2H18A

Structure of human adp-ribosylation factor-like 10b (arl10b)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
174
Chain Sequence
b'LVPRGSLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMINMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 8A
molecule tags Transport protein
source organism Homo sapiens
publication title Structure of human ADP-ribosylation factor-like 10B (ARL10B)
rcsb
total genus 60
structure length 174
sequence length 179
ec nomenclature
pdb deposition date 2006-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h18A00
3D7MA 3QF4B 5BN3A 1H8HA 1CR4A 1RVDA 4F92B 2IXGA 1PLKA 2QQEA 3OEED 4MGZR 4ASUA 4DZZA 2JJ2A 4RFSA 1MKYA 5LDDC 1CJMA 4NP6A 4JVNA 1SVIA 1ZAKA 2G6BA 1NG9A 2EYUA 4CEHB 1Q12A 2RGDA 3CO5A 4IJMA 2CJWA 1UKYA 1G3RA 4AYWA 5KTYA 4ZKEA 1ZNYA 1FX0A 3HJNA 1WE2A 5J4YA 3QF4A 3TSWA 4MQBA 1CP2A 2AHOA 2QSZA 4M22A 2AWNA 4LOAA 1KI2A 1GUAA 3BFVA 2FF7A 4E07A 3FOZA 4BZPA 2AKYA 4RZXA 4GFDA 4D82A 3PFIA 2H17A 2V9PA 1W0JA 4NCKA 2IWRA 2J0QA 4LWZA 5J47A 4ESVA 3PUVA 4JKIA 4D0LB 1SVMA 4JJKA 3FYHA 3IO3A 3QVVA 1BMFA 2D4HA 3NBFA 4FWIB 4ON9A 5FTKA 2BIFA 2V8OA 2AK2A 1R8QA 3QVUA 1WQ1R 3MRSA 1YVDA 4Q9LA 3QJYA 1UBCA 3KDSE 3REGA 4EPWA 3L2OB 2FFQA 5B64A 1F6BA 3IGFA 4P4SA 5UKDA 2BM0A 3TSZA 4JLKA 1R8SA 2OLJA 1RE0A 3KKNA 4MYTA 2JCSA 4PX9A 2G1JA 4DSUA 4TMZA 2XZPA 1TEVA 2CHGA 3K70B 2CLSA 1HY3A 4NU0A 4B33A 1XTSA 3ECCA 1T3SA 1G19A 1Z06A 1OT3A 1OXXK 2ZRAA 3L0SA 3Q9LA 4GPTA 3B60A 1UEJA 4ILEA 4JIMA 3K70D 1DTSA 3R9IA 3U7EB 2CK3A 3FHTA 1FMJA 3WRYC 2NO6A 4E22A 2ZETA 5B30A 2QZ4A 4ITRC 2CDNA 4B34A 1NN0A 1W1WA 4MRVA 2GK6A 2F3RA 4LBWA 2ZRCA 1XMIA 3SR0A 1KTVA 2YVUA 1P75A 2VQSA 4AD8A 2XXAA 2QP9X 4CYMA 4ERNA 1ZBDA 4ACAA 1Z22A 4QGFA 1KSJA 1WCV1 1XPUA 1E9CA 4DBLC 1CXZA 3VR4A 2RKOA 8OHMA 4A9AA 3VU9B 2CE7A 3JVVA 5EJEA 2JEOA 1P61B 2JLYA 3K70C 1YKSA 3DPUA 4FCTA 3B1WA 721PA 2GESA 2D2FA 3CNOA 3L82B 2HLDA 3FKSA 2IYXA 1OV4A 1ZNXA 4A0RA 2Z5FA 2Q6TA 3TQCA 2W83A 4M9XA 2I3BA 1UJ2A 3K9NA 2OFOA 5FPKA 5HZKA 3DKVA 521PA 3CIOA 2WWIA 3W8NA 3HU1A 1KI9A 3IDQA 3I4LA 1UEIA 2AFHE 4B2IA 1A2KC 1KDOA 4DIEA 1G3UA 4RZUA 4B44A 4YMVA 3IPXA 3THOA 4HDQB 2WSMA 4M1KA 2B6HA 3NKVA 2B92A 5FUXA 4FW9A 2ZRNA 1EFHA 5JS8A 3RS0A 3B1YA 2ZITA 5K8TA 4YQFA 2EQBA 4F38A 1WA5A 2IUSA 4B6EA 2IXEA 2QAGB 1FX0B 4XTRA 2FFBA 4QJ5A 4BWYA 2VP6A 4EUNA 5BQ5A 2ZRLA 4P32A 3NDPA 1LB1B 1VYUA 4P4TA 1KKLA 2NGRA 4DCUA 2C5LA 4IEIA 2QRNA 4A82A 3NBYC 4Q9HA 4TMWA 1SVWA 4MKGA 5HTKA 3RRMA 1DADA 2H57A 3GPLA 1QHHA 4QM7A 2ZREA 4TTRA 4OQMA 1VDZA 1GP2A 3A1VA 4LHVA 1E3MA 1P62B 1E1RD 1P2SA 3NTUA 2JLSA 3CONA 2BBSA 1N0UA 3B5JA 4XIGS 1DAHA 2BEKA 2WJHA 2HJVA 4V0KA 4PHFA 1I4LD 1F3OA 5HPYB 2OCAA 2JLVA 1L7VC 4KU4A 1R5OA 1UBEA 4OK5A 4RFSB 1QDEA 5DYIA 2J0SA 2F43B 3NH9A 1T8UA 4JLBA 4BE7B 4FI3C 3OIVA 4G0NA 1VG9B 3EZ9A 5F3WB 2GZAA 4A8JB 1OKKA 5GJBA 2J41A 1Z0AA 1ELOA 2ZRBA 1G7SA 3AUYA 4Q48A 1X3SA 5GVRA 4HUTA 1E9DA 4B71A 4C0KA 5F2EA 3CX8A 2GJ8A 5FR1A 3T1OA 2YOHA 1KSGA 1E2LA 4OK6A 4HB0A 1E9FA 4L9WA 1GL6A 3TH5A 2ZI7A 1Z5ZA 2FFAA 2FPLA 4Q00A 4YDSA 3VX4A 2C98A 4C0QC 2QU8A 2A7QA 3W5JA 3EARA 4Y0VA 3X1WA 2OFXA 3L43A 2E87A 2P6UA 4D0NA 2Q9BA 4C0JA 2V3CC 4FINA 4IOMA 4B6FA 2HDNB 4JLDA 2N42A 4MITA 5FPTA 2PZEA 2CEAA 2XNDA 1Q57A 2BHRA 4QBFA 5FOSA 3ZVNA 3DMNA 1FTSA 1OW3B 3QI2A 5FPHA 4DRZA 4B47A 4V03A 3SFZA 1N2CE 1VCNA 1IN6A 4WBSA 1NLFA 3H1TA 1R6BX 3QSYA 2WIAA 1FP7A 2QN6A 1X86B 1GRRA 2RGBA 3CWZA 4ABYA 1E1QD 2BMFA 2RGNA 1HT1E 1H65A 2ORVA 3RC8A 4BECA 1IY1A 2IUUA 2OCPA 1HQYE 1SULA 3IBGA 4JLAA 3GLHE 1UM8A 2XEXA 4URVR 3KJGA 5A4JA 4XWKA 4U02A 4NMMA 4EIWA 5FH9A 4RFVA 1DG3A 2VSOA 4LPSA 4OHWA 2QPTA 1T4GA 2HYDA 3REFA 1PJRA 2IHYA 5KU1A 3QBVA 1RRGA 2EFEB 4A2PA 3SQXA 1IHUA 1XEFA 4RVCA 1M74A 1Z0IA 5CIQA 1MOZA 3C5HA 3LD9A 1NVWQ 1WMSA 3TGPA 1HE1C 4F4IA 3CPEA 2JIZA 2ZE6A 4AY2A 4TLDA 4MH0R 4ZCIA 3MWLA 5H68A 2W2TA 4NYJR 1XTQA 2RGXA 2AFIE 5FBVB 1XTKA 4ZDKA 4G01B 2O0HA 1JEEA 4NKRA 1AS3A 3IHLA 1ONBA 1K5GA 1TU3A 4LJAA 1JR3D 5KSOA 5IK2A 2ZI3A 4G5OA 1M7HA 4DDVA 4C30A 1I4DD 2KWIA 5G40A 5GJVC 1EESA 3DDCA 1W5TA 3R8CA 3GEIA 2HT1A 2A5FA 2IYLD 2BBTA 3D3QA 3DZ8A 4PQFA 3WY9A 1OH5A 4G1UC 3K0AB 4KJZA 5IRCD 5TY0A 4OJQA 3UMRA 2DB3A 5D3MB 1G64A 3AVQA 1W36D 3DMDA 2AKAB 3EC1A 4OHZA 2ORIA 1ZD1A 3LWNA 1T9HA 5EXSA 1J2JA 4HAYA 5FL7A 3AF4A 1Z2CA 2VSFA 3N2EA 3SFVA 1H8ED 3KX2A 4XWOA 1R5NA 5LD2C 5JZVA 2V7QD 1OIVA 1GZSA 1XJ0A 3CZPA 1HH4A 3NG1A 4PHTA 3AVYA 3KQLA 2Q21A 3SJBA 4JVMA 1XEXB 4LJ8A 4Q18A 3TUIC 3DVLA 3D8BA 4PPNA 1VCMA 2P65A 1XBTA 3QF7A 2BKEA 1TUEA 3CUEF 4RJLA 1R0XA 3CF6R 3RYTC 3JZAA 4DLYA 1N0WA 1YE8A 3MUFA 1M7GA 3FE2A 3NWJA 2NMVA 3B9PA 4A8JC 3QIAA 4E09A 4B3DA 1A1VA 4DCVA 1Q1ZA 3GJXC 4DB2A 1LVGA 2IEYA 4KAXA 1Z6AA 4M1MA 4PZZA 2GXQA 4QL3A 4R9UC 5AJWA 5DHAA 3FMFA 2P5SA 5EE9A 4ASUD 1XD2A 1II8B 1NKSA 3A37A 4CIDA 3ZVLA 3GMTA 1Z29A 2N46A 3BERA 1IJFA 4L15A 3P1JA 1FL9A 2CVFA 2XOKD 1W0KA 4JJZA 4PC1A 4AKGA 2W6JD 2A30A 1ZD8A 2CVHA 3EC2A 5L3VA 1J99A 5EP2A 4PR0A 1OH6A 3NIBA 2O8BA 3KFVA 2GAAA 3PUWA 3VU9A 1TU4A 2R8RA 5EP1A 2GJ9A 2QUZA 2WBLC 4TTQA 5F9FA 4Q1BA 4RKFA 1YU9A 1ZNZA 4GBMA 3HDTA 1M1YE 2QBYA 2W6IA 1G8YA 1QG4A 1SVSA 5B2ZA 1YR6A 4IOKA 1QG2A 2X8AA 2UZIR 4TWZA 3EWSA 3GLFB 4LHYA 4Q01A 1GNPA 4BUJA 1FMLA 1Y3AA 3K8YA 3SC3A 4ZDIA 4MGYR 4D80A 1C1YA 3B78A 1E2MA 1G6OA 2DCUA 3SQWA 2EFDB 1COWA 2P67A 3OZXA 2IXFA 1YZKA 4TL9A 3AVWA 3CZQA 4YMSA 5KPDA 3MJRA 3A8TA 1W0KD 4QG7A 4HDCA 3GLIB 2FEOA 1E6CA 2QAJA 1KO1A 1CRQA 1GG2A 2UZ3A 3MWYW 1SXJB 2QNRA 1W4RA 5DI3A 2HF9A 2GEVA 1R4AA 4M1OA 5KHOC 4GMXA 4P0TA 4JKYA 1CJVC 1OIXA 2ZE5A 2Q3FA 3BBPA 2ZR7A 3DZDA 3EZ6A 4R98A 3WYAA 2B21A 2NPIA 3IO5A 2VHJA 3GCGA 4JL5A 1AN0A 1DVRA 2PX0A 2VBCA 2ZYTX 4TYPA 4YONB 1U0HC 2GJAA 2WKPA 1XMSA 1PLJA 4LI0A 1QHYA 3BGWA 2VL7A 2UVQA 4JLPA 1VIAA 1CKEA 1ODFA 2JATA 2JASA 2WOOA 1NLZA 4IDHA 1P9NA 1EFRA 2BOVA 4PHHA 1E0SA 3NHAA 3QKTA 3VX3A 4AG6A 2CNWA 3GLGE 4V0ME 4Q4HB 3SZRA 1CU1A 2RGEA 3X1ZA 2A5JA 4V0NA 3OHMA 4B3BA 3BXZA 2QTVB 5EXXA 2DFLA 4CRWB 1WF3A 1N3BA 3TKLA 4Q4HA 1S4QA 1ZUIA 3LW8A 2CK3D 3DOFA 4J0QA 1NP6A 1NKTA 1Q1EA 4LY6A 1OSNA 5FPSA 2WZQA 4WZ6A 1ZC3A 5KDOA 1Z07A 2B8TA 1OB5A 1T0HB 4XTCS 2W6JA 3LA6A 1DE0A 4QHTA 3NXSA 3PR1A 1ZW6A 3H86A 2BV3A 5KUTA 4UKDA 3K0FB 1K6MA 2PZFA 3OEHD 3WMGA 2HEIA 3RS4A 5EP3A 3L0OA 4A6PA 3RS7A 4HB4A 4RZ2A 3CX6A 4KVGA 2ZQ5A 4CEJA 2PL3A 1E96A 4A8JA 2OUKA 1DARA 1P5ZB 4XWAA 3KJHA 3SE0A 4IRUB 4DLUA 4YMTA 3AKEA 1EWQA 2R9VA 2IS2A 5FI0B 2CNWD 1G4AE 3CR7A 3WP0A 1OFIA 1ZM9A 3ZIAD 3LXRA 1AA9A 4TMKA 1XD9A 3EZ2A 3T15A 4D6PA 4Q4AA 5L3RA 3TUZC 2GCPA 2JLQA 5JLJA 4LK2A 1S9DA 4WZBE 1E2EA 1OXUA 4I1UA 3MAAC 3EPHA 5CJ2A 3GJ6A 2ODBA 4HAZA 4Q4AB 3VHXA 2FWRA 5JSZB 3IKJA 4TN1A 2VLIA 2J7KA 3SYNA 1GNRA 1HYQA 1KNXA 1ZCBA 3WMFA 3X2SA 2GVZC 4H9GA 2FFHA 5EE5B 5HCIA 4R2HA 3ZQJA 1OHHD 2ANBA 2TMKA 4URUR 3EA5A 1XU4A 3ZD7A 3RS5A 2V4ZA 2XGJA 3K09C 2BJWA 2W58A 1Q44A 5DSZA 4JVLA 1Q3HA 1UKVY 2I1VB 4DCSA 5KYKA 4RSGA 1W36C 5JWHA 1ANKA 4NPHA 2GA8A 5DI9A 2F1JA 4P31A 2DWPA 2ZI5A 4M9QA 4QBGB 1CRPA 1OF1A 4JBXA 5GJCA 4JBYA 2FNAA 2R2AA 3M6AA 5C1BA 4LSGA 1LS6A 1XTRA 5IF9A 3TE6A 2E9SA 3UIEA 3GLFA 1FFHA 3QPWA 3GLIE 1XD2B 1G8GA 3PEVA 2WJIA 4TQ9A 1SXJE 2V6IA 4C2TA 5ANRB 1KY3A 4BLQA 3PUXA 4LZZA 2ZJYA 5J4VA 2V6JA 3E70C 3ZJYA 4TT3D 2YWEA 5JHGB 4LYJA 3Q7PA 4GMDA 2ZRDA 2QM7A 1XJCA 1XXHB 4LHZA 4R7ZA 5SZJA 3S1AA 2QGZA 3TW8B 3U44B 4EPTA 1AS2A 1P2TA 2BMJA 4JL6A 2ZE8A 4OQNA 1US8B 2G3YA 1XNJA 1KKMA 1JALA 1T8TA 3RS2A 1FOEB 1IAQA 2WPDD 2GCOA 3FDIA 5FUVA 3SHWA 1OYWA 3FHOA 4DEYA 3M0EA 1YZLA 1NVVR 1S1MA 1S96A 3U6KA 1E2PA 1II8A 4OYHA 4RD0A 4W9MC 1ZJ6A 1KMHB 1N0VC 1D2NA 2ATVA 4K81B 2JA1A 2UKDA 1CR2A 2WSSD 4QOSA 4BLPA 4DB4A 4TLEA 2WM9B 4Q4JB 1KOFA 1NN3A 4RD3A 3JVUA 2R6AA 3VKGA 3I62A 1E94E 4PPFA 1E9BA 3U3KA 1GKYA 4Q4JA 3TVTA 4I1SA 3OAAD 3MCAA 4LDJA 4MKHA 2R6FA 2RH5A 3F8TA 3RHFA 3Q72A 1JAHA 4PXAA 3ICQB 3FMIA 1EFRD 3KTAA 1NN1A 2RGAA 3Q5EA 2VIIA 5AJXA 2C99A 2RGNC 4DVGA 5JBQA 2O8EB 2H7VA 2YWGA 2Z4SA 2EFGA 2C78A 4N3NA 1UDWA 1GIAA 3AVTA 1RIFA 4BZXA 1Z6XA 3C7KA 5DN6D 1NBMD 1KI8A 4DUGD 3SBEA 1W7AA 1D8TA 3PXGA 2P2LA 4RD1A 5JCPA 1EFTA 3A58B 2ZUCA 5G3YA 4HYYA 3RSLA 4BFVA 2P6NA 4BEBA 1G8PA 1N25A 3UWKA 1M2OB 3TLXA 4TZ6A 3FPAA 3AVVA 4S35A 2XJ4A 1G291 2YOGA 1OXSC 2AN9A 1ZNWA 4OHYA 3I5YA 3EAQA 1E0JA 3RWMB 4L5BA 2FPMA 2Z43A 3NC0C 1YRBA 2GF0A 3GFTA 3OF5A 2ERYA 2XOKA 4TYQA 1SGWA 2CCJA 4WAUA 4EAQA 3CW2A 2F9LA 3GFOA 1GM5A 3AKDA 2D3WA 2GTPA 4KODA 3U60B 2IC5A 3DHWC 5DH9A 1U2RA 2ZS9A 4EPYA 3KXKA 4DT1B 3ICEA 4KITB 5EE3A 3BC1A 2CCKA 3SOPA 4BLSA 2I4IA 3IEUA 2H92A 4LJ6A 1XXHE 2OHFA 4MKFA 2H16A 1LTQA 4LYAA 3ZVMA 3BRWD 1R0YA 1ZM3A 3O8BA 5EUMA 2OBLA 4BQSA 2Z0MA 4A1FA 1BMFD 4QGHA 3RC3A 4PZLA 4P33A 1VCOA 2P3SA 4S2EA 2QMEA 1EWRA 3QPUA 4URWR 1QHSA 1W5SA 3W6OA 4O3MA 1P9WA 3HPRA 1AIPA 1DPFA 4A6XA 1I2MA 1NLYA 2GK7A 3NHBA 1XPOA 1VMAA 2W00A 2JIZD 2XSZD 2V7QA 2MSEB 4US0R 3QKSB 4OJKA 1D9ZA 1OYYA 2IYUA 4JT4A 5EQTA 4OI1A 3WBJA 4AI6A 4CEIB 4UXHA 2PEZA 3W3AA 5FOUA 2YC4C 5KO2A 4EKDA 4LJYA 3QENA 621PA 1J70A 1D6JA 4JVSB 1KIMA 2IYYA 1A4RA 3EG5A 5DI3B 3MSXA 3S1AB 4QGGA 4IDNA 2X1VA 3F5FA 1IN8A 3WRXC 1FTNA 2VHUA 5CK4A 2P6RA 5B57C 3LX8A 2J7PD 5E95A 4A15A 1WBDA 1NG1A 1RRFA 2GJSA 1HQCA 1N6PA 5FFMA 4B48A 4M1YA 1ZCAA 1LV7A 4A0FA 1MV5A 1I4TD 3WHKA 3ZZTA 1G18A 5A0FA 4TT3A 3VHLB 5SZKB 1DELA 5J4KA 3Q85A 3PJRA 1E99A 5GADl 3THXB 2ODWA 4GOXA 4Z54A 1S3SA 2ASEA 1UF9A 4ZDJA 4KI0A 3U44A 221PA 1E2HA 1RFLA 1MO5A 3CX7A 1EXMA 2YJTD 4HDOB 1KI4A 1ZRHA 3T5DA 3U7GA 2VF8A 3IBYA 2ZSDA 1HV8A 1AS0A 2O0KA 1VG0B 3AQ4A 2ZRIA 4CGZA 5FBQB 2CXXA 3CKLA 2WJJA 3CRVA 3QNUA 4FXPA 4Q21A 3KTAB 4HAUA 2HXSA 4P4SB 4DIDA 4PANA 2PX3A 2VO1A 3SJCA 2QBYB 2OM2A 5AUOB 4JS0A 4C2UA 1EG7A 3ADCA 2GWHA 3ZVRA 5GVSA 3MD0A 1G5TA 2AK3A 2H5EA 2JJ2D 3NVAA 4DLXA 4M9SA 1JPNA 1VHLA 1YJ5A 4G5GA 4Q47A 2ZU6A 3RWOA 3PUYA 3SHFA 2OXCA 5KSPA 2WICA 1LF5A 5EZ5A 3RNLA 2VPPA 1NL3A 1PUJA 4GOKA 5SZIA 2H1LA 5M04A 4TQAA 2XB2A 5FR2A 4ZI3A 3H84A 4HAWA 4Z8YA 2MMCA 3RANA 1L8QA 3Q7QA 1U99A 4IXMA 2DFTA 4YMUA 4HZUA 3UMSA 1VYTA 2QA5A 1U0JA 2WTUA 1F5NA 5C46F 2YNMA 4WXRA 3EPLA 3PIRA 4ARZA 1OJLA 1KK0A 3BB1A 3ADDA 2H8KA 2ZU0C 4H1VA 4ZO4A 3OESA 5TMPA 1G4UR 1OLOA 3K53A 4KSBA 1T6NA 1US8A 2DBYA 5DLQC 2FA9A 4POAA 4XD7A 3C5CA 4PTLA 1E4VA 3FVQA 4LJ5A 1Z63A 1YQTA 2VP2A 4URYR 2CL7X 3EIHA 3LQRA 5D3MA 3RLFA 5AUNB 4F91B 1XMJA 5CK5A 2ZJ5A 4TLCA 3BIFA 1OFHA 2FH5B 3TQFA 1GSIA 4DT1A 2OZEA 2NTYC 2MSDB 4R71A 1KMQA 4UXJA 4C0SA 1G9XA 2XNSA 2QI9C 4ZV4A 2W2VA 3ASYA 5CYOA 1J8MF 2WWFA 3CBQA 1H8HD 2PH1A 1G7TA 2DY1A 1S3GA 2OCBA 2QG6A 3LO5A 3HYRA 5HKKD 1F2UA 2QAGC 1A7JA 3ZZ0A 1XTJA 1KMHA 1S0UA 1LS1A 3LRPA 5AJVB 4OI0A 4O0MA 4TZ0A 3NH6A 2JAQA 3MG9A 4GP6A 1QF9A 1ETUA 2D7DA 1XJQA 4KO8A 1NVVQ 4DSOA 2A3RA 4HAVA 2YV5A 2ZSEA 2Q3HA 3LDAA 3GP8A 4WA7A 3G0HA 3UK6A 3RRZA 1FZQA 1ESMA 3RSOA 5ELXA 2A78A 2IX3A 2OXRA 1CS4C 2F3TA 1UKEA 3GJ3A 5DNYB 3EPJA 4MRRA 1KO5A 2GNOA 4C0HA 2LCFA 5E7MA 3TAHA 4IHQA 3KKQA 1ZU4A 1ZU5A 1AJEA 1U0LA 2WWWA 2C95A 5KPJA 1BYIA 4M8NE 2AL7A 2JLZA 2ZXUA 1MABB 5DO9A 2R6GA 2ZRGA 3PENA 3KKOA 2PT5A 2V54A 2YINC 2C9YA 2GJKA 4XJXA 2XNDD 1N6IA 3GLHB 2HUPA 1G5PA 1T5IA 2DYKA 3MLEA 2NG1A 2WVJA 2ODNA 3BB3A 4HUQA 2G83A 3FGNA 1WDTA 1V5WA 3ZH9B 1PV4A 1YR9A 3WNDA 3W34A 1OE0A 3SBDA 4AKHA 2JLRA 1YR8A 4NONA 1D5CA 3A6PC 4OQFA 4B3FX 1TQ4A 1E79A 4KXFB 4XOIA 2NO1A 2BCJQ 2WMNB 3GLGB 3U3OA 2XAUA 3KB2A 2ZJ8A 1T91A 2X19A 2IYTA 2JLWA 3A36A 1OH8A 4GDFA 1E32A 3A4LA 1BYUA 1IM2A 1W49A 2BC9A 3EZFA 3VAAA 4D81A 2BMDA 3B13B 4KSCA 1M6NA 4AURA 1TX4B 4PZYA 1TMKA 2GEDA 3EPKA 3N5CA 4UNNA 4CT5A 1G7CA 4B3GA 2ZI6A 4B73A 4C0BA 3K9HA 1N5LA 3GEHA 4HZUB 2ZS7A 1IQPA 4NCIA 5H70A 3QOFA 2LKCA 4Z1MD 2J46A 4EPXA 1WXQA 5KOYA 3GJ0A 2GEUA 4Q1EA 4MKIA 5AUPB 1IOZA 1FUKA 3WNCA 1DO0A 2RAPA 2RMKA 4TQUS 5JWOA 3LFUA 2XJ9A 2EU8A 1GOTA 3AF2A 4RKEA 2WAYA 1VKJA 2XTNA 1UBFA 4LV5B 2IS6A 1AK2A 4DXAA 3SNHA 3BAFA 3DKPA 4GSYA 5G53C 1XX6A 4NCHA 2F1IA 3CNLA 4AIIA 4PPGA 2JJ1A 3KXLA 2KJQA 3T5GA 4C0LA 4ZKDA 2DR3A 3LBIA 1HEIA 2ZYVX 3M1IA 5K8LA 1ZINA 1N5JA 3BH6A 3VR3A 2ZANA 1E0AA 3O8CA 5KNBA 4HAXA 1E9RA 1GKUB 1FQJA 2W2XA 2VA8A 2BKUA 4QRHA 2PJRA 2IYSA 4MRNA 3W6PA 5BN4A 1SHKA 4HI0E 1E2FA 4LV6A 4Q7JB 3EW9A 4N1AA 3BOSA 2IF2A 3TR0A 4W5WA 3PEYA 4HATA 1R10A 1DAEA 2C77A 2I1QA 4FD2A 3CF0A 1E9SA 5FTJA 2ZRPA 2QRZA 1XB2A 3QXCA 5JSZA 2J9RA 2QMOA 3CF2A 4F4CA 1AGPA 4OHXA 4UNRA 1NJGA 1NI3A 1NRJB 2ECKA 4DLVA 1W36B 1S8FA 5L3QA 2Y8EA 2FMXA 1JJVA 1YZNA 4Z51A 4TLBA 2ZIAA 3U3JA 3VTKA 1IBRA 1JNYA 2XB4A 3CRW1 5L8VA 3BB4A 3GEEA 4URZR 5KNCA 1G21E 4U5XA 3HPQA 2FSFA 2WWHA 3T34A 4BEJA 2FV8A 5TXGA 1IN7A 3KJEA 1G7RA 3LLMA 5E7IA 2PEYA 4Q4LA 2HXYA 5HZHA 4U7DA 4Q9JA 4UXIA 1T0JB 2X2EA 1Q1BA 1W4BA 2VH5R 1PVOA 4V02A 1NIPA 3TAUA 5CB8A 1T3HA 4JLNA 4B2PA 3CR8A 3I5XA 4NL4H 1KK1A 3B82A 3K0EA 4NBSA 3JZMA 5CDFE 2BWJA 3QKRA 1FNMA 1YRAA 1JAIA 1G16A 1K5DA 1TUIA 2H18A 3T1VA 4B32A 2WPDA 4OHVA 4NH0A 3CNNA 4DLSA 3L0IB 2GZDA 3VR5A 4DJTA 1X8LA 3QUSA 1MO4A 1J8YF 1J90A 1IY0A 1D2EA 1JECA 1NBME 2QPOA 2GETA 1VCIA 1HT2E 4IVRA 1OFTA 1H8EA 5C18A 2ZJBA 2LKDA 1N5IA 4P4UA 3I1FA 1Z83A 5HE9A 5TV2A 2QROA 5C4MA 5J4LA 3HR7A 1KJYA 3K9LA 1UBGA 2EWVA 3ZDQA 1GTVA 821PA 2NOAA 4A0GA 5LPNA 3UG6A 1ZYUA 4EFNA 1Z6YA 2WAXA 1RJ9B 4QBIA 3FWYA 5FOWA 5LB2A 2ZSBA 4H1UA 1NSTA 4HLDA 5KNDA 4MA4A 4PC3A 1JR6A 1KI6B 1C4OA 2ZJ2A 3UKDA 3W3ZB 4GL2A 1U9IC 2IK8A 3H2YA 5EE0A 1JQJC 1II9A 3OIWA 1KSHA 3PUZA 1NVXQ 3K0CA 2Z6VA 4W5HA 3TBKA 4D4JA 2AX4A 1P7CA 4BPBA 1G3IA 5JEDA 2MSCB 5DGXA 3AUXA 2CMKA 4B3CA 1DG1G 2ZM5A 1XDBA 2BMEA 2ODEA 4GOJA 3CPHA 4A2WA 2V1UA 1NMYA 2D62A 4OL0A 4C9BA 1TNDA 4KLNA 5EXPA 3B85A 1GNQA 3BORA 4TYNA 4HB2A 2FSIA 3AF3A 2PT7A 4JBWA 2G88A 2WJVA 2OESA 1E9EA 1G3MA 1P2VA 3NEYA 1ZD9A 2ZAMA 4QKQA 3B2EA 2F7SA 1F2TB 4DDWA 5FPYA 3SDZA 4DHEA 1GITA 3N70A 4D0GA 4II7A 1E2QA 1AKYA 5SZHB 2IWHA 2EFCB 2REOA 4GI7A 3PCRB 2EVWX 4FMCB 4C7OA 4U00A 2FE4A 2MMGA 2C8VA 5L3SA 4Q1CA 2ATXA 2QAGA 1ZIPA 1IXRC 4BFSA 1CR0A 3TRFA 1E0KA 4WW0A 4ZCLA 3K0AA 1KO4A 2IYQA 3B1XA 2QORA 4L9SA 3LW7A 3QXXA 4QBHA 3GJ5A 3G82C 3SEAA 2VHCA 1CJKC 1JEDA 1VPLA 3FKSD 3R20A 4QHYA 3GJ4A 4Q9KA 4QXAA 3K0SA 3X1YA 3KQUA 1P72A 4BFXA 4N0DA 2QY9A 3IHWA 3ZS9A 3HU2A 3B8HA 2WHXA 1ZM7A 3V00A 4EJSA 5LD2B 1W46A 3AP2A 4WIAA 4JLVA 5CDFA 3OE7D 1F48A 5DN6A 2EYQA 1QHXA 2IYZA 4KFRA 2KI5A 2QEQA 3UWOA 4BLTA 2D06A 3A1TA 4C3ZA 4BRWA 2J0VA 2IHBA 5DISB 1IJEA 4PSKA 5JECA 3KB1A 1W44A 2AD1A 2QP3A 1FNNA 4M53A 4ZCMA 1TPZA 3AH8A 3AGPA 3P4XA 2LWIA 5IHPA 4A2QA 2PZGA 2ONJA 2R6DA 4NCNA 1R5BA 3DM5A 4PO8A 4LJ9A 4IXNA 1SXJD 4OKSA 3C15C 2PLRA 4D2IA 5LBIA 3LLUA 5KSYA 1IY2A 1UADA 3IILA 1N6LA 2D74A 1GL7A 3TMKA 2WWXA 1IN4A 4IDPA 4L4UA 5JJIA 1E1RA 3TW4A 3A1WA 2P5TB 4MRPA 4AKIA 4YMWA 2K5UA 3FMPB 4HLCA 2GCNA 3OIYA 3KXIA 5EXTA 3U3MA 1E9AA 1YR7A 1Z6TA 1XCPA 1VTKA 1U94A 2FZLA 4RD4A 4US1R 1KJWA 4BZQA 3R9WA 1KK2A 1KZ7B 3C14C 2CLCX 2A9KA 1D9XA 4JYBA 5FOXA 4OQXA 1QHNA 1E69A 5C4GB 5C2JB 2VRWA 1RRCA 2P0EA 3DM9B 2OAP1 1LF0A 2V1XA 3C41J 2QTFA 3QKUA 4TSFD 2OV2A 4JZKA 2BBOA 4F93B 5JCZA 4M21A 1KI6A 4YC7A 1R0ZA 2GKSA 5FL7D 4EFLA 3I72A 5CITA 2HCBA 4LGMA 1XD8A 2RCNA 1RZ3A 3HR8A 4IDOA 2WIBA 4JLOA 3ZZUA 1OXTA 3U61B 1R0WA 1S9HA 1M8PA 2WOJA 2B8WA 3K0CC 4YXWD 3L8ZA 2GZHA 1SVOA 1CULC 1A5TA 3LBHA 2ZSFA 2W6ID 1MR3F 2GBLC 5JHHB 3GQBA 4DDUA 5CYPA 4OQLA 2OILA 3LVRE 3NDBB 3X1DA 1S1CA 1SZPA 1M34E 5FTMA 5G41A 4HLUA 2ZRMA 3I32A 3RS3A 4GZLA 3R8FA 1XP8A 3A1SA 4PC2A 2ZJZA 1JR3A 3SS8A 3D31A 5HKKA 2VHTA 2RB4A 4V0LA 1SKYB 3OFND 3V4RA 1D2MA 2NO9A 4EDHA 4LRWA 4EPRA 3T12A 1FW6A 5FBRB 3OEHA 5FUYA 1I2DA 5AUQA 2GHIA 3X1XA 1VIYA 3Q3JB 4IFBA 1JJ7A 5AK0A 4B75A 3P4YA 4FMDF 5E4FA 3QKRB 4MGKR 2OAQ1 3THWA 1TF7A 1GRQA 4M1TA 5E7JA 3MMPA 4F7WA 5CM8B 2FOLA 1YZQA 1JXOA 4AWXA 2IS4A 1RW4A 1S2MA 4HUQB 2HCJB 3T61A 1XF9A 3QQ5A 1KAOA 1Z47A 1FPMA 1U90A 5E3HA 5HR5A 4W5JA 1CJUC 3B9QA 2J0UA 4R2IA 1MT0A 1T3LA 5L3QB 1VG1A 3R7WA 1L4YA 4PO1A 4O25A 1BIFA 2VP9A 3QBTA 4IDQA 1TQ2A 1OKKD 1EFUA 4G5SA 5TB5A 3KFXA 2XZLA 2CHVA 2XXAB 1NY6A 2BEJA 3VQTA 4UNPA 1QHGA 4EJSC 3CB4A 3DO6A 4WVFA 5DE3A 2WWGA 3O8RA 3UMFA 4MYHA 2DFNA 2QE7A 4L16A 1ZM4A 1BS1A 4KVAA 2CHQA 2XITA 2J87A 2OT3B 1YZTA 4BFUA 4BGDA 2Z4RA 2VTKA 3UXMA 2NPFA 4JLJA 4KFTA 2B7CA 3KZ1E 5JMTA 1ZIOA 3LXXA 1JBKA 3PV0A 5K8UA 5KDDA 4CEJB 5EE1A 2IL1A 2WSSA 5FBLB 2YWFA 2QT1A 1MRSA 2NO7A 4MYCA 3OE7A 4JSYA 3IIJA 5KDLA 3WYFA 3NBZC 1E2IA 4LBYA 3ZLJA 1NVUQ 2OCYC 3RVBA 2GVDC 6Q21A 3BFXA 4NE2A 3LVQE 2VP0A 3E5HA 2AR7A 2REBA 1OPXA 2GXSA 1T5LA 4HEJA 3A4NA 2QE7D 4QJ3A 4KBFA 3THYB 2DWOA 4Q1DA 1Z2AA 3AF1A 2FGKA 3AVPA 4LBZA 4NDZA 3BH7A 1AQYA 4Q7LA 3I61A 1N6HA 2QPAA 1KO7A 4BLOA 3EIQA 5CIWA 1NIJA 4V0OA 4LYFA 3KL4A 4PSVA 1XEXA 3T1QA 3V9PA 3TK1A 3UG7A 3AVOA 1LW7A 4CW7A 4QNMA 3U4QB 5JI3E 3I73A 3WMEA 2O8DB 4M2LA 4URXR 3PVSA 4C7OB 2CL0X 2RHDA 4FCWA 3EX7C 4KFSA 3AM1A 2AWOA 3BE4A 1G17A 1SQ5A 2FZ4A 2QGNA 2R6CA 2Z83A 3D6TB 4HZIA 4QFMA 421PA 4B76A 1L2TA 4DEXA 4D4MA 1Z3IX 4NYJQ 4QHSA 1W2HA 2JDID 3B1ZA 5FTNA 1FQKA 1GFIA 1SVLA 1UDXA 4OI4A 1P6XA 3P27A 4JSTA 2GBLA 1COWD 4I4LA 2R65A 1JR3E 4NHOA 3THYA 3LX5A 2ERXA 2ZI9A 3TSOA 3GJ7A 2VYFA 3WP1B 1TADA 1KGDA 2VSXA 5J5CA 3AB3A 1SKYE 5TVKA 2IT1A 3I8XA 4FMDB 4LV8B 5BYKA 4D25A 4GT1A 4TYWA 2G0NA 5J40A 5CB6A 5CLLA 4LX0A 3BK7A 3NC1C 1CIPA 4TL8A 1E2JA 2VF7A 4KBGA 3AP1A 1MH1A 2YZ2A 1FUUA 4IOJA 3PEUA 1OXVA 4UJ3A 4Q9IA 1NY5A 3L8YA 5BXQC 2AXNA 2WMOB 2F55A 4A92A 1DAGA 1KDTA 5IT5A 3ZD6A 2J5XA 1Y63A 4IOLA 4IEEA 5JS7A 2ZRHA 4D26A 4LHXA 5AJYA 3ZGXA 3U4QA 4AG5A 3MWKA 2JLUA 4PSAA 1R7RA 2DPXA 2E1RA 2JGNA 3VNUA 1Q1QA 1KO8A 1DEKA 2QQ0A 5H8WA 1DO2A 3QG5A 4Q7MB 4PHGA 1G1MA 3SYLA 2HJGA 2IYRA 3FFAA 4TL7A 3W90A 4EFMA 3ONWA 3NEJA 1DS6A 1P60A 5JI2E 4DC9A 4A36A 2GILA 3KJIA 3QE0A 4M1SA 2NQ2C 3AP3A 3Q8XB 3A4MA 2JJ1D 2J7PA 3GD7A 1XPRA 2OEPA 1QVAA 4HLQB 3AVXA 1W48A 2J0UB 1NMXA 1VG8A 3WNBA 4B3XA 2HF8A 1XZQA 2HT6A 3VR6A 4I99A 3KQHA 4I1OA 2OBMA 1Z28A 4MGIR 1XTIA 1TF5A 1NSFA 1RYHA 2KBFA 4BFYA 4LJ4A 4WZAE 3ZS8A 3TIFA 1CTQA 2QMUA 4GRAA 1ZM2A 1QZXA 1NNEA 2CLDX 2Q9CA 2XSZA 4PQYA 1P73A 2G77B 3ZIAA 4ZIRA 4MDFA 5JWRA 1W0JD 2A5GA 4OK3A 5EP4A 1KYIA 2ORWA 4KV9A 4M4SA 2EFHB 1HUQA 2WKQA 2RGGA 4Z8XA 3LQQA 4ACBA 3ADBA 3RDPA 3R7WB 4DLTA 3N2IA 2QP4A 4M1WA 1CEEA 2WKRA 4MUAA 1Z6GA 4HSEA 1Q22A 4M0LA 1GKIA 4K8OA 2NZ8A 3ASZA 3CRQA 3VFDA 4BFZA 3AVUA 3QPVA 4JYCA 2HV8A 5A5GA 3SN6A 3LNCA 2ZYWX 1P2UA 5H1YA 4EQ6B 1NF3A 4D4LA 4O2RA 5JRJA 3EIEA 1PZNA 2CE2X 1U98A 1ESNA 4Q7KA 4FMBB 3SJZA 3OAAA 5FUWA 2OLKA 4CDGA 1QBKC 1GDDA 1XCMA 2OSBA 4LUCA 4AKEA 3QXJA 2PBRA 3F0TA 1U8YA 2IW3A 4JLMA 1VYVA 1RC8A 4CF7A 5L3SB 2OO7A 5CM9C 5K8IA 3U2QA 3THWB 5D3QA 1G3QA 1P4SA 4P3YA 4W7SA 3C16C 1XXHA 4EQ6A 3TJZA 1WBBA 1JB1A 3VKWA 1EK0A 1ZVQA 3I92A 3OEEA 1KK3A 4XH9B 1G6HA 3RRYA 4UJ5A 2YKGA 4DSNA 2IEZA 1MABA 4RCYA 5CLQA 5JJKA 4GP7A 1TF2A 1XEWY 2YHSA 4GZMA 2ZRKA 4EPVA 2BCGY 5F98A 1KHTA 3DOEA 1JI0A 2PCLA 4XSHA 4ZIRB 2IA5A 4B74A 4DLZA 5JFGA 2ZE7A 2KBEA 3GFPA 3AEZA 1ZC4A 2YOFA 1HA3A 3LAWA 1SKQA 4NCJA 5HE8A 2KE5A 2XX3A 2J1LA 3DL0A 1JQLB 1GAJA 1RKBA 3DEFA 1EX6A 4IVPA 1WB9A 4O2LA 1W4AA 1O87A 2AD5A 2FSGA 4DUGA 1MO3A 3E2IA 3MWJA 4ZPXA 2O8CA 2GXAA 3R9XA 2B7BA 4NYMR 4XSGA 3QXSA 3GLHA 1Z08A 2ZVQX 1VHTA 3KKMA 4LJ7A 1ZUNB 5AWFC 1TQ6A 2FSHA 3LY5A 2ZR9A 3W5IA 4WOPA 2VP5A 3AKYA 3LH5A 3HU3A 3UANA 3CM0A 5AR1A 3SU8A 3AV0B 3EA0A 1UKZA 4FN5A 4AK9A 4G3XA 1G8HA 1Z0KA 2ANCA 2ZRJA 5EUQB 3WHLA 3EXAA 2O8CB 1NBMA 1XZPA 1XEWX 2F6RA 3FMOB 3LV8A 5FI1B 3QKSA 3OFNA 1U8ZA 1Q20A 4NZYA 4E5UA 3W9YA 1DOAA 2QSYA 1OH7A 2WJYA 4GNKA 4NYIQ 4MYUA 1G8FA 1ZUHA 2GF9A 3BH0A 2A5YB 2OBNA 1Q3TA 2YC2C 2ZUBA 4X8MA 2W0MA 2YYZA 3C4JA 2PCJA 2EWWA 1BO6A 3FFBA 1HTWA 2QM8A 2FDCA 3VR1A 1B23P 1AZTA 4C0AC 1KI7A 2ZS8A 1F60A 2O8DA 1AQUA 3K0FA 4KYIB 1WP9A 3BJIC 2BM1A 4JMPA 5IDVA 4XVUA 4BASA 4TLAA 4AC9A 1CJTC 2O5VA 2JJ8A 3CWQA 2BVNA 4QC2A 4Q19A 4LYHA 4PFSA 5LB4A 3KUDA 1G41A 1X8KA 1AGRA 4NTZA 2J45A 4TSFA 2ZSAA 1TL7C 3KQKA 3SYKA 3AGQA 3PQCA 2CL6X 3AF0A 5JEEA 1RPZA 4K46A 2O8BB 3EASA 1E79D 2DWQA 4DKXA 4ESHA 3GLIA 3GJ8A 3GLFE 2J3EA 1KNQA 4IVQA 1NN5A 1KDRA 4DWJA 4HB3A 1Q0UA 1MRNA 2OFWA 3C8UA 4KFUA 4LC1A 4PPQA 2D7CA 2C03A 2SHKA 4F4JA 3CH5A 1YZUA 4KHZA 3KQNA 2JLXA 2D2EA 1E2DA 4BRUA 1F2UB 4JT2A 3CLVA 4BLRA 4CZ2A 4I81A 2VHQA 1IXZA 4TL6A 5BW8A 2AXPA 1X8JA 2R62A 4EJSB 3HP1A 1GILA 2VP4A 1P9RA 2O8EA 4PC7A 5EZ6B 3IIKA 3CRRA 3ETLA 3L0PA 3TR5A 1DAMA 3M4YA 1IXSB 3HWSA 1KJZA 4QM6A 3ZYCA 1YZGA 1AKEA 1Z0JA 1QVRA 5AJZA 4XVQA 1UFQA 3K1JA 2L0XA 1E2KA 5TARA 5BWMA 3UPUA 4PAMA 4I1VA 3T35A 3NBXX 3SJAA 1PUIA 3QG1A 3HYTA 2BBWA 4YXWA 4A0HA 3CRMA 1N6NA 2PLFA 4CEHA 1ZP6A 1L4UA 3CPJB 2NZJA 4X8HA 3BD9A 3OIUA 2O52A 3H4MA 2DFKB 3CH4B 2GDJA 1QRAA 2QENA 1KSFX 1E98A 1B0UA 1Z0FA 1DAKA 3VMFA 4IW3B 1X1RA 4ZI2A 3O47A 3P32A 3K09A 2V55B 4Q66C 2ZUDA 1W4CA 1SXJA 3FKQA 3TVDA 1TTTA 3J81k 2FN4A 2GCOB 1XFAA 1V43A 2IS1A 3VKHA 1EX7A 3FTQA 4G5QA 1A82A 2X2FA 3PITA 2A5DA 2FU5C 4MDEA 1U8AA 3IIMA 1G5RA 2NO0A 4ARZB 1OB2A 4PAOA 1QHIA 1UPTA 4FMCF 1SVKA 2C96A 4B35A 5B58C 2XZOA 5GJWC 2ZRFA 4FIDA 1DAFA 3P26A 3Q5DA 4KLZA 1N5KA 4BFTA 1CR1A 1TQDA 1LY1A 3WYGA 3GLGA 1NMZA 3H0KA 2ZTSA 4PAQA 4LPKA 2F1HA 1A2BA 4LHWA 1HURA 4QGAA 1Z8FA 3T1TA 1AZSC 3V4FA 4DCNA 2QMHA 1KY2A 3RABA 3IUYA 3QEJA 1OIWA 1W47A 2C04A 2WJGA 3KKPA 4DCTA 3IPYA 4CEIA 1C9KA 4QNRA 3MGCA 4OBEA 1X6VA 3TUJC 4JL8A 3MFYA 4RZ3A 3SI7A 1U81A 1KDPA 2N1BA 4DLWA 3W6NA 3FHCB 2Q9AA 2GRJA 4Y0AA 2R44A 3I8SA 1F2TA 2RHMA 4MRSA 3B6EA 4LBVA 4UNQA 3E1SA 1PLLA 1VECA 2FPKA 2QTHA 3ZQ6A 2A2ZA 1AM4D 3TNFA 1SXJC 2NIPA 1X1SA 2ZPTX 4M9ZA 4Q5IA 1E1QA 3G5UA 2ONKA 1BH2A 2ZVPX 4YDHB 2IYVA 1IN5A 2FGJA 2PMDA 4Q02A 1J7KA 1GL9B 1TAGA 1RJ9A 2ZI4A 3RAPR 3THXA 4TMVA 1G20E 3K9GA 3A1UA 4AYTA 3EZ7A 2O0JA 1JXMA 5HCNA 1BOFA 2QL6A 2GAOA 2ZEJA 3KUCA 5TDHA 1Z0DA 1IONA 4IFEA 1XRJA 2QT0A 1E2NA 1CLUA 3B7GA 3VNVA 3U6BA 2OG2A 1GWNA 3PG5A 4FWTA 3RRNA 1II0A 2CBZA 2ZR0A 1E4YA 2F1RA 3IQWA 4FCVA 4RD2A 3U3RA 2IYWA 4V0MA 4B43A 2FX3A 3EWAA 5FBWB 2RGCA 4LCBA 121PA 1Q21A 2CCGA 5DYGA 3U5ZB 2YWHA 4XVRA 1YHNA 2EW1A 2J59A 1N6KA 4DDTA 1LFDB 4A4DA 2C2HA 4KCGA 1OFUX 1XCGB 3QXHA 4NYMQ 4ZDWA 5KSZA 3B1VA 1P3JA 2OE2A 5FTLA 2W0SA 3MJHA 4D4KA 4RCZA 1DAIA 2ZYUX 1CBUA 1N6RA 1ZMXA 4AYXA 1DBSA 4L8GA 1R2QA 2FEMA 1RRPA 4Q1AA 4DLRA 2JDIA 1EGAA 1HE8B 3ND9A 1BKDR 3P20A 2G1KA 2ZAOA 1CF4A 2Q0HA 4BFWA 1LNZA 1FP6A 3U7HB 1M7BA 2HYIC 1U9IA 1KZGB 4PO9A 2F43A 3AKCA 3BS4A 4OI2A 4Q03A 4TMXA 3U7FB 5JJLA 1GRNA 3WBKA 3QY0A 1SHZA 2KB0A 1MO6A 1EFCA 1KAGA 4X8LA 1TEXA 4KYUA 4TYYA 4NYIR 3BWDD 4E03A 2IUTA 4XD7D 2G9NA 1XWIA 2BDTA 2FG5A 1UAAA 2XTMA 5J4HA 5FOVA 5G3ZA 3BFKA 2XTZA 4Q1FA 3IEVA 1XMVA 4X8OA 4UNSA 3ADKA 2X77A 5JRZA 2REXB 2F9MA 1GVNB 5IK2D 4HLUC 2O8FB 4PC6A 3O8DA 1KI3A 2CJWB 2HLDD 2WV9A 4QJ4A 2PJZA 2C9CA 4TTPA 1QHHB 2Q3MA 5DIFA 3PEWA 2KSQA 3T06B 4IKEA 5FOTA 4RY2A 1OHHA 5DHFA 5F9HA 4CVNA 2O8FA 3LBNA 4DSTA 4WXPA 2IBMA 2ZROA 2VEDA 3QEOA 4YLGA 1WRBA 4US2R 4TMTA 3W8RA 4LC0A 4B2LA 3I3SR 1O3YA 2GXUA 2IF0A 4N0EA 2ZJOA 4CT4B 1KI1A 1NJFA 3ND8A 1E2GA 3FB4A 4G5RA 1W2GA 5BN5A 2FJUA 4Z1MA 1N6OA 1RYFA 3WXMA 4MUBA 1K8RA 2BJVA 2C9OA 4PQRA 4UQOA 5P21A 3UATA 3F3YA 2WWYA 4C4PA 1JPJA 4RD6A 3IQXA 2G0TA 2PMKA 5CJPA 3VR2A 5BYJA 5FL3A 2DHRA 2ZJAA
chains in the Genus database with same CATH superfamily
2FCRA 3PKIA 16PKA 1DQZA 3AWIA 1HE2A 1CR4A 2C7OA 1DP4A 1LTHR 1NXPA 3WK6A 2IXGA 2OCKA 1OREA 1PLKA 2QMQA 4EYKA 2ZQYA 3JYPA 1EK2A 2FZGA 1ODJA 4PZ9A 5FLEX 4DZZA 2AEFA 4RFSA 1MKYA 5LDDC 1IEXA 2IEBA 4LWOA 3NI2A 1RQ7A 4KMSA 4X1KA 3RSFA 4MCAA 3SQLA 5AW7A 1VL0A 4I6GA 1Q12A 5L9AA 5EERA 2R4TA 4AYWA 4RJTA 4AN0A 1ZNYA 4L08A 2UUBB 3DEJA 5I5EA 4AZ0B 4AS3A 4H7IA 3ZGLA 1UMCA 1VJGA 1DMRA 2MCFA 4MQBA 1JEJA 4HTFA 2AHOA 3FYSA 1ZQ9A 3OZVA 4M22A 1OLSB 4D2IA 3BFVA 1T3GA 2FF7A 4MW6A 2AOWA 3LYAA 3U7QB 4BMOB 3D64A 3OP1A 4LYEA 3C3BA 2GLXA 4FDMA 3T3DA 3TPZA 1VXOA 5B2EA 4H08A 1OWNA 5M2QA 1QRUA 3NR2A 4ML3A 1U2GA 5CT4A 1WHSB 2JGIA 2C59A 2YXDA 2D8AA 4JKIA 2JI8A 1QIJA 2CXHA 3VR2D 2WTBA 1ILWA 3HVUA 4JN6B 4FWIB 3AEQA 2A58A 2QR2A 3E2MA 2BIFA 1YQEA 2AK2A 2HIAA 2DH6A 3F4KA 1Z26A 5CVCA 1T8YA 4OSEA 1JDBC 1JTVA 1H05A 1X0VA 3E53A 4UHBA 2QRJA 3RASA 3ZQ4A 1F6BA 3IGFA 3Q41A 1P7VA 1QV9A 3R3YA 3VPSA 2OLJA 4BQNA 4EB8A 4UTVA 5LXTA 3PUKA 3TZEA 4PX9A 2JVKA 2XZPA 5CXQA 2H2WA 2FQWA 3UJCA 1CS0A 4K26A 2CLSA 3ZE2B 2QL9A 4WVLA 2G1PA 1HY3A 2WG2A 4NU0A 1F12A 1XTSA 3ECCA 4KN9S 1FFDA 1Z06A 4YVFA 3WJAA 1U0TA 3QVGB 4E5PA 4V1CB 1UZUA 1UEJA 1NDHA 2I5PO 2X5XA 4LDQA 1Z62A 4UU8A 3GFQA 3RIXA 5CVJA 1OV6A 4KJXA 3WRYC 1VL5A 3A32A 4AO7A 4E22A 2RHTA 4E5SA 3EGVA 4ITRC 1K68A 2CDNA 4H4EA 5FFNA 1SXGA 3MMNA 3PK0A 3S44A 4Q0MA 2GK6A 4QPDA 5BRNA 1P81A 4AMVA 4ZFNA 7REQA 3SR0A 4QUJA 1KTVA 4DV3B 5AOVA 1R0CA 1U5AA 3NJ4A 4OX9Y 3P2OA 5FX2A 1KVTA 4ERNA 5K3EA 3DEIA 2Y9MB 3R4CA 5DXFA 5BSHA 1V37A 2XUGA 3BQMB 2XTJA 3K5WA 2R96A 1NU8A 3ED1A 3IDZA 4YRMA 1IUNA 1E9CA 4DBLC 1XPUA 2ZWPA 1QQ5A 4MX8A 5K4HA 2MINA 5KNCH 1RM5A 1KZ4A 2GSWA 3QEKA 3QVOA 4IUDS 1RP7A 4P35A 4WRRA 3ZU2A 2JLYA 1BEUB 1QP0A 1YKSA 2JARA 2XV1A 3E9CA 2XBMA 2B98A 4KG7A 2LTAA 4PX2A 1H6BA 4OSOA 721PA 2G1AA 5T7BA 1QJCA 3HJAA 3NV9A 1C3OB 2XVZA 3ZHSA 4RDHA 2Z5FA 1D5WA 4XX1A 4F1WA 3PFNA 1KJIA 2FWPA 2PFGA 3DTNA 3TQCA 4GKJB 2I3BA 3X3HA 3K9NA 2VBFA 3EDYA 2EIXA 3VDXA 2AQ8A 3H6GA 3ANTA 4XWWA 2C3UA 3TBFA 4N7RA 1PT7A 2WWIA 4BO1A 3S0JA 4ZD6A 4UHKA 5HEKA 3N74A 3IQGX 5IYZA 3I4LA 3VM6A 4B2IA 1TMYA 5ITZB 2PYIA 5COAA 3O4GA 1KDOA 1SRRA 2DMRA 4LI3X 3JTMA 4OQZA 5HG0A 4OY3A 1QORA 4RZUA 4YMVA 1J8VA 1PL7A 3MWEA 3DDZX 4J3FA 3PNOA 3RU3A 4YEDA 3ROZA 3TL3A 3NKVA 5FB3A 4XCXA 1D6NA 1EFHA 1M3SA 4XB2A 3O31A 2PZAA 2LV8A 4G07A 4CR6A 1Z75A 5T4BA 5JAOA 1A8HA 2AFHA 1GZVA 1O77A 4PONA 4S1OA 1A0OA 4J0CA 4BUZA 3NUZA 1NP7A 1DJMA 5KEIA 1UBSB 2RI1A 3Q8KA 1WA5A 4JT8A 2IUSA 4QQFA 4ZARA 5K3AA 5LP6A 3E3MA 2IXEA 3AB7A 3UK1A 5CDUA 2X40A 1RMYA 2FRXA 3ORHA 2YH2A 5E9AA 3FCUB 3G8AA 1QK5A 3H1GA 3HYSA 1YC2A 4EUNA 3FNIA 1WCIB 4TLCA 5DN9A 3C5EA 5BQ5A 4LECA 1C14A 1J1UA 1L7NA 2CFSA 3RSCA 2I6SA 1LB1B 1VYUA 5LYYA 3W9SA 1X39A 4UMEA 5HFJA 3TG2A 4Q37A 3COPA 3H2IA 2W2QA 1WDWB 3LC7O 1HC7A 4OXQA 4ZVOA 1SBHA 1E1MA 4QDZA 4Y2VA 1ZVJA 4Q9HA 3I0ZA 2FLKA 4QYIB 2XQJA 3ST7A 2HO5A 4DJ5X 5G0SA 2FMKA 3IKMB 4ZT2A 5HKBA 1DADA 4I4CA 3VV3A 3CUTA 4OQMA 2H0RA 2HSGA 2XODA 4N65A 4R9SA 5TT1A 1NF8A 5FLXA 1E1RD 5E2AA 4J0DA 3LGXA 3NTUA 3CONA 4WI1A 4EX7A 4FS3A 4C04A 3B5JA 3OPVA 2RC6A 2H7CA 1DAHA 3FKJA 3MYYA 2BEKA 4TVOA 2QZSA 2JAUA 4V0KA 3ETHA 4EW2A 5A9TA 1NNLA 1BJTA 2HIGA 3AUSA 3F6CA 4DMRA 1FVHA 1R5OA 4MUKA 4UBKA 3E8XA 3MCVA 2VJKA 3CG0A 4RVOA 5KVAA 4NK5A 5DYIA 5EVCA 4AF7A 2JGDA 4R1UA 1ECFA 2QL5A 1T8UA 3LSYA 3FIUA 4BE7B 4BQOA 3WGVA 4G0NA 2IP2A 3R2JA 4M9CA 4ROSA 2V7BA 2JPDA 1ISSA 3WDSA 1RLJA 2QLTA 1DIRA 1FTYA 1FNBA 2IHZA 3HUEA 5TJHA 3RREA 5FR1A 2YOHA 4FYXA 5HJEA 1KSGA 4OX9B 4L6AA 2IDZA 1E2LA 1MEEA 4HB0A 2H31A 4XW2A 3VPDA 3ZCUA 1E9FA 2B99A 1SY7A 2ZI7A 2FPLA 4K5QA 4N5HX 4NI5A 5C7YA 4Q00A 1M6WA 4X64B 2ST1A 1B3RA 1SG9A 2A7QA 3HI6A 1CD5A 3TZBA 1FE8A 4FCCA 1YDFA 1U2SA 2XVXA 2YFKA 3L43A 3X1WA 4WCFB 4BBPA 3PUJA 4B0OA 4RMJA 4D4GA 1GZ3A 2P6OA 2VHVA 3M6VA 1LQTA 3HKBB 2HDNB 3MWEB 1BEEA 2N42A 3FUXA 4MITA 4FYYA 1I1HA 2Q9UA 4G1EB 4L7VA 1IMOA 2XNDA 2BHRA 4FSXA 4NAVA 5FOSA 5HYVA 4CMBA 3ZVNA 2GZ2A 4U6SA 3ANXA 3MTDA 4YASA 5H0IA 4DRZA 2YQZA 3C3AA 3EGIA 4V03A 2WTXA 4GXNA 1VCNA 1IN6A 1T4BA 1KOLA 4RNCA 2AN3A 5L53A 1XRNA 1Y33E 2VNAA 4FDAA 4TROA 4YPOA 5IJ9B 3QSYA 1SU6A 5LZ5A 1FP7A 2QN6A 3ZU5A 1LU9A 4HDNA 1LX7A 3ZHUA 2WG1A 4EHNA 2P4HX 3QXGA 1T4CB 1Z9BA 3B7WA 4DV0B 2A88A 2HHCA 4B4OA 1WAMA 3F74A 1LFAA 1WW8A 1QH8B 1VJDA 2AXEA 3O1HB 2OCPA 4KTTE 4ZU6X 3GLHE 3DOUA 1YZ3A 3VPHA 3WBBA 1OGJA 3B6IA 1OX5A 3KJGA 3LNTA 4XWKA 3LUBA 4NMMA 4U02A 5D8DA 1EBUA 2HK8A 1WNFA 3BYZA 5EKSA 1V5FA 5HP4A 4OHWA 3W1VA 2QPTA 5E1BA 4C4TA 1T4GA 4ZVMA 3NHLA 3KSDO 5DP2A 1QONA 3REFA 1JLSA 2IHYA 4O4LF 2ZUVA 3QBVA 4OQDA 3C4VA 1M33A 3ZYZA 4U2FA 2G6TA 1RRGA 5K5EA 3SQXA 4HK4A 5L3ZA 4RVCA 4YUVA 3TLKA 1MOZA 3C5HA 4MAFA 1NVWQ 1DXOA 1HE1C 2BD0A 2OV8A 4ZCIA 3MWLA 2BKXA 2W2TA 1QX3A 5FULA 1XTKA 2QXYA 5CDHA 3NOXA 3TB6A 4G0XA 1NVTA 5ESXA 1KEEA 1ONBA 1W4ZA 4GPEA 1COZA 2XMGA 5F1KA 2HSJA 1M7HA 1SG6A 1HQDA 1HNNA 1T9KA 1I4DD 2CBGA 2BFEA 2IXDA 2KWIA 2R60A 3K2QA 4R2WA 1E3JA 1W5TA 1XNHA 1NONA 5DKFA 3JD0A 4GAEA 2H2GA 3D3QA 3WY9A 3TQTA 1UPFA 4I19A 5EHNA 4KJZA 4HWPA 3KT3A 3VPBA 1ETHA 3GUYA 1RYBA 3HCCA 1MFZA 2MR5A 3HDVA 4KSYA 4ZTBA 2AGVA 4TXMA 3BTVA 3NP9A 5AW9A 3TLGB 1PV1A 2YWDA 3AVQA 3BRQA 4IMJB 3DMDA 4BGUA 3HUUA 1ZHFA 3NHRA 2AKAB 4IDAA 1B0ZA 4HBGA 3BD6A 4YMGA 1ZD1A 1A9ZA 4ZK2A 4KL8S 4BNJA 5E38A 4E6EA 5ENZA 2I2BA 3GIWA 1C9YA 1N2BA 2VWGA 2XE7A 3AF4A 3A9UA 1Z2CA 3N2EA 3FCYA 2VS1A 2HA6A 1BVYF 1R5NA 1EP2B 2NV6A 2Z30A 4PRKA 3DD5A 4PNPA 1XR3A 3OQMA 3SJBA 1TTPB 5EP4A 2OBBA 5DCLA 2YXLA 3DVLA 2VKTA 2YN4A 1VCMA 2B1RA 3DZJA 4H17A 2LE0A 1H6DA 3IT2A 3GGJA 3CCBA 1R0XA 4LQLA 4ZEXA 3USES 1E5LA 1N0WA 4QREA 1M7GA 3NWJA 4P53A 2WQ6A 2NMVA 4A8JC 1TYBE 3QIAA 4E09A 3ETGA 5EL0A 4JDUA 4B3DA 1FSPA 3HCDA 2YUTA 2AZ4A 3GJXC 2E18A 3BAZA 1LVGA 4KAXA 4REQA 3KVOA 5DHPA 5TQ0A 1E5XA 1X0XA 5AJWA 2GXQA 3IA2A 4QL3A 1BFDA 5DHAA 5DPMA 5EE9A 3RK0A 3WWPA 1NXQA 3N07A 4ZYYA 4BU0A 3GMTA 4YX9A 1PDOA 1Z29A 1VL2A 3BERA 2FSVA 1RLOA 2G1UA 2NAPA 3F6BX 3P1JA 4L15A 4K3VA 3GQBB 3LQYA 4G9BA 4IO0A 4P2GA 2PGIA 1C4WA 4U7JA 1O57A 2A30A 3MERA 3Q7TA 5L3VA 1J99A 1K9SA 3G1TA 4R1SA 5FRDA 1M0TA 3NAQA 2MINB 2ID4A 4LMBA 2D0IA 3COSA 4ZYXA 1NOKA 1KIAA 4MA0A 4ZOLF 2OB2A 4RSHA 1U02A 1ZNZA 2QMYA 1M1YE 2VJYA 1V41E 3HDTA 3PQ8A 3QWIA 3TR6A 4POOA 3SZGA 3KSMA 4OLBA 3IULA 4ZU1X 2JHGA 3G2MA 3GFRA 4FWBA 4IOKA 4RDCA 2BCEA 2MR6A 3ZI0A 3UKJA 1QG2A 3BZWA 3IKVA 4JOCA 5PNTA 4CFSA 2P68A 4U2GA 1H2EA 2GMWA 3GLFB 4LHYA 1BDIA 1VHDA 5BQXA 2XKBA 6LDHA 1DJOA 2PZMA 4E5KA 1FMLA 2LRHA 3DMGA 3K8YA 3SC3A 4L5AA 4XDYA 1EXDA 4KRYA 2DPHA 2I8LA 4RV5A 1S7CA 2DCUA 2O2ZA 5TPWA 4E14A 5HIKA 1COWA 4TYMA 3LP8A 3V4ZA 3SQWA 4CMIA 4YMSA 2VTEA 3NHZA 2COUA 3IBSA 2BH2A 3IVRA 3MJRA 3ANMA 1IAVA 4OXXA 4QG7A 1CY4A 4HDCA 5C8YF 2EX0A 2NADA 1JPVA 1KO1A 2QAJA 3AIKA 4FVTA 1R74A 3IVAA 5JYDA 2GEVA 1R4AA 1XTBA 4E88A 1RPNA 4GMXA 1OXKB 5KHOC 4P0TA 5FNVB 1OIXA 4WY5A 3Q15C 1EVLA 4JLWA 4F2DA 3KOWA 1TXGA 5EJ8A 5AKKA 3X2EA 3GCGA 2VPZA 1HDYA 5CB0A 1T29A 2J5BA 1Z6ZA 2V7UA 3DVRX 2II6A 1YF3A 1A8IA 5D3KA 4NZNA 4HBZA 4R3NA 1C1DB 5KYXB 5JROA 1GO2A 1MJGM 1PLJA 1CNMA 1NW9B 1RCFA 3OU6A 1F7UA 1WMDA 2VUUA 1ODFA 2JASA 3O7WA 2Q41A 2B4YA 4IDHA 1XZEA 4TV8B 3VX3A 4JSRA 2GD6A 5BSUA 5HTOA 5REQA 4CIWA 2RDMA 3GLGE 1DEOA 1CU1A 1FUIA 5AK6A 3X1ZA 1QO0D 2A5JA 4R8SA 4B3BA 5DGIA 5JMOA 3JYLA 4WLOA 3WJ1A 4AN4A 5EI5A 1XN4A 1XVAA 1JILA 2H2IA 2NVUB 1G8MA 3P0FA 1X7GA 4Q82A 2CV2A 1N3BA 3B6MA 2L2QA 4FJ1A 5KYNA 3L7BA 4R9NA 4IIBA 5T41A 1S4QA 4Z3DA 3T3HA 1ZUIA 3TG8A 1SVUA 1VE9A 2CK3D 4RAOA 4YQZA 1QKKA 1V48A 2O50A 4JHLA 1OSNA 3RUEA 3OG9A 4EA8A 4LWPA 1T0HB 4B6PA 5HOEA 3LA6A 3FGZA 5DWQA 3M6LA 3NXSA 5DNAA 3M2PA 3QTBA 3KU4A 1DB3A 1J4AA 1PZMA 3IUMA 4ZQBA 5JU6A 3HV2A 1VKRA 3WMGA 4WNCA 5EMNA 1O0CA 3AI3A 3PXXA 1U0SY 1P19A 3GIDA 4G0WA 4RZ2A 2VUIB 1L4KA 2D3TA 5DHTA 3WL4A 4ER6A 3U4GA 2ZQ5A 3WGJA 2D1QA 5J59A 2XMZA 5A5VA 1NR5A 2VTBB 3CH7A 3G0GA 4NEGA 1E96A 3SP1A 4CEJA 1DARA 1P5ZB 4Y30A 1RJFA 4PYIA 4DLUA 2FXVA 4DBLE 4Z4GA 3KR0A 4NH4A 2BGGA 1OT5A 3A6HA 4PPYA 2AQIA 1ICIA 4FFPA 3ZJ5A 2Q8PA 3OU2A 3LT4A 1LWNA 5DHQA 3WP0A 1OFIA 1ZM9A 5CA1F 3GJTA 1E7QA 3LXRA 1AA9A 4MGHA 3U0VA 1ARZA 4NVRA 2I4MA 2OVBA 4PN7A 3N2KB 5L3RA 9GPBA 5LC1A 2GCPA 2YVQA 1TKAA 1S9DA 4DZRA 4I1UA 3T1HB 1KC3A 1KR2A 4RTMA 2W2KA 4E51A 2YMLA 2JKVA 2ODBA 2LZ0A 4HAZA 4IIJB 5AKXA 3VDRA 2FWRA 3AHFA 1S02A 2OHXA 1ULZA 1UC5B 5CURA 2VLIA 7GPBA 3FI0A 9MHTA 3S7ZA 1GNRA 1KNXA 2UU9B 5LQJA 5H3LA 1E62A 2DGDA 2GVZC 4H9GA 5EE5B 2YV4A 1A88A 1OHHD 2ANBA 3DHNA 2GEJA 1XU4A 3ZD7A 3KQSA 1E63A 2VPWA 3L7JA 5TE9A 2BJWA 1W34A 4U2BA 5A4IS 4HDNB 1PEDA 1UKVY 2OMEA 4DCSA 5KYKA 1KVSA 4CF4A 1W36C 2REQB 1BQEA 5C4IA 4OFBA 1ICEA 1ANKA 1ISPA 3MJVA 4FHGA 2A0KA 4KMMA 4NPHA 4WZBB 5KYTA 1MPXA 4DF3A 4J7AA 4P31A 1XQVA 2ZI5A 4B3JA 1K66A 1JQ3A 3C98A 3NKLA 2YRFA 2GHQA 3PEFA 2VDWB 4G65A 2DUJA 2NSDA 2YNMC 4GMKA 2CY0A 5GJCA 3VO1A 3PYMA 5C1BA 1DCKA 2YIVX 2ZTMA 4KQIA 4YI5A 4B4UA 1PP4A 3ZCSA 2M1ZA 3OF3A 4DMFA 3MWDA 2OK7A 4HAOA 3PFFA 1DHTA 2C8LA 4TQ9A 1A71A 3DKIA 4UZFA 4GEGA 2DF8A 4GHWA 4D9IA 4BLQA 3PUXA 1TIBA 3HWX1 1UXOA 4G2NA 2CLLB 4IDBA 4KXQA 1AX9A 1FRFS 5J4VA 5KVCA 1ZRNA 2V6JA 2XRYA 1L4LA 2YWEA 5DXAA 5JHGB 2ZRDA 3C7CB 3JQAB 3R4VA 4AXXA 4M1ZA 5H16A 1P29A 1GPBA 3K0KA 4LTMA 2VJMB 4I4NA 1WBJB 4ZVSA 4EO4A 1NT2A 4MMZB 3WGMA 4FGJA 1X7XB 1DUSA 2ZE8A 5BWLA 4R5MA 3IBTA 1TUBB 1GHTA 1US8B 1XHLA 3UF0A 5HRUA 1K86A 1QS0A 1IAQA 4FNGA 2WPDD 3TQOA 3RVNA 3FDIA 3DLBA 1GZUA 2HGZA 3VI3B 3FPFA 1I2AA 3MIZA 5AK3A 4CCYB 3GA5A 1S96A 4IL5A 2OZPA 1N75A 5B7QA 3U6KA 1UXJA 5EHIA 1N0VC 4DB4A 2JA1A 3AFIA 2HIMA 3NIWA 4QOSA 1RKUA 1KOFA 1NN3A 2WLSA 3ZHVA 1C9MA 4XJSA 3W4IA 4ZV9A 1TCVA 3AFGA 4PPFA 1IZ8A 3G2QA 3U3KA 1S3IA 1F6DA 1OY1A 2VK4A 3AT1A 5CAEB 4AO6A 3MCAA 4MKHA 3VRHA 3PGA1 5F7JA 2RH5A 3PSHA 5EJ4A 1JAHA 2FP4B 4PXAA 4KPFC 5CFQA 2CVZA 1RAHA 1EFRD 1V6AA 2PGOA 2QRQA 2RGAA 1M2VA 1RLMA 2GYVA 2O2JA 2Q5CA 4O4JA 1OCEA 3ZI7A 2QVXX 2W8BA 3PDCA 2YBDA 3WLFA 4HF7A 3P9SA 3SM3A 1LLCA 4DVGA 2A4KA 3CNHA 3IX7A 4BNFA 2Z4SA 4Q3KA 3S2YA 2EFGA 2C78A 3G0IA 4WFKA 1ORDA 1Z6XA 2Q6IA 3H1EA 3R77A 1KI8A 4JI0B 5HCUA 3LK6A 3URMA 1NT4A 4L4YA 1GPNA 4XPZA 5G3YA 3RSLA 2ZJ0A 1I6LA 2P6NA 1TM1E 2QXTA 1ZA1A 4JJFA 4QIHA 3UW1A 5EP1A 3UMBA 5LQUA 3TLXA 3FPAA 3AVVA 3WSTA 4CCWA 2YOGA 1OXSC 4QASA 1MQ8B 1TGVA 3TGLA 4P22A 3UAYA 3I5YA 2J4DA 3WLRA 3TL2A 5K8VA 3RWMB 3GRVA 1B42A 1R1DA 4RIIA 5IAKA 4XSVA 3IT3A 4CR7A 5K45A 1EEHA 4JGGA 1YRBA 1VLLA 3GFTA 4WZZA 1DC8A 2G04A 2LBPA 3ILVA 1Y9EA 2ERYA 3OF5A 2XOKA 4TYQA 1SGWA 1TVCA 1DJLA 1WQ3A 2JFGA 1B6GA 4TTSA 2CCJA 4CQJA 4E21A 4Z7JA 1JR2A 4RPKA 3CVWA 1YFLA 3K0BA 3AKDA 3USCS 4ZOQI 4ZI7F 4ZZ3A 3IV6A 1VKZA 1U7XA 1UXGA 3ICEA 3K9BA 3N39C 2OYRA 2QX7A 4CM7A 4AKTA 3NTOA 4BLSA 1XN1A 2I4IA 3IEUA 1YS6A 1NVFA 1XXHE 2OHFA 4QVIA 4LE0A 5FPQA 3GFFA 5EUMA 2Q3DA 2OBLA 3FPJA 2Z0MA 4Z0NA 1WP4A 4QGHA 3A1NA 1SIOA 4LXUA 1IB0A 3CURA 1PO7A 2P3SA 4ETNA 3C87A 2WJ6A 2UXCB 1EWRA 4PYRA 1RACA 3FMVA 1RVV1 3NEAA 3DULA 1ZRSA 1J39A 2CF5A 1XK7A 3QFHA 3HN7A 3QBEA 4S2UA 4O3MA 1RC0A 3HPRA 4E12A 4Y18A 5IJ0A 1NLYA 2GK7A 4LRYA 1Z5WA 3FFTA 2A8YA 2W93A 2PZBA 4R0MA 4NJMB 4Y2PA 4OFWA 2EGGA 4K6GA 4MICA 3JQGA 3I83A 4LDNA 3PZBA 4DUPA 2F8LA 4LOIA 2HMWA 2PSEA 5EQTA 3RVPA 1HSZA 2AMVA 3AF5A 4HC4A 2PEZA 2C3YA 5AKGA 4QUIA 4P8RA 2QN8A 1D6JA 4JVSB 1KIMA 1ZGZA 3SLGA 1THMA 2PMFA 3JQAA 2EZ4A 2IIPA 1W76A 3PDUA 1OPRA 1QOQB 2FSUA 2H1HA 1E2BA 1EB9A 5EQFA 1FTNA 5CK4A 2OC4A 4B3MB 2GX6A 1R37A 2OO5C 3DFUA 5DYTA 2ISCA 1SHLA 1NG1A 4ZAXA 1DRWA 3CUUA 1HE4A 3NAGA 1UZAA 4B48A 2O5CA 4EG5A 6AT1A 1SIBE 5JXGA 1A9TA 1KYZA 5B4UA 4MS4A 4IZIA 2I78A 1KC1A 4HJRA 1T24A 3WHKA 3HCFA 4BV3A 3B8EA 1V1RA 1OWLA 1UMBA 1DU4A 3C7DB 2VYVD 5A0FA 5JNLA 5EJ2A 1O97C 1CQIB 4HEA1 2HU5A 2A14A 3ZWBA 5GADl 3OQIA 4FB5A 3M9XA 3BXEA 4HFMA 2ASEA 1UF9A 3NT2A 4NQRA 5IDXA 3Q9UA 3K1ZA 4KI0A 221PA 5C53B 4IRXA 3ZG6A 1MO5A 3BICA 5JXWA 2YJTD 4KE8A 2B37A 3T5DA 1ISIA 1XRRA 1HV8A 1Z4LA 2OWEA 2O0KA 3GEDA 3BIJA 4A91A 3G3EA 2QDKA 2ZBUA 1PJBA 1R4ZA 3GJZA 5HFAA 4RQBA 4AUEA 5KNDH 3EHDA 5AM1A 4CU5A 2AC7A 1P8AA 3H5RA 2D1FA 4ERXA 4BVLA 5IJ0B 4PANA 2AE1A 2WWVD 1Y6RA 5ARDA 2VO1A 1EX9A 4HFJA 5KMGB 1UWVA 2QD5A 3ZNNA 4KWEA 4WHMA 2JS7A 2HW8A 1BTOA 2GWHA 5HQJA 2QW8A 5GVSA 3PXBA 4NS4A 3NVAA 2H5EA 2C4MA 4UBNA 4M9SA 2HXGA 2APJA 3GCZA 3TEFA 4A23A 1RE1A 2FQXA 2E4VA 2ZU6A 3T3GA 5KWIA 1E4OA 3PUYA 1GPAA 4II2A 1EE2A 5LXTF 3DWFA 3V7WA 3TIGA 1JG2A 6CHYA 4W7IA 1BVHA 1TZCA 1NL3A 2Z8YM 3L46A 3NNSA 3H2GA 1IZ0A 4GOKA 4CQMD 4TQAA 3TGWA 3K9WA 4JJ6A 5KZMB 2XB2A 3G49A 4LXXA 1P0IA 3H0CA 3SLKA 4HNUA 1C81A 1NSYA 3BCRA 4ZVRA 5E9QA 4C21A 4YMUA 4EF5A 2QA5A 2PAAA 1OFUA 1WMFA 4EDFA 2V96A 3MJFA 2WTUA 4CTNA 3RYCB 3LXUX 3CA8A 2PRYA 4RM2A 3EPLA 4HFRA 3UMJA 4BKRA 1ZITA 2E85A 2H8KA 2XDQA 1BROA 1IVSA 4ZO4A 3OESA 4XIYA 1QQAA 3SEQA 2J67A 1X7HA 3K53A 2FAXA 2R79A 5DLQC 4N47A 3YASA 1PJ8A 4PTLA 3FVQA 4MVJG 4Z9AA 1YQTA 2VP2A 4UUMA 2CL7X 4LYYA 4ZRDA 4BZZA 5KYWA 1F8GA 5T8KC 3UO8B 2Y1LA 2Q6KA 3N8KA 2NXEA 2YHIB 5LJLA 3ZJVA 2HA0A 1H3FA 2ZJ5A 2P90A 1OFHA 5SV2A 2ZAGA 3VOSA 3U16A 2OZEA 3ZTWA 1YBMA 1QYXA 2IZ0A 3DBIA 3RQSA 2MSDB 1CF9A 1RMTA 2MSLA 4PCVA 1U3UA 2XNSA 2QYSA 3HE3A 2W2VA 3HKCB 1A9RA 4IYRA 4R01A 2WE8A 3MT0A 4WXEA 5JATA 1XDDA 4YT5A 4IQ8A 2PH1A 3RSZA 4NENA 1YUBA 2GRAA 1P7WA 3HYRA 1O96B 4Y2XA 2QAGC 1A7JA 3Q0EA 4XVHA 2PM8A 1KMHA 1LS1A 3LOUA 5KQMA 1PBNA 4L75A 3H1FA 4O0MA 4X6XA 5AJVB 2FKAA 1XKXA 2WEKA 4ER7A 2JAQA 3GZ4A 5LMCA 4DG5A 1QF9A 1WU8A 2HV9A 1HK7A 2PKEA 1NVVQ 3V6LA 4JLUA 1GZHB 2EBHX 2YV5A 2ZSEA 3I9JA 2OWDA 5BN3B 3WYNA 3LDAA 4WA7A 3ZKWB 4EB6B 3G0HA 1UZMA 3KQVA 1YDGA 4S24A 3VJKA 5A9SB 3FPLA 1QGZA 1FZQA 2Z8YA 1ESMA 2VJMA 3DHEA 3RSOA 2C2KA 2A78A 2F1OA 5FYDA 5ELXA 2F3TA 4HDRA 3BJZA 4YCAA 4C0HA 5E7MA 4JGBA 1ENOA 3KKQA 1NHGA 4GI2A 1SUSA 5HK8A 1ZU4A 3LUKA 4JC5A 1TI7A 3EQ6A 4S3MA 4INOA 5AXBA 4BO7A 2EKLA 1PK7A 1SCNE 4YRLA 4YRFA 1CUDA 1DJNA 2ZXUA 1TRHA 4H7EA 2JLZA 3CLTC 1MABB 2GPSA 4G41A 1YBVA 2FDXA 4Y1RA 1Z37A 5C8ZA 2PT5A 3JQRA 2CDAA 1Y7HA 5IT4A 4BNTA 3F8WA 2EQ5A 2C7RA 5GP1A 3DA8A 2N75A 3DEHA 4BJ5A 3MZ0A 4ARSA 3PJFA 2JVJA 1AKTA 3H42B 4JP1A 2P2YA 4FLFA 4B3SB 2OPHA 3FGNA 4AIRA 3PQDA 4KO2S 3STHA 5JJBA 1CNFA 1YR9A 3WNDA 1PS9A 3JWIA 3WGLA 3PC8A 4JUDX 4RQTA 1ZL0A 4YRNA 4AKHA 2IEAA 1JG3A 3FJ1A 3RVJA 1LI4A 1EJ2A 3HMKA 1UFRA 5AI8A 4BNHA 3PNVA 4RGVA 1N3LA 3MRXA 1RXCA 1TKRA 2WMNB 4RK0A 3ROFA 2NNLD 3UW3A 4MEBA 2FWIA 4BL5A 3GLGB 2H1OA 2DX7A 3B2NA 3KB2A 1T91A 1TYAE 2X19A 2IYTA 4KNWA 3A36A 3VNAA 3LU1A 4D4HA 1XZCA 1BYUA 2EBFX 5BSVA 4RK5A 3VAAA 1LK7A 5FUBA 2BMDA 4I1PA 1F8FA 4K1XA 4KSCA 4BVFA 4PTYA 4BX8A 4LXYA 3F7MA 4Q1VA 1MAVA 4INAA 4P4LA 1E6LA 5DBOA 4UOEA 1ZUWA 4OAPA 3WGKA 3HFSA 2H3HA 4B73A 3W5HA 1Y4DE 2ZYIA 4HZUB 3GU3A 3AY0A 2I3AA 3LDFA 3L4BA 3OZRA 2HLNA 2LKCA 2J46A 5EQJB 5C0OE 4PW0A 4QQNA 4YRZA 2YFYA 3T3PB 2WDZA 4CM6A 3GJ0A 1LRJA 5KPDA 4I4TA 1Q83A 4FSHA 1W88B 1ZFNA 3N05A 4I1YA 2J6CA 4I2VA 4LKOA 5JWOA 2PX8A 2HFJA 4RUKA 5CHEA 2E2WA 4DRXB 4KGZA 3NBKA 3VKFA 4FZ5A 2XJ9A 2H9YA 3A2NA 3OLZA 3TTWA 1GOTA 3AF2A 2YVKA 4RKEA 4HQOA 1HYGA 2VZEA 3FOBA 3G85A 1GPMA 3GLUA 5DYWA 4LV5B 5SYNA 3DVAB 3ZDZB 2IQIA 3M70A 4G67A 3T0IA 2QG4A 4NCHA 4P0PB 4CLHA 3G9QA 3CNLA 3VPCA 4AIIA 3HB9A 2JJ1A 2ETXA 1CQJA 2CHUA 1V4NA 2KJQA 3DS8A 3L8MA 2C2XA 4FHCA 3OZDA 1JAYA 3WGZA 3WICA 4MVYA 5C5CA 3KAQA 5JCJD 1E0AA 4JJAA 4GI1A 3SXUA 1C4XA 4HAXA 4D3SA 1E9RA 3DEAA 4FPXA 4ZT6A 1FQJA 3ROKA 2HA4A 4GRIA 4BZWA 2BKUA 4OAQA 3V1UA 2IYSA 3CTMA 4ESEA 2CUTA 4HI0E 4LV6A 2A92A 2A59A 4ZK6A 1E4EA 3ZTTA 1U2PA 1DAEA 5IHXA 5I8WA 2WD9A 3MILA 3C4QA 4B5LA 4KPEC 1CB7A 2Z1DA 4JR0A 3T52A 1YCHA 3CV3A 2DECA 3QXCA 3S2GA 1AA6A 2POCA 1ORIA 5IC5A 1G98A 2AI2A 4WUTA 4BQRA 4IJUA 2AXQA 3IAFA 4UNRA 4ZI5A 1WZNA 3PP8A 1HDXA 1NRJB 5B1IA 1B2RA 3CUKA 3RUIA 3WLNA 2FMXA 3R7BA 3QW2A 2JRCA 5KYGA 5D85A 4TLBA 1NQTA 2ZIAA 1M6EX 1ZG3A 2OK8A 1CYEA 3VKHA 1A9SA 2WZCA 2SKDA 8AT1A 3A6EA 3DFZA 4AY6A 5H9WA 3P5SA 2QX8A 1RQLA 3EBLA 3KRTA 3RGGA 1V7PC 2EEZA 4UPDA 4U5QA 3I5MA 1X7WA 1YOBA 3KQWA 2JGRA 4MVJH 1U6JA 1ZRMA 4BEJA 1G7RA 3LLMA 3T38A 2IV2X 3QX3A 1IHPA 4CQMB 3G8BA 4NBNA 4UXIA 1Y7PA 5KTNA 2VH5R 3T4XA 4TTTS 3DWEX 3TAUA 3EDMA 3R3XA 3EZGA 5EMMA 5K0CA 4JLNA 2ZGVA 2QTGA 3WOVA 3QLUA 5DNUA 4L0DA 4F2HA 4HV4A 1W0CA 2JGJA 3B82A 4BVEA 2MDTA 2I34A 3VTFA 3MJ4A 5IAJA 3L6EA 2DZDA 1P77A 3GAFA 3QKRA 3TL6A 3GVHA 1JAIA 1P3DA 2OQ2A 3HA7A 3WB0A 1HLDA 3FWKA 1YBHA 1ZWKA 1Z56C 2WPDA 1JEAA 4JUIA 3CNNA 4NH0A 3DD1A 5DWVA 4RDXA 1Y6QA 5CPBA 3B70A 2GZDA 2GKGA 1XU9A 3QVXA 3T9BA 3ULKA 3ZBUA 5BSEA 2DQYA 1J8YF 1EM8A 5LQMA 3ENVA 1JECA 2QPOA 4MV0A 3ZLUA 4WCDA 5H3HA 1VCIA 4F4UA 2ENWA 4BMVA 3HGQA 1H8EA 4X45A 1JHUA 5G0TA 1BHO1 2ZTUA 3DVAA 1JV2B 2X7JA 3H0EA 1IXYA 4BXOA 5AJTA 1M76A 2VNIA 5C4MA 5TQ2A 1KJYA 1OAOA 2GARA 1N9KA 1M67A 2BRUC 2JHFA 3TD9A 1PR0A 1Q7TA 1XEAA 2WYIA 3FNQA 1V1MB 3HBAA 3WLPA 2PU5A 1P5HA 2I2CA 1ZYUA 4UTOA 4BV9A 4EFNA 2VAWA 5CA0B 1RJ9B 4MVJI 4QBIA 4DRYA 1B16A 2CWWA 1IC6A 2XCLA 4M0FA 4UHEA 1HETA 3GRFA 2GUGA 2ZSBA 4OBBA 2CFCA 5T3UA 1AUQA 2PIAA 3FCXA 5BY2A 5LMZA 1VPDA 1NLUA 4UEKA 4MA4A 1A2QA 4PC3A 3HN6A 2NVBA 4TLMB 2PL9A 2B61A 2ZSJA 4TVKA 1XZIA 4GL2A 1M1NA 2IP4A 2VSQA 2BLNA 4LXIA 1WZEA 3KHSA 4V0SA 3E4DA 2Q3CA 4BIMA 4G4JA 4LFBB 5T6MA 1ISGA 3PUZA 1NVXQ 4W5HA 2VWPA 3GRKA 4LF8B 3VPFA 1P7CA 1DMSA 3WWOA 1WLYA 3RQIA 3GZJA 1GYPA 1HFWA 1GEEA 4YK7A 1L5SA 1GG8A 3ETDA 1T9AA 5JRDS 4F72A 1P18A 1JLKA 3WIVA 2J9FB 3AZQA 1AGYA 2ODEA 2GGSA 2H29A 3ELYA 4GOJA 2ROQA 3OCWA 5FP0A 4ZXFA 1U0OC 2QVLA 2FSSA 4B4KA 4WLUA 2J3KA 3DVSX 1DBPA 3NETA 2D62A 4C9BA 2V1UA 5EXPA 4ZVKA 1R64A 3B85A 3BORA 1UODA 2J07A 4W99A 1FYVA 1RHJA 2C0CA 4P82A 2Q7OE 4Y2YA 3TJMA 4HB2A 3NBAA 4TYNA 2AC2A 4ID3A 3ZJUA 2G88A 3R7FA 2C7BA 3DZCA 3NEYA 4HD8A 1MJFA 4RE5A 1SIUA 3JVIA 3LLSA 5IKXA 1JGTA 5B3LA 3F1KA 5HF6A 3B2EA 2F7SA 1GPUA 3T5MA 2CXQA 4B4VA 1F2TB 2CVPA 5FPYA 1XZGA 2J4FA 4D0GA 5EIHA 5ARBA 1YFZA 1OLXA 1F0YA 2EFCB 3HLTA 2QRUA 2XD9A 4GI7A 2O1SA 1JSCA 1QPBA 3LOQA 3KWMA 4KDFA 4FXPA 1YIOA 2MMGA 4AO8A 2IH2A 2R68A 3W7BA 2ATXA 1FYDA 1RIIA 1U5BB 1XCOA 1ZIPA 1CR0A 2JLAA 2R48A 2XNKA 1RQGA 3RH0A 3TRFA 3J81A