4DCNA

Crystal structure analysis of the arfaptin2 bar domain in complex with arl1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
TREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for membrane binding specificity of the Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-2 determined by Arl1 GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords ADP-ribosylation factor-like protein 1
total genus 47
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcnA00
1N6IA 1S1CA 4KJZA 4Q9IA 4HLCA 4OK5A 2R2AA 5TVKA 2GXQA 3MGCA 4UQOA 4HLUA 1FW6A 2DPXA 1OIWA 4CVNA 4YONB 1GP2A 2F3RA 2W58A 3DL0A 4AC9A 1NY6A 2ZJZA 4PSKA 5K8UA 3EPJA 2HLDA 4LJ8A 4X8MA 1UFQA 1NL3A 2QAGB 3ECCA 4IDQA 3V9PA 2WPDD 4A0GA 4HZUB 2HT1A 2AKAB 1W44A 2P6UA 1OH6A 1S9HA 1DTSA 1T5LA 1EFRD 3QKTA 2OV2A 2QUZA 3NXSA 2CJWA 5KDOA 1Z07A 1GDDA 4NYIR 3S1AB 4KV9A 3KZ1E 3SFZA 1E2NA 1U0LA 2ATXA 3DMNA 1FZQA 2CXXA 2FA9A 3LQQA 4M22A 3SJCA 4ACBA 4BFTA 1NN3A 2QQ0A 4A2PA 2BKUA 1XPOA 3W3AA 4IFEA 1KO1A 3NC1C 2JLVA 2JJ1A 3B1VA 4IXMA 4K8OA 4OQFA 1P9RA 4HDCA 2QM8A 1EFHA 1Z0FA 1EG7A 1IN5A 2B8WA 4R7ZA 2NO6A 4JLVA 4KFUA 3BERA 4BLPA 4BQSA 1Z2AA 2UVQA 3LO5A 4Q02A 3TUZC 3CWZA 3AP3A 2DB3A 3IEVA 1NBME 4Q4JA 3LBIA 2IHYA 2X2EA 2Z43A 4Z1MD 2WPDA 3VU9B 4PQRA 4NHOA 5J40A 2J0QA 4DSNA 4UNRA 1E79D 2QPOA 4UNSA 4CYMA 3ADKA 3RSLA 3BS4A 3U60B 2XTMA 4JBYA 4JLAA 5H70A 5C4GB 4A8JC 3THWA 3L0OA 4QHTA 2ZYVX 4DBLC 4BLQA 2G1KA 5DO9A 4KCGA 2NO0A 5CK4A 2FWRA 3ZQ6A 2YVUA 2P6NA 3V00A 3GLIB 1DAHA 2FOLA 2G0NA 4Q18A 2GWHA 5DLQC 5JWOA 2J7PA 2YC2C 4TL8A 3H1TA 3AVVA 1TL7C 2BVNA 2GK6A 1E0AA 2O8BB 1CBUA 1FMJA 1VCMA 3CRMA 4LWZA 1MR3F 3IO5A 3EPKA 1R5OA 2WICA 2NOAA 5JBQA 4PC1A 3ZD6A 5JWHA 3CF0A 2FU5C 3RRZA 4DUGD 2PX3A 4TMZA 3FKQA 2ASEA 3R8FA 4QJ4A 4FD2A 3RYTC 4PQYA 3WNBA 1W0JA 1QHNA 3LXRA 4NTZA 3A4LA 1VCNA 2FZLA 2DFKB 3AVUA 4V0MA 4B34A 5J4HA 2DHRA 2J0UB 3HR7A 1U94A 1WE2A 4HAYA 2V9PA 2ZJ8A 4MRRA 3WMFA 4A2WA 4A15A 3KJHA 4JVSB 2QN6A 4URVR 2MMCA 4MRSA 2CNWD 1Z0DA 2X2FA 4NE2A 4AG5A 5AJYA 2OCYC 1J70A 1Z0AA 2BEKA 2VTKA 1NIJA 3DPUA 4EQ6A 1SVOA 3NIBA 3SDZA 1DS6A 2XJ4A 4Q01A 3QF4A 3AH8A 2JJ2D 4LUCA 1DG3A 1E9FA 3AVPA 1N5JA 4DXAA 4JKYA 2ZRDA 2B21A 3GJXC 5EE3A 2R6DA 4KXFB 4MYUA 1H8HD 2IF2A 1UBCA 4HUQA 3UANA 2XB2A 1G4AE 1G64A 1RPZA 2Q6TA 3BORA 2H1LA 2IWHA 2H16A 4IOKA 2GTPA 1RZ3A 4PFSA 5LB4A 1F5NA 1W0KD 5H68A 2O52A 2G1JA 1G18A 2YV5A 3T34A 1PVOA 1RYFA 5B2ZA 1SHZA 2P2LA 5KO2A 2CLCX 4OJQA 4PC3A 4EPTA 3KUCA 2ZR0A 1XCMA 2EWVA 4HLUC 4AK9A 2CNWA 4BFWA 4QM6A 5HTKA 4TMTA 1E2GA 1YR7A 4OHWA 3CKLA 2IS4A 1CXZA 1D2NA 4KLZA 3GLGB 4CIDA 1P4SA 4DDVA 3GPLA 2G3YA 1XD8A 4Z1MA 1AN0A 3K1JA 3LLMA 2CE7A 3CNNA 4LBZA 5G41A 1ONBA 4M0LA 2IA5A 4PZZA 4WZBE 1XP8A 3ONWA 3SFVA 3KQLA 5A0FA 3K9LA 1T4GA 4OQXA 4AY2A 1XTQA 4QGFA 3QEOA 1XEXB 2BMJA 5EZ5A 3A8TA 5GVRA 5FR1A 5L3SA 1VDZA 2F9MA 3ASYA 2GDJA 2CEAA 2OESA 3MWYW 2ZJ5A 4OL0A 3ZZTA 3GCGA 1ZP6A 1NG9A 3LDAA 2XXAB 4YMWA 1X6VA 1MOZA 5IT5A 1E69A 2J7PD 3CRRA 4TMXA 3AVTA 2FFAA 5KPJA 1D2EA 4C2UA 1II9A 2GEDA 2LKDA 4PPNA 2VSOA 4IFBA 2RKOA 2ZJAA 4MGZR 5CB8A 4LYHA 1NVUQ 4HB2A 1CEEA 2OAQ1 2QTVB 2BIFA 3AVYA 4DCNA 4QL3A 2O0HA 3JVVA 3HU3A 2GZAA 1JXOA 5IRCD 4EIWA 2GEUA 1XB2A 3QQ5A 1W36B 4KSCA 5EE0A 3K8YA 4LBVA 4FWTA 2NO1A 4J0QA 2D4HA 3CX6A 2WKQA 3NBFA 2P67A 1X1RA 4XIGS 2ZREA 1Z47A 2JLXA 2ZSAA 4C0KA 1JR6A 4D0NA 4A6XA 4KYIB 2EVWX 2REOA 3IO3A 3U4QB 5ELXA 5HCIA 5JJKA 3TE6A 1N0WA 3L0IB 4MDFA 1R8SA 2AXPA 3REGA 4PSAA 1G8GA 1NN5A 3FGNA 2ATVA 2RGGA 1HY3A 1Q1BA 1ESMA 3TGPA 4WXRA 1HTWA 1GL7A 2O8CB 1ZUNB 1F2UB 1SVLA 3X1YA 1C9KA 4B6EA 1OKKA 3QXSA 4ON9A 1AZTA 1XTSA 2Q3MA 3BFKA 1CJVC 3OEHD 1YHNA 4MGIR 5HE9A 3ZIAD 4M1KA 4C0JA 3QKUA 1Z63A 2HJVA 2QBYB 1I2DA 2ORWA 3SYKA 4ZI3A 3DKPA 3LLUA 1OSNA 2QA5A 4LHYA 4FI3C 1HQCA 1G8FA 3NH9A 1KK0A 3L8YA 3T06B 4A8JB 2RH5A 2AR7A 4PXAA 4JT2A 1K5GA 2V3CC 3DZDA 4EFMA 1BKDR 1TX4B 1Z6XA 1K6MA 2O5VA 1ZC3A 3CW2A 4PHHA 3C5HA 2O8CA 1L4YA 4XOIA 1TUEA 5GJWC 3TUJC 4A82A 3EIEA 3T12A 2QP4A 4YDHB 5BW8A 2HF9A 1JPNA 1R10A 1RVDA 3K9NA 5M04A 2IYZA 4E03A 1XX6A 4Q1BA 4UNPA 2HLDD 3TK1A 3TW4A 4QOSA 3VFDA 2XZOA 4PZYA 5B64A 2ORIA 2ZYTX 1RRGA 5FOVA 1NN1A 5C46F 2D2EA 4QXAA 1AS0A 4RSGA 2RGAA 2CL7X 4FMDF 3UG7A 4CT4B 4C4PA 3WMGA 2IYVA 1SVWA 4BPBA 1M1YE 3AQ4A 5FOWA 1OHHA 2D06A 2ZROA 3QG5A 1Q20A 5DYIA 3I62A 1ZD9A 1W4AA 1CR4A 4C3ZA 1SKQA 2QE7A 1MT0A 1MO3A 3WNCA 3T1TA 2P65A 3THXB 4M8NE 5EE1A 1XTJA 1C1YA 2VEDA 4CRWB 1OH5A 1TPZA 3B7GA 2QQEA 2JJ1D 5AK0A 3KQHA 3NBZC 3R9XA 1CLUA 1GL9B 2IYUA 2ODBA 2IYYA 2FFHA 1IY1A 1FUUA 3N70A 2OCAA 2QROA 1BOFA 1MO5A 1VCIA 1ZINA 1TQ2A 2OXCA 2XAUA 4KHZA 4U5XA 3UWKA 3F0TA 3BFVA 4JKIA 1AS3A 1IONA 4LJ5A 5ANRB 5CJ2A 3IIJA 4Q1DA 3U7FB 5B30A 3ZVRA 1J8YF 4TYNA 2D7CA 4V0KA 1GITA 1CRQA 1RC8A 2GBLC 2ERYA 2GXUA 1VG8A 3R20A 2BMFA 4JT4A 1KO8A 3RVBA 4GMXA 4S2EA 4AYXA 1N0VC 1UEJA 1KNQA 3CIOA 4G3XA 2A7QA 2VPPA 3LBHA 2Z4SA 4ILEA 2YOGA 1RRCA 2GJSA 1D8TA 1JPJA 1G21E 4H1UA 2GXSA 2CHQA 4D81A 5FBVB 1S2MA 1UM8A 1ZM7A 4PQFA 4HI0E 4F4IA 3NC0C 2W6ID 4KO8A 2WJJA 1A5TA 3H2YA 3KKPA 1GILA 1LVGA 2EFDB 4LPKA 4WXPA 4G5QA 4MKIA 1EFTA 2O0KA 5A4JA 2JLSA 4YMUA 5FTNA 1TQDA 3ZZ0A 5E7JA 3Q7PA 4KITB 3QG1A 4R9UC 4B32A 4ZCMA 1FL9A 2JIZA 3GJ4A 3NBXX 4FW9A 1NJGA 2GETA 2ZRBA 2V6IA 1S0UA 3H86A 4YMVA 4W5HA 1OKKD 4FMCF 2DWQA 1ZYUA 2AFHE 1NP6A 2B7BA 1J2JA 3EZ9A 3V4FA 3K09A 1EK0A 1N5IA 2FN4A 3VNUA 3EWAA 1G3MA 2V8OA 4JLNA 1FPMA 3F5FA 4DUGA 5K8IA 4HUQB 1E1QD 4G5RA 4IVRA 4TQ9A 3RWMB 1PUJA 3M1IA 4C0BA 3KTAA 3KXLA 5JEDA 2JGNA 2AL7A 5FPYA 3REFA 3QF4B 1H65A 1U8AA 1CS4C 3IHWA 5JCZA 3RS2A 1Q1EA 3LW8A 3GJ7A 4EQ6B 1P2SA 5DH9A 4TYWA 1IY2A 1M6NA 5EE9A 3TKLA 4C0LA 4R2IA 1GZSA 1TU4A 3CO5A 2JEOA 2CL6X 1W2HA 2K5UA 2ZS7A 1Q3TA 1E9RA 2BBWA 2XNDD 2Z4RA 4Q66C 3TRFA 2F1JA 1ZUHA 1ZM3A 3QVVA 3AF1A 1AKEA 3EZFA 1NJFA 4B35A 1TADA 3SI7A 3PEUA 3TR5A 2NZ8A 4ZKDA 4NCJA 3VR3A 1ZM2A 4WZAE 1YE8A 1FTNA 4F7WA 2B7CA 3C16C 5EXPA 4B3CA 1COWD 4M53A 2ZSFA 1EESA 2QRNA 2GJ9A 3KFXA 4B2LA 2IL1A 2WJIA 3OF5A 5HR5A 3PJRA 2ZVPX 4KFRA 1I2MA 2LWIA 1A2KC 3B5JA 4ZKEA 2IUSA 2OHFA 1N6HA 2VA8A 5J47A 3DO6A 4DCSA 4XVRA 3KQKA 2IS1A 1DELA 1JECA 5JJIA 3FKSD 1G5PA 3QIAA 5AUNB 1QHHB 1Z6TA 4BZQA 2OSBA 3TBKA 4B48A 1GKUB 4BE7B 4DLXA 4E22A 2RGNA 2VL7A 2WKPA 1VYUA 1IOZA 3DOFA 5CDFE 3SQWA 2ODNA 1JJVA 2XSZA 4B76A 4LHXA 3AM1A 3TW8B 3FVQA 1XJQA 1CRPA 2GJAA 2ANBA 4OQLA 3LRPA 2L0XA 2OFXA 4PHTA 3SE0A 4MKFA 4Q7KA 4WW0A 1E2FA 4C0AC 2CK3D 1E4VA 4LC1A 3IPYA 1W0KA 2HCBA 2A5DA 1N6RA 4MUBA 4NYIQ 2JAQA 5CLLA 1ODFA 1Z22A 4Q9HA 3WYAA 2GCNA 1SGWA 5IF9A 1N5KA 5GADl 1B0UA 4MKGA 3IGFA 1RJ9A 1N2CE 5KYKA 3RC8A 1NVWQ 2VSXA 1BS1A 1HUQA 1V43A 1FUKA 4Q9KA 4IVPA 4UNNA 1UAAA 3AVXA 1B23P 4URYR 2HYDA 2XX3A 3JZAA 2QRZA 2BOVA 4UXJA 2ZVQX 3G5UA 2ZRNA 4GDFA 5HPYB 2V7QA 4IHQA 2WWFA 3P1JA 4A8JA 3W90A 3NWJA 3PVSA 5JRZA 2OLKA 1UBGA 1GRNA 3VR5A 1E1QA 2WIBA 2GBLA 5TB5A 3TSZA 3ZZUA 3IQWA 5L3QA 1WA5A 3ZLJA 5FBLB 4D4LA 2CJWB 4TTPA 3CPJB 2PJRA 1G3RA 1Q44A 2ZE6A 1KI4A 3AB3A 5FFMA 4DLUA 3I72A 2W2TA 2FH5B 2FJUA 4B2PA 2B92A 3K70D 1LB1B 4F93B 1F2UA 4Q1EA 3WHKA 4ZDJA 3THOA 5HKKA 3EA0A 3GFTA 2CCGA 1JQJC 2GJ8A 1SXJE 2A5YB 3MWKA 1AA9A 3B6EA 1T3LA 5JLJA 5CYPA 3TMKA 1NN0A 3K0FA 2QENA 1E2IA 1KAOA 1U90A 2H7VA 4B71A 4JLBA 1R8QA 4W7SA 5AUQA 4YMTA 1XU4A 1Z83A 4AI6A 3VHXA 1UKZA 2R62A 3U4QA 5FL3A 2PMDA 2XNDA 5BN5A 4BASA 2O8FA 1S1MA 2QT1A 4D82A 4URWR 4EDHA 1GNPA 1II8A 4O25A 2MSDB 1E0SA 3CR8A 3OFNA 5AJZA 1WBBA 1E0JA 4JBWA 4QHYA 3B60A 2OXRA 4LZZA 5J4LA 3M6AA 1KK3A 3K0SA 2J41A 1Q3HA 2QGNA 1PLKA 3WP1B 1KSHA 1NRJB 2VLIA 3WP0A 2HF8A 5AR1A 1CJKC 1Q0UA 3KQNA 2BMDA 1E1RD 1FQKA 1P62B 4N0DA 2KJQA 4XSGA 5KU1A 4RFSA 1F48A 1II8B 1R6BX 1XJ0A 2WAXA 3A1SA 3LW7A 4LC0A 3B1WA 4LJ4A 4MKHA 5FOUA 3GJ3A 4B73A 4QM7A 4D25A 3SJAA 1CIPA 1LNZA 3G82C 4JLJA 4FCWA 1XJCA 1WB9A 1E96A 1L4UA 2FX3A 1V5WA 1YR6A 2C5LA 3CF2A 1P2TA 2FDCA 2OBNA 1XEXA 3U44B 3MD0A 3F3YA 3IIMA 3SS8A 4IKEA 1OHHD 4LGMA 2PL3A 4MRNA 2GJKA 5DE3A 3SJBA 1QVRA 3KQUA 1KAGA 1WP9A 1GVNB 1JB1A 2BJVA 4CDGA 4JLDA 4URXR 3HU1A 2QGZA 1GUAA 5CITA 1JXMA 3QUSA 1XD2A 2QEQA 5FTKA 4C9BA 4TL9A 2ZI3A 2HV8A 4LYFA 3CUEF 5DN6A 4XVUA 3MWLA 4CEHA 1JAIA 1XMSA 3HR8A 4FMCB 4GRAA 2ZSDA 4XTRA 4A6PA 1TEVA 3IKJA 4NONA 3AP2A 3ZS8A 4US0R 4C0QC 3IUYA 3UKDA 2XOKD 1QHIA 1G3QA 2PBRA 4P33A 1CJTC 1AQYA 2I1VB 3NDPA 1XD2B 4XWAA 1J99A 3E5HA 4I81A 1E79A 1SKYE 1Z8FA 2JA1A 4MITA 3FE2A 2J59A 1KO7A 3L43A 2ZJ2A 1OIXA 1AS2A 1QHXA 2JLWA 4OI0A 1SZPA 1YR9A 2BHRA 2P5SA 1EFCA 1OF1A 1OPXA 3BH7A 3EZ2A 5FOXA 2PZEA 1ZW6A 4TL6A 4I1VA 1G8YA 3PITA 2NZJA 4JJKA 5C1BA 2EYUA 3O8RA 4MDEA 4LJYA 1ZD1A 2OM2A 1TQ4A 3LX8A 3GLHE 3LH5A 2XTNA 1Z2CA 3IHLA 3SQXA 2NGRA 5KSPA 2HT6A 4BFYA 1YZQA 3HYRA 4GFDA 4UXIA 4JJZA 4GMDA 4BFUA 3PUWA 3WBKA 3K9HA 5IHPA 2YYZA 4RFSB 1GKIA 4KBFA 2WSSD 2RHDA 4MRVA 1CR1A 2OUKA 5AWFC 3AVWA 1FP7A 2VP2A 2DYKA 1IJFA 3FFBA 3CR7A 4LV8B 4JL8A 1E9AA 4TL7A 1NMZA 2YWFA 4WAUA 1KDTA 3I61A 5E95A 2WJGA 1NI3A 3KJGA 3DEFA 4C0SA 1G17A 2J46A 2Z5FA 5FI0B 3SN6A 1JBKA 1XPUA 3GJ8A 3VAAA 1E2QA 2CL0X 2EYQA 2OILA 3MAAC 3WRXC 1TU3A 1UBEA 1UBFA 2WIAA 4OHYA 2ZEJA 2YC4C 4D4JA 2WTUA 1ANKA 2QNRA 2WKRA 3GLHA 3I1FA 4BFZA 4JLMA 2VF8A 2F55A 4Q5IA 1LTQA 3D3QA 1P2UA 1JJ7A 4JLKA 3OHMA 521PA 1JQLB 5KNCA 3QBVA 2OCPA 3AVQA 1VG9B 4XTCS 4GL2A 2KBFA 3EXAA 3K0AB 3GJ0A 1SULA 4DSUA 1KI6B 3PG5A 3B13B 1OFHA 3GJ5A 4DCTA 1X86B 2ZR7A 2WZQA 1DO0A 3QKSB 3THWB 3DDCA 3C5CA 1G3UA 4Q7JB 2V1UA 3QY0A 3W34A 3BOSA 4M1YA 3FMFA 4D4MA 4EFLA 1P61B 4LJ7A 4Q03A 3AEZA 5A5GA 3N2EA 1DEKA 4W9MC 3MRSA 2V4ZA 5FUVA 3X1ZA 3IILA 4EPWA 1JR3D 2OE2A 2CCJA 5L3RA 1DAIA 1T3HA 1KDPA 1G7SA 3BD9A 1S96A 1Q12A 2GCPA 1CR0A 5DHAA 2ZSEA 1ZCBA 1WBDA 3AKDA 4ARZA 4Q48A 1HE1C 4IDNA 1G4UR 1QDEA 3BH0A 4OHVA 2XB4A 2ONKA 2BCJQ 4MYCA 4AKIA 1GOTA 1NIPA 4LJ9A 1CKEA 2AHOA 4HLQB 1IXZA 2QSZA 1YRAA 1GRRA 4LRWA 4V03A 4BRUA 2UKDA 2WBLC 3ETLA 2J7KA 1SVKA 3TSOA 3ZJYA 2J5XA 2BMEA 6Q21A 4HLDA 1GNQA 4EJSA 4G5SA 3RDPA 4DLTA 5JFGA 2ZRAA 3U6BA 1E9BA 1X1SA 4Q21A 5IK2D 4TLEA 3I3SR 4HB0A 1R0WA 3QENA 3BJIC 4X8OA 1T9HA 3GFOA 3CPHA 4PAOA 3WYGA 4RY2A 4NYJQ 8OHMA 4P4UA 4Q7LA 1PUIA 5G3ZA 1G8HA 4KU4A 2E1RA 4CF7A 1QRAA 4BEJA 2G83A 1SXJC 4Q1CA 3I92A 2AD1A 2VP4A 2VF7A 4GNKA 3LBNA 2QMOA 4DLYA 2D2FA 2JJ2A 4M1MA 4QBHA 4XVQA 1AM4D 2NPIA 3EPLA 2VHQA 2R8RA 3MSXA 4BLOA 3LA6A 3U3KA 3KKOA 1NLFA 1ZVQA 4AKHA 4WZ6A 1GSIA 1IN8A 3PUXA 4RD4A 3SNHA 3FMOB 3EX7C 2WSSA 3CWQA 2B8TA 2PCJA 3KXKA 4JVLA 5CJPA 1NKSA 5AJVB 5DSZA 2YOFA 3OIUA 5DI3B 4PTLA 2VQSA 1RE0A 4PHGA 4URZR 2WV9A 3AUYA 3LFUA 4QGGA 1XEWX 1F60A 4N1AA 3I5XA 4OJKA 2BBTA 3O8BA 2REXB 4L8GA 2P5TB 2EW1A 4JL5A 3L2OB 1KJWA 3NKVA 4W5WA 4L15A 1P75A 1Z0KA 1ZD8A 3NBYC 3KJIA 3K70C 1OT3A 4G01B 3P26A 4Q1FA 2V7QD 5HE8A 1J90A 3A4NA 4NP6A 1IAQA 2A5FA 1OLOA 3GMTA 3QEJA 2ZRKA 4ZV4A 3FTQA 1VG1A 5JEEA 1KZ7B 3LVQE 1Z5ZA 1A1VA 2ZI4A 2DWPA 4CT5A 2F9LA 3EARA 3AV0B 5EXTA 3EA5A 2FEOA 2HEIA 1E94E 3ADCA 1L2TA 1OB5A 4NU0A 4M4SA 1D9XA 1RKBA 2ZXUA 3UATA 4A1FA 2PLRA 2RAPA 1A4RA 4CEJB 3U5ZB 4US2R 1XEWY 1R0ZA 2YOHA 3BBPA 1YZTA 1Z6YA 3TJZA 4DRZA 3SU8A 3W8NA 2IYSA 3WYFA 2ZJBA 3TR0A 2QTFA 4EKDA 2H92A 1AGPA 4BEBA 2A30A 3GLIE 2PT7A 1KKMA 2G6BA 5EZ6B 4ARZB 2QBYA 4LSGA 1DARA 1GFIA 4OYHA 1O87A 3UMSA 3U7EB 1H8ED 2Q3FA 3EIHA 5F3WB 3Q7QA 1QG4A 1W46A 4F4JA 1PLLA 1IN4A 5AUOB 3LXXA 1T5IA 2XOKA 3PUVA 4ASUA 3OE7D 3A6PC 1ZRHA 4PAMA 3TAHA 1UADA 1ZCAA 4B3GA 1G9XA 4MGYR 1E2KA 1R0YA 1ETUA 1F3OA 3QOFA 1AK2A 2Z0MA 5HKKD 2FGJA 1F2TB 3DMDA 2R6GA 3QKSA 4IOJA 5AUPB 3B1XA 1ESNA 1JAHA 1HYQA 5LBIA 2AX4A 1NVVQ 1XWIA 2IBMA 2KI5A 1KI6A 3GD7A 1VPLA 1E2LA 3I32A 3L8ZA 4R98A 2WWIA 1LV7A 2ZRJA 4M1TA 1G1MA 4B47A 1RIFA 4DZZA 1RRPA 4V02A 4OHXA 4P0TA 3ZDQA 1PJRA 3DHWC 4PO1A 4RZ3A 3CX8A 2H57A 1IY0A 3AF0A 3GLHB 3ZYCA 1P73A 5KTYA 3BIFA 4DT1A 3RS4A 1KO4A 1M34E 1KI3A 4XWOA 3TIFA 5JSZB 1JALA 4HB3A 1XRJA 2BCGY 4GPTA 3ZQJA 3H4MA 4MRPA 4LCBA 3R7WB 2WJYA 4H1VA 1VG0B 2FGKA 4Q19A 3IPXA 5BYJA 1NBMD 1VIAA 3KKNA 5FL7D 5JCPA 4LYAA 3D31A 3QKRB 4OK3A 1MV5A 2UZIR 5FH9A 2R6CA 2CMKA 2I1QA 2ZRCA 4Q9LA 3SEAA 5FUWA 1E3MA 1OXSC 1PLJA 3C15C 5C4MA 1CJMA 2VHTA 3EW9A 4I1UA 2A2ZA 1CULC 4URUR 1EFUA 2CBZA 1SVMA 3LAWA 2GXAA 5F9FA 3KDSE 4KYUA 4Y0VA 2BV3A 3AF3A 3P4YA 1SXJA 4DIEA 1MRNA 3BH6A 4TLCA 3Q3JB 1JR3E 2GZDA 1YKSA 1Z06A 2CE2X 3BC1A 3CRW1 4RD2A 3BB3A 4IDHA 2IYLD 4NYJR 3I8XA 1SKYB 4LK2A 3KKMA 1KMHB 1XDBA 2FMXA 1R5BA 1U81A 1Z29A 2QI9C 5KSYA 1LS1A 2H8KA 5C2JB 3GLFB 4KLNA 1NMYA 1PV4A 1M7GA 2FV8A 4AURA 5FOTA 5L3SB 2HUPA 4E07A 3MLEA 3ADBA 1XEFA 3L0SA 1P72A 1MABB 1KK1A 2QP9X 1XD9A 2ZAOA 1G19A 2NTYC 4OQNA 1ZM4A 4U7DA 2P3SA 1OB2A 2ZUBA 1SHKA 1CP2A 1QBKC 4BFXA 4PC2A 2VBCA 1N5LA 1XCPA 2G0TA 5TV2A 1N25A 1A82A 2I3BA 1MABA 5CK5A 2W6JA 1W4CA 4A0RA 2NO7A 4N0EA 5AJXA 1T91A 3W5JA 1DAEA 5EP3A 4B75A 4DWJA 2ZIAA 3KL4A 4DLWA 4JS0A 1KOFA 3VKGA 1H8HA 4OBEA 3HJNA 2PCLA 3RNLA 5D3MB 2CLSA 1SXJD 1ZMXA 2ZRLA 4II7A 3BRWD 5DYGA 3RRNA 3SJZA 1S4QA 2BC9A 2AKYA 1FMLA 3BB1A 2IYWA 1UKYA 5DIFA 4BFVA 1O3YA 3GFPA 5LD2C 2FSIA 1M2OB 2BM0A 1W48A 3ZVLA 3VKWA 1SXJB 4MH0R 4M9ZA 2NG1A 3UG6A 2DR3A 1YJ5A 2C9CA 1WDTA 3BB4A 3UWOA 2P0EA 5HZKA 2VP6A 3GLFE 1OFTA 3K53A 2G77B 1BMFD 1OXUA 1QHGA 2ECKA 1KKLA 3I8SA 3FWYA 2V1XA 4MA4A 1Z0IA 1E9EA 1OV4A 4X8HA 2AWOA 2F43B 4ACAA 2QZ4A 4D6PA 1HE8B 3C4JA 1R2QA 2X19A 3PEVA 3VQTA 4A36A 2C2HA 1KMQA 5E4FA 4F4CA 1LY1A 3M4YA 4KI0A 1C4OA 1QHSA 2KBEA 1ZC4A 3IIKA 3RAPR 3U61B 3B8HA 2EFCB 1ZU4A 3QXHA 2VH5R 4HATA 3K70B 1S8FA 4MQBA 3TVDA 2ZRPA 2JIZD 2J0UA 3PQCA 3PXGA 2ZRMA 4C30A 3GLGE 1M7BA 4QJ5A 5JHGB 4QRHA 1E98A 3N5CA 2CVFA 4RZ2A 2J9RA 1VYVA 3CX7A 5EUMA 3LY5A 4EPYA 1SVIA 5CLQA 1S9DA 1YR8A 2CLDX 3PFIA 2C96A 3MUFA 2IW3A 1G7TA 2VHCA 5DI3A 2ZI7A 2RGEA 3L82B 3PIRA 1M74A 1X8JA 2A3RA 3LNCA 2ZU0C 3B1ZA 2OCBA 4IXNA 5AJWA 4DIDA 2IX3A 2QU8A 3SBEA 1G5RA 3E2IA 1ZIPA 4HSEA 3U7GA 2F7SA 3ICEA 4LHVA 1MH1A 2Z6VA 2IEZA 2QY9A 4D26A 3EC2A 4GSYA 2ZM5A 3MG9A 5FBWB 4RZXA 1VIYA 2VP0A 2ZS8A 2BM1A 4Z8XA 4F38A 2GAAA 3D7MA 4PSVA 1Z28A 2ZRFA 3T15A 3Q5EA 4RKFA 3R9IA 3TQFA 2Y8EA 2WVJA 3TLXA 4C7OA 3A36A 1U8YA 5CIQA 4CEJA 2V6JA 3UXMA 4TMKA 2A5GA 1YRBA 1TMKA 4IEIA 1KY2A 4NYMR 3CRQA 4A9AA 1NSFA 1IHUA 3EAQA 4YXWD 4QBGB 2NQ2C 4EJSB 4Q47A 3WY9A 4LV6A 4WVFA 3SZRA 4CGZA 2W6JD 2PEZA 2EFEB 2FG5A 2CCKA 3HDTA 4ZDKA 3ZVNA 1P6XA 1IN7A 1CR2A 3ND8A 4HDOB 3TH5A 3UIEA 1N6NA 4E5UA 5E7IA 4TMWA 2XEXA 5JHHB 4MUAA 3ZH9B 3FFAA 1LS6A 4P4SA 2GAOA 1TUIA 4OK6A 1ZUIA 2ZSBA 1T0HB 1FTSA 2ANCA 2HJGA 3Q9LA 4L16A 4O0MA 1FFHA 4DJTA 3FHOA 1HT1E 4TZ0A 5KDDA 4TQAA 1ELOA 3QXCA 1UKEA 2JLUA 2IXFA 3AKYA 3C14C 4TSFD 3QPVA 3C7KA 3O47A 4AD8A 3IBYA 4D0GA 4BFSA 5CYOA 5FTLA 5JS7A 3CM0A 1BMFA 5D3QA 4DLRA 2QP3A 2FSHA 4WIAA 2DWOA 5EP2A 1KTVA 3AP1A 4AG6A 1E2JA 2DCUA 2JLQA 1N6PA 3NTUA 2YHSA 2MSEB 1HURA 2WJVA 4R2HA 2OT3B 3E1SA 4HZUA 1QHHA 2CHGA 2PEYA 3EWSA 3HU2A 2VO1A 3BWDD 4LJAA 4N3NA 4DHEA 3PV0A 4DDWA 1W36C 3VR2A 1XTIA 5LPNA 1OFUX 4AKEA 3I5YA 2O8DB 1QZXA 3KFVA 3TNFA 2AWNA 4D4KA 2RMKA 3H0KA 1KSJA 1UF9A 2HXSA 2E87A 4OQMA 3RRMA 1ZJ6A 3T1VA 1XNJA 3HP1A 4IJMA 3FHTA 3QSYA 4WA7A 1U99A 3KB2A 1MRSA 3PEYA 3DM5A 2PZGA 3EASA 4Q4AB 2PZFA 2ZAMA 1Z3IX 3T5DA 4AKGA 1E2DA 4UJ3A 1Q21A 4NCKA 2JASA 3V4RA 1VTKA 4GP6A 1NLZA 1COWA 1TF7A 2JLRA 3RS7A 3Q5DA 4Z8YA 4C0HA 1IN6A 2C78A 5EP1A 3U3OA 3OE7A 3L0PA 2Q9CA 4KFTA 2PLFA 4WBSA 1HEIA 1TNDA 3W9YA 2ZTSA 2VHJA 3QE0A 3TAUA 4MGKR 1IM2A 5KDLA 2QL6A 1KNXA 1OIVA 1QF9A 2OFOA 3KJEA 1KGDA 1R5NA 4Y0AA 2RHMA 4HAUA 2XGJA 4IOLA 2GHIA 3G0HA 1F6BA 2GEVA 3OIVA 5TMPA 4TT3D 4JYBA 1EFRA 2MMGA 2FPKA 3W8RA 4F92B 1MKYA 2WWGA 1OW3B 3W3ZB 1BO6A 3QBTA 4Q4HB 1KK2A 1KYIA 2W6IA 3VU9A 4DLZA 2HXYA 4MYHA 4UKDA 1XCGB 5JS8A 2W2VA 4LPSA 3QNUA 2DY1A 3LX5A 1AKYA 3DZ8A 3SOPA 1DAGA 2QMEA 5GJCA 2YNMA 5DNYB 2QMHA 5HCNA 3RHFA 3RS0A 2H5EA 2OLJA 2REBA 4FIDA 1LF5A 4LV5B 1GL6A 5P21A 2A9KA 4Q4AA 1UKVY 4PR0A 4DDTA 4GI7A 5JZVA 1JI0A 2IHBA 4QBIA 4HYYA 1DAFA 5FPSA 4JLPA 1G291 2SHKA 4RCZA 3QJYA 1N0UA 2W2XA 4HEJA 3QVUA 2N46A 1UDWA 4RD1A 5FBQB 1W49A 3S1AA 2XZPA 2O8DA 1OXVA 5KSOA 5DGXA 4YC7A 5UKDA 1E99A 1GWNA 1P2VA 2ZUDA 3U3MA 3THYB 3T61A 2C8VA 4PHFA 1GM5A 4OI2A 2XZLA 2WOJA 1NKTA 3FMPB 1U9IC 2LKCA 4ZO4A 4GP7A 1RFLA 1PZNA 5GVSA 2O8EB 2YWGA 3AGPA 1E4YA 2F6RA 1FX0B 5JJLA 3RANA 2IUTA 2PJZA 3ZS9A 2QG6A 1LFDB 1XXHB 3HPRA 1EXMA 2W0SA 4GOXA 4JSTA 5FUXA 1YU9A 4Q1AA 3RRYA 2IS6A 3B9PA 4NZYA 2C04A 1EWRA 2VRWA 1D6JA 3KB1A 2QT0A 3A58B 3ZIAA 1JEEA 4B6FA 2R44A 1KI9A 4LY6A 2OG2A 4V0NA 2N42A 2J1LA 4WOPA 1KZGB 1U9IA 4P4SB 3QPWA 3K0CA 2IXEA 1FNNA 3CRVA 2ERXA 3U7HB 1AQUA 4DDUA 5FL7A 1W4BA 4LBYA 1M8PA 1G20E 2ZI5A 3T5GA 3U3RA 1W4RA 3OFND 2Q21A 4GZLA 4B44A 3VMFA 1FNMA 1YQTA 2AK2A 2C99A 5BWMA 2B6HA 1WCV1 4QBFA 1ZNYA 2QPAA 4FCVA 4PAQA 1XTRA 1DG1G 4FXPA 2QMUA 2WWXA 1RYHA 2EU8A 2O8FB 4DC9A 1J7KA 2ZYUX 2WOOA 4B3FX 5CDFA 1ZNZA 4D2IA 3X1WA 2C77A 2YWEA 4FMBB 2ZE8A 1NG1A 4C7OB 2F43A 1WRBA 1Q22A 1BIFA 1E9DA 5G40A 1SVSA 2BWJA 2ZI6A 4LX0A 4M1OA 4FN5A 1OXXK 1DOAA 3K9GA 3T1QA 2WMNB 4KVAA 4RJLA 2G88A 4IDPA 2FZ4A 5F98A 3FMIA 1D9ZA 1W1WA 2R6AA 5JWRA 3MJRA 2DFNA 221PA 5TARA 3CB4A 5SZIA 3OAAD 2OZEA 3C8UA 2J0VA 4EPXA 1KJYA 1BH2A 3FPAA 2D7DA 4PPGA 1W47A 3ICQB 2GRJA 3AGQA 1U98A 2PT5A 3EC1A 1W36D 1S3GA 1GAJA 3F8TA 3I4LA 4HAZA 3UMFA 3P27A 3IBGA 3CNLA 3BGWA 4PZLA 1N6KA 3GEIA 2Q9BA 5FTMA 4GZMA 2ZE7A 1VYTA 3NG1A 4PO8A 3U2QA 3ZVMA 5GJVC 4NBSA 4M9QA 2BJWA 1Z6GA 1ZAKA 2VIIA 2D62A 4G1UC 5DI9A 4U00A 2BBOA 2IC5A 5FTJA 1G3IA 5CB6A 1GKYA 3A1TA 3VTKA 4JVNA 1GIAA 1NVVR 2WHXA 4Q7MB 3FKSA 5K8LA 5KNBA 5FOSA 4TTRA 1W0JD 1YVDA 2XNSA 4RZUA 3TVTA 3QXXA 3O8DA 3BFXA 4PANA 4V0OA 2IUUA 4EPVA 4TQUS 5FUYA 1KI1A 1EX6A 3PR1A 1KI8A 2OAP1 1DAMA 4OI4A 4AWXA 4M21A 4RCYA 4E09A 3IEUA 3W6OA 4NYMQ 4PPQA 3BXZA 1FQJA 1XXHA 4GT1A 4NCNA 1KMHA 3I73A 3CZQA 1OXTA 1FX0A 4L9WA 4CZ2A 4KBGA 2OEPA 1DBSA 3M0EA 5G3YA 5BXQC 2EWWA 2X1VA 1GRQA 3QXJA 4HB4A 2YWHA 3B2EA 4YXWA 2ZI9A 3X1XA 4ESHA 1HH4A 3FYHA 2EQBA 2CVHA 1AIPA 1JR3A 3CH4B 1E9SA 3U3JA 1XMVA 2ZPTX 3GEEA 3W5IA 1KDRA 2A5JA 2RGXA 4LI0A 1A2BA 2KB0A 4YQFA 3GQBA 2V54A 1R4AA 3T1OA 4DVGA 3R9WA 3AF4A 4TZ6A 1OH7A 1I4LD 1M7HA 4CW7A 621PA 1GNRA 1I4TD 1E0KA 5D3MA 1E1RA 2EFGA 5FPKA 4M1SA 4ZDWA 4ERNA 1OYWA 1DVRA 3DOEA 4TN1A 3RWOA 4BECA 1ZNXA 5J4YA 1WF3A 5JSZA 2UZ3A 3CH5A 4QC2A 2OBMA 4FCTA 3VX4A 1UPTA 2BKEA 4OHZA 2ODWA 4HUTA 5JRJA 4TSFA 3ZD7A 3GEHA 1GTVA 1KDOA 4QKQA 2YINC 3AUXA 2XSZD 2VP9A 3SHFA 2XTZA 1IQPA 2A78A 2IT1A 3A1UA 4IW3B 3ADDA 4TYPA 1Q57A 3J81k 2YKGA 3SYLA 3GLGA 3Q72A 4NKRA 3PENA 3K0CC 4I4LA 4IEEA 3O8CA 2O0JA 2QE7D 1JEDA 4RD0A 1F2TA 4L5BA 3B9QA 4DCUA 4HAXA 2DFTA 5BYKA 2F1HA 3VR1A 5L3VA 4R71A 2OBLA 3CONA 3FDIA 4M2LA 3VKHA 4TLBA 4I99A 4JYCA 3ND9A 5H1YA 5J4KA 3SR0A 4U02A 5FR2A 2ODEA 4ZDIA 1D5CA 2ZANA 4A4DA 4O2LA 2YJTD 3KTAB 5FPHA 3PUYA 4Z54A 1WXQA 2JDID 2HCJB 5TXGA 3A37A 4D80A 821PA 3VNVA 2GVZC 4ZCLA 1AJEA 4POAA 1NSTA 1MO6A 4XD7D 4BWYA 4G0NA 3LV8A 2VSFA 2H18A 2W00A 1KSGA 3RS3A 3BK7A 3AKCA 3NEYA 4QG7A 4KVGA 3FB4A 2LCFA 1XZPA 2PMKA 1MO4A 2IEYA 3P20A 2QM7A 1VCOA 1R7RA 4QNMA 1KY3A 1XMIA 4DT1B 3NEJA 1TF5A 4G5GA 2NPFA 3OESA 2WMOB 1DPFA 1OJLA 3B78A 4B74A 4JL6A 4H9GA 4KODA 4ABYA 4BZPA 1LF0A 4TT3A 1W5TA 2ZJOA 2CK3A 5F2EA 2IYTA 3OEEA 2W0MA 4B3BA 1G6OA 3NVAA 4QJ3A 1KHTA 4A2QA 1D2MA 1NBMA 4I1OA 3TQCA 3HYTA 4LDJA 4BLRA 3AKEA 4EFNA 1G16A 2RGCA 4A92A 3VR4A 4K46A 2EFHB 5E7MA 1XTKA 4EAQA 5EJEA 4CEIA 1S3SA 2JDIA 4X8LA 2FFQA 2ZRGA 5IDVA 3R8CA 3OAAA 2R9VA 4UNQA 2O8BA 1E6CA 1E2HA 4ITRC 3K0EA 2FPLA 4JIMA 1L8QA 4LJ6A 1OE0A 4O2RA 5J4VA 3WNDA 4ASUD 4B43A 4XWKA 3OEHA 1JNYA 3GP8A 3PUZA 3A4MA 3JVUA 4TMVA 3RLFA 3EPHA 2RGNC 3GLIA 2IK8A 5F9HA 1NMXA 4JLOA 3LQRA 3KX2A 1DAKA 2Q3HA 4DKXA 3TSWA 3ASZA 2ZYWX 2WWWA 2C95A 4BRWA 5KPDA 5K8TA 1Z6AA 2JATA 721PA 2ZRIA 3FOZA 5EUQB 4M9SA 2VP5A 2VYFA 1CJUC 1AGRA 2FEMA 4JZKA 4ESVA 5SZKB 3QI2A 1US8B 2J87A 3Q85A 3CZPA 3OZXA 1XFAA 2WJHA 1X3SA 3QF7A 4F91B 1IJEA 5FPTA 2DBYA 4MYTA 1US8A 4LOAA 3B85A 4P3YA 4PC7A 1XMJA 2AN9A 3NH6A 4Q4JB 4NMMA 2TMKA 2V55B 3LD9A 5TY0A 1TEXA 4Q9JA 1NF3A 3TUIC 2IWRA 2P6RA 3D6TB 1QHYA 5GJBA 5EE5B 3CBQA 2AXNA 4B3XA 2JLYA 4HZIA 1P3JA 4EPRA 2WM9B 1YZGA 3BAFA 3EZ6A 2MSCB 4L4UA 3WRYC 4HAWA 2BDTA 3B1YA 2AK3A 4FMDB 2QSYA 4NCHA 4CEIB 4XD7A 4HAVA 4PPFA 3A1VA 1HA3A 4GBMA 4QHSA 1CTQA 1TQ6A 4DSOA 5C18A 2IYRA 1VKJA 2NIPA 2OO7A 3H84A 2QAGA 1IXSB 3ZGXA 2ZS9A 1EX7A 3MJHA 3UPUA 2FSFA 5KUTA 4B3DA 2F1RA 2C9OA 3THXA 5TDHA 3MFYA 2GESA 3MWJA 2GF0A 1E2PA 2IF0A 5CIWA 1U2RA 2GKSA 3P32A 4TTQA 4DCVA 2WWHA 3D8BA 4FWIB 2AD5A 4P31A 1Q1ZA 2RGDA 1XZQA 4YDSA 3OEED 4Q00A 2QAJA 2GNOA 2E9SA 4K81B 4S35A 4TLDA 5CM9C 5JI3E 3A1WA 3VHLB 1NVXQ 4B2IA 4V0ME 5LD2B 1KO5A 2D3WA 2WWYA 4IVQA 1TTTA 1Z0JA 2C9YA 2GZHA 2RB4A 3OIYA 3B82A 4NH0A 2KSQA 4YLGA 4EUNA 4YMSA 5B58C 2IYQA 5EXXA 1NLYA 1HQYE 4W5JA 1P60A 4QFMA 1X8KA 5KOYA 2Q9AA 3PEWA 2IYXA 4LHWA 1G7RA 4DEYA 3W6NA 4BLTA 2X77A 1ZNWA 2W83A 1UDXA 2FF7A 2GF9A 4DSTA 1NNEA 4US1R 2DFLA 1E2MA 5JI2E 3HPQA 4NPHA 3AVOA 2ZU6A 4D0LB 3RS5A 3SBDA 2N1BA 1G7CA 3U6KA 1L7VC 5LDDC 1OH8A 2J0SA 3X1DA 3LVRE 3UK6A 2NMVA 2GCOA 3C41J 4FINA 3K0AA 3RABA 4KSBA 2WAYA 4M9XA 1HT2E 3K09C 3WMEA 1VECA 1IXRC 1DE0A 1K8RA 1RRFA 5LB2A 1G6HA 4TWZA 1Z08A 4XH9B 4JSYA 2X8AA 5L8VA 4C2TA 2ZUCA 1YZLA 1VHTA 1WMSA 4OKSA 2ZETA 1IBRA 3EIQA 2AFIE 1FOEB 1J8MF 2WSMA 2C98A 4TYYA 3KXIA 4JMPA 4P4TA 1DADA 2IXGA 421PA 3GLFA 4LYJA 3VX3A 3RSOA 1KI7A 1E2EA 2OFWA 1ZIOA 4AIIA 4A0HA 4ZIRA 4CEHB 2ONJA 2PX0A 5JECA 2QTHA 1U0JA 5EXSA 2Q0HA 2RCNA 3JZMA 3PCRB 1WQ1R 4PC6A 4Q4LA 4QNRA 3EZ7A 1U8ZA 2FNAA 4Z51A 1AZSC 2QPTA 2FSGA 2ZE5A 4UJ5A 3W6PA 5DN6D 4RFVA 1G8PA 1P9NA 1EGAA 1NY5A 3CF6R 1E9CA 4ZPXA 2QORA 1I4DD 2BBSA 1YZNA 3IDQA 3IQXA 2R6FA 1ZU5A 4PO9A 3SYNA 4BUJA 5BN4A 3U44A 1SQ5A 5IK2A 3QKRA 4IDOA 1XF9A 3E70C 2XXAA 4IOMA 1XPRA 1QVAA 3CNOA 4LHZA 3T35A 1T3SA 4G5OA 1G41A 4XSHA 4NDZA 2NO9A 3KUDA 1CU1A 3R7WA 1Y63A 4IRUB 4KAXA 1RW4A 1BYUA 1KI2A 4LBWA 1QG2A 5E3HA 4BLSA 3DM9B 3KKQA 2FPMA 2KE5A 1A7JA 1OFIA 1N6LA 4NCIA 2ZQ5A 2KWIA 2HDNB 2O8EA 2F3TA 5J5CA 2GILA 3UMRA 5KNDA 4RD3A 4TYQA 1ZM9A 3HWSA 1K5DA 3FHCB 3GJ6A 3THYA 3NHBA 4ZCIA 1P7CA 4HDQB 4M1WA 5FBRB 3WBJA 1E32A 3WHLA 3RC3A 4AYTA 4OI1A 2ZR9A 2FFBA 2GK7A 5BN3A 4ZIRB 2Z83A 2J3EA 2JCSA 4DLSA 1N3BA 4P32A 5KHOC 2JLZA 1XBTA 2XITA 3VR6A 1YZKA 4V0LA 5EP4A 1H8EA 2FE4A 4BZXA 1LW7A 4NL4H 4EJSC 1CF4A 2IS2A 2I4IA 2R65A 4KFSA 1W5SA 5H8WA 2J45A 1TAGA 1XXHE 1EWQA 2HYIC 1X8LA 4ZI2A 5SZHB 1OYYA 1UJ2A 2F1IA 2ZRHA 5SZJA 3K0FB 1BYIA 1UEIA 2XJ9A 4I1SA 2GA8A 2QAGC 3DVLA 1KSFX 4XJXA 3QPUA 5EQTA 2ORVA 2CDNA 4RVCA 1FP6A 1N6OA 3OIWA 2GCOB 2RGBA 3P4XA 4L9SA 5DISB 3SHWA 4DEXA 121PA 4GOKA 5G53C 4DLVA 5KSZA 4JBXA 1VMAA 5CM8B 2ZITA 5BQ5A 2YZ2A 2C03A 4Q4HA 4DB2A 2H17A 3NHAA 1DO2A 4DB4A 3MMPA 3CPEA 3Q8XB 2G9NA 2PH1A 1P9WA 5L3QB 5JMTA 1T6NA 3LWNA 4B33A 1W7AA 1W2GA 1U0HC 3SC3A 4O3MA 2BEJA 4QGAA 3NDBB 5B57C 2D74A 4A0FA 5FI1B 4PX9A 4RD6A 4UXHA 1KJZA 2GVDC 1T0JB 1HV8A 1VHLA 3EG5A 1T8TA 1Y3AA 4TLAA 4AYWA 1ZBDA 4GOJA 3WXMA 3BE4A 2ZJYA 1G5TA 1T8UA 3CLVA 1P5ZB 2VHUA 1RJ9B 2JJ8A 3MCAA 3N2IA 4JVMA 3AF2A 5DHFA 1Q1QA 3DKVA 1GG2A 3X2SA 4BGDA 4RKEA 1II0A 1KIMA 1TF2A 1YZUA 4QGHA 5HZHA 2CHVA 1R0XA
chains in the Genus database with same CATH superfamily
1G8SA 4KJZA 3UJAA 3GPBA 4Q9IA 2R2AA 4MVJI 4N5MA 4PWYA 3G0IA 3N6XA 1ZCJA 5LNK1 2WTEA 1FW6A 4RLQA 3OHSX 2D5BA 2QZJA 5LA6F 2BT4A 4CVNA 4Y6PA 3O83A 1GP2A 2F3RA 3IP3A 4YONB 2JAHA 3LPDA 4AC9A 5GZ1A 1BWQA 1H2XA 1L5HB 5K8UA 2J4FA 1MFPA 2HLDA 3QEMB 4HRXA 4CCSA 4G1VA 4LRUA 4NXNB 1AV6A 3VSAA 9ATCA 3O94A 4QU9A 3ZV7A 3ECCA 4EHDA 4N5LA 5HWSA 1M5RA 1HFKA 1SURA 3NUZA 4HZUB 2WTNA 2IU0A 1ZISA 4GD3Q 5FWNA 3F3MA 1S9HA 3PC7A 1U7PA 2YJNA 3CLSD 4O02B 1Z07A 4R9NA 4ENWA 4FLFA 1GDDA 1LW6E 4XX0B 1ONPA 3BXHA 5DTRA 2XB9A 2HWUA 5H02A 3SFZA 1U0LA 3P0IA 3DMNA 5J1TB 1FZQA 2CXXA 2FP4B 1DIBA 1NN3A 3IUJA 2QQ0A 2O2IA 2VTEA 4QUBA 4YAEA 1XPOA 3VSEA 3W3AA 2XVZA 1L8AA 1KO1A 3NC1C 5GGYA 3QOWA 1XU7A 2JJ1A 4K8OA 3UAVA 3KKKA 2R87A 4OQFA 4Q34A 4O2AB 2X58A 4L74A 4LDAA 3F7NA 4AMUA 3LPNA 1UJ5A 2A57A 1U7HA 1B8UA 4MR7B 1Z0FA 3T7KA 1BA3A 1USIA 4MKZA 1IN5A 3UC9A 2Z4TA 2GZ1A 1TLLA 5TNXA 3IELA 4GMKA 4MI1A 1X13A 2ESRA 2XRMA 4QTZA 5EIWA 3JQGA 3NLLA 4BQSA 4Q4CA 1Z2AA 1VI2A 1KF0A 2UVQA 4MO2A 4JWTA 4A7PA 2HN9A 2DB3A 1FFAA 3U9SA 1F17A 1UDCA 5H9WA 3GGGA 1Z3CA 4XCXA 2FRDA 3N0XA 3LBIA 1FFXB 1B2LA 4JUBA 2QLBA 3THRA 5J40A 4P2BA 3VU9B 1TLFA 3QP9A 2Q5JA 2H2FA 3C7AA 3DDWA 1TT5B 5CW1A 5HKOA 4E1BA 1KAEA 2XCLA 4OKSA 4P3KA 5HOEA 4CIWA 1OAOC 5I8WA 1J1IA 1OFUA 2R3SA 4GYWA 1OXBB 5IP5A 4JLUA 4YMLA 4A8JC 2H2WA 4CF6A 2XBUA 2RHLA 3HSKA 5IC4A 4BLQA 2FW0A 1YOBA 1DTWA 1B6GA 2F8TA 4XQCA 3L04A 2DLCX 4RMNA 3F90A 3DXYA 4WN9B 2RD2A 2FWRA 1OQAA 3N3AC 4IO1A 4WGFA 4LC9A 3LC7O 2G0NA 1G8JA 3M70A 2GWHA 1W76A 1X1TA 5DLQC 2YC2C 3V5NA 3PLRA 3AVVA 2DETA 1JVBA 3AYZB 5J5VA 4RPLA 1H2EA 4P9NA 4CIVA 3GN1A 3CRMA 4LWZA 1PT6A 2Y77A 2E4YA 3QFSA 4UM8B 5IVHA 2AZMA 4G56A 2C4TA 2JLCA 1QVVA 2CDBA 1I7SB 2PX3A 3ZXSA 3ZQKA 3FKQA 2G28A 4QJ4A 4EB3A 3KZVA 4AP5A 5BN3B 5KYTA 2JD2A 4IIVA 1PR1A 1W0JA 1TCUA 5F5XA 3HEBA 3G7NA 3QWFA 2FZLA 3JQQA 4KQMA 3ROZA 4A27A 4ICIA 2GFIA 3KD2A 4HWSA 4HMOA 4V0MA 1T2VA 3HR7A 4MUMA 1U94A 4WLNA 4A2WA 4DNXA 4KMMA 2RH8A 4G1EB 5DNUA 3NUQA 4JXXA 4EZIA 3KJHA 3RVJA 4JVSB 2IP1A 2QN6A 3NWPA 1KVQA 1W75A 1Z2PX 3AHFA 4V3BA 2XY4A 2MMCA 4FHDA 1BHSA 4IGAA 5TQ0A 4JU8A 1BDJA 2OV4A 1LXCA 1WXXA 3UK1A 3I9JA 1YL5A 1Z0AA 2BEKA 2YDYA 4MTCA 3SD7A 2VTKA 2XECA 2XEDA 4OX9Y 4EQ6A 4YAOA 1ZOPA 1M5TA 3HDQA 3MTQA 1X38A 1G8KA 5HMLA 3KHUA 2XJ4A 3F9CA 4FNMA 5KX5F 2BFCB 1SJ9A 1MC4A 3CZMA 3LTNC 3LQ1A 4MQ4A 4NCAA 1XZFA 2YXPX 5ICGA 4N5IX 1AV7A 3TTSA 2CZGA 4QO8A 3VR3D 4JKYA 1LTHR 3CVXA 1I24A 1YASA 3GRVA 3QYAA 1COZA 1GA6A 1YRYE 3MWEA 3NBMA 5EE3A 3QE9Y 4AT1A 2ZOSA 1IRXA 3ORSA 4GYJA 3UANA 2XB2A 3NNDA 4QUHA 5IJ0B 2IUYA 3RFXA 5K5EA 5ISMA 3OLYA 2XTAA 2IWHA 4RY8A 1FSSA 2GTPA 5FNVA 5LB4A 1ZGGA 5IZ4A 1O4WA 1DINA 16PKA 1XHFA 3ONDA 3RS9A 1GSAA 2DTDA 3DXZA 3QRWA 5FWAA 4AU1A 5CIYA 3ZNPA 3TF5A 1RYFA 4DHEA 4ZU6X 2A0XA 2P2LA 5F9MA 4LNUA 5HJEA 2REQB 3GLQA 3ITEA 2OGZA 5L40A 4X94A 3ZJ4A 3DAGA 1QPBA 4FSXA 5H80A 5C8DA 3UTCA 3FHJA 3HEAA 4OHKA 5HTKA 2G36A 4BFWA 4M7RA 1A9SA 2PUCA 4QM6A 3CKLA 2JL1A 4YDRA 4P7BA 2E82A 1CXZA 1D2NA 4ZOAA 3U1TA 3ZHUA 3GLGB 4TXLA 1HLFA 4M49A 2QLMA 2G3YA 5JBNA 2FEPA 3SSMA 5ICEA 2WABA 3AM3A 1HTBA 3CNNA 3TFQA 2R1VA 4S24A 1QZTA 4O4LA 1ONBA 4K0KB 1E8NA 4R16A 2H0RA 2VC2B 1TTQB 2X8JA 4PZZA 4WV3A 1REQA 3AILA 3ONWA 2BKVA 2H59A 1B8PA 1WZEA 2ZWIA 5A0FA 2FSPA 4DG9A 2CT8A 3BXPA 4GQIA 1EVJA 3DHNA 5E6RB 3DMHA 3KUXA 1JSCA 2QVLA 5I4CA 2BMJA 2HHCA 4QIHA 4ATNA 4E2ZA 4UW9A 4RK4A 3IUQA 4AZSA 3J7TA 4KK3A 1VDZA 3ZI4A 3IE1A 2H2HA 3LWZA 4GWGA 5DTMA 4EEXA 1AK1A 1CW2B 3KYDA 4ARIA 4RHXA 3CG0A 3GCGA 4EY5A 1BQ3A 3FF4A 1JWBB 2V0GA 4JEHA 4DRYA 5KHLB 1MOZA 1A9RA 5IT5A 2J7PD 4TMXA 4ZWNA 3A2KA 5KPJA 2EJCA 4C20A 2LKDA 1A5BB 2VSOA 3KCNA 1YBHA 3LZCA 3LIPA 2RKOA 1TCBA 4PG4A 5B3KA 1YBVA 4IIFA 4KWIA 1ZD5A 1VKRA 2XE6A 2YWCA 5CB8A 3KD3A 1SZCA 4HB2A 2N0SA 2QUJA 4NK5A 1N7JA 1QE5A 2G67A 3PXUA 5A06A 3D4IA 2QTVB 2C7OA 3AVYA 2FP3A 4UOQA 3ZN2A 4C14A 4K6MA 4XR4A 5CDYA 3JVVA 1ZGZA 4ZAYA 1GCIA 2WILA 1NQ5A 1JXOA 1KVRA 1U5BB 3EY9A 4HWTA 5IRCD 5JO0A 1XB2A 4LF7B 4KSCA 1M2JA 4QD3A 5EGNA 1NOJA 2WI8A 3EVFA 4HN4B 4J0QA 4UTPA 1KYXA 2J5QA 1VL0A 5HM6A 2G40A 2UZ0A 3NHMA 3HK2A 1X1RA 3W5SA 2RGYA 2GO1A 3IUPA 3TLEA 3VR4H 1EVQA 3QJGA 2JLXA 5ARDA 2HOQA 1JFRA 4B9AA 4MHTA 4V39A 1L5OA 4NULA 2LD4A 4W1PA 1OREA 4N4AA 5ENDA 1QK5A 1UANA 5AKXA 2BFBA 2EVWX 1QV9A 4KO4S 3RAGA 5ELXA 5B6JA 5D01A 5HCIA 3VC7A 3U56A 1FP1D 4YLEA 5A5EA 5JJKA 1U2TA 2X6TA 4UEOA 2K87A 5CEEA 3UW3A 3REGA 4TTIA 4PSAA 2VBIA 3H97A 3A04A 2C2YA 3FGNA 3EMDA 4CF5A 1Q1BA 2FKNA 1ESMA 4OXNA 3TGPA 3BSFA 2ZTMA 3COZA 3EQ7A 4BKPA 2ZPAA 4GICA 1ZUNB 4RWEA 1F2UB 2O06A 5FO1A 1QNLA 1GTZA 4I6JA 3X1YA 4B6EA 1OKKA 3QXSA 3REQB 1AZTA 3QU2A 4ZT4A 3BFKA 1YHNA 1K6JA 2F4NA 4M1KA 2NU6A 1OZAA 2I2CA 2VN8A 1FDSA 5CCEA 1L3IA 3MYRA 4GI3A 3KZMA 3DKPA 1PJQA 3LLUA 1OSNA 2QA5A 2FF5A 3A9SA 1F6DA 3IBFA 4GQAA 1HQCA 1G8FA 4WOCA 1HE3A 5EKDA 1HYHA 2AR7A 4CL2A 3PNPA 4JT2A 2JFHA 4CIAA 3TLCA 2V3CC 1W30A 1TZCA 3MC1A 3O2SB 4F4UA 3WL6A 1A5ZA 1QGED 1N1EA 1NI4A 1P9LA 1LPOA 1E60A 2A0WA 1SU6A 4PIVA 3BGSA 1OTXA 5I7FA 2BGTA 2XGMA 3T12A 3LX6A 3IOMA 5AVVA 1BH6A 3TD2A 2OBXA 3V8VA 5EJ6A 3QH4A 3NIWA 4RZQA 3PPIA 1PGOA 2PD6A 2IYZA 5C80A 5K99A 3TZEA 1VE3A 3MS7A 4EHJA 4ZYZA 5F77A 5BORA 2E55A 4Q1BA 4UNPA 4X62B 2J6IA 1FW8A 4IH9A 5C5EA 1KS9A 3AFGA 2WMYA 3EPRA 4KTVE 4FFNA 1C1XA 5C46F 2CXNA 1NN1A 4QXAA 2VJCA 5EXEA 2AN4A 2RGAA 4GVPA 3UG7A 4CT4B 2FOIA 4C4PA 1W9HA 3AZQA 2AZTA 2FR1A 1TFUA 2FWJA 2NAFA 2ZDGA 3H2ZA 3PL1A 4IQ0A 1SQFA 2YFQA 3TW8A 1R3UA 2W93A 4ZK2A 1T8RA 2D5IA 3W3AH 2DKFA 2DPHA 1I13A 1MO3A 3WNCA 1DC8A 4S2UA 1T9CA 1CUUA 1YS2X 4QODA 3E9RA 1SK8A 4G1FA 5LQNA 4CRWB 4EVQA 1OH5A 1TPZA 2QQEA 5GP1A 2IYUA 3HFJA 3OQJA 4S1TA 5EKSA 5IAEA 2SBTA 3TKYA 1YK1A 3N70A 3IR6A 4A23A 4CG0A 2QROA 3QFRA 4GOOD 2OXCA 1OI4A 1ZINA 1TQ2A 4MVJA 5CA0B 1FVHA 2GEBA 3Q3CA 4KMSA 3F0TA 5B1IA 4JKIA 1AB6A 3VO2A 1CRLA 1NX9A 2YXLA 3O4HA 4Q1DA 4BAGA 3U7FB 4CF4A 3UK2A 5B30A 4I2VA 2X9LA 4P1ZA 4V0KA 1GGKA 5IM5A 4RTLA 2EJTA 3NYRA 3QZUA 4N39A 3BJMA 1RC8A 1B3BA 1MQAA 1PKEA 2ZSJA 4UCWA 2GBLC 4N9WA 4RS4A 4ESEA 1VG8A 3RARA 1KO8A 2OC4A 3H11A 1ADCA 3MLAA 4GMXA 4BIMA 3VA7A 3E22B 1UEJA 3JX9A 4CLEA 3SMQA 4F60A 3VNQA 4AY4A 1WETA 2A7QA 1JBQA 3WL7A 3VHQA 1MB3A 5MFZA 2GJSA 1JPJA 3TIGA 4H1UA 4YP6A 1S2MA 2DFDA 5IULC 1RE1A 3K2EA 4BFLA 2MDTA 1XQ9A 4HI0E 1K8ZB 3H17A 4G8CA 1WZCA 1SEVA 1A5TA 3H2YA 3FVVA 3GT3A 3KKPA 2GUWA 3HCFA 1O89A 3QVGA 5KYVA 4N12A 2CFOA 4WXPA 2VI5A 3GN2A 1EFTA 3B1KA 2JLSA 3WVNA 3UHAA 1QGDA 2JLBA 1PZGA 2X14A 3KAQA 1CJCA 1GCOA 2CVOA 3Q7PA 1SUAA 5E7JA 4ND7A 3JQAB 3L92A 4I46A 1NJGA 2GETA 4DCGA 1QUEA 1JFLA 2ZJ1A 4MPDA 5D00A 5CYFA 1OKKD 4X6YA 4UHEA 4E5KA 3WB2A 3V7FA 1E61A 1NA5A 3L7YA 4P80A 1NP6A 2B7BA 3FOWA 4Q37A 4G9EA 4ZZ3A 5D7NA 4AO6A 4FFMA 1G9TA 1E77A 1ZD4A 4H7HA 3G17A 4IX1A 3K09A 4NDNE 1K1EA 4BEVA 2WHPA 4R1PA 4WD3A 1G3MA 4YNBA 4AP6A 4F1JA 2LW7A 3AFNA 1USUA 6CHYA 2GN6A 4HUQB 3QX3A 5JNRA 3NEAA 2FPWA 3HP7A 3UMVA 2X4LA 3FPKA 5DMHA 3I1JA 2V7GA 5DXAA 3DO8A 3NHUA 2WJZB 4ENUA 1Z45A 1V5IA 3OZDA 2G5PA 5FPYA 2GKOA 3QFTA 4DF3A 4XDYA 3P94A 1E1DA 1U8AA 1QF6A 3IHWA 4RZHA 4OTZA 2WM2A 1QB7A 3GJ7A 1UEXC 1MO2A 2O7RA 3AUJB 1IL0A 1P2SA 4PLPA 4TN5A 4XPIA 3DTNA 5JO9A 5IJ9A 3WRYA 4TYWA 5EE9A 4FHGA 1U1CA 1FFBA 2PH5A 4UCQA 3RNOA 2JEOA 2AW3A 2WHEA 4ND2A 1W2HA 3LUFA 2X0IA 2ZIEA 5JH7A 3T9BA 4LDPA 4QREA 1VC2A 1GL3A 3R5HA 3ZTYA 2WHQA 4FNGA 3VBCA 2YYSA 3QVVA 1ZUHA 1ZM3A 4KWTA 5C7OO 1TE2A 5M2QA 2EF1A 4D8YA 1N1MA 4OREX 1HDEA 2JK1A 2XAAA 4CKZA 1KFEB 4B35A 5KQMA 3M6IA 5LZ5A 3CX4A 3W7AA 3ND6A 1RHMA 5AIBA 4FU0A 3URMA 4QTXA 3TR5A 2IOFA 5LVAA 3KAPA 4CMEA 2R00A 5KJCA 4WZAE 1ENYA 2FQWA 4F7WA 5C5IA 2KS6A 3NB0A 1HPLA 2B7CA 2Z1DA 4FYHA 3EH1A 2A86A 2F3PA 5AUOB 3SEQA 4YEDA 2ET6A 1NQXA 3OQIB 2QRNA 2GJ9A 3KFXA 4ZVOA 4M8KA 2WJIA 2J33A 5JCXA 5AVTA 1I6KA 5KWEA 4MKRA 4NHEA 2AOUB 3PFHA 4UARA 1A2KC 3CVUA 4WHMA 4D9MA 4H1HA 1MNQA 1M6VA 3Q7IA 3COSA 4IJ6A 2VA8A 4S1PA 2X41A 2VCYA 1L7BA 3TL2A 2DPLA 4LNHA 4PYIA 5JAUA 3G1UA 1JECA 3DO5A 5KYXB 1S8AA 1M8GA 2H2DA 5LP6F 3I6QA 4A0SA 2ZBGA 1JI3A 3TBKA 1MIHA 1A9TA 2J3KA 1QYRA 1GKUB 4HEQA 4RWZA 4LMPA 5JT1A 4AJEA 4DM4A 3HGQA 3ZW8A 1VYUA 3SQWA 3T4PA 4NRDA 1JJVA 2W6QA 2XSZA 3GCZA 3PL5A 1N34B 1WHTB 3WK8A 4LHXA 4U0JA 4RX1A 2BE7A 3ICOA 2FRVA 1OZ0A 3LRPA 2CY0A 2L0XA 1Y6ZA 4D7AA 5FXMA 4EY7A 3BK1A 4TRNA 2V59A 4C6HA 1T9GR 2CK3D 2R8EA 2F00A 1E4VA 4ZYXA 1F51E 2Q50A 4JVOA 4HRVA 3FWPA 4MUBA 2A5DA 1N6RA 4Y18A 3WO0A 3KOUA 1QQAA 2JAQA 3K6SB 1Z22A 3RVNA 5L4NA 3AETA 4J07A 4UUBA 4Y30A 5GADl 3PC4A 1RYDA 2AQHA 3DE2X 4ZO8A 1HKUA 2BFFB 4N0PA 5A6VA 3U7JA 3HUUA 3N2GA 4NBVA 1UQRA 3COYA 3R23A 1YVPA 1NVWQ 1U31A 3EVBA 5A62A 1HUQA 4EATA 3NOXA 2LCIA 3FB1A 4YO8A 3ZWDA 3HWWA 5AQEA 3DOIA 3JZAA 2ZVQX 5GTDA 3Q2KA 1XNHA 2PZJA 2V7QA 1QS0B 1C5KA 1XIVA 3EZGA 5K03A 1EFAA 1ZA1A 5JRZA 3NWJA 4YJKA 1F14A 3I39X 3WLOA 1GAWA 1I3MA 1UMDB 4DM7A 3GLFA 3ZZUA 2IPXA 4KXNA 2PVSA 4N48A 4D4LA 1WDMA 2RBGA 3JASA 4H3SA 4TTPA 4AY3A 3IOYA 3BTSA 5AXAA 5KNLA 1UJ4A 2X5KO 1CFZA 3AB3A 3Q2OA 2YQ5A 4DLUA 5F1OA 4ZC1A 3L0YA 3QTTA 2FJUA 2EGUA 1SPXA 1AKNA 3K70D 1E1CA 4RU1A 5F1KA 4AKTA 3WHKA 3NHFA 1QFJA 4LZPA 4OQQA 5J2TA 3ET4A 3JRXA 3LY8A 4U00A 3EA0A 3OF2A 5DGDA 2CCGA 1NV9A 3ZGVA 3RF7A 2D0PB 4FDLA 2BJHA 1YE5A 3ILHA 1LBTA 5L7TA 1T9DA 3H5RA 2Q28A 1QIIA 4OGGA 3OTOB 3PTZA 2O2HA 2QTBA 2PMDA 1OTYA 3RTCA 1O8CA 2XNDA 5BN5A 5IF3A 3DDHA 3DMTA 4KDCA 2CDAA 3M4JA 4DR6B 4FQ7A 1U3TA 2GPBA 4Q3BA 2F1OA 1P91A 4GI5A 3W05A 3QVOA 4EH1A 3UMMA 1GU7A 3OIGA 5KYWB 1RAGA 4EDHA 3KKLA 1GNPA 3ZU5A 2XMCA 2MSDB 4E7PA 3Q0IA 5TC4A 3RFCA 1QIFA 2FLKA 4QHYA 5LQJA 7MHTA 3B5IA 4FOPA 4MI6A 2PSFA 4C6RA 2FPIB 4LZZA 4RF2A 5J4LA 3M8KA 2J41A 3IV6A 1L5ZA 1R4ZA 2QGNA 1CVLA 4EKEA 2WA2A 4YCBA 1RKXA 3V3KA 1T9ZA 4GHWA 4H31A 3EXEB 2ZZMA 1YZ3A 3FXAA 5AR1A 4RJIA 4YA6A 2KJQA 2ZIXA 1K7EB 4RFSA 2VTBA 5DN9A 4LC0A 2FK7A 2XODA 1EDBA 2HFJA 1C2TA 3LW7A 1J2YA 3UN1A 3WLHA 4E14A 5L4LA 5TGZA 4D25A 3DB2A 1CIPA 2Y71A 3SJAA 3RYIA 4AZTA 3G13A 4ZJZA 5BSVA 2VDRB 2QMZA 2V6FA 4JLJA 1VL8A 1XJCA 1L5VA 2FWPA 4FZRA 5LZ2A 1Z5PA 4TT8A 3KTFA 3GUZA 4KXMA 3L8DA 2FX3A 1KXZA 2I8CA 1E1MA 3JQFA 3UB3A 2H4HA 3K1AA 4MGEA 4QO7A 4UPDA 4HY3A 2BFDA 1P2TA 3LP5A 2FDCA 3FGPA 4BOYA 1NUUA 2Q3JA 4CODB 5EJ2A 4EARA 1F4PA 2PPVA 4IV8A 4J9VA 3C70A 4CNBA 3W1VA 1AO0A 4BMDA 3WHPA 3QOYA 4B7ZA 2K7ZA 2PL3A 3SJBA 5K6AA 1QVRA 4Z0NA 1OI2A 5BSKA 1ZN9A 4Z6KA 1JB1A 3PPWA 2BJVA 4E6EA 2BP7A 3E6AA 2XE4A 3E03A 4JLDA 4XM0A 1CJSA 3ETCA 1GUAA 1PJ4A 3AJRA 4MEBA 4URXR 4FGWA 9ABPA 3I58A 2QEQA 3KKEA 3UOAB 3ZLTA 4Y9SA 1P4JA 3PQ8A 2BUAA 2BI8A 3GLUA 4OFXA 1K5HA 1H6DA 4WKPA 4D8TA 4QLOA 4WT7A 1ORDA 3HR8A 4FFPA 1UR5A 2BFNA 2QSUA 1GPLA 2P9EA 4FMCB 1QOZA 3BL5A 3NAQA 2PLWA 4JN6B 3UUFA 2JANA 3BBLA 4BO2A 1K7CA 4YJGA 3I9V6 2XMZA 2HPZA 5E2AA 1CY0A 1CNMA 4C0QC 4F8JA 4JI5B 4IKOA 3DYVA 4M0FA 4F5ZA 3A28A 1GN8A 1Q7EA 1G3QA 2PBRA 3SEZA 4C7BA 3IQFA 1FYVA 2HQRA 2WSLA 3F4KA 1Z8FA 4MITA 3TLGB 1GQFA 2BP7B 4UBNA 1KO7A 1OIXA 4PNZA 4B4OA 4WJKB 4HH3C 8MHTA 3HXOA 1YR9A 3VPDA 1H4SA 1OPXA 1V6CA 4S3MA 2Y9PB 5FOXA 2PZEA 1QM5A 5SV2A 4CLXA 5HX7A 3C3AA 4WCFB 4XQ9A 1GZ4A 3GEPA 1G8YA 5KTOA 2QMYA 1I8TA 3K1AB 1ATZA 2XV1A 1GTJ1 3IR5A 3MJEA 2AIRA 4M1QA 1VGQA 4BMOB 1DQPA 3CFYA 4HQKA 3FYDA 3GLHE 3CZCA 2XTNA 2H5JA 1Z2CA 3EXHB 3NEPX 3NV7A 4IHJF 3TEFA 2HT6A 4BFYA 4HO1X 3RYIB 1TRKA 4ZT7A 4BUCA 4GMDA 1CY8A 4O4IF 1L3BA 5B7NA 4FVTA 5IHPA 4RFSB 2VTBB 5KMGB 1GKIA 3CUSA 3ZU4A 2WSSD 4B3JA 4BX9A 4IS3A 1X7WA 2PKQO 1NUHA 3CA8A 1U8UA 2Q3BA 1BE1A 3MOGA 3QPBA 1SC4A 1IJFA 2DYKA 3UQYS 3KWJA 2WP8J 4JL8A 4LV8B 1VE1A 1E9AA 3RJTA 2IYOA 2VSQA 4LMBA 3T0FA 4DMCA 1L5MA 3BHMA 2HMWA 4UVHA 5E95A 1NI3A 3EC7A 3EBOA 3FWZA 5FI0B 2EP7A 3GJ8A 4KIUA 5JSKA 1EQUA 1YUMA 2F64A 4RMIA 2EYQA 1PZHA 4I5GA 5DT9A 3SLGA 1TU3A 4IJ5A 4HFJA 2B2NA 3FOAA 4N7MA 4PZDA 5JQWA 1OZGA 2COUA 1DKUA 1UZNA 2ZEJA 3GAAA 2EZTA 3MQ2A 4PR3A 5REQA 4OHYA 3HXPA 2YC4C 1JEQB 2HA3A 3OIFA 2RKWA 4UHKA 5COQA 3WSVA 4ALLA 2QNRA 3I1FA 2QW1A 1T4BA 4J16C 3UCFA 4H15A 1IBKB 1LTQA 2H4JA 3D3QA 2HCFA 4BBZA 3W2HA 4DY4A 2VCHA 1JQLB 2YXBA 3ZY2A 2FR8A 2XA1A 2HTFA 4M3NA 1V25A 3D8HA 4FGUA 1GPYA 3EXAA 3RI3A 4RK5A 4D3SA 4R7GA 2VWGA 3C1AA 3A9RA 4Z4IA 1KQPA 4B4WA 5IXYA 4DSUA 1KI6B 3OPYI 3PG5A 2OHJA 5HXAA 2ZR7A 2WZQA 3L4SO 3HYSA 4ZTZB 3THWB 1WMDA 2HCRA 2Q6IA 3C3MA 3R3XA 4LXTA 2V1UA 1J5EB 3W34A 2FCRA 3O82A 1HT3A 2BTQB 3DZIA 1YVEI 3OWHA 4L28A 1K27A 3ELWA 4OBBA 1YNSA 3F71A 3HVJA 3I04M 4DGQA 1AKVA 1IOLA 2V5UA 3QIVA 3COJA 3QUAA 1ZXBA 1XQYA 1JR3D 1O8BA 2CCJA 2OE2A 3EUEA 5L3RA 1T3HA 3GRYA 1CY2A 3VDQA 1Z7BA 2ILVA 3V48A 5FA5A 4CR7A 2FEKA 3GNQA 4ZU1X 4IIGA 3TTUA 4U3JB 1CR0A 1KFJB 3NHKA 4RIFA 4F0JA 5MN4A 1WBDA 3AKDA 4ARZA 4DMKA 3PYXA 5CD1A 2JGRA 3N2GB 1KJ8A 4N3AA 2PUEA 1WM1A 2BCJQ 1OWPA 1XDUA 4OLJA 1GOTA 3V32A 2UZ4A 1GAQA 2AHOA 4I5IA 4GI1A 1L7AA 3V8QA 1BGXT 3I37X 1GRRA 3NOVA 2IUEA 4V03A 3NIGB 3GFQA 5IZCA 5C51B 3ZJYA 4X6LA 2J5XA 1WSWA 2BMEA 2XB6A 1VRCA 4CUJA 4EJSA 2R4QA 5B4UA 3LSTA 4EMUA 2Z3WA 1WXEA 3RDPA 1AUQA 1EG2A 1Z4IA 2JAUA 1J5PA 1NDUA 2OOKA 3L7DA 3MINA 4Q21A 1ONSA 5IK2D 4MYDA 1U9JA 1ZOLA 3GH1A 3I3SR 5FHQA 4CF3A 4EY4A 3AG6A 5JS1A 2X3UA 5DLDA 3WWZA 1DDIA 1SOVA 4OB6A 4PAOA 4JBNA 2VJYA 2PMEA 3WYGA 5AW6A 4QDOA 4NYJQ 3BZWA 2XKJE 3KB8A 4CF7A 2E1RA 1QRAA 1X70A 2I6GA 3LC0A 4TQGA 3HVHA 3B7PA 1JQEA 4B4DA 2ZIWB 5K8VA 2AD1A 3NNNA 5I9IA 2HMSA 1ZJ5A 2VP4A 1J1ZA 3A9TA 3OQ1A 4DLYA 4ZOEA 4M1MA 4RETA 1MOPA 3OE4A 4WEQA 3ZDYB 4W6QA 4F4FA 3HACA 2GBGA 4ZJPA 1AM4D 3EPLA 2XMRA 4GC9A 1V7CA 4DJFC 1MHPA 1C3OA 2FZCA 3ED1A 3F78A 3SNHA 1LJ8A 3FMOB 5BNWA 4YAFA 3EX7C 3KXKA 2B8TA 5AJVB 5TEVA 1NP3A 3LUAA 1BQEA 1J8DA 1UP7A 2GCGA 3KKZA 4YAKA 5GV8A 2VQSA 1RQ7A 1UDRA 3ILVA 3W1EA 4URZR 2WV9A 3AUYA 2IGTA 4Z9YA 4ARSA 1F60A 2GX6A 1ZGHA 3I5XA 4OJKA 2BBTA 4Y0VA 2HBYA 3L2OB 3NKVA 4XYEA 1ZVKA 4X1YA 3T9FA 3TLBA 2XXBA 3DEIA 3HVUA 4F96A 2IOFK 5TPWA 2PA0A 3DBOB 3IP5A 3K70C 5HJ5A 1RP7A 3VH4A 3PC3A 2I6QA 2V7QD 1HX7A 1RAAA 2C9MA 4HNAB 1OLOA 3GMTA 3WLIA 3F46A 2QD1A 4ZV4A 2JB9A 3LVQE 3FFTA 1P39A 2V9ZA 2YRWA 4N65A 2SNIE 1L6IA 4L6AA 5CA1B 3A06A 2HEIA 1RPNA 2IXAA 1L2TA 1ZG3A 3ZCPA 1IBLB 1SUIA 1D9XA 1DKMA 1N5DA 4M4SA 1YA8A 4C0XA 4XPIB 4A1FA 1Y5MA 2ZBUA 2RAPA 4WCVA 4ZXFA 2HHLA 4BQQA 4DJDC 4US2R 1HC7A 1IK6A 1NI5A 2QZPA 3BBPA 4U5QA 1XVVA 4QYIB 4NZMA 1VKNA 3SU8A 3DPSA 4PZCA 3UCXA 3V97A 2W48A 4JOCA 5B2FA 4RVGA 3U19A 1VLQA 2OD7A 3NV9A 4XIIA 1JA0A 3Q40A 1WUTA 1Y8QA 3FUWA 4INAA 2PT7A 4EG3A 5JS6A 2XMSA 4J0CA 2QBYA 2I2XB 3UGJA 4BMZA 1N7IA 5ALVA 2YHUA 1O87A 3UMSA 5KOIA 4KN6A 4CLRB 4W1SA 1U0SY 3MMXA 3P97A 2OO5A 2WHPB 1P4GA 4E6PA 5I7SA 3GMDA 4XRGA 3TMAA 3IDAA 3RUCA 3RW9A 4S12A 3LXXA 1OAOA 3QXGA 1U7XA 3IAXA 3WAGA 3ZX5A 1RLJA 4PAMA 1UADA 1G4HA 1IXKA 4DG8A 4B3GA 1E2KA 4HNSA 4JEMA 5H3HA 1F3OA 3L40A 2F62A 2NZYA 2Z0MA 5HKKD 2AG6A 2BZGA 1D1QA 2FGJA 4I9FA 4IOJA 3B1XA 4H3VA 1ESNA 3UHPA 1URPA 1IEQA 2A5LA 2PZAA 4MTLA 3I32A 1FFWA 3SQDA 2IBMA 1TEHA 3V6LA 1B14A 1T34A 2W7TA 5AM1A 1E5VA 5FNVF 1DQZA 3OTWA 4WBNF 4GL2A 1TEZA 1GHTA 1RVV1 5AI8A 1PYOA 4V02A 5JJBA 2IYAA 3UPDA 3HG7A 5EHNA 2PWPA 5DOZA 2ZIVB 5LU9A 4PO1A 2VDOB 1DWOA 1GQSA 2ERCA 1AGYA 1C8VB 3BIFA 4GIBA 1M34E 2C4MA 2JS7A 3D02A 4MZXA 1EJ2A 2QVXX 4JJAA 4HB3A 2QAIA 4K0RA 1W85A 4H0FA 3C8DA 3H4MA 4R2WA 3K73O 1PQPA 5EJ7A 1NVFA 4HNTA 2H52A 4DV3B 5DCYA 4H1VA 3AZPA 3HUFA 3S4YA 1DEOA 2QLTA 2ZWPA 4Q19A 2HW8A 1A0OA 3KKNA 1VCHA 4ID9A 4N3BA 2JVJA 4RA9A 5K8JB 4OK3A 1DCKA 2RBEA 2R6CA 2CMKA 2I1QA 3I1YA 2M32A 1JFVA 3A6JA 3DJFA 4L7VA 3VO1A 1OXSC 5LNK6 3C15C 1JG4A 3RUEA 3EGXA 4DYVA 1V8OA 2A2ZA 1J7JA 1T1JA 1JYFA 4LOJA 5F3DA 3AF3A 2JGLA 3P4YA 4AF6A 4PG6A 2HSZA 3J7AC 2VZ9A 4QYXA 4QLBA 3MB8A 3DF9A 4FCCA 3MCZA 1Z06A 4CU2A 1WCYA 1Y6QA 3LF2A 1QH1B 2IYLD 2P4EA 2W2KB 3AEKA 3CLKA 4IDHA 2HK9A 5EG5A 2K2WA 4LK2A 3UMGA 4HGPA 2M2IA 3KKMA 3PUKA 3B20A 2SCUB 3TPFA 2PHZA 1XDBA 2A14A 1X87A 3T9CA 1H9AA 3DBRA 1K3TA 2O2GA 1PV4A 2GN0A 3S2IA 3AF6A 1VP9A 3IEXA 4OQPA 4PZPA 4AURA 1VA4A 1RI1A 3F8SA 3MK31 1XEFA 4YRKA 3I6ZA 3ZJ5A 3Q6MA 4IYRA 4ZGWA 4JHLA 3FH0A 1XD9A 1YAJA 5DSTA 3ZWQA 4C43A 4J1SA 5E0OA 1JPUA 2P3SA 3AU9A 1K5PA 1QBKC 4IH4A 3H83A 1JU9A 4I50A 1KIAA 1JKFA 1TFRA 3UUEA 5BVHA 4EUHA 3PXCX 1HQKA 3Q6NA 4AS3A 1RBYA 3IP9A 4LWOA 2C9BA 1FTWA 4P5DA 5TV2A 1N25A 1OLSB 4V0SA 2ZAIA 3GJRA 5CK5A 2W6JA 3Q15C 4HTFA 2NO7A 3IDFA 3MOSA 1T91A 4A0RA 4B6QA 5EP3A 4GEKA 3T38A 4DWJA 2ZBVA 5HKBA 2FHSA 3LQFA 1E6EA 2VXOA 3KL4A 4FBLA 2CLLB 2WFLA 2WK1A 2O8NA 3VKGA 1H8HA 4OJYA 4WMLA 4R51A 5D3MB 3RNLA 3H4TA 1ZMXA 2C4UA 5DYGA 3SJZA 4E5SA 4OMCA 2AKYA 1E59A 5CLHA 3MTDA 5D51S 3BB1A 2IYWA 1SD1A 1PU2A 4BFVA 5LD2C 1O3YA 3C98A 3GFPA 3GVIA 3ABQB 1T8PA 3E61A 2WUVA 2A59A 3OKFA 1CP3A 2IU4A 1R9JA 3ZVLA 3EXFA 3A2MA 2C31A 5IYZB 2RHTA 4B7UA 2HC9A 1NJ2A 1EVLA 5AH0A 4ZC8A 1WB4A 1C7FA 2QJTA 4J49A 1H4QA 3G9QA 4E4YA 3C43A 5KSWB 2J67A 2VP6A 4PGFA 3A70A 4K9QA 5K3SA 2JHPA 2W43A 2VQEB 5IH7A 1KKLA 3I8SA 3FWYA 4ZK6A 2V1XA 1ZSNA 2I65A 4OXRA 1Z0IA 3KT0A 4X8HA 3EG9A 5JYEA 2YJ3A 1GN9A 4JA0A 4Y3UA 5IVKA 1HE8B 1R2QA 2Q3EA 3HYCA 3PEVA 3R2JA 2V58A 4MUNA 3HWRA 2C2GA 4YQYA 4A36A 3SSAA 3TIVA 4F4CA 3DYBA 1VJTA 2F8LA 3M4YA 2XUOA 5B1SA 1O9HA 3TI7A 2Q0SA 3LX4A 4KI0A 1JKIA 3RU7A 5IBCA 2UUAB 1U6IA 4MWCA 3IIKA 4JUCA 2B9VA 2P77A 4QXMA 4WUVA 3B8HA 3RAPR 2V7TA 5F1PA 3RSFA 2VH5R 3VZRA 3G6WA 4MQBA 5BMVF 3TVDA 1C50A 3AB7A 2WVGA 2J0UA 2V7UA 3HNPA 4RPJA 1U5BA 3NWOA 3RVLA 5B36A 2Q9UA 3BQNB 3G49A 4O1HA 3WYBA 4YJ3F 5THXA 1EP2B 4P2GA 2AYXA 1X2EA 1E98A 1DG9A 2QTCA 3LRXA 5AM4A 5HRAA 4QQFA 1QPZA 4Y2UA 3V8PA 1QMPA 2CXPA 5EUMA 1FRZA 3CX7A 5AK4A 4X1KB 4ENVA 1TGVA 2DJIA 1SVIA 5CLQA 1ZO8A 4F11A 1YR8A 3LT2A 1NKVA 3PFIA 4XLLA 3H2KA 5CP8A 5KC9A 4AS2A 2OP1A 3I52A 2ZI7A 5DI3A 4BYGA 1CNFA 5IVPA 2RE8A 2ZU0C 2YIVX 1DXQA 2FY8A 4IXNA 5AJWA 5HIKA 3WGIA 1ULTA 4KIFA 4FHFA 3HRHA 2ALJA 1W34A 3E2IA 3INTA 5GM2A 3ZH2A 1EDDA 4PZ0A 1MH1A 5TLSA 3AEYA 3H1BA 4B6GA 1GEEA 4Y6LA 3AUKA 1B93A 1DIOB 3PS9A 2IEZA 4LXXA 1ESCA 4P84A 2JH3A 4KPFC 2PTGA 1RJGA 4GSYA 2ZM5A 3MG9A 1BRMA 3WGOA 4FBGA 1EFPB 2XCUA 4HUJA 2H07A 1AF4A 2CKMA 1RYEA 2XYGA 5ICFA 4FBMA 1Z28A 3HU5A