4ND2A

Crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with substrate (pyruvic acid) and cofactor analog (3-acetylpyridine adenine dinucleotide)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
317
structure length
317
Chain Sequence
MIERRKIAVIGSGQIGGNIAYIVGKDNLADVVLFDIAEGIPQGKALDITHSMVMFGSTSKVIGTNDYADISGSDVVIITASIPGRPKDDRSELLFGNARILDSVAEGVKKYCPNAFVICITNPLDVMVSHFQKVSGLPHNKVCGMAGVLDSSRFRTFIAQHFGVNASDVSANVIGGHGDGMVPATSSVSVGGVPLSSFIKQGLITQEQIDEIVCHTRIAWKEVADNLKTGTAYFAPAAAAVKMAEAYLKDKKAVVPCSAFCSNHYGVKGIYMGVPTIIGKNGVEDILELDLTPLEQKLLGESINEVNTISKVLDNAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lactate dehydrogenase, adjacent gene encodes predicted malat
publication title Biochemical and structural characterization of Cryptosporidium parvum Lactate dehydrogenase.
pubmed doi rcsb
source organism Cryptosporidium parvum
total genus 116
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nd2A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4nd2A02
4ZQHA 1JQBA 5ILOA 1VL0A 4AJKA 3DMTC 3E1KA 3OA0A 1LA2A 5G0SA 3UGKA 1WVGA 3K2BA 4RPHA 5HM8A 3AY6A 1MGOA 1P77A 2NQTA 1V3VA 3FCOA 1PGPA 4WLFA 3ZH2A 4ILKA 1C3VA 2B5WA 3EZYA 2ZTUA 3GGGA 2G1UA 5CEFA 3ZU2A 4U0JA 1O95A 3TJRA 3ETEA 4NH4A 2Y68A 4LCJA 1DFGA 3GFBA 2BGLA 3BMCA 3JV7A 1Y8QB 1GV0A 3RUIA 4J3FA 4Z0PA 4IINA 2FOIA 2C20A 4JGBA 1BVRA 1XELA 2B37A 3IUSA 5ER6A 4BNHA 3WMXA 2ILTA 4CLDA 2WYWA 1NFFA 1R16A 3HSKA 4ID9A 5JAMA 4J16A 1YH3A 5DBGA 1HT0A 2BLLA 2DQ4A 3ICPA 4YJHB 2YZ7A 2GPTA 3MJVA 4H7PA 3DEYX 4ND1A 3KLPX 2WEKA 1XQ1A 3P2OA 3R1IA 1PGNA 4ZICA 3I9MA 1KVQA 3TZHA 2ZCUA 4Q3EA 3N7UA 4EUEA 4EZBA 3U4DA 1MC5A 2GCGA 3PYLA 4FOOA 3WIDA 4DBVO 4OXYA 3KEOA 3L9WA 3DMYA 3LT2A 5DCWA 2GZ1A 2BRUA 2YY7A 3ZV4A 4IDAA 1FJHA 5FEUA 5F1KA 2X86A 2EEZA 4WOJA 3GHYA 2IODA 3PHGA 4KTTE 1H6AA 5L7TA 1Y9EA 1R0KA 3OSUA 3IQDB 4CQMD 4J4HA 5CDUA 1M76A 5T67A 4BUCA 2X0JA 4EDFA 4E2ZA 4R5HA 2CVOA 2CF6A 1IPEA 3CZMA 4LISA 5EQDA 3RSHA 1Z82A 2O7QA 4K28A 2CNBA 2EG9A 3GNTA 5EERA 9LDBA 3GVIA 1MFPA 1E7QA 5I8WA 1J0XO 2FY8A 1ENOA 1J6UA 4CMGA 1DJNA 1V3TA 3QY9A 4QFDA 1RM4A 2Y1CA 3HG7A 4MVJF 4KWIA 4ALJA 3WTCA 1PR9A 4XYBA 1O5IA 2Y1OA 3CINA 2JCVA 3GN1A 4K26A 2VOEA 3HUDA 2IYOA 3SJUA 4CQLB 3KOUA 3RVDA 3AUUA 3I4FA 2CFCA 4DGSA 3PQEA 2I3GA 1BXGB 1B8VA 2ZJ1A 1QYVA 1C0LA 2BFAA 2HKIA 3BMQA 1BXZA 3TSCA 4BGEA 5A9SB 3KV3O 1FMCA 4FIZA 2D8AA 2O4UX 1PS8A 5EINA 1JTVA 4QFCA 1S6YA 3DTYA 4R3WA 4CLRB 3WNVA 1XCBA 3GH3A 3PIIA 3ZDFA 2X23A 1GDHA 1EDOA 1N1GA 3VZQA 4J9UE 3GMDA 3GAFA 1UDCA 4E4YA 5JNLA 1Q0HA 1V35A 4Z3DA 1DOHA 2VQ3A 2GD1O 4PIVA 2P9GA 4IGFA 4NPCA 5T6BA 4Y9DA 4NK5A 1DFIA 4MP8A 4XDZA 3WSWA 1LSUA 2Q4EA 1A4IA 1B8UA 3GZNA 4TROA 2ZB8A 4R3NA 4RZIA 4FJ2A 3UF0A 4DREA 4NJMB 1WDLA 5A4DA 4MVJE 1C0IA 1O89A 1PWXA 4Q3BA 1DAPA 3SLGA 1AUPA 1ORRA 1ZXLA 1F8FA 1YKFA 1ZVMA 1WP4A 3JQAD 5ILGA 3DL2A 3LT4A 1P1KA 2I67A 1EZ4A 3F6YA 3AOEA 1NQTA 2VYVD 1HWYA 2EP7A 4YWJA 3VKVA 4B79A 1U9JA 2O3SA 2Q45A 3DZFA 1ZK4A 1CYDA 1F12A 3GHHA 3H6KA 4EYEA 4M89A 3A4VA 2VRCA 3WBFA 4P22A 1KYQA 3DONA 3UCEA 4IDGA 1EQ2A 3FNGA 3ZWAA 4BO4A 1VPDA 2NM0A 1Y8QA 4R5MA 1AXEA 3DB2A 1GY8A 1I01A 3OP4A 4XX0A 4PN3A 2EP5A 3WG9A 3GR6A 2B83A 2NWQA 3C1AA 3BTUA 3RBZA 5AYVA 5U9CA 3GY0A 2V65A 3EW7A 3ON5A 1KS9A 4YJHA 4ROSA 1IZ9A 1KEUA 3KBOA 5DBFA 2YJZA 4L4RA 1EVIA 1QP8A 1V8BA 2PTGA 4BO5A 1U5AA 3BTVA 1MX3A 1VL8A 3A1NA 1KEWA 4CMCA 3PPIA 4W9NA 2PLAA 3T7EA 3GUYA 2VTDA 4A27A 4BNYA 4D3FA 1UZLA 1ENYA 3E9QA 4MIOA 3IKTA 4MKZA 1B0AA 1B26A 4JXKA 3RD5A 5GMOA 3X2EA 5IN4A 4JROA 5TT0A 4B7CA 1OOEA 2GR9A 4I5DA 4IGEA 1J4AA 3Q0EA 4GKVA 4BV9A 1NWHA 2PH5A 3TL3A 4YRBA 1XKQA 3CTMA 3BHJA 3CE6A 3H8VA 3LC1O 1R6DA 4FJ0A 2WTBA 1M2WA 2BI8A 4GVXA 2W2KB 5LC1A 2LDXA 1KY5A 1EMDA 1Q7GA 3E9MA 1GD1O 3FPLA 4R16A 1HTBA 3NT2A 3ONEA 2A35A 9LDTA 2OO5A 4BNUA 1PJ2A 1GYQA 1HLPA 3TZCA 1G0OA 1ZNQO 2VHVA 4EW6A 3MCVA 2QRKA 2JL1A 1H9BA 2YHIB 3JQ9A 1DB3A 3DQPA 3JQ7B 2HK7A 1WMBA 3ZV3A 4RGBA 1SB9A 3IIEA 1B3BA 1UR5A 4OMUA 5F5LA 2PKRA 5HWSA 1DIRA 3AOEC 4D42A 1H2HA 4N5MA 2OL4A 3ZHZA 3DXFA 5CHEA 3O4RA 4TSKA 4CQLA 4JN6B 1VRWA 3KRTA 1DIHA 4YACA 3GLQA 4J90A 4M8SA 4X54A 3TOZA 2NU9A 3L4BA 5TC4A 1ADBA 1BXGA 1LUAA 4E2YA 5A9SA 5KVSA 3VC7A 1TB4A 1IZ0A 3AI1A 4RDIA 1ONPA 1N92A 1ZH8A 2O50A 2YV1A 4N54A 4CLRA 1IHYA 1NFRA 3G3EA 3B1FA 1PZHA 4E31A 1MA0A 1ISGA 3TNLA 3VH3A 4W6ZA 5IDXA 5CDGA 1LEHA 1I2ZA 4GLLA 2QRLA 1E3SA 3Q1LA 2SCUA 1CEQA 1Z73A 3GNQA 4CV1A 5K0ZA 3DZKA 4HUJA 3H2SA 4DL9A 1V6AA 2GERA 2J3IA 4XYMA 1HSZA 1NAHA 1O94A 3NV9A 3PFWO 3WWZA 3K6JA 5KJFA 1J49A 2D3TA 3D5TA 1QLJA 4D0RA 1WDKA 4CV3A 1OMOA 4M1QA 4C7JA 1B2LA 1CDOA 1I30A 3QWIA 5BNFA 1O6ZA 4XGKA 4NJMA 1U3UA 4E13A 1W6UA 3I9JA 3AUTA 3B6ZA 4W9NC 2OBNA 1A72A 1PL8A 2RBEA 3WR5A 1RM3A 1JKJA 2NLOA 3TDKA 1GEGA 1LDGA 1P1FA 3I23A 4O1MA 5I7SA 3ZI0A 5KCZA 3C1TA 3KYCB 3GK3A 3M2TA 3WYEA 5JCJD 3Q2KA 2J5RA 4I9NA 1H6BA 1KVUA 4P38A 1ADGA 1YRLA 5CEJA 3ZWCA 3OIDA 5B12A 2UAGA 3OIGA 1E1MA 3GDFA 2FRDA 4QQRA 2HQ1A 1E92A 1EQUA 3DFUA 4BMNA 3R3SA 4UVGA 4OL9A 2AQ8A 4IM7A 2JD0A 2XXBA 1RJWA 1C1XB 1U7TA 1XU7A 3GG9A 1L1FA 1H0KA 4BO9A 1QSGA 1DIAA 3BXXA 3D5QA 3KYDB 2O4CA 2VYNA 4MO2A 3AM4A 1MXHA 3WTBA 3JTMA 1KC1A 3W8DA 4I5GA 2VWHA 4YRAA 3T4XA 3JQFA 2Q46A 1MP0A 5BQFA 2V6GA 3OQ6A 2C29D 1ISIA 3TWOA 3L77A 3JQ9C 4BGVA 1DEHA 1EFKA 4OGWA 5JCXA 4ZRNA 3GF4A 3BTOA 3PP8A 4ZQGA 3S2IA 3U5TA 4PG5A 1LLQA 2YFQA 1EFLA 2D2IA 2P4HX 3ZU4A 1YONA 5T57A 1HDYA 4DBZA 2ZKLA 4K9DA 5CFZA 2JD1A 4LVUA 3FWNA 5DF1A 4GVLA 3VPHA 3C8MA 4BOYA 1I0ZA 3L4BC 4CUZA 2WYVA 3ORFA 5AQ1A 1WDMA 2C54A 3BA1A 3UUWA 5CEEA 1GQ2A 4U6SA 2RIRA 5IF3A 3TQHA 3HWRA 4D0SA 2CUKA 2UV8A 4G5HA 4UEJA 2JJYA 4IDFA 5CG1A 3RC7A 3P19A 1IHXA 3A14A 1N9GB 4JP2A 1Q2XA 5A05A 2BH9A 2O3QA 4J9VA 1DC6A 1T4DA 3S2EA 1BTOA 4MVJI 1E5QA 2IEDA 4Z9YA 3E18A 5C7OO 4CLOB 1AN9A 2V7PA 4BNKA 4EJ0A 2IXAA 4C7KA 3JQDA 5L3ZA 2ZJ0A 4QUKA 4YA6A 1ZEJA 2JHFA 2Y0CA 4XB2A 1YO6A 3E5RA 2FZWA 3WB9A 3H2ZA 2W2KA 1EBUA 1I36A 4NJOA 4R01A 1A71A 1EK6A 2Q1TA 4IUYA 1JA9A 1MFZA 1U2GA 2HMTA 2DFVA 3RKUA 8LDHA 3C7CB 2CDCA 2Q99A 1LXCA 4FFNA 1DC5A 2HMSA 3KEQA 3K92A 1QYCA 1WAMA 2YHIA 3B20A 3JQ7A 4J7CA 4OQZA 3ZV5A 2BMAA 1ZK2A 1BDBA 3PZBA 5BSFA 2VNAA 4CODB 4WLNA 5CG2A 3K73O 1D7OA 3UHAA 1ZBQA 4CMIB 5ICMA 5L51A 4P4LA 2JHGA 1Q0QA 3WGHA 4TRRA 4Y67A 2O3JA 1UXHA 4QO8A 2XAAA 1SNYA 5A04A 4CMJA 2ET6A 3K8ZA 5I7FA 4XDYA 4WGGA 1LRKA 3H9UA 3RUAA 4BNMA 4IBOA 3RUCA 1LC0A 2FR1A 3JQFC 4CL3A 2DPHA 3OECA 1CETA 2OOSA 5I7VA 1LBEA 2XF8A 1NPYA 1PJBA 2FN7A 4BQPA 4Y98A 4XD2A 1ZK0A 1UP4A 5KVQA 4XEHA 3WGGA 1AGNA 1HL3A 2CD9A 1JAXA 4QECA 3RUEA 2YQ5A 4AVYA 4B8WA 2PKQP 4IIVA 3HQ4O 3SC6A 4ZD6A 4XB1A 4IJWA 4RPGA 5DN9A 2GN8A 1Z45A 3LT0A 1GTMA 4Y6PA 4Z9XA 4HFNA 4R54A 4IS3A 1F17A 4J0FA 4JP3A 2JKVA 2YDXA 5TNXA 1L7DA 1E77A 2XOXA 1NVMB 1MXFA 4NFHA 1PJLA 2NV6A 2C2XA 2P5UA 5H82A 1FDVA 1LSJA 1QXSA 3PJDA 4LGVA 1C1XA 2X5OA 1MG5A 3HJAA 2VTEA 3GUCA 4NNJA 2V6FA 3NTOA 5B37A 4FOSA 3MEQA 3RJ9A 3ZZNA 7ADHA 2NACA 3WJAA 5LDHA 4B3IA 1A9YA 2YV3A 2Y1EA 3TN7A 1DRVA 4AJ1A 4FS3A 4Q3CA 3PXXA 3ETGA 3U09A 3GRPA 1PJ4A 3G17A 3OEWA 1YJQA 3DBVO 3IUPA 3GVCA 2X5KO 3GVPA 4UUNA 2HJSA 3GC6A 3F4LA 5DT9A 1V0JA 3EZLA 3RUDA 4BNVA 4CM1A 1SEPA 1P31A 3AU8A 4ALLA 4BB6A 5IXYA 5KOIA 3DZJA 3HB4X 4RPLA 1E7RA 2UUOA 3DFZA 4RO0A 4R4JA 3DZIA 3P5SA 5IJZA 2NU8A 1YB4A 5HRUA 5LDGA 1GZ3A 5JE8A 3TL2A 4KP7A 2Q1SA 4JQCA 4EUHA 4RVFA 3C85A 1OC2A 2DC1A 3AI2A 3E48A 4CM5A 4GGPA 2X9GA 4AJHA 3G1TA 2Y0DA 4HY3A 3ZWBA 4YAKA 4J2OA 4GMFA 2DKNA 2G5CA 4TZTA 4CM8B 4B4UA 4UUOA 3OJFA 4O59O 3H9GA 1N9GA 4FFMA 4MIYA 1BDMA 1XR3A 1QRRA 4IMPA 1HKUA 3K96A 3V8BA 2Q2VA 1IB6A 2CZCA 1KVSA 1IUKA 2R2GA 2Z1MA 4FBGA 4YTEA 4DC1A 2ZIZA 2OZPA 1EBFA 3WQRA 4CLOA 3DOOA 2FZEA 4EI2A 1ISMA 2ZB7A 3HFGA 3G0OA 4LMRA 4RDHA 4CM4B 3PWKA 4B7XA 3TFOA 4PG6A 2BHLA 1SZJG 3NX4A 4FPXA 4YBZA 1DO8A 1LJ8A 3JYNA 1BXKA 4L4SA 4UEOA 1FDUA 3WFIA 3ZWYA 1T24A 3HHPA 3UKOA 4RZHA 2PD3A 3KB6A 2YQ4A 5KVVA 4J1NA 4DIBA 3TZ6A 4RVUA 2NTVA 1PJTA 1W73A 2GN9A 1NR1A 1ADFA 4L75A 4CMIA 3BMNB 3OH8A 4M49A 4OJNA 3G79A 4BMSA 3JD2A 4BNXA 3EMKA 4D3SA 2X0RA 3AWDA 1PQWA 2CMDA 4IXWA 1ZO8A 2PKQO 3AOGA 2BFMA 1RKXA 2OHXA 4DQUA 4NZ9A 3CPSA 4YAGA 1M6WA 4AJEA 3PJEA 3QWBA 2VHYA 1U5CA 1PL7A 5HS4A 2ZTLA 4TRNA 4F6CA 3V2UA 2HJRA 4AL4A 1VSUA 3UCFA 4W99A 4NQZA 5EPOA 4XJTA 1NP3A 5AXCA 5T8KA 4BNNA 2AEMA 1XDWA 2AA3A 3W8FA 2JFHA 5G0VA 3C3XA 1R66A 2CF5A 1DC3A 1XHLA 3CEAA 3PRJA 2QQ5A 3PYXA 5AXBA 4E5KA 1KVTA 1HEUA 1LLUA 2Q49A 2VUTA 2Q4BA 4DYVA 4WEOA 3PJGA 3DHYA 2P4QA 3WMWA 1ZXBA 1DAOA 1IL0A 4OM8A 4O5OA 1XG5A 1CJCA 3VZSA 5A9RA 3VAZA 1E1KA 3ZWMA 4WK6A 4ALIA 4LK3A 1BRMA 2Q50A 2FPIA 2DLDA 2ZB3A 3CKYA 1XEAA 3LDHA 4TRMA 5IG2A 1LRJA 4PG8A 1H5QA 2Z95A 2EERA 2B4RO 1A7KA 1PJ3A 5JO9A 3GPIA 1M67A 4Z0TA 4Q3NA 4D79A 5FYDA 1LLCA 2J5QA 3PGXA 4ND2A 1Z7BA 4RL6A 2GDZA 3DHNA 4AJ4A 3MJ4A 1P1JA 4YJDA 3VDQA 4BV8A 3PVZA 3ROPA 1MG0A 2EW8A 1B3RA 3GMSA 3HN7A 2GNAA 3VDRA 1SOWA 4BNJA 2BFPA 1KY4A 3I52A 4I9HA 2HDHA 2DTDA 2OORA 3WSVA 4INAA 2VYND 1XIVA 3LK7A 1V3UA 2J3KA 1ZJZA 1A7AA 2PGJA 4D44A 1QG6A 1T2EA 1HXHA 1H2BA 5ER9A 1R0LA 1U8XX 3ADOA 5DCYA 1YDEA 1GUFA 4DMMA 4E30A 4ZHSA 3OJOA 4BNFA 4L8VA 4CUJA 4RV9A 3KSUA 3PYMA 3ZHXA 1PQUA 3NJ8A 1U3VA 3KETA 3FBGA 1IYZA 3M1LA 4YEDA 4CM8A 3BMOB 1KIFA 2NU7A 1LQUA 2Y93A 2X22A 4W7HA 2D0IA 1GCOA 3H3JA 1N7HA 4YPOA 2OXIA 2GZ3A 4DIFA 3U4CA 4UUMA 4MDHA 3DBHB 1NM5A 1GQYA 3I6QA 2ZYGA 2CSUA 3F3SA 1Z74A 4FQ8A 5L7WA 3DDNA 5DP2A 3VHRA 3WX0A 4F3YA 1U7HA 2B36A 4B8ZA 1LQTA 2ZYAA 3NTQA 1BW9B 3DOJA 4KDFA 5T8KC 2O2YA 2I9PA 5G4KB 2EKPA 3DBLB 4KQXA 4DMLA 3BTSA 2Q3EA 1RPNA 4R1TA 3D4PA 4CM4A 1SAYA 3KSZO 4E12A 4FSHA 4NHEA 1YBVA 2GUGA 3EUWA 3JYQA 4GKBA 1N1EA 4NDNE 3LLSA 3FNEA 4F45A 4NBRA 1D8AA 4TVOA 2E4AA 1DC4A 4OKNA 1U4SA 3HE3A 1EVYA 4Z0HO 3D3WB 4RORA 3V2HA 5L40A 1UZMA 1DHRA 3OQ1A 2EWMA 4WUVA 2J5KA 3S2GA 3VOSA 1SB8A 4KUHA 3I6IA 1ZK1A 2O3UA 4AJOA 4HV4A 3BMNA 1P9LA 4E2WA 4FCCA 1CIVA 4QSMA 5CAEA 1M6HA 4L0QA 2NTNA 1QKIA 3D4NA 2VZ8A 4R1SA 3S2FA 5ITWA 1LDNA 1NQ5A 3IMFA 1PR3A 4ZJUA 4XIYA 3IS3A 1PSDA 3QJ5A 4CMBA 1P33A 5JXWA 2OFPA 5HBRA 4Z3KA 1I3LA 4PLHA 5G0TA 2WM3A 2NADA 3EYWA 3NEPX 5BT9A 3GZ4A 3H7AA 3GOHA 1K2WA 1ZMTA 1L7EA 3OJLA 4JNKA 4IDEA 3LYLA 4UAGA 1IY8A 1ML3A 2POQX 2AE2A 2DUUA 5A1TA 1LDBA 3LF2A 4KUGA 5EN4A 1ENPA 1ZSYA 2YHUA 1ADCA 3KUXA 1VSVA 2W90A 1HZJA 3LQFA 4OQYA 3UH1A 3RCBA 4WECA 1U8FO 3L07A 5COQA 2AQKA 3Q6IA 3EHEA 4XYEA 3L6OO 4B4WA 1E7SA 3WWYA 4PLTA 3QA9A 4JBGA 3W4KA 3WBBA 4RQTA 2HCTA 4GAEA 4MIEA 1I10A 2UDPA 1O0SA 3FRJA 3GGPA 4D3DA 1QYXA 4PRLA 2RH8A 2X1HA 1P45A 3A06A 4YJFB 5DP1A 1PZEA 2EIHA 3I9KA 1LSSA 5ADHA 4KTVE 4D41A 4WCFB 1K5HA 3IL2A 2RAFA 4P8RA 2VHZA 4PZDA 3NRCA 1HDCA 4BGUA 4J49A 2G76A 4B4OA 1YWGO 5F5NA 3WGYA 1XSEA 1D4FA 3E9NA 1D1SA 2IDZA 1XWFA 2HRBA 4G65A 2Y05A 4M86A 1XLTA 1A4UA 3QIVA 5JDIA 1B15A 2ZTMA 3W4JA 3FN4A 1N8KA 5H81A 2X9NA 1YB5A 3QVSA 3WQSB 3BIOA 4LN1A 4EJ6A 1C14A 1TT5B 1YL6A 3EDMA 1E7WA 2PK3A 4PLFA 5EL0A 4BHTA 4F6LA 1EVZA 2Y1GA 2PR2A 3IKVA 3JQEA 1XU9A 2P9EA 3D0OA 3U3XA 2ZQYA 5JLAA 4YT4A 3WOHA 2O7SA 3U49A 4BO6A 2EHDA 2W98A 1F06A 3ZNQA 2IZ0A 4RVDA 4WASA 1HDRA 3ZHYA 4CUKA 1JKIA 2I99A 3BMOA 1SO8A 3SJ7A 4LSWA 2VHWA 3O8QB 2WD7B 3ZW8A 2R00A 4U0KA 2PFGA 2UVDA 3I83A 3LT1A 1EUCA 3VH4A 1IULA 3DBHA 4YQZA 4Z6KA 5GZ3A 3L6DA 2I65A 5I7EA 2P68A 2WJPA 3FR7A 4OO3A 4ZQFA 4CM6A 2GN4A 1OZAA 2A4KA 2HSDA 3JQAB 2FSSA 3QE3A 1BW9A 1MV8A 2WD8A 3OHSX 1JU9A 4J1TA 1RM5A 4NMHA 5G4KA 1DBVO 1NHGA 3QVTA 3DBLA 1PU2A 2FP4A 2QZ9A 3V1UA 2PZMA 5KWEA 2C7GA 1Q7CA 3QWHA 2ZTVA 1JVSA 3KM0A 5JMWA 3AM5A 1PZGA 3PQFA 1I24A 2A94A 4TKLA 5BR7A 2P2SA 3HDYA 4DVJA 1C1DB 2HAEA 3PWZA 4RPJA 4NFYA 2FR8A 4U6QA 4XKJA 3Q11A 3ZNNA 4BNZA 2FWMX 4NBUA 1UXKA 3FF4A 2DVMA 4XGNA 3D3WA 4K1LA 1YDWA 2WWRA 3HDQA 3ZW9A 3JQBA 3VPFA 3MTGA 4BNGA 5TRTA 3O9ZA 5KJ1A 2HMWA 1DIBA 1GYRA 2VUSA 4A7PA 1O9BA 1X7DA 2YDYA 4I1IA 1NNUA 3HZZA 4A5OA 3RC1A 1T2FA 1JN0A 2DM6A 2V6BA 3ROQA 3K31A 2C5EA 3GPDG 4MPDA 1AE1A 1I8TA 1PZFA 1EUZA 1LTHR 1YVEI 2B5VA 3HDHA 4N5LA 4RLSA 2X0IA 4IY1A 4KDEA 4CJXA 2OP0A 1W4ZA 4II2A 4IIUA 3AY7A 2ZK7A 1OC4A 5IAAA 5FFFA 1P0CA 5JDIC 3AUSA 1JKFA 3WNQA 5CDYA 3CUKA 3DZGA 1UXJA 3PLRA 3WIEA 4WCDA 1P3DA 2UUPA 4H15A 4NU5A 2Y0EA 3KTDA 4IPTA 4I5EA 4D7AA 3E6AA 4IDDA 4NI5A 3VPSA 5DULA 3RAJA 3VVCA 2WE8A 4OXKA 1I33A 2FMUA 2J6IA 4IS2A 4BGIA 3LVFO 2E82A 1JAYA 4QX6A 3R6DA 1HE2A 1OFGA 2AEFA 1FDTA 4N18A 3WFJA 4DPKA 1P1HA 4OYRA 4R9RA 5EMHA 4HX5A 4K6CA 2R00C 4KZPA 4ZGWA 1VC2A 3TFQA 2W8ZA 3K9QO 4MP6A 4UVHA 1SEVA 4A2CA 3JSAA 3WGIA 3AU9A 4N7RA 1KOLA 1O8CA 1NTOA 4YJFA 4BKUA 3GVXA 1KETA 1PS0A 4JCOA 2UYYA 4WCFA 3ZNOA 4P4GA 5B1YA 4J2HA 2AG8A 2DBVO 2C5AA 1G6KA 1BWSA 1YQGA 1YS4A 1LDYA 1ZK3A 2FPPA 3QWFA 4XWYA 3GEDA 3OBBA 3RC2A 4H3VA 3FHLA 4IXTA 1R37A 3CMMA 1T4BA 1K6JA 4S3MA 2C7VA 1T1RA 5EJ2A 2OUIA 4YQYA 1Z75A 4CLEA 3ZNPA 2NTJA 5K9ZA 1PQPA 3PDJA 3JYLA 4M55A 3U62A 4EITA 1B8PA 3VPXA 4YT2A 1C0KA 3TF5A 3JD3A 4ZQBA 1TT5A 5JC1A 2BF7A 3WYBA 3JQBC 4W82A 3C7DB 3RROA 4YXFA 2VZ0A 2HRZA 2E37A 3RASA 3LC7O 3RFXA 3PTZA 2JFFA 1QORA 3H5NA 5L53A 3O03A 3ICCA 2BGMA 3JD0A 2WSBA 3FTPA 3VKUA 4ND4A 3S55A 1U3TA 5JAQA 5TT1A 4YR9A 5CP8A 4XIJA 4CM9A 4J1SA 3O8QA 3ANLA 3NT5A 2WD7A 1ID1A 3W4IA 1LX6A 4JJIA 4RVSA 1JWAB 3QQPA 5EQFA 2HK8A 2IE0A 3B1KA 3BAZA 4Z9FA 3FWZA 1YQXA 1T2AA 2C07A 4PLPA 2B4TO 3S8MA 3AI3A 5LCXA 2CDAA 3Q9NA 5F1PA 4PCVA 2OGUA 3JQAA 4BNIA 4E5NA 1JW9B 2XXJA 4GX1A 5AOVA 1XYGA 1ZMOA 4TRJA 4QO7A 1WZEA 4BKOA 5KVCA 4XQCA 1GEEA 2AG5A 4UULA 1NASA 1C1DA 1F0YA 4CMAA 1SOVA 5CDSA 2HLPA 2E6UX 2HMVA 5L95A 2VWPA 5I9NA 4BO8A 4PFJA 3RJ5A 1KEVA 3NTRA 3PI7A 5JYDA 1UZNA 3KVOA 4HXYA 3ZWNA 1UAGA 2PH3A 4HWKA 3QP9A 4P4NA 5A02A 4E3ZA 4YAIA 1DXYA 5L7YA 4YT8A 1ZSNA 1Q1NA 3PDUA 4OSOA 2Q1WA 4CR7A 4WCFC 3ZWVA 2GF2A 3GFGA 3JD4A 1Z6ZA 1U28A 3EVNA 2BKAA 3CMCO 4FW8A 4CMKA 2QZZA 4B3HA 1EVJA 3INRA 1D3AA 4MINA 5KJEA 3OF2A 1QYWA 2C2YA 3DZBA 3FPCA 2EGGA 3H5AA 3MJEA 2RHCA 4MKXA 1CWUA 5KKCA 2F1KA 2Z1NA 2RHRA 3DTTA 2AQHA 3OICA 3U4IA 5COBA 3WLEA 2H63A 4OOFA 4TQGA 2GZ2A 4NBWA 5AXAA 4WPGA 1E7YA 2VWQA 3IJPA 2VZ9A 5K6AA 2HUNA 4GX2A 4J6FA 3VTFA 4DLLA 1SMKA 6LDHA 5IDWA 2AEJA 4IQGA 3ZWPA 2QYTA 1FDSA 4NG5A 4MKRA 4YDRA 1GUZA 3LU1A 1UAYA 2VRCD 4IJKA 1E3EA 4RF5A 4J1QA 1K89A 3KO8A 5DDIP 4NR0A 3SVTA 4M54A 4PZEA 4ESOA 3PHLA 1X14A 1NVTA 5L9AA 1CRWG 1X1EA 2C59A 4MOWA 4YB8A 1FDWA 3DBRB 1QR6A 5L4NA 4D46A 4WNIA 5ENDA 2H6EA 1UXIA 3AFMA 1QYDA 4LRSB 4E21A 1PJSA 2PD6A 1HDXA 4S1VA 3SC4A 1IE3A 3Q2IA 2VRBA 4CLHA 3GA0A 1TI7A 2NVBA 4PLGA 4D45A 1BVUA 4EEXA 5G0WA 2WMDA 3PZRA 2AXQA 2D4AA 5DBIA 1DDOA 1OI7A 4CV0A 1WNTA 2AW5A 3GAZA 1E3IA 1B14A 5IZ4A 5I9LA 4D43A 1ZEMA 2EV9A 3NAQA 4A26A 4RF2A 2J3HA 2X58A 3I9OA 4GGOA 4JIGA 1SC6A 3ANNA 2NUAA 4XA8A 4PVCA 3H9JA 3STHA 4HNGA 2FR0A 5IZCA 4DLAA 1N7GA 2OP1A 4BMVA 1UXGA 4E5MA 3WQQA 2PD4A 4GX0A 1ONOA 5B4UA 3MJTA 4XYLA 1TLTA 1ZCJA 1HYHA 2O23A 4PLCA 4BIIA 4KWHA 3FI9A 3GDGA 3OA2A 4GWGA 4A10A 3G49A 1DHTA 1XGKA 1KERA 4FC7A 5KKAA 4YT5A 4DTIA 1TVEA 1MUUA 2HMUA 2IEBA 4URFA 8ADHA 3MWDB 1GFSA 2PY6A 1I5RA 3QV1A 4GI2A 6ADHA 4DPMA 4EUFA 1A5ZA 1E6EA 5AXDA 3D64A 4NK4A 3OETA 4Y8VA 4J7UA 3ABIA 5THKA 1HRDA 3RUHA 2Q2WA 3ONDA 5JAZA 1IOLA 5C7LO 4HFRA 5JW6A 1GYPA 3DWFA 5K6AC 1RYEA 2VN8A 1DJQA 5FI3A 4FD3A 5TQVA 1X0VA 4L76A 4RPKA 1RWBA 3LSYA 3QSGA 4TVBA 1HYEA 3GNSA 1CF2O 1H6CA 1AHIA 2G82A 3JQCA 3JYOA 1RYDA 1MC4A 1E3LA 1SPXA 2EJWA 2GN6A 3BZUA 3D7LA 4NBVA 4L9RA 2C82A 3GRKA 3Q3CA 4L74A 5JY1A 3ASVA 1LC3A 4XR9A 5FWNA 3RFVA 3GDOA 1J5PA 3NDJA 5BNTA 2CDBA 2X0NA 5TS3A 3WS7A 4JJGA 4Q3DA 1N5DA 4O0LA 4UVDA 3VH2A 1YL7A 5IXSA 5DNAA 2JFGA 2A9FA 5I8ZA 4RCVA 1ULUA 4MJLA 3SEFA 3OQBA 2EF1A 3R3JA 2J3JA 2GASA 4G81A 5DCUA 5GZ6A 4LW8A 4XQEA 4DC0A 1EE2A 2G17A 4JK3A 1T2DA 1NAIA 4GQAA 1R15A 3AFNA 2C0CA 2B69A 4CMEA 1MLDA 5B4VA 1HETA 5IZCC 3GQVA 3IC5A 1ARZA 4BNTA 1E5LA 4TMFA 4Q9NA 5IN5A 1NPDA 4YRDA 3HN2A 5MDHA 1A27A 4XJSA 1XA0A 3MZ0A 4LCEA 2AE1A 3ZU3A 5JC8A 1YBMA 4IQ0A 4FJ1A 3CH6A 3TPCA 2CY0A 1EEHA 3GG2A 3F1KA 1LDEA 4BO2A 3OJ0A 5ICSA 2JD2A 4J4BA 3DBRA 3SX2A 2DBRA 4CMHA 1HE4A 2GO1A 3W6UA 1C0PA 1P0FA 1JWBB 1GADO 2AMFA 2GGSA 2H5LA 2IRWA 2O3TA 1CQIA 5L4SA 3BHIA 4IDBA 4DXHA 2X5JO 4LRTB 1B16A 3ITDA 1QLHA 4FR5A 1NPTO 2I6TA 4AJJA 1W0CA 3IAHA 5KTKA 1E1NA 5TSDA 4OH1A 2X9VA 2VT2A 2P91A 1NFQA 2VUUA 2QIOA 1I3NA 3I5MA 1S7CA 3V5NA 1GL3A 1R4MB 4KQWA 3T4EA 3P7MA 1K3TA 2R6JA 2CVQA 3DO5A 3E5MA 5C7IO 2Y1FA 1NQAO 4WE3A 5DOZA 4AJNA 4RJTA 1LI4A 2GRAA 1WZIA 3MTJA 3ENNA 4IQ8A 3NDRA 4FGWA 3W6ZA 4HFJA 1IPFA 2E49A 3KYBA 4BS9A 4NFSA 4BO3A 4AJ2A 4AG3A 1GZ4A 1K6IA 4CM3A 3MOIA 4CL8A 4IZHA 2NQ8A 3ADPA 1M75A 3VTZA 4WJZA 1KVRA 2DBZA 1JVBA 1ISHA 4IDCA 1NR7A 1DSSG 4OIMA 3ASUA 1CERA 3C24A 3RFTA 4EBFA 1H94A 2PZKA 4YJGB 1X1TA 3DC2A 3PQDA 4YAJA 4C4OA 5JAIA 2O3RA 1Y81A 2QG4A 4CMEC 4ZRMA 3T7CA 4HKTA 3EAGA 3JCZA 3IJRA 1R0SA 3C7AA 3INTA 5KJCA 5IFLA 1FF9A 1M66A 1PTJA 4CM9D 4AFNA 1KC3A 4EJMA 2X6TA 3X2FA 4JLWA 4LSMA 1SCUA 3INGA 4BO1A 4L4XA 3QW2A 4EGFA 5JPIA 2WE7A 1Y5MA 2ZATA 1WW8A 1I32A 1WMAA 2D5AA 2PGLA 2PNFA 3CIFA 4IMRA 3RKRA 3S1LA 3VZPA 3WGTA 3ZU5A 1VKNA 3JQGB 3V1TC 1DRUA 4PRKA 2RCYA 2Y99A 3UOGA 5B4TA 1P74A 1HSOA 1KBZA 4W7IA 1VI2A 1WWKA 3D3EA 3M2PA 2HU2A 2Z5LA 1OAAA 3PFFA 4CQMB 1BMDA 3NKLA 3TRIA 1E6UA 1HDZA 4E6PA 4YYZA 3CXRA 4AJIA 2JAHA 5TGDA 1R12A 1YXMA 4BNWA 2Q1UA 4XZ3A 4DLBA 1GPDG 4QEDA 4AJPA 2NU6A 3PLNA 4K6FA 5TF4A 5CPBA 3RWBA 4ZU3A 1X7GA 3H65A 2QHXA 2NSDA 3PHHA 1E1LA 3FNFA 3SLKA 1GU7A 4DUPA 1H93A 4FFOA 1U4OA 4MVJM 4YCAA 5G2OA 1DLIA 5JBIA 4Q39A 3PHIA 1PGOA 3VZRA 3KXDA 3QRWA 3F1LA 1U2DA 4DRYA 4RVGA 4E5PA 4A0SA 4NBTA 4CM7A 3UAGA 5HTOA 3H3FA 4MVJA 4FGSA 1GPJA 4WLVA 4GX5A 3P2YA 4GPD1 3FBTA 2Q2QA 4OAQA 3EVTA 1YGYA 4RVHA 3TZQA 3QVOA 4F46A 2W4QA 1KEPA 4RF4A 1GUYA 3IOYA 1HF3A 3LC2O 3KSDO 4J7XA 3VPGA 1TXGA 4J43A 3H4VA 3RC9A 3PHJA 4R69A 3IDSA 3RI3A 2HO5A 2BD0A 5C37A 2D5CA 2VNSA 4ZQEA 4NIMA 2LDBA 2PZJA 2VCYA 1PX0A 3JQ6A 5A5FA 1HDGO 2JCYA 5HA5A 7MDHA 3ENKA 3UN1A 5U1PA 3ZCXA 5T64A 3UCXA 3RQSA 3K2EA 4DQVA 1VJ1A 4GSKA 4HP8A 4WLUA 4B3JA 3MJCA 4OSPA 1U1IA 2W2LA 4HBGA 1P44A 2X7HA 1R4MA 5JS6A 5BNIA 1LRLA 4MVJG 3HNPA 3DZHA 4LVCA 5L45A 3ZV6A 2I76A 3F46A 1BSVA 4GBJA 1T1SA 3TZKA 3DAGA 5BSHA 2ZCVA 3H9EO 2OMEA 2AQIA 3ZWOA 4A73A 1T26A 4U7WA 1HDOA 1P1RA 2P9CA 3OM9A 5TJ9A 2BFOA 2FPGA 3GN2A 1VJ0A 1WXDA 3N58A 4DIOA 4H16A 2E48A 5H83A 3B1JA 3AY3A 2EXXA 4XGIA 1VL6A 5COAA 4ALMA 3QVXA 2DAPA 4WNCA 1PS9A 1VJTA 1JDJA 3N74A 4RLHA 5TJHA 2FHSA 3OJEA 1P1IA 4JJFA 4IZIA 4YJGA 2PGDA 2VHXA 1BG6A 2XPCA 1HLDA 3B70A 3HFSA 2ZYDA 3K5PA 5F21A 3M6IA 4OOEA 3JYPA 2YFHA 1G1AA 4YAEA 1TA4A 3COSA 4HADA 3V2GA 1E3WB 1Y8RB 2YV2A 3OMLA 4IJUA 3HDJA 3NUGA 5A06A 1NYTA 4BKRA 1HE5A 1ZZEA 1NQOA 3PGJA 3DAPA 5TLSA 5JYEA 1WLYA 3WLFA 4LMPA 3ROMA 3SXPA 3SBOA 1K6XA 1QV6A 1HYGA 4I5FA 1YOVB 1ZW1A 2EKQA 2NNLD 3JQGA 4XYGA 1UP7A 4GMGA 4KOAA 3KLMX 1X7HA 4UEKA 3OIFA 1UH5A 1DIGA 1GQQA 1Y6JA 1PJQA 2Y67A 5EIOA 3UW3A 4CV2A 4FFPA 3FSRA 4OXNA 3L6EA 3UICA 1F14A 4E32A 4WLEA 3PJFA 4BO0A 4UVEA 4ALNA 4CQMA 4BKQA 1EUDA 4CR8A 1LNQA 4UUPA 1UDAA 2EKLA 4ALKA 2QW8A 4A03A 4BQRA 1PJCA 2O2SA 1OBFO 1Q0LA 3PEFA 1E0DA 3K30A 5F1OA 4OKIA 2YYYA 2ZQZA 3WYCA 3JD1A 4PZCA 1E7MA 3WICA 1YE3A 4ND5A 2IXBA 1X13A 4WLOA 1DPGA 5KNLA 3U9LA 4BVAA 3R0IA 3LZ6A 3FNHA 5FF9A 4I8XA 2I5PO 3M1AA 4J0EA 1R4NB 3H5RA 4RF3A 4XQ9A 4ZVVA 4GLOA 3I9LA 4AICA 4WKGA 4E33A 3GVHA 2QRJA 3G1UA 3HB5X 2YUTA 1UJMA 1BGVA 2G0TA 3OEYA 1YL5A 5L4LA 4MP3A 3IP3A 2EJVA 4FB5A 3I9NA 4FFRA 5GZ1A 1YBAA 1ZKMA 2O48X 4TKMA 1ULSA 4GL4A 5ITVA 5MGBA 4XRGA 1EE9A 2A92A 3IP1A 1ZFNA 3KZVA 3UXYA 4JBIA 3WGOA 4G2NA 4MVJH 1YQDA 1NBOA 4ND3A 2AHRA 5I9MA 3PIDA 1Y7TA 4HFMA 4KMSA 2V6MA 3U4HA 5BSGA 5IDYA 3PK0A 4CR6A 4YVFA 2WDZA 4R41A 5DOVA 3LF1A 2QX7A 3L0DA 4J4TA 3WJ7A 5G0UA 5KJ6A 5EESA 1Q7BA 1DRWA 3E03A 1X0XA 3ITKA 1VLLA 4M87A 5T5QA 2YW9A 4TZKA 3ZWXA 3ETDA 5F3RA 3VVBA 3AM3A 3AJRA 3QWAA 4DWVA 2BELA 5GY7A 3QHAA 5JDCA 3FR8A 1I3KA 2DT5A 1EK5A 4R68A 1YJ8A 4CPDA 4UREA 2BGKA 4R1UA 3AK4A 3JQ8B 1PEDA 4U8GA 3I3OA 4II3A 4ZN6A 1FK8A 2HK9A 3F9IA 3I1JA 1U3WA 1QV7A 1ZIDA 2WYUA 5JO0A 2H1SA 2VYVA 2CVZA 1SBYA 5ENVA 5TIIA 1NXQA 3ROKA 1LU9A 1GAEO 3RIHA 1PL6A 4RQUA 2X8LA 4ONEA 3RBVA 3F5SA 1Y5RA 1ZSVA 4J91A 2NVUB 2I3AA 1UDBA 3EY4A 3I4CA 1B7GO 3ANMA 2X4GA 5A3JA 4MVJP 3QLJA 3ZGYA 2VWGA 2D1YA 3UVEA 1ZJYA 3MJSA 4DA9A 1ZUD1 4Y6SA 1A9ZA 1T25A 4XCVA 3ZHBA 1K0UA 4UVIA 4JBHA 4FN4A 1QMGA 3L9XA 2RH4A 2BI7A 2Y1DA 3E82A 4PG4A 4U5QA 2EGHA 4BKPA 1HE3A 3EC7A 3O38A 4L73A 4R1NA 4GSLA 2IZ1A 3TOXA 5KIAA 3E8XA 4BL5A 2IYPA 3BMCB 1NVGA 1TEHA 5JSFA 3DAFA 4HNHA 1E3WA 1Y8RA 5JMPA 2B0JA 2GYYA 3GT0A 3RBXA 2PWZA 3GEMA 1XQ6A 3LLVA 1AHHA 3ZN2A 3GEGA 4I08A 4PLYA 1GV1A 3DR3A 4BO7A 3L4SO 1V9LA 1TT7A 5J23A 4JX8A 3NGXA 3RU9A 2B4QA 3UFXA 4CLXA 3KYCA 1DFHA 1ENZA 2QYSA 3C1OA 1VE9A 4GWKA 1PGJA 2DBQA 1YOVA 4GH5A 2TMDA 4O63O 3AW9A 1UP6A 5U4QA 4B4VA 4KUEA 4BNLA 1LSOA 4QXMA 3BYZA 3QVWA 2DTEA 5CPFA 2FSVA 5A03A 4E5YA 3CSDA 4AJLA 3D4OA 1H6DA 5HS6A 1Z7EA 4XQGA 3KYDA 3H9QA 1G0NA 3ULKA 4Y6RA 3D1LA 5FI5A 3DMTA 1I2BA 5A3VA 5AVOA 4TWRA 3ONFA 2VT3A 5JDCC 1EDZA 1E3JA 2P5YA 2DTXA 1WPQA 1GZ6A 4N5NA 4PLWA 3VH1A 4I9UA 5IDQA 4PGFA 3F47A 3W8EA 4E0BA 3EK2A 1GR0A 1RM0A 2PA3A 5G4LA 2PZLA 2PV7A 3HADA 4R9SA 1R4NA 5TX7A 4ZA2A 3A28A 1NHWA 3FD8A 2DU8A 2NVWA 3A9WA 3ZWWA 4EEZA 3MOGA 5C3MA 1ISFA 3CZRA 1FXSA 1Y1PA 1I2CA 4OHUA 4PG7A 2JCXA 3OFSA 4IJVA 2DUWA 1F8GA 1ONNA 3DHEA 3GGOA 1NX6A 3U0BA 4QT0A 4WEQA 3V1YA 1N2SA 2GSDA 2D59A 3WGQA 2IZZA 2TMGA 2Y66A 1T2CA 1PGQA 2H9IA 2GLXA 5C5IA 3FTNA 3MWEB 3PWSA 5A9TA 2F00A 4XRRA 5DZSA 3NDIA 1VKOA 2VOJA 3ST7A 4QTZA 1UUFA 3BMQB 4NU6A 3NT4A 5JY6A 4MVJD 2B35A 4O6VA 1PIWA 1ISJA 1CQJA 4DPLA 4ITUA 5JFOA 3NGLA 3DOCA 4WOKA 4PVDA 1Y9AA 4FC6A 3W1VA 1DLJA 3NYWA 1D1TA 4PLVA 3WDSA 5ES3A 3WXBA 4PLZA 1HZZA 4DQXA 4B7UA 3F5QA 3BHMA 5THQA 4E2XA 3AUAA 4BB5A 1BHSA 1I3MA 1AXGA 1H9AA 3Q9UA 1MB4A 5JCJA 1VM6A 4R51A 4FDAA 3NJ4A 2JAPA 3EGOA 3JQ8A 1W8DA 4XR4A 2ZB4A 3GZNB 4Q3AA 1NWCA 1E6WA 1YB1A 1JLLA 2DFDA 3O26A 3WGZA 2EW2A 2I66A 3RU7A 1PWZA 5A5EA 1LLDA 5BSEA 4W4TA 1X15A 5CDTA 3RUFA 2OBYA 3KHUA 2W2LD 3F4BA 2DPGA 2NVUA 1LDMA 2J8ZA 4DYDA 1GCUA 4FFLA
chains in the Genus database with same CATH superfamily
2NAPA 4OEHA 1E9VA 4A9AA 1OXSC 4GVPA 5K3AA 3OA0A 5HUHA 3FOEC 1LA2A 3QEKA 1J99A 5ALYA 1YRQA 3ZS8A 2A0YA 3C3YA 3AY6A 1MGOA 2DJIA 4KPUB 4X65B 1V3VA 2LD4A 3KAPA 4Q15A 2ORED 3HJNA 1C3VA 2B5WA 4ILKA 3HB7A 2INGX 4F12A 3ZE1B 4HWTA 4IWNA 3URMA 3QQ5A 3GGGA 4OYYA 2B7CA 3LVQE 4OFZA 1DV2A 2HY7A 2WU1A 4QSHA 1Y42X 1O95A 1T9KA 3R5SA 2Y68A 4LCJA 1DFGA 3UIEA 4R7TA 4PTYA 4ZCIA 3HXQA 1CD5A 1O1YA 1NW5A 2RK6A 3BMCA 1PV1A 3JR7A 1Y8QB 1XVAA 3RARA 2QJWA 4EBBA 3OLYA 5AMXA 4Z0PA 2C20A 5CYOA 4N65A 1BVRA 1IBRA 3EFHA 4PO9A 4WINA 3I9FA 4EA8A 1KI7A 4K81B 2R8BA 3KSMA 4L5BA 1WR8A 3WMXA 4CLDA 4C3VA 3Q7IA 1NFFA 1UL1X 1JFSA 5J3JA 3RB8A 1R16A 4ID9A 4EKYA 5JAMA 5GVRA 1PFQA 2O52A 1QTQA 5DBGA 3WRXA 1CUGA 1ZBDA 2BLLA 3LV8A 1BX3A 1E0KA 3ICPA 1ZUNA 2GPTA 5E8RA 4C3UA 3TGPA 2CB0A 4IIYA 4IOMA 2FWBA 4H7PA 4JU9A 3DEYX 1JLRA 3EUFA 1K7YA 4DANA 3D4LA 3B13B 1UIRA 1OUMA 4XM1A 1NDUA 5G40A 5KI6A 1JLHA 4CXMA 4J0HA 4D4MA 2VHTA 2ZRAA 4WZBA 3GPCA 4JWTA 4EUEA 3Q5DA 5LB4A 3U9SA 1OVGA 3BH0A 1EIWA 1WQ1R 1EVEA 3QA3E 2AN3A 3K70B 4FOOA 3V8NA 3QIAA 2FEAA 3KEOA 3DMYA 1DG3A 3EFBA 1LPSA 2QTZA 3GLUA 3LT2A 4IX9A 3IPLA 1JDTA 2BGUA 2BRUA 5EZYB 1U1DA 2C42A 3F96A 2VPWA 2H3EA 5CT4A 1RRKA 3GHYA 4X00A 5DW0A 2LPMA 5AHKA 4H1TA 4AK9A 1KAHA 4O02B 1KYIA 5KSWB 4XARA 5FTLA 1C3XA 1E0SA 3OSUA 4F3CA 5KOYA 3NATA 3ISTA 4DCMA 4CQMD 4HEA1 1TMYA 2ZI5A 1OB5A 1J8DA 3F6SA 4PS1A 1YS2X 1M76A 1GGJA 2J4CA 4CIXA 5GVSA 3QPWA 4R5HA 1YKGA 3TMKA 4E2ZA 1MB9A 2CF6A 3R5JA 3CWQA 3TL6A 2Q21A 1WPXA 4ZFNA 4PAGA 4LFAB 4Q7LA 4TXMA 4AN4A 1XVLA 3F5FA 3RSHA 3UMCA 1CS0B 2O7QA 3DXZA 2VPIA 3BVPA 3H0EA 4K28A 2E6KA 4MS1A 4XWTA 3RK0A 3KP1A 3R9XA 2YIVX 1XKLA 2QVYX 1FDRA 2WZBA 5HX7A 3N5CA 1J6UA 2X1LA 1DJNA 2GRUA 4KI0A 2JKYA 2KM1A 2JIPA 4KQ9A 4QFDA 3NETA 5IC4A 1EHCA 5D3QA 1KYYA 5I9IA 4KWIA 3ICEA 4MV3A 4ACAA 4JP1A 3OUTA 4TN1A 2WKRA 2Y1OA 4ODIA 4MGHA 3CINA 1AKQA 5DMHA 3V42A 2HF9A 2C3OA 3GN1A 3LJKA 4K26A 1NW7A 2HOQA 4B2LA 3O8RA 4UU0A 4I4NA 1UBMS 1N2ZA 3U7IA 2AN4A 3AUUA 2ZSUA 4KCGA 4CRWB 2WQ6A 4RJ2A 3QOXA 2AUNA 5ALQA 1O0BA 1QYVA 1A5SB 5T4FA 5GTDA 1BXZA 1W88A 1O95C 1OYYA 1AUVA 3N8DA 1U7WA 4QATA 4UAJA 2WABA 4ETWA 4XWGA 1D1QA 3UGJA 5EINA 1JTVA 2SICE 3C3EA 1S6YA 1I1NA 5ALMA 3D3KA 3QJGA 3WNVA 5EMKA 4AXBA 1XCBA 4UTXA 1GDHA 1EDOA 1XE3A 4FKBA 3VZQA 1O9GA 1XTSA 4NV1A 4LKOA 5DTQA 1Q0HA 1V35A 4Z3DA 3RTEA 1FB5A 2EEPA 2VQ3A 4UHCA 1Y6ZA 2EZ8A 1V11B 2YC2C 3RTCA 1O4VA 4IGFA 4D3YA 5IRCD 4Y9DA 2KW5A 3L7LA 1MEOA 3WRXC 2I22A 4MW2A 5I4IA 3GLVA 1E2KA 3BWVA 2E89A 1E9RA 4TTRA 3VMMA 2QTTA 3LRPA 3N3AC 3B7GA 1WS6A 2X7XA 1WY5A 3LMKA 2J9ZB 2OCDA 3V4FA 2UYOA 4OBWA 5A4DA 1MNQA 1V95A 1O89A 5DGHA 3RJTA 3DE4X 1ACLA 1JKJB 4LOHA 3N53A 1VPTA 2B7BA 2B21A 1JI0A 4QREA 1F8FA 3L46A 1ZVMA 3L1JA 3ROGA 4LGCA 4JYAB 5KKNB 1WP4A 5FWYB 3DL2A 3LT4A 4LF9B 2G09A 2BRUC 1Y89A 3AF3A 1QHNA 1P5HA 2WJHA 4YH1A 3X44A 4M99A 4OFXA 1WG8A 4DM3A 2VYVD 4HCJA 4LV8B 3JWIA 1WM1A 1X1SA 3VKVA 2IW3A 2MSDB 3AP2A 4G5RA 3H6KA 3BJEA 4L22A 3S7TA 4EG0A 3A4VA 2HV9A 2QM8A 2VRCA 4P22A 1CUEA 1KYQA 1OX5A 2EWVA 3DONA 4GP9A 3EY9A 5B1IA 2ARKA 3H86A 3FNGA 4IDGA 4RIHA 3RBAA 1YS7A 4N7JA 2MINA 4R1OA 1GKIA 3RV3A 4E22A 2OB1A 4HXEB 1QX4A 5CCDA 4MWOA 1VPDA 3OU6A 4Q37A 3JRNA 4ZOCA 5DNYB 4OQ4A 4DIUA 4ENRA 2Z09A 1Q11A 4LECA 2X8WA 2X0DA 4XX0A 4CGZA 1QE5A 2H0RA 3CLHA 2JG3A 3AF1A 4Q7MB 3AF4A 2EP5A 4L1KA 3WG9A 2XKKA 3C1AA 3EOZA 3MWJA 4GZMA 1OFHA 3N0XA 3RBZA 1W19A 3C7TA 3NXKA 3F2IA 4EI9A 4XVQA 3U4QB 1CRLA 3ZKWB 4S12A 4B2IA 2UXBB 3EW7A 3ON5A 1IZ9A 2TS1A 1ZINA 2R1UA 1Q0TA 3OZSA 1VZ2A 2NUTB 3KBOA 3R3VA 2RSLA 1QP8A 4L4RA 3GJYA 4M1TA 3EH2A 4NABA 3C74A 3WNZA 4BO5A 4BWYA 4YRGA 4V0SA 1R6UA 1TUBB 4UTZA 1AK1A 1L6RA 1BZYA 4W9NA 1Y8CA 2H1IA 5AQEA 3TEFA 2E9SA 4OPMA 4OQXA 1PT8A 3GUYA 3TQRA 3WLAA 4PZZA 2JGFA 2DFLA 4BNYA 4D3FA 1JSLA 5H80A 3KVRA 5ALHA 3K0SA 1W9HA 3G8YA 5CVJA 1OXMA 4MKZA 3KR1A 1B26A 1OLSB 1SG6A 2Z4RA 4JXKA 4L85A 5GOZA 1INLA 2MSLA 1T5LA 1J0CA 3CX4A 3UZUA 4DHEA 1PEYA 1ZRSA 2X0KA 4KR2A 1DKPA 1OOEA 3OQHA 1J4AA 3L7AA 4ZVOA 1LNZA 3MIIA 3Q0EA 2C3PA 4QXRA 4EPXA 2P2YA 5K45A 3D4BA 1NWHA 5HHTA 3VR1A 3E7FA 3NIGB 5KSOA 2PH5A 1QH1B 4JV5B 2H17A 1XKQA 4X5OA 4I3HA 1VHTA 1A1SA 1R6DA 2NZUG 2WTBA 3IAAA 3PSAA 4RY0A 2BI8A 2AT1A 5K8JB 2QTBA 4HATA 1K08A 2W2KB 4U7TB 3A9SA 1Z6PA 3MCUA 4M7WA 2FCAA 5BMVA 1EMDA 3FFXA 5KHLB 2XCLA 1B41A 3SXUA 3NT2A 4F8YA 3SZOA 4KN6A 3SIRA 3WA7A 1PFGA 3IP8A 9LDTA 1GZ5A 1HNXB 4DA7A 3H5VA 2CLHB 3RYFA 5TGTA 3GP5A 3DTVB 4PYOA 3AILA 5TARA 2ZUTA 3DQPA 2IDJA 1FYVA 3OLWA 4MK4A 1WMBA 5UKDA 5IUJC 4MLCA 4RGBA 1TYZA 2Z5VA 2QBYA 3TIFA 5JCOA 1S1MA 5REQB 5HWSA 2PKRA 1IXYA 4NYIR 4PNPA 1W2WB 1E2HA 4DLWA 5EOVA 4OXXA 2POCA 1JZSA 5BNWA 1XTZA 1FMLA 1K3UB 2OL4A 3A4IA 2C9YA 4N5MA 5CHEA 3SKYA 3I9V1 3UH0A 3ZHZA 2XYPA 3ICQB 1RQRA 3M83A 2M1ZA 4YACA 1DIHA 3SQLA 4TMVA 4HDRB 1JG7A 4FHEA 4L3WA 2Y6VA 4HUQA 2IOHA 5IT4A 3NHAA 5CW2A 3UJHA 1NY6A 3Q87B 4E2YA 5A9SA 3VC7A 4HLNA 2NO4A 4CFYA 1FE8A 4ZVSA 3GJRA 1NI5A 2AJ8A 1ONPA 2NV2B 4XGRA 2XMPA 1ZH8A 2IYTA 2YV1A 2G6BA 3CX7A 2Y92A 4TMZA 5LYYA 4DWVA 1IHYA 4DMCA 3B1FA 5GJCA 1BDJA 4ZI7F 1HLFA 1MA0A 4JKIA 3W9SA 4ASUD 1ISGA 5DYWA 2XRZA 4MUFA 1HQDA 1LEHA 2H4WA 3ODGA 1LF5A 1WP9A 1Z73A 2SCUA 1RWPA 2I8LA 3KOXA 4UKDA 4WBXC 5K0ZA 4HUJA 4DL9A 4DT1A 3NUZA 1TYAE 1V6AA 3QTTA 4D8WA 3WWZA 4QRHA 3K9CA 2GVZC 3D5TA 5ISMA 3W5UA 4C7JA 4OYLA 1E8MA 3GJ4A 1CDOA 2WM2A 2ZYRA 3OQIB 3QWIA 4EUSA 4UJ5A 1WSWA 4DSZA 1JIIA 1MDFA 3F78A 4W9NC 2OBNA 4EO7A 2RBEA 2WUGA 1W9MA 1GEGA 1P1FA 1OIWA 4MZDA 4TKUB 4JHLA 4BAZA 3NIFB 3PDIB 3WYEA 5F2NA 3QX7A 5A0TA 4WOCA 1Q7EA 3B78A 3O4JA 4I9NA 3OQOA 3M33A 4PYMA 4EG4A 5A1JA 4B82A 3NR2A 1JILA 3OIDA 1L5GB 4ZPXA 5LP6F 3UJCA 2VCEA 1AMUA 3GDFA 2HQ1A 1E92A 1HKHA 2C9DA 1NSTA 1XXLA 4BMNA 3NNDA 3RU2A 4UVGA 2AQ8A 1J5EB 4WKOA 5GIPE 4MLPA 2JD0A 2XXBA 4M0FA 2AKYA 3A9VA 3MMPA 3ODPA 2XOKD 1C1XB 3GG9A 3KJEA 3N0VA 5E6SB 3WZMA 4KR7A 4BMYA 3AG5A 3Q8XB 3QHQA 3BXXA 3D5QA 3KQOA 2IYUA 3NH6A 4UDXX 3T5AA 1WXEA 3JZMA 4Q93A 3SM3A 3EQ7A 1F2TB 3AM4A 2CJWB 3IAUA 5EPUA 5FJIA 3OC6A 3M34A 1SUFA 2YCLA 2BONA 1GO2A 1RNLA 3FCXA 4W7SA 1JG3A 2IA5A 1JTEA 2DRIA 1KRHA 3BIWA 1IM8A 3HUUA 3T4XA 4AURA 4ZO4A 4E11A 2V6GA 3HR4A 3IXQA 1OIXA 4Q48A 1ISIA 2OMKA 2G9VA 1ECLA 1NF9A 3I2YX 2QVCA 3TWOA 3ZPXA 4OI1A 1EFKA 5J43A 4Y1GA 5T3UA 4QGGA 4ZRNA 1P19A 3RSGA 1PI3A 3MF4A 2GKGA 2JJ2A 3L7JA 5DMXA 4DCUA 3MUNA 4DRXB 1K8XB 4PG5A 1T6XA 5JCOC 5LMNB 2DFTA 4OREX 1OBVA 3AUJB 5TY0A 5B3AA 3FDIA 1QO9A 4RC9A 1H3EA 3TNJA 2J87A 1HDYA 2AYZA 3B7PA 1XD2A 5C8YF 2B98A 3RS2A 4E6EA 3MQ4A 5DF1A 3VPHA 4ZCRA 1I0ZA 2YHSA 3L2OB 2WYVA 3DMNA 3E58A 3ND6A 2YL2A 1O7JA 1WDMA 3NPMA 5FL7D 5C8ZA 2XHEA 1ES9A 2F8SA 1RYMA 1X7YA 2KBEA 3ER8A 4AZ3B 3H11A 1K9SA 3L8CA 1T35A 3U3KA 2N9UA 2CHUA 4GKJB 5IAKA 5EXSA 1IDN1 2HJWA 4Q7JB 3ENQA 3SFZA 5LU8A 1O6CA 1E9CA 1T43A 2WUWE 1Q2XA 1TF2A 2ZRBA 3A14A 2GAAA 4I55F 4OGLA 2CLEB 5NLLA 4DB4A 3UXHA 1DCKA 1NSYA 1Y33E 2HT6A 1M1YB 2C3YA 2NSHA 2V59A 2R1ZA 3CM0A 3D54D 1E5QA 2IEDA 4RH0A 2HNBA 3E18A 1LVUA 3HNOA 4MWTA 4MVWA 1AN9A 4OBEA 5DLDA 2JARA 2V7PA 4R6XA 5AKLA 2ZT5A 2NYAA 3NBFA 2LWIA 3CPEA 4TS1A 5L3ZA 4BNKA 5LZ2A 4RTSA 1ZEJA 4LAFA 3AUXA 1G8HA 2DGDA 1TD9A 1U0JA 2YX1A 1COZA 3EYAA 3K1TA 3OZFA 1EBUA 2EW1A 3E70C 4NJOA 1A71A 3LG2A 4DE5A 1A50B 1E1YA 1WB5A 1JU3A 3QPUA 4YRIA 3PKZA 2X3YA 1B0PA 1OFUA 2LE0A 2YJ6A 4L15A 3ZXXA 3AESB 5KYWA 1WU7A 2G71A 3NTVA 1LXCA 2A33A 1DC5A 2G67A 2R751 1QYCA 2A88A 4L3VA 4J7CA 4OQZA 3ZV5A 3JQ7A 4D0LB 3FYUB 3FYTA 4RTLA 1ECFA 1ZK2A 4OX9Y 4AULA 5C5EA 3HFJA 2QP9X 5AW7A 1Z37A 1L5HB 2VNAA 4WLNA 1K0FA 4RY8A 1WXHA 5CG2A 3H75A 4MR9B 3C8UA 4US2R 4CMIB 1PR6A 1QG2A 3HCWA 4HX2A 4B48A 5HOEA 3OFVA 5EVJA 4BRUA 4CFZA 4YLYA 5FPSA 1W1IA 4TRRA 5JAUA 5AUOB 3HJFA 2GRJA 2O3JA 1E62A 4X1IA 3H9CA 1QQ6A 2C7QA 4UHHA 1OY1A 4KXLA 2ZYVX 4YCSA 2WHEA 5I7FA 3BHNA 3CZCA 4LJ6A 2R4QA 2NSYA 3RUAA 5D85A 4IBOA 4X97A 3RUCA 3W77A 1KHTA 2PO7A 2I4RA 1WL8A 4X1KA 3DNFA 5I6DA 5D7BA 4H31A 1V5GA 3P2MA 3RIXA 5JD6A 4PYJA 3D5EA 4CVNA 3A4YA 4GYYA 2FN7A 3EGWA 4U7GA 5KB3A 4BQPA 4JXZA 2I33A 4YP9A 1YZQA 4GZ5A 5KVQA 2BHRA 4LS3A 5EUQB 1ZJJA 3SIWA 1XU4A 3KVNA 1AGNA 4L0MA 2CD9A 1CG6A 2ODPA 3CH7A 4BDSA 4TYNA 1DXHA 2FQXA 2BDEA 2FSHA 3RUEA 4B8WA 4MS4A 5AJVB 4GOXA 4IIVA 1WO8A 2GUWA 2GK7A 3EG5A 3VV2A 3ZBQA 2IYQA 4JUFA 3D8RA 1ZL2A 3RFUA 1USVA 4N0MA 2DHDA 1QONA 2PX8A 4LOKA 2XMCA 3UMSA 3EULA 3I4LA 2XDQA 1F17A 3V8EA 2R1TB 2JKVA 4BLQA 1NDHA 2X8JB 1PT7A 3DNMA 5TNXA 2XNDD 4O4LB 4ZV7A 3HKBB 5KBYA 3UXEA 2A5GA 1PJLA 1F38A 1TO1E 1HYQA 2QI9C 3LNCA 2C2XA 4D2IA 4DYVA 4F1WA 5FPPA 2HF7A 1FDVA 2Z83A 1U0GA 1QH8A 5BSKA 3ZE2B 4B3FX 4IGAA 4E03A 2ZRPA 1YZUA 3IP5A 1YZYA 4LGVA 1X1BA 1IM2A 5BVHB 4AY6A 3FLMA 1T1EA 2YWFA 1SC1A 2V6FA 7ADHA 3Q88A 3BKXA 3MEQA 2Y8EA 1A9YA 2YV3A 1KMIY 1SU7A 4G1EB 3PXXA 1PJ4A 2YN4A 3KJFA 1YJQA 3O83A 3OEWA 5J4VA 4EB3A 2G9QA 3OFKA 2NQ2C 5L6MB 1BH2A 3FUXA 4JKOA 2FLKA 3ORRA 1RWNA 4BNVA 1SEPA 2RJOA 3D6VA 1YSCA 4ALLA 5IXYA 1FJGB 1T4CA 2O2HA 1RYBA 5E7JA 2TMKA 3CB2A 1K7XB 1MO4A 1NBMA 2BMDA 2C2GA 2G9ZA 2OBMA 3PEEA 3QLEA 4Y1RB 3VSDA 3VV3A 5CFMA 1L4GA 3O2SB 1BU5A 1CJMA 3E9YA 4GBED 3DZIA 3P5SA 3KQQA 4P81A 2HTFA 2W2TA 2H1VA 4Q4DA 4RHXA 1YT5A 2CXRA 2PRKA 3LTEA 1EWTA 1NP6A 2Z08A 3NWOA 2HXYA 4X9XA 4F4FA 2R97A 1H0HA 2WJ3A 4JQCA 2A67A 2VSQA 1L4NA 4RVFA 2H1CA 4MULA 4YJ2B 2BEKA 2X9GA 4AJHA 5CFPA 4YAKA 2DKNA 4CM8B 3I04M 4BMZA 5KWJA 3V33A 1RD4A 3DMDA 4B6EA 1EJ6A 3GI1A 3KZ1E 3OJFA 5BQOA 1U0LA 3VUFA 3H9GA 5ETJA 4MIYA 1BDMA 2Z5FA 4BJ6A 2CHVA 1E2BA 3MHPA 2AV6A 3VPCA 2Q2VA 5AVKA 3IP7A 4UFNA 1IB6A 2CZCA 2ZVPX 2GXAA 2PTHA 1KVSA 5CDFE 2C0PA 2XECA 2ZIZA 4JLKA 1EBFA 5CT9A 4CLOA 2VJDA 3DEZA 1Q0UA 1DAFA 1CZHA 4Q01A 2EFCB 4FHCA 5B6PA 1VDMA 3NU1A 1D09A 3VAYA 4ZCLA 4RDHA 4KNYA 4OX9B 2WF6A 2RH9B 4MMZB 4B7XA 4PG6A 3H19A 1Y98A 1SZJG 1PKEA 4FPXA 1JAIA 3OZGA 1VCMA 1JE1A 1DO8A 1OXKB 3C6MA 3JYNA 3MRTA 3ZWYA 1A97A 1L7VC 1JH9A 3DEIA 2ZSJA 3VR6A 2NXJA 5CB8A 5JNUA 1OF1A 3UKOA 4DJAA 1F60A 2YQ4A 4PSCA 3MLAA 1XAGA 1MOSA 1Y1KE 2J5BA 2AI1A 1MJ5A 2W83A 2R4UA 2ZT6A 2NTVA 3GUUA 1QZUA 1AA9A 4FFBA 1JIUA 1ORHA 3FF1A 2D2VA 2HU8A 3TCXB 1ACJA 1NR1A 4L75A 2CNNA 3FWKA 1YMUA 3OZ7A 1TCCA 3IA2A 4TZ0A 1KK3A 1BFKA 2DE0X 2XDYA 4R3UC 4ZVQA 5CAEB 1X3SA 4B8YA 4CKEA 3I42A 1G21E 3VSEA 4TM8A 4RA9B 4JVNA 4E94A 1PQWA 4KV9A 2B78A 3BDVA 1T2NA 2J9XB 3MILA 1NNI1 2QXUA 1NZFA 1J97A 3DWEX 1M6WA 3WJ2A 3ETJA 3PJEA 3SR4A 1FNCA 2YINC 4YRCA 2VXBA 4HS4A 3UM9A 4AZ0A 1L7MA 2FEKA 1U5CA 2VHYA 1QS0B 2QJRA 4OI4A 4OK6A 4N47A 3T0FA 2ZSDA 3THXA 1PNQA 5GONB 4C6TB 1NIPA 2HJRA 2AXEA 4N1AA 1JAHA 3E61A 1MO5A 2CHGA 4NQZA 4XJTA 5CR9A 3H87A 1GPWB 4WXYB 1I7PA 3K20A 2AA3A 2JFHA 1E8DA 3AUFA 1N7JA 3BSFA 3GCZA 2JS7A 3Q41A 2R8XA 2B3TA 4O4HA 2QQ5A 3DCJA 4LV5B 2VUIB 4KPYA 3LSTA 3JARA 4Y2SA 1J9ZA 1BEEA 3PJGA 3DHYA 2ZETA 1XZKA 2FVXA 2EX4A 5AICA 4M1ZA 3VZSA 3T9AA 2RBKA 3VAZA 1E1KA 5JBQA 2O8CB 2IHYA 4LE0A 2QJTA 3DA8A 2MYPA 3W79A 2BUAA 4IG9A 1GA4A 2QG6A 3W3AD 4ALIA 1OD6A 2FEMA 3PLAE 5FOTA 3R7DA 3VDNB 4F7DA 2Q50A 1MX5A 2B8EA 2CFSA 2FPIA 3USCS 2ZB3A 4ME6A 3LDHA 5FCDA 1HOTA 1OIVA 1UBGA 5G02A 2WINI 1LRJA 3I2GA 4IMJB 2W58A 4I81A 3FLAA 5DI9A 4GC9A 3E7WA 2ZSEA 2EERA 2B4RO 3T9CA 1AKRA 5JO9A 4KJZA 1GSAA 4RXUA 4OMDA 4OB8A 4Z0TA 3LK6A 4D79A 1GZSA 1JR3A 1LLCA 1N57A 1PG0A 2C9OA 3A3NA 3PGXA 3JZFA 3O92A 4WXMA 4AQ7A 1K7SN 1J21A 4M9ZA 1HX7A 1YR1A 2GDZA 4AJ4A 3EUEA 1P1JA 2W48A 2NVOA 3VDQA 4M36A 3L8HA 3WRVA 4BV8A 2JFXA 4EKEA 3HN7A 3KZNA 1A76A 1WXQA 4FZ5A 2H7CA 4Y6QA 3P27A 2GNAA 1H3NA 3N3BC 4PW0A 4BNJA 4JJEA 2JFOA 221PA 4I9HA 4QU8A 2ZBPA 2GN0A 3VSCA 2DTDA 3NC1C 1EP1B 3LK7A 2PGJA 2C8KA 3WK4A 1WEKA 4D44A 4RMGA 4AQYB 3QEBZ 1SVUA 1T2EA 1HXHA 1H2BA 2FN8A 1H8ED 4GXTA 1VQ1A 2VH2A 1Y4SA 3M5DA 4OGFA 5DCYA 4E30A 4Q12A 2PGOA 3EZNA 3UA3A 1HNZB 3O9MA 2X76A 2ZJ2A 5LZ4A 2DHEA 2JGRA 3KSUA 1BKYA 3F71A 4EYGA 4CIBA 1U7XA 3NC4A 1JEEA 3GJ7A 4LOJA 5LDDC 1DRJA 1NLMA 1RE0A 1TEXA 2J7PA 5HIMA 3V2IA 4BX2A 4YEDA 5EKDA 3P2KA 3KX2A 3MT9A 4N6OA 2NU7A 1LQUA 1IBMB 2Y93A 1E60A 3BH6A 3H3JA 1QG4A 4DIFA 4JSTA 4HDKA 3U4CA 2A5YB 3DBHB 2V7XA 1XWIA 2M6KA 1I1OA 4HWSA 3CH4B 2QPTA 3VHRA 1XAJA 3QELB 3DUFB 2DWOA 2BLNA 1E96A 4KDFA 1ZA2A 2FMFA 1W36C 3V97A 2ZR8A 2EBFX 1BU8A 3G2KA 3DBLB 4NU0A 1DEOA 3PC8A 1SUEA 2O0HA 1P8AA 2SKDA 4XSVA 2BMJA 3TQOA 2NTEA 2I7VA 4R1TA 4IIHA 4AS2A 4CM4A 4E12A 1GM5A 3UK0A 5JEDA 2JEZA 3JYQA 4GKBA 1Z47A 1APBA 4F45A 3FNEA 4OUDB 1TYCA 4C2AA 4YMLA 1X77A 2H4ZA 3K3PA 3MMZA 1D8AA 4LMAA 2E4AA 3SFVA 3MCTA 3QU2A 3IDZA 3UHOA 1G291 1JJAA 4XPIA 4Q9HA 4C4ZA 3GJ8A 2XSZA 3BOSA 4MHSA 2B1RA 1DGQA 4RORA 4O2BA 2IYZA 3ROEA 3OCVA 2WSMA 2PNJA 1TE2A 3G0DA 4KACA 3F6PA 3N8NA 1VHJA 4WUVA 4U7JA 2QZ4A 1RSZA 2VTVA 2ZRCA 2WIJA 1EFCA 3TQQA 3OC0A 4TQAA 1DQYA 1HUQA 2JPDA 1X9GA 3MWLA 1JEYB 4HV4A 3HO1A 1H2ZA 1IRXA 2YR0A 2RARA 1C4XA 4QXOA 3UAVA 5ICCA 3RAPR 3S5JA 1M6HA 2ZUBA 4P3OA 2MYUA 3D4NA 1M5RA 2R1VB 3L7YA 5EJ7A 1LDNA 4JLSA 5CM2Z 5DHSA 4EENA 1SULA 2CNDA 4IXNA 3OLQA 4LHSA 2CMHA 3T1HB 5EE3A 3HPQA 1M8JA 2H5JA 2OFPA 2BCEA 4FZ3A 1QZZA 1UMCA 1XBTA 5EEHA 5BR8B 4NY1A 3W0LB 4FZVA 4DR6B 1MBZA 3OFND 3EYWA 1J70A 2ODTX 2W6JD 3NEPX 4JBNA 4CCAA 1ZZGA 3GZ4A 1ZJ4A 3H7AA 1Z0ZA 1K2WA 1KQ3A 2HCBA 3EIWA 3GOHA 4B9EA 1V25A 4V0OA 1XVIA 4IDEA 2YYAA 4QU5A 1GTRA 1PK9A 2R6FA 3T3IA 3SD7A 1BD3A 5A6SA 3E5HA 3Q6NA 4URUR 5IAJA 2KWIA 3CRZA 1ZSYA 4IOKA 3LQFA 1HZJA 1ABFA 3EN0A 1AV6A 5COQA 1ESMA 4JZKA 4UPDA 4F9EA 1XZHA 3EHEA 4N3NA 5LKRA 2I55A 5FUWA 2AF4C 1KFBB 1O54A 4PLTA 4LPKA 1EM6A 4M0MA 4MUXA 4PRYA 1GQFA 1E2GA 4RKWA 1EH5A 2FXIA 3D6JA 3H42B 1A5TA 1I10A 2EGUA 4QOFA 4C05A 1DQRA 3D2AA 4QIHA 1V1MB 3G7NA 3WLNA 4D3DA 4KREA 2QZSA 3OEHA 2J3DA 2RH8A 1RC1A 1G42A 2X1HA 3ACDA 1I94B 1VBNA 1SA0A 2O8EA 1KJWA 1X1QA 2C61A 4AYTA 2V7VA 1RCUA 4NCBA 3L02A 5CT8A 4FYWA 1ZVQA 1XCPA 1K5HA 4WCFB 3PXGA 5ADHA 4QDKA 3QKSB 2H07A 3QY0A 4P8RA 5E0OA 1E4VA 3PC8C 2FK8A 4MH0R 1BC5A 1DBWA 1MOZA 2J9FB 2VHZA 5M34A 2YXPX 3O82A 5FORA 4PZDA 3O4FA 3T9DA 1IN1A 2BFBB 1GJRA 3SZMA 2H11A 2G76A 2IE8A 4H1UA 3FJYA 3SYMA 2ZFUA 2IDZA 4RVOA 2JVKA 1W76A 3GXBA 3S29A 1GQSA 1SXIA 2ATCA 2OKGA 3NAZA 5HFJA 5IXJA 4G65A 2Y05A 3AGPA 1SBNE 4DLYA 3CLSC 2HMYB 4L6IA 3GARA 3AL2A 2C1EA 4CIYA 4D9FA 1B15A 1X80B 3L8MA 5JDIA 3FN4A 3W2FA 2OHOA 2ZAMA 2X9NA 3GZTB 3WQSB 3G9XA 3BIOA 4EJ6A 3N1UA 1KSGA 2I6SA 1YL6A 4PLFA 3TIIA 4BHTA 2KLHA 4R31A 2Y1GA 4TLBA 1EGHA 1R2QA 3JQEA 3QOFA 1XU9A 4R84A 4QYMA 5AW0A 4EB6A 1B1AA 3U3XA 5LFAA 2JFBA 4KK4A 7REQA 1E64A 2WIKA 2O7SA 2JNWA 4L5CA 1I2AA 1SVNA 4I8IA 4KBGA 3VR0A 5KTYA 3YASA 1OA1A 4DUYB 3KZKA 5CLIA 2IDMA 4RVDA 2OUKA 2BYTA 2CE7A 2Q5HA 1KYTA 2ZBDA 5ED4A 2I99A 3S28A 1SO8A 1ZCAA 4WADA 3GROA 6NULA 3EEOA 4FX5A 1H1LB 2XODA 2VXCA 3KAJA 3MBOA 3OPQA 3EA5A 3OCYA 4LGMA 3ELDA 4PC6A 5KWVA 1C7JA 3B6EA 1E1QD 4YQZA 3Q7QA 4EHIA 1RLTA 4RTJA 4HH1A 4I46A 4CM6A 1NN5A 2GN4A 3I1YA 2YWDA 2A4KA 2IVZA 3VJMA 4NMHA 1RM5A 1R88A 3UEOA 4WN9A 2HV8A 8MHTA 4OQDA 2QZ9A 1BIFA 3B3AA 4B3XA 2QQEA 3QWHA 1LI7A 1SHZA 3KM0A 3AM5A 1LKZA 1PZGA 2LCQA 1PWYE 4I4CA 1GAXA 5F4ZA 3EMDA 5BR7A 2P2SA 1AHPA 2E18A 2HAEA 4RPJA 1IY0A 1GARA 4AC9A 2GCIA 4U6QA 1QFYA 4MHTA 2DPMA 2ZT7A 1Q7RA 2FWMX 2AI3A 3EARA 3KPVA 4UDYX 2XB2A 1M2FA 4F6RA 4IQ4A 1VB5A 3S2SA 2DVMA 4XGNA 1TADA 2G0AA 3D3WA 5BUQA 1IEVA 3HB0A 4Z9AA 1P6QA 5DNVA 4I1PA 3RH0A 2WLSA 4EH1A 4CEJA 1NV9A 4RK4A 5D5HA 5HKAA 5F2EA 4J0GA 1JXQA 3ZKAA 4HGOA 1IY2A 2I87A 5TRTA 4NRDA 5KJ1A 1US8B 1TX4B 2YWXA 5KNBD 2VRWA 1DIBA 1U8TA 2ZOSA 1QK3A 4Q9LA 2P6PA 4MYCA 3L1HA 3LIIA 2ZIVB 4JC0A 1NNUA 4LDQA 4X84A 5E3HA 4YRNA 1E1CB 3BFPA 4LNUB 2EJBA 4CTMA 4TTQA 1T2FA 3I1IA 4FE4A 4R05A 3VC3A 1L4EA 3L0CA 4P4UA 4DXDA 1IZZA 1HRKA 4FQ7A 4MPDA 1AE1A 1I8TA 1V7QA 2AFVA 3EAQA 1PZFA 1LTHR 3DDHA 4PU0A 2X0IA 3VYSB 4AW9A 2PYIA 4IY1A 4CJXA 5KSZA 1ORTA 1TK9A 1W4ZA 3IAS6 3AUYA 4N0PA 1LBIA 4JBWA 4RW0A 3IJ5A 3TPFA 1AQNA 3I5XA 1U9CA 1VJCA 1Z2CA 3KJNA 4MXDA 4HXGA 5JDIC 1O6FA 2P40A 5CDYA 1JECA 5L6LB 5IH7A 4WCDA 1P3DA 1T0PA 3FIJA 4RMIA 3BXZA 4JLJA 2Y0EA 5HFAA 2IHNA 1KJYA 2PBLA 4L8LA 2NSJA 1RQ7A 4YONB 3PC2A 4NI5A 1KJ8A 1KMQA 3H1BA 2UVPA 5DULA 3RAJA 3E22B 1G19A 2WE8A 1JSCA 1QRTA 4IS2A 3T3DA 2C5GA 1SXJB 1B6SA 3I6MA 3C3PA 3QPBA 3Q8WA 1HE2A 1M34A 4JA0A 2R65A 4KFRA 4Q1VA 2AEFA 3K6SA 2WT9A 1SBHA 3ES9A 4FR2A 4MI9A 1FDTA 2VDWB 5HW0A 1CRZA 1E69A 2QTLA 1PTKA 2Y1WA 1P1HA 1C3JA 5FXMA 4YY3B 2BSQA 3G9ZA 4N3BA 3T3OA 3H1AA 4OIFA 4K6CA 3AVVA 2GI4A 3F6CA 4KZPA 4ZGWA 3TFQA 1V43A 3GXOA 3MTBA 4L9WA 1SEVA 1NN0A 2Q6KA 1SWVA 3KTAA 5ALDA 3JSAA 3ECAA 4N7RA 5J5AA 1EM8B 3NHKA 4LC1A 5B1SA 5BWCA 2QTHA 3GVXA 3OHMA 5B6JA 1PS0A 4JCOA 4AAYA 2Z6QA 4P4GA 4PX5A 2PKWA 4RM2A 3T7TA 3HZRA 5T41A 2BM8A 4H4EA 3A1CA 1C0EA 1YQGA 1LDYA 4ZOQI 2WAAA 2ATEA 3JQPA 3QVVA 3RC2A 4Y18A 3IKJA 1T4BA 1K6JA 1LPAB 1PSZA 2FDRA 2J33A 1CJTC 2C7RA 1GSHA 4WFKA 1WEHA 3LXRA 4X1YA 2UKDA 5EJ2A 2XXAB 2G88A 1ZJ6A 2GN2A 3SVLA 1G8FA 1VXRA 3PDJA 4RA6B 1CB0A 2W6OA 4PQRA 5AJTA 4ZT6A 4QTTB 2JANA 3FPGA 2NUAB 3IR7A 3ZDEA 1UZUA 3NFRA 4GLBA 3CY6A 3FYSA 4WN3A 3EB9A 1DWQA 1XPJA 2OGZA 3KYIB 5DK6A 4RANA 3WL4A 3U26A 5JC1A 1I3CA 3J80A 2XWPA 4MUAA 1KXZA 1FLAA 1GNQA 1JG4A 3M6WA 3WYBA 3C7DB 4YXFA 5BW5A 3UB3A 1ZIXA 4L4ZA 3JWGA 1GCGA 1W5TA 4LJ7A 4UE6A 2Q8NA 3EZGA 5D3KA 2ZANA 4D26A 2Q9UA 4RACA 2E37A 4QGHA 1FDIA 2ZRGA 3PTZA 5L53A 2C9ZA 2OCGA 2PUDA 5EP1A 1DUVG 1RPZA 4JBXA 4EKIA 2I9KA 1MAVA 4Z2AA 3JD0A 1HQCA 1R6VA 2M2IA 3B5IA 3FTPA 3S55A 3TCNA 3VKUA 3W9UA 4MQFA 1CUWA 3AUKA 5TT1A 3LFUA 4YR9A 5J1SB 4X8LA 4CM9A 3E4CA 2VDVE 4I1OA 3S7ZA 1Q3TA 1VHLA 3NT5A 3O8QA 1ID1A 4F0JA 5JZVA 5LWQA 4M6WA 1LX6A 5L3QB 3V80A 5EQFA 3GT7A 3W90A 4JOCA 4GEGA 1YQXA 3L8DA 5DRYA 5IBPA 1WUTA 2B4TO 3S8MA 2JAUA 3E2MA 2CDAA 2XGMA 5LCXA 3FKSA 3Q9NA 1K8ZB 3DL4A 4PCVA 4UU1A 2FCRA 2B0CA 2OGUA 5AM5A 1S02A 2GT1A 1FU4A 1K06A 3VR2A 1JW9B 1AUXA 1P75A 2W6CX 3KFLA 1M8PA 4FMDB 2OLJA 4G1MB 1F7VA 1ZMOA 3P5BA 4DQ0A 3D6UA 4TRJA 1EX9A 5JS2A 4BKOA 4ZZ3A 1A69A 1N0HA 1XZMA 2Q8QA 1GEEA 1RC0A 3EF0A 2JAOA 3K1YA 1POXA 3OPVA 4ENPA 4QDJA 5JS8A 4RY9A 4S1WA 4YCDA 1F0YA 1BS1A 1QU3A 4CF7A 2CXQA 1SOVA 1Q74A 2YZ2A 4FLFA 1LPPA 2E6UX 3SLRA 4OY3A 3RG2A 4FWIB 1W36B 3PGA1 2QLJA 3PQ3A 3QHPA 2LGJA 3RJ5A 2I2FA 4KO1S 1KEVA 4RDCA 3WIBA 1MJGA 5T3YA 2E2WA 4LZWA 5JYDA 2BR5A 3R24A 2IS1A 4HXYA 4PONA 4V02A 1QK4A 3WGLA 1TK2A 2PH3A 2XJ4A 4HWKA 3QP9A 2E85A 3N8IA 5A02A 5F4BA 1KBQA 3PL1A 3U19A 1ZQ1A 4C7MA 3RSSA 2X14A 4TMXA 1FLDA 3PDUA 1OHHA 1PBNA 2J0UA 3HCBA 2H7YA 4YLEA 5ES4B 4P83A 1S8OA 3EXEA 3LL7A 5K6RA 2WI8A 4FR0A 1E2JA 4LHZA 4BN0A 1GWNA 4V3CA 3CMCO 4Q05A 2FZ5A 2O2EA 2OT3B 1TTTA 3RU3A 3MRXA 1CY2A 1J39A 1QIFA 4RZ2A 5KYUB 2H51A 4UTNA 4LXIA 1Q1QA 3P9XA 3PUJA 2C2YA 2BFCB 1Z0KA 2IITA 4IVNA 2CGEA 5H9VA 4QKQA 3MJEA 1V16A 1Z4KA 2DMRA 3R5FA 4OV6B 4QPNA 4E07A 5IFKA 1DKRA 3A6GA 2F1HA 2F1KA 5KKCA 2ANBA 3JS5A 3DTTA 3OICA 5B2ZA 5COBA 4BDTA 1W25A 4KXYA 5FDFA 5H9WA 3IEMA 4IJQA 1XRSB 4BCBA 2H63A 4QUDA 4F72A 2V1XA 3LDGA 5ARCA 5CLQA 2DT8A 2O05A 3IJPA 4Q47A 2SBTA 4GX2A 1UBRS 4Z99A 5AVWA 4ISBA 4WVLA 6LDHA 2AEJA 4HGNA 1FDSA 4B6OA 5JAOA 3A4LA 1RCFA 2B94A 1GUZA 3NPAA 3DM5A 4YMWA 3TMAA 3N0RA 5KVAA 4CQNA 4ZVPA 4IJKA 3NASA 4G8JA 2JJ1D 3FZGA 2VP6A 3KO8A 4WY8A 3TJMA 4H08A 2GCEA 4HQOA 4V0NA 5K05A 4YDHB 1EVKA 1TQ8A 1X1EA 3ZK7A 1HH4A 4YB8A 1J9GA 5LPNA 1QGDA 5L4NA 2J31A 5I48A 4WNIA 4PPFA 4YGXB 5ENDA 3AERA 9ATCA 1UXIA 2BFWA 1QYDA 2XZTA 4G0WA 4LRSB 4S1NA 1KZ4A 2VS1A 1BA2A 3NBZC 2C95A 3I8XA 4H7JA 1CW2B 3WZ2A 4F2GA 1HDXA 1P6XA 3EHDA 3PE4A 2VPTA 2FPXA 1IE3A 2VEDA 3HP4A 1QX3A 3Q2IA 3GA0A 2C92A 2H48A 3D7RA <