1EZ4A

Crystal structure of non-allosteric l-lactate dehydrogenase from lactobacillus pentosus at 2.3 angstrom resolution
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
317
structure length
307
Chain Sequence
SMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGALVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKERVIGSGTSLDSSRLRVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGVSDDDLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAIIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LACTATE DEHYDROGENASE
publication title Crystal structure of non-allosteric L-lactate dehydrogenase from Lactobacillus pentosus at 2.3 A resolution: specific interactions at subunit interfaces.
pubmed doi rcsb
source organism Lactobacillus pentosus
molecule tags Oxidoreductase
total genus 110
structure length 307
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2000-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ez4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ez4A02
1U1IA 3LYLA 1LDYA 4IGFA 4ZA2A 4MKRA 2VTEA 4JK3A 1LLCA 1DFIA 1M75A 3SEFA 4DYDA 3TZKA 2O3TA 1BWSA 3O03A 4EI2A 3OHSX 4I9NA 3TDKA 2P9CA 1ISMA 3H5NA 2A94A 2CFCA 2HMUA 4GSLA 1NWHA 1QRRA 1KY4A 4BNXA 3H9JA 1OI7A 4OAQA 2X1HA 3DZFA 2Y1CA 3QA9A 3RFTA 3PXXA 1WWKA 4AICA 2A35A 5KJEA 1ULSA 4E2ZA 2GN6A 3D4OA 3PJGA 4Q3AA 1YH3A 2NVWA 4RF3A 4Q3CA 4RORA 3PLRA 2VYNA 4XYMA 4KDFA 3DR3A 2YHIA 1VJ0A 2ET6A 3PYXA 2RIRA 5EIOA 2ILTA 5K9ZA 4CV0A 1IYZA 4IQ0A 3GDFA 4WPGA 1PS0A 1UXGA 2XPCA 3ZW8A 1PR3A 2J3KA 4DPKA 4BNVA 4ND1A 1J49A 2VNSA 1LX6A 1OMOA 2EP5A 3EYWA 4FN4A 2NTVA 3E82A 5EJ2A 1IB6A 3ZHXA 3EC7A 4IPTA 5IN4A 2W8ZA 1KETA 4E2YA 2GDZA 4IUYA 2PZMA 1A9ZA 3DTYA 5CG1A 3IDSA 4UEOA 2I65A 4BNWA 3DDNA 4UUNA 4GLOA 1E7MA 1WDKA 2ZYDA 4NIMA 2QX7A 4Y6SA 4YPOA 4J7XA 1UDBA 3WYBA 1H2BA 1H94A 4N5LA 5IZCA 1HSZA 1LU9A 3DBRA 2OZPA 1F0YA 4OO3A 4P38A 3GG9A 4Z9YA 3K8ZA 9LDTA 3I9OA 1XLTA 1PGOA 3HQ4O 3ZU5A 3AUUA 3H8VA 4HNGA 4ZU3A 4DREA 1Z7EA 4FFMA 4J1TA 4GX5A 1I3KA 3NKLA 4E3ZA 1ISIA 4R68A 2Y1EA 3JQFC 4MVJD 3LF2A 5TC4A 2BI7A 4Y6RA 3JD2A 8ADHA 1ENZA 3Q9UA 3NJ4A 4Q3DA 5DZSA 3LLSA 1K89A 3LF1A 3C1OA 5JO9A 4ALMA 4CLRB 4NHEA 4J0FA 3MZ0A 5EL0A 4IBOA 3PWKA 3BMCA 3JTMA 4B7XA 3RJ5A 4G2NA 1KOLA 2DUWA 1CERA 1JAXA 2DTDA 2AQHA 1D1SA 3ENNA 4J4HA 3RC7A 4JN6B 4O6VA 1RPNA 4M1QA 4ITUA 2IODA 4A73A 5ENVA 3ZU4A 2AEMA 4IMPA 2YYYA 4Q39A 2Y93A 3RU7A 4I1IA 1UJMA 2HDHA 3JQ8B 1EUCA 1X7HA 3M1AA 3ZWBA 1ADCA 5L4LA 4WCDA 3ZV4A 4HUJA 1NFFA 1TEHA 5K0ZA 2W2LA 1R6DA 2J3HA 1Y8RA 3EVTA 4R5HA 4IIVA 4RF5A 2CZCA 5KKCA 3TZCA 1OC2A 2B4QA 1K5HA 4AJKA 1PSDA 1DO8A 3UKOA 4DMLA 1Y6JA 2AQKA 1YB4A 3O4RA 4B3HA 4HV4A 1YL6A 1R4NA 3PVZA 2Q1TA 4D46A 4CLXA 1C3VA 1DC4A 3D3WB 4P8RA 4O0LA 1QP8A 4HFMA 4D43A 3KZVA 1C0IA 1HSOA 2BKAA 5L4SA 2BD0A 2O50A 1SOVA 2NVUA 2DPHA 4OOFA 2UDPA 1PGJA 5EINA 3C3XA 4UUPA 1KVSA 2CVOA 4JP2A 1WVGA 4U6SA 5BSFA 2C2YA 3DBVO 5BT9A 4R51A 1N1GA 3JD4A 3ANMA 1IPEA 1QMGA 3LLVA 4XB2A 1Q0QA 1P9LA 2Q4EA 3DZIA 4MKZA 1T1SA 5DNAA 1VL8A 2B37A 4CQMD 3RAJA 1ADBA 3KOUA 4N5NA 1C0KA 3R3SA 1HYEA 4P4NA 1B8VA 3ROQA 1PZHA 1K2WA 1P0CA 3P5SA 1ZMOA 3CKYA 4KWIA 1C0PA 4JP3A 2I99A 2WD7B 3PI7A 3DBLB 3RC1A 1CF2O 2XXBA 1GUYA 4XR4A 4XYLA 1W8DA 5T6BA 3NV9A 1WZEA 3STHA 5COQA 1T4BA 1SOWA 1KERA 1NQOA 4Q3BA 3C7DB 1KEPA 3ICPA 1UDCA 3W4JA 1E3LA 1DLJA 4CLEA 4ND5A 1ARZA 1GZ3A 1MUUA 1P1IA 3T7CA 5I9LA 1N7GA 2GN8A 4J9UE 3CMMA 3GMSA 4J6FA 1VRWA 1F8GA 1NQTA 1E3SA 1V8BA 2XF8A 3I4CA 4WE3A 5L7WA 5BNFA 4EEXA 1R16A 2CD9A 4IS3A 1HETA 4QXMA 5JBIA 3WX0A 1PJ3A 2IEDA 4N54A 4YWJA 1ZIDA 3LU1A 4DPMA 4J1NA 5C3MA 5DT9A 5A9RA 1H93A 1KVRA 3K30A 4QTZA 1DPGA 1QYDA 1HDCA 2O3UA 3V8BA 1PS9A 4YA6A 2HQ1A 3MJTA 4RPGA 4Z0HO 2DBQA 3WQSB 1E1MA 5A06A 3JYQA 3I9KA 1YQDA 4ALJA 1I3LA 3TF5A 4OSPA 1LC0A 4GX1A 4E31A 3ON5A 1JVBA 1LRKA 1YOVB 3UVEA 4WCFA 1ADGA 4AFNA 1EK5A 5JW6A 4K1LA 3GDOA 4AJNA 7ADHA 2VZ9A 2D2IA 1NAHA 3BTOA 3NDRA 4ZD6A 3VPGA 2P5UA 1ZK3A 2RH8A 4CR6A 4I08A 3L4SO 3BZUA 3EZLA 3KYBA 1TA4A 4Y6PA 2GR9A 3OIGA 3ZHBA 1NQ5A 4QFCA 4WNIA 4BNTA 4D3SA 4G65A 4RPLA 3VC7A 3ONDA 4RLHA 1DBVO 3VZPA 3D4PA 5IDQA 4YRAA 3IS3A 3RUEA 5JYDA 3RFVA 1W0CA 4PLCA 3ANNA 1BXZA 1NP3A 2ZB8A 4GBJA 3RCBA 4Z6KA 1LLQA 3DXFA 3KLMX 3GNSA 2X86A 3PFWO 2FR1A 4D45A 1I5RA 4XRRA 1E6UA 2RAFA 3G17A 4CL8A 3DZHA 3IC5A 5L4NA 4QFDA 4B4VA 4DQUA 4CMEA 2D3TA 3WMXA 2W2KA 3PGJA 2Y05A 1OAAA 3WGIA 4BKPA 1N92A 4R4JA 4S3MA 2I67A 5DOZA 4TROA 1GFSA 5IAAA 3TQHA 3JQGB 5DF1A 3DAPA 4NBVA 3U3XA 1ZZEA 1XSEA 3D7LA 4YJGB 4JCOA 1X0VA 3JQ9A 4K9DA 5EESA 3OBBA 2I9PA 2X5OA 3GY0A 3S2EA 1DHTA 4CUJA 1DB3A 3DOCA 5BR7A 4Q3EA 3CXRA 4BB6A 2OBYA 1Y5MA 2NWQA 5JCXA 3KYCB 5FI5A 3QHAA 2D1YA 1EQ2A 3KYDA 3RJ9A 1DSSG 1M67A 5I7VA 4IJKA 3DB2A 3AFMA 5B4UA 3FR8A 3TL2A 1CEQA 2X5JO 2HRZA 5C5IA 3E6AA 2OBNA 1UXHA 1X7GA 5T8KA 2C82A 1DXYA 1G1AA 2UAGA 4MKXA 5KVCA 1DC5A 3PHGA 4HXYA 4BNYA 1A27A 1ENPA 3GFBA 1YB1A 3OP4A 4Z9XA 1UUFA 2Q50A 1P3DA 3AM3A 3QLJA 3BMNB 1KIFA 4P4GA 3ZWOA 4KUEA 4QSMA 4B7UA 4NFYA 4M8SA 4ONEA 3ZWXA 2DU8A 3UH1A 1P74A 4LCEA 3V5NA 3PQFA 4RJTA 5A4DA 1HLDA 1XIVA 4BNZA 1HYGA 3ABIA 1EE2A 1ISHA 3VTFA 1HDGO 5KTKA 5TNXA 2FMUA 3N7UA 2UYYA 3JSAA 4W7IA 2O7SA 3AOGA 1CWUA 2PZJA 1QKIA 5T57A 3OFSA 4FFRA 5CEJA 4NJOA 5L7YA 1VKOA 3VDQA 2VHVA 5GZ1A 3EGOA 4BB5A 4ZVVA 1ZK2A 5T67A 4LVUA 3D0OA 4LMPA 2EKPA 3ONEA 1R4MB 4BNHA 4QO8A 2GSDA 1PJSA 1J5PA 1Q2XA 2OGUA 3RUCA 1YXMA 4MDHA 3GPIA 3KB6A 2J3JA 4ZQFA 4NU5A 2VYND 1PZEA 3W4IA 3WGYA 5KJ1A 2O7QA 4FSHA 1LDEA 3QE3A 4J91A 2TMDA 3GAFA 1F8FA 3PQEA 1K6IA 4IDCA 2C7GA 1SCUA 3JQ6A 4CM8B 3EHEA 2X6TA 4FBGA 1IHYA 2XOXA 4CM5A 2OUIA 4N18A 4X54A 3R3JA 1SMKA 4ID9A 3NT2A 3I6QA 1U2DA 2J5QA 1QYWA 1ZSYA 3ADPA 3DEYX 1VLLA 4RF4A 1UZNA 5ITWA 1B8PA 1T2FA 5DOVA 1AHHA 3P2YA 4AVYA 5MGBA 1LLDA 4R9SA 4R69A 1DIBA 4ZQEA 4CODB 4ALNA 1WMAA 2Q1WA 3DZJA 3RKUA 1TT5B 2J8ZA 2Y0EA 4F6CA 1WZIA 3HADA 2EEZA 3GGOA 3AY7A 5TS3A 1H2HA 3NT4A 2NQ8A 4ZRMA 8LDHA 1U5CA 1YL5A 4MOWA 3ZI0A 3ST7A 5AXAA 3IUSA 3T7EA 4J43A 2VRCA 5JXWA 3G0OA 2ZQZA 3GGPA 1CIVA 3AUSA 1GEEA 3WB9A 1H5QA 3AI2A 2H1SA 3MJCA 2C20A 4H15A 3JQ8A 3Q2KA 4A5OA 1T24A 2VWGA 1K0UA 4CJXA 3FI9A 3RBVA 7MDHA 3TL3A 3GRKA 2P5YA 2CVZA 3SJUA 5C37A 4EJ6A 2YV2A 3BIOA 4R1NA 1TXGA 3WBFA 1PJ2A 3AI3A 3GAZA 1VC2A 3I1JA 4J90A 3V2GA 2A9FA 5U9CA 3F4LA 4WJZA 5TX7A 4LSWA 1OFGA 1R15A 3E03A 2HRBA 3ZNPA 1T2EA 1ZCJA 4I5DA 4NH4A 4AL4A 4ALKA 2C29D 4L76A 5HS6A 4CMAA 4INAA 1MB4A 2DFVA 3RIHA 4EJMA 2DBVO 3D3WA 3DO5A 5COBA 1NVMB 4XJTA 3H5AA 3JYNA 3RUHA 2W2LD 4WECA 2JFHA 1DFGA 4A0SA 1UAGA 4NJMB 3KO8A 4DIFA 4CLDA 2X22A 5JDCC 3B1FA 6LDHA 4EITA 3KEOA 3AM5A 2SCUA 2I6TA 4L4SA 5I9NA 5KNLA 1MA0A 4YXFA 3DFZA 2CSUA 2FN7A 4GQAA 2B69A 4ZQHA 3ROKA 4UVHA 1VKNA 1LJ8A 1UAYA 4WGGA 4MPDA 5JDIA 1DLIA 5BSEA 3CUKA 3K96A 4TRJA 4R1SA 2P9EA 3SXPA 1BDBA 1UZLA 3HB5X 3JQBC 4EJ0A 1J0XO 3LK7A 1V0JA 2R00C 4URFA 2WD7A 3TOZA 3DBLA 2I5PO 2JCXA 4E5MA 5F5LA 1HYHA 1PQUA 2TMGA 3OMLA 3WYCA 1BRMA 2PR2A 3PPIA 2G76A 3JD1A 3AOEC 1BG6A 1PEDA 1KVUA 3WLEA 3NJ8A 1U4SA 1JWAB 2POQX 2V6GA 1V35A 1SEPA 1Y8QB 2DTEA 4OM8A 4BMVA 1I24A 4B4OA 2QHXA 2WDZA 3IQDB 3PIIA 2GYYA 4TKMA 3PDJA 3TOXA 1O0SA 5LDGA 2E6UX 3S55A 4D3DA 2WWRA 1IULA 4CM3A 4R01A 4OQZA 1B0AA 1GR0A 1PTJA 1PWXA 3E9QA 1EFKA 2V7PA 2FZWA 3DAGA 3OF2A 3LDHA 2AQ8A 3IJPA 3QJ5A 2J5KA 4C7KA 4XGKA 4WLNA 3FF4A 1FDUA 2EHDA 4CM1A 3H6KA 4RVGA 3A06A 1XELA 2GN9A 1DJQA 4XGNA 5A02A 5IN5A 4QQRA 1I2ZA 1GL3A 4RVSA 3RBZA 2AG8A 3ULKA 4H16A 2O3QA 3QWHA 3I9JA 4W9NA 3LSYA 2FSSA 4A10A 4IDGA 2AHRA 2DKNA 2Q2WA 4PVDA 1AN9A 4FIZA 2BRUA 1YOVA 3ZWMA 3QWBA 4ND3A 4B3IA 3QWFA 3AW9A 4TVBA 4PLFA 4P4LA 2HK8A 4UULA 2BFOA 4FGSA 4JJIA 4CLHA 3QSGA 3WGOA 1P1HA 2FHSA 3CINA 3GNQA 4JBHA 1YS4A 4J9VA 4HFRA 3DBHB 1HDRA 4L74A 2IXAA 4GSKA 1LRLA 4PFJA 4TZTA 1A4IA 4RPKA 1VI2A 5FEUA 4WEOA 1PU2A 4RQTA 3A9WA 5IZ4A 4E12A 1QXSA 2DBZA 2ZTMA 1AE1A 3NX4A 2VUUA 5KVQA 3SLGA 3HSKA 3O38A 1LEHA 2HCTA 3AI1A 3BMOB 1SBYA 5U4QA 2HMTA 4YBZA 3MJ4A 5T64A 4B8ZA 1ULUA 2Q45A 1X15A 3VVCA 1M66A 1U3TA 1GEGA 1BW9B 2JL1A 3HFGA 2DQ4A 1G0NA 1YBVA 3ETDA 4D3FA 4MVJI 4LSMA 1MG5A 4D79A 2ZTUA 4Y9DA 2DTXA 1EE9A 2AE2A 2F00A 1HDXA 4YR9A 5CFZA 3PDUA 2NVBA 3VKUA 4ND2A 1B15A 2BFPA 4PCVA 4YJGA 4XIJA 1I32A 4D44A 1LSOA 3H9GA 2F1KA 1U4OA 3I9NA 3PHIA 2XXJA 3BAZA 4LRTB 2AMFA 4D42A 3P7MA 4AJPA 2VTDA 4JX8A 4PLPA 4XWYA 2NUAA 1PZFA 3QWIA 1O94A 1MC4A 1NVGA 2ZYAA 3KYCA 3OEYA 5CPFA 1EDOA 2V6FA 3HE3A 5DCYA 2VT2A 1JU9A 2CDAA 1S6YA 4NFSA 1NX6A 4NBWA 4YT5A 2PGLA 4BQRA 2X5KO 4KTTE 4L9RA 1A72A 3LT4A 4QEDA 2OO5A 4BKOA 1KEVA 2PGDA 4YJDA 3WIDA 3R6DA 5ER6A 3OH8A 1JVSA 4RGBA 3PWSA 3L6EA 1I10A 3C1AA 2D59A 3CPSA 4F3YA 2ZATA 2HMWA 3P19A 4R3NA 5THKA 5TT0A 3WNVA 2V6MA 4GPD1 3D5TA 4J4TA 2B35A 4RQUA 1H9AA 5A5FA 3BMNA 3SX2A 2Q49A 3OEWA 3IKTA 2EW2A 1FF9A 1ONNA 3C1TA 5EQFA 1Q7GA 4FW8A 1EDZA 2J6IA 3FBTA 4GMGA 4WUVA 2B83A 3GN1A 3H9EO 1YE3A 3BXXA 3QVOA 1MGOA 4BNFA 5G0TA 5JMWA 1PWZA 4AJIA 2B36A 5L40A 5AYVA 5A04A 1DC3A 5TJ9A 2I3AA 1EVIA 2PK3A 3V1UA 1V3VA 1PL7A 4J2OA 3H65A 3MTGA 4J7UA 1F12A 3JQFA 4GX0A 1NPDA 1BXGB 1M76A 1TLTA 4FJ1A 2OP1A 1K3TA 3X2EA 1YDWA 5HA5A 4LISA 1SEVA 4UEJA 4FC6A 3FTNA 1P44A 3VDRA 4A27A 5IDYA 4DMMA 4E32A 4F45A 1R4MA 3JQDA 3M1LA 4NMHA 4CV3A 1RKXA 2GD1O 1FMCA 1MG0A 4NFHA 5G2OA 5A5EA 1I2BA 5FFFA 4ALLA 2BMAA 5ADHA 1C1XB 4AJ1A 3A4VA 4BNJA 3RUAA 4FOSA 4M87A 2YQ4A 3TFOA 2VYVA 3WS7A 3JQCA 1EVJA 5FF9A 3RC2A 2PH5A 3NTRA 3LC7O 1NR1A 4YYZA 4Q3NA 3ZCXA 3JCZA 4CM8A 1P45A 1Z73A 4J0EA 1DRWA 1YO6A 1E7YA 1WP4A 3DAFA 3MOIA 3AUTA 3UN1A 1QV6A 4NBUA 3V1YA 1PL8A 1A7AA 1LQTA 3ZH2A 5H81A 4DL9A 3H9UA 2C07A 5IXSA 1WDMA 1EBUA 3VPHA 1GZ4A 3WSWA 5CP8A 1R0KA 2E49A 3GA0A 3S1LA 4CMIB 5L51A 3MWEB 2W4QA 3MJSA 4FS3A 5H83A 3VPSA 3K2EA 4PZEA 1W4ZA 3DTTA 4R5MA 1ZSVA 1TT5A 3WLFA 2WYUA 3TWOA 1V3UA 1YB5A 2X8LA 4BMNA 1Y9EA 3H3FA 4Z3DA 2VUSA 3A28A 4ZGWA 4R3WA 3TSCA 5L9AA 4JGBA 3UF0A 4HY3A 3JQ7B 4L4RA 4E5KA 4GVXA 1N7HA 3F6YA 3WG9A 1IPFA 3Q6IA 1VE9A 4XDYA 1BSVA 1UXJA 3DONA 2DFDA 2QG4A 2G0TA 4YRDA 2O48X 1J4AA 1FDSA 4U0JA 2GERA 4BO0A 2X23A 1I30A 2YUTA 3I4FA 4JIGA 2Y1FA 5A3VA 4O5OA 1ENOA 1T2AA 4LK3A 5JY1A 4LGVA 3TZQA 4CM7A 2O4CA 2WMDA 1PGPA 3WMWA 4MJLA 4AJJA 3PYLA 4JROA 2YJZA 3OM9A 5TF4A 1GQQA 1CDOA 3AFNA 2VRCD 3VAZA 3GLQA 2BH9A 2CF5A 4FQ8A 2C5AA 2YDXA 3E5RA 4YACA 1U8XX 3OJLA 3GFGA 1P0FA 3T4XA 5DP1A 4UEKA 4B79A 3GMDA 3BMQB 3C7AA 1C1DA 3FNFA 3G1UA 3KUXA 4OYRA 4OQYA 2I66A 1VL0A 3WR5A 2RHRA 4BQPA 1GTMA 3WICA 1SB9A 4NJMA 3UW3A 2O3RA 5KWEA 3MWDB 1NWCA 1E92A 1UXKA 2ZTLA 3ZWYA 4B4UA 5AVOA 3I52A 1HDYA 4LVCA 5THQA 5ICMA 3L9XA 3PHHA 4IDBA 3H7AA 2YZ7A 4GGOA 2VWPA 2C7VA 2ZIZA 2W90A 3ETGA 2JD0A 2GLXA 2DVMA 3GOHA 5JAMA 3W1VA 3UCEA 4A03A 4IMRA 3RUFA 3X2FA 2D5AA 2VT3A 3FNGA 1NQAO 4I9HA 3LT2A 4XQCA 5TIIA 3KTDA 4WCFC 2FZEA 3CEAA 3CH6A 2JAPA 3ETEA 3HFSA 2VHZA 5EMHA 2EV9A 4CV1A 4D7AA 2NSDA 2DC1A 1U2GA 2Z1NA 3A1NA 4NG5A 4XA8A 4BMSA 3RU9A 2ZKLA 2IRWA 2NU7A 5B1YA 1NAIA 5AXCA 1DIGA 3GDGA 4L0QA 9LDBA 4LRSB 2Q1UA 1Y8QA 4I5EA 2OXIA 1YBAA 2O4UX 2EW8A 3UFXA 1JDJA 4F6LA 1XG5A 5G0SA 2NTNA 2H5LA 2EJWA 4ZRNA 4R1TA 4UREA 1YRLA 1NXQA 4B4WA 5CPBA 2O3SA 2CUKA 4CMCA 4GMFA 2HJSA 1PL6A 3V2HA 4CMHA 3ZU3A 4E4YA 1Z82A 4B8WA 5KJ6A 1XHLA 3DWFA 4CMEC 1PJBA 1H6BA 5JC8A 2UVDA 1BHSA 2OP0A 4YT8A 1MP0A 4MVJF 4YQZA 3W6ZA 3HN2A 3OIDA 4BNKA 3PWZA 2JD1A 3F46A 3EAGA 1P1FA 4BKRA 4XR9A 3ZV6A 3ZN2A 3ZGYA 2BI8A 3CTMA 3I83A 1NPYA 4A7PA 4J2HA 4BO2A 4JJGA 1ISJA 4PZCA 4YRBA 2IZ0A 3GZ4A 2FPIA 3SVTA 1B26A 3OJOA 3TNLA 4BNIA 3F5SA 2AQIA 1HRDA 4TKLA 1GCOA 2X0RA 4YTEA 3KEQA 1U9JA 3GVIA 4DBZA 3NDJA 4PLGA 1IE3A 4R9RA 4TRMA 5A05A 1NFRA 3DBHA 3V2UA 2NM0A 1YJ8A 3L9WA 4UVEA 5IDWA 5T8KC 1E7WA 1K6XA 3FWNA 4RVFA 2JCVA 4KWHA 3AU9A 3D3EA 2GPTA 1DC6A 4FCCA 4YT4A 1I36A 2C59A 3QY9A 3BMOA 3QIVA 3AU8A 3BYZA 3E8XA 3MTJA 1SB8A 1KEUA 1BVRA 1LDBA 4BO5A 2IYOA 3GR6A 5A9SB 3ZWWA 2P9GA 1KVQA 4IJVA 4OKIA 1BW9A 2Q2QA 3S2IA 3ITDA 2PA3A 1SO8A 5BQFA 4BNMA 1S7CA 1CRWG 1A5ZA 1UXIA 4QX6A 4XKJA 3LC2O 4II3A 4R54A 5ITVA 1O8CA 2BHLA 3DL2A 4YAGA 1GUFA 2FPPA 4E6PA 3FN4A 2HO5A 4WLFA 4C4OA 5CDUA 1LUAA 4PIVA 2AG5A 2G17A 1EUDA 2JHGA 4W7HA 5L45A 3RBXA 2BF7A 3DZKA 1JTVA 1QLJA 4CLOB 1DAPA 5FI3A 3DZBA 4L75A 5JE8A 4J16A 5I7FA 4FD3A 5AOVA 3DHYA 4RL6A 3LC1O 2X4GA 3ITKA 4GGPA 1I8TA 1EK6A 4YAEA 5EQDA 3R1IA 4D0SA 4DQXA 4KMSA 1SAYA 1YL7A 2IXBA 3QVTA 4OXYA 1T26A 3IAHA 4TMFA 3IP3A 2EGGA 3QP9A 4UVIA 3VKVA 1FK8A 1AUPA 5MDHA 4IXWA 1KS9A 3BTUA 3MEQA 1H6CA 2FP4A 4ZJUA 4U0KA 4J4BA 4PRKA 2ZTVA 3LZ6A 4CUKA 5CG2A 4XYEA 3U4HA 3WGQA 1ID1A 2ZB3A 1J6UA 3VZQA 1I3MA 3U9LA 4ALIA 2EIHA 2WTBA 1O9BA 4JLWA 5GZ3A 3B70A 1ZJYA 4WLUA 3FTPA 2JKVA 2HMVA 1NBOA 1DFHA 3F47A 2D5CA 1E7SA 5I9MA 1X1TA 3GRPA 4DXHA 4DRYA 4GI2A 4BUCA 2PFGA 3IUPA 3EY4A 3K9QO 2NNLD 3F9IA 4AJOA 4QUKA 2LDBA 2RCYA 4DC1A 1M2WA 4OOEA 4HBGA 3GUCA 3ZNQA 4E2XA 4LN1A 5IJZA 4II2A 4CLRA 2QYTA 2WE7A 1WPQA 3PHLA 5L95A 4XD2A 3ZW9A 3ADOA 3U0BA 5ILOA 1BXGA 4PG7A 1LDMA 5G0UA 3UAGA 2QZ9A 3H5RA 1CYDA 2PV7A 1W73A 3INGA 3ASUA 3RI3A 4XIYA 5EPOA 3TFQA 4L4XA 4YJFB 3I9MA 3WXBA 3PQDA 5EERA 1HE5A 3JQEA 4MP6A 4CMGA 1JKIA 2Q1SA 4L8VA 1QYCA 3PFFA 3WBBA 1E6EA 1B2LA 1G6KA 2HJRA 2Y1OA 5K6AC 2Q4BA 3KLPX 4BO9A 4CV2A 1C1XA 1DHRA 1XA0A 2Z5LA 2JFFA 3HDYA 3SC4A 5ILGA 4DLAA 2E37A 4KUHA 1GDHA 2JFGA 4MIEA 1XWFA 1JN0A 3EZYA 2QRKA 4IZHA 1XEAA 2NU9A 4HKTA 2CDBA 4JBIA 4Q9NA 4AJLA 3DC2A 2JCYA 4FOOA 3DOJA 1EUZA 1D8AA 4UAGA 5U1PA 3K73O 4XX0A 5G0VA 1BMDA 4KTVE 3Q2IA 2FR0A 4RO0A 3F5QA 1VJTA 5ENDA 3ZU2A 1ZXLA 2PNFA 2VYVD 4FGWA 1NASA 2PWZA 1E1NA 3K31A 4BNUA 4YVFA 4PLTA 3ORFA 1T2DA 2VN8A 3VPXA 4CMIA 3NTQA 5F1OA 3MJEA 5F5NA 1AXEA 4O63O 1QLHA 1Y5RA 3FHLA 2A92A 5TQVA 1NTOA 4XYBA 3UUWA 3U09A 1FDVA 1BXKA 5JDCA 3NRCA 3WWZA 1Z75A 4DGSA 4EBFA 3N74A 4WLVA 4TVOA 4ND4A 3JQ7A 3DQPA 2A4KA 3JQAB 1XU7A 1MXFA 2QZZA 2X7HA 1V3TA 4HFJA 3TZ6A 4RDHA 3W8EA 1WW8A 1ONOA 2PKQO 5A1TA 2OORA 1JW9B 4WEQA 4NDNE 2DBRA 2GZ2A 4W82A 1PZGA 1GU7A 1E5LA 2BELA 1L1FA 3JQBA 2HK7A 1ZK0A 2X9GA 4BGVA 2B5VA 2R00A 3SBOA 1IOLA 3L4BA 4BO6A 5I8WA 1ZUD1 3TN7A 1PQPA 2X9NA 3F1LA 1R12A 5DBGA 4BNNA 1AHIA 1U7HA 3ICCA 5DBFA 1PJ4A 3AY3A 1GYPA 2XAAA 4U5QA 1XQ6A 1PJTA 4WLEA 4DUPA 3I6IA 5KVVA 1A71A 2ZCVA 3K92A 3RWBA 1O5IA 4IY1A 3BMQA 3W6UA 1Q7CA 1G0OA 4E21A 5JCJD 3KSDO 2EP7A 1ZNQO 1W6UA 1GV1A 4O59O 5G4KB 4BGIA 2FWMX 2UUOA 1PJCA 3GVPA 4C7JA 3QWAA 1EFLA 2O23A 3G3EA 1O89A 3EMKA 1EVYA 3VZRA 3VPFA 4DBVO 4PVCA 2D0IA 4E30A 1Y81A 1HF3A 4EUEA 4CR8A 1WXDA 3NT5A 4BHTA 4UUOA 1ZFNA 2P4QA 2GUGA 3O8QB 1IZ9A 5C7OO 3VH1A 1KY5A 1QV7A 1RM5A 3BHIA 1QSGA 3OSUA 4FR5A 1LQUA 2DUUA 3MOGA 4MVJM 3RASA 2Y1GA 1UH5A 3KHUA 2Q46A 4OH1A 1MX3A 1E0DA 1LSSA 2YFHA 4BO8A 4BNLA 2CY0A 3OA0A 3U4DA 4WOJA 3SLKA 4DLLA 1CQJA 3U4CA 3VZSA 4J3FA 2EG9A 1X7DA 2GCGA 5FYDA 4JQCA 3I3OA 3WQRA 4XZ3A 3PHJA 3FR7A 3E1KA 3DMTA 2B5WA 2EJVA 5EN4A 5IDXA 2NU6A 3OA2A 1I33A 1E3WB 3AK4A 1CETA 3TZHA 3Q9NA 1R37A 1XGKA 5CDYA 1ZXBA 4RV9A 5JLAA 2WSBA 3AJRA 3LVFO 1A7KA 4KP7A 1KC3A 5F1PA 2WEKA 1GY8A 4CMJA 3A14A 1U28A 4IDEA 4JXKA 1NM5A 3EW7A 1LI4A 2FRDA 1H0KA 2GNAA 1QG6A 3HN7A 3JD3A 4ILKA 5HBRA 5JAQA 5TSDA 1BGVA 3RD5A 3RSHA 4CM4B 1LNQA 4M49A 4PG5A 3VOSA 4XQEA 1LC3A 4NK5A 2HLPA 4AJ2A 2DT5A 3JQGA 1M6HA 1B3RA 5CDSA 2O3JA 4IGEA 1N1EA 5H82A 4BO7A 3UCFA 3IMFA 1I01A 2VOJA 3M2PA 1P31A 1DDOA 1B3BA 4XDZA 5B12A 1Q0HA 5AXBA 4Y8VA 3FNEA 3E5MA 2NQTA 1SNYA 4EW6A 5DCUA 1WDLA 2C5EA 4MP3A 2GASA 4IJUA 1Z45A 4K6FA 1X13A 3DMYA 1DIAA 3CMCO 4QECA 4CM9A 1YGYA 3PK0A 4ZQBA 3BHJA 3NGXA 1T1RA 4YAJA 1LSUA 3K5PA 3Q3CA 4KQXA 3RUDA 1H6AA 1LLUA 4M86A 3WTCA 4EYEA 4WASA 5A9TA 1VJ1A 2Y67A 3K2BA 3PLNA 1ZK4A 3DZGA 2PTGA 4E5NA 4IDFA 2FY8A 3W4KA 1GPDG 1UP4A 1UZMA 1HLPA 5JAIA 1Z7BA 4S1VA 4Z0TA 2R2GA 5AXDA 5CEFA 3IIEA 4PLWA 5IZCC 4RZHA 3ROMA 4MVJP 5C7IO 5A3JA 2R6JA 4J7CA 3GHHA 1DAOA 2AW5A 4YEDA 5FWNA 4PN3A 4A26A 3U62A 5A9SA 3OQBA 3KETA 2VQ3A 5BNIA 3CIFA 1VL6A 2P2SA 3Q1LA 1YBMA 2H6EA 3ASVA 3HDJA 4CMBA 1EZ4A 4BS9A 2WE8A 3GGGA 4E5YA 4OL9A 4CL3A 4KZPA 5GY7A 4ROSA 1NFQA 4CQMB 4QT0A 1FXSA 1MFPA 1YONA 3GVHA 1HE4A 1DIHA 1ISFA 3GVCA 4IJWA 3H9QA 4YT2A 2VNAA 1IHXA 3S2GA 1OOEA 4NK4A 1YKFA 1PX0A 3GUYA 1N9GB 1HWYA 1PGQA 3RVDA 1MFZA 2CF6A 4CLOA 5HRUA 4I9UA 4I5FA 1NPTO 1TVEA 4XQ9A 5F1KA 1EBFA 4PLZA 3MCVA 5AQ1A 5DULA 1YJQA 4OMUA 3NGLA 4W4TA 4BL5A 3PZBA 3UGKA 2PD6A 4B3JA 3COSA 2ZYGA 2AEJA 2LDXA 1P33A 1TB4A 3KSZO 3JYLA 2PKRA 3GQVA 1XYGA 1YVEI 4NPCA 3ANLA 2E82A 1ML3A 3G49A 4Y67A 3OJEA 4I8XA 4MIOA 2C2XA 1LTHR 3L07A 5DDIP 1L7EA 4TZKA 3QRWA 4ZN6A 3GEGA 2CDCA 4RPJA 1HZZA 1Z6ZA 3WSVA 3INRA 3PIDA 4J1SA 1HDOA 2GRAA 1F06A 3BTSA 4YCAA 4XYGA 3RC9A 3CZMA 4P22A 3T4EA 5TT1A 3WGZA 1PJQA 5LCXA 4FDAA 3VH2A 2ZCUA 2JD2A 3DOOA 1TT7A 3WJ7A 4QO7A 4GWKA 5KJFA 5L53A 1B14A 4NBTA 2VHYA 1P1KA 1ZK1A 1GYRA 2C0CA 4RLSA 2ZB7A 4BNGA 3UOGA 3OIFA 3WYEA 1NYTA 4K6CA 2ZK7A 3PP8A 4GL4A 4GVLA 1U3VA 3OJ0A 3F3SA 4KOAA 5CEEA 1XU9A 1QYVA 2ZJ0A 4NQZA 1ADFA 1HE3A 4EDFA 3FPLA 3INTA 5COAA 4CQLB 4IS2A 4XCVA 1N2SA 4AJEA 4K26A 1ENYA 1HDZA 1X1EA 2PY6A 2EXXA 3FCOA 3GPDG 4YJFA 2GZ1A 3RUIA 2W98A 4OKNA 2RHCA 2EGHA 1NHGA 2X0JA 4AJHA 4ESOA 3GK3A 5CDTA 4I5GA 3H3JA 3IOYA 3D1LA 2Y68A 3L6OO 3WNQA 4TRNA 4IDDA 1V9LA 2FSVA 3C24A 2CVQA 4IXTA 2OHXA 2BGLA 1FJHA 4TWRA 5JCJA 1E1LA 4XB1A 4CR7A 4DLBA 5IG2A 3KVOA 3PJDA 4AG3A 1DJNA 4FFOA 5ES3A 1NVTA 5BSGA 1D7OA 4OGWA 3DHEA 5KVSA 5LDHA 2IZZA 2HU2A 1E1KA 4XQGA 4KUGA 4HFNA 4BV9A 5IF3A 3OETA 3HJAA 2BLLA 3E9NA 1E6WA 2UUPA 3GNTA 4W99A 3KXDA 5GZ6A 1P77A 1MV8A 2BFAA 1M6WA 1YDEA 1HKUA 4DA9A 2PZLA 5JMPA 1Y1PA 3JV7A 4BKQA 3PTZA 2FPGA 2YY7A 4E2WA 2GN4A 4HX5A 3C8MA 1QORA 4JBGA 4NI5A 1BDMA 4D0RA 3PRJA 1GQYA 1JKJA 1VSUA 4RDIA 2AE1A 1HXHA 4HWKA 3PYMA 1RM0A 1YQGA 3OECA 4WNCA 1U5AA 2YDYA 4U7WA 3CSDA 2D4AA 1U7TA 4WK6A 4GAEA 1D4FA 2HMSA 3QVSA 5JY6A 3L77A 5F3RA 3WGGA 1ZEMA 5HS4A 5BSHA 2X0IA 1T2CA 3GZNB 1ISGA 1HL3A 1E3JA 3HG7A 3JQAA 3AM4A 2E48A 1LSJA 3HDHA 2DLDA 1ZKMA 2IYPA 3PEFA 3GF4A 4BGUA 2J5RA 2Y0DA 3WGTA 2HK9A 4PG8A 1LBEA 3RROA 4M89A 5CDGA 3KBOA 3OQ6A 4BKUA 2VUTA 2HSDA 2V65A 2ZQYA 2VOEA 3C7CB 4MINA 4OJNA 2BFMA 3WDSA 2H63A 4YJHB 3AWDA 3VTZA 2Q2VA 4PRLA 2B4TO 4RVDA 3KV3O 3CZRA 4K28A 4YQYA 3FRJA 1HT0A 2YFQA 4MVJH 1ZVMA 1IZ0A 1KEWA 1I3NA 3L0DA 4LW8A 3ZNNA 5BNTA 1NNUA 4J1QA 4DIBA 3L6DA 1X14A 4GX2A 4DVJA 3BHMA 4M55A 5TGDA 1KC1A 3JD0A 2QRJA 1WAMA 4MO2A 4GH5A 2H9IA 1ZBQA 1OBFO 3W8DA 4GWGA 2O2SA 4R1UA 3WTBA 3DFUA 2OL4A 4MVJE 4Z0PA 1F17A 1HE2A 2VZ0A 2VWHA 5G4KA 1SZJG 1I0ZA 1NR7A 4E0BA 2PD4A 1UP7A 2WJPA 3BTVA 2DAPA 4OXNA 4BO4A 5F21A 1R66A 4FFPA 5KCZA 2G5CA 2G82A 2PZKA 1XQ1A 2Y1DA 1O95A 3WGHA 5GMOA 2JAHA 3B1KA 1H9BA 4FB5A 1IL0A 1RM4A 2VHXA 3JQ9C 3RFXA 5JC1A 2Y66A 1JQBA 4BO1A 1ZJZA 1V6AA 4UVDA 2D8AA 3FNHA 3O8QA 2CNBA 3QQPA 3GH3A 2JHFA 3LT1A 1DRVA 1JKFA 2YHIB 1T4DA 3K6JA 5ICSA 3PJFA 1U8FO 3FPCA 5JO0A 3ZWPA 1NHWA 4N7RA 3H4VA 1LDGA 2QIOA 5B4VA 2OFPA 4Z9FA 4DYVA 3PGXA 5G0WA 3DHNA 4N5MA 2VRBA 2YV3A 4KDEA 3TJRA 5HWSA 4YAIA 4NR0A 3B1JA 3NTOA 1H6DA 3I9LA 2EKLA 4Z3KA 5IXYA 3RKRA 2PGJA 2BGKA 4FC7A 4BO3A 6ADHA 4FJ2A 1WLYA 1DEHA 4OHUA 4RF2A 1YQXA 3QVWA 1CJCA 1E3WA 1JWBB 2PD3A 4MVJA 4E13A 1ZSNA 3G79A 4EEZA 5KJCA 2DPGA 5HTOA 3ZWNA 1GQ2A 4JNKA 1GUZA 3WIEA 4CM6A 1YWGO 3GC6A 4G5HA 3HB4X 2GF2A 3DBRB 4E5PA 1C0LA 4EUFA 3WFIA 4CM4A 4J49A 1C14A 3ZHYA 3ENKA 2ZB4A 3GN2A 1E7RA 2Z1MA 2NU8A 2B4RO 3GVXA 3HWRA 3NAQA 3IL2A 3LT0A 3Q0EA 1BTOA 2I76A 2VWQA 1RYEA 2YHUA 2VZ8A 3C85A 3U49A 3UXYA 3B20A 4IDAA 4R16A 3PJEA 4UUMA 4NU6A 4Y98A 3OJFA 4DIOA 2Z95A 4PG6A 2OOSA 4OIMA 3ROPA 2WM3A 4LCJA 1K6JA 1ZO8A 3BMCB 1E3IA 3FWZA 4U6QA 4B7CA 4H7PA 4DC0A 1B7GO 4IINA 1AXGA 1GV0A 4YAKA 5I7SA 1OC4A 4WLOA 1VM6A 4ZICA 4NZ9A 1U3WA 2YV1A 4IM7A 3S8MA 1QR6A 1OZAA 2GGSA 2P4HX 3VH4A 3ZHZA 4RVHA 4BGEA 5L7TA 1A4UA 3GHYA 4RZIA 4GKBA 4DWVA 4W6ZA 4NNJA 1Z74A 2GZ3A 3TRIA 3W8FA 1VSVA 3OQ1A 1GD1O 1Q1NA 3F4BA 4CM9D 1SPXA 3NEPX 1VPDA 1Y8RB 3HNPA 4DQVA 1PIWA 2ZJ1A 1T25A 4KQWA 5JYEA 4RPHA 3D5QA 3Q11A 5C7LO 1DOHA 3AY6A 3ONFA 3KSUA 2DM6A 1EMDA 1UDAA 4BIIA 4FJ0A 1BVUA 1EEHA 2E4AA 2J3IA 3JYOA 1R4NB 1KVTA 5JSFA 1HEUA 1MXHA 3QVXA 3HHPA 2NACA 1B16A 5DP2A 1LRJA 5TJHA 3EK2A 4CQMA 2QW8A 2OMEA 2FR8A 5I8ZA 1PR9A 3QV1A 5T5QA 5A03A 2NVUB 3AUAA 3ZNOA 2QQ5A 3EDMA 1N9GA 1LA2A 4MP8A 4PGFA 4M54A 4GKVA 4XEHA 4FFLA 2YW9A 4WOKA 3D4NA 5TRTA 1UP6A 5LC1A 4HADA 4R41A 1XR3A 1D3AA 1KYQA 2NTJA 1RJWA 1DIRA 5HM8A 1TI7A 1U3UA 4WKGA 1LXCA 3WFJA 3M2TA 4PLHA 3ZWVA 4MIYA 5JNLA 3WWYA 1ZH8A 4L73A 1FDWA 2IZ1A 3N58A 3JYPA 4G81A 1HTBA 3ZDFA 2RH4A 1P1JA 5K6AA 1WMBA 1DRUA 3WQQA 2AEFA 5DBIA 4IQGA 4TQGA 2WD8A 3ZV5A 1GAEO 4TRRA 1F14A 5DN9A 2VCYA 1Q0LA 3E48A 4O1MA 2HKIA 3HZZA 5DCWA 1GPJA 3G1TA 3E18A 2BGMA 2HAEA 2P68A 1D1TA 1RM3A 4OXKA 3H2ZA 1XDWA 1N5DA 2QYSA 3IKVA 3V1TC 5G4LA 1ZEJA 3VHRA 4JJFA 5JS6A 1R0SA 2EKQA 4IQ8A 1ZMTA 2UV8A 2Q3EA 4UVGA 3SC6A 4HP8A 1A9YA 2P91A 3HUDA 3P2OA 3R0IA 4CMKA 2PLAA 1SC6A 3QW2A 2X0NA 5J23A 1Y7TA 1C1DB 5ER9A 4DTIA 4XGIA 4CQLA 4IIUA 2C54A 5JDIC 2Q99A 1JLLA 4U8GA 4XRGA 2HUNA 1E3EA 2JJYA 3FD8A 4LMRA 3UICA 2AA3A 3FBGA 4FPXA 3NUGA 5JFOA 5CHEA 4EZBA 1GADO 4WCFB 3BA1A 2NV6A 3WOHA 5KOIA 5B4TA 4E33A 3WJAA 3D64A 1GYQA 3EUWA 4ZHSA 5TLSA 3SJ7A 2VHWA 4PG4A 3ZV3A 4A2CA 2NLOA 4BOYA 4DPLA 1IY8A 4IZIA 4RCVA 1MC5A 2IDZA 1GZ6A 3L4BC 2PKQP 1RYDA 3ZWAA 2IE0A 5JAZA 3CE6A 3GG2A 3AOEA 4D41A 5L3ZA 2GO1A 2X9VA 2O2YA 2PH3A 4YB8A 3VVBA 1PJLA 2AXQA 3FSRA 3IP1A 5IFLA 4YDRA 3NDIA 1UR5A 1WNTA 3H2SA 3F1KA 1E77A 3GT0A 2WYVA 4EGFA 1Q7BA 4PLVA 1LDNA 2X58A 3OICA 5JPIA 3IJRA 1EQUA 3VH3A 5I7EA 1IUKA 1I2CA 1ONPA 2YQ5A 3GEDA 1AGNA 1QYXA 1PQWA 4BVAA 4TSKA 4EUHA 4FFNA 1Y9AA 3KM0A 4GLLA 2WYWA 4AJ4A 1P1RA 3TPCA 4MVJG 4CUZA 2V6BA 1E7QA 3HDQA 2G1UA 1KBZA 2NADA 5KKAA 3E9MA 4W9NC 1ZW1A 1CQIA 2W2KB 4F46A 4OSOA 2B0JA 3GEMA 3O26A 1R0LA 4PLYA 2QRLA 4XJSA 2EF1A 1PS8A 3GZNA 4NBRA 4BV8A 1EVZA 3S2FA 3UCXA 2EWMA 2I3GA 3KRTA 1B8UA 1XCBA 4ZQGA 5KIAA 1JAYA 1N8KA 2FOIA 1GCUA 5B37A 1HZJA 4RVUA 3EVNA 2Y99A 4H3VA 1RWBA 2Y0CA 3MJVA 1L7DA 2CMDA 3PZRA 4CPDA 3RQSA 3NYWA 3ZZNA 4HNHA 3KYDB 4YJHA 3UHAA 1ORRA 1PGNA 5CAEA 1XKQA 4PZDA 1O6ZA 3U4IA 1E5QA 1JA9A 3JQAD 3M6IA 3I23A 3O9ZA 3LQFA 3U5TA 2EERA 1FDTA 1MLDA 1X0XA 2IEBA 2RBEA 3B6ZA 3DMTC 3ZWCA 3I5MA
chains in the Genus database with same CATH superfamily
1C2YA 3P27A 1LDYA 1C8VB 1E96A 1HYQA 1TZBA 3AVPA 4MKRA 2VTEA 3NWEA 4ZA2A 4AZVA 4YUXA 1KJ8A 1XCOA 2CXTA 3F7NA 3SEFA 3H5OA 2BGWA 2O3TA 3ZDBA 3O03A 4EI2A 2O8CB 4KXMA 5LLDA 1G5IA 4B1FA 4IIFA 3U6BA 2V5VA 1KI7A 2HMUA 3NHJA 4AG6A 2XTMA 1CW2B 1PK8A 1BH2A 1VYVA 5IJ9B 2PPLA 1QRRA 1RWWA 3S68A 2QBYA 4R8RA 2Z3WA 3H9JA 2Y2VA 1ZHHA 2H1CA 1LK5A 4OAQA 1AKEA 2GJ4A 5GONF 1RXEA 3T6KA 1KY3A 3DYBA 2I4MA 2ZRHA 4IO1A 3QA9A 1M6YA 2XZOA 2IY9A 5JNWA 4N1AA 3WK6A 4DQ0A 4L4UA 1NIPA 4KSBA 5KJEA 4E2ZA 1XAJA 4LGYA 5IVKA 2A9VA 2H7YA 2RKWA 3DYVA 2RGWA 1DRJA 2FPRA 2NT3A 3NP7A 1DDGA 1CD5A 4JOSA 4RORA 3UATA 4YLYA 2CHGA 2RIRA 3A1SA 5HW0A 3ZTYA 4Y18A 1IYZA 4IQ0A 4XFJA 3E58A 4NAHA 3NIWA 2IV7A 1PR3A 2D13A 4LYGA 3ZJVA 2BFFA 4MUJA 3C16C 1O95D 4NZMA 4ND1A 2VDWA 1J49A 3GFOA 1ZMXA 3PNSA 2VNSA 3PPVA 4XW2A 1M2JA 1DQZA 2EP5A 4FN4A 2NTVA 3E82A 1UC5B 3GJ6A 3KFLA 5EJ2A 4QDTA 1E9RA 1CZUA 1JDPA 2IYYA 1EGVB 3RSCA 3UH0A 3ZE0B 5MFPA 5LQRA 1JFLA 2QRVB 4IPTA 4QYMA 2ZWIA 5IN4A 2I3DA 2W8ZA 3PS9A 4W5HA 3FVTA 1HOTA 1T3GA 4FKZA 4ZOBA 3HNRA 2Z8ZA 3FAZA 4RAQA 2CEKA 5JEEA 3DPUA 4FSXA 4K6HA 5JXHA 4XM0A 1CUHA 4YRLA 3V7FA 5CG1A 4YRRA 3IOMA 1T4CA 5CLHA 3O91A 4BNWA 3IDZA 3X1XA 4JYAB 5IYZA 1MIHA 4FOLA 1D4OA 2KSQA 3WYBA 4JXJA 4N5LA 1D9XA 1LU9A 1NATA 4NICA 4DNXA 5HCIA 2OZPA 5GIOE 1YQ9A 3GG9A 4Z4IA 3K8ZA 4R81A 2F1JA 1IQ0A 1UDXA 1U0RA 4O2LA 3RRZA 3KKZA 3ESYA 3TLZA 4DMKA 1PGOA 2FSIA 3HQ4O 4PNZA 2UYOA 4ZU3A 4DN6A 3J81k 4IOLA 3N28A 1T8YA 3HJNA 4R68A 4GC5A 1THTA 4Q1VA 2HZBA 1A8HA 4MVJD 3VBCA 4W5NA 3LF2A 2IYWA 2DZDA 3NXKA 3WLOA 2H3EA 3KFXA 4LHYA 3EBOA 3MK31 3OCJA 2P2DA 4UZEA 5DZSA 5BVHA 2A9PA 4GYWA 1FYVA 1XWIA 2GK7A 2ZUWA 3LF1A 3HZRA 3LLSA 3C1OA 4KRGA 4MB2A 1AU9A 1UEIA 3N87A 4KYTA 4QL3A 2BGIA 1THZA 2H54A 4CLRB 1TAQA 3AVUA 3MZ0A 4IBOA 3JRXA 4B7XA 1ZYUA 3RJ5A 1K7YA 3CVWA 4G2NA 1QS0B 1WSDA 2UXDB 1XD2A 2ERYA 2AQHA 1XNJA 4HAYA 4G9EA 4Q21A 4V0LA 1SHKA 2MSDB 4ITUA 1A9XB 2OG1A 3QFFA 1J2UA 4Q0MA 1SBTA 1XQXA 1JE1A 3KAJA 1UFQA 2VP0A 2BBTA 2FPWA 2KYRA 4UM9B 3D6MA 2A58A 1TQ8A 1OU0A 3G1WA 4NPHA 4Q39A 3T3IA 3U1TA 5IW8A 3ZGVA 1XCLA 2ECFA 4LPKA 5PGMA 4TXHA 1EUCA 3PNPA 3GJZA 3M1AA 2G07A 5BN4A 5EXEA 4WCDA 5ALFA 1NURA 3PNLA 4I66A 3ZV4A 1DV2A 3OZ7A 1LFAA 1TEHA 4HUJA 5FUXA 3ETCA 4EF6A 1DGQA 2OV6A 2ZJBA 2W2LA 1P5JA 2NZVG 4ZYTA 2BSQA 1G21A 1Y8RA 3OHMA 1DKQA 2BM9A 5CD1A 4FS8A 2SICE 4RF5A 2CZCA 2W2VA 5KKCA 3A6EA 4EHIA 4AN4A 1OC2A 1DKLA 3DCNA 2B4QA 3BREA 3MLAA 2XA9A 3ONVA 3U3KA 3UKOA 3S6JA 5FUQA 2FQQA 2E6KA 2IX9A 1J8VA 3E81A 3TOCA 2GTHA 4FEYA 1R4NA 1VLHA 4NMXB 4D4JA 2Q1TA 4LV8B 5CUQA 4D46A 3MWKA 2RGXA 3D3WB 3OT1B 1CQPA 3IKJA 2NO1A 4O0LA 4P8RA 2PX5A 1QP8A 2WIAA 1G20B 1P4HA 3ICWA 1MJ5A 1HSOA 4QHYA 2BKAA 2PS3A 2ZR7A 2VBIA 3RT9A 4Z54A 2XA2A 1K86A 4ZKEA 3PXGA 4GG1A 5I7UA 1IZYA 4US2R 2GXAA 2DPHA 4OOFA 4H4CA 3OTHA 1JQ5A 1RHKA 1JUDA 1PGJA 4RSHA 5K3DA 1HMYA 1J8DA 1MOSA 3IJEB 1JKMA 3UV3A 4Z4FA 4HGPA 1M8JA 4MKGA 4RHYA 4WFKA 2P78A 2YZNA 1RQLA 4X90A 2DPYA 4WTOA 1NSFA 4BLPA 5ANRB 1OIVA 2HC9A 2PMKA 4NZNA 4LZOA 1N1GA 1MA3A 3NETA 3CLUD 1DAEA 5DTQA 2JB9A 3LLVA 4XB2A 1Q0QA 4C30A 3DZIA 2B92A 4G0PA 1LLFA 3A9VA 3AERA 3EVFA 4PX2A 4RM3A 2RGCA 3L0OA 4DXAA 3R3SA 3WWCA 1TF2A 5FBLB 2G28A 2FN8A 3UMJA 1P0CA 2FX2A 1NUUA 3CS3A 4KWIA 4JP3A 2I99A 1XC7A 4D6YA 721PA 4KV7A 5HJEA 1UAAA 3E1SA 1C3EA 1GUYA 4N6GA 4XYLA 3KTAB 3ED1A 5G02A 4G0VA 4XUGB 4YJ3A 1KERA 3I6ZA 5CDFE 3UKDA 1NQOA 9GPBA 4RHEA 4MB6A 5BUQA 3W4JA 3LT5A 2IWRA 2COUA 1YI0A 1QQTA 1ARZA 4LF5B 3L40A 1GZ3A 3OU6A 4PONA 1MUUA 4QRDA 4XPIA 2PUGA 3NOVA 1ZD1A 3T7CA 4BFUA 1I6MA 4X8MA 3DT8A 1WRBA 1Q95A 3GEEA 2ADFA 2AWNA 4F6RB 1NQTA 3I4CA 1Z2CA 1AK2A 5HJ7A 4IWXA 3Q8MA 3KQQA 3IVRA 5A3SA 1TDJA 2JJQA 4TVKA 3GARA 3R0ZA 4KEAA 4QXMA 3K6SB 2Q6VA 1QX4A 2Z9BA 3QTTA 5JBIA 3WX0A 1QGUA 3HBMA 4U2CA 1U3GA 3G8CA 4OYHA 2DH5A 4F3RA 1L9XA 2XVZA 4J1NA 1PYOA 4DCJA 5A9RA 2J7KA 1H93A 1N2ZA 4KXWA 2UZ1A 4Y6OA 4E1AA 4EKNB 4RKFA 2C8KA 5BMVF 1QYDA 3BSWA 3L41A 5CM2Z 2HQ1A 5BV2P 1BVHA 2FHPA 4RPGA 4C4ZA 2JGLA 1JQAA 1NOKA 4Z0HO 5IK2A 1SKYB 4UCXA 3RHZA 3HJCA 3OIWA 3E7DA 3GLHE 3SZLA 3T41A 1YQDA 1BXRB 1I3LA 3AINA 4D9JA 4FEAA 4L50A 3A3KA 4E31A 2F90A 3OF5A 3NCTA 1YOVB 1YHZA 3A9RA 4RTKA 4WCFA 3NM6B 2XGMA 3WMFA 4RULA 3C5HA 4YCJA 2BBWA 4CDRA 1U1CA 2XYVA 1CZNA 2FZ4A 2XHZA 4L8WB 4MQ6A 3RQIA 1CUAA 2HO4A 2Q3BA 2IE8A 2FEPA 3BTOA 1GILA 2DT8A 3GJSA 2P5UA 1LD3A 2RH8A 2WM8A 3OKAA 3SIPA 3AIOA 2BZ1A 2OG2A 2W48A 2XADA 4RV4A 3V8RA 4BX3A 3V7UA 3L4SO 5HIIA 5T3YA 4C08A 1R0CA 2BEUA 2FEMA 4I14A 1EJBA 1Q6YA 2AJDA 3D54D 3BZUA 2GCOB 2QTVA 1DO0A 3DVAB 2GR9A 3LUAA 4LBZA 1NQ5A 4G4IA 1ZGAA 1ABBA 4BNTA 1EFVA 4ITRC 2ODWA 2N1MA 1T9ZA 4LECA 3QYPA 1EFTA 4D97A 5AM0A 3D4PA 1BHJA 1KZ1A 3IS3A 4TS9A 4LE0A 4XM1A 3K9CA 4P6VF 3TUJC 1RMYA 3M1IA 1GO2A 5G41A 1NP3A 4UTOA 2VRWA 3KQPA 4GBJA 4JH0A 3FIUA 1GRCA 2IXTA 1LLQA 5P8WA 1O9GA 3DXFA 1XZDA 3L6UA 4MQFA 4QUJA 4RXTA 1W19A 1F8UA 4RK5A 2REQA 5EZYA 4HVLA 4D45A 1P60A 4LF6B 3U3ZA 5F52A 3RFCA 1QH1B 4DV1B 2OSBA 5L4NA 2WAAA 4A23A 4DADA 1Z6AA 3HYLA 2QZPA 2JGDA 3QVUA 5JH7A 3Q3JB 3U1VA 4CT0A 1EG2A 3IMKA 1LS1A 3DEFA 2FZKA 2VJMB 2QN9A 5IDVA 5LP6B 2FYTA 1OU4A 4WIAA 1TQ6A 4BUZA 4NZYA 4EW3A 2IBSA 5DOZA 2XKAA 1U0GA 3WWDA 2QU7A 5FBRB 1GWNA 2X6RA 4C0BA 4B3MB 3DAPA 1AUVA 2OBMA 1XSEA 1T6ZA 1EGAA 2PQMA 3NCHA 3RSZA 2AOUA 3DE7X 4MW5A 3OLXA 5BQOA 5HIAA 5GM1A 5H59A 4UUBA 1SQGA 3L7CA 4EO9A 3GJ0A 2BDEA 4TN5A 4JENA 3BM5A 4H9GA 4Q3EA 2O5RA 4BB6A 5IBQA 1JFRA 2NUAB 1I9CA 4D6XA 1UT8A 3R4CA 2NWQA 3RYCB 1NNEA 3EUEA 1U7WA 4DGQA 5AOBA 1IY2A 5ABPA 1PJRA 4IHQA 4R8KA 6GPBA 1EQ2A 1Y7LA 1OREA 1ZM2A 4IHKA 4YV1A 4E5SA 4EHFA 1R5OA 3DB2A 3DCYA 3K2QA 3VZCA 2X5JO 1G55A 5C5IA 4FEGA 4OHKA 3WO1A 1UXHA 1G5QA 2CNLA 2C82A 1DXYA 1K7FB 5BQ5A 3VHQA 2UAGA 3GJ5A 4BEJA 2YIJA 4XAQA 3GJYA 1JNXX 4JR0A 2B9VA 1DC5A 4YRCA 3EXFB 4XLZA 1QOZA 1D6SA 3AZQA 2PMCA 3LJKA 3GFBA 1ENPA 4RHTA 4BNYA 4C0QC 4ZT5A 1JR3E 4Z9XA 1YTUA 1XRLA 1U5BA 4ON9A 2BEWA 3F98A 4HWTA 2CVHA 3TRJA 4CI9A 1SKQA 2Y4OA 4WXEA 4ZYUA 1NI3A 1ZP6A 5K0NA 4MR8B 2REXB 4P4GA 3C41J 3AVOA 4KAFA 4TS4A 4IFEA 2R9VA 4DEYA 2XR1A 5AWFC 2HY7A 5ULLA 5ECYA 5ICGA 4JVLA 4S0XA 3ZWXA 4G1FA 3UH1A 4JVOA 5IAJA 2XOEA 4FVTA 1RR6A 5A4DA 3ZCPA 1V47A 4GICA 3WYNA 4JEMA 4NULA 5M7EA 3FZQA 1W47A 1X9GA 4Y0AA 4N39A 2FETA 1UFRA 5KTKA 2ZT5A 4OJQA 2H5JA 3JSAA 4UXIA 4LZNA 3GYBA 4N3CA 1N2CB 1CWUA 1EWTA 1QKIA 2PZJA 1NVFA 3E7PA 4ZV7A 1A88A 4NJOA 4RK6A 1C9NA 1QF9A 1J5XA 2VHVA 4CEJA 4D96A 4PCUA 3D6FA 2PH1A 3EGOA 2FQXA 3GRYA 3KZNA 5AVJA 4ZVVA 3SFZA 1AKRA 1R9GA 3OQVA 1G16A 4O4IF 3IODA 4YO8A 2OCPA 4P33A 4S1PA 4HAZA 1OHHA 2JIQA 4QO8A 1I4WA 1PJSA 1J5PA 3AL2A 4QPZA 4PBRA 3RK1A 1YV9A 4WBNF 1E1CB 3ML1A 2GBCA 3IOCA 3OE7D 1NJGA 1TIKA 3IR5A 2J3JA 4P4SB 5EG5A 4ZMRA 4ZQFA 2P11A 2VJNA 3VKWA 3JATB 3JY6A 3L8MA 1PZEA 5KJ1A 2O7QA 1XUOA 3QE3A 3I6BA 3AEUA 3NBKA 1Y1TA 2ODAA 2VYQA 4RTNA 1F8FA 1UPAA 2WUFA 3RS5A 3U80A 2HA4A 1P17A 3AESB 2CUTA 3PQEA 1K6IA 4IDCA 1DIOB 3C43A 4UC0A 5C8ZA 1SCUA 1X1RA 4NL4H 4X20B 2YNMC 1QHFA 3VNUA 1Q11A 4OQ4A 3PQCA 3ZY4A 4V1CI 4P9NA 4UCQA 2QG6A 1SGWA 1II9A 2JHAA 4CM5A 2VSYA 3R5HA 2OUIA 2VXBA 4X54A 2BKLA 2P4UA 2ZJ6A 3R3JA 4FDUA 1GFZA 1VCMA 3I6QA 2JF0A 3DEYX 4G0XA 3ZTWA 3FHCB 5JXJA 4Q3KA 1A0OA 4M1YA 2ACKA 4RF4A 1ECBA 2ZRCA 5HRAA 3CZ9A 4R7GA 2YWFA 2FW1A 1WCYA 4Y1GA 4TKVB 1TKBA 1EI9A 2ZSUA 2R1ZA 2QRMA 3RT7A 3HWWA 1B6SA 5BV7A 3PITA 1QZ3A 1IU9A 3NKVA 3LXUX 1HKHA 4BVBA 2VFAA 2X14A 4ALNA 4HGYA 5JZOA 3M9LA 5FCDA 1UK6A 3MTEA 2IPLA 4RESA 3I8XA 4H60A 3GGOA 3AY7A 1NQVA 2E4WA 2NQ8A 5FBVB 4HLUA 8LDHA 1ZD5A 1G17A 1U5CA 4MKHA 1UZAA 1XFAA 3ZDDA 1T10A 1YL5A 1QH9A 3W04A 3ST7A 5HZHA 2IOYA 3NYRA 4BLVA 4UZFA 4ZCIA 2FOLA 4FZ5A 3T7EA 2ZYHA 2DUJA 1TCBA 2BEVB 3A9TA 4NEGA 2B2XA 1L6IA 3G0GA 2DQKA 2XUJA 1JFFA 1PWHA 3IEXA 4HSGA 5FWAA 3E9CA 4FE3A 1E69A 1UJ5A 2GZHA 4CEIB 3ILVA 5HM6A 1FJGB 3OUZA 3AJAA 2C20A 4PO8A 3EF0A 1FJXA 3RS0A 3JQ8A 4OQNA 3Q2KA 5DNWA 3EGCA 2P30A 2P62A 3I3SR 4ZI7B 4N6OA 1G64A 4MR9B 3KKKA 5D3ZA 1K98A 3CUYA 3IA2A 2QNRA 4A2WA 4CJXA 1OAOA 2VSXA 4A82A 2IY8A 7MDHA 5LQDA 1OXTA 2P5YA 3UC9A 4QTUB 5C37A 2Z0MA 4YQEA 2YV2A 3QVGB 1BU8A 3O3OB 1PJ2A 3AR7A 3V2GA 3AVYA 3I1JA 4J90A 1UBKS 1TECE 2BY4A 1A4RA 5EIXA 3OFKA 1N33B 1LZLA 3NHAA 3RV3A 2HRBA 4TTQA 1IK6A 2IS6A 2P75A 1ZCJA 5GV8A 4X7MA 4ALKA 3U44B 3FJOA 1AKVA 1PR4A 1W5FA 1U1GA 4FKMA 4R2LA 3HCNA 4HNAA 1UOQA 3FGPA 3ABOB 5KQMA 1H22A 4FDTA 3L8FA 4XJTA 4TUYB 4HEQA 2F62A 4UM8B 5TVKA 1MRSA 2G6TA 3HXPA 3P9RA 3D4BA 1QG0A 2ZTHA 3EVGA 4IAOA 1XZFA 3H2BA 2FQYA 3PX2A 3ZHOA 2HA0A 4CLDA 5J5CA 2X22A 1NLMA 2YXNA 4K3UA 4OQPA 5JDCC 4ESHA 5JASA 2J0SA 4GQIA 3DWGA 2FRVA 2PBFA 1WMFA 5E38A 4EITA 3AM5A 3N2YA 5I9NA 4H18A 1T35A 1NVEA 2UVPA 2XUDA 2CSUA 5J4LA 2XBMA 3FNBA 5LQMA 1VKNA 4DHWA 1EAMA 4NTZA 5BYBA 2PSDA 3UBMA 3W7VA 2V8BA 2OFWA 5H68A 4RKQA 4MEJA 1DLIA 4QOJA 3CUKA 1SC4A 1BOOA 1RKUA 1J97A 1FS6A 1KFBB 1PR1A 5IKEA 5DI9A 1UZLA 3UA3A 1BE6A 3OZTA 1PCXA 1VYHA 3E35A 5J2UF 1J0XO 3EGDB 2FI1A 2GYWA 3IRUA 4URFA 3QFRA 4QELA 5LZ7A 2ZE7A 5DHPA 4D4GA 3SJBA 3BCUA 3DBLA 1N5MA 1QIEA 2ZXFA 3GQBA 4C0KA 2QF7A 1D2GA 1PQUA 2TMGA 4RZ2A 5C8XA 1ZINA 5ALNA 4X00A 4UTPA 3QU9A 1KPIA 3WB0A 4MGZR 2NU7B 1M9NA 2C9DA 3DNPA 2O8DA 3NJ8A 3C3JA 2WTAA 1V35A 5IC4A 1DOZA 4EF4A 1VMAA 3LO8A 4MUHA 3HJFA 3LP6A 3UFXB 4L8FA 2KX7A 4OU5A 1XEFA 1UODA 4L3VA 3SXUA 2VNIA 1T5BA 1MQSA 2GYYA 2J5XA 1TTHA 4X71A 3DLHA 3ESXA 3S27A 5LDGA 5BVGB 2CK3A 3LW7A 5K0JA 5KYXA 5D8DA 4ND8A 4LTNA 3KQHA 1ZH6A 1Z5OA 3FZYA 4R01A 4O5AA 3ISTA 1CULC 1PTJA 3CF6R 5JJCA 2QDKA 1EFKA 2V7PA 2FZWA 4KXXA 3TI9A 5LZ8A 5J5VA 2AQ8A 3IJPA 2ZI3A 4C7KA 1SG0A 4XX1A 4DMFA 2ZPTX 2EHDA 2W8BB 2AD5A 3MTBA 3A06A 4RVGA 2GN9A 5CTAA 5IN5A 3UMBA 3DNMA 2ECKA 1Q7EA 2R6CA 4MWGA 3ZVNA 3NTLA 2VRNA 2OPHA 2XUZA 2XMGA 3AEKA 3NHRA 2FWNA 3QWHA 1XFDA 4MJ3A 4W9NA 3TQFA 5EJMA 1W4CA 3WZLA 5BRAA 1XRQA 1Y4DE 1RIFA 1RTKA 3BXFA 2ZBUA 3GELA 4IFTA 4PVDA 2BONA 4FIZA 1TA9A 1B0PA 2BRUA 4MGYR 1SPBS 5HIKA 4NARA 5TPWB 1T0HB 3AW9A 1IJEA 2GPBA 5FBZA 3UA4A 4QOHA 4PLFA 4P4LA 4UULA 5C5CA 4QGSA 3HGTA 1SXQA 3UYLA 1W0JD 2ONCA 1VKRA 2QT0A 4JJIA 2V6JA 5G3ZA 3ZBTA 5KNBD 3VKGA 5CT6A 5B3JC 3AL0C 3BQNB 3HEMA 3ECCA 4DR1B 3NBYC 3HCBA 4WK0B 4DNOA 3DBHB 2QTLA 2E2WA 2G80A 4L74A 2IXAA 4F84A 2FV8A 2B8NA 3E53A 4PFJA 4HZUB 3ABSB 4TZTA 4RPKA 3BXEA 1JTEA 3S28A 3AKYA 1PU2A 5JJ5A 1KP2A 3LL7A 4GI3A 3BVPA 3ESDA 3T7RA 1US8B 2DWUA 5HOEA 3SLGA 3EPJA 3HSKA 4C9BA 1NM5C 4YBZA 3VR0A 4BTEA 4B8ZA 1ZGJA 2QD3A 1CIJA 5EYPA 2AR0A 4BWFB 2KHZA 3R8CA 1GNTA 4F4HA 1XZBA 1FMTA 1NKTA 3F6PA 1M66A 4JKIA 5AJVB 3HJGA 2EX1A 3NAMA 4DSOA 2AEEA 2ORYA 3DF7A 3NDPA 1BW9B 2JL1A 3HFGA 2DQ4A 2JLCA 1FXWA 3H8WA 3GA7A 1G38A 4LSMA 4RV5A 3UK1A 4UHHA 1BIFA 2X8WA 2ZTUA 1OZFA 2DTXA 4JLOA 2C9CA 1CY0A 3KAKA 4MUMA 4UBOA 4EELA 5IASA 3AVXA 4PR3A 1ILEA 2H07A 4KWCA 5AVWA 1WR8A 1U7DA 1IIRA 4MAMA 2NVBA 2HNAA 3TTUA 1P29A 4WNAA 1NW5A 1EUDB 2I7XA 4BTVA 4YCCA 4AY3A 3FOZA 4PCVA 2G36A 5JCPA 1XJ0A 1VPTA 1G7CA 1I32A 1XCGB 4XIJA 1TD1A 4P3OA 4OQLA 5I4KA 5M5BA 1I1QB 3R9XA 1WBJB 2QQFA 3KEFA 3K9LA 2PBZA 3LTNC 5D1HA 4N76A 3AVQA 3O1IC 4HGQA 3PU6A 4MV5A 3V8NA 3QSYA 1U81A 3U7QA 3E7FA 4JSTA 1JU9A 2I55A 4FLFA 3UC5A 4D8XA 1S6YA 1ZD2P 3SHQA 4BQOA 1NX6A 2VTBB 4EATA 2B4YA 2UYQA 4L9RA 2R66A 4TX1A 1QFSA 1FCJA 3KR2A 2ZJ8A 2Z8XA 2JFNA 2OO5A 4I6GA 2EBHX 4M0LA 1WCIA 1FFSA 2ZRJA 4IIJB 2GM5A 4YJDA 5ER6A 4ZVSA 3MAAC 3SC3A 1FNDA 1Y3FE 3DMGA 4RXUA 3CPSA 1UPBA 2GETA 2GEUA 1NF3A 5THKA 3HP4A 3AF6A 3HCEA 3TLKA 4MAFA 3NO4A 4QPNA 4J4TA 2B35A 4RIFA 3TLGA 1G21E 2QTWB 3BMNA 3Q6MA 3OJWA 3WRYA 1WV0A 1LWNA 5EA2A 5KHLB 4AG5A 4ZZ1A 1RRFA 1UJ6A 2IJGX 1Q0TA 2F3UA 1Q7GA 4R31A 3VU0A 5LVAA 3H5TA 4UCFA 1OZ0A 2HZ7A 4X6LA 5A5DA 2MINB 1M1NB 3H9EO 1YE3A 2XRMA 3FYUC 5J40A 3QVOA 1L4KA 1T6BY 5G0TA 3LBAA 1WA5A 2B36A 3CB4A 3NRJA 1ZR4A 4DWOA 6YASA 3CQ9A 2P41A 1ZVVA 3CF4G 4V0NA 1WLSA 1V3VA 3NH6A 3T9BA 4DUGD 2IEAA 2IF2A 4PC1A 3JQFA 1KMHB 4DOMA 1GG8A 1M76A 2CCJA 1BZYA 1DXHA 1JG7A 1WPXA 1Y6RA 1ZI9A 3KVYA 4HSEA 5U4XA 1LPOA 5F12A 4ENQA 5F64A 4DNQA 1KQOA 2JKZA 3BS4A 3V4OA 4HN4B 4OHZA 4BV3A 2ESRA 3THWB 3U2QA 2ZVJA 5L3QB 5CLQA 2VTKA 4FC6A 3AP2A 2VDOB 2XMSA 3FMIA 4BQNA 4E32A 4MUXA 4LQDA 4IHAA 2FLKA 1R4MA 1QIKA 5FKJA 4CNBA 1C5KA 4GQBA 1FMCA 5EMNA 1DT3A 1SR8A 1T6XA 2RHTA 5K3SA 1QGED 5DVZA 1V11A 4JD5A 4DTCA 1I2BA 5DLQC 5FQOA 4CKYA 5ADHA 2RARA 1C1XB 4AJ1A 2JLAA 2OBBA 3G2IA 3D0RA 1JQDA 5I7AA 1JHRA 1T5OA 3VAAA 1EVJA 2V7TA 4N47A 3WLIA 2POCA 3RC2A 1V1JA 2PH5A 1JIXA 2PSFA 3NTRA 4QPDA 4BATA 4JYMA 4POOA 5CIQA 2NU9B 4EG8A 4C2BA 2PUBA 4Q3NA 1JQEA 2IKQA 3QZUA 2XYGA 5DGDA 3K9NA 1J0CA 3I6YA 1L7VC 4U7PB 4MQUA 1DRWA 1NOIA 1G1MA 1II0A 1YQUA 3DAFA 3E7XA 2GVNA 3FDFA 4R1QA 1NSTA 3AUTA 4UBKA 4YS6A 2ZS9A 1QV6A 1LH0A 1MT0A 1ORDA 1Z25A 2PRJA 2WA1A 2Q6OA 1DOAA 1YR6A 1P7YA 4IUBS 1A7AA 4KI7A 4BMDA 5IAGA 4DL9A 4ZALA 2WF6A 2BZGA 3FPBA 1XCMA 4X5OA 2CLIB 2RC5A 1RHUA 1JR6A 2QUHA 3ZHRA 3GT3A 5KYUB 1TTPB 1OXSC 3MJSA 4YCNA 1G98A 1NL3A 4LJ6A 5HKAA 3PKZA 3DFFA 4PZEA 4AM8A 4LOIA 3G9UA 4R5MA 3CRNA 3PGLA 2AC4A 4E14A 1U0LA 1V3UA 3E9RA 5DYYA 1Y9EA 4ZRDA 3TQOA 2DOKA 2VUSA 3V1NA 4ZGWA 5JNTA 2P9QA 5L9AA 4LK2A 3UF0A 1JI3A 1GTL1 4RAOA 4HY3A 3OOHA 1T34A 1Y82A 4Q1EA 3NWJA 1Z22A 3FXAA 1N7HA 4BFSA 1O6FA 4HDQB 3P52A 2G63A 2KBEA 1ZIOA 3Q6IA 4WZZA 4XDYA 3SZUA 2FPLA 2H2FA 2QG4A 3T12A 4CTOA 3AFHA 1L4EA 3LW8A 1J4AA 1CHNA 1FSPA 4PS0A 1AS0A 1RJ9A 1QBKC 1RW4A 1X7ZA 4LMAA 4GBMA 4Z8XA 1IDOA 2JAOA 4JIGA 3MGCA 4O5OA 1F7UA 3RR2A 4RTJA 1T2AA 3V9PA 2GJKA 3NBAA 3ZWDA 4CU2A 3AKDA 3KZKA 3SZ3A 1PGPA 1Z0JA 1ODTC 3E23A 3T54A 4AMBA 4MJLA 3DT9A 1IM5A 2QX4A 2YHAA 3OM9A 4N0QA 2IDKA 3C98A 2C42A 3AFNA 2VRCD 3G7SA 3A1TA 1DAMA 2CDNA 2CF5A 4UM9D 2ZJFA 4Z7QB 2R1TB 3E0QA 1U8XX 2WSSD 3P2JA 4F2DA 2ZWOA 2EW1A 4KYIB 2A67A 3EIHA 1TX4B 3T4XA 2C2BA 3C7AA 4F85A 1C1DA 3AC0A 3KJHA 1TKAA 2PJUA 4OQYA 4ZAFA 3ACBA 3WDLA 1H2WA 1VL0A 4G4GA 2RHRA 4BQPA 5K8TA 1SB9A 1GJRA 3AJEA 5FORA 4PPGA 1RKQA 1W85B 2RBGA 2AMYA 2ZTLA 1Q7TA 3OX4A 4NEQA 4RNCA 4C20A 3I52A 4LVCA 3DW1X 4ZI2A 2AOWA 3LXRA 4GGOA 5C34B 3KB2A 3T61A 1MV5A 2VWPA 5KTSA 2HFKA 2V59A 2C7VA 2ACWA 3SZOA 4AP9A 2JD0A 4OP3A 3F5FA 1D2AA 2EBUA 3H84A 4QU5A 3VDMA 1PX2A 1VYTA 2HSJA 2VDJA 1TYDE 3DVRX 4QBFA 2YMQA 5HE9A 4DHEA 2V58A 3KQYA 4H2DA 1UBMS 1LNZA 1VI6A 4ZK2A 3BXPA 3QNUA 4I9HA 5C1PA 4Z51A 5DM1A 4HDNB 4WCFC 4ETWA 2FZEA 2QVZX 4ZAGA 3BFXA 3CEAA 4Q4JB 4BMZA 3TIGA 3R7DA 2JAPA 3BFPA 3ETEA 3RWMB 4O4LB 4LRYA 3FVQA 3HFSA 2VHZA 2OQRA 5EMHA 3ZU6A 5JS7A 1GZ7A 3I34X 4TLBA 4AQ7A 1AF7A 3N8HA 5EEHA 1M5UA 1U2GA 1FFGA 3A1NA 1QAQA 2ZI7A 4NG5A 4OL0A 3S29A 3M6XA 1PZNA 3RU9A 4WT7A 2OE2A 1QNLA 2FW7A 2I1LA 1XRJA 2QN6A 4JC8A 5I7OA 4DT1A 2UUAB 3M9WA 1U2RA 5B1YA 2GX6A 5JHGB 2ZJ3A 1DIGA 3GDGA 5E6SA 9LDBA 5FL7D 4ZDJA 3GPCA 5IAOA 2R6ZA 5L3RA 1YCFA 3OESA 2I6UA 4TL9A 5BMVA 1EUQA 1IHOA 1JDJA 2CYAA 4IEEA 3SZGA 2ZPUA 1OQAA 1JG3A 5JLJA 1BS9A 2H5LA 1GT6A 1N2OA 1RIIA 1W5SA 2EJWA 2GH1A 1DJMA 2YZ2A 4QOIA 3U4QA 3MS7A 1H5NA 2PVCA 2C58A 3H5VA 1BFUA 3COPA 4EABA 3KT8A 2WA2A 4AQDA 2O3SA 1AUQA 2GM9A 5FFNA 2I22A 4GMFA 3VYRB 2GKGA 4J0GA 3QOFA 1J42A 2WWYA 4B8WA 4IV8A 5KJ6A 3DWFA 2EKBA 4YROA 3V6LA 4UBNA 4Q34A 1VGRA 4Y6LA 4HLCA 1UMCB 4ZV9A 5DM70 1MP0A 2EFGA 3CY6A 4GRDA 3W6ZA 4RZSA 4G86A 2WKRA 2C96A 5E6UA 4MX8A 1COWD 4BNKA 3PWZA 5THXA 1FX0B 2JD1A 2P2YA 3F46A 3L93A 4UU0A 5TQJA 2ZRAA 3TW4A 1JQJC 3L0SA 4YRJA 1W581 2BI8A 3Q15C 1JDNA 1D03A 3ZV6A 1W44A 3K6KA 4RKRA 4URHA 3TK1A 3NOQA 3WLRA 3DUFA 3U31A 4DCNA 5EP2A 4BO2A 3HVRA 2FVYA 1QQAA 1CQZA 3ITEA 4PZCA 5CB0A 2RJ3A 2ZJ4A 4YRBA 4B2LA 5B6JA 4X6YA 1MC1A 1J2EA 4JEIA 4OHRA 3SVTA 4PFSA 4B6PA 2BM8A 2J9XB 3FDIA 3F7TA 3VR4D 1CZKA 2LR0A 2AQIA 5BYKA 2OQ2A 1R0ZA 4ISBA 4YTEA 3RIXA 2DECA 3ONWA 2AZMA 2R68A 5IX8A 4ME6A 3LSTA 1YKSA 1LV8A 4TRMA 4M38A 1KF0A 3QVMA 4C5BA 1YJ8A 1ZL0A 1ZUNA 3LUPA 1Z13A 1XMXA 3A10A 5KNDD 2BFWA 4XSGA 4LJ8A 2O0HA 3LBFA 3SOZA 4EY5A 1S9HA 2GPTA 2OLKA 3MC1A 3ZE6A 4FCCA 4EJ2A 5C46F 1I36A 1AIPA 1Y7HA 3B89A 1O8BA 3QY9A 4I55B 1VBNA 3AU8A 3HCDA 5WRFA 2QV0A 3E8XA 5MN4A 1UJCA 2CCGA 2IU0A 3VR2A 5CIYA 3PLAE 2WAOA 3RLFA 5DBEX 2IYOA 5A9SB 2AOTB 4KE9A 4DYHA 3OIVA 3U16A 2H52A 5I7FA 3CBQA 2B8EA 4ZO4A 5FUBA 1SO8A 1WO8A 1C1HA 5A2QA 3DE0X 5B6IA 1CRWG 4J6EA 2OBXA 2BUCA 1S3IA 5ITVA 1LK7A 1O8CA 1EGMB 2FPPA 2HO5A 2EQBA 5DH9A 4N5DA 5CDUA 1LUAA 4Z4GA 4PIVA 2G17A 1JWLA 2IYTA 2JHGA 2XMDA 3B7WA 3BE8A 1WS6A 4WXHA 3EXHB 2I7CA 3UWDA 1E9VA 1F5SA 1ZM4A 1BE0A 4DSNA 1N2BA 4E4TA 2WIBA 1CR2A 1J9ZA 4GNKA 1DKOA 2C9MA 3TXYA 5FI3A 1EJ6A 4L75A 3VHLB 4EPRA 4BTLA 4C0HA 5AOVA 3DHYA 3N6RA 4L9AA 2A88A 4ND6A 1QG2A 3LC1O 1EK6A 4D0SA 4CEHB 2VS1A 4DQXA 4KMSA 2RK3A 5EMMA 1YL7A 2Q3LA 3T06B 4LYEA 2VEDA 4ZK6A 1GPWB 2DFPA 4PAOA 1AUPA 1FJ2A 1TIPA 4C6RA 4IXWA 2XWPA 3BTUA 1L9KA 3MEQA 2FP4A 4ZC1A 3EIEA 4J4BA 4PRKA 2FNAA 3MG9A 1Q0PA 3UT0A 1E0SA 5CG2A 4FGUA 1KI3A 4OQFA 4PN7A 4KPGA 3CEJA 4NCXA 3VDNB 2WTBA 4U2KA 5CNKA 5KAPA 1ZJYA 1JLHA 4TLCA 1QDUA 2V3CC 5A7HA 1M33A 2OKGA 1OGYA 2XQKA 3LXXA 3PUVA 3T7JA 1Y9JA 4RA9B 1CUGA 4AZ0B 4LC1A 3GCZA 2D5CA 5CVCA 4NJEB 3GRPA 3CRQA 1VHTA 4NVRA 4ZVQA 2NUPA 1T3LA 2FJPA 2XUQA 3IUPA 3PQ7A 3NPMA 1I5OA 4X8OA 4AJOA 4NBNA 3VNBA 2Q5IA 3ORSA 1II8B 3ZJ4A 5BR8B 1RCFA 2LDBA 2J7PD 4B7AA 1KR2A 3BBLA 4O4IA 4EDHA 3K0CA 2PRSA 2EIXA 3PQ3A 5IJZA 4KQHA 2YS6A 2PZBA 3OURA 3K9HA 3N70A 4HXFB 1OI2A 3I8SA 3NKFA 4WBNA 3PHLA 3B2NA 3PL5A 4X60A 1GQOA 5KNCD 5ILOA 4WVLA 3FVVA 3OFND 3AJDA 1LDMA 3MUOA 4LQLA 3G6WA 3UAGA 2QZ9A 4A8TA 1L8AA 2PV7A 2W6ZA 3C3EA 3INGA 4QJ3A 4MB0A 4FXPA 4ZCPA 4HLUC 1JECA 4K9OA 3SBDA 4D80A 1E2LA 4BJ1A 2WV9A 1L7BA 1ESEA 1DTSA 2VJOA 3PQDA 5DHRA 1JKIA 4H08A 3F4KA 2ZQ5A 2OSVA 4L8VA 1JHOA 3CG4A 5L6MB 2IHYA 2FFRA 3PFFA 2IUUA 2V1XA 3WBBA 1G6KA 3I0ZA 1U0TA 2OD9A 2XGSA 1ORTA 4V2IA 3UHFA 1P73A 2XRZA 1DHRA 1QU3A 4UOQA 1YMUA 3BX1A 5ILGA 1FRNA 2KW5A 3EFOB 2M1ZA 4PWYA 1FRZA 1RXUA 3MA0A 4JHLA 2DPMA 1JU3A 2PUTA 1U0EA 1MGPA 1TD9A 3IP5A 4FXOA 4NONA 1L5KA 4IZHA 1XEAA 3SYLA 3Q3EA 1V5EA 4PTLA 1TKRA 5DHTA 3V4VB 4W5JA 3DC2A 1Z4KA 3NBZC 3AUKA 4L0DA 5ERXA 3DOJA 4UUAA 1EUZA 2BGJA 4K88A 4ITVA 4KXQA 1JHMA 1OE0A 4LDJA 3ETNA 4C04A 3Q2IA 4F06A 5HR5A 1RWQA 3UK2A 3RVSA 4CKBB 2FPGB 4JXXA 1UFKA 4R0NA 3AV0B 2NAFA 3E05A 3H9BA 1RAFA 5DEIA 2X0EA 1HR0B 3ORRA 1FTWA 3ZU2A 4ARZB 2FLWA 2PNFA 2YIMA 4F2WA 1S2LA 3TD9A 5IKXA 1O0CA 1TL7C 3K31A 4YVFA 2DLNA 3ORFA 4I50B 3NJRA 3SF8B 1G60A 3S44A 5JVDF 2ZBGA 3BXZA 3AIKA 4JQSA 5EE9A 1B6RA 2C99A 2BJVA 1COZA 2VQFB 1RACA 1IJBA 1D0VA 1AXEA 4HZIA 3R6WA 2I2AA 2OZLA 2X2OA 3IT0A 4IKPA 4ZPXA 5KVAA 3GLGA 1IBRA 4JZKA 1NTOA 2HU8A 3UUWA 4KFUA 4W8OA 5D84A 3L1KA 4TTVA 5IUNC 3B60A 4LNUB 1U1FA 1URPA 2BM1A 5AKGA 3SJAA 4E88A 2HWUA 3R8FA 2TMKA 3KOWA 1KZ6A 2IHKA 4RPCA 3TSAA 4DGSA 1AUOA 1KO4A 3DKKA 4F4DA 2VLBA 3JQAB 1MXFA 3NVKI 4ZCSA 3TZ6A 1VMIA 3ZLBA 2JBAB 4RDHA 3PR3A 4M0KA 5EXSA 2JNWA 4M21A 1FU4A 1R0YA 4NDNE 1Q15A 4FYHA 1U8EA 5KCMA 2PRIA 1ZIXA 2WF8A 3RSLA 4UOZA 2Z4SA 5KC9A 1NW4A 2N47A 3M4NA 3L7MA 2AZDA 2EZTA 2DLCX 2GWHA 4FHEA 2CVFA 1XMSA 2HK7A 1SD5A 3HCPA 4BO6A 3L4BA 5L8VA 3FTDA 1M3SA 1VB3A 1L5QA 3B7PA 3JVIA 3N6VA 2X9NA 1PL0A 3SQLA 4B85A 4BFLA 4X1IA 4TWZA 3WQBA 3FGOA 1ECGA 4PHFA 3C6KA 2OOKA 4U5QA 2WZDA 1YI8A 2JA2A 2CMGA 5KKNB 1N75A 5CVDA 1F4LA 3QH4A 3T4PA 1W4AA 4P3PA 2C8JA 5CB6A 3ZJ5A 3KQLA 1U4NA 3NBQA 1XPOA 5JTUA 3BL6A 3BMQA 1ITZA 5JROA 1OB2A 3CLSC 1E6CA 1G0OA 2F64A 2AC2A 1DNPA 5LQKA 1W49A 3U7JA 3ZLVA 4RIHA 4C4RA 3P94A 5H16A 3RYTC 1MORA 1P0MA 4EQ6A 5A7FA 2JBHA 1G8KA 5HF9A 3WA7A 3LFUA 3O8OB 4WD3A 4C7JA 3GVPA