2H18A

Structure of human adp-ribosylation factor-like 10b (arl10b)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
174
Chain Sequence
LVPRGSLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMINMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ADP-ribosylation factor-like protein 8A
publication title Structure of human ADP-ribosylation factor-like 10B (ARL10B)
rcsb
source organism Homo sapiens
total genus 60
structure length 174
sequence length 179
ec nomenclature
pdb deposition date 2006-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h18A00
1SVKA 2VP0A 2IS4A 4YDHB 3T34A 5IK2D 2QSYA 3NBZC 2J45A 3RS4A 4BASA 1D9XA 1XF9A 4CW7A 4LHWA 2WIBA 2Q3FA 5JECA 4DIEA 2QAGA 1NBME 2R2AA 2PLFA 5BYJA 2ZRIA 3AKEA 3KZ1E 4NYMR 1M7GA 2GJAA 1SKYB 3K09A 2FNAA 2GETA 1Z6AA 2ZSEA 5L3SA 4ARZB 1LS6A 4KO8A 2IEYA 1N5JA 4MYHA 1SHZA 1ZJ6A 4IVRA 821PA 1GL6A 5C2JB 2W0MA 1T0HB 3A1SA 3GJ8A 1HE1C 1AQUA 2OAQ1 2ZSAA 4QRHA 2EFCB 2CHVA 3SQXA 5FL7A 4Q9HA 2OLKA 1MH1A 4OI2A 2R65A 1N0UA 4QOSA 1R4AA 2ZITA 3SBDA 4C0QC 3OEED 4AK9A 2XB4A 1P60A 1G64A 3THWA 3VU9A 3THYB 4URZR 2C8VA 4M9QA 1Z22A 4A6PA 4M0LA 2GVDC 3GQBA 5TY0A 1RVDA 3SU8A 3K0CA 1DARA 3EC2A 1R8QA 2JCSA 4NCNA 2I4IA 3HWSA 2GJSA 3EZ9A 5FR1A 2O8EB 3EW9A 2YKGA 1ODFA 3PUWA 4QJ4A 1GNPA 5IHPA 5JS7A 3H84A 3UPUA 4GL2A 1Z83A 1XNJA 3MWYW 3W3ZB 3GLIA 1S3SA 1XMIA 2E9SA 1US8B 3ADBA 1W2HA 1QZXA 2XJ4A 1KK1A 2ZPTX 4JT4A 4F7WA 1BKDR 1TU4A 2CCGA 3GJ7A 4JVNA 1TEVA 3GD7A 1VG8A 3SJZA 2JJ1D 4B3XA 3X1ZA 4Q1BA 4Q1EA 1NN5A 2EW1A 3AF2A 2WKRA 4JZKA 1E9DA 4FINA 4C0KA 4Q00A 1GL9B 1XMJA 4LYJA 1EFTA 1NY5A 1NL3A 3GLHB 4G01B 2JIZA 4D4KA 2XZPA 4NTZA 4DVGA 1AKYA 4A6XA 4YMUA 4DLZA 1H8EA 1PVOA 1F60A 2F6RA 1LTQA 3RS2A 1CJMA 2CL0X 2IWHA 5A0FA 4PHTA 5FBVB 5JI2E 1J99A 1YR8A 2IK8A 3GJ3A 2BJWA 4JSTA 4RFSB 1HH4A 4QKQA 4LV5B 4WA7A 1MO5A 4UXHA 1NKTA 3AVVA 2O0HA 2ZQ5A 1W0JD 4MKGA 2G83A 3A36A 1K8RA 2REXB 2HXYA 4JLVA 3BK7A 4GPTA 5FTMA 1XZQA 3K70D 1KI6A 4IFBA 4ZKDA 2D74A 1AQYA 2ZJOA 1KAOA 4PHHA 4HLUC 4MGIR 2RGNC 3D7MA 2DFKB 3G0HA 4URYR 5HPYB 2BWJA 2QMOA 2WVJA 4A1FA 4BGDA 3U60B 2WM9B 2XTZA 2XAUA 3NH6A 4RZ3A 3EZ6A 2I1VB 3DZDA 3MG9A 5KSPA 3JVUA 4IXMA 3ZZTA 2OCPA 1G4UR 3GEEA 3HPQA 1E2MA 4LJ4A 2AXPA 3WP1B 1TEXA 2YNMA 3THOA 3BH0A 4V0MA 1G3UA 2ZJYA 5FH9A 4ZIRB 2J59A 5H68A 1P75A 3WY9A 2G77B 1OXUA 3WNBA 1R5OA 4PFSA 3NVAA 4JBXA 3ETLA 4OJQA 1AZTA 3IBYA 2J1LA 4OBEA 2ZYTX 4BRWA 1OPXA 4JBWA 3SN6A 1GITA 3SBEA 1JECA 3C14C 4B48A 3GLIE 2O8CA 3VKGA 4GI7A 1ZP6A 3PUVA 2PH1A 1G7RA 2VSFA 1E9AA 2N1BA 5JEDA 2V1UA 2O8FA 2MMGA 3ZVNA 1GZSA 2LCFA 2PT7A 1OHHD 2IYYA 4KSBA 4JYCA 4LX0A 4HB0A 4Q7LA 2WIAA 5K8UA 2J46A 1LY1A 1G291 2WJGA 2QPAA 2EFHB 4ZCMA 2YINC 3QXJA 4MGKR 3F3YA 5ELXA 1E9RA 4BZXA 2IX3A 1Z6YA 4HDCA 5GJWC 2GESA 2ZRCA 3OIWA 1JQLB 3UWOA 4B3CA 5AJYA 1OIXA 1Z3IX 5AJXA 1VHLA 1IXZA 1LV7A 2OG2A 5AK0A 4DSUA 5EXXA 3D6TB 5FOSA 1JJVA 4TQAA 4IVPA 1E99A 4KI0A 2QMHA 2GK6A 1E2HA 4KU4A 4TYQA 1JALA 5F9FA 3EPKA 2QT0A 1XMSA 1CP2A 2BOVA 1FOEB 5E7MA 2XB2A 4P32A 3GLGA 3SYLA 4US0R 2V7QA 3B1WA 2RHMA 3HR7A 2GEDA 1YR9A 1OFHA 2J0QA 3V4RA 2R6DA 1KO7A 1Z2CA 2J41A 3QPUA 4D0GA 2QAJA 2ZM5A 2NO7A 4C0JA 1UEJA 4NCJA 3SZRA 5KOYA 1Q1ZA 2BM1A 4Z8XA 4DB2A 3GFPA 4LHXA 1KDRA 3N2IA 3RLFA 3M0EA 3QF4B 4DCNA 1E79A 1G6OA 1CRPA 1E0JA 1NMZA 3PR1A 3FDIA 4V0ME 5JCZA 4Q7MB 5JZVA 5CDFA 1EFHA 1XEWY 1A2BA 3LNCA 4ZI3A 4PSAA 1F2TA 1KDPA 2RGCA 1FUKA 4UJ5A 5CB6A 4MRVA 5EZ5A 4HUTA 4O25A 4LJ8A 4W7SA 3UK6A 3NBYC 5AR1A 3AGQA 4UNNA 2FOLA 1XWIA 4BE7B 1QVAA 2FFHA 1W4CA 4FI3C 3KB2A 4XD7D 4II7A 2ZI5A 3MWJA 4IEEA 1RZ3A 4C4PA 1N5IA 1Q44A 3CH5A 3I73A 5KHOC 2O5VA 2XJ9A 3LW7A 3UMRA 3BBPA 4ZPXA 2JA1A 5JWRA 1E1QA 2ZI3A 1X86B 3LXXA 2XSZD 2VIIA 1TADA 3QG1A 4JBYA 2YVUA 3W5IA 1ETUA 1SXJA 4D26A 1Q3HA 2FZ4A 1ZD8A 3A58B 3EARA 4DXAA 1KK0A 3MJHA 3CNLA 4L5BA 5JSZA 3THXA 1M7BA 2F1JA 3EIEA 3ZVRA 2EFEB 3NC1C 2BBOA 4KVAA 2F9LA 2ORIA 1PLJA 2B8WA 4TYNA 4OJKA 1FL9A 1OKKD 2A2ZA 2O0KA 3GJ0A 2GZHA 2KB0A 4HB3A 1SKYE 4LPSA 2CVFA 2DBYA 3P4YA 1IN6A 3LLUA 4YC7A 3W6OA 3RRZA 1R2QA 4AWXA 3KQHA 4FCTA 1G21E 2Q21A 4ZKEA 4HAYA 2DWQA 1AS0A 3IKJA 4BLSA 5GVSA 4NMMA 4D25A 4JJZA 3NHAA 2ZRBA 3B1ZA 1X8JA 4GSYA 1S1CA 4M53A 1SQ5A 5CDFE 4RD4A 1JR3D 4BFUA 2XEXA 3W6NA 3TSOA 3FKSD 4Q4HB 1DADA 1Q3TA 5B30A 5K8TA 3O8CA 2QP3A 4FIDA 3IIKA 1ZRHA 1KDOA 1MKYA 1CIPA 1IM2A 4KHZA 1R0YA 1DAKA 3AF3A 3ZJYA 1UJ2A 3OZXA 4NL4H 1CU1A 1FQKA 2FE4A 1Z07A 1KMHA 2GCOB 3B6EA 1E2GA 5FTNA 1HQCA 3CWQA 4UKDA 4OI1A 3RS3A 1NMYA 1M6NA 3HDTA 3TBKA 1XD2A 3I72A 2X8AA 1OYWA 3W3AA 1JR6A 2ONKA 3OEEA 3W90A 2AR7A 2OLJA 2QP4A 2VP5A 2P5TB 3QJYA 2QU8A 2CMKA 2JLZA 2DYKA 2A5GA 5AJVB 5AWFC 2CHQA 2J0UB 2ORVA 3KXKA 3NEJA 4MUAA 1PLKA 2IC5A 2IWRA 1OH8A 1OLOA 2N46A 4HLCA 1RIFA 4E22A 3WXMA 5FL7D 2RGXA 1NN3A 1Z8FA 4NZYA 4CEHB 3GLHE 4MGZR 1NVWQ 2ZI9A 2FGKA 2ZVQX 2YWGA 1JNYA 4JLPA 5C46F 2OBMA 4BLOA 3TQFA 3ICEA 3ZIAA 4M1SA 1KHTA 4BQSA 4JVSB 2P67A 3KKMA 1B0UA 2CDNA 3PEYA 4ON9A 5K8IA 3AUXA 5G53C 1R8SA 3ASYA 3U61B 3EA5A 1IONA 5C4GB 1Q1QA 3H4MA 5B64A 5E7JA 1D5CA 2PZFA 1XBTA 4F4CA 2ZI4A 3QXHA 1JAIA 4F91B 2D7DA 4LJ7A 2GCPA 2F9MA 1DOAA 2WJHA 3KKQA 5JLJA 2ZRDA 3A8TA 2AL7A 2FFQA 5CYOA 3KJHA 3T15A 1ONBA 3LRPA 4V0OA 2GJ8A 2Z43A 1E1RA 1KI7A 5LPNA 1E98A 3SJAA 2VP9A 1FQJA 3B1XA 2CE7A 3RRYA 3LBNA 5CM9C 3KQUA 2AX4A 1E0SA 2IYWA 1KI3A 1N6RA 2HJVA 3UIEA 4PAMA 4KITB 3QKUA 2CLCX 3SHWA 3EAQA 3VR5A 2UZ3A 1KOFA 2IS2A 1S0UA 1L2TA 3MAAC 3NBFA 4HUQB 4P4SA 2BBSA 5J4YA 4CEIB 1XCMA 2OFOA 1N0WA 2JIZD 4TSFA 1G8FA 3LD9A 5G3YA 4B6EA 3BB3A 1AA9A 4BEBA 2VP2A 2JLQA 2QPOA 1H8ED 1X8KA 2BMEA 4JYBA 4E07A 1PJRA 3AV0B 1ZW6A 4QL3A 2Z83A 4ZI2A 3TUZC 4M1OA 4TL7A 4WZBE 3QNUA 1BMFA 3NKVA 1Y63A 5SZKB 3BRWD 1ZNWA 2OAP1 3EA0A 4EPTA 4Z54A 1SKQA 4IHQA 4BFWA 3QF7A 1AIPA 4ZO4A 4BEJA 1JPNA 2ZREA 1MABB 2DCUA 4A92A 4EQ6B 4KFSA 4OK6A 3U3RA 2OM2A 4CVNA 1RC8A 2OCYC 2GJ9A 4G5SA 2QMEA 3ZYCA 1KSHA 3O47A 2GXUA 2VHTA 4HLUA 4AKIA 2RGNA 3LXRA 4TMXA 1FP6A 1G8PA 3NDPA 4WIAA 2CNWA 3AKCA 2WOJA 2WKPA 1GP2A 1XD8A 3HR8A 3FYHA 1W0KD 4LJAA 4QC2A 3PEVA 1R0ZA 3CLVA 1BIFA 3N2EA 1YZQA 4G5RA 2R6CA 1XX6A 2GK7A 4PC1A 1LFDB 4Q4JB 1VCNA 4BFSA 1KSGA 2MSDB 2Z5FA 4KSCA 2WJYA 3PCRB 4JL5A 4OK5A 5G3ZA 4F93B 3KJGA 5JEEA 2TMKA 4B34A 1VYUA 3LWNA 1IOZA 3WRXC 2P6RA 1D9ZA 2ATVA 2W58A 2XXAA 2VLIA 4OHWA 4PAQA 4Q18A 4PQYA 4MDEA 2XOKA 4DLTA 4TL6A 1N6NA 1DELA 1AS3A 3U44A 1ZUHA 3CR8A 4BFZA 3TQCA 4UNQA 1AGRA 2O52A 4Q7KA 5BXQC 1IN8A 2JDIA 1MR3F 1CRQA 2I3BA 4QBHA 1GIAA 3RAPR 2IYVA 1VTKA 2PCLA 3IILA 5KPDA 1Z29A 3L82B 3CF6R 1WXQA 3NEYA 5KSZA 1S4QA 4XJXA 4IOKA 1DS6A 4R2HA 2ODWA 4B2IA 3U3OA 3CF0A 3MWKA 2AWOA 3P26A 4V0LA 3K8YA 1IJFA 2YWHA 1ZM4A 3N70A 4PSVA 1Z0DA 1MOZA 5FTKA 5GADl 5C18A 3KX2A 1GAJA 4X8HA 4HAUA 4B3GA 1DO2A 3EG5A 2V7QD 3EIQA 2MMCA 3OESA 4RD0A 5FFMA 1W1WA 4DB4A 3R9WA 1AM4D 3A1TA 3PJRA 1K6MA 1QG4A 4AYTA 4IDHA 4B44A 2PBRA 4LUCA 2UVQA 1X1SA 2NOAA 1E9EA 4C0SA 5FR2A 3ZDQA 4ESVA 1WQ1R 3IHWA 1E79D 2J0UA 3GFOA 5DN6A 1KO4A 2KE5A 1T6NA 1G3QA 4GRAA 2C95A 3O8DA 4PANA 2CXXA 2JEOA 1I4DD 2DY1A 2CJWA 5FOXA 2A78A 2H92A 2HT6A 3AVOA 4GBMA 4Q5IA 1NBMA 1P72A 4RY2A 5BW8A 2BMDA 3LH5A 3SHFA 3LQRA 3B2EA 4QHSA 3VHLB 4CF7A 2BEKA 4HI0E 3WNDA 5LDDC 2W00A 2WMNB 1SVLA 1R0WA 3A4MA 4I4LA 1Q12A 3ZH9B 5C1BA 1G4AE 1E2KA 2IS1A 4L9SA 1A4RA 1P61B 4QNMA 5KSOA 1RPZA 1M2OB 3QOFA 5DIFA 3EC1A 3L0IB 4DCVA 3SNHA 4DEYA 5J4LA 2O8DB 3T35A 3DVLA 1E1QD 4HEJA 1KK2A 5FL3A 5KDLA 4ZDIA 1S8FA 1GDDA 3SJBA 4C0LA 4TYWA 3U5ZB 4NCKA 1EX6A 1IJEA 1G7CA 4FMBB 2ZYWX 3CNNA 4Q1FA 2A5DA 5EZ6B 1TMKA 1G18A 2ZRFA 1OKKA 1H8HA 3IQXA 1HTWA 2OILA 2JATA 2QORA 1A7JA 4EPVA 5LBIA 3J81k 1SXJD 4MRNA 1QF9A 4IOLA 5ANRB 2ZR9A 1E4VA 4FCWA 4WVFA 3ADDA 1YZUA 3F8TA 2YC2C 3HU3A 4KVGA 4UXIA 2ZETA 4E09A 4LYAA 5CJPA 1CR0A 5HCNA 4F4IA 1HEIA 2LWIA 2XTMA 3X1WA 1E2IA 1T3HA 1WCV1 2GZDA 3CM0A 1NLZA 4IDNA 5BWMA 2W2VA 3CUEF 4CYMA 4Q01A 3QKRB 2FH5B 2WSMA 3I4LA 3PXGA 2X77A 5L3QB 2IUUA 2EVWX 1PUJA 4B75A 4DRZA 3PITA 4XWKA 1GUAA 3EIHA 4G3XA 2IXGA 3NHBA 1YVDA 2PLRA 5JMTA 1JXMA 2Y8EA 4EAQA 3V00A 4FMDF 4ACBA 2J7PA 5LD2B 4AYXA 1II9A 1Q20A 5KPJA 1ZNZA 3IGFA 3DOEA 1N3BA 1XXHB 2WJVA 3CPHA 3SDZA 1Q22A 4DC9A 4E5UA 3A6PC 5DI3B 5DNYB 2ANCA 5HE8A 4D2IA 3P27A 1FP7A 1Q0UA 2A9KA 2XGJA 3BXZA 1E3MA 4TL8A 1CR4A 3QVUA 1OH6A 1OV4A 2CK3A 5KYKA 4UQOA 2NPIA 2DFLA 3ND9A 2PJRA 5L3RA 1N5KA 2RGAA 1F2UA 4B47A 4B2PA 1S9DA 4POAA 2R6GA 3K0FB 3WMGA 1V5WA 4KV9A 4AY2A 4AI6A 2IF2A 3CRW1 1N0VC 3LFUA 3K9HA 1T0JB 2OCAA 4TLDA 4RD2A 1RFLA 1MO4A 3Q5DA 4B74A 2GHIA 2W6JA 3BORA 3Q7QA 2GF0A 4PR0A 5EE3A 2FA9A 3ZS9A 1UBFA 5CIQA 2IYXA 3FMFA 4YDSA 1UM8A 1IQPA 4BZQA 2ZSBA 1ZC4A 2Z0MA 3Q7PA 5LB2A 1OB5A 3VKHA 3LAWA 2GF9A 4KAXA 1NIJA 2V1XA 5KNCA 1CF4A 2J3EA 4GZMA 1FW6A 3ZIAD 4WW0A 4M1YA 1LVGA 4XSHA 1NNEA 4OL0A 3SC3A 4PXAA 1E2FA 1YQTA 2REBA 1G1MA 1SVOA 3C7KA 5CK5A 4F4JA 4B6FA 2X19A 4IRUB 4MKFA 4PQRA 3G5UA 3U6KA 1EWRA 5KUTA 2JLVA 4LHYA 4Q66C 4O3MA 3BFXA 5EE9A 4QBFA 4ZDJA 2Q9BA 1I2DA 5DLQC 2ORWA 3FMIA 4EFLA 1AKEA 2KJQA 3I61A 3WBJA 1NVVQ 3W5JA 1E1RD 4P3YA 4ACAA 1Z6GA 2O8BB 1HQYE 4EJSC 3BH7A 1QHSA 4EPRA 5JFGA 3Q3JB 2O0JA 4LYFA 3I5YA 1CR1A 2R6AA 3UG6A 2FEOA 1W48A 1YU9A 2ZRHA 3O8BA 4DT1B 3B1VA 1ZUIA 1IXSB 4NONA 1KZGB 4P0TA 4B2LA 4N0DA 2C5LA 1NSFA 2WOOA 4DLSA 2FSIA 2HCBA 4MRRA 4TSFD 1VPLA 3IIJA 2RAPA 4PZLA 4PX9A 4E03A 4JKYA 3UMSA 3CH4B 4DSTA 1N6IA 1P2TA 2W0SA 5CM8B 2A7QA 1KSFX 4NYJR 4TMTA 4IKEA 1A5TA 4I1UA 1DBSA 1D2MA 3NDBB 1GRQA 1DPFA 5EP1A 2GEUA 4QM7A 3NBXX 1QHHB 1WP9A 2C96A 2QN6A 1JJ7A 2CLSA 4LHVA 3T12A 1BMFD 1ZM7A 2QTHA 2BIFA 1M34E 3GJ4A 4XH9B 2BCJQ 3R8FA 4G5QA 2F43A 4GNKA 5TV2A 4EPXA 4I99A 4Y0AA 2ZJ2A 3HU1A 4JLKA 4U7DA 4PC6A 2BVNA 1W0KA 1CLUA 3T1VA 3P32A 2NIPA 2GXQA 4NKRA 4BUJA 1RE0A 1E2DA 4L9WA 1U8YA 3AQ4A 3DMNA 4FW9A 2QMUA 1NI3A 4A4DA 1TL7C 1TNDA 4Z8YA 4AYWA 4Q9KA 1ZM3A 4PHGA 2AKAB 4Q02A 1UKYA 1J7KA 1ZIPA 2PX0A 3QEJA 2CNWD 5JI3E 3K0EA 3QEOA 1VIAA 1T4GA 3QPWA 3QXSA 5FI1B 3DM9B 1FMJA 2ZANA 4N3NA 4IDQA 3WHKA 1HUQA 4IXNA 5B57C 3TMKA 4M1WA 5EP2A 4DBLC 4IW3B 3OHMA 1OJLA 4NYMQ 3VFDA 1ZU5A 1EX7A 1WMSA 2BCGY 2C2HA 4MRPA 3LO5A 1GRNA 3I8XA 1UEIA 1W4AA 2AHOA 4KLNA 3B5JA 4OI4A 3AGPA 5CLLA 3ZD7A 2MSEB 4MITA 4C7OA 4MA4A 4QNRA 4V0KA 4C0HA 4JS0A 1P4SA 2XOKD 4PPQA 1KMQA 1L8QA 1QHIA 2ZYUX 2F7SA 2KI5A 3CPJB 4LJ6A 5EP4A 4PZYA 2ERXA 2PL3A 2NQ2C 4D81A 4JLNA 1MO3A 3QKSB 4JJKA 2ZUCA 3CPEA 2ANBA 2JDID 1G20E 2HV8A 4KBFA 2QM7A 4HB4A 3TVDA 3W8NA 1YHNA 3VR6A 2OEPA 4H1VA 1N2CE 1TPZA 2DWOA 2F3RA 1UDXA 2ZRLA 3DKPA 4ARZA 4DZZA 1N6LA 4JVLA 4R71A 1XTKA 1M74A 3H1TA 2JLWA 1VMAA 1LW7A 5JWHA 1VG1A 4DDWA 2ZEJA 2ZS8A 2VPPA 3BERA 1W4BA 1LB1B 3VHXA 4PPNA 1JBKA 1YRBA 5D3QA 3WYFA 3EZ2A 1E2JA 4GP6A 2BMJA 1FNMA 1XMVA 4NYIR 4WXRA 2Q3HA 3ONWA 1WRBA 4G5GA 2IA5A 3HP1A 2ZRKA 1VECA 2WWGA 2VQSA 1XFAA 4U00A 3THYA 1NN1A 4K8OA 4HAXA 1UAAA 2ZRGA 4HLDA 2YV5A 4QHYA 1U9IC 4EPWA 1KI9A 5DN6D 1NLFA 3N5CA 4EJSB 3WBKA 3ZGXA 2ZS9A 2O8EA 1RRGA 1E96A 2V9PA 2FGJA 3SFVA 4AKEA 2ASEA 1E69A 221PA 1NG9A 5HKKA 1NBMD 4A2QA 4GT1A 2FPKA 2C9OA 1US8A 2ZRAA 2V6JA 1NG1A 3AUYA 1RJ9B 3AH8A 2QY9A 4EKDA 3TJZA 4IOMA 3ECCA 4Q7JB 2JJ2A 2AD1A 1MRSA 1HA3A 3KTAB 3FHOA 2R44A 1RRFA 1ZAKA 3IBGA 4KJZA 2AWNA 5DE3A 4XIGS 5BN4A 4MKIA 2V55B 4HAWA 1R7RA 3PVSA 3GLHA 3IIMA 1KTVA 4IOJA 1YJ5A 2IUTA 4BWYA 2ZUBA 3K53A 4KODA 2O8BA 3AF1A 1A1VA 4DCSA 4M9SA 1CXZA 5FBQB 1U99A 1XXHE 4B71A 1H8HD 2UZIR 1GKYA 1TTTA 2XTNA 1J2JA 4PTLA 4RJLA 3TAUA 2HT1A 4IEIA 4GMDA 4AKHA 4RFSA 1GKIA 2PT5A 3GFTA 1RYHA 2QE7D 1BYIA 1TQDA 3IDQA 1KYIA 1W36C 1QVRA 1OH7A 4NCHA 3GLFB 1VKJA 1G7TA 2WMOB 4DUGA 2FPLA 3D3QA 4RZUA 3QI2A 4G0NA 4M4SA 5FOTA 3UMFA 1XCPA 2PCJA 2AXNA 2QENA 2VA8A 2OSBA 4EDHA 2HYIC 2XITA 1N6KA 4P33A 1KSJA 4OQNA 4TQ9A 3ND8A 4I1VA 4B3BA 1AK2A 3F0TA 1DO0A 1F5NA 3M4YA 4AG5A 3ZZUA 4ITRC 4P31A 3S1AB 1E2LA 1A82A 4MKHA 1DE0A 3SQWA 4JLDA 4RVCA 2D7CA 2ODBA 1Z08A 4UNSA 4ZIRA 1JXOA 1P62B 2F55A 2OXRA 3W34A 2J7PD 4OI0A 4B32A 3WYAA 4BZPA 4ZDWA 1Z47A 3K09C 3I3SR 4OYHA 4A82A 3ZZ0A 4DHEA 5EUQB 2NG1A 2DFTA 2C03A 3C5HA 1R0XA 3F5FA 3UATA 1D6JA 2ZU6A 4WBSA 3K0AB 5FPKA 2BMFA 1F6BA 3A1UA 3CIOA 5F3WB 1F48A 3AEZA 3LX5A 2CK3D 4PQFA 4NH0A 2HDNB 3JZMA 1UBCA 1OSNA 4W5JA 4Z51A 1BO6A 3IEUA 2ODNA 1ZCAA 2XX3A 3B7GA 2BBWA 3RS7A 2PMKA 3SYNA 2RGGA 1R5BA 2NPFA 2P6NA 3EXAA 2FPMA 3OFND 3W8RA 4RKEA 3FE2A 4TMZA 3EPJA 5HTKA 1EK0A 3EASA 1PV4A 3DDCA 1IBRA 2NGRA 3FFAA 4DSOA 2XZOA 3CRQA 1ZVQA 1QHXA 4LK2A 4DCUA 2W6JD 1X3SA 1E0KA 4C30A 1ZIOA 3RANA 1ZNYA 2RB4A 2G0NA 3CONA 3U4QB 1DAIA 2QNRA 2QSZA 3CF2A 2BKEA 1QHGA 2P3SA 2LKCA 1Z0IA 4NBSA 1P2SA 1BYUA 2W2XA 1DG1G 2V8OA 3DL0A 3EX7C 4CGZA 3PEUA 4Q19A 5HZHA 4H9GA 5H70A 2PMDA 2DB3A 4LPKA 4PC3A 4AD8A 1XP8A 3CX6A 2Z4RA 2WHXA 3EZ7A 4Q47A 2P5SA 4QFMA 5AJZA 4BLTA 3QF4A 1L4UA 4EUNA 2IYTA 3SEAA 4OHYA 3VQTA 4US2R 1W2GA 1Z06A 1KI2A 3EWAA 5J47A 1JQJC 2BDTA 1W4RA 3KKOA 3WMFA 4RKFA 2FEMA 1H65A 3RDPA 1YE8A 2FG5A 2IT1A 3BFKA 2XNDA 2CLDX 2YYZA 1B23P 2H17A 2MSCB 1UKVY 3L0PA 4Q4AB 1JB1A 4TN1A 3R7WB 4DLWA 1L7VC 1P7CA 2CL6X 1G16A 1NJFA 1P2VA 1SVMA 1U8AA 2REOA 3MWLA 4QXAA 4NE2A 3K9GA 2GTPA 4EJSA 1E6CA 1UPTA 2BC9A 1CJTC 3BB4A 3TUJC 2R8RA 3Q85A 4D82A 5TARA 2IYQA 2F1RA 4W5WA 1DAEA 4MH0R 4MYTA 2QBYB 1U90A 1W36B 1AJEA 3JZAA 2AK2A 5HE9A 4Q9JA 3RWMB 1QHYA 3L0SA 4XVQA 5DSZA 3TGPA 1UBEA 4XVRA 1XPRA 2ZU0C 4P4UA 2RGDA 4PO9A 1KKLA 1GNRA 1ZD9A 1IN5A 2GZAA 5AUNB 4C0BA 4XWAA 2YWEA 1W46A 2BBTA 1LS1A 1KO5A 1C1YA 4BLQA 2ZJ8A 2FF7A 3SYKA 4DLXA 5HZKA 5A5GA 2VF7A 2E1RA 4A15A 1M8PA 3RC8A 1J8MF 4WXPA 1ESMA 2NZ8A 3DZ8A 5UKDA 3X1XA 3CO5A 1OH5A 2QGZA 4FMCF 2H1LA 3AVTA 3PG5A 2NO0A 3P20A 4GZLA 4Q48A 4M9ZA 3LQQA 5FBLB 4LSGA 3PQCA 2QAGB 1E32A 2OT3B 4AKGA 2QZ4A 3FB4A 3GEIA 4X8OA 2YHSA 4G5OA 1WBDA 3Q5EA 1TX4B 5FBRB 2WKQA 2JLRA 3SFZA 2G3YA 4ERNA 5L3SB 5IF9A 5LD2C 3KQLA 3QPVA 1CTQA 1QBKC 3T61A 2IYSA 3U3JA 3A4LA 3OE7A 1U98A 2PX3A 5IT5A 1LNZA 5KTYA 1HURA 2AN9A 4H1UA 1ANKA 2D4HA 4P4TA 2E87A 2XZLA 3AVQA 4ILEA 2GBLC 2ZAOA 4FWIB 2IS6A 4Q4HA 1D2EA 4HSEA 2DFNA 1U0LA 1EESA 5H1YA 3EPLA 5TXGA 5IRCD 1BS1A 3BD9A 3THWB 4JIMA 1WB9A 3QG5A 4JLAA 3VU9B 5JRZA 2VSXA 3DHWC 1IN7A 4YMWA 1CEEA 4ZCIA 2PEYA 2RCNA 2KBEA 1GOTA 2QROA 4X8MA 2IYUA 1Z0KA 2WWIA 3PENA 2GCOA 1VHTA 3BGWA 2G6BA 2X2EA 2J0SA 5B2ZA 5P21A 3UKDA 1Z6TA 1G17A 1GKUB 2YOHA 2QT1A 3LW8A 4G1UC 4EFNA 1W44A 3GLIB 2QUZA 1GTVA 4LI0A 1VCMA 1JAHA 1U2RA 2GDJA 2PEZA 3ZQJA 2J87A 3LLMA 3RABA 1GRRA 1VG9B 2CEAA 2Q3MA 1EG7A 3GPLA 3T1OA 2EU8A 4YQFA 1UBGA 4PAOA 3IPXA 4C9BA 3REFA 3RSLA 4EIWA 2ZUDA 4RFVA 5BN3A 2VHQA 4Q03A 4LBVA 4CEHA 1W7AA 4EPYA 3B13B 4BFXA 1F3OA 1TF7A 3C16C 4L4UA 2B7BA 4LV6A 1LF0A 4XVUA 1VYVA 4LBZA 3KXLA 3LVQE 5HCIA 5HR5A 1SVIA 3BJIC 2GCNA 4RCZA 3MUFA 2N42A 5EJEA 4BFVA 3AVYA 1J70A 4BPBA 3OEHA 4DLYA 1E9SA 2FSFA 2H5EA 3FHTA 1SGWA 2OHFA 4PSKA 5FUYA 3SJCA 4TMWA 3TW8B 4UNRA 2NMVA 4GDFA 1U9IA 4JT2A 4KXFB 4LC1A 4OK3A 5HKKD 1SZPA 1WBBA 3HYRA 2ZXUA 1UKEA 3X1DA 4NP6A 3U2QA 3EPHA 1KI6B 2QTVB 1XTQA 1HE8B 1G8YA 1FPMA 2OESA 3CR7A 5J4VA 4O2RA 1KIMA 2B6HA 3U7GA 2JJ2D 3B9PA 2K5UA 3HPRA 3UG7A 4S2EA 2GILA 4AIIA 4OQLA 2QE7A 3RYTC 2OBLA 4HUQA 4CEIA 2QPTA 3O8RA 1XDBA 1CJUC 2WWFA 3D8BA 2NO1A 2WICA 3AM1A 1SULA 4OHVA 2ZE7A 1G19A 3A1WA 1VCOA 3NC0C 2HYDA 1ZM2A 4Z1MA 3R9XA 3ADCA 3MLEA 4A8JC 1HT1E 3UANA 1XD9A 3TNFA 4AG6A 3CRMA 2H7VA 3VR2A 1XEFA 2C04A 1FTSA 4YONB 4DWJA 5H8WA 2O8FB 5KNBA 1G8HA 2J0VA 1P6XA 1AN0A 3DEFA 1TUEA 5DO9A 2IXEA 1OXXK 1ZNXA 4QJ5A 3RNLA 3U3KA 3UXMA 3DPUA 4DUGD 2UKDA 4WAUA 4XOIA 1YZKA 1CBUA 1G5PA 3TAHA 2B7CA 2VRWA 1MABA 3QBTA 3VX4A 1GFIA 2ZJAA 4EQ6A 1U8ZA 3TKLA 1TF5A 4ZDKA 1ELOA 2JLSA 4A0FA 1NLYA 1WA5A 5DHFA 4L16A 4R7ZA 3NXSA 3U3MA 4A0RA 2ZRMA 4Q9LA 2IF0A 3WYGA 2HEIA 4KCGA 3WNCA 5FOUA 1CS4C 4IDOA 1HT2E 1YR7A 3QBVA 1VIYA 1WE2A 3BIFA 1PZNA 2YC4C 5E95A 4HLQB 1U0HC 2EFGA 2RGEA 2Z6VA 2VL7A 4FD2A 3P1JA 2YWFA 2FSHA 2B92A 5FPYA 1N6HA 3M1IA 4GFDA 3GLGB 3Q8XB 5TMPA 4HZUB 2WSSA 2ZAMA 3OFNA 2VTKA 4Q4JA 3MCAA 5E3HA 4KFUA 4RD6A 2D3WA 2HXSA 3CW2A 3KB1A 3B60A 3KUDA 1EFRA 1II0A 1C4OA 5FOWA 5G41A 5TB5A 5JHGB 2D06A 3SS8A 3PUYA 3I32A 1M7HA 4X8LA 3TVTA 2ONJA 3CB4A 2VHUA 421PA 2EQBA 2FMXA 5EE1A 3QVVA 3TRFA 3TE6A 3FKQA 1Z0JA 4BFTA 4HB2A 4URUR 3BS4A 4A9AA 3AF0A 2KBFA 1G5TA 1G7SA 3DMDA 3LDAA 4GMXA 5DISB 1JI0A 1OXSC 4LBWA 4M22A 4RZXA 5CB8A 3TR0A 1O87A 3WHLA 3AP2A 3DO6A 4DLVA 1OE0A 2GXAA 3ZVLA 1KI4A 3EWSA 1F2TB 2ZE8A 4MYUA 2F3TA 1NY6A 2EYUA 2WAYA 3CRRA 4Q9IA 4XTCS 2RGBA 4LDJA 2C9YA 4ABYA 3DKVA 1P9RA 4JVMA 5BQ5A 1COWD 4TLAA 4M21A 4PHFA 3MD0A 1G5RA 1UKZA 1EGAA 4N0EA 4YMSA 5L3VA 5EXPA 5KO2A 1TAGA 2G1KA 3G82C 3KQNA 3I1FA 2ZROA 3FVQA 4OHXA 4TYYA 3A37A 2FX3A 2DR3A 2CL7X 3QKTA 4C3ZA 1E2EA 1I4TD 1YR6A 4FWTA 2XNSA 5E7IA 3M6AA 4PC2A 1JR3E 5KDOA 1EWQA 2J5XA 3L2OB 3Q72A 4MUBA 3H0KA 5KNDA 4CT4B 4GOJA 3KFVA 1M1YE 1YZNA 2QGNA 1SXJB 4TMVA 3IO3A 1XJ0A 4LOAA 2VHCA 3A4NA 2G9NA 3RVBA 3VKWA 5JSZB 1XB2A 4KLZA 4R9UC 4DLRA 3K70C 3THXB 6Q21A 3SI7A 1MT0A 2WWXA 3JVVA 2XNDD 2QA5A 2F1IA 2ODEA 1XJQA 4PPFA 2GRJA 1ZCBA 1G41A 4HATA 4DKXA 2JLXA 2GVZC 2OCBA 5SZIA 1G9XA 5AUQA 2ZTSA 1G3MA 1O3YA 1CKEA 2ZE5A 1S3GA 4RZ2A 4QM6A 4WZAE 3CX8A 3LA6A 4M1TA 1YRAA 1A2KC 4XSGA 5BYKA 4MGYR 4A8JB 4A0HA 1KK3A 1XPOA 3IUYA 2GEVA 4TMKA 1X8LA 1UFQA 4KFTA 3ICQB 5JJKA 3AVWA 1V43A 4B73A 5CITA 2CHGA 4D0LB 4GP7A 1S2MA 2O8DA 4DLUA 4W5HA 1OFUX 3C5CA 3UWKA 2IHYA 1XU4A 1IY0A 2B8TA 5GJBA 2QTFA 2IBMA 4B3FX 3R8CA 5TDHA 4HDQB 4M1MA 3KQKA 3FPAA 1AZSC 3B82A 1E2QA 2FFBA 3H86A 4US1R 5J40A 4MDFA 121PA 4BECA 2OZEA 4Y0VA 1E2NA 3HJNA 2OE2A 3L8ZA 1KJYA 2EFDB 4EFMA 4PPGA 3WRYC 1KNXA 3PV0A 3FHCB 2VP6A 2GA8A 1KMHB 4JKIA 1EFUA 1CJKC 5KDDA 4W9MC 2IL1A 4QHTA 1CJVC 1U0JA 4LV8B 1RRCA 3QKRA 4C2TA 1E0AA 1XD2B 1T8UA 5L3QA 5DHAA 5DYGA 3B9QA 1NN0A 4R98A 1K5DA 3RRNA 5EP3A 3VTKA 3AP3A 3OAAA 4B3DA 2KSQA 1OXTA 4WZ6A 5FTJA 1DAHA 1S96A 2CBZA 3OE7D 3NH9A 3QE0A 1XJCA 1IN4A 4O0MA 2P6UA 2VYFA 3VNVA 2WV9A 5D3MB 2H18A 5F98A 1FUUA 1P5ZB 1XXHA 1OB2A 5DYIA 4CDGA 5CLQA 3CRVA 5DI3A 1GVNB 3BE4A 2D62A 3ASZA 2GBLA 4TTQA 2A3RA 1GNQA 2W2TA 4M9XA 1UDWA 2ZRJA 1TQ4A 2IYZA 2DHRA 3FMPB 4U02A 1K5GA 1NRJB 5J5CA 5EE5B 1JPJA 4ASUA 3QIAA 2C99A 4NHOA 2JLUA 1ZINA 4TT3A 1TU3A 2FWRA 3K0FA 4D4LA 2V6IA 4HZUA 4TZ6A 4NCIA 1G3RA 4QG7A 5TVKA 3VR4A 2ZSFA 1S9HA 3FFBA 2QP9X 1NIPA 1E94E 3LBIA 5DI9A 3SR0A 1GILA 1FMLA 4KFRA 1SHKA 4RCYA 3I62A 3TH5A 3AVXA 3B1YA 4TWZA 3LV8A 4JSYA 1YKSA 1Z6XA 5FUXA 4AC9A 1U94A 1FX0B 2CVHA 2FU5C 4MQBA 4LCBA 4D0NA 1J90A 2F1HA 1GM5A 3CBQA 1S1MA 2OV2A 3LX8A 4V02A 3VMFA 5M04A 4FXPA 5IDVA 1N6PA 4LGMA 4P4SB 4F92B 1Y3AA 3NTUA 3DOFA 2FN4A 3RS0A 1T5LA 3BAFA 3C41J 4JLJA 4YXWD 2G0TA 4JLOA 4LJ5A 2W6IA 4D4JA 4PZZA 3PEWA 1KO1A 2HF9A 3K70B 3K9NA 1KO8A 4UJ3A 1YZTA 2IW3A 3OEHD 4KYIB 3X2SA 2QI9C 5JHHB 2V3CC 1JEEA 2ZRPA 4FMCB 4F38A 4CEJB 2IHBA 1GWNA 2AK3A 3KKPA 4Q21A 4A0GA 1L4YA 2VSOA 2A5JA 3NG1A 3QENA 4ZCLA 1Z5ZA 3AP1A 3DM5A 4LHZA 4NYJQ 5JRJA 2WPDA 4FN5A 1AGPA 4O2LA 2NO6A 4V03A 2WJJA 2WAXA 3BB1A 3MMPA 3TK1A 1T9HA 4YMVA 3BOSA 3GJ6A 4LZZA 1ZC3A 1XCGB 3AKYA 1FFHA 4DDVA 2FDCA 4DT1A 1KKMA 2PZEA 4URVR 3U7EB 3IQWA 3E5HA 4NDZA 5CYPA 1PUIA 4IVQA 4B33A 2PZGA 2WZQA 1W47A 2HLDA 3A1VA 1VDZA 1KZ7B 1NF3A 1KI8A 2H8KA 2JJ8A 3X1YA 3GLGE 4JMPA 4PO8A 1N6OA 3C8UA 3R20A 4Z1MD 4D80A 1NKSA 3Q9LA 1ZYUA 2QL6A 2WWHA 2QG6A 4MRSA 2OUKA 1D2NA 4TLEA 3TLXA 2RH5A 2ZJZA 4K81B 1QHHA 3QSYA 2JGNA 1X1RA 1I2MA 4A8JA 2QM8A 3FTQA 2P2LA 1PLLA 2XXAB 3T5DA 4RD3A 2QEQA 5J4KA 1Z28A 3I5XA 1W36D 1NP6A 4LC0A 1U81A 2ZIAA 5JS8A 4BLRA 5SZHB 2QAGC 3KJEA 4DSNA 4FCVA 3U44B 3AB3A 3CX7A 5IK2A 5SZJA 3ZLJA 1Q21A 3NIBA 1KNQA 4TYPA 4UNPA 3REGA 4TLBA 2V54A 3VX3A 2NTYC 3CNOA 3AF4A 3KFXA 4D6PA 2HUPA 4B76A 4GOXA 4N1AA 5J4HA 1DG3A 4Q1DA 1OIVA 2X1VA 3RC3A 2QRNA 3GP8A 2ZI7A 1CR2A 4ESHA 3SOPA 3C4JA 3EZFA 2AD5A 1P3JA 2C78A 2CCKA 2WSSD 5G40A 4TTPA 3KXIA 4HZIA 3AVUA 3IPYA 3RS5A 3K1JA 1QDEA 2AFHE 2ZJ5A 4R2IA 3BWDD 1EFRD 2GAAA 3H2YA 1G3IA 5FPHA 1II8B 4WOPA 5JJIA 3K0CC 4M2LA 2A5FA 1T3SA 2P0EA 4KBGA 1NMXA 1XEXB 4DDTA 5EE0A 1SXJE 1E9FA 1P9NA 2BHRA 3L43A 3T1TA 4NYIQ 1DAGA 1COWA 1J8YF 2YJTD 4U5XA 4BLPA 1W49A 1WDTA 3QKSA 4LYHA 5AJWA 1KDTA 5BN5A 5D3MA 2Q6TA 3IHLA 2ECKA 4TL9A 2CJWB 3PUZA 2D2EA 2NO9A 1RRPA 1ZUNB 2ZJBA 3BC1A 4PC7A 5AUOB 1QHNA 1C9KA 1XTRA 1MV5A 1Q57A 1FZQA 1XEWX 3FGNA 4OQXA 4HAZA 1IY2A 2IYRA 3VAAA 2J7KA 3TSWA 1OXVA 1TQ6A 1VCIA 1T5IA 3I92A 1E2PA 3KKNA 621PA 2JJ1A 5JCPA 2H16A 1OFTA 1GG2A 4I1SA 4JLBA 5KU1A 3KL4A 3W6PA 4B43A 3ZQ6A 3NWJA 2BM0A 2YOGA 1MRNA 3E1SA 1HV8A 2GAOA 3E2IA 3L8YA 3MRSA 5L8VA 3AVPA 3OF5A 5F9HA 1N25A 2GNOA 1FX0A 1QRAA 3CWZA 4RSGA 2EWWA 2R6FA 4NU0A 1CULC 3ZD6A 4CT5A 4URXR 5C4MA 2B21A 2D2FA 5DGXA 1W5SA 4FMDB 1P9WA 1RW4A 2IEZA 4DDUA 5AUPB 4QGGA 1UADA 4OKSA 2C9CA 2WWYA 1W0JA 3IO5A 2G1JA 1KJWA 2FV8A 2P65A 4L15A 2WBLC 1XZPA 1RJ9A 3PIRA 2WTUA 4A2WA 4DEXA 4S35A 4DJTA 2EWVA 2VEDA 5FPSA 2NZJA 3R9IA 4QGFA 3IEVA 4J0QA 1KGDA 3KTAA 5CIWA 1SVSA 2OFWA 2Z4SA 3P4XA 5GJVC 3K9LA 2AFIE 4PO1A 3T1QA 5B58C 1TUIA 5JWOA 4CEJA 4I1OA 4XWOA 2VH5R 2SHKA 3GEHA 2GXSA 2R9VA 3ADKA 1IY1A 3TSZA 5JBQA 3W9YA 1OYYA 3ZVMA 2IYLD 1Q1BA 3QQ5A 4LY6A 5FBWB 2OBNA 3FWYA 2H57A 3L0OA 2CE2X 1OF1A 1MO6A 1N5LA 2R62A 3CZPA 1XTIA 4IJMA 3MSXA 4OQMA 3E70C 4QGAA 2ZS7A 2C77A 4QBGB 4CRWB 3I8SA 4BRUA 2HJGA 1WF3A 5KSYA 3GLFA 1OHHA 1XTSA 5FI0B 4TTRA 4AURA 1T91A 5FPTA 1XPUA 2YOFA 1RYFA 1E9BA 3RSOA 1G8GA 1F2UB 3CZQA 2KWIA 1GSIA 3MFYA 4DIDA 2ZRNA 3TR5A 3QUSA 5FUWA 4LBYA 4LJYA 3GJXC 5K8LA 2DWPA 3S1AA 1X6VA 4QGHA 3CKLA 5GVRA 1NVUQ 2W83A 5A4JA 1VG0B 2BEJA 4HDOB 4JLMA 4LRWA 5EUMA 2LKDA 5E4FA 2FFAA 3WMEA 3OAAD 3PFIA 2FZLA 1KY3A 2A5YB 2QQEA 1TF2A 3FOZA 3VNUA 3QY0A 3TIFA 5CK4A 3GMTA 3MGCA 3OIYA 4IFEA 2ZE6A 4HAVA 4L8GA 1FTNA 2VBCA 2ZR7A 2ZSDA 3OIUA 2A30A 4Q4LA 2YZ2A 2FSGA 5GJCA 1ZBDA 3T5GA 1KAGA 3U7HB 4M8NE 1VYTA 3LY5A 4JL6A 3K0AA 4D4MA 4I81A 1T3LA 4HYYA 2QRZA 2J9RA 3HYTA 3OIVA 1XRJA 1E9CA 2ZR0A 3PUXA 1I4LD 4UXJA 4ASUD 3V4FA 3D31A 4TT3D 5CJ2A 5EXSA 1D8TA 3RWOA 3GJ5A 2RMKA 4ZV4A 2ERYA 4QBIA 1DAFA 2BV3A 4M1KA 4URWR 1E4YA 1DAMA 2QQ0A 1YZLA 2OXCA 3C15C 5FUVA 1RKBA 4YXWA 3QXCA 3B8HA 2C98A 2HCJB 3FMOB 1II8A 1KY2A 3LBHA 2FJUA 721PA 1XEXA 1G6HA 5F2EA 1NJGA 3U4QA 4NPHA 4TQUS 3WP0A 2GKSA 1GL7A 3U7FB 3LVRE 1OIWA 1OW3B 4V0NA 4XTRA 3GLFE 1R5NA 1FNNA 1TQ2A 2GWHA 1LF5A 4XD7A 5LB4A 3KDSE 521PA 4TZ0A 1ZD1A 3QXXA 3VR3A 1XTJA 2DPXA 3SE0A 2IUSA 1OT3A 2BKUA 2G88A 2W6ID 3HU2A 1JEDA 5JJLA 2GJKA 4OQFA 2CCJA 1Q1EA 3KJIA 2EYQA 4K46A 1NVVR 1SXJC 2XSZA 1KJZA 4MYCA 4LJ9A 2JLYA 2JAQA 4IDPA 4GOKA 1EXMA 2JASA 3KUCA 3K0SA 2Q9AA 2X2FA 2RKOA 4RD1A 1Z63A 3TUIC 2WWWA 1KI1A 2F43B 4KYUA 1IXRC 2Q0HA 3B78A 2ZVPX 1P73A 5FOVA 4OHZA 3RHFA 3U6BA 4BFYA 2WPDD 1ZU4A 2V4ZA 2IXFA 3VR1A 4LWZA 3BFVA 1UF9A 4Q4AA 4A36A 3T06B 3R7WA 1HYQA 1ESNA 1DEKA 1DVRA 4JL8A 2O8CB 1DTSA 1NVXQ 5EQTA 4C2UA 1IHUA 4DCTA 1YZGA 3MJRA 3GCGA 4YMTA 4C0AC 1W5TA 2ATXA 2RHDA 2OFXA 1R10A 1QG2A 2HLDD 2QBYA 3AKDA 2L0XA 3V9PA 4B35A 1ZM9A 1IAQA 2ZI6A 4CZ2A 1HY3A 1EFCA 4YLGA 2ZYVX 2HF8A 4Q1AA 1BOFA 1R6BX 2WJIA 4Q1CA 2VHJA 5DH9A 1JR3A 3TW4A 8OHMA 5FTLA 5EXTA 2VO1A 2BJVA 1NSTA 1Z0FA 1Z2AA 3FKSA 1SVWA 2I1QA 3RRMA 4QJ3A 2OO7A 1ZMXA 2PJZA 4C7OB 2AKYA 1T8TA 2VF8A 1AS2A 3BH6A 4TLCA 1Z0AA 1BH2A 4A2PA 2VP4A 4CIDA 3B85A 3ZS8A 1OFIA 1P2UA 2Q9CA
chains in the Genus database with same CATH superfamily
4H4EA 5JXJA 4LZPA 4S1WA 4U7JA 3HKEA 1MFPA 4N0MA 5IK2D 4RW0A 5CFZA 1QONA 4CW7A 4LHWA 2BFPA 4LQCA 1RWMA 1AQNA 1SXGA 1Y1KE 4EG8A 3GZNA 1UXKA 3EAGA 4GYJA 3TLKA 1APBA 2IY8A 3BMNB 3AKEA 4NYMR 5AK4A 4WZAA 4XIJA 4BO7A 3HLTA 4EEKA 3T0GA 4A7PA 5C9ZA 1HFWA 4IY1A 2IYNA 5CD9A 1XQWA 4GKAA 3G85A 1FLAA 2ZSEA 3HKBB 4O5OA 3L8GA 3AI7A 3KC2A 3ZZ1A 3HYSA 2B9VA 4MR8B 3WLRA 3OQBA 4LMPA 2IEYA 1FSPA 1ZUWA 4RVSA 4RCVA 2FMIA 2K7FA 2W0MA 1KH3A 3A1SA 1WPQA 1VSQA 1AQUA 4LMRA 3SQXA 2EFCB 1Y1PA 4FKZA 1Z8HA 4RA6A 4RLFA 3M6VA 2JC3A 4Q9HA 4B85A 2BSQA 8LDHA 2DBQA 3OJXA 4QOSA 3HABA 3OEED 4WLNA 4WBXC 1T2DA 2XB4A 4AK9A 3ELUA 5EIBD 4O4LF 2ZBVA 3JWEA 2C2GA 5KHAA 2M98A 2ZYRA 4FXOA 3UAXA 4A6PA 9LDTA 5HQTA 2J33A 3K6JA 1RYBA 1PZFA 3FWHA 3GVPA 3PT9A 4H2DA 3SFTA 2WF8A 4HWOA 3SF0A 4NOKA 3K0CA 1DARA 3EC2A 4UMFA 1R8QA 2HR1A 4OP1A 5HBGA 4D02A 2I4IA 3HWSA 5F2OA 1H2EA 2HI0A 1C9YA 3HBMA 3UPUA 3ORRA 5IHPA 2RBEA 5JS7A 3W3ZB 3HB4X 1GD1O 4WNCA 1OX4A 2PN1A 1US8B 4FFRA 3RSGA 5FPPA 4DM3A 1U5BA 1HDZA 3E23A 1JV2B 1CS0A 1YS2X 2ZPTX 3IPRA 4JT4A 4DY6A 1QRSA 2CLKB 3EIUA 2F3PA 1TEVA 2J4CA 5T3UA 3ET5A 1PDOA 1U11A 2JJ1D 2FQQA 4B3XA 5CB4F 4WI1A 1NN5A 2EW1A 4JOQA 4G36A 3DF9A 4C0KA 1T1JA 3BDIA 1GT91 1P8JA 2A59A 3LRXA 3QTTA 4MS4A 4OQPA 3QVJA 1EX1A 3H2ZA 4PFKA 2JIZA 3AJ9A 3JYNA 4ZEOA 4BZZA 4DVGA 3KZCA 2NZWA 2XE6A 4B46A 1PZMA 4DLZA 2JG3A 5JXHA 1H8EA 1X80A 4CL0A 1PVOA 4XM2A 4GXNA 3N0VA 1EH5A 3UJBA 1I0ZA 3RVMA 4BQQA 1U2EA 4IMIB 3VHQA 4JXXA 1EDEA 2FPUA 4JIGA 5AW6A 1QVZA 4ENPA 2ETXA 5FBVB 2RBGA 5JI2E 3ZVKA 4RFSB 1JKIA 4JSTA 4UXHA 1NKTA 3AVVA 2O0HA 3BRWA 1ECFA 2ZQ5A 3F1LA 4QDOA 3S2EA 3LCMA 4OFWA 2EGHA 4WBNA 3EN0A 4PLHA 2XH8A 2V7TA 3SJUA 5JVDF 4JLVA 1KEEB 3GGJA 4GPTA 5FTMA 3P0EA 4FCCA 1JDBC 1L5SA 2OOSA 4RGYA 2QTVA 4IFBA 1SCAA 4X24A 2ZJOA 1AQYA 2WA1A 4ZKDA 1BS2A 1FYDA 3I23A 4HLUC 5BYBA 3VUEA 2DFKB 5M3BA 3G0HA 4MAAA 5HPYB 4V2UA 1IWBB 1RYZA 3DAPA 1Z7YA 2XTZA 1TYDE 2DQ4A 4GOLD 3NH6A 5AXDA 4ZYLA 3DZDA 4C5CA 3CLHA 1G4UR 5A4KA 1E2MA 2J9YB 1E1CB 3A3NA 3STXA 3PSHA 3WP1B 3THOA 3IBTA 4V0MA 2JHPA 2ZJYA 4DZTA 2CJYA 1LNSA 2J59A 3N6RA 5H68A 2BEVB 4UUPA 4E08A 3QPCA 4JBXA 5K7SA 1XK6A 3UAZA 1I2CA 1FTGA 1K7XB 1LPMA 3IBYA 2X42A 4BRWA 2JFHA 2WE8A 3F7NA 3SN6A 1QHFA 1KYVA 1UBTS 1JECA 3C14C 3KSDO 2IYFA 4GI7A 2BGUA 2HJRA 4WKOA 1H0SA 3ZLBA 4BNMA 1U02A 2V1UA 3L7AA 3QZUA 4YUVA 1L7QA 3ILHA 3TM4A 2Q50A 2I67A 2BY4A 2WKSA 2XB8A 4H1TA 5JDCC 1GZSA 5K0FA 4WZBB 1V1JA 3R8XA 1EHIA 1PK8A 1JLKA 2GEFA 3ILXA 4KSBA 4QJIA 3G17A 4MA5A 3GLVA 2ZLBA 4HB0A 3R4CA 1TLLA 4MX8A 3FPCA 1DIRA 4HYQA 4ZEVA 4ZCQA 1WY7A 1I2BA 2YINC 3QXJA 1UK8A 4RGVA 3RROA 3LP8A 3WQSB 3ZIUA 2FXIA 4DDHA 2IX3A 2FSUA 2NXWA 3G1WA 1JE1A 3OZFA 2YDXA 4M60A 1EFPA 4HDCA 1SAYA 2ZRCA 1WXIA 3E8SA 3OIWA 3UWOA 1DWOA 2QN3A 4P22A 3EXHA 3MPOA 5CYFA 1TW3A 2YY7A 5AJYA 1ENYA 1YACA 3KR1A 1Z3IX 4X6LA 4AS1A 5AJXA 4DILA 1HEYA 5BRJA 1VFPA 2O06A 2CF6A 2QJRA 4ZI7B 5L9AA 3JD0A 2C31A 4TQAA 2ACKA 4EELA 4B6SA 4TRJA 4Y2VA 1E2HA 4RY8A 2DPHA 4KU4A 4MW2A 2IJGX 3FNRA 1VLJA 1A4UA 2JZCA 1A2OA 1OV6A 1X7YB 2HCRA 2ZBQA 4YBRA 1CP2A 4ZJZA 5HX7A 2JFWA 4K03A 4JB0A 4EJ2A 5K8VA 1MQAA 2ISQA 2WLSA 3DAYA 4P32A 2IEIA 3ZWPA 4EGFA 2XB2A 3SYLA 4EI2A 1OXBB 1L5ZA 1U8XX 1XRNA 2JI4A 2R4TA 3CXUA 3B1WA 4US0R 3O4FA 4F6RB 3VPHA 3U81A 1X39A 3N3AC 2GEDA 2GEBA 2HIHA 2RGYA 2DKNA 1OFHA 3IMGA 3ZHVA 1KO7A 4D0GA 1UDCA 2BP7B 2ADOA 4RVGA 3K0HA 4U6NA 4UQPA 1Z34A 1BZYA 3KL2A 4B84A 2BM1A 2G28A 2ZDQA 3CX4A 4QYWA 4X3PA 3G2IA 2X0RA 1RSZA 3N2IA 1V11A 2Q1WA 1P1BA 2B1QA 3TNLA 3ZCUA 1DXQA 1MW9X 1UUFA 3PR1A 4A1OA 2I2WA 3QELB 3ZDZB 5K3SA 4MMZB 5JCZA 4TZKA 3U13A 4PNEA 3TDKA 4YUAA 1EFHA 4Q12A 4REQB 1A2BA 4P92A 1P4AA 2VKTA 1K88A 3H8SA 4TRNA 4ZVRA 4KRGA 4FVTA 4UJ5A 1RD4A 5BVGA 5TC4A 4MRVA 3GVIA 5EZ5A 1OC4A 1N7JA 1NQAO 1L1QA 3FWPA 5D3KA 3PC4A 3NBYC 4F0JA 1YJXA 5AR1A 1TKRA 4DKJA 1QIFA 4LFAB 4Q3CA 2Y1EA 3SM9A 3UH1A 5D7NA 5M34A 4BE7B 2D5IA 1QVAA 1RAEA 2F3QA 3GUHA 1XA4A 4XI9A 3ANTA 2ZTUA 1KMNA 3C70A 3MWJA 4F3RA 5C81A 3S1LA 2XCRB 3U09A 5ALGA 3PIDA 3W2TA 1Z2PX 1BU5A 1NYLA 3VR3D 3WTBA 2IHKA 1GT6A 3BBPA 5LQDA 3K71B 2AFHA 3VZCA 2JA1A 4V3BA 1ESDA 2EJVA 3CT6A 1C4WA 2H11A 1CUZA 4MI1A 4R68A 4XGQA 3EUWA 3PE4A 1P74A 2CL5A 3E9EA 4HQ0A 3EOBI 1B8VA 4G8DA 4B7ZA 5A2GA 3TI9A 4AU1A 5IAEA 1WLYA 2A9VA 3W5IA 3RVLA 1GCOA 2C3UA 2ZSJA 4OMDA 4D26A 1Q3HA 1BOOA 1EJ2A 2FZ4A 3NONA 3P9XA 4BJ1A 1RYNA 2R7MA 3GUYA 1JG4A 4KTTE 1P9OA 1PX2A 3THXA 2EF0A 1T9GR 1AB5A 4ZGWA 5K0TA 4KVAA 2O7NA 2F9LA 1LRJA 2MOKA 1VIDA 4IHJB 4QTTB 4XX1A 4CCSA 2ZUVA 1JQKA 4AAYA 2RGRA 1FL9A 2NU8B 2A2ZA 3BHMA 4RE5A 3GV0A 1FEZA 3JASA 5CDYA 5IX8A 2FKAA 2KB0A 4K28A 4LPSA 2ZXEA 3RRZA 3DDNA 3M5PA 1EFAA 2TS1A 3QA9A 3KQHA 3AEQA 2PPLA 3PNVA 1AS0A 1YO6A 2NYVA 2EHJA 4IV0A 3BA1A 1LNQA 3R7BA 3UEOA 1FX1A 1I6MA 1NE2A 4D25A 3FVTA 3OJFA 4JJZA 1E4EB 2ZRBA 2PZBA 4BQNA 2FEXA 3ZGOA 3FUTA 1XROA 4YS6A 3AW9A 4M99A 4DR4B 3R3UA 4YP7A 3C1AA 1GUYA 1K8YB 3R24A 3ZWXA 4EF6A 3IJRA 3AYZB 2JI9A 3P2YA 2EFYA 3TSOA 3FKSD 1D7AA 3H18A 4HNAA 4CQMA 2XF2A 3OC0A 1QG0A 1USUA 3KQPA 4HN9A 3TRKA 2BGWA 2C1XA 1CLEA 2DY0A 2QP3A 4FIDA 3GA5A 4Z4FA 1C4XA 1ZRHA 4L3OA 5EJGA 2JHCA 5DMXA 1R0YA 2I71A 5LKRA 2HJ9A 3SC2A 3BD7A 1UJ2A 3WGVA 5C37A 2QUJA 1NVFA 4NL4H 1JHOA 4L51A 4Y6OA 1CU1A 1HRKA 3A7EA 5BNZA 2NXCA 2HU2A 4KP7A 2IIBA 3JWIA 2ZDGA 3IR7A 2ET6A 1ZOPA 2C3YA 3I9V1 1JDSA 1HQCA 1SXHA 4HQLA 1EVQA 5FTNA 1NMYA 2PX2A 3EIWA 1E3LA 2IU4A 1W35A 1GPYA 2GQ0A 4TUYF 3TS1A 3JQQA 2CYAA 3I72A 5GZ1A 1OYWA 2CXSA 2ONKA 2V4UA 3H9GA 3OEEA 4LEIA 1RHUA 4CCAA 3ILVA 2P5TB 1OTXA 3QJYA 2O2YA 4E7OA 2QYSA 4YV2A 5LVAA 3OPVA 5I9BA 1WDLA 3LHDA 1EDBA 3F6EX 1DQSA 2DYKA 4JT9A 3OM1A 2ORVA 1LDMA 2J0UB 2PIDA 3KXKA 3NEJA 3F6BX 4DJJA 5C8YB 2Z6AA 5DBHX 3FSJX 2BN4A 2N46A 4E13A 4DUPA 1ZIYA 3JQAA 1NN3A 4UTRA 4NZYA 4MGZR 2ATCA 2YUTA 2FGKA 3CTMA 3OM8A 3PHGA 4QSHA 4EQZA 1JFRA 1E3TA 1A3CA 2NZYA 2YWGA 3HVJA 3L1VA 4MV8A 1CUBA 4YA6A 1WZEA 1Y80A 4MMYB 4YALA 5MN6A 1KOGA 3TZCA 3ZOKA 3P9IA 4GW3A 4RKQA 3LYLA 3ZQKA 2CDNA 1AUXA 2CYCA 1RRVA 5B2FA 3PEYA 5G53C 2GHTA 2R11A 1LSOA 5JFTA 5H81A 3ED1A 1Q1QA 3ZJUA 4EZIA 5B64A 1MDFA 1PFYA 1U3VA 2XDYA 5CIYA 1D2HA 1D5CA 2PZFA 3D3JA 1XQ9A 4AXXA 3C3BA 1VHDA 1F0PA 4K0KB 1Q0PA 2D7DA 4LJ7A 1T8SA 3PL1A 4HX2A 3H75A 4F4DA 3KKQA 4ROTA 2ZRDA 4BV3A 5JLJA 2EX1A 2FFQA 4M8KA 5CYOA 1E9VA 3T15A 3LRPA 4B7UA 5KJ1A 3WYEA 1NXXA 3TSCA 1DT3A 3OC6A 3RBAA 1O03A 3L7JA 1XGKA 1RP7A 1XHEA 1E1RA 1KI7A 1UDAA 2EP5A 2PK3A 4IJQA 5IH7A 2KMLA 4R31A 1E98A 3SJAA 1CT9A 5DYNA 2BLLA 4DR1B 5BORA 4ZHQF 4DR2B 4EKNB 1GADO 2IYWA 1KI3A 3UIEA 4KITB 1EGVB 3QKUA 1EVYA 3ANXA 3EAQA 1SPXA 4PV7A 1N34B 4B80A 1FSZA 3K1AB 3LLVA 2IS2A 4GZ6A 3NBFA 4P4SA 1KVUA 1LDNA 2VH1A 3OOJA 1N0WA 3S2ZA 3USCS 3LD9A 4FGLA 1AA9A 1BW9A 1IDOA 2RGWA 3RYIB 1U3WA 4UMEA 3DB2A 5LA6F 2UYGA 4JYBA 3R9XB 3SQMA 1FSGA 1ONOA 4J76A 4E07A 2IUFA 1QCCA 2OD7A 2D00A 4IZ6A 4QL3A 4EVQA 4MKXA 2C5FA 2VRNA 1BA2A 3Q87B 4WZBE 4UHFA 3OMXA 1OT5A 1I1HA 5DX8A 3DYBA 2CFSA 5KVSA 1MX1A 1ZNWA 2OAP1 3EA0A 4Z54A 1UOOA 1WHSA 3K6SA 3NASA 2HXGA 3PD0A 4HPWA 4IHQA 4MYRA 2VWHA 1J39A 1TK9A 3EH2A 3GRKA 5B1HA 2C59A 4FFLA 5JT1A 4ZO4A 2C4MA 4XUDA 2DCUA 1QP8A 1T8RA 2IY9A 4KFSA 1GXSA 3E03A 4GPD1 3TXAA 3U3RA 3W04A 2GJ9A 1O6CA 1Y48E 3EAFA 4IXDA 3LL7A 5CFOA 3I30X 5KTNA 5DHUA 1Q16A 2B94A 1T9ZA 4LWOA 3WBFA 3A9WA 4C1BA 3D43A 3IAM6 2VI5A 4AKIA 1D7OA 2RGNA 3LXRA 5I8WA 4K5QA 3W5VA 2WM2A 3NDPA 1WM1A 2CNWA 3UAWA 2WKPA 5JXIA 1XD8A 1OD6A 1I32A 1XDZA 3D7RA 3U62A 1Q83A 4WE3A 3LQYA 2H1FA 1XTVA 5D3ZA 3VUFA 4GKBA 5ERGB 2H0QA 1GN8A 2JAHA 1QF6A 1VKOA 3DQPA 2PZJA 1PFKA 3PEVA 4R8VA 3KQOA 3ZWCA 4RTNA 2EKQA 3CLVA 5IANA 3A1CA 1LVHA 4G5RA 3A9TA 4EECA 1VSVA 1N9GA 1P39A 3OE4A 4PC1A 2EIXA 1XKQA 2B78A 4G4GA 1QRDA 1ADJA 3NVKI 4M0EA 2MSDB 5AKZA 4K9RA 1UXJA 2MHCA 3HMKA 3KYCB 3LO8A 3JATA 2MDTA 1PWXA 3JTMA 1RXIA 3PCRB 3R6WA 1V4BA 4B34A 5JV5A 5FJJA 5DTQA 3VSDA 5KTSA 4G26A 3GIWA 1ZRMA 2P6RA 5F7OA 4EB0A 1D9ZA 2BHTA 4GXTA 5ARDA 3OJCA 4PAQA 4FDLA 3W2IA 4DLTA 1G6Q1 3I4CA 5FHRA 4GMGA 1WXDA 1AS3A 1BCSA 2HQ1A 3KQMA 4G63A 2C5EA 4BFZA 2C1EA 1XMPA 3ELYA 4FYYA 1PZXA 3W7BA 1Z5NA 4GQBA 1FMCA 4RENA 5TE9A 1RXEA 4PX3A 1EUCB 1W0CA 4WK4B 2QLNA 3SD7A 3B3AA 4MOWA 2IYVA 4B6QA 4BNYA 5KPDA 1B3BA 2ETVA 5EPOA 1DRUA 2VBFA 2WM8A 4M7OA 4DNFA 4BMVA 1S4QA 1GAWA 4D92A 4R2HA 5B7GA 3U3OA 1O89A 5BMVA 3MWKA 2PL1A 1BXZA 2AF4C 4V0LA 3D3WA 4X94A 3GT0A 5J2UF 5AD1A 1UPCA 3L1UA 3WOVA 5A2QA 4OFZA 1FBNA 3M6IA 5BSVA 3EG5A 1FCJA 2V7QD 4AJNA 3R9WA 3BWVA 1W1WA 1L4LA 7MHTA 4HGQA 4L78A 1YAJA 3L04A 3A1TA 1UMCB 2XDQA 1YB1A 1QG4A 3QJGA 2ZIXA 4I6EA 2Q6OA 1O95A 4OXXA 4B40A 3BCSA 1EA7A 2JFQA 3S1SA 2FZ5A 2A9OA 2WUVA 3K7EA 1IWPB 2DHQA 4C0SA 4KZKA 2C3OA 2HZ7A 1WO8A 2WP8J 1WQ1R 4J03A 3M83A 1G8JA 4CM8A 1KO4A 1U04A 3BRCA 1T6NA 1U9YA 1TIBA 2XZDA 3I6YA 3UAGA 1JDUA 2C7BA 1TAUA 3RRBA 3O8DA 5BSEA 2CXXA 3L1JA 5CA1F 2C00A 1I4DD 1NUQA 2CJWA 2NPOA 3HVIA 3ACCA 4XYMA 2A78A 2C8JA 2HT6A 3C3MA 4GBMA 4OP3A 5B1DA 1P72A 1ZUNA 5BW8A 3B38A 1R5JA 2BMDA 4CLHA 2C2BA 3GY0A 4HI0E 2CB9A 3JV7A 4ARUA 5A0VA 3SF8B 3DOCA 2W00A 4LK3A 1A71A 2PUFA 1SVLA 3UJ3X 1R0WA 2R8YA 1FK8A 3A4MA 3MWFA 4L1KA 3ZH9B 3ZY2A 3EQ9A 4GEKA 5U4QA 5CFNA 5JADA 2IS1A 3BJEA 3MMXA 2CVZA 1WB4A 4BEWA 1H5NA 3G2OA 1WS6A 2G9UA 4DSTA 2R6ZA 4QNMA 2H2FA 3BFJA 5ITWA 5KSOA 3KQSA 1H0KA 3ZGZA 3QOFA 2XEDA 4F8EA 3EC1A 1EJ6A 3PXBA 5E6SA 5U9CA 1GTSA 3T35A 3TCXB 1YTUA 2PQMA 3OQIA 1RLUA 3SEQA 3D8UA 4C0LA 3G2JA 5HF5A 5LYYA 3UUFA 3QUCA 4TYWA 1EX6A 1Z74A 3CNNA 1L4MA 2A5DA 3M6WA 4L6AA 1XLVA 3BIWA 4OJYA 5EZ6B 1ZWLA 2OILA 5HTOA 4EPVA 4FHEA 1A7JA 4K3VA 4M9RA 4V2IA 1R4NB 1SXJD 3NIDB 5ALHA 5G0VA 1QF9A 5LBIA 1VPDA 3M9WA 1RYYA 3D2LA 4P4GA 4CHTA 1E4VA 4FCWA 4WVFA 1TLFA 1ZK2A 2AE1A 1YZUA 2R8OA 1LU9A 2X4DA 1YHYA 1ZH2A 2IY7A 3MFQA 3MTJA 1EI9A 1I9CA 1W94A 2FPOA 4UXIA 5EMNA 1I10A 1S2NA 2NN3C 1CR0A 4OSOA 2ATEA 4RH1A 2JGAA 2YRFA 3BRQA 4CNQA 1G38A 3AB7A 1KU0A 2LWIA 4LRUA 3AHDA 3COYA 4PXSA 1T3HA 4AZWA 2J5QA 2K4MA 1I3KA 3H3JA 3HA5A 3CUEF 3ROEA 1CQJA 5AVJA 3PPIA 4DV7B 2NTJA 3HKCA 3PXGA 2AG6A 2X77A 5L3QB 1ZI6A 5L6LB 1T6XA 3PITA 4RSMA 2KM1A 4QQKA 5D01A 1X9HA 1GUAA 3EIHA 1OLUA 2NQ8A 1SBHA 4M7RA 5GPBA 4YH1A 1G9TA 1EGQA 1CW2B 1PK9A 3OPQA 5U4XA 2P9YA 2W6OA 2AVNA 3EEQA 5LD2B 1Q3KA 1OFUA 3MIZA 5FLKA 1II9A 1ML3A 1KVSA 4DR5B 3P9RA 1GG8A 1H6CA 2QSJA 2WZDA 3DOEA 1N3BA 1FFDA 2O7SA 1PNOA 1SCJA 4DC9A 1T36B 2H7XA 5T3YA 3KBBA 1T5TA 5FXMA 1PJZA 2BJHA 1JWAB 3AILA 3PDIB 5DNYB 4JU8A 2ANCA 3HJGA 1QVVA 4D2IA 3KZXA 2W5UA 3BXZA 4DA0A 5K6AA 3IXLA 2P7IA 5FKJA 1JFSA 4OVKA 5CDUA 4C4SA 1J23A 4UQOA 3ND9A 4Z4CA 2PJRA 3WQHA 5L3RA 1N5KA 1F2UA 2NVUB 3RJZA 1S9DA 4POAA 2R6GA 4JEIA 3VHXB 1CY0A 4AZTA 1V5WA 4AY2A 4AI6A 3DVRX 1N0VC 3MJCA 4N9WA 1MCZA 4OUDB 5KYYB 1U2TA 3IV6A 1MT3A 1L8LA 1T0JB 2XWQA 3VPFA 1TM7E 4RD2A 4I55B 3W3AD 4KDFA 4BMNA 2ZBPA 5F9MA 1MAAA 4AL4A 1MO4A 3Q5DA 4C4TA 1T34A 1HK7A 4JENA 5E3JA 3S5JA 2FEWB 3NCTA 4ZOAA 4N6GA 3ZS9A 2H08A 3N7TA 2M32A 3RFUA 3VO9A 3PEFA 4E4TA 2E55A 3LQKA 5CIQA 2IYXA 4XQCA 3FMFA 2DR0A 4YX9A 3R5JA 1UM8A 1IQPA 2QZJA 3I28A 5KIAA 1M66A 3LKBA 1N5RA 2Z0MA 3TZHA 2WDZA 4QLOA 5EI5A 3UJPA 3QMVA 1NJ5A 1Y7TA 3T3DA 3LAWA 3FF1A 3K5HA 4CKXA 4UPEA 4IIJF 1NIJA 3E0QA 3PDWA 4UDNA 3DE6X 3WIBA 4GZMA 4AN0A 4PRLA 1GKKA 1ZVJA 1EVJA 5KB3A 4CL3A 1FW6A 4WW0A 3FRIA 2JIOA 3ICOA 1LVGA 3DDUA 4AKTA 3ORQA 3VZRA 1P2FA 2GEJA 2VJOA 3O4VA 1E2FA 4CE6A 4YI5A 1HGXA 3DNMA 3TLAA 3UKJA 4B6FA 3OQ1A 1QXSA 2CNBA 2X19A 4LSWA 1ITZA 4KMOA 4MKFA 4TV9A 6AT1A 1CX9B 3D0RA 3V7UA 1JWLA 3H8VA 3OLQA 3U6KA 3SMQA 4RYLA 2B36A 3KLPX 3KWMA 4LHYA 4O3MA 2B0CA 1UZNA 4RK7A 2Q9BA 2Z2JA 3BE8A 3DL4A 5DGHA 4JQSA 5CX4A 2ZG6A 5ED0A 2ORWA 2HH9A 3FMIA 5FTWA 1V3UA 2OCDA 4F46A 1AKEA 3DV2A 3MW8A 3OPXA 2VF5X 1QIHA 1T4DA 3UUWA 3CA8A 5CEJA 1R8YA 5ICMA 2D3TA 4Q7QA 4UDYX 1XWFA 3BH7A 4TSKA 1O08A 3EGEA 3ZGLA 3Q3JB 3RG2A 4EJSC 3FOFC 2YWXA 3JR3A 4L95C 1V4NA 4LYFA 3DFIA 1F17A 3QVGA 4TRRA 3UG6A 1ZESA 4DIBA 1W48A 4EKGA 3N2ZB 2V0NA 5FNVA 4DT1B 3OX1A 4OA5A 1O97C 2PGOA 1U0BB 3I4FA 4NONA 2EF1A 4G5FA 1VMEA 3VR5D 1RCUA 1TO1E 1TVKB 2JFOA 4B2LA 1ODKA 2Z04A 4QG3A 1NSFA 1SC4A 2E6KA 2WOOA 4E5NA 2FSIA 3RIYA 4TSFD 1VPLA 4CGZA 5CBKA 2RAPA 1AXGA 3NORA 4PSDA 2YASA 4U7TB 4UVGA 1RE1A 3UMSA 3N0XA 3ZE0B 2W0SA 5CM8B 2A7QA 3DB1A 1ZR2A 2IIPA 4IIFA 4ZJUA 4NYJR 1SY7A 1XZDA 3DE1X 3RJ9A 1SXPA 1DBSA 1D2MA 1S6YA 4BO6A 1DPFA 3BD6A 3HUUA 2XBMA 1C1XA 4WSOA 2ZBFA 2CSXA 4OBWA 2C96A 1HI9A 2X3UA 4LHVA 3T12A 4B4WA 4EGCB 1BMFD 2QTHA 1M10A 4NZ9A 4XH9B 4YAEA 4MVJM 1WSAA 1USWA 2C0CA 4G5QA 1NRXA 1QKJA 1N8TA 2E4XA 2E7ZA 2J3DA 3KPVA 2ZIWB 5TV2A 1IZ8A 5I4CA 1STOA 3OQHA 1U2PA 2BTEA 1I51A 2R25B 1XLWA 2LRHA 1YOVB 2XMRA 4FZRA 5H70A 5IC5A 1TYEB 3T95A 1B6SA 2NIPA 2GXQA 4BUJA 1E2DA 3GUUA 5KREA 1U8YA 4EY7A 4FW9A 5F5XA 4RY9A 1TL7C 4BAGA 2VUSA 1U5AA 2FN9A 4Q9KA 4EAAA 1W87A 3B1KA 2GKOA 4QODA 3G2NA 5TMDA 3E22B 3IOBA 1UZMA 4AJ9A 3COSA 1DAPA 1L5FA 2DPMA 1SD1A 5TNXA 3K0EA 2JIDA 1O96B 5DOZA 1ZN7A 3GQVA 2ZANA 3LF2A 5KWIA 5BV7A 5A9SB 1A9XA 1HUQA 4IXNA 3QSGA 1M0TA 4YWHA 3AR6A 3GH3A 3P0RA 5COBA 5B57C 4QUDA 1QX4A 3GLKA 4M1WA 4U9IS 1E63A 4TKUA 2Y68A 1ZMBA 2O2HA 1OJLA 4I1RA 4IW3B 1ZU5A 4IMRA 1EX7A 1WMSA 1TOAA 3FDZB 3L6CA 2RCYA 2GN2A 2HWKA 1HSZA 3FH0A 1KF0A 1VOTA 1XKLA 1Y5IA 3B36A 4RMGA 3PFFA 1ZX1A 2JGEA 3HLKA 3PXDA 4MITA 5JS1A 3DCYA 4KACA 4P1ZA 3UXMA 1REQB 4KXWA 1C8LA 3RR2A 2JRCA 4C0HA 2C84A 3ANYB 1E7QA 2QVZX 2IHTA 1KMQA 3QYJA 1QHIA 4M9CA 3CPJB 5TQVA 4AW9A 3OSUA 2ZAIA 4I19A 5IG2A 1LLDA 5EP4A 4BJ5A 4GR9A 3DE2X 4OX9Y 2GH1A 2H5IA 3T3OA 2R5NA 4WESB 1BWQA 4XLTA 1MO3A 4RQUA 2ZUCA 2IHZA 2NNWB 4RK4A 5CM2Z 6LDHA 4N0QA 4LOHA 4KBFA 3N76A 1EU1A 5C1PA 5B6IA 4CDMA 3TVDA 1PWHA 4MUKA 2OEPA 3RC9A 1GGJA 1EVZA 2YQ5A 3FR8A 3RC7A 1PD1A 2OMKA 4PGAA 2F3RA 5CH8A 3TOVA 5EHIA 4YMIA 1GUFA 3AR2A 2I2BA 3AOGA 3K2QA 4K9PA 4TS3A 1XTKA 1M74A 1G21A 4WNAB 1VMAA 1LW7A 1WCIB 2GD6A 3DL7A 4J0EA 5G0UA 5HRAA 2JLWA 3JRXA 2ZEJA 2ZS8A 4YAWA 3CG4A 1W4BA 4HR7A 4NU5A 4RULA 2I1LA 4QARA 1LPAB 2IPNA 5JH7A 1ESZA 3P5BA 4PPNA 1F8FA 1DZ3A 3WYFA 4NYIR 1E2JA 5GWXA 4WXRA 4BQFA 3VZQA 2Q3HA 1CK4A 2YYSA 2GNAA 2WU4A 5FQOA 3I04M 2AGVA 3NRJA 4PS1A 2VQSA 3GWZA 4U00A 3THYA 4K6MA 2NT4A 3DWIA 4HAXA 1UAAA 1ZGCA 1M76A 1T2FA 2Z3ZA 2HRZA 4PPYA 2X5OA 1KI9A 4C4OA 1V5EA 4PSCA 1NLFA 5F3RA 1CUSA 3DLBA 2A6PA 2ZS9A 1C9NA 2V9PA 1QIKA 2FGJA 2O2DA 2ASEA 3PC3A 3W1WA 1N2JA 1E69A 1PVDA 1O6FA 2Y3IA 1NG9A 3JQ8B 5HKKA 4NG4A 4B5KA 2ZM6B 2H7YA 1HQDA 1YS7A 1YBMA 3HCAA 1HWYA 1TTHA 2P9JA 1DTWB 3ONEA 2ZRAA 5F21A 1ECCA 1E7WA 2OY0A 2QY9A 3LXUX 4J2OA 4TUYB 1J7JA 2J85A 4HGRA 4RHXA 1WSDA 3R75A 2RDMA 1J8DA 3D8NA 1HA3A 2DWUA 3FHOA 2R44A 1RT9A 2AB0A 4RTRA 4C29A 3IBGA 1PKXA 2AWNA 3BE5A 4JD5A 3RFVA 5BN4A 4CQNA 2XCQA 2FAXA 3GLHA 2X4IA 4IOJA 4QWWA 4Z9YA 1OAKA 2FHSA 2FUKA 2HBRA 5TPWB 1ORIA 3RC1A 2ZUBA 4K6KA 4N6OA 4BWYA 4CUKA 4CCWA 3DVAA 2F90A 3K4PA 3SSAA 2O8BA 1KIAA 3AF1A 2XMSA 1HNXB 4M9SA 2CUKA 4FONA 3ZDYB 4XJSA 3J81A 1PTKA 1NXVA 3Q6MA 3OEWA 2WU0A 4Z4HA 1H2AS 2OD9A 1IEWA 4IEIA 3VU3A 2A94A 4AUKA 2HT1A 1GKIA 2D13A 3GFTA 4AKHA 2QE7D 2FUCA 1J9EA 1TQDA 3H4TA 3IDQA 1L1RA 3JQGA 1L8OA 1ZNQO 1UCFA 3STHA 1OZ0A 1EA5A 1HQKA 4KQCA 4PCUA 5A3JA 1XZKA 2QG4A 1DCTA 5E3IA 3RADC 3HMQA 3SSOA 2FPLA 1FVXA 3D3QA 1G63A 4D97A 5FOTA 1XCPA 2AXNA 2QENA 2VA8A 1HLFA 3CGGA 3I76A 4DWWA 2CN1A 4P35A 4AY6A 1HSOA 1Y1RA 4QOIA 4HDMB 5K3OA 2OPHA 1H85A 2ZXFA 3ND8A 4C7KA 5H16A 4ER6A 1DO0A 1GEGA 1M75A 2FR8C 3M4YA 4FU0A 4UAJA 5DGTA 4P31A 3DUFB 4RIIA 4ZVUA 1X2EA 2WM3A 3BGSA 4CKCA 4JLDA 4R7TA 3SQWA 3PI6A 4YUWA 2XUOA 4N40A 3TRIA 3VV2A 3NEPX 4G56A 2ODBA 1CFJA 3ABOB 2I7CA 1PQYA 4UOEA 5ICCA 1JXOA 3NW9A 3R7AA 4BAZA 3D4NA 1Q0ZA 4JK3A 2J7PD 4MTLA 5CT5A 5K99A 5JS6A 4AIRA 1A9YA 2JBAB 1A8IA 4A8HA 2CVQA 5EKUA 3KT8A 1ODIA 2D1SA 3I3SR 3GR6A 3WGTA 1UMKA 4HL6A 4Z7JA 2C97A 2Q4DA 2AN1A 5ALIA 3CZ5A 3C5HA 5KMGA 4RTOA 3F5FA 4WJLA 3C8HA 1D6JA 3EBPA 1KRXA 4DJAA 3K0AB 4N5IX 1F6BA 2O3TA 3CIOA 3FMGA 2D4AA 3IKVA 1F48A 3R77A 1IG3A 2WJ6A 4NLLA 2CK3D 3ZCPA 5AK3A 4O33A 1YVEI 3JZMA 1OSNA 3IMCA 1BO6A 2YMQA 3N2NA 2ODNA 4EG3A 1ZCAA 2YV3A 4DV3B 5FYDA 3DTTA 2PMKA 3RWBA 5FWYA 3SYNA 2W8BA 3OTOB 1R5BA 2E0IA 3FA2A 4NJMA 3EXAA 1KVRA 4Z0TA 4RKEA 4J75A 3JQBA 1FS6A 2H52A 3BJZA 3VH1A 4H0CA 2VAWA 1J6UA 3DE5X 1PFGA 4Y9TA 4HNVA 1FYWA 3B6JA 3LUBA 2QYTA 2HREA 5IJXA 1DCMA 3WFIA 3BPSA 1AE1A 4IWNA 4X71A 1ZGZA 1X3SA 1QR6A 2HRBA 3JWHA 3DLIA 4C30A 3AU9A 5IEBA 2AMJA 3RANA 4DIMA 5ELMA 1NKVA 1T4CA 2G0NA 5I7AA 3RE1A 2BKEA 3K1TA 4XVHA 3NKFA 4RNDB 4E5KA 1WXXA 1O94A 2W2XA 3KJQA 3MSCA 4ZAFA 2I6QA 4Q19A 2MINB 4F56A 1P2BA 2WYUA 1VLHA 3VZPA 2DULA 3NYRA 3ZU2A 4OLHA 2HIGA 3FPKA 2BD0A 4U3JB 4XLZA 3JALB 3CX6A 2QLTA 1ND6A 1JEQB 1ZOOA 3CLTC 5EGSA 1M6YA 4HWKA 1XA3A 1PGPA 4BLTA 1PYDA 1L4UA 3QF4A 2IYTA 5M29A 2B30A 1GQRA 1Y89A 1HBJA 4K3UA 3VDNB 3KR0A 2PFKA 1PYGA 3SKVA 3VQTA 5COAA 4US2R 4XWWA 2BSXA 3I9MA 1KI2A 1WCXA 1CUWA 4A3SA 2JLBA 3N59A 1JQJC 1JXAA 3PGJA 2BDTA 3KKOA 2FEMA 3WB9A 2AOUB 2HB6A 2XNDA 3FHJA 2YYZA 1KDZA 3GAAA 4X95A 1QE3A 4EO7A 2DX7A 4OSEA 2H17A 3O4GA 4GPZA 5DYYA 3OCUA 3PICA 1XCOA 1RTKA 2FW1A 4I5GA 1G16A 4S05A 3UMBA 4IRMA 1KZ9A 4NE2A 4HQFA 2GTPA 2PGLA 5AVQA 4GS5A 3K92A 2A88A 5IF3A 5IXYA 1WUYA 3BGDA 3OHSX 6REQB 2P8SA 3Q85A 3ABQB 2H9AA 2QBYB 4FYIA 3JZAA 4RFLA 1SUDA 3WIOA 3CKMA 3IA2A 4IHAA 4R5MA 2IGBA 2HA5A 1RWPA 4LXIA 1V45E 2B61A 2WD9A 4XVQA 3DOJA 5I5GA 4HDKA 2VJLA 3TZLA 4NNPA 4FD3A 5IPFA 3WQBA 1GNRA 1XZNA 3ZBUA 3NTQA 4XWAA 1W46A 1ESCA 4IJ5A 2YJ4A 2R8EA 2J9ZB 1LS1A 1KO5A 3U9LA 3TIXB 4BLUA 1ZGAA 3D2BA 4AVYA 4W6QA 4J7XA 2ZJ8A 3SYKA 2GD0A 1JMVA 2F67A 4GE3A 4PZAA 3W9BA 4ZAYA 4GMHA 1ESMA 2NZ8A 3DZ8A 4RDCA 1LK7A 4KN6A 3HKEB 4ZREA 4FMCF 2HPAA 3PG5A 1ZI9A 2NO0A 1B0AA 4GZLA 1O6ZA 2IV3A 7ABPA 3O4IA 4LSGA 1LSSA 3UFXA 5BSGA 1BWRA 2OT3B 3GZNB 4H27A 1KJNA 4BBPA 4AKGA 2L42A 3FB4A 1JP7A 4AECA 3GB9A 4K7JA 4G5OA 4WZAB 4NZMA 1M73E 3QVSA 3OM0A 3C6BA 5LQJA 3TW6A 5IF9A 5TJHA 3KQLA 4AJEA 1PJ4A 5DWDA 1K06A 2IYSA 3QOYA 5FTJA 1CYDA 4TS1A 4LF7B 5HZMA 1U98A 1Z18A 3B53X 3TEMA 2FMTA 1B6RA 4H1UA 4H7IA 4P4TA 4RA6B 2XZLA 4FNGA 4ILEA 1OH8A 2NUPA 4XIFA 2HU8A 4FWIB 1D2EA 1ZHOA 3ZKAA 3PNBA 4RK5A </