3A7DA

Crystal structures of rat catechol-o-methyltransferase complexed with new bi-substrate type inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
214
structure length
214
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Hit to Lead: Comprehensive Strategy of de novo Scaffold Generation by FBDD. Part 2: Ligand Fishing using Mass Spectrometry by Detection of Ligand-Protein Non-Covalent Complex after Matrix Click Chemistry
rcsb
source organism Rattus norvegicus
total genus 83
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2009-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3a7dA00
5E1BA 2XVMA 3BUSA 1L3IA 1FJXA 3GO4A 1QAMA 3OU7A 1RI4A 4R8SA 1IM8A 3EVZA 5E1MA 4F84A 3Q7EA 4WXHA 3JWHA 5FTWA 5KVAA 1WS6A 3FTCA 2C7RA 1RI3A 4GF5A 4IKPA 5EKXA 4GEKA 4AX8A 2P7HA 1VIDA 5K0JA 3REOA 5K0CA 4P7KA 1UIRA 4RTNA 4P7GA 3UJBA 1ZG3A 5EHIA 1T43A 1WY7A 4PYMA 3P9IA 4HTFB 3GGDA 1ZGJA 2G70A 3EPPA 3KPUA 2FRXA 3ERCA 1TPYA 2P3LA 3NDJA 5JUWA 3GRVA 2P7IA 2YXLA 3HCBA 4JXJA 1N7JA 5HOQA 1I4WA 2ZIFA 4PYOA 1R8YA 4GOND 3MCZA 5G02A 4OX9Y 3BZBA 5DTRA 3FTDA 5LQNA 2WA1A 4C07A 3KQTA 4YUWA 3TOSA 3EEOA 3X0DA 2FK7A 1YFLA 4BY9E 4C03A 5EMMA 4YUVA 4RVFA 3OZRA 3TLJA 1O54A 2VDUE 3K6RA 3VYWA 2ZWVA 1XJ5A 4PWYA 3UA4A 3FUUA 2ONZA 3H2BA 3HCEA 4IV0A 3O4FA 4QQKA 5KQRA 4LWOA 2VS1A 4Z2YA 2I9KA 3CBGA 1EJ6A 2GB4A 4GUAA 1INLA 1WXWA 4OA5A 2AOTA 2GH1A 4RTJA 5DRTA 3LHDA 2PLWA 4X1OA 1XXLA 2C7OA 1FP1D 3MCTA 4X61A 5C0OE 1AQJA 1FBNA 2Z6AA 1NW3A 5K0BA 3UJ6A 4CKEA 3NVKI 1VE3A 5DPMA 3DXYA 1Q0SA 5DX8A 5F2OA 1EJ0A 3KPVA 4C06A 4CWAA 3LBFA 4F85A 3C0KA 3ER9A 4QVGA 3KR0A 4X41A 3DULA 3OU2A 5F2NA 5ICGA 1XTPA 4QTTB 4EKIA 5K03A 3ELDA 4C05A 5K0EA 3LDGA 4M36A 1BOOA 5EC8A 3UFBA 5D1HA 3KR9A 3HCAA 5GIOE 2QRVB 3M6UA 4ER3A 3HTXA 1QAOA 1FP2A 4NECA 5HZMA 3B3GA 4L7VA 1NW5A 2OKCA 2VZ9A 2NXCA 5FA8A 1QANA 2OPBA 2YR0A 1YF3A 3DMHA 3KU1A 5EEHA 2JH8A 7MHTA 4HG2A 5FQNA 5P8WA 4CXMA 5K01A 5GP1A 3BWYA 3P8ZA 2B78A 5BW5A 5BW4A 3OE4A 1YZ3A 3TKYA 2YVLA 3G89A 1VP9A 3G7UA 3OFJA 1RI1A 3HNRA 3PT9A 1X1DA 5CVJA 3GCZA 4E30A 4P7FA 3B3FA 4BP3A 2K4MA 2XVAA 4PINA 2QM3A 3KQPA 1R6AA 2Y1XA 3IHTA 3MAGA 1D2HA 4R6XA 5EIFA 4ER6A 2WA2A 4DQ0A 4PNEA 1JTFA 3JWJA 5M5BA 2ZFUA 3FPHA 4PYLA 3EVEA 2FCAA 5EGSA 3PFGA 2CKDA 4R05A 2P35A 4U7PB 2B9EA 5ICEA 3CKKA 1EQAA 2G8NA 1ORIA 2FHPA 3I64A 1L3CA 3VC1A 4G56A 2NP7A 2JH9A 2HTEA 2H00A 3DXZA 3UJ8A 3DOUA 1NBHA 1JSZA 2P3QA 3FRIA 3UJAA 5BP7A 4PIMA 4RTSA 4X60A 4F86A 5DXJA 2ADMA 1X19A 2ERCA 3EVGA 3FUTA 5DLYA 5GOZA 3UJCA 4HC4A 4OQDA 1G38A 2BH2A 3PFHA 1P1BA 3HVHA 3NW9A 4A6EA 4FT4A 3GJYA 4P58A 5E1OA 5T6BA 2GAFA 2VDVE 1SQFA 2AVDA 3FUWA 3G2QA 3PTAA 3UWPA 3EVCA 4UOEA 2HNKA 4GOOD 4FZVA 3KKZA 1Q0TA 1NE2A 5EMLA 3M6VA 3SX0A 3FZGA 4RTPA 2Z6UA 3LCCA 3DLCA 1HNNA 3UZUA 3GU3A 5K0LA 4RV9A 1SQGA 3CVOA 1NW6A 5E9JA 5HEKA 1IY9A 1JTEA 3TM4A 5KYGA 2NYUA 1BC5A 2FYTA 2ZZNA 1NT2A 4EVIA 3U81A 3ELWA 4MTLA 4YUZA 2O0LA 1P1CA 2P3OA 3GDHA 4YV1A 2H1RA 3OZTA 4FR0A 4Y2HA 3AXTA 1F38A 3NTVA 2B25A 3A25A 2XBMA 2AOXA 3BWCA 4ISCA 3G5TA 2AZTA 1VLMA 2QY6A 3DXXA 3NWBA 1X1CA 2ZZMA 1Z3CA 1RJFA 4XUCA 1KYWA 4ZTBA 5HIJA 3NJRA 3P71T 4OBXA 3HEMA 5GWXA 3SXJA 1ORHA 2PX5A 2VP3A 1KP9A 3K0BA 1JR4A 2QYOA 3HVIA 5GIPE 1P91A 2JJQA 2Q41A 3LECA 2OBFA 5EZSA 5EKUA 1MHTA 4HH4A 1ZQ9A 1M6EX 2AOVA 3SVZA 3KQMA 1VL5A 2O06A 5K09A 3ORHA 4EKGA 4OQEA 3LX6A 2CMHA 2PV0A 3DUWA 3KQOA 4PCLA 1YZHA 2DPMA 3SMQA 3T0IA 5U4XA 4POOA 5LQRA 3P9CA 4PYNA 1B42A 2FPOA 3DR5A 2IDJA 3HA7A 3NMUF 2PX4A 5LSAA 3KR1A 5ICFA 1L1EA 4PYIA 2G1PA 3EGVA 5FHRA 1VBFA 1QYRA 4BLUA 4V0RA 1YUBA 3LSTA 4RSRA 4P7JA 1UFKA 3A4TA 3LDUA 4HGZA 1JQEA 4DF3A 3SSMA 4RVHA 2AOTB 4YUYA 1XDZA 4B17A 1AF7A 4A6DA 3PX3A 3MQ2A 2IIPA 2IH4A 5CIYA 2HWKA 2IFTA 2P8JA 4K6MA 3E8SA 2A14A 2G71A 3HCCA 3R24A 3BGVA 5IKMA 3UA3A 5LQJA 3QV2A 3BGDA 3HVKA 4MWZA 2PXAA 5FADA 1D2CA 1V39A 3BWBA 3GIWA 4M7RA 3T7RA 4DM3A 3GWZA 3OE5A 2AOUB 4WVLA 1AQIA 5E8JA 2O57A 4FS8A 3B5IA 2HMYB 5ICCA 4HSGA 4GQBA 1BKYA 4M37A 3NWEA 3V8VA 2ZTHA 2AN4A 2IPXA 5EIWA 3B7PA 3OFKA 4Y30A 4ER0A 4QTUB 3A27A 1JG3A 1AV6A 3G2OA 1QZZA 3KPYA 3SSOA 3KQSA 3AWIA 3MB5A 2OB2A 3CC8A 1X1AA 1M6YA 1HMYA 2PJDA 3PVCA 2ONYA 3DTNA 2NXEA 2PY6A 3KQQA 3QOXA 3DLIA 4HTFA 3TKAA 5GM1A 3UJ7A 3C3PA 1H1DA 3C6MA 3ELYA 3EVFA 1G60A 5DWQA 3GNLA 1NW8A 2PSSA 3FYDA 5DM2A 4AZTA 2NXJA 1JSXA 1UWVA 2OB1A 3OZSA 5DX1A 4DKJA 2CWWA 2QE6A 2H11A 3EVAA 1DL5A 3ELUA 2DULA 4GBED 4FP9A 4M38A 2JG3A 4RTQA 1JG1A 3S68A 2R6ZA 3P9KA 4E31A 1KPHA 5EVJA 2R3SA 5GM2A 5D1NA 1N7IA 3BKWA 3I9FA 3HVJA 3Q87B 5H02A 4DMGA 3SR4A 1TW2A 3OPNA 3A7DA 2BR4A 4GOLD 2PX2A 2IGTA 5DRYA 2IDKA 5T67A 1EG2A 2PXCA 1YB2A 2OZVA 2GPYA 1U2ZA 2UYOA 2EX4A 2PXXA 3RW9A 5DM0A 5ERGB 2P40A 2ZZKA 5DX0A 3QOWA 3MTIA 5DXAA 2P41A 3G8BA 3IEIA 4ER7A 1ZGAA 2UYHA 2ZIEA 3LL7A 3THSA 3CCFA 5LR6A 3LGAA 3T7TA 4GOMD 3MGGA 5K0NA 1R00A 1WXXA 2QRVA 2ZSUA 1KR5A 4FSDA 4RTKA 4QPPA 3MHTA 1XVAA 1Y8CA 4V0QA 2NXNA 3MERA 4CTKA 1JQ3A 3FRHA 1QAQA 5DT2A 5IH3A 3UJ9A 1SKMA 3CGGA 2ZVJA 2ZLBA 2PVCA 3NVMB 4RTMA 1BHJA 4RVGA 4BLWA 4E2ZA 3GRYA 1NV8A 3BWMA 5EOVA 5K0FA 5EZQA 3D2LA 3B89A 2ZWAA 5CVUA 1DUSA 2CMGA 3TQSA 3FTEA 3AXSA 4O29A 5DTMA 5DSTA 4RVDA 5HILA 3DMGA 4HGYA 4R6WA 3B3JA 3LKZA 5LQAA 3VSEA 5LQKA 5FULA 4FT2A 2JHAA 4DCMA 1NBIA 5FQOA 4EMSA 4PYKA 1KPIA 2XYVA 2ZULA 1F3LA 1FPQA 10MHA 3E23A 5C9ZA 2EFJA 3A26A 2PT9A 5LQUA 2AR0A 1JG2A 5DM1A 4AUKA 2O05A 4MIKA 1KIAA 1PRYA 1RJGA 2GS9A 4CKBA 2YTZA 3KPJA 4RX1A 3LCUA 3KR2A 4U7TB 4X63A 2NNWB 5MHTA 3G2MA 1TW3A 2ZBQA 3G5LA 4KDRA 4XUEA 2AN3A 4OA8A 5DSXA 1O9GA 2IH5A 8MHTA 3RIEA 4EQZA 2Z6QA 2B3TA 2EJUA 3R0QA 4IWNA 2PGXA 4YMGA 3TRKA 2KW5A 4PIPA 2AVNA 2GLUA 4R8RA 1EIZA 5FWAA 3O31A 3THRA 1WZNA 5E2BA 5JR3A 2PBFA 1RI5A 2N47A 3C6KA 1SUIA 3EMBA 3EMDA 3IYLW 2BR5A 4KRGA 2HV9A 3A7EA 3HM2A 2I7CA 3FPFA 3P2EA 4GC5A 5CD1A 1KPGA 2IBSA 5FUBA 4E2WA 5EMKA 3FPEA 3ID6C 3ME5A 5E1DA 3PX2A 4RTOA 3LBYA 4PCAA 1I9GA 4RTRA 3F4KA 5C1IA 3NDIA 3LCVB 3CJTA 1KHHA 3M6XA 2PX8A 4KVZA 3TPZA 4KW7A 3SGLA 5FCDA 2OY0A 3BXOA 5EEGA 3EVBA 2WK1A 2HR1A 4LECA 3GRRA 3GXOA 3R9XB 1VPTA 3HP7A 3AY0A 2IBTA 2YUIA 5B1SA 4YUXA 4KIGA 4ATNA 5DTQA 5F2KA 1NV9A 2VDWA 5HIMA 2ZIGA 3WSTA 3TMAA 4E32A 4OBWA 4IV8A 4E33A 5CUQA 2XYQA 4ER5A 1OR8A 1YFJA 4E70A 2AOWA 2OYRA 3GRZA 4FGZA 3M4XA 1JG4A 3CJQA 2PT6A 3P2IA 1KXZA 2AN5A 3G88A 3KQYA 3KQWA 5CVEA 3SM3A 1NW7A 2E5WA 3V97A 1ZKDA 2BZGA 2IP2A 1SVUA 5CCXA 1L9KA 1I1NA 1RJDA 3DMFA 3L8DA 1L3BA 1N2XA 5EQJB 3ANXA 5HIIA 4MHTA 2PKWA 3FYCA 3M70A 3I58A 3P97A 4HRAA 5T64A 1KYZA 5FHQA 2YXEA 3FUVA 4BP1A 2YQZA 3KHKA 1G8SA 4DZRA 4PGGA 5CVDA 5CVVA 1SG9A 4EK9A 2AOUA 5CM2Z 2UYCA 2BM8A 2I62A 4YV0A 1D2GA 2FK8A 3G2PA 1G55A 3RODA 3FUXA 1VQ1A 2V7EA 1R74A 1XDUA 5EHGA 3TR6A 5GINE 2IH2A 2LD4A 4PGHA 4MQ4A 4GC9A 1R18A 4LWPA 5K8VA 3SSNA 5K05A 3O7WA 1XCJA 2C7QA 5FWDA 1G8AA 1XDSA 3FPGA 1DCTA 2CL5A 2Y1WA 3IV6A 3R6TA 4LG1A 2BR3A 4H0NA 1P39A 4DA4A 2V74B 4QDKA 1PJZA 3JWIA 5EG5A 3DH0A 1JQDA 4DCGA 3I53A 5EMJA 3TM5A 5E9WA 4AZWA 2GA9A 3CJRA 3EGIA 4RWZA 4BLVA 4YMHA 3UBTA 3E7PA 3LPMA 3P9NA 1EAMA 3AJDA 2PWPA 4C08A 3R3HA 4C4AA 4E2XA 2P1DA 1WG8A 2JHPA 3BT7A 1VP3A 4C04A 3ER8A 1MJFA 3OCJA 3GRUA 4KWCA 2C7PA 3TFWA 3EVDA 4KIFA 2EG5A 3JWGA 4PONA 2OXTA 3BKXA 4PYQA 5LQCA 3I5UA 3KPWA 1M0EA 2ZW9A 3PLAE 5CCBA 3MTEA 1ZHFA 2PWYA 3EGEA 3DP7A 3LKDA 4RTLA 3FPJA 2JHCA 4FSXA 5FA5A 3P2KA 4QDJA 4CKCA 5K0GA 5E8RA 2UZ4A 2F8LA 3T7SA 4AZSA 2XYRA 2YXDA 4KDCA 3E05A 4QQNA 2ZBRA 1NKVA 4XCXA 5DM4A 5KQSA 3M6WA 5E9QA 2I6GA 4QPNA 2ESRA 3PS9A 3FTFA 2G72A 4PYJA 5BXYA 5E2AA 5HFJA 3HCDA 2ORED 2YX1A 3PB3A 4RYLA 4YV2A 2O07A 5EPEA 4CTJA 3EEYA 1RJEA 3C3YA 4QVKA 3M33A 3HA5A 3BGIA 2EJTA 3VC2A 1SUSA 1G6Q1 1R8XA 3KQVA 3OU6A 2B2CA 3UJDA 3G8AA 1IXKA 2OO3A 3LDFA 4AZVA 5HIKA 2NP6A 1RI2A 3HA3A 4XUDA 3HCFA 2UYQA 5KS2A 2BM9A 2AS0A 2ZBPA 4E2YA 2ZCJA 1X1BA 9MHTA 1XCLA 1O9HA
chains in the Genus database with same CATH superfamily
1EMDA 4ZQCB 2LKDA 2P75A 2RG7A 3KHSA 4K9SA 2NTYC 5JDIA 2Z8YM 1DSSG 4HWTA 3GO4A 4MPJA 4XM2A 5AD1A 2QRHA 5T4FA 1LZLA 3CIFA 1DRVA 1MRSA 1TCUA 1PJTA 4HJRA 4IO0A 2MYNA 4J0JA 2WUGA 1WA5A 3KQNA 3FPAA 2HPAA 4LYEA 1JEAA 5CDHA 2QRPA 3E2PA 4IJUA 3BMXA 4NYMQ 3NALA 4MR8B 5JXJA 5B3LA 3EY9A 1EXVA 2IYLD 2VPPA 4YDHB 3DBHA 5JJIA 1UOPA 2VDOB 3L6DA 4HFNA 4QYIA 3SSAA 5ADUS 2WILA 3LC0A 1Q0ZA 3AESA 4IY1A 3ZCXA 3ETCA 4AKIA 1Z26A 3LYHA 4FWIB 4KBFA 3L02A 1MV5A 1YUMA 2F4VB 2YMMA 1G5FA 3G02A 3CM0A 3ZWOA 3MJFA 1UPBA 4PYOA 2BI8A 5FBZA 2JVJA 5ALIA 4A4DA 4EKYA 1KKLA 4XJXA 4BFZA 2FP4A 4RJJA 2XTAA 4TMTA 4QJ4A 1RRKA 3VDRA 1UKEA 2FFBA 3HYSA 4XLZA 4LKOA 1OWMA 3D6NB 1ENPA 3WGJA 3JS5A 1A8IA 1C7RA 1TD1A 3H2JA 1RM0A 1DPGA 2I3BA 4NZMA 1I51A 4D79A 4G5FA 3I1YA 1II9A 1XMJA 5I7HA 3C6BA 1E79D 2B2XA 4EKEA 4C6RA 3P9QA 1YZTA 1WVIA 2WF9A 3CT6A 2AOTA 2GH1A 4XVCA 2O2YA 2XWSA 4AO7A 4NHOA 5DCLA 4I3FA 3RYHA 1EHYA 1L1QA 3QPCA 5BSFA 4CKEA 2PKEA 5DX8A 3OZGA 4MKXA 3KR0A 5FNZA 1NUQA 1FUEA 3ZTWA 3PZRA 2C1EA 3M4JA 3WLIA 1QLWA 1OVGA 2OVBA 4HNUA 1LWNA 3E81A 4DM7A 1GAXA 2WPNA 1IATA 3TX6A 2XTJA 3KOZA 3KR9A 4Z0HO 4MDEA 1N3IA 4KGVA 3L4BC 4A15A 1EJBA 1QONA 2BD0A 4QYXA 1O8CA 4FX5A 3V48A 5K6AC 2OOSA 1VIMA 2AUNA 2ZJOA 3A06A 3IAM6 3KU1A 3O1LA 3AETB 3U4CA 5FQNA 2I6QA 5P8WA 4DPLA 1F7VA 1GPNA 4BNWA 3ZJYA 2AR9A 3DMNA 4A7PA 5D8DA 3R7WA 1M8JA 4CJXA 2XZOA 4RXMA 5I9IA 1TCAA 3V4VB 1S9DA 2JGAA 4OY3A 5DNAA 4HVLA 5I9NA 1GQYA 3ZE9A 3NKVA 4YJ3F 2H1VA 4N5IX 1VHWA 1OILA 2XZTA 1K66A 3KTDA 5A5DA 5IN5A 1GU7A 1H66A 2J6BA 1HG1A 3AVXA 1T36A 1ZD9A 2B9EA 3N6XA 2NW6A 3CKKA 4ID3A 4J0IA 5JY6A 2ZXUA 5L7WA 5ERYA 3TSOA 3DXZA 4B43A 3UJAA 2DKFA 1H8HA 5EWMB 1Z8NA 4XYGA 3ZHOA 5KTKA 2PGIA 1SA0B 2FUG6 4OQPA 1JIVA 3SXUA 4S05A 4PZ0A 2ZRMA 3GP8A 2HMAA 3F67A 5SY9A 1TVKA 4ZQGA 3U17A 1SD2A 2C4WA 5ALQA 1TJ3A 1QOQB 1B00A 1J06A 3U09A 2AT1A 1AQUA 2XZLA 2QN7A 2Q5QA 4BP9A 2C2WA 4GBMA 3R2JA 4Q9NA 4O0LA 3UWPA 2O7RA 5E4TA 1YBFA 1XUOA 2OGSA 4X6XA 4D6PA 1ECFA 4Q6BA 4M0LA 4J1TA 5L4NA 3KXKA 2ZI4A 4J6EA 5I8WA 4DHWA 4TRJA 1YBHA 3G9ZA 2BZ0A 2C4TA 1EP2B 4ZOLF 1D03A 4O3FA 4MS3B 4QQFA 2I76A 4MW4A 4UW9A 5JCOA 1RKUA 4DMUB 4JSYA 2ZR7A 5IZCA 5K99A 3EC2A 3L4JA 1QRSA 1WB6A 3AP1A 2XYHA 4MQBA 4ZAXA 3VR0A 1DEHA 1PSDA 2FG6C 4I7EA 2JVKA 3AUXA 4LIPD 1JZQA 4BN0A 4QWWA 4RHEA 2VTEA 2A5YB 3A25A 5FPQA 2H17A 2MTBA 1VLMA 1ZC3A 4B80A 3W8RA 2QDXA 3AB8A 4MAAA 3TEJA 2W4MA 1B23P 3BH6A 3I6BA 1L7NA 2ASEA 1GZVA 2GSDA 3WL8A 1MU0A 1N5DA 2JH3A 3PWSA 3HVIA 3NYIA 2BSAA 2GK3A 4W7IA 5FTJA 1QJCA 1KJZA 2X4LA 3D9QX 3L8GA 3PR2B 3IC5A 1CF2O 4HH4A 5EKUA 5E6SB 1VIVA 1Y0BA 4DCCA 3GI1A 4DHEA 5A05A 1B41A 3PDUA 3QW4B 4KQKA 4BU0A 1EDZA 2CMKA 1D4ZA 2GZDA 3DR5A 2FN9A 5JXWA 2IDJA 1T35A 4CIXA 1NG1A 3EGWA 2PX4A 2O23A 3KR1A 3W34A 4CMJA 1NLZA 3R0ZA 3NOVA 4NMMA 4DAOA 3H7AA 4M9CA 2C3UA 2AEJA 2PUHA 3E0XA 1C1DA 2J67A 3G0BA 3S5JA 4BPBA 1SHKA 1Z13A 1W29A 2J6IA 4O59O 4RPLA 4HB2A 4BO4A 3VNBA 1FNCA 3FFXA 3JYNA 4HX2A 1F8XA 4OQZA 4L9WA 1SJ9A 3V4SA 2HZBA 2Q4EA 4PHCA 2XTMA 5DHQA 3ESAA 2IPLA 1ZRMA 2REQB 1BTOA 3IODA 3OLYA 1D2CA 3BCUA 2WLTA 2VTKA 3L1UA 4UE2A 4WE3A 5E0OA 3FVRA 3A28A 1AQIA 1IXZA 4ZT5A 4ZO4A 4NOKA 3KQLA 5A5VA 1M0TA 2NYAA 1RHRA 4Q48A 3VKWA 2Q3LA 4DA7A 3VAZA 4DMHA 4P3NA 2NVWA 2Q9BA 1Y9DA 1QWSA 3A27A 3FNIA 4MDFA 2FMUA 2A94A 3RTCA 2PL1A 1L4EA 2OWDA 3O26A 4PLGA 3NHBA 2X41A 3MTQA 4PNPA 1KA9H 1BCSA 1KBZA 4O2BA 1EUCA 2AJLI 3M9XA 1DBWA 2B4AA 3RC9A 3UMJA 3A6EA 1M1UA 1ZA1A 5FI1B 4YEDA 4AJ4A 1EINA 3P0JA 4WXPA 4ZVVA 3CRQA 2RIRA 3KQQA 2DETA 2PY6A 3AOEA 2AFRA 5CLGA 1C3OB 1T6ZA 3H65A 4UFNA 4RY2A 4AK9A 3ELYA 3IUJA 5ALWA 1PT6A 1HT0A 3LT2A 4UCWA 1N2GA 3FYDA 3OY7A 4MVWA 4IL5A 4XJSA 2A86A 1C9KA 1PVVA 2CMFA 1J49A 2GWRA 3I61A 1XAJA 2I4RA 2Y1DA 5A4MS 4S1NA 3ZIDA 2QTCA 4Q24A 1SOMA 4TTIA 3UG7A 4WKGA 1FMJA 4GRDA 3SPXA 1CETA 4H9GA 5LXTF 3D7LA 3P4XA 3HBJA 4FKMA 1QG4A 4RANA 2Z4TA 1BE0A 2AMYA 1MOZA 3SR4A 2FJUA 4IMRA 5CBPB 4RFSA 4XYBA 1PHRA 4ZV7A 1MZPA 3PBKA 2DPHA 1RQLA 2FF7A 3E5MA 4IHAA 4J16A 3QNWA 2IGBA 4OBEA 4QBGB 5AKEA 1JR2A 3GLQA 3NLLA 3ROGA 5JBQA 4OM7A 2R1VB 4CEIB 2D5BA 2GUWA 5JQWA 1Z6TA 3HGTA 4JH0A 4QU8A 3E9MA 1XD9A 1ZUHA 5ES3A 3L7BA 3Q9UA 2QROA 1ES9A 1AB6A 2XWPA 3FCEA 5NULA 5TPZD 1S2MA 1IWBB 4DSNA 1R15A 5JS6A 3OLQA 3T7TA 3PX7A 1Z5NA 4GSLA 4FSDA 1RWBA 1LY1A 3OPXA 4YXFA 1KL7A 4OYYA 3ZTTA 2HRDA 4RTKA 4TYYA 3KOXA 4BMSA 3WL7A 2ODNA 3N9IA 2YV4A 4CMIB 1LNQA 1E2GA 4Q01A 1YJQA 5G40A 2NUTB 3ZGZA 1QIFA 4LJ5A 1U0SY 1Z28A 2HBQA 2C0QA 3EARA 1FXWF 5JH7F 1BHJA 1Q7EA 1GD1O 5H80A 1XZDA 2XUIA 2EFHB 4NAUA 1RWMA 3DVAA 1QG2A 4O1HA 5B3JA 4LFCB 4OU4A 4EA6A 5JYBA 4MITA 4B09A 2KJQA 4NYIR 5JPCA 2QLMA 2O3SA 3RKSA 4AUMA 1CUJA 2YDYA 5DYNA 4DW8A 1FRFS 3U9SA 2FG7C 3DMGA 4HGYA 1OIVA 1XX6A 2FZWA 2YMQA 5AUQA 2CL7X 5LQKA 4CM5A 4X54A 1SXIA 1XQXA 3JVVA 3L6RA 2QAIA 3Q9NA 5KQLA 2BRUA 2Q9AA 1SHZA 4G26A 4AJEA 4ZIRB 5KWIA 1H4SA 2IYUA 3TNDA 4B3DA 3OX4A 1H42A 1FRZA 4LYHA 1UDWA 1W48A 2MSNA 4OYRA 1GPWB 5C80A 3KSBC 4Z4QA 3LCUA 4PQFA 4CCAA 5ADHA 2HEIA 1NBWB 1I5OA 2D1RA 4YCDA 2NNWB 4YR7A 2J9XB 4XUEA 5IBQA 4BO7A 2UZ1A 5KOHA 3IERA 5CXSA 3ESYA 3K96A 1PX2A 4RXTA 4P92A 4DEXA 3L8ZA 1KC3A 4OU5A 2X5JO 1N5LA 1Z74A 4HQFA 4W7SA 3L43A 4BLQA 4UOZA 5KTTA 1JHOA 4URWR 1X1EA 3C6XA 4WN3A 4RFVA 1YWGO 5H5JA 3STHA 1PJ4A 5E2BA 1K08A 2CLKB 4JOBA 3EMDA 2YICA 2D74A 2HCTA 3KOUA 3H5IA 4LHWA 4ZMRA 2JFBA 2AMFA 2V7QD 5EJ6A 1OH7A 4EY3A 2OLEA 4GEGA 4PU0A 3O92A 2FPXA 4CLRA 3PX2A 2VZ0A 1MFZA 2B7LA 1TLFA 5JS2A 3UB4A 4NRDA 3HBNA 3LCVB 3MFYA 3DUFB 5FBHA 1ONNA 3M6XA 1OU0A 1CUXA 4KVZA 4ITVA 3AVWA 1Z08A 3GJ8A 3ROZA 1J0CA 2H1OA 3DO6A 2QPOA 3S2IA 3IP3A 3QENA 5BNFA 2O9JA 3RABA 2CVQA 4NIMA 4UJ3A 3L0SA 2QMOA 4KOEC 3ZHRA 4HHEA 2JJ2A 2IXDA 4DMKA 3DO5A 1YQWA 3KHTA 4R5HA 3DMDA 1V6AA 3PFWO 3QGMA 4IV8A 4OBWA 4EZIA 1RRFA 1ZNWA 1P2TA 3G2IA 4PX9A 2PZEA 4CBVA 2CYAA 1KXZA 2CVZA 2AN5A 5LZ5A 2AHOA 1ZKDA 1FW6A 3GHYA 4IGAA 3ZD9A 4DCTA 1E98A 3V80A 4QHTA 1L3BA 2B6NA 3GLGB 2CT8A 2PKWA 4FGUA 2IUUA 3RFUA 2BHSA 2GLTA 2HSZA 2G06A 2ZRFA 3KHKA 3VR6A 3C8ZA 1JHMA 4H16A 1AG9A 3IBYA 3IIMA 1XLVA 1KI6A 4CM9D 1NBMD 1D1SA 2NOAA 1SZPA 4PR3A 1VPDA 4A03A 2KE5A 3SQXA 3KEMA 4B75A 1OKKD 4KNYA 5MN5A 2P90A 3VH2A 3N2ZB 3NFRA 5K8UA 1HK7A 2GBLC 2XLCA 3C8MA 2RK4A 3KBBA 4KB5A 4DCSA 3VR6H 1Q50A 5K05A 1XCJA 4LOJA 4NCIA 1FA9A 2CL5A 4ZHQB 1ULTA 2OMKA 2Q2WA 4OKNA 2I4TA 4UQPA 2H1IA 3VNQA 2XQFA 2QTFA 5EWJA 1ZMRA 3ANMA 1CUDA 4JLNA 1XYGA 3CYFA 1DO0A 3GQBA 3JU3A 4D0RA 1O9BA 2JAUA 2J3IA 3H5AA 1UM9A 3N7UA 5JDCC 4WDRA 5J9FA 4X8LA 1DQRA 2GA9A 3EGDB 1B6GA 2HN9A 2WJZB 5D7BA 4F8EA 1RM3A 1AZTA 1EAMA 2AXEA 3LMKA 4J03A 4Y67A 3WLAA 4REQB 3DJFA 3HUFA 2WJ6A 3E27A 3ZYZA 3EEIA 3ZZTA 3ZH2A 3COYA 4KWCA 1A27A 2OG1A 3DE6X 4S35A 3ZU2A 1KVTA 1D5WA 2J9RA 4NJMB 5J5AA 3WC4A 4PZDA 4R54A 2BHRA 2AKAB 4HADA 4FI3C 3MIZA 3ZDYB 1PQPA 3PLAE 1X0VA 3WWOA 4BJ3A 1PQUA 1ZHFA 3MTEA 4ZZ0A 2D0DA 3O21A 4PPNA 2GNAA 4YRBA 4WLEA 3FPJA 1BE8A 1BQEA 1HH4A 1IEWA 4HN2A 4PY2A 3PC3A 1YZVA 4WKPA 2A3RA 3C3AA 3FMPB 4HO1X 5UKDA 2M6LA 2BFNA 4GOKA 1Y6GA 1KMIY 1QS0A 2BGNA 2JBHA 4PE5B 5AHXA 2IHJA 2OAEA 2PD4A 2ZIXB 1UUFA 1WSAA 3MOSA 1Y6RA 2IT1A 2YJZA 3KKMA 3PS9A 5ETJA 5HCUA 4EH1A 3UN1A 4IH4A 2PMFA 1VGRA 3DWGA 3I2HA 1FDVA 1QQ6A 1T2CA 1VA4A 2AYXA 3GT7A 4P3XA 3V2IA 4AY5A 4HK4A 5BMVF 2XCUA 3C3YA 4GIBA 4M1YA 4ARSA 2ECPA 3N87A 4WINA 4NSNA 4OFXA 3N07A 2HRRA 4IM7A 1X0XA 4QJ5A 1QVWA 4R2HA 4TKZA 4F38A 3EPHA 5AOBA 3LUBA 1R27A 1NNEA 1LV7A 3CPHA 9MHTA 1NM5C 1SG6A 3RS7A 3E9EA 4INOA 4JEHA 3V2HA 5DM70 1DWOA 3PTZA 1E9AA 2WM3A 4RSGA 4TVOA 1RI4A 2PK3A 1W19A 1JWBB 5C3MA 1RQGA 1DO2A 2B1QA 2D4HA 4PSVA 4QT0A 4LE0A 3GEBA 5C5CA 4EKNB 5FNVB 4UU0A 5HW0A 4IKPA 3FPBA 3EZNA 1R5JA 3N76A 3NT2A 3TTUA 3KEFA 4B32A 2DAPA 3GLFB 1VMDA 1U2GC 2DU8A 3L1VA 4Z99A 4HL6A 3OUZA 1E89A 3NJ8A 1N6LA 4IHJB 4TLCA 4AP6A 4A36A 4GR9A 4IIXA 1DAOA 1ZVJA 2DHRA 5J2TB 1JKXA 1XTKA 3P9IA 3PC8A 5DSZA 5F1PA 1Y6JA 1OUMA 2FSIA 2P3LA 5JUWA 1KEEA 5DIZA 4RCVA 4OYHA 3QVGA 4EI8A 1SN7A 1Q6YA 1I4WA 2B21A 4G1MB 5ALRA 2DERA 4L4YA 2WHPA 4R9SA 5JJKA 1NSYA 1QB8A 1T5OA 2Q6IA 5LD2C 1KFCB 4GGMX 1KK0A 1T13A 2WA1A 2HA5A 3D6HA 2YIDA 4FE7A 5FJIA 3RSOA 3TOSA 4E2FA 1QBGA 2X6RA 2QKYA 3WIEA 4MJ7A 4O4LB 3MVEA 1RYDA 1A9ZA 1YK0A 3CW2A 3RANA 3P19A 5JAQA 5HUJA 5LP6A 2O8EA 2JLSA 1GUYA 4JNKA 4O4JA 1RU3A 2X22A 2K2WA 1TTHA 2Y77A 1RHJA 2XQIA 4ZVPA 4C29A 1U9JA 3I0ZA 2EIXA 2YOFA 2D2FA 4ZV9A 2ZJ8A 5BWOA 2E87A 1KDYA 4X61A 1WOYA 5C0OE 5MFZA 4PSCA 2V8BA 1BVRA 2LIPA 2X8BA 1FMLA 2HDOA 3KAPA 5IC6A 4PX5A 4C4XA 3K35A 4C5AA 4HYTA 4RHUA 1D1QA 2QX6A 1DBRA 3DZDA 1LGYA 4K0RA 1QTIA 2XE6A 3W7AA 2NSDA 4F85A 4OXIA 1GQSA 5DXFA 5ILQA 4DILA 4JI1B 4A8HA 1KZ4A 1U31A 2GKOA 4X41A 3GBVA 2WWIA 3OCCA 5IXYA 4LDJA 5ICGA 2IEAA 3T38A 1WEHA 3MCVA 4C2UA 1Y1TA 4BO8A 3ZWBA 1AUOA 4CL3A 2IYQA 5ALZA 3T3IA 2H2GA 5D1HA 4E09A 2FMKA 1K5DA 1WSWA 1YS4A 4JI4B 1PNVA 2PRZA 1JIXA 3AX6A 1GIAA 2H4HA 5JNVA 5LN1A 1T25A 3WADA 1S4MA 1UF9A 2HHLA 3JYQA 4MSUA 1IBKB 3M3HA 2ZE8A 2BFPA 2F3SA 2ZI9A 3ZDEA 2A57A 5GONF 3ZBUA 5BT8A 4IIJA 3R7SA 5AVRA 4Q3BA 5F76A 5BW4A 4Q1EA 4JK3A 1C81A 1X39A 4CV1A 1C9DB 3RNLA 3DVQX 2ZCJA 1RI1A 3HSYA 1Z12A 2OLJA 3JWPA 1KE1A 4YS6A 2NVBA 2P6NA 1IG0A 1AMOA 3SF8A 1Z29A 1KQGA 1R16A 5CA0F 5EQTA 1EVKA 6ADHA 2WLSA 5LZ4A 1QHHA 1XMXA 2GEKA 2VRNA 1JN0A 2HLPA 2FUNB 2UVPB 3E58A 4RW0A 3HYCA 2WIFA 4CN8A 2VQ3A 4F5ZA 5KKNB 3SHWA 4LYFA 3P2OA 2AWNA 4AKTA 3BXPA 3QZUA 1Y4ZA 1SOAA 4JSTA 3WP0A 1NXXA 3EXG1 3BGSA 1FRNA 5DFAA 1NBHA 1P4JA 2FZKA 1J99A 1XXHA 3LKBA 5G4KB 2JIPA 4OSPA 5IAGA 1WMBA 3UKOA 4IGIA 1CR1A 4NZZA 5F78A 4B81A 2FEWB 3KB6A 5LBUA 3WLOA 3NXKA 4CDGA 2RI0A 3MJDA 4JLSA 1F5SA 4UXIA 3BIOA 3HR4A 4KAFA 1E4EB 2XCIA 5EUBA 4P86A 2GGSA 3PTAA 3L0YA 2W6OA 1JSLA 1NP6A 5T6MA 2IVFA 3QXCA 4UFPA 5CGZA 1ZEJA 1RZRD 4G1UC 3M6VA 3CSUA 3OH8A 4ZCLA 3BC1A 1D4FA 4Y2PA 1T5BA 5IULC 4FMDF 5BSEA 1JIQA 1M2EA 1NW6A 3COWA 1K5HA 4RVOA 5DGIA 1N2CB 5HDQA 3R7DA 4E7OA 2EC5A 2CLOB 4C20A 4I3GA 4NCKA 3TEFA 3TK1A 3IAEA 1P1CA 3K94A 2PSJA 2D7DA 4KMSA 3PJDA 3P26A 1WX1A 2L19A 3BMCB 1U1IA 2OQIA 3ROXA 1V8BA 1SCIA 3O73A 4EI9A 2BGUA 1OVMA 1KK1A 4YMVA 3DXXA 2D5CA 1Z7GA 4PLYA 1N1MA 3FB4A 1HYBA 2H5EA 3FR8A 1O77A 2P2GA 3DEYX 1P91A 4C4TA 1DDIA 2HEGA 2FN8A 2H6EA 2JI8A 1OZHA 1HSOA 2IEGA 2C20A 2DZDA 3AF2A 2PQ6A 2O06A 3ORHA 4M8IA 4TVKA 1VSBA 3CONA 3E2MA 2CK3A 4G0XA 3U4AA 1N3YA 2BHNA 2CDRA 4RFLA 1T8WA 4ZHSA 4QJIA 3JY6A 4MUEA 5D2CA 1IMOA 3H13A 2JGKA 2YQ5A 4KKXB 3EDQA 4LJKA 3ZE2B 1OIXA 3LHFA 3OEED 1X7YB 3F8WA 3K05A 3D43A 3QU5A 2R7LA 1S7CA 4ZAGA 5L3RA 1DJNA 1V8ZA 1OWPA 3SBOA 2AW3A 2QAGC 2D1SA 2WMNB 3KC2A 4R1SA 3ZE6A 4YLYA 3L6OO 3I9LA 5JQGB 2R4QA 4R1LA 1YA6A 3H87A 5KYUA 1DG3A 3ZGYA 2EQAA 4OI0A 1ECPA 1RJ9A 3NANA 4C4SA 4CPDA 4NPCA 4Z7OB 3MZ0A 4F0JA 5FOQA 4NBVA 2YIJA 3ZX5A 4DWJA 3ZCTA 4YRCA 1QV7A 2WUVA 4ZVNA 2JZCA 2QSJA 4IXMA 5CH3A 2O8FB 4QE3A 3INYA 2O57A 2P1ZA 3PUZA 1Z6ZA 2OL4A 4HSGA 2NIPA 4YJDA 4GSKA 1L7DA 1RTTA 4FB4A 4U4AA 5JC8A 2ZTHA 1RPJA 2QPAA 4D6XA 1IQRA 2FUEA 5C37A 4PAWA 4ZO8A 1I1HA 1UJNA 3SSOA 2R85A 2R79A 1HURA 4PC7A 4J1QA 1G59A 2PJDA 2QR2A 3PVCA 1T9BA 2FPWA 2V7WA 1A4RA 3L6BA 1UT8A 4FHFA 3WDSA 2C5FA 4EF5A 3FWYA 3GWGA 5SYAA 1SD1A 3TG2A 5JD4A 2C2GA 2Q1YA 3DCNA 1U5CA 3ITEA 1NVGA 1OT3A 3BWEA 4HFMA 4A0QA 2AW5A 4O08A 1NJ8A 1M5RA 3OTOB 1UWVA 2FW6A 1IONA 2C8VA 3DVLA 5FI3A 5G0WA 4BVAA 3WQRA 3NOOA 3EVAA 1DL5A 4HGOA 5I7OA 2G82A 3HPQA 2TSYB 5JJ5A 1DOZA 3OAAD 4CMHA 1Y5NA 5HKAA 4DNPA 1FU7A 4MPPA 4X71A 2BC9A 2XHZA 2W5UA 3HG7A 5DCUA 2Y0PA 5FPTA 3TTWA 1CUHA 1KVUA 2VTDA 5D1NA 4B9AA 4ZI7F 2VH1A 3WHIA 1CX9B 8ATCA 5KWJA 5CFMA 4J6FA 2F1JA 5CX4A 4JZYA 4URXR 4EGJA 4UM5A 4BO0A 4TQUS 1XXHE 2IGTA 1OBHA 1NDHA 1EVJA 3ZY2A 5FT9A 4P54A 2DX7A 4E3WA 1ECJA 4RPKA 4A27A 3JD3A 3NC4A 5B6PA 2I8CA 1IM2A 2GEFA 3DQZA 1I0ZA 5CB4A 1E9FA 1DAKA 1G6KA 1JU3A 3I3SR 5JAZA 5HYVA 2TMGA 3AEUB 1G2OA 3MJTA 4LZOA 3GF4A 4Z3KA 1OXMA 2YYAA 1E2LA 3TIFA 1NZJA 4BQOA 5LR6A 2HMUA 3LY8A 3B6KA 4H3KB 4RS4A 4BJHB 1WXXA 3RCBA 2A84A 4J0QA 4G0QA 4G5QA 1CERA 3DHYA 3WMEA 1XVAA 4BECA 3FDIA 3CLUC 4WN9B 1ODLA 3MERA 1L8OA 2G1AA 4CTKA 1IUNA 3HL4A 3TZHA 3UJ9A 4Y2JA 4BNIA 4CYMA 1NYTA 5BPHA 2BGRA 4HFRA 1XQVA 2R7AA 2LV8A 1YL7A 1ACMA 3FETA 3V8MA 5ECGC 1X1TA 3OQJA 4QM7A 4IJWA 1UK7A 4BLWA 4E07A 1KY2A 1CDDA 1HFWA 2WICA 4ED9A 4KR0A 5KBYA 5LLDA 5F98A 1N2OA 4AIIA 2YZMA 4EPRA 1QHGA 5BQXA 2FZLA 1USUA 1TAQA 1VBMA 3M4NA 2V4MA 3BQNB 4ZJYA 4O0MA 3C6QA 4WK6A 3U3JA 3IBTA 3I39X 4O29A 2Y9PB 4OSEA 4X24A 5AO9A 4ZI3A 2DYKA 2WMYA 3MUEA 4YALA 5JYCA 2BW0A 3T0GA 2H08A 3TQOA 4BKQA 2V0NA 1CIVA 2AC2A 3NQ41 1KPIA 2JHGA 1J00A 1F3LA 3OOEA 3PNKA 3LPCA 1MPXA 4AZ3B 3OOWA 3EZFA 1QMPA 3QF4B 4DLVA 5LYYA 3DM5A 2XDWA 3T99A 1S1CA 5C7OO 3K9FC 2ECFA 1LUAA 3JQQA 4JJEA 4JZKA 2PSDA 4RYDA 1EP9A 2HSJA 5DV9A 3U3KA 3V1NA 5JZMA 4ITUA 1TGVA 2VHJA 2KWIA 3PC4A 1ILEA 5IDVA 5KYKA 1MQSA 5CYPA 1RD4A 1TW3A 2AF4C 1MEOA 1CQIB 2KS6A 2P1RA 4CR7A 4N8EA 3EFBA 5DSXA 3EW7A 5HUQA 4EQZA 5CT6A 2PLFA 2GPNA 4FDMA 3UBMA 3F46A 1GFIA 3BRSA 1FSZA 2G1JA 1EHCA 1EFTA 1QUEA 2AVNA 2IV3A 1L4MA 4MKHA 1F3OA 2ZSBA 3OZAA 1O96B 4Q1BA 4WKNA 3C6KA 3IB6A 3EMBA 5JMOA 1EIWA 3BCSA 5DO9A 1LU9A 3OWOA 4DXDA 1XB2A 2BSQA 3G6WA 3SIWA 3PC7A 2ZT5A 3FJYA 3GG2A 3EPRA 2MT9A 1BJRE 2FW0A 2HA4A 2O3RA 3ESBA 721PA 5I7WA 1U0HC 3A1WA 3JVUA 1VL6A 3E4DA 1CQWA 2PX8A 3AM1A 3ANSA 3DEAA 3HDYA 2E0IA 4ZVQA 2FKNA 1D2EA 4M99A 1Z07A 3PPIA 5H68A 4P34A 1XEXB 2RCYA 5BNIA 3H8VA 1VBNA 3X2FA 4LTDA 1RWQA 5LU8A 1IZ0A 2UDPA 1VSQA 4II3A 4ARVA 4LY9A 1E0JA 2ZIGA 1XSEA 3RAFC 1EA5A 1R0WA 2RONA 1YOVB 2NWQA 4WV3A 5C1PA 1BD4A 5DHUA 4S1TA 2QTLA 1F17A 4E4YA 2BAGA 3PD0A 3KQWA 3K6KA 2E5WA 4TWJA 4YGYA 1T0IA 3FNFA 4AWAA 1C3EA 1BDHA 3RD5A 4ZALA 1RXSA 1BW9A 2IEBA 1VLQA 1Z0DA 1FLDA 2GZAA 3MM4A 4S1PA 4ZGWA 4TVBA 5A2QA 3RYFA 1Z37A 4LY3A 1GV1A 3I58A 2BGWA 1PWXA 1BFKA 1UPAA 2OHVA 2XQVA 1COWD 3GUUA 5JSYA 1TAHA 3BSFA 2Z2KA 2HLDA 3OZIA 1KF0A 4G1EB 3R4CA 4BMVA 2VYND 3F3SA 2UYCA 1FCJA 4BZZA 3FTPA 1FS4A 4OQLA 2FK8A 5KYWA 2P0EA 2P62A 3GAZA 3FVQA 3NONA 4L27A 3ESZA 5I45A 4F5DA 2E55A 3D6MA 4LZNA 3GMIA 4RM2A 4UM7A 4EHKA 5KNBD 3RYIA 2LD4A 3U48A 4LJ9A 1MW8X 1JR6A 1YZLA 4LWPA 2I6FA 3OG9A 4PZ9A 2ZUEA 1MO4A 3FPGA 2VT7A 1C30B 3FWZA 5E4JA 3HBLA 3ZDQA 1MJGM 1QHSA 2NVOA 3O8LA 3SHOA 3IEPA 4NKRA 4M0FA 4B3JA 5L8VA 3AK4A 2CYCA 3R0IA 4JBYA 2JGDB 4JHXA 1L5SA 2FSVC 5LOVA 4TN5A 1HYQA 5EMJA 1V47A 2Q6KA 5E9WA 5JALA 1GAWA 1QCCA 5JJLA 5JTTA 2GD6A 4BLVA 3ND7A 3D7NA 4HBGA 4TSFA 5BNWA 3ABSB 3DZGA 3AJDA 4RS3A 4XR4A 4RPCA 2OBMA 1T8RA 4WXRA 3ER8A 1JG7A 1X1SA 4NMWA 4BMNA 1IOZA 1KDTA 2Y4NA 2ZB8A 3CURA 3PJEA 5A4DA 1RLMA 1LEHA 3UUEA 3DPIA 3LKDA 1I3MA 3A6GA 5LLSA 3ZTYA 1UPUA 4X20A 3AIOA 5K51A 4EHAA 1CYEA 3RU3A 3WIOA 3UMGA 4WESB 1KO8A 5TB5A 3TRDA 2WFZA 4MCJA 1Q3KA 4QQNA 1NKVA 3NNNA 3EA5A 3HYNA 3VVMA 3HEBA 1NJ2A 1NBOA 4ZZ3A 2MSCB 1UBGA 5AI8A 4IJQA 4L5IA 1KK3A 4NWIA 2FF5A 3HEAA 4X45A 5DJ5A 4EHLA 3UAYA 5CW2A 2PH1A 3TLGA 3VHXB 1WZIA 3ZX4A 1QG0A 4YIHA 4WVFA 3HLKA 3M33A 5EJ5A 5A62A 2QT9A 1M7GA 2VAPA 3PIRA 2POQX 1WUKS 1UXKA 3GJSA 4K6HA 5KREA 1XVLA 4NYMR 3R3XA 4JKIA 4JP8A 2UYQA 2WYHA 3TCNA 5M04A 4GZLA 1R6BX 1H0KA 1VJCA 1ULBA 1GLVA 1UJ2A 1YB7A 3KAJA 1DKMA 4KC0A 4XQEA 5E1BA 5DBGA 4J3NA 4BNKA 2IIQA 2X2OA 3OSUA 3KNZA 2Z04A 1K7YA 3K73O 4B6RA 4R8SA 4NFSA 4FSHA 4MR7B 4NK4A 3RTBA 4BV2A 1J24A 1A7JA 4XGRA 3KB8A 1Y33E 5A0FA 1KSJA 3C8UA 1L7BA 1I0IA 2XXJA 1UPXA 3GLUA 3GVIA 5EIHA 3QMPA 3C97A 3ESXA 3LZDA 2N1MA 4RTNA 1FSPA 1KYXA 4YRRA 3TFOA 4JODA 4CLOB 4XJVA 2D06A 2ZTUA 2Z9CA 3GGDA 4Z54A 4OL9A 2PUVA 1BH2A 1YS2X 1FFAA 1NYQA 1TPYA 1YIAA 4M6WB 4RD3A 2X6QA 4Q9KA 4GI2A 3RV3A 4CM8B 4ZEXA 1JFVA 2FKAA 2P7IA 2II6A 2VEOA 2YXLA 2YZ7A 1JL3A 3FOCA 4HNRA 2Y71A 4ZVSA 1UK6A 2IPMA 3MNFA 1E2NA 5DHSA 1YMQA 4N9WA 4F2DA 2I54A 4OMDA 3RT1A 1H3NA 4EB8A 3DMRA 3OZEA 4MZXA 4CL8A 2HZ7A 1P4AA 1QFYA 4C07A 5AW9A 4EL0A 4P0QB 1IZZA 2ZT7A 2XMRA 2OXEA 3M9LA 4H18A 3I6ZA 1UMBB 4BE4A 2ZYGA 1AJEA 4CT4B 4TTJA 1YU6A 4ERNA 1FYXA 3J7AC 3TQHA 1EESA 3Q9SA 3AF0A 3CNBA 4A0RA 3UMBA 3WWZA 3UT6A 5T4BA 1EJ6A 2B4YA 4KPEC 3AJAA 2AG0A 5L6LB 1WXWA 4OA5A 1VZ2A 3T1QA 2F55A 2JI6A 2ZI7A 2G63A 4I4IA 2ZRHA 3KIPA 3UKJA 2WKQA 2Q1XA 4QSHA 1QH8B 3VUEA 5EINA 5JG7A 1RAFA 1FW8A 2ZJYA 4OXXA 1VE3A 4R9NA 3ZEAA 1PEYA 5GVSA 1NDQA 1WNTA 2XGOA 2BGLA 4F6CA 4MO2A 1U3FA 2FETA 4X1YA 3E5RA 1KFKB 2H4JA 4H1HA 3RSLA 3GJRA 3DTTA 2Q8NA 3JTEA 1M6NA 5ANRB 5CM8B 1BOOA 4LX8A 2FEMA 3E7WA 4QUKA 4F93B 4Y1RA 3NHRA 1FYVA 1GTMA 1X9GA 3CX8A 3GJXC 2ZSDA 3Q6MA 5EWLB 3B3GA 3JQFC 1NW5A 3LPAA 2GPTA 1TYBE 2G25A 3PQ5A 5FA8A 1QANA 4TYNA 5NLLA 3F2VA 4L0MA 1UDXA 2W6NA 1Z0KA 4MCAA 2VHYA 3OD1A 4FYWA 4YRMA 4LC1A 1IXYA 1T5LA 2IE8A 1YZ3A 3QE3A 3TKYA 3W77A 3DAPA 1MJHA 4JQSA 1DG9A 1J90A 1L8QA 2C2ZA 3LYLA 2JF0A 2PRYA 4YT2A 1RPTA 1KI4A 2J30A 3ZHXA 4ND2A 5FUMA 5EIFA 4N82A 1KEZA 2PGJA 1SQSA 4KO4S 4F6RA 2QQGA 3FPHA 1OH5A 2FCAA 4R2MA 4UBKA 3R41A 5FUXA 5LC1A 3WOHA 4Z51A 3QFFA 3BJIC 3HVUA 2RARA 2PMCA 3A1EA 1L4YA 4NDZA 1N9GB 4ZARA 1OFTA 1JKFA 2OE2A 3LOUA 4JCOA 1P8JA 2G0TA 4DR5B 4RTSA 1M2VB 2P3QA 3OZFA 5I7VA 1VSUA 3GR6A 4JEIA 3IQGX 4PQEA 4WZBA 3J80A 4IVQA 3K31A 4P58A 2F8SA 4KGXA 2EAUA 1PYOA 4BKPA 2GCNA 2GRJA 4M8KA 4UXHA 3VR4D 1W5EA 2EYUA 2RGXA 3BYZA 4GOOD 1UMDA 3GCXA 1ISFA 2K5UA 2DTXA 2FRDC 2DQSA 2IHZA 3LWNA 4G85A 4OK5A 2IV2X 2AJ8A 3T3NA 2Z6UA 3DLCA 3EC1A 3KB1A 4KFSA 2JI4A 3A9RA 3JD1A 2C5GA 4L8LA 1O0BA 3HB0A 1EUZA 2XOKD 5ALTA 2FU5C 5THKA 4JXKA 4LZPA 3BH0A 3KOOA 4ICIA 3ZHVA 1NT2A 1R64A 5DP1A 3MRXA 1QNLA 3REQB 4HS4A 3L0BA 4LSZA 4XIFA 1F1BA 1UFRA 3LD9A 4WW0A 1VMIA 3BPSA 3SIXA 1EPUA 2ZJ3A 3CO5A 1V8DA 4HDNB 1G8YA 4PNHA 3TO5A 3PWKA 4CG2A 2W2KB 1RT9A 4MLPA 3IPXA 4EUHA 3NWBA 1PJ8A 2CHVA 3BJEA 5A04A 3PA8A 1V26A 2VHWA 2YHUA 3VOAA 2XKBA 2F62A 5C1DA 1EFCA 4EUNA 1GNQA 3OQVA 1Z0JA 3KUUA 5G0SA 3NIFB 1YJCA 2P2SA 2QYOA 3JATB 4P2BA 3S2ZA 2CLLB 3PUVA 1K0UA 1OC2A 3MTDA 2WAYA 4UAGA 3BF7A 5AR1A 1DKLA 2H0AA 2AZ4A 3TYXA 3EE6A 1VCNA 1K7SN 1ORDA 3LQYA 3BFXA 3FCOA 2VDWB 1EWTA 4Q4CA 4LGCA 4MRNA 4IWYA 1H65A 4TS9A 4XWGA 1FYEA 3A31A 5E6UA 2ZPAA 1C9MA 1Z15A 3NT5A 4Q1CA 5BUCA 1A4IA 1EFVB 4WCFC 3A4TA 4OGWA 1P0PA 1H6BA 1U0TA 1WE2A 4DF3A 1KH2A 3OBIA 2C2YA 5JATA 1XK6A 4JJAA 1N5RA 2XGJA 1E4VA 1QVAA 2JBAA 3CX6A 3FR7A 3OMXA 3E8SA 2A14A 2OCPA 1P0MA 3JSAA 4GMDA 2NPOA 1G4AE 3BGDA 3KVOA 1XRLA 4IH9A 2DG2A 3O8QB 3ZZNA 3U1VA 1AKQA 2VSFA 3PEVA 1T9AA 4IGFA 3T7RA 3ZXYA 3GUZA 3RSQA 1WB5A 4IVRA 3VTKA 2G4VA 2OP1A 2EEZA 3NIDB 4DLZA 4X91A 3MWDA 2J87A 2XAAA 3B60A 4ADSG 4UNRA 2I6TA 5AKGA 1C8VB 3V1LA 2G6TA 1R0XA 2P4UA 1JRLA 5KDOA 1V1RA 3BEDA 2Q5JA 5REQA 2QYSA 2CLSA 2GN4A 2QYHA 3RS2A 5CIQA 4BVLA 5BOSB 1VHDA 1IPFA 4E14A 1QO7A 5D3QA 5AHRA 2O8BB 2BMDA 4XB1A 2WIKA 2QN6A 4Z4HA 4XIYA 2QGZA 1P7ZA 2RAPA 4NPAA 5J47A 3OOYA 5H4HA 2YVKA 5B1YA 1SUBA 1LPSA 3PDIB 1H1DA 4I8IA 1N3LA 4K28A 4PPQA 5ILGA 2BFBA 1SELA 2BKXA 1QWOA 3JAWB 3O8OA 3GNLA 2PSSA 2IPNA 4UASA 2R2GA 2AYYA 2D3WA 1Z0UA 3N2NA 2VRBA 1QDUA 3KALA 2QZJA 2VWQA 1VB5A 1P0CA 3MGBA 4Q18A 5JXHA 4AP5A 3QFCA 4JT4A 4YFVA 3RI3A 3NHLA 3BL5A 1CUIA 1Y9JA 1OXVA 5AM4A 5JD3A 3NDPA 2R6DA 5E9AA 4I14A 4KQ6A 5AKKA 3RFXA 4D8UA 3LXUX 2B8EA 2HUNA 5ESXA 3QPBA 4Y6RA 1SK8A 4B3XA 1ZMBA 2AIRA 3AIMA 4QU9A 4RDXA 2QZ4A 2O6HA 1ST2A 4WCDA 3WLEA 1Z4OA 1Y4AE 1MFPA 1TF7A 2BDEA 4HZIA 4OAOA 4H7FA 4M1MA 2XAUA 4WZBE 3RW9A 4CF4A 4TXHA 5AJTA 2YWFA 3A4LA 4FQ7A 2HK9A 3PHGA 4J1NA 1THZA 1ONOA 2FA9A 2Q46A 3K1TA 4JWKA 1NWHA 3PI7A 4QARA 2SCUA 3C74A 5B1IA 1OBFO 3UCFA 5HGXA 5KVVA 1BXKA 4Q4HB 2V7GA 4PAGA 4R40A 2EHJA 3ZGOA 1GKKA 5FOSA 4DCUA 1W9HA 1HM5A 2R8OA 2ZSUA 3GZNA 3R7FA 4DRZA 3PI6A 4UMVA 2GFQA 4Z3OA 1ADFA 1UC5B 1QE3A 2E1RA 4X95A 1YKFA 1WV0A 4Q1VA 2Q7OE 4MGIR 1T0JB 4GL4A 4BBZA 3IAM1 3UQZA 5BRJA 3NBUA 1AD2A 5MF6A 1FFYA 1XDWA 1VB3A 1CEEA 3F5MA 1BKSB 1ODJA 4P8RA 3TGPA 1QFJA 1XZGA 3CA8A 4CKYA 2EJWA 1HMPA 5IKXA 4B6QA 1RHUA 2JBWA 3K1AB 3WI7A 2VCHA 4CQMD 5J2UA 5LM3A 1TYDE 2G28A 5F12A 4TTPA 2FQQA 1IE3A 1NQOA 2JAQA 3BFKA 1GR0A 1H2BA 4KFUA 4RVDA 2EFGA 4MYCA 3FA2A 2H2DA 4D9HA 3R77A 3COZA 5JY1A 2HJGA 4FE4A 1JAZA 2J7PA 4S1OA 3M9WA 3TL6A 1OOEA 3A6KA 4Q4JA 5BWNA 4BNDA 2GAIA 1ISMA 1WPQA 3QYAA 2C3OA 2IU6A 1VE1A 2FUG1 4P22A 3WRWA 2O54A 3CLRD 2VHZA 3KWMA 2WSSA 5DW0A 3H5OA 3M6LA 2VAVA 1HUQA 5IK2A 5KNDA 3M7IA 2X86A 3OI7A 2EYQA 4MV6A 5AP9A 2WU8A 1LW7A 2JD0A 4YI3A 4GPD1 1L8XA 4N40A 1QIDA 2VKTA 4UULA 1O9GA 3GHHA 4JN6B 1J8FA 2MR5A 4MINA 1NURA 3NBKA 1JZSA 1M83A 5D51S 2FPIA 1UQUA 4V3CA 3W4JA 5E95A 2OORC 4MVJM 1EFKA 5CDUA 1ODSA 3KLPX 2OZLA 4MV8A 2DCMA 4D3YA 3AR7A 2YWHA 4LISA 7ADHA 3U4QB 3GEGA 5KNDH 3W6PA 3DQPA 5KYYB 3PQ3A 1JR3D 1A04A 2CXSA 1P7PA 3JZIA 3NTRA 4KV7A 4NU5A 4CMAA 3K70C 3PKIA 4EG7A 2H18A 5CD1A 3PHJA 2P6MA 2IBSA 1KO7A 3BB3A 2AB0A 1QX3A 1QVZA 1B7GO 1RBMA 2I03A 3KYDA 4OAPA 4U2KA 5FBQB 4F1KA 5JZ9A 5C18A 1XTZA 1U5BA 4KAJA 4O33A 1I9GA 2B61A 3B1FA 5ER9A 2W11A 5IYZF 4Z1MA 3FSGD 3NI2A 5COAA 4GKJB 3VKVA 2PKQP 1QHEA 5C8XA 2WNIA 3TPZA 2ZUDA 2E4WA 2BJHA 5DASA 1CY2A 4D4KA 1FSSA 1W4LA 2RGBA 3KO8A 4UEWA 5AJZA 2WQ7A 3GROA 5IRCD 2ODEA 3KKOA 4WBXC 5ALLA 5I47A 2IBTA 2V6MA 1X2BA 1JQLB 1MB3A 5SV2A 3H6KA 4U3JB 4M55A 4BV3A 5HIMA 2WVJA 2X42A 3IIIA 2AI3A 3K8OE 3VU3A 5LQSA 4N65A 3LX5A 3N2KA 5MN6A 1F6WA 2Q0SA 1E4YA 4L28A 5BQPA 1ZFNA 1MA3A 2PUJA 1LF0A 5FTMA 3L01A 3F71A 1FFHA 3EBOA 4X6LA 2OOKA 4TXLA 5KDDA 3HXQA 3WKEA 1QKIA 3IKJA 5HIIA 5EQDA 1KOJA 5LDHA 3M70A 3ABZA 1ZM7A 3VR3D 4MYHA 2YXEA 4V0MA 2QT0A 4I55F 4GBJA 1G4HA 1GN8A 1YC2A 2WD7A 3ONDA 3IV9A 1CZOA 4UEOA 1H22A 4FHZA 2I4LA 3ISVA 4ENPA 3B78A 1NY6A 4YV0A 1SBZA 2ZJ0A 4PNZA 1CFZA 3NHFA 2OHOA 2HOQA 2FMHA 4DPKA 5H70A 4AG3A 2X3YA 5T8KA 1KQFA 2VYVA 3DLBA 3JR3A 1DBQA 2QZ9A 2V6JA 1KDOA 2YV3A 4QL3A 2ZCVA 2G7ZA 2Y1WA 2ECQA 3D54D 2OV4A 1NZFA 3CZCA 3BH7A 3KKEA 4H7KA 4M7OA 4RGQA 5CK4A 4YO7A 5FL7D 1VCMA 2IS6A 1IVYA 2RHCA 4OVKA 1PG0A 1MDFA 4MO9A 3JWIA 5IH7A 1TTTA 3MAAC 1DBVO 2FWIA 4DCGA 2A35A 3TDMA 1U3WA 2H4YA 2IXBA 3IOCA 3EEBA 3C5HA 4AIRA 1GDDA 5GZ3A 4FXPA 1IK6A 2XMPA 1VHQA 4C08A 2VDQB 4C7KA 3WX0A 3M1IA 1Q0HA 1WAMA 3R7NA 1XZ8A 4HWGA 3FE2A 1MJFA 4KQHA 4CG3A 2ZWIA 1H0RA 3KEGA 2WUEA 3G1UA 3R6GA 4JC8A 1U1EA 1E5XA 1VGQA 2AN9A 2J46A 1OA0A 1O6CA 1KTVA 1YOBA 4CM1A 2FPKA 2WFAA 1CHNA 4L9RA 3JD2A 4TL6A 5IJ9A 1X7ZB 3DP7A 4WH0A 1FMTA 1TUIA 1WPRA 1A2OA 1EBFA 5AH0A 1UH5A 3G5AA 2WAOA 4PRYA 3V8PA 2HQ1A 4AJPA 4FBGA 5KSWB 3U26A 1XO1A 4BS9A 1EH5A 1HEUA 2DT5A 1I7NA 2X77A 4EY4A 2P9QA 1EK5A 1OPXA 2YXDA 1ZESA 2WWTA 1NI3A 2HXSA 3LW8A 3BMOB 1TUGA 3HZZA 3M6WA 3MJHA 4WMLA 4IG9A 3VGPA 4DWVA 4FOTA 4OYLA 5E2AA 2VUTA 5KYXA 3UAWA 4FCTA 4KE9A 1SH7A 1TU0A 3G2NA 3LNCA 1EGHA 1SU8A 1V35A 2OESA 4DVJA 4Y98A 1IY1A 4RMGA 4GS5A 4ZICA 5MN4A 2FR1A 4FGWA 2DQYA 3O2NA 1NOIA 3DV2A 1NW4A 3LS2A 5G1OA 2HGZA 2Y0DA 4JFRA 3RVOA 3NIWA 1IXKA 1LI7A 1TGYA 4GI1A 4ZCPA 3P5BA 3NO4A 4DUYB 4OHRA 3FBWA 4YXWD 4MKIA 4G1FA 2X9LA 3IUNA 1X1BA 3TB6A 2AZXA 3BD6A 1N32B 2J6HA 5CW1A 3L6EA 1T8PA 3M8KA 2XVMA 3S0JA 4GNKA 1KMMA 2A1UB 4U0JA 3PPWA 1GXSB 1M76A 1W0JA 1R4NA 2R8BA 2A88A 5LA6A 3RIHA 5F5NA 4BE9A 1XRRA 5KNLA 3TCXB 4AS1A 3TZLA 3JWHA 1K8XB 2HT1A 1TQ4A 2QVZX 2FOIA 4Y0NA 5EKXA 3HCRA 2ZG6A 3M1LA 2UUOA 1TB4A 3NH6A 3X1JA 3EQ9A 4J75A 3W8FA 4EW3A 1US8A 5K0CA 3E5NA 4CF5A 1UIRA 3R74A 1GKUB 1HA3A 3OIGA 4GQAA 4U6QA 3R8XA 3UJBA 1B15A 1ZEMA 3PLRA 4MJLA 3QVJA 3G0GA 3DNMA 2DF8A 1KFEB 1PEAA 1VE6A 2V97A 3KSZO 4HAYA 4HNGA 4HSEA 1DJLA 3ZJVA 2PEYA 4KPUB 3U4MA 3GRVA 5BYBA 2WB4A 3KZOA 3JW8A 5F33A 3SDBA 5KSYA 2XUGA 2HI0A 3R6LA 4BVBA 1LDBA 3D2AA 4C76A 3GCDA 4RF5A 1I2ZA 2K87A 2KX7A 1ZI8A 2P5SA 2VAWA 3JARA 4KCGA 1ZOIA 2TMDA 1SXJB 4DQLA 1DT5A 4BGIA 2QQFA 5FTLA 1NXQA 4Y6SA 1EGVB 1G8JA 1GGFA 1U6KA 2X40A 1KAQA 1U0LA 5ENVA 2D0IA 2NU7A 4NV3A 1L1RA 2ONZA 1G5IA 1FDUA 2A67A 3A70A 5J63A 6AT1A 5TQJA 3TLXA 2O8FA 1XTQA 1U4NA 1DEKA 4BZQA 3GMSA 3JQEA 4LXQA 3MJRA 4V0ME 3SLKA 4X3CA 1RYFA 1CR0A 2B92A 3FUCA 1L5NA 1HR0B 4BNNA 4X97A 5DW3A 3L92A 1IL0A 4YBZA 1RSZA 5FR1A 5BO5A 1KY3A 4F5YA 4RWEA 1Z73A 2C2BA 5B2EA 3BK1A 4YCNA 3O82A 4M1QA 2DM6A 1L4BA 1I4EB 4YJHB 5D00A 3HJGA 2INGX 4AC9A 1RRGA 1U2PA 1KRHA 2KI5A 3B6EA 3D6TB 5LDGA 1FS5A 3O4HA 3BE8A 1EHIA 3Q98A 3JYLA 4F91B 2V1XA 1N77A 1C3VA 3NS7A 1DUVG 3C5WP 4H6PA 3WRXA 4H4DA 3ILXA 1FL9A 1N6RA 3DV0A 4BNGA 1A1VA 3DTVD 1SXJC 3HDGA 4ZK2A 1I3NA 3KBOA 2KM1A 3R9KA 3LDGA 4C05A 4EY7A 2XUQA 4KI0A 3KWFA 3ZG6A 3G9QA 4TYPA 3HTXA 2NUPA 4NENB 3CN7A 3PXEA 2JAHA 3ZPXA 4PIVA 4WAUA 3U13A 4ZDJA 2O2EA 3GJ3A 2XLBA 1YF3A 2X5XA 4CEJB 1I3CA 2HNBA 2I80A 4ETMA 1W2WB 1I2MA 1XR3A 1Z6AA 3U37A 2AD5A 3V8NA 4X3PA 1LTQA 2F48A 3VOSA 5EP3A 4OGLA 3EUEA 3W05A 4EEZA 3I45A 4N3GA 2COUA 3CZRA 4P7FA 3RS9A 4MYSA 2VK4A 4A1OA 4I5DA 1BX1A 2FLWA 2ASVA 4EB6B 3G2JA 1XROA 2IYEA 3JWJA 3L7YA 2ZFUA 5ELLA 1JI3A 3KHUA 3VJLA 1G2PA 1KYVA 3LX8A 5DLPA 5HJ2A 1Q57A 1ENZA 3WV4A 4MEJA 1LFDB 2WTEA 3LUCA 4D46A 5GONA 4ZXPA 1T4MA 4R2JA 2XA2A 4YR9A 4OHKA 2Y6VA 2I3DA 3D3QA 2Q8QA 4MVJD 1HXHA 3RBZA 4I3HA 3IHWA 4MTCA 5AT1A 3TJRA 2R4UA 2YYYA 5GOZA 5KAPA 3IQWA 4OQDA 3F90A 3FWNA 1G9TA 4MRMB 4XWYA 3UOAB 4MQEA 3A14A 5HXAA 3USZA 4V2IA 5K3DA 1K5PA 2HNKA 5G2OA 3DLAA 4L08A 3ISTA 3KKZA 3GMDA 3CO0S 4YA6A 2CXPA 4DAEA 3A3YA 5HQ3A 1ZJWA 1G0NA 3M6AA 1QU2A 1EDOA 3C5CA 3O90A 2JIZD 4IS3A 5IJWA 2IHKA 2AK3A 2XRFA 4KL8S 4OJQA 1I0LA 1IEXA 2XWBF 1ZGZA 2O0LA 2G9RA 2RC6A 3AUKA 1SIBE 3OEHD 2FUCA 4BGDA 3NTVA 4NJOA 1MQAA 2EBUA 2VHVA 2QRZA 4XGIA 1WXEA 4US1R 4AVYA 3UYKA 4F4HA 4YCMA 1UKCA 3ENKA 3PGLA 4P0PB 1AY0A 2DBQA 4XUCA 1KYWA 3DL7A 2OO7A 2Q5EA 3B1KA 2W70A 2PX5A 1K8RA 3G68A 3IR5A 4DJJA 1GQFA 1JR4A 1XP8A 1HLFA 5EIAA 4KGDA 4P98A 4PF1A 5F3DA 1MHTA 1N6PA 2E5LB 2OBFA 3FNBA 1G3RA 1PW7A 3O9VA 1A0OA 3NHZA 4JB3A 4G4IA 5LQMA 3FMOB 5IKEA 3D2BA 5JDIC 1VTKA 4DCVA 3KQOA 1JW9B 4R1TA 1M6HA 5L6MB 1NI5A 3P9CA 2YN2A 5A06A 3NMUF 2FMXA 3BXEA 1UWKA 3CUWA 3KSMA 4ZEVA 4PYIA 3IAS6 1SCQA 1UJMA 2QP9X 5H16A 2C5BA 2Q1TA 4FYVA 4X6UA 5BW8A 3ZS9A 2W37A 4C0AC 2IY7A 4EUEA 3NEJA 5JCJA 4X93A 2AOTB 2VP0A 1XDZA 2IUEA 4B17A 1UBRS 3BTUA 4CQJA 2IH4A 2OFPA 3BRWD 3SDZA 2B8TA 1VPWA 2Z30A 2X0EA 1NPYA 1XTVA 1JQBA 3WJ7A 4BIIA 1YE5A 1F8FA 2Q6TA 4WUVA 3HB9A 2I55A 1U8ZA 3OQ1A 5EYPB 3ZV7A 2Y99A 2WAAA 2O20A 4JMPA 2DKOA 1S2LA 4ZC8A 1ZK3A 4L51A 1E2DA 2H5IA 4WTOA 2P30A 4N76A 2WVHA 4FB5A 2QVCA 2JFOA 1BIFA 4W9NA 5EE0A 1UJCA 5H81A 4BFCA 2K6GA 4MHSA 4N39A 3UWOA 5A03A 4MUIA 3T52A 3OLXA 3WLMA 4AFNA 2OXFA 4BNMA 4XX0A 2X8AA 1KO4A 4V38A 3AWIA 1NXTA 2VT3A 3VDXA 2CL0X 2X15A 1X1AA 3CKLA 3QNMA 4L0DA 4MR8A 1G9SA 3V2GA 2FE4A 2QRNA 3ZHYA 4MKZA 1C0LA 3CUUA 2ZYIA 4FYKA 1GSOA 4AXBA 4C1BA 3OURA 1BNCA 3HPRA 4MX8A 4OHUA 1RRPA 3SOZA 2J9ZB 3MLAA 2HREA 5CITA 3EVFA 4NYJQ 2ON6A 1HDIA 1D04A 4BDTA 4JS0A 2FLKA 2NXJA 2WJGA 3IJRA 1KERA 2IXFA 1AKNA 1OQAA 2QMQA 1PR5A 4JB8A 4IQ8A 1Y3BE 1A96A 3AB3A 2R8XA 4HZGA 3WV5A 1VSTA 1BS1A 3ZWDA 3BIJA 1PTJA 4FKBA 3O95A 2GFHA 4US2R 3NHPA 1C0PA 1FZQA 1A50B 1QB7A 1SIOA 3L4BA 3FGZA 2B34A 4TKLA 4DLNA 3TLMA 3M5PA 3WL5A 3W5BA 3Q6NA 2R3SA 3I01M 3GL9A 4W1QA 2V5VA 2EQBA 4XSHA 3U5TA 1H9AA 2HC9A 3BBPA 1XKTA 1FFBA 4QA9A 4YRAA 3BORA 1TW2A 2JFZA 2ACWA 1UWCA 5TMEA 4OUKX 1UOQA 4DEYA 4ZYVA 4C14A 5K8LA 3RHFA 1TM3E 1S96A 4I2VA 1U4SA 2OZVA 3L05A 4U6NA 5DT9A 3IDSA 3LWDA 4F6LA 2EX4A 1T26A 2WWWA 3SZ3A 1UJ5A 3AM3A 1BO6A 2EQ5A 1RR6A 1A88A 2HMVA 1NQAO 1PZFA 1LLCA 2O0MA 3CWCA 3G8BA 4OF4A 3S2YA 1PDOA 3NRBA 3TXAA 2O5EA 3VR1A 1Y5RA 3MTBA 1G2QA 1M33A 3CWQA 1ZHOA 3KCQA 1QRUA 3H83A 2A9KA 2EGHA 2Z8YA 2QV7A 4FILA 5GGYA 4PGAA 3TLYA 2DY1A 2VJAA 5A5EA 3EIQA 4DB4A 4CL0A 1XG5A 4QO8A 4DV5B 2G4CA 2IEYA 5FF9A 3GEMA 3AETA 4FW8A 3F96A 2PVCA 3C7CB 1TO6A 5ITVA 5KWEA 2GDJA 5HJEA 2ZSFA 4GDFA 3GRYA 4JNCA 2AA3A 4G67A 1BE6A 5LNK1 121PA 2EIHA 1N2SA 1ATZA 4M1EA 3CIOA 1ZJZA 4XVHA 5BSRA 3LXMA 1IN7A 2IWHA 1UBNA 3LY5A 1MC1A 4J1TC 5IDYA 2HQOA 2JK0A 2ODQA 2MDTA 3Q3IA 2GQ0A 3TQSA 2BUBA 3MS4A 3CU5A 4G8BA 4PSAA 5HGJA 3UMVA 1H94A 4WXMA 1ZN7A 2HWUA 5JCOC 1Z63A 1CB0A 4B2YA 4XWKA 3VA7A 5IVHA 4N47A 5AI9A 5IZCC 4L0CA 2EJBA 2XPCA 1UDAA 1Z6QA 3ZLBA 4Z4CA 2I4OA 2XYVA 2A0XA 2B0CA 2ZYRA 4EUSA 3U4DA 5EHXA 1FPQA 2YCLA 3E23A 5EWMA 5IDQA 1SA0A 4HF7A 4AJNA 2AR0A 2BELA 3WMRA 3V6LA 4V02A 4MCIA 4MYUA 2GD0A 3AONB 3SHVA 3QFRA 4F3TA 2NQTA 4XDHA 2YHIB 3A6PC 5FBWB 4I1SA 2V4UA 1U3UA 4ZVTA 3SZMA 4LRYA 5FFFA 3TBFA 1KR2A 3ZBQA 3AF1A 2OM6A 1TJYA 1HSZA 2E3JA 4XCVA 2PQ2A 1Z6GA 4QASA 5DNCA 1YZNA 4OGKA 2EJUA 4QXAA 1E8DA 1HOXA 4YMGA 4YUZA 2CLCX 3TRKA 3TX2A 1VG9B 2QTWB 1KMQA 4MS3A 3MCAA 3M1AA 3NB0A 4UDXX 5A6SB 5DNVA 1NU8A 2C5LA 1SNYA 2PBFA 5CX1B 4CKXA 2IYVA 2Z3VA 4XJTA 3JXEA 4O2BB 2ZSEA 1W85B 3WIBA 4KHPB 1K8YB 1BKDR 1R3UA 4E2WA 3ID6C 4N7MA 3O8CA 3FFTA 3QA9A 1GFZA 2RE8A 1GZHB 2R5WA 4CGYA 2H1CA 2WZBA 3MXTA 4LX0A 3F4KA 3UNXA 2ZK7A 2JAWA 3EIHA 3KG2A 3VZSA 1KZ9A 2FEPA 2V7QA 5K5EA 2CJFA 2MU1A 4RIFA 3RVRA 3IE1A 4Y6LA 4EMTA 2BKVA 3MXOA 2I7DA 4RY8A 1SU7A 1G6OA 3NBXX 3PQ8A 5E6SA 3MT9A 1YJXA 3L0PA 1ESDA 4YUXA 2FEKA 2VYCA 1XTTA 2CN1A 2MHCA 4ATNA 4RKRA 1PR1A 4LK3A 1XDDA 3NBZC 1Z5GA 1H85A 4OB6A 3LK6A 3ROFA 1U2SA 3G0DA 3EN0A 3ZNNA 1OR8A 2B35A 1IDN1 2C3YA 3KQUA 2WJAA 2ZDGA 3GRZA 3PUJA 4POAA 3STYA 4LRWA 4B3FX 2QK4A 3E9CA 1E2KA 2A5FA 1Z17A 1J1IA 4GXTA 3WK8A 3GT4A 3A36A 3TIXB 1J39A 3AOEC 4ZYWA 3DE3X 3TNJA 4LDNA 2X5OA 2WE8A 4Z9AA 1DKOA 1PP4A 2YJNA 3MJCA 4N3BA 3FUVA 5DI3B 1UBHS 3OKCA 4I4LA 3KZNA 2REQA 1RM4A 4K9DA 3MILA 3JYPA 4OHWA 4TS4A 3PCXA 3FXAA 4KJXA 3WYCA 5IC5A 2ANBA 2VHUA 4Y2TA 5J4LA 4RK4A 2BM8A 3R3UA 4PG4A 5CURA 1G5TA 1G55A 1IN4A 3H42B 3I05A 5TGTA 3QUAA 2B6HA 2SECE 3OE7D 2HRCA 4PGHA 3WWDA 1XVIA 2F67A 3FN4A 4NAHA 3PRKE 3PEFA 4L72A 5C3UA 5JVDB 4ALIA 4CM9A 3DV9A 1ULAA 4LDRA 1PR3A 2IP1A 2NT3A 2Y8EA 3F6EX 1FYFA 3ODGA 2FWBA 1DCKA 1OKKA 2BISA 4J8PA 3WYAA 3OIUA 4EGFA 1PS0A 2D59A 3WLQA 4V3BA 4B3SB 2EW8A 4AL4A 1F20A 2Q50A 2YFQA 1C3OA 1T2FA 5IKPA 3DT9A 4ERXA 2GBGA 3EIXA 3VQTA 4AZWA 3B82A 2R44A 4J16C 4YX9A 1E5QA 2QN2A 3G0HA 4RWZA 3CSSA 5I9TA 4CHTA 4CE6A 1B14A 4XPIB 2WWGA 2L2QA 3C3MA 1P5HA 2JHPA 4WFKA 1YDGA 4YPVA 3IJEB 1ZO8A 2OZKA 2SICE 3DE4X 3SJZA 3EWNA 2RHGB 4OV6B 4IMPA 1GUFA 2CZCA 3G2HA 4IOLA 4MPTA 4MGZR 1SEPA 4WNAB 3T8YA 1PS9A 1VE5A 1O58A 2JATA 2YY6A 3AV0B 1PD0A 2F2TA 2WU4A 2VH5R 1EP3B 2FCRA 3UV7A 1I6KA 1KBQA 1R8QA 3ZNPA 3HKCA 5CBPA 3WO0A 3SY8A 3W1EA 4TV8F 2PH5A 3O8BA 5F3RA 3OP1A 4NVRA 1SFRA 2A92A 2G80A 2CFCA 1WSBA 1TMGE 3JRNA 2BKEA 3PGVA 5E9QA 3VI4B 3IUQA 2UZ1B 5B3JC 3QM1A 5TVKA 1A9PA 2R1VA 4HQOA 3U7EB 4G23A 2VDNB 3O93A 4GOXA 5LZ7A 3PUIA 3RK0A 1K9SA 2WRZA 3EEYA 3I28A 1U94A 4ZDIA 3HCNA 3HA5A 2PUDA 2RGCA 1V45E 2OGTA 4L02A 1L5FA 2JRCA 3C1AA 2OO3A 4AMZA 1XU9A 2XJ4A 5LQCA 1VKOA 2NVUB 3HA3A 4XUDA 4ZOCA 2D3TA 1RKQA 2G6BA 2ZIVB 3R3ZA 2A30A 2BRUC 2IW3A 2ZBPA 3QHAA 4FN4A 3SFTA 4CLRB 2LKCA 4CMIA 2WMOB 3WL3A 1V1MB 4BU1A 1YA8A 4XQ9A 5ARBA 4OLBA 2NUTA 1M2KA 3C15C 2PWAA 3VV2A 1H5UA 1J8YF 4FD3A 1MRZA 5AVKA 3W2EA 2YHAA 4KITB 2Z2XA 4L78A 4HWSA 2VT2A 3UIEA 1HFKA 1QIJA 5JROA 1VG8A 4RETA 3TZKA 3L8FA 4Y6PA 3REOA 2IY8A 4LFBB 3DHNA 4AM8A 2YZGA 3AY6A 1YRLA 1ZG3A 2H3EA 3AFNA 3M83A 3STVA 1PR2A 2JFXA 2X8JA 4GUDA 3RBXA 3KTOA 1Z22A 5HE9A 1HRKA 2Q6VA 5I7EA 1KRWA 3CLHA 5DNYB 4ROSA 3CF4G 2ZIFA 4ZIRA 3IH5A 4KG7A 3JVEA 4E1AA 5M2QA 3MCZA 3PT5A 3MS2A 5K6RA 1Y98A 4U63A 4YUWA 5DYYA 2R6AA 2ZI5A 3DXFA 4O8CA 5T5QA 4XOUA 4QLBA 4K9NA 4C43A 3AR3A 4X64B 2ZUSA 1J23A 2ZAMA 1EI9A 1MAUA 4DY4A 5EA2A 5KQRA 4KK4A 3A9CA 3JQPA 1W93A 5A3RA 4XW2A 1KI6B 2NSLA 2NZJA 4Z2YA 1WDKA 3CBGA 4E4TA 2VUHB 4F21A 7YASA 2GB4A 4WFJA 4J1SA 4WBNB 2GBFA 3KZKA 1WDLA 3AHHA 2F3UA 4GKVA 4MVJG 2GAJA 4INAA 1MMFB 5DP2A 1NVTA 2QF7A 4PXYA 1XXLA 3GUCA 4RKYA 2VHQA 4ZQBA 4BB0A 5CG1A 3HDHA 4BNTA 1E7YA 3ADPA 3ETJA 2ETXA 2R68A 5I9BA 1XVVA 4HAOA 3CF2A 4CWAA 4OX9B 4PV7A 1DV2A 1M2HA 1RPAA 2O7NA 1YBMA 1VMKA 2FRVA 2QXYA 4L8VA 1S3IA 2PZAA 2NSYA 2GBCA 3LQQA 4IHQA 5HZGA 2QNIA 3ZD6A 1AK2A 4BNLA 4MWOA 3B1YA 3WYEA 1TUBB 4KBYA 3M6UA 4CG1A 4ER3A 5I7FA 1APBA 1FP2A 4Z3DA 5H1YA 4UU8A 4NNOA 1F51E 5TF4A 1K06A 2GN2A 5K45A 5IXSA 3SYMA 4O2AB 1P45A 5E7QA 1DJPA 1X14A 2NZ8A 5C4GB 4F9GA 5BW5A 2IKSA 2PZBA 3X3HA 3WWEA 4K46A 1ZSVA 1JJFA 3AI2A 4AURA 4CCYB 5KVCA 1E6LA 1GAQA 2YVLA 3G89A 4OFWA 1V8OA 4R8LA 3PT9A 4GXRA 4WK4B 3WQQA 4C21A 1TQ8A 1PNTA 1PGQA 3IA7A 4RLQA 4DRYA 1L0BA 1IAQA 3CZPA 1VJDA 2QM3A 3FYTA 1PKXA 5JLAA 3KQPA 3QBEA 2IYAA 3FHTA 3DBRA 2FZCA 1L7XA 3ORQA 4PYLA 1QCDA 1PJSA 3DZ8A 4ZVRA 3GLGA 4U7PB 1KDPA 1RKVA 3COPA 4D56A 5JNTA 1P9LA 3DWEX 2XDAA 3VNAA 4YRGA 2NP7A 3SFVA 3EYAA 4UUQA 2CB0A 1XU4A 4KTVE 4X60A 3RSCA 1TYZA 1VJGA 1NOJA 1XDGA 2ERCA 2WSYB 4E0BA 3NAQA 4G09A 5DLEA 4DNOA 4B46A 1L7VC 3O84A 4Q9DA 4OJKA 5HF8A 1W49A 1Y6ZA 2VC2B 3CVJA 3FUWA 5AXCA 5KYVA 1M6VB 3ZIAD 3PNOA 3OPYI 3RVPA 3SJBA 4ZHQA 1AZLA 4G5SA 1FNBA 1N2ZA 1AQNA 3RV4A 1HNNA 2WYIA 3UHJA 1JDPA 4BHTA 4MWDA 4N0MA 4NZOA 4H0FA 2QTTA 4EENA 4RHYA 1NXSA 3CB4A 3PFKA 1GN9A 5DCYA 3EGDA 5CT5A 1RZRA 1E3TA 1H1LA 5F1OA 2Q4DA 2JVIA 2OZPA 1XCOA 1CR4A 4REQA 1SEVA 5LWHA 3HXLA 1RAGA 1MAWA 1IWPB 2FR0A 1IMJA 1E8NA 3G5TA 1R5OA 2O5VA 5IZ4A 2GERA 4NJMA 4ZTBA 4UNQA 1QHIA 2CEKA 5B6JA 2W2MA 3PNLA 1XD8A 3VOBA 2VL7A 1HPLA 3O0TA 3LECA 4O2RA 2WWXA 3GYBA 2RKBA 2FOLA 3E18A 2GJSA 2ICAA 3KQMA 4JOQA 4R1PA 1XVUA 1HQYE 3QWFA 1PLLA 2P27A 4NLLA 2FB9A 4G9GA 1YZQA 3TLBA 3HVRA 3WRVA 5LQRA 8ABPA 4L2IA 2KHZA 5IT4A 1MQ9A 2FSUA 2ZIXA 2VOJA 3C6YA 1CB7A 4INZA 3GDOA 2RDMA 4YCAA 3RUEA 4ESHA 2MINA 1U7PA 4II7A 4ND3A 4I1OA 6ABPA 4RSRA 5FXMA 4LGMA 4NARA 3H7IA 3P2JA 3YASA 2GETA 4K0KB 2R1TB 2X6TA 1PKEA 4A6DA 4F4DA 3DWIA 1CUSA 2ZANA 4G37A 4FR5A 3PC8C 1RMTA 4XWAA 4ZAZA 3U3XA 3BGVA 3F8TA