4DCNA

Crystal structure analysis of the arfaptin2 bar domain in complex with arl1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
TREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for membrane binding specificity of the Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-2 determined by Arl1 GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords ADP-ribosylation factor-like protein 1
total genus 47
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcnA00
1CJTC 5B64A 4XSHA 2ZROA 4P0TA 5IK2A 1M6NA 4MRPA 2FX3A 3K09C 3C7KA 3HYRA 4IXNA 2GHIA 1G17A 1GFIA 2WJYA 4A0FA 2EFEB 4EQ6A 5A5GA 4LRWA 4B34A 3RYTC 1JNYA 1MRNA 3T5DA 4XVUA 1COWA 3LXXA 3P4XA 1XMJA 4JLPA 1U2RA 3M0EA 4M9SA 1ZUNB 3NBYC 2LKCA 1RRPA 2ZRHA 3QOFA 4AG5A 3I72A 5IF9A 4C7OA 1F2UB 1KJZA 3D8BA 5C1BA 3EZFA 4QGGA 3AGQA 2AKAB 2QBYB 4TN1A 5KOYA 3WNDA 3G0HA 3CB4A 2GCPA 4Q1EA 1F2TB 1F5NA 4KJZA 5G3ZA 1TAGA 5FOUA 3IUYA 4MKFA 3QF4B 2A5FA 3PEVA 2IXFA 5FTNA 2W83A 5EP1A 4NHOA 3A4NA 3CRQA 4QRHA 4NYMR 3RS3A 2GCOB 3RS4A 5JZVA 1O87A 1A5TA 1NBME 2ZAOA 3AUXA 3GJ8A 1Q57A 3TUJC 3VR1A 1LY1A 4AKHA 1S3GA 4BFTA 4TTQA 1GNPA 4HAXA 4MKHA 3B7GA 2PLRA 2O8BB 2OCPA 1TF2A 1E99A 2PCJA 3LWNA 3VR3A 1G8YA 1I2MA 4HDQB 3B60A 4TMVA 3NG1A 4QL3A 3TSWA 1N5IA 4ZI2A 1QZXA 3GEEA 1JXOA 3NKVA 3ECCA 2PX0A 3KTAA 3GQBA 1N6RA 4HZUA 1QHSA 1R4AA 3MRSA 1R0ZA 1E1QD 1D2MA 4V03A 1XTSA 5EQTA 4QFMA 2RCNA 1SQ5A 3DZDA 1AQUA 3TQCA 5JWOA 3KJIA 4TLAA 4HZIA 4MDFA 4KO8A 2C9CA 1FTSA 3GJ3A 1TUIA 2YVUA 1ZM3A 4CEHB 1DAMA 1XWIA 4G0NA 3X1WA 3X1DA 2RGCA 1Z5ZA 3HU1A 3NBXX 4I1OA 2ODWA 4PHTA 2KWIA 1RC8A 1VYVA 2F6RA 1AGRA 1G20E 2HXYA 5J47A 4TYWA 4B3XA 2ECKA 2C2HA 5JWRA 1QHIA 1Y3AA 2C98A 2DFTA 1OJLA 3LFUA 3A6PC 2P5SA 4KCGA 3VX4A 3W3AA 3U44B 1NL3A 4W5JA 4G01B 1PVOA 2O8CB 3U7FB 5JMTA 4MRSA 4O25A 4P3YA 4ZDIA 3AH8A 4A92A 3RC8A 3Q5EA 4DEYA 4DJTA 4A6XA 2RGBA 3Q8XB 3VKGA 4YMSA 5DH9A 2R62A 4MRNA 1TQ4A 1G291 4BFSA 3TIFA 3BGWA 4V02A 2VHQA 1KSHA 1XXHA 2FFBA 1G7SA 1ZM2A 4OHVA 2VEDA 4UKDA 1R0WA 1ZJ6A 1SKQA 1W36B 3EZ6A 1VMAA 1OKKD 3CH4B 3GJ6A 3S1AB 5TMPA 4TLDA 4FMDF 4RCYA 5J4VA 1A1VA 3R9WA 2GBLA 2ZXUA 1EFCA 2IYRA 2H57A 2ZRDA 2AK2A 4FMDB 1Z83A 4DLRA 2CLSA 3CW2A 3K70D 2ZTSA 4RZXA 2IA5A 3UMFA 1P9WA 3I8SA 1JAHA 5TB5A 3TSOA 1KY3A 4YDHB 1RVDA 2KBEA 1Q1ZA 3GD7A 1XD2A 2QGZA 2YC4C 1D9XA 5FUYA 4M53A 1ZD8A 1K6MA 1HQCA 3L0SA 4C0KA 3BC1A 4BLSA 1OXSC 1J8MF 3K8YA 4HDCA 1VHLA 2A9KA 2G6BA 4JYCA 4RD0A 1DELA 1E98A 5KHOC 4PZLA 1GKIA 3DPUA 4PC2A 5KNDA 3C5CA 5DISB 4BLOA 4CGZA 2R44A 1DOAA 1W0JD 1ETUA 1ZNYA 3C16C 1NF3A 3QNUA 5BN4A 4X8MA 1HY3A 1R0XA 4A2QA 1YE8A 1G64A 3TUIC 5GADl 1JXMA 1Z6GA 3UATA 4HEJA 4JLOA 4KV9A 5BN5A 3KQKA 3U6BA 3I8XA 2DCUA 3PENA 2OXRA 3SYLA 1NVVQ 4PQRA 4ZDKA 4CEJB 1FX0B 4LHZA 2VL7A 2QN6A 3AVXA 4NZYA 1HURA 2A7QA 4Q4AA 5LD2C 5FBRB 3RRYA 1QHHA 1YU9A 2O0KA 1YKSA 2XOKD 5CITA 4OHYA 4JVNA 1KO4A 4EQ6B 2YV5A 3BH7A 4FCVA 5EXTA 4B33A 3OEED 4F92B 5CLLA 1Z2AA 2ZRBA 3LVRE 2JA1A 3AF1A 4V0OA 2H5EA 3RS7A 2RKOA 1KI7A 3W90A 2ZR9A 5IHPA 1KSJA 4TYPA 3A36A 1CR2A 2ZSBA 1AA9A 2AX4A 1JQJC 2CK3D 4Q4LA 2J7KA 4YC7A 4D26A 1W7AA 2UZ3A 3A1UA 1S1CA 1F2TA 1FL9A 1LTQA 2BOVA 2NO9A 3QUSA 4M21A 4RD6A 4DLXA 2CCKA 1VPLA 3Q3JB 1CIPA 2ZRIA 2ZRMA 2JLWA 1UDWA 3WP1B 1UFQA 3CNOA 5JECA 3ZGXA 3Q7QA 4D82A 1HT2E 4LI0A 5DGXA 1UAAA 3PUZA 1XRJA 2WWIA 4Q5IA 3IIJA 1U8ZA 3BE4A 2ZVQX 3CRW1 1DG1G 5FR2A 2IYLD 2ZS7A 3PEUA 2ZE5A 3MWLA 3Q9LA 4GT1A 4BWYA 1SXJB 5KO2A 2E9SA 1KK3A 5CIQA 2NPFA 3BB3A 1UEIA 1DEKA 3UANA 4GOKA 4WIAA 4D0NA 1QHHB 3CNNA 4YLGA 4WZBE 4OL0A 2R6DA 5EJEA 1G8FA 1LS1A 3EZ9A 3CF0A 2ZRNA 4NCKA 3WNCA 2DFNA 1MO6A 2BKUA 2R6GA 1NG9A 1E3MA 2UZIR 3AVQA 3LRPA 2GA8A 4KYUA 2ZPTX 3FMPB 4URXR 1MABB 4JT4A 3B9PA 4U5XA 4IDQA 5EE3A 5LPNA 2J41A 3N70A 1I2DA 1UBFA 4KSCA 3H86A 4HAYA 2ZI3A 4K8OA 2O0JA 2R6FA 1XCGB 5TDHA 4URYR 1Z3IX 1Y63A 5JEDA 1RW4A 2WIAA 4YMTA 1EWRA 5F2EA 4B73A 4A0RA 3FGNA 3I4LA 4IVPA 4GRAA 1FMJA 2P5TB 4G5GA 1G9XA 4AURA 5FPHA 3PEWA 3CR7A 4RVCA 3U44A 1II8B 2GXQA 3CRMA 2QP4A 2XZLA 2PH1A 5HCNA 4BLTA 3NDBB 3PV0A 3UG6A 4RJLA 5JCPA 2VO1A 1MO4A 3N2IA 3FPAA 3CIOA 2KB0A 2IYQA 4PHGA 3B85A 4L9WA 4TTPA 4DZZA 1FP6A 1Q3TA 4X8HA 2FZLA 2YWGA 2NPIA 3FHOA 5BYJA 4ZV4A 1OE0A 4GZMA 2J46A 4AKIA 2WKQA 4LJ8A 4OK5A 4DUGD 2JLQA 4NH0A 3V4RA 2FGJA 3A58B 2ZI4A 4D4MA 2ZYUX 4M2LA 2D2FA 2EFGA 1E1RA 1MABA 3VHLB 2JDID 1P73A 1KK2A 4Z54A 4ZO4A 2JLUA 1N0VC 1XXHB 4D81A 2J0VA 2P0EA 2E1RA 2XZOA 2RGNC 5CDFE 3ZIAD 3PCRB 5H8WA 3DHWC 3E5HA 3TGPA 4Q03A 3UIEA 2CJWB 4NDZA 5DLQC 3WYFA 3P1JA 3ASZA 1R7RA 4Q7LA 5L3QA 4UNRA 3HJNA 3HPQA 4JLBA 1AK2A 2JLRA 3UG7A 1C1YA 4FD2A 2CXXA 1G3IA 3L0PA 1YJ5A 2FH5B 2Q3FA 2FPKA 1GVNB 2AWOA 4ZI3A 1AZSC 4K46A 1CTQA 3CONA 1T8UA 3AKDA 1DS6A 4Q18A 4OHXA 1BIFA 3QQ5A 4B71A 1YR9A 2WTUA 3U60B 2WJJA 3FOZA 1NLFA 3NIBA 2L0XA 4BLQA 2QBYA 4R98A 5HE8A 1CJMA 4C2TA 4F7WA 3O47A 2JLXA 2Z0MA 1VYTA 2G1KA 4Q9JA 5KSPA 4DRZA 1G5PA 1M8PA 3NTUA 2R6CA 2QP3A 3PQCA 4B43A 1CJVC 2J59A 2ZETA 2R2AA 2CVFA 3U3KA 2WJGA 1ZU4A 4Q4AB 1QF9A 4PR0A 1W2GA 4WBSA 4BFYA 3ZVNA 2V1UA 2J0UB 4JLKA 3EZ2A 1ESMA 2G9NA 1KO8A 2B8TA 5AJXA 5DYGA 4CIDA 3TW8B 3KQHA 3Q5DA 3RSLA 2CL7X 4M9QA 3GLHA 1GWNA 4D80A 4WOPA 1E2PA 1A82A 4HLQB 1E9EA 5C4GB 4OHWA 4W9MC 4PSAA 3LLMA 5FL3A 5L3QB 1AJEA 3OIYA 1E1QA 3OESA 4HB0A 3FDIA 1XPRA 4V0NA 4NYJQ 3K0AB 1NN5A 1MT0A 3MG9A 3W9YA 2QAGA 4B74A 1IM2A 1TQ2A 1AKYA 3SHFA 4QNMA 4OI0A 4BUJA 1F3OA 4GBMA 1XXHE 2Q0HA 2VF7A 4IDOA 4G5RA 1IQPA 3WMFA 1E0KA 2P6NA 3UKDA 3F0TA 1GL6A 3IGFA 3NDPA 4NONA 1N3BA 2C03A 4HLUC 4RFVA 4K81B 1KKLA 3ICEA 1BO6A 2IUUA 5JI2E 4YQFA 1CBUA 1JPJA 3LX5A 1KDTA 1RZ3A 3AVVA 1P2SA 2ZRGA 3B1ZA 4LV5B 2BM0A 1XD2B 1SGWA 2IXEA 4DT1A 4DLZA 4ZIRB 1OT3A 2GK6A 3B6EA 1MOZA 2VLIA 3OZXA 4BPBA 4EIWA 3K0CC 4A8JA 1XEXA 1IN8A 1NKSA 2EWWA 1E2KA 4KYIB 2B6HA 1H8ED 2OZEA 3B5JA 3ZYCA 4D2IA 3LQQA 4QBGB 4MRVA 4MYCA 4ZPXA 3C41J 5ELXA 4S35A 1VG0B 3TW4A 4IKEA 2QZ4A 5IT5A 4HLUA 2ORIA 4RCZA 2JLSA 2I4IA 1G8GA 5KU1A 1A2KC 2DWOA 1GRQA 2FOLA 1I4DD 2ATXA 4KHZA 2IWHA 3JZMA 1LVGA 3QXJA 3BIFA 3FKSD 3CX7A 4ZDJA 1TQDA 3AF3A 5FUXA 3CKLA 2IBMA 2WJVA 3DVLA 2ZR7A 2O8EA 4B6FA 1TEXA 2VP4A 1QHYA 2IYVA 1GIAA 4BECA 4D4JA 5F98A 2J87A 5AJYA 4LGMA 1W48A 2ORWA 4BLRA 3IDQA 1US8A 3TAUA 4M1TA 4DLYA 1HTWA 2J9RA 1W2HA 3G5UA 2IS4A 3KL4A 3LAWA 2HJGA 5JI3E 2FN4A 3T61A 2RGDA 1FW6A 2PMKA 4PQYA 3H1TA 2QSYA 4PO8A 1G3UA 3TQFA 1SKYB 4ERNA 4MGYR 4DSNA 5JJIA 4WAUA 2F55A 5HKKA 2WZQA 3M4YA 5K8UA 2ZJ8A 4PPFA 2YWFA 1Z47A 2FPMA 3L82B 3U3RA 1P2UA 3GLGB 4AY2A 4S2EA 4Q9HA 5F9HA 4GDFA 3TSZA 4DCSA 1E1RD 2AFIE 3AF2A 3LW7A 2ZSDA 2VQSA 1GITA 1XEWX 1G19A 3FKQA 121PA 3ZVLA 4MQBA 2WMOB 3SI7A 1FPMA 2PZFA 4Y0VA 4CT4B 4NPHA 3AP2A 3SE0A 4BRWA 2DBYA 1KDPA 2HCBA 2NO0A 2IYZA 2ZANA 4PPGA 4DUGA 2QMUA 4Q1BA 5FUWA 2AR7A 1L4UA 1WP9A 4AYTA 2QT1A 1G8PA 1HA3A 1Z0KA 4MGIR 4J0QA 1EGAA 2DWQA 5FR1A 2OCBA 1KTVA 2NO6A 1W4CA 3IPYA 4R9UC 3RNLA 4PHFA 4QGFA 1OFHA 1LFDB 5M04A 4TL9A 4AYWA 3CUEF 4NE2A 1X8LA 4JL6A 2P6UA 2ZI5A 2EW1A 4V0MA 4EUNA 4U00A 2ANCA 1W0KD 1YZTA 1U98A 3AVPA 4I4LA 4NCIA 2X2FA 2IL1A 4BASA 2RGAA 1ZAKA 2ZS8A 4LYAA 4CDGA 3NH6A 1D6JA 2DHRA 4B3DA 2CMKA 1B23P 2AK3A 4IXMA 3R8CA 2XAUA 4E03A 1WMSA 4Q1DA 1W5SA 4YMVA 5CK4A 1G7CA 1EFUA 2QEQA 4JBXA 2GDJA 4HB3A 1KO1A 1YRBA 3I73A 4R2HA 2D2EA 4P33A 4XSGA 4ASUD 1GTVA 1RYFA 4C7OB 5E95A 1E9RA 3TR5A 4LCBA 1G3QA 3D7MA 2J0UA 1Q20A 1MRSA 1N6OA 2Z43A 1D2EA 4JVSB 2CLCX 4NCHA 1OLOA 2GF0A 3QEOA 4Q9LA 2RHDA 1E9AA 4QG7A 3T34A 1SKYE 5C18A 5KSZA 1IXZA 5KSOA 3Q7PA 1G1MA 4B75A 1JEDA 3RWOA 1CR4A 1ZYUA 4OQLA 2O5VA 5FI0B 4ARZB 2XXAA 2AWNA 4U02A 3L2OB 4TTRA 3VFDA 1CR0A 4I1SA 1QVRA 4LWZA 2AD5A 1RIFA 2BHRA 1WXQA 1Z08A 2IYYA 4QBIA 521PA 3GLFE 2FEOA 4XTRA 2JGNA 2F1RA 2QPOA 2QQEA 3KB1A 5D3MA 1IXSB 4N1AA 1OFTA 4B2LA 1R10A 5CB8A 1DADA 2NO1A 1V43A 1VIYA 2PX3A 4FINA 1NY5A 1Z6TA 2PT7A 3BFVA 1Z0FA 4LOAA 1XNJA 1NNEA 1NLZA 4Q47A 3PG5A 2OFOA 4XJXA 2OFWA 1JJ7A 3OAAA 2FA9A 4PZZA 1CXZA 5IRCD 3FTQA 3TJZA 3NHBA 1US8B 5D3QA 2OSBA 4E22A 5HKKD 1GZSA 2XSZA 3PITA 3GJ5A 5FPTA 1DPFA 1OXVA 5JJLA 2V55B 3UMRA 4L4UA 4MRRA 4NCNA 2YNMA 4A1FA 3PJRA 1NSTA 1ZMXA 5TV2A 5FPKA 3T1TA 2GVZC 5AUQA 5FTMA 3PVSA 3EIEA 5FOVA 1JR6A 1UBCA 3SJAA 1BS1A 4TLCA 5CJPA 5IK2D 4JL5A 3MFYA 3VHXA 3W8NA 5HR5A 1KAGA 3P4YA 3MMPA 2D3WA 2XNDD 1N6NA 4Z1MD 2FU5C 4EFLA 3GMTA 1E2LA 3VMFA 1Z2CA 1W46A 2D62A 5JHGB 2V1XA 5FUVA 1RYHA 2ZU6A 1ONBA 5H1YA 2IW3A 2GXAA 4NKRA 1ZNWA 2AD1A 3PIRA 2EWVA 3TRFA 3T35A 4B76A 4PAMA 4AWXA 1VDZA 3PFIA 1XFAA 2MSDB 2J0SA 3WHLA 2OILA 1DG3A 1ZBDA 2BBSA 3MLEA 4WZ6A 3QBTA 2V3CC 3GLFA 2QTHA 1NG1A 1QHGA 2WWWA 3LQRA 4Q9KA 3BK7A 5FH9A 5KYKA 5DI3B 3ZIAA 1XCMA 2I3BA 4DEXA 4NL4H 4DDVA 3DOFA 2QMHA 2W0MA 3AVUA 2ZSFA 1BH2A 5JHHB 3LX8A 4HAVA 3KDSE 2J7PD 4B2IA 3BOSA 3VQTA 3FWYA 3KFVA 1JEEA 1FFHA 4B2PA 4IJMA 3X1YA 1W49A 3VR6A 4LK2A 4EJSA 1LB1B 4FCTA 3AF4A 2N1BA 4KVAA 4LSGA 5G41A 4KBFA 2WICA 2NIPA 1T0HB 4HLDA 4HAWA 4HAUA 1GL9B 4DSOA 3BD9A 1KYIA 5CM8B 3C15C 2VHUA 5A4JA 4YMUA 1Z22A 4TL6A 1YZQA 3DMNA 4PPNA 2ZRAA 3P20A 1LNZA 3I5YA 4KITB 3GJ7A 3I32A 2W2VA 4NP6A 4RKEA 4M9XA 3UXMA 5BN3A 1G16A 3GJ4A 1U8AA 2LWIA 3LO5A 4DCVA 1L2TA 1E32A 1MV5A 4W5WA 1H65A 3AKYA 3U2QA 4UXJA 2NZJA 4L15A 2ZJ2A 2O8BA 3LBHA 4Q66C 3QG5A 3GLFB 1AQYA 2FZ4A 3FMOB 3FMFA 2ZRKA 5EXPA 2EYUA 2YOFA 2BWJA 3FMIA 1KI8A 2VSXA 4D0LB 4TMWA 4HZUB 2F1HA 4CEIA 4JLVA 3T5GA 1X1SA 1KJYA 1W36C 3EPJA 2OCYC 4YONB 1T4GA 2V9PA 1W0JA 4NBSA 3QKUA 1GNQA 1HV8A 3EIQA 3F8TA 5D3MB 3K70C 4A0GA 1TX4B 2DWPA 3AEZA 3EARA 3U7HB 4DXAA 4LBVA 4XD7A 3KX2A 1W36D 4AK9A 1WQ1R 4FN5A 2VIIA 1NBMD 1UKVY 1E79D 1Z6AA 4G5QA 4RY2A 3KXKA 2IYWA 1QBKC 3KB2A 3V4FA 3QG1A 1L4YA 4ILEA 3BERA 1SVOA 4TZ6A 5FL7D 3TMKA 2A5GA 5G40A 2VHJA 3RABA 3IEVA 4Q1CA 4EJSC 1G6HA 2ZIAA 1DAGA 2XB2A 6Q21A 2IYTA 4JJZA 1RRGA 3HPRA 2CJWA 1OXXK 1TF7A 5J5CA 3QJYA 3OIVA 2AKYA 2GESA 1MKYA 3THYA 1CULC 4P4TA 1EK0A 4YXWA 2GILA 1VG8A 5L3SA 1K8RA 3IBYA 2YHSA 2GF9A 2C8VA 3FHCB 2OBLA 1Z0DA 3PUWA 5AJWA 2QENA 3OE7D 3SC3A 3MWYW 1S8FA 1EG7A 3WHKA 4ZKDA 4GNKA 4HLCA 3QVVA 1JR3E 1KI1A 4TSFA 4PFSA 3U3OA 8OHMA 4PZYA 4LC0A 1KMQA 2WWGA 4MITA 1FUKA 2CHQA 1E2GA 2O8FB 3U4QB 1DBSA 3CPHA 5AWFC 4C4PA 4HB4A 5C46F 4PSVA 3EA5A 3SYKA 3V9PA 2PBRA 1OFIA 3THWB 1QRAA 2XOKA 2FSIA 5K8IA 1YR6A 4LX0A 2WWHA 5LB2A 4CRWB 1SHKA 3DM5A 1P9RA 2QMOA 2ZI6A 1YZNA 5FBWB 5FBQB 4W7SA 2J1LA 3ZLJA 4TMKA 4DT1B 5HPYB 2OAP1 2YWHA 1IN7A 3WP0A 1KIMA 3DKPA 4O3MA 3WRYC 2XJ4A 3L43A 1NMYA 2C99A 1FQKA 2A78A 2IT1A 4JYBA 4POAA 4EAQA 4XVQA 4JMPA 3BH6A 2FNAA 1AS3A 1M2OB 1ZVQA 3CX8A 4A15A 2XGJA 1P75A 1VG9B 2FGKA 2ZE7A 4A82A 3F3YA 3IPXA 3B13B 4TYYA 3IQWA 4DB2A 4IDPA 4N0EA 2QAJA 1AZTA 1IY1A 3TBKA 5DHAA 2FPLA 4RD1A 4ZCIA 4JSYA 2CEAA 3NVAA 4AYXA 1E2HA 2C04A 3RC3A 3SBEA 2P2LA 4ESVA 1WBBA 2GJ8A 2OG2A 3QKTA 3E1SA 1TUEA 2A2ZA 2DPXA 2HEIA 4BGDA 1N6PA 3NC1C 2H8KA 3MJHA 1NY6A 1Q22A 4G1UC 1NN1A 1TU3A 2EFCB 1ZIPA 3O8BA 5HTKA 2GZDA 1NMZA 2IUTA 2Z5FA 3R7WA 1JR3A 1GP2A 1T3HA 4D4LA 3ICQB 1E2IA 2VBCA 1ZNZA 2QMEA 1D9ZA 1T0JB 3TLXA 2HJVA 3I1FA 3LH5A 5E7JA 2ZR0A 1OXTA 1P62B 1ZRHA 4MDEA 3ZZTA 3VNUA 2J7PA 2BKEA 1G7RA 2CLDX 2MMCA 2OLJA 2QPTA 4NCJA 1XTQA 3M6AA 2VF8A 2XB4A 5CYPA 3I5XA 4TLEA 2XNDA 2ZE6A 2Z4SA 3UPUA 2WAYA 1GSIA 1N6KA 3BXZA 1XJCA 4Q00A 1SVKA 2HYDA 4EPVA 4EKDA 1YVDA 2NO7A 1AS2A 4Q1FA 1VECA 1W5TA 4KFUA 4XD7D 2REXB 3S1AA 1NRJB 4HB2A 4OK6A 2DFKB 2QM7A 3UK6A 2IYSA 1E69A 3KUCA 1Q1QA 1OHHA 1DE0A 4JLNA 4M1OA 1W4BA 2C9YA 2WSMA 4XTCS 1NJGA 3EPHA 2H92A 5JSZA 1YQTA 3CWZA 4LJ6A 2WV9A 1XTKA 2ZRCA 3MD0A 4UXIA 3R20A 2BCJQ 4TYQA 2QP9X 4DCNA 1N5LA 3CO5A 1AGPA 1NKTA 1ZNXA 1SULA 3HU3A 3LBNA 2ANBA 2ODNA 1Q1EA 1SZPA 2QUZA 2HLDD 3JVVA 4PXAA 5TXGA 1IHUA 3ND9A 1LS6A 2BJWA 3LD9A 4CT5A 2A30A 2Q9AA 1JECA 1GILA 1FOEB 4LHWA 1CF4A 2QPAA 2OUKA 3CM0A 3LY5A 3SJCA 3BORA 1R5BA 1IN4A 1DO0A 1Z0IA 4JKIA 5BYKA 3R9XA 3OHMA 2GVDC 3KKQA 3PXGA 2DB3A 1MO3A 1SVWA 5K8TA 4B3GA 1L7VC 1HH4A 2WPDD 3IHWA 1EFRD 4E07A 4MGKR 4PC7A 4DSTA 4MGZR 4LJYA 4US1R 3RRZA 1F60A 2MMGA 4DC9A 4IOJA 3B1YA 3W6NA 5EP2A 3WRXC 2O8DA 4YMWA 1M7GA 2XX3A 3QXCA 4Q19A 2ZQ5A 3JZAA 4A36A 4A2PA 1TEVA 2F7SA 1HEIA 221PA 3AM1A 3AP1A 3P26A 3W5IA 2DY1A 1P3JA 4F93B 2ZREA 2ZAMA 2N46A 2A5YB 2YC2C 4TQAA 4OK3A 4U7DA 1H8HD 1OH8A 3MGCA 1RJ9A 4IDNA 1QVAA 4C0AC 4PC1A 1KKMA 3IHLA 2QG6A 3PEYA 2ZYVX 2ERXA 5E3HA 4G3XA 4M0LA 3ZS9A 3U4QA 2NG1A 2ASEA 2ZJZA 4OYHA 4RD3A 3QXHA 1WRBA 2GZHA 1Q0UA 2ZRFA 1N6LA 1QHNA 4IEIA 4M22A 1R8SA 1ZUIA 2GETA 2ZRLA 3C14C 2F43B 4MKGA 1TL7C 4NMMA 3AKEA 4BFXA 2D7DA 2PLFA 3IO3A 3PUXA 1II9A 3DMDA 4BLPA 4II7A 1E9SA 1U90A 4MH0R 1G8HA 5CJ2A 4F4CA 3THXA 1E2QA 3QIAA 1OV4A 2B21A 2HT6A 2YYZA 1TU4A 3U3MA 1MO5A 5TVKA 3ADBA 5KPDA 2BMFA 2V6JA 3DZ8A 5EUMA 5TY0A 2WSSA 1TQ6A 2ZEJA 2QTFA 3K1JA 4OQFA 1F2UA 1M7BA 1M7HA 2BBWA 3CZQA 3K0CA 4RZUA 5GVRA 4A8JC 4GP6A 1J8YF 4NYIR 4LJ5A 1BMFA 2WBLC 4D25A 3KKNA 2OHFA 3A1TA 2XZPA 2JJ1D 1C9KA 3HU2A 2IEYA 2OV2A 3QBVA 4JVLA 3WY9A 3GJXC 5B2ZA 4B47A 2QT0A 2OM2A 1AM4D 4DIDA 2Y8EA 2LCFA 2FSFA 5FTKA 5LB4A 1U0HC 3TKLA 2ZJBA 3X2SA 1KOFA 2KJQA 4JT2A 1N2CE 4C3ZA 2NQ2C 4N0DA 3CH5A 3SQWA 2GK7A 2JLZA 2R6AA 1JAIA 2V8OA 1KGDA 2GRJA 4EPWA 3QKRB 2GCOA 2QROA 2FFHA 1CJUC 4UQOA 2GTPA 3K0SA 4CVNA 3ZS8A 4GI7A 4B3FX 5JSZB 4JLMA 2AFHE 2O52A 1X1RA 2VP6A 2FSGA 2WKPA 3LDAA 4YXWD 2JASA 3M1IA 4PTLA 3CWQA 1OF1A 4G5OA 4JZKA 1W44A 3D6TB 3QVUA 1UF9A 4C30A 2WHXA 4LV8B 3UWKA 2JJ1A 1J7KA 3W3ZB 3AGPA 4B35A 4QHSA 4QKQA 4Z1MA 2WM9B 1Z28A 5P21A 1P60A 2RB4A 3ADDA 4PQFA 3RDPA 4B3BA 1R2QA 5H68A 2OXCA 1W47A 4RZ3A 4XOIA 421PA 4UNPA 3KUDA 1UKEA 3VU9B 5AK0A 2G0TA 4JS0A 4FCWA 2A5JA 3SFZA 4Z51A 5HZHA 1UKYA 2IX3A 1NN3A 1VTKA 3BAFA 2C77A 2IK8A 5FBLB 4Q7MB 1K5GA 3GLGE 4PO9A 4H1UA 1NMXA 3EPLA 1OSNA 4XWKA 3VKWA 3AF0A 2GEVA 3TVTA 1I4TD 2GKSA 4D0GA 5DN6D 1G21E 5KNCA 5FPYA 1EFHA 3L0IB 2OEPA 2Q3MA 4EPRA 2G77B 3WXMA 2I1VB 4GL2A 5JCZA 2SHKA 2RAPA 2ODBA 3T1QA 3BFXA 2CNWD 2GXSA 4DLWA 1DAIA 1AKEA 2OT3B 1R0YA 1NVXQ 1HYQA 2H17A 5A0FA 4G5SA 4ITRC 4B6EA 5DNYB 5FOWA 1XTJA 5DSZA 2W6ID 2I1QA 5KDDA 4LUCA 1YHNA 3R7WB 1NBMA 2X19A 3VR4A 2G0NA 4UXHA 3EC2A 3CX6A 2GJAA 4OBEA 2ONKA 1KZ7B 2OAQ1 2ZUDA 3K0FA 2AXPA 4EFNA 5DE3A 1J90A 2NMVA 4A2WA 3GJ0A 3G82C 5AUOB 3RSOA 1CLUA 1YZKA 2VPPA 4LPKA 4QGAA 2R8RA 4LHYA 1N25A 4ZCMA 2X8AA 4RKFA 4IVRA 4AC9A 4JSTA 4F4IA 3GLGA 1CEEA 2C96A 2WVJA 1P7CA 3KJEA 3ZJYA 2BMJA 1NLYA 2RHMA 1S2MA 2MSCB 4M1KA 5GJCA 5L3SB 3HR7A 3K0AA 3QPUA 1KDRA 1COWD 1G7TA 3B2EA 3UWOA 3KXIA 3QXSA 4CEIB 5CLQA 2ZUCA 2CL6X 2LKDA 3SFVA 2F43A 2VHCA 4QOSA 3RS2A 1WCV1 1XJ0A 1SVMA 4LV6A 2PZEA 1KO5A 1VIAA 1ZD9A 2QL6A 3FFBA 3KQUA 2WJIA 2ZJ5A 3H0KA 3V00A 4L9SA 1CKEA 4UNNA 5SZKB 1KHTA 5GVSA 1RRFA 5FTLA 2IS2A 4PANA 2EFDB 2R65A 5IDVA 2ZM5A 1MR3F 5KPJA 4JBWA 2J3EA 1E0AA 2DR3A 1NN0A 3FHTA 2CVHA 1PUJA 3W8RA 4FI3C 1HQYE 3K70B 4PAQA 3CR8A 4LBWA 4CEJA 4DDWA 3AQ4A 2IF2A 4BQSA 3QI2A 2REBA 3GCGA 3RHFA 4LBZA 4A8JB 4DKXA 1ZCAA 5FOTA 4FWIB 3BJIC 4TL8A 3CLVA 5G53C 1GM5A 1QHXA 4LYJA 2CHGA 5JWHA 3NEYA 1GRNA 1U94A 3BRWD 2ZJAA 4TMZA 4M1SA 2XJ9A 2BJVA 4O0MA 1NP6A 3X1ZA 3CZPA 1DAKA 1XMIA 3ZH9B 1OIXA 4F91B 1Z8FA 1FMLA 2W2XA 2WOJA 5BQ5A 1OPXA 3KXLA 4JLJA 4A6PA 1ZIOA 1S9HA 2HDNB 1U0LA 3W6PA 2KI5A 3A1SA 3BFKA 5L3VA 2B8WA 1HT1E 4XH9B 3SHWA 2BBTA 1G5TA 2WPDA 2ZS9A 1Z07A 3K0EA 5E7MA 1RJ9B 5HZKA 1LV7A 3J81k 3GEIA 4JBYA 4KI0A 3NEJA 3SYNA 1Z29A 4QXAA 1S4QA 1N0UA 4C0JA 2CK3A 2CHVA 2FJUA 1VKJA 4IEEA 4QJ3A 3TUZC 2ERYA 5HE9A 1CP2A 4DLUA 1U9IC 4LPSA 2X1VA 1XB2A 4MKIA 4PSKA 2FMXA 2IHBA 3A1WA 4OI1A 1XZQA 5J4KA 4WW0A 3E70C 1QG2A 1Z6XA 2HLDA 1Q1BA 3LV8A 1UBEA 4FXPA 2EU8A 1OYYA 2V7QA 2ZRPA 1U0JA 1YR8A 1SVSA 2A5DA 4EPXA 2QI9C 3C8UA 1CRQA 4GFDA 1K5DA 3VKHA 2VSOA 3F5FA 5B58C 1XD9A 4LYHA 4QHYA 1ZCBA 5G3YA 3R8FA 5JS8A 4TLBA 1T8TA 3IIKA 1ZM9A 3SS8A 4EFMA 5BW8A 1UM8A 2VSFA 4WA7A 1P61B 3VU9A 3KJHA 4DHEA 3GEHA 4JL8A 2P65A 1OHHD 3CRVA 4PAOA 3RS5A 1KSGA 1XEFA 3GLIE 4AKGA 2KE5A 2YJTD 1D5CA 4D4KA 1KK0A 3K53A 1JPNA 4P31A 1XU4A 3BH0A 5EE9A 4AI6A 1Q44A 821PA 1AIPA 2J5XA 1Q3HA 4P4SB 4CYMA 2J45A 5AJVB 2WJHA 3ETLA 2W6IA 4LHVA 4M9ZA 2FFQA 2CDNA 1KMHA 2BC9A 1ZW6A 5AJZA 1E79A 3BBPA 1FUUA 3QENA 2CNWA 2B92A 1X8JA 4Q1AA 2Q9CA 4MA4A 3OEHD 4DLTA 3BB4A 3PUVA 1SHZA 1KNQA 4L16A 2ZSAA 2Q9BA 2WWYA 5SZJA 3JVUA 5SZHB 3MCAA 5C4MA 4TQUS 4RD4A 3W5JA 5DI3A 1J70A 3MAAC 2ZJOA 3VR2A 4BEBA 3THOA 1BYUA 5CIWA 1RRCA 3DDCA 4B32A 4JVMA 2RGEA 3P32A 5L3RA 721PA 3OEEA 2QM8A 4O2LA 5F9FA 3I61A 4ESHA 5EP4A 2GEDA 3GLHE 1U99A 4ZIRA 4BFZA 1ZM4A 2JLYA 2HT1A 1JB1A 1W0KA 3OIUA 4V0LA 1XJQA 2O8CA 2H18A 4GMDA 2CE2X 4V0KA 5EP3A 2CE7A 4XWAA 3B82A 1TNDA 1PLJA 2AN9A 3FB4A 4BEJA 4DBLC 4TZ0A 4Q01A 3U61B 3RVBA 3AVYA 2O8EB 2VHTA 1XTRA 1IBRA 2G88A 2ZI7A 2PL3A 3LNCA 4IRUB 1U9IA 4URUR 1BMFD 1S1MA 4KFTA 2FEMA 5KTYA 4LJ4A 1YZLA 2CBZA 3K9NA 4C9BA 1Z0AA 5AR1A 3VX3A 2V6IA 2VTKA 1XX6A 3T12A 5FOXA 1Z06A 2PJRA 2RGXA 4DCUA 2VRWA 1TTTA 5KUTA 3EX7C 4US2R 2F9MA 1G6OA 2NTYC 4H9GA 4I1VA 3REGA 5KDOA 2QAGC 2J0QA 2GZAA 3WMGA 4C0SA 2Z4RA 5KDLA 2R9VA 3QPVA 2IC5A 4HUTA 2VP2A 4GOXA 5LDDC 3CF6R 2G1JA 4F38A 1A2BA 621PA 3ZQ6A 1S3SA 1PV4A 3HP1A 1OIWA 4Z8YA 2XITA 1E96A 5LD2B 2FG5A 3NHAA 3OEHA 4OQXA 1DAFA 2PMDA 2ZYWX 2YOGA 3QF4A 3NH9A 4L8GA 4MUBA 3C5HA 3OAAD 4MYUA 1E2MA 3O8CA 3OE7A 2BEKA 3CF2A 4NU0A 4GOJA 2W58A 3CPJB 1N5KA 2ZI9A 1JI0A 3ND8A 3KQLA 3AVWA 1E9DA 2N42A 1XEWY 1ZP6A 5J40A 1KJWA 3GLIB 4Q4HA 4P32A 1GKUB 3EIHA 3ONWA 3H4MA 2ZRJA 3EZ7A 3GLHB 1II0A 2IS6A 2GAAA 4XVRA 1TPZA 2PCLA 2EQBA 4E09A 2F1JA 1E0SA 1KK1A 1OYWA 3K09A 2WSSD 3T1VA 2REOA 2WAXA 1IN5A 5EUQB 4M1YA 5DN6A 3RAPR 4MYTA 4KLZA 2DYKA 4GMXA 4HUQA 3KKOA 4BFWA 1RKBA 2PEYA 3NXSA 3AUYA 1KMHB 5EE5B 1M1YE 4FW9A 4C2UA 4Q9IA 3FVQA 1S96A 3GFPA 4TSFD 1KZGB 1E2EA 1CU1A 3EASA 4KFRA 3DEFA 3LXRA 1J2JA 1E9FA 3U7EB 3KQNA 4AIIA 1WDTA 1FTNA 5F3WB 3SU8A 5B30A 2YKGA 3LBIA 2BBOA 2XXAB 1BYIA 1UDXA 4NTZA 1N6HA 3DO6A 3DM9B 2W2TA 4OJQA 2JJ8A 5FBVB 1SXJA 1O3YA 2HUPA 2W0SA 1G5RA 3IO5A 2UKDA 4IVQA 4QM6A 4EDHA 3ZZ0A 4RFSA 2F3RA 1V5WA 5BWMA 2C9OA 3SBDA 4CF7A 2MSEB 4IOLA 3HR8A 4V0ME 3IIMA 3I3SR 3KKMA 3OFNA 2QQ0A 4I99A 2EYQA 3EA0A 3EG5A 4NYIQ 4UJ5A 1EESA 2JIZA 3MSXA 5FTJA 3SN6A 1EWQA 2GAOA 5JRZA 4BZQA 1GL7A 1YZGA 4M8NE 4D6PA 2HYIC 2HXSA 4HUQB 3ADCA 2QTVB 3IKJA 1E9BA 2FV8A 2O0HA 4IFBA 4KXFB 1S0UA 1GRRA 1YR7A 3B8HA 3GPLA 5DIFA 3QXXA 4BZPA 3SJZA 2ZYTX 4DLVA 2B7BA 4XWOA 1JR3D 1SXJC 3B9QA 4TT3D 1P9NA 2K5UA 3TNFA 2VP5A 1KSFX 4KBGA 2FSHA 1QDEA 2GJ9A 2ZITA 4M4SA 3RRMA 4C0BA 3VR5A 4MUAA 2H1LA 2CCJA 4C0HA 2Q21A 1OH7A 2F3TA 1LW7A 1SXJD 3QKSB 4US0R 1GDDA 3THXB 4LDJA 3TE6A 2WWXA 2FE4A 4I81A 2D06A 2IYXA 2D7CA 3IBGA 3OF5A 4KU4A 1YRAA 1II8A 2P3SA 1SXJE 1T6NA 1T9HA 1GUAA 3KFXA 4UJ3A 5CM9C 1DO2A 2ZU0C 1OW3B 5FPSA 1E0JA 4LYFA 4OQNA 4CW7A 1KI2A 1GNRA 4BFVA 2IHYA 5EXXA 3T06B 4CEHA 1G41A 1F48A 1ODFA 1E2JA 2Z6VA 3MWKA 1X86B 4JJKA 3SOPA 5J4LA 1XDBA 4PHHA 3RLFA 1T91A 4O2RA 1IJEA 1LF0A 3DL0A 1EX7A 1KNXA 4X8OA 4IOKA 4OI4A 4Q02A 1Q12A 1E2NA 4URWR 2OCAA 1W4AA 2G3YA 4ZKEA 2Q6TA 3RANA 3THWA 5TARA 2Z83A 3CNLA 2F9LA 2YOHA 1FNMA 1N0WA 3U7GA 2QRNA 1NVWQ 1EFTA 5EZ5A 1UBGA 2EFHB 4QM7A 3ZD6A 1VHTA 2IUSA 4A4DA 1PLLA 1UJ2A 3QKSA 3QKRA 1P72A 1S9DA 3L8ZA 2IF0A 3OFND 5BXQC 3A4LA 1GG2A 2V4ZA 3N5CA 4DB4A 4LJAA 2BMEA 3RWMB 3O8RA 1W1WA 3BS4A 3REFA 2GEUA 4ARZA 3SDZA 1M74A 4JIMA 5ANRB 4C0QC 1WA5A 2QA5A 2G83A 3EWSA 2QE7A 1I4LD 1H8HA 1AN0A 5JS7A 1ZC3A 2YWEA 2VYFA 1EFRA 1L8QA 2VP9A 4FIDA 4WXRA 1HUQA 4ON9A 1EX6A 1F6BA 3K9HA 2W6JA 4QC2A 3CBQA 3GLIA 4A0HA 2BMDA 4LHXA 5AUNB 1SVLA 2FFAA 4QHTA 1RFLA 1TADA 1UADA 1R8QA 4FWTA 3QF7A 1ZU5A 3HDTA 4X8LA 5LBIA 2JEOA 1R6BX 4JLDA 1BOFA 2WKRA 1VCOA 2VH5R 5C2JB 4TQ9A 4QBHA 3U5ZB 5J4HA 4DDTA 1NVUQ 1XD8A 2EVWX 4I1UA 4WXPA 4GZLA 4HI0E 4URZR 2GWHA 3TVDA 1RE0A 4DIEA 1JALA 3QE0A 2FWRA 5CYOA 3QEJA 4A9AA 3SR0A 1FZQA 1OXUA 1RPZA 4GSYA 4RFSB 3DKVA 5EZ6B 5DO9A 4AG6A 1P4SA 1LF5A 3THYB 3VTKA 4Q7JB 5SZIA 1KI6B 5KNBA 3D3QA 1GOTA 2XTMA 1BKDR 5FI1B 2ZSEA 3LVQE 3ZZUA 4RZ2A 1XCPA 1UPTA 5CB6A 1NI3A 2QAGB 2BIFA 2D74A 2PZGA 1P2TA 2FF7A 3AB3A 4ZDWA 1NVVR 4NYJR 2XTZA 3TAHA 1A4RA 3GFOA 3P27A 3BB1A 5DYIA 4WVFA 3UMSA 2BDTA 2QNRA 1IOZA 1X6VA 3HWSA 3B1XA 1E6CA 1KY2A 2PJZA 2HCJB 3RRNA 1WF3A 4WZAE 4OHZA 4OQMA 1EXMA 1WE2A 3DOEA 4GP7A 5KSYA 1PJRA 4Q48A 2JAQA 1B0UA 5JJKA 1JQLB 4N3NA 2RH5A 4TMTA 4ACAA 1PUIA 1KO7A 2GCNA 1U8YA 3CRRA 4Z8XA 2GBLC 3HYTA 3K0FB 1OB2A 3EPKA 2F1IA 1DARA 5FFMA 2C78A 3EAQA 3L8YA 2CCGA 2ORVA 3N2EA 1N6IA 4DVGA 4PC3A 2B7CA 1VYUA 3H84A 3Q85A 1FQJA 1XEXB 3KZ1E 1E4VA 3K9GA 1XF9A 2QE7D 1DVRA 2WWFA 1G3RA 1KI6A 3K9LA 2OFXA 1E2DA 1CJKC 4HYYA 3PR1A 2C5LA 1TF5A 1AS0A 1GAJA 2RMKA 3NBFA 5CDFA 1ESNA 1XMSA 2JATA 3SZRA 2ATVA 4ASUA 4JKYA 1IXRC 1PLKA 3EXAA 1D2NA 2Q3HA 1P5ZB 4P4UA 4OJKA 2IWRA 2OE2A 1U81A 4LJ9A 4R2IA 2X2EA 2NGRA 3L0OA 3ZQJA 4HATA 3B78A 2ZVPX 3BWDD 4F4JA 4HAZA 1NIJA 1FX0A 1XPUA 1DAEA 2O8FA 1G18A 1ZUHA 1CRPA 3IILA 2DFLA 3A1VA 4FMBB 2V54A 4KVGA 2YZ2A 4Q7KA 2H7VA 4XIGS 3NBZC 2QRZA 1KI3A 1ZM7A 3EW9A 1VG1A 2BVNA 4QBFA 3E2IA 4TWZA 4R71A 1FNNA 2OLKA 2GNOA 1ANKA 1XP8A 4HDOB 3H2YA 5UKDA 2XTNA 1JJVA 3SJBA 5JFGA 2BEJA 3A4MA 3MJRA 2IEZA 4FMCB 4DDUA 1E9CA 2OO7A 1Q21A 4GPTA 4LBYA 2IYUA 1H8EA 5GJVC 3T1OA 4AKEA 1SVIA 1P6XA 2WIBA 1J99A 4KFSA 3AKCA 3QPWA 5H70A 1CR1A 1T5LA 1TMKA 1OIVA 2VA8A 3ASYA 3FE2A 3NC0C 4HSEA 4IDHA 2ODEA 4QGHA 2X77A 4PPQA 3AP3A 4TT3A 4IOMA 2A3RA 2FDCA 1OKKA 2NOAA 1G3MA 1P2VA 1VCNA 1DTSA 4RSGA 1X3SA 2JJ2D 4CZ2A 3EWAA 4LZZA 5JLJA 1ELOA 4KLNA 4LC1A 3SNHA 2QSZA 1R5OA 4M1MA 1E4YA 2QY9A 2HF9A 1OFUX 2WOOA 3WYGA 1HE1C 2QGNA 5JBQA 1VCMA 4JLAA 1OH5A 4B3CA 1KAOA 3VAAA 1XTIA 3W34A 1M34E 4PC6A 1ZC4A 3W6OA 1ZD1A 1C4OA 2IXGA 4RD2A 5DHFA 3IQXA 1UEJA 4KAXA 4R7ZA 1Z63A 1NIPA 2OBNA 1JBKA 2JCSA 3T15A 1Z6YA 2OESA 2JIZD 3O8DA 2HV8A 1T5IA 4DWJA 2BCGY 3KTAB 3EC1A 1XBTA 2AHOA 1OB5A 2RGGA 2PEZA 4TYNA 2HF8A 1GKYA 4Q4JA 2AXNA 5HCIA 3WNBA 4OKSA 3FKSA 3Q72A 1T3SA 1IAQA 2JJ2A 1IJFA 5GJWC 1IY0A 5B57C 1OH6A 5EXSA 1DAHA 5FOSA 4UNSA 4EPYA 1PZNA 1UKZA 3IEUA 5GJBA 4EPTA 2YINC 4H1VA 4Y0AA 3NWJA 3ZVMA 2XSZD 3A37A 3LA6A 4M1WA 4MYHA 5CK5A 3AV0B 1D8TA 5E7IA 1WB9A 4IW3B 1CS4C 1T3LA 5E4FA 3FFAA 4EJSB 3TR0A 4QJ4A 2KBFA 2IS1A 5DI9A 4BFUA 3ADKA 2P6RA 3LLUA 4BE7B 2XEXA 3FYHA 2ZUBA 4IFEA 1KDOA 1NSFA 2V7QD 4AD8A 3QSYA 3SQXA 3ZVRA 4TL7A 1A7JA 3LW8A 2WMNB 4ACBA 4P4SA 4DCTA 2VP0A 5JEEA 4NYMQ 5EE1A 2ONJA 3GP8A 1KI4A 3B1VA 4URVR 3ZD7A 2GJKA 4QJ5A 4L5BA 3U6KA 1Z0JA 4B48A 3PUYA 3VNVA 3AVOA 4Q4JB 2W6JD 1VCIA 1G4UR 3WBJA 3WBKA 5JRJA 5K8LA 1X8KA 3TK1A 3MWJA 3X1XA 5J4YA 2O8DB 2NZ8A 3CPEA 4B44A 2GJSA 4Q21A 2AL7A 2UVQA 1HE8B 2QU8A 3RS0A 1FP7A 1MH1A 3AVTA 2TMKA 4W5HA 2RGNA 4ZCLA 3MUFA 5FL7A 1NJFA 2D4HA 2E87A 4Q4HB 1N5JA 4E5UA 3A8TA 4UNQA 5L8VA 3GFTA 5EE0A 3R9IA 4LY6A 1W4RA 3ZDQA 4DSUA 4DLSA 1IN6A 3TH5A 4FMCF 4BZXA 1E2FA 2GXUA 2XNSA 3SEAA 1YZUA 3WMEA 4YDSA 4QNRA 2JDIA 1IY2A 1KI9A 3QY0A 4LJ7A 1IONA 1E94E 1QG4A 4PO1A 4C0LA 3KJGA 1XMVA 2W00A 2H16A 1XZPA 4KSBA 4OI2A 4KODA 4PX9A 4ABYA 1G4AE 4TMXA 3KKPA 2KSQA 3D31A 2ZJYA 4IHQA 3B1WA 3WYAA 2ZE8A 3OIWA 2PT5A 4BRUA 2JLVA 2QORA 5AUPB 1R5NA 2OBMA 3C4JA 2P67A 3U3JA 3I92A 2C95A 1XPOA 3I62A 1ZINA 2CL0X 2BM1A 1WBDA 2BV3A
chains in the Genus database with same CATH superfamily
2WNIA 1JSLA 3HGMA 4LVUA 4QUJA 2OXIA 3P7MA 1QGUA 2DVMA 3VR5D 3WR5A 1SUSA 4AN1A 1VSBA 1NYLA 1M6NA 2UYGA 5EUBA 4OBBA 2IQIA 1OBHA 2UVPA 2GO7A 3D0KA 1GFIA 5EHGA 1XZ8A 1UK6A 1FFDA 3NMUF 4PZ0A 3P9XA 4BL5A 4EQ6A 2W22A 4DEVA 4DMLA 1XG5A 3VC7A 2NACA 4XVUA 3DAOA 3A3OA 2EF0A 3BVPA 4QELA 3CG0A 1COWA 3DHYA 3FTDA 3LXXA 5ILQA 4EUKA 3ND5A 4TROA 3VPGA 3JD1A 4C7OA 2H31A 4YNBA 2CDAA 1SKUA 2AKAB 3ZKWB 2QBYB 3JQGB 4AZ0A 2D5CA 1KVTA 3ZH2A 2O2CA 1CG6A 1YRWA 4I36A 1U7UA 4INJA 2HDHA 4IIGA 3IUYA 4OEHA 2PSFA 4XDHA 5FOUA 5F5LA 2A5FA 5BWCA 2IXFA 1P4HA 3OLWA 1ZKMA 4QULA 5ALJA 1BHJA 3B6IA 4NYMR 4LK3A 3UHPA 1Q0ZA 1L8AA 2OD9A 5JZVA 3IP7A 1PL6A 2GR9A 4OQPA 4E31A 5FJIA 3TUJC 1M2VA 3EIFA 2AN5A 3ENNA 4E88A 4AKHA 5CXQA 4TTQA 1GNPA 1MEJA 3C8HA 3PC8C 4HFRA 3RVNA 4EY7A 4Z4GA 1JV2B 3R3JA 3SIWA 2QUHA 4E14A 2CHEA 2I4NA 3EUEA 2O8BB 3FDJA 1E99A 2DRIA 2PCJA 3Q4GA 4CTNA 2P4SA 4ETIA 1I2MA 1Z16A 3DLTA 1V4BA 3NG1A 4QL3A 1N5IA 2QYSA 2IU0A 3GEEA 3EPPA 4ZYYA 3TM5A 1K92A 4FZVA 5AKYA 3KT8A 5HCUA 3ROMA 5D7BA 2PX0A 1A8PA 2PGIA 4FUQA 4MUGA 5F7OA 1N6RA 4HZUA 3MRSA 1RXEA 4BZZA 1D2MA 1N2EA 3R5XA 5HEKA 1WXIA 3DFZA 3P2MA 5EQTA 2RCNA 1M6WA 3AEUA 4EAAA 2ZB4A 1SQ5A 2LDXA 4EEKA 3DZDA 2AOTB 2PR2A 5JWOA 3T52A 3G59A 3SJUA 4ESEA 2X22A 2O3JA 1Z2EA 1N2XA 5BRAA 2C9CA 1DV2A 3UV6A 3WK6A 5CFLA 1LV8A 3MSCA 4RKWA 3DOIA 4CEHB 1XWIA 1ZNQO 3FI0A 1Z5ZA 4KQEA 1ZN7A 3HU1A 4O29A 5KHAA 1VYVA 3G8BA 1AGRA 1H3FA 3RRFA 4PNEA 3A6FA 2ECKA 1CUUA 3JZDA 4F2WA 3LS2A 4M7RA 5JISA 4H60A 3OJXA 2JHFA 3I2HA 3L1JA 4Q16A 4D8TA 3KVOA 5IYZA 1A8QA 4RJIA 3SF8B 4PYLA 1VQ1A 1QHFA 1QO0A 3F6BX 2A57A 2ZDQA 3W3AA 4BEVA 4MR8B 4W5JA 2XCIA 3P2KA 4YECA 2X0FA 1H6CA 1VHJA 2EGUA 3OI7A 1YMUA 3MRTA 3AH8A 5JPDA 2RG7A 1AV6A 1SCUB 5ARDA 4D8WA 2N3ZA 4MRNA 1IY8A 2PQ6A 4XFDA 3DNPA 3ZWKA 1F7VA 1U3WA 3JQ7B 4I6JA 3L04A 2FFBA 3F5MA 3HXPA 3QWBA 5JBNA 1G7SA 5DX8A 3Q6MA 2VEDA 4CCSA 5HM6A 1MV8A 3BXPA 1BGVA 2PO5A 4YJGB 1KYQA 4BGIA 3PJEA 5CJJA 4F04A 1VMAA 3G1TA 3GJ6A 1DWOA 1OLXA 1ODIA 4YK7A 4YEDA 4ZU6X 1CLEA 1E6UA 1G5FA 4FMDF 5C5DA 5SV2A 2LV8A 4QZVA 1JILA 2OHXA 4JOQA 5J4VA 1C1DB 1REQA 5E4YA 2GBLA 2Y6UA 3KQVA 2HD4A 3ZUPA 1RQXA 3D54D 4OQZA 1TVEA 1J5XA 4EUHA 2AYZA 2D13A 3IV7A 3OPXA 2HDOA 1LBIA 4IUYA 4ME6A 4MW9A 2PBZA 3ZTWA 3CW2A 2XVYA 3RUPA 1T1RA 3B1JA 2VDQB 2JFWA 2ZTSA 3A2NA 2R7LA 1FMTA 1RWBA 3QYPA 4FFBA 1Z2OX 2FRVA 3JY6A 4YDHB 1K7SN 3BMXA 4I6GA 1QTNA 4IUBS 1RVDA 2KBEA 1XD2A 2J6HA 2QGZA 1D9XA 2YC4C 3KYDB 2HNAA 5CXXA 3TL3A 4BVAA 2QQGA 2WFMA 3OCVA 6ABPA 5ALLA 5CNKA 2JVKA 4UUQA 5AKJA 3BC1A 4BLSA 1OXSC 4B7CA 1VHDA 3K8YA 2YN0A 4QUAA 1BDBA 1R4MA 2XWJI 3GD5A 1DELA 3NVKI 1DWUA 3IURA 1E98A 1SU4A 2XQGA 5E6UA 5BT9A 3DPUA 3MB8A 3OQVA 3PC4A 1DIRA 4H59A 5DISB 3VDXA 4PCAA 1DOAA 3K4QA 4QDUA 1ETUA 4X84A 4BLOA 2LW7A 3I4FA 4BTVA 1XKTA 5CFPA 4P08A 5BN4A 3L7DA 4KGZA 1R0XA 1D07A 1RKQA 1UFOA 1XALA 5H80A 1GZDA 1ODSA 2Q45A 3TUIC 1UZAA 1Z37A 4ZVQA 1JXMA 1Z6GA 4J16A 2ADFA 1YJBA 2RBGA 3TXAA 4BAZA 1PHRA 5LYJB 1NDHA 3HM2A 16PKA 3O1IC 4CEJB 1GG9A 1RQ2A 2WILA 2QN6A 3AVXA 4NZYA 2NSJA 4OMCA 1LBQA 5FBRB 4MULA 3RRYA 5KINB 5LD2C 2NU9B 1K6IA 3O75A 4OHYA 2BGNA 1MGOA 3BICA 4HH3C 4JVNA 3PDJA 2YV5A 4B33A 5AW7A 3OEED 3K4PA 3Q87B 2NP7A 1XTVA 3FUVA 3G8CA 3VPHA 1X15A 1S2OA 5LQNA 4K28A 2PNFA 4RH0A 5I6DA 4EG3A 3KZCA 2H4ZA 1YA6A 1QYCA 5CAEB 2P4EA 2B2CA 3C6KA 4TYPA 1HDYA 3A36A 1CR2A 2ZSBA 1AA9A 2AX4A 1C1XB 3O5AA 2QXUA 4JJEA 3ZVKA 2FVYA 1W7AA 4D26A 5I7SA 5GONF 4YDQA 3QUSA 4JB8A 1LTQA 4HWTA 4NAUA 4RD6A 4QPCA 3OPMA 2CCKA 2PGAA 3HGQA 4MVWA 4Q9NA 1ZUD1 2ZJ3A 1JLLB 3VPDA 3C97A 3LT1A 1T5DX 3GGPA 5ALMA 3HM9A 1VE6A 3D3JA 4XYBA 4L4RA 5A02A 3F7OA 1AK9A 3PHIA 3Q7QA 4D82A 1UAYA 1XLVA 3PUZA 1XRJA 2WWIA 1HDCA 3IIJA 2M32A 2X0JA 2QUJA 1CZHA 3BE4A 3QM1A 1RWPA 4BVGA 1DG1G 4FTWA 5FR2A 1TGVA 1Z5NA 1SXJB 3H2SA 3WMWA 1Y8QB 1A97A 1T3GA 2E9SA 2QTRA 4L2IB 4M49A 1Z82A 3PQ8A 4TZTA 5CIQA 3JYLA 3G8YA 3HXTA 1DEKA 1BHO1 4R3WA 2ZT7A 3UANA 4WIAA 3V3KA 2ZT6A 2JFQA 3INNA 3BKXA 3AR7A 3H2KA 4YLGA 3ZDCA 4WZBE 2VTEA 1JSXA 3QIVA 5DHSA 3AM4A 1QSGA 4DLLA 1G20A 2R6DA 3IJRA 4QQRA 3RTAA 5JAIA 1CF9A 1CX9B 2I1WA 2X5NA 4GSKA 2DFNA 1YDFA 2BKUA 2CXOA 2R6GA 4KB5A 2H1RA 4NCBA 2K87A 1O5OA 2YBDA 2OZVA 1C9MA 1NNUA 1ZJYA 2JFZA 3AJRA 5ALDA 1ML3A 2IIVA 3AVQA 3O9VA 2GA8A 2HMAA 2HWKA 3FMPB 4KYUA 2P62A 4TMYA 1V4NA 4FGJA 1QH9A 2NV2B 5EE3A 2OGSA 1L6RA 3QTLA 2JJYA 1VKNA 1APBA 2DMRA 1RM3A 2MSLA 1BHQ1 4TXMA 4UAGA 1I2DA 3CT6A 4MI9A 1PR0A 5FA5A 4L95C 1Q2UA 1B76A 1NW3A 2JFGA 2R6FA 3SKVA 4ZOCA 4CL0A 3OO1A 2XQVA 1LKZA 1Z34A 5KU7A 2FG6C 3WWEA 2CW5A 5JEDA 4FHZA 4DQ0A 2ZB7A 4B3RB 1PGPA 2OBFA 4GRAA 5JMWA 1E5VA 4JNCA 4G5GA 5C1DA 4LF7B 5E2IA 3MIIA 4RVCA 1Q5PA 4AMUA 3OUUA 3CRMA 4UC0A 4BJ3A 4BNDA 3A3NA 3VR3D 1LD3A 3PGLA 2IHKA 3UG6A 2J5BA 2QTGA 1Z88A 5FEMA 1WDKA 4RJLA 4WGFA 4IR7A 2DPHA 4YR7A 2FZCA 5JCPA 4I5FA 4WK4B 1MO4A 3N2IA 4EARA 1PQ4A 3QVKA 2IYQA 4TTPA 2I0FA 2VBIA 3QUQA 4X8HA 4RW0A 2C00A 2YWGA 3LUCA 3NHKA 3FHOA 4XPZA 2QUKA 1OE0A 4MCIA 2HPHA 4RKQA 4XGQA 3D4OA 5BYJA 5I51A 2J46A 2AIRA 4K9SA 2C07A 1JBEA 1QAMA 1BEUB 2XXBA 3JRWA 3UJ8A 1PTJA 1RWKA 3V4RA 4KACA 1GXSB 2FGJA 1V1MA 3IEPA 3NYIA 4DLNA 5A6SB 3KOYA 1NQVA 4FFNA 3PZBA 1KK2A 3JRNA 4RVGA 1OA1A 2Y3IA 3P2OA 2HDWA 3SLKA 1V47A 1MU0A 4WCFA 1RZUA 1AE1A 5JW6A 4INZA 1ID1A 3FX2A 5B1IA 4QLBA 4RS3A 3TD2A 1QV6A 2ROQA 2HN9A 3VPSA 1BXZA 2CJWB 2GA9A 3CVJA 2PT6A 3MOGA 3N8IA 4UEOA 2SICE 5K0LA 1ETHA 2O0LA 1UFRA 4PG6A 2B78A 1WDLA 2YDYA 4QXPA 4F5WA 2B69A 2P75A 5JYEA 4UNRA 2FN3A 3G68A 2BFFB 1VSVA 3GMSA 2PGXA 3P52A 3LDFA 3VI3B 1QH0A 1XZMA 3K5HA 1UJNA 3GGDA 4HXGA 3WI7A 4ZGBA 1J5EB 1NX6A 1RT9A 2DBRA 1KYXA 3QP9A 4J4TA 1DI0A 4BAGA 4ZI3A 3R44A 3DCIA 1LPNA 4K46A 1HG1A 3CONA 5LWQA 4LFAB 4ZT6A 1T8UA 1VP3A 1XQ1A 2B6NA 2BONA 1NT4A 2Z9BA 3LP6A 4A5OA 5T4EA 1YR9A 3FYUC 3MRVA 1L1QA 1NE7A 1RHUA 1PDOA 4LZJA 4EUEA 5ICFA 4R98A 5HE8A 1CJMA 2G5GX 4ZGGA 2Z0MA 2ZYIA 4CV2A 3LQFA 2XHZA 4Q9JA 3AIOA 5KSPA 3QEMB 5C5EA 1M8PA 1PHPA 3NTUA 4FXOA 1E3QA 3PQCA 1E3EA 1OLUB 3V48A 2NVWA 4GBGA 4GRIA 3SXUB 2FQQA 2ZETA 2R2AA 3FNIA 3P5SA 3STYA 1O6BA 1YONA 4XUDA 3SXPA 3VJMA 3JWJA 1BDIA 1U0RA 4Q4AB 3T3HA 4C4AA 3WRVA 4WBSA 4BFYA 1F1BA 2J0UB 4JLKA 1LW6E 1TQ8A 4JHXA 4OSPA 1KO8A 2ZIZA 2HA0A 3KQHA 1PEKE 3TW8B 3WFJA 3Q5DA 3ELWA 3RSLA 2JGRA 5KTNA 1Y4AE 3GLHA 3L7CA 4Y3UA 5F2NA 1GWNA 3BZBA 2HGZA 1E2PA 4IPTA 4WOPA 4DM4A 4W9MC 2X2PA 2DULA 4PSAA 3LLMA 3QX9A 4C6RA 4EGSA 1WXEA 2KLHA 1RQ7A 5HIIA 1AK1A 5HNKA 2A92A 1PR4A 2P35A 1CY6A 4NYJQ 1XPRA 5C7YA 5TMEA 2ZZNA 5GV7A 3RK1A 3I6YA 1C9DB 4L73A 4JJIA 3L8DA 5HIKA 2R1VB 4JV5B 3C4VA 1XA0A 2ATIA 3THRA 1IUOA 1GUZA 1F3OA 3ORQA 5TQJA 1XXHE 2W11A 2A5LA 2VF7A 1ULTA 4IDOA 4G5RA 2LE0A 4MPDA 1GCAA 3IDZA 2VDJA 5A3VA 5IXJA 3IMKA 5TT1A 3E7WA 2AQIA 1D0SA 3EHEA 1V26A 3B52X 1GL6A 3MF4A 3RVDA 2KLBA 1CZNA 4RFVA 2CJYA 3DL2A 1KKLA 2RBEA 3CLTD 2XB9A 3DXZA 3KDPA 4IHJF 1GUBA 1ICEA 4LQ4A 4A0SA 2IZ5A 4OQYA 2W8BA 1QVZA 3LX5A 3DTVA 3ULKA 3EZLA 2CV0A 4U2GA 4MWSA 3PTZA 4LI3X 3LK7A 1WY5A 1XD2B 3KYDA 1SGWA 3N2YA 3HJCA 4DLZA 1X39A 1OT3A 2LZ0A 4WNYA 2CFCA 5LP6C 4EG7A 5JZOA 3B6EA 4YLYA 5HRUA 1WUHS 2CMDA 1IOLA 1Y9AA 1CRWG 4FKBA 3D6FA 3EAGA 3EULA 4A8JA 2QMYA 3GA0A 3T3NA 3PNOA 5BV2P 1IN8A 1NKSA 2OZEA 4XGIA 2VH2A 3CVXA 3L0DA 2NYRA 4MYCA 3ISTA 1U7WA 1OLSA 2AJDA 2Q4BA 3C41J 4HF7A 4BO7A 4FZJA 3FFWA 3DFFA 4W8HA 1MOSA 4HCJA 3TSCA 4RGYA 2QZ4A 3GLSA 1PJ2A 2FZGA 3SC2B 1BMDA 3GLKA 4XDZA 3H5AA 2JLSA 1G8GA 5KU1A 3QSGA 1AXRA 3NWBA 1PS0A 1VM6A 1ZI9A 4HNUA 2H2HA 3RRBA 3JZMA 4F3TA 2R7KA 2X0IA 1JHOA 3BIFA 1Z6PA 2PKYX 3CX7A 4WZBA 1NOKA 4ZO6A 3NHMA 5NULA 1VLZA 3CVYA 4B7UA 2C1EA 2MT9A 5BSHA 3PQ7A 3QV2A 1R0SA 2HJSA 2HRRA 2ID8A 2AT1A 1H2BA 2H07A 3AF5A 2QRJA 4WASA 5HK8A 4AG3A 3WX0A 1QYVA 1TEXA 2VP4A 4MGHA 1P45A 4UDXX 3IULA 1T8YA 1T2CA 2CXHA 1LWOA 3ID6C 3OCXA 1W48A 4LGMA 1RRKA 1X1DA 2VQ6A 4R5HA 2J9YB 3IDQA 3TBFA 2VRCD 4UDYX 5AW0A 2NADA 3CKMA 1HTWA 3G5UA 2IS4A 3KL4A 3MELA 5AM2A 4OHOA 4MS4B 3PCXA 2E3JA 4GKAA 3RIGA 2RGDA 4N4AA 1EBFA 2C0PA 2WU1A 1DTEA 3I6IA 3LBFA 3D6HA 1TT5B 4PQYA 4BYGA 1G3UA 4F45A 1X92A 4YHBA 2IDZA 4DSNA 2IU4A 3WGUA 4WAUA 5HKKA 3QV1A 3ZJVA 2WZQA 5AHKA 3PC8A 3AFGA 3DYBA 5KQSA 5TGTA 3U3RA 3OEWA 4F60A 3GLGB 4AJEA 3C3AA 4S2EA 1YFJA 1TRKA 4Q9HA 1UT6A 4CM8B 5F9HA 3BFJA 5AXCA 1E1RD 4DCSA 2AFIE 5IG2A 1Q0QA 1L5NA 3OJFA 4FJ0A 4AROA 4QOEA 3PQ2A 5I9IA 2GKOA 2PANA 5CHEA 5JCXA 1G19A 2EIHA 121PA 1XYVA 3OZTA 4OAPA 3SI7A 3ZU4A 1FPMA 5JXWA 2J31A 3RU3A 3AP2A 5IT0A 2DBYA 4HDNA 2ZANA 4PYIA 1TZKA 2YZMA 1L0BA 3K6KA 4PPGA 5CU7A 3HP7A 1YKGA 2BFEB 5FUWA 2X86A 4IIHA 2J6CA 2ZR8A 4M60A 3BL8A 4FKMA 4FR0A 2QT1A 3MT9A 2X42A 4FDUA 4AF7A 4UUOA 5FR1A 1SPXA 1KTVA 1W4CA 3DCJA 4X92A 3IPYA 4ZT4A 1C7RA 4YCNA 5ALKA 2HSGA 5JAZA 1ACJA 5K6TA 4MIOA 5EHIA 5K3DA 2V0CA 2FPPB 4JL6A 1MH9A 4NE2A 2BUCA 2YYYA 3OU2A 2VF5X 4XDGA 2J3KA 2QR3A 4JBHA 4B5LA 4GLLA 2PD6A 1B3BA 1QGAA 1UBSB 3I09A 4IJ6A 5CH8A 4EUNA 3QK7A 5JXIA 3PPXA 1LCIA 3A9SA 2IL1A 2MYTA 3QE3A 3R76A 4BASA 2H4HA 4K6FA 2UUCB 3TI9A 4C7BA 3NH6A 5ULLA 1JR4A 1VLHA 2DHRA 4YRBA 3F2IA 4IZIA 1EFLA 2ZWPA 1QQBA 4IXTA 4WINA 5AKZA 4C76A 3BSWA 4PZEA 1W5SA 3EGEA 1E3LA 3FH0A 3NKLA 5LMZA 1EFUA 4FYHA 2JGIA 4D96A 1VE7A 5KQRA 2I6GA 4QPZA 4CMAA 1ZH4A 3CO0S 2Q07A 1E9RA 4MVXA 3E4DA 3UFXA 5DHPA 4BVJA 1G3QA 1MHPA 1Q20A 1M1YA 5BNFA 1I7DA 1A9ZA 1OLOA 1J2YA 3MAGA 1TTHA 3B20A 2GZ1A 4QG7A 4RLSA 5C18A 1SKYE 1U02A 2GPTA 1IXZA 3VYRB 5KSOA 4IYRA 3VPXA 4EECA 2AB0A 1OX4B 4BX0A 4HH4A 1R0RE 4QUBA 3DTVD 3UPDA 4DLAA 3DE1X 4XM2A 3CNQS 2CXSA 3WO1A 1CS0A 4U4AA 2RHGB 3WYDA 3L2OB 1MQ9A 1CR0A 4BWFB 1RIFA 2O50A 1WXQA 3B1FA 4UBNA 1Z7YA 4XTRA 5JQWA 2JGNA 2F1RA 5A6SA 4UHKA 1C3XA 1C41A 4KP7A 3KB1A 4GXTA 3IE2A 1HLFA 2DLCX 1YRYE 1XR3A 1DADA 4JROA 1JQ5A 4F4HA 4MAAA 4ZYXA 1C3OA 2HCTA 2EL7A 2FRDC 3BFVA 3RV3A 2LXNA 3M4ZA 4BC0A 4LOAA 1XNJA 3VU0A 2XBLA 2OFWA 4WJZA 3TJRA 4LW8A 2B4AA 1E7YA 5JY6A 4DV5B 2OB1A 3DFUA 5F12A 4DIOA 3VO2A 3L46A 3DQZA 4Y2JA 4AW9A 2G04A 2WINI 1IHDA 1ZO8A 1RS0A 5HKKD 3HJFA 2XSZA 1X13A 4L5CA 2GHTA 3OFSA 3PNVA 4MKXA 1IZ7A 2FP3A 3I9V6 1DPFA 2BEVB 3UJ6A 5JJLA 3BIXA 1A69A 4NCNA 1B2LA 4A1FA 3PJRA 4B81A 4EYKA 5K6AC 3GU3A 5AUQA 3DDUA 3V97A 4R54A 1S2DA 3EIEA 3BA1A 1GZHB 1J49A 2I8LA 3R7SA 1ECBA 3GUCA 3AK4A 2G67A 5CJPA 1KVUA 1XVIA 3D81A 3KBOA 4KWHA 4ZP1A 4LXIA 1JA0A 1TM5E 3VHXA 2OVBA 4BQRA 2EX0A 3W8NA 1VSUA 1ZH0A 3E7XA 3MOSA 1ZOPA 4MIYA 1TUBB 1M8JA 3P4YA 3IA7A 1I33A 3C6YA 2OHVA 5G0SA 2DJIA 4YREA 4BX2A 4D4GA 1IHPA 4M0KA 4EFLA 1Z2CA 3CQ9A 1I80A 1W46A 1YQQA 2D62A 3EQ7A 5JHGB 4QFCA 2NQTA 2DX7A 2V1XA 3QU4A 4LWOA 1RYHA 1ZCZA 4MW0A 1T2AA 2IW3A 1PS9A 2XE4A 3JAWA 3V2UA 4NKRA 4L8VA 2AD1A 2JFBA 5HG0A 1AKWA 3TRFA 4B76A 5DWVA 1LUAA 1VDZA 2EFJA 3JPWA 4P54A 2QRPA 3F3KA 3IBCA 3KAPA 5DBEX 1KH2A 4P3KA 2BBSA 4KEAA 3QBTA 1OFVA 4TOIA 3RIEA 5AI5A 3HHPA 1QGZA 1QHGA 2QTHA 3FUXA 3BK7A 3H2IA 1KR2A 1NFRA 3LVFO 1XCMA 1LZLA 1R9JA 2I3BA 3S5UA 1W96A 4ZVMA 4EMTA 3O2JA 2PXAA 4MV8A 1M83A 3GDHA 2ZSFA 1FP4B 5GOZA 1DJPA 1EFKA 3LQ2A 4GR5A 4CTMA 2J7PD 1HT0A 3UAVA 5TGDA 4ZK2A 1U2TA 5M34A 2DU8A 4IJMA 4JBNA 2P4HX 1FJ2A 4G41A 4X65B 4EQ6B 4KWEA 3D4IA 3ZK7A 1AHHA 4LSGA 3KD3A 1N57A 4KBFA 5K3BA 2NIPA 1T0HB 4HLDA 3VC2A 4HAUA 1GL9B 5EERA 1GCIA 5EZQA 3S68A 2DG2A 1TW3A 1EHIA 4R9RA 3C15C 2OAEA 4LYDA 2J5RA 2IQ5A 1Y1SA 1YZQA 1PK9A 1FUIA 2C20A 4HRXA 4UAVA 3DMNA 3WDLA 2ZRAA 3P20A 1LNZA 3BFPA 3ESRA 4IDEA 2H4XA 2W2VA 1FU8A 1G16A 2OFPA 4DCVA 1XRSB 1KJNA 4W5WA 1MV5A 2CYAA 4MVJD 4Z9BA 4KRFA 1V39A 4UXJA 2LPMA 4RK5A 5AFSA 3DFKA 2O8BA 1MMFB 1FRQA 3LBHA 1YS4A 2MOKA 4KQFA 3SE7A 3NRCA 4QREA 3U9TA 1FRFS 3ZDYB 1T6BY 3FPLA 3FMOB 1QOZA 3IP3A 3OQMA 1QO9A 3D6MA 1X1QA 2YOFA 3VSCA 4QEZA 2BWJA 4LXHA 3ZBUA 1YL7A 4TS9A 4J1TC 2EEPA 3MTAA 2F1HA 2VC2B 4F4UA 4MW4A 2HW8A 3AR2A 1T6ZA 3V7NA 2OCYC 4DDMA 1Q7RA 1T4GA 4NBSA 2IDKA 1XNHA 3UT5B 1TX4B 3ELUA 4B4WA 1M75A 1RI4A 4YPVA 3OLXA 1WXDA 4MQEA 4TWJA 1W36D 1ILWA 2CZCA 1PT9A 4LZNA 3TRIA 1UKVY 3HJTA 1Z6AA 2QJWA 4GPD1 1H2RS 3ZWQA 3ZE1B 4ZEMA 5CGQB 3VNSA 1QS0B 1P6QA 1L4YA 5HQ3B 3TL6A 5IUJC 3BERA 2O48X 3H9BA 3TMKA 3N5KA 1Q6YA 4DMFA 3SF8A 1DPGA 3I34X 2ZJ0A 4IUDS 5FBZA 1BWQA 2B7LA 3KLBA 4GEKA 4REQB 3KYCB 1E5QA 1G6HA 1N3LA 2ZVDA 1TK9A 4DY4A 4EJSC 5C5IA 2ZIAA 2NU7A 4G0XA 4GPIB 4H4CA 3LRTA 4IL5A 4EHJA 1EEHA 2XKBA 3GRAA 1E2BA 3HADA 3HPRA 3SS7X 3NIGB 1OXXK 3F8SA 4V3BA 4YPFA 2QRVB 4OD0A 1EH5A 5JC1A 3A6KA 3R8XA 3GQVA 2C0CA 2Z1MA 3MJVA 4UULA 1CULC 3WDMA 2UXCB 4Q3BA 1Z5PA 1EWYA 3LPNA 3IBYA 3E9EA 2GVNA 4ZU3A 4AY3A 3PUWA 3H7AA 4DQDA 2QENA 4AL4A 4EB0A 3WIEA 1GKKA 3MWYW 3A6EA 1NXQA 1S8FA 4XA8A 4GBED 5EMKA 4RFLA 2GZMA 3L40A 1JR3E 3QVVA 5DLDA 3HCEA 5EVJA 3SSNA 2JA2A 4RA9A 3UWPA 1AZLA 3O4GA 4LC0A 3TRJA 4MITA 1CNMA 1GYRA 1HTBA 2A1TR 3U4QB 1DBSA 4OXIA 3FFXA 4C4PA 4P36A 4B4DA 1V48A 3EA5A 3DPIA 4GYJA 4J7XA 4PSVA 5DBHX 4CDNA 5ADVA 1QRAA 2GASA 1VRVA 1ZHFA 3HBAA 4QICA 3DM5A 1NRIA 2QMOA 5KWJA 1YZNA 3HB4X 4G4SP 4N5DA 3P4UA 2TMYA 5FBWB 1ESDA 1SNYA 5FBQB 2BP7A 2J1LA 3IQHX 1DAPA 4PZPA 1EDZA 4UTNA 1YCGA 3ZLJA 3J7TA 3NIFB 1ECGA 1ECLA 4O3MA 3V1LA 3WRYC 5KYNA 3TLJA 2WM8A 1CUIA 1D2AA 2Y92A 3K5IA 2QLNA 1H23A 1FQKA 2IT1A 3DGEC 4OAQA 1HR0B 1MB3A 1X70A 3SLGA 1QCZA 3OPYB 2EKQA 3QW2A 3PPYA 1YZHA 3HABA 3DMGA 3NGMA 4HDRB 4N48A 1M2OB 4B6OA 1G0NA 1YMVA 4JQYA 1ISPA 3DAYA 1ULZA 2P2NA 3QVWA 3GO4A 4Z2YA 4BGVA 3U4AA 1ISMA 1PJLA 4RYDA 3F3YA 3PUKA 1E3TA 1U3DA 3HNPA 1F4PA 1EFPA 3LX6A 3IQWA 4MVJI 3QY9A 2C83A 5ALYA 5CB4A 3JATA 5LOVB 4UQLA 4OU5A 4NARA 3T4EA 1IPFA 2XLBA 3I4CA 4AUEA 2OQVA 1NM5A 3PU6A 1XOIA 2AG1A 1CZKA 1V2GA 4AYXA 3SBEA 2HRBA 2P2LA 4GX5A 1MAHA 1MPXA 4NZOA 3GR6A 3IV6A 2OG2A 3EHDA 2JIBA 4FHEA 3BF8A 3LIIA 1RMQA 4X97A 3E1SA 3U17A 4G5YA 2RJNA 1RJDA 1P2GA 4JIGA 3ZGZA 4HQNA 5HYVA 4H6PA 1JEOA 3WMXA 3WZ2A 2D0IA 4LOKA 3K9BA 5EPUA 2EFCB 1TU3A 3VHRA 3B6ZA 1R0LA 3O8BA 4AICA 3TTTA 3VZSA 4L0QA 4ENPA 2DJ5A 2JIRA 2W8BB 1JR3A 3KK0A 3VZDA 5JVDB 3CCFA 3ELDA 4JY7A 3SQNA 4YT5A 4MLPA 1PJ3A 5ER6A 3MGAA 1ORTA 4MIKA 5CG2A 2I2AA 4GL4A 4DAOA 1D9ZA 3TLXA 2OHIA 3AW9A 2PUHA 4HX2A 4QOFA 3ZWPA 3KXDA 5JNWA 2E4YA 3QBEA 3E5RA 1OXTA 1P62B 3HO1A 3ZZTA 4ZQHA 2PKEA 2J7PA 3U62A 3W4JA 4CIAA 1MVLA 2CLDX 4Y6PA 4L8FA 5BY2A 4JUAA 4LNHA 4NCJA 2XB4A 1A1SA 4TLEA 2XNDA 1SG9A 2NO5A 2ON6A 2ZE6A 1WTAA 3R3ZA 1N6KA 3AJ9A 3BXZA 4CU2A 3R9XB 4GKBA 4Q00A 3W5HA 5AQ1A 1SVKA 3O03A 4K3UA 4MJ7A 4YV0A 2Z8XA 4EEXA 3ZJUA 2D0OB 3GHYA 1YVDA 1ORVA 1IN1A 1AS2A 1J5PA 3EGCA 3N0XA 4OJNA 4OQQA 4LOIA 1W5TA 1YIOA 1SXQA 1MTOA 2BKXA 4EY8A 3RF6A 1O94C 3L06A 3C6MA 3C1AA 4HB2A 3PXEA 3K8QA 3TJMA 3OU6A 3WLFA 1TT5A 2IYSA 3NUQA 4IZHA 1E69A 2WFLB 1Q1QA 3AL0C 4FHCA 2GBIA 3EWIA 1VKZA 2IFTA 2BW0A 4M1OA 2EERA 4QDTA 3EPHA 1JQAA 2PWAA 5JSZA 1UM9B 1YQTA 3V4SA 4QYSA 2XMPA 1JJBA 3OCJA 2WV9A 1XTKA 2GI4A 2ZRCA 3GAFA 4G1VA 3NHYA 4G0VA 2BGKA 3R20A 3MGKA 1WKVA 4O1HA 2OV1A 4AJPA 4DCNA 5B12A 3CO5A 1AGPA 2FCRA 5D3ZA 2AC4A 4YUZA 2E5LB 1SU7A 3W2HA 4B09A 1XO1A 2ODNA 5ETJA 1NW5A 3I45A 4EVIA 1R9NA 1TOAA 3JVVA 4ZO9A 2IY8A 5TXGA 5AXBA 3RU9A 4LVOA 1KDZA 4OHBA 1HXHA 2CXTA 2K7FA 2GYVA 2A0FA 2A30A 5ALOA 1LDGA 1JECA 1Q11A 4NBKA 1GILA 1MW8X 1FOEB 4HSGA 5B7PA 1BNCA 4V38A 3RYIB 4J0KA 1Q3KA 1U5BA 1IZ0A 3FDFA 3IPAA 4TM8A 1DO0A 3RRXA 1ZH6A 1W29A 5BYKA 3OHMA 1NDUA 3PF8A 3PQ4A 4PLGA 1K9VF 4PONA 4BBAA 5LR6A 1NBOA 2PRZA 5ALSA 5K8TA 3GLQA 2JKVA 1L7VC 3LGAA 2WA1A 1YK0A 2WSLA 1HH4A 1V7PC 4GLOA 5GM1A 1XRLA 5JASA 1FCJA 1M6YA 5TS3A 2X2OA 3C7TA 5DXAA 2IH5A 3KVYA 1F60A 3LC7O 2PIAA 4LHEA 4M9CA 3NT2A 5K0CA 4K9RA 3T7IA 2O8DA 1E6WA 4GXQA 5U4XA 4Q19A 2YWDA 3ES9A 3NVMB 4IFTA 1TEVA 3AM1A 4NBVA 4RTJA 1TKAA 3P2YA 2YIMA 4KPUB 2ZREA 2RC6A 2N46A 3DJFA 3RVKA 5A5VA 5AVRA 2F1KA 4BB9A 1M6HA 3FF4A 1W4LA 4E4TA 1OH8A 3MGCA 1ECPA 4BAUA 5LJIA 3VOAA 2QZPA 1KKMA 1U6IA 3AEKA 5EIBD 4BIMA 3AG6A 2W71A 4GVPA 2QN7A 3HSSA 1DXHA 2R6JA 1V9CA 5T3UA 1JLMA 1UXIA 5IAKA 5E3HA 4G3XA 4M0LA 1E7WA 2FK7A 2DSTA 3TTVA 2ASEA 3M5WA 4G97A 2Q6VA 4LOHA 4P1ZA 4RD3A 2QRMA 2JI8A 2ZRQA 1GG8A 4R9SA 4L75A 1N6LA 4M22A 4X1KA 3WAKA 4WQMA 1T6XA 1ZUIA 4PINA 3BZUA 2HMYB 4BFXA 2YIDA 4UEKA 5DLYA 2A9PA 2D7DA 4IQFA 1II9A 3THXA 2K2QB 2OBYA 4GMGA 1VSQA 1ZK2A 1U3TA 5BSWA 5K45A 1E1KA 1ODTC 1EK1A 2AX3A 2B21A 2BFFA 2HT6A 3A6ZA 4FZRA 2VPZA 4AZWA 1OTXA 3CMMA 1V0JA 2YRWA 4AF8A 4D0SA 4QD3A 4DMGA 3I2KA 1EUDB 2V6JA 1GKLA 2JCYA 4OGLA 5LYYA 1LSSA 1FEZA 3VSDA 5EUMA 3L92A 2ZPUA 3FUCA 5TY0A 3EIUA 1TQ6A 1M1NB 2PV0A 2EZTA 2DT5A 3K1JA 3WAJA 5JS2A 3HVUA 1A77A 3KPJA 3N75A 3NGLA 3NOOA 4GE3A 1M7HA 2BBWA 3K0CA 1DRJA 3BSSA 4RZUA 3A6JA 1J8YF 1O9GA 5JAPA 2FWMX 1VXRA 1TCBA 4LJ5A 3UKOA 4Y9DA 1BMFA 1CP3A 5CLGA 4D25A 1GRVA 3KKNA 4CM7A 1U80A 4WNAA 4E7PA 2JJ1D 1C9KA 1JFLA 5LZ2A 1TUGA 1QR2A 5CX1A 4BATA 3N74A 1X2EA 3N8HA 4DR6B 1P4AA 5LZ7A 3GJXC 2Q5HA 3EXIA 4L5YA 1WS6A 1JPUA 2QT0A 3QFFA 1WNFA 4PCUA 2Y8EA 2YICA 3T41A 3K32A 4DIDA 1G66A 3LT5A 3TKLA 4KIJA 2D1YA 2X5JO 3X2SA 5LYJF 1PNQA 2O06A 4ZZ3A 2WTEA 2CLLB 1RJEA 1LPOA 3DHEA 4R9VA 2R6AA 1JAIA 2V8OA 1TT7A 1XJWA 2QROA 3UBMA 5LDGA 2FHSA 1RQPA 4DMUB 1LC0A 3IXQA 2IYNA 3D8UA 3ZS8A 3TFWA 2V65A 4DA6A 1ZD5A 4JLMA 1AHPA 1SIUA 4BCDA 4WY2A 3KUXA 2EV9A 2IYOA 4WXHA 4D7AA 5AKKA 1N77A 2BSQA 4IO1A 3BUSA 5EYPB 3U4HA 4YXWD 5EGSA 4KNWA 5K0JA 4PTLA 1C14A 3KYIB 4Y6GB 3RK4A 4LE2A 1QGDA 4ZJYA 1ISJA 3L0BA 2JD2A 4G5OA 3D6TB 4TRJA 1E1NA 3ZQKA 3ZU6A 1C1XA 2JJ1A 1J7KA 2E6KA 3W3ZB 1P7VA 3AGPA 4RF3A 3WQBA 1YOVA 4B35A 2DP4E 4NENA 5P21A 4TQGA 2DQYA 3OY2A 4GGOA 2WIKA 3TOSA 1UZNA 1OAOC 3ADDA 1JMKC 4PQFA 421PA 3NBAA 3BCHA 3EN0A 3KR0A 3I2FA 2ICAA 3PGXA 4IY1A 3VJLA 1Z7GA 4PWYA 1X87A 2HWXA 2PD3A 5BW5A 4CG2A 2E4XA 5KMGB 1PSWA 1EUZA 2Y1CA 3L1KA 1PQWA 1Q7GA 2B1JA 2HK8A 3AZPA 3E8SA 1J8VA 2EDCA 4R8RA 2YFKA 3CX3A 1R64A 2FB9A 4FC6A 5EWLB 3F4KA 4JEMA 1R12A 4LIPD 4YJ3A 1V95A 3AR3A 1CZUA 5DNUA 3GLGE 4PO9A 1NMXA 4CBVA 2OP0A 1M2OA 2WJPA 2X0NA 3EF1A 3AF0A 4JKOA 2GEVA 4AZ3A 4A7PA 1GUFA 2JLBA 2GKSA 4D0GA 4Z7OB 5DN6D 2R48A 4XCXA 2XUDA 1JJFA 5FPYA 3N59A 1ZSYA 4KK4A 4K9NA 1NBIA 1EFHA 2JGEA 3L0IB 2BEUA 1NUHA 2G77B 3ZX5A 2I1VB 4WZBB 3RREA 3AC0A 4XB1A 4DPKA 1IIRA 3G2JA 4FFOA 3BFXA 4L9AA 1OTYA 2CNWD 3OTHA 2GXSA 4PXSA