2H18A

Structure of human adp-ribosylation factor-like 10b (arl10b)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
174
Chain Sequence
LVPRGSLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMINMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 8A
publication title Structure of human ADP-ribosylation factor-like 10B (ARL10B)
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 60
structure length 174
sequence length 179
ec nomenclature
pdb deposition date 2006-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h18A00
5JMTA 1O87A 4A8JB 3CRW1 4DRZA 1E1QA 1NRJB 2F3RA 1AA9A 2OM2A 2VYFA 5EE9A 4CF7A 2JDID 2W0MA 2ERYA 4YXWA 1OFTA 1Z6TA 5G41A 1OKKD 5E7MA 1VTKA 2WWHA 1MABB 2QTFA 4KXFB 2RHDA 3OIVA 4Q7KA 3M4YA 3QBVA 4GP6A 3FMPB 2GTPA 3OIWA 1U8AA 5HTKA 2WJHA 1E2KA 3MSXA 4TZ0A 1OXUA 1IY1A 2AN9A 1UBFA 1SVOA 4HI0E 1QDEA 3NBZC 1UBCA 1EGAA 3ZZUA 2J0QA 1GM5A 2FX3A 1DVRA 1JXOA 3NHAA 2ZTSA 4NBSA 3DMDA 3GJ7A 2QM8A 5FTMA 1NN1A 3H84A 3V9PA 4Y0AA 2FSFA 3WP0A 3ADDA 2NG1A 2QGNA 4A2WA 4I1UA 4YMWA 1HQYE 4JBXA 1KJYA 5KNBA 4DCSA 1G17A 4QJ4A 1TQDA 1DG1G 1N6OA 2O5VA 4Q4JA 4AYXA 2EFGA 2WTUA 1JR6A 2DWOA 2CLCX 2F3TA 4WVFA 4Q9IA 1CBUA 3KFXA 1Q20A 4ZCLA 3SE0A 4HZUA 3TLXA 4GFDA 4HUTA 1OT3A 2WAYA 1QRAA 1YZGA 4LJ6A 2ZAOA 4M1WA 2CLDX 2VSXA 5AJVB 3TUJC 2GJ9A 1XXHE 4US0R 1Q1BA 4GSYA 3SJBA 4ASUA 5GJCA 4B47A 1OH8A 1A7JA 2H7VA 4XD7D 3VKHA 4DCTA 5J40A 1RIFA 2BBOA 3ICQB 4Y0VA 3WHKA 1KO8A 2B8WA 4EJSC 1DAFA 4QRHA 2E9SA 5FTJA 1G3RA 2ZVQX 4Q9JA 3X1DA 2R6FA 1UFQA 1E9DA 4IVPA 2V7QD 3AVUA 4QFMA 2ANCA 1B0UA 3M1IA 2CXXA 1E69A 2AFIE 3A1WA 4GBMA 3BD9A 4V0KA 3MMPA 4GP7A 3MLEA 5DH9A 5FUXA 1EX7A 1P9WA 5D3MA 1J8MF 1TEVA 4JJZA 2WMNB 1XRJA 3IBYA 3T06B 3GLIE 2IYLD 3ZVMA 4CYMA 3SC3A 3QUSA 3SS8A 3LNCA 3E5HA 2WV9A 4D2IA 4KVAA 3I8SA 1VG0B 3Q5DA 4LHYA 4BPBA 2XTMA 2G6BA 4L8GA 1JEDA 4CEJA 4Q02A 3HYRA 5AUNB 2HT1A 3R9XA 3U5ZB 1P2SA 5FPTA 2KE5A 4P33A 1J7KA 4M1MA 4KSBA 1CJUC 2WAXA 3B8HA 4MRRA 3EXAA 1KO5A 2BV3A 1FMLA 1SKYE 1WQ1R 2FSHA 2WSMA 1ZM9A 2JIZA 4BRUA 1IOZA 4LBYA 5FOWA 5JBQA 1G6HA 5JRZA 1RJ9A 5K8UA 2YWEA 3K0CA 4EAQA 2ZJ2A 3NTUA 5M04A 4TTRA 1RC8A 2WWXA 2BKEA 4OHXA 2EYUA 1EFRD 1X8KA 2J45A 2QT1A 4QHSA 2JAQA 4Z8YA 1GIAA 5G40A 5L3SA 4TQAA 2FG5A 4BFZA 1IAQA 1C9KA 1XCGB 4UJ3A 1Q1ZA 1ZIOA 2K5UA 3REFA 3WRYC 3MWYW 4KITB 5JHGB 4V0MA 3I5XA 4B3DA 3VU9B 4PR0A 1Z0JA 4EPRA 4D4LA 1F3OA 4C30A 2IX3A 1ZUNB 2F9MA 4C0JA 4HDQB 4V0OA 3VNUA 4H1UA 2GAAA 4V0NA 1SGWA 4J0QA 3SEAA 1OXXK 4E22A 4HUQA 2C78A 2JJ1D 3P32A 4W5WA 4LV8B 3VKWA 4BFSA 3N2EA 5DHAA 5GJWC 4PC6A 3W6NA 2GXAA 1P73A 4FMDF 3VTKA 3GJ0A 3EC2A 3KKQA 4B71A 4QM6A 3NBFA 4D4MA 2AD1A 1TQ6A 1CU1A 4PZZA 2R6CA 4M1KA 5E4FA 3GLGA 1MT0A 3U3KA 1E0JA 2FMXA 4CEIB 3QXXA 4BFUA 4XJXA 3X1WA 4YONB 5AJWA 4TYPA 4C0KA 1NBMA 1P72A 1VCIA 4TLEA 1U0LA 3P4YA 4I81A 1SVLA 4FD2A 3TSOA 2ZETA 2JJ2A 5FUWA 1YR6A 1N0UA 1Z0FA 1KHTA 2SHKA 3NHBA 4TT3A 4WXPA 4EFMA 1S3SA 4KCGA 5CIQA 1N5KA 1T5LA 4UKDA 4ZKDA 1N25A 2XJ9A 4XVUA 2WOJA 3B60A 3GP8A 3FWYA 4RKEA 3THWB 4TMTA 4EUNA 1W2HA 4LPKA 4FI3C 1NVXQ 3UWOA 1HYQA 4NKRA 2NO6A 3C4JA 3I62A 3WBKA 4US1R 3TR5A 4FMCB 3LBHA 1XFAA 3W3AA 2OESA 1IM2A 2IYQA 3ZZ0A 2GK7A 1R5OA 5AUQA 2RB4A 1OH5A 1Z6YA 4HB3A 4TLBA 2A9KA 4WZ6A 3VR3A 1XEWY 1E2MA 1LF0A 4LJ4A 3FB4A 1F60A 1LS1A 2OEPA 4Q9LA 2NGRA 1N6RA 4P31A 3EC1A 8OHMA 2XZLA 1OJLA 2XOKA 4D4KA 3VR1A 1E96A 2DWQA 2Q21A 2B8TA 4NYIR 4OHWA 1UADA 4XSHA 3EPKA 2QP4A 1R0WA 2A2ZA 4JYCA 5FBQB 3LD9A 1TAGA 2FFQA 4PZYA 4A0GA 4Q01A 2Q9CA 2XNSA 1CR2A 4V0LA 2VHJA 3NVAA 1G8GA 3C8UA 5B58C 5JLJA 1C4OA 4KFTA 2IYYA 1IXZA 1ONBA 1Z22A 3HP1A 3FDIA 2QPTA 1DE0A 2EFEB 1CEEA 5DHFA 1E2EA 5CLLA 3DDCA 3U3JA 4C7OB 1ZNZA 1KDPA 1N6NA 2QAGC 1ZNYA 4Z51A 1M1YE 1WMSA 3B13B 3BAFA 4ZO4A 1U90A 5CDFE 4EPYA 2Q3FA 5LD2C 4B3XA 1KK3A 5EZ5A 2D2EA 2JDIA 4Q1BA 2RH5A 4YLGA 3EX7C 3P4XA 3PV0A 2KBEA 4OI2A 1OKKA 1RZ3A 4GL2A 1XP8A 1XXHB 2VTKA 3B6EA 2ZRMA 1XZPA 3KJGA 1G3QA 1OSNA 4I4LA 1W4AA 3ZJYA 5KNDA 3DPUA 1VG8A 3GJ5A 1XCPA 2IYWA 4P0TA 1OV4A 1XX6A 5CK5A 4X8LA 3AKEA 4FWIB 5CYOA 2QNRA 5C4MA 2O8FA 5EE1A 2IYXA 3I8XA 3QKTA 5EXPA 2CHVA 3Q72A 3KUDA 1NJGA 2CE7A 3DO6A 2GJAA 3RRNA 5A5GA 1CS4C 1BS1A 1G64A 2BIFA 3FFBA 2ZROA 4DLVA 1IY0A 1HUQA 4MQBA 4V0ME 4JSTA 4D25A 1U8ZA 1NKTA 1G1MA 4A2QA 2ZRFA 2O8EA 3FKSD 2EFDB 3AF2A 3C14C 3WYAA 1KMHB 2V9PA 3JZMA 4MRSA 2AX4A 3GLIB 1E2FA 3HR8A 3H1TA 1C1YA 1T9HA 4W9MC 2DFTA 3KB1A 4MKHA 4PAMA 2JLWA 3GLHB 2P3SA 4MYHA 2BC9A 4EPWA 1YR9A 3EWSA 3MWJA 3GLGE 2QE7A 1KIMA 1SKYB 1II8A 3JZAA 3UATA 4BUJA 2CNWD 5AK0A 3MGCA 1JAHA 4RZUA 4JL8A 4XD7A 2HXYA 2OCBA 4C0HA 2N46A 4DLRA 4ACBA 4ZI2A 1Z2CA 1XPUA 2ATXA 2ZVPX 4BFTA 4OJQA 1WBBA 3Q9LA 4DC9A 4IDPA 3N2IA 3LX8A 4TQUS 5EQTA 4C0QC 1N6IA 3PEWA 2YOFA 2V7QA 4LWZA 4M9SA 3T1QA 3RNLA 3WRXC 5FI0B 3NDPA 5H1YA 4MRNA 3AF4A 2RKOA 4MUBA 4ZI3A 3AVXA 1R8SA 4L15A 1ZAKA 1Q3TA 2QI9C 3A4NA 4Q9KA 1FL9A 4KHZA 1JPJA 1VCOA 3CPJB 3EPJA 2AD5A 1XPOA 1Z0AA 4MKIA 4JLBA 1IN8A 2ODNA 4OI4A 3WP1B 4DCUA 1QHYA 1MR3F 4DDWA 1RRPA 3NIBA 4JT2A 3O47A 1FOEB 3B1XA 1Z0KA 3LH5A 4UNSA 5FPYA 1XJQA 4A2PA 2DFNA 3R7WA 1JNYA 1Z3IX 2B6HA 5J4HA 1H8HD 1W4BA 4DLSA 1NY6A 2QU8A 5B64A 1NLYA 1X8JA 1JJVA 1E9RA 2GNOA 4BRWA 3QXJA 4AK9A 1G7TA 1IJEA 1HTWA 1LY1A 2FSIA 2IXFA 1FP7A 2A5FA 4I1VA 1SZPA 2JLZA 5HE8A 3C15C 1XU4A 1ELOA 1JPNA 4KYIB 5KSZA 1YHNA 2Q9AA 4XTCS 2YC4C 2ZI4A 1Y63A 1ZYUA 1IONA 4Q47A 4JBWA 4RFSA 1EFRA 4Q4JB 3HPQA 4EPTA 3PQCA 2NIPA 1S4QA 2VSFA 5EUMA 4QG7A 1XMJA 1PUIA 121PA 2YJTD 4KI0A 5DI9A 3C7KA 2PCJA 3B1VA 1XZQA 5JCZA 2VF8A 2DPXA 1ZP6A 2OAP1 2ZI5A 4HB2A 3M6AA 2CMKA 3LVRE 4N0DA 2PX3A 4QBFA 1ZCAA 3WHLA 3L0IB 3ZVRA 1FX0A 2PH1A 2AK2A 2O8CA 3CNNA 2ZI3A 2FH5B 3EIHA 4KAXA 4G5OA 4JLNA 1KNQA 1ZMXA 2QN6A 4LJ8A 3OE7D 3FFAA 5FTLA 3X1ZA 3H86A 2JJ1A 221PA 2BHRA 2JLQA 3KJIA 1GKIA 4NYJR 4RZ2A 4ITRC 1G41A 4M1TA 3CF0A 2OZEA 2ZSAA 3OEHD 3IKJA 1KSGA 4PQYA 1RYHA 1E2NA 3QNUA 2BWJA 1WXQA 3RRMA 4LZZA 5EE5B 2VP2A 4O2LA 2GXQA 1WF3A 3A4LA 3SU8A 4R9UC 3W6OA 4JLVA 2XZOA 1E2PA 5BQ5A 3GPLA 3AKYA 1S9DA 5D3MB 4DBLC 4NH0A 3LRPA 3GJ6A 2J87A 1W49A 1Z5ZA 1XEXA 3LVQE 2FZ4A 1GL7A 1P9NA 3W6PA 3BK7A 1NMXA 2DFLA 4GRAA 4IDQA 2IC5A 4W5HA 2NPFA 5JZVA 1QZXA 2FPKA 4A36A 2CVFA 3CNOA 3DHWC 4MUAA 2R44A 3OIUA 5FTKA 4F91B 4CEJB 2X2FA 3A6PC 5L3RA 4BGDA 4KBGA 3K09A 2W6JD 1EG7A 2L0XA 4CVNA 3RC3A 1BH2A 3ECCA 2PL3A 2F1RA 3Q8XB 3QIAA 1TADA 2DCUA 3B78A 5EP1A 4BLQA 1N5JA 1RJ9B 4NCNA 3GEHA 3TR0A 5G53C 5SZHB 1KI8A 4OYHA 1SXJD 1U9IC 3U60B 1GSIA 1MRNA 4LHVA 5L3SB 1U94A 2GCNA 4DXAA 1GKUB 1E6CA 3KL4A 2RGGA 5JJKA 3ADKA 4WXRA 4C0LA 4OI0A 5KO2A 3G0HA 1GUAA 2ZE5A 3CM0A 2JLVA 2ZJZA 3IUYA 4BLSA 1R7RA 2FFHA 3EIQA 4BLTA 3T5DA 4YMVA 1KJWA 2XITA 4AY2A 1KTVA 2ZIAA 3W9YA 4P4TA 2G0NA 3W5IA 4BLOA 1WA5A 2LWIA 1Q57A 1FW6A 4BE7B 3GFPA 4Q7LA 5LB4A 5FR1A 1S3GA 3K70B 1SHZA 3U7HB 3ONWA 4HUQB 1E2JA 3KQNA 3AM1A 1T5IA 3EPHA 3O8CA 1TF2A 3AF3A 4MITA 4Z54A 1W36B 1IN6A 3WNCA 4HDCA 2WKPA 4LRWA 4KFUA 3GLGB 2DWPA 1XMIA 1ZVQA 4ZCIA 5FOXA 4IRUB 1E2IA 3IIMA 3W34A 4URXR 1EFUA 4P4UA 1OE0A 1P75A 3PUYA 4Q7JB 2OCPA 2WWGA 1QVRA 5CB6A 4PO9A 2ZJ8A 3BS4A 1NP6A 1IBRA 3IDQA 4ESVA 1CXZA 5BN4A 4A8JC 4PSVA 3SFVA 3VQTA 3Q5EA 2F55A 3T1OA 1VCMA 1R0YA 1P2VA 2KSQA 1E2HA 3CRMA 2D74A 2J46A 1ZJ6A 1YVDA 3W90A 2WWWA 2WJVA 1UKEA 3TVDA 1D6JA 1FPMA 1N0VC 5KPDA 2FGKA 4Q4HA 4HLCA 2GJ8A 1ZU5A 2IW3A 1G5PA 1Z6GA 4QGAA 2GESA 1TQ2A 4QKQA 3PUZA 3CKLA 4XVRA 2JATA 3X1YA 4C2TA 2ZE7A 5HKKD 1AN0A 1E99A 1SVWA 4EIWA 3D8BA 4PPGA 3CZQA 3QQ5A 2ASEA 4IEIA 821PA 4D26A 1P6XA 2QBYA 3QEOA 3SQWA 2ODWA 5HCIA 2RGAA 5EP3A 2PMKA 4Q4AA 1VG1A 5J4VA 3HR7A 1R4AA 2V3CC 2Z4SA 1RRFA 2P5TB 4BECA 4CIDA 1FQJA 2CNWA 4WAUA 4BZPA 5BN3A 5TV2A 2NZ8A 2XNDD 2LKDA 2ZPTX 2ZJAA 3BB3A 5JEDA 4LJ5A 4G0NA 4B74A 5J4LA 1GNRA 3LBNA 3NC0C 4MYTA 1E4VA 1SHKA 1W7AA 4G5RA 4B3GA 5FOTA 3KJHA 2DR3A 2VA8A 3QKSA 1L4YA 1NVWQ 4RFVA 3KKOA 4LY6A 1OLOA 3U7EB 1GZSA 2OILA 2QM7A 1KKLA 1KI3A 3IO5A 3KTAA 3I4LA 1FZQA 4PTLA 4TL9A 4FXPA 1T6NA 4F93B 1DADA 4G3XA 2NO7A 2D06A 4TYWA 2HLDD 3PIRA 2ZEJA 5DI3A 2B7BA 3FOZA 2CJWA 2G9NA 4DEYA 2PZGA 4WOPA 3WY9A 2B92A 1NSTA 2QZ4A 2CDNA 4NU0A 1W0JD 2IXGA 4TQ9A 2QQ0A 3BWDD 4Q03A 3VR2A 4IXNA 5ANRB 1GNPA 2O8FB 4NL4H 4LYAA 2ZJBA 1KI7A 3D6TB 2H16A 2QTHA 3SFZA 1HE1C 1H8HA 3T12A 4YQFA 3BH0A 4NCIA 4B48A 4IOJA 2AWOA 2WWFA 1GWNA 3EWAA 3K0FA 2BDTA 2W6ID 1U0HC 2PBRA 3DM9B 5JJIA 2REOA 3WYFA 3B7GA 2C95A 2VIIA 2FDCA 3ASYA 2HYIC 3N70A 3TH5A 2O8EB 2WWYA 1RKBA 3TSZA 2IL1A 4LBZA 5JFGA 1J90A 2OT3B 1R0ZA 1KAOA 1GDDA 4NCHA 1D9XA 1JEEA 2KI5A 2Q3MA 4DCNA 4PO8A 3R9IA 1VYTA 2Q0HA 1LTQA 5JSZB 1DO2A 4G5SA 1OW3B 1E2GA 4HEJA 4N1AA 4PAQA 3KQLA 2HUPA 3HDTA 1NMYA 1XD8A 2F43A 2C9YA 2ODEA 2RGNC 1T8UA 2ZSEA 3BFVA 4GPTA 2OSBA 1II8B 1VHTA 3OF5A 2C2HA 2FFAA 2IYVA 2QPOA 1P2UA 2XTZA 4QNRA 3PITA 1E9SA 4RKFA 1E2LA 2BCJQ 3PFIA 1TF5A 2IF2A 4FMCF 1G8HA 5CM8B 4TLDA 1Z8FA 2E1RA 3OE7A 4HYYA 3GLFA 5CK4A 4GZLA 3IHLA 3PEVA 4M1OA 5EP4A 2QPAA 1P2TA 2WJYA 4URYR 4ON9A 3OEHA 2HCJB 1Z08A 2W2VA 1G8FA 2PT5A 4B6EA 1CRPA 4KFRA 1QG4A 1U0JA 5EXTA 4WZAE 2I1VB 1S0UA 2HF9A 1TUIA 2QL6A 3D3QA 2FN4A 2ZI7A 1E4YA 4L4UA 4LX0A 1NNEA 2QG6A 3B5JA 1UKYA 5EUQB 3OZXA 3TK1A 4IDOA 3HU3A 1UKZA 1FTSA 1NVVQ 3KDSE 4LHWA 1IN7A 2AKYA 2IXEA 4JLPA 2IYZA 1TU3A 3RDPA 3IIJA 3R7WB 1W48A 4DLUA 3NEJA 4NYMQ 5KDDA 1SVSA 3U44B 3NKVA 2OXRA 1Q22A 4AIIA 5L3QA 1Z83A 2W6JA 3GLHE 3L0PA 4US2R 1ZBDA 2G1KA 2J59A 3IEUA 1A1VA 1I2MA 5TY0A 1UKVY 3AQ4A 1XJCA 4IDHA 2VRWA 4RZ3A 4ZPXA 3ZQJA 2J7PD 2NO1A 3BE4A 5FH9A 3NWJA 4KLZA 4RFSB 1NY5A 2YNMA 1SXJA 5FOSA 1W4RA 2IS2A 1G9XA 1L7VC 5DN6A 1A4RA 2BEJA 2Q3HA 2ZE8A 4LJ7A 1N5LA 3I1FA 1KI6A 4IXMA 4B75A 2O0KA 3R8CA 3SHWA 1RRCA 1KAGA 2J0VA 3WNBA 1BIFA 1EX6A 3BH7A 5DYGA 1SVIA 1S96A 1FX0B 2XZPA 4DDUA 2GBLC 3W8RA 3FMOB 3VHXA 2NOAA 2O8CB 4AI6A 4R7ZA 721PA 2IHYA 3TAHA 2REBA 4GT1A 1COWD 3MWLA 3F5FA 3FHOA 1K5GA 2G83A 1E9CA 3ASZA 2D7CA 2ZUBA 1Z2AA 4L5BA 1W4CA 3W3ZB 1B23P 1F5NA 1Q0UA 1NF3A 3QF7A 1MRSA 4PQFA 4XOIA 5J4KA 2IWRA 2V1UA 1G3MA 1ZUHA 2VBCA 4AKGA 3I73A 4B3FX 1Z06A 2GEVA 3KXKA 4LUCA 2RGXA 2QEQA 4MA4A 4P4SA 1M74A 3MJRA 3BFKA 4KO8A 1BO6A 5G3YA 1V43A 3QBTA 1IN5A 1R8QA 2OBMA 1EK0A 3AKDA 4NHOA 4KSCA 1KK0A 5AJYA 1XCMA 5GVSA 3P20A 4OQMA 1D5CA 1D2MA 2PLRA 1XPRA 4IVQA 4A4DA 3HU2A 4HB4A 2IEZA 3TRFA 3PEYA 1G4AE 1WE2A 4QBIA 1XNJA 1XEXB 2EVWX 1UAAA 4RD6A 3KQHA 3T61A 4A9AA 3QJYA 1CR1A 3QI2A 4O3MA 1GL6A 3U7GA 3A58B 3SYLA 2C03A 2DY1A 3UK6A 2PZFA 1U99A 2PZEA 5FPHA 2P67A 1NLZA 2WBLC 2XJ4A 1QHGA 4KVGA 2GZDA 4DLTA 1ZM3A 3K9LA 1KJZA 4AG6A 2RCNA 1AQUA 4LJYA 4ABYA 2ZREA 1H8ED 1XTKA 4RD1A 5E95A 4YMUA 1DEKA 1X3SA 2RHMA 3W5JA 3PG5A 4MYCA 1VIYA 3CWQA 1S1CA 4OKSA 3K0AA 1EFTA 1UDXA 3FHCB 3DKPA 1AS0A 4Q1EA 3TQFA 4D80A 5HKKA 1BOFA 2CLSA 1YRBA 1F6BA 2PEZA 4U02A 3U61B 2BOVA 1N0WA 3OFND 1GP2A 1H65A 1OH7A 1IXRC 2F1HA 3C5CA 4URUR 2W0SA 2XB4A 4IEEA 4PHTA 2VLIA 3JVVA 4XIGS 4QOSA 4JVNA 3RS0A 4RVCA 1Q44A 1KI9A 2JA1A 2ZS8A 4OBEA 5KNCA 5P21A 1DTSA 3U3OA 1CLUA 2JEOA 4CGZA 4LDJA 3PEUA 3UANA 2JLXA 521PA 1F48A 1AS3A 1S2MA 2W00A 4M21A 1G21E 1J70A 2FPLA 3CW2A 3GEEA 2WJGA 5FFMA 1ZRHA 2H8KA 1NIJA 3WBJA 4TLCA 3TE6A 1VECA 3IBGA 3PJRA 4O0MA 4W5JA 1F2UB 2A5YB 1X6VA 3SZRA 3MRSA 5HPYB 2OUKA 3WNDA 2YZ2A 5KUTA 3DM5A 1DAGA 3CX8A 4FCVA 3BRWD 2D7DA 4A0HA 2JASA 3ADCA 3U7FB 1SVKA 2HLDA 3RVBA 2VP4A 4HLUC 1OFIA 4RJLA 1K6MA 1E2DA 3ZVNA 4BLRA 2F6RA 1LB1B 4Q66C 5F9HA 5GJBA 2ZSDA 2P2LA 1XD2A 3FMFA 3VKGA 5JCPA 1QBKC 1W0JA 1WCV1 1YZQA 4PSAA 1E0KA 1SXJE 4XVQA 3EG5A 5CLQA 5KTYA 3BGWA 1RW4A 1L2TA 3NXSA 2JJ8A 3LLUA 5C2JB 2GZAA 3M0EA 4H1VA 4TWZA 2CCKA 4PXAA 4ARZB 3RS5A 2BM1A 2YWGA 4X8OA 2W6IA 3IO3A 4G5QA 1G8YA 3AGPA 3GJ3A 1O3YA 4WZBE 2WIBA 2ZRDA 3H2YA 4DSNA 4Q4HB 3AKCA 3VR6A 1G4UR 2GDJA 1NN3A 2ZYTX 3OESA 3E2IA 1CR0A 4TMXA 5DGXA 2HXSA 3IEVA 1JQJC 3EZFA 3CLVA 3F3YA 4RSGA 5EXXA 4MKFA 3AUYA 4JVSB 2J0SA 1ZC4A 1GRRA 4KBFA 2IS6A 1ODFA 3CH4B 1UJ2A 1WDTA 1SVMA 5IF9A 4K46A 3TW8B 3VAAA 2UZ3A 1VMAA 4NTZA 4EFLA 2GCOA 5AWFC 2CL6X 2QBYB 3UMFA 3T1TA 4KV9A 4URWR 5FUVA 2OCYC 4TMWA 3ZLJA 2W58A 3G5UA 2WKRA 4QGHA 4BEBA 1PLLA 4AG5A 4Q4AB 4E03A 3B1WA 5C1BA 4M1SA 2ZRJA 2WHXA 2ZJ5A 3AF1A 3CIOA 4AKEA 2FSGA 2ORIA 5AUOB 1JJ7A 4HAWA 4B32A 1NBME 1ZM4A 4M8NE 4M9ZA 1CTQA 4EPVA 1M8PA 2GWHA 3CF2A 4DIEA 3AGQA 4CW7A 2JLUA 1TPZA 1AIPA 4TYQA 1IXSB 2WSSD 3CO5A 3ZIAD 1E3MA 3KX2A 2H17A 4L9WA 2I3BA 3FKQA 2X2EA 4LC1A 5BN5A 2EFHB 1MKYA 2Z6VA 3B1YA 1BMFD 3SBEA 5K8LA 3LQRA 5IDVA 4DSTA 4UNNA 5DYIA 1KK2A 4OK5A 1VIAA 1AKEA 4PO1A 3K1JA 4HZIA 2MSDB 3G82C 3LV8A 3NG1A 2RGBA 1SKQA 2X8AA 2W83A 2ATVA 2VP5A 1RPZA 1Z28A 2P6NA 2Z43A 4TL8A 3LLMA 2VQSA 5F2EA 4DHEA 3B2EA 3A4MA 2YVUA 3QVVA 2G1JA 1K8RA 4XTRA 4ZDIA 4IHQA 2QENA 3QE0A 3K0FB 3QPWA 1DELA 3EZ9A 1JAIA 4C0SA 1XEFA 3GMTA 3BJIC 2H92A 2G0TA 2ODBA 2QGZA 5E7JA 3VR4A 2F1IA 2J7PA 2ZQ5A 4V03A 4B6FA 3GJXC 1PUJA 1OPXA 1DS6A 2A5JA 2ZS9A 4DT1A 5DO9A 4FWTA 2VO1A 5GADl 3QKRA 4LBVA 1EWQA 2PJRA 4PC2A 1W5SA 4X8MA 2XAUA 4JLAA 4MGZR 4HZUB 2QTVB 3RWMB 5FL3A 1W44A 4OQFA 1YJ5A 5TB5A 3RRYA 5AUPB 2F43B 1YZLA 2FFBA 1DARA 2UVQA 3K0CC 4LBWA 3NDBB 2F1JA 1TEXA 2HYDA 4HAVA 2PCLA 4A6XA 4B2IA 1HE8B 1XTRA 5K8IA 3W8NA 3SDZA 1MH1A 2ORVA 1R5NA 1COWA 2N1BA 3GLFB 2Z83A 4WA7A 3PVSA 5FL7D 3VNVA 2R6AA 1Z63A 2ZI9A 2XGJA 3CPHA 2QMHA 1T0JB 4OL0A 1G7CA 2VHTA 1L8QA 4BEJA 5F3WB 4EJSA 3QG5A 4B73A 2RMKA 1DAEA 3L0SA 1TUEA 2IYUA 2ZYUX 3BERA 2NZJA 3AVQA 3LW7A 1KYIA 4FMBB 4PHGA 3QXSA 2IHBA 4TZ6A 4ZIRA 4A0FA 3L2OB 2FV8A 3K70C 3T35A 2GVZC 4GI7A 2GAOA 2DFKB 1UM8A 5FBWB 4Q48A 1MO6A 4IFBA 2IUUA 1Q21A 3KUCA 1U81A 4C9BA 1XWIA 4C0BA 1M6NA 1F2TA 2GJSA 1NG9A 2WZQA 2FJUA 1S8FA 2BMJA 3RYTC 4JLMA 1ZD1A 5CJ2A 2P0EA 4Q00A 5L3QB 2XXAA 4F92B 1XD9A 2QQEA 4CEIA 4CZ2A 3BB4A 3BFXA 3ADBA 2OE2A 1H8EA 5KYKA 1R10A 5GJVC 1LF5A 3MFYA 2A5GA 3TKLA 1N2CE 3NEYA 4E5UA 3QF4A 3K8YA 5FI1B 5DE3A 3GFTA 2P65A 3LBIA 5F9FA 1OFUX 4O25A 1OXVA 1AJEA 3U3RA 1SXJB 5SZJA 2IEYA 4NCKA 2YV5A 4NDZA 4LI0A 1D8TA 1W1WA 2GRJA 3EASA 3OFNA 3RS2A 3EZ7A 3QSYA 4GOKA 5C18A 4FIDA 4L16A 4E07A 5E3HA 3RS4A 5DISB 3A36A 5TXGA 5D3QA 3R8FA 1PLKA 1DG3A 3V4RA 2RGDA 1N6HA 2YINC 1TX4B 2GA8A 3CWZA 4QHTA 3NBYC 3THXA 3MD0A 4AC9A 5FUYA 2GBLA 4M4SA 5EE0A 2J0UA 2O8DA 4TTQA 2O8BA 2V54A 1ZW6A 4P3YA 1CIPA 2VSOA 1CF4A 4N0EA 2HCBA 3FTQA 3TJZA 3TQCA 3RHFA 2F7SA 2WJIA 2ORWA 3C5HA 3NC1C 4GMXA 4P4SB 1IHUA 4JJKA 4V02A 4MDFA 2CK3D 1E1RD 2ZRHA 1E79D 1ZC3A 4IVRA 4XWAA 2GCPA 4WW0A 5KSPA 3TMKA 3U4QA 2XX3A 1AZTA 1SULA 2PLFA 2UZIR 2WM9B 3PUWA 5SZIA 4C4PA 3I5YA 3EIEA 2MSEB 2GHIA 4C0AC 5DNYB 2RGCA 2I4IA 1FP6A 3Q3JB 3A1UA 1XMSA 1D2NA 4I1OA 4A15A 2GF9A 1YE8A 4C7OA 3KXIA 3TIFA 4E09A 2Z4RA 1Z0DA 2MSCB 2VHQA 1HH4A 2G77B 2UKDA 4G01B 3Q85A 1BYIA 4DB4A 4TMKA 3E70C 4GZMA 2EYQA 3WXMA 2EWVA 4NP6A 1ZD9A 4M2LA 2D2FA 2CCJA 1QG2A 2YWHA 3LA6A 2AWNA 5FTNA 1YQTA 3FKSA 1J2JA 3QPUA 4DUGD 2X1VA 3KQKA 3CZPA 1JR3D 2O52A 1E0AA 2OO7A 1RVDA 2ZU6A 4JVMA 1ZM2A 5AJZA 4D0NA 5KU1A 1S9HA 4G5GA 2ZSBA 1JBKA 3MJHA 2C04A 1E94E 2REXB 3VFDA 1J99A 1VYVA 4JZKA 1NMZA 2QMEA 3AVPA 3RRZA 4RD2A 1G7RA 4R2IA 3D7MA 3RC8A 3DZDA 2ERXA 1ESMA 1DOAA 5KHOC 3K0EA 2JLSA 3L43A 1OHHD 3PXGA 3CX7A 3I61A 4S35A 4NONA 2CCGA 3EZ2A 3BIFA 4JL5A 3LW8A 4LYJA 1KMHA 3TSWA 4BFVA 2O0HA 3SYNA 1HA3A 1Q3HA 3F0TA 3H0KA 3FPAA 2FNAA 2JLYA 3EPLA 5JS8A 3FGNA 4Q7MB 3DZ8A 4EQ6A 2ZITA 4CEHA 2GILA 2FOLA 2ZYWX 3GEIA 1E0SA 2IWHA 3AP1A 5B2ZA 4DDVA 2WSSA 1AZSC 1G16A 1KMQA 1JQLB 1RE0A 3ZIAA 4ZDKA 5IHPA 2V55B 4ACAA 1PZNA 1CULC 1FUKA 3KXLA 2ZRPA 1BMFA 1QHSA 2X77A 3RS7A 2QAGA 4LOAA 3ZQ6A 5TARA 3T34A 2QAJA 2VL7A 3H4MA 3L82B 1T8TA 2R2AA 4LGMA 5FBLB 4HLUA 1A2KC 1XD2B 5F98A 1KY3A 3SR0A 1KZGB 4CDGA 3EAQA 3ZS9A 3A1TA 2R6DA 3QPVA 2HV8A 2EU8A 2NO9A 3CRRA 4M22A 1LVGA 1KSFX 5KSOA 2QY9A 4OK6A 3SNHA 4PANA 2IUSA 4KODA 4KLNA 4B44A 3RABA 1YKSA 4GMDA 1ETUA 4HSEA 2VP9A 1DAMA 4UNQA 1II9A 2X19A 5KDOA 1P60A 1AKYA 2H18A 5A4JA 1ZD8A 3F8TA 4CRWB 2DBYA 4DEXA 1KOFA 4Q1CA 2ZUCA 4YMSA 3I72A 1YR8A 1P62B 2OLJA 2C8VA 4MGKR 4BFXA 3HJNA 2EW1A 1EWRA 2Q9BA 3KKPA 1FTNA 5LB2A 1I4LD 1UEJA 2EQBA 2PJZA 3PR1A 2QSYA 4OK3A 1QHHA 3CH5A 3IPYA 5CJPA 3S1AA 4B3BA 2IA5A 1KI4A 3SYKA 1IJFA 3IILA 1XB2A 4EFNA 4UXIA 2VH5R 4NCJA 3BORA 5CM9C 4DSOA 2GCOB 3ZS8A 2JCSA 2QP9X 2ZE6A 3J81k 3AEZA 1ZUIA 1RFLA 2V8OA 3AUXA 3QVUA 1W46A 2HF8A 3IQXA 1ZNWA 1FNMA 3ZVLA 4A92A 2B7CA 1EFHA 1IQPA 3QKUA 2OBLA 4QGFA 1QF9A 2BEKA 2FEOA 1A2BA 3K9GA 1TTTA 2XEXA 4QHYA 1Y3AA 1NN5A 4QJ3A 4ESHA 2MMGA 1KDTA 2P5SA 3U6KA 3BC1A 5FL7A 1GRNA 3TAUA 4Q19A 2CEAA 3UG6A 3QEJA 4GNKA 4HAYA 3D31A 2D3WA 3UG7A 3AVOA 4BASA 1XF9A 2WPDD 4D82A 2NPIA 2ECKA 4PHFA 4MRPA 1IY2A 4D81A 2DB3A 3NBXX 3PUXA 5HE9A 3LXXA 5FOUA 1II0A 1XEWX 2QT0A 4C3ZA 5HCNA 4PQRA 3TVTA 3ZGXA 2FU5C 2QE7D 2V4ZA 4QGGA 2QUZA 2H57A 3A8TA 4BZXA 4YMTA 5FPKA 1G3UA 4QBHA 2QORA 2BVNA 3U3MA 4TYYA 4DVGA 1Z6XA 5FBRB 2BMDA 2CHGA 3K9HA 1OYWA 4MRVA 1TQ4A 1XTQA 2BJVA 2HJGA 4LJAA 4DLZA 3O8DA 3PENA 3LWNA 4FCTA 1GOTA 4JLKA 1G3IA 4LPSA 3EW9A 3SJAA 4DLWA 1JALA 3GJ4A 4AWXA 1CJTC 1W47A 1KSJA 1KI2A 3NH6A 4BLPA 1EESA 3B85A 2A78A 1ESNA 1KO1A 3ZYCA 1CJMA 3DOFA 4IW3B 2KWIA 4UJ5A 4TSFD 4PC3A 4DT1B 4XWOA 4IJMA 3QKRB 2HDNB 3K09C 1JI0A 3Q7PA 2J7KA 4IFEA 4M0LA 3CONA 5JWRA 1KDRA 1PV4A 2C77A 5CDFA 3LX5A 1M7BA 2BJWA 2YWFA 4PX9A 4H9GA 4Q1DA 3CR8A 2J41A 3UIEA 3AB3A 4O2RA 2ZRBA 4MGYR 2IS4A 3U6BA 1UBEA 5IRCD 1JECA 1MO4A 1QHXA 1YZKA 4LYFA 1X1SA 2XTNA 4B76A 1OIXA 1XTIA 1ZU4A 1OIVA 3K53A 4JS0A 2NMVA 1VDZA 4PSKA 1YZTA 1X8LA 1FUUA 1RYFA 2YC2C 1KK1A 1U98A 4IKEA 2QSZA 3LY5A 1NVVR 1OFHA 1ZM7A 4UXJA 5SZKB 4MDEA 4B33A 3WMGA 3FE2A 5B57C 5J47A 2IS1A 2WWIA 4I1SA 4NYMR 4LJ9A 4WBSA 4DLYA 4EJSB 4JIMA 2ZANA 2HJVA 3GD7A 4Q1FA 2ANBA 1E1RA 2CK3A 1E79A 4S2EA 4FN5A 3RSOA 2DYKA 3CF6R 3N5CA 4BFWA 5LBIA 4IDNA 2IF0A 1HT2E 5UKDA 2KJQA 3A1SA 5ELXA 4JKYA 4ZIRB 3SQXA 3AVYA 1KY2A 2HEIA 2OV2A 2R9VA 1US8A 4PC1A 4XSGA 2CHQA 1HEIA 4Q1AA 4LK2A 2BCGY 4TL6A 4RY2A 2FZLA 1OXTA 3C41J 4RD0A 4URZR 1F2TB 1M7GA 1KZ7B 1N3BA 3LFUA 5FOVA 2G3YA 3V4FA 1XTSA 2ZJOA 2VPPA 1E98A 2ZRGA 621PA 3B9PA 4A6PA 2OCAA 2GJKA 2XXAB 2QROA 2ZAMA 4TTPA 1NN0A 5JWHA 4KJZA 1KKMA 1U8YA 4NYIQ 4M53A 3LXRA 3Q7QA 3THOA 1R6BX 1IN4A 4DUGA 3HU1A 1GITA 1Z07A 5GVRA 3QF4B 5IT5A 1EFCA 1JR3A 2J5XA 1KGDA 4GDFA 4UNPA 5AJXA 3GLFE 1XDBA 4B2PA 1FQKA 3P27A 2Z5FA 3KKNA 2GF0A 3IGFA 1E9AA 1QVAA 3EA0A 4P32A 2QMUA 3EZ6A 2LKCA 4R2HA 4R71A 3CRQA 1GVNB 1Q12A 5BYJA 5JEEA 5LPNA 1U9IA 4K8OA 1JXMA 4A82A 1HY3A 1NIPA 2OFXA 2FE4A 3RS3A 2GVDC 4M9QA 5JJLA 1YU9A 1OHHA 1OB2A 4AKHA 1UPTA 3BBPA 3SJCA 3THXB 4MYUA 1NKSA 4U00A 3IPXA 1RRGA 2FA9A 1G20E 2XNDA 1OYYA 1KDOA 2R65A 4TYNA 4EPXA 1P9RA 2ZS7A 4PC7A 2J0UB 1E32A 4HB0A 3ZH9B 2IT1A 1T3SA 2O8DB 3SJZA 2BM0A 3KB2A 3SI7A 3VX3A 2O8BB 5JI2E 3PCRB 1KSHA 3OEED 1NSFA 1YZUA 4DDTA 2Z0MA 3THYA 2GETA 3OAAD 1W0KD 5KDLA 5DLQC 4MKGA 4B2LA 5K8TA 3FYHA 2C9OA 2IYTA 1ANKA 4FW9A 3U4QB 4HDOB 5J5CA 1Q1EA 4LC0A 2LCFA 1OIWA 2QMOA 1HT1E 4TLAA 1G291 5G3ZA 4QL3A 4Q18A 3QXCA 4JLJA 5EP2A 4RD4A 4B43A 2ONKA 3EARA 4R98A 3ZD7A 3WMFA 3HWSA 3MUFA 3VMFA 3TW4A 1M34E 3MG9A 4FINA 1X86B 4M9XA 4OQXA 2GXUA 3SBDA 4A8JA 3U2QA 2JLRA 2VEDA 3O8BA 4I99A 4MH0R 5KOYA 2AK3A 3TUZC 4M1YA 2DHRA 3ZZTA 3AP2A 5KPJA 1G18A 3ZD6A 1K5DA 4D0LB 1CJVC 2D4HA 1T3LA 3CNLA 4JBYA 2W2TA 4RCZA 1G8PA 1VYUA 4QNMA 1DPFA 4B3CA 4D6PA 1MABA 2C96A 2XSZD 1J8YF 2FPMA 1M2OB 4ZDJA 2E87A 3RWOA 1MV5A 1LNZA 2G88A 3PUVA 1KI1A 2ZRNA 4FCWA 4D4JA 2ZR0A 3ETLA 1CKEA 1E9FA 4IOKA 1GNQA 3CRVA 4Q5IA 5LDDC 1A5TA 2TMKA 1I4TD 1WB9A 4OQNA 5H70A 2D62A 3DVLA 4Q9HA 5CB8A 1U2RA 2F9LA 2OAQ1 4QXAA 1GFIA 2V6JA 4F4IA 2ZRAA 2A7QA 1XMVA 4K81B 3FMIA 2ZJYA 3TUIC 5FR2A 4TN1A 1MO3A 3T5GA 2FWRA 2AFHE 4PZLA 3OHMA 4C2UA 3BB1A 3QENA 4JLDA 5CIWA 3AF0A 3ND8A 3BXZA 4KYUA 4CT4B 4EQ6B 1YRAA 4CEHB 2OFWA 1G7SA 2CBZA 2WPDA 3QKSB 4FMDB 4LHZA 5JSZA 1GILA 4JKIA 1TL7C 1WP9A 3SOPA 5TMPA 2R8RA 3KTAB 1QHNA 1P7CA 1TU4A 2KB0A 2WICA 3MWKA 3P26A 2QAGB 4Z1MD 3RAPR 2VF7A 5DI3B 2CJWB 4D0GA 4OQLA 1W2GA 1FNNA 2IYRA 5EJEA 5LD2B 1GRQA 3MAAC 3SN6A 1GG2A 1JR3E 4ZCMA 2PEYA 4RZXA 1VPLA 1ZIPA 3DKVA 3KKMA 1UBGA 1HURA 2ZRLA 5IK2D 4LYHA 2ZR7A 1M7HA 3K9NA 2IUTA 3L8YA 3RANA 1T91A 1GKYA 3GCGA 2P6UA 3OIYA 5BXQC 2GEDA 1E1QD 2ZR9A 5KSYA 1GTVA 2ONJA 1ZNXA 3UMSA 5L3VA 3E1SA 1R5BA 3KFVA 3CR7A 4IOLA 2ZYVX 3B9QA 2OXCA 2V6IA 1Z0IA 1E2QA 4W7SA 4YXWD 4DWJA 2AXNA 4ZV4A 4EDHA 1CRQA 3S1AB 4AYTA 1VG9B 4U7DA 1QHHB 2MMCA 2VHUA 4JVLA 3O8RA 4EKDA 4OHYA 2ZSFA 4TSFA 3VX4A 1NVUQ 3I32A 1A82A 4DSUA 3GJ8A 3T15A 3ICEA 5J4YA 4NYJQ 2O0JA 3U44A 4KFSA 5HR5A 4F7WA 1CP2A 1OF1A 2A3RA 3HPRA 3A1VA 2RGEA 3NH9A 1NL3A 3VHLB 2W2XA 4BZQA 4F4JA 4Z8XA 2P6RA 1KO4A 4BWYA 3X1XA 3KJEA 5JECA 1SXJC 2ZRCA 1I4DD 4URVR 3FVQA 3TBKA 3I3SR 2RGNA 4UQOA 4OHZA 1P5ZB 1T4GA 4ILEA 1E9BA 3LAWA 1G5TA 2OG2A 4OJKA 2A30A 3UKDA 5C46F 5AR1A 6Q21A 3VR5A 1MO5A 2XB2A 3KZ1E 3L8ZA 2ZUDA 4F38A 2QRNA 4NMMA 1YZNA 4PHHA 2YOHA 1N6LA 3VU9A 1GL9B 3GQBA 3DL0A 3EA5A 1SQ5A 1G6OA 2YOGA 4YDSA 4U5XA 3IIKA 3RLFA 2GKSA 4JL6A 4ASUD 5JI3E 5HZHA 1MOZA 3AV0B 4UXHA 2WVJA 1YR7A 2EFCB 2VP0A 2C98A 3AVWA 1PVOA 4KU4A 4AKIA 1Z47A 2C9CA 4OI1A 5B30A 4ERNA 2WOOA 5FPSA 2ZI6A 3SHFA 1W36C 1D9ZA 1LFDB 2QA5A 3TNFA 2CL7X 2AXPA 5L8VA 3BH6A 2YYZA 1Q1QA 2HT6A 4YDHB 1OXSC 4HAZA 5H8WA 2WMOB 1LV7A 5JHHB 3C16C 5EZ6B 2B21A 1JB1A 2I1QA 4JSYA 1P4SA 4HLDA 4G1UC 3ZDQA 1HQCA 5JWOA 2H5EA 1VHLA 1DAIA 1N6KA 3TGPA 2AHOA 4XH9B 2OHFA 4JYBA 5BWMA 3WMEA 4XWKA 1UDWA 1R0XA 3CPEA 3R20A 5BW8A 2ZRIA 4NPHA 1KI6B 4A0RA 1UEIA 5CYPA 1Z6AA 3QOFA 2BKUA 1TF7A 1KO7A 1N6PA 4DKXA 4DZZA 4LSGA 3QXHA 3THWA 2BBSA 4AURA 3HYTA 3CBQA 4Q21A 5CITA 1PLJA 5HZKA 3UPUA 4NZYA 2PX0A 3I92A 3UWKA 3L0OA 1AM4D 1DO0A 1XBTA 5EXSA 2J3EA 2JIZD 2R62A 1NJFA 2ZU0C 1DBSA 5EE3A 2A5DA 4BQSA 1N5IA 4TMVA 1I2DA 1T0HB 4RCYA 5TVKA 1R2QA 4CT5A 2FGJA 4DCVA 4DIDA 5DN6D 2GZHA 3AVTA 5JRJA 4HAXA 4II7A 3IQWA 3OEEA 1LS6A 2VHCA 2QP3A 3T1VA 1S1MA 1E9EA 3OAAA 4GOXA 4GOJA 4B34A 1W0KA 2GK6A 5TDHA 3RSLA 1AK2A 3UMRA 2IK8A 4BFYA 4TL7A 1BKDR 3AP3A 2NQ2C 3CUEF 2PMDA 1BYUA 4IOMA 4WIAA 3CB4A 2YKGA 2C99A 4ZDWA 2OFOA 4TMZA 4PPFA 4AD8A 1US8B 2QRZA 1VKJA 4LCBA 1LW7A 3AH8A 1FMJA 1VCNA 1F2UA 2C5LA 2RAPA 2ZXUA 3K70D 4QM7A 2H1LA 2ZRKA 2OLKA 3UXMA 5DIFA 2CE2X 2OBNA 1L4UA 1TNDA 4LV6A 3P1JA 2BMFA 1W36D 1UF9A 4F4CA 2KBFA 3B82A 1EXMA 1P61B 2BBTA 3GFOA 1TMKA 1NG1A 2J9RA 5BYKA 1XXHA 2Y8EA 4PPQA 2XSZA 4HATA 2BBWA 1NBMD 2IBMA 4YC7A 3LO5A 3K0SA 3K0AB 421PA 2AL7A 2JJ2D 4POAA 1WRBA 1AQYA 1W5TA 3REGA 1V5WA 1G5RA 4TT3D 3A37A 4QC2A 4QBGB 2WKQA 4RD3A 5E7IA 4ARZA 2V1XA 1G19A 3LQQA 1AGRA 1KNXA 2GXSA 1OH6A 1XTJA 1GAJA 2BMEA 3KQUA 3MCAA 4DLXA 1DAKA 3JVUA 3IHWA 5JS7A 5H68A 4QJ5A 2R6GA 2CL0X 1ZINA 2N42A 1T3HA 1CJKC 4JT4A 4NE2A 5C4GB 4HLQB 4AYWA 2JGNA 3DEFA 1XJ0A 1DAHA 3B1ZA 1NLFA 3GLIA 1WBDA 1X1RA 4ZKEA 2FF7A 3BOSA 4LHXA 4UNRA 2NTYC 4HAUA 5DSZA 1P3JA 2IYSA 3FHTA 1FFHA 4JMPA 1OB5A 1AS2A 4X8HA 3THYB 4B35A 3GLHA 2AR7A 3V00A 4A1FA 3CX6A 1AGPA 1HV8A 1D2EA 2WIAA 1PJRA 4DJTA 2FEMA 1QHIA 2XOKD 3DMNA 4Z1MA 2ZM5A 2CVHA 2AKAB 4PAOA 5FBVB 1CR4A 3ND9A 1NI3A 4MGIR 3DOEA 2WJJA 3WYGA 5A0FA 2VP6A 4PPNA 4Q4LA 3X2SA 4LV5B 1ZCBA 2EWWA 2Q6TA 4OHVA 3QY0A 5IK2A 4JLOA 1Z29A 2GEUA 4L9SA 2NO0A 2YHSA 4N3NA 4PFSA 3AVVA 3LDAA 3R9WA 4DB2A 3QG1A 2J1LA 2PT7A
chains in the Genus database with same CATH superfamily
2PZBA 4A03A 3BE5A 3UKOA 2DUUA 4A8JB 5DW0A 1L5RA 3TIXB 2VDWA 1T3ZA 2YMLA 1RACA 1V11A 2O1SA 4C5CA 4PIPA 2ZUVA 1QM5A 4EB6B 1YCFA 1OFTA 1OKKD 3QLTA 5KQSA 2A1UB 2CC2A 2H48A 2WY2D 2NVBA 2BI8A 3GFBA 1NI4A 4XM0A 2RHDA 5M5BA 1T9DA 2VWPA 1PSZA 2NU7A 2GTPA 3TCKA 1YS2X 3USCS 1E1LA 2VC2B 3S8EA 1E2KA 4TZ0A 1OXUA 1IY1A 2X0FA 1UBFA 4TT8A 3QW2A 4ER0A 5HGXA 1KF0A 4AQYB 4HI0E 3SD7A 1RRMA 1GGMA 1QRSA 1XAJA 2HR1A 1UBCA 4X85A 3OKCA 1WQ3A 3SSNA 3ZZUA 4MO9A 1JDSA 4L1KA 2REQB 1JHUA 1USUA 1J0XO 3OFSA 1DVRA 1IIBA 1XWFA 3TTUA 3KZMA 1N5MA 2IVFA 1Z37A 4NBSA 4I5IA 3IBSA 3SICE 3GJ7A 1NPDA 3V9PA 4UMEA 1I7QB 4OU4A 4EKNB 2NG1A 2PGXA 2XQKA 1WZCA 2ZQYA 2I1WA 5AJTA 4I1UA 5HFJA 2Y0PA 1KJYA 3BRCA 5KNBA 2WFLA 4DCSA 4QJ4A 2C7BA 1TQDA 4PV7A 4MHTA 1DG1G 4HDKB 2O5VA 1OQAA 5ALEA 2OA0A 2AFRA 4G0VA 2DWOA 3B6KA 3HWWA 1FVFA 5IUJC 4LDQA 1Z12A 4HZUA 1Z25A 3BTVA 3ZBQA 1ZRMA 3DB2A 5FV4A 4PN3A 4F3NA 1OTHA 1OT3A 4J6FA 1SB9A 3DDSA 2WAYA 3IQDB 3ORSA 4N49A 4TKVA 4IDBA 1IOLA 2RARA 1KWKA 3DBRB 5TQ0B 4FR0A 5F9MA 4WV3A 1WHTB 3LRTA 5DF1A 3IP5A 5A6VA 2ISCA 2R84A 1GG9A 2C2BA 3KQSA 4MGEA 1J06A 2XT9A 3SJBA 1IY9A 4B47A 1OH8A 3DXZA 4Z3DA 2ZM6B 4DCTA 5J40A 1NXPA 1NYQA 1SUFA 4Y0VA 1YI8A 1BDJA 2ZBGA 2Q99A 1FLAA 1KO8A 2B8WA 3OWXA 1VRCA 4UBNA 3WIVA 4C6RA 5BW5A 2ZZNA 1ZEJA 1ZVVA 3MQ2A 4AMUA 1Z5NA 2NV0A 2OD7A 1GU7A 2PXXA 1A50B 1E9DA 2PV0A 2VKQA 4G0XA 1Q6YA 4HMQA 1NBIA 4QFMA 1B0UA 2BFFA 5JAMA 2CNKA 2CXXA 1NM5A 4V0SA 3RBXA 5C34B 3JQRA 3A1WA 2RONA 4GBMA 3BD9A 2FCAA 3NP7A 1J8QA 1E61A 4V0KA 4DREA 3UXHA 2JGMA 3BSFA 5BT9A 1K0FA 3ISTA 2X0EA 2LV8A 1P9WA 4DV0B 1H3EA 4GKAA 4JJZA 3HA2A 2PBLA 1M1NB 1QKKA 3T06B 4X1KA 4H31A 4LZJA 1Z4LA 3UWMA 3QUSA 1Z82A 4G36A 1ATIA 4RIEA 3SG0A 3HDYA 3KR9A 3QELB 1RTTA 3SS8A 4AMZA 2AC2A 3R5JA 3AB7A 5C3UA 4XWGA 2FWJA 1GZHB 2G6BA 4V39A 4L8GA 1JEDA 1ENPA 2Z98A 4Q02A 4PLHA 2Y1CA 3HYRA 3L7YA 5AUNB 3H99A 2QLNA 5JIBA 2BGNA 5IMBA 3I6IA 3V4VB 4ISCA 5ILQA 5KC9A 1XDWA 2ZSHA 3U5ZB 1R6TA 2Q1UA 1J7KA 4G8BA 2BGTA 3IBCA 4HH1A 2WAXA 4MRRA 4CLOB 5JT1A 1WQ1R 5BWLA 1CERA 2WSMA 1ZM9A 4LC9A 5IANA 2FN8A 1EGQA 2BEWB 2H9AA 1L7XA 3I34X 4IV8A 4LBYA 5FPQA 5G0SA 5BRJA 5CNIA 4CKWA 5JBQA 4G8JA 4TTIA 2I87A 5DTRA 4Y9TA 1SPBS 3KDPA 3NALA 4EAQA 5M04A 3CC8A 1TK9A 3E8MA 1JA0A 3EMBA 3K2QA 4WINA 4AF6A 5HJ7A 1RC8A 4G0PA 5TNXA 2EYUA 2W48A 3IHTA 4QHSA 1OYVA 2FSSA 2JAQA 3N76A 2XXJA 4Z8YA 5L3SA 1J2TA 2FG5A 3PDHA 4HX2A 3ZHRA 4BRSA 3ZN2A 3CIFA 4ZO8A 3MCUA 1IAQA 2F3UA 2GEFA 1C9KA 1ND6A 1C0KA 1WU7A 2BFDA 3M9XA 4NMHA 1UZUA 4UJ3A 3FPLA 1RZVA 4AUNA 2K5UA 2WSYB 5JHGB 4UTOA 3I5XA 2AZXA 1ECGA 1RQLA 2Z3WA 3H9UA 2VSYA 5JPIA 4B3DA 1Q1AA 3HKBB 5EMKA 3VU9B 3DCJA 4EPRA 1TB4A 3B1FA 4QDXA 1BU8A 4C30A 5C1DA 5BV7A 4JNKA 2IX3A 3HUFA 5DNDA 2FN7A 1E6WA 4CQJA 4R7TA 2PVSA 4HDQB 4V0OA 4EKEA 1DXHA 2DTXA 5H02A 3HYCA 2YXBA 2A1IA 1SGWA 1L4GA 3T3EA 1QQ5A 1X1EA 1W4LA 2WF9A 4E12A 1YL7A 1RBMA 2FUEA 3VSAA 3AJEA 4HUQA 2QT9A 1G2PA 5DM1A 3SQDA 3WDMA 1XF1A 1DQYA 3LA8A 1DKUA 5BNTA 4H7FA 4BFSA 3SE7A 5E1MA 1R50A 4RE5A 3AF6A 1P73A 4FMDF 2EGGA 3EC2A 2C59A 3VOAA 4CM8A 5AHOA 3HLYA 4HJXA 3AI3A 1HDCA 1QIJA 3N2KA 3QJGA 4PZZA 1BCSA 1SBIA 3H5RA 2I67A 5E4FA 2V96A 5FNVF 4KR9A 4BZWA 4CEIB 3QXXA 4NU5A 1Q1NA 4X92A 3NRJA 4UHCA 1KOGA 2YZ7A 2W2KB 4YONB 3W4JA 3WMXA 2HSEA 1NBMA 1JSLA 1VCIA 2WD9A 1U0LA 3PF9A 3QYJA 3T9AA 4L7QA 2F8MA 4I81A 1E60A 2JJ2A 3L6OO 5FIUA 3TSCA 1N0UA 3GMDA 3RVRA 1XZFA 3PFFA 5AVVA 4CM9D 1S3SA 3L7BA 4EFMA 1PDOA 2O1WA 3TS1A 2VPXA 3FN4A 5A71A 2OWDA 4UKDA 1N25A 2XJ9A 4PS0A 1QGUA 2WDZA 3BDIA 4XVUA 5K0LA 3ECSA 2DULA 2DCMA 3GUHA 1YFKA 4RKEA 3GP8A 2Q6KA 4TMTA 3SDBA 4EUNA 5FORA 3O8QA 4JI5B 1HYQA 4BFCA 2F2TA 4RLSA 3RKRA 3C4JA 3KOZA 5A6SB 3I62A 4YP0A 4JJ8A 4KMOA 3ZV4A 2HFKA 1XFAA 2VR1A 4CFZA 1DI0A 1FDWA 2IYQA 1ZOLA 2GK7A 4MCHA 3TMAA 1F51E 1A5BB 2WMDA 3VNBA 1OH5A 3RSZA 4Y6RA 1NNUA 1Z6YA 2W7TA 2PA3A 2AYYA 4WZ6A 1EWVA 3VR3A 1XEWY 2P1RA 4LJ4A 1GN8A 2AG1A 2B34A 2Q3LA 3FB4A 3MD9A 5IYZB 3ETDA 4GVLA 3PNBA 4BWVA 3PGKA 4JP8A 4EGFA 2DUMA 4Q9LA 4P31A 1RXVA 1OJLA 2XZLA 2HA5A 4LA4A 3I6MA 3MWDB 3RROA 1KJQA 4NYIR 2WZCA 3EPKA 2QP4A 1R0WA 4JYCA 2NVOA 1ZY2A 2ZJ6A 1XCBA 3T4EA 1OY1A 2WHRA 4Q01A 2XNSA 1LBSA 3QLUC 1U3TA 3DBLB 2VK2A 3M5DA 4FC6A 1C4OA 2JC3A 2GERA 3D6JA 3I5UA 3OPVA 5DSTA 1Z22A 3HB9A 4M36A 1X9HA 3R0IA 4TUYA 5DHFA 1CHDA 3MIIA 3I37X 3EFHA 3U3JA 1JEYA 1SQFA 3P0HA 3TCXB 1ZNZA 2PT6A 4C7OB 1WDMA 3A4IA 3E9CA 3G8YA 1J21A 1IB0A 1VLMA 1M1YE 3ICWA 3TAXA 1WMSA 2NLOA 3B13B 3AESB 3NHKA 3W05A 1U90A 4EW6A 4EPYA 2P5YA 3NPMA 2PUDA 8LDHA 1K8ZB 2HK7A 1DUSA 3DMGA 3GFFA 3PA6A 1PFYA 2JDIA 4TWRA 5EZ5A 4BJHB 2FMTA 1DBVO 4JJGA 3EX7C 3G6KA 4R2JA 3PV0A 2D2IA 4KSYA 3ZWQA 5KNBD 3GCZA 1TUBA 4WXEA 1XXHB 4BKQA 4EVSA 5BORA 3JS5A 3JQFC 1OSNA 3OQHA 5CA0B 1BN6A 4UUNA 3DPUA 3UAOA 3GJ5A 5IC5A 5CK5A 3EBPA 4TV9A 1G6KA 1J09A 4FWIB 1CFJA 1AZWA 2J5BA 5K6RA 5EE1A 4URFA 1DQZA 1P45A 1Z4MA 3ETGA 3RUIA 3UHFA 1Y7HA 3UT5A 3KUDA 4I66A 1CY2A 5KVVA 5CLJA 1LRJA 2EL7A 3OF2A 3FFBA 5KCMA 4W1PA 1HG1A 2I8CA 2JJMA 1QC5B 2HWUA 4D25A 1GV0A 2AFIB 2GI4A 4JSTA 3WIBA 1VE9A 1VKRA 1Y3FE 1N77A 1K6EA 3FKSD 1R0LA 1USVA 2EFDB 3AF2A 3C14C 3JZMA 1KVSA 2AI3A 1DWOA 1FDIA 1O5TA 4X60A 5CFRA 2R68A 2WQ7A 3OOHA 3KSAC 4YJFA 1AGYA 3RK1A 3SPXA 2XI4A 4DMCA 1HSZA 4FFRA 4ZOBA 5K51A 1C1YA 2LCIA 1EXVA 2MWMA 4L2IB 5A03A 1AUVA 1P4JA 2QS9A 1YQGA 2WIJA 1RXSA 3MEQA 2WP0A 3QNWA 2G07A 4MYHA 3S5JA 3L7JA 5JQGB 1WP4A 3EWSA 4KWHA 1Y5RA 1LQ2A 2QE7A 4RIIA 1U0BB 3WO1A 2G82A 2YVLA 4J0HA 3FOEC 2PKRA 3JZAA 2D0OB 3GPBA 3UATA 2XQIA 3SLRA 3U09A 1Q50A 5AK0A 1E5DA 3I12A 4OMFG 1JAHA 4RZUA 4F6RA 4JY7A 3JZDA 1MW8X 4XD7A 1TMGE 4I55A 2N46A 1AQLA 4MYRA 5ALTA 4F04A 2A58A 1QYWA 4I5GA 3JVDA 2ATXA 3T5BA 1E8MA 4YRTA 4OJQA 3Q9LA 3LX8A 3NUZA 1NE7A 5EQTA 4YRFA 2AA3A 1SRRA 4LQ4A 1GR1A 2QN1A 5EERA 1C9EA 4Q15A 4R2KA 3T1QA 4XZ3A 1QGED 1FNCA 1X7ZB 1CUJA 4F2HA 2QIOA 3USZA 2F1KA 5H1YA 2UZ4A 1JA1A 4KNYA 3QYAA 2RKOA 4ZI3A 2WNHA 2BR4A 3AVXA 1ZAKA 4FHDA 4KQGA 4UQLA 1Q3TA 4Q9KA 4DV7B 2DUJA 2MR5A 4JBHA 3KSZO 4CNBA 1VRVA 1UDRA 2QTTA 2P11A 2HSWA 4F45A 5JYCA 3CN7A 3O6VA 1OWPA 2ODNA 3IPCA 4JLBA 1C29B 1XNHA 2QTRA 2WT9A 4DDWA 2XNJA 1CDDA 1DAOA 1RRPA 3D1JA 3NIBA 1A9XA 4UNSA 1H6DA 3B1XA 3LH5A 1SKAA 3AYXB 3B1KA 5EIOA 2DFNA 4IQFA 4UUAA 1J2UA 5JNRA 2QYHA 3S1SA 5CFLA 4DLSA 1NY6A 1ZOOA 1SG9A 1WIWA 2O2EA 3WBFA 1X8JA 4RGVA 1ST3A 4BRWA 3I45A 3UHJA 3BJEA 3FM9A 1RZRA 3C7DB 2CYAA 1ISSA 3HR4A 3K0BA 4GDMA 3DFZA 1PR0A 2R6R1 4O2BA 1SZPA 3D2LA 2HJWA 3NOQA 4QU8A 3ODPA 4XARA 5ICCA 1ELOA 1JPNA 1RDFA 4MS4B 1P39A 1BCRA 1PS8A 2ZI4A 1Y63A 4YMLA 1RPNA 3HGQA 4UHBA 5AKJA 4D41A 1A71A 3MJ4A 2B1RA 4OFBA 4FGJA 4J7UA 4Q4JB 4EHHA 3PQCA 4NJMB 3TRHA 1SZDA 2Q8PA 3IP1A 3JASA 3O93A 4QXPA 1I7SB 2C2OA 1PUIA 121PA 2YJTD 1LK7A 4D74A 1L7RA 3WL3A 5JCZA 3EXIB 5E7QA 1U7DA 4PXYA 2Y92A 2OAP1 4PYJA 5DXJA 4XDYA 3LVRE 2BMAA 2PX3A 4EJ6A 4H77A 4NULA 2EATA 3VI3B 3WHLA 1R9MA 1R0CA 1WUJS 2OGSA 1EP9A 1LH0A 2QJTA 2CMDA 3Q7IA 4XEHA 2YRXA 2FH5B 2ZI3A 1E1MA 3DKIA 4S1PA 1KORA 3EQ6A 4G5OA 1FX1A 1KNQA 1KEEB 2QN6A 4JB3A 3T7CA 2HIAA 4CQLA 1JILA 1MTOA 2QTNA 2YJ4A 4FILA 221PA 3PZBA 1UPUA 2BHRA 2O4CA 3O2QB 4F86A 3U0VA 1Q5PA 4KQ6A 1F7VA 3WGJA 1EA7A 2I6XA 3FX2A 1TKAA 3MK31 4MQ5A 2OZEA 3G13A 1RYBA 2ZSAA 3ZV7A 3IKJA 1KSGA 1L5HA 4PICA 4HYEA 4RXMA 4CDNA 1E2NA 3NNNA 3RLIA 2FOXA 2RH9B 1CIVA 2WF8A 2XZDA 3GGDA 3ANMA 3GR6A 3AFHA 3OTQA 4GYWA 4LZZA 3WWZA 1WF3A 1D4FA 1CZUA 2Q5IA 3IEMA 1BTOA 4INPA 4JLVA 2XZOA 1DMSA 3IPAA 3ODGA 1Y4DE 4DBLC 4OHKA 1BGWA 2ZFUA 3LRPA 4U1RA 3PQEA 4P5PA 2QJFA 5JMPA 5HEKA 4C89A 3AX6A 1P9NA 1XRNA 1L5FA 3BK7A 4W5HA 2NPFA 5A04A 1A04A 4O1HA 5CAEA 1QZXA 3OU2A 3SZLA 5LMCA 1YNOA 3H13A 4WVLA 3A6PC 5FTKA 5DMHA 1QMPA 4N65A 3D2CA 2X2FA 2XMDA 4IXDA 5HIIA 1JBQA 5L3RA 2FWBA 2EGUA 2FWIA 4EGJA 3BHJA 4KBGA 2HAEA 4E5PA 3BPSA 3MCZA 1MXFA 1ORHA 4GZ6A 4CVNA 9GPBA 3RC3A 2WB4A 5BUCA 1RXCA 1NA5A 2PL3A 1A0OA 2VP3A 4G09A 2DCUA 3V7YA 4QDKA 5BNWA 5EP1A 3AL2A 5F7ZA 4OX9B 1EGVB 2VZLA 4JYPA 1RJ9B 1DC5A 3VC7A 3GEHA 4BC1A 4EELA 2JLAA 5TC4A 1LLQA 4CM1A 3F49S 4DMGA 5AK5A 4QRDA 1P0CA 2YNMD 4WN3A 5JS2A 3PXUA 1U9IC 3EC7A 1EVKA 3U60B 2ONZA 3OJCA 1OLSA 1U94A 2I65A 2JGIA 3KL4A 1AKQA 4WXRA 4C0LA 4OI0A 2VYVD 1GCAA 2MDTA 3EVTA 3PPXA 2NACA 3HJGA 4TTAA 3G0HA 1EDDA 1NW5A 2ZJZA 4ZRDA 2B9EA 3BA6A 4GG1A 2YN4A 4CV0A 3EIQA 4PVDA 5A1JA 4H1HA 3UBMA 1WCIB 3ZCSA 2XECA 3PWTA 4IXWA 4LVUA 4U6NA 2ZIAA 3W9YA 5ARBA 4GPZA 2OSVA 4P4TA 1FDUA 2G0NA 3L49A 2GSDA 1EVJA 2G4VA 2JHGA 5DHPA 3RASA 4ZAFA 5JJ5A 1E6KA 2WTNA 1FW6A 4UVIA 4RPJA 2HQSA 3RRJA 3K70B 1PT5A 3SSOA 1HOTA 3PDIB 1ONNA 3QEMA 4RGQA 3V7NA 5A5VA 3KAQA 5L95A 1QO9A 4LXYA 1NQVA 3KQNA 1SXQA 3O8CA 3R5KA 2W6QA 2ZSUA 1TF2A 5F5NA 3RU2A 3J80A 2OKGA 2EKQA 1KVRA 3MJFA 4YT5A 3WNZA 2C94A 3GLUA 4HDCA 4AZSA 4UOEA 1QQAA 1FJGB 2DWPA 1XMIA 2CFRA 5LP6C 1YT5A 5KQMA 3A3KA 3NKFA 1TAUA 4AU1A 1ISHA 2F9FA 2O2GA 4XYEA 2ZB8A 2J85A 4L6CA 3ZHXA 3OZSA 1DIOB 4LDPA 1GPUA 2D5AA 3P96A 1QVRA 2XQFA 5CB6A 4NPAA 1YBAA 2FXIA 3WAGA 1KEPA 3BS4A 3D4OA 2JFFA 3PC6A 1EJBA 4OOFA 3S7TA 2R11A 3DZFA 3IAM6 1CXZA 4QPPA 3LYHA 4A8JC 2SICE 3ETJA 4PSVA 1PG2A 2F55A 1O03A 2RHOA 3T1OA 3WLNA 2DTDA 4HTAA 2IEIA 1JP7A 4QUHA 1E2HA 5AHKA 4ZI7A 2D74A 3PD0A 5CLFA 1TM3E 5EGSA 1Y8QB 1GUFA 1ZJ6A 1FXWF 2F8LA 3L0YA 3CLKA 4LVNA 1UK9A 1G1AA 3RIHA 5C7IO 2JIQA 1HDRA 1Z4PX 2OUIA 3O0DA 4NDAA 4QFCA 3G2HA 3FOBA 1AF4A 2GJ8A 3QVTA 3H2BA 4BO1A 1G5PA 2OLEA 1TQ8A 2C0CA 1PHPA 2GESA 2E4YA 2TMDA 3DT6A 5HK9A 3Q0IA 1E3IA 1QJ4A 1CFZA 2GYVA 3OPMA 2BGGA 1U0GA 1Q0LA 3B7WA 2H1FA 1B3RA 1UANA 4JAVC 1F8GA 4O4LA 4UM7A 5K0BA 2VDJA 1RD4A 2V03A 2QNIA 1UT5A 2G4LA 1UXGA 1PGOA 4BO8A 3QVSA 1NVDA 2PWZA 1CVLA 2ASEA 4FVTA 4D26A 1H2ZA 3D9QX 3QEOA 4CETA 1ZL0A 1F2VA 2P9YA 2ODWA 5HCIA 2RGAA 4X00A 4PYRA 4QREA 1YJXA 5K01A 7GPBA 1LSUA 4Q4AA 1IXYA 4FX5A 5JE8A 3MT8A 3PR3A 4H4CA 4BO3A 4FGZA 1R4AA 3FCSB 1DG9A 2P5TB 2Z4SA 1ZI6A 4L4RA 1FQJA 1WS6A 2JI8A 3RFTA 4OV6B 3ZGOA 2RAUA 1OTYA 1T9KA 4TWBA 4R4JA 2W11A 4RYLA 4JC5A 1WNFA 3C5EA 1NUTA 4LJ5A 5ER9A 3LBNA 4B74A 4DIMA 3E9MA 4B5KA 3OQMA 1RQPA 1W7AA 4G5RA 3OQ1A 2OXFA 4X1IA 4Z9AA 3KJHA 3R3HA 2VA8A 2IEBA 4J0DA 3OVMA 4FFPA 4TKMA 2OILA 3KOYA 1RXYA 3Q2IA 4GM0A 4I50F 4QJIA 4XPIB 3M4XA 3UV7A 5HRCA 5CHEA 1KR5A 1T6NA 1DADA 4KQMA 5H82A 1E6EA 4JYZA 4JLSA 1EE9A 3WVNA 2YV1A 2XUKA 2HNKA 5CVDA 2GFHA 5JADA 3HO1A 4BU0A 5HBGA 4UHFA 4ENUA 1PWXA 4JFAA 4A0QA 2P4EA 4KXVA 1P0PA 1TM2A 1QH8B 2FRVA 1OAKA 1WPQA 3FYDA 1DRVA 1JHYA 1NSTA 4NJEA 2CDNA 3TR6A 2JG3A 3ZWOA 1RI2A 4QWMA 5G0WA 3BGSA 4RC9A 2QQ0A 4X91A 4Q03A 2ZYRA 1M67A 1WSBA 2FR1A 2P0AA 4IXNA 3ELYA 3GPIA 5CPBA 3VC1A 1GNPA 8ATCA 4XOUA 4YP5A 4P93A 5IAKA 5K0CA 5C1PA 1YK1A 3WZMA 2BKAA 4R8RA 5AKKA 1FU7A 4NCIA 1E3QA 1GA4A 4YCBA 1QX3A 4B48A 2W70A 1WUHS 4M3NA 4IL5A 1PJBA 3OPQA 4LNUB 1JA9A 4MJLA 5GONA 1CDOA 3CXRA 3KEQA 3ZD8A 5JNSA 1K66A 3EN0A 3B7GA 4GECA 1ZX1A 2QQ5A 4F1KA 5ERXA 2ZIUB 1KQFA 2B9VA 4U5QA 5K0JA 4L02A 1ST2A 4XRGA 5FWXB 4KQHA 2C7QA 3O82A 4FHFA 4RHEA 5K8VA 4JMLA 2OT3B 3PXDA 1PR9A 2ZBRA 3NGXA 1GDDA 1JVSA 1D9XA 4NCHA 4M89A 3LTNC 4QWWA 2KI5A 3Q6IA 2Q3MA 2Q5HA 2Y05A 3D0QA 1CEQA 3R9IA 4BP1A 5A62A 1G2IA 3FOWA 2Z6QA 2W93A 3LUBA 2HIHA 2H2FA 1ZVJA 4X1YB 4EM6A 1U0TA 1E2GA 3OPNA 2O3SA 1KE2A 3SHTA 1ABEA 1CUCA 1XD8A 4M7OA 3RTAA 4GKKB 1J8FA 4WI1A 4P81A 3TLBA 5KINB 1VJTA 4MVJG 1DIAA 3WLIA 2RDMA 2FFAA 2WTMA 5DCLA 3WDLA 1P2UA 3BMXA 2XTZA 3IA7A 4G56A 4QNRA 5TGDA 3JQ9A 4HXYA 5TF4A 5DP2A 5THKA 4C5BA 5B3JC 4MQUA 5HDBB 4FMCF 3PFIA 4KWCA 5A7GA 4TLDA 3S5UA 2E1RA 1BXGB 5FQNA 1PJ4A 2QTBA 3VPSA 2PKWA 2OO5C 4K86A 2VOEA 1MV8A 2XGGA 5EHGA 5HX7A 1M83A 5EP4A 4YRNA 4TPKA 3UJBA 4URYR 3KJZA 3EGOA 3M82A 3OEHA 4ND5A 1YULA 1F3LA 2QAIA 2C61A 1ZDMA 5KB3A 4ZHQA 4KFRA 1TD9A 5CMLA 5TGTA 2ADMA 3FNHA 2H2IA 4HDSA 2YV3A 1SM4A 4JEIA 2H31A 4XGNA 1WXFA 5HM6A 3ZTYA 1YJ8A 1FUEA 1EVLA 3IOCA 5LQRA 1J8VA 3ZJVA 3C8ZA 3FHLA 4LTNA 4RDHA 4DV4B 2O06A 2ZJ4A 4NBNA 1QO0A 4HQKA 5EUQB 5BV1A 1C81A 4B83A 2PZMA 4HRVA 5AVJA 3MTDA 4FZVA 4NR0A 4AJKA 3EH2A 4BLWA 4ABTA 4L5AA 2Q3BA 1EEHA 4HOYA 4RH0A 2ZSKA 4TLLB 2IXEA 4EGCB 1TU3A 3L18A 1KJJA 2V6MA 1HE3A 3EGEA 3R7WB 4DLUA 1SIUA 3HYLA 2FYTA 4KI7A 4WKCA 3BEDA 4DJAA 3AHHA 1NVTA 2CDRA 2OXRA 3KDAA 5L3QA 3VDQA 3GLHE 1ZBDA 2SKEA 4DCJA 1V5EA 2EERA 4TQGA 1QQ7A 2I2WA 3G9UA 3GO4A 2AJ8A 2QLBA 2ZKIA 4NVRA 5TY0A 1CJSA 1CY7A 3ROXA 3U56A 1FMFA 1R66A 2ZVJA 3OTWA 4IDHA 5A7FA 1MC4A 4BBAA 1T8SA 1JZSA 3T0FA 1B6SA 4RZ3A 4ZPXA 1NVAA 4LZWA 2OVBA 1CQIB 2BDEA 3EK2A 3RYFA 3F7TA 1SC3A 2LDBA 3BE4A 3O21A 3NWJA 4GRDA 2C92A 3ZJ4A 5FH9A 1NY5A 3EVFA 3MVEA 5FOSA 4CF6A 1KRXA 4F1WA 4B6OA 1Y7IA 2BEJA 2VJLA 4FDUA 3ZX4A 4E08A 3Q98A 4HNAB 2B37A 5ED0A 4FFBA 2TMGA 4B75A 3R8CA 2A0FA 3FAZA 5ALGA 1VJ1A 2GBGA 2V7UA 3HVUA 3WO0A 4FFOA 1T26A 5JNUA 3GNQA 2C5AA 4LMRA 5D51S 1A9RA 1Z5VA 2ASVA 5DYGA 4PFKA 1POWA 2R6HA 3E9YA 4F5DA 1UKCA 5DNEA 1S96A 1RHKA 1FX0B 2XZPA 1JKJA 3M3PA 3R7FA 3FMOB 2Q4DA 1ESDA 4J43A 4NMWA 3EYWA 1HE5A 4AI6A 2PPVA 3H5TA 3OCCA 4V2UA 3WMWA 5TVGA 3KALA 3TAHA 1COWD 1RP1A 4Q6WA 1JDJA 2G83A 3L6RA 3L7MA 1KXZA 1MJHA 2H07A 4L5BA 3PNQA 1JUDA 1ZOSA 1KL7A 3W3ZB 4PQFA 1V16A 3NHFA 3T52A 2YJGA 5K4GA 5KNBH 3QMMA 2IWRA 5I6DA 1G3MA 1MP0A 1ZUHA 2VBCA 3A6GA 3EBLA 3GUYA 1XQWA 3ISVA 4EHJA 4YP7A 5JZBA 3MJSA 1YQXA 1Z2DA 2C8KA 3KXKA 1M74A 4NFLA 1V43A 1IMOA 2DHEA 2OBMA 3AKDA 3MNFA 4JBGA 4XI9A 5ECWA 5NLLA 2IKSA 4MW1A 5GVSA 1V8ZA 2VDOB 1ZH8A 3IUSA 3P20A 4OQMA 2IU3A 1GTJ1 2J3JA 1D5CA 4R16A 3HY4A 3M6IA 1K7SN 1XPRA 4IVQA 3TRFA 1FC0A 3PEYA 2WQ6A 1DKRA 3N3BC 4B1FA 4F46A 1I3LA 4X94A 3VZBA 4BX9A 1KRWA 1F6DA 2YBEA 3ZYZA 4O3MA 4G25A 1A77A 4KDFA 3TQQA 3MW8A 2A14A 2DY1A 2ALJA 3GGCA 1FXUA 3UK6A 5CB4A 5FPHA 4BTLA 5LYJF 1MGPA 2HBZA 2I2DA 3M3DA 3JCZA 1N4AA 1AGNA 3N0VA 1ZK1A 1FP4B 1J0CA 1FJHA 1TYCA 2FMHA 3BIWA 3E5RA 3FPBA 4MUJA 1ULTA 4LJYA 4NU6A 1H8ED 1XTKA 4GC9A 3RRMA 4YMUA 3HDGA 3WADA 3CZ5A 3W5JA 4L8VA 1PEAA 3PG5A 1VIYA 4R5MA 1CVRA 2QK4A 5JY1A 4RORA 2VS1A 1TZCA 3T7AA 3V7WA 4ITUA 3PVCA 5DM60 1AS0A 1P5FA 1BOFA 2DM6A 2XT6A 1F6BA 2PEZA 4HFJA 3KG2A 4PG5A 3H4IA 3H5WA 4WWHA 4Q3DA 5GPBA 5C4IA 1N0WA 1GP2A 5COQA 1HBJA 3ESXA 3SX0A 4URUR 1S3FA 3BMQB 4TSRA 3S27A 2DGDA 3M6FA 1M0WA 1IWOA 1A2OA 1BMDA 1ZS9A 2VLIA 4HK4A 3GARA 3N6XA 4JVNA 4PHTA 4H0NA 4QTYA 4UD2A 5REQA 3O31A 4MV1A 2Y0DA 3D54D 1GYPA 1Q44A 5JDIC 1KI9A 1QIDA 3HFJA 3SIPA 4X97A 4CKCA 2Y99A 2Z2IA 3EZXA 3FH0A 3U3OA 5K0FA 2XNHA 3PEUA 3T5TA 4ADSG 2JLXA 1C9NA 2AB0A 2QD2A 3N3AC 3X44A 4J8PA 4M21A 2BI4A 4IQGA 2W2LA 3UA3A 2PMFA 3ANTA 4FE3A 4AAYA 4OHOA 4QO8A 1VECA 3SGLA 1ZSYA 2G0AA 1F2UB 4OATA 4PZ9A 3V55A 1J2EA 4PZEA 3PDJA 3SZRA 3MRSA 4ZU6X 3DT8A 4B4UA 3JAMA 4M1OA 3IR5A 4ZOLA 1YB7A 4R1UA 2G8NA 5KUTA 2HZ7A 1GUYA 5DB4A 3KV1A 4F4FA 4LSMA 1YC5A 2QUBA 3BRWD 3U17A 1EBUA 3SX2A 3ADCA 5T67A 4HY3A 3HNRA 2RD2A 3NTQA 2IEAA 5F1PA 2IZ1A 4RU1A 3DTNA 3EEBA 4NFSA 2BH9A 2XUDA 2ZSDA 3UJAA 1J49A 4RJTA 1PRYA 1U6IA 1TO1E 1ZQ9A 2R7NA 3DCYA 1QBKC 1QQTA 4A0SA 5A5DA 2V5VA 1WCV1 1PEYA 1E0KA 4B3SB 1MGOA 4XVQA 3VH3A 4FLMA 4TVSA 5GINE 3DV9A 1QR2A 5CLQA 4Z53A 1L2TA 2JJ8A 2WHEA 2LPMA 4IGKA 4DANA 5C2JB 1JYFA 3S28A 4GO1A 2GZAA 3DZJA 4H1VA 4MICA 1SUCA 4PXAA 3DEKA 2VBGA 4TWZA 5BQOA 3BJMA 4HVAA 1EUDB 4ARZB 5BSEA 3GCXA 2YWGA 1E6LA 1W5FA 3TL6A 1RQXA 1ORIA 1WHSA 3Q41A 4YHBA 3GJ3A 1G4HA 2AIRA 2G67A 3AGPA 1O6ZA 5C7LO 4C88A 3H5IA 3C1TA 1Z34A 3RIYA 3AJAA 4RLHA 4P92A 1NP7A 2I9PA 3I9LA 1KFKB 2G40A 4WOCA 3ZBTA 1XQ9A 4YJ3F 2Y1XA 3K2EA 3L06A 3OC6A 2CNDA 4LOLA 3ROKA 2JIRA 4MKFA 4UHKA 1OLXA 3VH2A 4BJ3A 1WDTA 2ATIA 4N7RA 3WWPA 4K46A 1D7OA 4E0BA 2UZ3A 3NIFB 2NO5A 2B7LA 2ZBUA 3MCTA 1RHRA 4EFLA 3ANLA 4IDGA 2GCOA 4TN5A 2QBYB 1ITZA 3I09A 4R81A 4FB4A 4KV9A 1AQ6A 2CZGA 1IZ9A 3AHEA 5AM0A 2WKRA 4HH4A 4BEBA 4E03A 5H16A 4EMTA 2QLTA 5EUCA 1CW2B 2ZRJA 4FNGA 4KTVE 2WHXA 2RGRA 3AF1A 4AKEA 1GCOA 1B8OA 2R8OA 4TGLA 4JP1A 2CUZA 1LLUA 3A6HA 3LC1O 4WCDA 1NBME 1ZM4A 3KVYA 4UU0A 3UHAA 3K8QA 1CTQA 4J94A 1O89A 2AMYA 5U4XA 4D9MA 2Y0CA 2DR2A 1Q0SA 4DIEA 3AGQA 1VLHA 2J4FA 2JLUA 4FEAA 1TPZA 5K6AC 1ZUWA 4TYQA 1H66A 2AN3A 1UM9A 1PFKA 3UWDA 4I08A 1JSXA 1T8RA 5DCUA 4LC1A 1R8XA 4DMUB 1BMFD 4UE2A 4S04A 1JJFA 3CJRA 3VH4A 4C3VA 5DYIA 1KK2A 1J56A 4TWAA 2UXBB 3GBVA 4PO1A 4M7PA 2FQWA 3G82C 5DNVA 3LKBA 1HOXA 1SKQA 2A0WA 3CLUD 3NHZA 3FI9A 5ADVA 1RPZA 3WB9A 2DT8A 1RMQA 3GT4A 3I9OA 3KVVA 2FHPA 4RDCA 3DE3X 4DHEA 1F17A 2GZ3A 2ZAYA 3RYIB 2GVNA 4RSRA 3B2EA 4C05A 4OHBA 3SS9X 1SCAA 4XD2A 1K89A 2G1JA 3WLHA 2C2KA 4U7PB 2YVQA 2IPXA 4G97A 3VNSA 3AR9A 3ZV5A 1Q77A 2OP0A 4BE9A 2B78A 2KYRA 4LF6B 1NX9A 4I9HA 3RQIA 3EZ9A 3OZTA 4CQMA 2WSIA 3QTLA 4ZVNA 3R0XA 4S1NA 1TC1A 3V1MA 3ZXXA 5F4ZA 4P0QB 2G0TA 5E7JA 3N0XA 2YJNA 3RJMA 4Y2SA 1QV9A 2F1IA 3QFHA 5F76A 4I7EA 1IUPA 3GJXC 1ZGZA 1NJ1A 1PUJA 1OPXA 2I91A 2ORYA 2ZS9A 2FR8C 1QQBA 1DCFA 2X5XA 2VO1A 3MTAA 1FF9A 3P2JA 1EAYA 3HBNA 2BAGA 4UEKA 1CZNA 2AG8A 1M6EX 2HGZA 2PGAA 3MTGA 4YMHA 1VJ5A 5K0SA 2QTVB 3DLIA 3CUKA 3GDWA 3E3AA 4R9VA 5FL3A 3NQ41 3WA7A 5TB5A 4DV1B 1QX4A 4CM5A 5AUPB 3K0CC 4LBWA 1NXOA 1FYEA 3GLVA 1T1IA 2CJXA 3KHSA 4KZKA 1TEXA 3N58A 3GJYA 3KZNA 4M1ZA 2RKWA 3IT2A 3KQVA 1HE8B 3OOJA 1R5NA 1DTWB 1P7PA 4KOAA 4C7JA 1SD1A 1J0BA 2HL6A 1IBKB 3V1KA 3G5MA 1QORA 4BX8A 2BN4A 3CPHA 2A88A 1VFPA 2QMHA 2X9QA 3ZZ1A 5T8KC 2VDNB 1OX6A 4FFNA 4BNTA 4NBLA 1ODTC 2X76A 4ZXFA 4BEJA 2NVUA 5FLEX 1LBQA 5F3WB 3LQ4A 5CEJA 1TYZA 3U4MA 2ZT5A 2J8ZA 6YASA 3H97A 4B73A 4YH1A 4XGIA 1U3VA 1E1DA 1HTBA 2RMKA 3CRNA 3GMSA 3L0SA 3UBTA 4C14A 4RY9A 2IYUA 3BERA 3LY9A 4G0MA 2AJBA 2B2XA 5TR9A 2FX5A 3MBKA 3B38A 1Z33A 3QUBA 4TV8F 3T3GA 4A0FA 3K70C 2FV8A 4M99A 1PR5A 2GVZC 2DFKB 4K87A 1A2QA 3CISA 1AK9A 3M5PA 3KUCA 4H3VA 4Y1GA 4O2AB 4C9BA 4CDMA 3W5HA 1SWVA 3ZNNA 1N5RA 1Q7CA 2GJSA 3H1FA 4OYYA 1DP4A 2UUAB 4CM9A 1PZEA 2ODPA 4MQEB 4IX1A 1Z62A 2DUWA 4TUYF 1WJGA 2WKWA 2XXAA 3PTLA 3BZUA 1C41A 1UJ5A 3A9UA 3FETA 3HABA 3HZRA 3VYUB 3S81A 3GLSA 3A9TA 4PIMA 4D3XA 4CEIA 1DJLA 4V3BA 3AERB 3K9FC 3VTFA 4ER5A 1U1IA 5GJVC 1T4CA 4RK4A 5SYAA 1XROA 4H0FA 1QRRA 4Q3OA 4C6HA 2H29A 2F00A 2P65A 3GFTA 1R12A 3LTEA 3D1VA 3Q1KA 2OBBA 3QOYA 4M9CA 1WM1A 4ZARA 3AHFA 3UHPA 1AJEA 1SXJB 4D4HA 1GSOA 2YV5A 3HJHA 2O3UA