1QWOA

Crystal structure of a phosphorylated phytase from aspergillus fumigatus, revealing the structural basis for its heat resilience and catalytic pathway
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
435
structure length
434
Chain Sequence
CDTVDLGYQCSPATSHLWGQYSPFFSLEDELSVSSKLPKDCRITLVQVLSRGARYPTSSKSKKYKKLVTAIQANATDFKGKFAFLKTYNYTLGADDLTPFGEQQLVNSGIKFYQRYKALARSVVPFIRASGSDRVIASGEKFIEGFQQAKLADPGATNRAAPAISVIIPESETFNNTLDHGVCTKFEASQLGDEVAANFTALFAPDIRARAEKHLPGVTLTDEDVVSLMDMCSFDTVARTSDASQLSPFCQLFTHNEWKKYNYLQSLGKYYGYGAGNPLGPAQGIGFTNELIARLTRSPVQDHTSTNSTLVSNPATFPLNATMYVDFSHDNSMVSIFFALGLYNGTEPLSRTSVESAKELDGYSASWVVPFGARAYFETMQCKSEKEPLVRALINDRVVPLHGCDVDKLGRCKLNDFVKGLSWARSGGNWGECF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of a Heat-resilient Phytase from Aspergillus fumigatus, Carrying a Phosphorylated Histidine
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Hydrolase
molecule keywords phytase
total genus 158
structure length 434
sequence length 435
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2003-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1qwoA01
2F90A 1BIFA 3LG2A 2YN0A 3ZHCA 2I1VB 3D4IA 1QFXA 5AJVB 1SKAA 2PA0A 3C7TA 1XQ9A 3HJGA 3K4QA 4JODA 1NT4A 2ENWA 4IJ6A 3NFYA 2OWDA 4PGMA 4ARUA 2OWEA 3LL4A 4MA4A 4ARSA 2P77A 3MBKA 3IT1A 4TSRA 2P6MA 5AJXA 2P30A 3FDZA 2P9FA 1DKQA 1SK8A 3BIFA 4EMBA 1BQ4A 2P6OA 1QHFA 5CU7A 4ARVA 2QNIA 3F3KA 2P2YA 2RFLA 3K4PA 2P75A 1QWOA 3E9DA 2A6PA 3OI7A 1T8PA 1V7QA 2P78A 1TIPA 1ND6A 2A9JA 4EO9A 4D4LA 2H4XA 3NTLA 1RPTA 5CDHA 1YFKA 3GP3A 2EKBA 2YN2A 1DKNA 3QPVA 3FDZB 4HBZA 5AJWA 1C80A 2WNIA 3EOZA 5HTKA 1CVIA 2EKZA 3IT0A 5AJZA 2WU0A 3KKKA 2ENUA 3GP5A 1UJCA 4AROA 3IT3A 2WNHA 1IHPA 1K6MA 1SKBA 2DWPA 4D4MA 1FZTA 2P9ZA 5AJYA 3MXOA 2HPAA 1UJBA 2P9YA 3QPUA 2H4ZA 5AK0A 3DCYA 1EBBA 1V37A 1C81A 1E59A 4D4KA 3QPWA 2BIFA 4FDTA 4JOCA 2HIAA 4GPIB 1RIIA 1ND5A 3D6AA 4IJ5A 2P2ZA 1E58A 3D8HA 3F2IA 3EZNA 2EOAA 2H0QA 4JOBA 1FBTA 4PZ9A 3E9CA 4E3WA 2DWOA 1DKMA 3PGMA 1DKPA 3O0TA 5CX4A 3FJYA 3R7AA 4PZAA 1H2EA 2P79A 3DB1A 3IT2A 2HHJA 4GPZA 2GFIA 3GW8A 4FDUA 4ODIA 3LNTA 4D4JA 4QIHA 1H2FA 5PGMA 1BQ3A 2IKQA 1DKLA 1DKOA 1YJXA 2H52A 3E9EA 2AXNA 1SK9A 1RPAA 5HR5A 1C7ZA
chains in the Genus database with same CATH superfamily
4YUVA 3VU9A 4MW4A 4FOOA 4JEUA 1NFRA 3R09A 2JGLA 3N1UA 3DHNA 4G0OA 4D0LB 5CG1A 3KLOA 2HXGA 2I67A 2XGMA 3SDSA 3VHLB 4CM1A 2VTDA 5BVHA 2I33A 3QKRB 3OQBA 2B2CA 3GGGA 4D99A 4WN9B 3CRVA 5C7LO 3A1VA 1T1GA 4OSEA 3B2QA 3R0IA 4X20A 4X61A 3TSCA 1ISHA 4P53A 2B2NA 4I8DA 5AI8A 3MMSA 3FHOA 3T5BA 4MNTA 4BMPB 2GCOA 2NSJA 3DFIA 3LKDA 2X13A 1XRJA 4JWKA 5D1HA 3D7RA 3CZ5A 3DXXA 4WINA 1Q83A 4R1LA 4Z9XA 1CVRA 3C6BA 4KB5A 5G53C 2IUUA 3UAVA 4DHEA 4MV1A 3PVCA 5JFTA 1D2CA 3E9DA 3FBWA 1RQGA 1U1GA 2PKYX 3O2SB 3W5DA 2IY8A 2NO1A 2RD2A 2A9FA 3EXAA 1DDOA 2YQZA 3E05A 3L6BA 3EGDA 4WCFA 3MINB 2CKMA 4YJFB 5FP0A 3TIVA 1JAZA 4B2IA 3RYHB 5G3YA 4EI2A 4EO9A 1KI3A 2AOTA 1VSBA 1QZ3A 3KXIA 2VRCD 4EKNB 2FZLA 4EZBA 1Y3DE 4GMHA 4JT9A 2P27A 3BQ9A 1Z0ZA 1PQYA 2YWXA 3L4SO 2WQZA 1MV5A 1TUIA 3IULA 4EHFA 2Y8EA 3K1YA 3RBAA 1GZ6A 4DV6B 1KK1A 5D8DA 1KE1A 1C50A 4G0WA 1EPUA 3L01A 3K73O 3N87A 1CPYA 3UV3A 1X80A 4B4VA 4ER5A 2Z6UA 1MG0A 3GLIE 3CFYA 3UB4A 1XPOA 1SCUA 4KFCA 1I24A 1FRFS 5FBKA 1XRQA 4ZZ3A 1XDBA 4FYKA 4V02A 3SLGA 4JB8A 4JGBA 4NS4A 1YQXA 1KF0A 5KYYB 4RYDA 3UWPA 3UGTA 4F9GA 3KIPA 4FNMA 1E2JA 4HNRA 4M1EA 3M9WA 2V97A 3T5CA 2DKOA 5ADHA 2A9PA 4MX8A 3P4XA 2OCKA 1P4AA 1MJNA 4GMDA 3V33A 3E3NA 4B3XA 2OKGA 2Z4SA 3P2KA 4IJQA 3V4FA 1TC1A 1SZDA 4D42A 4G07A 2A57A 2QL9A 1CJKC 1JKIA 2NGRA 8OHMA 1QE3A 4CF7A 4R3NA 3H0KA 3LPMA 4E22A 4GYKA 3ZCXA 4D96A 1QDEA 4K9SA 3USES 1NGSA 2G9NA 2AD1A 4MCHA 5JS1A 2N46A 3GAMA 1RHQA 5LMCA 4HZGA 4XYBA 4ZRNA 5F4ZA 4AVYA 2JC3A 3BHIA 9ABPA 1A7KA 3O0TA 4Q3AA 2J85A 3DUWA 4BVHA 1A72A 1NYTA 2O7SA 3BRSA 4UOEA 4H27A 5LB4A 2O8CB 4Q9JA 1PJLA 1K68A 4IIJA 2DXIA 3RRXA 3KQKA 1XTUA 3DV2A 4G1VA 1K7CA 2A9KA 3ZW7A 3H13A 3Q2KA 3ZU5A 5BSRA 1GQQA 4B87A 2MYUA 3PK0A 4O2AA 1HBJA 4PCAA 2AKAB 3R76A 4HLNA 2BN4A 1B8VA 2GMWA 4UC0A 4WZ6A 2HFKA 4QPDA 5LFAA 1GRCA 5FPHA 1YKFA 2W6ID 2ZJ0A 3LXMA 4NMLA 5FTNA 1XNQB 3DE0X 3KOWA 5BNTA 4LKRA 3JALA 3R5FA 1LBHA 1EU1A 4F45A 3HADA 4OHOA 3ZDFA 3PTZA 2JJ8A 2CFCA 4JY7A 3KETA 2HI0A 2H4FA 4MP6A 3BD7A 5A3SA 2IV7A 1HLPA 2PLWA 1J8MF 2B7LA 4M0FA 4WLNA 4YRQA 3W2GA 2A1UA 4C04A 3GLGE 3SQDA 4JX9A 4LHXA 4AECA 4BNTA 3E3MA 2GZHA 2ODPA 3QE4A 3A1EA 2PXHA 4OX9B 1QU3A 3FYUA 3O2QB 1OLXB 4JVOA 2CXPA 1P9OA 5DSXA 5KYUB 1N2IA 2AN4A 1NRXA 2VSNA 4FEEA 4I55B 4S0ZA 4MKIA 4LZNA 4E5KA 3PXAA 2P8JA 4R31A 4TV9B 1QQAA 4ZMRA 3PDIA 3ZGZA 1E2KA 1US8A 2BHLA 4F1KA 3BA6A 3VH2A 2X40A 1ZJ6A 3QYFA 4CKZA 5E7JA 2AFHB 2XE8A 2YFYA 7GPBA 1GPBA 2XTMA 4J2OA 1XF9A 1MO5A 2P7IA 1NNUA 5CP8A 3F7OA 2EW1A 3GJRA 3R5KA 4PHHA 1KQOA 3IOMA 3UCEA 1N1GA 4QUJA 1JUDA 1R9MA 3OZ7A 2ZXEA 2QN6A 4OJNA 5SY9A 3QSYA 1ZK4A 3AUAA 1SG9A 1CJMA 2EKBA 2G4VA 2V6FA 2NUTB 2YN2A 4FHZA 2AX3A 3FNHA 4L02A 1JMYA 4TUYB 1AHNA 3E22A 3NX4A 1QNFA 1ADFA 1R12A 3GJQA 4NI5A 1K63A 3NC0C 1PR9A 4FHFA 4OFZA 1ZUD1 4ICIA 4R2KA 3K6SB 3UAGA 2G9RA 2OBBA 2X9NA 3C39A 3DW3X 3TVTA 4PZLA 2XZDA 1WO8A 3KDAA 4LGVA 4Q3NA 1KRHA 1HYQA 2PD3A 2F3UA 3DCIA 1GCGA 1OZGA 3NHBA 4JI5B 3U60B 2NO4A 1HKUA 1C7EA 2VT6A 4MRSA 2RC5A 5DXJA 5E9WA 4RAQA 4ZT4A 2E6UX 1G2IA 1I1OA 1K98A 2I4RA 4G0VA 4IXMA 1HSOA 3R74A 3DVAB 3WYCA 3S2YA 5J47A 2C9BA 1CUIA 2GPWA 4ZQHA 1N9GB 1N3IA 2KMLA 2VSXA 5ARDA 5FTKA 4FS8A 2HMUA 4HXFB 4DUGD 2HRDA 4KXVA 4EW3A 4BX3A 1OPRA 1VJCA 4EG0A 3OX2A 3C3MA 2ANCA 1GXSB 2DECA 1RE1A 1LDMA 3M4ZA 4NMXB 3QLVA 4V2UA 5EVJA 2EJUA 4F8JA 2FZWA 5F7OA 5CDFE 1RIIA 3PKZA 1AN0A 4W5TA 2RI6A 1ZOOA 1OLUA 2Y4OA 5LQKA 3L8GA 1UBSB 2BM1A 3A4NA 3U4CA 1QYCA 3Q9NA 3ORSA 1G98A 1JQLB 1P9RA 2Q1WA 6REQA 1IB0A 2HK8A 2IP1A 4AW9A 1XCOA 1NQTA 2E0IA 1HT2E 3I1FA 3M6VA 1NNEA 3LQ4A 4FS3A 2I2CA 5I9MA 3VR6A 1Y8RB 3AKDA 4PO3X 4UNNA 3U1VA 2WBLC 1P44A 4HNVA 3NIGB 1Z39A 3PRYA 1OROA 1M66A 3CCBA 3DB1A 3LE8A 1IVNA 5C5EA 1NYRA 1UBHS 1QVZA 2EP8A 1R6VA 2I6GA 1L6RA 3GV0A 3LWZA 3L0IB 2W6MA 1QM5A 1KQGA 2C9MA 4KGXA 2O0HA 2QI9F 4RPGA 4MAMA 3E61A 3LT1A 5DBFA 2AJCA 2CVPA 4I81A 5U4XA 2GD2A 3V4RA 3OLZA 2XMRA 1VI2A 4ZOAA 3LOPA 3U3OA 3AP1A 5HQJA 4HVCA 1ZLYA 4TV8F 2W6JA 4OTZA 1E64A 4J07A 1F2UB 3RE1A 3K70B 2ESRA 3VR2A 3OE7A 5FUMA 5BRJA 5ENDA 2PYZA 3H42B 5IMSA 2CCGA 2H5IA 3L1IA 3L6OO 3HR4A 4IDCA 1V11A 4OK3A 4PIVA 4IV5A 4BP1A 1QDLB 3PI6A 4XIYA 2JLWA 2J7KA 3BBLA 1ZIYA 4HFJA 3ZI7A 4D8VA 3WRWA 2HJHA 3MWJA 3NYRA 3VOTA 4NECA 2YV1A 1A5ZA 2GBIA 4QBFA 4RK5A 1KJWA 3CRRA 4GX1A 3GJ0A 1M0WA 4DSNA 4YAIA 3DV0B 1WW3A 5T41A 5SV2A 4UUQA 5ECYA 3EGXB 4J16C 1S2LA 3RFVA 1TGYA 4GMKA 3WNCA 5IJ9A 4EPYA 1H65A 4A0FA 3GRPA 4KHZA 1YL5A 3PFBA 1C2YA 3PYMA 1TE2A 2NPIA 3EBLA 3HFGA 4D41A 2ZQ5A 4D4LA 4G67A 4HMPA 2WU4A 3P9KA 4N6GA 1EXVA 1FSPA 5G1OA 1KNXA 3IDZA 3X1JA 1UK7A 1Q0HA 1NW6A 2WVHA 4G36A 3WQBA 4ZVLA 5DTRA 3GRRA 2PX3A 2AMLA 3EOZA 1KI7A 2BF4A 2HU8A 2VQ3A 1M75A 3WV4A 4BUCA 2P6NA 4RFVA 1Q22A 1ZGAA 2HPZA 4N5LA 3RWOA 1JAHA 1VL5A 2BFNA 5BN4B 3E2MA 3TZCA 3EIQA 1VKHA 2QUBA 1M2FA 2P9ZA 2X19A 1L4NA 1LJ8A 2HPAA 2QSYA 3H4IA 4ZT5A 2O8NA 5A6SA 2O3JA 5KNDD 3NBQA 2IYNA 1HDGO 4CQMB 4TTTS 1RVDA 1TYEB 2GN1A 3CMCO 4BBAA 5KQMA 2CGEA 2NO7A 2GB4A 3FYCA 4S12A 4OMCA 4LVNA 3ESQA 4QUHA 4BJ6A 5KVAA 1ZLXA 4IHJA 2AW5A 2YXNA 4EMUA 4NYJQ 4BX0A 5K4HA 4L73A 1B74A 1ZI8A 3RJTA 3HB1A 3U48A 3A4TA 3WGOA 4PG4A 1AZTA 2GJAA 4ID9A 3W3ZB 3DUFA 2X9LA 3EVFA 1GRQA 1SVIA 2OHJA 2XMGA 3U2QA 1RZRD 1P18A 1PR0A 4XWAA 1VTKA 4P3PA 3LLCA 3C3XA 3O4HA 4LY3A 1FSGA 1U1CA 2EERA 1SD1A 4LWZA 1Y9JA 3EDQA 4L57A 3ZE1B 3CLRC 1GPKA 2ECPA 3O3MB 3QRWA 2BSAA 4ZDJA 1GQFA 3OJCA 2OP1A 3FCAA 3NGLA 3VYUB 2OGTA 1GCIA 1PGJA 5JV5A 3VTAA 2HJGA 2IXGA 3IUQA 3FMFA 5EEHA 3ZY5A 3GBPA 1Z5OA 1H8EA 2VYVA 2R11A 2RHDA 3QWAA 5T3UA 3ELWA 1BVRA 4TRMA 3EMBA 1UZNA 2O3RA 1FFEA 2R2GA 4RA9A 4BCCA 2VH5R 2Z8YA 3HSSA 4HFMA 3FOEC 1E2GA 4HS9A 1P19A 4HD8A 1UDBA 1Q0LA 1ZH4A 1PNQA 4YX9A 1T2UA 2DVMA 2FP3A 1J07A 3LV8A 2QX6A 1OU0A 1JIXA 2AN1A 4EG4A 2C3PA 3F71A 5K03A 3WNBA 4KPYA 1WOYA 1TF5A 1Q0QA 3GLHA 4DLKA 3WK5A 1YQUA 2Q9UA 4L8WB 1HDYA 3G0GA 4R3UC 3NAQA 1KJQA 1ZNYA 2M32A 1N0HA 1P81A 3MFQA 4ITUA 3K5HA 5BNFA 3LCCA 4JFRA 1ZU4A 2AFRA 2AN3A 3UPTA 3RTAA 2O0JA 4FMDF 3TEFA 2DQKA 2Y9PB 4UBOA 5BXQC 2VK2A 3BXXA 1M33A 4Z1MA 1B6RA 3OTGA 4PNPA 3B5IA 1YB4A 4KWIA 3MGCA 4RFSA 1TUBA 2R62A 3WNVA 2IHTA 4MJXA 4MYHA 4UE6A 3RAEC 1P7PA 2YMPA 3DFUA 3IMGA 4C20A 4YYEA 1G8AA 2P5SA 2PUAA 1WSWA 5IANA 1RAGA 1G8MA 4M4SA 4Y98A 2GEUA 4MS3A 1LNSA 4RZQA 3GCWA 3VPBA 3JQ7B 3WGIA 1EFUA 1OWOA 3T06B 3SU8A 5D7BA 2XWQA 3ZBQA 1WPQA 4G86A 1Y3AA 2G17A 3LFTA 2CYAA 4EYKA 2O50A 2BTEA 4Y2TA 2XRMA 1Z6XA 5DNEA 1ODKA 3A2KA 3B6JA 2IITA 4LJAA 1GQSA 1RABA 1XYGA 3C6YA 3HYLA 5AUNB 2XOKA 2B2XA 3ROFA 1UJCA 3SXPA 2DLCX 4IICA 2FWNA 2JFWA 5LU9A 4NS1A 4R68A 4EEKA 4GRAA 2GD6A 1M0TA 3QWFA 1QPGA 4I9NA 3RKUA 1SPXA 2WD9A 4GM0A 1KI1A 1RDFA 2YOHA 2FPKA 2YTZA 4MMXB 3VPAA 4CDNA 4UM9B 1JEYB 4RABA 2NZ2A 1OAOC 1XMXA 2GRAA 2YDXA 3M4NA 3F6BX 3NWEA 3TQSA 4Q5IA 5FR1A 1BO6A 2X9GA 2BZ0A 5HMMA 2IOFK 4U2CA 3I2JA 4L5BA 2WF5A 3NHPA 4WW0A 2AI3A 3EFEA 1RZRA 1C1DA 4AJPA 3RREA 1NQXA 1H4TA 1YA8A 2VJQA 4LWOA 3AHCA 1OT5A 5JDCA 1HDZA 1A9ZA 2XUHA 3REOA 1Z8DA 1QC5A 1VSQA 4W5OA 4W6ZA 1J5XA 1DZIA 1O94D 4R7GA 4YRRA 4WMLA 2GXSA 2XTAA 3LSTA 2JHPA 3MJHA 2DUNA 3A8TA 3NETA 4FBGA 2ZROA 2WU8A 1BJRE 2ASEA 5CVUA 5BPHA 1RYMA 2E89A 1T5SA 5H1YA 3H2BA 6ADHA 4GKVA 3IL2A 1S8FA 3H19A 3D8BA 1P2VA 2NAFA 2FP4B 3WBFA 2QGNA 3G2QA 4XSVA 3Q10A 4EUHA 3WFJA 4NP6A 3GA7A 2ACWA 4C0HA 1VCHA 1XVVA 3KB8A 4IG4A 5JSYA 2B0JA 3C1OA 5B6JA 4GD3Q 1JWAB 2F3QA 2JRLA 4MPTA 1EUDA 2OBYA 3NEPX 3OPYA 3U49A 5BO5A 3UHFA 1MV8A 3CZPA 4BZXA 1FUKA 3ZWWA 4DCUA 2V55B 5C51B 3NW9A 1ARZA 1YJ8A 1QFXA 5CCDA 4D80A 1X1QA 1K75A 1YZYA 3RRZA 3FXAA 3ZWNA 4GM1A 1T4CB 2PGJA 2C4MA 4ZVQA 4ZYZA 4RPLA 4BFVA 821PA 2IL1A 3S4YA 2JLBA 3LL4A 3PC4A 1OA0A 2GI4A 4F85A 4Y9TA 3AHIA 4J7XA 2OBFA 4JI0B 2XQKA 2W5UA 2BBTA 3PNOA 2FYTA 1UXOA 2RSLA 3DEIA 3GNQA 4UM7A 4CV3A 1SXJD 3WC4A 3NHRA 1M2VB 2H4WA 2EQAA 1NSFA 3D2CA 3MOIA 4X44A 3EBPA 3PGXA 5LZ5A 5D85A 4Y2PA 3UKDA 1VG1A 4JQYA 3GH1A 4J0JA 5K8VA 4MYDA 4PNEA 4GMFA 1F2VA 3PXXA 3QKUA 1X7HA 2A3RA 3T15A 1V7PC 3Q0EA 1CHNA 1MD9A 2REQB 3C43A 3I2GA 4WIAA 5CB6A 1D6JA 5JRDS 4MVJF 5I9BA 3LWBA 5A7FA 1XHLA 2OA0A 3N2KA 1NX9A 3THYB 3OECA 5ALIA 3V3KA 3SZ3A 3EOAI 3BFPA 5EQTA 4HFNA 5FAKA 1D4ZA 4FDLA 4C2AA 4RHUA 3FOAA 2H4HA 3TW4A 4QDJA 1K92A 3HHPA 4BNDB 4YT4A 4HUQA 4TYNA 4J0HA 3RUDA 4NKRA 3NTRA 4FFNA 4FSHA 5BSMA 4ON9A 3VZDA 1K3FA 5JPIA 1FZTA 3QELA 4CXMA 2QUAA 2AYZA 1H9CA 5DSZA 1ZC3A 4KVGA 4MP8A 4ARZB 5MN6A 2WFZA 3PA8A 1CIVA 3CLSC 2WWXA 1XUOA 5INTA 4HJXA 4C4SA 2VPQA 2JG3A 4M8KA 3LNCA 3VO9A 3K0AB 2ZM5A 2H9IA 3KPUA 3O1IC 2E87A 1KZ1A 2ES4A 2QAGB 2QX9A 2OCIA 2W4IA 2YHIA 3HBMA 1WDKA 5DSTA 2EG9A 4BY9E 2IEAA 3CY6A 5C7OO 2C97A 2FEXA 4BNDA 4HLUC 1CEQA 1Z5PA 3V8RA 3JSXA 3IMKA 3DE5X 4UJ5A 3C8UA 3W6UA 2HC9A 2PT9A 1E1KA 3N05A 1XU7A 1Q1BA 1MABB 1DFHA 2YW9A 4L5YA 3NPMA 4ZQEA 3V3TA 4C5AA 3C45A 4ZTUB 2H2HA 4YC7A 1Z63A 1WUKS 3DO6A 2ZJ4A 3UMYA 1YRHA 3SF0A 4J76A 5G0TA 3U9SA 2A86A 1TQDA 1E6UA 3ET5A 2GSDA 4L8YA 2OSBA 4QTXA 3RSQA 2ZK7A 3VVMA 4MA5A 3CN9A 3EZ9A 4RJLA 1JDUA 2WF6A 2R3SA 5KTNA 1B23P 7MDHA 4QUAA 2J7PD 3DEFA 3NNDA 4KMMA 2MOKA 4WVLA 4E7OA 1SCBA 4N39A 3BEDA 1ODIA 1PYOA 2X77A 4KI0A 2J9ZB 4RA9B 4PN7A 2XVAA 4J3JA 4O8ZA 3IX7A 3UMRA 1GGHA 2ZJ5A 2Y0BA 3X44A 1P2BA 4ZOEA 4JLWA 2P9QA 2J8ZA 3NVDA 1RKBA 2CDAA 2A35A 3P96A 4NHOA 2H1WA 2XTNA 3GEDA 3VNRA 3L8EA 4X92A 1O94C 1WX1A 3DWGA 3A4VA 1B15A 5JCJD 5EJGA 5T67A 4CCWA 5K3EA 1K4KA 5H9VA 1UZUA 3EFHA 4BMSA 1N9GA 2VBFA 4XDGA 3BGWA 1QK5A 1C4WA 4HDSB 2HPHA 1NN3A 1P6UA 2O0MA 2LIVA 4HGPA 4OHKA 4EA9A 5C35A 1FUIA 1UKZA 2C7GA 2XQGA 1SC4A 4FFRA 2VAMA 3DUFB 3UXEA 4RV5A 3VH1A 4HZUB 4YMUA 4H1TA 2AG6A 2E1PA 2AK3A 1INLA 4J49A 3R8CA 3UJ6A 4LE1A 2QU8A 3AHEA 3FDXA 4N6OA 3OPQA 4PFJA 4RZHA 5EUCA 5JYDA 5JYEA 4AN1A 4FR0A 4YAEA 2XF2A 1I5OA 1XHFA 1N2CA 2R5FA 3E8SA 4CMEC 1EXWA 3SHQA 4S04A 4E32A 4BDSA 1H94A 5A6SB 3RG8A 3ZEAA 1BHQ1 3E8XA 5KI6A 2JARA 1NW8A 1G41A 3O4IA 5HFNA 1RC0A 1GDDA 5BN4A 4NBLA 2SNIE 3JATB 3CGGA 5EP1A 3VSAA 4BMYA 3ZLUA 4C76A 1DKNA 2CXSA 4BEVA 3I4CA 2QX8A 2PJUA 3HC7A 2PUBA 3BWXA 3D3JA 4UMVA 3NDPA 2AFHA 1Y7HA 1LPPA 1TAQA 2LRHA 4OF4A 2O07A 3KU4A 4P58A 1O57A 3ASVA 3T7DA 5AW9A 4B73A 4DIUA 4DPKA 1OBCA 4XUEA 2JGKA 3EWSA 3WGHA 1JNXX 2RJOA 1VLZA 3GLHB 4ZO8A 5E8RA 3TUJC 4EO4A 5M04A 1E5TA 1R0LA 5EERA 1YQEA 3W3AA 2OZKA 1BN6A 1KU0A 3OQVA 3DVLA 3WYNA 4YQYA 3AKYA 2FX3A 5JJBA 1TEZA 2YOFA 4G0ZA 3MAAC 4KN6A 4KH1A 1C3EA 3TNFA 4XWYA 2H00A 2JFZA 1YBHA 1BTOA 1CERA 2LR0A 3CO5A 2DWUA 3HDQA 1SXHA 2VLIA 5LP6B 3E4CA 1SVKA 2CN1A 2ZYHA 4NZOA 1TCUA 3GJSA 3E70C 2REBA 3WLEA 1NV8A 2A9VA 3KJZA 5CCBA 1YE5A 4D4HA 1AM4D 2LDBA 1R5OA 3AUUA 3JD3A 1KAHA 1MIOB 1SB8A 3HLTA 2X15A 4UTNA 1DTEA 3OT1A 4RY0A 4I6EA 4X1KB 4KBGA 2AZMA 1E2UA 4HYYA 4NBNA 2WHRA 1N6RA 1T5IA 1U8AA 4KQHA 4RU1A 4BWFB 3PNYA 3SYTA 5BV1A 2QY9A 4O4HA 1OJ7A 2MSCB 4B43A 2HGSA 1ORHA 2Q50A 4L1KA 5IAKA 1YDGA 1ESZA 3B3JA 4A0SA 1F2UA 1TEXA 4OI2A 3DNPA 2XMBA 3QQPA 1S01A 4Y6LA 1LK0A 5J1TB 1P1RA 1N5KA 1WRBA 5ERGB 3W7AA 2O8CA 2V7GA 1L5SA 4TGLA 3I9OA 1B6GA 4A2QA 1K2WA 4PC6A 3DBLB 3TL3A 4DG8A 1PD1A 3M6IA 4NAVA 2ZKIA 3A6DA 2VYNA 5CGQB 5E9AA 4RKEA 3UGKA 1SURA 4IZIA 2VP5A 4IIJF 1RI2A 3P9RA 3PIRA 1UWCA 4X45A 2NT3A 2BLLA 3N39C 2FKNA 4KKXB 4M6WB 4LMBA 3TLKA 4QUGA 3TPCA 2HQOA 2JLQA 1VLVA 4X1IB 3AB8A 3RAPR 3VU1A 4BMZA 3FCXA 5AVRA 1PTKA 4ZOQI 3HCWA 4TXNA 2VUSA 4Q1CA 1T36B 3KZ1E 5G3ZA 2YV4A 4REQA 3UTDA 5EXDA 4OXRA 1AA9A 4DYHA 4ARUA 1GT91 2FF7A 5B7NA 3SJBA 4W63A 4ZV7A 3ZHQA 3O7WA 3WYGA 4L9WA 4FGJA 4Y6OA 1O5OA 3CF0A 2C78A 2FU5C 2I80A 4ABTA 4EVQA 4DDVA 1Z82A 1CF4A 3CLTC 1GKYA 3KKMA 4DSTA 4WNIA 3SZUA 3N2IA 5CDFA 1PFGA 3DLCA 3DNFA 4O2BF 3TNJA 3TQOA 3ZU2A 4D2IA 4OMUA 2CJWB 3EA0A 3BCUA 4B79A 1KQPA 4DEYA 4G0MA 3SGLA 2FAXA 2Y76A 3G9QA 2IS6A 2FRDC 1FLDA 1J5PA 1OASA 2QQ0A 3OFND 4NNJA 2FEPA 3EXG2 1WBBA 3K8QA 4FN4A 1X0VA 2VNKA 4BP9A 1TM4E 3F5DA 3CX3A 4Y2RA 1Y1QA 1NVDA 3QBTA 3IOYA 4FPXA 2C04A 3HKCB 4GZMA 4NOJA 5AJUA 5HF5A 3IRUA 4NZNA 4Q03A 1X6VA 2CXOA 1CQPA 1F2TB 1BKYA 2CEKA 4IWYA 1SVWA 3GGCA 5TQ0A 5MGNA 3U44A 3K0EA 2KX7A 1S8AA 3BJRA 3H5IA 3VR4A 1F0KA 5F77A 5C8DA 3EJ6A 4PBSA 5AT1A 1J1UA 4KIJA 3ICVA 4MGHA 2AW3A 1QCYA 1EDBA 1SKBA 1X9IA 2NX2A 4UDOA 5AVKA 3WJ7A 4C9BA 4XYLA 4RTMA 3PJRA 5F2OA 4FGLA 2DPYA 2P9YA 4M76B 1B8NA 1Z2CA 4DRXB 1VFPA 1XNGA 2JFUA 5F64A 1P4GA 1IXSB 4FLEA 1G17A 3MTJA 4QUKA 1FMCA 1T1EA 4G5FA 2K7ZA 3WGUA 2W0SA 2VXYA 3B82A 1GEGA 4G0QA 2PLFA 3H5OA 3UAWA 3NT5A 3U81A 1TU4A 1EP9A 2L0XA 4DEXA 4HQ0A 1KMQA 1ZD4A 1A9TA 2I1WA 2I4LA 2YJ3A 4MQEA 4J0KA 4J4BA 2PLRA 2J30A 3AF1A 3GHHA 1U0GA 2I6SA 3O8BA 1A50B 4QEDA 4LJ5A 3H1FA 4XLTA 3REGA 2JJ1D 1XZBA 2GK3A 3UANA 4DJFC 5IDWA 3JAMA 3I01M 1XNHA 3IVAA 3KUCA 1NATA 2WMNB 4RXMA 3GLGA 3H04A 1PL0A 4B48A 3GLFA 3QFRA 1D8AA 4GI7A 1EUYA 1N2ZA 3TTVA 3ENNA 3GX1A 3B6ZA 2W2KB 2AZ4A 4N5MA 2F00A 1GL3A 3DD5A 2ZAGA 3PHLA 4MVJM 1ZRMA 4G1EB 4DZZA 5KTMA 1CYDA 1T8YA 1LJLA 2J5BA 4MQMA 1H2RS 2Z04A 4HTFA 5LQJA 4Y2GA 1G7TA 3DKPA 4HEA1 5IAJA 2GZRA 3BE8A 3W77A 3ETLA 4LYEA 4HDKB 4M0KA 5HDQA 5ICGA 5C8VA 2LBPA 1PG2A 3U3ZA 1MRSA 3TR5A 2FXIA 1R4ZA 4FWIB 2JI4A 4D8UA 2CXUA 2NO6A 4JGIA 4IAOA 3FTFA 4LY9A 1WPRA 1HE5A 2C4TA 1DEKA 1DC3A 2HDOA 1PT7A 3N8NA 2GYVA 4KW7A 4QL3A 2RGYA 4XGRA 4XQ9A 4YP5A 4CQLB 5K0NA 3F2VA 2BFCA 4K28A 2AE1A 1E9SA 2I6FA 2IX9A 4HFRA 3H2HA 1M1YA 4MYRA 2PUVA 4OHXA 3VYSB 3W8FA 3WLTA 5KX5A 4YB8A 1A9SA 3FDZA 1N0IA 4WESA 4QZVA 3T7AA 1T5TA 3CUTA 4Q3CA 4IL5A 1KIMA 1BWRA 1K8XB 1ODJA 2BMVA 1TYDE 3LUPA 4V0SA 1M2KA 5EPOA 4DLXA 4Y9DA 5B7PA 1CRWG 3GQBA 3THXA 1WZIA 3C4VA 4B83A 2I9KA 3I92A 2DPGA 4QGBA 3ZE7A 2X6RA 1JDBC 7ABPA 2I8LA 1YDFA 1CUSA 3PXBA 2JAPA 1C0KA 2FOLA 1W8IA 3IVXA 4QFBA 3SJAA 5IAAA 5J2UA 4JC0A 3P27A 4KVFA 2WD8A 4V39A 3T7RA 4ZJZA 4RLFA 4R69A 1CHDA 2I03A 3KR0A 2BZSA 4P7BA 4LDRA 3ANYB 2H1SA 1E99A 2EP7A 3NB0A 4LX0A 3OIGA 1REQA 4D0RA 4PGGA 1LF0A 3HPQA 1BRTA 4BUJA 1KEKA 1AKYA 1J23A 3GH3A 3CPHA 4H08A 4MV6A 4U39A 3R44A 1E20A 4JD5A 1KRXA 4Q9AA 2CF5A 2P41A 4ILKA 3VNVA 1QTRA 5GZ6A 1W4CA 3AW8A 1LBIA 1RYHA 1VOTA 3JD0A 3L1UA 3LUFA 3QLJA 4PNZA 1OV4A 2ZW9A 4LDJA 1SU8A 5E4JA 4WEQA 3MVEA 2YQ4A 1CVIA 3OZRA 5FQOA 3PCXA 2E21A 4BNMA 2XW6A 2ZS7A 3CLVA 3A6FA 4EWLA 4KR6A 1VCIA 2XYVA 5A9RA 4F8EA 5L3RA 4GWGA 4QBHA 1K8QA 1UFVA 3DDZX 1XZLA 3OC6A 2JGEA 3W2EA 4KPGA 1CE8B 1P2SA 5G41A 2JJYA 4X8LA 5IEJA 1H4QA 1PG0A 2CB0A 3FVQA 1H9AA 2BGKA 3H2IA 2H1IA 1Q5PA 4HDNB 4MI9A 1OFHA 4U1RA 1TQ2A 4EQ6A 1X42A 2HL6A 3AIIA 3H2KA 1T4MA 4GGMX 4KQGA 5BT9A 2R8YA 3C41J 5CNKA 1O97D 3NHFA 1L5ZA 2VSOA 2XODA 1AV6A 3PRJA 1NRJB 3KUUA 4FEGA 1CR2A 3BFVA 1J7JA 3G85A 3OD5A 4EO7A 2QTWB 2GPJA 3RD5A 2UUAB 2ZBFA 2GEBA 1IXKA 3PF9A 2OLKA 3MTGA 4A8PA 4U5XA 3NTVA 4P92A 4E21A 2G5PA 1J8YF 4I50F 4IUBS 5EQJB 5KOJA 2V7XA 3CNNA 3RYCA 5KZMB 1FNNA 4GRDA 5FDFA 4QXMA 1X2EA 2P67A 1KOGA 1OWPA 4N54A 1DT3A 3JZAA 4FD3A 3MMNA 5KSOA 1XXHB 2TSYB 4M0DA 1VA4A 3T9DA 1AZLA 3FPSA 4Q93A 2Y92A 3NUZA 1EM8A 4AJ2A 2ZRIA 4JT4A 4RK7A 3QENA 1YU6A 4HEJA 3DOHA 2IDJA 3CKYA 1NMXA 5AYVA 3B48A 3FSJX 5JJIA 3EGVA 1XCBA 4HAWA 1JX6A 4WA7A 2BZ1A 1EK0A 3DBRA 3V9AA 1JZQA 5CPFA 2GN4A 5AI0A 5KYYA 2HNAA 3N2ZB 1E4EA 4IOKA 5HBRA 2H59A 3HU2A 4I8IA 3DDOA 1DBSA 5F1YA 4MVJG 4OQZA 4P93A 2P2NA 4E09A 3X1WA 3ZTYA 4F21A 1G38A 3KD2A 1E89A 3G5UA 4NE2A 5CA1A 2C57A 1FY2A 3R0ZA 5KCMA 3TDKA 3K9WA 3UUEA 1R0WA 1G5FA 2J0UA 4KH0A 4N6NA 5EVCA 4BGIA 3PDCA 4E14A 3SQWA 2PZEA 4UOQA 3TDMA 3ZX5A 1TQ8A 2GFHA 4ZPJA 1U7DA 2R8RA 4HZIA 3GZTB 3CM0A 3LKZA 4Z86A 3V1TC 1NU6A 3IYLW 1NAIA 1HZZA 2OZLB 4O25A 3JQBC 3ZCQA 2PX0A 1TKAA 2QTCA 2CDCA 1ZCZA 1PEAA 2HO5A 2ZT5A 3MINA 4I8XA 4MKGA 5IMBA 1APBA 1ZL2A 5HZKA 4A27A 3LC7O 5ALTA 3T4EA 1XOIA 4PFKA 4C3ZA 4M2LA 3VR5H 3R3ZA 5BOSB 2WHEA 1RQPA 1C0LA 2HPVA 4PBRA 4CQJA 1U8UA 3I6IA 4FFWA 4AMGA 2IPNA 1RWWA 4E12A 4F7DA 3PWZA 2PH3A 3O21A 1Z5UA 3HUTA 5K6TA 1O54A 4X60A 1JBKA 3QLUC 1KRWA 5I4IA 3F97A 3MAGA 3Q3GE 1RJFA 2NTNA 3GP3A 2QMEA 3FRIA 3Q7EA 2M6LA 1HE3A 4ZCPA 1PI3A 1ULSA 1UQUA 4AS2A 3MUNA 5H9WA 5SYNA 4OFXA 3TLBA 1RXSA 4Q6BA 4TWIA 4TWRA 3W1WA 1FDSA 2DCMA 3QU7A 5LQDA 3CVWA 3R75A 5E3HA 3CVXA 4Q4HA 3ED1A 2F48A 3T61A 4MGKR 2AJTA 2WIDA 3OQ1A 3BYZA 4AAYA 3WMWA 4QFDA 4XGKA 1TB4A 3C3CA 2HJVA 4TVSA 1XV5A 5IJXA 3V34A 5KTYA 4M98A 4UZEA 2UUOA 1WZCA 4PSAA 1XVIA 2EEZA 2NZWA 3OOYA 5AVYA 3CONA 3E15A 3EH1A 3B6KA 5L7TA 5D84A 3AM3A 1UL1X 2ZSHA 3WGTA 4E46A 4DRYA 3T0IA 1H8HD 5D5PA 3OPNA 4JOCA 3RBZA 4BU1A 4HVAA 5CFQA 2VDWB 4M9RA 4O0LA 2XWBF 1AK9A 1JJ7A 2VVTA 1NY5A 1PZMA 2WVJA 4FZVA 4IGFA 4J0CA 3VUFA 3WYFA 4RH0A 3ZQ6A 4KEAA 4JL6A 4PTLA 5EXSA 2X58A 4K9KA 3A4YA 2OR3A 2P1ZA 4OK5A 2HT1A 2GCPA 1NY6A 3DMFA 4HDMA 4IQGA 1BGXT 3OTIA 3CZ9A 4LTNA 3IDOA 1M1NA 4R2MA 2VAXA 4WZAE 2W37A 4L8GA 3RS5A 3MTEA 4Q24A 3TFWA 2Y1CA 2ARKA 2Y67A 1C30A 1W85B 2Z5FA 3HU5A 3IT2A 2PFKA 4EJ0A 4LJLA 3WZMA 2F4VB 1GGVA 4LDZA 4DCGA 3KOZA 1GPAA 1XD2A 4WOBA 4ALNA 1OBHA 1UBUS 4BQIA 1RKXA 1P73A 3ZWOA 5IF9A 5IN4A 4OGGA 4YIKA 4BMDA 4X62B 3E22B 4AKHA 4GKJB 1BQ3A 2DULA 1JHVA 1SZCA 3HZHA 1DKOA 3AG5A 3AUFA 3PRKE 3HN2A 3IQGX 2L18A 4K5QA 2YR0A 4U0JA 5B53A 1QHNA 2HKIA 2XUJA 5JC8A 1OZ0A 3EEOA 3KB2A 2HLPA 2ACVA 4QICA 2EZ9A 5TRTA 5FLEX 1Z5ZA 3A25A 4TSFD 1OWMA 2PG3A 3MELA 3LPCA 1PFYA 3IO5A 1XYYA 4GPD1 4IIGA 1PUXA 4ZEOA 3P0JA 2QTAA 4EUKA 2ODBA 2NXEA 5A6VA 5DZSA 1N36B 2WYVA 1JXQA 3AR7A 3TL6A 2QZPA 1ZAKA 1ZNWA 1XZCA 1Z16A 2R7MA 3AFOA 3RB8A 4IILA 3ZKWA 1Z6YA 4L9AA 4BO5A 2WTUA 3ZNQA 9GPBA 1CEXA 1UT8A 3S7TA 1G7CA 4RCZA 4B31A 1TTHA 1O5IA 3OJEA 1NBEA 1FDIA 4OBBA 4BTVA 1XC7A 1DX4A 1YR2A 4JZYA 4M1YA 4WK0B 4YJGB 1QHFA 5AHOA 5JD6A 2OGZA 3IE1A 3DS8A 3L43A 3ZD9A 5KJEA 2ZAMA 4IVPA 1U4NA 4TXMA 4TKMA 1CUCA 2PMWB 2ZREA 2FEOA 4MMZB 3SHOA 4R0VA 5GV7A 1IG0A 4UEWA 4FR5A 4JZKA 4P4GA 2DBZA 5LDHA 4W9MC 5DX8A 2A92A 2DP4E 3KQHA 2QM3A 2ZXFA 3OZTA 5CIQA 2FGJA 4C30A 4FMBB 1LPOA 1RRKA 1H2BA 3MD0A 3PQ4A 4QARA 3B1VA 2A94A 4S24A 4UXJA 4COKA 3L4JA 4DRXA 1QZTA 1VP9A 3EXFB 1Z34A 5KC8A 2W2QA 5DASA 4J1QA 5GQSA 3UVEA 2X5KO 1QGZA 2ZYIA 1SXJE 2P4EA 2VDNB 1W25A 2G9ZA 1MOSA 1U9IC 5FLKA 3ZD8A 4I5FA 4LSMA 4PYQA 1XVLA 4E5DA 3KYCA 2RIRA 1X7GA 4X3PA 5IJ0A 2DPXA 2VOEA 3I6MA 3PUWA 3WKDA 5JBIA 4YDQA 2JEOA 1F2TA 1N5JA 2Q3LA 1C29B 1P9NA 3IMCA 1DINA 1F51E 3PB3A 2WW8A 4RMHA 5A62A 4R2HA 1A2QA 3DTVD 4X8OA 4H7HA 2O5VA 2WIBA 5IARA 1IULA 4L9SA 4XRGA 3W6ZA 3E0XA 1JQBA 3H6KA 3SR0A 1AQ6A 4OJQA 3UXMA 2OM2A 4QLOA 3LA8A 4ZOLF 2XYRA 4QNRA 3DMGA 2QSZA 3FMOB 1JMKC 3AF3A 5FA8A 5HE9A 3KM0A 4Q7JB 3ANTA 3K94A 4F6CA 4B8WA 3JQGB 4LV8B 4PW0A 1UINA 1SC1A 4L3VA 5EKXA 2PZBA 4AWXA 1E9BA 2Z5LA 5ED4A 4CMGA 2ZRNA 4I3FA 4V0LA 3DDWA 5H4HA 5TT0A 5ADUS 1Q3KA 3TBFA 2FJ0A 3OE4A 4DA6A 1E4EB 3RSOA 5EZYA 5BPFA 2ZZMA 2ORYA 1Y8AA 1LS1A 4REQB 1RHKA 4R1NA 5IK2A 2HR1A 3BL6A 4AD8A 4KITB 4Z4GA 1ZRSA 3ZH2A 1G18A 1NVTA 2OV2A 4DR4B 4XJVA 3B52X 3HQ4O 2VAWA 3HRHA 4RIGA 2QQFA 3NHZA 2OTCA 3ZQ4A 1PW7A 4TKVA 4ALIA 1A9QA 4LHWA 1L4GA 4KSCA 2UZ3A 5FWXA 4JN6B 2QLBA 2PJZA 4HWPA 3OM0A 4IKOA 3T5TA 2R751 4DR5B 4R8SA 2EJBA 4D97A 4H1VA 2FPPA 1V1MA 2E9SA 3ACBA 4OREX 1BQEA 3AK4A 3LJKA 5AR1A 4ZXPA 5EHZA 1U2PA 3QKTA 2V1UA 2QP9X 2BFAA 1I13A 2FI1A 2XOXA 3PIIA 3ROQA 1JFSA 3MTAA 3OMXA 5E6SB 5DEOA 3ZZNA 4S2UA 4LF7B 1X92A 1D9XA 4GXRA 2CBZA 4MAAA 1E2FA 4CZ2A 5HOEA 4QJ5A 3B13B 1FFBA 5L7YA 2MJLA 4IEEA 4ZQCB 2O8DB 1QB7A 4B6RA 4FKZA 5HKLA 3ZUPA 4NYIQ 3EMDA 2FUKA 1V3VA 4GP6A 4HEHA 3CXUA 3EC2A 5EEGA 3AU9A 1Z2PX 3SNKA 1QRTA 5IJWA 1D2EA 2F7SA 3G59A 5BYBA 5B1IA 5I9LA 2C61A 4C7OA 2HCTA 2NUPA 1TC2A 1ZDMA 3GIDA 1SEPA 1XT6A 3UMFA 1DARA 4X3OA 5DK4A 3NVMB 5KYTA 3E5RA 1U2RA 2RHCA 2P78A 3LF1A 2VIIA 3U7IA 4OB6A 4D81A 2PIAA 4FJ2A 1ZH2A 4L75A 5CUQA 5F52A 2WM2A 3V4SA 3RVMA 2YRWA 4RDCA 2MSDB 2UVDA 5A4MS 5HF9A 3PWTA 5LVAA 4KI7A 5F3WB 2V5UA 2V3CC 1E7SA 1E8DA 1L5QA 2Q28A 1EWTA 1IEXA 3P0EA 3PXUA 4RZ2A 4NENB 3K0KA 4G65A 5DNVA 3RRMA 3EDRA 2H2FA 1KI9A 4NYJR 2JAUA 1YA6A 1G21E 4BNYA 4B3HA 3ZWKA 2K87A 3WP1B 1QTQA 5F5XA 4BB6A 1XDGA 1NKVA 4K3VA 2Q1YA 1EG2A 4ENQA 2JCBA 3CIFA 3BDAA 2CBXA 3KX2A 1U9YA 2ZJ8A 3LX4A 4CEIB 5AM0A 4ALMA 3FKQA 1VC2A 4IDPA 3PNKA 4X7PA 2PRSA 3LC1O 3NTXA 3NEJA 4QX6A 4UNSA 1ZVQA 3CWCA 4CF3A 1ISJA 2XLCA 3CPEA 2Z1DA 3DCYA 3I9V1 3IQDB 3QH4A 1UKCA 3P5BA 4ETNA 1NJ8A 2FGKA 1RRPA 4XX0B 3MRSA 4F46A 1N2GA 3LBFA 5TY0A 1JS1X 3M1LA 4FJ1A 3UBMA 1IK4A 5D3KA 1TA0A 1KWKA 4CMCA 3NJ4A 5EC8A 2JCXA 1SHKA 3KHTA 3LUGA 4REOA 2VTKA 1C30B 1W85A 5H59A 3ZKAA 1AQJA 1B00A 5DMXA 3E58A 1HNXB 2WHPA 1E6EA 3E23A 2IIPA 4V0OA 3ULKA 1CY0A 4YYZA 5HRAA 5FWNA 3N0WA 2IU0A 4D0SA 4BYMA 1N2BA 1JEAA 2ZT8A 3ZJYA 3L0BA 4KBYA 2B82A 5K6AA 1ZL0A 2AVNA 4OHCA 4MYCA 2XKAA 1IZ0A 5FTJA 5J2TB 1CUXA 1LI5A 2TMDA 1DQNA 3MM4A 4XIFA 3GNTA 1PJTA 2DKNA 1RAIA 4DM7A 1MQAA 1T6XA 4NATA 1H2FA 1JPVA 4RELA 1IY2A 3BZUA 5K3OA 4MGEA 3TLMA 2PSSA 3VZSA 3KJIA 3OH8A 4LXHA 1VZ2A 4IS2A 4P81A 5LZ7A 1NMSA 3PJFA 3GEGA 4HLCA 5EKDA 3ZQJA 1LNZA 1XROA 2E5FA 3K96A 1GZUA 2NYUA 3DQZA 4K6MA 2YWEA 4AP9A 9MHTA 1GUDA 5EE9A 2GJ4A 1CY7A 1TOAA 2C3YA 3NV9A 4C0AC 3AB7A 1AURA 1OZAA 5HYVA 3JQRA 3NIWA 5L8VA 3A14A 1MFZA 1M7HA 4QULA 4F9FA 5B3LA 5JXWA 4BP8A 1RXVA 3A11A 2CHGA 1PJRA 4NE9A 2CUTA 2XECA 3CXRA 3T6KA 1YOVA 2PKCA 5DYIA 3RGGA 3UKOA 3DOCA 4IIHA 1ZMTA 2A4KA 2FQ1A 4BNNA 1I4TD 3C5HA 2G9QA 1F7UA 1SQ6A 4UBMA 1JSXA 4UBJA 3K2EA 5C8YF 4FW8A 3FHLA 2HXSA 2IELA 1M8KA 1UM9A 4AP5A 4DIEA 2FB9A 2J07A 1RZUA 2ZJOA 1QG0A 1NJFA 1ZNQO 2HDHA 4UREA 5BSHA 4WY2A 4XSGA 4XUDA 2P2GA 1WB9A 1QUEA 4E7PA 4UVGA 1USGA 3IQXA 5K9ZA 2O2JA 2V58A 4M49A 3OUZA 3U4QB 2A2ZA 5CH5A 1RTKA 4TZTA 4X00A 4Q1EA 5IJAA 2BEJA 1SWVA 4BPRA 3GGOA 4UFPA 4LQLA 4GYWA 4L72A 5AXDA 4BNIA 1N33B 1OZFA 2XHZA 3LQQA 2OG2A 3SJUA 3OOHA 1FSFA 2FMTA 2BM0A 4M1KA 4CEHA 2IYLD 3N3AC 2D2XA 4TTVA 4CRWB 1SUDA 1IAQA 1LLUA 5GOZA 4D9HA 5A5DA 1BYUA 4LNUB 2FDCA 1XAIA 5DIZA 5KU1A 4C3OB 1T5BA 3Q5GA 3TH5A 4MS1A 1HG0A 3Q9SA 4EELA 3DL2A 4L5CA 5EA2A 5T8KC 2DWPA 3RTCA 4OI0A 4ZHSA 1H0HA 4BMXA 4ZVNA 1Y1KE 1II0A 1FRQA 3R5TA 2UDPA 3RNOA 2EBFX 1KDRA 4QRHA 4DA4A 3Q1LA 2H4ZA 3OT5A 1NT2A 4JK3A 1FQKA 1TM7E 2BTQA 1ISSA 2R7KA 2W2PA 4CKWB 1HZJA 4PG8A 4GKKB 3EVCA 1ETUA 1JPJA 2ZRFA 4D4IA 1A9RA 1TPZA 1SH7A 4HWKA 3GFFA 1L3IA 2AK2A 3LY8A 1AO0A 4C07A 2P90A 4K40A 2OCGA 4DN6A 2I8AA 4LDPA 1Q17A 3THOA 1YHZA 4HUTA 1E1QA 3TG8A 3OIFA 4LQDA 2GJ9A 2P3OA 3OZCA 3V2UA 2JFXA 1P60A 1T2VA 3CF4G 4EFMA 5JNLA 3ZLBA 4E51A 1JHPA 1RTTA 3A2LA 4Q4JA 4WLUA 4WZBA 1TK2A 1TJYA 4NL4H 4RMGA 4CI0B 2CSUA 2MCFA 4CI9A 2FW6A 2CV2A 2BUBA 2KSQA 3EEIA 1WXXA 2GTIA 1V25A 4G1CA 4LDNA 1WZNA 2PSFA 1SQGA 3JQ6A 3L82B 4MKFA 3ZDRA 1M5UA 2G09A 1I5RA 3T1QA 5AD1A 5L3SA 3L8ZA 3ENKA 2P1RA 3WSTA 4YR7A 4B0PA 5AP9A 1E1DA 2LE0A 3O82A 5DGTA 1L5NA 1TYAE 3VJKA 5KSYA 1VFNA 2ZSEA 3FPGA 2P91A 2VHZA 3QK7A 5CVCA 5FNVA 2RAFA 2YY6A 4MI1A 1EK2A 3EZ6A 1EFAA 5EWJA 1KL7A 4JP8A 1FF9A 1L5HB 1DCMA 2W22A 1XTSA 1Z4MA 2HWYA 3KXKA 2Y1XA 1ZH6A 4RV4A 1SU7A 1PDOA 3Q3CA 5J59A 1JJIA 3N0TA 3EUEA 5EP4A 2A78A 5AVXA 3FZGA 4L85A 1J2TA 2PL5A 4FFLA 4LYYA 4RM2A 3RSHA 4BFSA 3TTXA 1DQYA 1JHDA 2MR5A 1DJQA 5TQ2B 2JKZA 2P9EA 1MX3A 4NCNA 1CUFA 4DS3A 1NC3A 3NCHA 3U6KA 2VJOA 2BGIA 1MC4A 3AY3A 4IJUA 3VRHA 4FMCF 3D8SA 1M1ZA 4CDMA 2Z2JA 1QC5B 4HDAA 2M6SA 2VYFA 3WGVA 3UKJA 1ZCAA 4WXPA 4JFAA 1HQYE 4BGUA 5LYJB 2WUGA 3WXBA 1NRWA 5AH0A 3GDHA 1EX9A 4XIGS 2GXUA 4XD2A 3WQSB 3EA4A 1ANKA 4Q48A 4YRSA 1UFRA 4HGOA 1CSEE 2JI7A 3A9VA 3RIHA 3UT5A 1XCMA 4H4EA 3WK6A 1Q1AA 4OHMA 4BN4A 2PRKA 3A9SA 3UXHA 2LCQA 5KPJA 1L1EA 2FEKA 2ISCA 2WWFA 3HLKA 3UJ8A 4Z7JA 4TYPA 4L76A 4KIGA 4MVXA 1W36B 5JARA 4M8NE 2DB3A 2JJQA 4PWZA 3QI2A 3GLQA 1J22A 4C22A 3WLMA 4D0GA 4U2BA 4ZEXA 2R7LA 1MUUA 2PAAA 4UUNA 2CE7A 2VK4A 2IHKA 4X97A 3ELUA 4HKTA 1M1YB 4FUQA 4DJEC 4DQVA 3MN1A 3S99A 1FXSA 1ZOPA 2LV8A 4E2FA 4KZPA 2QNRA 4B80A 1JIVA 3PNVA 1YR9A 2VJNA 5H68A 1T91A 4WFIA 2IWHA 4D8TA 1KO7A 3COPA 1OI3A 1F9EA 2X0RA 3QKIA 2FHPA 3Q7RA 3EZGA 5SYMA 2Y1KA 1B3RA 3WGJA 4JS0A 1GYRA 4ZHQB 3B7WA 1DTWA 3ZDYB 5DTJA 1LY1A 2EJWA 3ZD6A 5AKLA 5K09A 1ICEA 1R0SA 3FH0A 1ZH0A 4LTDA 4ENVA 1FNBA 2OB1A 4P7GA 3RYIA 4OD0A 1DAEA 4P2GA 5H4GA 1FC0A 3ASYA 3AYZB 1A4UA 1A96A 3MWEB 1CZKA 1ZP6A 3O8LA 4A0HA 4U7DA 1FDWA 1B6TA 3TLEA 5AKZA 3K71B 5TPZA 1OOEA 2PGDA 4FCVA 1XFDA 3UM9A 2BFWA 3ML1A 2P11A 5JWOA 2GPTA 3OESA 3PFKA 5JSHA 1WPGA 2YV2A 3T95A 1EFTA 3THYA 2IBTA 2OCDA 4BJHB 4JYAB 3DWFA 1E1CA 2ZI5A 1E1YA 2HV8A 1E8MA 3UMCA 1KKUA 1I2MA 3PLAE 1UMCA 3GQVA 2H48A 3GZJA 3P1JA 3IQEA 4UDYX 3KS9A 4KHPB 2JEYA 2XY4A 3GVCA 5KPDA 3K70D 2Z9BA 2I1LA 4O4IB 3DO5A 4UKDA 2BLNA 2NZUG 4I50A 4FYHA 1YTUA 3Q3VA 3HKDB 3O74A 5AM2A 1NQWA 1XZKA 4LBVA 1Z4KA 1Z6ZA 4B5KA 1ZK3A 2WPDD 1OYVA 1SOMA 3KVVA 5EMJA 3L8HA 4XDHA 3OLXA 2ECKA 2VO1A 3M3DA 3PHJA 1H9BA 1CQIA 2E4UA 1N1EA 4JLMA 5BUQA 1B0ZA 5LXTF 1TX4B 4OB8A 2BKUA 2RJNA 5TARA 3UWDA 5IPFA 1Z7BA 2NTJA 4AJJA 3MPOA 3P19A 4UAVA 4DLSA 1U7ZA 2VF2A 3OWHA 3GGPA 4WGFA 1GFSA 5FIUA 5T64A 3RVBA 4CM4B 3ILYA 4LOHA 1W47A 4EY7A 3LKBA 1RLUA 4G25A 1L7AA 4CKCB 3MTBA 2VP9A 1KFBB 3G68A 1LXCA 3E5NA 5AKXA 3V5NA 1Q7TA 1A27A 1RYDA 4EVIA 4QUIA 2GBFA 5ER9A 2H1HA 3TIFA 4YRZA 3BCSA 3ON5A 4WV3A 3FMIA 1SXJB 1WD5A 3HCDA 5TQ2A 3PS9A 1FQJA 2MINA 4CV0A 4JP5A 4XUGB 5AJXA 4JJ4A 1ML4A 3OTWA 1DOZA 3LRTA 4G2TA 4Z2YA 3KOMA 1QGDA 2PTHA 2QZZA 2BBOA 1JG4A 4LXUA 3ZVKA 1U0HC 2YS7A 1WCYA 3AZPA 2RONA 1EJBA 1PFWA 4K6GA 1J09A 5FWYB 5G4LA 3RTBA 1A8HA 1R8SA 2HMWA 4PWYA 3TKAA 1Z75A 1JVBA 3GP8A 1WU7A 1KMMA 1TA4A 4FCTA 1CY1A 1CEYA 1MGPA 1NVVQ 2PY6A 3KEQA 2XJ4A 4G01B 3W1VA 2FN8A 3PC8A 2O6HA 1J49A 1SU6A 2ZDHA 3CT6A 1LSOA 3H75A 3SC3A 1FNMA 3OICA 3KPVA 2X6TA 2PGAA 2PUWA 4BRUA 1QQ6A 2RG1A 5L53A 4JUBA 4NARA 3REQA 3T3MB 3DXFA 4XGIA 2OFFA 5K2MA 3S1SA 2YASA 3HP7A 1LQ2A 3W8DA 5B55A 4H4CA 4OOFA 2OGWA 4ZIRB 4FHGA 4PAQA 1QJ4A 1XVUA 3NFRA 4ZCTA 1U7OA 1L4YA 5LR6A 1NONA 2C8LA 4IDNA 5L4LA 1S5PA 1XTBA 2H5JA 3PF8A 5AI9A 1SUSA 2HK7A 3AOEA 2II6A 2QRKA 2XMDA 3PFFA 4OO3A 2R8PA 4F96A 2QPAA 4HYQA 2IUSA 2DX7A 2QT0A 4IOMA 4K9RA 4FGZA 2CNBA 2JAQA 3MMZA 4CHGA 3O93A 5JD4A 3M7IA 5F33A 5HP4A 2R00A 2JNWA 4KFRA 4FZ3A 2F6RA 4IMIB 2ZXUA 4RQBA 2DY1A 2NP6A 4HR7A 1FRZA 4TVOA 4YUYA 4WSOA 2AGVA 4HAIA 2CNWD 3G2HA 4FMDB 5CM8B 3GMIA 2OVBA 3IIIA 1XWIA 2B3DA 2BKVA 1J33A 1QHXA 2Q41A 3NBFA 4MVJP 4XW2A 3D8HA 1EVJA 4EY3A 5CA0F 1XNRB 4ZEWA 5FNVF 1FFCA 2X8JB 4KAAA 4MS3B 1BC5A 2BEUA 2XVZA 1ZX1A 4I1UA 4XFJA 3AJDA 3TGWA 5KVSA 4MULA 3HP4A 1E77A 1VSUA 4QO8A 4B81A 3HNPA 4G8DA 4LYAA 3N6XA 4RMNA 3J80A 3W5UA 1I51A 3LXUX 4CLHA 4I4NA 5ALQA 2RK4A 3BB4A 4B3SB 1ZBDA 2PKRA 1QR6A 1AOXA 4UTVA 3TRFA 2OP0A 1NRIA 1I94B 1V26A 2GHQA 1RQ2A 1U02A 2D2VA 1W9HA 2JASA 2JCGA 2QM0A 3O4JA 4UCQA 3RC2A 3S55A 3WWEA 4D6YA 4I4IA 1FMFA 4S1TA 3RVNA 5JPDA 5K6AC 3QUCA 4JLNA 2H52A 3DL7A 2PUEA 3WOVA 5C1DA 2IF2A 3FSRA 4RVHA 3VPSA 5D87A 5LZ8A 2PRIA 1E5QA 1DFGA 5IVHA 3AB3A 1ZAYA 2C5LA 3T1HB 4ZQGA 1EGQA 1M8JA 4WPGA 1GD1O 2EZ4A 2LIPA 1E3WA 1H66A 3D3WB 3RIXA 1GCAA 3TLGB 3M49A 3O1HB 3EVTA 4C01A 1TFRA 1WW2A 4MDFA 5JECA 4YJHB 3S27A 3O3CA 5ALPA 3SE0A 3H4VA 1HE1C 1VIDA 1D4OA 3ZQKA 4KO4S 3CQ9A 1U65A 2B98A 4Z7OB 3ICWA 5JS7A 5KJFA 3NJ8A 4C6SA 5F7JA 3CNOA 5JEEA 4DSZA 1OLUB 2MU1A 5JOQA 2X5XA 2PJRA 4DMFA 1EJ0A 3LCRA 2WV7A 3PX2A 2X8AA 1SVUA 3TCKA 4FOLA 5HUQA 5DGDA 1J20A 1XMSA 3JAKB 4KRYA 1JSLA 2ID7A 2OO7A 3PNMA 4CLXA 3GIWA 1WPXA 2NXWA 5CRIA 3PEWA 5CGZA 5BSFA 3PFHA 4ONEA 2R6GA 2FV8A 5B2EA 4P36A 2FPWA 3AIOA 4BECA 2LKDA 5IG2A 3DEKA 2D00A 4HZUA 4RXTA 2QLNA 4IFEA 1BOOA 3PPXA 2F1OA 3N6RA 3UV6A 2G70A 4C7VA 5CK4A 5AJWA 1XAHA 1YZUA 1SBZA 5EMKA 5K20A 2WNIA 1PR4A 2BEUB 1ZGHA 2GEVA 2VSFA 2QRUA 2ZS9A 4YCSA 4DV7B 4DQXA 4XOIA 2LCIA 3A6GA 3DLIA 3TQFA 2Z4TA 4OAPA 1GUAA 1GQOA 3KQPA 1TZCA 2FE1A 2GM4A 3OSZA 4PZPA 1GP2A 1Z2AA 4D92A 2N1MA 2XQJA 4D4MA 3FHJA 1GARA 1FTYA 5DYWA 4MVJA 3EUFA 1R0BA 4M0EA 5DX0A 1LBTA 4NDNE 1OV6A 1TT5A 2F1RA 1PR2A 3FTQA 1J4AA 4L6CA 3S70A 1Z6GA 1HY3A 2GWHA 4WZBE 4RETA 4P5DA 1YBVA 4IO0A 1YMUA 1E98A 3GEBA 4PZEA 4YEDA 5DVZA 1W4RA 2DZDA 4CEIA 1B26A 3B78A 3BK2A 1FDVA 4EJSC 3BUSA 3LGSA 3M5PA 4DWOA 3SKVA 3FWYA 3OFSA 2CNWA 2GN8A 2QTGA 3VPFA 4KNYA 1QBGA 3N2GB 2AR0A 4R2JA 2D8AA 1K0UA 2PX8A 2CEAA 1QG2A 1ZM4A 2UYOA 1OI2A 3JD2A 3KAPA 4XJXA 5DW3A 3OFNA 4HADA 5DWVA 4YONB 1VKZA 3Q85A 2A88A 2G80A 2QP4A 5IJZA 3M8KA 5EFOA 5GADl 3NTUA 2YY5A 1DEXA 2ECQA 1W94A 2E48A 3VSDA 1T24A 5AVSA 5U1PA 3X3HA 1R16A 3OEHA 3PYLA 4EF6A 1Z2EA 1EZ1A 3GROA 5C8XA 3DFMA 4X0EA 1NHWA 1TAUA 2ZULA 3LK7A 4OSOA 5JDIA 2CNNA 1UAYA 4Z1OA 1U3UA 1H2EA 4LIPD 3UG7A 3Q5DA 3GVHA 4ZN6A 2NPFA 5IBRA 1VMDA 1OZHA 4HYTA 2C92A 4ROTA 4IJWA 1Z26A 2HDNB 4L8FA 1PQWA 1AUOA 1CETA 4EGSA 1OH8A 1ESCA 3TDNA 4Z6KA 3HMKA 3G8CA 4NFLA 3QF4B 2XT9A 3ZY6A 1DG1G 1YB1A 3TVDA 1VRVA 3FSEA 1ZIOA 2H2AA 3QLTA 1IJKA 2WUVA 4PPGA 3KSRA 5HBGA 1C8KA 4EHIA 3JQDA 1B43A 2QROA 1XCGB 3QHAA 3Q9UA 3ZIUA 5LZ2A 4AJKA 1DPGA 5E6SA 3A3YA 1QHSA 3DOFA 4HX2A 5HEKA 3K4QA 3JTMA 4LPKA 1JE1A 4FGUA 2HNKA 4TS1A 2N47A 1R0ZA 2WZCA 5DHSA 3ZS9A 1QQ7A 1ZZEA 2HRBA 5K0GA 2AFIB 3C3DA 4IHJB 4D9JA 2R44A 3NT2A 3WWOA 4OP3A 1WUIS 1FS5A 1JA1A 4KXYA 3GJ6A 4EYGA 3TI9A 3BL8A 2ZU0C 2ONKA 4ENRA 1EQAA 1RXIA 2XQFA 5CXSA 2ZSBA 1SUWA 3WGQA 2PUCA 2HBYA 1IE3A 3P20A 3R40A 3CWQA 5FA6A 3CSUA 7REQB 2ZB3A 1S1MA 2GN0A 3IIEA 3OUTA 5A06A 4DUPA 4RE5A 1SCKA 3O91A 3H65A 4P4NA 2I7TA 1CYEA 2QPOA 1Q1QA 3JQAD 3HO1A 4HBZA 2OGSA 2QQGA 4A6XA 4EYOA 4NCHA 3CKKA 3O5AA 1NBMD 4G0UA 1GAXA 3K09C 3MWDB 4YRTA 1VIVA 2C20A 2OGUA 3UBTA 3RYTC 3ZVNA 1FPQA 1XVTA 3TX6A 2DBRA 4EQZA 4RA6A 4DIFA 5KYWB 2QP3A 1TRHA 1URPA 4RY2A 2C59A 2AHRA 2P40A 5LYJF 3IEUA 2BKXA 3I34X 4M0UA 4DLZA 3ZDCA 3HJFA 1BMTA 2VEOA 1QAMA 3W9SA 1SHJA 3VHRA 4BQOA 2O2XA 3O9MA 3LVQE 4PTZA 4M88A 2AOTB 3WO1A 1J2UA 1S3SA 3PT5A 3R0JA 4UNQA 4W7HA 1NOJA 2E4WA 4CVNA 3RH0A 3NEYA 3ZGVA 1GG2A 1OX6A 4HC4A 4LXIA 2XT6A 2FP4A 1YI1A 2GR9A 3QPWA 4YY3B 1O8BA 3TEMA 1EP3B 3U4QA 5TB5A 5JNTA 3D6AA 2IEZA 2ZUFA 2RI0A 3B85A 3QEKA 3D7KA 4RL4A 5FR2A 1QHYA 4PLWA 3QM1A 3I9KA 2IXDA 3K8YA 3RKRA 4BZZA 4CKCA 2GCNA 1L8XA 1LPBB 1JLSA 1N9ZA 4TYWA 5C31A 1VBKA 2WJ4A 5A3VA 4AMYA 1MC5A 2Q1TA 2R8EA 5ALXA 1M8GA 3MYYA 4FZRA 3S5UA 3ZCRA 1KS2A 4NV3A 4EHNA 3UH1A 2ONYA 3EXHC 3GJ7A 3NRBA 4CM8A 1GJRA 2LNDA 5LKRA 5DNYB 5JO9A 1PLKA 5HUHA 1GTZA 2X7JA 3HSYA 3O26A 5DPMA 1IB6A 1RI1A 2PX2A 2JHCA 1VPLA 1IATA 2OMEA 3VC1A 4MYUA 3Q0TA 3PVZA 2NZJA 5BV7A 4K6FA 5HJEA 4CDGA 4RQTA 4IIUA 1RXYA 4UHJA 4B7UA 1KYWA 3DBVO 1ABFA 4RZXA 3UJHA 2NU6A 3FPKA 1N3YA 4LHEA 1G21B 3IHLA 3ZBTA 5F98A 3H8WA 3JPYA 3QYJA 2R8OA 4U7GA 1JHZA 2XCUA 4ME6A 4HN9A 3V4ZA 4E4YA 2OQVA 3TLXA 1EFVB 2Z43A 2JLSA 1PE0A 1NMYA 1HGXA 4FE7A 5FUQA 2CJFA 4HH1A 4CMBA 2GAIA 2QN7A 1JN0A 2Z8XA 5BSEA 4MYTA 1HZZC 3PPYA 3O8DA 5A02A 4D98A 1W6UA 4FC7A 2XCQA 3C97A 5ILGA 2EX1A 1DC8A 3PEYA 1UZLA 2VJYA 2Y0EA 4IX1A 4NU8X 5CVJA 2EW8A 1KI6A 1EE2A 4QPZA 5L3VA 1OR8A 3LHKA 2P9FA 1XLWA 2IZ1A 1NSTA 1J5EB 2WWWA 3OCVA 1WLYA 1U31A 2UZ1A 4Z99A 1U1IA 1IMJA 1WSBA 2YV5A 2YJ6A 2QG4A 2D2EA 1FMLA 2XE4A 3KB1A 3U37A 1DTWB 1U8EA 3GPLA 1F06A 2JEZA 1PZGA 2R25B 3I12A 4RHCA 3J7AC 3I32A 1NF8A 1IVYA 3WSWA 3WG9A 5DM0A 1HT1E 4MB6A 4G5XA 4O4LF 4GKAA 2PCLA 1D3AA 1NJ2A 2O5CA 4JP1A 3GA5A 3JVEA 2IV3A 4M54A 1GZVA 4KR3A 3PX7A 2C4HA 4XX0A 5F7ZA 1YFZA 3KAQA 3EYAA 3OKPA 5CLJA 2QRLA 2NUTA 3T0FA 1T0HB 3NGMA 1U0TA 2CDBA 4U8HA 3ONEA 3ZPXA 1CVLA 5G1PA 1R1DA 3EODA 4FOSA 3OLCX 2DUWA 2XOKD 4I3GA 4AWAA 2JH8A 5CFNA 1GAWA 1KO4A 2QTTA 5K3FB 3VQTA 4W5WA 4LJRA 2QV7A 4JJ7A 5EZYB 5JCZA 4QECA 2ERCA 2P5TB 3K9GA 2PQ6A 2XSZA 4K88A 1TO2E 3KBBA 4JVSB 4MRMB 5KVCA 3K16A 2G8NA 4IQ8A 3T7IA 4E03A 5KX5F 4LFAB 4JXZA 4I9UA 5FUVA 1YT5A 4N1AA 5KTPA 1DFIA 4C87A 3VSCA 3O95A 4L15A 2OQIA 4JOQA 4L4XA 4I1RA 1F6BA 1LEHA 4ZKDA 3ZJUA 3I2YX 5DOVA 1WHSB 5B36A 4A6PA 1PL7A 1BDBA 2ZI6A 2N9UA 2JFBA 1G42A 2JF0A 3LECA 1N5DA 4RKFA 4U9IS 4CGYA 5KHAA 4TLEA 2EZUA 4N5IX 1LUAA 4CF6A 3S8EA 3AUJB 4BVJA 2X4LA 5MGBA 1A8PA 2ZRHA 3JVUA 1SGWA 2O2IA 1E0JA 2OBLA 2G7MC 3FR7A 3L18A 3LBNA 5AW2A 4CMIB 2H4JA 3RUIA 4E3WA 2J08A 3KKOA 5BWCA 3RC3A 2IEDA 1IQPA 1KQNA 4BV3A 2EVWX 3X1DA 3A9RA 4M0CA 4QT0A 1JHOA 1KIFA 2OFWA 3C8DA 1GZHB 1A9PA 1VL8A 3IQWA 4D9IA 3ZDXB 3SQXA 3SFVA 2KQUA 3VR3A 3N07A 1PK9A 1R4MB 1QMGA 1ONNA 2BCJQ 2WPNA 3C5VA 5KQLA 1U4SA 3UFXA 2P6UA 2D4HA 1TM1E 2OQRA 1WD7A 1LW6E 1WBDA 3SBDA 5KCZA 1UC4B 1CNFA 5GGXA 4X20B 5G0WA 1KPIA 1QF9A 2KYRA 3D5TA 2C0QA 1SK9A 2J3LA 1HR0B 1Y7PA 1ZVJA 5CTAA 3RHZA 2JBWA 3TG2A 1CZOA 1PNRA 1C7ZA 2IH4A 3AI3A 2QTBA 3LCUA 4ENUA 5G02A 1QKIA 2W6IA 1H8HA 2ZYGA 4ML3A 3M6MD 1QV9A 4ZO9A 1UT6A 2NU9B 5K05A 1Q2UA 3V48A 5EGNA 4WCVA 1KEPA 1GTG1 1OX4B 1T8UA 4DLTA 1P33A 3LQRA 4JT8A 1UXGA 2FFBA 1PF7E 2QR5A 3C7AA 1P2TA 1YQTA 2C4UA 2NYVA 3TO5A 3WRXA 1JQ3A 4BFCA 3TMYA 4JODA 5JZVA 1FW6A 1HI9A 1TYBE 2QTRA 4RZUA 3RW9A 3W5VA 4CMHA 5A4DA 4XWTA 2F1KA 4G8BA 3AI1A 3HEBA 4AM8A 1M2OB 3Q8XB 2D7CA 2WTMA 3AR8A 4OQFA 1XJCA 2X8LA 3SXJA 3N9IA 1YC2A 2REXB 1DAPA 4XEUA 2NW6A 4MRMA 4QO7A 4US0R 5FTMA 1V5GA 1OT3A 5UKDA 4C43A 5IXJA 1P3Y1 4BWVA 2IHNA 2ZUCA 4WLVA 1RYBA 1JR3E 2H7CA 5EIHA 3TNYA 3B1YA 2HHAA 2VP2A 4EX6A 5DHTA 2B8NA 2HW8A 1PLJA 1U9IA 4Y30A 5F23A 3VA7A 1CS4C 3Q15C 2GTHA 4CCYA 3MLEA 4G1MB 1RYZA 3H5TA 1U0JA 3QGMA 4MVJE 4K6HA 4IYRA 3AILA 4LHZA 3ZDEA 3GRCA 4QQRA 5E6UB 3O8CA 3B1ZA 5JY1A 4UQPA 2V8BA 1N78A 3B3QA 4RHXA 1O96A 5CD1A 5TQVA 5I7WA 2DRIA 2X8WA 3GD7A 4Y7CA 4XARA 1RBMA 5FOXA 4ZFNA 3DTYA 5IYZA 4DANA 4DMMA 2JA1A 3UYKA 4ABYA 3DE1X 3RUEA 4AMUA 3ZHYA 3KKKA 5KYXA 4A92A 3GGDA 5EIEA 2I78A 3SEFA 5A5EA 4JIMA 1Z62A 1FRNA 2PL1A 3LH5A 1ST2A 1LWNA 4J7UA 1MO2A 1ILEA 2D3WA 2HMTA 5DRYA 4F71A 4RTOA 2XI4A 1RLOA 5B1SA 3VHXA 3VI3B 1EEHA 4NV0A 4WZAA 3IXQA 4CEJA 1YRAA 5FQNA 5IH7A 2C5SA 2FX2A 3LUHA 3EVDA 3WL7A 4AICA 4BFZA 4EHKA 3WYDA 3TS1A 1R15A 4DNOA 3OJOA 3T7EA 4DCVA 3QTLA 3EPHA 3LS2A 3K1JA 1RRFA 2GARA 2QW1A 2WSIA 1M34B 2PEZA 4PHTA 4AS3A 2XJ9A 2VCHA 2JIDA 4D7AA 1VA5A 2FSHA 1IQRA 2YOGA 4R5MA 4A6EA 3ISVA 1CFZA 1D5CA 1TTPB 2O2CA 3PDUA 1IDN1 2HX1A 3DYVA 3EZXA 1S8NA 2HJ9A 4QOGA 2ZWAA 4CMEA 5DHQA 5FCDA 1T9GS 2VTBB 1RBZA 4II2A 1X86B 3K0SA 1U2ZA 3GFBA 3DVSX 3BC1A 3F8WA 4IR7A 4LRUA 4UDXX 2B8TA 3DA8A 1K06A 4QYMA 4W4TA 4E6PA 3GLIA 1ZGCA 1K5HA 1R6BX 1E2QA 3A2MA 3C3YA 3TECE 3N7UA 3J81A 1EM6A 4N7BA 3SR4A 2OYRA 5IHPA 4RQAA 3CKMA 4KC0A 4V03A 1D03A 3P94A 2J31A 4Y7DA 3CB2A 3BRQA 1FLNA 3PJDA 2J0SA 2CFSA 3BIJA 2XEDA 2WG1A 5HG0A 4XYGA 3ZWBA 5HGJA 4PU0A 1CP2A 4JA2A 4K1XA 3VI4B 4ZO7A 3ZGOA 1ZVKA 1NP7A 3DMNA 3X43A 2OO5A 4EEZA 3L7MA 3UV7A 1RPZA 2H1FA 3OP1A 4JXXA 4MWTA 4Y6GB 1FFGA 4OBWA 4EJMA 2WE8A 2SKDA 2W43A 4AF7A 3L41A 2XA2A 1Q91A 4BATA 1N7HA 4UOZA 2ENWA 2BW0A 3GJ4A 4X6UA 1X7ZB 4PGMA 3VO8A 5TEVA 3HB4X 1DO2A 1EDDA 1SXGA 3MUFA 2O1XA 4PSUA 3OG9A 5DV9A 2FG5A 3FIJA 4PQYA 5TF0A 5TX7A 2RGBA 3RM3A 5EXXA 2E55A 4HVLA 4CR7A 1F4PA 1SUBA 2ZB4A 5AIAA 5IUKC 4EW1A 4PR0A 5HCIA 2XUAA 5FWXB 5C5CA 3E82A 3M2TA 3G1WA 5J4YA 2HBQA 4UXHA 4QG7A 3RFFA 1L4UA 2A1IA 5K0BA 2I7VA 4CIXA 3IB3A 3LWDA 5JZSA 5KYGA 1S7CA 4MB2A 2TECE 4TKVB 4Q1AA 2GCEA 3AV3A 3M34A 5CPBA 2ZBRA 4C7KA 3QJ5A 2FJPA 4UVIA 2E18A 1SVSA 5IVDA 1UC8A 3L6CA 3RSGA 2IYEA 2QQ5A 3MWDA 3R3VA 3DPUA 4B34A 1CWUA 1GKUB 2WF7A 3COZA 1GA4A 3LQYA 5H7XA 1YJBA 2X1LA 3TE7A 3OY7A 1Y0BA 5KYUA 1N0WA 5FPKA 1I0ZA 1V9CA 3G0IA 3ITDA 1DWPA 3OJWA 4QQFA 5JRJA 5AI5A 4CMJA 1RKQA 1KEEB 3E7WA 3LIIA 5DTIA 3ZIAD 3ZWCA 3A2NA 5DIFA 2M1XA 1TJ3A 1TMYA 4DXHA 5KHOC 2DFLA 4S35A 2ENUA 3FNIA 1VJ1A 1FTNA 4BX9A 4AROA 4E5YA 5M5BA 3OCUA 5SYAA 4Z4HA 4XWWA 1AN9A 1SB9A 2NU9A 2Y27A 3QVOA 3K09A 4IZHA 3RYCB 1Y6QA 3PJGA 4YRAA 4ARAA 3C14C 5HSGA 4F04A 1ULZA 3D3QA 3ZZMA 4Y6SA 2XZTA 4V1CB 4B6QA 3DJYA 2X1VA 4FFPA 1I3KA 5FUWA 5HWSA 3MSCA 4PYOA 4DA7A 4G56A 1ZJ5A 2MT9A 4OQNA 2ZU6A 3QBJA 4BKRA 4EAAA 2H8GA 5DU2A 3VHXB 1A2BA 2GEKA 3NWJA 1P7VA 1V8BA 5E0OA 2M6RA 3OMWA 1TM2A 1E6CA 2C5AA 1K6JA 1RXCA 3DZJA 7MHTA 2QZ4A 4LZAA 2CLEB 2IV2X 4YGXB 2ZAIA 2V8OA 3VR4H 2RHJA 1K4YA 4PZDA 4KWHA 5I9NA 2P2DA 2H4YA 4LZWA 4AO6A 2Q7XA 3L3BA 5AICA 5TR9A 2FPPB 4G3XA 1H23A 2BM9A 2GPBA 1LC0A 2PFSA 3Q5EA 4FLFA 4GH5A 4LSGA 4K87A 3O4GA 5BSGA 2X23A 4C2TA 1NF3A 1H6DA 1YVPA 1TU0A 5M34A 2PXAA 4D3FA 1D6SA 3H9BA 3ILXA 4JYBA 3RANA 5C32A 1UWLA 1PQPA 2EKQA 1H8ED 2PZFA 3CUSA 3PNPA 4MUXA 2X0KA 3LTEA 4Z9YA 3KZXA 4BLWA 5K4GA 3WIDA 3EXHA 1VLQA 3VPHA 1CDDA 2AUMA 3H18A 4N0QA 3I53A 4D74A 2G6TA 4DJDC 2X86A 3OWOA 4RF3A 3QVWA 3G2MA 4NJOA 2F90A 3GLHE 5DN6D 1SELA 1GRVA 2RH8A 2XUDA 3Q8WA 4FOPA 4O4LB 3RU2A 4F5WA 1MDBA 1NBHA 2Z8ZA 4GPTA 3V1MA 4JV5B 1E3IA 1Z8NA 2H1VA 3GU3A 5IKXA 5K6RA 1M8PA 4BB5A 4Z4FA 5LU8A 1L7OA 1SVOA 2Q0QA 3H7IA 1Z0SA 1Y5LA 3N8HA 1XL1A 5AVJA 1E4YA 1M1UA 2OWDA 4PG6A 3AUXA 4KP7A 4ILEA 3ZBUA 2WP8J 3USZA 5KMGB 3BD8A 1Z29A 2P6MA 4GXQA 4BMVA 4GOJA 4CMAA 1IJEA 3K9NA 4L4UA 4MW5A 4Y2QA 4R2IA 3ZV4A 3BMCB 3D0RA 2Q2VA 3WWCA 3W34A 4DR2B 3AJ9A 1JU4A 4KX3A 1KA9H 2BMWA 4GUAA 3T35A 4IDHA 3F0TA 3ROKA 4TMWA 3VVLA 1UJ2A 5EJAA 1QXSA 4IQ0A 4M7PA 4UVHA 1OB2A 4LDQA 3ECSA 4MI3A 3RJMA 3ZS8A 3VR1A 1CULC 2IU6A 4Q4DA 2QN1A 2P68A 2OCAA 1IUKA 4LRWA 4PCLA 2Q5LA 4N41A 2V03A 5HXAA 2XBUA 2HCRA 1GVNB 3C1UA 5A1TA 1YVUA 2QJOA 3GFGA 4XCXA 3GUYA 2EZTA 4EKDA 1GGMA 2ONCA 4HEA6 2JCVA 3R3JA 1YB6A 5JD3A 5BSTA 4ZO4A 3S28A 1YJQA 3DPSA 3NPAA 5JHGB 2WFAA 1U28C 2NP7A 1PJCA 1Y1LA 1C4KA 4RGBA 3IHKA 2FSPA 1S2MA 2HU5A 2J33A 1Y89A 4LRYA 4C4XA 1C14A 1GPWB 3F6YA 3Q3EA 5KNCH 3CV3A 3AVVA 3BMQB 1T10A 4G1UC 4M8IA 5J5AA 4YFVA 1JE0A 1DQZA 1G1MA 2E4ZA 1VB5A 1YD7A 2P2CA 2A84A 2QYSA 3C3BA 4KLAA 4C4TA 1K27A 4L4YA 3DCNA 2V96A 4YUWA 1U9CA 2JFGA 2QX7A 1MQ8B 3U7QB 2VRBA 3ENWA 2H07A 3ZK7A 1C5KA 1P1FA 5AOBA 3TX2A 3DMTA 3Q6NA 5CT4A 1IBLB 2ADOA 3QMMA 3V80A 4EM6A 4AKIA 5EJ5A 2CK3A 3RUPA 4YP0A 1B0PA 1RNLA 1TXGA 5KO2A 3IBFA 3EZNA 4DLRA 2ODNA 3D5QA 3ET4A 4JJIA 3ZQUA 5A4KA 2W42A 1WL8A 3K20A 1CKEA 1MKYA 1RYYA 4H0CA 4ZVSA 2VWHA 4F06A 1WSAA 1HE2A 5J4LA 1GGFA 3HA3A 3PCTA 3VMFA 4U02A 3GQBB 3THXB 2QT9A 4ADSG 1KFEB 2PKWA 2QTVB 3UNXA 2C8VA 1N0UA 3D0OA 4DB4A 1X38A 2NZYA 3V4LA 2J3JA 2ONJA 3RFTA 3WGYA 3QEMB 4EEXA 3MJFA 5IFKA 3IPAA 5KX5B 1W5EA 1TM5E 2H7YA 3O8QB 1PHPA 2G4CA 3IJ5A 2AF4C 3BWEA 3MLBA 4UUMA 3C24A 2W2OA 2P6RA 2VNAA 1X87A 4UHFA 3H9JA 3VFDA 2IC5A 4UTZA 3M6WA 3AY0A 2DH5A 4E5VA 3JWPA 3E7PA 1WXIA 3FUXA 3JR3A 4PINA 4DT1B 1J2RA 1OB5A 5ELXA 1BIFA 3R3SA 1R6XA 3G6WA 2NU7A 4TWBA 2UYGA 3FKJA 1WCXA 2X0FA 3UA4A 3I9FA 1E2NA 1EA7A 2AC2A 4N47A 1YUMA 1J97A 2OHOA 5I3CA 1J8QA 1JR4A 1OYWA 3EW9A 4B7XA 4ZT7A 1U3DA 2RCYA 2W8BB 2EFJA 1Z35A 3ZH9B 4E5NA 3G2JA 4CR8A 5JFGA 2JLAA 1KYIA 3UCFA 5I4BA 5KREA 3QSGA 2X0EA 5MDHA 1TMGE 4NK4A 2AJ8A 3KHUA 5G4KB 3NKFA 3GLUA 3BXFA 2XCTB 1BXZA 1NW5A 1QMPA 1IIRA 2R68A 1P39A 1AUQA 2XLBA 3SSAA 3AY7A 2XUOA 3CH6A 1BX3A 4EY8A 3T3NA 1FTQA 4F6RB 2ZTLA 1ZVVA 1YC5A 2W0MA 4WOPA 2Y68A 1CR0A 1X1BA 2O4UX 2ZI3A 3OFJA 2IWRA 1ZUIA 1SBCA 3M4YA 4C3VA 1XTQA 2XGGA 4R9RA 4WXMA 2IEGA 3SX0A 1Z4NA 2NZ8A 2W6NA 2NU6B 1PAUA 3CLRD 4BIMA 5HNKA 1TZJA 2WVAA 2Y4NA 3UFBA 3CRQA 2QXUA 5HPYB 3GL9A 3BGOS 1QIHA 4MR7A 1H3FA 1Q6YA 1JFFA 2ATIA 3TB6A 4WL0A 3UT0A 3KJFA 3ANSA 3LTNC 4NV1A 2X42A 1VYHA 5HFJA 1I4EB 4K9QA 1Q14A 1P2FA 3H4TA 4WOCA 5KOJB 2VRWA 2F3SA 3SNHA 3QEOA 2XMCA 1XZNA 1JJFA 3SLKA 3DHWC 2XE7A 4H16A 3GP5A 1O9GA 4B32A 2BFBA 1PYGA 3IMFA 5DP1A 3HWRA 4RS4A 3GA0A 4QPJC 1KP9A 1VLJA 1R4NA 1GU7A 4AQDA 1WDLA 2HLNA 1U6KA 2JGIA 1NWHA 3QPUA 4NCIA 3M33A 4J0QA 5HF6A 3M70A 5ALWA 4DR7B 3CSSA 1QGOA 3L2OB 1ODLA 1AUPA 2GK4A 3BTUA 1AKUA 5TJHA 1BHO1 4D8WA 5TQJA 3GRAA 4ZO6A 3KJNA 3AIMA 1KOJA 4CQNA 3RS0A 2P4QA 2VZLA 3AESA 5ALGA 1DAHA 1MOPA 1UK9A 4GI2A 3OIYA 5TF4A 3SDZA 1VG8A 4NH0A 1I6KA 5J4HA 4KR0A 3ISJA 2BMFA 4PZ9A 2NNLD 4RA6B 4POAA 1M2NA 2ZIEA 3LI2A 3NBZC 3S44A 1BGVA 1KTVA 2QD4A 3OKAA 3BFJA 3GEMA 4KJXA 3OZIA 4YUXA 4AZSA 1XGKA 2AD5A 5EUMA 3EGCA 2ASVA 3LGXA 1WVMA 4KGVA 5F78A 4H18A 4DZTA 5KWSA 1I2AA 1QH8A<