1EZ4A

Crystal structure of non-allosteric l-lactate dehydrogenase from lactobacillus pentosus at 2.3 angstrom resolution
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
317
structure length
307
Chain Sequence
SMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGALVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKERVIGSGTSLDSSRLRVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGVSDDDLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAIIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LACTATE DEHYDROGENASE
publication title Crystal structure of non-allosteric L-lactate dehydrogenase from Lactobacillus pentosus at 2.3 A resolution: specific interactions at subunit interfaces.
pubmed doi rcsb
source organism Lactobacillus pentosus
total genus 110
structure length 307
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2000-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ez4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ez4A02
1Z74A 3FWZA 1YBAA 2PD4A 2Y0DA 1DBVO 3RD5A 1B2LA 4JN6B 3ZV6A 4EJ6A 1X7DA 1I3NA 3WWYA 1K6XA 2OOSA 3QIVA 4I9UA 4OH1A 3C1TA 1SOWA 1XSEA 3ANNA 4QO8A 4QEDA 1XIVA 4R1TA 2P2SA 3K30A 1LBEA 4FC7A 2H6EA 4U7WA 4NG5A 3WGGA 4PVCA 3GUCA 4BO9A 1EMDA 1FXSA 2I66A 2VT2A 1ENPA 4ID9A 4W7IA 5FI5A 5T8KC 1PWXA 1E6WA 1I2ZA 2XXJA 4CLRB 3GZ4A 5I8ZA 5F5LA 1M6HA 4GWKA 1LTHR 4XJTA 1AXEA 1KS9A 3WMXA 3M2TA 2W2KB 4J1NA 4LW8A 2R2GA 3BMQA 4LCJA 3F3SA 5CDUA 4LK3A 4ZGWA 3WLFA 3ZU3A 1NTOA 1PJSA 4WECA 1JDJA 1LX6A 4KDFA 1M67A 4FBGA 3I9MA 3L77A 5C7IO 1GD1O 4YT2A 4RCVA 4XKJA 4U0JA 4K6CA 4TRMA 2AEFA 3RAJA 3F1LA 1ADCA 1EK6A 3H9UA 4NDNE 1BMDA 3AUTA 5F3RA 2HMWA 4CUJA 4Z9XA 4ALNA 1F8GA 2IXBA 1C1DB 1VJ1A 4EGFA 4DPLA 1O9BA 3GVCA 1X0XA 2BGKA 4GLOA 3H9QA 3ZWCA 2UYYA 2WM3A 3S1LA 4BKRA 3V1TC 4LGVA 3ZDFA 1RYEA 1H6BA 4DPMA 1WZIA 3JQGB 3I1JA 5MGBA 1R4NA 2CDCA 1M66A 3ZV4A 2P9GA 4UVEA 4IDGA 3TZKA 3HB5X 3IP3A 4FFMA 3GRKA 2FOIA 1O6ZA 1V3VA 3EZLA 2HKIA 3RUFA 5C7OO 1DFGA 1ZW1A 3MJEA 4BV9A 1DDOA 5IN4A 1ZSNA 2WWRA 2RCYA 4IS2A 3I9LA 4BNIA 4IXTA 5IF3A 1UDCA 4CMEA 2X9GA 1K0UA 2W98A 2Y0CA 3PQEA 3ETDA 4P4GA 1BHSA 5DZSA 4QFCA 2PGLA 4BO6A 2Y66A 4WGGA 3NUGA 3VZSA 5C5IA 5ITVA 2WTBA 2FP4A 4A5OA 4IQ0A 1JKIA 1JAXA 3RJ9A 2Z95A 1KEPA 2PKQO 3DZKA 3PGXA 4YT8A 3MTJA 2BD0A 4LSWA 1Y5RA 4DLBA 2WE7A 4NPCA 3MWEB 4XDYA 2CY0A 2X9NA 5L3ZA 3IS3A 3NEPX 3W4KA 1VSVA 2ZCUA 4CQLB 1LDYA 4IS3A 3WNVA 1DIBA 1DPGA 5BSHA 2Z1MA 5FI3A 2HU2A 2ZK7A 3JYOA 2B0JA 3IUPA 4XWYA 3CSDA 3QVXA 4LN1A 1GV0A 4KTVE 2FSVA 2GZ2A 1BRMA 3KB6A 4RGBA 5TNXA 3VZQA 4DIBA 1HDOA 3DR3A 2AQKA 1LDGA 3LC1O 5CHEA 3NAQA 4BQRA 1E1NA 1KOLA 4IDCA 1ISFA 1WVGA 3TL2A 3RUIA 2BRUA 4PLZA 4WPGA 1RM4A 1LC3A 1V3UA 4XRRA 3EK2A 4BUCA 3DZJA 2Y0EA 1KBZA 4XYGA 2VNAA 1O0SA 1IZ0A 2J3KA 3ULKA 1A4IA 2VHXA 4EEXA 1UXKA 1RWBA 2AQ8A 2PGJA 3WS7A 5ITWA 2D4AA 2JD1A 5T5QA 4HBGA 4CMGA 1E3IA 3EMKA 4K1LA 4QECA 3GGPA 5H82A 1NAIA 1ZK3A 3OJFA 1ZEMA 4DVJA 4DA9A 1VI2A 2IXAA 5CDYA 5JPIA 3EDMA 3D5QA 3E5MA 3T4EA 5IFLA 1E3WB 4XQEA 3F5SA 2WYUA 5DP1A 5ENVA 3WQSB 3PHLA 3ASVA 3BHJA 4BMSA 4IQGA 2X22A 4DYDA 4RVHA 3SLKA 1NAHA 3D7LA 4Q3BA 1G1AA 4ZRMA 3N7UA 1Y6JA 5F21A 4KUEA 3A9WA 3KV3O 1PJBA 3SXPA 2EERA 4EI2A 5COBA 2TMDA 2YV3A 1R12A 5KJ6A 5DCWA 4BNHA 4DTIA 1I2CA 3JQAB 1GPJA 3ZHBA 1HZZA 2VRCA 4HNGA 3IDSA 2EHDA 4J7CA 4MVJE 4FFLA 5CEJA 5JYEA 1YQDA 4DREA 1H93A 4RVSA 2O4UX 1GQQA 4AJ1A 4ZQEA 4JNKA 2Q4BA 1YE3A 4RPHA 1ZMTA 1YGYA 2GGSA 5F1PA 2CDBA 2E49A 3U49A 1GR0A 2DBZA 5ER9A 3GPDG 1SEPA 3JD0A 4KWHA 1NFRA 4ND5A 3WTBA 4EJ0A 3C7CB 4TMFA 4JJIA 3KUXA 5H81A 3W4IA 3FHLA 2RBEA 3ITDA 4E5KA 5BQFA 2PKRA 5ER6A 4BO0A 1X14A 2FPIA 4E0BA 5I9LA 2NNLD 4FIZA 4GVLA 3WOHA 3ZNOA 2IRWA 1C1DA 3GHHA 4FJ0A 1XKQA 3X2EA 3ZNNA 3GEDA 3W1VA 3JTMA 1YO6A 5IDYA 2FR8A 3AM5A 4RO0A 3GA0A 2QZZA 5TC4A 2H5LA 3GVPA 3MJTA 2RHRA 4RLSA 1PQWA 5DF1A 2GN8A 3QRWA 4XYLA 3B20A 3G3EA 2P9EA 4YRDA 3PLRA 1UZMA 4W7HA 3DMTA 4FJ2A 3TPCA 1PSDA 3ONFA 1E7QA 3DEYX 3HWRA 5T67A 3AI3A 3MEQA 1FJHA 3OJLA 1UH5A 3Q2KA 4N54A 4GWGA 3C7DB 4GKBA 4URFA 3CMMA 4W4TA 3U3XA 4EUFA 1DFIA 2I6TA 2PD6A 1QP8A 4MVJF 5CPBA 4PGFA 1FDWA 3OQ6A 3ENNA 3KYDB 4J4TA 4WE3A 4YBZA 4GX2A 4D7AA 3ZU5A 2X7HA 1EUCA 3WDSA 3T7EA 1YQGA 3KSDO 1P31A 1JVSA 5CP8A 5G4LA 4U6QA 4RPLA 1R0KA 4NBRA 3O03A 3ZH2A 4CMIB 3L4BC 2Q2QA 2O3TA 5CDTA 2Y68A 4S3MA 2GZ3A 3ADPA 1IY8A 5L45A 1HEUA 2ZB3A 1U4OA 5I8WA 1Y8RA 2O3JA 1ADBA 4HKTA 3HFSA 4KQWA 4KUGA 1HLDA 1VLLA 1ZO8A 1NVMB 3BHMA 4LVCA 4NBTA 4EYEA 4J16A 4RVFA 1BGVA 1YDEA 2YQ4A 4OO3A 1B0AA 1QYDA 2ZATA 4K28A 2BH9A 4KQXA 2ZYAA 3GUYA 1SZJG 1U8FO 3NT2A 4CQLA 1K6JA 3GQVA 1PJ3A 4I1IA 2PGDA 1B15A 4G5HA 2IYPA 4W6ZA 2GDZA 1ORRA 1FDTA 3H3JA 3U4CA 4MP3A 2PA3A 4OHUA 1OOEA 3MJ4A 3ST7A 3WIDA 2FR1A 4YJFB 4AJJA 1UP6A 4XYMA 4ALMA 1D8AA 4WEQA 2C29D 3JQAD 1S7CA 2DBVO 4WNCA 4OYRA 1YOVB 3I5MA 4MIYA 4PLPA 1DRWA 3MZ0A 5DOZA 3HDQA 1PR9A 2VYNA 4M54A 4TRJA 3ZHZA 4PG8A 2EKQA 3OSUA 4DMLA 4C7KA 2E37A 3UFXA 4ZHSA 1VL0A 1I10A 1P0CA 1PU2A 2J8ZA 4L8VA 4XGIA 3Q3CA 3ZWYA 1I8TA 2VN8A 5IJZA 1DC3A 2X9VA 1QR6A 3D0OA 2J5RA 1WWKA 3V1UA 4RF2A 3GH3A 1JLLA 4NIMA 4P38A 1ONNA 4PFJA 1W4ZA 2WMDA 2GO1A 2ZYGA 1LDMA 3BMOB 3FF4A 4Q3DA 3ZWOA 4K26A 3ZW9A 3JQBA 4XX0A 3E03A 3JV7A 1CETA 1DIAA 1IE3A 4DQUA 5C3MA 5L95A 1KERA 3DFZA 3E18A 2WDZA 4FJ1A 5TRTA 4Y6RA 3NTOA 4MO2A 4BNUA 4D43A 2NQTA 4UULA 2XXBA 1EVIA 1WZEA 4B3IA 4RVUA 2PZKA 3KO8A 3ROQA 2ZTUA 2X5KO 5T6BA 5IN5A 1A71A 2ZTVA 4QTZA 2RH8A 1PGOA 3GZNB 3ZWWA 1TA4A 1PJ2A 2DFVA 5ICMA 5HS4A 1K2WA 5KOIA 4DIOA 1CDOA 4FGSA 3DZBA 1PZEA 1JWBB 5THKA 4FB5A 5ENDA 1OBFO 1OFGA 2Q50A 1ULSA 3JD3A 1M2WA 4J4BA 1PL8A 2WE8A 4PLGA 4AJLA 3B1FA 2D1YA 1MGOA 3V8BA 1LLQA 3WYBA 1YDWA 3AI1A 4B3JA 2D59A 1PGPA 4NI5A 4R9SA 1QYCA 1P1IA 1P9LA 2EKLA 3K5PA 3ZHYA 4A10A 4BNJA 2WJPA 2UDPA 4TVBA 4JROA 1L7DA 2VTDA 3RUHA 3NJ8A 3FTNA 1A72A 4H7PA 1EVYA 3EHEA 2D8AA 3QE3A 4Q3EA 2BF7A 5G4KB 2NVWA 3WMWA 1JTVA 2J5KA 3GDOA 2DC1A 1DEHA 3G1UA 3S2IA 2NQ8A 3EGOA 3QWFA 4QSMA 2D0IA 1PJ4A 3KYBA 3I3OA 5K6AA 3SC6A 1DO8A 3SJUA 4BO5A 2NU6A 1LLDA 1NPDA 1A7AA 4B7UA 4ZN6A 2UV8A 4DQVA 3KYDA 3U62A 1F12A 5L40A 4MIOA 1E7RA 2O50A 3EYWA 4YAGA 2UUPA 3K92A 3W8FA 4NJOA 3VC7A 4CMIA 1YB4A 2GSDA 2G17A 3KETA 4BHTA 4GBJA 4BO8A 2JL1A 3NJ4A 4D41A 3LQFA 2B5VA 3ZNQA 2P5YA 1I01A 3L9WA 1LRLA 4IXWA 5JLAA 4E3ZA 4DC1A 4ZQGA 1EBFA 1UAGA 3RUDA 2GASA 4YJHB 2AA3A 3L6EA 1R37A 3C8MA 4AJEA 4BO7A 2JJYA 1ENOA 4OXKA 1KVQA 1MXHA 1LLUA 3RKRA 1IHXA 3P7MA 5CPFA 3EY4A 4HV4A 2WYWA 3RUAA 3Q2IA 3JQ9C 1F17A 2J3JA 5COAA 1G0OA 4HUJA 3OA0A 2Q46A 5A06A 1NBOA 1YVEI 4YJFA 5FF9A 3OEWA 3Q6IA 5KVCA 2ZIZA 5BNIA 1ZIDA 2HCTA 4BNVA 1X1EA 2I3GA 4NR0A 4UVHA 1HTBA 2AE2A 5EIOA 5HBRA 4AL4A 2P4HX 1Q0HA 1ZFNA 1C0PA 4BL5A 3ENKA 3JYNA 3OFSA 5DULA 6ADHA 3PYLA 5K9ZA 1GL3A 3EUWA 1D4FA 4MINA 1KY4A 3DOCA 3PVZA 3SC4A 1J49A 4IDAA 4BVAA 3H2SA 2FSSA 1NR7A 1TT5B 3D3EA 3RWBA 4E32A 5KKAA 4N18A 3UGKA 3BMOA 4KMSA 4Z9FA 2G5CA 3HDYA 4IINA 4GX0A 4G65A 4RVDA 3BTUA 4ALKA 5L53A 3AOEA 4GSLA 4BNGA 3IJRA 1A7KA 1NM5A 3DZHA 3VZRA 5ICSA 5JAMA 3HN7A 2FN7A 1V8BA 3NDIA 1SB8A 3NT5A 4FFOA 1CERA 2BGMA 2YY7A 1I36A 1Q7CA 2VHYA 5TX7A 1E3LA 1HDYA 1O94A 1QXSA 4WEOA 3TQHA 3ROMA 1Z82A 2E48A 1PTJA 2BFAA 3LLVA 4U6SA 1EUDA 1S6YA 1MP0A 4O59O 5LDGA 5A9SA 2POQX 3WTCA 5CEEA 3PJGA 2NWQA 5T8KA 2IZ1A 5TJ9A 4Z0TA 3I9JA 3V1YA 3GZNA 4M87A 2O48X 1NR1A 2W8ZA 4LCEA 4WNIA 5JDIC 3F47A 5KKCA 3TF5A 3PHGA 1C14A 3R6DA 4E2ZA 2B4QA 5A4DA 3F1KA 3JQ7A 1HWYA 4WJZA 1LUAA 4A2CA 1XEAA 1P45A 1GFSA 3GC6A 3H65A 2EXXA 2AQIA 3UCXA 2E82A 1N8KA 4CM6A 4DLAA 3OBBA 4OQZA 3UF0A 1P0FA 2X58A 5JO9A 3GAZA 2Q2WA 3A28A 1T1SA 3GDFA 2VWGA 3I9KA 1PJQA 4JBIA 3WQRA 4IJVA 4TKMA 2E6UX 3A1NA 1T2EA 3GEGA 2O3QA 3TWOA 5JDCC 4EUHA 3O8QA 5L51A 2Z1NA 1EEHA 5EQDA 5G4KA 4AJHA 4X54A 1Y8QB 3MJSA 2X0NA 1GTMA 1T24A 3OIFA 1C0KA 3UOGA 2VNSA 3UW3A 5IXSA 2RAFA 4UUMA 4DUPA 2WYVA 2BFOA 4W9NC 3O4RA 4B8WA 4D45A 1A4UA 1ZZEA 4L76A 3PPIA 3JQFC 2NUAA 1LSJA 1HZJA 4MP8A 4J1QA 3ANLA 1U7HA 4N5NA 3CE6A 4XQCA 4WLOA 4RV9A 2EWMA 3CIFA 4E5MA 3OETA 3DBHB 3VTZA 4MDHA 4FFRA 4M55A 2A92A 4YJHA 1LEHA 4J2HA 5B4VA 5G0WA 5TIIA 5CAEA 4D3SA 3ZV5A 3OIGA 4B8ZA 1I33A 5BSGA 1YB1A 2C20A 1P33A 3H8VA 1DRUA 4GVXA 4IDEA 1KEUA 1W8DA 2C7GA 3F4BA 4MKZA 4BMNA 5EERA 4CM8B 3BMNB 4BMVA 1KY5A 5KTKA 1AUPA 1K89A 1EE9A 4CV2A 3C1OA 2Q1TA 3K73O 1E0DA 1UUFA 3JQ8B 1ADGA 2CZCA 1LJ8A 4A27A 4YJDA 3JYPA 3WGYA 4FW8A 3W6ZA 4J6FA 4BIIA 3G0OA 2X1HA 4BB6A 1CJCA 4IPTA 2VHVA 2OP0A 4A7PA 5BSFA 3B1JA 3KEOA 2HRZA 3VPGA 5B4TA 1C1XA 4BKUA 3ZWPA 3OQBA 2EIHA 4R54A 1M75A 1MC5A 2ZQZA 3OF2A 1U3WA 1T2DA 2IZ0A 3IJPA 5G0TA 3OA2A 1GCUA 5DCYA 1TT5A 2QZ9A 4E12A 1WNTA 2CNBA 1BVRA 3TJRA 5I7SA 5EESA 4HADA 1BSVA 4DIFA 1A9YA 4NU6A 1M6WA 2A9FA 2YDXA 1J4AA 3V5NA 4BO1A 2WD8A 4UUOA 2BELA 3H3FA 5COQA 3UH1A 5CFZA 1U5AA 1ZJYA 3I23A 4YEDA 1HDCA 4JJGA 2OGUA 4UEKA 1RKXA 1VRWA 2I65A 2Y1OA 4E5YA 2NTNA 2WEKA 1BXGA 1PJTA 1D3AA 3HE3A 1I30A 3L6DA 3OM9A 4L74A 4PLCA 4XIJA 3RFXA 1VC2A 3WGQA 3E9QA 1MLDA 1GCOA 2OBNA 4ALLA 4YYZA 4GAEA 4R41A 1GYQA 3GNQA 3OMLA 4EZBA 3LT1A 3RU7A 5AXAA 2Y99A 4CM1A 2YYYA 3AOGA 4TWRA 4N5MA 2HUNA 1EDOA 3VH4A 1PQUA 2AXQA 2YZ7A 4J7UA 1LXCA 5AQ1A 5U9CA 4E30A 3PQFA 3D3WA 2X23A 1NPTO 2FZEA 2DPHA 1CQJA 1LA2A 1IHYA 1YBMA 1TI7A 4GGOA 3FR8A 3R1IA 4KP7A 1K6IA 5DN9A 3D4OA 3FCOA 1CIVA 3GK3A 2DT5A 3GG9A 1ULUA 2JCXA 4CM4A 3I6IA 1OMOA 1P77A 2D2IA 2NV6A 4ONEA 4YJGB 5BNTA 4ND2A 3F9IA 4KTTE 2Q4EA 3ZI0A 2VQ3A 4CUZA 5I7EA 3ZWBA 5L7TA 4B4VA 1DC6A 3ZV3A 3WLEA 4OKNA 4OOEA 4R1SA 3RUCA 4BO3A 1ISMA 1HYEA 1SOVA 1Y8QA 1R4MB 2QG4A 2HQ1A 1YB5A 3WGZA 1LSUA 2GCGA 1ZK4A 5DBGA 5BSEA 1NFQA 3OIDA 4NFHA 1I0ZA 3BAZA 2F00A 3KM0A 3T7CA 4DC0A 4O5OA 2NM0A 5A3VA 5HA5A 4RJTA 3X2FA 2ZB8A 5DT9A 1ZNQO 3Q0EA 3FNHA 4S1VA 3WSWA 1E5LA 4BNNA 3HG7A 4E21A 5JFOA 4IM7A 4XYEA 1MC4A 3FPLA 2Q45A 1DIRA 1X15A 4CR7A 4UAGA 4D42A 5U4QA 1EZ4A 1YWGO 4H16A 2JAHA 5KCZA 1PGNA 4CODB 4B4OA 4D3DA 4PCVA 4BNTA 1NWHA 4EDFA 3L4BA 4CLRA 4HXYA 3QWHA 1JKFA 5ILOA 3CUKA 4BQPA 3TZHA 1GQ2A 3Q11A 1H9AA 5BT9A 2VT3A 1H9BA 4INAA 2W2KA 1GADO 1B8PA 4M86A 2O3UA 2RHCA 4F46A 1LU9A 3GR6A 3QJ5A 3WJAA 1Q0LA 3KHUA 4M1QA 1Z6ZA 2P4QA 1N7HA 2OFPA 3CTMA 2GLXA 1JAYA 1TVEA 4IZIA 4UVIA 3MJVA 4XR4A 1NXQA 4CMJA 5A04A 3EC7A 3AM3A 3AM4A 4R68A 2HJRA 4J43A 4LRSB 4LSMA 1I5RA 5TSDA 3BMNA 4YCAA 2GR9A 1HYGA 5TS3A 3TFOA 3U4IA 2DUWA 1GPDG 3H9GA 4PLHA 1XG5A 3GLQA 3LT2A 5KWEA 3SBOA 3H5AA 3AUAA 4FS3A 1H5QA 1GEEA 2I3AA 5IXYA 3JSAA 1HF3A 4N5LA 1MV8A 2OBYA 9LDBA 5B4UA 1HT0A 3I9NA 3LK7A 3VH1A 3JQGA 3DHYA 3TSCA 3TZ6A 3TL3A 3WG9A 3FRJA 3C7AA 3FBTA 4JJFA 4Q3CA 1I3LA 1UP7A 4ILKA 4FSHA 3ZN2A 1PWZA 2A94A 3VPSA 4E5PA 1O89A 3RKUA 3DFUA 1B7GO 4OM8A 1W73A 3B1KA 2DUUA 3UICA 2P5UA 3E9MA 4E13A 1WMBA 2AE1A 5JBIA 4J9VA 4XR9A 4EW6A 4I5FA 1Y9AA 3C3XA 4DXHA 1CWUA 3GY0A 4W99A 4CV0A 2BI7A 4NNJA 4RPGA 1AHHA 1E6UA 1WXDA 1HL3A 2EW8A 3AFMA 4BGIA 3I9OA 3DAPA 3Q9UA 2V65A 3SEFA 3G79A 1IPEA 2R00C 3PIIA 1BTOA 3H2ZA 3KLPX 3WIEA 3OJOA 2CD9A 5KVQA 4F3YA 1E6EA 1BXZA 4TROA 1ID1A 3AU8A 5KJCA 4II3A 1QORA 1P1JA 4IJKA 2CF6A 5JAIA 2J5QA 3GVHA 4JP3A 5L4SA 4MVJM 2VUUA 3RFVA 3WFIA 4J9UE 3K2EA 2B36A 3PFWO 3DB2A 4CLEA 5K0ZA 4GQAA 2IE0A 4HX5A 2HAEA 4OGWA 4IDBA 1DJQA 4I9NA 4XDZA 1ARZA 1TXGA 2X4GA 2WSBA 2OORA 4AVYA 5A9RA 5JE8A 1WDLA 3NKLA 4BGEA 4CMBA 1Y81A 3TNLA 1NASA 3WNQA 4DQXA 3H5NA 3DHNA 5A9TA 5EL0A 1E92A 3L9XA 2JD2A 8ADHA 4KUHA 2P91A 1U1IA 4L73A 4YAIA 4Z3KA 3BZUA 1HRDA 4BKQA 3AY3A 4YRBA 4FD3A 1EVJA 1KVUA 1B14A 4NU5A 3VH3A 2X0JA 2RH4A 4II2A 4FOSA 1OAAA 1NYTA 2DM6A 1R6DA 1T4BA 5ADHA 4CL3A 2VOJA 4R16A 3DZFA 1U5CA 2B4RO 3NGLA 4XRGA 4R51A 3JD2A 4NHEA 1X7HA 4GX1A 4YAEA 3GOHA 4H3VA 3S2GA 1GUYA 3M2PA 3TRIA 4E2YA 1K5HA 1DSSG 3WYEA 1E3WA 1HE5A 4ZD6A 2VTEA 1IB6A 3INTA 5HTOA 2NLOA 3AWDA 2GN9A 4CLOB 4Q39A 4PZDA 2NSDA 1Y1PA 4ZQFA 4L4XA 4PRKA 3ZWXA 1LLCA 4GLLA 1Z73A 1W0CA 3M6IA 4DBZA 2X6TA 1T4DA 5B12A 3QVTA 5AOVA 3QY9A 1ZXLA 1UAYA 2WD7B 2QRKA 3TZCA 4CM5A 4OQYA 4J1SA 4OKIA 3JQAA 2RIRA 4NQZA 4NBWA 4XQ9A 3VH2A 3MCVA 4QX6A 1ZCJA 3GDGA 3K6JA 1VSUA 3WBFA 5HRUA 1LSOA 3DBLB 4YTEA 3CH6A 4DL9A 2OO5A 1FK8A 1GEGA 4XGKA 3BMCB 4K9DA 3STHA 4B4UA 3HUDA 4XEHA 4ESOA 1NX6A 1XLTA 1KIFA 1DRVA 1QSGA 4C4OA 1ZVMA 3RFTA 3ZNPA 3JQ9A 1FDVA 1PZHA 1YRLA 3IP1A 1KC1A 3MJCA 4J3FA 4YQZA 2AW5A 2NVUB 1F06A 4GSKA 3M1AA 1HKUA 4OSOA 1XGKA 3ICPA 4C7JA 1IZ9A 5GY7A 4BB5A 4FFNA 4ND1A 1GV1A 2PLAA 2JFGA 5EMHA 3DZGA 1MA0A 1R16A 2ET6A 2H9IA 2Q1UA 4R5HA 4JP2A 2X0RA 1E77A 2GN4A 4I5GA 1J6UA 1E1KA 2CSUA 4DLLA 5HS6A 2IYOA 3AW9A 2YHIB 3HDHA 2JCVA 2DAPA 3LZ6A 2B69A 3OQ1A 4XCVA 4ZA2A 2UAGA 2HJSA 3QHAA 3FR7A 5TLSA 4JQCA 4PZCA 2FPGA 2EW2A 1LQTA 2QW8A 1LDNA 3GRPA 3MOIA 3PJDA 4D3FA 1YJ8A 5B37A 2X8LA 3AFNA 3BTVA 3HFGA 4I8XA 1BW9B 2OXIA 3P5SA 2YUTA 3IL2A 1PQPA 4P4LA 2HDHA 3PDUA 4WCFC 1V3TA 4ND3A 2YQ5A 3FWNA 3AUUA 4MP6A 2QYTA 1ZK2A 3DC2A 1GZ4A 1HDRA 3RJ5A 4TRNA 3WICA 5DOVA 4OXNA 4ZVVA 5GZ1A 7ADHA 2VWHA 4Z9YA 1G0NA 4MOWA 1GYRA 1XU9A 5TT0A 1I3MA 3GMDA 4CLHA 5L4LA 3VVCA 4RQTA 2ZKLA 2PKQP 3KTDA 1DFHA 1C3VA 2CVZA 1UXHA 1MG0A 4YB8A 3BHIA 1FDSA 1V9LA 1U3UA 3LF2A 1VL6A 1NFFA 1X13A 2DTDA 3ANMA 4NK5A 2PZJA 1P3DA 1Y5MA 2CDAA 2GERA 3DTTA 3DOJA 4TQGA 2VZ8A 4NBUA 4JBGA 4A0SA 3Q1LA 4CLDA 1BXKA 4FQ8A 3HNPA 3F4LA 3GNTA 5JAZA 3H5RA 4D46A 4E4YA 1QYVA 2C7VA 3P2YA 3NYWA 2OZPA 4IJWA 4DBVO 5G0UA 5J23A 1U2GA 1YOVA 2Y93A 2AQHA 2I76A 3FSRA 2Y1GA 5IZ4A 2QRJA 3GFGA 2D3TA 2LDBA 3NX4A 4IZHA 2C07A 4HFRA 4HY3A 4H15A 4FPXA 3VHRA 4E33A 1DHRA 3AY7A 3MOGA 3ABIA 1LI4A 4GGPA 2O2SA 2VZ0A 1B8UA 5G2OA 2V6BA 3K96A 3RASA 4PLTA 9LDTA 2G0TA 1GY8A 5AXCA 4YRAA 3C24A 5JDCA 3A06A 3HHPA 2PV7A 3QA9A 1A27A 3RC1A 1VM6A 1XDWA 1C0LA 3E8XA 1MFZA 3O26A 2DKNA 3GPIA 1QYXA 2C5EA 3RU9A 3PK0A 2BFPA 1KETA 1WW8A 4AJIA 2FHSA 3L0DA 3CZRA 2Q49A 3WSVA 1VKNA 1ZXBA 2ZTMA 2PNFA 3RC9A 4W9NA 4WASA 3FN4A 1U8XX 2CF5A 3DBVO 3FNFA 1Y7TA 1HETA 3FNEA 2GNAA 5DCUA 1G6KA 1QYWA 3JQFA 4BNWA 1I24A 4CUKA 5A02A 1AN9A 5JCJD 4DWVA 1IOLA 4WOKA 1HE2A 5L4NA 1EDZA 3ONEA 4WLUA 3D64A 1HXHA 4NJMB 5JC1A 3PHJA 1H6AA 3ZWNA 1LRKA 4AJKA 3DBLA 2GYYA 3M1LA 1KVSA 1ZK1A 2BI8A 4NFYA 4CMCA 1PJLA 5IG2A 4HNHA 1EQUA 3QW2A 4YPOA 1JA9A 2AG8A 1DOHA 2EGGA 3VPXA 5BR7A 1XR3A 1ZJZA 5JMWA 5EJ2A 4HFMA 2J3IA 3RC2A 1ONPA 1XA0A 3KSUA 3I4CA 4DRYA 1CQIA 4UEJA 4F45A 5LDHA 4NZ9A 3VDQA 3G17A 3I52A 1IUKA 1DAPA 3RROA 4EEZA 1F8FA 3UCFA 1ZSVA 3HQ4O 3W8EA 3QVOA 5I7FA 1GZ6A 1AXGA 1Z45A 3UCEA 1L1FA 2Y1EA 5G0VA 4RQUA 3L07A 1V35A 4XB2A 4BNLA 2O7SA 1NQ5A 2C5AA 4AJOA 1SBYA 3FD8A 2NVBA 1E3SA 2DFDA 5F1OA 3RBXA 2Y67A 3QVWA 3JYLA 1VKOA 2HLPA 3S2FA 3U0BA 1NVGA 2IODA 4RZIA 5T64A 4Y6PA 4J2OA 5CDGA 2FR0A 3OEYA 4RZHA 2XOXA 1PGQA 4MKRA 4YWJA 1B3BA 4GMFA 4IY1A 1BW9A 4Z0HO 1HE3A 3B6ZA 3VOSA 4U8GA 3WR5A 1GQYA 5EN4A 1U3VA 1UZLA 2QHXA 1PR3A 2ZJ1A 4KZPA 4OMUA 3WFJA 4QO7A 1PZGA 5BNFA 2I67A 1YJQA 1P74A 1NPYA 4WOJA 4XGNA 1KVTA 3DQPA 3HN2A 5I9NA 4G81A 4EJMA 2JD0A 3G49A 4NFSA 2I5PO 1T1RA 4ZQBA 4LMPA 3PI7A 1SEVA 3DDNA 4OAQA 1QV7A 4A73A 3IKTA 1LRJA 1O95A 5EPOA 1T25A 2PZMA 1UDBA 2R6JA 4J4HA 3EAGA 3JQDA 1C0IA 4BV8A 2PR2A 4L4RA 4AJPA 1B3RA 1ZUD1 1YH3A 3AI2A 4IDDA 5H83A 4F6CA 3HJAA 1XQ6A 1ZK0A 3VDRA 4QXMA 1XU7A 3LYLA 2X5OA 1DLJA 4YT5A 1QG6A 4ALJA 2BLLA 2C2YA 2HMTA 2V6MA 5LCXA 3RC7A 5IZCC 3BXXA 5JY6A 2A4KA 4ITUA 4R1NA 3OP4A 1VJ0A 2BKAA 1EFKA 4XJSA 4CM3A 4RDHA 1GUZA 4QUKA 1WPQA 1T2AA 2CVQA 1UP4A 4B4WA 1NVTA 2EP5A 1Q7GA 1PS0A 2E4AA 2O2YA 2TMGA 4BGUA 2VUTA 2IEDA 1YL6A 4FC6A 3T4XA 4Q3NA 3KLMX 4DMMA 3PXXA 4TSKA 2HO5A 4LVUA 3LDHA 2J6IA 1PIWA 3NGXA 4CPDA 3H4VA 4IQ8A 1A9ZA 1RYDA 1A5ZA 3UHAA 4PLVA 4WLFA 7MDHA 5IDWA 1ISJA 2GRAA 3EZYA 2LDXA 2HSDA 4E2XA 1JW9B 4O1MA 3PLNA 4IGFA 2ZB4A 2Y1DA 5DBFA 2CFCA 5A5FA 4ALIA 2F1KA 3KBOA 3GF4A 3ITKA 5AXBA 3RBVA 3PWZA 3K31A 4NH4A 1EVZA 4I5DA 1QMGA 2B83A 1PL6A 4U0KA 1HDGO 1GU7A 4Q9NA 5L7WA 3INGA 4Y6SA 5JAQA 1U7TA 2D5CA 4BNFA 1B26A 3BTSA 4GI2A 2XAAA 4A26A 2O3RA 2FRDA 1SPXA 4QFDA 1R15A 1H0KA 3GAFA 2FWMX 3UXYA 3ZWMA 5HM8A 1HLPA 3NRCA 2C54A 2EJWA 4RDIA 3WYCA 4ZJUA 3IC5A 2YV1A 1TEHA 3LU1A 4NJMA 1D1TA 3R3SA 2ZYDA 1WDMA 2QYSA 3ZGYA 1R0LA 3V2UA 3PHHA 1WAMA 2I99A 4MKXA 1I32A 2CMDA 3V2HA 3BA1A 1Y8RB 4OL9A 2O3SA 4OSPA 3ONDA 2ZTLA 2G1UA 3ZW8A 3R0IA 5KVSA 2VYVD 3HB4X 3PYMA 1SMKA 3H6KA 4OXYA 4ND4A 3PHIA 1XWFA 2ZCVA 4GX5A 1FF9A 1KVRA 4XYBA 1N1GA 3CINA 3GGOA 2X5JO 2UVDA 3IUSA 4RLHA 4WLNA 5JMPA 1GUFA 3GVXA 1H2HA 3JQEA 4WKGA 3AU9A 1PX0A 2DTEA 1PEDA 1YKFA 1JVBA 2JHGA 3B70A 3JYQA 3E82A 5JC8A 4QT0A 4XIYA 2PD3A 1PS8A 3ZWAA 1RM3A 3IQDB 4UVGA 1GAEO 3UN1A 4XA8A 2EV9A 3ROKA 4WK6A 4TKLA 2VRCD 3D4PA 4OIMA 2PK3A 2SCUA 1WP4A 2IZZA 4JX8A 2PH3A 4IIVA 5IDQA 2AG5A 3U5TA 1NQOA 5TJHA 1F14A 2GD1O 4MVJG 1M76A 1WMAA 5JCXA 5JYDA 3LT4A 2Q2VA 3UUWA 4IMPA 1W6UA 4IJUA 3WB9A 4R01A 4YACA 3PGJA 4Q3AA 5A05A 4LMRA 4DYVA 1DIHA 3VTFA 4WCFB 3FTPA 5A5EA 2PTGA 5DDIP 4CV3A 1DXYA 4RORA 3WGIA 4OOFA 3QV1A 1NQAO 1N2SA 2VYVA 4PN3A 4CMEC 2R00A 1NHWA 3LT0A 3S2EA 1BWSA 4Y98A 4HFNA 1DLIA 1QV6A 2DBQA 3DBHA 1FMCA 1N9GB 1DB3A 2VZ9A 1CRWG 1ZSYA 1U9JA 4YDRA 4GPD1 3RCBA 3ZHXA 2QRLA 4MVJH 3WX0A 4ZICA 3DBRB 3IOYA 3PWKA 4MVJP 3O38A 1XCBA 3H9EO 4UREA 4Z0PA 5JO0A 1AHIA 2HMSA 1RM5A 1Q0QA 2VHWA 2Y1CA 3PIDA 5AVOA 4CM8A 4MJLA 3GN2A 4I5EA 1OI7A 4R1UA 5JW6A 2VWQA 4JLWA 1HDZA 4CMKA 1ISGA 2EKPA 3QVSA 5F5NA 3EVNA 1Q1NA 2I9PA 2W90A 1LDEA 1PJCA 4CV1A 1DHTA 4JK3A 3RSHA 3PDJA 3D5TA 3SX2A 3LF1A 2NU7A 1O8CA 2Z5LA 5FWNA 4RF3A 4PIVA 3LVFO 3GT0A 4GH5A 4WUVA 2YV2A 3JQ8A 4MVJI 4L0QA 3F6YA 4GL4A 3VAZA 4QQRA 1NNUA 3PP8A 3OHSX 5A03A 4CR8A 1ENZA 3DOOA 3IMFA 3HDJA 3LSYA 1SAYA 1ONOA 1P44A 2C59A 2EG9A 5ILGA 4IDFA 4BNKA 4ZQHA 4CM9D 2HK8A 3JQCA 1JQBA 3ORFA 5DBIA 2PY6A 1EQ2A 3DHEA 2NU8A 3ZZNA 4NMHA 1SNYA 2A35A 3L6OO 3S8MA 3IIEA 2PWZA 3NTQA 1B8VA 3C1AA 2DBRA 3CZMA 1T26A 3JCZA 3OECA 4MVJD 4AJ4A 4PLFA 4F6LA 3KRTA 1MG5A 4E5NA 1UXGA 3NV9A 3QWIA 2NADA 2PZLA 3GFBA 3SLGA 1P1FA 4O0LA 1UZNA 2GUGA 4IIUA 1GZ3A 4KWIA 1XYGA 1U2DA 4UUPA 1VE9A 1D7OA 3AJRA 3MTGA 1YQXA 4B7CA 2JHFA 2O23A 4PZEA 4CR6A 5IDXA 4R4JA 3ETGA 1BG6A 4WLEA 2HK9A 4R69A 3WGOA 2AHRA 1Q2XA 2DVMA 2HMVA 2J3HA 3C85A 4HWKA 5GZ3A 2DU8A 3CEAA 5MDHA 4LISA 3AY6A 2VYND 5JSFA 5CDSA 3PJFA 1I3KA 3AK4A 2NTVA 2YFQA 2VOEA 3IAHA 1PGJA 3PZRA 2BHLA 3N58A 2O7QA 1HSOA 2PFGA 2YDYA 5C7LO 4Y8VA 4CM9A 2B37A 4YQYA 2HK7A 1QRRA 4AFNA 1DC5A 3P19A 3NT4A 4XD2A 3GNSA 3D1LA 3UAGA 3L4SO 4JCOA 2YW9A 4FOOA 3WWZA 3FPCA 4DGSA 4J49A 3ZWVA 1HE4A 1YBVA 4MVJA 3W8DA 4IBOA 1T2CA 3VKUA 1RM0A 3QLJA 4E2WA 4E6PA 4ZU3A 3PWSA 4PRLA 3ICCA 3TOXA 4UEOA 4OJNA 3U9LA 4YJGA 1UDAA 5KNLA 3CKYA 3KYCB 4NBVA 2EJVA 3RI3A 3R3JA 5B1YA 3PTZA 4PG4A 3AUSA 3KOUA 5C37A 2OHXA 1DJNA 2V6FA 3I4FA 4CQMB 5IAAA 1R4MA 3DXFA 3A14A 3LC7O 2JAPA 3DMTC 4CJXA 3RUEA 1IPFA 4BOYA 3CPSA 3K9QO 1E5QA 4LRTB 3V2GA 3QSGA 4BO4A 2ZQYA 4FDAA 1NP3A 2HRBA 5I7VA 1E3JA 3KXDA 1R0SA 3E48A 3JD1A 4M89A 1N5DA 3COSA 5EINA 4WCFA 4ZRNA 4BS9A 4J0EA 2BFMA 2QX7A 4WLVA 3TZQA 2XF8A 3ROPA 5LC1A 2BGLA 1ZH8A 1X1TA 3K2BA 4YA6A 3OJEA 2QIOA 1UJMA 1YXMA 5TQVA 3OICA 4Z6KA 1ENYA 4I08A 1N9GA 1LNQA 3FI9A 5U1PA 4TVOA 4R3WA 2FMUA 3P2OA 1E7SA 3Q9NA 3OJ0A 1PS9A 3CXRA 3SVTA 1U3TA 3KEQA 4WCDA 5ES3A 3TDKA 1MX3A 3PJEA 4CMAA 1T2FA 1Z7EA 3DBRA 2VRBA 4D0SA 3CMCO 3WGTA 1DIGA 1J5PA 3SJ7A 4EUEA 1QKIA 2IDZA 1F0YA 3F5QA 5CG1A 3E6AA 1H6CA 1WDKA 1ZKMA 1EBUA 4E31A 1YL5A 1IYZA 3TN7A 1GDHA 2FPPA 3H7AA 1YONA 1DC4A 3GMSA 2AEMA 5AYVA 4TZTA 2B4TO 4O6VA 4IMRA 4A03A 4YT4A 5A9SB 1V0JA 3VPFA 4TZKA 1E7MA 2VUSA 3RQSA 1RPNA 1TLTA 2QQ5A 3G1TA 1N1EA 3PYXA 1QLJA 2P9CA 3UVEA 1BDBA 3WQQA 3HZZA 4AG3A 2AMFA 3JQ7B 3NDJA 2O4CA 4AJ2A 2JFHA 1KC3A 3DWFA 4FR5A 4IUYA 2DTXA 1ISHA 3H9JA 3INRA 3ZCXA 4DPKA 2BMAA 4PG5A 4FN4A 2FZWA 2P68A 1P1HA 1JU9A 2VWPA 3ADOA 1EFLA 2GN6A 4B3HA 8LDHA 2X0IA 5JY1A 1SO8A 2OP1A 4JBHA 3DZIA 4PG7A 2EEZA 5DP2A 2Y05A 3DAGA 3JD4A 4K6FA 3ZU2A 4YVFA 4RF5A 5T57A 1MB4A 2W2LD 5JS6A 3O8QB 1OC4A 1YS4A 3QWAA 4MIEA 1BDMA 1HDXA 3E5RA 4HFJA 3ETEA 2YFHA 1UXJA 4KOAA 5AXDA 5TF4A 3U09A 3JQBC 3NTRA 4CMHA 2Y1FA 3MWDB 2OUIA 4CLXA 5A1TA 2EGHA 4M49A 2UUOA 5CEFA 4PVDA 3GVIA 1E3EA 5F1KA 1H2BA 2D5AA 3F46A 4CQMD 3K8ZA 1N7GA 1LDBA 3WBBA 1CF2O 5FEUA 1ZEJA 1EE2A 5EQFA 4YAKA 5THQA 2HMUA 1EUZA 4RL6A 4FFPA 1XQ1A 1O5IA 1IULA 5TT1A 2G76A 2IEBA 4BNZA 4PLWA 3TFQA 1Q7BA 2ILTA 1DAOA 3S55A 2ZJ0A 1X7GA 2NTJA 3NDRA 2ZB7A 5KJ1A 4P4NA 1ZBQA 2H1SA 1NWCA 1PZFA 4NK4A 3WGHA 5HWSA 5JDIA 3BMQB 1AE1A 3LLSA 1KEWA 4R3NA 4MPDA 4U5QA 2CUKA 2FY8A 4W82A 1ISIA 4YXFA 3GEMA 4FCCA 2V6GA 1SB9A 2W2LA 5A3JA 2GZ1A 2Q99A 1WLYA 4GMGA 1E7YA 1YL7A 1R66A 4XZ3A 5JXWA 3PFFA 3DAFA 2H63A 1UXIA 3KYCA 5I9MA 1BVUA 1NQTA 4YR9A 3GN1A 1VJTA 4UUNA 1OZAA 5GMOA 4BO2A 2XPCA 4CQMA 1Y9EA 1IL0A 1N92A 1MUUA 4JGBA 1FDUA 1MFPA 1SCUA 2YJZA 4AICA 4BKPA 3VVBA 3I6QA 1OC2A 1NHGA 4EBFA 2NACA 3PQDA 1VPDA 4KDEA 5TGDA 3RVDA 5KIAA 1C1XB 1R4NB 3EVTA 1VL8A 5FYDA 4L9RA 2PH5A 3ASUA 4CLOA 4M8SA 4FGWA 5K6AC 2V7PA 5KVVA 3RIHA 4CL8A 2G82A 4BGVA 3D4NA 4JIGA 3KZVA 1TT7A 4R9RA 4JXKA 1CYDA 4J0FA 3KVOA 2B5WA 4Z3DA 1KEVA 3QWBA 4RF4A 2WD7A 4UVDA 2Q1WA 4B7XA 4PLYA 1SC6A 3N74A 4XQGA 3DMYA 2OMEA 1B16A 3RBZA 1E7WA 4P8RA 4L4SA 4D44A 5L9AA 2JFFA 5KJEA 2DQ4A 1MXFA 5G0SA 3JQ6A 2VHZA 4G2NA 3WXBA 1CEQA 1ZMOA 3PZBA 3GG2A 1D1SA 4J1TA 2C2XA 3UKOA 1E1LA 3W6UA 3VZPA 1L7EA 2DPGA 1ML3A 4BNYA 3QP9A 1H94A 5FFFA 5KJFA 1BXGB 3BMCA 1Z75A 3A4VA 4J90A 2B35A 4RPJA 1P1RA 4D79A 2OL4A 3FNGA 2JKVA 3KSZO 4J91A 4EITA 1X0VA 2EP7A 3VKVA 3VPHA 3QQPA 1AGNA 1LC0A 1PL7A 2NVUA 5JNLA 3BTOA 2DLDA 3E9NA 1JWAB 3O9ZA 4J7XA 1JKJA 2Q3EA 1LSSA 3DTYA 1ADFA 1P1KA 5IZCA 3PRJA 4I9HA 4BNMA 2EF1A 2C0CA 5DNAA 4HP8A 2W4QA 4BKOA 2VCYA 3D3WB 3LC2O 3ON5A 1QLHA 2X86A 3E1KA 3GHYA 2YHIA 4BNXA 1GYPA 4B79A 4D0RA 4AJNA 4Y67A 5GZ6A 1K3TA 3HADA 3I83A 2GPTA 3HSKA 5JCJA 1UR5A 1Z7BA 2AEJA 3DONA 5L7YA 3ZU4A 4N7RA 3BYZA 4GKVA 1H6DA 1LQUA 1V6AA 3FBGA 1E1MA 2C82A 4CM4B 1XHLA 1HYHA 1KYQA 1U4SA 1HSZA 2Q1SA 3TOZA 4R5MA 1J0XO 3EW7A 3OH8A 3WJ7A 1U28A 1JN0A 3IKVA 2CVOA 4YAJA 3U4DA 2JCYA 2NU9A 2YHUA 3BIOA 4L75A 4XB1A 3GGGA 4IGEA 1TB4A 3DL2A 4O63O 1XELA 4RPKA 4TRRA 1RJWA 4CM7A 3W4JA 4ROSA 1I2BA 3DO5A 4RVGA 3AOEC 3PEFA 1EK5A 4P22A 4PG6A 4Y9DA 5CG2A 2GF2A 3U4HA 6LDHA
chains in the Genus database with same CATH superfamily
5J3JA 1V7CA 1JG2A 3P2MA 3D6UA 1UKZA 5EKUA 4H7FA 2PD4A 1KK2A 4EVRA 2JLUA 4H4DA 2WJAA 1I3NA 2BKEA 2JIBA 1XZBA 4M0KA 5F51A 4OH1A 5E9JA 4LDZA 4C2TA 3ANNA 5DVZA 4QO8A 5FOXA 2VLBA 1XIVA 3MJFA 5FADA 3SQMA 4C0LA 2SHKA 1LBEA 4F4HA 3IELA 4FC7A 4U7WA 2PRKA 3AF1A 1MQSA 3W9UA 5KYNA 4JYPA 2DQKA 1A5AB 1EMDA 2I66A 2OC9A 3CQ9A 3GUCA 1CJBA 1NP6A 1UQTA 4GRIA 3LWBA 1JQ5A 1DADA 1QNFA 2HUPA 2ZETA 4LJ6A 3WL6A 2OLJA 1J9GA 1JHPA 3CX8A 4GWKA 1LTHR 1E2HA 1AXEA 3V97A 1K06A 3WMXA 3AKEA 1N0VC 3M2TA 4J1NA 3A1CA 3RS9A 3W7VA 5BT8A 2ENWA 2VNIA 3G6KA 3OLZA 5FO0A 4LCJA 3CY6A 3TPZA 4AUNA 4LFBB 1PLKA 1CUGA 4EVQA 1SOUA 2WA1A 3C5VA 3PT5A 1LX6A 2QBYB 1XRLA 4RHTA 1VYVA 4UCQA 3TIFA 2XI4A 3JS5A 1UJNA 3NHPA 2XGMA 1ZCZA 3WA6A 2IYAA 5C7IO 3TGPA 1GD1O 3EIFA 4MUBA 3SC3A 1DJMA 4U0JA 4K6CA 4TRMA 3WLNA 3T1TA 1T1IA 4X7RA 1G8KA 2NYUA 3H9UA 5AVTA 4I55B 1BMDA 1XJQA 3AUTA 4HNAA 3HVIA 1CD5A 3A6FA 4AUKA 4ALNA 1FBTA 1F8GA 4CT4B 2DR2A 1VJ1A 4DPLA 1IU9A 1SKAA 1X0XA 4PHCA 2OCYC 4QODA 2DWQA 4GLOA 5HNKA 2FW9A 2P77A 4B3XA 4MS1A 2AOWA 4KIWA 4ZZ2A 2BCEA 2AN4A 2W93A 3B6KA 3T9DA 2C4KA 1RYEA 4DPMA 4Z7OB 2RHMA 3BA6A 4KLCA 2A2ZA 3JQGB 3W9SA 5MGBA 2B4YA 3L7DA 1R4NA 4LX8A 1FU4A 2L42A 3KALA 2DBYA 1M66A 2GYVA 1P61B 3DOUA 3HB5X 5EJMA 4FFMA 1E1YA 2LZ0A 3GRKA 3MBIA 1O6ZA 3BXPA 2IZ6A 5C7OO 1GL6A 3GPLA 3HCOA 1JLSA 1J70A 2HWWA 2LW7A 3TQQA 4JJEA 4BV9A 3E0QA 4BTLA 2RGWA 3NVAA 4RE5A 3U56A 2GX6A 1CB7A 2A6PA 3HP4A 4J07A 2GCEA 2OG2A 2W6JD 4MV3A 1AX9A 2M1ZA 4QDXA 4ZOLA 3P9NA 5BW5A 1NJFA 3L8ZA 4L6CA 4BNIA 3MPUA 1W4LA 3IR5A 5JSUA 1EUCB 3RSGA 4BQFA 3M4ZA 3LBAA 3MMSA 1U04A 1UDCA 5IFKA 3IAXA 4MB2A 4Q0MA 5GJBA 1NLMA 2W98A 4O02B 3EVCA 4QVGA 1M33A 4MQUA 4EYKA 1CVIA 5EGSA 4MRMB 1SHTX 3GLIA 4XH9B 3HZOA 4RMIA 4C6SA 1SQGA 5LD2B 1PTKA 5KIAA 4W5RA 2ONYA 2FP4A 3RYFA 2WZCA 4UASA 5ERGB 3RJ9A 4CFZA 1BVYF 3DZKA 1KEPA 2PKQO 5AOCA 3PGXA 3ZHVA 4UNRA 4OATA 3MTJA 2MYTA 3T35A 1ZP6A 3OQIB 3ECCA 4FGLA 4DLBA 1TYDE 1UBUS 3SZLA 3M83A 2GNOA 3MWEB 1WUJS 3V1LA 4MYUA 2CY0A 1SRRA 2Q2OA 3MCTA 1VSVA 4IS3A 1S9HA 1U0GA 1DPGA 1V7PC 1BJTA 4Y2UA 3U17A 4D80A 4X1IB 3NBYC 2CE2X 2XUDA 3GJ8A 3U7HB 2CFOA 1CZUA 3CSDA 1GV0A 1OKKA 2FSVA 1C4OA 1K97A 1Y98A 2BEJA 2IYSA 3RK1A 2BTQA 1EJ2A 2WVHA 5JYBA 1HDOA 2AQKA 3IVCA 5CHEA 2QN3A 4FTWA 2CFIA 4BQRA 2PKYX 3QBDA 1DAIA 1KOLA 1M72A 1NRJB 2QK4A 3GCGA 3LL4A 1WVGA 4MS4A 4W1RA 1NE7A 3UAXA 4BTEA 1LC3A 4LF6B 1N2CE 4EABA 4F3KA 3ESXA 3VNBA 1KBZA 1IZ7A 1UANA 2C77A 6YASA 3Q8LA 2ZTHA 1DO0A 1IZ0A 1O0SA 1Y48E 3DS8A 1GPKA 3O73A 1DBWA 1K75A 3DYVA 2JH8A 4XB6B 1RI2A 1ZIYA 1HE8B 2AQ8A 1PCXA 4J0CA 3WS7A 4YLGA 1PWHA 4JLPA 3DGFC 5KZMB 2D4AA 1AMUA 4G01B 3UPTA 1WW2A 4DV6B 3U0VA 4QECA 2PZAA 3IVGA 5DJ5A 2QTHA 3IYLW 1ZK3A 3OJFA 5AHXA 3EPPA 4YRRA 5HRCA 2AC4A 1JLLB 2A9OA 2P4SA 1TECE 3LKDA 3QOFA 4RY8A 4W8HA 2WABA 5CMLA 4ENRA 2ETVA 2W2QA 5JPIA 4MAAA 5C7YA 1UBJS 1ZLYA 4H6WA 4CKZA 3E5MA 5EWJA 2B3DA 4FFBA 5A2GA 5FV4A 2YVKA 5FWYB 1UWVA 1U0BB 5MFZA 2VF4X 4JL6A 1V3QE 2WYUA 1Z13A 1U0EA 1J21A 3ASVA 3EFEA 4BMSA 3GJZA 4IQGA 4UZEA 4DCMA 1E9DA 1GNRA 1NAHA 2AHOA 3OKAA 3SLKA 3T0IA 4U2FA 1YJ5A 1XLWA 3TKYA 3N7UA 4PTZA 3KV3O 2JK0A 1DX6A 3QVMA 4CCYA 2CUNA 4RABA 4HYEA 3DF7A 1EFPA 1NVUQ 1YR7A 1YRAA 5COBA 3ZBTA 2ECQA 1J09A 4RLFA 5KJ6A 4FEAA 4DCTA 2WUEA 3FY4A 4M6WB 1KSHA 3LGXA 3I04M 3RABA 2AJTA 4KAAA 1T3HA 1GPJA 4C5BA 1PT5A 4CEJA 2GETA 3WLAA 4J7CA 4RUKA 4FFLA 1TIPA 3NWPA 3PC6A 5T67A 1RBYA 1RKUA 2W4MA 5TMBA 3TK1A 3UANA 1XCOA 1QGUA 1NQXA 4HJRA 2O4UX 5DTMA 2CXSA 4PIPA 5NLLA 4F4JA 3AKZA 1GTSA 3IP6A 1I7DA 1YE3A 1AK2A 3L8YA 3P9PA 2GGSA 4K6GA 3GLGE 3RVOA 2OG1A 2ID9A 5ER9A 3JD0A 4ND5A 4ON9A 4G5QA 2FETA 1JHOA 3FLAA 4NARA 3L0PA 1RHUA 2BFFA 2DPMA 5H81A 1NMYA 1P80A 4GRAA 1U3GA 3FHLA 3F8SA 3OSZA 4FQ7A 4ACBA 5L3SA 1IN1A 1LK7A 3IEPA 5I9LA 1ESCA 2IELA 2PX4A 2NNLD 2IE8A 3EA5A 3Q2OA 4FIZA 4QU8A 3WOHA 4F3NA 1L4EA 1N5RA 1C1DA 3GHHA 4K9KA 4PR3A 1GNVA 5A6SB 5KOYA 3ZK8A 1SCDA 2QF7A 2ZUWA 3GA0A 4RPGA 1OGJA 1O2DA 1YK1A 3LX8A 5TC4A 1R8YA 3EQ7A 5F98A 2QAGB 1IATA 1VBKA 2DQYA 1E2EA 3JW8A 2RCNA 1GVHA 2EIXA 2GN8A 2QY6A 3EF1A 3M5PA 2H4YA 3QRWA 5DF1A 1PP4A 3GJQA 2G9NA 3ZJ5A 2OHJA 1WVMA 1YFZA 3WGJA 4ZYWA 4YRCA 3S2UA 3DEYX 3HWRA 4YYEA 1JS1X 2CLEB 4NS1A 3FDZA 3OJLA 3WK6A 3Q2KA 3L8EA 1W5EA 3OEED 3FYUC 3W3AD 1P4GA 4GKBA 4P36A 4W4TA 4D02A 3N3AC 1XL1A 3K1YA 2NU6B 4KRYA 4PO9A 4IH9A 4DBLC 4GKKB 2XWBF 4YBZA 3MJDA 3LXMA 4G6ZA 4UMEA 5AHKA 3EPLA 2G80A 2XECA 3HNOA 3BRCA 3V3KA 1QH1A 4AZ3B 1Z22A 3T7EA 4EYOA 2H1LA 5REQB 3ODPA 1JE1A 1Q1BA 1I4WA 3I73A 3KUCA 4NBRA 1XRRA 3ZYZA 3QPAA 3L4BC 2G70A 1GKUB 2Q2QA 5AW8A 2GO7A 2M2IA 4R0VA 1MBZA 5CDTA 3DM5A 3DE1X 4TMXA 3FFBA 3DJYA 4MRSA 1U4OA 2CL5A 2G9ZA 1W5FA 1Z4JA 4U63A 5IJ0B 5EE1A 1YC2A 3DAOA 2V9PA 2NZ2A 4V0LA 5E6SB 1MIOB 1T0BA 1T35A 4YJKA 1FFCA 3BHMA 2JPDA 5IYZA 1B0ZA 2EWVA 2WFLB 4AN4A 4EYEA 1RQXA 4G1FA 4MWCA 4UAJA 4EF5A 1XZCA 3EISA 1QYDA 2ZATA 5AVXA 2BUCA 4MI9A 1IAVA 3I2FA 4GLJA 2O8NA 2WWVD 3GUYA 1U8FO 5I3ZA 3NT2A 2HZ7A 2VHQA 1YR6A 3GJ6A 3LHIA 3K32A 4L3VA 4L9SA 4M7OA 2B1IA 5DO9A 3S70A 3VZBA 3LPMA 1WB4A 4DA0A 5EWMA 3O83A 2IY8A 1ICIA 5FPPA 5KQRA 1RXEA 4YRFA 3CR8A 1FDTA 1YKSA 3E8MA 3F78A 2F43B 2P4EA 3H3JA 4JJ6A 3U4CA 3T3NA 1WZCA 2XB8A 4PFQA 3DCNA 1LW6E 2PL3A 1UP6A 3J7TA 2HA3A 3OCWA 4RGVA 4XYMA 4B6GA 3UMRA 4EARA 4WEQA 3STWA 1ZD8A 2DBVO 2QG9A 2QI9C 1KHHA 2VDUE 4QASA 2V9ZA 2VHUA 4Y1EA 5K99A 5H3LA 1KTVA 4N3NA 1S5PA 5SZIA 3T15A 4MQMA 2PWBA 5K8CA 3BICA 5SZJA 1RJ9B 2EKQA 5HQ3B 3OSUA 3OLVA 4M21A 4C7KA 2CB9A 2E37A 2RFLA 3CUUA 1VL0A 1PU2A 2FQYA 2J8ZA 5AK4A 1T9HA 1RP1A 2VN8A 4YHBA 1IUOA 5D84A 4ETMA 5E8RA 3KKKA 2X9VA 3VAAA 4DV5B 2J5RA 1WWKA 2Y4OA 1C81A 2ORYA 4GT1A 4P38A 1NN5A 4L8YA 5GIOE 2RGBA 1V39A 2WMDA 3IEXA 4JB0A 4IIBA 2AR7A 5AW9A 4UC0A 4K26A 4L8LA 3ZW9A 3N39C 1EVKA 2RHBA 2XITA 1Q77A 4TTSA 4DDWA 1CETA 3NXKA 3QKRA 2VKTA 3ZCTA 2GESA 1W88A 1JH9A 4OB6A 4GP6A 2WTMA 5L95A 1L0BA 2W8BA 4K9MA 1Z83A 4MXDA 3E18A 1RJEA 1XDZA 2WDZA 4F2PA 4RQBA 2IUTA 3NTXA 1R4AA 2JI7A 4ENTA 3P0IA 1J97A 4NMWA 4AWAA 3LBIA 1A8IA 3ZHOA 4B3IA 4YMUA 1WZEA 1A88A 1WKCA 4J0GA 4RVUA 2ZJOA 4OJQA 5LUAA 3ROQA 3DKPA 1MU0A 2FJ0A 5AW5A 1U81A 3PQ4A 1NULA 4OMFG 4TN5A 4HATA 1FCJA 1YZUA 4QTZA 3A31A 4MAMA 5IJWA 1ZAYA 1N36B 2GVDC 4B6EA 4RWZA 5CFLA 3L8FA 5KOIA 1YB2A 1NVDA 1YDGA 4INJA 2X0EA 1KEKA 4MV0A 2R6DA 5THKA 1K63A 4FB5A 1UEIA 2QUIA 2H4ZA 3IKLA 3JD3A 3MVEA 1M2WA 2VJNA 4LC0A 3AJEA 3FB1A 2WZBA 3HHEA 1XMPA 1QQTA 3PXAA 4L02A 4PLGA 5G40A 4CDRA 1QF7A 1FRZA 1LLQA 4N7JA 5G41A 4DANA 4F3TA 1CRLA 2P6MA 3ROFA 4KLAA 1H2FA 1XVAA 5BYBA 1PGPA 2NVOA 5AJXA 3RLFA 2IH2A 1QWSA 4OHMA 5ENZA 3T9EA 2GEUA 4HTFA 1B0UA 2FMFA 2WF6A 3R5JA 3ABZA 3G68A 1NN3A 2IF2A 2WIDA 2BBWA 2XV1A 2Q5JA 1P9LA 2EKLA 4KQHA 4BNJA 2WJPA 2UDPA 3NASA 1BA2A 5AM2A 1L7DA 2C3UA 2WJHA 1AXRA 1NRIA 1TJYA 2GCOB 2VYFA 3DYIA 4IXMA 3TQCA 1EVYA 2HJWA 2ZJYA 2D8AA 4K9QA 1CJUC 1V1JA 4HLCA 5FT9A 4D4JA 2V97A 3ZI7A 2FWAA 3HJCA 3RVSA 3U31A 5ISMA 1JTVA 1YA4A 2J5KA 4LRWA 3E61A 4QHYA 3RFXA 1ODFA 3D54D 3AKYA 3MINA 4IIFA 3EGOA 3QWFA 5ANRB 1FSPA 1KMCA 1ZM4A 1ZG3A 5FCDA 1B76A 1CDZA 2Y1KA 5FHRA 2CVPA 2GDJA 5C46F 2HADA 2PUBA 1DO8A 3SJUA 4BO5A 1YASA 1G16A 1LLDA 1A7AA 3X44A 4QBIA 2HYIC 1HYBA 2UV8A 5C0OE 1JH8A 2GPWA 1R6BX 2DKFA 4L4UA 1KYWA 5DNEA 1QZ3A 2OILA 4YAGA 5EJGA 1QH0A 3EUFA 4CT5A 1VZ3A 1VLZA 3HCEA 3K92A 3B5EA 3L0SA 4JU8A 2PMWB 3EBOA 3VC7A 4EYQA 1OI4A 2J41A 1YB4A 4U7DA 3MTBA 1T6YA 4GBJA 4BHTA 1NMSA 4ZI7A 4D41A 2GN0A 4PAWA 4I50F 1XF1A 2B5VA 1E9FA 4RA6A 2ZQ5A 3EAQA 1FTQA 4ZPXA 1MC1A 2P79A 4DC1A 2HR1A 4ZQGA 2YVUA 4ZZ1A 4A6EA 2X0KA 3Q7RA 4B32A 4BFCA 1N5JA 1UAGA 1KK0A 3MTQA 3WRXA 1R37A 3C8MA 4BO7A 3U7GA 2BEUA 1ENOA 2PMFA 4OXKA 1WXFA 4F84A 3AM1A 1MOPA 421PA 3OQPA 1OFUA 5KNCH 3RKRA 3L8HA 3UV7A 3IAUA 1ZM9A 3CLTD 4DMUB 1X7WA 2B8JA 3CBQA 4DLYA 3RUAA 1JFRA 1G6HA 5GM1A 4YH1A 1IM8A 3AIOA 2ZZNA 2YNMD 1DX4A 4IIDA 4UPDA 1YGPA 2EYUA 3KHKA 5FRDA 4A8HA 3GOQA 2RGUA 4RKFA 4LXUA 1OV6A 1ZVQA 1PD0A 3EZXA 3FPJA 3SOPA 2WC1A 1GPMA 1O94D 3W8RA 2IHZA 5AMXA 1RCUA 3W9YA 5JSZB 2ZXEA 3Q6IA 2ZIZA 3ANXA 4EA7A 1ZIDA 1HYQA 5CXQA 1MB9A 2P2NA 3O9MA 4WCVA 5FLKA 3K0FA 5CLGA 2YXLA 2FUCA 3VXKA 2QDKA 4RVCA 2PCJA 3MFYA 1QHIA 4Z7NB 3O8CA 1XXLA 3ENVA 1SXJA 4BL5A 1ZHHA 4PGHA 4EAAA 3OFSA 2I4OA 3GJ4A 4MUJA 1P0PA 2AN5A 2R5NA 4KXWA 2QROA 1SUIA 1EQAA 4LQDA 1I0IA 3BDAA 5CGQB 4QNNA 4DJ5X 4YCLA 4ENVA 3NOVA 5HVNA 3PVZA 2GD2A 3DOCA 3MS7A 5LJIA 1J49A 1WVIA 1XKLA 1XLUA 3RAEC 5FFNA 1WXIA 3LPNA 2E1PA 5BW4A 3JU3A 3KKOA 3DC7A 4N18A 4DMGA 1ZHFA 1OU4A 3DJFA 5A71A 4JBNA 2G5CA 4IINA 1N0HA 2DHQA 1UBGA 4ZFNA 4KYUA 3IQHX 1IEQA 1DZ3A 1M34A 1FFXA 2IDJA 2JFVA 4TYPA 4UNQA 1SC4A 4ALKA 3A9UA 1CW2B 3CN9A 3IJRA 4U3JA 5ICSA 5JAMA 3VZRA 5J2UA 3AX6A 4FSDA 2YIJA 4TLBA 1BOOA 2V55B 1AUOA 1V8BA 4P6VF 3NDIA 4DDMA 3N8NA 4R2MA 4UEQA 2BGMA 2X9QA 4H1HA 4Q01A 1E59A 2A3RA 1Q7CA 4OHCA 1EDEA 3WJ1A 2I0FA 2FWBA 4WEOA 3HV2A 4WZBB 1GPNA 2R6AA 1GN8A 1PTJA 2WF8A 1DWPA 1IIBA 2WSSD 3K8QA 3LKBA 4FXOA 4KBGA 4LOJA 2I6FA 2YUIA 3QLVA 2CCGA 1EUDA 4U6SA 1MP0A 4P81A 5YASA 1W4CA 1OY1A 2AWOA 5LDGA 2GD0A 4NZZA 2POQX 3WTCA 4ZJPA 2NWQA 5SICE 3SFTA 4ZCMA 2Z9CA 2C1ZA 1ZITA 3SFVA 4Z0TA 1L3IA 3V1YA 1XXHE 3GZNA 3S7TA 4M87A 2QM3A 5DBEX 4KW7A 1LNSA 1N75A 1HI9A 5JDIC 1WF6A 3TF5A 2YOGA 4FN5A 1C14A 3PUXA 1PZXA 4E2ZA 4YP1A 3NPAA 1UBNA 3KR9A 1RYNA 2I4NA 2PX6A 4LECA 3Q8WA 3C3KA 4WJZA 1LUAA 4A2CA 2DX7A 4GUAA 3G2KA 3GC6A 4YIKA 2EFEB 3KXIA 4Q7QA 3JAKA 2E82A 3AVOA 1N8KA 2F1OA 1P4RA 1Y3FE 3DLCA 3RS5A 3X43A 4CM6A 2Q0HA 1DUSA 3UF0A 4FE7A 3CB2A 2E7ZA 5JO9A 1T1SA 1IWPB 1JRLA 1QPZA 4S35A 5JCOC 3I9KA 2JIZD 1NVAA 1QCYA 1P3Y1 5DSXA 3OU6A 1U9IA 1DVRA 2E4VA 4XFDA 1YR3A 3TWOA 5DX1A 1XE3A 3RV4A 4EUHA 1XN1A 5CVTA 2E87A 1CS0B 2Z1NA 4QDJA 3KYJB 3PEEA 3Q7SA 4Q3LA 5G4KA 1V2HE 3D4IA 1XZDA 1Y8QB 3CTPA 4X54A 3LP8A 1XL0A 3MJSA 2X0NA 5J43A 2NZYA 1GTMA 1T24A 3EVAA 4E5VA 1J23A 1UCFA 2PV0A 2XGSA 4PSCA 3UOGA 1MEOA 3JQQA 5IXSA 1CJMA 2RGDA 4UUMA 1NXOA 3TMAA 4DUPA 2CBXA 1QAOA 4US0R 5I9TA 3L7LA 1JR3E 2NOAA 2YNMC 4IDQA 4IL5A 4PQFA 3VC1A 1G8YA 3H6HA 3PL5A 4OLBA 1UKVY 3GLSA 3DMPA 2SNIE 4CXMA 5BUQA 3TBKA 2NP7A 3CHYA 4EY8A 4B6OA 2O05A 4MP8A 4J1QA 3CA8A 2XCUA 3MIZA 1ESZA 4O4LA 4V1CI 1KGDA 1R50A 3JVDA 3OHPA 3BB3A 4UPVA 1BIFA 3L7MA 5BOVA 2Z30A 4UMFA 3CZCA 4G1CA 3K09C 2EWMA 3CIFA 1P7WA 3WBJA 4LHVA 3VTZA 3WB0A 1B73A 3CEMA 4KC0A 4LKRA 3A1SA 3KU4A 1B43A 1WF3A 3OY7A 1LEHA 1RHQA 5IABA 2RKWA 2BZ0A 2IKSA 5B4VA 1D4AA 5B5SA 3KJNA 1COWD 2HQSA 2QVYX 4FYIA 1I33A 3O91A 1GPAA 4MWZA 1YB1A 5BQXA 4X66B 2QLMA 2C00A 2J32A 1BDHA 4LWZA 5KWJA 5TPWA 4DLRA 3GLUA 2C7GA 4RS3A 4CM8B 5EERA 2BGJA 4V2UA 1YD7A 4R3UC 4BMVA 1KY5A 4D57A 1I51A 2AUTA 1RJDA 4RK4A 4EQZA 4J75A 3BXEA 3FDFA 2XUFA 4A0RA 2X7XA 1TM7E 3S8EA 1WXWA 2IIPA 5AVZA 3LPDA 2Q1TA 1RC8A 3ZE9A 4FINA 3ZS8A 1Z08A 3GLHE 1UUFA 1SURA 1UDXA 3JQ8B 4S1NA 5I4CA 4YJDA 1QIEA 1VE7A 3WGYA 3G0OA 5ULLA 4IH4A 1NUHA 1AUQA 2VHVA 2OP0A 2AD1A 4IPTA 1KO8A 3WO0A 4EFDA 1D09A 4A7PA 1BS1A 3CVYA 3D7NA 2ASEA 1V16A 2Q4RA 3KEOA 3OOHA 3VPGA 3WNDA 4CFSA 5B4TA 2JVKA 4O4JB 1S0UA 2O7NA 1MC5A 2C2WA 3OF2A 1T2DA 4FYYA 4EHDA 5AKEA 3OA2A 1DS6A 1WCXA 2RH9B 4NPHA 4V0MA 5CX4A 1TT5A 2AG6A 1BFDA 1T43A 2ACEA 1SUWA 4E12A 1THGA 3FYTA 3TJRA 3TLKA 3QJYA 1BSVA 4DBLE 3PUYA 4NU6A 4EPVA 1EU1A 3BB1A 2R25B 4G8BA 2O5CA 1KIAA 3P96A 4IDHA 2VDWA 3UT5B 3P0FA 3V5NA 2H5IA 3EXAA 2C3YA 3KG2A 2GBGA 3PSHA 1PLLA 2PX8A 4UUOA 5FKJA 3RC3A 4Z3OA 1XZAA 1ZJYA 4ZEOA 4V1CA 2JANA 1M8GA 2KBEA 3HFJA 1GILA 4P3YA 4NV1A 2FFQA 2Y1OA 3O1LA 4X7MA 4P4SB 5AM4A 10MHA 2JAWA 3KK0A 5JRJA 2CHQA 1APBA 4F6RA 3L6DA 1D3AA 2BZ1A 1I30A 5D5QA 3RIMA 2W22A 3OCUA 4D5EA 3ILYA 1A9XA 1N5KA 2OBNA 4V0SA 3DQZA 4YYZA 5BVGA 2DHRA 3ESAA 2ZM6B 4W5NA 3OMLA 1E2PA 1YAJA 2OR3A 3EIWA 4XPIB 4JD5A 4A8JC 2YYYA 1ZDMA 4P35A 1TRHA 3K0AA 4JEMA 3GQBA 1CX9B 1PK7A 2AXQA 3KFLA 2INGX 5IKOA 3VH4A 1XNRB 1JHZA 1F4LA 1MJNA 4F11A 1J0BA 1T4CB 1BS9A 4H6PA 2ANCA 2QLFA 1SQ5A 3LW8A 2E85A 4RAQA 3C48A 1D2HA 4HAZA 1DXHA 1LA2A 3ECSA 4OGGA 2D0DA 4Y9UA 3VR5A 4Z2AA 3C3AA 3FR8A 4KP7A 5ALMA 2ZYTX 1UWCA 1SVIA 2FZ5A 6NULA 5DN9A 4FFDA 4G56A 4MQEB 4KYIB 2AL7A 5JEEA 5M5BA 2TRSB 4HDRB 3ZXUB 4RMNA 4WXYB 1XVTA 4DABA 2Q8NA 1T8WA 5TGTA 2BTEA 3ERCA 5FOTA 3R5KA 1Q16A 5JJLA 1I7QB 1W44A 2VJDA 4KQCA 2D13A 4ND2A 5GJCA 5LZ9A 3GA7A 2XLCA 3F9IA 1J07A 4ACAA 4KTTE 3TQTA 4CUZA 4WVLA 1KOJA 2J7PA 1NXXA 3MT8A 1DC6A 4BATA 4EQ6B 1ZN2A 2PBZA 4TSFD 2H1RA 4Y2QA 1ISMA 3E9CA 2HK6A 1AIPA 3O8NA 2G0NA 4GSYA 3U1BA 1JJ7A 2C2BA 3AMVA 4D3ZA 1YZVA 4ESVA 2N75A 2NUTA 1VJ5A 1ZOLA 1SPBS 4C7VA 5EFOA 2F7SA 5ALKA 4L0MA 1ZK4A 5BR8B 4M3NA 3MUOA 1NFQA 3OIDA 3BS4A 3TQOA 3ZY5A 5FFMA 3X2SA 2OBMA 1I0ZA 2DZDA 2QZPA 3L05A 4ME6A 5JSKA 4WDRA 2BDEA 4HEQA 1ZN7A 5K8JB 5CA0F 1IVSA 1NW3A 2GBFA 4O5OA 1ICEA 2PA0A 3ZI4A 4C0JA 4ED9A 1DCTA 3KS9A 1L5RA 3AIKA 2PO5A 3BF8A 1WU8A 1XNHA 3FNHA 2B8WA 3HG7A 4X8LA 2J85A 4E21A 3ICOA 2YN0A 1DIRA 2IYFA 2RARA 3AW8A 1F2UB 1OT5A 2KMLA 2ZP1A 4UAGA 1YR1A 1EZ4A 3G0BA 1SBZA 1GPWB 2JAHA 4H16A 4H7DA 1PGNA 3O8BA 3WYDA 4D3DA 3HDVA 4KKVA 1T10A 3IVAA 4BNTA 5FA8A 4HXYA 1C9EA 1JKFA 1E2IA 1QE3A 4WA7A 5DGHA 3AR6A 1H69A 2HMAA 4P7JA 1VJRA 3I0NA 4P5PA 3SQDA 3ZWYA 1RQNA 4GC5A 3OZAA 2W2KA 3GLVA 4Y9RA 1QZTA 2O3UA 4QYIA 3TW0A 3WKEA 2IYQA 1BROA 4BE7B 2WJ3A 1Q0LA 2XVXA 4YN3A 4D1YA 2YXBA 3L18A 2P4QA 2OEPA 1XPUA 1TVMA 3QUAA 5IVDA 1AS3A 1JAYA 2GLXA 4ML3A 4WIAA 3MJVA 4RPIA 5I47A 1W6RA 3H42B 3EC7A 4AC9A 5AW7A 3GLIB 3KHTA 4RGYA 5J59A 4UDNA 3AM4A 4EO4A 1XNGA 5E7MA 2I34A 3L41A 3SMVA 2JRCA 3BMNA 2Y3IA 2BFNA 4YCAA 1NZJA 2AF3C 1K88A 1USWA 4RD3A 3TOSA 1TKAA 3AR7A 1G9TA 3BQMB 2BEVB 2EKDA 3DUFA 2DUWA 2XMZA 4KX5A 5AW2A 2H2HA 3A0RB 1Z0DA 3GLQA 3STTA 2OD9A 5AOAA 1U02A 1A9TA 2PZBA 4IZ6A 2KM1A 1Z62A 2JI6A 1YK0A 2ODEA 3A32A 3JZDA 1GAXA 3LXRA 2BMVA 1ZUHA 2RGCA 1FLDA 1HT0A 1RHJA 1HH4A 1GZSA 2BFWA 2I03A 3DHYA 1JBEA 3FPKA 1CXZA 2D1QA 1F6DA 3C7AA 5CTAA 4Q3CA 4JJFA 5P21A 1I3LA 1XDGA 4HDMB 4A82A 1UP7A 3TCXB 3ZN2A 4FSHA 2X3YA 2O5EA 4C4XA 1J0CA 2A94A 1FBNA 3PKJA 3VPSA 2Q6OA 4QBFA 3V2IA 1ZI9A 4D6YA 1VB3A 3DFUA 4NU0A 3K1TA 3B2QA 3B1KA 2O8DB 2DUUA 4LZZA 2ZLBA 3UICA 4V0RA 4QVIA 3PEYA 4YRJA 1UIRA 4XR9A 2NZXA 2PIAA 3AFIA 1DQRA 3KDPA 5LQKA 2V5AA 4G0UA 3C3XA 4DXHA 5C8YF 4ROTA 4RDCA 1KMHA 2BI7A 1PYDA 1G66A 1E6UA 2XZDA 1TF2A 1A9OA 1HL3A 1ZD5A 1WXDA 1K8XB 1OXVA 2FLWA 2ICAA 3FI0A 4KXNA 5T7BA 3Q9UA 4CIVA 1IPEA 3CWZA 4X1YB 2R00C 3AEXA 3PIIA 3I62A 4EG7A 3P0JA 3H2ZA 3KLPX 2DF8A 3HLKA 3RTCA 5TPZA 2R8BA 2HY7A 3IPLA 4JYCA 1BXZA 3BH6A 1S2DA 4RGQA 3BB4A 5E4YA 5F33A 3PWTA 2QENA 4MNTA 4ZOAA 4KXYA 1JQ3A 1GPLA 1E63A 4UD6A 2GPAA 5KJCA 5F12A 4CIAA 2CF6A 2J5QA 4I36A 1EA5A 4GLFA 2M9MA 2VUUA 3WFIA 4HGQA 4Y3UA 4AO6A 2JBAA 4IHAA 4P84A 5JSYA 1DEAA 4OHZA 4GGMX 3EQ2A 5HFAA 1DP4A 1SVWA 4NBSA 2GRJA 2UVPB 3OZXA 3JAMA 1O97D 5AHWA 3MB5A 4XDZA 1ARZA 1S2MA 1WM1A 2X4GA 2ZPUA 3RE1A 3UWMA 4AVYA 4E22A 1TA9A 5HOEA 2EFDB 5I7OA 4LPKA 1OZGA 4ZARA 4DQXA 3CF0A 3DHNA 1ZKDA 1FP4B 3AKDA 3GJRA 2Q5CA 1E92A 4AS3A 1GKLA 5B36A 2AZDA 2IYZA 1P4AA 4OH7A 5TQ0A 2VAMA 3AERA 3EXEA 4YJ3B 2P91A 3G5MA 4H59A 5K2MA 4YAIA 4Z3KA 1HRDA 4LVNA 2DUJA 4AQ7A 5BSWA 4KAXA 2CXOA 4FWTA 3P45A 1Y3CE 1EM6A 3O31A 5EJ4A 2G5GX 3VJMA 2X0JA 3AL2A 1B6RA 2DY0A 1R6DA 4ZAZA 5ADHA 5HXAA 4PINA 2VOJA 4R16A 4DIUA 3DZFA 2B4RO 3GFRA 2ZDGA 3NGLA 3GRUA 4NONA 1FOEB 3OQNA 1JEQA 3GA5A 2YVQA 5DM60 3SICE 1X1AA 3NXSA 1H9CA 1ZN9A 2WILA 3NONA 5LQDA 1GUYA 4PBRA 4DG9A 1T8SA 3F7OA 3M2PA 3MGAA 4MYDA 1B8NA 4U7HA 4CKCA 4E2YA 4KFCA 3LRTA 5AP9A 3M6AA 4ZVUA 3ZIDA 4GR9A 2XMBA 3INTA 5CNKA 2RJ3A 3AWDA 4FK8A 3OZTA 5FOQA 3PLAE 4KQGA 1GPUA 1J2JA 3K0CC 3L4EA 4MQ4A 1Z0ZA 4PAMA 4FZJA 3IMKA 4PZDA 4Q39A 4B6PA 2Z5VA 4AY5A 1I6MA 1SD2A 2YY5A 5DHFA 4KRGA 1U6JA 4CKBA 4GLLA 3U37A 1YQ9A 4WFIA 1Q7EA 1N1MA 1T6BY 1W0CA 2VPTA 1KMNA 3N7AA 3PNMA 4TLDA 3DE7X 1SBCA 2AI1A 3BXFA 5AOVA 3KJXA 1ZXLA 4IZOA 5CJ2A 1UAYA 1VMDA 3ZHQA 4CM5A 2CT8A 4OKIA 4OJTA 3UMJA 4LF4B 3T12A 2PX5A 3MCVA 4KBFA 4N6GA 4WXRA 4AMZA 1X1CA 2EFHB 3BREA 4FEEA 3SQWA 2ZXFA 4X60A 3ODGA 4ITVA 3WBFA 3BCUA 5KNCA 5DLYA 5BSTA 2R48A 3U7EB 3DBLB 1G5RA 1Z12A 3CKMA 1YI8A 4QUDA 5LM3A 1RBQA 3FPEA 1U3FA 1T8YA 2X14A 1NI4B 2ALJA 3G85A 4IUBS 4ND8A 5B1DA 2ECPA 2HPAA 3V32A 4EW1A 1GEGA 1U5BA 3LWZA 4MW7A 4K6MA 1WG8A 2AXEA 3BMCB 4AZWA 3CJTA 5HE9A 4ESEA 4B4UA 1SK9A 1X92A 3KTFA 3R3WA 4ESOA 3LSTA 1XLTA 3PUJA 5IANA 3KQTA 4UXJA 3DH0A 5KREA 1AQ6A 1ZVMA 1PQ4A 1E5TA 1PG0A 3QM1A 3RFTA 5JZMA 4GDFA 4J29A 2LP4Y 2HPHA 2Z8YM 3E9EA 3GU3A 3MJCA 3M9LA 2AW5A 2NVUB 1F06A 2Q5QA 4PZPA 4XSVA 3M1AA 3W3ZB 3VDMA 4DA4A 4OSOA 5EIXA 1ETUA 3DE0X 1SD5A 1VG8A 3KQYA 4NMXB 1IZ9A 2MINB 4HNSA 2LCIA 5C18A 1Z2CA 2PLAA 5EMHA 3VGPA 5HIAA 3GW8A 1SXPA 1MORA 2H9IA 2NW6A 5ARCA 1T5HX 3AZPA 1RQ7A 3AF3A 2X0RA 4QQFA 2HU5A 4I5GA 1W1WA 3MK31 1WZNA 4U9HS 3IEMA 4Q4JA 5HS6A 2IYOA 1T6NA 5EVCA 2YHIB 4NZMA 4BTVA 4QWWA 3LZ6A 4XCVA 3FGZA 2HJGA 2AOVA 2HJSA 4NATA 3X1JA 4JZKA 3FF1A 4O4IA 3ZE8A 2QW8A 2ZYWX 3DWEX 2IUEA 4CG0A 3ENWA 2OXCA 5E2IA 3ZUPA 4ER3A 1XD2A 4LHSA 1HFKA 2BMJA 2X8LA 3IL2A 3BTVA 1BW9B 1Q74A 2XE4A 1WDWB 1RC1A 1PQPA 2YUTA 1KORA 2HDHA 3O2JA 4P4LA 4Q7KA 5D6OA 3THSA 5JJKA 2ZTSA 1V3TA 1F6WA 1US8A 2YQ5A 2NU9B 4MP6A 4EF6A 2RHDA 2JZNA 2KS6A 1ZK2A 3DC2A 2XUQA 5I7RA 3C16C 1GZ4A 3MWKA 4IJQA 1UFVA 1JJBA 1TJ3A 2EZ8A 5E1BA 1KRWA 2Q6KA 1X38A 3EFBA 1KKUA 3ZGOA 2QAJA 1U7WA 1XU9A 2DWUA 1VP3A 3FUCA 3TMYA 3GMDA 2UYQA 4G26A 4F60A 4UZSA 3ZLBA 1MJ5A 2ZI9A 2D7DA 2PKQP 3R3VA 1M54A 4EPRA 3DSRA 1P4JA 2FJUA 4QOGA 1G21B 1DFHA 4GMDA 3E9DA 3EG9A 5GVRA 4WGFA 2P1RA 1N78A 5DHUA 2GAFA 3BHIA 3WBKA 1V9LA 4K03A 4FONA 5JT1A 1YBHA 2R8OA 4QG3A 1J8MF 2Z8ZA 2P9FA 3OIUA 2ISCA 3EDQA 4LXXA 5G53C 5IAEA 3UHFA 3LECA 5JXHA 1C8KA 4JEIA 2GERA 2CZQA 4M1KA 4TQGA 3WLLA 4DQDA 2VZ8A 4NBUA 1HNNA 3B9RA 4JBGA 2WWYA 1V8DA 3C6MA 3GEBA 4F4IA 1L9KA 5JD5A 5EUCA 1HOTA 1VLVA 3HBAA 1Y7PA 4H9GA 1JNXX 2ZR7A 2WG0A 3SZOA 3I2GA 1GR1A 4AX4A 1Y37A 3NYWA 4Q1BA 1IN7A 3C45A 4FDVA 1LV8A 3MAAC 3THOA 2GZMA 3QYPA 2I76A 3FSRA 2Y1GA 2IW3A 1OE0A 4HWRA 3VI4B 3PNKA 5IAOA 5IZ4A 3L3BA 4B3MB 1KJJA 5F4BA 1HG0A 3NX4A 4IZHA 1RMQA 3HPRA 1UT5A 4HFRA 1B0PA 3UC5A 4H15A 5AHRA 2VH5R 4E33A 1CF4A 3AY7A 3P0RA 5TVKA 3ABIA 4II7A 5AQEA 2OY0A 4RFVA 1IC6A 2VP3A 3K8YA 4Y0AA 3UJBA 1XVUA 3DQQA 5EJ5A 3RASA 3CRMA 3DMNA 1F9AA 1J0AA 1J22A 3BXGA 3FCUB 4QXPA 3OQMA 5AXCA 3O8LA 2J4CA 4HMPA 1PEKE 2ISSD 1VHJA 2AYZA 1F3LA 4HLUC 4WKCA 1P6UA 3QA9A 4LBYA 1CR2A 2QRHA 2C4NA 2O8CB 1X8JA 4OGKA 3RC1A 1WUIS 3ENQA 1RAEA 4CN8A 3D2CA 3URMA 1OFVA 3GPIA 3LYHA 3WGNA 1KETA 1IBCA 3B3FA 3HABA 2AMVA 3CZRA 4F56A 4LJLA 4QOSA 1VYTA 3A6GA 3CX6A 1CHDA 3V8EA 3AESA 4HAXA 1HFEL 3D0QA 4IX1A 1OH6A 4K40A 1NJGA 3LX4A 4H7KA 5CM8B 1NUPA 4RZ2A 4U2GA 1LH0A 2VDPB 1Q3TA 4IFIA 1G8AA 1ZNZA 4PICA 3GDWA 5M29A 1SUEA 2D00A 3JQFA 3QEKA 1ULAA 2FDCA 1SELA 5HDQA 1AN9A 2HQBA 4HUQA 2LV8A 5E7QA 4OF4A 4QOFA 3HEBA 1JPUA 1IN4A 3KKZA 5BSKA 5L4NA 1TZKA 2X8JB 3D64A 4CF5A 4FLMA 4I4TA 3NTVA 3ZDXB 3ZJ4A 5IWAB 1AM4D 5DPMA 4BYMA 1XTJA 1ZK1A 4K9RA 4RHEA 4CMCA 5L3QB 1PJLA 3ZY6A 3QUQA 4HNHA 3R4CA 3T38A 2AOXA 3CIOA 4QUHA 4B2LA 4YPOA 2DUMA 3M1IA 3RAFC 3FYDA 2VK8A 2Q3BA 2AZ4A 3UXHA 4Y9TA 3UMFA 2AG8A 2FSIA 2CHUA 3O5AA 4EM6A 2EGGA 2A0UA 1I1OA 2ZGVA 4HB2A 1IWBB 3Q3JB 1XR3A 4PWZA 5H59A 1BEZA 4FLEA 3VPAA 3IBGA 4HFMA 5F73A 3ZKWA 1O58A 3FXAA 1ONPA 3HDGA 4O2AF 4KN6A 1ZL2A 1X1QA 4NCKA 1JHAA 4UEJA 3NBUA 3OAAA 1CSEE 2QL9A 2I62A 2R44A 4LBWA 4NZ9A 1C9YA 4PYQA 3U7IA 3VZDA 3RROA 1VMKA 4EEZA 3UCFA 2FOLA 4AU1A 1ZSVA 4AS1A 4TXHA 1AXGA 1VFNA