFA 1WXWA 2P7HA 5T64A 3ANXA 3EVFA 3FUXA 3FPHA 1T43A 3MCZA 2IH4A 5CVDA 3DH0A 2XYRA 4FSDA 2CMGA 4AZWA 1SVUA 5KVAA 3CCFA 3FUUA 5HIIA 5LQKA 3CBGA 4MWZA 4KVZA 1H1DA 1KIAA 5LQNA 1RJDA 3PT9A 2G70A 3UA3A 2OO3A 3EMBA 3FYDA 5K01A 2AOTA 2ADMA 2PBFA 2PXAA 3BUSA 3MQ2A 3PX2A 1P1BA 3EVAA 5U4XA 3SSNA 4RTQA 3B89A 3OZRA 5KQSA 4RX1A 4DZRA 2ZWVA 3DMGA 2C7QA 5HILA 2WA2A 2ZBRA 3TKAA 5GIOE 4HC4A 3GCZA 4ZTBA 3MCTA 3G2PA 4AUKA 3SX0A 4EKGA 5LQJA 5DTQA 3G8BA 3UWPA 4E2WA 5GOZA 3OU2A 5DM1A 2AOUB 2YX1A 4KWCA 1EJ0A 4ATNA 1EJ6A 1I1NA 3X0DA 4XUCA 3I53A 1EG2A 4RTJA 2N47A 3EVDA 3I64A 2GLUA 3HVJA 3MB5A 3IHTA 3EGEA 1JG4A 2QY6A 3CJRA 2P41A 3H2BA 3LECA 3MERA 4RVFA 1PJZA 4C04A 2P1DA 4V0RA 3K0BA 4BP3A 1NV8A 3JWJA 3M6VA 3FTEA 3KQWA 5E8JA 3UZUA 1YUBA 5K0GA 2PJDA 5C0OE 2AN3A 4M38A 1G60A 4GC5A 5DLYA 1VL5A 3FRHA 1EQAA 2ZSUA 2KW5A 2HR1A 3NDIA 4GOND 3NW9A 2R6ZA 4DCMA 3OE4A 3B3GA 4CKBA 1EIZA 3R3HA 2YXLA 5EOVA 2ZCJA 1INLA 1FJXA 3ID6C 2Z6AA 2CMHA 1ORHA 4BY9E 2G72A 4OBWA 2PT6A 3TMAA 4C4AA 3KR1A 4V0QA 4YV2A 5K05A 2VZ9A 5LQRA 5E1DA 2IP2A 3TM5A 1NBHA 3HCBA 3T0IA 5ICGA 1VLMA 1JG3A 2HTEA 3C0KA 1NW6A 1TPYA 3GNLA 3LKDA 3QOXA 4M37A 5DRTA 2AOUA 4X61A 1N7IA 2PSSA 5DSXA 3KKZA 2E5WA 2GB4A 2ZVJA 3HCEA 2YXDA 3V8VA 5GM2A 3KQTA 3OCJA 4Y30A 5LQUA 5FTWA 2ESRA 3DXXA 1SG9A 4WXHA 2O0LA 2AS0A 3BGVA 2AN5A 3M6WA 3P97A 2OXTA 1Y8CA 3DR5A 2ZIGA 5JUWA 2R3SA 3UJCA 3EEOA 3FZGA 3NJRA 3VYWA 1Z3CA 2XBMA 3R24A 1I4WA 2JHAA 2O06A 1FP2A 4HRAA 1B42A 3DOUA 3DMHA 3DP7A 3THRA 3LSTA 1AQJA 5E8RA 3GRRA 3G8AA 2ZLBA 5F2OA 2NP7A 4PYMA 3UJBA 3I58A 3B7PA 4OA5A 1XDSA 4MIKA 5EEGA 4PCLA 4HSGA 3PB3A 4LWPA 2V7EA 5DTRA 3G7UA 5GP1A 5CVUA 3KQMA 3HTXA 2YXEA 3G2MA 5CD1A 3LDFA 3O31A 4B17A 4EMSA 2H1RA 2AR0A 2AN4A 5D1HA 3GU3A 4DQ0A 1Q0SA 4FT4A 3R6TA 3PTAA 1ZKDA 2UYOA 3JWGA 1XDZA 4QVGA 3T7SA 1SUIA 2ZULA 3KPJA 1R18A 5FADA 3C3PA 3DLCA 3SVZA 4BLWA 5EGSA 4X60A 1NW7A 1HMYA 3GRYA 5LSAA 3OPNA 3V97A 3OU6A 2PKWA 4ER7A 3CVOA 4QVKA 2ZW9A 1KP9A 3QOWA 1EAMA 1JTFA 4GF5A 1VP3A 3FPFA 3GRZA 2IDKA 4PIPA 5FWAA 2ZIFA 4CKEA 5HOQA 5K0BA 3P2IA 4RTRA 4EQZA 2UZ4A 4GOMD 4O29A 5IH3A 4M7RA 5EEHA 3LBYA 2PXCA 2PX5A 5HIKA 3HCDA 2C7RA 1YF3A 1R74A 5EIWA 2EJTA 4PONA 2P40A 2P7IA 3AXSA 7MHTA 2FK7A 1L3BA 5E9JA 3FTCA 3BXOA 3LX6A 4PGHA 5DT2A 4RTSA 3MTIA 3GWZA 4PINA 1O9HA 1WY7A 1L9KA 1NW8A 3NWBA 3HM2A 1BOOA 1M6YA 5DXAA 5FULA 1G8SA 3HVKA 3KU1A 4POOA 1R8XA 1XTPA 3CJQA 1NKVA 5DSTA 1WZNA 1XCJA 4FT2A 4LWOA 3P2KA 3KQPA 1ZG3A 4X1OA 5BW4A 2GS9A 3BWBA 5K0FA 2AOVA 1RI1A 5EKUA 2F8LA 3P9CA 5F2NA 4AZVA 4IV8A 1JR4A 3K6RA 4R8RA 2I7CA 1RJFA 5H02A 3R0QA 3U81A 1G8AA 4PYJA 2AVDA 4QPNA 5DM0A 5DX8A 5FHRA 3M70A 4FSXA 3SXJA 1YZHA 3HA3A 2AOXA 2PWPA 3CGGA 1VPTA 1NV9A 3TKYA 1BC5A 3EMDA 2QRVB 2NXCA 2BR4A 4HTFB 3MAGA 1DUSA 3MHTA 3NDJA 4LG1A 1NE2A 2YUIA 4PYLA 4RTNA 3C3YA 2H11A 4R6XA 1QZZA 3E05A 3M6XA 3O4FA 2UYCA 4YUVA 3F4KA 5KYGA 3I9FA 1X1AA 3ME5A 1WS6A 3NVMB 2H00A 1IM8A 2FRXA 3GO4A 2P35A 5EIFA 3TRKA 3TPZA 4QTTB 2BR5A 5BP7A 5KQRA 4L7VA 1FP1D 3BWCA 3Q7EA 2IH2A 1NT2A 3P9KA 4DCGA 3PX3A 1QAOA 3LCCA 3EVCA 3I5UA 3T7RA 3EVEA 4UOEA 2OZVA 3UJ9A 2IPXA 2UYQA 4OQDA 1YFJA 3HCAA 4YUYA 2I9KA 2ZZMA 3MTEA 4IWNA 4IV0A 4PIMA 4C08A 2B78A 2FPOA 3OFJA 3A7DA 5HIJA 2OBFA 4RVDA 3DULA 3KR2A 1TW3A 1VBFA 5EMMA 5LR6A 2QRVA 1R8YA 1QAQA 3B3JA 4HTFA 2Z6UA 2I6GA 2ZFUA 3TQSA 2BZGA 4ER5A 5IKMA 2CL5A 2QYOA 4EKIA 2B3TA 2ONYA 3CJTA 3HCFA 5GM1A 4FR0A 1N7JA 3HVIA 1AQIA 3ER8A 4EK9A 2YVLA 4PYNA 5E1OA 5EZQA 2JG3A 3LCUA 3UA4A 4PYIA 4GQBA 2WK1A 3G89A 1IY9A 1N2XA 2FK8A 1ZGJA 4P58A 3UJ6A 2Z6QA 5DX0A 2QE6A 4PGGA 3ELWA 3VC1A 5ICFA 3P71T 2OY0A 2K4MA 4PNEA 3VSEA 2ZWAA 3G5TA 3FPGA 3FTDA 1UWVA 3SM3A 2XYQA 2IDJA 4HGZA 3A27A 5DTMA 5E1MA 3S68A 1SKMA 2WA1A 3DXZA 3FUWA 5EMJA 4BLVA 3VC2A 5CUQA 2JHCA 3P2EA 3TLJA 2HNKA 3FPEA 3P8ZA 4RWZA 4G56A 5E9WA 5DRYA 3E7PA 4IKPA 3UJDA 2BH2A 4E30A 3MGGA 1I9GA 5C1IA 5ICCA 1XXLA 5DM2A 4Z2YA 5DXJA 3EVBA 5FQOA 1HNNA 1PRYA 5CVJA 4HH4A 5JR3A 1X1DA 5FUBA 1NW3A 3KHKA 1AF7A 1XCLA 3FYCA 4P7KA 5GIPE 3LL7A 1QANA 3BT7A 3REOA 1KPGA 3KPVA 4RTKA 4DKJA 4RYLA 5K09A 1O54A 2ORED 3FPJA 4C03A 2EFJA 3KPUA 5EMLA 3BGIA 4EVIA 2EJUA 5T67A 3AWIA 2ZTHA 3RODA 2JJQA 3NMUF 3KPYA 3LPMA 5EHGA 2Q41A 2P3OA 4E2YA 3HCCA 1IXKA 5EQJB 1XVAA 3A4TA 2JH8A 1KPHA 5GWXA 3P9NA 4CTKA 4E2ZA 1RJEA 3DMFA 3GIWA 2ZZNA 4YUZA 3OZTA 4YMGA 1V39A 2IBSA 4ISCA 2FHPA 5K03A 2O57A 5K0LA 4KW7A 3SGLA 4OX9Y 3PFHA 5CM2Z 3TR6A 3AY0A 4P7FA 5K0NA 2I62A 4PYQA 2BM9A 2O05A 3A26A 4RVGA 4JXJA 5EZSA 10MHA 2IGTA 1BKYA 4R8SA 1RI2A 1L3CA 1YB2A 3THSA 4A6DA 4OQEA 1M0EA 3DUWA 3LBFA 2PX8A 5T6BA 5EPEA 5DWQA 4GOOD 3PFGA 4K6MA 4RVHA 2FYTA 1RI3A 4NECA 3OU7A 4XCXA 4U7TB 3B5IA 3EGIA 5E9QA 5HFJA 2IIPA 3GXOA 4HGYA 3CKKA 5E2AA 3R9XB 3ELDA 1DCTA 2GAFA 3M4XA 4KDCA 2ZZKA 4R05A 4X41A 3RIEA 3L8DA 3O7WA 4RTMA 4AX8A 2NP6A 3IEIA 3GJYA 2EX4A 1KR5A 2PVCA 1TW2A 2HWKA 3EEYA 3ELYA 3JWHA 5K0EA 2HMYB 3KQVA 5FHQA 3P9IA 4E33A 2DPMA 2EG5A 2PX2A 2QM3A 2V74B 3NWEA 3HP7A 4YV1A 5K8VA 2YTZA 2PV0A 2JHPA 1XJ5A 3E8SA 2AZTA 4FZVA 4QQKA 4RTPA 3A7EA 1ORIA 5ERGB 1G55A 4GEKA 4RV9A 5MHTA 4E2XA 8MHTA 4E70A 3JWIA 2JH9A 1FBNA 1L3IA 4Y2HA 3EGVA 4DMGA 2P8JA 3LGAA 1SUSA 4KIGA 1JQDA 5GINE 3C6MA 2A14A 1P39A 1VP9A 3DTNA 3LKZA 3M6UA 4DM3A 1X19A 5C9ZA 3ELUA 3NTVA 4YV0A 2NXEA 3PLAE 5HEKA 5CCBA 2B9EA 3SSOA 2IH5A 5EHIA 2P3QA 3GGDA 3TM4A 4E32A 4MQ4A 2VDWA 3KQSA 4OBXA 5EG5A 2OPBA 3PS9A 5LQAA 4C06A 4F85A 2PT9A 3B3FA 5EMKA 5CCXA 2NXNA 3OZSA 1RI5A 4CXMA 2OB2A 3FUVA 2YQZA 5G02A 3BGDA 3DLIA 3KPWA 1X1CA 2ZBQA 3E23A 3DXYA 4YUXA 2VDVE 1U2ZA 3GRUA 1D2GA 4QDKA 2XYVA 1Q0TA 5CIYA 1ZGAA 2PY6A 3SSMA 1G6Q1 3LHDA 4AZTA 5EC8A 4FGZA 2CWWA 3BZBA 4RTLA 2DULA 5CVVA 1OR8A 3G2QA 1G38A 2G8NA 3ERCA 4M36A 1UIRA 1AV6A 1L1EA 3FUTA 5D1NA 4ER3A 2VDUE 3HA5A 4BLUA 3KQYA 1DL5A 3QV2A 5K0CA 3ER9A 1P91A 4RTOA 2ZBPA 4BP1A 3SMQA 4GBED 3UJAA 3BWYA 3M33A 1VIDA 3OE5A 4F86A 5FA5A 1X1BA 5HIMA 3UFBA 2GH1A 5K0JA 1JQEA 4C05A 3AXTA 1JQ3A 2CKDA 5F2KA 3HNRA 3D2LA 4FS8A 2OKCA 1VQ1A 2GA9A 3C6KA 4XUDA 5FA8A 3UJ8A 2FCAA 4PYKA 2B2CA 5CVEA 4FP9A 2Y1WA 3EVGA 2O07A 1QYRA 3HEMA 1JSXA 1SQFA 1JG1A 4HG2A 4KRGA 3PVCA 5B1SA 1JG2A 1YZ3A 1ZQ9A 5E2BA 2UYHA 4QTUB 1MHTA 3G88A 3EVZA 1RI4A 2VP3A 3KQQA 3KR0A 3TFWA 3Q87B 4ER0A 3GRVA 2C7PA 3UBTA 5DM4A 1ZHFA 3G5LA 1JTEA 2AOWA 2YR0A 5E1BA 2XVAA 1SQGA 4XUEA 3GDHA 3HA7A 3OFKA 2HV9A 4P7GA 4QPPA 1KHHA 4GC9A 3G2OA 2C7OA 2ONZA 3IYLW 1NBIA 5P8WA 2BR3A 1RJGA 5FQNA 2OYRA 5LQCA 2IBTA 4CTJA 2XVMA 1YFLA 2PXXA 3BKXA 3UJ7A 3SR4A 2B25A 3RW9A 1UFKA 5M5BA 4CWAA 3AJDA 1R00A 3IV6A 4GUAA 3T7TA 2PGXA 4YMHA 5FCDA 4DA4A 5KS2A 2OB1A 1O9GA 3LCVB 4GOLD 4U7PB 1VE3A 4WVLA 3BWMA 5EVJA 4DF3A 1D2CA 1KYWA 1KYZA 3EPPA 4H0NA 3WSTA 4MHTA 4P7JA 2P3LA 1R6AA 2IFTA
chains in the Genus database with same CATH superfamily
1FX0A 2HBQA 4BEVA 1UF9A 4IDFA 1L4LA 3QY0A 4US1R 2ZAYA 3KYBA 2ZJ6A 3ZWVA 4YUWA 2H7VA 5D3MA 2BM8A 3NRJA 4NHOA 1FTNA 2DTDA 4RNCA 1U31A 4X1YA 2V3CC 1UBSB 3K0AA 1T4GA 2XAUA 1X2BA 3AH8A 4IIJB 3OZEA 3ZE0B 4EQ6A 2WYUA 5DX1A 2BW0A 3SHQA 1RRCA 5HVNA 2D06A 3TRJA 5K0TA 2AD1A 1ZKMA 1I7DA 3J81A 5BVHB 2CNKA 3L02A 3R1IA 1J70A 4BQOA 5BVGB 5F1YA 1B8UA 1WPRA 2F1JA 2ZS8A 4O8ZA 1SK9A 4UE6A 3JQAD 2IXEA 4KGVA 3VUEA 3REGA 1XX6A 4OY3A 1EFUA 3LIPA 2FE4A 4K87A 4MKIA 5KI6A 4D9JA 4RSHA 4HDSB 2P4SA 4OATA 2VYVD 2QRPA 3ROMA 1G7CA 4CIVA 2MDTA 1WRBA 3K7EA 4US0R 2FE1A 4EJ6A 3PYLA 3FWKA 3C70A 2EBWA 4OLBA 1GG2A 1W4LA 2YW9A 1HI9A 3JVDA 3LWNA 1L7QA 5E38A 3UAVA 4RX1A 2ZWVA 5F9FA 4E46A 4RGVA 2ZVPX 2CVZA 3OQMA 3QEMB 2P9BA 1FFDA 2QVXX 5HX7A 1CC1S 1U7PA 2C58A 3R44A 3EF1A 1NVDA 4IIJA 4I5DA 1T9BA 2YX1A 3DTVB 4J0QA 1U6IA 1L4HA 4FNAA 2GK7A 3ZDXB 2WZCA 5EE5B 1GQSA 3HZRA 5BVHA 4QDZA 1TC1A 5BVGA 3EGEA 3T3DA 1Z5GA 1DEAA 4YP9A 2VRNA 3LKVA 4DUYB 2YWXA 4D3DA 4MB0A 3RKUA 2NQ2C 2FW9A 2IW3A 1RRVA 2ADOA 3ETNA 1JB9A 4HDSA 1ESEA 2Q1UA 2NVWA 2R6AA 4FHEA 4LGVA 4RZUA 3TQCA 3UCFA 2NWQA 3JU3A 4KMRA 2MHCA 3QV1A 3BTOA 4JKYA 2Z6AA 2W6IA 2C0CA 3BXXA 3OD5A 1ZAKA 1ZI6A 3CB2A 4V0QA 1TU0A 5LQRA 3IAHA 3I6ZA 4JEIA 4Y2TA 4UMDA 3AHHA 4DYVA 3QEMA 3HJBA 3O8QB 1A9ZA 3T34A 5BMVB 1JG3A 2ASEA 4HDMB 1LSOA 4WAUA 2ID8A 4D3SA 3H42B 1UL1X 5GY7A 3LY5A 1YQ9A 2IHUA 3DTVA 2FI1A 1I4LD 2GRUA 1W581 3VC3A 2AQIA 2E5WA 4BVGA 4DCVA 1VL8A 2VLBA 1ZNXA 2JLXA 3V8VA 2CNWD 4BZPA 2E2WA 4MCHA 4LXTA 5KSWB 1ZUHA 2ESRA 1GNSA 1SG9A 2I7TA 3V1UA 4OJKA 1LW6E 3BGVA 4CN9A 1JZQA 1F0PA 4KXMA 3GD7A 1KFKB 5CURA 4KPEC 1MEEA 4NIMA 1VCIA 1O2DA 3WL8A 2QVLA 3Q9SA 2QTLA 4P6VF 5HCNA 4A0RA 1YDMA 2LDXA 1QJ4A 3KDSE 4E7PA 2A30A 1RRPA 1X0XA 4MIKA 5HFNA 2ILVA 2QV0A 1CD5A 3A4LA 4PCLA 1FQOA 2PYIA 4UTXA 3AQIA 4JBNA 1Q0HA 2FVXA 1Z33A 2Q0QA 5FFNA 3NXSA 4ZI7F 3HKDB 1ZLYA 4IV5A 2Q7DA 1WSBA 3CSDA 2C03A 1XU4A 1JFFB 2XNDA 3G2MA 5JJLA 2GJ4A 1RQRA 1WNFA 4HZIA 3I23A 4WFIA 4Z4HA 2BMVA 3MB8A 2OV4A 3O8QA 4TZ0A 4EDFA 5BMVA 4HDMA 4CIYA 1U0NA 3ZNQA 3IPYA 2PHZA 3K5IA 4HFRA 4O4HB 2O7RA 3I92A 4JMLA 1XDZA 5H81A 1RQPA 1EDZA 3U4DA 1JFTA 1Z83A 4BEJA 2NO4A 1XKXA 2CXRA 5EFOA 4AECA 3HJUA 1C1XB 4QEZA 3CLHA 2AJDA 5JALA 4DBZA 5KPDA 4DDWA 1E6LA 1CUWA 3ST7A 1LBSA 2A7QA 5DBIA 1S2NA 1GUBA 3QKRB 2VHEA 2JGAA 4MRRA 1OYVA 5CJJA 3BWEA 5K0BA 3GYBA 4DSZA 4WK4B 4RTRA 2V0GA 3L3BA 4FX5A 1ZN2A 3W2FA 3PC8C 4M7RA 4M1MA 3DVLA 4D56A 5CDTA 3E61A 1M1YE 4G3XA 3REFA 1JPJA 4ZCSA 4BX0A 1A04A 1PKEA 4C0SA 4EG6A 3B78A 1QORA 2WG0A 3HKDA 4PXYA 2R4UA 3TCNA 1W5TA 2Q2OA 5CW1A 2DFTA 1JFFA 3RF7A 1GG5A 2HJRA 2P3SA 1Y5RA 1TT7A 1VYUA 4PGHA 5AUQA 4ND7A 2TMKA 5LUAA 4M87A 4LOIA 4AQYB 1ZH2A 1M6YA 5AOBA 1RRMA 3D3QA 3KU1A 1T25A 4L08A 2VKTA 1K7SN 4YR9A 2QU8A 4TL7A 5DIFA 2X76A 3DAYA 3I2HA 4O4HA 1XCBA 1A3CA 4QGBA 3PHJA 4A9AA 1P0PA 5KNBH 4JJ8A 3PGLA 1OB5A 3KQPA 3KT6A 5F35A 2DLCX 4Q9HA 4UC0A 1RI1A 2WD7B 1O5IA 1C1XA 4OOEA 4UEQA 5KYXB 1OY1A 5IM4F 1OI7A 1VA4A 4V03A 1RRFA 4WKNA 2G08A 4RZHA 1ZNWA 3OI7A 3JXEA 3QKRA 3R0QA 3NYQA 3HRHA 4YVFA 3FCAA 1TVEA 2FWIA 1IVNA 4B85A 4HUJA 5HS4A 1T4CB 1WW8A 3K9CA 4FBLA 3HA3A 3LQ1A 2D4AA 1RYZA 2XXJA 3UUFA 4I9UA 1BC5A 1JHAA 1XYYA 2XVXA 4M55A 4H3KB 3MAGA 2C1ZA 1MW8X 2YVQA 5BSRA 2FUKA 3HWX1 1H2ZA 1IY1A 1R50A 1K8QA 4JLSA 1QZZA 4N3GA 3TR5A 5JCPA 1THTA 1CVRA 2IHNA 5A5DA 4KXFB 1ZH4A 4QULA 3I9FA 5AXCA 5K7SA 3B48A 3ME5A 1PJAA 2VN8A 4N3NA 1DI0A 4OVKA 4Z0HO 3X2EA 4A0QA 3JW8A 3EIXA 2VTKA 1E8MA 3ETHA 1NPTO 3R20A 4UTZA 3U17A 3Q8XB 2C7GA 3D3WB 3W6ZA 4C0BA 3RVJA 1R12A 2VDOB 2JFWA 1NT2A 3E15A 2WD7A 4HDCA 3A9TA 4FFLA 1QAOA 1HG1A 1OCEA 4BBAA 4DCGA 2DBYA 3B2NA 5KYXA 2R5FA 1YJXA 1XZNA 3ZLJA 1NBEA 3NC1C 3V55A 4QGAA 1J5XA 3HCAA 1XUOA 1U2EA 3C3WA 3O92A 2MYTA 1OXSC 1T4CA 4ZVMA 2NTEA 1AQLA 1AB6A 4QFMA 4YV7A 1ZR4A 4G5YA 4WKPA 3NBUA 2P0AA 4LQDA 3S28A 3ZJTA 4PQRA 2D8MA 4B3RB 4F1WA 2ZAGA 1QIKA 1L5GB 2ONYA 2UVDA 3QZUA 4JAVC 5FPKA 1Q1ZA 2C2ZA 3PSAA 1H2WA 2VXCA 5DKFA 4LFCB 1XNQB 2JLSA 3VGJA 2R84A 3ER8A 3IPRA 2L19A 4UEKA 1Q7RA 2C4MA 2WJVA 4UHDA 3BXGA 1XEWY 2I71A 2YICA 3GN1A 2FK8A 4P58A 2Z6QA 2Z1DA 5I9LA 3C3CA 2IS1A 3L49A 1X6VA 4PVCA 1M2OB 4CF4A 3P71T 3VZPA 1H0SA 3M1YA 5FBWB 2FSIA 1EXNA 2O48X 2R6CA 1Q7CA 3D3WA 1AY0A 4EEZA 1SKUA 1TMGE 4A23A 3H99A 5DYTA 1Z0SA 4Y2QA 3E9DA 1IVYA 2YQ4A 4BQNA 1P5FA 3QPCA 3WGNA 2JHCA 3IAS1 2AR7A 3H1PA 3CU5A 1ZVQA 4OPMA 4S12A 1L4FA 2XRZA 5JY1A 4RPIA 4EY3A 1L4EA 1ENPA 4X44A 1QG2A 2B8NA 1Z6PA 3HI6A 4ZYZA 3DF9A 4CU5A 4OQQA 2QUBA 2XR1A 2J31A 5DLDA 3VO8A 2YJ4A 3L8ZA 4UHCA 1J0XO 1Y98A 3AESB 3O2SB 221PA 5GOTA 2UYYA 3C8UA 2DFVA 2QUJA 4GPBA 4P7KA 4PAWA 1B2LA 2BLLA 1QANA 5EE0A 3UAOA 1EDEA 1DKPA 1R3DA 2C5EA 4LCBA 1C4XA 4N3BA 3MMNA 4OHMA 3RE1A 3SHTA 2VDQB 3LHIA 4ZYUA 1PNVA 3NTRA 3O1IC 4ZYTA 4K1LA 2JJQA 2WG1A 1M2OA 1NPDA 3A1NA 4DA7A 1M1UA 4D9FA 2XA1A 2G1UA 1NP7A 1W4AA 2UUAB 1R6VA 3I5YA 3HCCA 4XWYA 5JI3E 2A1TS 4UFPA 4AF8A 3DMFA 4OAOA 1XZ8A 5A2QA 1FF9A 1RKUA 2C4VA 1MQSA 3GFSA 1KJQA 2AD5A 3IVAA 4OXIA 2FKAA 5H3HA 4EY4A 3WP1B 1IXYA 1L8LA 3SDZA 2R1ZA 2WIJA 1FFCA 1WY5A 1IN7A 3EZYA 3FZYA 3MFYA 1E61A 4NZ9A 2ERXA 4IO1A 4QGSA 5IYZB 1HT1E 4WEOA 5LC1A 3E8MA 4XD2A 5ALJA 9ABPA 1FVFA 3PGVA 3KOOA 3OX4A 4GM1A 5AVOA 2QRZA 3IB6A 4BGEA 3IQFA 1PLJA 3AESA 4JB2A 4TLLB 1QKIA 1YB2A 4NFLA 3N8DA 3PGMA 3WGGA 1K4KA 3NASA 2AUMA 4OTZA 3D81A 2H7YA 4P34A 1PJRA 4RFVA 1QGDA 4C0XA 4CT5A 2ZI4A 4R1MA 4EFLA 3EXG1 1JKXA 4PX5A 3FA2A 3SLGA 1KU0A 1R9GA 3ZDFA 2VTBB 1UJ2A 2DT5A 1RQGA 3H2IA 5JJ5A 5EFZA 3ECSA 3HGMA 1LGYA 1SOVA 1Z8FA 3KQVA 3Q9NA 1QZXA 3A6GA 4MDYA 3PUWA 2QM3A 5EE9A 2JBHA 2YTZA 4GPAA 3G2NA 1YS7A 4JP5A 3LYUA 5HCUA 4DM7A 1ZXBA 2C78A 2QJWA 1NF3A 2EJWA 3PPXA 1Z5NA 4P83A 3ADBA 2VHZA 2AC4A 5FV7A 4Z99A 4A2PA 4FQ8A 4MITA 1T2EA 1MT0A 3N8IA 2MSWA 2QAGC 3OJCA 4C9BA 5AWFC 4FTWA 3B60A 4TYPA 1H4TA 2CUTA 2I33A 5M5BA 1RAEA 3PNPA 3IQWA 2EAUA 4DM3A 2FSPA 3GW8A 1MG5A 4US2R 2A6PA 2GRJA 4FS3A 1AK2A 1H2AS 2W2TA 1U11A 1ZU4A 1F8FA 2FXVA 2W83A 5EG5A 2DZDA 2HU7A 3AP1A 2VTBA 3ONVA 1OU4A 2I34A 1L5KA 1Z88A 4LSMA 2GNOA 2Y3IA 3K4QA 2WNHA 2IZ6A 3NV9A 3C8MA 1JLLB 4YJDA 1GL9B 1NNUA 2GZMA 1P33A 4M76B 1UXKA 4XQGA 2J0UB 3HE3A 3WYDA 3VO2A 2C57A 1KS9A 2BTQB 3CWZA 4AN4A 1G8GA 1SHKA 4UTNA 5A0VA 2YOGA 4UVGA 5H5JA 4G8DA 5CIYA 3R0ZA 2PKYX 3PJDA 1HKUA 1RLIA 4X20B 5C3UA 4INJA 3L7AA 1IJBA 4P82A 1TVKB 2FMKA 3JQGB 4ZVPA 1KAMA 4LF7B 2AYZA 3BXFA 1A0OA 1U7UA 4PO8A 5TC4A 3EGXB 3DWEX 3GNTA 2G8NA 3I2GA 2ZUBA 4MRAA 2IYLD 3CZCA 3ZCVA 3V42A 2VF7A 1ND5A 3TSOA 1UBGA 5BSMA 4RE5A 1K8RA 1PEDA 4JC5A 1MRSA 1S2MA 1C4OA 1PT5A 2IUEA 2GRAA 1E1LA 1TIPA 2DFDA 1HDRA 3MT8A 1HYBA 1S8NA 2HHLA 3GN2A 5AHRA 2JFOA 1TRHA 2L0XA 4EH1A 2Y1WA 3EDMA 1JLLA 3LUBA 4R9RA 4O2AF 2ZE7A 2J0UA 4HG2A 1IUKA 4WKCA 2CL6X 3DHVA 5BYBA 2PO7A 2BTQA 1PJBA 2W37A 3B2EA 3ILYA 3V4PB 3GDGA 4DMLA 2WZDA 1UINA 3KQQA 3SX2A 4IIXA 3EA5A 1CUBA 4OLHA 3ZIDA 3VNUA 1I0ZA 2P91A 4X20A 3MD9A 5BUZA 3I8OA 2D1FA 2GPTA 3O4IA 2V6BA 3KJFA 4G01B 1TVKA 3JQGA 4C6TB 4DCPA 4ZZ1A 4DV2B 2YDXA 2R68A 4NAVA 1R16A 1Z47A 2B4KA 2YR0A 1K1EA 1LI5A 3E58A 5E1BA 1A95A 5ANRB 3ZY3A 1IUPA 3EGXA 1UAAA 2PMDA 3ILVA 1T15A 2CB9A 1HK7A 5JMTA 3A4YA 1VE9A 5ALKA 2QN7A 2W58A 3ENZA 1DFHA 5TB5A 2O2HA 1ZAYA 1B6SA 1WMDA 3UKOA 3ZI7A 1V3QE 3R3ZA 4CQMB 3TTWA 4ENWA 3U4AA 1CUEA 4IRMA 3AIOA 4CNQA 4CYMA 1QPZA 1OFGA 4KWIA 4LZOA 1SOMA 2OB1A 1GSIA 3ASZA 5ES4B 2Q45A 1YA4A 2R2GA 3GNSA 4D5GA 2XDWA 1JEEA 3NVAA 2JEZA 3SQMA 1V25A 3A1VA 2QRJA 3AEKB 2ODNA 1T5BA 3OIDA 4FNMA 4HYYA 2IFTA 5D01A 1IBLB 3G0BA 3AI3A 5C18A 4QDJA 3LPLA 5EP3A 3DV9A 3KQOA 1KRXA 3GJ4A 1U80A 4JASB 1VHJA 4RK5A 2BBWA 1NMXA 2G1KA 2RHCA 3LRXA 4LZAA 1MW9X 2HU2A 1DAEA 2QTVB 4X63A 4C6TA 5I8PA 4BNLA 1LVUA 4RJTA 1NUSA 1ZRMA 3FUCA 2JBAB 4ZVTA 4AO7A 6YASA 2PUEA 3OJFA 2GBIA 1I5OA 4ZAYA 3LXUX 4A6PA 5DPMA 4CMGA 4LRUA 2IU4A 1ZS9A 1FDTA 3HSKA 4NL4H 4PCAA 2CD7A 1F9EA 3JV7A 3SR0A 2OKGA 3E70C 4J8PA 1EUQA 1CYDA 4F46A 1LDMA 1SC1A 1R1DA 3KAKA 4HXFB 1VI2A 1KKMA 2YC2C 4CQMA 5KTYA 5IARA 3OZXA 3U80A 1C14A 3EVFA 2ODTX 3MHPA 1SUCA 3S8MA 2Q6VA 5DULA 3ZD7A 3DH0A 2JLQA 5WRFA 4E5NA 1QVVA 4EJ0A 2I4RA 1G20B 3RPEA 2HNBA 3AEKA 1H1DA 4RA6B 1ZSVA 2DT8A 2C2HA 3EJ6A 3VO1A 4DAEA 3DWFA 2IS2A 3W1WA 1P60A 4YPVA 4AO8A 3QMMA 3U62A 2X0FA 4DVJA 1BRMA 1D8TA 2P6OA 2YFYA 1CDDA 3DMGA 1K7CA 4GNKA 2XCRB 5JSUA 5GIOE 2HF2A 5FBVB 2QTVA 2RB5A 4AK9A 3V6LA 4P80A 5DTQA 2ZYSA 5LDDC 1Q11A 3HDYA 4ZQIA 1P2UA 4CMCA 5IX8A 3D8UA 4JC4A 2JBAA 2IZ0A 1HFWA 1XTTA 3DAGA 3VNBA 1EXWA 4R01A 1T10A 4CQJA 1I4EB 2QQGA 5BV8A 5KNDH 1QB8A 1AO0A 3C7DB 4TTJA 1T1GA 4GSYA 3QU5A 1DHTA 4TLMB 3PQFA 4DIMA 2A57A 2QY6A 1KEUA 2JDIA 1TA4A 4J1QA 2DQSA 3CHYA 4M1KA 2R11A 1FFWA 3RUPA 3GJ7A 4E4TA 1NV8A 3U3OA 1ADYA 4JXXA 2D2IA 4IGKA 1DIOB 2Z1NA 3KQWA 4GMDA 2B4RO 2J5KA 3AK4A 4KFUA 3NBYC 4PCVA 5EL0A 1R8QA 4YCDA 1UBFA 1XAGA 2TS1A 5C1DA 5I7VA 5AQEA 1Y3HA 3AVXA 4D0SA 2O19A 2QXTA 1G20A 4DDMA 3NW9A 1RCFA 4KQ1A 4OMUA 2PS0A 1HYQA 4RA6A 3GRCA 1X1EA 2JFHA 3AL3A 4OP3A 1VYHA 3EGCA 2E0IA 3KUXA 2QM8A 4JS0A 1P45A 2ZRJA 2PRZA 4M8NE 3ODPA 2ZRIA 3NHZA 3L7DA 1CY4A 4IH9A 4NZZA 2G6BA 3VM6A 4QJ3A 4WOPA 1HR0B 1S8FA 1K3UB 4ZICA 3PKJA 3UWMA 2H2WA 4RORA 1P4RA 2HPZA 2QVYX 3KSBC 3H9EO 4UUPA 1FW8A 4AJPA 3DZFA 2D3TA 4R71A 4L5CA 3S2FA 2IE0A 2O8BB 3UCXA 3EHEA 4HB3A 3DVSX 4GU5A 1W8DA 1XP8A 2R6HA 2AN5A 2V7QD 2QG6A 3DKKA 3O8OB 5K3DA 2DTXA 2ZIGA 4FK8A 1ETHA 4B6RA 5JAPA 2BMWA 2E85A 1KKUA 3FZGA 3NHMA 3NRBA 3ZNPA 4D92A 3UGJA 4JI7B 3IAM1 2P9CA 3GR6A 3WICA 2W8BB 5DJ5A 1Y1QA 4EJMA 1P4GA 2GBLC 5E8RA 1XTUA 5BQOA 3WK4A 2H5EA 5DWDA 3CX8A 1Q95A 1YK1A 3HU1A 1YR7A 5BRNA 2FOIA 3OSZA 3ITDA 4YFYA 1YJCA 4X7RA 3RFUA 5CA1B 4Q18A 3R5KA 4WKOA 1JIUA 4GBGA 4TLCA 2G9VA 2YXEA 5AIAA 1U9YA 4H1TA 3SQOA 2VPXA 1RMYA 4E2FA 1E99A 2H1RA 2O0JA 2BKVA 4V2UA 1PG2A 3QE4A 5G2OA 4LXGA 1T5IA 1IM5A 5B6JA 2CHEA 1YVEI 2XD4A 1HL7A 3IP9A 4FT4A 4J4HA 4KWTA 4LHXA 4YAFA 4BFCA 2H4YA 2HK6A 3B3AA 3EWAA 2UYOA 4MQFB 4CF3A 1CJUC 1SIBE 4DWJA 2O5RA 5BN5B 2FSUA 1TIBA 4LBWA 2O8BA 1P7CA 4ZDIA 3N8HA 3F2IA 2JI9A 3K2QA 3PWTA 3N59A 1UZLA 1U2PA 2PVPA 2QPLA 3O8OA 5LSAA 2A92A 1EP3B 5LZ7A 5CDFA 4ND2A 2YWBA 4DUPA 1C7ZA 3FSEA 4FFRA 3USZA 4OIMA 4CV2A 4TYWA 1ST2A 2W8BA 4U6QA 3AJ9A 3F98A 4A27A 2WOOA 5CHEA 4MCAA 1WPQA 3LBYA 1YS4A 4XPZA 4DOMA 1JIIA 1TKAA 2Q9AA 1VKHA 2WSMA 5J1SB 1XAIA 2P65A 2OCPA 3IQDB 5CA1A 2NZYA 5AXBA 2CMKA 5DN6D 1GNQA 2FK7A 3TAHA 2PD3A 3RAJA 2WLTA 5KOJB 1D4AA 1YAHA 3QWHA 4M0CA 3WIUA 4JGBA 1IZ8A 4RTSA 1NWCA 3SJCA 1K6IA 5FA5A 3I5MA 1WY7A 4R9NA 4ZDWA 3T54A 4E14A 5BW6B 3S1AB 4U0JA 2KPOA 3NM4A 4GYYA 3DQPA 4JBYA 1JR3E 1PR3A 2C5LA 4MQFA 4RNDB 5DH9A 1XK7A 2Y1DA 3KZNA 4J7CA 4LYAA 3U13A 4K9MA 4X1OA 1GTG1 4WKBA 4A16A 1DCFA 5BN5A 1I36A 1Z34A 4MYRA 3TVTA 1NBOA 1TZJA 3ZDRA 4DCNA 3GLHB 3K6RA 5ALFA 5FPQA 2FF7A 1XTQA 4NBSA 1I3OA 5CG1A 1CDZA 5AHWA 1ZVMA 2ZIZA 1WXGA 4PYJA 4QBGB 4C29A 1KJNA 4MUAA 2EW8A 1M67A 4H9GA 1RDFA 1H2YA 4KJXA 1RMQA 2FFRA 2OCGA 4PZLA 4N47A 2QZJA 2Q1XA 4PRYA 5K8IA 2V9CA 3W3AD 1GEGA 3LPCA 3EMDA 3PQ5A 5DHAA 5K2OA 1K89A 4O4JF 3VU9B 4EY5A 1KE2A 5BN4B 3V32A 5KOJA 1GPUA 3X1DA 1W1UA 3GT0A 4LZWA 2X9NA 2Z30A 3HLKA 1QGUB 2QRQA 5L40A 3NVMB 3PDIB 3IE1A 3UW1A 5JISA 3UATA 3S1AA 3T4EA 2QTGA 5HQ3B 1FLVA 5BWMA 1XCGB 4NBNA 3NKLA 2IYPA 3TPZA 3GQVA 4YJFB 5BP7A 2LCFA 4LWQA 5CLLA 1IPHA 3ZQUA 4YCBA 1DV1A 4QDXA 1FP1D 2QMYA 3H0CA 4BZXA 2AI3A 4R0MA 1NF9A 2RGEA 3JX9A 4YRCA 3LCCA 5LDGA 3GLHA 4CLRB 4OGGA 5I9SA 1EHIA 4UOEA 4II3A 4FIDA 1IATA 3JQ9A 4DYHA 1CS0B 1YDEA 4IIHA 1SVNA 4RF2A 1KDTA 2E7ZA 4MVJG 4WOKA 4B4KA 2PKQO 3SXUB 3A7DA 3V34A 1H1LB 1KFJB 3LZCA 4Z2AA 2IX3A 1SXJB 2AXPA 2VPIA 1E66A 3UXYA 1P77A 4BYMA 4X8MA 4G09A 1ESNA 3CZAA 1HF3A 2CY0A 4A91A 4FQ5A 2HJHA 3TQSA 4ZVKA 1TYBE 3U4QB 3VU9A 1KJIA 2CL5A 5BN4A 2D7DA 5JCJD 2W2QA 2CVHA 1IQ0A 3ULKA 2QSZA 4LVCA 2PO5A 4QNMA 2IU6A 3EVTA 3N8GA 3AF3A 5DHFA 1QGUA 3PDIA 5F1OA 4KOAA 3DG9A 4MRPA 3E2PA 4JQYA 3W9UA 1JR3D 4UE3S 5BSEA 5HQ3A 4G8JA 1FX1A 1YNSA 2B69A 2JVIA 4G84A 4YJFA 5T4HA 7ABPA 4S35A 3R0VA 1XDGA 3OA0A 4G4JA 4JJFA 1S3SA 3D8SA 3WA7A 5EAIA 3BS4A 3M9XA 3TDMA 4YYEA 3FCXA 2B5OA 1JLRA 2W43A 4K2HA 4ZCMA 4CLRA 4UUBA 1SQ6A 1KEEB 1KC1A 2A3NA 2QSUA 3F1LA 1TTPB 3TRFA 4AT1A 3ICQB 1CS0A 3OZFA 4AJJA 3BK7A 4TLEA 2HZBA 1DDIA 5LIPA 2HNAA 3SXUA 1JA0A 3HR8A 2B3DA 1AS2A 1MX3A 2J3IA 1BGVA 1C1YA 1H1LA 1A8HA 2O2JA 2YZ7A 1SXJA 4WL0A 3S2GA 4BXOB 1BX1A 1HX7A 5JQGF 3DHYA 2A59A 2ZTVA 4I1PA 1U4SA 1OTHA 5IJAA 4IIDA 3COYA 5FPYA 3U4QA 1HZZA 1GGVA 2YJ3A 1DKQA 2CVOA 2JGFA 3IQHX 3P9PA 3LL7A 4I4IA 1Z26A 2LWIA 2WT9A 5DFAA 3K6SB 1IEVA 4CR8A 1JQAA 1IWBB 2ZTUA 5DNVA 2J9ZB 3T0GA 1K0UA 2BEVB 2P2ZA 2V6GA 4DRXB 3JRNA 3NT2A 4RZ2A 2ZE5A 4J2TA 4FHFA 2HPAA 1L7PA 1TD9A 3G2IA 3L7NA 1FP7A 3LW8A 3PR2B 3C4QA 4KNYA 4OMDA 2ZZNA 1KOGA 3AFIA 3Q2KA 2CHUA 4YUZA 2WBLC 4U00A 3OZTA 1U8EA 4OK5A 3GFGA 3GT4A 3I4FA 1KEEA 2I8LA 2XWQA 5K03A 5JS2A 2J5XA 2ZXUA 1X92A 4HYQA 4L8VA 3ZY5A 2VO1A 2YWRA 4PG7A 2J08A 4FFMA 3Q5DA 2XMBA 2JCBA 1AZWA 4I1IA 5CK5A 3RSOA 3WAGA 1VCMA 3K8YA 4BXOA 1E77A 1W0JD 1WCV1 3AR9A 3M6MD 3CURA 4Q9NA 4LJSA 3VU1A 2CMFA 3QMWA 4OAPA 1BKYA 2IY9A 2FQ1A 2FSSA 1W5FA 4L4XA 4P2BA 3UC9A 5FTKA 1E3TA 3PA8A 1UZMA 4V02A 1P19A 5A7HA 1THGA 3R5TA 4M6WB 2XNKA 3K6SA 4IDCA 3NHLA 2FYTA 4PXAA 4G0UA 2FXIA 4XCXA 1UDAA 2I7DA 4CIXA 4IVRA 2BEVA 2R6DA 5AK3A 4DRXA 1AV7A 4EP1A 1P4JA 3FSRA 3AUTA 2BE9A 4NV1A 4AX8A 2Q99A 1U7TA 1C8KA 2ZAMA 5TIIA 3SCZA 2Y1KA 2FZ4A 2LXNA 4FVTA 3HH8A 3IIIA 3AF2A 4I1SA 4NYJQ 4PLYA 2IV2X 5A5GA 3UMCA 2X0RA 3NLLA 1RXIA 3HB1A 3OIUA 4GBMA 4H31A 3PKZA 3D8RA 3HP7A 4RWEA 4BN4A 1J2YA 3FG9A 2ABWA 4OHFA 5KUTA 1GILA 3QKSB 1N77A 1QYVA 5H4GA 5TJHA 2QZZA 3GF4A 4IVQA 4YXFA 3ESBA 2ZXFA 1T5SA 3SC6A 4UNNA 3EOAI 2VRCA 1E2IA 1ZIYA 4GSLA 3VPBA 3JQRA 2ZRDA 3R4VA 4U6NA 3R75A 4DMGA 2BV3A 4B47A 4QASA 1ZUD1 4JWTA 4X3PA 4R68A 3T0FA 5JZ9A 2FUG1 5HTKA 4J9VA 4UBNA 1CRWG 3I9KA 3VSBA 1BFKA 2GPBA 4KR0A 4M6WA 2F7SA 3U49A 1H3EA 3MMXA 3HO6A 3H5WA 4HLUC 4Q15A 3L1UA 1WIWA 3NHRA 3I6YA 1T34A 3WKAA 2IH5A 1EESA 2QTWB 3I3SR 1EA5A 4DTIA 3W9SA 1G21E 2XMZA 2B5VA 2Z9CA 4IH1A 3PPVA 3AO0B 3ZXSA 1PE0A 2VNSA 2PT9A 3B3FA 1OW3B 1PS0A 5H83A 3AERB 1PFGA 1QWSA 3BQ9A 4OHPA 2DFKB 3FUVA 1KAGA 3ESXA 4JT9A 4RK7A 1E69A 2Q1YA 3GDOA 13PKA 5G02A 3W8DA 1VJ0A 3ZPXA 1USVA 3EXG2 3ZZNA 1OXXK 3PC6A 4MI6A 2ZBDA 4LOKA 2G09A 3W6OA 2VT6A 2QEQA 4Q1EA 2A9RA 1GRQA 3OZUA 4UTVA 3QKSA 1C3EA 1Z5UA 3WMFA 4GO1A 4XARA 4AJKA 4TUYF 3MWDB 1SD1A 2CLMB 2XXAB 2CWWA 1GZHB 4RPJA 4YALA 1EPUA 1BHSA 1K8YB 3CCCA 1DTEA 3DLAA 4HB2A 4Q19A 3QPBA 1AV6A 1V4NA 1Z6GA 2O8NA 4UEWA 3Q11A 1FDSA 1ZUNB 1TQ2A 4PGAA 2ZBPA 4BP1A 3MBKA 3HU3A 1NLMA 2Q0HA 3KVVA 4DUGA 5JXWA 1HT3A 4IDPA 4LKRA 3MFQA 3WLOA 3ZIAD 3HY6A 1SCKA 3LC7O 3PVZA 3IP3A 5JO0A 2WF5A 3UHOA 5IXYA 4FWTA 3RR2A 3FGNA 2HM7A 3VAZA 1CLUA 4EPVA 3OTOB 3EA4A 3KLBA 2VPYA 3AERA 4H2DA 4W5JA 4ZAGA 6REQB 2F55A 1SQ5A 4MW5A 3LI2A 4WNIA 1NUQA 1DEHA 4ZDKA 5AKLA 4JI0B 3CMMA 1A9QA 4IIUA 4K8RB 4KRGA 1Y5IA 1K9VF 3OOEA 4UUOA 3CW9A 3A6LA 3L8YA 4FCVA 1YRHA 3BEOA 3QY9A 4K1XA 4TYMA 3SVTA 2YFHA 4ZVVA 3QF7A 1NJ2A 3FAZA 2CXPA 3M6LA 4YP7A 1JV2B 1Z2NX 1BMFA 4Y6RA 3MWDA 5HHTA 1AMUA 1IN6A 1YCGA 1C0IA 5GAJA 1YB7A 3NO4A 1HEYA 2XXAA 4HXEB 2RGUA 3U7FB 3AR8A 2HK7A 1NM5C 4BEBA 1CY2A 1P7YA 3E1SA 3B2QA 2ENWA 3NT4A 2Y66A 1KHHA 2ZDHA 5AJZA 5ECDA 3G2HA 3TRHA 5GZ1A 1DAGA 1ZUNA 5CB6A 2BR3A 1G59A 2O5EA 1J97A 2IPMA 3NOVA 4CTJA 2QT0A 1JYFA 3BKXA 3B8EA 3UJ7A 2QS9A 3NGXA 2WZBA 4QYWA 1P72A 2P2YA 3T15A 2I7XA 4F5DA 1PJCA 3DAOA 1JEQB 1KZYC 2QN8A 3AU9A 6REQA 2HCTA 4ENPA 1S0UA 1X3LA 4LRTB 4PFSA 2PSHA 4RK6A 2FEXA 2ZVQX 3AV0B 4I14A 3CUWA 1B43A 2AIRA 2F64A 2H9YA 3DOHA 1VFPA 3PDHA 4H77A 4WIAA 1U2QA 1YT5A 3RHFA 1TL7C 2H63A 4OK6A 2RCNA 1OFUX 1NW5A 3U3DA 3M9WA 3GLKA 2IA5A 4KQIA 4L4ZA 1J4AA 2OXIA 4Z1MD 1U0HC 1R0ZA 4C7KA 1NN1A 3V1NA 3GLGB 3F6SA 3QEOA 1OHHD 5HK9A 1XRSB 1YSCA 3UOWA 2OSVA 4L4SA 1HFKA 1MVOA 1DCKA 2OK7A 4HS4A 4H27A 4NVRA 3BCHA 4MH0R 3TCXB 2YQ5A 4UXJA 3M81A 3MWEB 4RLQA 1DG1G 1ULHA 3ANXA 5T64A 1EZZA 2E6UX 3WV5A 1IZ9A 5I9IA 1CPYA 4LYFA 4GRIA 1V48A 2NUBA 1RWXA 4DLTA 5KVAA 3NG1A 1TKRA 1CZLA 3CBGA 4BDSA 4BZZA 2QQEA 4FFSA 3ZZ1A 1RHRA 1JEQA 1VI5A 2C2KA 1PJLA 3IHKA 3ZBUA 3BFXA 3NZEA 2VJDA 3DO6A 4PG6A 3TQRA 3D7RA 3IDQA 2PXAA 4XWWA 1H3FA 5HWSA 4I8DA 5KQSA 1UZNA 1YJAA 4I3GA 4M0LA 2GLXA 3PIRA 1DT5A 1N2BA 2C54A 3KM0A 3OUUA 1CUSA 5HJ5A 4JKIA 2WM2A 3UAWA 3W9YA 4E2WA 2HXSA 4ZO7A 2C9OA 1J24A 1IXSB 4B84A 1I1NA 2H6EA 3DVQX 3IIEA 1W76A 3GLGA 1L5YA 2PGLA 4R1UA 3UG6A 3A58B 2Y4OA 3NGLA 3HFJA 3PXXA 4HGOA 5KVVA 1WQ1R 3HVJA 1MTZA 3L43A 4KVGA 4X1IB 5JD5A 3MERA 1SUAA 4RVFA 5F3DA 5JS8A 3T4UA 2P9EA 4MR8B 2P1DA 2BMFA 4PS0A 3WSWA 1EVQA 3MWEA 3SJBA 4EW3A 4Y6LA 4YJGB 3R8XA 2WU4A 3T7EA 1XRQA 2CFCA 4R0VA 5CU7A 4QT4A 1MDBA 1RWWA 3WV4A 3MJCA 4WY8A 4GOND 1PGOA 3SR3A 2ZI7A 3ZVRA 1EIZA 2GTIA 3TIGA 1MABB 2P4QA 3AY3A 4FR5A 1JLMA 2VWPA 2ZDGA 4XYEA 1MAWA 1R9MA 4YV2A 2NUAB 1N2SA 1H0KA 2A5LA 3ZGXA 1LWNA 2GNPA 2IP2A 2QLNA 4NLLA 4Y0VA 5BSKA 1F6WA 1X70A 3OTWA 4RDHA 4AQDA 1RZRD 1AN9A 2QUIA 1YMQA 3LKDA 1T8WA 3EC2A 5DNCA 4JXKA 2O4UX 4Y0AA 4YYZA 3JAMA 1S2GA 2FPPB 1XTVA 2PMCA 1Z6ZA 3A6EA 3TSZA 1ZVVA 1BYUA 2XE6A 3UWOA 3WK8A 4C4PA 1PYGA 3BX1A 1NIPA 3JPWA 5MN5A 1OREA 2APJA 2HEIA 5KO2A 1GDDA 4X1IA 4H1VA 1EGVB 3FTNA 4QXRA 2I6FA 4MR8A 3UWKA 1QE3A 5K8JB 3FLAA 2EKPA 2GM5A 2EFDB 2JVJA 4I6GA 1FP2A 1B42A 4YJGA 1VSUA 1RABA 5EIHA 1P18A 4ETMA 3LSTA 3BFVA 4M1WA 4PYMA 1JQBA 5CYOA 1WZUA 1BX0A 1NRXA 1BFUA 1E1YA 1AA9A 4P32A 3OBBA 1F0YA 3NDBB 2X2FA 3WMWA 2QRHA 2XVYA 1S6YA 4ARVA 2H0RA 3TSWA 4Y6QA 4UUAA 3WJAA 1V8FA 2NUAA 3DZGA 4DMUB 4F5WA 3BAFA 3OPMA 3A1CA 3B9QA 5T8KA 4A10A 4DQ0A 1G64A 2Z4SA 3QRWA 4LOAA 4ALMA 1KQFA 3AF4A 3OZVA 3HM9A 1GCIA 4OSEA 5EUMA 2PFSA 4LGCA 1YA8A 2CLDX 3P4XA 2FPPA 1VOTA 2H85A 4J0JA 4U7GA 1GGJA 3DLCA 1QTRA 1G2IA 5IMSA 1ST3A 1MLDA 4RKFA 5CMLA 4RGQA 4G67A 5CEFA 5IABA 2QLBA 2ZBVA 2SCUB 3KB6A 4GMGA 3OE7A 4GPZA 3RTDA 4QFCA 2W48A 1MPXA 3INGA 4NYIQ 1L2TA 4GPTA 4HB4A 4NHEA 5LD2B 5BRAA 4ALLA 3QW4B 3GEDA 4DQVA 1VHWA 2BTOA 4EG8A 1Y42X 4GOMD 3PUHA 1MMFB 3JQFC 2QRLA 3SG0A 4RQUA 3IE2A 1SBCA 3QVSA 4A7PA 3SZLA 1OD6A 3QBVA 3RFFA 2HDWA 4QUBA 5CPFA 1QOPB 4WN9B 5J9FA 1E6MA 1GSOA 1DWOA 1EHCA 3CIOA 4CCWA 3ZHXA 1S4QA 4K6OA 1CR0A 5EZYF 2JLZA 1YDGA 3GJ5A 4OMFG 3LPDA 1PD1A 1X2EA 4ID9A 3BXPA 1VZ2A 3HV0A 1JYEA 1BOOA 3DMTC 5ABPA 1OWNA 1QQTA 2XUIA 3GWGA 4S2UA 3WE7A 4BNMA 1F0KA 4CL2A 3L1KA 3LUJA 4GS5A 1KFBB 2VJMB 4CLXA 1AKTA 4YGXB 2QSYA 9ATCA 1FFBA 1Y1LA 4Y8VA 4HMPA 1COWA 4XJTA 5A1JA 1D1SA 1U8TA 5J2TF 1V16B 3W5VA 2NPOA 4B0PA 2SCUA 5AJWA 2I7CA 1G17A 1PO7A 1XJCA 3AZOA 4JQZA 4K7JA 1W44A 1PR0A 5DK4A 3T7KA 3U81A 4EUEA 5LFAA 1RYFA 1A4XA 2IY7A 2Z9DA 3P9ZA 3QITA 2BUAA 1V96A 3DCNA 4O59O 3I8SA 4PG8A 2X8JB 3ZK7A 1WUJS 1I0LA 3F9IA 3WB9A 1U3FA 3UK1A 1V6SA 5KVSA 4M0DA 1UBKS 4MV6A 3V7YA 5DHQA 2GKGA 1EFPB 4WN9A 1VMEA 3KQNA 1UFVA 2IOHA 2W8ZA 3HBLA 1Z4IA 3GA0A 2H5IA 2B2NA 2GJAA 2CXQA 5CBKA 1EVEA 1QTIA 3DV0B 5ALIA 1OWPA 2X8WA 3AIKA 3WNVA 2O5CA 4G63A 1WS6A 2QDKA 4XKJA 3WY9A 3ZEIA 2D59A 1WQ3A 2JGDB 2Q50A 4MWOA 1LRKA 4K5QA 1XO1A 3F0TA 2DTEA 2BR5A 3B1FA 2VJMA 5LMNB 4H08A 4KLNA 5MFPA 3L01A 3FROA 3DCIA 1I6LA 4OLFA 4UKDA 2XB6A 3N8KA 1V16A 2BT4A 4A4DA 4D4GA 2DUJA 4YBZA 2OZVA 4Y9SA 5LP6F 2H2HA 2WYWA 1KR2A 1NX9A 3AM5A 3GLRA 4OQDA 4XR4A 2PL1A 3EA0A 5EIBC 1JQ5A 4FM9A 4MYCA 2VDLB 1ZW6A 2X8JA 4A5OA 3PRJA 2ZJOA 3AEYA 3IERA 1BROA 1UKZA 4L16A 3RADC 5H82A 5DGTA 4QGFA 2NO7A 1EFPA 1HQCA 1Z36A 2CN1A 4H7IA 5J4YA 3HYSA 2B3TA 4UD6A 5GJWC 1ZK3A 2QLLA 4LF4B 2EWVA 4YAEA 1YZVA 3PD7A 3I1IA 3DV0A 4S1WA 4BVJA 8OHMA 3PLNA 1QTQA 2QMHA 4OJQA 1BD3A 1J6UA 4ZQEA 4L50A 2DHRA 2H8GA 2VDPB 2WK1A 4GQBA 3V1MA 2JGDA 3ELWA 3F6YA 3O9ZA 2ECKA 4ND6A 1GUYA 2V9PA 2X6QA 2DKOA 4JOSA 3G0GA 3AOEC 3U0BA 2R8ZA 4ARUA 1GQQA 1RLUA 5TS2A 3BDAA 3G5TA 5KX5F 1ZNYA 3CONA 4IILA 5JZOA 1UJMA 3Q0TA 5DTMA 1LK0A 1SKMA 5LU9A 1Q1EA 1G5FA 3GH1A 3RFCA 3W1VA 4YR7A 3WRVA 5E3HA 1J0EA 1WUHS 3ITEA 3TJMA 3U16A 1NBMA 3OQNA 4NI5A 1XRMA 2MOKA 2Z8XA 5EJGA 5B36A 5AI9A 5HZKA 3SN6A 4IKPA 2WNSA 5EY5B 721PA 1T8RA 1A97A 3HJRA 2R1VB 4CM9A 3MGGA 4MRSA 1JP7A 2PKQP 2Q5CA 3AWDA 2VUHB 3O74A 5AI5A 5TSDA 3AUSA 4RYDA 2F90A 3EJWA 3RHSA 1Y3DE 3OQHA 1FYXA 2QTZA 3C3XA 3ZDCA 1E6EA 3H2SA 1DU4A 3CXUA 3DWGA 2X9LA 3KPUA 3PJRA 2V6FA 2QMEA 1II0A 1PGNA 1CUXA 2R00C 3KTDA 1LI7A 4UXIA 4AIIA 4Z5XA 5ADVA 3GMDA 3CSUA 3LNTA 4AM8A 2QGFA 3KPYA 3MIIA 1P1KA 5AM4A 2I4IA 4M2LA 1A8QA 1E63A 3BMXA 1N5MA 2X1HA 4LMAA 2OCAA 4DIFA 3HXQA 2JJ8A 3GIWA 2CF5A 4L3VA 4YJ2F 1GARA 2F1KA 4DPLA 2WYIA 3VI3B 3T7IA 3RVLA 5JNUA 4PNZA 2JEYA 1YZUA 4D99A 2O6HA 2QMZA 2W2XA 3ILXA 3OM1A 1CR1A 1Q0RA 3BIJA 3WLMA 2VI5A 2JCGA 2ES4A 3PFHA 3UHJA 3MJ4A 2D62A 1T35A 3GLSA 3U5ZB 1M2EA 2A1UB 1ZIOA 2AWOA 2R1VA 3IMEA 4CIDA 1ZJ5A 2BHSA 2I62A 1VKNA 5L7WA 4JXJA 1NY6A 4L6IA 4RU1A 2OXRA 3NATA 2GAOA 1GPMA 4W9RA 1E5XA 5KNCD 2RBKA 4MIOA 5ARBA 1CJTC 4TL8A 3W05A 8ABPA 4JZYA 4Q05A 2PUBA 1TC2A 3B6ZA 3JQQA 4Q4HB 4TT3D 1PCXA 3LZ6A 4QWMA 4FB5A 3FB1A 4I55B 4BJ6A 5J4KA 3ZD9A 5ALPA 4PM4A 3ROQA 3O7WA 4OJMX 2IUUA 2ZUDA 4ZTZB 4GPD1 3UYKA 4A0FA 1G8MA 1KTIA 4YJ3F 2O8DB 4WXPA 2LPMA 4DSTA 5C1OA 1SKAA 1II9A 1QHXA 3SJAA 2QMOA 2W4IA 1VJRA 1I7QB 1XJ5A 4FZVA 3KOXA 4TGLA 3HJGA 2AH5A 1G4AE 2Z56A 4FJ2A 3NI2A 4XWGA 2VHXA 4AICA 4EHDA 1UDBA 1VXRA 4M88A 1FDVA 1V71A 2A1UA 3COPA 5LZ8A 8MHTA 1UJ5A 1VPEA 1YIOA 3E3MA 3MZ0A 1CY1A 1KK1A 1MPTA 4GOXA 2OAQ1 1PV1A 3UAZA 4HLCA 4XWKA 4N9WA 2OGTA 4E5MA 3RGGA 4MDEA 1KSGA 3QA3E 2GZRA 4YCCA 4TXLA 5EJAA 2YN4A 3KSAC 1X19A 2IYTA 4V0MA 3OJOA 4PFQA 2B9EA 1P2FA 4Q4HA 4ACAA 1OWMA 2Q3MA 4N5LA 4I55A 4JVMA 2J4FA 1ILEA 1E32A 2XWBF 4KO1S 3S7ZA 3B6KA 1AURA 2ZM6B 1Y3AA 3D6MA 5TGZA 5EIBD 4CXMA 2OB2A 2O8DA 1Z4JA 3OEEA 5JNWA 3VOTA 4YUXA 1X1CA 3H84A 5T4EA 5HJ7A 2V3VA 2BFEB 4DPMA 3BDVA 3GRUA 4DCSA 3W06A 5C8YF 5TQ0B 1Q0TA 5I9TA 3MMZA 4BRZA 2QKYA 2NO6A 3KWLA 4QLBA 1G8JA 4PBTA 3QNMA 2YJZA 3DMPA 3Q7SA 4B48A 2PZFA 3T5BA 1LJ8A 1NE7A 2HT6A 5BV0A 5JFTA 1V5GA 3PNBA 3WG9A 3KETA 1CUIA 4H6XA 1OR8A 3G2QA 1CNMA 3UAXA 4D0LB 3K15A 4LE2A 1UIRA 3AW8A 1AHPA 3I1YA 3UK0A 2E4WA 4N12A 3ZWBA 3GCGA 5ALVA 4G9EA 4JFRA 3ER9A 5GONB 1K98A 4LISA 4BLRA 4CCSA 4JJ4A 1NLZA 4RF4A 5T6MA 1Q7BA 3GDWA 3SIPA 4DS3A 3EQ9A 4B80A 1R0CA 3FNFA 5HIMA 4AZ3B 3FIUA 5HW0A 3VTFA 4YCNA 1AJEA 2O2DA 1HORA 3C6BA 4NU5A 2CEAA 3FWYA 3KAPA 4GP7A 2FWMX 2YYZA 4QUJA 3U1VA 3GRAA 4Q1FA 2VKQA 4HNTA 3UJPA 2P0EA 3EXFB 4BO9A 1TX4B 4EYQA 3W5AA 3UT0A 4EPRA 2M6RA 3DFIA 3JZIA 4NBUA 1VKJA 1JHRA 3T5AA 1A5TA 1Z0KA 2BFEA 2C42A 2OFPA 2Y1LA 3AVOA 3FNEA 4IHAA 1P44A 4WJZA 5TQ0A 1SPXA 2HD4A 1VYTA 1NJ1A 1ZJYA 3KV1A 2IBMA 5FYDA 5IAEA 4Z49A 1XC7A 5GV7A 2FEAA 5KQMA 1I51A 1XIVA 5HKOA 2I8AA 4CUJA 3UBTA 4U9IS 4HQRA 3AW9A 3P52A 2DHDA 3RRFA 3WLQA 4BO0A 3SKVA 2ZTMA 2R751 2BHLA 1L7RA 2WU1A 1CQWA 5IDQA 5LL6P 4EKNB 1P8JA 2HV9A 3OQIB 3FZNA 4NFHA 2OA0A 3W5BA 1Z7BA 2J3LA 3OCUA 1HT2E 1Z15A 5GONA 2O54A 1YZQA 2ECPA 3WK7A 3C48A 4F56A 1LVHA 2YVUA 3O82A 4F3TA 4AZ3A 3EFEA 3LRPA 1EUDB 1MB2A 1RWNA 3KJIA 1ZNZA 5CT4A 1QP7A 2YJ6A 4DA4A 2H7XA 3LVBA 1ZVKA 3IT3A 3NIFB 4MVJP 4UHJA 4P3NA 1TECE 3BWMA 3D2AA 1K5GA 3CSSA 3RJMA 1Q15A 3WGLA 2W42A 1G3UA 2P69A 2YJGA 3EXFA 3SXPA 4F9EA 3Q8MA 2W6MA 2FN7A 4QJBA 4F3NA 1CEYA 4BKUA 5D8DA 1QBKC 5EQDA 4A0SA 2WZQA 1VKOA 5CXQA 1KZGB 4I4LA 4DCCA 4TKZA 1UJ6A 4FKZA 3Q2IA 4AMGA 2JGMA 4DZTA 2XUKA 1W36B 4HUQB 5FXMA 3TLAA 4Z4QA 4OXQA 4X54A 3T4XA 4KYTA 1NDHA 3L8CA 4OHXA 3DP9A 2Q7OE 1TNDA 3FRIA 1YTUA 4MTLA 1H4SA 2QNBA 1H5NA 3OQIA 5JNVA 4YCLA 1BJKA 3CC8A 4LECA 5JJIA 4Q1DA 4NJEB 1XQWA 1G3IA 4BE4A 4W5TA 1DE0A 4QXQA 1C5KA 4OQFA 1LLCA 4ZXFA 2MT9A 2YIMA 3AX6A 4XDGA 1I3NA 5B4VA 3CO0S 4FU0A 4NBLA 1EUDA 2QRUA 5JNLA 2YZKA 1E2UA 1MJNA 1W2WB 4TZ6A 3FUXA 1KAEA 2YZGA 3OG9A 2BGLA 4JVLA 4QGHA 3WOHA 3V46A 3VFDA 1RE1A 3E53A 3IVMA 1QRUA 4Y9UA 3CCFA 1AKVA 5HIIA 5ALZA 4BTLA 4CG1A 1BSVA 1Y1PA 2KI5A 2XYHA 4HPWA 5B3JC 1U0GA 4NOMA 1UJNA 2ZYGA 1ACJA 2TSYB 5KBYA 4Z4GA 1CJBA 4A36A 1EFHA 2XWSA 3ZHTA 3PX2A 5A0TA 1P1BA 3BYZA 1NVWQ 4RGYA 2GETA 5TPZD 1UEIA 1K3FA 5IT0A 1ZL2A 1GYQA 1TF2A 4ZHQB 2WA2A 4HUQA 4W9NC 4ZAZA 2BHRA 5B57C 1NHGA 4AUKA 5JJCA 3U09A 4TWJA 2HMSA 3FLEA 3KJGA 3LA8A 3M1IA 3GAMA 3PQ2A 1WP4A 2AOUB 2WTMA 4D5EA 1NGSA 3KX2A 2H4HA 4EFNA 2H52A 2Y27A 1NQXA 4YT5A 4RW0A 3SEAA 3FVVA 3KKEA 1EG2A 4NJEA 2FR1A 1XZMA 4JBWA 2Y68A 5JDCA 3EGWA 3NVDA 3L4KA 2OHHA 1IG0A 2QD4A 1B26A 4N82A 3QG1A 4JELA 3I72A 2NZJA 2AN3A 2NYRA 3DXFA 4KR9A 1YULA 1MHPA 4MYDA 1YS6A 4ZAVA 2AYXA 4J3NA 3S44A 4GMXA 4CDGA 3AL2A 3QHPA 2NN3C 2WY2D 1JIJA 2BPOA 5AHKA 3OE4A 5E9AA 3RVMA 5ULLA 3H17A 3FMOB 3D02A 2PL3A 4F4CA 4FN4A 3PPIA 3QQPA 5GQSA 4A6DA 5I7SA 1TA9A 2RHWA 3GEBA 4GXQA 2Q9CA 3TMAA 5K05A 3DE3X 1TJPB 1NULA 4X24A 4ZHQA 1UP7A 1UXJA 2WPDA 3WL3A 2A0KA 1GTZA 1NW6A 1FXUA 4BLTA 4EELA 2ODWA 2AOUA 1N7IA 2PSSA 3NETA 3JAKB 4UHEA 4RXMA 5LQUA 4Y30A 2IYYA 1DTWB 2OLKA 4OI1A 3MCWA 2VNHA 1JECA 1BVRA 2FR8A 3CW8X 3B7WA 2OCBA 1SZCA 4FXOA 3PXEA 1DAOA 1O9BA 1QYXA 3BRQA 3OECA 4PWZA 3NBZC 3HKBB 3R2JA 3W2EA 2XBMA 1ZOLA 3NC4A 2J7KA 2F3SA 2QR3A 5GVSA 5ALRA 2W6PA 1UKBA 3QX8A 2BDUA 3R7FA 3ISJA 3A3OA 3RIGA 3JQBA 3SFVA 5CG2A 2J6CA 4MI3A 3MLEA 2DP4E 1ODTC 1WQ4A 3PUZA 3H83A 1M34E 5KNBD 1BKSB 1XDSA 4WCFC 5IZ4A 4B8YA 3L06A 2H3HA 3R7SA 2ZI5A 2QTTA 2WWIA 1DUVG 1EFRD 3E9RA 2IDMA 5A05A 4OQMA 1SVSA 3RU7A 3X2FA 4LDQA 4YMUA 1FY2A 5DCLA 1N9ZA 3HYNA 3O31A 5BSWA 4DJJA 1E2PA 2AG6A 1PSDA 3QLVA 5GTDA 3CEHA 1CRPA 1M2FA 3P0FA 2OCIA 4FFNA 2OGWA 4M60A 5AI6A 3UV3A 1UM8A 4LDJA 3EXEB 1RW4A 1UH5A 3AGPA 1SUDA 1QIEA 3JAKA 3FVWA 4H7HA 3G9QA 1CUUA 1LBHA 2CVQA 5JECA 1E1NA 1B4DA 4FFWA 1IUOA 2DLDA 4GX5A 3QF4B 5A6VA 2FPXA 5TMBA 3QNWA 4M89A 1PBNA 2ID7A 2W22A 1NP3A 3KKOA 4MVJA 4LC0A 4OXNA 4D81A 4DIEA 3HKBA 3HQ4O 4G4SP 4GF5A 3BXZA 4RL6A 4JZKA 2P90A 5DNYB 1ULTA 5G0UA 1EKXA 5JAZA 1UZUA 4JLMA 1FQWA 2IYOA 3FYUC 1MDFA 1A5BB 2NAFA 1UDCA 1EU1A 1UC5B 5DHRA 3C4JA 1QV9A 3NBAA 4QHTA 1JYSA 4BTEA 4QOSA 3JQCA 4ZCLA 1NG9A 1CNEA 1QFYA 1A8SA 4BU1A 4RENA 5ICSA 5JO9A 5KSOA 1L9KA 2IYSA 3CUUA 4PY2A 2IWHA 1C9DB 3N2GB 3TINA 1GZ4A 4EF6A 2PMKA 3TLXA 3H75A 3TVYA 3IIKA 2VSFA 3D4NA 4OQ4A 1YQUA 3EXEA 4JHLA 3V4LA 5CYGA 4KR3A 1XCOA 5LB4A 2FZGA 5HKKA 1ISIA 1ZM7A 2AOVA 2A5FA 3DFMA 4Z86A 4LDAA 3KAJA 2B1RA 2GHTA 2E5LB 3FFTA 4BGVA 4GKKB 4GNRA 1A8PA 3QF4A 3A1FA 5J43A 4ZV9A 1NXQA 3GFFA 2J7PD 2VOJA 3CNQS 4IQ0A 1FJGB 1DXQA 3H97A 3LT1A 5FHRA 1OJLA 3Q3JB 3SXJA 2C0QA 2TECE 4ODIA 3H1BA 3JD4A 4I36A 4B3XA 1XMXA 1E0KA 2B36A 1F2TB 2UZ0A 3UUWA 2ZSEA 4M8SA 2UXCB 3I39X 4IINA 2GGSA 3FJYA 1VC2A 2HZ7A 3E05A 2H1FA 3M6XA 5TEWA 3V7UA 3WYEA 3K5HA 2EBFX 1N6PA 4D6XA 3E5RA 4EBFA 4BNFA 2Z3VA 3QIAA 2EGHA 2UUCB 5KWJA 3N2GA 1IM8A 3N7AA 4CKXA 2LIPA 5B64A 4IXTA 3MF4A 2WJIA 4LPKA 5LQMA 4DJFC 1ISGA 5CH5A 5JMWA 2YOHA 1RBQA 1N3BA 1QIIA 3RS7A 4M0UA 4J43A 4M49A 3U3XA 3QNUA 1M9NA 4TSFD 4HYEA 3T52A 4YRIA 2QTCA 2RKOA 3U3MA 4WBNF 2RGNC 4A8JB 1IG3A 3H5LA 2JRLA 3OWHA 3HI4A 3K2EA 1YFJA 1TPZA 2C8LA 1DHRA 2JPDA 4PLGA 4W5WA 4GQAA 4C0WA 2GFHA 5KTPA 1U63A 3Q9UA 2BP7B 2P78A 2HV8A 1Z4KA 3LBHA 3RSFA 2BFNA 3VYVA 1F2TA 3D54D 4LYHA 2YWHA 2R9VA 2X7JA 3CCBA 1H8HD 2G17A 1GRRA 1O94C 3CNLA 4QUHA 4TV9B 1KOLA 4UM9B 3E2MA 3H4TA 5CEEA 5GM1A 2QP3A 4FOPA 3QE9Y 1EUYA 3WWEA 2IEBA 4QSMA 2P9TA 4PYNA 2JG3A 5EZQA 3EX7C 5TT0A 3TQTA 4XD7A 3R6LA 5CW2A 4EJSC 4IW3B 4PGGA 2E89A 3NM6B 2WAMA 3DR3A 3ET4A 4G0NA 4PHTA 1LY1A 1DIHA 4KQWA 2HB6A 2PGIA 4URWR 4F8YA 1GYRA 3KJNA 2Y1OA 1MUUA 4HN2A 4YCMA 4TWRA 1UWVA 4MUMA 3G6WA 4W1PA 4IMJB 3A27A 5JWOA 4QKQA 1AN0A 3KS9A 3H6GA 3B7GA 2SKEA 4HFNA 1QQ6A 4DM4A 4A8JA 3T9AA 4E0BA 1FNNA 3CR8A 3TLJA 4CMEC 3KDPA 3OPYI 3DMYA 1NQ5A 3P8ZA 3EY4A 3PXCX 4GGPA 4HK4A 3WKBA 2VT7A 3N74A 2BP7A 4LHVA 3GEIA 1QIHA 1J8YF 1Y5NA 2H0QA 3INRA 4KAAA 4KK4A 4QBHA 4R81A 4X7PA 3KZVA 1I32A 5AKYA 1SKQA 5JARA 2C4HA 2OR3A 2Q6IA 1LQUA 5DXJA 1O58A 4TV9A 1DJOA 3VR5A 4O6VA 4K05A 2PVSA 5J47A 2K2WA 1E59A 5DBEX 3CGWA 4Q01A 4YMLA 2ZM5A 5BV7A 1JIXA 5D2CA 3I83A 3GGJA 1KC3A 1PYDA 5AKIA 5IH7A 5L8VA 1WU7A 5T3YA 4RZ3A 1R0KA 1ZL0A 3ROZA 5EHGA 5CBPB 5JT1A 1DQNA 1HLPA 2N9UA 5IT5A 1EDOA 5KNLA 2AG5A 1DB3A 3AB3A 4M53A 4ZV7A 4QT0A 5IAJA 4ZV4A 1GKIA 9LDTA 1N57A 4NCHA 1N6KA 2WQZA 1G6KA 2WE7A 4JUBA 5AK4A 4IGFA 3FPLA 3PNOA 1NN0A 3DCJA 3KKNA 3S8EA 1U9IC 2Z5VA 3DLPX 2RARA 4ABYA 3R3UA 2F9MA 4CF6A 4D9EA 2XKKA 4IDEA 1E8NA 4KDFA 1ORTA 3K1TA 4ZYLA 1DXOA 1NVKA 2F3RA 3ADDA 1UWKA 2BM9A 1T2AA 4GGMX 1HLFA 4XIGS 1XZFA 5JSYA 3VR6H 1DG9A 2IGTA 4BB9A 5AI8A 4ZCPA 2Q3JA 4M7OA 4H1HA 4F6CA 2SECE 3BMNB 1M0EA 3IBGA 5K0SA 2MSDB 5AESA 5C2JB 3H9BA 5MDHA 1QMGA 1WDKA 3F6BX 3PFGA 3L8MA 4D9CA 2WJ3A 4BJ1A 3D5TA 1IQPA 3A28A 1NC3A 1YC2A 4NNPA 1BGWA 3STVA 4O1HA 3VKVA 2NV6A 4X6XA 5HKBA 3VISA 2O6LA 2DFNA 1QYWA 3PQCA 4H35A 4N5DA 1C9KA 4R05A 5CBPA 4U7DA 4NS4A 1E2LA 5I51A 2DSTA 3NIDB 2YASA 1N2CB 3R9KA 2IODA 1O03A 5SY9A 4CKYA 3EEYA 3JWHA 4YMVA 3W8RA 3EWSA 1LLFA 3H19A 2VRBA 3DGEC 1OH5A 4E33A 5KOYA 3GLUA 1RXWA 1XYVA 2B21A 1Z63A 3PJGA 4MI1A 4DQUA 4PFJA 4QQKA 3EZ7A 3SYMA 3IBSA 6PFKA 2FDXA 2GBPA 2L69A 3QPVA 3RVNA 2DJIA 4P33A 4OJTA 2JJ1A 2VZLA 3AP2A 2Q28A 4ZT4A 4CM7A 2FNAA 3BGSA 2BFWA 3K72B 2RD2A 1MVNA 2NT3A 3BMNA 1R6UA 4PC7A 2C0PA 2OCYC 2V0NA 1LSJA 2X14A 1SBZA 3H2HA 1AQUA 2BCJQ 5IG2A 4KO8A 1XZJA 3SSOA 4B34A 1PWYE 1IBSA 1ZIPA 2P9YA 1IHDA 3AB7A 3WR5A 2IYUA 3OM9A 4HLQB 3RS9A 2FN8A 2W2LA 1DO8A 1ZK0A 2C83A 4H4EA 1XRNA 4NQZA 5IJZA 4S0XA 4IDOA 2X5NA 2CV0A 3FX2A 3M34A 4F4DA 3LY8A 3W5UA 4KLCA 2O0KA 1WSDA 1BS1A 3Q85A 2O3QA 3OPQA 4B6SA 4GX0A 1N2CA 3FRJA 4WCVA 1NAIA 1CLEA 3LK6A 3DMDA 3IQXA 5HIAA 1SUPA 4KV9A 2X0IA 5JZBA 3LC0A 3RSHA 1NBAA 3ZTTA 3U7JA 3DXYA 2B8EA 1I2BA 4EJ2A 1KEPA 3NUZA 4PGFA 4M21A 5DBGA 4KFCA 1Z3IX 4I3FA 4OYLA 1O94D 2IEYA 1Y8AA 3MWJA 3N07A 3O5AA 4R31A 2HWXA 4BOYA 4PX2A 5KQLA 5FLXA 2PE5A 4OGKA 2QROA 1Z4QA 1YKGA 3FPSA 3DDWA 1CVLA 1FTYA 1O6GA 1SWWA 1EEHA 4PLPA 3TTSA 3ERCA 3H0KA 1U7HA 3IURA 4ZVUA 2F9LA 1D07A 3GY0A 4KVAA 1Y81A 5BWLA 1JL3A 2NSDA 5BSHA 4HD8A 1KVUA 4GZMA 2OK8A 5EQFA 4UPEA 4REQB 1CP2A 3IR5A 3HNPA 3N05A 4N6OA 3QBTA 3IEKA 1O95A 3HNRA 4TMFA 2KM1A 4MARA 5BR7A 4DDVA 3ZC3A 2TYSB 1ODFA 1P2TA 2QTHA 3C7TA 4L0MA 4U5XA 4DR3B 4WECA 3FDJA 2GILA 1K4MA 2XRFA 3O38A 1PKXA 2ZK7A 1OPXA 2WQ6A 1XQXA 2HGSA 5FOXA 1BMDA 1TYAE 1WKBA 3RLFA 1HM5A 5DGXA 3X1KA 5AUPB 3U6BA 5C46F 1D2AA 1MGPA 1UWLA 3FW1A 3PHLA 3C5HA 2ODEA 2OO5A 4I6EA 5JSQA 5IWAB 1V9CA 4L9WA 3O8BA 1XTIA 2QQ0A 4Q7LA 3HBJA 3WIVA 4GT1A 1GL7A 2PUHA 3CZQA 4HAVA 2X1VA 4KE9A 3N0VA 4DEVA 2XEDA 2WSBA 1E96A 5AW3A 1CUFA 5ECWA 1UC8A 1PX2A 2PKRA 4AMZA 1RHQA 4YXWD 3AVVA 2UDPA 4R1LA 1U7DA 1M7HA 2WM8A 2WAOA 1RJGA 2JHFA 1EQUA 2OYRA 2R1UA 3UMYA 4REQA 1QIMA 3T1HB 2AQHA 1LKZA 1PFQA 1VHLA 1VLHA 3GXBA 5CJ2A 5LUBA 2ZUTA 4E12A 3GPLA 2MR5A 1OXMA 1SVIA 3AJRA 1R00A 4ZEVA 1KI8A 2QIPA 2OFFA 4BLSA 2COEA 1KY4A 2JD1A 1AHIA 3CNBA 1JE1A 4D8WA 1EWVA 3UK7A 3WSTA 1GPWB 3H3XA 3ZXXA 2H8KA 1J09A 1R6AA 1KYTA 5I5EA 1IEWA 4UHKA 3UKJA 1NXTA 4HO1X 2FPUA 1HOTA 1V7CA 3TZBA 4XGNA 5FWDA 3DE1X 2FPIB 2HUPA 1HSOA 3DB2A 4Z7NB 4G0QA 1ULUA 2CLCX 3AF5A 4UQLA 4MOWA 5EIOA 3UMBA 4QQNA 4FBGA 1EQ2A 2N42A 5DU2A 2ORWA 1OWLA 4H6VA 4D96A 3TOXA 5IJWA 3RBAA 4DXHA 3K53A 2B94A 3I05A 4EB6B 5I3ZA 4YECA 2OECA 4R8LA 2Y1EA 1WDLA 1TZMA 2PLWA 3R77A 2XT6A 2SHKA 1T8UA 3OQPA 1P7PA 4R16A 1AH2A 5EKXA 3AJ8A 3BL8A 5ESDA 1DKNA 4BBZA 4GLLA 2QE7D 3LA6A 5FTLA 5B7QA 1A9OA 2GAJA 2ZJZA 1BG6A 5ALMA 3H3FA 4GR4A 3QHQA 4HQ6A 1EUZA 1S1MA 3MBIA 5TQJA 1SVUA 2HDHA 4NDZA 3TCKA 3FWPA 3TX2A 5GPBA 4U2KA 3LPAA 2HAEA 1IRIA 4MJ3A 5TGTA 4HAYA 3VZDA 4BMXA 4F96A 1U3CA 4YDQA 5J4VA 3UA3A 1U0RA 1K9SA 4OHRA 1ENZA 1DDOA 4PO1A 5U4XA 5EJEA 3IXLA 1O5TA 4DZRA 4X9XA 2FPIA 2G04A 2J33A 2F1OA 2KQUA 1H6BA 5DGHA 5AM1A 5HILA 3WNDA 1U8ZA 3G0IA 4BMNA 3ZVNA 2YDYA 4XB1A 3M6IA 5JU6A 3EF3A 2H29A 3C4VA 4M86A 2QL9A 5CCDA 2O5VA 2O8VA 1JAXA 3BULA 2GHIA 4EB6A 4I50F 3ZTWA 3I53A 4DLZA 1IC6A 2EKQA 1GFWA 4RTJA 3I52A 4J0KA 5DO9A 3RNLA 1JW9B 1RWMA 1OC4A 2QN2A 2CLFB 2XWPA 4MUNA 2QMQA 5E95A 1E20A 4HLDA 3WYAA 5C8DA 4LJ4A 1NFRA 4V0RA 2QX8A 3IOCA 5KTOA 2GBCA 3G2JA 3UZUA 3W3ZB 1Z38A 5K0GA 3MGCA 4J7AA 2YHBA 3HZOA 4G1CA 1XZEA 4Y9DA 3VXKA 3HLYA 1HNZB 1IOLA 4WEQA 3Q98A 1GZ7A 2XQGA 3NDIA 5GMOA 1AK1A 2ZUUA 1KEVA 1QGYA 1KEWA 3WFZA 1F5SA 3NBMA 4JIMA 5LIRA 4XOIA 1KEKA 1KY2A 1S1CA 1QVRA 2VTEA 2WWFA 4JL5A 2OTCA 3OLZA 3OZDA 4PXSA 1AZLA 2AYYA 3CS3A 3OWOA 5I9BA 1FB5A 3MLAA 2DC1A 2FW0A 1RBZA 2IE8A 2Z6VA 1CDOA 4BVBA 4E03A 5GZ3A 1LDEA 1OLXB 2B92A 4P3YA 4MQ6A 5AVYA 4RKEA 3OX1A 2H2GA 1JKFA 4M9UA 1GP2A 4TOIA 5CFZA 3WL4A 2DKNA 1GTVA 1KQ3A 2RONA 4HS9A 4YWHA 5BSTA 3CNNA 2JIRA 3VR1A 1QMPA 3JQAB 5IXSA 3QG5A 2LTAA 2QN9A 1EM6A 4O5OA 4ZO9A 3VVBA 3MILA 5ILQA 3TI9A 3VYWA 3WWYA 1HE4A 4ME6A 5DASA 4CKEB 3ADPA 4ZO8A 3OH8A 5FD8A 5ALTA 2O8CB 2RAPA 2QG9A 2O20A 5AVJA 4UMEA 4B7UA 4CTOA 3PENA 5ER6A 1GU1A 2PRKA 1AKQA 2IHKA 1KI1A 5FPPA 2BYTA 2CEKA 1UKVY 2ZUSA 4LBYA 2FY8A 2BI8A 2QPOA 3HB7A 3TBHA 4YMWA 2GZDA 3K5PA 1TMYA 3WGVA 2JAQA 4JJAA 3HBFA 1TO6A 3NOOA 4FJ0A 1S5PA 1LS6A 3IILA 1RHJA 3BGWA 4R1QA 4JI4B 2PBRA 1XMSA 1EP1B 5K8LA 2X0KA 1HTWA 1OLXA 2UUOA 2UZ1B 4L7QA 1TM5E 1VIVA 3PK0A 1I7LA 1GR1A 1NW7A 3L04A 4W63A 3E3LA 3ZW9A 3IBTA 3JQAA 5CA0B 3MQFA 1P2DA 2CZGA 2PKWA 1X7WB 2I03A 4I81A 3QYJA 1D1PA 4CKEA 4IUCS 4I1RA 2VYVA 4ISBA 3UW3A 1KDPA 3P2IA 2PT5A 3KKLA 1BCRB 3RS2A 4EQZA 2YFQA 2O8CA 4BWYA 4L4YA 1CUYA 3RC3A 1SBYA 3TL2A 1NQOA 4OIFA 2P7IA 3V5NA 1AIPA 1OGJA 5G41A 3RC7A 3GVXA 7MHTA 2DSNA 4HJRA 2X1LA 1BXZA 3OHSX 4ZU6X 4D43A 2WR8A 1LSUA 2DWQA 3BXOA