4DCNA

Crystal structure analysis of the arfaptin2 bar domain in complex with arl1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
TREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/signaling protein
molecule keywords ADP-ribosylation factor-like protein 1
publication title Structural basis for membrane binding specificity of the Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-2 determined by Arl1 GTPase
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcnA00
2KSQA 4UNQA 4ZCMA 4GBMA 3AF0A 4QJ5A 3GLIB 1E9BA 1NMYA 1TTTA 2QAJA 4H9GA 1ZC3A 3KJIA 4MRNA 2HT6A 2IYWA 3CNOA 4FWTA 3SEAA 1U94A 4PFSA 3B2EA 5LB2A 2WMOB 2ODBA 1UADA 2I3BA 1EFCA 2ZAOA 4TMWA 4RD4A 3IIMA 4B2LA 4TL9A 3L43A 3AVWA 3GP8A 1VTKA 2Q6TA 2EW1A 1VYUA 1ZRHA 4EQ6A 3DMNA 2QEQA 4FMDB 4IOLA 3QBVA 3V9PA 2QE7D 1SULA 3OESA 5EE5B 2EU8A 4GI7A 2VSOA 4PSAA 2D4HA 2G83A 3D6TB 1JAHA 4DEYA 5J4LA 2C77A 5F3WB 3K9GA 3SBEA 4MH0R 4BLPA 3ETLA 4JL8A 2ODEA 2CEAA 3QPVA 4JLJA 3T1OA 4CEJA 2OO7A 5AUPB 1ZUNB 1CLUA 1OFIA 3EARA 4FN5A 2CCKA 4HSEA 1UEIA 4LJAA 4QL3A 1J8MF 1DAKA 2FPKA 4Y0AA 5DGXA 2OZEA 3DM9B 4QC2A 2QE7A 4US1R 4B34A 3KDSE 3BBPA 1Q1ZA 2GCOA 3QXXA 3VKHA 4BFVA 4ZCLA 2GESA 1U99A 4ZI3A 4PZLA 3CPEA 4PANA 3GCGA 1YR8A 5B30A 4S2EA 4PSKA 4LSGA 1BYUA 5FBVB 3SDZA 1P61B 4OI0A 1QHYA 5EE9A 4WXRA 1ZM9A 2H17A 3NH9A 2EYUA 1BO6A 4LCBA 4KV9A 4L9SA 3SQWA 4IVRA 2DBYA 2ZUCA 4Q4LA 1GTVA 5CJ2A 1UBFA 3ZZUA 1XBTA 4P33A 5JHGB 3FDIA 1CJVC 2A5JA 2BV3A 2IYTA 2QROA 4CIDA 2G1JA 2GKSA 3H2YA 3KQHA 2PCLA 1ZAKA 2W6JD 4EIWA 2B8WA 3BH0A 3RSOA 5EE0A 3A1TA 1E2QA 4PSVA 5FUWA 3WNDA 4DVGA 2IS1A 1MV5A 2IYUA 2GCNA 2QM7A 1P6XA 1OKKD 3G5UA 1R0YA 3SFZA 2WAYA 4XD7A 3W6OA 1ZU4A 4GNKA 3LBNA 4B3BA 2A5GA 4LYHA 4U02A 4ZKEA 4LY6A 2DHRA 3VMFA 2VSFA 2JJ1D 3AVPA 3HU3A 3OAAD 2HEIA 1FP6A 3W3AA 2BCJQ 2W6JA 3KX2A 4KITB 2BBTA 1VHLA 1E2JA 3UMRA 4M1WA 1DAIA 2CL7X 2MSDB 4Q1DA 5KPDA 1OKKA 1II8A 1DAHA 3QIAA 3AF4A 3R7WA 3KQNA 3NHAA 4OBEA 1I4TD 1UKYA 1JR3D 3NEJA 1OIVA 2H18A 4Q4JA 4Q9KA 5KNBA 3GLFB 3QKUA 3BOSA 3T06B 4FXPA 4ZCIA 4LJYA 4QNRA 3UANA 2JJ1A 4XTRA 3OAAA 4TLBA 4A8JB 2NMVA 3NH6A 1FZQA 2ONJA 1AZTA 3VR2A 4KFTA 3LA6A 1UDXA 4TLDA 2VTKA 3AEZA 1KI2A 1T3HA 3VR4A 1Z6TA 4LK2A 4KSBA 4KBFA 2JLSA 5D3MB 4E5UA 1JR3A 1ZINA 4LX0A 4RCZA 4OQXA 1XJ0A 2ZSFA 2OXCA 4X8LA 3TQFA 3BFKA 2ZJYA 2IYQA 1XCMA 3WBKA 4ZDKA 4MKGA 2IS2A 1CF4A 2DYKA 3IEUA 5FOXA 4B43A 3NBYC 2OE2A 2C98A 4OQNA 1YRAA 1NSTA 1W4BA 3B8HA 1EFHA 3CR8A 1XFAA 4JLVA 3WYGA 2ZYVX 1ZM2A 5LPNA 4JBXA 2FH5B 4KCGA 4TYPA 3X1WA 1YZKA 4NYMR 5K8UA 1M74A 2P67A 3KFXA 3RS0A 1P9NA 3PQCA 1TX4B 3NEYA 4A92A 2R8RA 2OBNA 2A78A 3PV0A 2CE7A 3K09C 1OJLA 4N3NA 1UM8A 2EQBA 1UBGA 1VPLA 5AJVB 1WMSA 4FD2A 2KBFA 1I2MA 4PO1A 1P2SA 2ZU6A 1Q44A 1II9A 5F9FA 4ESHA 3GJ8A 3QENA 3QJYA 4AYXA 1S8FA 4B35A 4BFWA 2IT1A 3OEHD 1S9HA 1NL3A 2ANBA 2OFXA 2B21A 5G53C 4YMWA 1CJUC 1PZNA 2ZRAA 3CW2A 5BN4A 5M04A 1W4AA 4DRZA 3T1QA 2ZE8A 4DB4A 3CNNA 1FOEB 5C4GB 1M2OB 2J3EA 3CLVA 3QG1A 1JAIA 2YVUA 2GJAA 1E9DA 2QMOA 4CT5A 2QPOA 2YWGA 5JCPA 1QHNA 1XZPA 4XWAA 1MO6A 1NIPA 2RMKA 4IW3B 3PEVA 1X6VA 1KDPA 1JB1A 4A8JC 4M9XA 2Z5FA 2ZJ5A 2QTFA 2REOA 4HLDA 1XTQA 2NO0A 3THXB 4OK6A 4C0AC 2BEKA 2REBA 5EXPA 1R5OA 3IHLA 2RGCA 2NPFA 4URUR 3LV8A 3BXZA 4HAYA 4NL4H 4TYYA 1XMVA 2CK3D 4ILEA 4URZR 4WVFA 3E70C 3LX5A 4TTRA 1YZNA 2XB4A 4AURA 4NCJA 3GD7A 1DADA 3TSZA 4MRPA 2HCBA 3R8FA 4MRRA 1XTJA 1VCOA 2FZLA 2IK8A 5EE3A 3T1TA 2ERYA 1X8KA 1PV4A 1KSFX 4TN1A 4LV5B 1ZD1A 1G41A 4XVRA 4BWYA 4WA7A 1HE1C 2QBYB 1KK2A 1NN5A 2ZRGA 1Z0AA 3T5GA 2FA9A 2FSGA 2PZFA 2CK3A 1VIAA 1VIYA 5CB6A 1KKLA 4K46A 1KI4A 4DIDA 5A5GA 4CZ2A 1NLFA 2DFNA 3QF7A 2NZ8A 4LV8B 4NYMQ 1GKYA 2ZRIA 3ZVLA 2ZSDA 3T1VA 4ITRC 1E96A 3SQXA 2ZJ2A 4B73A 1NVUQ 3C5CA 4PAOA 5JRZA 3F5FA 4A36A 4HAVA 2KI5A 4V0KA 4RJLA 4D0NA 1F6BA 1Z47A 4BEBA 2FX3A 4BLRA 4IHQA 2GXSA 2OESA 2J59A 4DCVA 4UNNA 1X1RA 4MUBA 5H8WA 1Z63A 1XD2A 2QRZA 3A37A 3SZRA 5KU1A 1CR2A 5CIQA 2CMKA 4QKQA 2BOVA 2YJTD 1G9XA 3FHOA 1OH7A 3I32A 1JQJC 4NDZA 4Q02A 1E2GA 2OXRA 4LHZA 4EQ6B 1IY1A 3RC8A 3RDPA 2FN4A 4BPBA 2IC5A 1TQ6A 5DHAA 3BC1A 1XD9A 3H86A 3IPYA 2YV5A 2ZI5A 4X8MA 2WIAA 3SR0A 5L3VA 2P6RA 1BOFA 2KE5A 2ZSEA 2KB0A 4PO9A 5CDFA 4AG5A 4CEJB 3B78A 2O8EA 5EZ6B 4TQAA 5JLJA 3KTAA 2PMKA 4BFZA 2VP9A 2IF0A 4JLBA 1WBDA 4CEIA 2CL0X 1G8PA 3PJRA 4MKIA 3FMPB 2G88A 3ZZTA 4BFTA 5KDDA 2B92A 3EWSA 2LWIA 1S96A 3KL4A 4ACBA 4JLKA 3U7FB 2VHJA 2PX0A 1PLKA 4OQMA 2C95A 1DAEA 2JIZD 4RCYA 1NSFA 1ESNA 1XTRA 3QQ5A 4QBFA 5DYIA 1R0ZA 4D2IA 3ZD6A 1SKYE 2EFHB 1Z83A 5G41A 3IILA 3A1WA 4UNPA 4M2LA 1F2TA 2YOFA 4B47A 2OILA 4BQSA 2C9OA 2HXSA 2C2HA 1RIFA 2ZI9A 5GJWC 4EPTA 4V0OA 1AQYA 4CYMA 1WP9A 2ZE7A 1XX6A 4DLSA 3TW8B 2ERXA 4LYAA 3X1DA 4JLMA 2EFGA 4I1OA 1QHSA 4H1VA 2ZSAA 3WP0A 2Q9CA 2QENA 1KDOA 4RD2A 4LV6A 3PITA 1K6MA 3NXSA 3KJHA 3P27A 1M1YE 2BJWA 4TMVA 1TF2A 1W2GA 4CEHA 5BN3A 3TUIC 4BLSA 1Q3TA 1OXVA 2WHXA 1VYVA 4P4SB 3SC3A 1OXSC 2PZEA 3CH4B 2V7QD 5EZ5A 1R6BX 1NMZA 1U8YA 4TMZA 4Q9IA 2O8DA 2Z83A 4JBYA 4BEJA 2NPIA 1O3YA 1W47A 1HY3A 1E9EA 4GP6A 4I1UA 3T34A 4M1KA 4KFUA 1QRAA 2CVFA 1G5TA 1CR1A 2ZRDA 3RS5A 3T15A 1T8TA 3K9LA 3OIYA 1KJZA 2BBOA 1KO4A 4WBSA 2XXAB 2IUUA 1KZ7B 4M21A 5FOSA 1GNQA 3RRYA 2X2FA 4G1UC 2ZRCA 1SVMA 1U9IA 2ZEJA 2DWOA 4NPHA 5FH9A 4BUJA 2V7QA 4KJZA 4ZKDA 2PJZA 2IBMA 5EP4A 2A5FA 3QXHA 4Q7KA 4POAA 3SU8A 4TYNA 1ZCBA 2VP0A 2AR7A 5C46F 4JIMA 5FPKA 3AQ4A 5JMTA 3AP1A 3KXIA 1G3MA 3LW8A 5JJKA 3D31A 1T5IA 1Q20A 1JJ7A 3H1TA 2BVNA 4DDUA 3AVXA 1A5TA 1BIFA 4US0R 1JR6A 4EPXA 2VBCA 4RZ2A 2OSBA 3TBKA 1YVDA 3EA0A 3A8TA 4TL8A 5CM8B 2J0UB 5FL7A 4BECA 2Q9AA 4HLUA 4LC1A 4P32A 2GHIA 1U2RA 3GLHB 3KB2A 4MRSA 4ZIRA 1EWQA 2O8BA 1M7HA 2PEZA 2FSHA 3RRMA 4EJSB 1E2LA 2WMNB 4YMTA 4Z8YA 4V0MA 1C1YA 2V6IA 3D8BA 4R98A 2DPXA 1RRGA 3FMIA 1XU4A 4P0TA 4NKRA 5GVRA 3QF4A 4C9BA 1NIJA 1CR4A 521PA 1E9RA 1JNYA 2YYZA 3ICQB 4QHTA 1XTIA 3KJEA 2ZRPA 1G3UA 1OH5A 4C30A 1LF5A 1ANKA 2F6RA 4TTQA 5JWRA 4A2QA 2XNSA 3MD0A 1FMLA 3BORA 4FMCF 1IXSB 3Q5EA 2ATXA 3MAAC 3L82B 1AS3A 5DI3B 3AUXA 1SVSA 1LB1B 1RZ3A 4HDQB 3CUEF 1T6NA 4DLXA 3K70D 2R65A 5L3SB 2I1QA 2Z43A 3ADCA 5EP3A 4FW9A 3OE7A 5JSZA 4D25A 4JJZA 3M6AA 3WXMA 4QOSA 1ZVQA 2VF7A 2V1XA 3OIVA 2MSCB 4LHYA 2NO6A 4B3DA 1Q22A 4OHVA 4B3CA 1GDDA 4G5RA 2IYXA 1W49A 1FNMA 2IX3A 1EK0A 3WYFA 1CP2A 2QG6A 4M0LA 5J4KA 1OIXA 5TV2A 2ZPTX 1W0JD 1J90A 4ZV4A 5J4YA 3FGNA 2ZM5A 2J0QA 2ZE6A 4DLTA 1KYIA 3SYLA 4N0DA 3E5HA 1KK0A 2OCPA 3ND9A 4FINA 4M22A 4Z1MD 2G1KA 2HF8A 4NCIA 4DB2A 1KI3A 2VP5A 4E03A 2J7KA 4ZPXA 1RYFA 1XXHB 8OHMA 3UXMA 3CWQA 1IN7A 1UEJA 1P5ZB 1Z06A 1W0JA 3OHMA 3WYAA 3G0HA 3I5XA 4DJTA 2GEVA 2IYLD 2Z4SA 4PAQA 4OYHA 5E7IA 5EQTA 3U3MA 4CW7A 1Z29A 2QORA 1GG2A 2J41A 4EJSC 4ZI2A 4GMXA 3QEOA 4D4KA 2Z0MA 1A2BA 2VLIA 3NBZC 4BGDA 3VX4A 1KK1A 2OBMA 5BW8A 1NBMD 3ZH9B 4MYHA 4D80A 1XEFA 5LD2C 1QHGA 2IXGA 2J7PD 4LYJA 4DDVA 2FZ4A 5FPYA 2V4ZA 3ZLJA 3LFUA 1YR6A 3VKWA 3JZAA 1N6IA 1CKEA 1M6NA 3BAFA 4PXAA 4AIIA 3VKGA 4B76A 3AGQA 4ON9A 2GVDC 2OAP1 2E87A 3P4XA 1NVVR 1CU1A 3ND8A 4Q47A 1N6OA 1KI1A 3A4NA 1NP6A 1WE2A 2GILA 3WNBA 1AIPA 1NBMA 3EASA 2NG1A 1PLJA 2ZS8A 2E9SA 2WWXA 2J7PA 5E7JA 3DKPA 4TSFD 2EWWA 3Q7PA 1U90A 1T3SA 2QP3A 1JPNA 3K9HA 2PMDA 4JBWA 2ZRJA 3GLGE 2J45A 5CIWA 2ZETA 2VL7A 1C9KA 3U60B 4C7OA 4DLWA 2CVHA 3AVTA 2GXUA 2VSXA 4QXAA 2IS6A 5FOVA 2AHOA 3WMGA 1ETUA 4HAXA 1UKEA 1J8YF 4FCWA 2JLQA 2IHBA 4GZMA 4D0GA 2D06A 2D2FA 2WV9A 3X1ZA 3SFVA 4CDGA 4TSFA 1K8RA 1E9SA 2ZSBA 5CK5A 2X1VA 3I62A 4AC9A 4EFNA 5KUTA 3QUSA 3DM5A 4QRHA 1XTKA 4MYTA 3KTAB 4A82A 3DKVA 1FNNA 2ORWA 1HT1E 3MFYA 4GT1A 1UBCA 4CF7A 2FDCA 1BYIA 4U00A 1E99A 1E2EA 4IDQA 4RKFA 1TL7C 2BM1A 4MITA 2O52A 5JS8A 1W5TA 4PC7A 5JFGA 3H0KA 2ZXUA 3GEHA 2MSEB 3AVVA 3U6KA 4AK9A 3O8RA 2C04A 4JT2A 3DVLA 4GOJA 3SNHA 3VX3A 1F2TB 4NCNA 5L8VA 3GLIE 2YINC 5B57C 3EZ7A 1K5GA 2H7VA 1P75A 5EE1A 1A1VA 1OV4A 2GZHA 4PPGA 2FWRA 1N6NA 4Q1AA 3DL0A 3FPAA 2RB4A 3K0AB 4LJ4A 1GAJA 3B1ZA 3KKQA 5BN5A 5KHOC 2WM9B 2YOGA 3THOA 1KI6B 5F9HA 2ZVQX 3C16C 3U7GA 1G20E 3E2IA 2C9YA 3SBDA 2C03A 1XJQA 1HUQA 4RZUA 3RRNA 2OFOA 4KO8A 4NYJQ 5CK4A 4US2R 1HA3A 3GPLA 2YKGA 3I73A 5DE3A 3IDQA 4CEHB 4OL0A 4ABYA 3EZ6A 2ZRFA 1SKQA 1NVVQ 1Z3IX 3P32A 3NWJA 1FX0B 1WA5A 1TQ2A 5DLQC 2JA1A 4G3XA 3A58B 3HR7A 2ZJ8A 3BH6A 2C5LA 3DOFA 2VP4A 1MKYA 4FMDF 3TR5A 4WW0A 5EP2A 3LXRA 2JAQA 5C4MA 3S1AA 3AV0B 3VHXA 5DSZA 1I2DA 1G8GA 1DBSA 1SXJD 4Q01A 1DS6A 3I3SR 4C0QC 5GADl 2Y8EA 4XJXA 2QN6A 3MWYW 1R7RA 4Z8XA 2D7DA 1G18A 2C9CA 4B3FX 1U81A 1X1SA 2Z4RA 1R5BA 4Q7MB 4WZAE 2GDJA 4LBYA 2BWJA 5GJVC 4HUTA 1I4DD 1YQTA 2VF8A 1IQPA 3AP2A 3AH8A 2NO7A 3CX6A 1R10A 3K8YA 2GK7A 1J2JA 2QUZA 3EIQA 1Q0UA 1SXJA 3WBJA 4MKFA 5LDDC 1RJ9B 1U8AA 3BFXA 1ODFA 5D3QA 4MKHA 4QHSA 5FTKA 2NGRA 4EPVA 4AY2A 1PJRA 2RGNC 2VPPA 1OH8A 2ZR9A 1ZW6A 4CGZA 3TSOA 4FMBB 3F3YA 4XWKA 1IAQA 4DT1A 1G6OA 1UKZA 4XD7D 3FVQA 5FTJA 1P60A 5E3HA 2ZUDA 1IN4A 4GOXA 4DHEA 2O8BB 2QTVB 4UJ3A 3ZQ6A 3VR5A 1E2FA 3KZ1E 4Q00A 2FU5C 4HZUB 4F92B 2JEOA 3TAUA 3QF4B 1ZNWA 4R71A 2J5XA 2A3RA 3W3ZB 1JBKA 3ASZA 3IIKA 3L8ZA 2QU8A 1XCGB 2HJGA 3BB1A 3ZS9A 2Z6VA 4KI0A 2BMJA 3AKDA 4DLZA 5C18A 1VG9B 1GNRA 3GLFE 4LOAA 3U61B 3EA5A 4B75A 5TMPA 1YZGA 2ZI3A 2ZRNA 1HEIA 2F7SA 2WJYA 3MCAA 2XGJA 4NTZA 4JLPA 3QPUA 2O8FA 1IN8A 2G0NA 4IOJA 5JZVA 1G16A 1J99A 1PLLA 2P6UA 5FTNA 3RHFA 3QXCA 4KFSA 1TU4A 2XZLA 3PG5A 1W46A 2QP4A 3TKLA 4L4UA 4MGIR 2WJHA 5CYPA 2L0XA 4EKDA 3EPHA 1X8LA 1E9CA 1GRQA 4YLGA 3BK7A 1XRJA 5KO2A 5FI0B 2F1RA 2NO9A 2CHVA 1QF9A 3A4MA 5DO9A 1IN5A 4TLAA 2GBLA 4URVR 1Z2AA 2ORVA 1E0AA 1D6JA 2C96A 5LBIA 3IO3A 3P1JA 2QAGA 4HEJA 3NC0C 2VH5R 2HUPA 1A7JA 3EC2A 1EESA 3A1UA 2W2VA 1WBBA 2XAUA 1P2UA 4DKXA 2PBRA 1ZBDA 1IN6A 4QBIA 2ZRLA 3IUYA 4Q9JA 4YMVA 4IJMA 3EZFA 4AWXA 1H8HD 3MMPA 2QSYA 3BJIC 3U44A 4IEEA 5KSOA 1KO7A 1Y3AA 2ANCA 1HV8A 2R6AA 4UKDA 1P2VA 1R0WA 4RD1A 5BQ5A 3SN6A 1V43A 4R2IA 4DZZA 4A4DA 4F38A 1GRRA 2BC9A 1E2MA 4HAWA 4LYFA 4NHOA 3DDCA 4U7DA 2F43B 1GRNA 2XNDD 4PHTA 1OSNA 1QBKC 1H8HA 1A2KC 3AM1A 2F9MA 5TY0A 1NY6A 5H70A 3I8XA 2NOAA 3L2OB 2F3TA 1DO0A 1W36D 2GTPA 3QKSB 2QQEA 3GQBA 3Q3JB 4TTPA 1MO4A 3LD9A 4QGGA 3NVAA 3FKSD 4F4CA 1AKYA 3CF2A 2ZI6A 1K5DA 5AJYA 1SHKA 1HYQA 2QGZA 2R6FA 1VCNA 2XNDA 2WZQA 1VCIA 2JLRA 5L3QB 4TMXA 1TF7A 1AS2A 1YZQA 4FCTA 4Q4HB 3THWA 4WIAA 1R8SA 3VNUA 1CEEA 1D9XA 3Q7QA 3Q5DA 3CF0A 2IUSA 1HQYE 2QA5A 3L0PA 4Q5IA 2YWHA 3JVVA 2X2EA 3EIEA 4DLUA 421PA 3B7GA 5H1YA 3FKSA 2N1BA 4XH9B 1RE0A 3LNCA 2O8CA 3BH7A 5GVSA 1VDZA 3DHWC 3NBFA 1V5WA 2IYVA 1N6LA 5FR2A 3AGPA 4L9WA 2QPTA 3TH5A 3CB4A 3CF6R 1N0UA 2WWYA 3SI7A 2J0SA 1XEXA 2FEMA 3CPJB 3CRMA 3AVQA 4M9SA 1EFRD 3P4YA 4GFDA 4RD3A 1WXQA 3X2SA 5AUNB 3RS3A 1E2PA 4M9QA 3PUZA 1AGRA 3SOPA 3UATA 3RYTC 2FNAA 1AK2A 5KNCA 4D81A 4CVNA 2GZDA 4KXFB 4EFMA 3U4QA 4A2PA 4OI2A 3IBYA 1BKDR 1FL9A 1E2IA 1F2UA 4G5SA 5J47A 1OXTA 4OQLA 1NY5A 4DSUA 3BB4A 4NH0A 1SVLA 3CRQA 2IHYA 1ZUIA 1RRPA 3NIBA 2QT0A 3WRYC 4GSYA 3OEED 3U7EB 2FGKA 1EFRA 1E0SA 4XWOA 5FBRB 5CITA 1OH6A 1U98A 3AF2A 2IUTA 1OF1A 3F8TA 1KI8A 1DVRA 1N5IA 3BRWD 4Q1FA 2CCGA 3CRW1 1OYYA 3VU9A 3OF5A 5TARA 4A15A 3X1YA 3WY9A 3G82C 4BZQA 5FI1B 3FWYA 1C4OA 2OCYC 4TMKA 3MJHA 3OZXA 5ELXA 2IXEA 2JASA 3WP1B 1ZM7A 3PUVA 5SZHB 1VG1A 4JLDA 3RSLA 4QNMA 3WHLA 3OEEA 1KGDA 1EX6A 1WQ1R 3JZMA 3QKTA 4BE7B 2YHSA 3CZQA 3K0CA 4OI4A 4A9AA 4NONA 2GEDA 5JHHB 4J0QA 1Z8FA 1VCMA 1G1MA 1MT0A 1QHIA 3W90A 1KJYA 1AS0A 2FF7A 4GP7A 4E09A 4FI3C 3U3KA 5ANRB 3LQQA 3GEEA 1W0KD 2QMHA 2TMKA 3S1AB 4TL7A 3NDPA 1HH4A 4L5BA 4URWR 4LBWA 1B23P 2PX3A 1TUEA 2YC2C 2JLXA 2RAPA 4ERNA 1JPJA 3LLMA 4GZLA 1QVRA 4UNRA 1E32A 3U6BA 2RHDA 3LBHA 1EGAA 4RFSA 4NCHA 4TQUS 4D6PA 4PQFA 5B64A 4JVMA 4KYIB 1OYWA 4PR0A 3TAHA 2JGNA 4NU0A 3C41J 2NIPA 1OLOA 1W0KA 1D8TA 1KHTA 2OCAA 4JYBA 1OHHD 4LUCA 4DDTA 1SXJB 2GCOB 2OFWA 1T4GA 3MG9A 1UJ2A 2P65A 2F1HA 2AD1A 1YZUA 1KAOA 1VYTA 2ZAMA 3NHBA 4EDHA 3O8CA 1E9AA 2XZPA 2BEJA 2WBLC 5J4HA 4JMPA 1XWIA 4P31A 2EVWX 1XMIA 3GLGA 3SYKA 4DT1B 4TQ9A 4ZDWA 4N0EA 5JJLA 1M7GA 1R0XA 1WRBA 2XOKD 1Z0IA 3IQWA 3QBTA 1ESMA 2W6ID 4O0MA 3ZYCA 4ZO4A 1UKVY 3B1WA 5HE9A 1OHHA 2FFBA 2ZR0A 5FPHA 2H8KA 1TEXA 2QGNA 4JVSB 2OLJA 5FOUA 1Q1BA 4HYYA 3QOFA 2WWIA 4JL6A 3AVUA 1S1MA 1D5CA 1LF0A 4EUNA 3E1SA 5FTLA 1F48A 4RD0A 1OFHA 5J5CA 2XOKA 4B3XA 1ZD8A 1S2MA 1IXRC 3BS4A 2W6IA 3PXGA 1EFTA 3K0FA 5EJEA 4DLRA 3ZVRA 2O8FB 1U0HC 1E1QD 3QE0A 1N25A 3LQRA 1MABA 3ZGXA 2YC4C 1II8B 3B85A 1GZSA 3R7WB 5EP1A 3SYNA 2GXQA 2WOJA 1OB5A 5JJIA 3SJBA 1ZNXA 3GLIA 4Q4JB 2AWOA 3HU2A 3W5IA 1F60A 3D7MA 2J9RA 5AR1A 1JALA 4JS0A 3KB1A 2N42A 4MGYR 2WOOA 2BCGY 4KLNA 2P3SA 1FFHA 3PUYA 1LFDB 5CYOA 5SZIA 1E1QA 4LJ9A 1NG1A 4MDEA 1OFTA 2J1LA 4PO8A 3KQKA 1E94E 1KK3A 2HYDA 1R4AA 1P2TA 1ZD9A 4C2UA 1SVIA 4NE2A 5AJZA 4MYCA 3LX8A 5FL7D 3A1VA 1SXJC 3LY5A 3CM0A 1L4UA 2OLKA 1GL6A 1YU9A 3GLHE 1Z5ZA 1O87A 1Z22A 4TWZA 2AFHE 3FMOB 3HP1A 4UXHA 5JWHA 4AD8A 4C0LA 2AX4A 2PJRA 2IS4A 1NVWQ 1Z07A 2B7CA 3VFDA 1GITA 3KKOA 4KBGA 2EWVA 1NF3A 4M8NE 1VG0B 4EPYA 1JEDA 4A0RA 2W0SA 1NJFA 2YZ2A 4NYIQ 4WOPA 1IXZA 1FUUA 2YWFA 5KYKA 3O47A 1BMFD 2FFQA 1QVAA 2D62A 3K0SA 4IXMA 5HPYB 1KI7A 1E98A 3IQXA 2CXXA 4GOKA 3R8CA 3U44B 2V55B 2QTHA 1S4QA 2ZROA 3OE7D 1E1RD 4Q9LA 2GXAA 2NTYC 1RYHA 4HLQB 2WWFA 3VQTA 5LD2B 4HB2A 3BIFA 2JLZA 3M0EA 4QM7A 2H5EA 1SZPA 4H1UA 1LVGA 4F4IA 1COWD 3CRRA 1VECA 3O8BA 3U3JA 1BMFA 1DG1G 2IF2A 3CBQA 3R9WA 3L0SA 4DLVA 2AD5A 1RRCA 2Q0HA 3MWLA 3TR0A 2LKDA 4OHXA 4DCSA 5FR1A 3AUYA 4QFMA 3C14C 1AKEA 1E1RA 3AF1A 1JJVA 2H57A 4B74A 3GEIA 2JCSA 5JWOA 1XJCA 4HAUA 1YHNA 2GZAA 1COWA 1NKSA 1KMHA 3PVSA 2JDID 2WJIA 1W4RA 4RD6A 1DARA 1KSGA 3I5YA 2BMDA 1BH2A 4G5OA 1TUIA 4X8OA 4B33A 4TMTA 1XXHE 4TYQA 1HTWA 4FMCB 1W1WA 1RRFA 3RABA 2OT3B 2W58A 3CPHA 1LS1A 1XMJA 2GBLC 2QP9X 5A0FA 2XJ9A 2BKEA 4EPRA 3RLFA 2OG2A 5KSZA 1NVXQ 4JSYA 1NJGA 2RKOA 2FE4A 3EXAA 2JDIA 1WF3A 3U5ZB 4DDWA 2CBZA 3CRVA 3GLFA 3LVRE 4R9UC 1N5KA 1OPXA 4KHZA 1RC8A 2P5TB 4RSGA 2XSZA 1QZXA 2N46A 3HU1A 3HDTA 2R62A 3Q9LA 4XSGA 3TIFA 2GAAA 2XEXA 1QDEA 4C0SA 1SHZA 2Q3FA 3U2QA 1HT2E 1F2UB 2SHKA 4LWZA 5D3MA 3BFVA 3PFIA 4IFBA 1N5LA 2GF0A 2PLRA 4DXAA 5DH9A 2DY1A 2GRJA 4KAXA 2VHTA 4M1YA 2ZI7A 3PUXA 3NG1A 2CLSA 4NYJR 4ZDIA 1DAMA 4PHGA 1E0KA 1CBUA 1UF9A 4ESVA 5J40A 4DBLC 5CLQA 4AKIA 1L2TA 3HPRA 2QY9A 4KODA 4UJ5A 4LJ6A 2AK2A 4URYR 2XTNA 5E95A 3VAAA 1ELOA 3UK6A 4XSHA 2V1UA 2ECKA 3L8YA 2XITA 1MOZA 1YE8A 1FW6A 5C1BA 3B9QA 2XZOA 1US8A 2FMXA 4GMDA 2ZUBA 3EPLA 2DB3A 4G0NA 4L8GA 1XD2B 4P3YA 4R7ZA 4DCTA 2NO1A 1TF5A 1OB2A 4QGFA 3P26A 4UNSA 5JRJA 3QXSA 4PQYA 4LGMA 3I8SA 4E07A 4LZZA 1T0JB 3PENA 4JLOA 3TUJC 3FFBA 1W36C 5KPJA 2D3WA 2V3CC 2CJWA 2VHUA 5TB5A 3RNLA 1CJMA 1Z6YA 221PA 2ZTSA 1YRBA 1KAGA 1X3SA 1TMKA 4MA4A 4G5QA 2GAOA 2Q9BA 4C3ZA 4I81A 5KDOA 3KXKA 1DO2A 4O25A 2IXFA 4OQFA 4RFSB 2O8EB 2G9NA 4JYCA 4C0KA 2GF9A 1HE8B 2AN9A 4D26A 4M1TA 2R44A 1RVDA 4CEIB 1EWRA 1MO3A 1D2EA 1GNPA 1OW3B 2C8VA 2VP6A 2GJKA 3WMEA 1E9FA 2AXPA 3R9IA 3VR3A 3IKJA 1WDTA 4GPTA 3C8UA 4TL6A 1W4CA 3QSYA 1UFQA 2CHGA 4BLQA 4UXJA 3THXA 4MRVA 4Q18A 5CLLA 2IYZA 1VG8A 4WXPA 5AK0A 5JS7A 1GFIA 3PEWA 1KNQA 1NN0A 5G40A 1IJEA 3M1IA 4KVAA 1KIMA 1R8QA 5FPSA 4PZZA 2ZITA 5EUQB 5TXGA 1EFUA 3SHWA 4KSCA 4YQFA 2JATA 1PUJA 3DZ8A 3EIHA 3QXJA 1T9HA 4LPKA 3A36A 1MO5A 1WB9A 3EC1A 2B7BA 1G7SA 1QHHA 1DAGA 1OXXK 3UG7A 1FQKA 4DUGD 2X77A 1AQUA 2WWGA 3ZQJA 5HKKD 4MDFA 1T0HB 2QBYA 4JT4A 1FTSA 2F9LA 4IDNA 3REGA 1G291 2FOLA 3NDBB 1E2KA 3K0CC 4F93B 3B82A 5HCIA 3PEYA 5LB4A 3K0FB 3SS8A 1LV7A 1D2NA 1G7CA 1KZGB 1MH1A 1ZM3A 1RW4A 2DFTA 1EG7A 1XEWX 2QQ0A 4AYWA 4Q7JB 4DUGA 4TZ6A 2HF9A 4R2HA 1MABB 3ZVMA 4L16A 2O8DB 4HB3A 5HKKA 4QGAA 5FUYA 2WJGA 3WRXC 4Q4AA 4OJQA 5E7MA 4B32A 2GJ9A 4TLCA 2HXYA 2RGAA 3T61A 1M7BA 5BYKA 3HPQA 1W44A 1UPTA 3WMFA 4BLOA 1S1CA 4HZIA 4B2IA 1DOAA 1NLZA 4JSTA 2WPDD 4Y0VA 1L8QA 1ZCAA 2BKUA 1XB2A 821PA 1KTVA 2PT7A 2ZQ5A 1N6HA 4JVNA 1E79D 4LBVA 1LW7A 5AWFC 1XPOA 3TGPA 5JI2E 1FPMA 3ECCA 3AKCA 1XEWY 4KVGA 4V0ME 2QMUA 3RC3A 2IYSA 3RWMB 4B6EA 4AKEA 1MRNA 2OAQ1 3ICEA 2WPDA 2CNWD 2PLFA 1E2NA 1KY3A 1N2CE 1NG9A 4DCUA 3H84A 4WZ6A 5TVKA 1XZQA 1E79A 3QI2A 4NZYA 1E4YA 2IW3A 4KU4A 1OFUX 4OK3A 1CS4C 3IHWA 4ZIRB 3RS2A 1TPZA 1Z0DA 3ADBA 4TYWA 3HYRA 3EAQA 3GMTA 3LBIA 4IFEA 4QGHA 3RRZA 1OE0A 2O0KA 1CRPA 3UIEA 3SJCA 4V03A 2CNWA 3Q72A 4P4TA 2BBSA 4D0LB 4QM6A 1FUKA 3IBGA 1P72A 1GKUB 3W9YA 3GJ4A 2MMCA 1E3MA 2PH1A 1KO5A 1P3JA 2F1IA 3TLXA 4PHHA 3IIJA 5IDVA 3QVUA 4B48A 1GWNA 2RGXA 2FFHA 2W2TA 5JSZB 3W34A 1QG2A 3W8NA 3EPJA 2A5DA 2JJ2D 2J87A 2O5VA 3GJ0A 3HWSA 5AJWA 2QNRA 1CJKC 4C4PA 1KMHB 3AKYA 3LO5A 1ZIPA 1GIAA 3OFND 4BASA 4XIGS 3TMKA 1A4RA 4GDFA 3CKLA 1U9IC 1ZC4A 4YMUA 2GJ8A 5JECA 5BXQC 2UZIR 5KTYA 3K70B 3NBXX 4M53A 3U7HB 3AVYA 1ONBA 4P4SA 3MWKA 4O2LA 4NP6A 4LHXA 2JJ2A 1NNEA 3AF3A 2IA5A 3B5JA 5UKDA 3V00A 5EXTA 2BBWA 1GM5A 4XVQA 3OFNA 3B9PA 4C0JA 2OEPA 1D2MA 5AUQA 1D9ZA 4I1VA 3HJNA 1Z0FA 2XXAA 1TU3A 2V54A 3RS7A 3CWZA 4BFUA 4PQRA 1LY1A 3L0IB 1IY0A 5JI3E 4JLNA 4Q1EA 1MRSA 3EPKA 3THYA 4HLUC 2GWHA 3FE2A 4FWIB 1G3IA 2HV8A 1KOFA 3A1SA 2C78A 3HYTA 5JEEA 2OBLA 3GJ6A 3ZZ0A 2FJUA 1U0JA 3GJ3A 1G3QA 3RVBA 5IHPA 5F98A 4YDSA 1NBME 2RGBA 2QT1A 2J0VA 1L7VC 3EWAA 1DTSA 4HB0A 1N6PA 1XPRA 2IEZA 1U8ZA 4TT3D 1GL7A 1CRQA 1XF9A 3KKMA 621PA 2R2AA 1GUAA 3C5HA 2P5SA 4XOIA 3UWOA 4DSNA 2G77B 2NZJA 2J0UA 5TDHA 4IVQA 2ZYTX 3L0OA 1OIWA 1P4SA 2PEYA 1HURA 4IOMA 3BGWA 3GLHA 2H16A 4D4LA 3EX7C 3CNLA 4BLTA 4V0LA 4EJSA 4A0FA 3SE0A 3ZJYA 1SVKA 2W00A 5JEDA 1M8PA 1US8B 3A6PC 1XNJA 2GCPA 3BE4A 5FL3A 5IRCD 3T12A 4TT3A 2GK6A 4Q48A 2CDNA 1YKSA 3VR1A 2ZJBA 3U3RA 4C7OB 3FB4A 2JLWA 3KFVA 2DWPA 3UMSA 2V8OA 3ZVNA 3K70C 1GVNB 5DI3A 4JKYA 1CTQA 2DWQA 4HUQA 3T5DA 3Q85A 2CJWB 4KLZA 1DAFA 5L3SA 4JKIA 4HB4A 4E22A 1RPZA 1XMSA 3IGFA 2RGGA 3TNFA 1KI9A 1W2HA 2F3RA 2OCBA 4I99A 2W83A 5HZHA 3BWDD 3QPWA 2ZE5A 3I4LA 1S9DA 2J46A 1N0WA 3D3QA 3OEHA 2PZGA 3ONWA 3UKDA 3I1FA 1NN3A 4ARZA 2IEYA 4OJKA 3LW7A 3QEJA 2OM2A 3PCRB 4JL5A 3TUZC 5FTMA 1EX7A 1YR7A 4JLAA 5KNDA 1F3OA 1G8YA 2ZRHA 5IF9A 5K8TA 3KJGA 2V9PA 1AGPA 5IK2D 1E4VA 1NKTA 2ATVA 4B2PA 2ZVPX 1N6KA 4O3MA 4IOKA 3ZIAD 4YC7A 2VHCA 2E1RA 2HJVA 4PC1A 1PUIA 4D4JA 2ZRBA 3I72A 1G7RA 1KSHA 1G5RA 4DLYA 4G5GA 2QSZA 2CE2X 1CULC 5J4VA 3Q8XB 5CB8A 1TADA 2BJVA 3X1XA 2HT1A 2A9KA 4B71A 3R9XA 1XXHA 5FUVA 1DEKA 5P21A 1VMAA 2WWHA 5IK2A 2IYYA 5DISB 4LI0A 1JI0A 3ZIAA 4F4JA 4IKEA 4CRWB 2WJJA 1ZU5A 3EZ2A 1JXMA 1QHHB 3KQUA 2VHQA 1AN0A 3FMFA 1CR0A 4II7A 3IPXA 2QMEA 4HDOB 2DR3A 1YJ5A 4PC2A 2LCFA 2FEOA 2AKYA 2VIIA 2K5UA 2Q21A 2REXB 2RGDA 4MGZR 4Q19A 3RWOA 4ASUD 4AKGA 2AWNA 3W5JA 4A0HA 3TVDA 3N70A 3PR1A 4U5XA 2QL6A 5SZKB 1G6HA 2P0EA 2ZS9A 2G6BA 4W9MC 4HLCA 2P6NA 4PC3A 4DEXA 4RZ3A 4S35A 3AKEA 1KSJA 1II0A 1X8JA 1OXUA 2GETA 4M4SA 2CL6X 1KO8A 4Q4AB 1S3SA 2B6HA 3LWNA 1KNXA 5KSYA 4QJ3A 2QZ4A 4ASUA 3GJXC 3PIRA 5KDLA 2F55A 1SXJE 1TQ4A 2ZJOA 1KDRA 2D7CA 2Q3HA 5KSPA 4AYTA 5IT5A 4W7SA 2ZR7A 4NBSA 3EW9A 3JVUA 2WIBA 4JVLA 2QI9C 4V02A 1G4AE 5CM9C 1DELA 4HI0E 2ZRKA 1JQLB 3QKRA 1G8HA 5HTKA 1ZIOA 3C4JA 3MRSA 2GVZC 2KBEA 4AI6A 3VR6A 2I4IA 5L3RA 4NYIR 4GRAA 2ZJZA 1UAAA 3AB3A 4PPNA 4BZPA 5EXXA 4F91B 1HQCA 2JLVA 2R6CA 2FGJA 3QG5A 4RFVA 4LBZA 3TE6A 3F0TA 1KO1A 3NKVA 2W0MA 2FG5A 4IVPA 2CCJA 2GA8A 4FCVA 2VYFA 1ZNYA 3LDAA 5BWMA 3HR8A 1N6RA 1G21E 4IDHA 4W5WA 2DFKB 2YWEA 4P4UA 1W7AA 4Q21A 2OHFA 3LH5A 4YONB 3R20A 1P62B 4B6FA 4QG7A 2IWRA 1P9RA 4EAQA 4M9ZA 5JCZA 2RGNA 2RH5A 3TVTA 1Y63A 3AVOA 2EFDB 5A4JA 1T8UA 2XTMA 6Q21A 3UPUA 1XPUA 4PAMA 2HLDD 1RFLA 3DEFA 1MR3F 1ZP6A 3DO6A 3MWJA 4O2RA 2RGEA 1J70A 2VP2A 1M34E 2PT5A 4Q03A 4LRWA 5FBLB 4XTCS 4RY2A 3M4YA 4CT4B 4KYUA 5G3YA 2JIZA 3ZD7A 3K0AA 4PPQA 1SKYB 3MGCA 4C0BA 3VNVA 1KI6A 5HCNA 2WVJA 2ORIA 3DZDA 2WJVA 4UQOA 4LJ8A 1H8ED 1KY2A 5DIFA 2HLDA 2IYRA 4IDPA 5FUXA 3SJZA 1WCV1 2HYIC 1JR3E 2CHQA 2JLUA 2FFAA 5FBQB 1J7KA 4HDCA 3ADDA 3K53A 4YMSA 2YNMA 1GSIA 1BS1A 1GP2A 2UZ3A 1YZLA 1FX0A 3QNUA 5EXSA 4PZYA 3FTQA 1AJEA 1Z08A 3B13B 1H8EA 4NMMA 2ZREA 4KFRA 1RKBA 4WZBE 4PHFA 5FBWB 2IL1A 2QAGB 3B60A 3GFTA 1SGWA 4IDOA 1Z0KA 2LKCA 1KKMA 121PA 5AUOB 2QPAA 1FP7A 2BHRA 4Q66C 4RVCA 1W48A 721PA 1NRJB 3KKNA 1P7CA 2FPLA 3C15C 4LDJA 1AM4D 1CXZA 2PL3A 3THYB 1ZM4A 4WAUA 2YOHA 2O0JA 4QHYA 2WSMA 4Q9HA 5FOWA 3C7KA 4DWJA 4D82A 2W2XA 4F7WA 2WTUA 4OHYA 3SHFA 4DSTA 3OIWA 1L4YA 2AFIE 2WKRA 2FV8A 2WWWA 5GJCA 4EPWA 1UDWA 1NLYA 1E6CA 2GNOA 4RZXA 1RJ9A 3LLUA 1IBRA 3RAPR 5K8IA 2RCNA 5K8LA 1X86B 4BZXA 1Q3HA 3A4LA 4Z51A 2EFCB 3U3OA 5JBQA 2XX3A 2X8AA 3CX8A 4YDHB 1G19A 3N2EA 2BM0A 4A2WA 4BRWA 1ZNZA 2A2ZA 1Q21A 1PVOA 5KOYA 3MJRA 3KKPA 1U0LA 4LHWA 2ZANA 2ZU0C 1TQDA 3BB3A 4LHVA 4DIEA 2CLDX 1G17A 1OT3A 1IONA 1GKIA 5DNYB 4QBHA 4N1AA 1IM2A 1IJFA 1TEVA 3FHTA 4HZUA 3K09A 1VHTA 1FQJA 3DOEA 4MGKR 2D74A 1Z0JA 2BMFA 3I92A 5EUMA 3UMFA 4IXNA 5FPTA 3V4RA 1B0UA 4LC0A 1JEEA 2VRWA 5GJBA 3LVQE 3FYHA 4OK5A 3UG6A 4MUAA 1S3GA 4Q7LA 3THWB 1G7TA 3CIOA 1G8FA 2DCUA 4L15A 5FOTA 4BFYA 1W5SA 4TLEA 2AK3A 2EFEB 3LRPA 3KXLA 4OHZA 1N3BA 2NQ2C 2XSZD 2WAXA 4HUQB 3TJZA 1W36B 2B8TA 1Q1QA 4M1OA 4BFSA 4I4LA 3N2IA 4QJ4A 5HZKA 1Q1EA 3H4MA 4URXR 1QG4A 4IEIA 2G0TA 1ZUHA 3ASYA 2O8CB 5DI9A 3TW4A 4ARZB 2QAGC 3K0EA 2G3YA 4UXIA 1LNZA 1R2QA 3K1JA 2BIFA 1YR9A 4IRUB 4W5JA 4A6PA 1ZJ6A 1SVWA 2VEDA 3B1VA 3EZ9A 3W6PA 3B1YA 1XEXB 2ODNA 2RHMA 3CO5A 1DPFA 3B6EA 4B44A 1LS6A 1Z2CA 4OI1A 3OIUA 1H65A 5SZJA 3K9NA 4YXWD 3VTKA 4A8JA 1G5PA 4MYUA 1IOZA 1EXMA 1A82A 4XVUA 3U4QB 5DHFA 2WKPA 2H1LA 2ZYUX 3GFOA 2JLYA 3FOZA 4V0NA 2OV2A 3PEUA 1G3RA 2VO1A 1N0VC 4JJKA 3UWKA 3NC1C 5CJPA 4DC9A 4AG6A 3I61A 1G4UR 2V6JA 5B58C 5HR5A 1NI3A 1NN1A 3WNCA 3CR7A 2IWHA 4A6XA 4YXWA 3MLEA 5BYJA 1GL9B 1R5NA 3O8DA 2JJ8A 3VU9B 1IY2A 2FPMA 2QRNA 1P73A 1FMJA 3BERA 2FSIA 1Q12A 1NMXA 3P20A 4LJ5A 4X8HA 4Z1MA 2ZIAA 2H92A 2AL7A 2UVQA 3T35A 3TRFA 2GEUA 1E0JA 2HDNB 2HCJB 1XDBA 2FSFA 4BFXA 1S0UA 4ACAA 2BDTA 3DMDA 5FFMA 1VKJA 2ASEA 1E2HA 4LJ7A 2Q3MA 4EFLA 2AKAB 1KDTA 2CLCX 4C2TA 1TNDA 4G01B 1SVOA 5CDFE 3FKQA 1YZTA 5G3ZA 1AA9A 1E69A 2XTZA 1T5LA 2D2EA 2F43A 4HATA 3KUCA 4OKSA 2DFLA 2MMGA 2KWIA 1XCPA 3B1XA 2WSSD 3GFPA 4HAZA 2X19A 3LAWA 5HE8A 4A0GA 3LXXA 3TK1A 2KJQA 4LPSA 3N5CA 4AKHA 1N5JA 2OUKA 4B3GA 4JZKA 3RS4A 2WKQA 3QKSA 5B2ZA 4TZ0A 1T3LA 1CIPA 4DCNA 3PUWA 2XJ4A 3ZDQA 2GJSA 2ZI4A 4W5HA 5DN6D 3MUFA 3QKRB 4I1SA 1TAGA 2WSSA 5L3QA 3CONA 2ZYWX 4PPFA 3EG5A 4OHWA 1E2DA 4Q1CA 4Q4HA 1XP8A 1KJWA 3AP3A 2XB2A 3RANA 2R6GA 3NTUA 5H68A 3QVVA 2ONKA 2C99A 3CH5A 1JECA 3GJ5A 4PC6A 1ZYUA 2A7QA 2ODWA 1JXOA 1Z6AA 4ZDJA 3KQLA 2I1VB 2O0HA 4PTLA 3ZS8A 3GLGB 5E4FA 2PCJA 4PX9A 5DN6A 2WICA 4K8OA 2VA8A 3ADKA 1G64A 1P9WA 4DSOA 1DG3A 1AZSC 1FTNA 3MSXA 2VQSA 3QY0A 3WHKA 5DYGA 1XD8A 2F1JA 3J81k 2A30A 3VHLB 3BD9A 3FHCB 4Q1BA 2R6DA 2UKDA 1XTSA 2R9VA 3DPUA 1IHUA 1SQ5A 2ZS7A 1F5NA 3IO5A 3CX7A 1T91A 1Z6GA 5AJXA 1LTQA 2A5YB 4QBGB 3SJAA 4GL2A 3TQCA 4K81B 4A1FA 4M1SA 4NCKA 3W8RA 4MQBA 3REFA 1QHXA 4D4MA 3GJ7A 3CZPA 4BRUA 1Q57A 2QM8A 3IEVA 1Z28A 2BMEA 2AXNA 4RKEA 5F2EA 2EYQA 3W6NA 3TSWA 1Z6XA 1CJTC 1GILA 2ZRMA 3FFAA 4M1MA 4Z54A 3V4FA 2ZJAA 1DE0A 1UBEA 1KMQA 5C2JB 1I4LD 1ZMXA 4FIDA 1GOTA 4C0HA 3KUDA 2P2LA
chains in the Genus database with same CATH superfamily
3IQIX 3O1IC 4UNQA 1PDOA 2PJDA 1U6IA 3ZU3A 3AF0A 2UYYA 4G0UA 3A6LA 4G1EB 1DHTA 3K6JA 4RORA 1P6QA 1ZC3A 3KJIA 4LDPA 4ZAZA 1TYAE 4MRNA 2HT6A 4NQZA 2EEPA 3PGMA 2HPVA 1RXEA 2NSDA 3NHLA 4ILKA 4E2XA 1JJFA 1Q11A 3B2EA 4O4IB 3EGXB 2IDJA 3UMCA 3CB2A 2ZAOA 4TMWA 5D5QA 2IHZA 1R12A 4TL9A 5IKXA 4E5VA 3L43A 5J1SB 1ARZA 1YFKA 4TMYA 3BT7A 2Q6TA 1G20B 1I0ZA 2XUHA 2J85A 3CH6A 4FNOA 4ZVKA 4BMNA 1USUA 4RIEA 3PHHA 4KWHA 3R3YA 4EQ6A 4OFBA 4WFQA 4FMDB 2O06A 3QFSA 3UHJA 1Q6YA 4I08A 5ITZA 3OFVA 1MC4A 2AHRA 2CZCA 2EU8A 1ENOA 1CE8B 3FBGA 4PSAA 1EP2B 4G4JA 4DQ0A 1NURA 3F47A 2G83A 1T4CA 4YCMA 3O4IA 5J4LA 2HTEA 2C77A 4QT0A 4NJOA 3K9GA 1LRLA 3SBEA 3ODPA 4BLPA 4JUDX 1O1YA 4JL8A 3OUTA 3KFLA 3QPVA 4X7RA 1VGVA 4ZVTA 5KYNA 5AUPB 2IOFA 4BOYA 1SCDA 4BNVA 2R68A 4WVLA 3TLEA 2M32A 3M9LA 4B6SA 4QL3A 1J8MF 1T29A 1GZ5A 4K9OA 1QG6A 1DAKA 2FPKA 2MYNA 1YB7A 3DLTA 3NHSA 3DM9B 4Y0AA 1RXIA 1HDOA 5IW8A 4EO4A 3I30X 3BBPA 3KDSE 1BRMA 3D43A 1JHDA 1RCUA 2C84A 2FPWA 2NZWA 2VT2A 4CFYA 4PNEA 4BFVA 1C3OB 1OBOA 4YS6A 3VMMA 2NACA 2X0IA 3PXAA 4ZI3A 3FTEA 1AA6A 3LQ1A 2QTZA 3FZQA 3IMEA 4DGSA 4WZAB 1YR8A 3IJRA 1N4AA 3AQIA 2OZLB 4EL0A 1AKTA 4R6WA 4OM7A 4ZO7A 2PS9A 2PE5A 4H1HA 5EE9A 1TZCA 5T4HA 4LXUA 1ZM9A 2H17A 4L75A 1BO6A 2VWQA 1X7XB 2Z9DA 4KV9A 4WNAA 5DCUA 3SQWA 1N34B 4Q4LA 4WCVA 1KOJA 1JU9A 1UBFA 1JHPA 1H5QA 1ISSA 3IAM6 4JJ4A 3K2EA 4KWEA 1N1MA 4MIEA 2AZMA 4IBOA 5EKDA 1Y9ZA 1RQNA 1THMA 4MX8A 2G1JA 1GCGA 2GKSA 1OWPA 2W6JD 5HBRA 4FR0A 3BH0A 5ALIA 3WNDA 5LU9A 4E33A 1JH8A 1QE5A 2IYUA 2BH2A 2PRSA 1P6XA 3BMCA 5CNIA 2PUFA 2WAYA 2GVNA 2JLAA 3W6OA 3L04A 3RU2A 5AQEA 1CB0A 3LKBA 3C1UA 3VMFA 1EXVA 1PRYA 1Z8DA 1PQ4A 2FUG1 3IP8A 3OAAD 4RBNA 4R1LA 1A76A 3W3AA 5A7GA 1VHLA 4PLFA 3VR2D 2CL7X 2MSDB 2HJWA 3RJTA 1Q17A 1KZHA 3VR4D 2I4RA 3AF4A 3R7WA 1C30A 4OU4A 3SVZA 4C7XA 1PWZA 3DZFA 4TZKA 1UKYA 3NEJA 3ORRA 1A9YA 4WQMA 2P41A 1Q7CA 1OLUB 4YAGA 4QG3A 3HN6A 1XQ6A 4LRUA 2JJ1A 4MI1A 2GCIA 3AXTA 5G0UA 3GUCA 2NMVA 2ONJA 3VU3A 4KFTA 4TLDA 1WUKS 5FTWA 3MJEA 3BJRA 4HTFB 3JWGA 3X43A 3ZPXA 1C9YA 1J6UA 4WUVA 1Z6TA 4LMAA 3W2TA 4X6UA 1E3JA 1RYZA 4G5FA 4KBFA 5BSWA 3OFJA 1A04A 2PQ6A 1JR3A 1RDFA 4OQXA 3AJ8A 2OXCA 3KOWA 5DRTA 4Q12A 1I4EB 4U0JA 2FAXA 5FB3A 3WBKA 3PYLA 4MKGA 2IS2A 4HTAA 3QFRA 4BKOA 1JAXA 1GADO 2DYKA 3IEUA 4CIWA 1APBA 1Z2OX 2R8ZA 3MQ4A 5FOXA 4B43A 4D9BA 1AQJA 1ODJA 2C98A 3ESAA 3JRNA 4BCDA 4IWYA 1RRMA 4Z7OB 2BN4A 2H2DA 5H81A 4V3BA 1A9OA 3ND6A 4JLVA 2ZYVX 3ZCUA 3ZY2A 1Z16A 2D0OB 4ODIA 1MTOA 2IELA 4OHBA 2BGMA 1SBNE 1WUIS 1YRLA 3X1WA 1YZKA 2Z09A 3HE3A 5JZSA 2YJ4A 4WZBA 3RS0A 4QOGA 4Z7QB 1X7HA 4MCJA 1N0HA 1S3IA 3QEMB 1PAUA 2ZIFA 2FEKA 3O21A 3PV0A 4ZQFA 5C1IA 1UM8A 2EEZA 3V42A 3EIUA 4HX9A 4XYMA 5ALLA 1TOAA 4YUZA 2ZU6A 4E51A 1LU9A 4J29A 1U7OA 4OOEA 4DREA 5F9FA 1PEKE 3F9CA 3JAWA 4JQYA 5F64A 4RSHA 4JI3B 2D6FA 1Z4OA 1PV2A 3LTNC 3OEHD 2OHIA 3ETGA 1W5FA 3ISJA 2WUEA 5G53C 1ZJZA 2B21A 2OFXA 3A1DA 4BGEA 4MI9A 3PNPA 5ALYA 1PZNA 3BMXA 4OSEA 5BN4A 3TFWA 4L8VA 1W0CA 1HDCA 1W4AA 1YKFA 1W4ZA 3ZDYB 3WDKA 2J3DA 1MBZA 2AR9A 2PSFA 4U0KA 2J3EA 4KQKA 4WE3A 3CLVA 2HCTA 3NV7A 4P2GA 2QQ5A 4I4TB 4CMIB 1TCUA 1Z75A 2Y1XA 1GA6A 2YVUA 4ZVLA 2DPGA 4INPA 5C4MA 4HBZA 1DL5A 2QMYA 3FJOA 3ND5A 3R5SA 5EWJB 1I6WA 1QIJA 3IFSA 4C05A 5C7YA 1DC5A 1OX6A 2B0JA 5JCPA 1QHNA 3UMYA 1PT6A 1Y48E 1DX4A 1MO6A 1ULBA 2FX2A 2Q5IA 1NIPA 3WYNA 4LGVA 3WKDA 2EJVA 1ZOSA 3GRFA 3AERB 1X6VA 1N7GA 4IMPA 1K06A 1YVUA 2VQ6A 4B3MB 3EFOB 2Z5FA 4WCFA 5C34B 4H08A 5CDGA 2QTFA 4MTLA 4BRSA 4LF7B 1NOJA 3THXB 4OK6A 2YV2A 2ERCA 2REBA 3GLUA 4G4SP 1WXDA 2GTHA 2FZ5A 3IIEA 4FYPA 4IXWA 4KMRA 5T3YA 5AVVA 4U9IS 4P84A 4R01A 3RRFA 4X91A 2P6OA 3B20A 3PEEA 3U4IA 3N2KB 3TKAA 1KOGA 1TCVA 3A6HA 1VGRA 2JGAA 4CFSA 1DBWA 1XG5A 4TTRA 4DYDA 4L3WA 3JAMA 2R5WA 2WF9A 3KSMA 3ZTTA 2XB4A 1DJPA 2HEGA 3GD7A 2XGGA 1DADA 4NCJA 2X5XA 3TSZA 2HCBA 3OC0A 1XTJA 1ISRA 2AOVA 1VCOA 4HQRA 3U4HA 2O7SA 3HNPA 3P9YA 1KSFX 4LZWA 4TN1A 3K1AA 5K3BA 5JUWA 2CFCA 1G41A 4XVRA 3ZK9A 1WWKA 2X8BA 4BWYA 3LUGA 5LOVF 2ZRGA 1LPPA 4WLUA 1Z0AA 3TIVA 2FSGA 2WVAA 2CK3A 1MAUA 4FT2A 4J1TA 2OK7A 2BLLA 3I2YX 3PQ3A 4LAFA 1QYCA 1ZESA 4MQEB 1JDUA 4K46A 3CEAA 2GH1A 4UVGA 3QBJA 1KZ4A 2QJOA 4GUDA 5A5GA 4LV8B 2NZ8A 4C87A 1M83A 5T5QA 4KQFA 2ZUVA 2BHNA 3HVIA 4I5IA 3TM5A 1XHLA 1TCBA 1G5FA 1I0IA 1NVUQ 2VAWA 3WLEA 2YWCA 5JRZA 1QGOA 4A36A 4HAVA 1EVIA 2KI5A 2HSGA 3L6OO 3NW9A 4AB1A 2D5CA 4BV3A 4RJLA 1HOTA 4XSVA 4HMPA 4RH0A 5FA8A 4B6QA 4D0NA 1MHTA 1JTFA 4BEBA 3CVYA 3GBPA 2FX3A 3L8EA 3ZHBA 2CVZA 4URFA 1UP4A 2GXSA 2PN1A 4RK0A 2ICAA 3GU3A 1XD2A 2QRZA 3ZH2A 4EA7A 3LT4A 3G13A 1DUIA 2BOVA 2F59A 4DWWA 4HYQA 5BW4A 3FHOA 1BXRB 1OH7A 3VYSB 3CQ9A 3DFMA 4NDZA 4S2UA 1E2GA 1ZL2A 1DQNA 3MHPA 5ALJA 3ZDZB 2OBXA 3WIDA 3RU3A 1IY1A 1CG6A 2DCMA 3AJAA 4FP9A 5F4ZA 2P9GA 4ZRDA 1TQ6A 3LWDA 2X8JB 2XQJA 4MK4A 4O4LB 5TF4A 2I29A 1OJ7A 2H9IA 3DMGA 4L5YA 2VJYA 3SZUA 4RTOA 3D8HA 2ACWA 2C97A 3H86A 1RABA 2WNHA 4QUAA 1MXHA 2V7GA 1VSBA 4BTLA 4KGZA 1FF9A 2ZSEA 1VPVA 1QIGA 2KB0A 4JBLA 1PGNA 3UWSA 5CEFA 3WGHA 4CEJB 3NCHA 3B78A 5FYQA 1X13A 4EGAA 5EZ6B 3DYBA 3CVOA 4OVKA 2VP9A 2IF0A 3HYNA 4JLBA 4E3WA 3T7AA 2IHKA 1WBDA 3C6ZA 4PLGA 4BU0A 1AT1A 4MKIA 3FMPB 1SRRA 3ZZTA 4N0PA 2AKEA 4GG1A 3QNWA 4GYYA 3VDXA 3JWHA 1YDFA 1M8KA 2O2EA 1S96A 3KPWA 3QLJA 5G0TA 3WK9A 9ABPA 3QX8A 2BYTA 2CNKA 4OX9Y 3OZUA 1XV5A 2GUGA 1M8GA 1TEHA 1AGXA 2JJQA 3C7DB 4EM6A 5IN5A 1DC7A 4M6WA 2JIZD 1DAEA 1ESNA 1GKKA 4QBFA 3QW4B 3LYLA 1U1CA 3BCSA 1R0ZA 1CQJB 5EZYA 1DKQA 2EFHB 4MOWA 3QHAA 3A1WA 4UNPA 3CX4A 2EKPA 2P30A 4GAEA 4M2LA 2BFCA 4UBJA 2Q1WA 2OILA 4QXOA 2DSTA 4BQSA 1CZOA 5CH8A 3F6YA 4LZNA 1C9DB 1P77A 3S29A 2CYAA 3I37X 1VRVA 4V0OA 1T2NA 1VKHA 1MG0A 4IDEA 3JQAA 4DLSA 3RCBA 1YJ8A 4ZGBA 1LGYA 1PCXA 1XVUA 3LQ2A 4I5GA 3SKXA 1E92A 4JLMA 2EFGA 4I1OA 1QHSA 3IJPA 3WP0A 3OPYA 2Q9CA 2QENA 3UB4A 5C3MA 4RD2A 1IE3A 3P27A 4TKUB 2QRQA 1RCFA 2X7HA 3QVLA 4WRRA 4KHPB 4I50B 1W2GA 1AKQA 4IHJB 4CEHA 3L8FA 1O94A 4E94A 1DP4A 1A5SB 2I99A 4JT9A 3NOVA 1K88A 4NABA 1GXSA 4PLVA 4X7PA 1R8JA 5LVAA 1OXSC 1Z13A 2PZEA 3CH4B 3O8OB 4W1PA 2PT9A 2Z9CA 2M2IA 4PZCA 1T9BA 2VNSA 1P4GA 2O8DA 3I2GA 3BMNB 5JH7F 1IEXA 1SUDA 2AF4C 1YDMA 1T9GS 3OD1A 1W47A 1Y7PA 3KAQA 4GPEA 4WX2B 2C2XA 2XLBA 4PG6A 4M1KA 2A1UA 1QRAA 3ROTA 3T15A 4UEJA 3K73O 1MGOA 1T8TA 3K9LA 3OETA 4WBSA 1XLUA 2XXAB 1GLNA 2FWBA 4EKEA 4M21A 4O2BF 4ZVVA 3SKYA 4JY7A 4NG4A 4N5HX 4X24A 4LVOA 4RGVA 2FQXA 3VO8A 4NPHA 4ZVOA 3K1TA 4V24A 3K9BA 4KUGA 1X87A 2BUAA 3H04A 5EP4A 5ELLA 4POAA 3KCQA 3LGXA 3DVAA 1RP1A 3PDUA 2VP0A 2W6MA 2GTIA 4JIMA 4WFJA 4E5NA 4MVJD 5FLYA 1Q1AA 5LQSA 1C7JA 1G3MA 3JASA 1XLTA 2UAGA 5EFOA 1GTMA 2E5WA 2VRCA 2YS6A 4RXUA 3FPBA 4CMBA 4DV4B 5B1YA 3KB8A 4L7VA 3H1TA 3HXLA 2AGVA 5CNKA 1DCTA 5IJAA 1KEPA 4DDUA 3AVXA 3L77A 1L5ZA 2HIGA 1U1EA 2QTBA 2OSBA 3I53A 4RZ2A 5JR3A 1J0AA 2CDRA 1MUUA 3A8TA 3AWIA 3KG2A 4WHMA 5AKKA 3G2QA 3JR7A 3O8LA 2B4QA 3UJPA 2AV6A 1TPYA 2XTJA 4HLUA 4NQRA 4XQ0A 3KT3A 2EFJA 3TVYA 3LT5A 4ZIRA 1M7HA 1VMDA 4YMTA 1E2LA 1E66A 2ZDHA 2AFHB 4QOEA 4YVFA 2O7QA 3HM9A 1LW6E 3FCXA 4P0TA 3LBFA 4NKRA 3QF4A 2GK3A 1W5AA 1SU4A 4UUNA 4CM4A 1C8KA 1JNYA 1FUIA 4QHTA 1XTIA 3IJ5A 4MIOA 1DJOA 4ND7A 1ANKA 4A2QA 1MNAA 2XDQB 1KXZA 3JXEA 3H97A 4LTDA 3GRCA 2ATXA 2WB2A 4D9EA 1ZXXA 3BF8A 1K7SN 3EDCA 4FYMA 1IK4A 3DOOA 4NOMA 5ISMA 1Q5PA 3KEGA 4DLXA 4LYGA 5MFPA 1YVEI 2Z43A 3EUEA 1E8DA 3BMOB 4KIJA 1V1JA 3D6VA 4JR1A 4D25A 2RHRA 4CQMD 4OXXA 2NVUB 5HOEA 2CB9A 5HKLA 5HMLA 4A16A 5JCJA 3SXUB 3NHWA 4ER0A 1HF3A 2NO6A 4B3DA 1LPNA 5BY2A 3DC2A 4F85A 2IYXA 1FNMA 2H4FA 4CG2A 3WYFA 5AI5A 3S7ZA 4ZAXA 4XAQA 1J07A 2AXQA 3KXDA 4GBED 3A1CA 4QO7A 4RACA 4ZV4A 2ISSD 5J4YA 2FPGB 3E5RA 1V3TA 2XUAA 1NI4B 3P0FA 3UY4A 4J7XA 5D2CA 4D02A 2HL6A 1IJBA 4GR5A 3SYLA 5C8YF 1IPHA 1EVQA 1NQWA 1KK0A 3MCVA 4HFJA 5E6UB 3ND9A 3VXKA 3DWIA 4MROA 1X80A 2HF8A 3V4ZA 2RIPA 3T99A 3MLBA 3RFUA 3EZGA 3IBSA 2CUKA 1XXHB 1BC5A 5KYYA 1O9GA 1JQDA 3ONDA 4O08A 3UXMA 1TO2E 1VE5A 4P93A 5E1BA 4U7WA 1IHOA 3OKPA 3OLWA 1QRSA 1C0IA 2P78A 1WLYA 4HEQA 4QYMA 1VJ1A 5H16A 3SFTA 4DJTA 5L4LA 4NZ9A 1AN9A 3OY7A 3SF0A 4XGRA 4CW7A 3OZGA 1G63A 1AKVA 1JSRA 3W5CA 5MGBA 1W76A 3NKLA 5E9QA 1NYTA 2Q6KA 4YYZA 2E6KA 1EAMA 1KYYA 2FUG6 2J41A 4JUCA 3TNYA 2Q4OA 3WA6A 1KVRA 1JQEA 1SUEA 5AKEA 5HX7A 2XTAA 2Q0QA 1FDRA 1TUBA 2OBMA 3LGAA 8GPBA 1NBMD 3VYRB 2VSYA 3E61A 3QJGA 3RNOA 4D9CA 4DQDA 1BXKA 1QHGA 2IXGA 2ZWIA 4PG4A 2I6UA 3QVTA 4WMLA 3WQBA 4DDVA 1J1UA 2V4ZA 3VJLA 1PVDA 3VKWA 4N5IX 1Q6ZA 1WNTA 4PGHA 3JZAA 1CKEA 2AJBA 3QMVA 4D56A 4DQVA 1GU7A 1NE2A 2Q1TA 3B48A 4ON9A 2OAP1 5BMVB 2YCBA 6CHYA 5JAZA 4YR7A 2CLHB 1NVVR 1PQYA 3PHBE 4NENA 4XGKA 1KVSA 1RYBA 3K1YA 4CM9A 2B20A 1GYPA 1TVKB 1XA3A 1H94A 3JAKB 1WE2A 4G6ZA 1UFVA 1AIPA 4FOPA 4KXNA 5IKOA 3ZKWB 3EASA 1R8XA 1VMIA 3KWMA 4ZTBA 1Z3CA 2O2ZA 3AESA 3HXOA 4NBRA 3S2UA 2E9SA 2WWXA 2J7PA 3R3XA 3DKPA 3E03A 4TSFD 1F06A 1WNFA 2DZDA 4FLMA 3SGLA 1CNMA 1YTLA 3H6HA 2C31A 5DGIA 4OHPA 5DX0A 3QKIA 4CF4A 1M5UA 2QP3A 2GRAA 4R83A 3OTIA 3NEAA 4J7UA 5EKXA 1GPDG 4JBWA 4DL9A 1B8VA 1RJWA 2ZRJA 3LYHA 2ZSHA 4A03A 3U60B 1JFFA 2ZETA 3H19A 3KVNA 1EWKA 4RPGA 2V8BA 5LZ7A 4DLWA 1K3FA 5ALZA 4EMUA 1J2YA 2A9PA 3UW1A 2HWUA 3KT0A 1GQFA 3ZR4B 4XDGA 4OFXA 3JW8A 5T57A 4LOHA 1J9EA 2JLQA 2IHBA 4GZMA 1RHJA 2Q5EA 2ZOSA 2WV9A 3TCKA 5KBYA 4CDGA 4OLHA 2O2HA 1E9SA 4R1TA 4BFLA 2HU7A 3L1IA 4EW3A 5K01A 2A0WA 3RVNA 2X1VA 4AQYB 1XVVA 4YJGB 4CTJA 1N32B 4KE7A 3I62A 4YYEA 4EFNA 4QRIA 2FP4B 1YJCA 4A82A 5T4BA 2A0FA 3UJ6A 1L3BA 4GT1A 3HJAA 4J9VA 3DAPA 4NFLA 3BWYA 2INGX 4CF7A 4G0WA 3CEHA 1PD1A 4U00A 4DDHA 1ZOLA 2P9FA 4B83A 4IDQA 1UL1X 4LDRA 4BCCA 5IAGA 3RGGA 3FIUA 4ZHQF 2COUA 2Y99A 3I4CA 3EDOA 3AVVA 2HB6A 1E7WA 4TVBA 2X22A 2QM0A 3MLAA 2GLUA 2J07A 3MCTA 4PGMA 2F00A 1V7CA 5F2NA 1WS6A 1V1MA 2BZ1A 3TZKA 1ZX1A 2B4KA 4NCNA 2ECPA 3L02A 5L8VA 3GLIE 5B57C 5K05A 3UNXA 2H7VA 3EUFA 4WXYB 1K98A 1P75A 1ZKMA 3MFQA 4BVKA 2CB0A 2Y2VA 4H4CA 4TXMA 4JI1B 4FKZA 4GOOD 4ZRMA 2FWRA 3WYBA 4BNHA 2HA5A 2AIRA 3FPAA 2PL9A 5EWMA 5KOJA 2GMWA 1JILA 4R69A 3ZCPA 4OOFA 4YX9A 3MINA 3UENA 3R0VA 5JJCA 1RADA 1JHMA 1KI6B 4YDRA 2B9EA 1T8PA 3EVZA 5K6TA 3U7GA 1DX6A 1XROA 2G5CA 3ZHRA 4CIAA 1A5ZA 5BQOA 2APJA 5EJ4A 1JHZA 2G4LA 3S7TA 5LOVA 4KO8A 4NYJQ 3GPLA 2YKGA 3EIXA 2JFVA 1Z34A 3EZ6A 1KEUA 1SKQA 3VJKA 2ZWPA 1DJQA 1NVVQ 2VT6A 5HKOA 5FT9A 1FX0B 5K2MA 1TQ2A 5KC8A 2OO3A 3GAAA 4G3XA 3A58B 4H6VA 4ZQIA 2ZJ8A 4H0NA 2H31A 3GNLA 3DDZX 4FMDF 4WW0A 4D4GA 2WWRA 1CUJA 3LXRA 4BVFA 1UBRS 2JAQA 3D8RA 5ALKA 4D4KA 3IOCA 4BUZA 5BNIA 3PJEA 4QEKA 4EZBA 5DSZA 1VA4A 3EFEA 4UHFA 4KR6A 5LMNB 2CNNA 4W5QA 1JIKA 2HRDA 1DS6A 2N3ZA 4C0QC 4L9AA 3H5AA 5A4KA 2Y8EA 3DBOB 2X9LA 3HLKA 2AYYA 3RTEA 2D7DA 4B3FX 3PQ6A 4I36A 5HZMA 2H0RA 2JKVA 4A3SA 4L85A 4CCWA 1R5BA 2GDJA 4LBYA 2Q5OA 4PX3A 1GSAA 1GNTA 1I4DD 3HCWA 3MTAA 1HBJA 3U39A 1KP3A 2VF8A 4JI2B 1EFVA 2NZ2A 2NO7A 2YXPX 2ZXEA 1NQTA 5AVTA 1J2JA 4UM9D 1GFSA 3PRYA 1ZJYA 4XCQA 2Q6LA 1GZ6A 3P0JA 4HG2A 1RJ9B 1X14A 5LUBA 3BFXA 4JUFA 1ODFA 3F4BA 1QK5A 2C2OA 2Q7OE 3VR5D 4MPJA 5IZCA 2BGLA 2X40A 5ESWA 5JV5A 2AOUB 3TSCA 4BDSA 4XWKA 1JG4A 4RHYA 4BMZA 5ILGA 3JARA 4K7JA 3QX9A 1UK7A 2R86A 3L7MA 3D3JA 1ZVMA 3UUWA 1IN4A 2XWSA 5FWXB 1U2TA 4RVNA 4WXHA 4PX5A 2QTVB 5EWLB 1EXDA 4ZAFA 3HJFA 2ZVJA 2J3HA 1H1DA 5L45A 4FBMA 4H7IA 3S5UA 3I6ZA 4F92B 1CY0A 1ST2A 1WG8A 3EDMA 3ESZA 3TAUA 4EUSA 4R71A 1RWPA 3V1MA 2FG7C 4OO3A 1I51A 3HYLA 4TM8A 4LXQA 3IIKA 4F8JA 1G59A 1HDYA 5CLJA 3ZS9A 2Z6VA 4HK4A 4RA9A 3WXBA 1GUDA 4C4YA 1KRXA 2J6IA 2D5AA 3D0KA 1RVV1 2V3VA 3JTMA 4OGFA 1KPIA 1GCIA 2QD3A 1U2DA 1GNRA 1T2UA 2V0NA 3DA8A 3HN2A 1Y1SA 4J0CA 4WDQA 4Y9TA 4HWPA 3L8DA 3LY8A 5D8DA 5BOSB 1HDZA 3U61B 1PWXA 1YZGA 4XUDA 1ESDA 5DN9A 5B37A 5LQMA 3EG9B 4NXNB 2G0NA 1EYZA 1G16A 2I3DA 3OIFA 2OPBA 2FYTA 4MV7A 2AN4A 3C87A 2OGTA 3QXCA 1PN3A 1RHKA 1YDEA 2CVOA 3CYFA 3F3KA 2PSSA 1Y1TA 1W46A 3LI2A 1WW8A 3C7CB 4L4UA 1Z33A 3RC1A 1G2IA 2VI5A 3IKMB 2OV3A 5ILOA 4UE3S 3WK5A 1TLLA 2WJHA 4EKDA 1G4HA 2VPIA 3OLZA 2OBBA 4LOKA 1GSHA 3T0IA 1KQPA 3TPFA 2WSIA 2Z5VA 4EUFA 2D1SA 3W2FA 4K03A 2FEPA 3D2AA 3ZUGA 1R0KA 1ISHA 1QF9A 3H2HA 5DO9A 4L3OA 4RE6A 1IN5A 1DRVA 2X1HA 3PXXA 4PYNA 2TRSB 1L5HA 3G2LA 5THQA 1D6JA 2PVCA 4BNIA 5JH7A 3L0YA 1WCXA 3C8HA 2I6SA 5KI6A 2WP8J 2EIHA 3OCCA 2A9RA 3P1JA 4Y2XA 4OATA 4YWJA 3ZHUA 1A7JA 3EC2A 3GUZA 4KWIA 3IDOA 2X41A 4CV3A 4J43A 1ZXLA 4QTTB 3JS5A 4JP3A 4DKXA 2IUFA 3AUSA 1CS0B 1QV7A 2HV9A 2R97A 2PBRA 4ETWA 3K15A 4YJHB 2W9XA 3IUYA 3JYQA 1PJCA 4ETMA 5JSHA 1HT3A 4IJMA 4YP6A 1QQ6A 5IJ9A 1UEXC 3RG8A 1EUQA 3IQGX 4ZN6A 4AWXA 1H8HD 4MGEA 1HFWA 5TQJA 1K7YA 2QSYA 3WWEA 3TIXB 1M66A 1HRDA 5ES4B 2C3YA 1E7RA 3OF2A 4JU8A 2VXCA 4YUVA 2M98A 1AGNA 2R6AA 4U7HA 4IIJA 4WZZA 4BNKA 2HBZA 4RD1A 5BQ5A 2WD8A 4KNYA 4C2AA 3H3JA 1BE6A 3JQ7A 4C01A 2NO5A 3B6IA 4LYFA 4PBTA 3TZEA 1W52X 5EMHA 2F43B 1XTZA 1SXIA 3Q3GE 3H2SA 4JBIA 1A2KC 2F9MA 5TY0A 3VSCA 3ZX5A 1B41A 5H70A 4P3XA 2HQBA 4N65A 4I4TF 3RQSA 3J81A 3L2OB 4D3FA 1ZVVA 3E0XA 1W36D 3HSSA 3VI4B 1OD6A 3RRXA 1KQNA 1MO4A 1Q7EA 4G86A 4LZLA 2QN7A 3U17A 1GGJA 1FJGB 1L4MA 3FKSD 4ETNA 4NS1A 4TS3A 3Q6IA 2ZI6A 2OUIA 1CIVA 3I3OA 2QGZA 2XNDA 2NM0A 1I3MA 2WZQA 2YFKA 3IB6A 4WJKB 1TF7A 1LCIA 2D5LA 1YZQA 3Q7EA 2Q5QA 4HDNA 2OL4A 3A7EA 2RI1A 1P1KA 5DNCA 2UDPA 4I66A 3IDZA 4Q5IA 4ZVQA 1X0XA 2WZCA 1YC2A 5JDCA 421PA 4DLUA 4NNJA 1HYGA 4IUYA 2F62A 2IHVA 2QW8A 2WYIA 3ZWBA 2H08A 4D26A 3LP6A 1B26A 3RTGA 3LHKA 4BCBA 1YQGA 2N1BA 2XRYA 3OEYA 4TM7A 3E7PA 5LZ5A 1YASA 3VBEA 2GA9A 2X5NA 3BBLA 2FW1A 3BDVA 3H05A 3C5WP 1MPXA 3K8QA 3LNCA 3BH7A 3HWRA 3PWSA 4J0GA 1VDZA 2XXJA 2EHDA 3MAJA 4UBNA 1LBHA 3PSAA 3NBFA 1YUMA 1V5WA 3QUBA 1L5FA 3ZWNA 1M0WA 3FKJA 4RU1A 1EM6A 4YXFA 1XXLA 3V3TA 2J0EA 3BEDA 2RBKA 1JFSA 3GCDA 4AN4A 3JX9A 5KWSA 2CLKB 3OKAA 5KYXB 1EFRD 3P4YA 1EDEA 1NQVA 4RD3A 1WXQA 4FE7A 3R24A 4N3AA 1AGRA 2DM6A 3QA3E 3SOPA 2PO7A 3CW9A 4GLFA 3U4QA 2GZDA 2VT7A 4KXFB 1K8QA 4OI2A 2NN3C 3N39C 4OGKA 5GONB 1J5EB 5C8YA 3FMVA 4G5SA 4P54A 3ISVA 3JVEA 1OXTA 1R66A 4OYYA 4W8HA 5ECGC 4K6HA 4OMFG 3BB4A 3SR3A 4ABTA 1RBQA 3GVHA 3IT2A 5BT8A 2F9FA 5EJ5A 1RRPA 1L7EA 4NZNA 3WRYC 2QTNA 3H8SA 4MWTA 1IQ0A 1BU5A 3BXPA 1HZZC 4P5DA 5B1HA 3U7EB 1I6MA 1OH6A 1DDGA 3B1KA 1XZCA 1QYWA 4I5FA 1H2YA 1KI8A 2H1FA 3NTRA 4OHMA 4Q1FA 2AG8A 2OYCA 3CRW1 4LF8B 1MC1A 1J9ZA 2EW8A 3I9NA 1CUFA 3Q10A 4A15A 2GZ3A 3A1NA 1XZGA 3X1YA 3MOGA 3G02A 3WY9A 2XMBA 2GM4A 1ULUA 3OZXA 2Y77A 2B2NA 3NAMA 2PIAA 3WP1B 3HB0A 1WR8A 3WL5A 4CQJA 5B3LA 3MRXA 5LIRA 4C89A 4XB2A 5KYWA 3WHLA 4TTAA 1EEXB 1XDWA 2FETA 2QVGA 3PGA1 3LP8A 4BE7B 4D8TA 2VH1A 4D9IA 5JNVA 3MB5A 4G1MB 4QSHA 3LPLA 4PTZA 1LLDA 4PNZA 3DQPA 4J0QA 4OQPA 1VCMA 4KN5A 3QKWA 3W90A 3OOSA 2VTEA 3NS7A 2FPUA 3AHIA 3PFFA 1A8HA 2IVZA 2FF7A 1NW8A 3L7YA 3B38A 3R6LA 2PMFA 1EUYA 2B5WA 4PZ0A 1W0KD 3HB7A 1QGDA 4O4LF 3S1AB 5C5CA 1HH4A 2O3RA 2RJOA 5GZ1A 2A84A 3URKA 3VTZA 1B23P 3I04M 2PX3A 3VBCA 1TUEA 3BREA 4NX2A 1Y0BA 1JPJA 1U7TA 4UNRA 3OTOB 2VXYA 1YCGA 5JMWA 4RZIA 3IDSA 4K6KA 1OY1A 2AJDA 3QFCA 1Y3DE 1H2FA 1GN9A 2RK4A 4RV5A 5B64A 4JVMA 1D0VA 2DQ4A 1JFRA 3VR0A 1LSUA 1XZEA 2H3HA 4AZ0B 2NIPA 4C3UA 1RLOA 1KHTA 2QUJA 5DZSA 4P86A 3UBMA 2W4QA 4LUCA 3SXJA 1SXJB 3HXKA 5FWDA 2OFWA 2BTEA 2P65A 2F1HA 3NHBA 4ALMA 4MYDA 2VDLB 1ZW1A 4IQ0A 4UFPA 1JTVA 4XR9A 4YRAA 5KHLB 5IFLA 2CLOB 1J97A 4P31A 1WVMA 2EVWX 3ZWPA 1KJ9A 1XMIA 1HGXA 1A77A 1LLFA 2HMSA 3NGXA 4YRPA 4BBJA 5AKGA 1WXWA 4DT1B 5I7FA 2HLPA 4TQ9A 4ZDWA 4KQ9A 1WRBA 3LUFA 1Z0IA 4X1YB 3QBTA 1G5IA 4NFYA 3TLGB 1D09A 4ARVA 3D8NA 4ZO4A 4FX2A 5F21A 1U3GA 3ZYCA 2BSAA 1OHHA 4ZWNA 1FC0A 3WZLA 2WIJA 2ZR0A 2PSJA 4H0FA 3TTUA 4QDOA 4DMUB 1E63A 1O5OA 5FPHA 5FOUA 1TEXA 2GYVA 2HF2A 3OZ7A 4J1QA 4WLNA 4C6TA 3L84A 4HYYA 3HA2A 3I64A 3OICA 3GZNB 2WWIA 3PC8C 1ZA1A 1UXHA 3C8DA 1LF0A 4MW7A 3N28A 2P75A 4ZHQA 1X7GA 2SKEA 1M6VA 5LP1A 2VF4X 3DR3A 1F4PA 1OFHA 4OHKA 2XOKA 5JAOA 3BS4A 4I50F 5BSHA 1G21B 4EKIA 5JNSA 3QITA 4M83A 4IYJA 3V4PB 4J8PA 1JG1A 3PXGA 4EY6A 1U28A 1AUOA 2WG2A 2JCYA 3DE6X 2JRLA 4COKA 4X3CA 1UBKS 4UEOA 3PQ8A 1J2RA 1NBAA 1PT5A 4UAGA 1L5OA 1Y8ZA 3WL8A 2VK1A 5HM6A 5TX7A 1QH8A 1TZ2A 3T4XA 3EHEA 2WT9A 4HADA 3ZGXA 4I8IA 5E9WA 1U8TA 2YC4C 3D4BA 3H3FA 1F14A 1GZSA 1K92A 2WOJA 1OB5A 1OA0A 5JJIA 4BRZA 4F5YA 1BJTA 5YASA 1B76A 1RFGE 4R0VA 3V33A 3GRYA 4KAJA 1TDJA 1YL6A 3U9SA 4CKXA 2WE8A 2EWMA 2N42A 3L1VA 2SKCA 1R6TA 2B2CA 3GHYA 1V4NA 1SOVA 4M98A 5AK6A 5K0LA 3RRJA 1GUBA 5BQFA 3EGXA 4R31A 4IEFB 4N9WA 3GF4A 4X1OA 3JQBA 2CV0A 2V7UA 4MDEA 1OFTA 2QY6A 3KQKA 1E94E 4LXYA 3A1FA 4NE2A 1A98A 1G20A 4MYCA 4RW0A 3OZSA 1W6UA 4IXDA 3KWLA 1Y3FE 1R4NB 5AI6A 1E3WB 2WR8A 1Z2PX 2PMCA 2Q07A 5FHQA 3PUKA 4HCJA 4R9SA 5KCMA 1NVGA 1YU9A 5BORA 4KUEA 1Z22A 1CVIA 1C9EA 1PJ2A 3LWZA 4IVNA 2DY0A 1PX2A 3HP1A 3ORYA 4P3OA 4YROA 3C3DA 3N07A 2PJRA 3DBRB 3EOBI 1Z07A 3VFDA 1WXIA 3HO6A 1GITA 1DWOA 4JC4A 4CR7A 2EWVA 5A03A 2XRZA 1NF3A 2NNWB 1VG0B 3R3JA 4EPYA 1R50A 4FGZA 3AJEA 5EPUA 5IT4A 1SQ6A 1WZCA 4WOPA 4EHDA 1IXZA 1FUUA 2YWFA 5AKXA 3WYDA 5KYKA 1BMFD 3TDMA 2QLNA 3OZDA 1DIAA 2H9YA 4OYRA 2ADOA 2ATIA 4YAUA 5HPYB 2XVXA 1NJ8A 1KI7A 3VRHA 3IQXA 2CXXA 1GGNA 2FB9A 2N0SA 3U44B 2IV7A 2ZROA 2QLBA 1RD4A 3EXHC 3SK0A 2GXAA 2G7MC 3JR3A 2XT6A 3VQTA 5CVUA 3CV3A 1IM8A 4RLQA 4HB2A 3BIFA 2JZNA 4OXYA 2NQ8A 1HL7A 3D4NA 1SC6A 4WZAA 5F9MA 4BMSA 4X62B 2OZLA 3B1JA 4H1UA 1LVGA 3ECAA 3RC2A 3GD5A 3GT3A 5KMGA 3NP7A 1H2XA 4Y2TA 1NHWA 5JXWA 3WFJA 3HB4X 4L8LA 4S1PA 3R9WA 1X7XA 1CRZA 5K0GA 1ZN7A 5PGMA 4F2HA 4ND5A 3TR0A 4CCYB 3UH1A 3RIEA 1NPDA 4OIMA 1TZKA 4CF3A 3BSYA 4N49A 3JWEA 4UC0A 4QFMA 2DGDA 3C14C 1QR6A 3VAZA 3AF1A 1MORA 4FR2A 1ZIXA 5K0NA 4NY1A 5TPWA 4K28A 3RI3A 1BE0A 4NICA 1M73E 2CXOA 2GZAA 3PVSA 1KMHA 2IP2A 2WJIA 1T0IA 2X14A 1TLFA 3BXEA 2BMDA 3PC4A 4HH4A 2OD9A 4IRXA 3HVRA 2BFDB 3HQ4O 4TYQA 4FOSA 1R0CA 2Q5CA 1HORA 1W1WA 4LYYA 4NE7A 1MX5A 5LZ8A 5AK3A 2FK8A 2XKAA 4LSMA 2W58A 3RVMA 1EB8A 2WVGA 2WE7A 3DUWA 5A0FA 2XJ9A 1LH0A 1NT4A 4U1RA 4EPRA 2OG2A 3VC2A 1DG9A 1JNXX 3F71A 2IBTA 4OMCA 1RIIA 3IUNA 4ZVUA 3EXAA 3L1UA 3O2JA 4OQEA 4QECA 1MLDA 1WSWA 4FGLA 4AWBA 2CBZA 2O7VA 4GLOA 1IWOA 4OJTA