4ND2A

Crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with substrate (pyruvic acid) and cofactor analog (3-acetylpyridine adenine dinucleotide)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
317
structure length
317
Chain Sequence
MIERRKIAVIGSGQIGGNIAYIVGKDNLADVVLFDIAEGIPQGKALDITHSMVMFGSTSKVIGTNDYADISGSDVVIITASIPGRPKDDRSELLFGNARILDSVAEGVKKYCPNAFVICITNPLDVMVSHFQKVSGLPHNKVCGMAGVLDSSRFRTFIAQHFGVNASDVSANVIGGHGDGMVPATSSVSVGGVPLSSFIKQGLITQEQIDEIVCHTRIAWKEVADNLKTGTAYFAPAAAAVKMAEAYLKDKKAVVPCSAFCSNHYGVKGIYMGVPTIIGKNGVEDILELDLTPLEQKLLGESINEVNTISKVLDNAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural characterization of Cryptosporidium parvum Lactate dehydrogenase.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Oxidoreductase
molecule keywords Lactate dehydrogenase, adjacent gene encodes predicted malat
total genus 116
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nd2A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4nd2A02
3VPGA 2G1UA 2Y1GA 2C20A 4TZKA 4D3SA 1P1FA 2BMAA 2VNAA 4NNJA 4CLDA 4R9SA 4UREA 2TMGA 1XWFA 4UUNA 3WGHA 3O4RA 1H94A 1PGOA 4P8RA 1FXSA 2C2YA 2I66A 5K6AA 4DLBA 1VI2A 4J49A 1SC6A 3H8VA 1A4UA 1ZEMA 3BMQA 4RF5A 1QR6A 2HQ1A 2Y1DA 4XCVA 1O94A 5F1OA 4NPCA 5GZ6A 1VLLA 4RJTA 4LGVA 1X7GA 3H2SA 2OP0A 2ZB8A 4DLLA 1U7HA 3IQDB 3RFXA 4N7RA 4E32A 2WD7B 2JD1A 4RLHA 2P68A 5EL0A 4YCAA 3U4CA 3E9QA 1TXGA 2YV3A 3DAFA 5U4QA 1E7MA 5DP2A 1CWUA 4YT2A 5FWNA 5DBIA 2SCUA 2DAPA 4NDNE 3GN2A 2ZCVA 3JCZA 3ADPA 3AI1A 4E5YA 5BQFA 3WLEA 3DZBA 3L07A 4DTIA 5JS6A 2HK8A 3HZZA 3IUSA 3DHEA 4EYEA 3NYWA 3C1TA 1PL7A 1R0KA 2GN4A 2E4AA 1BSVA 2IXBA 3FR7A 3FWNA 4GKVA 3SJ7A 5C3MA 5HWSA 4W9NC 1GDHA 3SJUA 3I5MA 3L77A 4LVUA 1Y81A 2WE7A 3EAGA 4BO4A 3ZZNA 4ZQEA 1ZO8A 1NPDA 3PWZA 5ENVA 2GUGA 4CM9D 2LDBA 4XRGA 1BRMA 1UXKA 4XJTA 4DIFA 3DZGA 2TMDA 3MJTA 3NTRA 4KWIA 3F4LA 3E82A 4Z3DA 1Z74A 1WXDA 4OJNA 4TWRA 1UAYA 1PJSA 4KTTE 2GN6A 2HO5A 5JDCC 3BTVA 3CZRA 5ER6A 3I4FA 4FFRA 1KY5A 3CUKA 4MO2A 1P1RA 3TFQA 2PA3A 1GFSA 1YXMA 4BVAA 3ITKA 3L0DA 4LISA 1O5IA 2VWQA 1U1IA 1SOWA 2AHRA 1LSSA 1NVMB 1HL3A 3K2EA 1BXZA 4IY1A 5EQDA 2D3TA 4HADA 4BNYA 4CMEA 1ENZA 1E7QA 4FPXA 1EUCA 1W73A 3PYLA 2WD7A 3NT4A 4JN6B 3U4HA 1YE3A 3OP4A 3KVOA 5TLSA 2B37A 2ZB3A 4RPHA 3VPFA 3GR6A 1GUYA 2PD6A 2HK7A 4MINA 1P31A 4WECA 3PP8A 1GUZA 5COBA 3PI7A 5TX7A 1I3NA 4OHUA 3PYXA 1W6UA 4FJ1A 1CQJA 3WJ7A 4B3HA 1Y8QB 2C0CA 1LDNA 4MJLA 3ZV3A 3ZWOA 4JK3A 1VSVA 4NFYA 2H1SA 2NLOA 1PGPA 1ZZEA 4YVFA 3KM0A 4GQAA 4IIUA 1KIFA 4QFDA 2AE2A 3VKUA 3JYOA 5KCZA 5I9MA 1QV6A 3R1IA 5TIIA 5CDSA 5MDHA 1MG0A 4J3FA 1N1EA 3OECA 5COQA 4E6PA 4YAJA 3QVTA 5JAZA 2GN9A 4AJHA 3I9LA 3S2IA 3WICA 5L4LA 2QYTA 4DGSA 3D1LA 4XYLA 4ND1A 1GYQA 4RPJA 5L4NA 4R5MA 3GGPA 4JBGA 4UVIA 4EITA 4B4UA 4PFJA 2XPCA 2HMTA 5TJ9A 5ITWA 1UZLA 2CMDA 1I36A 1VJTA 4WK6A 4DYDA 2Q1SA 4YQYA 3FBTA 3QIVA 1MLDA 2OOSA 3DFUA 5DCYA 4A5OA 4D46A 4M86A 1WMAA 2JKVA 1ADGA 1V6AA 1EBUA 1JAXA 4J9VA 5CDUA 1UDAA 1T2CA 3GHYA 5AQ1A 4KUGA 4GX1A 3M6IA 4QUKA 1NWCA 1E6UA 2BH9A 1G6KA 3PHLA 4R01A 3DFZA 5JMPA 1JVSA 2ZJ0A 2O7QA 3IKVA 4J0FA 2YDXA 3ROKA 2IYOA 2C5EA 3KB6A 3QWFA 4U5QA 4FFPA 2P9CA 3EGOA 3GH3A 5JSFA 2Y1CA 5L45A 2A94A 4H16A 5JAIA 3WGOA 4DBZA 2A92A 5KOIA 1O0SA 3FR8A 4XR4A 3GT0A 4F6LA 1KETA 4Z9XA 5IDWA 1I01A 3D0OA 3H9JA 4U8GA 2WTBA 3D3WA 2EW8A 5DBGA 1OMOA 4TMFA 4MKRA 3WYCA 4CM8B 4MP3A 2I6TA 1T4BA 4HY3A 1BVRA 3H9GA 2ZATA 3INGA 3HG7A 3TQHA 3GFBA 4KP7A 1OFGA 1XEAA 1SEVA 3D5TA 1SOVA 1LDEA 1IB6A 1DC5A 1PJCA 3QWBA 1CJCA 4KMSA 4NFSA 5F1PA 4XB2A 2P4QA 5ER9A 1BTOA 4PG4A 2RAFA 5CPBA 1DO8A 2FRDA 4NBWA 1HF3A 1M67A 1EQ2A 5L7TA 1P1JA 4IGFA 1ADFA 4KUHA 2AQ8A 2X58A 3BHMA 3TRIA 2I76A 1Q7CA 2NTVA 4BNWA 1FDVA 2FR1A 1VC2A 1ZK3A 3L4BA 4IMPA 1OAAA 4E30A 3AWDA 4RDHA 4ALNA 1A7KA 4Y9DA 2YQ5A 3I9NA 4GL4A 3VH4A 3LLSA 5F3RA 2R6JA 1LI4A 2Y0CA 3G1TA 3WNQA 4O59O 4UVGA 4W6ZA 4AJOA 1WMBA 3K6JA 1OC4A 3QP9A 2JAHA 4HFMA 3DBHB 4WCFA 3OJLA 3SVTA 5KVQA 5IFLA 4CLOA 2F1KA 4FOOA 2E48A 4RVFA 3PRJA 1BW9A 2VHYA 4OKIA 2HSDA 5JMWA 4YR9A 1BW9B 3CPSA 1SB8A 1ZKMA 3FTPA 4RQTA 2Y0EA 5JNLA 4LRTB 4AJNA 4J2OA 4N18A 4U6SA 3WGYA 1GTMA 4BNJA 1EUDA 4CMHA 3V5NA 5GZ3A 1RYDA 5JC1A 4ZQBA 2CVOA 3MWDB 4TRRA 3TL2A 2NQTA 3GN1A 3PFFA 1RJWA 3DOJA 4BKUA 4QT0A 3KRTA 1DRVA 1L7EA 3BMQB 1A9YA 4J4TA 4YBZA 3ZV5A 3MTGA 1HSOA 3GG9A 3OHSX 3GY0A 3U4DA 5C7OO 4N5MA 1B7GO 1VRWA 1VL0A 4FFLA 1X1TA 4NJMA 4RPLA 2RHCA 5I7SA 3F47A 1I2ZA 1A72A 1ISHA 2VWPA 3RBVA 1UZNA 4YPOA 2X5JO 3KO8A 4YT5A 5LDGA 1O6ZA 4O5OA 2PKQO 3ETGA 3N74A 4PLVA 3U3XA 5A02A 1EBFA 1ISMA 3QVWA 2DT5A 3OFSA 4MIOA 3ZW8A 3JQDA 2XOXA 3IP3A 4W99A 3PQFA 4F6CA 4ZJUA 3AY7A 2VT2A 5EIOA 1XELA 3TZKA 4BMVA 1AE1A 4L0QA 1WZIA 1BVUA 4BNGA 4CMBA 4ZICA 1OZAA 2Y1EA 1PJQA 1XIVA 4CQMD 5MGBA 1H0KA 4Q3EA 4H15A 1PJLA 2VHXA 3PFWO 4B4VA 4ZN6A 3NDRA 1EE2A 4NZ9A 4PRKA 2Z5LA 3GEMA 3E9NA 4DQUA 3PWSA 1ULUA 4BQPA 2B69A 3IOYA 1R4NA 2H5LA 4MVJA 4BV8A 1E7SA 4RVHA 5T8KC 4CM6A 4CUZA 3ROMA 3PLRA 2C7VA 2O23A 2EP7A 1Z73A 3VPHA 3AM4A 2P9GA 1DAPA 4TROA 2OP1A 3DL2A 4NHEA 5BT9A 1EMDA 3O9ZA 3JYPA 2A35A 3GK3A 5LC1A 2VHZA 4CR8A 4NK4A 4EW6A 4YT4A 2EXXA 1RM5A 4JBHA 1TT7A 3X2EA 3ST7A 3KZVA 2B4RO 2BI7A 3GG2A 5COAA 3D4NA 2WMDA 1B26A 3ZWMA 1EFLA 5EJ2A 1DB3A 2UUOA 1T2FA 4YJHB 1GYPA 2YJZA 4FOSA 1K5HA 4I9UA 2AEJA 1H2BA 3S55A 1E6WA 4PVCA 1UXGA 2IE0A 4YYZA 3NTOA 3IC5A 3WFJA 1RWBA 3ZNOA 1SO8A 1GD1O 2Q49A 3H3FA 3RFTA 4CM3A 3A9WA 1U3WA 4AJIA 4I5DA 4URFA 2OL4A 2Q2VA 4DQXA 1WPQA 5HBRA 3D64A 1I33A 2I67A 4BL5A 4AICA 1YONA 3G17A 1BDMA 4GH5A 2W8ZA 1E3EA 1HSZA 1Y5RA 2RIRA 4BNXA 4JNKA 5FYDA 1GR0A 3OA2A 4CLRA 1PS9A 4GX2A 1ZK1A 1GV0A 4IQ0A 4L74A 4L8VA 5KNLA 2VWHA 3R3SA 1JA9A 1JWAB 3PJFA 3PDUA 2Z1NA 3M1AA 1TEHA 3HFGA 4R1TA 1MV8A 5IN5A 3GNTA 3SLKA 1D4FA 4E5PA 6LDHA 3IJRA 4CJXA 2R00A 1XYGA 1SBYA 4CM9A 2G76A 3H6KA 1P0CA 5ENDA 3RQSA 5KVCA 4Z9YA 4BGVA 5JY6A 4Y98A 2RBEA 2YV1A 2YHIB 4ID9A 4R3NA 1U4SA 4BO0A 1QP8A 3TPCA 4ND3A 4J91A 3LT4A 3ZGYA 3PZRA 2PKRA 3DEYX 1ADCA 1PJTA 2PFGA 3ASUA 1RM3A 1YL7A 3SBOA 1ULSA 3ZWPA 1WDKA 2Q4BA 3BIOA 1H6BA 1I0ZA 3FNHA 2C54A 5C7IO 1XKQA 3LF1A 4YAGA 2NU6A 2DBZA 2EHDA 1VM6A 1BMDA 1MGOA 1NX6A 1P1HA 1S7CA 1Y7TA 4YDRA 3GNSA 1U3UA 4RQUA 1E7RA 3F4BA 1P74A 1V3UA 1R6DA 1KY4A 1UXJA 1V9LA 4J1TA 2V6MA 3AY3A 1HE2A 5LCXA 3O38A 1NFRA 1M75A 3K73O 1DLJA 1QXSA 1SAYA 3T7CA 3ZWVA 3HN2A 3U09A 3VZRA 3RJ9A 1EQUA 1U5CA 3EW7A 4BUCA 4HNGA 2IZ1A 3BMCB 2PWZA 3INRA 3DO5A 1J4AA 4PZDA 1IHYA 1LJ8A 5DT9A 4ZD6A 5DF1A 3B6ZA 2DC1A 5JAQA 1ZXLA 5I8ZA 2ZB4A 4CM4A 1LXCA 1HLDA 3GUYA 1N92A 3P7MA 1ZIDA 5DZSA 3TOXA 2OZPA 3LQFA 5BSEA 4H7PA 4QX6A 3TZHA 1FF9A 5JYEA 1ISIA 2NVBA 1T26A 4R54A 1A7AA 1FDSA 4CV3A 5U9CA 3PJDA 4MVJP 4YTEA 5L7YA 4XQ9A 2IEBA 3QWHA 4HFRA 1YDEA 3W1VA 1V3VA 2B83A 3JQAA 4S3MA 5I7FA 4Q3BA 4DIBA 1C1XB 2OORA 2YUTA 4Q9NA 2JCVA 2D1YA 1LDGA 1LC0A 1I3LA 2CUKA 2NVUB 9LDTA 3ETDA 4IDEA 3HUDA 3BHJA 1VSUA 3GDFA 4BNUA 2B4QA 3DAPA 3MJ4A 3NGXA 4XD2A 5G2OA 3RU9A 5JDIA 2WYWA 4ZRMA 3STHA 2D5CA 5KKAA 2O2SA 5IDQA 1YOVB 4J90A 1L7DA 3ZWWA 1U9JA 1H9BA 5BSFA 1NWHA 1QRRA 4CL8A 4EJ0A 3HDYA 3K92A 1X0VA 2FPPA 2XF8A 2EJWA 3GVCA 2W2KB 3ZWNA 1GL3A 1P33A 4XIJA 2QRJA 3KUXA 3OMLA 1ZK0A 1JKFA 1OI7A 1DJNA 3I9MA 4INAA 4MDHA 4DRYA 1YB1A 4XX0A 1P44A 3JYLA 3T4XA 3OETA 1YVEI 4ALJA 2D4AA 4CMGA 3CINA 2YFQA 4Q3AA 2DKNA 3RC9A 5K9ZA 1DFHA 3H9EO 4XKJA 3GRPA 2EKPA 4IDBA 3W4JA 1YS4A 4TKLA 3MCVA 1P3DA 1Y8RA 2B35A 3CSDA 3FNEA 3MOIA 3HFSA 4UVDA 4Y6SA 5THQA 9LDBA 3K5PA 3OBBA 2C59A 4MP6A 3NGLA 4M1QA 2CVQA 4R4JA 1N7GA 3VZQA 3CH6A 3L4BC 1T2DA 3NDIA 1DSSG 4HP8A 5CDTA 3I4CA 3ZU5A 3E8XA 1HDOA 4O6VA 3UKOA 5G4KA 4IM7A 1HE5A 3SEFA 3H9UA 3WBBA 5HM8A 1NR1A 2VHVA 3CMCO 2FSSA 2BFOA 1Q7BA 4BMNA 3ON5A 2G82A 1GADO 1H6DA 4JQCA 3I3OA 1T24A 4PLTA 5TNXA 5KWEA 3UVEA 3UH1A 3DXFA 3VPXA 1PQWA 1T1RA 5JE8A 3EZLA 3AY6A 3VVCA 5B4VA 3ABIA 2DTDA 2BGMA 2IODA 3PGXA 3PZBA 4YJFA 4PLFA 3DMTC 3UGKA 2NACA 1Y1PA 3W8EA 1QYWA 3FN4A 2W90A 1P45A 4P4GA 2EF1A 1YOVA 2VRCD 1E7YA 4GMGA 4UUPA 4PLHA 4ALMA 3KV3O 1SNYA 3H5AA 3LLVA 3V2UA 4IDFA 3QW2A 4BNNA 5KKCA 3E18A 4AJLA 3JQGA 3OJOA 1T2EA 4FGWA 5F21A 5DP1A 1YB4A 2PKQP 1GCUA 4GAEA 3FNFA 4UUOA 5CEFA 1X7HA 3RUEA 1WZEA 2EIHA 1MA0A 3WDSA 4CV0A 4DA9A 2O48X 2WYUA 3X2FA 4WCDA 4J2HA 3JQAD 4YT8A 4UVEA 2QZ9A 4L9RA 3UOGA 3WQQA 3DZJA 1MC4A 1MP0A 4XIYA 2D5AA 2VUSA 3TDKA 4I1IA 1ZK4A 2ET6A 2YHUA 3INTA 4B3JA 1M6HA 2PZMA 5EPOA 1K2WA 3A06A 4CM7A 1RKXA 2ZYGA 5C37A 2JFHA 2DU8A 4CQLA 4A03A 5TT0A 2I65A 4XZ3A 3VDRA 1VKNA 2G17A 4OSOA 4EEZA 3IL2A 2Q3EA 1IL0A 3PK0A 4I9NA 4RVSA 3GEDA 5CHEA 4GKBA 3NJ4A 3WWYA 2Q1UA 2XXBA 1NR7A 4YXFA 4GSKA 1HXHA 2G5CA 4KQWA 3OM9A 5ICSA 3ZWCA 4UEOA 3BZUA 5AXDA 2RHRA 2E49A 3IJPA 3OJEA 1DDOA 1NP3A 2NU8A 1I3MA 1ZSNA 3I1JA 3ZU2A 3IS3A 4WPGA 2OBYA 5T64A 3TF5A 4PLPA 1DBVO 1P0FA 4WEOA 1P9LA 1LU9A 3RUHA 5BSHA 3RUAA 1KVQA 2WE8A 4NBRA 4D3DA 2FPGA 1ENPA 2FP4A 2GERA 4YAEA 4BS9A 3DZKA 2W2KA 1GV1A 1A71A 3GLQA 4BGUA 2NNLD 2ZIZA 1ONNA 1C0LA 3O03A 1Z7EA 2UYYA 4IGEA 3B1KA 4Q3DA 4IJKA 1BWSA 5HS4A 3DMTA 1H2HA 3KHUA 2C2XA 2FOIA 1EVJA 3AOGA 3H9QA 5KJEA 3GZNA 3WGGA 3ZW9A 5FI5A 4E2YA 5A3JA 1OC2A 4FJ2A 4BO6A 2W4QA 1XQ1A 1UDBA 1U4OA 3RC7A 1QKIA 2X0NA 4BIIA 3KBOA 3HB4X 3B1JA 4QECA 1QYDA 1VE9A 1ONOA 3EDMA 4OGWA 2AQHA 2CSUA 1ENYA 3NX4A 3OF2A 1ADBA 1GPDG 7MDHA 4PVDA 1LC3A 2C07A 5FI3A 2X23A 1QSGA 2HRBA 3K8ZA 3C7CB 5IZ4A 4RV9A 3K96A 1OBFO 1XDWA 3ZWBA 2V6FA 4PLWA 1KBZA 2ZJ1A 3MTJA 3F6YA 1LLQA 3PPIA 1KC1A 1J0XO 1VJ1A 1ZW1A 2P5UA 1VL8A 3ZI0A 2VTDA 1T2AA 2E6UX 5U1PA 3UCEA 4D42A 3JQCA 5C7LO 2OXIA 1GUFA 5B4UA 4GLLA 2J3KA 1KVUA 2P4HX 2Q46A 1YL5A 2EW2A 3GPDG 3BTUA 3JSAA 2PH3A 3BXXA 3E1KA 2ILTA 1F06A 1QYCA 3KYDB 4E2WA 1LNQA 1P1KA 2VRCA 3AU8A 4Z0HO 4JXKA 5L51A 5BNFA 2FPIA 4JP3A 2JD2A 3GEGA 3CKYA 3FPLA 3SX2A 4XGKA 2DBQA 2FMUA 2NTJA 3MEQA 3C1OA 1YBVA 4JBIA 2NVUA 2O50A 5G0UA 4E0BA 4Z0TA 4XDZA 4ZHSA 3IAHA 2AQKA 4BMSA 4JX8A 4JJFA 5KVSA 2EGHA 3QVSA 3CIFA 3PQEA 5CFZA 3WTBA 2X6TA 1JKJA 5H83A 3V2HA 3ANNA 3DC2A 1QLHA 2AG5A 4XYBA 5A9RA 3NV9A 4QO8A 1PX0A 5IN4A 4MVJE 1UZMA 1LQTA 2CDBA 3H4VA 4E31A 1A27A 3WQRA 1TI7A 1Y6JA 2Q2WA 4D7AA 3CXRA 4NH4A 5KJ1A 4NJMB 2PZJA 5CEEA 2GRAA 3FTNA 1HRDA 4CLRB 1N1GA 1Q7GA 1K3TA 2LDXA 5THKA 1LDBA 4CMKA 1DHRA 1CF2O 1NPTO 2DTXA 2EEZA 4MVJF 4J16A 4DVJA 4OOFA 4YAKA 4J4BA 2HAEA 3BMOB 4RF4A 1TT5B 3O26A 5ADHA 5I9LA 5ILGA 3BMCA 4C4OA 1WWKA 4BHTA 5BNIA 3GOHA 4CV1A 3GZNB 1M66A 2J8ZA 3UAGA 4OM8A 4M55A 1K6IA 3LF2A 3ONEA 4PLCA 4MVJG 5JFOA 3V1YA 3HE3A 1DIBA 1NBOA 4FFOA 1H6AA 4QO7A 3AW9A 2JHFA 1FDUA 1HDCA 4WOJA 2X86A 8ADHA 3E03A 3AOEC 4PRLA 5F5LA 2ZB7A 2VYND 4EEXA 3WWZA 1R4NB 1PSDA 3G0OA 3L9XA 2DBRA 3L6OO 3V1UA 4AVYA 1EVYA 1F8GA 2QRLA 3GF4A 3WBFA 1ZFNA 3VDQA 4EJ6A 1XA0A 1K89A 4WE3A 4XDYA 4B4WA 3AUUA 4R16A 4YRAA 3HADA 2JCXA 1NQ5A 3D5QA 4JLWA 1PQUA 4K9DA 1N8KA 3ZN2A 4E5KA 1LQUA 3R0IA 4KDFA 1Y9AA 1PIWA 1NVTA 1HDRA 1D1TA 4B7UA 1U3TA 4LSMA 4ND5A 4OSPA 5HRUA 1QMGA 3JD0A 1I32A 1UAGA 1E5QA 2AEFA 3U4IA 1PJ2A 1U2DA 3EVTA 4D44A 1GQQA 3FRJA 1CQIA 1UP6A 1K0UA 3ZV6A 1ISFA 1V35A 3LVFO 4IUYA 5AXBA 2H6EA 3QHAA 2AE1A 4GMFA 4CR6A 1QG6A 4WKGA 1R16A 2W2LA 1GQYA 1BXGB 2EKLA 1JQBA 3W6ZA 5TJHA 4CLHA 3DBRA 1DFIA 3WJAA 4RL6A 4TRMA 4RF3A 2GPTA 4CM8A 3HJAA 1X13A 2QQ5A 1HEUA 1NM5A 2IRWA 5T5QA 3G1UA 1MXFA 3GFGA 4O1MA 4XQCA 3PEFA 3AI3A 4J6FA 4X54A 1T4DA 4NIMA 1U28A 3AOEA 2AG8A 5G0TA 2FY8A 3ADOA 2Q45A 1XU7A 1EK5A 3DDNA 4OQZA 5IZCA 5A4DA 2AEMA 4W82A 2OHXA 3T4EA 1ISGA 4MVJH 1HYHA 3ZHBA 3AI2A 1LUAA 2FSVA 1E3IA 1UJMA 5ICMA 2PD4A 5A1TA 3H7AA 1I2BA 4M49A 5A03A 4WGGA 3L6DA 2NWQA 3ICCA 2EP5A 1CETA 3E9MA 1NFFA 4NFHA 1AGNA 3EK2A 1XSEA 4FFMA 5TS3A 4J7XA 4J7UA 4HUJA 3VHRA 3QVOA 2EG9A 2O4CA 1GZ4A 2VZ9A 1RM4A 2PY6A 2GZ1A 4KZPA 5FFFA 1XG5A 5T57A 1R37A 1E3WB 1N7HA 2HK9A 4D43A 4BGIA 3EY4A 3ZU3A 4CLOB 2PTGA 3F5QA 3DBVO 3KYDA 1I30A 1ZK2A 2PGLA 3DAGA 4II3A 5TRTA 4CM1A 5A9SA 3ANLA 1ZVMA 4OIMA 4FIZA 1KYQA 1PTJA 4EUEA 5A3VA 4BNIA 3JQFC 3P19A 5DBFA 1LSOA 1GU7A 2A4KA 5IXYA 1R66A 2ZTVA 3RFVA 4HBGA 4WLFA 1IZ9A 4XJSA 3HSKA 2BELA 4EZBA 2IZ0A 1NHWA 1YO6A 1QYVA 4YJGB 2AA3A 2H9IA 3GQVA 5CG2A 1KVRA 1SB9A 2FN7A 3NUGA 1SEPA 3O8QA 4IBOA 1DXYA 2HJSA 2QG4A 4RZHA 1DPGA 2VHWA 3ZCXA 3FI9A 4RGBA 5ES3A 3U62A 4BNKA 2EKQA 4HV4A 2PZKA 3F5SA 4ZA2A 3QWAA 2ZKLA 2QW8A 1EVZA 1M76A 5JCXA 3ORFA 2BFPA 2ZTMA 1N2SA 3WXBA 1Y8RB 3E5RA 2B5WA 2PGJA 3RASA 3CEAA 5AYVA 3W4IA 5KTKA 2WM3A 3KYCB 3I6QA 4BKRA 3L6EA 5JO9A 3TFOA 1VL6A 1ZMTA 1LDYA 2JFGA 2Y1OA 3PJEA 4IS2A 3KEQA 4PLYA 4XA8A 2JCYA 1QV7A 2J5RA 3JQAB 1F17A 3WSVA 3WX0A 1C0KA 3ENNA 3NTQA 2YYYA 1RYEA 3ROPA 5L40A 4PLZA 2DFVA 2JHGA 2NM0A 1YBMA 2VRBA 5CG1A 1KEPA 1E3SA 3DTYA 1XQ6A 1W4ZA 2NU7A 1JTVA 1YWGO 4U0KA 3JTMA 4G2NA 3OIDA 3PXXA 2NU9A 1PWXA 3UCXA 1ORRA 2GSDA 2O3UA 1DOHA 2DQ4A 1R0SA 3T7EA 1PS0A 2CDAA 3KETA 3IKTA 3ROQA 1HZJA 3AU9A 4XYMA 1Z45A 1BGVA 4CLXA 1DAOA 2X8LA 4OXYA 4OXKA 4D0RA 1WLYA 3P2OA 3RCBA 3AM3A 2P2SA 4O0LA 3RVDA 3QA9A 1N5DA 3FNGA 1B14A 1LRJA 1YGYA 3JQEA 4LSWA 2PH5A 1HLPA 4DC1A 2QRKA 2VUUA 1KS9A 2EWMA 4OOEA 2VTEA 3G49A 3FPCA 4XEHA 1FK8A 1E1MA 4UEKA 1GEEA 5T6BA 1AUPA 1J5PA 1NXQA 3DOCA 1EFKA 2PNFA 1XCBA 2BD0A 2XAAA 4GVXA 4R41A 4WLNA 3DHYA 3JD3A 4W7HA 1ID1A 4JJIA 4E4YA 3JQ6A 5L3ZA 5L9AA 1BXKA 2J3JA 4OL9A 3GPIA 4J43A 2I5PO 3CE6A 4BNHA 3VC7A 5A9TA 2DBVO 3C7AA 2IZZA 3Q1LA 3DBLB 4QQRA 4ZQHA 3UUWA 4J1QA 3LYLA 3S8MA 3GNQA 4HWKA 4IDGA 3ETEA 1C3VA 1MFZA 1X1EA 3WTCA 7ADHA 1R12A 1TLTA 3ZV4A 4Q3NA 1DIHA 4OQYA 1GY8A 1W8DA 1PGNA 4FQ8A 5AOVA 5L95A 2D0IA 2ZQYA 4QEDA 4B4OA 1B0AA 5KVVA 1N9GB 3TZQA 2NTNA 3PVZA 4E5NA 2X5KO 1N9GA 3WMWA 2GDZA 3LT2A 1DC6A 4ND4A 1YJ8A 3EYWA 1ZCJA 5DCWA 3RSHA 3GMSA 1I5RA 1PL8A 3WGIA 3GC6A 4ZRNA 2Y0DA 3RD5A 1F8FA 4M87A 1G1AA 3A1NA 4LVCA 4R1NA 2X1HA 1U2GA 3ZWYA 4FR5A 4ITUA 3ONFA 4MP8A 1NQOA 2CY0A 3LT0A 3RKRA 1E3JA 3RC2A 5IF3A 2D2IA 2C5AA 2HUNA 4II2A 2Y68A 1A9ZA 2X9GA 4ZU3A 3WGTA 5B12A 1HE3A 5I7VA 3RJ5A 4R69A 1UP4A 4MVJM 3WNVA 4AL4A 4CPDA 2PZLA 2BHLA 4GWKA 3SLGA 3ULKA 1ZJZA 4TRJA 1Z82A 1ZNQO 4GI2A 2OBNA 5BR7A 1G0OA 4I08A 2X0JA 3GVPA 4B7XA 1YKFA 1B3BA 3GHHA 3DQPA 1LA2A 4NBUA 3VVBA 4WNIA 4N54A 1BHSA 3KLMX 3GAZA 4RDIA 2OFPA 4MIYA 1H93A 2VQ3A 2RH4A 4DPKA 3GMDA 4YJDA 4OXNA 3MJEA 2YDYA 4WLVA 2EGGA 5DN9A 3ZHZA 4DYVA 5GMOA 1B15A 1NAIA 4PG6A 3V1TC 4DUPA 4BO8A 3PLNA 1EDZA 5H81A 3B20A 3SXPA 4J9UE 3RAJA 1PGQA 3VZPA 1E3LA 3OSUA 3W8DA 1UXIA 3MJSA 5ITVA 1B3RA 3WGQA 4AJJA 3V8BA 2HRZA 4UVHA 4FBGA 3WS7A 4IDAA 1XHLA 3AM5A 2WSBA 3UW3A 2FZWA 2C7GA 5KJCA 1XU9A 3NAQA 2XXJA 3DTTA 3QJ5A 4R9RA 2X22A 2P9EA 3TZ6A 1E0DA 1LSJA 3EVNA 5EMHA 2Y05A 3ZHXA 4TVOA 1LLDA 4CMJA 3JQBC 1XR3A 4U7WA 1FDTA 3WOHA 5JY1A 2X9NA 2DUWA 4LMRA 3CZMA 4ZVVA 4W4TA 2UAGA 3S2FA 3PIDA 3C8MA 3PQDA 4WOKA 3WFIA 4D0SA 4BB6A 3QQPA 2JAPA 2UDPA 4Y67A 4I5FA 4OH1A 2X0IA 1ZBQA 1O8CA 5EERA 1AHIA 3H5RA 2RH8A 5IG2A 5JO0A 3NJ8A 2VOEA 1PZHA 4YRDA 1EZ4A 3E48A 4FW8A 3LSYA 3PYMA 2VOJA 2Q2QA 3MJCA 1YRLA 3G3EA 3DBRB 4U0JA 4QFCA 3E5MA 4ONEA 4GX0A 1IPFA 2YY7A 2HMVA 1X7DA 1ZUD1 4ZGWA 4PCVA 3H5NA 3TSCA 2Y93A 3U49A 1ZEJA 4JIGA 4TKMA 4PG7A 4GBJA 3MOGA 5JDIC 1AN9A 3GDGA 1QORA 3GGGA 1HT0A 1MUUA 4FGSA 4R3WA 3VH2A 2X0RA 4W7IA 4WLEA 3O8QB 3P2YA 1PGJA 1G0NA 2YW9A 5TQVA 3DMYA 4DIOA 4W9NA 4M89A 4KWHA 3I9OA 3ZWXA 2WDZA 3L9WA 2O3TA 2OUIA 4BGEA 4BO3A 3E6AA 5JYDA 3QE3A 5DNAA 2CNBA 1GZ3A 3JQGB 4YA6A 3IMFA 5A5EA 3A14A 1FDWA 3QV1A 1PJ3A 5LDHA 4LCJA 1GEGA 3C3XA 5TT1A 3UN1A 3DHNA 3JD4A 2CF5A 3U5TA 1Z75A 4CLEA 3A28A 4XRRA 1LEHA 4OAQA 1D3AA 5JBIA 1F0YA 1PR9A 5KJFA 2VCYA 3KLPX 4WCFC 1PJ4A 3RBZA 3HN7A 1T1SA 2ZCUA 4XYEA 1UH5A 1ISJA 1D1SA 2HMSA 5IDXA 4K1LA 2VNSA 1HZZA 4NK5A 3AUTA 1X0XA 2Z1MA 3MWEB 1C14A 2VUTA 3W6UA 2VZ0A 3KEOA 4TVBA 2DPGA 4EUHA 3ZHYA 2CDCA 1ONPA 1XLTA 2Y66A 4I5GA 1TT5A 3VTFA 4DL9A 5ILOA 2V6GA 4B8ZA 2NSDA 1GAEO 3RUCA 3HNPA 1LRKA 1ZSYA 4B3IA 1Q0QA 3KTDA 3GA0A 2BRUA 1IE3A 1QYXA 4BV9A 1MX3A 3ICPA 2ZK7A 2PGDA 2PD3A 2PK3A 3DONA 3Q0EA 4J1SA 4E2XA 3WB9A 4UUMA 2I9PA 1KERA 1Q1NA 4EJMA 4RCVA 3U9LA 5JC8A 1KOLA 3WG9A 4DC0A 1ZMOA 2QYSA 2VZ8A 3DWFA 4XQEA 2GF2A 2YV2A 4GWGA 1DC3A 3RUDA 4AJ4A 3D4PA 4CUJA 1H5QA 3S1LA 4D41A 4EBFA 4B8WA 1LLUA 4OMUA 3D3WB 3PHIA 1KEVA 1B16A 3WLFA 4HXYA 2I3GA 1AXGA 5T67A 1EK6A 1E92A 3I9KA 3QRWA 3KSUA 4LRSB 1Z7BA 3OA0A 1QLJA 1DIGA 2ZYAA 3RBXA 2EJVA 3QSGA 4E33A 4BNLA 4D79A 3BYZA 3H65A 5B4TA 3M1LA 3F46A 3ZDFA 1B8VA 1YBAA 2CVZA 1EDOA 3WIDA 1KEWA 4E13A 1V8BA 1AHHA 4WASA 4J1NA 2VYVD 3OJFA 5TF4A 2Y99A 3IUPA 1PU2A 3ENKA 2BLLA 4FFNA 1KC3A 1U8XX 3K31A 3U0BA 2AXQA 3BHIA 4H3VA 4LW8A 1B8UA 4OO3A 4NBVA 3PHJA 4L75A 2ZYDA 3C24A 1IZ0A 2NQ8A 1I10A 4A26A 1YQGA 4WNCA 4GVLA 1HETA 4CQMB 3I23A 5EESA 1JN0A 3GAFA 2DTEA 4HFNA 4RORA 1TVEA 3OICA 2OO5A 2QIOA 1K6JA 2O4UX 4GPD1 2CFCA 3JQ7A 5JCJD 5HS6A 2DLDA 1PR3A 3OIFA 3I9JA 1LX6A 4PG8A 1DRWA 3DZHA 5CAEA 2WJPA 2Y1FA 3DBLA 4BKOA 3COSA 4P4LA 3PDJA 4CM5A 3UCFA 4DPLA 4FB5A 2HKIA 2OGUA 3R6DA 4A7PA 2GLXA 1C1XA 3BMOA 3G79A 2NUAA 3FSRA 3Q9UA 2X5OA 4AJ2A 4FDAA 4KUEA 4R1UA 1DFGA 5GY7A 4TZTA 1U5AA 4CMIA 4JCOA 1F14A 4E3ZA 4YJGA 3MJVA 3TOZA 3JD2A 1ML3A 4YWJA 2YZ7A 1GYRA 1HE4A 5L4SA 1AXEA 1IHXA 3JQ8A 3I6IA 1WW8A 3AUSA 2O3RA 2QX7A 2ZQZA 3WQSB 2FWMX 4IMRA 4KDEA 1W0CA 1E7WA 5IDYA 8LDHA 2DM6A 4N5NA 1WNTA 1LBEA 5G4KB 1C1DB 3RUFA 1YDWA 1C1DA 1P1IA 4UAGA 1Y5MA 4R5HA 1C0IA 1GPJA 4WJZA 2BI8A 2J6IA 4F45A 5J23A 3VPSA 5K0ZA 4BNTA 1SCUA 3B1FA 1DIAA 3LC1O 1F12A 4PGFA 2NV6A 5KJ6A 1PZEA 1E77A 4A2CA 4FJ0A 1NNUA 4GGPA 2Q50A 3VKVA 4IJUA 2VWGA 3RKUA 3UHAA 4IJVA 3GVIA 1KVSA 3OQBA 4YJFB 1YL6A 4IZHA 1J6UA 4OYRA 3QWIA 4Z6KA 2WEKA 5I7EA 3GVHA 3JV7A 5CPFA 3RU7A 3VTZA 1NVGA 4PIVA 4RO0A 1WVGA 3FBGA 5F5NA 3BTSA 4BNZA 2HJRA 2W2LD 3UFXA 4DWVA 4DREA 1J49A 1ZH8A 3N7UA 2H63A 4IIVA 5FF9A 1DEHA 1FMCA 4IDCA 5DDIP 5F1KA 3IIEA 4NMHA 1V0JA 3K9QO 4A27A 3WIEA 4MPDA 1X14A 1Y9EA 3DB2A 3EHEA 5BNTA 2I3AA 2O3SA 4IQGA 4KQXA 4E5MA 3W8FA 4S1VA 3A4VA 4RVGA 1LLCA 2BKAA 3K30A 5IAAA 5KIAA 1T25A 2P91A 3ONDA 4ROSA 2GNAA 1OOEA 1P77A 4IDDA 1E6EA 1MG5A 4GX5A 4XWYA 4C7JA 1E1LA 4E21A 1EEHA 4A73A 2ZTUA 4JP2A 5G0WA 4F3YA 4M8SA 4K6FA 5DCUA 5G4LA 4Q3CA 2I99A 1JWBB 4BO5A 5L53A 3OH8A 1BXGA 1I8TA 2Q4EA 1ARZA 1BDBA 4XR9A 3VH1A 3WR5A 1DIRA 3WSWA 3ZH2A 4FS3A 4PN3A 4B7CA 3CMMA 4IINA 1JKIA 4IJWA 4AG3A 5B1YA 4PLGA 1UR5A 3LC7O 1FJHA 3BTOA 1I2CA 4J4HA 2GZ2A 1PJBA 2EERA 3S2GA 3I83A 4O63O 1R0LA 4NI5A 1HWYA 1NAHA 3QLJA 3WYBA 4NBTA 1WAMA 3BA1A 4ALKA 1KVTA 1JAYA 3GRKA 2QZZA 3VH3A 3QY9A 4K26A 2CF6A 2YQ4A 2BGKA 1BG6A 1H6CA 2ZTLA 4J7CA 2PV7A 4L4RA 4XGIA 4BB5A 4YRBA 1TB4A 4NU5A 1E3WA 2Q1WA 4AJ1A 1EUZA 4AJPA 1K6XA 3BMNA 4R68A 4BQRA 1LTHR 1PZFA 2O3QA 2CD9A 5A04A 1DLIA 4QSMA 1UXHA 3FD8A 3UF0A 4CMEC 2J5QA 3P5SA 2VYNA 2UUPA 5IJZA 3F1KA 1MFPA 3JYNA 3AFNA 2JJYA 4YAIA 5JCJA 3HDQA 4CQMA 2GASA 1CERA 4CUKA 4PZCA 3VAZA 2IDZA 1NFQA 3Q6IA 4HX5A 2O3JA 1CIVA 1RM0A 1I24A 4HFJA 1RPNA 4ALLA 2POQX 3DOOA 3OEYA 2HMUA 4N5LA 2DPHA 2DUUA 3TJRA 2AQIA 2J5KA 4IXTA 2NADA 4D45A 3GDOA 2X4GA 3OIGA 5JDCA 3WYEA 1S6YA 1KEUA 3HB5X 4DLAA 2WYVA 2WD8A 4UEJA 4ILKA 2FHSA 2BFMA 5EQFA 3I52A 3DBHA 4WCFB 1HDYA 1ZSVA 2O2YA 3UICA 5AVOA 4YJHA 5A9SB 6ADHA 3DZFA 3OJ0A 4K28A 4MVJD 3QVXA 4I8XA 2VYVA 1D8AA 2B36A 4G65A 4XYGA 1NASA 2VT3A 3D7LA 4M54A 2UVDA 1WDMA 2C82A 4BNMA 4DQVA 3JQFA 3PJGA 4LCEA 4NR0A 3PHGA 4DXHA 4QXMA 3JQ9C 1PQPA 3DZIA 1GCOA 5FEUA 2QHXA 5A06A 4EDFA 1JDJA 4UULA 1NQAO 3N58A 3JQ8B 3HHPA 3LU1A 1PZGA 4RF2A 1NQTA 1SPXA 2VN8A 3FF4A 2FZEA 2DVMA 4IPTA 3ITDA 1PL6A 4TSKA 1UP7A 1U8FO 3AUAA 3TZCA 3GUCA 2IXAA 1R4MA 5GZ1A 4AJKA 4E12A 1B2LA 3AFMA 3IDSA 3KYCA 5IZCC 2V6BA 5CP8A 3PTZA 4KOAA 4AJEA 4YB8A 4ZQGA 3TN7A 2HDHA 3FHLA 4BO7A 3OQ1A 4GSLA 3TL3A 3OQ6A 2A9FA 4RPKA 3AJRA 1LRLA 3EMKA 3Q3CA 1DC4A 3RIHA 3R3JA 4F46A 3GGOA 3ZNQA 5EINA 1U3VA 4JGBA 3M2PA 5T8KA 2HMWA 3PGJA 3PHHA 2B5VA 1HDXA 3KSZO 4DBVO 5I9NA 4TRNA 1A5ZA 4DPMA 1HYGA 2C29D 2RCYA 4BNVA 1NTOA 2EV9A 4C7KA 2GR9A 1Q0LA 3LDHA 1U7TA 1D7OA 4PG5A 4CM4B 1Q2XA 4AFNA 2V65A 3RROA 1O89A 2PLAA 2D8AA 2E37A 3LT1A 2GCGA 3GZ4A 5TC4A 2Z95A 4Q39A 3BAZA 1E1NA 4R51A 2B4TO 3TWOA 1DRUA 2GN8A 5G0VA 2X7HA 1IPEA 1LSUA 1DJQA 3ZNPA 4R1SA 4BO1A 5HTOA 1XGKA 1MXHA 5A5FA 3ZWAA 1SZJG 1JU9A 2UV8A 4Z9FA 3RWBA 3LC2O 4P4NA 1ZJYA 1UDCA 5G0SA 3FCOA 2E82A 1NYTA 3RUIA 5DOZA 1LDMA 1WP4A 3NEPX 4WLUA 2X9VA 3WMXA 2AW5A 2P5YA 4MKXA 1DHTA 4FSHA 3H2ZA 2BFAA 3JYQA 5JPIA 4EUFA 4EI2A 4FCCA 4GGOA 3VOSA 2D59A 1MB4A 3GVXA 4NU6A 4DMMA 4NG5A 4K6CA 3C1AA 1TA4A 3CTMA 3F3SA 2YHIA 4IXWA 1JVBA 1YB5A 3HQ4O 3RI3A 1SMKA 3Q2KA 3SC4A 4WEQA 2GO1A 4MIEA 4RVDA 3HWRA 4RLSA 4RZIA 1O9BA 1PS8A 1Q0HA 4CL3A 3DR3A 4CV2A 2GYYA 1PEDA 3D3EA 4MVJI 4L4SA 2J3HA 2GD1O 4Z0PA 5CEJA 4Z3KA 3S2EA 1O95A 3PIIA 1YQDA 4DMLA 1I3KA 1JLLA 1E1KA 4A0SA 5AXCA 1R4MB 4JROA 1EE9A 1VJ0A 3C85A 4D3FA 2HLPA 2JFFA 1E5LA 4Y8VA 1WDLA 4ND2A 3ASVA 4CR7A 1ENOA 5BSGA 4BKQA 4CMIB 2JD0A 5DULA 2WWRA 3AK4A 2F00A 2Q99A 5AXAA 3C7DB 3EC7A 1CEQA 3F1LA 5JXWA 5L7WA 1Z6ZA 4Y6PA 4RPGA 3ANMA 1C0PA 3NDJA 2R00C 3ZNNA 2IYPA 4QTZA 4YEDA 4CMAA 3SC6A 3EZYA 4I9HA 1M2WA 1L1FA 5I8WA 3BMNB 2HCTA 3FWZA 2Q1TA 1IYZA 1CDOA 4OKNA 5K6AC 1YJQA 3V2GA 3NT2A 3M2TA 1X15A 5TSDA 4P38A 4J0EA 4YQZA 5DOVA 1IULA 3NKLA 3Q9NA 5CDYA 1H9AA 2V7PA 4LK3A 3PWKA 1EVIA 4IQ8A 1HKUA 2W98A 3JQ7B 5HA5A 4Y6RA 2O7SA 3JQBA 3ZU4A 3F9IA 4WUVA 4MOWA 3KYBA 3NRCA 4P22A 4XB1A 4L73A 1GZ6A 1B8PA 2NVWA 5EN4A 4KTVE 3TNLA 3JD1A 2G0TA 4FC6A 4BO2A 4BOYA 5TGDA 5A05A 4CQLB 4FN4A 3W4KA 4BKPA 1MC5A 1R15A 2GGSA 4ZQFA 5CDGA 5IXSA 5JW6A 1HDGO 3Q2IA 3HDHA 2J3IA 1IUKA 4L4XA 2PR2A 3H3JA 4JJGA 4U6QA 3IP1A 1Y8QA 1HYEA 4XGNA 4PZEA 3KOUA 3UXYA 4BNFA 4HNHA 4EGFA 4B79A 2FR8A 4HKTA 1YQXA 3NT5A 4L76A 1UUFA 4LMPA 3K2BA 3KSDO 2DFDA 4CMCA 1CRWG 1V3TA 5JAMA 4A10A 3D4OA 1YH3A 3HDJA 4BO9A 1JW9B 5B37A 3WGZA 2B0JA 5C5IA 1GQ2A 2BF7A 3RC1A 4IS3A 1M6WA 1VKOA 2GZ3A 2JL1A 4FD3A 4I5EA 3MZ0A 2BGLA 3OEWA 4NJOA 1NHGA 5JLAA 4XQGA 4YACA 3LK7A 5H82A 3JQ9A 4TQGA 4G5HA 4ESOA 1HTBA 4RVUA 2AMFA 3Q11A 2IEDA 3EUWA 4E2ZA 2YFHA 4IZIA 4WLOA 2FR0A 1CYDA 4GLOA 1IY8A 4LN1A 4G81A 2HU2A 4MKZA 3L4SO 3LZ6A 1NPYA 2R2GA 3KXDA 4FC7A 1PWZA 1A4IA 1IOLA 4CODB 1VPDA 2OMEA 4NQZA 2CZCA 3VZSA 4ALIA 2Y67A 1ZXBA 3B70A 1HDZA
chains in the Genus database with same CATH superfamily
1V7QA 2YRWA 3DAYA 2C20A 4D3SA 2YWJA 2EFJA 3WYGA 2JIZD 1JJVA 4EMBA 3Q2OA 4UREA 1L5NA 2OFFA 2P2GA 2V6JA 3OX1A 1PT5A 2IIBA 2W9XA 2GT1A 2W6ZA 3AESB 3NOQA 4RKYA 5AM4A 5J9FA 2V54A 1JNXX 2H51A 5KYKA 2ZSKA 5CFNA 1VI2A 1EP9A 5HILA 1H5NA 3LV8A 4GZLA 5H4HA 4DQ0A 1ZEMA 2XCUA 3VZBA 1UOOA 3QX3A 1UJ5A 1C8LA 2Z4SA 1WMFA 4G1UC 4YRJA 2Y1DA 3PG5A 1O94A 3NIGB 3ED1A 3R6GA 4NPCA 5DI3B 3WL6A 5DCLA 4RJTA 5CDHA 3H2SA 2CNLA 3P9XA 2OP0A 2D7JA 3KQTA 1JSLA 3QKSB 3U3JA 1RZ3A 1SHUX 2JW5A 3DMDA 3RFXA 1M1YE 1WVIA 3KSRA 4GRAA 4E32A 4MRMA 1ZCBA 2YH2A 2P68A 2B1RA 1Q6ZA 4FE4A 3U4CA 4LRWA 4QYWA 1QWSA 1Z2CA 1T3LA 4KWEA 1B6GA 5EMNA 1EFUA 1UBUS 2YYZA 3QNMA 3HEBA 2FZ4A 5DBIA 1ZOOA 1ZI8A 5E3JA 2XIQA 4NDNE 4X7RA 5JS7A 1U9ZA 3TSWA 3TLAA 3WO1A 2ERCA 2NO5A 1Q16A 3DZBA 4L5JA 4GOKA 4DTIA 2H0QA 5FUWA 3Q8XB 3HZZA 1P9WA 4KQHA 1ONSA 4YONB 3W78A 2EFYA 2IS4A 1R0KA 3T3HA 1IMOA 2WAMA 3FR7A 5FAXA 2G07A 2Q4TA 2NO9A 2JBWA 3BD7A 4KK3A 1Q0SA 3I5MA 1ZRSA 3L77A 1AF4A 1II8A 4LVUA 2RCNA 3EAGA 1FU7A 1OSNA 2IUEA 4ZQEA 3U62A 1ZO8A 3UK0A 1NPDA 3BFPA 5LM3A 3PEWA 1UODA 1WXHA 2PUEA 5A0TA 1AOXA 2XJ9A 4LV6A 2WWHA 3PJRA 2Q7XA 4OBXA 4WK0B 3WAKA 5FLYA 1BRMA 4JLSA 4F5WA 4GT1A 4KEAA 3P96A 1T8UA 3NTRA 3MJTA 1F7VA 4KWIA 1N0UA 1CLUA 4IEFB 4MDYA 2BHNA 3MRTA 1Z74A 4NYJQ 4XD7A 1F51E 2HF9A 1H2XA 1WTAA 4EHAA 2AS0A 1KH2A 2AI1A 3B1ZA 1RNLA 3CUKA 5K0LA 2WJVA 1GNQA 1P6XA 3NALA 3TFQA 1FQKA 1O0CA 4D02A 1YXMA 4OAPA 3AB8A 4ZKDA 3REFA 4R0MA 1Y80A 4WFQA 4ZP1A 3Q7SA 3MWLA 1U1IA 1IOZA 4MO9A 1NVDA 1NBHA 4UPEA 2AHRA 4C4YA 1XPRA 1LSSA 3DKVA 3RS4A 4IJ5A 3AVUA 2IHZA 1BXZA 1FSFA 1OCEA 2D3TA 1V47A 3K2EA 3L0BA 2HHCA 4GNKA 1LFAA 2WILA 4HADA 4CCWA 4CMEA 1KYVA 2D1TA 1G38A 1W73A 2AX4A 5DVZA 4UBMA 3OIUA 1HNWB 3KT8A 3LPAA 1W2WB 4MRSA 3A7EA 3AY0A 3OP4A 4X20A 4C4XA 3I53A 2B37A 5TLSA 1JSRA 2W2PA 4AKHA 5C4GB 5AK4A 1ZM4A 3KJQA 3PXBA 1GUYA 3TRDA 2ONJA 5AI4A 4LWPA 1RBYA 4ICIA 2PD6A 4A9AA 2PS0A 2XNHA 5B58T 2XEDA 1E0KA 1P31A 1BOFA 2P62A 4FWIB 5H9VA 4ER7A 1V4NA 3FDZA 1JYFA 2OCDA 3QXCA 4P3KA 4WESA 5TX7A 2JGMA 1CQJB 2JZCA 2W8BB 5EIBD 4HAWA 4QTTB 2OC9A 2O2IA 2AFHB 3BN3A 4XM1A 3WADA 1RVV1 4OHWA 3WJ7A 5HJ5A 2G9ZA 4DLTA 3T35A 4MJLA 3BDIA 3IBTA 3WHPA 1I2AA 4PQFA 4LX0A 2OZKA 1VSVA 3ZEAA 4MCAA 3HNRA 3SOZA 2E4WA 5JROA 2VRWA 3OC6A 5LYJA 3D6UA 4YVFA 1CY0A 3RVLA 4IIUA 3TTTA 3F7TA 4B74A 1MHTA 4G5OA 5AKXA 4QYSA 5KCZA 1JMYA 2CYCA 2DOKA 1FDOA 1Y7IA 1EVEA 2WJWA 5FBQB 4BE9A 5CDSA 3ES9A 1AV7A 2AYYA 3OECA 2ONZA 1JKMA 4TLLB 4E6PA 2VJBA 3I09A 4A6PA 3G7UA 4AJHA 4P2GA 3CT6A 2AUNA 4ZEOA 1TLLA 5C4MA 4DGSA 2QSZA 4RPJA 4R5MA 5D3MB 3TS1A 5JUWA 3E3NA 4EITA 4N8DA 2VSQA 3OFND 4LCBA 4PFJA 5CCBA 2PBLA 2XPCA 3QENA 1J0CA 3PE6A 1CJVC 3Q3GE 4IQFA 1QNFA 3TTWA 4MV7A 3DXZA 1SGWA 1Y1QA 2G28A 2QLJA 4FWBA 4DYDA 1C30A 3FBTA 5CVDA 1MLDA 2M6RA 3H5OA 2OUKA 4HQNA 1RJ9B 2F43A 3VDNB 5BP7A 1Y6RA 1ADGA 2P0EA 5KSYA 1IJBA 1JAXA 1A98A 1EBUA 1OYVA 4J9VA 1UDAA 3GHYA 2GJ8A 4IXDA 4KUGA 3RNOA 4N40A 3VC3A 1R0RE 2PGNA 4QUKA 5K20A 3KSAC 1CKEA 1PN3A 4P3NA 4R01A 3PHLA 4E6EA 1PHRA 1JVSA 4JLVA 5IVIA 3KUDA 2ZJ0A 3O47A 2N75A 3QBJA 3H5TA 4Z3OA 2GTPA 3A8TA 2FWPA 2YDXA 3ROKA 3WRWA 2IYOA 1N5RA 1ZD9A 2GA9A 3KB6A 1D4AA 1J8YF 2F1RA 1ULZA 16PKA 2IHBA 5BVGB 5T7BA 4CWAA 3EGOA 4KG7A 1FTSA 5JSFA 4EMSA 1ZRMA 4ZARA 2Z9DA 1NNLA 1C29B 3ZJVA 1DJMA 5CHYA 1XN1A 2A92A 4LV5B 2I6GA 3CRQA 1O0SA 7REQA 4F6LA 1RHRA 2QAGC 3EZ7A 2OBFA 3NHKA 4RTOA 5DI3A 4Z9XA 3WXMA 5F7OA 5IDWA 1Q83A 4HTFA 3D0OA 3KELA 3TGPA 3GFRA 5GVSA 5KB3A 2QKYA 4DV1B 3LT5A 2EW8A 2X2PA 5ALJA 2FPLA 1D04A 4TTRA 1IY0A 3A4TA 1IONA 4M1EA 5JU6A 4P86A 1QOPB 5B6PA 1J0AA 1I4DD 3FZYA 5IJAA 2O8BA 4OQLA 3LUAA 4JEMA 1TK2A 3UKDA 4ACBA 2HX1A 4KP7A 3T54A 4WERA 2GK4A 1CEEA 1SD1A 3ZW7A 3E35A 1TZKA 4C6TA 1SOVA 2FUCA 2QRVA 1HQYE 1LDEA 1BFKA 2WM8A 3DFMA 1DC5A 3TEFA 4QU5A 2R8PA 3A7DA 1U28C 3C16C 3W2GA 4AS2A 2P4QA 5CYGA 4JHLA 2AYZA 2CWWA 3P0IA 4PG4A 5DI9A 2FRDA 4DG9A 1DJOA 3EIQA 2PLFA 4INZA 5EZYB 3UWOA 2APJA 2BMWA 3NBMA 1U2SA 4QGAA 1HI9A 4TMZA 5EIWA 4IGFA 2QD4A 3EEOA 2VP3A 3BHMA 1V7CA 3TRIA 3KEFA 3AEUA 2H2HA 1L0BA 5DYWA 4BNWA 3HU2A 4ILEA 3L4BA 1ZK3A 1FVFA 5LD2C 3KZNA 1OAAA 2MSLA 3SEAA 2VNHA 1A7KA 1C9MA 1Y33E 3NYQA 3TDNA 4CKWB 4BECA 2OD2A 3I9NA 2FMIA 2VAWA 3I5UA 3LLSA 4RSGA 4G56A 3BWYA 1DDGA 1U3FA 4FQ7A 4JLJA 3TVTA 2R6JA 3O3CA 3G1TA 5CJPA 3WNQA 8MHTA 4XOUA 2IW1A 4O4IA 4UVGA 2VC2B 3C3BA 1S3FA 2PBZA 3KZKA 1QDEA 1QGDA 2C31A 3OJLA 1PAUA 4WCFA 2P78A 3STTA 2ECQA 2F1KA 2IJGX 4ISBA 4LSZA 4Y6OA 1KBOA 2B0CA 2QR2A 5EJAA 1TVCA 2I91A 3VNAA 3GIDA 1F4LA 5JTUA 1BW9B 2QEQA 3FTPA 3WA6A 2Y0EA 4K05A 4LRTB 3PI6A 3O1LA 1THGA 1OXXK 4U6SA 1EJ2A 1L5OA 1GTMA 3KTAA 1EUDA 3GA5A 1UIMA 1W75A 4I6JA 1C3JA 2JLVA 5FT9A 1RYDA 4M9QA 1P7YA 4DUYB 4EAAA 2VYCA 3MWDB 2NGRA 2NSYA 4TRRA 1IY1A 2Q3BA 4G1BA 3ZY6A 1JSZA 2BGGA 1PFQA 2JCBA 2HPHA 521PA 1X80A 4US0R 4DMKA 1DRVA 1L7EA 5FTNA 2QL5A 3ZV5A 5AVWA 2ZXFA 5LSAA 1HSOA 3HJRA 3GG9A 1S5PA 3PHBE 5CT4A 2BW0A 4DM4A 2BTOA 1P2DA 4RPLA 5DLYA 5FADA 5TR9A 4BGDA 1W2GA 1WZ2A 1I2ZA 2BGTA 4ZAYA 3WKEA 1F9EA 4FDMA 2VWPA 2ZIWB 1K6EA 1JEQB 1NXVA 4RY8A 5JD3A 4YPOA 1QDUA 5DK4A 4MEJA 1UANA 2PL5A 4YT5A 2IV3A 3ETGA 3U3XA 1KZ9A 4MWCA 4DSZA 2RONA 4E22A 4Q6WA 3BILA 2DT5A 1QG2A 3ZW8A 4PC1A 3I01M 2XOXA 4JLBA 4OP3A 1PT8A 4ZOCA 4ERXA 3KS9A 2JGLA 1U1DA 3WK5A 4ZJUA 1S8AA 3AY7A 2VT2A 2ZUCA 1OXBB 5EIOA 1XELA 4E5DA 4KITB 4BMVA 4BNGA 2AC4A 1WU7A 1WZIA 3G0BA 4CMBA 5MGBA 4EGQA 1H0KA 3A70A 4PTZA 1KQGA 5E6UB 3N0TA 4BIMA 1RC1A 3L1VA 2WJJA 3OZTA 4ZKEA 2FG6C 4GD3Q 4OLHA 3RO7A 5CMLA 3T7TA 3T3EA 2UYCA 2H08A 4UDNA 2PE5A 4ZOLF 2Z5LA 3DB1A 1OPXA 3ZY5A 1U9YA 1PKEA 4DQUA 4ZJZA 2KLBA 3AZQA 4KZKA 1BN6A 1OT5A 3U1VA 2Q5JA 4QXOA 1QQAA 5K4HA 1N1DA 3DYBA 2EZTA 2I6UA 2JH9A 2YRXA 3D3JA 4DC9A 1U9IC 5T8KC 3VR6D 2QD3A 3SNHA 2OAP1 3ZH9B 4DCPA 1CVRA 4CCYA 5CNJA 2EP7A 1BYUA 1QIFA 1Y0BA 2EX4A 3PPWA 1FIUA 2CHEA 1UPCA 2H17A 2MOKA 1RP7A 1M0TA 3BULA 3JYPA 3OF5A 4HQKA 4NATA 1OBCA 2XBUA 3KQMA 5JH7B 4JBHA 1TT7A 4BBPA 3BSWA 1FP1D 3ST7A 1ESCA 5COAA 3B3FA 3D4NA 3LECA 3UPDA 3RLFA 2UZ4A 1BKSB 1DB3A 5J2TF 1KKUA 1O94C 1Z56C 2RGDA 4HGQA 4YHBA 1X92A 4YJHB 4FZRA 4RHXA 3CJRA 3D31A 4N3NA 4JSYA 3JALB 4HGPA 2AEJA 1AKNA 1H2BA 5HPYB 5CW1A 4EPVA 3T5AA 1P2SA 2CEKA 1DQZA 1RE1A 1JE1A 1IN6A 3GCWA 4YYZA 3LA8A 1J1ZA 3NTOA 4MGEA 5LZ4A 3AONB 3TRKA 3SM3A 1OXKB 1RJGA 1L8OA 2L42A 4G1VA 3A3KA 3S2YA 2I7XA 1RJEA 1QGUB 2I2CA 2ZPAA 3L3BA 1VI6A 4L08A 3H19A 3HCBA 4LG1A 1P7ZA 4UNSA 2BKUA 3D64A 3KPVA 4TYMA 4W5NA 2ZYWX 3T0IA 4ZO8A 4AULA 4BP8A 2W8ZA 1E3EA 3B8EA 3DZ8A 3F96A 4H1VA 1YS1X 1Z9BA 5FYDA 1GR0A 4C43A 4CLRA 4L74A 4GZ6A 4IQ0A 2NT3A 2GNPA 1OF1A 2JARA 2YUIA 4L8VA 5HRCA 4B46A 3R3SA 2OCYC 4HLCA 1FNMA 1Y6GA 1XJ5A 4JJEA 4FSDA 2G72A 1BNCA 4L72A 1ORHA 1SC9A 2GBIA 2O2ZA 1L4KA 2JLRA 3HFGA 3K4QA 2ZS9A 3S28A 1MV8A 1KJJA 1Z4OA 3KAJA 2LCFA 1XBTA 3GNTA 3K6RA 3KEMA 3L8FA 4ENUA 1G7SA 2YWBA 3KIPA 3IAM6 2V9PA 3ITEA 3BM5A 4GSYA 4ZO9A 1XYGA 2GAAA 2Q5OA 5E1OA 1N0IA 1CFJA 2G04A 4JI8B 4L28A 5J4LA 2IYLD 1QQ5A 1ACMA 4RKFA 2QR5A 3O31A 2JC3A 2WABA 3H4TA 3OCYA 4RZXA 1CJKC 4Z9YA 5G40A 3V4PB 3ZIUA 5K3OA 5JY6A 1KIAA 1W9HA 1BMQA 4HNQA 3TMYA 2YHIB 3NOXA 3R3VA 2C4VA 3O3NB 4ID9A 4R3NA 4BO0A 5C8ZA 4OTZA 1Z22A 4KHPB 1OZFA 1T9BA 4FMCB 4ENSA 3ZE7A 4RIIA 4DR6B 3AIIA 1JHRA 1QJ4A 3ZGYA 4BFXA 2PKRA 3DEYX 1X7YA 3ML1A 3Q3JB 5HQJA 5C3UA 4Y2PA 2RGXA 1A9RA 3ASUA 4F84A 5EE3A 3QKRB 4YRRA 1WDKA 2Q4BA 3NB0A 1S3SA 2C3PA 4H08A 4NZOA 5BWCA 2WG0A 1HBJA 4YAGA 2CD7A 3K9WA 4FNOA 3DCIA 4N6OA 1VZ3A 4E4RA 5AW3A 1RRCA 3ZZUA 4RQUA 3I92A 1NUQA 1G2PA 4URVR 2IK8A 2XZDA 4B84A 1P0QA 4G4IA 2D3WA 2O2XA 4M6WB 3UHPA 2V6MA 5KWJA 1MB2A 2QNRA 2V4MA 4KIUA 5L3VA 1JPUA 3LE8A 5JH7F 1HE2A 5LCXA 2ZRBA 5AW4A 3EWIA 1H69A 2YJ4A 3W2HA 1QXSA 1SAYA 3T7CA 3ZWVA 4KLCA 1Z13A 3H1PA 4MWEA 1DX6A 4JJZA 4JL6A 4DLRA 4OP1A 1JHPA 3REQB 4EWLA 4HTFB 5KAMA 1SQSA 3L7LA 1U5CA 5CFPA 2NQ2C 3TFWA 1CS4C 4Q3KA 3BMCB 2PWZA 3DO5A 2DGDA 1A2OA 1Y5IA 3DQQA 3NM4A 3E22A 1J97A 4MV5A 2G40A 1YMUA 3UMCA 4TXLA 1LJ8A 1MIOB 3EH1A 3S5JA 1LY1A 5J4VA 2QENA 2ZI7A 2Z2JA 4OHCA 3G8DA 4UXJA 4CM4A 3EARA 3K2IA 1M1ZA 1R0XA 4EFNA 4OP2A 4OV6B 5DGTA 3TQQA 1AQJA 3PXCX 2XMDA 1Z4IA 1SXGA 3T3OA 2JI8A 3LQFA 5BSEA 2GN1A 2I3ZA 3OZIA 4AM8A 1KJ9A 2F90A 1RPZA 1Z0AA 3QKUA 2FRXA 1ISIA 2F9FA 2NVBA 3LHIA 3VO1A 3VYWA 4EJ2A 3I73A 3EVAA 3PJDA 5L7YA 2ODBA 2R0QC 2IEBA 1E60A 3QWHA 4HFRA 1L7VC 1CW2B 1RJ9A 1V3VA 3JQAA 1JHMA 3OIVA 1N2JA 5FPYA 1C1XB 2IPAB 1F1JA 2BP7B 1QVRA 2OORA 3GRFA 3OKFA 3WLMA 1N32B 1B74A 4MKIA 3ZD7A 1I3LA 3P52A 3RANA 4F9EA 3ZBUA 5T3YA 9LDTA 5JWHA 2Y0PA 1QG4A 3HXKA 4ZPXA 1UFRA 3HUDA 1FBTA 1SKBA 1V95A 3ZCQA 1ZM9A 5I5GA 4OHKA 3RU9A 5JDIA 3H8JA 1OLXA 1N9KA 3C3JA 3STHA 4LYEA 2D5CA 5KKAA 4MITA 1SG0A 2O1EA 3AR8A 4HQOA 2B20A 1RLUA 3IELA 3ZWWA 1KSFX 1QRRA 1T9HA 4NDAA 2WRZA 3FJOA 4H0NA 3UWSA 3HDYA 4JH0A 3L7DA 4K9SA 4UBIA 4WDQA 2FPPA 1OXVA 1CR2A 3OPYA 2XF8A 3S99A 1L7XA 3CW2A 3GVCA 5GV8A 3KDSE 2CWDA 1TNDA 1P33A 1AQNA 1TUBB 1YUBA 4XIJA 5JLJA 1U65A 1RMQA 2JI9A 1MO6A 3ZS8A 4INAA 5CUQA 1YB1A 2WUVA 3GELA 3A1WA 1D9XA 1LF5A 1H42A 2BONA 1V5WA 4TTSA 3KXPA 2AR9A 2OYCA 3OURA 3OZ7A 4OI1A 2BZSA 4LX8A 2DWQA 1YRHA 3DUFA 1NIPA 1SCKA 3RC9A 4CBVA 3LOQA 3H9EO 3S27A 3GRPA 2EKPA 1DBQA 4HNUA 4OQQA 1Y8RA 2CLLB 1T36A 1BXRB 1X7ZA 1AK2A 3HFSA 4DE5A 4GR9A 4XPZA 4MS1A 5DK6A 4RK4A 1O5OA 5FORA 1K88A 4MP6A 5LZ8A 3AF5A 4IFBA 3WFZA 4EK9A 5C8XA 2J87A 3VZQA 1NV8A 2BGUA 1T2DA 3PEEA 3FRHA 1DSSG 4RX1A 4HP8A 3E7XA 3CVVA 3I4CA 3ZVKA 4G09A 3ZU5A 3WI7A 5G4KA 4KPFC 5HFJA 3PT5A 2GCNA 1PJZA 3T9DA 3A6GA 2QXTA 1RAIA 1UJCA 2OHOA 4XASA 2VHVA 4ZVLA 3HCAA 3UJDA 5HM8A 4Q24A 4M8NE 1BS9A 1RMYA 3GMIA 3LBFA 2H3HA 4Y7DA 3R7BA 1KOJA 2CXXA 3ZDEA 2W6CX 3GLHA 3IO5A 2VP0A 2V6IA 4PLTA 4AY6A 3KLNA 2GLUA 3L4EA 5KWEA 1W5SA 2XZPA 1UEXC 3EGVA 4QBGB 4YUXA 2R86A 2XVXA 3WMFA 3SIWA 3MAJA 5B4VA 2B8WA 5C0OE 3V4FA 1E3MA 2V7XA 1LTKA 2CW5A 2BGMA 2DTDA 2H65A 2YV5A 3F4KA 1JF8A 1NSYA 3M1IA 1KP9A 2FQ1A 2IE8A 3PZBA 4LFBB 3DMTC 2NUAB 1X7XB 4RJIA 4EBBA 4Q7QA 2PV0A 2Y2UA 2DZDA 3W8EA 4EY6A 4ZYZA 5KYYB 1JMVA 1KJYA 2EF1A 2RBKA 4GMGA 3STWA 4UUPA 1K3FA 3LYHA 2XUFA 2FN8A 2FQYA 4PLHA 4AN0A 4KRFA 3RRZA 4IDFA 4AJLA 1ZISA 2DPMA 3OJOA 2ZFUA 3AYXB 4L22A 2BWJA 1YA4A 3MLEA 3NIBA 5DP1A 1RFLA 1POXA 3CZQA 4I0WB 1F4PA 1GRVA 1R9MA 2CFRA 4HDKA 1DG3A 1R0WA 1C8VB 1C7ZA 3JAKA 3CVJA 2QX6A 3RUEA 4TVKA 2C92A 1QH8A 1SVNA 4DIKA 1MA0A 3MQFA 3SBXA 1KH1A 4DA9A 1UZUA 1R5JA 2O48X 3EIHA 1UDRA 3HYLA 5J5AA 3T15A 1BJRE 3HJFA 5AH0A 3VNSA 2GHTA 3KR1A 3SQWA 2JLYA 1XROA 4IUCS 1PG2A 2A0FA 2JLBA 2HB6A 1F20A 1MC4A 3WQQA 2QJTA 5LA6F 4MRRA 2WWGA 3C3PA 1JFLA 1I3OA 4RA6B 4UUBA 3HR4A 3PICA 4I1IA 4W8HA 1ZK4A 1AMOA 4B3JA 2PU5A 1M6HA 3TLBA 5DTMA 1OXMA 2XW6A 1GAWA 3BEOA 1K2WA 2QL7A 1XVLA 1RKXA 4OJYA 5C37A 1P72A 2VJLA 3GJZA 4LWZA 3VR6A 3IBGA 5B6IA 4PGGA 1XF9A 4P82A 2VTBB 3H18A 4KLZA 1BMTA 2FZCA 1LW7A 3NWOA 2FTKE 1S8OA 1S2GA 2WWFA 1J70A 4Q9KA 3NWBA 4Q9JA 4A0RA 1YJBA 5C34B 4YMIA 3TXYA 1GGHA 1PJAA 1QZTA 3PK0A 4KAFA 1MOPA 2AI2A 4RVSA 2XNCA 4UNNA 4UZSA 5CHEA 1PEYA 1RBMA 2Q1UA 3WGVA 3MSXA 1R6UA 1W1IA 1DRJA 2ZUWA 4L3VA 4U7HA 3RIYA 4S12A 3SS9X 3OM9A 3VV2A 4D3ZA 5F33A 2J0EA 3S1AB 3BZUA 2QP4A 5SZJA 3ZWCA 1E2HA 1W8IA 2RHRA 3L6CA 2E49A 3IJPA 4LZWA 2CXNA 5AHWA 4RJJA 2OV1A 3I1JA 3IS3A 6GPBA 1M2OA 1V8PA 2OBYA 2PUTA 5T64A 4KBYA 3OX4A 3TLKA 2E1RA 3LLCA 3LUCA 5BSHA 1IIRA 2JJ1D 2ZYIA 3SHTA 4QLOA 4MWGA 2FP4B 1ENPA 4EGCB 2FP4A 2GERA 3DZKA 5DN6D 3D1VA 4IVNA 4M2LA 4CNBA 1Z35A 2DR0A 2V03A 4BGUA 4K5QA 4ZOAA 4BVLA 1ONNA 3O03A 2H4HA 3NR2A 3W1EA 1DQSA 1RXUA 3B1KA 3OZGA 3L0ZA 2OCIA 2X41A 2HTEA 3MWJA 4LMBA 2VPXA 2FRDC 3G5AA 3KHUA 4G4SO 3INNA 3TMAA 3QBTA 4G0XA 1JVNA 4BV2A 1EVJA 4ZZ3A 5ESXA 3GZNA 2P7IA 3RSOA 1HOTA 1U9CA 4E2YA 1Z7WA 1OC2A 4FJ2A 4HDMA 4B0PA 5IULC 4P3XA 3FX2A 4QPNA 2ZBPA 2DYKA 4CDGA 3KUKA 4DR3B 2UYQA 3PFNA 2PX3A 3KBOA 3OCJA 4RXTA 4QECA 3RREA 1ZLYA 5BSRA 4V0NA 1VE9A 1ONOA 3TIIA 3EDMA 3SZGA 1SUCA 4RZ3A 1KDPA 2OFWA 3ONWA 3NX4A 3Q41A 3OF2A 3U3DA 2ZXUA 3EH2A 3MUFA 3QVJA 4Z4HA 5REQB 1POWA 1LC3A 2C07A 1Z5PA 1QSGA 1Z7YA 2J46A 4Y0VA 3LKZA 3P4UA 3C7CB 2CMGA 1WG8A 4BLQA 2WHYA 1OBFO 2IXEA 2ZJFA 3ZWBA 2V6FA 3F7MA 1EAYA 2WJAA 1GKYA 1TD9A 1IBCA 5CH5A 4HNVA 1IDOA 2RGYA 2YZNA 1WNFA 3F6YA 5HP4A 3W5VA 2BEUB 1ZJJA 2WJ6A 4COOA 1VJ1A 5DW3A 1VMKA 3EIOA 1T2AA 2YIMA 5EMLA 1QHHA 1E1CA 1U0OC 3Q40A 5U1PA 5KX5B 5EE5B 1SXPA 4EB3A 1N6HA 3SHQA 3IAEA 2J3KA 5IC5A 3HGMA 4K9LA 3VR3D 1A1SA 1YL5A 5EKSA 4B2IA 1MQ9A 3K0SA 5J1SB 4GI7A 3HRKA 4LXGA 5ALHA 2VRCA 1FXWF 5TQJA 3K9CA 3NOOA 5P21A 1KZYC 4QBHA 4Z0HO 5L51A 1H1DA 5BNFA 5DASA 4KAXA 3OTGA 2HCRA 2WAYA 1FP4A 1W34A 1WV1A 3NKVA 2JD2A 4HAZA 4HO1X 3ZXIA 5CB4B 2QRQA 3FB4A 4A6XA 4H4DA 2G9VA 2OCPA 1FRVA 4E0BA 4DRZA 1R6VA 3IP8A 1U2RA 4XDZA 2X1MA 1K66A 1GQOA 2HTFA 5HF6A 4BMSA 4WADA 3U7RA 4D3YA 4ETMA 1DKRA 4JJFA 4JLPA 5KVSA 3WK7A 4FNMA 4MV6A 3RQIA 2CT8A 2IH5A 3CIFA 2YINC 1UBMS 1XRQA 3PQEA 4HN9A 1DAMA 1XDDA 4MRAA 3TZLA 3A0UA 3WTBA 3GJYA 4OX9B 4GKKB 2BV3A 3V2HA 3DC2A 1QLHA 2BGIA 2H4WA 4YROA 5A9RA 2BEWA 1OD6A 2FEAA 1GQFA 1UZMA 5MN5A 4U3JA 1FRNA 2BFEA 2CDNA 5E8JA 5EIHA 3WK8A 1Y6JA 5E3HA 1HQDA 5CEEA 4QDZA 5BW8A 1SD2A 2HZBA 4IZOA 2NVOA 4NFLA 4Q5IA 1P2VA 3BK1A 1LDBA 4AMZA 2XQKA 2C83A 4CMKA 1DHRA 3IULA 3NP9A 1MAAA 1ECCA 3M9WA 4DVJA 4OOFA 5E1DA 4Q4JA 3SU8A 3BMOB 2E5WA 2HWWA 2OHJA 2OHHA 1Z5NA 3G9XA 4RF4A 3V7WA 1EWYA 5CB0A 1UOPA 4BCBA 5ILGA 2Q3LA 3BMCA 3EG9B 4B80A 1UKVY 1X7WB 2GESA 4C4OA 3RHFA 4QZVA 4FXOA 5B30A 2RHJA 1G9TA 3Q1KA 2NO4A 3B38A 5LQRA 4M55A 1K6IA 3QF4A 3E3AA 1QM5A 4DR5B 3O73A 1NE2A 1KSJA 2Q9UA 1WW3A 3V1YA 2C00A 3OQVA 2CL5A 4QO7A 2Q27A 2A1TR 2JHFA 2XADA 2XRFA 2C9YA 3AW9A 3CPEA 3N0VA 1E2JA 3ORSA 4GNRA 4CTOA 2WF6A 4XX0B 1CR1A 4LQ4A 1GLNA 1VGVA 1HDCA 1FQJA 4AO6A 5EJ8A 1A0OA 3NHAA 4XIFA 3A6LA 3IKMB 1E2KA 3E03A 1A95A 1DBIA 3FETA 5MGNA 3DDWA 1H2FA 1B1AA 5DRYA 1MJGA 4PRLA 2VYND 1C3OA 3NCHA 5GIPE 1OUMA 2ODTX 3WWZA 2IS1A 5LZ5A 1Z0JA 1IH8A 1XZAA 2AR7A 2R60A 2BFNA 1DU4A 7REQB 2GK6A 3GF4A 1TECE 1U11A 4MS1B 4N5IX 4QPCA 2HXGA 2P67A 3LQRA 2ZRAA 4B4WA 4YRAA 4LJ7A 5AVRA 3I62A 2FCAA 2P3LA 2NX2A 1NQ5A 2R6R1 3FZEA 1MPTA 3G2LA 1RC8A 4YQEA 3RHSA 3UK6A 5TQ2B 5G1NA 1LQUA 1DTWA 1NUSA 4ZU1X 3AQ4A 4MHOA 2GZMA 4HCJA 2HBQA 1T5LA 2O20A 2ATCA 1QMGA 3JD0A 1I32A 3IO3A 4LY6A 3SSMA 4EH1A 1ILWA 3LBHA 4RVOA 2AEFA 2C7QA 4RHUA 4WKNA 5EFZA 2F9LA 3VKHA 2G9QA 4KSYA 3HCOA 4IIGA 1K0UA 1SIOA 2WM2A 3B51X 3OPNA 4NU8X 3ZV6A 6REQB 3FOEC 2JNWA 5DXAA 2WUWE 4ZCIA 4LF4B 2C4HA 4CR6A 4LBZA 3HHEA 1R4AA 3QEOA 4WKGA 4UM7A 3S1SA 1YVDA 4Y3UA 2FFQA 1V96A 1JPNA 1TM4E 4OB8A 4AAYA 4I4IA 1JU4A 2CB9A 1AQUA 1YQTA 4L7VA 3W6ZA 5TJHA 1DFIA 3R76A 3WJAA 5EMJA 1RP1A 3RWBA 2VPWA 4TRMA 1V4VA 4YHHB 1X13A 2QQ5A 2LZ0A 3B2EA 1KYWA 2B3DA 3LI2A 3LKVA 3OMWA 3UKOA 4DIMA 2WYOA 2P0YA 2WIJA 4PRYA 3UOWA 3KT3A 3MINB 2AN1A 1ATZA 2ZAIA 2A3RA 1WF6A 3BQ9A 3X1ZA 5CRIA 2JLUA 4MUGA 5G0TA 4AZVA 1YFKA 3ADOA 2JIRA 1W29A 1G3IA 2BEKA 5B6JA 5K8CA 4KI7A 1XU7A 1EK5A 3DDNA 5IZCA 1XE3A 1O6CA 4CFYA 5JVDF 4N3GA 1XZEA 1Q1QA 2CXOA 2HY7A 1HYHA 2C4WA 8AT1A 3G7NA 3M5PA 3AI2A 5D2CA 4HUTA 3DEFA 3NFYA 1VPLA 3TPZA 3TVDA 4A92A 4BN0A 5C52B 5A1TA 4M49A 5AVJA 1BCSA 4WGGA 2C1EA 3L6DA 4FLMA 4D8UA 3HXTA 3F2IA 4TL6A 1FPQA 3LRXA 4X24A 4L3WA 1KQ3A 4Y7CA 2CZQA 1WU8A 3UNXA 4JBYA 4LYFA 3EK2A 1JHUA 3PCTA 1LWOA 4TV9F 2HA4A 4WXPA 3WQBA 2BKVA 2JCSA 3DNFA 4L78A 4F11A 4POOA 3SOPA 3QVOA 3U19A 3V4ZA 4OPMA 1FX0B 1Y3HA 2FP3A 5DTIA 1RM4A 1YV9A 2J3EA 2PIAA 2PY6A 3P1JA 4FGUA 4WA7A 1A97A 1P9OA 3NKFA 3AV3A 4M36A 1E3WB 4RK1A 5LMZA 2DUJA 5LP1A 1JR2A 4BGIA 4XGRA 4HTAA 3F5QA 3P9SA 3CVWA 3AUXA 2YHBA 2HM7A 3D1JA 5BW6B 3DAGA 4NOLA 4CM1A 2VBFA 1DKOA 4TWBA 1R8JA 4MW7A 4UEQA 2GS9A 3W0LB 1T0PA 1ZVMA 2XMPA 2QTHA 2YOFA 4MPRA 4PYRA 2DWCA 4EYSA 5IEJA 1PTJA 4MGZR 3LFUA 2Q5IA 2WHQA 3LVRE 1A69A 4K8OA 1YDFA 4ZVRA 3KKQA 3LG2A 2KSQA 2YJGA 5IXYA 4KI0A 4C6RA 2IYUA 4HZUB 2ST1A 2ZTVA 3MYRA 3RFVA 3VGPA 1ULBA 4G5GA 4LHSA 4X6UA 4DA6A 2G25A 4HDSA 1J8FA 2HF2A 4YH1A 2AA3A 2F3SA 3W9YA 2J48A 3ZQKA 1KVRA 3IQHX 2OD7A 1NJSA 3FOAA 3P4XA 3IODA 1C9KA 2HRCA 5DGIA 4AY3A 3VKWA 4MRNA 1RQNA 1PFUA 4NYMR 1DXYA 2GXQA 2HJSA 3IV7A 4MS4B 4JQOA 1LH0A 3U6BA 1DPGA 1XT6A 4D9HA 3FJ1A 3OD1A 5AKIA 5GJWC 4Y9UA 5G3YA 5SY6A 3CYFA 1HG1A 2AFIA 1Z62A 1EGMB 4TSRA 2EKQA 1UQRA 4P7BA 4Y2RA 5AIAA 3TW8A 5B7GA 4ZA2A 3OM8A 3QWAA 3ZZMA 1XMPA 4KIFA 3LUBA 1R8XA 2EFEB 2ZLBA 3FKSD 3PNLA 1M76A 1DAIA 3ORFA 1OX4B 4MJ3A 1N2SA 5DX0A 3QPAA 2M32A 4BWYA 1SU6A 2OGTA 1QP7A 2B5WA 1AB5A 2C3UA 1DEXA 4ZOQI 5KTKA 2G9NA 2CKMA 2WM3A 3QFHA 1W9MA 4BKRA 1OTHA 3P9YA 2AFVA 4PTYA 1XTIA 1QAMA 2P1ZA 3A2MA 4UW9A 1VL6A 3TXAA 3VU0A 5GOTA 3KKKA 5A5VA 4HNTA 4O4LA 2A9RA 3FZNA 2QUJA 4PSUA 5G3ZA 5B1DA 1UCFA 2JLZA 4PLYA 2DETA 1FX0A 1E96A 4LOIA 1EYZA 1U98A 3DL0A 5ESWA 2R4UA 3PF9A 1PV2A 1WB6A 3CS3A 1SBHA 2X6RA 1P2UA 3AEKA 3II6X 2YYYA 1HMPA 1RYEA 3ROPA 5LOVA 2BFWA 2ESRA 1DEKA 4BQNA 2HSWA 2VG8A 2POCA 1A8QA 3K9FC 1JEQA 5BWBA 4EG0A 3UQYS 4EFKA 4RHTA 1FS4A 4QPZA 4YFVA 3JTMA 4E14A 4G2NA 1YT5A 3K4PA 4ZDIA 3PXXA 1C9NA 4JVMA 2BCEA 1ORRA 1U0GA 2O3UA 2XWBF 4KE7A 4O0MA 3T7EA 4DT1A 3IKTA 1R5BA 2AFHE 1U1CA 1DUVG 3KTOA 4K2AA 2VAPA 1T1GA 4OXYA 4QRDA 2Q7DA 1LPMA 3BRSA 3FMIA 3HZHA 5AT1A 5IW8A 4A1FA 4DDMA 1VIYA 2OR3A 4O1IA 2VQEB 4DV6B 3AM3A 2AEEA 1IRIA 2VJKA 1QHSA 5HKLA 1ITZA 2P9QA 4FN5A 2AN4A 1NUUA 3A1VA 5E4FA 3WOVA 4R81A 3HRIA 3CWZA 4PYLA 1YGYA 2AD5A 3Q7QA 3HBMA 4LSWA 4MS4A 1FE8A 4G07A 1DQNA 2QRKA 3SYNA 4OOEA 4DC1A 4EL5A 3G49A 3I1FA 4BMYA 3KQWA 1WD7A 4EJSA 1GEEA 2ZQ5A 4M8LA 1BKDR 1J5PA 3PD7A 2Y27A 4M1MA 3CVUA 3DOCA 3W2FA 4ZZ0A 1EFKA 2PNFA 2QVZX 1THTA 4G5SA 1Q44A 4K6KA 1KZGB 2I1VB 4NTZA 4WLNA 4ZV7A 3JD3A 4W7HA 1Z5WA 2GB4A 3U4AA 1ZUWA 3DEHA 2ZJ6A 5L9AA 1P2TA 1BXKA 3DW3X 3DW1X 4AN1A 3GPIA 1KQFA 5A0VA 5DM4A 1CPYA 3HR7A 5JQWA 1X9HA 3CE6A 4FONA 1TGYA 1G2QA 4HYEA 2XLBA 5A9TA 4E3WA 1YHNA 4TN5A 2V96A 1DV1A 4M98A 3C7AA 4DIEA 2WFAA 4CKXA 5IT5A 1JJFA 3C0KA 1Y63A 3MMNA 2CMHA 6YASA 2XA2A 2WPNA 1PVVA 1F2UA 4IDGA 1I2MA 5DBHX 4AMBA 5K09A 4NEGA 1Y5NA 4RTMA 2XQIA 2Q6TA 1VLHA 2R1TA 4CT0A 2WZBA 1TLTA 2HDNB 2ORVA 3JZIA 2DPYA 4Y2UA 4Q4DA 1GY8A 3WNCA 3ZGXA 5JNTA 1G3MA 4B4DA 5AOVA 4AF8A 5L95A 1ZVVA 1RAAA 2N1MA 2XKKA 2QM7A 2YW2A 1KDRA 3KJNA 3NC0C 2FDCA 2BFBB 1U7OA 2FKAA 3EJ6A 4R2JA 1CB7A 2NU6B 4H2DA 2GDZA 1OYWA 4DF3A 3FH0A 2Y0BA 3GXOA 3EYWA 1NU6A 2J4DA 4PSCA 1P4JA 1I5RA 1PR2A 1YULA 1T5BA 4O4LB 1SELA 1XEWY 2BHRA 2XTZA 5K0NA 4BRZA 5C81A 2K7ZA 3GC6A 5EUBA 3RD5A 2M2IA 5TE9A 1N0HA 2QVXX 1BRTA 1GFZA 2YNMC 4BXOA 4DLSA 2X1HA 1WOMA 1U2GA 3AFOA 4RZQA 2JGKA 4FR5A 5EAIA 4MP8A 1QOQB 2IT1A 4E51A 3G1WA 3RKRA 5BVHB 5GP1A 4MSUA 3RC2A 5IF3A 2C61A 3L49A 3CNHA 1G7RA 2XY4A 3GROA 4II2A 3ZJTA 1U4NA 1UEJA 4KKVA 2W2XA 3O4GA 4HB4A 3AFGA 3LMKA 5ITZA 3SD7A 2ZI3A 4RW0A 3TTUA 1B23P 5KAPA 1CDDA 1Z17A 2PZLA 2COUA 1JG6A 2BHLA 1M6NA 2C4UA 3E3MA 3NORA 3SLGA 1LX7A 1ZJZA 2WHEA 2MYTA 3QJYA 4TRJA 4FTWA 2J85A 3H2BA 3PNOA 4DV7B 3O91A 5JVDB 4YXWD 1MO5A 2YICA 1T9ZA 4I08A 5LBTA 1ZHHA 3D6TB 5EXTA 2H06A 2LGJA 3PUZA 4PGHA 1I7LA 3V00A 2GFHA 1GAQA 3DQPA 3K0FA 4NBUA 4RHCA 3DVAA 3UXMA 1BHSA 4LXXA 2J0UA 4CT5A 4HZUA 4RDIA 3KJGA 3G2IA 1H93A 1JXQA 1XD2B 3RW9A 4DPKA 3D0KA 1RAHA 1EESA 4PO3X 3RG8A 2YDYA 4MB2A 3ZJYA 1WUIS 5DN9A 4CN9A 4R84A 4G4GA 2XXAB 1AH2A 2BMJA 2HRDA 4NYIQ 1SC3A 3V1TC 1PO7A 1SBZA 4GZ5A 5B53A 3GNLA 3PDHA 3TUJC 5KU1A 3VZPA 2MYNA 3LQ1A 1MOSA 1CU1A 2LW7A 1CYEA 1R64A 3HCNA 5ITVA 2H4FA 4TV8A 2V7QD 4B6FA 3NM5A 2F48A 1E79A 3WS7A 2X8BA 3VO9A 3BRWD