1QWOA

Crystal structure of a phosphorylated phytase from aspergillus fumigatus, revealing the structural basis for its heat resilience and catalytic pathway
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
435
structure length
434
Chain Sequence
b'CDTVDLGYQCSPATSHLWGQYSPFFSLEDELSVSSKLPKDCRITLVQVLSRGARYPTSSKSKKYKKLVTAIQANATDFKGKFAFLKTYNYTLGADDLTPFGEQQLVNSGIKFYQRYKALARSVVPFIRASGSDRVIASGEKFIEGFQQAKLADPGATNRAAPAISVIIPESETFNNTLDHGVCTKFEASQLGDEVAANFTALFAPDIRARAEKHLPGVTLTDEDVVSLMDMCSFDTVARTSDASQLSPFCQLFTHNEWKKYNYLQSLGKYYGYGAGNPLGPAQGIGFTNELIARLTRSPVQDHTSTNSTLVSNPATFPLNATMYVDFSHDNSMVSIFFALGLYNGTEPLSRTSVESAKELDGYSASWVVPFGARAYFETMQCKSEKEPLVRALINDRVVPLHGCDVDKLGRCKLNDFVKGLSWARSGGNWGECF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phytase
publication title Crystal Structure of a Heat-resilient Phytase from Aspergillus fumigatus, Carrying a Phosphorylated Histidine
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Hydrolase
total genus 158
structure length 434
sequence length 435
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2003-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1qwoA01
5CDHA 1CVIA 3E9EA 2P79A 4ODIA 2WNHA 2ENUA 1QHFA 4EO9A 3PGMA 2H52A 5AJXA 5HR5A 1C7ZA 1V7QA 4JOCA 5AJZA 2OWDA 4JOBA 3IT2A 1DKNA 1XQ9A 2WU0A 2BIFA 1K6MA 1H2EA 3EOZA 5CX4A 4IJ5A 1E58A 1E59A 2QNIA 3KKKA 1QWOA 1SK9A 1IHPA 3O0TA 1DKLA 1DKPA 4D4KA 1UJCA 3IT0A 1BQ3A 4MA4A 3MBKA 4D4MA 2AXNA 2OWEA 2P78A 5AJWA 5HTKA 3F2IA 5CU7A 3E9DA 1SKBA 2PA0A 1SKAA 2EKBA 3LL4A 1NT4A 3QPUA 5AJVB 2P30A 2DWPA 2IKQA 1TIPA 2WNIA 3C7TA 3QPVA 4AROA 1UJBA 1SK8A 1V37A 4ARVA 3F3KA 3LG2A 2H4ZA 4HBZA 3R7AA 2EOAA 4FDTA 2P2ZA 1T8PA 2YN2A 2RFLA 3GP3A 4E3WA 3HJGA 2H0QA 1BIFA 2YN0A 2P6OA 1FZTA 3K4QA 3NFYA 3DCYA 3BIFA 3IT1A 2P9FA 3FDZA 3GW8A 5PGMA 3FDZB 4ARUA 3MXOA 2F90A 4PZ9A 4ARSA 5AJYA 1DKQA 1EBBA 4PZAA 1ND5A 2HPAA 1C81A 2ENWA 2A6PA 4PGMA 3DB1A 4JODA 1YJXA 2P77A 4TSRA 1BQ4A 1YFKA 2P6MA 1RPAA 2GFIA 3GP5A 5AK0A 4GPZA 4D4JA 3ZHCA 3EZNA 3QPWA 2HIAA 2A9JA 3IT3A 3E9CA 4IJ6A 2I1VB 1DKOA 1FBTA 1H2FA 1ND6A 3D6AA 3FJYA 4D4LA 3NTLA 2HHJA 3LNTA 1C80A 3D8HA 2EKZA 4FDUA 1RIIA 4EMBA 1RPTA 1DKMA 4GPIB 2P2YA 4QIHA 2P9YA 2H4XA 2P75A 3K4PA 3OI7A 1QFXA 2P9ZA 3D4IA 2DWOA
chains in the Genus database with same CATH superfamily
1TU0A 3KJZA 2JIMA 1ZITA 2VXOA 1TEVA 1SEVA 2KQUA 1NY5A 1T0IA 4HATA 3UQZA 4N5LA 5IXJA 3KHKA 1H9BA 1O8CA 2XOEA 1FP4B 1L8AA 1S8NA 3PKJA 5K99A 2VHXA 4TMKA 1VJCA 4NCAA 3Q9UA 3PC4A 2XXJA 1NJ2A 3OKAA 2HHCA 2WJJA 4OHXA 4CMHA 5KWVA 4L08A 3GHYA 1Y1SA 3MOGA 1QNFA 2BFCB 3NM5A 2GTHA 1E94E 1MNQA 1X1AA 2ODAA 2PSJA 1YJBA 3DEIA 3PNBA 4TMYA 4PEVA 2ZBFA 3F5SA 3Q11A 1RAAA 3EB9A 1CUIA 1ODFA 1YDMA 1AQYA 4PX5A 4YDSA 5BV8A 2QXUA 4GBED 1PBNA 2PH3A 4DUGD 2QVLA 2H1OA 3HC7A 4ZYWA 4OATA 2HJ9A 4GRAA 2XBUA 1U4SA 1Z4OA 4DOMA 4F5ZA 3S8EA 1LBQA 1Z7GA 3BZBA 3PUXA 4EX7A 1FJXA 1L1EA 1SWWA 3ED1A 4MDEA 4K9QA 3C8MA 3BMXA 3DL4A 1S0UA 3I34X 4H18A 4QX6A 4XEHA 5FA5A 3PGLA 4JLBA 1TECE 2G72A 4U00A 3URMA 3HPQA 4F3RA 3B3GA 3OIFA 5IFLA 2FTKE 4N1AA 1PL7A 4GLBA 1IZ9A 1Y0BA 4IIHA 3A2MA 4PAOA 4GR9A 4EEZA 3PUJA 1WDTA 4FPXA 1EHIA 1DRUA 5LJIA 1PJLA 3LCMA 4UJ5A 1Z5UA 3D5TA 2JLYA 2BELA 4FR5A 4AP9A 2O1WA 1EJBA 2DHEA 3FW1A 4F4UA 4M53A 4X1YA 5DT9A 4FVTA 1U7DA 1N33B 1KMIY 2KYRA 1X38A 2Z04A 3A2NA 3DMNA 4MB6A 4H3HB 4FGJA 2R60A 3CEMA 4OQZA 5GONF 1W4BA 1MB0A 1XFAA 2QVGA 1FDSA 5BQ3A 2RJ3A 5JV5A 3O4FA 2DR2A 1PVVA 1S01A 4I0WB 3ZZMA 2B6HA 4F4JA 2VYQA 3SC3A 2ZCUA 4D3XA 4DKJA 1EVJA 3H1FA 5F77A 2PAFA 3AG6A 4CM4A 2D62A 2PX2A 1ZMTA 1QU2A 2JVIA 3W1WA 1SQFA 3KSDO 4YRFA 4E22A 1UBTS 3DKVA 2UYOA 9MHTA 1TCAA 2IEGA 3RRYA 2JJMA 5AUQA 1IM8A 2VHUA 1DJNA 1XLTA 2R8BA 3T3HA 2XWQA 5EHGA 1JMYA 3ME5A 1LSUA 2O6LA 3B70A 2ZANA 1LEHA 2A14A 3C98A 3HHEA 3V8NA 1ODLA 3AUXA 1CDZA 2RBEA 1UKAA 5EE1A 5LCXA 3QWHA 4UXIA 4DARA 2P62A 2JI4A 2A0FA 4C20A 2BJVA 3DP9A 1YR6A 5BV0A 5CEFA 2GVDC 2QPTA 4QJ5A 5FAKA 1OU0A 1WPRA 4N41A 3LJKA 4AY6A 1JGTA 2HY7A 4JXZA 4BB9A 4DV4B 3B3FA 3IVAA 1UP6A 2Q49A 2YXDA 4DA4A 5ECDA 2JRCA 1WF6A 1KYIA 1SWVA 3ESXA 4QXAA 3LLCA 3WVNA 1VSQA 4NHEA 5AJHA 5ICSA 3QX3A 3OJLA 4MWZA 2Y27A 3VKHA 3AXTA 3FMGA 3UAYA 4U02A 4A92A 2VDVE 3TIFA 4LZJA 5AI8A 2C92A 4CFYA 4PN7A 2FWMX 3KWLA 5BVGB 4QRDA 5AW0A 1Z0ZA 1DWPA 1RLIA 3BXOA 1LNSA 2JGFA 2C03A 1T9AA 4RMGA 3N8GA 4WA8A 3M9XA 4R2XA 5CT6A 1Y9ZA 2WAYA 2IYVA 4HF7A 3F6CA 4WLEA 3PBKA 4HGNA 1KNXA 1Y81A 2OSBA 4IEEA 4B85A 1JBQA 4E21A 2XUGA 4BQRA 2BI4A 2JKYA 3OT4A 1NPTO 1GXSA 3EBPA 4UTPA 4W5OA 1AS2A 3RB8A 5JU6A 7GPBA 4YYEA 4QOEA 5ENDA 4UNIA 1KO8A 2HA2A 3KQSA 2SKDA 1WSWA 2G5PA 1GGFA 4ZZ0A 1E8MA 4MNTA 1GPLA 2YOGA 3HU5A 5ICFA 5B7NA 2IYRA 2O0JA 4DUGA 4EP1A 2G0AA 3INYA 2NSJA 5DNVA 3W1VA 4RM3A 3CH5A 4KH1A 5ITWA 4Q9KA 4BVHA 3WLQA 5E95A 4R7TA 4GE3A 2J41A 1NUAA 4QOSA 3PDHA 5BN5B 4UBNA 4EY8A 3GJSA 1FW6A 2C3PA 5C8ZA 1RHMA 3VOAA 2PUFA 1XSEA 1FYFA 2VHZA 3TRKA 5C4MA 1MJGM 1XCLA 4G36A 4MR7A 5DWDA 2B94A 3PRKE 1EGAA 1DEOA 1VMAA 4OG2A 1G9XA 3O92A 4DCNA 1DRKA 3AJEA 3NP9A 1QMPA 5KYWA 2PGLA 5GZ3A 3JV7A 2NXEA 3UJNA 4JJGA 5DGDA 1V43A 3HWSA 1LPAB 1Z0UA 2BBTA 5IVPA 3OIGA 1XRMA 2EBUA 3U39A 1QQAA 4PYQA 3ZD8A 3PIDA 4B6GA 3RSSA 3DE2X 3LFTA 2XUIA 5ALVA 2ZRMA 1K6JA 3V8BA 5EIWA 1P1CA 3LC2O 3SI7A 4UEOA 1IQRA 3LRXA 5G3YA 4L6CA 4I8XA 4GHWA 1M2EA 3WJ7A 3ABOB 3KQQA 3ACDA 3SZGA 4F2HA 3I61A 2OUIA 2G9RA 1RZ3A 2I5PO 1PVDA 2WU8A 3KXLA 4HHEA 1X15A 5JJBA 3D3QA 4S1VA 3THOA 3VOBA 2C5SA 3CCBA 4P6VF 3BWBA 3ZDXB 1DGQA 3PCXA 1W2WB 1CP2A 3ZWCA 1YOVB 4HWOA 4LOIA 1FXSA 4X8OA 1ZNZA 4KEAA 3BRCA 4IGFA 1NOIA 2IF2A 1UBMS 2HT6A 1DQRA 3Q7QA 2X9GA 3GLHE 5BPFA 4MVJF 1CYDA 3H1TA 5ER6A 5ER9A 4CKBB 4ZYXA 5JTUA 1Y1KE 5MDHA 1IY0A 4KWEA 1E2EA 5F1OA 3I2IA 4XIGS 3DE5X 3VXKA 1SUAA 2AMJA 1G4AE 1YB7A 4L51A 4QGHA 3LCJA 4URWR 2WJGA 4FQ5A 5AM3A 2AQ8A 1EFTA 2YS6A 4B7UA 5JFGA 5K0EA 2QJWA 4P4TA 1M66A 1MQAA 2ZAYA 3VJLA 4JDUA 3OUTA 4D3SA 4BVEA 1ESZA 3C1AA 4X3OA 4YUWA 2HNKA 3IRVA 4X85A 4DCUA 1XPJA 4F4IA 1MDBA 2OV1A 4OV6B 2A7QA 3FG9A 4OGFA 5CK5A 4OQXA 1RFLA 2A0UA 1GRVA 4J7CA 1LPMA 2YMMA 3I6BA 3GYBA 1EP3B 3W9BA 4O59O 3G7NA 3THXB 3UB2A 4GKJB 1JLMA 1M2HA 4Y9TA 3UPTA 1SOVA 3EAFA 4R1UA 1N4DA 3A4MA 3AESB 4WLVA 2WTUA 2VP3A 1L5WA 1MXFA 1SIUA 1C1YA 1TZJA 2CFIA 4CIYA 4YCDA 4YECA 2JCBA 4YLGA 4R3NA 5K6AC 3OQNA 4PHGA 4WK6A 4C3ZA 2Q6LA 4HZGA 1M1NA 4PXYA 4RACA 1KZ9A 3FOWA 4HAYA 1KQGA 4ZANA 1JEDA 5BXYA 3ZHUA 3BTVA 4JLKA 1OTHA 5AESA 1EFVB 1MV5A 1EA7A 2VEOA 4XZ3A 3PQ7A 4CKWB 4DB4A 1XNRB 3A6GA 1WB5A 3HKBB 3P2MA 1ITZA 5FR2A 4PAMA 2OA0A 4YO7A 2NTNA 4BNMA 2ETVA 1XDZA 1TU3A 2GPAA 1SKAA 2YC4C 3ORYA 4G56A 4XSHA 1LD3A 1I10A 5IZCC 3RBAA 5LOVF 3K5IA 1F6DA 1Z07A 5A6VA 1YB5A 3EIOA 3PRJA 5FADA 4OHRA 2CBGA 1WBDA 3LC7O 3IBTA 3W6ZA 2NUPA 1K5GA 2CNOA 3UK6A 1V7PC 2EOAA 3N53A 1G20A 3HBJA 2QBYA 3II6X 3R1IA 5KJ6A 3A27A 3ZY6A 3IGFA 3ORHA 4OQYA 3JQ9A 3UV6A 3KQTA 2ID7A 3CLHA 3R4VA 1BJKA 2P11A 3SSAA 1U4OA 4IEIA 4ND2A 4YNBA 1CULC 1TJNA 3MRVA 3RU3A 2ZSBA 1O57A 1EJ2A 3NFYA 1NF2A 3AIOA 3PDJA 5D6OA 2ZB8A 4L4UA 5CFMA 2XRMA 3O21A 5DF1A 4ZC1A 5EXPA 4DLZA 4DMUB 1GG2A 1RM4A 2Y67A 5C8DA 1XKXA 4LMBA 4L9RA 4PVDA 5DZSA 3RQSA 1RZUA 3I5UA 5IS2A 1PJ8A 1R00A 4P31A 3OOWA 1R0BA 4PVCA 3SHOA 4UEKA 2HH9A 4QUEA 4TLEA 4ZHSA 4ZMSA 3ONFA 4LJAA 2QLTA 5LM3A 1TO1E 1QIMA 3IP7A 2BJHA 3BSFA 3C3MA 3IPCA 3K7EA 4WKNA 4QO8A 2IZ6A 3KKMA 4EF4A 4LX8A 4OUDA 2DPGA 3IHWA 3KCNA 4GPZA 1C0IA 4RD1A 5I7WA 5IP5A 5FBVB 1UJ5A 2O2EA 4GZMA 4BNIA 4J1SA 3U09A 3A6PC 3QLJA 1ZA2A 4JUIA 2I1VB 2AJCA 2JHAA 2NU6A 2OV4A 2RC6A 4FMDB 4LQDA 3W2FA 4EY6A 1E89A 1Y6QA 2AC2A 1RLUA 2SECE 2R8RA 2W90A 1Q6ZA 2KX7A 2XVXA 3BDIA 4M0FA 2QL7A 1QGAA 1IH8A 2ZWOA 5JI2E 3QYFA 2VPTA 3Q8LA 1QV7A 3ZY4A 4JUCA 4DADA 3KQHA 1GUBA 1JH9A 2DY1A 5GY7A 3OEWA 4M1WA 5FBZA 3U4DA 1CQIA 3ETCA 4V38A 4D9FA 5K2OA 4YV0A 5DOVA 3GH1A 5C51B 2AOXA 4M89A 3DE7X 2DLCX 1U0GA 1L7DA 3T1VA 1XTUA 1TI7A 4OH7A 2D1SA 5EHXA 1U3DA 3B1XA 3H0EA 2DE0X 5LQCA 4GLOA 3UAGA 5L6LB 4OP2A 3CLSD 2C9OA 3IUJA 3ZZNA 4LZLA 2OPHA 4EENA 2XWJI 4J7AA 4G5RA 5HDBB 4PIVA 4BZPA 1AUPA 3C4JA 2HZBA 1E9DA 4LG1A 1RS0A 5A06A 5AOVA 3MQ2A 1OXBB 3DXZA 1X7DA 2H4FA 4K1XA 3UUEA 4QVGA 3T8YA 3DZFA 3VI3B 2QTBA 4F8JA 4J0QA 4MLZA 3AWDA 4CLRA 3ELUA 2Z8YA 3UA3A 3GF4A 2GBLA 1Z5NA 1YVUA 4ZTBA 1BGXT 2ZVDA 1OLUB 1PQPA 2KPOA 2P65A 4L22A 4EFDA 4L8WB 3WLOA 1AUOA 4OLFA 4CMKA 1KL7A 2G3YA 5KNBA 2HO4A 2Z2IA 3HI4A 2WLTA 3R75A 2GUGA 5YASA 1W34A 2WKRA 1BDHA 3NKFA 2R6HA 2IU3A 3HUUA 4EEKA 3QKSB 1YRLA 2W71A 2QTHA 2NQTA 1PLJA 1REQA 1OA0A 1R15A 3BGOS 3INNA 2F1KA 3HUTA 1R4NA 3IJEB 3GBVA 4ARVA 1Y1LA 3DV0A 3NUQA 4OK3A 3OQIB 4R9UC 1JEOA 4MHOA 5EHZA 2ZBUA 1KP2A 1UAAA 1BGVA 4MARA 1WLSA 3BQMB 1P77A 4UM9D 4CM6A 2CVQA 5K8LA 3PEWA 1M6WA 4LSWA 1T26A 1A77A 1QKKA 4BVBA 3NAZA 1KYXA 2Q9BA 4UULA 4KLCA 1QB8A 1YDHA 5EVCA 2PSFA 2IYQA 2ZRQA 5LOVB 3IVXA 2GZDA 2NUBA 4OFBA 5IM4F 1SB8A 1UANA 3VR4D 1Q7BA 4YASA 3M3PA 3H4IA 4KHPB 1TGVA 3K0CC 1X94A 4CR8A 2VP9A 2WOJA 3ZU5A 1K66A 3ZJVA 1XELA 4KSBA 1DO2A 3ZWXA 2Z2ZA 3RYFA 3K1JA 5FHRA 4LWPA 1EWTA 2PWZA 1GP2A 3VR4H 1GKUB 1PG5A 2BGLA 3OIDA 4OXQA 3I92A 5HCIA 3DH0A 1BYIA 2OE2A 3U3OA 3LGAA 4QT4A 3EDMA 2UYCA 4M8NE 4HFJA 4EHAA 1E62A 1BE6A 3MTQA 1M8PA 2E4VA 4CMGA 2DFKB 2CL0X 1ATZA 2XMQA 2Z6VA 3PNKA 1P4RA 4FONA 2NYVA 3AR3A 5LNK1 1ZMXA 1CJKC 2ORED 4MV5A 4P8RA 1RPZA 2M32A 3F9IA 5FUYA 3RUFA 3GP8A 1TCCA 4QEKA 4B79A 3EUEA 4URVR 4PXAA 3QUAA 4II2A 4NU8X 4MDFA 3HCDA 3FSJX 3T6KA 2I6QA 1A88A 1NC3A 3RFXA 5JYCA 3ORSA 4KNVA 1VPDA 3FIJA 4RCVA 3WJ1A 2NG1A 2JLXA 2O50A 1NYRA 1XMSA 3C5EA 3K6KA 3P9KA 4DLVA 3ZDAA 2DHQA 3FFAA 4TTAA 4O5OA 5BT8A 1SEPA 3ZG6A 1H9AA 2QD4A 3AKZA 3V2UA 5C37A 4ZYLA 2M9MA 3VU9B 2G36A 5JYDA 4FMDF 1O1YA 4IINA 4YP5A 2Q4BA 5G4KA 1RAFA 4DMLA 3U4MA 3OICA 5A6SA 3DNMA 4GC9A 2HRQA 1VZ3A 2PO7A 2XR1A 1UT8A 3ESBA 3K1AB 3UKDA 4E5NA 2PG3A 5ITVA 1XTQA 4CKXA 2JJ8A 4DLAA 1DCMA 1N25A 3DBHA 3JQCA 4MVCA 4KQGA 4DNXA 3ADCA 3NXKA 3OWXA 1Q16A 3MT9A 1MMFB 2C2WA 1EXDA 4ZEOA 4E7OA 1XU7A 3RREA 3PUWA 1OI7A 1Z5PA 1SZDA 4I5GA 4PSKA 4H35A 2Z57A 4MA4A 4X7PA 2PT5A 8OHMA 3H75A 5C5DA 4GP7A 2VTDA 2XLCA 1UFKA 2ZE7A 3B3QA 1I2ZA 1L8OA 3AUUA 4XWAA 5EIFA 3BFVA 3RC1A 5BSHA 5AVXA 3NMUF 2A8YA 2X2EA 3MCUA 1OLSB 4RE5A 2WHEA 1NT4A 1FVHA 1UQRA 1T34A 3GEIA 5AJVB 3SF0A 3KPWA 4E6PA 1TIPA 4RMJA 1ENPA 3TPCA 4EVIA 5JASA 1FP2A 2XNHA 2ZIZA 3CZMA 2UXBB 3HXTA 2PYDA 1ZX1A 3KTAB 3FPHA 3OM9A 4WAUA 5AKEA 3N2KA 2R8PA 4B35A 3J7TA 3ZHOA 4BNDB 4X64B 2TS1A 4NY1A 1YE3A 5FOWA 3ETEA 3GNTA 2N3ZA 4CLDA 1S02A 1YRQA 3EF1A 2X1HA 3TOXA 1Y80A 2ZRBA 1T5TA 4AJ9A 2QYOA 3RW9A 2FHPA 3ASZA 3RADC 2C7BA 5J5VA 3R9XB 2CHVA 5HG0A 4AF6A 1PFUA 2JH9A 4MQ4A 3BTOA 4RTQA 1S1MA 2AJBA 1OC4A 2B8EA 2Z5GA 4FZRA 1GZ3A 1QM5A 1U0LA 2BE9A 4Z9YA 3RCBA 1QGED 3KL2A 4MGYR 3AUJB 5A02A 3OMXA 2Y0EA 3MRSA 3STUA 1XB2A 1ZO8A 4M60A 1I32A 4B6FA 4IDAA 4BGUA 1TJ5A 2PWPA 2QRNA 3LW8A 2I87A 1O94D 5EJ2A 2J0UB 4MP6A 1SD5A 1NKSA 3GRZA 4ARSA 5A4KA 2FMTA 1K88A 4LMAA 1LNZA 3KZXA 3WL7A 4F2GA 4MUXA 1PT7A 3RVPA 1ECFA 1E9SA 2XF8A 3BIWA 2X0EA 3CZ4A 2QX9A 4E32A 4Z4HA 1VG8A 1UJ6A 2OLEA 1A9SA 2YDXA 1XD9A 4WY8A 3ZC3A 4BKMA 2BEVB 1YL5A 1X7ZA 2D8AA 3VHXA 4FC6A 2O3UA 4J2TA 4M7RA 1TDJA 3FIUA 3ZV4A 3PEUA 2PZ8A 4UD6A 5DYYA 1PGQA 1AXEA 4IXDA 4MVJP 5I5GA 4EX6A 1ZI8A 1FQJA 2E37A 3EN0A 5A04A 5KYYA 1H2FA 4QPPA 3ND9A 4CM8B 2PGAA 3OX2A 3NTLA 4FSHA 2EX1A 2V9ZA 2XVYA 1V9LA 1SUBA 2OB2A 2ZOSA 1QONA 4Z0PA 2G4LA 2PANA 1N77A 2QENA 4B6SA 2JGDA 3NHUA 1OFUX 1YSCA 4TS1A 4Y2SA 1IMOA 1NRWA 4C05A 4C5CA 3KKOA 5SYAA 5J40A 1FNDA 4MPRA 4CM1A 1MA3A 4H1WA 3O2QB 3P97A 1GDTA 3PFCA 1QHYA 1KK2A 4FOPA 1AS0A 4RZHA 4RJLA 5AKXA 3L93A 1EBUA 4PLZA 4S0ZA 4ZO8A 1P1HA 3Q3CA 2HTFA 3TTTA 5LDDC 2OORA 4GNRA 3VPBA 3TLYA 3X2FA 2WB4A 4O4JA 1M2FA 3KB1A 4ZIRA 2CJYA 4UNNA 4GUDA 4MDHA 1JG1A 3U60B 3X2EA 3FAZA 2PL9A 4CIBA 3CNNA 2RHBA 3I28A 1YAHA 1IXKA 4F9GA 1JFTA 3BEOA 2RGNA 3CUTA 1X39A 1PDVA 2QOEA 4N8SA 2C8KA 1AS3A 1DQZA 1QZUA 3QF7A 5D3QA 1P3JA 3AF1A 4IJ5A 2ZRKA 4G4SP 4AJLA 1ID8A 4IRMA 1U2RA 5EJIA 2NVUA 4ZI2A 2FSVC 2R5FA 3DZHA 4JY7A 2YS7A 5H5JA 2PM8A 1HI9A 4BX2A 3V4VB 1JP7A 2PX4A 4LWQA 1K3TA 4UDXX 3WG9A 2YIJA 4G0YA 3MT7A 5I47A 4MEBA 2PFSA 3X2SA 3QY0A 2IHNA 3N2YA 5HRCA 2D7DA 1X86B 2ZJ5A 1ORHA 2FQYA 3I45A 1M8JA 2R1TB 4RJTA 5I7OA 3VO8A 2YWBA 3JYPA 3AR4A 2O3TA 1MABB 3IHLA 4FLEA 4JJEA 4EG0A 2HJWA 4R0NA 3T38A 4EHFA 1CJSA 4F56A 2F43B 4NESA 3TLAA 4NULA 1U1IA 3RUHA 1E1CA 4RHCA 2QF7A 1YI8A 1GPUA 1KOJA 1T2NA 4NG4A 4S1WA 1BDMA 5BP7A 1VJ0A 5IAKA 4DLBA 4E5DA 1U9JA 2QJOA 1VLVA 2R8XA 3NAGA 4UUNA 4WZAA 5KI6A 3PXEA 4AWXA 4ENWA 2X5KO 3CZRA 1R4MB 2B3TA 1JKIA 2CDCA 3HJCA 3OZSA 3RKSA 4HUQA 3N2IA 4XGRA 1XKTA 1L5LA 4NZYA 3NC0C 4DLLA 4PN3A 5C32A 2YOFA 5E9JA 1KQ3A 3FTDA 3D0KA 4U3JB 3ZE6A 5F98A 3ZDBA 2FMKA 1NXPA 4JQCA 5IN5A 5DNDA 3ZWBA 5C7YA 1WB9A 2O8DA 1O94A 2C1ZA 2IUFA 5D5HA 2MINA 4JA0A 1JTEA 1SQ0A 4R1NA 3E4CA 4US2R 3WNZA 3GLIB 3I9FA 1YONA 1ZJYA 5DX0A 1VHJA 2ZAIA 1XROA 2ENWA 3AH8A 3PXXA 4M1YA 1Q22A 4BTEA 1TYBE 4Q4JA 2WU4A 4J1TC 3EY4A 5KU1A 1QLWA 4LHZA 2A67A 1MFPA 1RJEA 3A9TA 4RX1A 4AC9A 5IJAA 3CLTD 1NQXA 2WM9B 1IPHA 2OO5C 4RWEA 3UJ8A 2WUDA 4C0SA 4EGFA 4XJTA 4G0VA 3PDIA 3CNHA 2C1EA 1SBIA 2IYPA 2VF8A 1ISIA 3NOOA 4RK4A 5TPWB 2OZLB 1QHHA 1Y4DE 4HOYA 3KPJA 3QFRA 1ZN7A 2VRWA 3ZGVA 2JI7A 2WSLA 3BF8A 4ZP1A 4YPVA 2H07A 3MJCA 2NZUG 2PUBA 4G6ZA 4JLSA 2I66A 4KKXB 2QVCA 4B3FX 4BRWA 3U6BA 1XD2B 1XR3A 1NWHA 7REQB 3CSUA 3GARA 1IPEA 1W93A 2QR5A 3ELWA 2FWIA 4BNNA 4F3TA 4D3YA 5LC1A 1QFXA 2YQ4A 5FH9A 1PW5A 5JDCA 1M2GA 4CDRA 3AL0C 1RQ2A 1ZUD1 2R8OA 1YNOA 3MPUA 1CTQA 1G55A 1HMYA 1L4NA 1OHHD 1L1FA 1MF7A 1TYCA 2A5GA 3OE7D 3U3RA 3PLAE 1XNJA 1Z5ZA 3A6HA 3RHSA 4BFUA 3U40A 4LDJA 2OXRA 3C3DA 4CXMA 2JH8A 1RAGA 2JK0A 2BTQA 2K2QB 4DJ5X 4F3KA 4UVIA 4E7PA 3H5RA 3LCUA 4NG5A 5JSKA 1EUQA 5EP3A 1G2PA 1N9GB 3HKEA 2R1ZA 3O8QB 5TIIA 4AO6A 5AFSA 3PVSA 2VT7A 4GDFA 2BM9A 2VJCA 4H77A 2GEUA 4TPKA 3GAFA 2ZRDA 5L40A 2RHMA 3K6JA 3OWOA 4QECA 5FJJA 2ZJ8A 1CF9A 2F3TA 1PDOA 2WUVA 1SR8A 1YZFA 1MR3F 4FEEA 3W4KA 5JRZA 3P0FA 3ZGZA 4LZAA 5HFAA 1T1JA 2EKBA 2B37A 3LK7A 2F8MA 5DBFA 4CMJA 3DL2A 4D9JA 4UTRA 1Q1GA 5JYEA 1HDYA 2OBYA 4LISA 1WS6A 2G5CA 2IKQA 2PLNA 4PC2A 3EC1A 3DF9A 3ENNA 2YIMA 1YD7A 3JSAA 4JYZA 2ZAOA 1QXSA 1UJBA 4EAQA 1B6SA 1O54A 1N75A 1OR8A 1Z22A 2C1XA 3K0AA 5HZKA 2OXEA 2HSZA 1D03A 2PA3A 2QZ4A 2X13A 4QHSA 4ZCLA 5GV7A 1FRZA 5H3LA 2P7HA 3RU7A 1M5RA 3SC2B 2GBIA 3KXDA 4WXRA 1ZQ1A 5DXAA 1VYHA 4JOQA 2YN2A 1ZIOA 2VNKA 1R9GA 3QMPA 3HYTA 4KDRA 3KD2A 3ER9A 1ETHA 3OD5A 4R31A 2ZI9A 3W9SA 3QA3E 4E4TA 2XMDA 1L6RA 3KZOA 4L5IA 3KVOA 2C5GA 1KSHA 4HCJA 2VNAA 4JFAA 1UFOA 4UNSA 5KNDD 1SXPA 4BEJA 1BRTA 3VPAA 2X86A 3EWNA 4PQFA 3KOYA 4PY2A 1I1QB 3OPYA 3ZLUA 5C5CA 4FYKA 1R0XA 4CTMA 5B12A 5E1DA 1Q91A 3MMPA 3GJYA 4CDNA 2VXCA 3RYIA 3PTAA 4RLSA 3EEIA 4JC5A 2VYND 2OQ2A 5BVHA 2F7SA 2ZSIA 2I29A 4C89A 1ZCAA 2TMGA 3I2GA 1N6LA 2DH6A 2GD0A 3N39C 3T34A 2ZYUX 2GCEA 1QAOA 3IULA 4AQ7A 2W8BA 4H6XA 2NAFA 2FZ4A 5AHOA 4GLFA 3VYWA 1JPNA 4F6LA 5GVSA 3BM5A 4BP9A 1I9GA 3WTCA 3KETA 4G81A 5HMLA 2A9JA 3DF7A 5GP1A 4ZHQB 1K2WA 3ZNNA 1CUCA 1G20E 4CLEA 1AQLA 2J87A 3MWLA 3CM0A 3CSDA 3NHRA 1NSYA 3BCRA 2IPOA 4Q1FA 2ASVA 4CMEC 4OVKA 1J2RA 5FOQA 1WZUA 4UE2A 4MCHA 4B82A 4YUXA 3N8KA 5A5VA 1L1RA 2HCTA 4FP9A 1X9HA 4H2DA 2R00C 3PQ2A 3UMGA 2GJAA 4XIIA 3BDVA 1FUEA 2WV7A 1DG1G 4MVJG 5ETJA 4D3FA 1HORA 1N2SA 2VG8A 4PZZA 3LHFA 3I1FA 4CVNA 2CJWA 4UJ3A 1R5NA 1D5WA 3D4IA 2XOXA 1JKJB 1IZ8A 4B83A 2ODEA 5E0OA 4IQ0A 4WOKA 2PRJA 3EZLA 5ITSA 1OHHA 3B85A 4J0JA 3OE7A 4MWDA 2ZIFA 4DV3B 3TBHA 3IKJA 4G4JA 4XSVA 2ZSUA 2YFHA 2ILTA 2OQVA 2R96A 4PONA 2J46A 2VI5A 4O4LA 1XN4A 3A1WA 3BWMA 4CPDA 3E8MA 1U8UA 1RXEA 5EIXA 1MG5A 2X15A 2X42A 5I7RA 5LJLA 4HNHA 4JYAB 1E4VA 4J16C 3W5IA 4CF3A 1CNFA 1IBSA 1YVDA 1ESEA 1NN3A 2BVNA 3ZGYA 2LDBA 1HT1E 3KKZA 3LVFO 3DDUA 4LRQA 5A9TA 1AIPA 1MT3A 4B43A 4BVJA 4EJ0A 3OZ7A 5BSVA 2OYCA 1OYVA 1BS2A 1JWAB 2A0YA 1GQFA 3GJ8A 1JEYB 2UAGA 1I4DD 1K5DA 4W8OA 4E2YA 2I03A 3W8DA 1W52X 3GG2A 3L8FA 4WFJA 4NQZA 4DWWA 3AB3A 1HBJA 2BEKA 1GY8A 2FMXA 2F3QA 1P0QA 3SF8B 2NU7A 3TAHA 4K87A 2PKQO 4EI8A 4JYMA 3SYTA 1XMXA 2OBBA 2PDAA 2HDWA 2XNKA 3RSGA 5ILQA 1O95D 3DONA 3GK3A 4RGQA 4NAVA 4XH9B 1RLMA 1SKYE 2OXTA 1EFHA 1XZDA 1VCMA 2GKSA 2IOFK 4M54A 5J4HA 1MKYA 2I2BA 4MYUA 5B64A 2EX4A 1M0SA 1T4GA 4WI1A 2QPOA 4RHXA 4F92B 5KSOA 1NLUA 1TA9A 5DB4A 2H08A 3FSRA 3K9BA 2J7PD 4R1QA 3WQBA 1EWYA 5ANRB 1R3DA 2BTOA 3G2LA 3IXQA 4QE3A 4R7GA 4DLNA 2CJPA 1RW4A 1DMRA 1VBFA 2AD5A 4Q4CA 2IS4A 4PG7A 1BXRB 4QYXA 1FTNA 2I7DA 5FQOA 5KNDA 1XWWA 4JI4B 2IOQA 3RGGA 2FJ0A 4RPCA 4RF2A 3KOWA 4M21A 5EEGA 2Z5VA 2WSSD 3T5PA 3WWYA 1CZRA 3FFBA 3KLBA 1EEXB 2G08A 1IYZA 1TF7A 3O26A 4N3AA 3MHTA 4RIFA 3N0VA 2VYNA 4OHVA 2O06A 2VDKB 3PDCA 4P7FA 2Q0QA 1M1XB 3RYHB 3KR0A 3SXUB 2JK1A 2PT7A 2WHPA 6Q21A 3PICA 4NYMQ 3U80A 5IYZB 2AG6A 4QYIB 1Z74A 1FIUA 2QZPA 3EZFA 5BN3A 2Q7OE 2FF7A 1NJ6A 2WJZB 4WXEA 3JQGA 6GPBA 5CH3A 2PCLA 2C82A 3BK2A 4OHZA 1P7WA 4MS1B 1QP8A 4X1IA 2QRZA 1J99A 3FJYA 3FPEA 3MINB 4FYXA 3DZCA 2Z6QA 1OROA 4MWGA 4XQGA 4FHCA 4MYCA 3HKCA 1XRSB 5CVEA 3DMHA 3ZV5A 2H1HA 2BRUA 1SZCA 1KY4A 2JGKA 4D9IA 2OCIA 4N0EA 1NW6A 1WZIA 2DQ4A 4EQZA 2GCGA 2W2KA 3I01M 3RS2A 3KJHA 1BVRA 1HE5A 1XEFA 2WZCA 1KJYA 1E98A 2X58A 2B1IA 2XNDD 3CLRD 3OPQA 2UYGA 4JBGA 1Y8QA 4LKRA 4YAFA 2EWVA 5AVOA 1JFRA 3RSZA 1IUOA 4PPGA 2WB2A 1NV8A 1P9NA 3HJNA 1XTVA 4MUYA 5FBHA 4TXJA 4ZHQF 4B33A 4WCDA 2G82A 2A1TS 2ENUA 3GCWA 3KZKA 5JVDB 3WFZA 4LSGA 4IWNA 1VFNA 4QRIA 1IBCA 4JI6B 2ADOA 3K5WA 3ZXYA 3TZCA 4OQQA 1KZHA 1QDUA 2I1LA 3ILHA 4KOAA 1RQXA 2ZBPA 4UMFA 1EUCB 5LQKA 5K8IA 4OBXA 1CF2O 2JFBA 5EMLA 3ZLBA 1QFSA 3CW8X 3LBIA 4KNWA 1PU2A 4WY2A 1V71A 3RC7A 1NRIA 4UCFA 4ZJZA 4JCCA 3ETJA 1JSXA 5ECYA 4ZALA 2W6PA 3Q2KA 4LRSB 1RI1A 1H0SA 1W6RA 2IFTA 3G6WA 3A1TA 3FM9A 1TL7C 3IP6A 4ZOAA 4KNYA 3NHWA 1GG5A 1H93A 2A94A 4TSFD 4BLRA 3H1AA 5JSHA 2X1MA 4G9BA 2CZCA 5CLHA 4KLZA 3VNBA 3F6YA 5JS6A 1KO1A 4P4GA 3LFUA 2YJZA 4YQFA 1Y9EA 3F96A 1JZSA 4RSHA 1FVOA 5EYPA 3UC9A 4XOIA 1QHIA 3IEPA 3D3KA 4K3VA 5A3RA 5A0VA 2YIVX 3HBAA 1P4HA 1YVRA 1O95A 3HB9A 4JASB 4K9OA 1FFXB 2EGUA 2Q5LA 1LK7A 2AIRA 4PG5A 1POWA 5DIZA 2JANA 3WMFA 2PD4A 2XUFA 3NATA 2JBAA 2XGMA 4RKQA 4NMMA 4F1KA 3M4YA 4OFZA 2BFEA 3D3JA 2J7PA 3CTMA 4DJAA 5HSGA 1AUVA 1U8YA 1U80A 3DZIA 3EXHA 4YACA 4EFNA 5B57C 3QVOA 3L0DA 1W4ZA 5LZ5A 2AN9A 1JPVA 1R6DA 4A0QA 1AOXA 1ZMBA 3CVYA 4Q4AA 1VMDA 1LJ8A 4GUAA 3UWSA 3VV3A 5C5IA 5CURA 4L0DA 2GF2A 4HKTA 2O8VA 3HEBA 2RH8A 4DMHA 2I6TA 2WSSA 3V8QA 1P60A 3IMFA 3KUXA 1HDRA 4Q3CA 1DQYA 2CSUA 4MVJD 1ECBA 1YZTA 1W9MA 1UP4A 1XEAA 4RK6A 5T4FA 1DC4A 4JC0A 1HTTA 4O3FA 3PQ3A 5FTWA 4V0QA 3H1EA 1EBFA 3GRCA 1NFQA 4M46A 3RFCA 1YRBA 1HDGO 1OH7A 1PKXA 2J67A 3QEMA 2JGRA 1IN8A 2WYIA 2YYSA 2IS1A 2JLRA 1OYOA 3WWEA 3OX4A 4AQYB 4FB5A 2WQ6A 1FYEA 3RSHA 3D3WA 1A4UA 2ZYIA 1S4QA 3BYZA 1VB5A 4IY1A 5EWJA 1W4LA 4Q9HA 4YMLA 4H1HA 1GG8A 1R12A 3FB1A 1W88A 4Q3BA 4YCBA 5CTAA 4IRXA 4XKJA 2Q3MA 2D3WA 1RLTA 1B43A 1FMCA 1PTJC 2CMKA 3DQPA 1GUZA 2DBYA 3KR9A 1BEUB 3ZBQA 3S2SA 6AT1A 4BXOB 3I9KA 1E9BA 2MR5A 2W6QA 2ZCVA 4GQAA 4JBIA 1YB6A 5GZ1A 1VLHA 4WBNA 2BL4A 3ETLA 5GM1A 2GZSA 2P67A 4ND8B 1J8VA 2JAUA 4Y2RA 5DISB 2XNDA 1J1IA 1RC0A 3QGMA 4JP8A 4PLCA 5IYZF 2AFIB 3HNOA 3F6BX 3EPJA 3UJHA 1P7PA 1GGVA 2ZQ5A 5JDIA 1KMHB 3E7PA 2R68A 3P52A 4H7JA 4HGOA 5FT9A 5H82A 5KTKA 3OD1A 4L5CA 3RVNA 1EVQA 1ST2A 1DJQA 2AXEA 3F3SA 1J9EA 3EYWA 4F86A 1FP4A 2ZTHA 1BDIA 4ACBA 4UFPA 5K4HA 1OGYA 3ECSA 2QN6A 1NYQA 4LXTA 2ACEA 3EVNA 4KPFC 1AV6A 3ORRA 1GFWA 3OCJA 4D42A 5HIKA 5K3EA 3GFFA 1H2EA 3AIKA 3DR5A 1A72A 4RPKA 1SD1A 1KJQA 2BFCA 1OW3B 5J63A 4JL5A 1KH1A 2UKDA 2R9VA 2FZKA 2Z09A 2AMLA 1GCIA 2B8TA 4XLLA 2EARA 4TSFA 1OXVA 4XWWA 1GGHA 4QQ8A 1FYVA 3NASA 2QUKA 4EW2A 5JVDF 3H8SA 5C0OE 1OB5A 2R62A 5D86A 4N0MA 3MRTA 1RCFA 1TZBA 4ZO7A 2BLNA 5JWHA 4RTRA 1BW9B 5CU7A 3GLFE 3DLHA 3Q2OA 4PRYA 4L02A 3GCGA 2P90A 4KWIA 4PQGA 4HUTA 4YN3A 1Z9BA 3PPYA 3QPUA 3UW3A 1JHAA 3ET5A 4JUFA 5EINA 2H2WA 3IKMB 4E88A 4XUEA 3K9CA 3AVVA 2BR4A 1QQTA 4CU5A 3I72A 3BXFA 4O25A 2IYLD 3D31A 5I7SA 3CRRA 4BAZA 3UB3A 2I7TA 3RAGA 2AK3A 2YYAA 3GGJA 3WLLA 4OQ4A 2XE6A 3WK7A 4RL4A 5LU8A 5ES3A 4TN1A 2OVBA 2SKEA 1P61B 4HNAA 2C2OA 3FKJA 1LDBA 4XFJA 5EXTA 3N6RA 1TIKA 3PXAA 4D2IA 2JASA 1PZHA 3PFIA 2GCOA 1RE1A 2VDOB 4LJ6A 3RAJA 1G42A 5JJLA 1NMEA 2YWRA 1KY5A 2HK8A 3W5VA 4KQFA 2YV2A 4Q19A 3D6FA 1OAOC 2VPIA 1DKUA 3ONVA 3UAVA 1JR2A 4MVJA 1UOPA 2PU7A 4B3IA 2QNRA 1PRYA 2B4YA 3PXCX 1M8KA 3TZLA 4EF5A 1SNYA 1U7TA 1DC8A 2IELA 5KTSA 4F1WA 1K08A 2XHEA 3DD5A 1GAWA 1ACLA 2GR9A 3Q3IA 4MUMA 4UAVA 1U31A 3HB7A 3ZH9B 4Z9FA 2V0GA 3KOXA 2B7BA 2H2DA 5GM2A 2W43A 2FEAA 2IEAA 2ONKA 3VNVA 2X6RA 4EM6A 1P39A 4DLSA 4TRJA 2LR0A 4NJOA 4TV8B 4CKYA 2WP8J 2GN2A 1FRFS 3WWOA 3NM6B 1P7CA 1NP6A 1W4RA 2V6BA 4IXMA 4F2DA 4WJLA 5JFTA 4MQLA 2XD4A 3KQWA 3DULA 4FGKA 5IUKC 1C4WA 4AYTA 2K6GA 3R24A 3KOOA 4P4LA 4O02B 5BMVB 3TO5A 4JUDX 3WV5A 4Y30A 1I3LA 2E5FA 3E27A 1MVLA 4P5EA 4HFRA 2IRWA 4WZAE 4CN9A 1RHJA 4GI1A 3LNTA 3MSCA 4H3SA 2OBMA 5DV9A 1E7MA 5D7BA 3TSYA 5MN4A 3FOCA 4N9QA 1MB4A 2QE6A 3AP1A 1XI2A 3HVRA 1PX0A 4B32A 5CFNA 3AB8A 5AVSA 3HTXA 2A30A 1CZUA 1I51A 3AUYA 3P9PA 2HMAA 2FU5C 5IT0A 1HFEL 4TL8A 3T1OA 4IG4A 4KXUA 2Q7XA 2DVMA 4CKCB 5JECA 3AY7A 2YV4A 1CUFA 1R0YA 4HN9A 4TTIA 5BVGA 5HPYB 2LPMA 2OL4A 3MC1A 1M34B 3NONA 4D79A 2PZGA 5LU9A 1MH1A 2QRPA 2COKA 1BCRB 4HAZA 4YAIA 1A95A 1M5TA 5LOVA 5IM4A 3NHYA 2ZM5A 4AXBA 3KM0A 3FETA 2PKXA 2NX2A 3WKBA 1KK3A 5GAJA 3VPXA 5IDXA 4V1CI 1QE5A 3VYVA 1VYUA 2G1JA 1CUXA 4CCSA 5IJWA 3WAJA 5LDHA 3I04A 4LYJA 3NDPA 4D81A 2Q9UA 4Z7JA 1ZH6A 1FMLA 3DFFA 1J5EB 4NONA 1I3CA 4GWGA 3HMKA 4YR9A 4X1OA 2G88A 2HKIA 2Q2QA 3IVRA 4D3ZA 1TUIA 4ZXFA 1EQUA 1J24A 2HSWA 4WLNA 1U4NA 4E3ZA 2JA1A 4WECA 3FLAA 1IRIA 3OT1A 4WXMA 5DLPA 4ZI5A 3W3ZB 1C30B 5BN5A 2OUKA 5KS2A 2HQOA 1H05A 2QMQA 4CT5A 2VTVA 2CGEA 3D8BA 3CURA 3K1TA 3TCKA 2QM7A 3KSUA 4NNPA 3ZI0A 3SQLA 4E5KA 4O8ZA 3I52A 1LX6A 1EXMA 3K1YA 3GFQA 1KSFX 1TVCA 2XWBF 4C3VA 2X1LA 1MC1A 3N05A 2H2HA 2IYXA 1AQUA 2VL7A 3QXSA 3LM8A 4HXYA 4KACA 3WB1A 4MZDA 5MHTA 4PPQA 5B3KA 4NBNA 1Z25A 4XJXA 1M5UA 1L7EA 2J5RA 1P29A 3WV4A 3K15A 1I2CA 5H4GA 4A7PA 2XCUA 4R8SA 2BDUA 1EK0A 3Q5EA 4QULA 5BT9A 3I6ZA 1KY2A 3U9TA 1XZPA 3ZKWB 4QBGB 2AMFA 2VP0A 3NVDA 4IV0A 3WI7A 3JWIA 5B6PA 3QKWA 2JGNA 3VYTB 1Q0SA 1R16A 5L3RA 2IPNA 3ML1A 3QWBA 4BC0A 4DDVA 5IKPA 1A0OA 3HLYA 3IQFA 1BO6A 1QCDA 2HL6A 3DEZA 3E61A 3N6XA 1B4DA 3FOZA 2O20A 1ZOSA 3C3CA 4N7JA 4ZAGA 4AZ3B 3FLBA 4KIUA 4YGXB 4KE8A 3EIFA 3H6KA 1HYQA 4IIFA 1IBMB 3KBBA 3MFQA 2VK8A 2GYYA 5GTDA 1NHWA 1U63A 4NLLA 2BN4A 2PZMA 2Z5FA 4A26A 1U1FA 1O2DA 2B9EA 3HRIA 4XGIA 3HZRA 3SDSA 5LB2A 4C22A 2C9DA 3I1YA 4JD5A 4LVUA 5T8KC 1FVFA 1YOVA 3T7SA 2QMEA 1H6CA 4B7AA 4J0KA 4WA7A 1WAMA 3KE9A 5CCDA 4KFSA 1XZCA 3DDHA 1U5CA 3ZQ6A 8ATCA 2XZTA 3WLHA 3NDBB 5CA1B 3MS4A 1ZW6A 1BD3A 4MAAA 3CJRA 4CKBA 2PXAA 3OCZA 2JHPA 3NIWA 2VT3A 3TIGA 3LYUA 1QK3A 4UMDA 1C9MA 1XF1A 1IDN1 1RWMA 4TZ6A 3TUZC 1PS0A 3FWHA 4M8SA 1E0AA 2PTGA 3AR6A 1ZG3A 2G09A 4TTSA 2W6NA 1LPOA 3DYVA 1FUKA 4ENTA 1OFIA 2FP3A 1K4MA 4JXJA 121PA 1F9EA 2OY0A 3CXRA 6YASA 2FW9A 4OA8A 1B16A 3D6VA 3VMMA 3GDWA 3A32A 5HRUA 1BXGB 3IAXA 2FAXA 1NATA 2WA1A 1TAQA 1NXOA 4YPFA 5AVQA 1OAKA 2QY9A 1GFSA 3A8TA 3L0SA 3AG5A 4YRKA 2GVZC 4LMPA 16PKA 3P27A 4IJVA 3VR6D 5BMVF 1NX9A 1OXKB 1QFYA 2PPLA 3HCFA 2EP7A 4BKPA 3NAQA 2ZWIA 1U0OC 4C03A 4FHGA 4AJJA 3K0SA 4E2XA 3THXA 1Y1QA 1K97A 4C4OA 2V4MA 1CK4A 2YH2A 1YR7A 2PT6A 3AUKA 4XARA 1UFVA 2O2HA 4YCMA 4C7OB 3DAHA 1CUAA 3OE4A 1AKUA 1VJGA 4R2WA 2VNIA 4JIGA 4DR1B 1P0PA 1THZA 3T94A 4DR5B 1ZWLA 5D1NA 5AVTA 4BDSA 3QOWA 4BFTA 1C3VA 1VCHA 5EWLA 2O2CA 3M4XA 4X3CA 1EFVA 1E2HA 5ALPA 3COYA 5IBPA 5L4LA 3A6JA 3LW7A 5BNIA 5K4GA 1M2WA 4MI1A 5JT1A 1A97A 2OCLA 3HKBA 1NYTA 1OREA 5F7XA 2HJRA 2E55A 3C5WP 3MS2A 2UZ1B 3O2NA 3LQQA 4ZARA 4E5VA 2Y1GA 1JHMA 4I1RA 1SA0B 1U11A 1NNLA 2O7NA 2Q29A 2ZJFA 4JT8A 3WYCA 1PD1A 3VR3D 1RM5A 4M4SA 3F7NA 4ZKEA 3VFDA 4KQEA 3BRSA 1C8VB 4EG1A 1GPH1 3L7AA 2G7MC 3PXDA 1KYQA 2ZIXA 3AU8A 5EIBD 1YA6A 4IKOA 5LP6C 5TDHA 1OYYA 3VPGA 3PD7A 3IIKA 1UOEA 3M7IA 4OJKA 1XTKA 1T35A 1F48A 5DW3A 3KE8A 4HLUA 1OBHA 1WPQA 1YL6A 1Z6QA 2DLDA 3HSYA 4HGPA 3MTGA 5AI9A 5JNSA 3SX2A 2EJWA 1MX5A 3AP3A 4EGAA 3A6ZA 2GJKA 4N82A 1G8GA 2W8ZA 3WGMA 4R2IA 4WVFA 1QO7A 2F1RA 5CVTA 1FZTA 2G70A 3EGXB 1BXZA 2WF6A 4PSVA 4UHEA 4RAOA 3IPRA 4C78A 2D6FA 2VS1A 1JA0A 4OBEA 2JZCA 3BGWA 3ZIDA 2XB8A 5AI5A 2QUBA 4HQKA 4OXKA 4BFLA 3PX7A 4ZV7A 2YMQA 1I9CA 3LXUX 1QFZA 2VP6A 3TR6A 1JG3A 5JOQA 3MTIA 1EQAA 1GSOA 1NBOA 5IAEA 4N5DA 4DB2A 3A9UA 3OZGA 4RD0A 1NVGA 2Q6TA 2YJ6A 3DLIA 4HEQA 4DCCA 1CKEA 4DIBA 4PGMA 4FWTA 4W5RA 3O1HB 1X7XB 5CH8A 3JALB 3AEYA 3BX1A 4KXQA 5ICGA 1PNVA 4JBWA 4UVEA 5TEWA 2GZAA 3LRPA 4C06A 4YXWD 1EDBA 1N5OX 2GLXA 2HQBA 4KRGA 4F45A 2ODBA 1Y3AA 5KOYA 1JDNA 1NVUQ 2HM7A 2ZDGA 1EX1A 2H7CA 1LBIA 2GK4A 5AVVA 3B6JA 1WM1A 1J0EA 1FSZA 4YJKA 1IJFA 1HKUA 3LUPA 1H85A 5ELMA 3F73A 1D4FA 3ISVA 3O8DA 2HJHA 1XNGA 2CXOA 4OLBA 2XQIA 1FTQA 3NYQA 4HX9A 2O48X 4TXMA 3S2ZA 1N9ZA 4EY5A 3B48A 1G8HA 4BUZA 3FTFA 5FTKA 3B5JA 3HFGA 4G9GA 4XJVA 1EE2A 1X80B 2MYTA 3QVJA 4FNOA 4DNQA 3KEFA 1Y8ZA 2HQRA 2ZIAA 3FXAA 4KRXA 4ENPA 5CA1F 3VR6A 3OFKA 2BBOA 3MVEA 1KOGA 3FPKA 2EP8A 3Q2IA 3ENZA 3RIXA 4AJPA 1A7UA 2ZR0A 4FQ8A 3GLKA 4N5MA 2DFLA 3W34A 4NE2A 1OBCA 4J07A 4TRRA 3L1VA 4RIEA 1ZM4A 1G3UA 1WOYA 4BKRA 5BR4A 5K03A 1XVUA 1F9AA 2WU0A 2YJGA 1CE8B 3PHCA 4KGZA 2CK3D 3FBGA 1K75A 1KBQA 3BH0A 2JIBA 5ELXA 1ZD4A 3FF1A 1EUDB 2AMYA 2A9RA 3BE4A 4CG0A 4DJJA 3R6TA 4LF7B 4BYGA 4F5WA 2DHDA 4AG3A 3AVOA 1SBZA 1OLUA 2FPUA 2BR5A 1NG1A 4LXGA 4A6XA 1D09A 4KXNA 3PPXA 4RELA 2Z9CA 5GPBA 4IO1A 1RRPA 3L7BA 1HNZB 1NFRA 1EFKA 1ZGAA 2PY6A 3OZRA 3PRHA 4PZPA 2SHKA 4WASA 5ERXA 3VH1A 5DYTA 1MAWA 2ZSAA 3VTZA 3VR3A 2EW2A 5DHTA 1LI7A 4PNEA 3QVKA 2PD3A 4W9NC 4Z2YA 3LUHA 5ARDA 3W7BA 2I9KA 2ZE5A 1NXWA 4AKIA 2JEOA 3O3MB 3OQIA 3DV9A 4O2BA 4Z99A 1F0PA 1QJCA 3F3KA 4GBJA 4IH4A 2R4UA 4D9KA 2C0PA 1DBRA 2QRGA 4D9HA 1H4SA 3GXOA 4FS8A 5K8JB 5AXAA 4KH0A 2QSUA 5DW0A 4ZAVA 4NRDA 5EUCA 2XE8A 1PWHA 2H06A 2R1VB 1L8XA 1SZJG 3E3MA 2C57A 3OQPA 2WYWA 2IPAB 3QUBA 3E2IA 1IOVA 4LXQA 2JGIA 3TEFA 5KB3A 3L0ZA 2IV7A 5B6JA 5H9VA 221PA 3T99A 5GQSA 2FPMA 3OEED 3AIIA 4IJWA 3LX5A 5DNAA 4C0JA 5I4KA 3ZJTA 2QD3A 1KP3A 1RWPA 5I4CA 3U4QB 2PU5A 3B5EA 1BWSA 1J6UA 1TPZA 4MO2A 5LQDA 3SLRA 3QP9A 3CA8A 3EXAA 4RK1A 4AJIA 3TNLA 1NKTA 3T3GA 2G77B 5ADWA 2G9QA 4EB8A 3CRQA 2FXIA 3E03A 1ODTC 2GA9A 5ILGA 3EZ6A 3TZKA 4DLKA 4DVGA 5I8PA 5FNZA 1BQ4A 1XZIA 4MVWA 1K68A 4AN1A 1YCFA 3ONDA 4YXWA 4FUTA 4EABA 4JYCA 2OCAA 2AB0A 2Q1WA 4BJ3A 2X2OA 4OKSA 3S5UA 4D80A 2AH5A 3TVTA 4IJ6A 2JHGA 4M55A 2WM3A 3WIUA 1LCIA 2ZWMA 2XCRB 2NP7A 5BOSB 2BMVA 1FNCA 2OHHA 4G0QA 1IJBA 3ASYA 5CR9A 3SZLA 3VOSA 3H9QA 1TT5B 1A8QA 2OCPA 3K92A 4YMVA 2FH5B 3I6IA 1Z4LA 2WMYA 4QATA 2BGMA 3SKYA 4XB2A 2DJ5A 2A1TR 4ZAWA 3WLMA 1ZM7A 4YJFB 2R7NA 4N54A 4M1MA 1LFAA 4F93B 4Q12A 1RQPA 1NM5A 4DLPA 4CEIB 4N3CA 1GAXA 2CVHA 3STTA 3WHIA 1KRXA 4JLDA 2AFHE 3FLMA 1QHFA 2EWWA 3K1AA 1LI4A 2IDKA 3KSZO 1MPXA 1CEYA 1IIBA 4C7XA 4J3FA 4M9UA 2WAOA 2E1PA 3EUWA 4YCAA 5DWVA 2CK3A 3PWZA 1PHRA 3K9HA 4EVQA 1ZQ9A 1FRQA 1A7KA 1R9JA 2XXBA 4YCNA 4D26A 2J4DA 1QYWA 2QA5A 2BCGY 4B6PA 5TMEA 1OI3A 3NVKI 1SCUB 3H1PA 3BA1A 1P4AA 2AV6A 2R7MA 1UMBB 2YWDA 3G79A 4IDDA 1CUVA 3H6HA 1TM7E 2JLBA 1PJSA 5AM5A 5A4FS 4K81B 3AERB 1GZHB 3KEQA 1E6KA 3NWEA 4W5QA 2C94A 5AYVA 5SICE 3P94A 4EJSC 3IVCA 3G9TA 4D43A 4BQPA 2QUZA 3HDQA 5ADHA 3MD9A 2C9YA 3KS9A 1V95A 3D4LA 1PE0A 3ESAA 1SN7A 2DWPA 3ZCXA 4OREX 3GLGA 2W5UA 3QIVA 3H8JA 4L6AA 4PV7A 3MT8A 2ISQA 4Y1EA 4BNDA 3O4IA 4PLGA 3SMVA 4UMVA 4M83A 5EJEA 3M2PA 1RWNA 4ER5A 1VRWA 1XU9A 1O08A 1FXWF 5AHWA 3TQSA 3C15C 2JIPA 2ZKIA 2J30A 4OQLA 2I4TA 4DBLC 2H18A 2WAMA 3R9XA 1O9HA 4YRMA 5HS4A 2ZVJA 3K96A 3UMCA 3AQ4A 1NW8A 3BGSA 4HTAA 4MITA 5EG5A 3B36A 4LV8B 4A3SA 3OM1A 4M2LA 4TX1A 3PQ5A 1FMTA 2RI1A 2GNAA 3G3EA 3SJUA 1PGNA 1YS6A 3OEEA 4Y0NA 4ARCA 4AZWA 4V2IA 2IOHA 3G8AA 2Q9AA 3IO3A 1BD4A 4CTNA 3OF2A 2OAQ1 2XUKA 3MGKA 3NNSA 2J0UA 4EECA 1P9WA 5LD2C 1FF9A 4JUAA 3U4GA 3AM1A 2C4HA 4I3GA 2JFXA 5TF0A 3SEQA 1XZFA 3DLTA 1NQAO 4IMJB 1Y48E 2OCDA 4M0PA 3ZHZA 2VDWA 4BFYA 1YBMA 2P0EA 2C3OA 5KYXB 3WA7A 3W77A 3QUSA 3HCCA 1GR0A 2NV6A 5K0CA 1G3QA 4G1MB 1YJXA 4RK0A 3SR3A 1PGJA 1CEEA 1FSGA 5JLJA 2V9PA 3GZTB 2OD2A 3GFSA 1ADBA 3IQEA 1O5TA 4NAUA 3PFKA 1N5MA 4NMLA 5AVJA 3EFEA 4FHEA 5I7AA 2J6BA 2IHUA 3ZHCA 5KTPA 3HYRA 3NETA 1CCWA 4DV1B 4P3NA 1ZU4A 4CM8A 3CH6A 4IJUA 3TG2A 1YVPA 3D02A 1USWA 5K3AA 4E12A 3BJMA 2JBHA 3ZOZA 5F51A 1YHNA 3EVGA 1K0FA 1LJUA 3EH2A 1ONPA 4FXPA 4IJQA 3D6UA 3H11B 4HZIA 2YZKA 3PUKA 2ATCA 1P4SA 4YROA 4U9UA 3R76A 3FYHA 4DL9A 3CBQA 2ZULA 3TJMA 3E5RA 4ZGBA 5B1IA 3HP1A 3E53A 2Z2KA 1JYSA 1ZNXA 4PLVA 4J3JA 5EQFA 1U94A 3WDMA 1S2DA 2KBFA 3VMFA 5CLLA 2IIPA 2C2MA 3GOQA 4QDUA 2G9UA 3E9ZA 2WD7A 3GFGA 3IPXA 3QV2A 4QUKA 1Q0PA 3EMDA 1KFCB 1T4CB 2ZB3A 3JQAB 1YUMA 5KJ1A 1PR3A 3W2IA 3HCWA 2NO6A 1T5LA 4DUPA 1YR2A 2BIFA 5FUMA 5JMTA 3E7FA 4RIHA 5LP6F 1LFDB 2R6GA 3SWWA 3C70A 2QRVB 2Q4DA 1N3YA 4MVJM 3LVRE 4MINA 4OH1A 2J9RA 4E2ZA 4G0OA 4RQBA 2BHRA 1VP3A 2E0IA 1V16B 3HWX1 5LQUA 3AHFA 1E5XA 1GYRA 1K86A 2ONYA 3DR3A 3PC2A 4IV8A 4RM2A 3ZW8A 1SUSA 2ZG6A 3QQPA 4JBNA 5F21A 4FINA 5HA5A 1E2LA 2C8LA 3NOQA 3HDTA 1NQVA 1TTQB 1UXOA 2Z2JA 2DEUA 4QVKA 1PJZA 1XRLA 3DV2A 1JB1A 1MABA 2ZWAA 4Z7OB 1TKAA 4FK8A 1W48A 1UZNA 2CHEA 2DWUA 4NOMA 5DHFA 5AQ1A 3GRPA 3H4MA 5ECGC 2F43A 3BXHA 4LY6A 3VAAA 3VPDA 4AROA 4ENQA 3Q8MA 4IDPA 5C35A 2W6OA 1Y9AA 1J70A 2Z2YA 1XVTA 3MLBA 1M67A 2I6SA 2ZI3A 2CJXA 4LE1A 4CIXA 5BSGA 1SBTA 1ZXXA 4B80A 1N6OA 3K8ZA 2ACWA 3VNUA 1NJFA 1HL7A 3ZDRA 3HM9A 3L0BA 4OHCA 4H7PA 1WZNA 4AP5A 3LOPA 1CLEA 4HRYA 2A9QA 2FPPB 2OZPA 2V5VA 1XN1A 1UJ4A 1C8KA 3L0OA 1Y9JA 3A4TA 4DRXB 5JSYA 3DFMA 4U3JA 3IDZA 3MBOA 7MDHA 5DFAA 3BWYA 3JS5A 1UK8A 1ZINA 1C9DB 1X1BA 4P58A 2NUAB 4AMGA 4ENVA 3JU3A 1JJIA 2QTAA 5JPIA 1UPAA 7ADHA 4FBLA 1GQQA 4JMLA 3GLIA 2A1IA 3CKYA 5EZ6B 3UOAB 3O91A 1NNUA 3MUFA 2IUUA 3MTAA 4E11A 4ECEA 2D5IA 3W04A 4QG7A 1Z0FA 4TYYA 4C4TA 1QGZA 4K6CA 4UBMA 5FPQA 2PD6A 2C7GA 2Y93A 4HDRA 9LDBA 5M3BA 2JJQA 3WNBA 1RZVA 2ARKA 1MB3A 1VJ5A 2OO7A 3QUQA 4NU5A 4I81A 4P34A 3I04M 1YZLA 2NVWA 1RZRD 2XB9A 3A1DA 4RE6A 4WESB 4BASA 2IYYA 4LIPD 3GT7A 4KFUA 1P5RA 2N0SA 3Q8WA 1O96A 5TPWA 1LY1A 2OZLA 5BQPA 1KKMA 2PE5A 2Q6IA 2PLFA 3LCCA 1DG9A 3C74A 2VDRB 3Q98A 3G8YA 1PFVA 1XQ6A 5FO1A 1O6CA 2Q7DA 5C18A 3OTQA 3DKPA 4KR9A 3RRNA 7REQA 1QRTA 4F4FA 2AC4A 2D1TA 5B2EA 4EPTA 4AZVA 3KLPX 1EK6A 1YFZA 2W58A 3G2JA 1AV7A 2FW8A 3DAPA 1JIIA 3UMSA 4EEXA 621PA 3KQKA 2GPNA 4NYIQ 1CC1S 2EFJA 3UUWA 1LUAA 3GDOA 2WM8A 5B30A 3TMAA 4HPJB 3HXKA 2HWKA 2P1RA 1ZHOA 3ICEA 3LQKA 4C43A 4OHKA 1E5QA 2AOUB 1XTZA 3G0BA 3OHPA 5LYJB 3DVAB 1JSZA 3IOBA 5B2ZA 2YXPX 5AR1A 1YFJA 3JYLA 4JOBA 4Y67A 5I9TA 1DKNA 3QM1A 3O8NA 4Q3NA 1KJWA 1ZZEA 3DP7A 5FR1A 2DTXA 2FWRA 1IEXA 2ZIUB 2V7EA 3QMMA 1UEXC 3HADA 2O19A 1NVXQ 2P5YA 1N9GA 1FPMA 4ZN6A 3FZNA 2VCHA 5BR7A 2IGBA 3DYIA 5KSWB 2OCGA 1JLLB 3T5MA 5DLQC 1DKLA 3BJZA 3L4KA 1K7XB 4P3YA 3WYNA 3RIMA 2Q5HA 3X1JA 1MU0A 3KKLA 3WWDA 2YFQA 1SHUX 1XZHA 3D7KA 3UMMA 3KU1A 3DOHA 3EIXA 4JXKA 1EX9A 3WE7A 2QL9A 5CW1A 2O2IA 1WV1A 2ZWPA 1SIBE 4CCWA 1SXQA 4BY9E 5WRFA 2OO3A 4RV9A 3R8XA 4ER7A 3IDSA 4WOCA 3Q5DA 1NBWB 4NFYA 1D4AA 4E5MA 3R0IA 4MUJA 2JLZA 1A5SB 1JR4A 3G2QA 1MC4A 3LGSA 2WT4A 3SC2A 5FEUA 1VKZA 2C5HA 3DNFA 1WXGA 4S1TA 5H3CA 4BU1A 3VKUA 1PS8A 4FDTA 2PL1A 1V47A 4OJYA 3ZNQA 1T36B 2PZEA 2YXLA 3F9RA 4Z2AA 3F6SA 4B31A 1R5OA 2C00A 1RWKA 5BY2A 2IXBA 5CHYA 3FWKA 5KYGA 1DLIA 3MK31 4HDMB 4NWIA 3EZYA 1WZCA 2I6GA 3KQOA 3W6OA 1QIFA 5LLDA 1RQ7A 1QQBA 4D5GA 4UHHA 5H1YA 3IE2A 3D5QA 4ROTA 5BO5A 1EFLA 2M1XA 3JQ9C 3RG2A 4DN6A 4BO6A 3GJ3A 3IP5A 3LMKA 4CI9A 5ERYA 3U3JA 1E0DA 4FNGA 1XQWA 1XKQA 1A71A 4G3XA 2WIGA 3MWEA 4LXIA 3WKDA 5A03A 4F6RA 3LI2A 4WL0A 2HAEA 1RZRA 3JVDA 4IWXA 1U8CB 5GIOE 2XB6A 5AW3A 4YR7A 3CF2A 2BFOA 1N2CB 3E9MA 3TEMA 4ZHQA 2JG3A 2XA9A 1X8KA 1LRJA 4DQUA 4P9NA 3QBEA 5K6AA 1OWLA 3MM4A 5KCZA 4MV7A 2PRSA 1N5LA 4BE7B 2WIJA 2HA0A 3C0KA 3X1WA 2D5AA 1NA5A 3CB2A 2PPVA 3UF0A 5ARCA 5K9ZA 4LDAA 2IP2A 1F5NA 3P1JA 2FR8A 2P6PA 4ZQEA 3B9BA 4B7ZA 4BEVA 4JLMA 4MCJA 1SBHA 4YJHB 4KIWA 1ADGA 1AGXA 1F2TB 1WZ2A 5IZCA 3QXXA 4J0HA 3MF4A 1KAHA 3OCVA 4RVSA 5AW4A 2QIPA 3BSSA 4MUIA 2B36A 4I9NA 3U3KA 2VT2A 3VTAA 1OX4A 1C29B 1SVOA 2G71A 2FPGB 4IS2A 1N57A 2J6HA 1JKJA 2CNKA 4U2GA 1TRKA 4R41A 4L28A 3BA6A 4PC1A 5U4QA 4JHXA 1PNQA 3JTMA 1IN6A 5LP6B 3WOHA 2WD8A 1DLJA 1U8EA 4EH1A 3JQ7B 3ZV6A 4EATA 1Z15A 1ZNYA 5CW2A 3QSGA 2JJ2D 1XQXA 4CRWB 4CUKA 2QHXA 4YQYA 5LPNA 3JD4A 5CNJA 3TFWA 1UXKA 1S2MA 4LN1A 3DFIA 1OE0A 1PEKE 1T3ZA 3COSA 2WM2A 3X1YA 3V1MA 3TG8A 2HA4A 1SGWA 3GLSA 3LUBA 1JXOA 1ML4A 4IQ4A 3SDZA 2XBMA 1Z75A 4UUQA 3B3JA 3SBOA 1OWPA 2ZRIA 3L18A 1KEPA 1XVIA 3NR2A 1ZJ4A 4HYQA 4WOJA 5LZ8A 3S2UA 2BKAA 3DXYA 5U9CA 3NPAA 4P81A 4J75A 4NDNE 1UQUA 4JT9A 5HZHA 1JEYA 3W8NA 3LXXA 4BO8A 5LYJF 2Z1DA 4PX2A 2RHRA 3B1YA 3TAXA 1VDMA 2J9FB 3UWDA 2IF0A 1T3LA 3BMCB 3MAGA 3C6YA 1Y7TA 3OG9A 1XZQA 4S0XA 3SF8A 5T7BA 4GYYA 4LRWA 3A31A 4ZVKA 1D1SA 5BNFA 4PWYA 1Q1AA 2PSHA 5ALMA 4F71A 2NXWA 1Q1BA 2FOLA 3BRQA 2PUEA 2Q4RA 3WYFA 4P5DA 4I50B 4NMWA 1QVRA 4UHKA 1T2DA 1V5EA 4OL9A 1YRHA 3KAKA 1QIJA 4EKIA 2ZJOA 4D57A 1USUA 4AO7A 1JR6A 1M74A 1YAJA 2OILA 3I58A 3IC5A 1Z2AA 3NWBA 4Z1MD 2NAPA 4PPYA 2JZNA 4XD7D 1LPBB 1AGPA 2D0PB 2FPKA 2PFGA 2W4MA 3NEAA 3WGVA 5AO9A 4C3UA 4BC1A 1EZZA 1HDCA 1BXRA 5CD1A 2X0RA 5FJIA 4B3MB 3K0FB 3OZWA 1E3IA 13PKA 1XCPA 1C8LA 4M38A 3FUCA 5EZSA 2EEZA 1TM5E 3HJAA 1ZD3A 1T8TA 2P6RA 2JGEA 2YTZA 2WKPA 2QD1A 2WHQA 1PO7A 3EQ8A 3S7TA 2HEGA 1WQ1R 3BJIC 4P0PB 3QG5A 5DI9A 3IV9A 2WHRA 3KJXA 3KWMA 3R3XA 4IUBS 4Y98A 2MMCA 3WIEA 5BSFA 4RFSB 1COZA 4JFRA 2WZDA 4KXLA 3RYHA 3EZGA 4S3MA 1QGUB 4ERNA 3SXUA 4LVNA 5LN1A 2Z4TA 3SQMA 2FFRA 4HJXA 1C81A 2OVFA 2WMOB 4AP6A 2YX1A 4U0JA 4QA9A 2XGGA 5IYZA 3CYFA 4RU1A 4OHBA 1FX1A 1ZUWA 2H29A 2P77A 1U9YA 4URUR 1UDBA 3IP1A 3UK7A 2HHHB 3ONWA 5AK0A 1ZUNB 2BKEA 5JZMA 4MS1A 2YZ7A 3X43A 1UAGA 4D46A 3G9ZA 1DKOA 3TL3A 3TOZA 1BZYA 4D4LA 5BUZA 2WJWA 1B26A 1QYVA 3G2KA 3M4JA 1NBHA 3JPYA 1M6HA 1MFZA 3CRW1 1E3TA 3RG8A 2Q5CA 3VR4A 1K27A 4C6SA 1VE3A 1VXRA 1CZKA 3AF3A 1BE8A 1NWCA 4RK5A 4ND5A 4W5WA 3NBFA 4TKLA 4RL6A 4QDKA 2HLDA 3MS7A 1DBPA 4MJLA 5BWLA 1QVAA 4YT5A 3QYJA 1ABBA 1YJQA 1AURA 5JVDA 3WHLA 3GGOA 3ZU2A 2Y0DA 1I6MA 1LDGA 3UHOA 4OX9B 3DBOB 5EMKA 2JLAA 2RGEA 2YWFA 4GP6A 4QUHA 1PTKA 2JJ2A 2PLRA 2HOQA 2V7QD 2WT9A 2P8SA 3AP2A 3F5DA 1DX9A 4B3CA 5BWCA 1IJEA 2ZT8A 3WNVA 4BNHA 4XD2A 4A36A 1EZ1A 1XQ9A 4R81A 1AGNA 1EUCA 3D54D 2QX7A 1PYOA 2I3GA 3NOXA 4IKEA 3U7JA 5L3QB 2F55A 4E2WA 1CQWA 2B1JA 2GEJA 2H0RA 3OURA 3PNQA 2G67A 5A3SA 3S68A 4U39A 3CCCA 4MPDA 1ZJ6A 4UTVA 1IZZA 1QWOA 1NTOA 1I4EB 1Q7CA 3GA5A 5BR8B 5FI0B 4LXXA 3OF5A 2I34A 3K0CA 4D6PA 2QTFA 5K8VA 3HWRA 3O9VA 1ZP6A 4HY3A 2RB4A 3ABIA 1OUMA 2ATEA 2ZEJA 4OXXA 5F5NA 3AEQB 1T1GA 4QYWA 4QLAA 5FYQA 5HQJA 2DQKA 5TS3A 3FKSD 1U8FO 3ACBA 4MRMB 1VPWA 2XI4A 3SY8A 4YEDA 4B6RA 4A4DA 2D0DA 3VO9A 4FKBA 4PYKA 4Q6WA 1FFXA 2REOA 3WP0A 1TF5A 4UHJA 5B1HA 5AW6A 3JYOA 1P6UA 3IR5A 2PRZA 3WLPA 5IUNC 2YXBA 3L0CA 3WIBA 3TCNA 4Z1MA 4XD7A 2GEDA 2OCKA 3KJQA 3U7IA 3VA7A 1OKKD 2EGHA 4XWKA 3BWEA 4G01B 1ZL2A 4J43A 3AUSA 3T0FA 1YU9A 4MW0A 4EKDA 4BFWA 1DAPA 3M33A 3IAHA 1ADYA 5FV7A 5KYUB 3TTWA 1EM8A 2K5UA 1JTFA 1CQJB 1WSBA 3RD5A 2D8MA 3QOYA 3RYTC 2I91A 2VAVA 4I50F 1WJGA 1UXGA 2WAXA 1QYCA 4PZUA 4ZT4A 4KFCA 2BSAA 3E82A 1JHUA 2W00A 3MWDB 4O0LA 4X60A 5IDVA 3RVRA 4EB6B 2CFTA 2GEVA 3BK7A 1RE0A 1KQPA 1GA6A 1UAYA 1U2SA 5FHQA 2D5LA 1IMJA 1SRQA 1QBKC 4F9EA 1DKQA 1EBBA 1FRVA 2IVZA 4REQB 3SJ7A 3LSTA 1RP1A 1KI3A 1L3BA 2PKQP 1XZ8A 2PLAA 3CW2A 1EE9A 5IWAB 4FDMA 1MOQA 3IDQA 4MQFB 1R6XA 3AR9A 4E15A 3U1BA 1JAHA 3HYCA 3AFIA 4H9GA 5CT4A 5B37A 1I1OA 2GZRA 3TIXB 3FTCA 1QOZA 5FLEX 2OESA 2WICA 3ESZA 1K4YA 1ZY2A 1WCIA 3WSWA 3FBTA 2Y1KA 1VI6A 2C2KA 2PQ2A 1DPGA 3EVDA 3HB1A 4M87A 4PSUA 1Y6FA 4AS1A 4UPEA 2O8EB 3NI2A 3RLFA 5TS2A 3Q7RA 1EA5A 3I2HA 2IHZA 4MDYA 4R4JA 2IU6A 1AQIA 2PJDA 3WKEA 3SQNA 4ND8A 1Z88A 2IOYA 1DRVA 2WTBA 4MCIA 2C2HA 2ZU6A 1PHPA 4EJSB 2AFIA 4IXTA 3AB7A 3ZQJA 3HL4A 2HXYA 3KKQA 4GW3A 1J09A 1KMHA 2JAWA 3IBSA 3KPUA 3N8IA 3GNLA 4RO0A 1AKQA 1E0KA 1W8DA 2AG1A 2ZTLA 1GKKA 3E5NA 2OCXA 1XK7A 2V4ZA 2QL5A 1DVRA 4RV5A 3V4FA 2V7QA 2V7WA 1UK9A 2JFZA 1UZAA 1B1CA 3LRTA 1MGOA 2M1ZA 4M9XA 2D1YA 3KSMA 1U0FA 2O2SA 1E1DA 3NGLA 3NYRA 5AP9A 1ML3A 2PBZA 1D07A 4UPVA 3ZDEA 1GZDA 4IOLA 1UH5A 4Y6SA 4IVPA 1TM2A 4MI6A 5JADA 1VE6A 2ZUDA 5E0KB 1GITA 4PQRA 3U26A 4HUJA 3GH3A 2RAUA 5HJ5A 2W2QA 2PIDA 3OMWA 4Q1DA 4RPIA 2BSXA 4H1UA 2VQDA 2VSOA 1Z0SA 2CWWA 3NV9A 3OWHA 4QJ4A 2BEWB 4QTXA 5JBQA 4KFRA 2RGNC 1MW8X 3MWYW 3G0GA 3PPVA 4MI9A 4OQFA 3YASA 4V02A 1FDTA 3LT4A 5LD2B 4A03A 1BW9A 3FKSA 1J8FA 1MO2A 2OAGA 4LYEA 1BMQA 1XMJA 4YMIA 1BEZA 4V0MA 2PXXA 1LTKA 3E35A 3JCZA 4X1YB 3T5CA 821PA 1SG0A 1NNEA 3IEIA 1B74A 5BSKA 3FCOA 4J3NA 4LYDA 3UICA 3ZPXA 1YQWA 4KDFA 3PA6A 3IUNA 2LCQA 2HR1A 3MJRA 3OFSA 3S1LA 3HDVA 3KHUA 4DTCA 2YYYA 4XDHA 3H5OA 2GXSA 3DVLA 4G5OA 4HEJA 4QAJA 4WBXC 5C31A 1IHXA 3RIGA 3LDHA 1NG9A 1OKKA 1T0HB 1WB4A 1DI0A 1RRKA 2O0KA 2N9UA 3D7SA 4LJYA 1II0A 3GN1A 1X19A 5E1BA 1WB6A 3NH6A 4K0RA 1P2TA 1VI5A 1XZLA 5TEVA 2HCFA 1MTZA 5IEJA 2FX5A 4EA7A 4BPRA 1KY3A 4E3WA 3V9PA 1P0CA 3HA3A 1NVVQ 4EBBA 1E3DA 5A3JA 3TE7A 1E1NA 4OQNA 3M4ZA 4GYJA 3X1KA 1STOA 1FXUA 3IE0A 1E1YA 1QHNA 5EJ8A 1HOXA 4WCFC 1VJTA 1V8FA 4ZRMA 1G7TA 2PYIA 1Z7EA 2EYUA 2H5EA 3W4IA 3RWOA 4ND3A 1JHOA 2J3EA 4QQNA 1T2VA 1KJ8A 4KB5A 2XJ4A 2IOFA 3PVCA 4G0PA 1YULA 3D4PA 4IGAA 4OJQA 1LF5A 4PGAA 5AXDA 2QX6A 4BVGA 4AJEA 5KC9A 4EYGA 1GPAA 5K20A 1A5BB 1CHDA 3PENA 4UUPA 3ON5A 3T4UA 1SVWA 3ABSB 3FUXA 3TNFA 4AG5A 5JSZB 1BAPA 5L3VA 3ZCUA 1BKYA 3F6PA 5EI5A 3TPFA 4ZZ2A 3D7RA 3I05A 4ZWNA 5HNKA 1UM9B 2FSVA 2H4WA 1C7JA 2JVKA 3B52X 3EGDB 3IT3A 2J4FA 3KOUA 3M3DA 4B34A 1RQLA 1DELA 1UDXA 1UT5A 2JKVA 3C7DB 4NE7A 4YRQA 1EWQA 3IESA 1R6UA 1OB2A 2HIHA 3PHJA 1KI6B 1JAYA 3KYCA 4K46A 3RUAA 4QSMA 2VJNA 2EKZA 4KXWA 4BO3A 3KWJA 1DUSA 3CZQA 5DI3A 1ECJA 2GHTA 3QU5A 1RAHA 3VO2A 3IURA 5L45A 2GRJA 4YUZA 3QVGA 5H59A 1R74A 1OIWA 1T8YA 4CKCA 2JRLA 4F96A 3EXG2 3GLIE 1IB0A 1G19A 1JJAA 4MPJA 1UBEA 3HCEA 5ENZA 3LIPA 5G3ZA 5B7GA 2O57A 3FGZA 5KNCH 4YRIA 4GWKA 3JAKB 4BZWA 1BCRA 3VUFA 3H87A 5IW8A 5C53B 2VNSA 5JATA 4FFPA 2HJGA 3EULA 4F9FA 3DE4X 1R8XA 5EHNA 1KZ6A 3PCRB 1U7OA 2L82A 3H1GA 1Z83A 4Z0HO 4ISBA 4Y7DA 2GOYA 4JH0A 1K89A 4YRBA 5JZSA 1A27A 3ZN2A 2DSTA 3IAS1 3S8MA 1O58A 4DG5A 4QUGA 2ZBEA 5T5QA 1HE2A 2E87A 3QE4A 4OCZA 3E23A 4PYLA 4E4YA 2BGTA 2NU9A 4Z8XA 3UQYS 5HYVA 2XXAA 3QX7A 1KEUA 4JBHA 4MWBA 1C30A 1Y5RA 3COZA 3V7FA 3VBEA 1CJTC 1ZN8A 4FYPA 4KR3A 1U7HA 1IOWA 3ZW9A 2XTAA 1XTPA 3LPCA 1N2HA 1L4HA 2COUA 3ZK7A 1B8OA 1D04A 1SU7A 2QB5A 4HGYA 4NI5A 1OVGA 1XAHA 1X1RA 3QI7A 3BXZA 4OEHA 2DQYA 1URPA 1S1CA 1VGQA 2OO5A 1IFXA 2VDUE 4JX8A 4XA8A 3WB9A 3EW7A 2V74B 4NDZA 1YHYA 3BFXA 5AM1A 1BHO1 1KDYA 1JHZA 1KI9A 2OAEA 2RHOA 3ZKWA 3MOIA 1MAVA 1U8ZA 1NF3A 2YASA 2VUUA 2X8LA 3LVQE 4IYRA 4TL7A 2EX0A 4DNOA 4DYDA 2B8NA 5KKNB 1JHQA 2AW3A 1OIVA 2XOKD 1B73A 3VJRA 1JA9A 1PFWA 5TQ0A 3KCQA 4NJEB 4V3BA 4MW1A 3QU7A 5TPZD 2OGSA 2P1DA 3P0EA 1W0KD 4R6XA 2PV7A 3VVCA 1EP1B 2YHUA 3TN7A 5JROA 2GI4A 2GN0A 5BSWA 4OIFA 3RVDA 1JHDA 5LIPA 1THMA 3TLGB 1J1UA 5BNTA 1YIAA 4L76A 1DMSA 1PQYA 2W48A 2W42A 3EVAA 1BCSB 3A1FA 1JA1A 2JFQA 2ODTX 2WRZA 3I30X 3KVRA 2H1VA 1QNLA 5I9MA 2EFHB 3TINA 4KPGA 4FBGA 2UYQA 3LLMA 1K5HA 1RHQA 1Z38A 3O94A 2X0DA 2MHCA 4NH0A 2FSIA 2H2IA 4W99A 1P2UA 1BWQA 5CEEA 4Q1BA 1OLOA 2Q50A 5E2AA 2CCKA 5C7OO 4FB4A 5CA1A 1M6NA 4KDEA 1U8XX 3DEFA 4WKGA 2Q3DA 3FZGA 3UV3A 3H5IA 2YBEA 1JBKA 4M76B 1H3NA 1WX1A 4ALIA 5L7TA 1T15A 2ODWA 2AT1A 3KP1A 4YRGA 3QSYA 4ZO9A 5DGTA 1BVUA 3O2JA 1J25A 3QEBZ 3EQ6A 4C0AC 2C96A 4ZRDA 3EGWA 5FLXA 3CLTC 5JFOA 4YMHA 1E2MA 1KFBB 1CDDA 2H59A 3R0JA 4IDEA 4INJA 2IX9A 4OJTA 4S1PA 3C8DA 4IOMA 3RU9A 4DZRA 2D5CA 1VL2A 2V6IA 4J03A 2A59A 1F8XA 3T9AA 1BXGA 2BZGA 3OZAA 4DDUA 3GFTA 3EEYA 2GLTA 2YHIB 3RARA 1XDUA 1LZKA 3T95A 4GS5A 4DWJA 4OO3A 4TRMA 4AWBA 3CB4A 3NYWA 2HSJA 2A33A 5JH7B 1NVEA 2FUNB 5CDHA 3PLNA 2UZ4A 3LECA 3FB4A 4RDCA 1FFCA 5K3FB 3TM5A 4WK2B 4EYKA 2Q07A 2BUAA 1YS2X 3ED5A 4LPKA 1I6WA 3UV7A 5G53C 1DOZA 3UAWA 5DCYA 4C7OA 2W2NA 4L5YA 3EWAA 3UXMA 3WLTA 1VMIA 1LC0A 2J59A 1YTUA 2AZTA 3RUPA 4BN0A 4Z9AA 2FSGA 1MBZA 3EOZA 3CN9A 2XUDA 3FCXA 3KJNA 1E3LA 3GCXA 5MFPA 2XTNA 2ACKA 4HDSB 4KUEA 4A2CA 4ADSG 1EUZA 1GZVA 2WVHA 3QVWA 2H57A 4B71A 4ESVA 2QBYB 1Z08A 5HGJA 2IK8A 4RD3A 4UTZA 2B6NA 4B44A 1IONA 2ZT6A 3R6WA 2XNJA 3UMRA 3NNDA 2UZ1A 1QLHA 1I1NA 1QRDA 1NVWQ 1Z8FA 2EKLA 3DZ8A 1DTEA 1ZMOA 4M0MA 1SA0A 5FUXA 5K09A 4FFWA 2FSUA 2OBNA 2QRMA 3RFUA 5TR9A 1SCJA 1G16A 5H0IA 4K6KA 2G1KA 4XUDA 1SY7A 3R41A 1QF6A 4FD2A 4KC0A 1E2PA 1R9NA 2PWBA 4AUKA 2IPLA 4K40A 2GH1A 4L73A 5I7UA 1GA1A 2IUTA 1GGJA 1AO0A 2ZB7A 1YH3A 3GEHA 1C0PA 1M8FA 4Y2TA 2ZFUA 4MKZA 1Q5PA 2XQGA 3PYMA 1W76A 4D96A 4CMEA 3WZLA 1TVEA 4L8GA 3HUDA 1NQTA 1MOPA 4GBGA 3STHA 4CQMB 4XVUA 3LO8A 1T3HA 3P9NA 2KB0A 3VOTA 3H4VA 3ZCSA 2VPXA 4DNFA 7AT1A 4LRTB 4UOZA 5CG2A 3G1TA 3MMZA 2XOKA 3Q7PA 1UQTA 4QBKA 2Z43A 3EGXA 1VPVA 5TPZA 2NTYC 5KVSA 3F74A 1GQRA 3C3WA 3TZEA 1G8KA 2FW0A 1I30A 3BGDA 3R77A 4RY9A 3BIFA 3LY9A 2WY2D 3TKLA 3W3AD 2AOTB 3VNAA 1E18A 1PGOA 3RSOA 2GVNA 4OQDA 5AI6A 5GZ6A 2AEMA 1OBFO 1U04A 5AKIA 2Z95A 1G3MA 2AHOA 4HPWA 1M1YA 3M2TA 1CR4A 1RCUA 1X7XA 3CPSA 3HZHA 5DRYA 5ABPA 1WULS 4GXNA 4JJFA 4HWGA 1XALA 1XEXB 2YKGA 4DR4B 3MN1A 4WZZA 4KQCA 3PXGA 2WTEA 4MTLA 3WLNA 4J16A 1PKEA 4DCPA 4YDQA 1Q14A 2CVPA 2PGDA 3ZWQA 4RTJA 3AR5A 2CC2A 2INGX 3UAZA 1V6CA 3A4VA 3I6YA 1CG6A 1WUYA 3ESRA 4X44A 5ED4A 3COJA 2EHJA 3WGNA 3G5TA 2DB3A 4QXRA 1D2NA 1IN4A 4HRAA 4ALNA 4B3TB 5JG7A 1DBVO 1W8IA 1B8PA 5E7MA 4EFMA 4NYJR