4DCNA

Crystal structure analysis of the arfaptin2 bar domain in complex with arl1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
TREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 1
publication title Structural basis for membrane binding specificity of the Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-2 determined by Arl1 GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 47
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcnA00
5E7MA 3THXB 2G1KA 1K6MA 5H68A 2YKGA 1XEXB 4UKDA 3K9GA 1XBTA 4BFVA 1IBRA 3TBKA 1F2UB 3QEOA 1XJQA 4IEIA 4O2RA 4DZZA 4M2LA 2ZETA 4B3DA 3LX8A 3LNCA 4LBZA 1E1RA 4OHVA 2BVNA 2ZE6A 2GVZC 4B76A 1ZIOA 3LLUA 2A5YB 4E22A 1ETUA 2CCJA 1AIPA 1ESMA 3M1IA 1SXJD 3IKJA 1NVVQ 3PEVA 1A1VA 1G3IA 3VX3A 2F1HA 3LA6A 1Z06A 2AR7A 3A4NA 4IXNA 4HDOB 2DFLA 4EFLA 1P2VA 1KSJA 2F1IA 4P4SA 2IUSA 3QF4B 2FEOA 1GKIA 4A2PA 2WHXA 3HWSA 1S96A 4FINA 4PO8A 1E2HA 2FPKA 2IEZA 4A6XA 4WA7A 2YOFA 4FMCF 3C41J 3BS4A 4DSNA 4ON9A 3U44A 5EZ6B 3UMRA 1GKYA 3WXMA 2F3RA 4QJ4A 4R2IA 1M8PA 4HAVA 1ZNXA 3THWA 2OSBA 3V4FA 4DCTA 1NBMD 4B6EA 3U60B 1KGDA 2OLKA 3E5HA 1E2IA 4QNRA 2ZRHA 3WNDA 3K0CA 1Q1BA 1EFTA 4RKFA 3ADKA 1OFTA 1G6HA 2A9KA 2V6JA 3MWJA 4B3FX 5KHOC 4CEJB 2ZJBA 8OHMA 4DDTA 5DLQC 1YR7A 3QKUA 4E5UA 1TU4A 2FGKA 2ZRAA 1QZXA 1RRPA 2V7QD 4W5HA 3I5YA 1W5SA 4R9UC 4URUR 5JZVA 1IXSB 2A5FA 3KXKA 3QOFA 3GEEA 2OAQ1 2NZ8A 3QXXA 3KQNA 1U0JA 4FIDA 421PA 1G17A 3R7WB 3IHLA 2A3RA 5SZJA 1EFCA 3GLFA 3P32A 2O8BB 1E2JA 3RC3A 1I4LD 1W46A 3CKLA 3LW7A 2X19A 2ZRLA 2ZSDA 4TYNA 3NVAA 4ESVA 4LJYA 1E9SA 3A58B 1XU4A 1B0UA 4D81A 4D82A 2CK3A 2YWGA 4PAQA 1IXRC 5ANRB 4RFSA 4CT5A 1QHYA 3CH4B 2AX4A 5C1BA 3TVTA 5DISB 1TX4B 1M6NA 1R5BA 2OXCA 3BIFA 3V9PA 1J7KA 1F2TA 1XXHA 1J8YF 2AWOA 1YZUA 3EA0A 2ZVQX 2QMEA 3LDAA 1U98A 1LF0A 2ZRMA 2GDJA 2JCSA 4M8NE 3RS2A 1OSNA 2XXAA 2IYVA 4IKEA 2E9SA 4DT1B 2OZEA 1W49A 2PX0A 4PQRA 4QL3A 1CR2A 2BCJQ 2VHCA 4ASUA 1GNQA 1MV5A 4OL0A 4OI2A 3SYKA 4KYIB 2H16A 4KYUA 4JLNA 5B58C 2VP2A 4OI1A 1CTQA 1FMLA 2ZRFA 2IT1A 3U4QA 1UBEA 1JALA 2ZI5A 2JLRA 4XVRA 4JLPA 5H70A 4KSCA 4IW3B 1XTIA 3IEUA 3T12A 1TEXA 4ACAA 4M1WA 1N6HA 3V4RA 3JZAA 3F3YA 1JAIA 3TVDA 1RYHA 4FI3C 1DARA 4BFUA 1H8HA 1W0KA 4BWYA 4Q18A 1U81A 3SHFA 3SU8A 2VP5A 4A1FA 2XSZD 1Q57A 3IQXA 1G6OA 2VLIA 3NC1C 4DRZA 3OF5A 1ZM4A 4TYWA 1N25A 5CIQA 5L3QB 1HYQA 1NLYA 3THYB 2GRJA 1MO6A 2GBLA 2B8TA 4MGKR 4NYMQ 1NP6A 4L16A 2FX3A 4G01B 4G5GA 2LKDA 3MUFA 4TN1A 2QM7A 4LJ6A 4HATA 4LGMA 1SVSA 4FMDF 3TW4A 5DE3A 4AY2A 1KI7A 2VO1A 1W1WA 1ZRHA 1CRQA 3IQWA 3KB2A 3L8YA 4C2UA 2F9LA 4D80A 4BLRA 2V1UA 4NDZA 4DDVA 4HZUA 4B73A 4CVNA 1BOFA 2G0NA 3UKDA 1ZIPA 5IDVA 2IK8A 2GJ8A 5DI3A 4ZI2A 4QHYA 3RS5A 5HE9A 5GVSA 4F91B 4QKQA 4B2LA 1GIAA 1KDTA 1V5WA 1QVAA 3KKNA 3RS0A 5FFMA 1AJEA 4M22A 4H1UA 2XTZA 2FSIA 5CDFE 4V02A 3FFBA 1T5IA 1W4BA 2JJ1A 1FP7A 3GLGE 4WZBE 1ZCBA 3QXSA 5F2EA 2QRZA 5FBRB 4A0RA 1ZYUA 5EXPA 3NH6A 4LV5B 4MYTA 4Q9IA 1HV8A 2NGRA 5DH9A 3EW9A 3R9XA 1OPXA 4ZCIA 2NO7A 4B32A 2R9VA 2HF9A 2WWXA 4KVAA 2IYLD 2VP9A 2Z5FA 4AG5A 2IWHA 1PZNA 3N70A 1VMAA 3GJ5A 2QAGC 3OIYA 2HF8A 2Q9BA 2OCAA 3RRZA 4MH0R 3KKPA 5C18A 1ZM3A 1A2BA 1KMQA 4BFWA 3A36A 1CF4A 4AURA 1QHSA 4YDSA 3REGA 1XP8A 1JEDA 1VHTA 1JI0A 5AUQA 5C46F 2XNDD 2CHGA 2ECKA 4F92B 5DNYB 1Z08A 1G19A 4KFUA 2D06A 2ZSAA 1GNPA 1OXVA 3KQUA 4JZKA 4LI0A 1OFIA 4GP6A 1E2DA 4Q1CA 1I2DA 4KFTA 1KI6A 5FBVB 3K70B 4CT4B 2QTVB 4JVNA 4L9SA 3QKTA 1W48A 1ZNZA 2OE2A 3CRRA 4WZ6A 1FZQA 5FL7A 2J46A 4TQAA 1Q3HA 4PX9A 3SYNA 3OE7A 2IYQA 4JL8A 1DVRA 4TSFD 3TK1A 4PHTA 2AKAB 2J45A 3OEEA 3I8SA 3SN6A 2ZAMA 2CHQA 2O5VA 3EAQA 4B3CA 2QEQA 4EIWA 1NJFA 4Q4AA 1GDDA 1KI9A 1OHHD 2QAGB 2ZJ2A 3ASZA 2WSSA 4C0AC 1YQTA 2PCLA 2O8CB 2V6IA 1Y63A 4JVMA 1ZP6A 5IK2A 2CMKA 4C0HA 1LFDB 1UJ2A 1V43A 4PC1A 1W4AA 1X86B 1OH7A 4HAWA 3DZDA 3B7GA 4I1OA 3AM1A 2GXQA 1Z28A 2BJWA 4I99A 3A6PC 3AVXA 2CE7A 1CRPA 1WBDA 1L7VC 1XEXA 2XNSA 3B8HA 3UMFA 1UEJA 4YXWD 4G5SA 3Q72A 3VTKA 1FP6A 2J7KA 2Q3MA 3ZD7A 4LYAA 2NO1A 2WM9B 4U5XA 2W6ID 4FMCB 4Q21A 2AK3A 4GP7A 3AF4A 2ZI4A 2F7SA 5FPSA 4KODA 4AKIA 4LHYA 1GP2A 1G8HA 2FNAA 1VCOA 3KTAB 3NTUA 3D7MA 4HEJA 5C2JB 3TAHA 5FR1A 4JBXA 4NCHA 3ZZTA 4MGYR 1OXXK 1Z6AA 4TL8A 1IY1A 2FSFA 2XB4A 2NPFA 3TLXA 4Q4HB 4MKIA 2PLFA 3LD9A 4DHEA 2H57A 3K09C 2VHQA 2HCJB 2D2EA 2RHMA 3CX7A 1KK1A 1ZD8A 2PEYA 2GEUA 4LPKA 5EXXA 1W0JD 1UM8A 2L0XA 4OHWA 3NBZC 821PA 5LB4A 5K8UA 1PUJA 2AWNA 1YZGA 4AKGA 4PSVA 1VPLA 1ZNYA 1ZAKA 3GLGB 4QXAA 2LCFA 3SC3A 1JR6A 1G8FA 2FJUA 2MSEB 4Q48A 4M1SA 5KDLA 3PUYA 2BHRA 3FDIA 3U7HB 5LD2B 2R2AA 1DE0A 2X2FA 2RMKA 5TY0A 1S9HA 5EQTA 4TYQA 2QUZA 1KKMA 1X1RA 4JLKA 4XD7D 4CEJA 1AGPA 3MAAC 3AP1A 3C5HA 2JLUA 3IGFA 1DBSA 2FGJA 2DFTA 1OIXA 3P20A 1NN3A 2RGNC 3LQQA 2VSOA 3BB4A 3OAAD 2AKYA 4P32A 2I1QA 3DL0A 4DBLC 3O8DA 3CW2A 3R7WA 4OQLA 2W83A 3SYLA 3KDSE 4LJAA 3EXAA 2O8BA 3NDBB 3VR2A 4OHXA 3R9IA 1Z8FA 2OG2A 5B2ZA 1ZJ6A 1DAGA 3H4MA 4BLTA 5AUOB 4YMWA 2CJWB 1SXJE 2EFGA 4CIDA 1FNMA 1BYIA 2RB4A 3EPJA 3GJ4A 3QF7A 4DB2A 1E2PA 2C77A 2G0TA 3DOEA 4I1VA 4KLZA 1RJ9B 3QKRB 2Q21A 5KNCA 4MDFA 1DS6A 1N3BA 4F4CA 4JYBA 3GJXC 3V00A 3WRXC 1E9FA 2J7PD 3S1AB 2IXEA 5JS7A 1TEVA 1EFUA 1HT1E 4DT1A 1AN0A 1Z07A 1P2TA 1FPMA 2Z4SA 5A0FA 5D3MB 4IJMA 2QMHA 3BAFA 3BORA 5J4LA 1NBME 1X3SA 1KDOA 2J0SA 1II8B 1KDPA 3AKYA 1ZU5A 2J1LA 3GJ3A 4FMDB 4TT3D 4O25A 1EWRA 5KU1A 2QNRA 4I81A 4KHZA 4RKEA 4JJZA 5A5GA 2A7QA 2WWWA 4V0ME 3QUSA 2BKEA 3U2QA 1KNXA 2C9CA 3AUYA 3IILA 1UEIA 3E70C 3ZVRA 2FH5B 2BCGY 2ZANA 1E3MA 2C99A 1ZD1A 3EPLA 2CCKA 2ZRJA 1LVGA 3DKVA 3E1SA 4PZYA 4D2IA 5L3QA 3I62A 1M7HA 3BGWA 5EE3A 4K8OA 3SQXA 3KJIA 5BQ5A 1PLLA 2C78A 4V0OA 4KJZA 3T1VA 5JWOA 4FN5A 4LV6A 5JLJA 2N42A 4KAXA 3NHAA 5B57C 2BBTA 3OIVA 4Z1MA 4EDHA 2XJ9A 1SQ5A 2DWPA 1F5NA 2UVQA 5SZIA 3EPHA 3IO5A 1S4QA 3PIRA 1TUEA 3FMPB 4JSYA 1F2TB 2QL6A 4IFEA 1E1QD 1EWQA 3OIWA 2F3TA 1NIJA 1Z2CA 1R0YA 1AKYA 4DUGD 3DMNA 5FI0B 3RLFA 1P3JA 4G0NA 1KK2A 4G5OA 1Q1EA 2BDTA 4L9WA 2QP9X 3LRPA 2QQEA 3AP2A 1Q12A 4KLNA 1LB1B 1AS2A 2JDID 2IXGA 4MYHA 4PPFA 4TYPA 2ERXA 3CZQA 3T1TA 2YNMA 2OCBA 5FTLA 2R62A 1GAJA 2KJQA 1U99A 2GTPA 3AUXA 2ZS8A 2GILA 4NPHA 3HU1A 2QI9C 2GXUA 3LAWA 5FTNA 621PA 3IIJA 1I4DD 3GJ7A 3ZVLA 3EIHA 1UDXA 3R9WA 2WIAA 5IT5A 2WWGA 2RGXA 3AH8A 2XX3A 4A36A 2F9MA 4QGGA 4LHWA 4PQYA 4Q03A 5BN5A 5FUXA 2GWHA 2WPDA 5UKDA 4AKHA 3FMFA 1TPZA 1N5JA 2PEZA 1KSGA 4UNRA 4RD2A 4HLCA 4OK5A 1ZVQA 2D7DA 4EJSB 4L4UA 3SJCA 3RABA 2H18A 3ICEA 4Y0VA 4BFSA 1E9CA 1E79D 4HB2A 4DLUA 1KO7A 1KMHA 2CCGA 4NZYA 3QNUA 4CF7A 1WMSA 1GL6A 1XFAA 2DWOA 1A2KC 3SBDA 3BJIC 3CR7A 1VYUA 1OB5A 3SDZA 1MO4A 2R6FA 1SXJB 1H65A 1RYFA 1Q1QA 4DDWA 1T8UA 2GESA 1J70A 4RFVA 3L0IB 3CPHA 4QC2A 1IY2A 4P33A 1L4YA 1NLZA 5SZHB 1FFHA 1QVRA 4DCUA 3NKVA 4BFYA 4US2R 1N6LA 1F6BA 3QPVA 4MRPA 2RGBA 4JKIA 3CNNA 4KFSA 3ZQJA 1R2QA 4YMVA 2QAGA 3AEZA 4Q5IA 2REOA 5FTKA 3CR8A 4Q4JA 1QHXA 2V9PA 1N6RA 2WJIA 4LSGA 3NDPA 3VMFA 4BZXA 4D4JA 2Q3FA 3G5UA 1PV4A 1GG2A 1KI8A 2YYZA 5GJWC 4AYTA 2FWRA 1UKEA 4R7ZA 3CO5A 1ONBA 4D0NA 5KTYA 1EESA 4EFMA 3LLMA 1Q0UA 3CBQA 2JJ2A 2FFAA 4B71A 1HEIA 2Q9CA 3GJ8A 1VHLA 1II0A 3IPYA 1TQDA 1WE2A 4R2HA 3W8RA 3OEHD 1WB9A 3D31A 1XRJA 1VG0B 4C0BA 1ZINA 4FCWA 3LO5A 4FW9A 4Q00A 3P1JA 5HKKA 2DY1A 4Q1FA 3TUIC 3LVRE 3KTAA 2HJGA 4IFBA 1ODFA 3QXJA 2MMGA 1J8MF 4TLAA 5IRCD 2HLDD 5EP4A 1E9DA 1AZSC 4I4LA 4BEBA 4Q4HA 5CLLA 1D6JA 4ARZA 2IHBA 5JI2E 3CB4A 1Z3IX 2H1LA 4OBEA 3B1WA 3TNFA 2HJVA 1SVWA 2IS1A 4BASA 3H0KA 4MGZR 2A5JA 2X1VA 1YZLA 4NMMA 3RSLA 2VIIA 1MABA 2KBFA 2QROA 3SQWA 2G83A 1G8YA 3A8TA 1OKKD 3W5JA 2YWHA 1P9NA 1U9IC 3GLGA 1XTJA 3BFKA 1N6NA 2WICA 4TL7A 2JLVA 4H1VA 3AVQA 1DAFA 2BIFA 5FOUA 1JEEA 1GRQA 1TADA 2A2ZA 2CL7X 2WJHA 2OUKA 3ADDA 2C9OA 1NG9A 1QHIA 2ZAOA 1SGWA 3MWYW 3T35A 2BM0A 4E03A 3PUZA 1M7GA 1NY6A 2ZYWX 3BH6A 5AJZA 5C4GB 4IOLA 1P6XA 2ZU0C 1H8EA 4IRUB 5HCIA 4AYWA 3RS3A 3SE0A 1XPRA 2VH5R 5CJPA 1G4UR 3Q7QA 2ZUCA 1IJFA 5CITA 1XEFA 2Q3HA 1QHNA 1N6KA 5E7JA 1XZPA 1P2UA 2CNWA 1T3SA 1YE8A 2IYZA 2C2HA 3ZVMA 121PA 4MGIR 4BLOA 2PJZA 5FUYA 1A82A 2WWIA 2CJWA 1ANKA 1OIWA 2XTMA 4BECA 5KYKA 2RKOA 2A5GA 1FNNA 4URVR 1G8GA 4MITA 2ZSBA 1QBKC 3SBEA 4TTPA 4EFNA 3OHMA 2RGDA 5FOVA 1RJ9A 3F8TA 3QKRA 1IONA 1VG9B 4OK3A 1OXUA 2BMFA 4BFZA 1VTKA 3U6BA 1RZ3A 2J0UB 3L2OB 3U7EB 1Z0FA 4XVQA 2JLZA 1N5IA 1D2EA 1LV7A 4MRVA 1E4VA 3IIKA 3Q5DA 2HT1A 1CJUC 1Z2AA 4UXIA 4C2TA 3S1AA 3AF2A 4E09A 3A1SA 3VR4A 2D62A 2GKSA 2IWRA 4LJ8A 2FFQA 4PR0A 3DOFA 4OYHA 5D3MA 4Z8YA 5DHFA 1P2SA 4UQOA 3RAPR 3BD9A 3AP3A 2BJVA 3N2EA 4MUAA 5AUPB 3ZLJA 2RGNA 5LBIA 1II8A 3UG7A 5J47A 1NI3A 1T8TA 3MJHA 1UF9A 4R98A 4DIEA 4HI0E 4YDHB 3BB3A 3W5IA 1FUUA 4M0LA 4K81B 1I2MA 5E4FA 4BFXA 4B2IA 3Q5EA 2D74A 2ZJYA 4YMSA 2QU8A 3C5CA 4BUJA 2P3SA 3P26A 5JCPA 4II7A 2GJ9A 2GAAA 3KXLA 4RZ3A 2P6UA 1DG1G 3I8XA 4TL9A 4X8LA 2PZFA 3KQKA 2GK6A 2E1RA 1S1CA 2HDNB 1BO6A 2Q9AA 2WJJA 3TMKA 1IN6A 4JT4A 3U5ZB 2PBRA 1TF5A 1NY5A 4D0GA 1CXZA 1CBUA 2VF8A 1TQ6A 1JJ7A 3F0TA 5FL3A 4DLYA 1Q1ZA 4Q1BA 4EPXA 4MKHA 2Z6VA 3MFYA 4Q47A 5AUNB 3GFPA 1UADA 2ZRPA 3Q8XB 4TMWA 5FOWA 4LC0A 3OIUA 3A1TA 2GVDC 1M2OB 2D7CA 4V0NA 4S2EA 4M1TA 4DLSA 2IYTA 2OCYC 4A0FA 3W34A 1XMVA 1KI1A 3C8UA 3ZIAD 1NN1A 3KJEA 4DIDA 1BS1A 4A0HA 3IO3A 3QPUA 2VHTA 5FUVA 3ZZUA 5KOYA 1TMKA 2JLYA 1U94A 1S9DA 3GFOA 4IOMA 4NYIR 3CRW1 3B1XA 2VSFA 1E98A 2HT6A 3K0AB 1W7AA 2QE7A 1VG8A 1F3OA 2AXNA 2FPLA 1PVOA 4NCNA 1OH8A 2CHVA 1Z5ZA 3U61B 1C4OA 5JFGA 5FPTA 4LJ4A 1P75A 1KHTA 3B6EA 4HDCA 3EG5A 5EUMA 1ZUHA 1VIAA 4EJSA 3MMPA 4L5BA 3LX5A 1DAMA 4C7OB 4HZIA 3N5CA 1T5LA 1SVLA 2VTKA 4NCJA 1YVDA 3L82B 5HCNA 2OBNA 5DN6D 2DPXA 2QP3A 1KSHA 1UAAA 1DG3A 2JLQA 3QBTA 2N1BA 4Q9JA 4KBGA 1DO0A 1XCMA 2KBEA 2Z4RA 3TAUA 1BH2A 3DKPA 5CB6A 4EQ6A 1SXJA 4PFSA 1EFHA 4RCZA 2PLRA 2J5XA 2YC2C 3FTQA 3AKCA 2IS4A 4HLUC 3TJZA 2BOVA 1Z47A 2J9RA 3EWSA 4LYFA 3NXSA 1E9RA 1GOTA 2RGGA 3PXGA 2CLDX 4M53A 4EPTA 4KU4A 4Q02A 3QY0A 1E9BA 4B35A 4F4JA 5EE9A 4RVCA 1JNYA 2JAQA 1PJRA 3WHKA 3AVUA 1JQLB 1GL7A 2XOKD 4W5JA 5F98A 1JR3D 3QKSA 5JECA 1T91A 3B85A 4NP6A 2VHUA 4ZI3A 2QBYB 4ESHA 1XPOA 2VP4A 4IHQA 2FG5A 1NBMA 2SHKA 4A9AA 1L4UA 4HUQA 5FR2A 1DPFA 1CJKC 1DAKA 3DPUA 2RGCA 3TE6A 4ZDJA 3FWYA 2PMKA 1DO2A 3RRMA 2ZXUA 1JBKA 4LOAA 2A30A 1F60A 3BE4A 3CNOA 1SVOA 2NQ2C 1ZUIA 1CP2A 4V0MA 3RS7A 3TRFA 2IS6A 1O3YA 3QQ5A 3WMEA 2ZIAA 1P5ZB 3GD7A 5JJLA 1KMHB 3AVOA 2V7QA 2C8VA 2CLCX 3I73A 3G0HA 3NBXX 1NNEA 1XEWX 1L8QA 3AVPA 4GMDA 2ZEJA 1T0HB 5EE1A 3AB3A 1RVDA 5E3HA 3KKOA 3GQBA 3UWKA 4DSTA 4Z51A 2OCPA 3WYAA 2JLXA 1OXTA 1D2MA 4WAUA 1N5KA 3X1ZA 2ASEA 1OYYA 1Q20A 3A1VA 4ZIRB 4ABYA 3AVYA 4NYJR 3GLHA 2AK2A 2KWIA 4GZLA 4FWTA 1N6OA 1JQJC 3GFTA 4TLEA 5TB5A 4A2WA 1SULA 4HDQB 4IDPA 1VDZA 5AWFC 5CB8A 1ZW6A 4OI0A 1P4SA 3CPEA 4C0LA 4QGFA 4Q4JB 2GHIA 1KAOA 4FXPA 3KQHA 3EWAA 1S1MA 5FPYA 4LHZA 2OM2A 4RY2A 5IHPA 4PHHA 3X2SA 3H84A 4XSGA 5CK5A 3T1OA 2JATA 2QPOA 3ZD6A 1NN5A 3WYFA 4A0GA 2CBZA 3C15C 1HT2E 2KB0A 2BMJA 2EWWA 2AD1A 1X6VA 3TW8B 2YOGA 3CONA 2B7BA 4QOSA 1KZGB 2EVWX 3FYHA 1N6IA 2O52A 1YJ5A 4Q7LA 3NG1A 4ERNA 2XSZA 4OHZA 4B43A 3SHWA 4N1AA 4NTZA 6Q21A 4G1UC 4LWZA 2IYUA 1FQJA 4N3NA 1G1MA 2IF0A 3U3OA 3M6AA 2EW1A 4BLPA 3OZXA 1P72A 4JLAA 4C4PA 1R8SA 2XEXA 2ZRCA 1DTSA 3MG9A 1Z6TA 2EFEB 2Z0MA 1W4RA 1U9IA 4E07A 4CGZA 2NO9A 4NCKA 1EG7A 4ARZB 1U2RA 2FE4A 3DVLA 3AF3A 3B82A 4PPNA 2XZOA 2OV2A 2BMDA 2J0UA 2VF7A 4BE7B 3TUZC 1KI4A 2P5TB 1OIVA 1G7CA 4P3YA 1MABB 3R20A 3UANA 4UXJA 2C03A 5KSPA 1EX6A 4TYYA 2BKUA 2ONKA 2WZQA 4D0LB 3WBJA 3K0SA 3CX6A 3RNLA 1FL9A 3MWLA 1UKZA 2ATXA 2P6NA 4Q7MB 2E87A 3K8YA 5JWRA 1XD2B 3SOPA 1HE1C 1VKJA 4CEIA 1ZU4A 3TIFA 2ZTSA 4XTRA 1SVKA 1ZM9A 5P21A 5L3VA 3O8RA 1LTQA 3B5JA 2LKCA 1R0WA 4RD4A 1U90A 1RRFA 3NIBA 1QG2A 2ZUBA 1E2KA 4ITRC 2ZE8A 2GEVA 3RDPA 5FPHA 5K8IA 1KZ7B 5B30A 1U0HC 2PL3A 1YHNA 1TQ4A 2H7VA 2X77A 1YU9A 3IBGA 4CZ2A 2QY9A 1WDTA 3ZQ6A 2ERYA 4MUBA 2VP6A 3OFND 3FMOB 3UK6A 4C0KA 1E2NA 5KO2A 5J4VA 3TH5A 3MSXA 2OHFA 1TUIA 2EU8A 2EQBA 5M04A 3SR0A 4HB4A 5EXSA 4LBYA 2HYDA 2XNDA 1XDBA 3D8BA 5KNDA 4GBMA 1N0VC 1QRAA 4RZXA 1GTVA 2O0HA 3OESA 4JBWA 3FB4A 1Z83A 5TARA 5DHAA 1C9KA 1XX6A 4PC2A 1FUKA 2DR3A 4URYR 3LBNA 4LX0A 1VCMA 4QNMA 3W3AA 4F4IA 1R7RA 3K0FA 2JLWA 5TVKA 2CVFA 3K0CC 5KDDA 2JIZD 1X1SA 3Q7PA 3Q9LA 4RD1A 1KKLA 4YLGA 3EZ9A 1U0LA 4YONB 2AD5A 2F43B 5JHHB 2IF2A 3C4JA 5EXTA 1E32A 1KJZA 5HE8A 5DO9A 1PLKA 4PZZA 4TSFA 1NRJB 5GJBA 5L3SA 1IM2A 1K5GA 4PPQA 4PSAA 3O8BA 1Z6GA 3IBYA 5EUQB 2HEIA 2PT5A 2FPMA 1OHHA 5J5CA 5EJEA 4M9XA 4KI0A 5JEEA 4NHOA 2P67A 4MRRA 3BXZA 4W9MC 2QGZA 4IVQA 3K9LA 2CDNA 5AK0A 1DAEA 2OT3B 3LXRA 1Z0AA 3K0AA 1W44A 1OH6A 3KQLA 4BGDA 1JPJA 2QMUA 4OQXA 2ZS9A 4RD0A 4TMVA 2ZRNA 3FKSD 4DSUA 4PC6A 4B34A 2WWFA 2P2LA 4A4DA 5DGXA 4GOKA 4JT2A 2BBWA 1W36C 4YXWA 4PAOA 4XIGS 4M1MA 4URWR 1NSFA 1XEWY 4F93B 3G82C 1P7CA 1FOEB 1NIPA 3M4YA 4C7OA 2W6IA 2ZM5A 2VPPA 1VECA 4M1YA 1U8ZA 2ORVA 3QJYA 5GADl 1E96A 1N2CE 1Z0IA 4D4LA 1NL3A 1CS4C 2Y8EA 3PVSA 3GLHE 1MKYA 5BW8A 4G5QA 2O8FA 4A92A 4RCYA 3MJRA 2GCPA 2IYYA 4KFRA 4GPTA 4ZV4A 2QORA 2GXSA 4DCNA 5L3RA 1RPZA 5AJYA 1L2TA 2FFHA 3BH0A 4BLSA 3AVWA 2PT7A 1IN7A 3K1JA 3U3MA 4XH9B 1KY3A 4QBFA 2ZS7A 2ZPTX 3W6NA 4QRHA 3PJRA 3AGPA 1Z22A 1W0JA 2W6JD 4IXMA 4PAMA 1MO5A 4U00A 3F5FA 3IHWA 3TSOA 1GRRA 2V8OA 1US8B 5D3QA 2WIBA 3I5XA 2ZE5A 4IEEA 2GBLC 2KI5A 4EPYA 2YHSA 3RYTC 1GILA 4YC7A 1EX7A 1AGRA 4HB3A 2ZRBA 4DLXA 4DVGA 4Z8XA 2QBYA 3EZ6A 4PO9A 1KTVA 1SVMA 2ANCA 4JVSB 1U8YA 4TMZA 4LC1A 1R6BX 5C4MA 1DAHA 4B3BA 2ZJOA 2WAXA 3C7KA 3B60A 3VR3A 4DCVA 5KSZA 2R6CA 3SJAA 1OH5A 3X1WA 2G88A 1KDRA 4HB0A 1BMFD 4H9GA 4XD7A 2ONJA 3UXMA 5BYJA 2IW3A 1WCV1 4X8OA 4HLUA 1TAGA 2WMNB 3R8CA 1W2HA 1GITA 3LW8A 2FEMA 2GJKA 3I1FA 3SZRA 1OFHA 2J87A 1NKSA 3OAAA 4JIMA 1NVXQ 1FQKA 4B3GA 4QM6A 2ZRIA 1OXSC 1RW4A 2CL6X 3BBPA 1EXMA 4A8JC 1E1RD 1NSTA 1R0ZA 1QHHB 4EQ6B 1MR3F 5EE0A 5FUWA 2FU5C 3EASA 4YQFA 2YC4C 1VG1A 2UZ3A 2PH1A 2HV8A 2IHYA 4PHFA 2XB2A 4ZIRA 1MRSA 3BERA 3AF0A 3HR7A 2FSGA 5JRJA 4BQSA 3VKGA 2D2FA 4POAA 4PSKA 4CEHB 4GL2A 3SJZA 2WWYA 4G3XA 2GCNA 1B23P 3MD0A 1XMJA 4JLBA 1G20E 1N0UA 4XWOA 2RH5A 4ZCMA 3KXIA 3A1UA 4G5RA 1DADA 4OQFA 2B21A 2YINC 2YV5A 3LBHA 3PG5A 4US0R 3QKSB 3DMDA 1XF9A 2F1RA 2J7PA 5FI1B 1J2JA 2GF9A 2ZJAA 5AJWA 4TL6A 1A5TA 1JR3E 2RHDA 3LQRA 4JLDA 5EP1A 1OE0A 4PTLA 2IYXA 4JBYA 5AJXA 5FBQB 3ETLA 2DHRA 4HUQB 1G64A 4ILEA 1LF5A 1A7JA 3QBVA 4LY6A 1R4AA 1S0UA 1ZM7A 5L8VA 5KPJA 2XZPA 4C0JA 1QDEA 2ZVPX 1IQPA 4TT3A 4PO1A 1HY3A 3JVVA 3VX4A 3TGPA 3WP1B 3FOZA 4A8JB 4D6PA 2JA1A 2V1XA 2ZSEA 1XWIA 2O0KA 3CWQA 3FGNA 1HE8B 1KOFA 3GMTA 3A4MA 4AC9A 3L0OA 3Q85A 2GCOB 3ZS9A 5FH9A 3QVUA 5FOSA 1KO8A 3NHBA 1W47A 4JL6A 4Q9LA 1ZC4A 1XNJA 3ZJYA 4XVUA 1SHZA 4RZ2A 2ZR0A 3DM9B 1GKUB 1E2FA 2EWVA 2GEDA 4JSTA 2YZ2A 1G5TA 2ZRGA 2ZRKA 3B1ZA 1Q3TA 3GLHB 4MQBA 3ZYCA 1PLJA 2V55B 2A78A 1G18A 4WOPA 3M0EA 4JKYA 4M1KA 3VU9B 1G21E 1BKDR 2CK3D 2KSQA 4PZLA 1WRBA 4WZAE 4C30A 4HSEA 1Y3AA 4RD3A 4NONA 2GNOA 1YRAA 1CJMA 1E1QA 3T5GA 2C04A 2PJRA 1P9WA 1AQYA 4Q7KA 4DUGA 1ZCAA 4OHYA 3U7FB 1W36D 4GMXA 1NVVR 2MMCA 3VNVA 2BEKA 2QN6A 3AVVA 2VP0A 5J4HA 4LBVA 1XD2A 5HPYB 2JDIA 2DFKB 1XD9A 1JB1A 1Z0KA 2ZRDA 2QSYA 3QG1A 4ASUD 4Q1EA 2XITA 4TWZA 2W2VA 4B33A 2QAJA 3KUDA 5GJCA 2VRWA 2WV9A 1OLOA 2GAOA 1KAGA 1LS1A 1JJVA 1G5RA 1MOZA 2QGNA 3LWNA 3GJ0A 3U3JA 2WKQA 1Q21A 2EYQA 3T06B 3QPWA 3B2EA 1IY0A 4ZO4A 4JLJA 2PZGA 1LY1A 2PX3A 1ZD9A 2IL1A 1QG4A 4NU0A 3KFXA 2JJ8A 4QBHA 4W7SA 4AG6A 2D4HA 3K09A 2OBMA 2IC5A 5JCZA 3L0PA 1W0KD 4DEYA 2PZEA 4PHGA 3AGQA 2V54A 2FN4A 3REFA 1UBCA 1JXMA 3UATA 2W0MA 1E79A 4MYCA 5HZHA 2ATVA 4DXAA 2HXYA 3RWMB 2XGJA 4V0KA 3GPLA 3H86A 4BRUA 4XWAA 1E2MA 2I3BA 1R10A 3NC0C 1R5NA 3L8ZA 1OT3A 2GZDA 4DDUA 3EC2A 1XB2A 1R8QA 1QHGA 2FV8A 1OYWA 2G1JA 5EP2A 1XTSA 1YZTA 2EFCB 3KL4A 1E2EA 4JJKA 4MKFA 1X8JA 2WJYA 2IYSA 3GEIA 4B3XA 1AM4D 2F43A 4GT1A 3D6TB 2ZYUX 2QPTA 3FVQA 3QG5A 4BEJA 3BB1A 4M9QA 4Q4LA 4CEIB 1CKEA 3KFVA 5JRZA 2Z43A 5G41A 1GFIA 2XTNA 3BFVA 5J40A 3QI2A 1TU3A 2JJ1D 3RVBA 2BWJA 3CWZA 4OJKA 4B74A 3I32A 4DWJA 1P62B 1Z29A 1I4TD 4L15A 4OKSA 3RSOA 3VNUA 2NIPA 2QENA 2WOOA 1SKQA 1AS3A 1VYTA 3NBYC 2EYUA 2VEDA 3CF0A 4KCGA 4ACBA 2P6RA 3UG6A 3I61A 5FPKA 3RRNA 3VFDA 1S8FA 2QP4A 3PEWA 3WHLA 3L0SA 1R5OA 3RWOA 4LHVA 1HQCA 2VA8A 2PCJA 2NO0A 3OEHA 4I1SA 4Q9HA 5B64A 3HPRA 1KNQA 2MSDB 1X8KA 2BV3A 4JVLA 2FDCA 2O8EA 3FHOA 1KSFX 2KE5A 4TQ9A 1XCPA 3WRYC 5GVRA 1S3SA 4ZKDA 1IHUA 1UBGA 3L43A 5CK4A 5G3YA 2B6HA 3K9NA 1R0XA 1E9AA 3ADBA 4NH0A 2QA5A 4DCSA 3K0FB 4DC9A 2VSXA 3IDQA 4GSYA 3X1YA 4DJTA 5JJIA 4LDJA 2FF7A 3ZH9B 2HLDA 4TZ0A 5DSZA 2GJAA 3LXXA 4CYMA 3AVTA 2WJVA 4J0QA 5F9HA 4IVPA 2F6RA 2FZLA 4Q19A 5DYGA 3KUCA 4NYMR 1Z6XA 3MLEA 4X8HA 3DO6A 1XD8A 5L3SB 2ZSFA 3QEJA 3KJGA 5FL7D 3IUYA 4QFMA 3OE7D 3PCRB 3K0EA 3SFZA 4PXAA 2BMEA 3WMGA 5CLQA 4GDFA 4UNPA 2ZYTX 3OEED 2UKDA 3MWKA 1FX0A 1US8A 4KSBA 2J3EA 1MO3A 1OKKA 3NEJA 3GLIE 4IDOA 4LV8B 2HCBA 1UBFA 2WSSD 1KJWA 4GNKA 2ORIA 1J99A 5H8WA 1N5LA 3BWDD 4EPWA 4C9BA 3THOA 5IK2D 2QT1A 3W6OA 2MSCB 2REBA 4NL4H 1GZSA 4M21A 4BLQA 2O8DB 3W3ZB 4DSOA 3CRMA 1E6CA 1DELA 1T3LA 2Q6TA 3GJ6A 1C1YA 1JXOA 1YR9A 3TR0A 4B44A 5JEDA 3VR1A 2XZLA 3GCGA 2A5DA 1GM5A 1CU1A 2ZU6A 3VQTA 1YZQA 1EFRD 3QE0A 5BXQC 1G5PA 1N6PA 2AL7A 4IOJA 3SNHA 4DLRA 5KSOA 2VHJA 4GI7A 3CX8A 2O8FB 4HAUA 5FBLB 3PUXA 4WBSA 1T3HA 4GOJA 4M1OA 3HDTA 1UPTA 1RFLA 1QHHA 1E2LA 1UKYA 3DDCA 4KBFA 5JSZB 5KNBA 3H2YA 5H1YA 3MGCA 4RD6A 4B2PA 2GK7A 2QT0A 1YKSA 2WTUA 3UMSA 3FHCB 2QM8A 3CUEF 4ZCLA 1NKTA 2H5EA 2CEAA 2CLSA 3FMIA 4Q01A 4CEHA 3FHTA 1AZTA 1G7TA 1Q44A 3T15A 1TNDA 1M7BA 2OESA 5JBQA 4QJ5A 3QXCA 4QG7A 2BC9A 3PUWA 2ZJZA 4NYIQ 2W2XA 1OB2A 2X8AA 5AR1A 2QRNA 3SFVA 4FD2A 4URXR 1JPNA 1IN4A 1E2QA 3UPUA 1XMSA 3D3QA 1OV4A 1NJGA 3LV8A 1WA5A 3EC1A 4DLWA 2GXAA 1XJ0A 5FBWB 3K9HA 1T6NA 1GRNA 3EA5A 2AFIE 1NLFA 1JECA 1ZNWA 3K53A 5BYKA 5SZKB 1NMXA 1T4GA 1SKYE 3KX2A 4Q1AA 3K70C 2IS2A 2XJ4A 1Z0DA 4A8JA 2AFHE 1D9XA 1TL7C 2EFHB 2IA5A 2ZREA 4AWXA 4KXFB 4QGHA 4B6FA 4A15A 3HP1A 4KO8A 2ZJ8A 3PV0A 4DB4A 2GCOA 1W5TA 3TR5A 1E4YA 2C9YA 2IYWA 4EPVA 3QXHA 3QVVA 3TSZA 3U3KA 5JHGB 5JMTA 1RRCA 3JZMA 2C5LA 4IDHA 4UXHA 2GJSA 4QM7A 1KO1A 2WMOB 1VYVA 1YR8A 3PQCA 2WKPA 1K8RA 4FCTA 4QHSA 1T9HA 1P61B 1CR4A 4Z54A 1CJTC 1D8TA 2GF0A 2OAP1 1AA9A 3RC8A 4BZPA 2ZQ5A 5ELXA 1CLUA 5F3WB 3HYTA 1XTQA 3ZZ0A 2C96A 4RZUA 4LJ9A 3VU9A 3SI7A 2R6GA 3B78A 3J81k 1YZKA 2F1JA 1Z0JA 4WIAA 2D3WA 3LFUA 2H17A 4US1R 1XMIA 1VCIA 1YRBA 2ANBA 2GETA 1ZUNB 3TQCA 3WMFA 4AKEA 4HYYA 5BN3A 3CZPA 2QPAA 1E94E 2QTHA 2H8KA 2J59A 2W0SA 3ZS8A 3ZIAA 2K5UA 5FOXA 3CPJB 4UNNA 2NOAA 5AJVB 3RS4A 4GFDA 3GLIB 1COWD 3WBKA 1A4RA 3BOSA 4U7DA 5KSYA 2EFDB 2OILA 1FW6A 1SHKA 3ONWA 3QIAA 4EPRA 2IUUA 3A4LA 1W4CA 4LJ7A 2I4IA 2ZITA 5CIWA 3AQ4A 4LYHA 2F55A 2DCUA 3TKLA 1AKEA 1NMZA 4LZZA 3HYRA 3LY5A 2G3YA 2GA8A 1J90A 3BRWD 5EP3A 1CULC 4JLOA 3CNLA 4AIIA 2J0VA 4YMTA 1YZNA 3THXA 3MCAA 2GZAA 4HLQB 4EAQA 5J4YA 4L8GA 4NYJQ 4GOXA 1PUIA 5CJ2A 1CR0A 3HU2A 5DN6A 1EFRA 2RGEA 4GZMA 1BYUA 2WAYA 1ZBDA 2IX3A 1F2UA 4TMXA 4IDNA 2N46A 3GLFE 2B8WA 2QMOA 1AS0A 3QENA 1GSIA 5LD2C 2CXXA 4JS0A 2HYIC 1AK2A 2ODNA 1WP9A 1LS6A 4Z1MD 3LH5A 2J0QA 2RGAA 521PA 1NMYA 3EZFA 3I3SR 3LBIA 1OFUX 4TTRA 5JJKA 3T61A 2B92A 2QTFA 4EKDA 4JL5A 4DEXA 3ND9A 1XXHE 3SJBA 1E0JA 1MRNA 2CVHA 2JGNA 1BIFA 4NCIA 2RCNA 3QF4A 2JEOA 4O2LA 221PA 2XOKA 4B47A 2R65A 1JR3A 2WKRA 2OBLA 3CM0A 1Z6YA 4N0EA 4PC7A 5LDDC 4XSHA 2ZJ5A 1K5DA 4RSGA 3VKHA 4BRWA 1N0WA 3KJHA 3RANA 2FOLA 3IIMA 5EZ5A 1SKYB 4QJ3A 3EX7C 3JVUA 4LPSA 5DYIA 4ZDKA 3A1WA 4M4SA 1RRGA 4KVGA 3WY9A 1EK0A 4C3ZA 2NTYC 3KKMA 3FPAA 1HTWA 1LNZA 2OXRA 4OI4A 2FMXA 2NZJA 2OO7A 4O0MA 4OK6A 2WPDD 3N2IA 2AN9A 4PPGA 1OW3B 1XTRA 1CJVC 3BK7A 3ECCA 2R44A 3FE2A 4Q66C 3I92A 3BC1A 1MT0A 4WXRA 3UWOA 1G41A 4M9SA 4QBIA 3TQFA 1S3GA 3U6KA 1QF9A 4HAZA 2NO6A 3DM5A 4HAYA 4ZDWA 2ZYVX 2R8RA 2CL0X 2XAUA 4P0TA 4D26A 2VQSA 4DLZA 4JLMA 2RAPA 2V3CC 2IBMA 3K70D 2WBLC 1HH4A 5HR5A 3QSYA 4A82A 2G77B 3RRYA 5J4KA 2WWHA 4PANA 3ICQB 4C0SA 4NE2A 5G53C 1G7RA 1W2GA 3FFAA 3DZ8A 1TTTA 1D9ZA 4P4SB 1XJCA 1M74A 2LWIA 1F48A 2ZR7A 3WYGA 4NBSA 2ODBA 3AV0B 1G3MA 3B1YA 4TMKA 3I72A 5BN4A 3HU3A 4M9ZA 1GUAA 2FSHA 3WNCA 2C95A 2WOJA 2WJGA 2DWQA 4DKXA 2DYKA 1S2MA 2ZI3A 1IN8A 4MRSA 1G3UA 1T0JB 3U44B 3PEYA 4CDGA 4TLBA 1HUQA 3HPQA 2FA9A 2QSZA 4P31A 4UNQA 5TDHA 1WBBA 3KKQA 3CH5A 4ZKEA 3THWB 2PMDA 4YMUA 4QGAA 3X1XA 1COWA 2C98A 2O8DA 4DLVA 3VKWA 3SEAA 3T34A 1CIPA 4I1UA 4ZPXA 1OJLA 2UZIR 5TV2A 2JJ2D 4JMPA 3PUVA 3IEVA 3CRQA 3NH9A 4IVRA 4LK2A 2O8EB 2IXFA 4URZR 5FOTA 3BH7A 2BBSA 4A2QA 1RKBA 5G3ZA 2P0EA 1E0SA 4PQFA 4AD8A 2OFWA 4KV9A 4C0QC 2X2EA 4BZQA 4Q9KA 2ZE7A 4MYUA 1IOZA 4MA4A 2DBYA 4LBWA 5FTJA 2WVJA 1TF7A 4TLDA 5HKKD 4BPBA 1JAHA 5CM8B 1NF3A 2IYRA 4WXPA 5CM9C 5JSZA 3WNBA 3SS8A 3TUJC 5CYOA 3LVQE 3GLFB 1P9RA 2AXPA 5JS8A 2ORWA 3THYA 3VAAA 3KB1A 2OEPA 2YVUA 1KY2A 3C14C 3CRVA 2P5SA 1M34E 5BWMA 2VYFA 3EARA 3W8NA 5G40A 1KO4A 4LJ5A 2ODEA 5E7IA 1HURA 4AYXA 1IJEA 4RFSB 1RIFA 3TSWA 5TMPA 1KK0A 1KIMA 1FX0B 4EJSC 2BEJA 3W90A 2YJTD 2ZR9A 1W36B 3MRSA 1XXHB 3EZ2A 3AF1A 1FMJA 1ZM2A 3B9QA 1MH1A 3EIEA 3CF2A 2V4ZA 2W58A 4EUNA 2XXAB 1KI3A 2AHOA 5HTKA 1IN5A 3H1TA 4DLTA 4D25A 1HQYE 3CLVA 5A4JA 1U8AA 4QBGB 3W9YA 3P4YA 5EE5B 4TTQA 1LW7A 1SXJC 4RJLA 3O8CA 3GP8A 3DHWC 4XJXA 1NVUQ 4KITB 3U4QB 3R8FA 2Z83A 5GJVC 1D2NA 4HUTA 1VIYA 3ADCA 1OF1A 3CF6R 1WF3A 3U7GA 4HLDA 3AKDA 3AKEA 4WW0A 721PA 2DFNA 1WQ1R 1M1YE 4FWIB 3PEUA 1H8ED 3OFNA 4D4KA 1NG1A 1G7SA 3HJNA 3EPKA 2NG1A 1TF2A 1Z63A 4B48A 4CW7A 2OFXA 1KYIA 1UFQA 4IDQA 3P4XA 4HAXA 4W5WA 4D4MA 3B9PA 2R6DA 2QQ0A 2GZHA 1ELOA 3I4LA 2NPIA 2CNWD 5DIFA 4XTCS 2JASA 1G3QA 4P4UA 3VR5A 1KJYA 2P65A 1VCNA 2REXB 3KZ1E 3PFIA 1IAQA 2G9NA 3W6PA 2HXSA 3WP0A 2IUTA 1SVIA 1UKVY 2JIZA 1Q22A 3UIEA 1G4AE 4TMTA 2R6AA 1II9A 2OLJA 1E0AA 5LB2A 4HZUB 1E9EA 1SZPA 2H92A 2YWFA 4TLCA 3T1QA 4A6PA 3U3RA 3ZVNA 2CE2X 1E2GA 4F7WA 1GL9B 4MDEA 4O3MA 5DI3B 4MKGA 2OFOA 4UJ3A 2FZ4A 1XZQA 4WVFA 1NVWQ 5TXGA 1IXZA 2W00A 3DEFA 3C16C 4X8MA 2HUPA 4BFTA 3GLIA 1XCGB 5KPDA 3B13B 1CR1A 1EGAA 5F9FA 3B1VA 3T5DA 4R71A 4Y0AA 3VHXA 1CEEA 4K46A 2O8CA 4AK9A 1DOAA 3ASYA 5LPNA 1GNRA 4JYCA 4GRAA 2YOHA 3FKSA 4ZDIA 4LHXA 3VR6A 2FFBA 4OQNA 4V0LA 3CIOA 4TQUS 3IPXA 2WSMA 1NN0A 1YR6A 4XOIA 5K8LA 2I1VB 1KK3A 1D5CA 4LCBA 1G9XA 1G3RA 5IF9A 4Q1DA 2ZI6A 3NEYA 1E69A 2TMKA 2W2TA 2ZI7A 1O87A 4IOKA 1G16A 3ND8A 3HR8A 3Q3JB 4V03A 4NKRA 3EZ7A 2BBOA 4JLVA 3O47A 1ZMXA 4LYJA 4QHTA 3NBFA 4Q7JB 4S35A 1TQ2A 2ZUDA 3X1DA 4CRWB 3PENA 3NWJA 2J41A 4N0DA 2B7CA 1KI6B 2Q0HA 1DAIA 3ZGXA 4B75A 2VL7A 3EIQA 5FTMA 2YWEA 2DB3A 4TZ6A 1KO5A 2NMVA 2ZI9A 1E99A 3ZDQA 1XTKA 2W6JA 3BFXA 1GVNB 3PR1A 5DI9A 5KDOA 5K8TA 1GWNA 1KI2A 4UJ5A 2G6BA 5HZKA 1RC8A 5JI3E 1ESNA 1P60A 4LUCA 4MRNA 3A37A 4Q4AB 1AQUA 1G291 1X8LA 4XWKA 2ODWA 5E95A 4AI6A 4F38A 2BM1A 3FKQA 1RE0A 4PC3A 5JWHA 5CDFA 3P27A 5CYPA 4FMBB 2IEYA 4FCVA 1XPUA 2QG6A 4U02A 1P73A 1FTSA 4P4TA 2QE7D 3RHFA 1E0KA 4OJQA 2ZROA 2VBCA 2QZ4A 3GEHA 3PITA 4OQMA 2O0JA 2JLSA 1DEKA 1WXQA 4LRWA 1G8PA 3VHLB 1H8HD 5KUTA 1UDWA 1ZC3A 1HA3A 3E2IA 1BMFA 4UNSA 1FTNA
chains in the Genus database with same CATH superfamily
3THXB 3Q3HA 2OZKA 4NQZA 1XEXB 4IQ4A 4DREA 4UKDA 3K9GA 1XBTA 3I04A 3QBDA 4G41A 5EJ4A 1Z18A 4JBHA 2XIQA 2VAXA 1IBRA 4KPUB 3TZKA 4RMIA 1QVWA 1L7NA 2FW9A 3RIYA 2AF4C 3COWA 3L46A 3TAXA 3LUPA 2QN8A 1YGPA 2R84A 5DF1A 4OHVA 2XVMA 3CKKA 3UHFA 3EQ9A 1I6LA 1LVUA 2WYWA 1ZIOA 1X74A 1X7XA 1P0QA 1M1XB 4GEGA 5CTAA 2Q3LA 2Q5LA 3L93A 2WA1A 2IEBA 3VR4H 4HT3B 5JYCA 3AEQB 3WS7A 1AQNA 1QB7A 1AIPA 3GCXA 1H5NA 2RFLA 4COKA 1Q16A 4ZJYA 4XWWA 1GA1A 2OFFA 3S29A 3VX3A 1JKMA 4MNTA 4NNOA 2CF6A 2AR7A 5GZ1A 3C45A 1EFVB 1VYHA 1RI5A 3EYAA 4PWZA 4EFLA 3VGPA 4MDYA 4EF6A 4YR9A 4RACA 2F1IA 2QTWB 5I7OA 3C74A 3QFHA 1D1PA 3LKZA 2FEOA 1GKIA 3UUGA 4QYTA 2WHXA 3HWSA 4ZAYA 4YRKA 4J3JA 2NXCA 4D57A 3OI7A 1IPFA 4HYTA 1OXKB 3VOTA 1Z17A 1LA2A 2ZTVA 4PXSA 1OI7A 3IA2A 3IAS1 3ZPXA 2PZJA 1JT2A 3UT5A 2FRVA 1SZCA 2QRLA 4RV4A 2RJOA 3QPDA 4DSNA 5B1EA 2FEXA 3FTEA 3CSSA 1ZW1A 2OP0A 4DANA 4YJFA 1I3OA 4BQPA 3DOIA 4YPOA 3PPXA 1PFGA 4PG7A 1PV2A 4AJNA 4N6OA 3QLJA 4HAVA 1QGED 3H2ZA 3V4FA 3ASUA 5ALNA 4YRFA 1KGDA 2FUKA 4UEKA 3V3KA 4QBTA 2OLKA 2JCYA 3REQA 2AHRA 1SN7A 1XDGA 1HKHA 2QLFA 2ZRHA 1C2YA 3FKJA 2QUKA 2IOFA 4DCGA 4L3WA 4P0PB 1CDOA 3I0MA 4QPPA 4RKFA 3MJDA 1OFTA 2A9KA 4EGSA 4LRQA 4CEJB 2ZJBA 1EGVB 1RLTA 1G60A 2ZM5A 3O2JA 4JGBA 5JSFA 3D1LA 3I52A 1CZNA 2GZ1A 2GAJA 4CR7A 2FGKA 3BMNA 1ZJYA 3I5YA 3GGDA 3FNRA 4URUR 3KQNA 1H6CA 3EUAA 3WYNA 1T0BA 3HI4A 5A6SA 5I7RA 1SEVA 1I24A 2WNSA 3ZV6A 3IUMA 2NUTA 1CRLA 1M1NB 1PUXA 2HZBA 1PL7A 2JKVA 4KH1A 1QM5A 2A3RA 4WRRA 1E2JA 3CLTC 3L0YA 5ERGB 2X19A 2ZSDA 3NVAA 4ESVA 4C04A 2Y1OA 3NHWA 1F8GA 5JCOC 2YW2A 5LBUA 3HB1A 4PAQA 2CHFA 1C1HA 1WABA 5ANRB 4YIHA 3CH4B 1O94C 1QO0D 3R3ZA 5DISB 4BMSA 4LJKA 1TX4B 2RHGB 2ZUVA 4L4YA 2GD6A 5BN4B 3N3BC 3TZHA 2AWOA 3U3DA 4BV2A 5HFAA 4F5DA 2BFCB 2ZRMA 3W2FA 1B8NA 1A7KA 2NTJA 2XXAA 3GUUA 1ZJ4A 3HYCA 2ZIXA 2E9SA 3KIPA 4FBLA 4N01A 5CNMA 1W49A 2PX0A 1QPGA 4YRTA 4DT1B 2VHCA 1GNQA 2MYNA 4NFHA 3RYHB 2GPSA 4OI2A 4OHMA 3WXBA 2E37A 1ODTC 3RC2A 5A1JA 2ZBFA 2XE6A 2ACWA 1CTQA 1FMLA 1D2AA 1EK1A 1YZHA 2IT1A 3L6EA 3NPMA 3KSDO 4HQLA 5H70A 4JLPA 4ZAWA 2XNHA 3EPPA 2Y71A 3IEUA 2QUIA 1TEXA 1VP3A 3FSRA 4KQHA 5JSYA 3P96A 3V4RA 3W1EA 3JZAA 3F3YA 2ZT6A 4QA9A 3AESB 1XRMA 1TW3A 3UNXA 2QYTA 1RYHA 2G80A 3KEFA 4OU4A 5DKFA 1R4NA 2GYYA 1BJTA 2CUTA 3IALA 1U81A 4ZU3A 5IAJA 3S7TA 3URKA 4CDNA 4MPDA 3KPJA 3DE4X 4X84A 3DTVB 1SO8A 1UC8A 3IQXA 2OGSA 3B3AA 1G6OA 2VDKB 3KALA 4MQFA 3OJEA 4PBTA 3FHJA 3OF5A 4DRZA 1OI4A 3EF1A 3IV6A 1EP1B 1JIQA 3VJKA 1X87A 4RDCA 2AZDA 1NLYA 5CIQA 3T95A 2GRJA 4GOLD 4GX0A 2R5FA 4YASA 3FW1A 2GBLA 1PJTA 4J4HA 1NP6A 4RGBA 2WILA 4M98A 3HB4X 1PG0A 2PMFA 3E4CA 1I7LA 2GWRA 4QSHA 4TN1A 2QM7A 1W85A 4MW2A 2LD4A 2DSTA 4I4TB 4YB8A 3NTRA 1RRVA 3ML1A 3L7KA 4RVOA 5DE3A 2VYCA 4O8ZA 1KI7A 3IQWA 3KB2A 4M87A 1SCUB 1C1DB 5DOZA 3WRVA 1LEHA 2P9CA 4NDZA 5KJFA 2V1UA 5I4KA 1T0UA 1KP2A 3K94A 3PFNA 4OHKA 1X0VA 3UA4A 4KAJA 2WWRA 3EBLA 5DTIA 5IYZF 2Q5IA 4F7DA 3AYZB 3GD5A 5DI3A 3O9MA 3RS5A 1UJCA 1CF2O 1QVAA 1V5WA 2W48A 3DBVO 1XOIA 4JJ4A 4M22A 4OHCA 4H1UA 4RABA 5H02A 1ZR2A 2V0CA 4HVLA 1T5IA 4RKRA 1TK2A 3BCRA 3GLGE 1J8VA 1ZCBA 2QTBA 5F2EA 1LPNA 2FYTA 4LOJA 2WMYA 4WOCA 2PSEA 4MA0A 3N7UA 1ZNQO 1MQSA 2K6GA 3HCPA 4LV5B 4MYTA 4Q9IA 2NGRA 4GM0A 3R9XA 1A77A 1LTKA 1V3UA 1XDUA 2VQDA 4K87A 1BWRA 4O1HA 1GLVA 2IYLD 4KVAA 4BQRA 3DLCA 3SNKA 5K3EA 1F3LA 1FQWA 1Z4OA 4YRPA 1VC2A 1PZNA 4C4TA 4Y1FA 5D5PA 3VO8A 3R7BA 3V2HA 5C8XA 3T1NA 3M49A 2Q9BA 2OCAA 3RRZA 3W4KA 4EG5A 5JMWA 4CKEA 1T2VA 2BR3A 3FFXA 2VCYA 1KZHA 1CF4A 3E3AA 3A36A 1QHSA 1YDEA 3GT7A 1CY7A 3TXXA 3REGA 3GGJA 1V8DA 3EZGA 1JEDA 5EMJA 4F2WA 4PW0A 1RQPA 2ECKA 2IXAA 4DADA 5KQLA 1RWKA 4K9OA 2ZSHA 1G19A 2LZ0A 1ZGAA 2YFHA 2C7BA 1GPNA 2ZSAA 1OC2A 4EKYA 1B8PA 5A4DA 1OXVA 2P4UA 2JFYA 1ZESA 4JZKA 2O2ZA 1YB7A 3ZG6A 4GP6A 3SS9X 1E2DA 3FDJA 1I2DA 3IR6A 4Q1CA 4GGMX 3VZCA 3W6ZA 1NP7A 4HWOA 2QSJA 3AETB 4XJSA 4L9SA 3MQ2A 1ZNZA 3RRFA 2QTAA 3CRRA 4OHBA 9GPBA 2RH9B 3CX4A 4KIGA 4P08A 5FL7A 5FKJA 2GRUA 4PX9A 3ER6A 2H2DA 3OE7A 1L5VA 2IYQA 4KNYA 2QZSA 2ABWA 3G9UA 1U2SA 1NJ6A 3K1AA 2WI8A 4TSFD 1USKA 3QKWA 2A14A 3R0ZA 4CCYA 1DOHA 3SN6A 1E2UA 1JN0A 2O5VA 3EXIA 3G9ZA 5CURA 5GV7A 4ALMA 1NJFA 2P9JA 2D0OB 3F97A 3QITA 4GW3A 4DRXA 1GDDA 5F2KA 1OHHD 3BWVA 2NTEA 3ASZA 4C0AC 1YQTA 3RT1A 4YRBA 4YV1A 3VHXB 3MTBA 2PNJA 4UCFA 2QTGA 2O8CB 5IK2A 1EUDB 1IM8A 2Y0PA 3KAJA 2J4CA 3OT4A 3QYAA 4G07A 4PC1A 3UN1A 3EIXA 3NETA 2J07A 3LUFA 2P5UA 4HAWA 3QVOA 5DCLA 2XYHA 2Y3IA 1VBMA 2HH9A 3KLMX 5WRFA 2QG4A 5IBRA 1VMKA 1Z28A 1DQPA 3AVXA 5E0KB 3WK8A 2C4NA 3L01A 1F2DA 4BC1A 2Z04A 3VC7A 3FM9A 1L7VC 1XEXA 4PNEA 2WPNA 4URFA 1AH2A 1UEJA 3L1IA 3DB2A 1X7WB 3Q72A 1VL6A 5ES3A 3I05A 3VTKA 2QJOA 2Q3MA 3CZ4A 3HN6A 2GBFA 3Q8KA 1XQXA 1PJAA 1RZVA 4KPUA 2KPOA 4Z3DA 4P8RA 4Q21A 4GP7A 1K3FA 2YCBA 2F7SA 5FPSA 4DWVA 4GXQA 2C5EA 2ILTA 2WVAA 4RDXA 4CG2A 4JT9A 1G8HA 1U8XX 4CLOB 2XWSA 1EXVA 1VCOA 2BEWA 1KVRA 3NTUA 2GYUA 4LOKA 5E2BA 5HW0A 3OTOB 3NM5A 3MRVA 1OZ0A 2WU0A 2DUUA 3AEQA 1TJ5A 4HWPA 4NCHA 3BJRA 5LMNB 4FXOA 1SC3A 2GFIA 3IFSA 2EDCA 2HPVA 3ZZTA 5B3KA 1PJLA 1FFSA 4BNWA 1NBEA 1IY1A 1U6JA 2SCUB 4JYMA 1PZFA 3C7AA 4Q4HB 1EFVA 1JHRA 2P77A 5TE9A 1SQFA 4KHPB 2IKQA 2L69A 4ZI5A 5TMBA 4DHEA 2OHXA 2QLBA 2VHQA 4P80A 4AJJA 4C5CA 2HCJB 4P7GA 3CX7A 3T7AA 1ZD8A 2F1KA 1SD2A 2BGRA 4EUSA 1UBMS 2C07A 2QX4A 1AV7A 3MBOA 3PP8A 2V4UA 1K92A 4Q3KA 4RVHA 5I7VA 2AWNA 2C3UA 2HRBA 1A72A 3MMNA 3NUQA 1FSPA 2Q4OA 2PKCA 3K8ZA 5L4NA 2J3MA 4PSVA 3WIBA 1JEQA 1VPLA 3L18A 1G8KA 4B5KA 4YRGA 5C5IA 1ID1A 1LV8A 3PCTA 5EL0A 1QYCA 2KS6A 4UE3S 1NJSA 3ZDFA 1BWPA 1CR6A 2X58A 1GNLA 3QOYA 4EG6A 1QF7A 4D9GA 3TZEA 5ALGA 3ESYA 2RARA 3DBRB 4EY5A 2C54A 3NIDB 3U7HB 4NWIA 1DE0A 1IDN1 3FZYA 5BV2P 4WNYA 1U2DA 3RFVA 3T3EA 1VLJA 5IAOA 4ZEOA 1PS8A 4TYQA 3PFHA 1X1RA 4PSCA 5JSKA 4CEJA 2NQTA 1C9EA 1UC4B 3JQBC 3MAAC 3R5KA 3C5HA 3WIUA 1XJWA 3IGFA 1IHYA 3UOWA 1DBSA 4DG8A 2FGJA 2DFTA 2E89A 4QYMA 3WYDA 4Q6WA 3OCWA 4BQEA 2BFFB 3NNSA 4P32A 5EIXA 2NAPA 5KOJA 3DL0A 2A35A 4IHKA 2P1ZA 4OQLA 1Z8DA 2VUSA 1E1KA 3S55A 3A2NA 2D0IA 4Y9DA 3EXAA 3IOEA 3TEMA 3KR1A 3HJUA 3IVCA 4UPVA 3T6KA 3ZCSA 4BQFA 4ECEA 5AUOB 3E8XA 3K7EA 4YMWA 2EFGA 1F7UA 1OWLA 4QPNA 1VJTA 1BYIA 3QF7A 1RJWA 2EL7A 1Y5IA 2Z09A 3KKEA 3QKRB 1HXHA 1XXLA 7REQB 4BO3A 1TO6A 4AWAA 3PFWO 3LUAA 4UUOA 3B8EA 1DS6A 1N3BA 3EODA 3RB8A 2EWMA 2P9ZA 2JFQA 3DXFA 3GJXC 4Q3LA 2BFCA 2Z30A 1WUHS 3IJRA 4CQMA 1ECPA 2J7PD 1MVNA 1L5WA 4RWEA 1EFUA 3AR8A 4IJVA 4KQFA 4MGHA 1T36B 5JS7A 3UMCA 4DT1A 5E9AA 3NGXA 4BO4A 1QS0A 1O9GA 4MLZA 1DEXA 1OBCA 3RYHA 2YRWA 5EHZA 1JT9A 3RC7A 4IJMA 2MTBA 3BORA 1S2IA 3S0JA 2B94A 4BY9E 1BGVA 2W2LD 4PS1A 4RULA 1JMYA 1II8B 2IYPA 2IEIA 4UVGA 4G1VA 5D3KA 3GJ3A 3ZKWB 4LFAB 2HK8A 2G82A 4JUCA 4JR1A 3VDXA 1HOXA 5KU1A 1V1RB 4LOHA 2ZBPA 4I81A 3ZWQA 4BV9A 4JJZA 4CQNA 1LNSA 3OY7A 3IP8A 2A7QA 2WWWA 3UHOA 3EFOB 3MCVA 2OSVA 2WVHA 1DJQA 3CJRA 3OO1A 2BKEA 4XEHA 5GV8A 3TTXA 5IYZB 1UFOA 1KNXA 2C9CA 1E1NA 1R1DA 1THTA 2B1GA 1BVRA 4L9RA 3IILA 5E38A 3E70C 3ZVRA 5KJ6A 1RYBA 2FH5B 2QX8A 2P9GA 1TM7E 4WUTA 5LP6C 5BQFA 4DV1B 3EPLA 2CCKA 2XKKA 2WFZA 4PZYA 3ZWAA 3I62A 1M7HA 4QYXA 1GFSA 5EE3A 3UGKA 2X0FA 3H2HA 1PLLA 5BQ5A 4ZZ1A 4AVYA 2C78A 3T1VA 4C05A 4FN5A 2HR1A 1SA0B 3LSTA 2X23A 3FIJA 3IQZA 4KAXA 3SI7A 4WCVA 3L84A 4ENPA 3OJXA 1I1OA 1RQ7A 4Z1MA 5NULA 3DKKA 1CV2A 1Z68A 4BX3A 9MHTA 3EPHA 1C1DA 1L3CA 5IVIA 5JISA 5A4KA 3KSRA 1TUEA 3BHMA 3A9WA 1F2TB 2QL6A 1NUQA 3JQAB 4BEVA 3A3YA 1WW8A 1AUOA 1EWQA 3OIWA 2GQ0A 1SBHA 2PH7A 3L4SO 1R0YA 2CNLA 3OJOA 1CDZA 3DMRA 3G8YA 1E7SA 1IRIA 2WG1A 4G5OA 3DR3A 4TLLB 2P90A 3DZBA 4YQYA 3RKUA 1DCTA 2BI7A 4KLNA 1LB1B 4J9UE 1YHZA 4KQGA 2IXGA 2NXEA 4LQCA 4PG6A 1E3QA 5ULLA 1KPHA 1TA0A 4PPFA 1QGDA 4TYPA 5K0BA 4JKOA 3A3NA 1I36A 2PSHA 4FE3A 4BCBA 2R62A 2WUWE 1CUSA 1GAJA 2COUA 1AO0A 1I94B 2HA5A 2HDWA 3E3OA 3L49A 2G8LA 2QD1A 4RL4A 5JAUA 3LAWA 2FZVA 1RHKA 4RF2A 1A9XB 5KC8A 1RC1A 5BSTA 5ENZA 1ZHFA 2ADOA 2V58A 2FZWA 1RJGA 2RGXA 2G5GX 4ZVPA 4A36A 3UV7A 3KKZA 4LHWA 1XN1A 4PQYA 5I01A 3HFJA 3QXGA 4KVZA 3DMYA 4DV7B 2WPDA 3VZBA 1XYYA 5EMMA 3F73A 2PEZA 1KSGA 3G2QA 3FSGD 1ZN2A 3SJ7A 3KYCB 3OQNA 2OCGA 2VATA 4BCDA 3KDPA 3RABA 2Z5GA 4TKLA 4DL9A 4RH1A 4BNHA 1E79D 4HB2A 2V98A 4ZOBA 3K1TA 1SCAA 4IWNA 1ORRA 1C50A 4Y2HA 4BTVA 5IPFA 2UZ0A 4E2ZA 3PQ8A 3ILYA 3LQFA 2V7XA 3UBMA 1HFEL 5ALDA 2PV0A 1FRNA 5AW6A 1RYFA 1UMBA 1B6GA 1NQAO 4DDWA 1T8UA 13PKA 2FRDA 1IL0A 1YS4A 2YN0A 1XNHA 3GBSA 2EL9A 4RTJA 2YR0A 2WFMA 2X0RA 3Q7TA 1B73A 1NLZA 2QM3A 3L1UA 4GKAA 4IEFB 4LZJA 5ALEA 8AT1A 1V45E 3LC7O 3W5SA 1K89A 2PRKA 3ZWMA 4G4SO 3QPVA 2BUCA 2BHTA 3CUSA 1VBFA 4DC1A 1JFFB 3CKMA 3CY6A 3Q7IA 5KYYB 4LJSA 1ZR4A 4GBGA 2UUBB 1N6RA 4R2LA 1PW7A 4LSGA 3NDPA 4N3GA 4BZXA 4D4JA 4XYLA 2YN2A 1KI8A 2FWRA 1UKEA 4JWTA 4NATA 1XR3A 2J30A 2D5IA 2RHHA 4P1ZA 3PD0A 5SICE 1IYZA 5KTYA 5LZ4A 1NP3A 2XE4A 1AZLA 2EBWA 3OZBA 2L82A 3DDHA 1T2DA 3LLMA 1GQFA 1Q0UA 2OG1A 2XUIA 4OGKA 3IPYA 1KIAA 2Q27A 1HFKA 3OEHD 1QYWA 3JWPA 3GHHA 2FMUA 1X7WA 3I83A 3I39X 3ZDEA 1U0RA 3AR3A 1XRJA 1P44A 2L18A 1G8MA 2EATA 3LUCA 4XUEA 2O7QA 4C0BA 3KWJA 1Z5UA 2QV0A 1AMUA 1F4VA 1EINA 4B0OA 4CIWA 3LO5A 4G0WA 3ROMA 3T3PB 1RACA 4ZP1A 3DCNA 3TZLA 1AD2A 2DY1A 4CLOA 5FAKA 4NOLA 5C52B 1PT8A 2HU8A 2IZ1A 2DTXA 3KTOA 2ZRQA 3D7LA 2FSVA 4IFBA 4K6KA 1RLUA 3BIWA 2CBXA 3GQBB 5JC8A 4H3SA 5C7IO 1YV9A 3D8HA 1E3WA 2NQ8A 1N2CB 2RC5A 3EVDA 1RHRA 1T9BA 1A8SA 1I5EA 5EP4A 1QRTA 4TMYA 5JMPA 2SCUA 4FYPA 4EHNA 4HX9A 1NYTA 4MZXA 4Q4HA 5CLLA 3NOVA 4PZ0A 5TQJA 4TV9F 1T25A 3TNFA 2HSGA 4YBRA 4KB5A 1PJ3A 3T7EA 3DE7X 1DFGA 4M1EA 4MGZR 3T7RA 1QCYA 2JJYA 1NVBA 3HC7A 4C07A 3FZQA 3O8NA 2R2GA 1KVSA 2XUJA 5IDWA 2OCIA 2JPDA 3TYXA 3A8TA 3WLAA 1FDUA 4F6RB 2CJYA 1U7OA 4UFNA 3FSEA 1K98A 3HUTA 3UGJA 1JEYB 3BFKA 3NYQA 3E2MA 4Z4QA 2BKVA 1JG2A 5HX7A 1EUCB 4YCCA 4IJ5A 3DBRA 5T4FA 4LYGA 3V1KA 3ZU6A 3R0IA 3FR7A 1QHIA 2ZAOA 3DR5A 1JDPA 1F1BA 4CI0B 1U5BA 2Y76A 2ZYWX 3BH6A 3ELDA 4XDYA 5AJZA 4RE5A 1H9CA 3UM9A 1KZ9A 1JP7A 5FWNA 2XDAA 4EGCB 5SY6A 2PDAA 1H2WA 1H8EA 2H2AA 3WYCA 5AW1A 2A0YA 3ETNA 2AE2A 1E5XA 1SK8A 3PRHA 4BL5A 4AU1A 2HI0A 3MGKA 5CJPA 4QASA 3GRZA 1IULA 5DOVA 4EJ6A 5J1SB 1IJFA 1NFRA 1UDBA 1MIHA 1CY2A 1XEFA 1T2EA 2BFFA 1TEHA 3AFHA 3NAGA 4EW6A 2ZK7A 1CUAA 5E7JA 3FZGA 5IVKA 1P2UA 3IQDB 3PXDA 3RVRA 4WT7A 4B3SB 2IYZA 4YJ2F 2WK1A 4R2JA 3U26A 121PA 3ZY3A 4RFLA 2O7VA 4ND4A 1NKVA 5FUYA 3AOEC 3KQWA 3EGDB 2WWIA 4LQLA 1ANKA 1OIWA 3GDOA 4J1QA 3U9TA 5KYKA 1UFRA 4DKJA 5GP1A 1G8GA 1YAHA 2VDJA 5HRCA 4LJRA 1OBFO 1FVFA 3D7SA 5SY4A 3SBEA 3OHMA 3GDWA 5JATA 1JQDA 3QKRA 3F8TA 3SEQA 3INRA 1NW7A 7REQA 3B1FA 2X3YA 1QB8A 4UCQA 2DPHA 4POOA 3FUCA 3HCRA 1N5IA 1P81A 3C5WP 1BD3A 2WF9A 1YOVB 3EEYA 3VO2A 3P5SA 1Z2AA 3KUKA 3IUNA 3B6KA 3KELA 1YVPA 1T36A 3EA4A 3VR4A 1G20B 2JHPA 3IV7A 5AM0A 1JRLA 2EEPA 1C3LA 2FFQA 3KWFA 1P45A 4XLZA 5TNXA 1LPSA 4Z8YA 3BD9A 3ZLJA 4MUAA 3OQMA 4E08A 2VJKA 4Q4CA 1II8A 1MCZA 1UUFA 2X4DA 3MJHA 4LVCA 4N5LA 3ZKWA 1T4CB 5J47A 2V5UA 3JALB 1V2GA 3L0ZA 4JR2A 4UD2A 4YCDA 1BMQA 1V35A 5GIPE 4Y6GB 1V1RA 3S2EA 3N8IA 4M0LA 5L4SA 1E6WA 1WKCA 4L50A 3EFOA 4U7GA 3RUCA 3Q5EA 5COAA 3KQOA 2XRYA 2ZJYA 3P0RA 3C5CA 4YMSA 2P3SA 3P26A 3RRBA 4BUJA 5JCPA 2Q0QA 4UAUA 4DM3A 3PNYA 4ZZ2A 2VSNA 4YDRA 3I8XA 1W88B 4TL9A 2QWXA 1B26A 2PGDA 4Y6OA 4BO5A 4YX9A 1CZKA 3MILA 3KQKA 3VKUA 1FF9A 1ADCA 1JG6A 1NPDA 2Q4BA 4GD3Q 2ZXEA 2Q9AA 5JLAA 1EVJA 4HNUA 4FQ5A 1H6BA 1R6AA 3GDGA 2PBRA 1TF5A 1CXZA 2PT9A 1RLMA 1CBUA 1HZZC 1H5UA 4I3HA 3HP7A 2ZJ6A 2EP7A 4Z0HO 3WRXA 1SA0A 2WD8A 1JJ7A 3F0TA 4MW7A 4QECA 5F78A 1HDOA 2QUHA 4FC7A 1SZDA 4QJIA 1UADA 1ESEA 2ES4A 2ZRPA 2G07A 3M3DA 2GNPA 4BATA 3LS2A 1XZHA 4D9JA 1MJNA 2I7TA 2GVDC 1YCHA 1NFFA 3JQAA 4Z0NA 5FLEX 4I5FA 1M2OB 2D7CA 1OFVA 1AK1A 3HY6A 5DYNA 4AZTA 1CIJA 3AF6A 2Z95A 4K9PA 4S2EA 5DX0A 4C7KA 3FPEA 1ZHHA 3MQFA 3NTLA 5EN4A 4BLWA 4WZAB 4I7EA 2DT5A 4DIDA 1U1FA 3IO3A 1XWFA 3F5QA 5FUVA 2IEGA 5A5FA 3D8SA 4MW0A 4D8XA 2DLCX 3N2LA 5KOYA 2RH4A 4UBMA 2YXNA 4LOLA 3VNBA 1VJ0A 1JHQA 1IWOA 2I55A 2QQGA 2WNIA 3CLSC 1MX1A 3K0HA 2Z2IA 1A9XA 1SXQA 1JFVA 1F3OA 5LQUA 1DKRA 1LZLA 1N3IA 1DAOA 3P0EA 4HH0A 1BS9A 1Y80A 2HHJA 1V95A 2ODTX 2CHVA 4YH1A 5E6RB 3PWSA 5BVHA 5I9NA 3KOOA 3KJFA 1FP4A 4CL8A 4PVCA 4ARSA 1ONOA 4MEAA 3EG5A 1MUUA 2BZ0A 1GQQA 3KYCA 2AVDA 2XUPA 1DKLA 2RI1A 3H9JA 2B4QA 3LWBA 3LX5A 4S05A 3HRKA 2VAMA 3CNQS 3O9ZA 5A02A 1SVLA 2PJDA 2VTKA 3M6WA 5HCNA 2FAXA 3WQBA 2EKQA 2QN7A 1O9HA 4HEQA 4XB6B 3HJAA 4K6CA 5AM4A 3WMWA 4L8VA 2OVFA 1N2SA 1O0CA 3L02A 4D9IA 3BF8A 1ZGZA 5CB6A 4NI5A 5B1SA 3U16A 1G59A 2PKEA 1L5SA 1P0CA 2G0AA 3ROZA 3FTQA 3AKCA 1P29A 3G88A 4HLUC 3TJZA 4G4GA 4ALNA 4YUZA 4XSVA 1VMDA 3KOUA 3LJKA 1T3ZA 4FFMA 1B8UA 5LQJA 4GM4A 2DHEA 4WMLA 4EVIA 3LKDA 1QONA 3VPFA 4M53A 3C8ZA 1BFDA 1BX0A 4KU4A 3R5SA 2C4WA 2VWHA 3C7DB 3N75A 4OKNA 4B35A 4RVCA 1JNYA 1YTLA 2I4TA 2JARA 3WK9A 1JFFA 2QQ5A 4LXTA 4OVKA 3VPGA 1GUZA 1NQUA 5KYYA 4DV4B 4IV0A 1GL7A 2ZB7A 3N7TA 1EDBA 1JR3D 4OBXA 1RYMA 1GNTA 4K5QA 2X1MA 2PH3A 4NP6A 4PZCA 3D8TA 4AG3A 3E7FA 3KNZA 4QBKA 4S1WA 2HJ9A 3PHGA 4ZI3A 2VP4A 1LTHR 2ESRA 1NJ8A 2FG5A 1Q0ZA 1KYTA 2QX7A 2VK1A 3T41A 4A9AA 1GQRA 1BQ3A 4DNOA 4E4TA 3K73O 4MJLA 1P4RA 1V37A 1M6EX 2JC3A 2W22A 2OL4A 3DPUA 1N2ZA 1SM4A 3MB8A 4BZZA 3WKAA 5B3JC 2WJAA 3RRMA 2GSWA 3LT2A 3DBHB 2DQYA 2N9UA 2A30A 3CN9A 3CNOA 4TV9B 5AW9A 1KETA 2BGUA 2NQ2C 2VJNA 4HTFA 4M9CA 4R9RA 3TRFA 1ZFNA 3PC8A 5TC4A 1CVRA 1EVLA 2GKOA 4MWOA 2X6QA 5IEBA 4YT8A 1ZGBA 4U1RA 1K06A 4E5VA 3L05A 4G1CA 3OZIA 1MXFA 3DYBA 4WCFC 1ZCFA 1FDTA 3I73A 5EWLB 4H7IA 1FS5A 4X66B 1B8OA 5HRUA 1YFLA 1GSHA 5ETJA 3WWEA 2ENUA 2H31A 2GM9A 1NNEA 1AXGA 2ZEJA 1T0HB 4RVFA 4NMXB 4MI6A 5EE1A 3GQBA 1DC5A 1RXSA 2Q41A 3WYAA 4N5MA 3ZV7A 1TB4A 5LQDA 2WHQA 2JLXA 2Y0EA 4WAUA 1N2CA 3X1ZA 4UCXA 1UCFA 1Q20A 1I10A 2HSJA 3A1VA 3GLHA 2AK2A 4LGCA 5G4LA 3RPEA 4HDMB 4LXYA 4NLLA 4YACA 2KWIA 4GZLA 4FWTA 5AI6A 4F3RA 1KEPA 1LU9A 1N2OA 4BNNA 1QO0A 4E11A 3HVRA 4DMLA 5C7LO 4V39A 5LMZA 1H4TA 4RHYA 3EIOA 1J0EA 5JIBA 3DLAA 4FFOA 4IBOA 2J0EA 4DXDA 1NX6A 3S40A 2ACVA 1JQ3A 2F59A 4QGFA 4F4HA 5AVWA 4Q4JB 1J2EA 3H9BA 3LA8A 3M89A 1NSYA 3NT5A 4R1NA 1VXOA 2OECA 3GAMA 4F6RA 3RT9A 5ALYA 4LHZA 2OM2A 4YJ2B 4GAEA 4Y6SA 5IHPA 2TSYB 1JEYA 4PHHA 1N33B 2UXCB 3RCBA 1EUCA 3EGEA 5ALPA 4CV1A 4LXIA 2BONA 3CV3A 3WZLA 3WYFA 4F3KA 2NUPA 4IWXA 3ENWA 3SZUA 1NM5C 5DT2A 4LKOA 4XEUA 2CBZA 2FLKA 3RVPA 4WLOA 4XB1A 1U28C 3B6JA 2QI9F 4N6NA 2KB0A 2YHAA 4PSUA 4UARA 1O54A 2BMJA 3BMXA 2ZSIA 5TVGA 4EL0A 1RPJA 3UJ8A 4DVJA 2A6PA 1F2VA 4DQDA 1X6VA 3MVEA 2BFWA 4MPPA 4ZYZA 2EZUA 3PQ7A 1NXWA 4CIAA 1OREA 2O52A 3H8JA 3NG1A 5FP0A 3T0GA 4ERNA 2Q6OA 3CNHA 2B8EA 1W2WB 2H5JA 2ZTUA 3VPCA 4LWZA 3P2IA 5FJJA 3CISA 2NYVA 4IV8A 4HZGA 3PC2A 2XY4A 2G5PA 3GK3A 3M6AA 4I3FA 1D0IA 4W7IA 1T8PA 2CFOA 1U9YA 2XEXA 2X13A 2B3TA 2IPNA 1DTSA 2VWQA 2Z0MA 2ZRCA 4R7GA 2JI9A 1IJBA 4BO6A 5J63A 4CGZA 1T4MA 5EJGA 1I5RA 4ARZB 4HEA6 1EVZA 2HB6A 3OG9A 3DVLA 4GQAA 4B3IA 1U2ZA 3BRCA 2NP6A 3TXYA 1P77A 1VRVA 4BE7B 3TUZC 1KI4A 3R20A 3UANA 4UXJA 2C03A 3WL8A 3DBIA 1PWHA 1WPRA 1NHGA 1YOVA 3G2NA 4M46A 4D0LB 3T5AA 3W5BA 4IMRA 3CX6A 4IIBA 4NHEA 1FDOA 3DZGA 3NI2A 4Z4EA 1UKZA 1X39A 1G20A 3K8YA 5JWRA 5FIUA 3LQYA 2B4TO 3C3BA 5BR7A 5EFOA 1PKXA 4E12A 2NP7A 3DJFA 2JCBA 3H9QA 3P71T 4UDNA 4UQLA 4LNUB 5HBGA 5P21A 5LU8A 1UPAA 3ACBA 4XUDA 1MENA 3MLBA 2PFGA 2LKCA 3MERA 3LHDA 1T4CA 4RD4A 4EENA 3V5NA 4G86A 1PO7A 2F4VB 5BQOA 1KY4A 4ITRC 5F1YA 3GA5A 3HCAA 3V4LA 4OGGA 3ODGA 4EY6A 4GYWA 1QP7A 2PL3A 4ESOA 2YZMA 3R4VA 2AT1A 2X77A 4H15A 1YU9A 1IPHA 1E4OA 3TS1A 1ILEA 1BA3A 2DJIA 4KBYA 4QPDA 5CT4A 5ELLA 4CZ2A 4K28A 1TE2A 3LOPA 5GAJA 2ERYA 2O4CA 3GJSA 2VP6A 3OJFA 3FMOB 3ZQ6A 3OECA 4AMYA 1W88A 1NDHA 2Y99A 1E2NA 4L5IA 4JFRA 3T3MB 5KO2A 1DRUA 2EU8A 1J23A 4EBFA 3SR0A 2AG0A 3EUWA 3AUAA 1DXOA 1FE8A 1U0OC 2C2BA 3D7NA 3FUTA 2HYDA 5CT5A 1WP4A 4AL4A 1NW3A 3WGLA 3EFEA 5BMOA 5CPFA 3JWIA 4KRGA 3IVAA 4JENA 3BVPA 2O0HA 4JBWA 4X7BA 2I78A 4QDXA 5BUCA 4TRRA 5DHAA 1JXAA 1Q7GA 5B7PA 3N86A 4RHCA 3LBNA 4HO1X 4V38A 1YB5A 4YP7A 3UOGA 4QNMA 5H3HA 1AVTA 3NDJA 3GX1A 2JIZD 5CVDA 1X1SA 8ABPA 1LBEA 4ZMBA 4RD1A 4E5KA 1M2OA 5A9SB 4YLGA 2XBUA 2AD5A 1G2OA 1Q5PA 3HWRA 5JHHB 1P1JA 1G21A 5DO9A 1QZZA 4JN6B 1PLKA 4U3JA 4TSFA 4KREA 1RDFA 1H0HA 1X1CA 1IM2A 4KQJA 4WZAA 3RTDA 3WLFA 3O3CA 1NW5A 4PSAA 5DHSA 2IZ0A 1AK9A 4QRIA 1MPXA 2YBDA 2GPTA 1JIIA 2HEIA 2PT5A 2FPMA 1OHHA 3RUAA 2QVGA 2DFVA 3UY4A 5IJXA 5A4MS 2QGZA 5KCMA 1I6MA 1WCIA 1ENZA 1W52X 3LXRA 1Z0AA 3WDLA 3WGMA 2XV1A 5ALRA 2QZJA 3HHPA 3KBOA 5JSQA 1K4YA 3I04M 5T3UA 1M6YA 2GPWA 4IIUA 1T2NA 4OQXA 1QE5A 2RIPA 1SY7A 4EEXA 5FFFA 3ND5A 5E6RA 1O5IA 1W96A 4AN0A 2P2LA 5M5BA 2EC5A 4O4LF 5LQSA 3TNJA 1TIBA 1FVOA 5DGXA 4A03A 4GPAA 2AG5A 2G04A 3LHKA 4JT2A 4IZ6A 2SKEA 4XIGS 4MR7A 5EWJB 1ORHA 5AVXA 3K6KA 5HDQA 1NSFA 1XEWY 2E3JA 2SKCA 1SNYA 1P7CA 1HMYA 4Z9AA 5KQGA 1NIPA 1W30A 2FG7C 1IHDA 1W5BA 2QN3A 1U8ZA 4R0NA 3D0KA 1L5LA 3R7SA 1CY1A 4AJ2A 1T5BA 5BUQA 5GADl 1T9GR 4H7EA 5K8JB 3E9ZA 1DBQA 2Y8EA 1CS4C 2P11A 4LIPD 4ISCA 3RK0A 1YIDA 2XA9A 2EG9A 3R3WA 3USES 2XPCA 1P4JA 2Y0CA 3JWGA 3LG2A 2R6JA 3AY0A 4S1VA 4A92A 1EAYA 1K66A 5I47A 1RT9A 3RBAA 2AN5A 3RSGA 2BUAA 4ZV4A 3GOHA 4FVTA 1A2OA 1KERA 3PKZA 4RSHA 5FD8A 2ATIA 1RPZA 2OMEA 3MWDB 2FFHA 3FPBA 5JAPA 2R4TA 1RBMA 1MOSA 3OQJA 3OIGA 4JZYA 4MVCA 3TRJA 3ULKA 4DDMA 2IU3A 3K1JA 4JR0A 4BKRA 3GZTB 2A0XA 4QBFA 4MQ5A 2ZS7A 4DMMA 1TVCA 1JMKC 3PNSA 4WGGA 1MIOA 1NE7A 1GZUA 5ITZB 1ZK0A 2YHIB 1E7YA 1DZ3A 3TSOA 3KVYA 2IEDA 3SSOA 1US8B 1IN1A 3DO5A 3CJQA 2QRQA 4OMDA 3OM0A 3OICA 2WAOA 3ROXA 1XLTA 1GILA 4G0XA 4L8FA 4YC7A 5T64A 5CG2A 4DLXA 1CQXA 4DVGA 3SCZA 4I1PA 3B5IA 3EZ6A 1QRUA 2AUTA 3C8DA 4C76A 3R3UA 4PO9A 3PQFA 4HQKA 4RPKA 5DSTA 1R6BX 5B6PA 1WUKS 5FWXB 1K3UB 2VRCD 3B60A 4B7AA 4DCVA 5T7BA 4RZSA 2R6CA 1JEOA 4A91A 2G71A 4QPZA 6PFKA 1OH5A 3UWPA 4RV9A 2H7XA 3KB8A 4TV9A 3X1WA 3ZY2A 4E1AA 2G09A 1BMFD 5CEJA 1ZY2A 1JILA 3A9VA 1D2GA 1DX4A 3A2MA 3GUCA 3KPUA 5BYJA 4Q7QA 5AVTA 1AV6A 3R8CA 2GJKA 2WR8A 3I1FA 5CUQA 4RZQA 4QQKA 4RJKA 2CL5A 1OFHA 3OCJA 2HNKA 3ZLVA 2IVZA </