1EZ4A

Crystal structure of non-allosteric l-lactate dehydrogenase from lactobacillus pentosus at 2.3 angstrom resolution
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
317
structure length
307
Chain Sequence
SMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGALVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKERVIGSGTSLDSSRLRVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGVSDDDLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAIIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of non-allosteric L-lactate dehydrogenase from Lactobacillus pentosus at 2.3 A resolution: specific interactions at subunit interfaces.
pubmed doi rcsb
source organism Lactobacillus pentosus
molecule tags Oxidoreductase
molecule keywords LACTATE DEHYDROGENASE
total genus 110
structure length 307
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2000-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ez4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ez4A02
4WNIA 4QFDA 4ZQBA 2PY6A 1GL3A 2BF7A 4KMSA 1OZAA 3MJCA 5DBIA 5THKA 4BHTA 3GZNB 1Z75A 2O23A 5CP8A 4UVIA 5BSFA 5MDHA 1AHHA 2J5QA 1CYDA 2NU7A 2G1UA 2G5CA 1XEAA 2FR1A 4IQ0A 1GYRA 1C1DB 4BGVA 1VKOA 1AXEA 5H82A 4H16A 4RO0A 1I32A 3PHGA 4ZRMA 4Q3DA 1N1EA 4KZPA 1E6UA 1GQQA 4YRDA 1R4MA 4AVYA 2WYVA 4CL8A 3AOEA 4GX5A 4K6FA 1U1IA 3GGGA 3VAZA 4N54A 4FR5A 4GQAA 1ISJA 2CVOA 3B1KA 1PJTA 4I08A 4IQ8A 3U5TA 1ZMOA 1CQIA 1PWZA 2EP5A 3JD0A 3WLEA 3JQFA 1JAXA 1PGNA 4PZCA 2NM0A 4R3WA 2ZB3A 2YFHA 1BG6A 5IDYA 5ITWA 4PLPA 1LI4A 4LSWA 3BZUA 4NZ9A 5ES3A 1G0NA 3QA9A 4L76A 3TL2A 1YVEI 3DFUA 1LX6A 3OA2A 3RUFA 3VZSA 1GQ2A 2P9EA 4J4HA 3DZBA 5I9MA 3PDUA 1XWFA 4DIFA 3EAGA 5DBGA 1PQUA 4PLHA 4AJHA 1ZNQO 4R1NA 4BKUA 1R37A 4YEDA 1O9BA 4CR6A 2B69A 2PGDA 1ADGA 1J4AA 2HRZA 3H9UA 3PWKA 3ZW9A 1UP7A 2FP4A 1ADBA 1XHLA 1GV1A 2E4AA 3VPHA 7MDHA 1Y8QA 3PVZA 4YR9A 3KYCB 4UULA 2B4QA 2JL1A 4ZRNA 4XRGA 1IY8A 1SOWA 3FNEA 1U8XX 3L9WA 3WICA 4UUPA 5U9CA 5KVCA 2PKQP 4I9HA 2O4CA 3TL3A 1ZSYA 4I5EA 2ZKLA 4ND5A 3FR7A 1Q0LA 4XYMA 1VKNA 2J3JA 1HETA 4II3A 3WMWA 2WD7B 3E03A 4WLFA 4ZQEA 4DPKA 4E31A 4HNHA 4XWYA 1KEUA 2VQ3A 1I24A 4DQUA 1I3KA 1XQ1A 1UXJA 3AWDA 3KLMX 3R6DA 5L4NA 3RBVA 1HZZA 4NPCA 1IPEA 5EQFA 2VCYA 2Z95A 4RF3A 2E49A 3C8MA 3N58A 2EIHA 2Y1CA 2BFAA 2PFGA 1KS9A 4ALLA 1Q0HA 1GUFA 1KVUA 1NQOA 1VM6A 3PIIA 3OHSX 4D3SA 1Y8QB 1VL8A 1DB3A 4WCFA 1R12A 1W8DA 4MP8A 1ENZA 4B4OA 1E1MA 2OXIA 4IDGA 1TT7A 4BNNA 3TZCA 1EVIA 1P77A 1B16A 1DBVO 1KYQA 2PZKA 4ZA2A 5JDCC 2RAFA 3ADPA 5L3ZA 5LCXA 4OSOA 2O48X 4DC0A 1M2WA 1PU2A 4AL4A 3H9JA 4S3MA 4J3FA 3LYLA 3OEYA 3RUAA 4B3JA 1YBVA 1DC3A 1RWBA 1WW8A 4TROA 4FPXA 4FCCA 3OETA 1RPNA 1BXGA 1ZBQA 3V1TC 4FFLA 3WFIA 2GLXA 4R5MA 1C1XB 2GYYA 1AHIA 4R9SA 3KLPX 2QRLA 3D7LA 3OM9A 3EGOA 3KVOA 5FF9A 3ZZNA 1J49A 1ZH8A 4H3VA 2O4UX 5ER9A 1Y7TA 4XDYA 3SBOA 3ZU2A 3WWZA 4WPGA 1I30A 3NX4A 3UN1A 4XQCA 4ZICA 4PN3A 3JYNA 2WEKA 1GPJA 4NMHA 1HXHA 2NU6A 3BMQB 4CMKA 4GWKA 3M2PA 2H5LA 4RL6A 5A1TA 3IAHA 4QEDA 1BDBA 1ADFA 2VUUA 2J3HA 3HDJA 1A7AA 1N7HA 1YXMA 5CFZA 5U4QA 2Y67A 1ISIA 5I7VA 5DULA 1B14A 2CF5A 1X0VA 4XKJA 3QWAA 1C1XA 4FIZA 2AQHA 2CDAA 4J49A 4U6SA 2C5AA 2AMFA 2EKLA 5DT9A 3JQ6A 3PJGA 4HFNA 4MVJP 4B7UA 4MVJF 3PPIA 4BNMA 1B8PA 2FSSA 4NJOA 3HZZA 4BVAA 3I3OA 1OC2A 2ZIZA 4J7CA 3B70A 4JBGA 2HLPA 1U3WA 1ULUA 1ZZEA 3KETA 3UFXA 2ZJ1A 4PLFA 4DLLA 1LDBA 3H9QA 3WWYA 1HF3A 1DO8A 1NXQA 3SVTA 1F8GA 3DZIA 5HS4A 2XXJA 3PWZA 2LDXA 5KKCA 1RKXA 1H6BA 4MO2A 1R16A 3P2YA 1VC2A 4YJFB 3RASA 3E9QA 3BA1A 2FZEA 1TI7A 4E2WA 4LGVA 3ZGYA 5DP2A 3O38A 1P1HA 1OBFO 4AJJA 2VTDA 4FGSA 1IZ0A 4A27A 5TIIA 1SB8A 4BNLA 1W0CA 3MJ4A 4KOAA 3AUUA 2GGSA 1EVZA 5GZ1A 1R66A 1GD1O 3KYDB 3WTCA 1AN9A 1GYQA 1PS9A 4PLTA 1BTOA 2NLOA 4JBHA 1JVSA 2EW2A 2Q3EA 2RH8A 4ZD6A 2J6IA 3M6IA 5EJ2A 5CG2A 1DFGA 4AJOA 4NBVA 4E2XA 3DL2A 5TSDA 2IZ0A 2JAHA 2PKQO 4BGEA 1PGJA 1BHSA 4DPMA 2O50A 1WZEA 4IXWA 3EW7A 3RU9A 2X0RA 5I7SA 3UUWA 2PD3A 3V1UA 4R1TA 1DHTA 3F5SA 3RC1A 1P9LA 2HMTA 1BXKA 1DEHA 4XQGA 3VH3A 3NT2A 4P22A 3AU8A 4MOWA 4NIMA 4L8VA 4R1UA 4RVGA 4E6PA 1LSUA 3DZHA 3JQGB 2TMDA 1D4FA 4R16A 4F45A 2O3SA 1QXSA 4PVCA 1D1SA 1GZ4A 4ALIA 5DCUA 2CDBA 3PQFA 3KYDA 3MJEA 3PXXA 4UVEA 3W4JA 3JD3A 4GBJA 4M89A 2HK7A 3TRIA 3JV7A 1V6AA 5CDSA 5A9SA 2D8AA 4IM7A 4XDZA 1BMDA 4MP3A 5IDXA 1N9GB 3JQ9A 3PQDA 2YQ5A 3CZMA 4IY1A 2Q1SA 5EIOA 3SLKA 3ZHZA 3C1OA 5DCYA 2JCYA 3HJAA 3K2EA 3TOXA 4PZEA 4OKIA 4IIVA 4BNZA 4J7XA 1YB5A 4MINA 4Z3KA 1UJMA 3VKVA 4BKPA 3TZ6A 3PK0A 4Z9XA 1YKFA 2WWRA 4I1IA 2IEBA 4OQZA 4Q3BA 2J5KA 1YB1A 4B79A 3K73O 2ZB4A 5TS3A 3VTFA 3VH2A 1QYXA 4AJ4A 5IZCC 3ZV3A 3BTOA 4NG5A 3EUWA 4ZVVA 1ZEMA 3P2OA 3CIFA 4CM3A 2ZK7A 4E5NA 1GYPA 3T4EA 2AHRA 4XX0A 4WCFC 1XU7A 1CJCA 1NNUA 2JHFA 2OP0A 3JTMA 1MG0A 4LCJA 3KYBA 1OFGA 4Y98A 4YJGA 3MZ0A 4Q3CA 4HV4A 4RGBA 4XGKA 3S1LA 4XYLA 4IDBA 1MLDA 3INRA 2AA3A 4U6QA 1KOLA 2QZZA 1ZXBA 2ZTVA 2GZ2A 3DBLA 4K6CA 3RI3A 2H9IA 5L53A 1HL3A 2XAAA 1R0LA 2DUUA 2SCUA 3QVOA 5HBRA 2VZ0A 1KERA 2I3GA 2OBNA 5TLSA 4PG5A 2JFGA 2ZB7A 3LC1O 3QRWA 3GT0A 4PVDA 1Q7GA 1LRLA 3HB4X 1EFLA 3BMOB 1RYDA 4PLYA 5TT0A 3SJ7A 1BXZA 2C0CA 1P1JA 3K96A 4CQLA 1A5ZA 4J16A 4R9RA 1N2SA 3NUGA 2OO5A 3QW2A 4BNXA 3MCVA 4HBGA 4GI2A 4PLZA 3FNHA 3AY3A 4WASA 1PJ2A 2UAGA 1IL0A 3GFBA 3WGZA 1WP4A 2O3JA 1RM4A 1LUAA 3GMDA 1ONOA 3LQFA 3K30A 3I4FA 3G17A 1BXGB 3H5RA 4KUEA 4J2OA 2IXBA 1MB4A 1HDOA 2GZ1A 4J1QA 4IJUA 3WB9A 1G6KA 1R0KA 4PFJA 4YAGA 1QV7A 1HZJA 4FW8A 1NVTA 2OL4A 3KO8A 4NI5A 4S1VA 3ASVA 4MVJA 3OJLA 4HXYA 3S2FA 3TWOA 3NAQA 3CMCO 2Q2WA 3QE3A 4RF2A 4W82A 4QFCA 3WYCA 3ZWNA 1V9LA 4BNYA 2V7PA 4I5FA 5A02A 1PJSA 2GO1A 4L75A 1SMKA 5BNFA 1E3WB 4JNKA 1NBOA 1GTMA 2OGUA 4P4NA 3S2GA 4CODB 1KY4A 3GEMA 4OGWA 3D0OA 9LDTA 3C24A 4KWHA 5B12A 4DLBA 4MKZA 3C85A 4YVFA 4YAJA 3CMMA 3VPXA 4FJ0A 3UICA 2FRDA 1PZFA 4EEZA 5A5FA 1YQGA 1XCBA 3B1JA 2X22A 3WGOA 4M55A 3D4OA 3ITKA 2BRUA 1F12A 1EBUA 1PTJA 1Z7BA 1LDGA 3I23A 4GL4A 3JYPA 4XYGA 3SC4A 3JQBA 3GF4A 4GSLA 2DQ4A 2HRBA 3BYZA 3GUYA 4IJVA 3ZWYA 4LCEA 4HFRA 4J91A 5JPIA 3LVFO 3DDNA 5KJFA 1PGQA 2JKVA 5DN9A 3G49A 1JKIA 1C1DA 3ULKA 3Q6IA 4CV2A 2BD0A 3H5AA 4J90A 4N5MA 2OP1A 5T6BA 4L74A 3VH4A 1E0DA 3F3SA 1UXIA 3L4BA 2PZLA 2DBVO 3GAZA 2J8ZA 2GERA 5L7YA 1VLLA 2R2GA 4DTIA 3MWDB 3CUKA 2PLAA 1GPDG 3ICCA 2AQIA 4IS2A 4JJIA 1PJQA 3ZWCA 2VOEA 3GHHA 2H63A 3ZU3A 1B8VA 2Y0CA 1I5RA 4J1NA 4EGFA 3QY9A 5HRUA 4BV8A 3DZKA 3DBHB 2CZCA 4W9NC 3E5MA 3V1YA 4BO3A 3Q1LA 2Y93A 1DIGA 3KEOA 4GH5A 4BIIA 2GPTA 3H3JA 3RIHA 1LDEA 1PZHA 4W6ZA 4EUFA 1C0LA 1HLDA 3I52A 2X5JO 2Q4BA 4M1QA 1I01A 4D43A 2BFPA 1H94A 3E18A 3I9KA 4D45A 3FWZA 1R6DA 1FJHA 2UYYA 2AEJA 2VWHA 1UAGA 3RBXA 2DVMA 4OSPA 2HCTA 4UREA 1DAPA 4Y9DA 3WIDA 3JQAB 3LT0A 3KOUA 1H0KA 2X0JA 4UUOA 1K0UA 1G0OA 3FPLA 2P5UA 4XR4A 5U1PA 2D3TA 4O6VA 1M67A 2EHDA 1E92A 4Z0TA 1IHXA 2Q49A 5JW6A 3PI7A 3ORFA 4XQEA 3X2EA 1LQUA 1PIWA 1YDWA 1QRRA 2CDCA 4CMIA 4CMCA 4FD3A 1GU7A 2F1KA 1L7EA 1EFKA 3GFGA 3OJOA 4EJ6A 5B4VA 2RCYA 2VHXA 4A0SA 1NWHA 3NT4A 3L07A 1EDOA 4IMRA 1EZ4A 1FDSA 3E9NA 1K6XA 1UZNA 4AJ1A 1N92A 4YYZA 1P33A 3A1NA 5CDTA 1R15A 3QQPA 3E1KA 1I2CA 3WYBA 1WMBA 1E7SA 3EVNA 1T25A 4U5QA 1X1EA 5EESA 5FI5A 1T2FA 5G4LA 5CHEA 4A7PA 4MVJH 3O8QA 1HWYA 2J3KA 1HSOA 3GK3A 3L9XA 4Y6RA 5L4LA 2PR2A 1XDWA 4W7HA 3K9QO 1ZXLA 3F4BA 1HYEA 1KEWA 4GKBA 2BLLA 5ADHA 3GEGA 5JE8A 3OQ6A 3FCOA 3ETEA 4JX8A 1UP6A 4PLGA 1R4NA 1HLPA 2QQ5A 4GLLA 3IP3A 1GZ3A 1KVTA 1DAOA 1ENYA 1WAMA 2HMUA 1OOEA 4IDCA 5B1YA 1YOVA 1Q7BA 2B5VA 3JD2A 2D4AA 1Z6ZA 3FNFA 1MFZA 1D7OA 3B20A 3U9LA 4CMBA 4DYVA 1Y8RA 2C7GA 2O3UA 3DTYA 4NFSA 2BH9A 3V5NA 4PG4A 4UUMA 3PJEA 4TRJA 5KTKA 5GZ6A 1RM3A 3TZKA 1GCOA 2P4QA 3WJAA 4IQGA 3R3SA 1T2DA 2W2KA 3DBRB 3WSWA 2FWMX 1C14A 3RFTA 4FOSA 3GNSA 2C29D 3OJ0A 1AXGA 3DHNA 4RF4A 2BMAA 2C54A 4OM8A 1DJQA 4CLRA 1YO6A 4XD2A 1ZSNA 1E7QA 3MWEB 3PDJA 4J4BA 3HWRA 4G81A 4JK3A 3W4KA 4ZQHA 3WR5A 5CEFA 1C0KA 4ZGWA 4RDHA 3WGYA 3PGXA 4GAEA 1QG6A 4A10A 5JCXA 4OXKA 3ZNNA 3OFSA 5F5NA 2R00C 1SNYA 4N5NA 2HQ1A 3RU7A 4ZN6A 4CMGA 1ZCJA 3WQRA 3PHJA 1TT5B 2DUWA 4PGFA 3ANMA 3DONA 1PJLA 5AYVA 4CQMB 3OP4A 1Y8RB 2X9GA 1MXFA 3OJEA 4CMIB 2V6MA 2V6GA 1O6ZA 1TXGA 3F5QA 1ISHA 2GCGA 2VOJA 4YJGB 3P7MA 2UDPA 5A3VA 2HDHA 3ONFA 4ALMA 5BR7A 2GNAA 3JD1A 4M87A 1F14A 1EVJA 3AM5A 3GRPA 3U4DA 1JWBB 3DBHA 2EERA 2FPIA 5A9RA 2H6EA 3E8XA 1HKUA 4K9DA 2I65A 2JCXA 3UF0A 4AG3A 3GVHA 3LLVA 1PZGA 4YJFA 5JMWA 1BW9A 4DWVA 4KUHA 2I3AA 2ZCVA 4CLEA 1H93A 2QYSA 4L4XA 3GDOA 4MIOA 3WBFA 3V2GA 2NTNA 3JQBC 3OJFA 4EJMA 3EHEA 3VC7A 4E2YA 1GR0A 1DFHA 4BGUA 2QYTA 4J43A 3QVTA 4YAEA 4CMJA 2NVUB 3WGHA 5A05A 3ZWBA 1PJBA 3AOGA 5FYDA 4EDFA 3GEDA 3DTTA 2IZZA 4RPLA 5L7WA 4BO2A 3ICPA 4NU6A 1AE1A 3AM3A 2CNBA 2DBRA 1BWSA 4TKLA 1Z45A 1MG5A 3ROQA 1O95A 2GF2A 5DNAA 5HA5A 4FFRA 4YT5A 4FSHA 2BHLA 3L77A 4YDRA 1PWXA 4KDFA 4OMUA 3UXYA 2AEMA 5TC4A 5IN4A 3FRJA 4XYBA 1CQJA 4MIYA 4PIVA 4TRRA 3QIVA 3DZGA 3JQGA 4GWGA 5A5EA 3KUXA 3UHAA 2E48A 4RPJA 4GGOA 3Q9NA 4EZBA 5KCZA 1KC3A 2DBZA 4XGIA 1V3TA 1X15A 1E3IA 1N5DA 1XA0A 5CAEA 3KB6A 4JROA 4BB5A 3F1KA 1YOVB 1PR3A 5A06A 3UKOA 1ZFNA 5EQDA 3GPDG 5G0TA 4B4UA 1CRWG 4J1TA 4P4LA 1MV8A 1P1KA 3FBTA 3KM0A 1OAAA 1R4MB 5JO9A 1NVGA 1UDCA 1QV6A 2EJVA 4P8RA 3L6OO 1XLTA 5THQA 4J9UE 1DFIA 4FOOA 3LDHA 2WSBA 1VJ1A 4E21A 2GN9A 4FBGA 4N7RA 1YH3A 5G4KB 3SEFA 2JFHA 4WLUA 2G17A 3WNQA 3ZWXA 5DF1A 4NU5A 4XR9A 4RVFA 4BQPA 2C7VA 1NFQA 1PSDA 1LRKA 1QSGA 1SPXA 5F1PA 5HS6A 1E7WA 4F46A 4OKNA 1NQAO 5K9ZA 3BHJA 4DA9A 5IDQA 2I66A 4NFYA 4IDAA 1BRMA 3G0OA 5I7FA 5KJ6A 3DAPA 1A4IA 1M6WA 1OC4A 3AUAA 1ID1A 1E3EA 1WVGA 3HUDA 1QLJA 3QLJA 3AW9A 5IXYA 2W2KB 2D5AA 3DBRA 3VZRA 4A5OA 4DC1A 2X58A 5JNLA 1IUKA 1TLTA 3OICA 5KIAA 1X1TA 1LSJA 1LSSA 4O63O 5JCJA 1H6AA 4NHEA 3A9WA 5T67A 3RKRA 5F1KA 1HDGO 1YL6A 2R6JA 4RZHA 5K0ZA 4BGIA 2OHXA 3AUTA 4E5MA 3IL2A 1YL7A 1H2HA 5A9TA 2WM3A 3SX2A 3IMFA 4DRYA 3V8BA 3GOHA 2AG8A 2PK3A 3OA0A 4IGEA 4BB6A 3GVXA 1EE9A 4E33A 5IDWA 3HN7A 2E82A 2EP7A 3VPGA 3ZDFA 4FJ1A 1QYDA 3ZI0A 4A2CA 3ZH2A 2GASA 4CQLB 1CEQA 4OJNA 3ZN2A 4YPOA 4FS3A 3GDGA 1HDYA 1HT0A 3TJRA 2A35A 3U0BA 1HE5A 1YQDA 4LMRA 4Q3AA 3BHIA 4YACA 4RF5A 1V8BA 4YBZA 3KV3O 4P38A 1WXDA 1L1FA 2RHRA 5F1OA 2Y05A 2NVUA 3OIDA 4M86A 4XCVA 5K6AC 2ZTLA 2NQ8A 3I83A 5KJ1A 3KEQA 1I8TA 4DBZA 3QVXA 2CF6A 5A3JA 1EK6A 3JQ7B 3ETGA 3DHYA 5TRTA 5T5QA 2VHWA 5DZSA 3R0IA 2X6TA 2OZPA 1XELA 2BKAA 3K8ZA 4D44A 2P5YA 1IYZA 2NADA 2P68A 3H65A 5AXBA 1GZ6A 3JQCA 3IJPA 3ZHXA 3JCZA 5JYEA 2DT5A 4XA8A 3H8VA 2PGLA 3WNVA 3WLFA 4R01A 1HTBA 3D4NA 3U09A 5TT1A 3SJUA 4FN4A 1X14A 5EMHA 4TQGA 3JYLA 5KVQA 3S8MA 3VHRA 1K2WA 3I4CA 3HG7A 4NH4A 2WE7A 4NK5A 4XJTA 2A94A 1E3LA 1HE4A 5DDIP 3ANLA 3PRJA 4AJPA 3PLRA 1KIFA 5EINA 3A4VA 5F3RA 5JC8A 2CFCA 4P4GA 4DQVA 2GSDA 5C7IO 5ENVA 3ENKA 5GZ3A 1Q0QA 4RVUA 4BMNA 1AUPA 5F5LA 1LEHA 2HJSA 2RH4A 3M2TA 3PHHA 4BNVA 3I5MA 3OQBA 2AQ8A 2D0IA 4YQZA 4MKRA 3H9GA 4Y67A 3UGKA 3RQSA 2DTDA 5JC1A 1QYCA 3TOZA 1E7MA 3HE3A 1LA2A 1C0PA 3DAGA 1VL6A 3DFZA 1U5AA 2ZCUA 3ROKA 1T2CA 5I8WA 3NKLA 4A03A 3R1IA 3ONDA 2O3TA 1HYHA 1T4DA 1A7KA 3DR3A 3GZNA 1FDVA 1JVBA 1DLIA 2BI8A 5DOVA 4BOYA 4UEJA 1DRVA 1F06A 3TNLA 1CF2O 2VRCA 1PEDA 1R0SA 2P9CA 2VWPA 3MJVA 4PG7A 1FF9A 1X7HA 4WLEA 4GGPA 5JDIA 1JU9A 3PLNA 2EG9A 3KXDA 1GQYA 4GPD1 3QHAA 4YJDA 2YFQA 5G4KA 1B0AA 2UVDA 4HUJA 1U9JA 3JQDA 3P19A 3WJ7A 1DIRA 1IE3A 1QR6A 2A92A 4QO8A 4W9NA 4CM4B 2IODA 4A73A 1CETA 1GV0A 2O7QA 1U28A 5L7TA 1Q7CA 4E3ZA 4QECA 5TGDA 3QWIA 2EGHA 5BQFA 3ZWWA 3UW3A 3M1AA 2PD6A 1I2ZA 1QYVA 2Y0DA 3CXRA 3VPSA 4CLHA 7ADHA 4BL5A 4E0BA 1HDCA 5DBFA 3RUCA 1U3UA 1QMGA 4CV1A 3KSDO 4XGNA 3DBLB 3BMNA 1Y5MA 2FR8A 3WDSA 4EJ0A 3ZNQA 4MJLA 1GUYA 4XZ3A 3KTDA 5AXAA 5DCWA 4L9RA 3PGJA 1ZK2A 3W8FA 4FC6A 2C5EA 2QZ9A 3PZRA 2QX7A 2WMDA 2YHIB 4DQXA 1BSVA 3PJDA 1MP0A 1ML3A 5ILOA 3ZU4A 4AJ2A 3WS7A 3ANNA 1XIVA 1UP4A 3TFQA 2B4RO 3D1LA 1JKFA 1H2BA 2V65A 4WUVA 4BV9A 2C20A 1TB4A 4LSMA 4PLVA 2CY0A 3IQDB 5EERA 4Y6SA 5DP1A 4CUZA 3R3JA 1U2DA 2NVWA 3KYCA 1IZ9A 1DRWA 4G2NA 1B7GO 3T4XA 3K92A 4DUPA 2VRCD 4R1SA 2Y66A 2RBEA 3KZVA 1Y6JA 4RV9A 3AFMA 1DSSG 3RUHA 5L51A 2O3QA 3LT4A 4BO1A 5B4UA 5JFOA 4H15A 1SEPA 2NWQA 3BMNB 3RC7A 3OF2A 4PRKA 5L9AA 4WE3A 4WGGA 1RM5A 3EYWA 4URFA 1DPGA 3NTQA 1LXCA 4J0FA 2AW5A 4CLOB 5B4TA 1E1NA 2PD4A 5I8ZA 4JP3A 3LF2A 2W2LD 3BTUA 3FBGA 4E5PA 3FNGA 1B3BA 2DTEA 3ADOA 4A26A 4E30A 2V6FA 4R51A 5JBIA 1S7CA 3E82A 5JAZA 4D3DA 4M8SA 3MEQA 4LISA 4BO6A 4BO0A 4KUGA 3UAGA 4Y8VA 4RDIA 4DMLA 5BNIA 3TFOA 3RFVA 3HB5X 2VYVD 4WLNA 4XIJA 1I3NA 2WTBA 5JYDA 1B26A 3NJ8A 1ZMTA 2JHGA 3G3EA 4WOKA 1X7GA 2VRBA 2DM6A 2VYVA 3ZNPA 3PIDA 2PWZA 1SEVA 1N9GA 4ID9A 5JMPA 2RIRA 2CUKA 3KHUA 3WIEA 4WLOA 1O94A 1PL6A 2OMEA 3MOGA 1KEVA 5TNXA 1H6DA 3EDMA 2NVBA 2PV7A 1PS0A 4F6CA 3I6IA 1PL8A 3OBBA 4FFNA 2RHCA 3RWBA 2WD8A 1J0XO 1JLLA 3GG2A 4FGWA 3EC7A 3K5PA 1HSZA 1XR3A 2W2LA 1DJNA 4JGBA 1T1RA 4E4YA 1Y9EA 4NNJA 5BT9A 5LDHA 4GVXA 3PYLA 1DOHA 2AE1A 2C2XA 4CQMA 2VHVA 2PNFA 3QWBA 2FR0A 1ORRA 4CM9A 2GN6A 2YV2A 4OQYA 2I9PA 1RM0A 3P5SA 4QQRA 5JY6A 1ZVMA 3VKUA 5T64A 1B3RA 3TN7A 4TSKA 1EDZA 1GEGA 3PYXA 2ZB8A 2AG5A 4TVOA 3W6ZA 3AFNA 5TF4A 5IG2A 2W8ZA 3FWNA 1ONPA 3EY4A 3HHPA 3FD8A 4DGSA 4ESOA 1NAHA 1VJ0A 2UUOA 3RC2A 1BVUA 2HUNA 2O2YA 5EPOA 4DBVO 2X8LA 4LMPA 4CM8B 1LC3A 3NDRA 1LLDA 1X0XA 4BMVA 4KDEA 4WJZA 1VE9A 5T8KA 3K2BA 3AOEC 3IC5A 4G65A 3GNQA 4HFJA 4INAA 4OH1A 1FDWA 1ULSA 2DU8A 2QG4A 2BFOA 1E1KA 4RVDA 2NV6A 3SLGA 3BMOA 5JAIA 4IDEA 3GDFA 4PRLA 3GHYA 5JXWA 1U7HA 2OBYA 1YDEA 3CPSA 5C7OO 1BGVA 4YT2A 3CKYA 1NAIA 5COAA 3O9ZA 4TRMA 2W4QA 2VTEA 1QP8A 1ZW1A 4L73A 1HE2A 4J4TA 4DYDA 5CG1A 1AGNA 3KBOA 5KOIA 4BO4A 3H3FA 3DC2A 3NGXA 3I9NA 4IINA 4QX6A 4MVJE 4DMMA 2GUGA 3AI2A 4RQUA 4NDNE 4NJMB 4BO7A 4EYEA 5JO0A 1I3LA 3H6KA 1CWUA 4B8ZA 5FWNA 1F17A 3GH3A 2LDBA 3PHIA 4TVBA 1YGYA 2WDZA 1PQWA 3PFWO 3U4IA 1T1SA 4NFHA 1ONNA 3JQEA 2I6TA 4ROSA 1I33A 1HRDA 3UOGA 1KETA 1OI7A 4BQRA 5JDIC 4RLSA 3BMQA 4EITA 3AUSA 1T4BA 1XGKA 2ZYDA 3H2SA 2B0JA 4IZIA 3NRCA 2E37A 5ITVA 1EQUA 2OOSA 2I67A 3LC2O 2NNLD 1A72A 1EUCA 4U0JA 3I9MA 5IZ4A 1U8FO 1P3DA 4B7CA 4CM6A 1PGOA 1PS8A 4CL3A 4D46A 4JQCA 1E1LA 1GADO 1BVRA 2G82A 4M54A 1PJ3A 3O8QB 4WECA 2BGMA 3DO5A 4JP2A 3ROMA 4LRSB 3B6ZA 4IDDA 1M66A 4N18A 2X9NA 1YWGO 4D79A 4TZTA 3DXFA 3OIGA 2P2SA 1ZKMA 1DRUA 1D1TA 1K6JA 4I9NA 3ZWAA 3D5QA 4HX5A 4YJHA 3HDQA 4RPKA 3W4IA 2B35A 3IUSA 5C37A 5BSEA 4BNTA 3PFFA 1LLCA 2JAPA 4ALKA 2VHZA 1WLYA 2DPHA 3GA0A 3VDRA 5A4DA 1QKIA 8LDHA 1Y1PA 3DOOA 4KQWA 3G79A 2VUTA 2YUTA 3H7AA 4GX1A 2YY7A 3QV1A 4ND3A 4WK6A 4BNKA 4CUJA 4E5YA 3AU9A 3K6JA 4CLXA 1LDYA 3AI3A 1G1AA 1NHGA 2Y1EA 4RVSA 4JN6B 2ZQYA 1DLJA 2FPGA 4E2ZA 2Q2VA 2YQ4A 1F8FA 4FFOA 2VN8A 4WNCA 4CLRB 4AJIA 3IKTA 1U4OA 1I3MA 4J7UA 4BO8A 1MX3A 2Q50A 4FFMA 5COBA 2Y99A 4GLOA 4D0RA 4R41A 3ZWPA 3JQ8A 2YJZA 2EWMA 3UCXA 2YDXA 2GD1O 5KVVA 1MA0A 3V2HA 1NPYA 1TVEA 3DEYX 3QWFA 1IULA 1WZIA 1NP3A 2WD7A 4HKTA 4IXTA 4ND2A 1FDUA 1JTVA 4CM1A 4BMSA 1NVMB 2NUAA 4JJGA 3WMXA 1U3TA 1DXYA 1UR5A 2BELA 3GRKA 1Y9AA 2UV8A 1I0ZA 2Q1WA 3JQ7A 1NYTA 1Z74A 1M75A 4IMPA 1I2BA 3I9LA 2Z1MA 2X5KO 2B4TO 3MTGA 3D4PA 4I8XA 4OHUA 4B3HA 4B3IA 1JQBA 3HDHA 3H4VA 4F6LA 1UDAA 3WFJA 4DL9A 1J6UA 2FN7A 1T2AA 3RFXA 3S2EA 1M6HA 2QW8A 4CR8A 4WCDA 2Q2QA 2DC1A 4QSMA 4CUKA 3OMLA 3VVCA 1DIAA 2BFMA 4Q3NA 1LBEA 5A9SB 2DAPA 1K5HA 1V0JA 1ZK4A 3HSKA 3IKVA 2NU9A 2ZJ0A 1RYEA 1XU9A 5H83A 4BNWA 5TJHA 4RPGA 3LSYA 4YWJA 3FR8A 3OIFA 3FPCA 3T7CA 2NTVA 2Y1FA 1SB9A 3IUPA 2X0NA 3JYQA 1FXSA 4CV3A 4C7JA 3F46A 2VZ9A 4J6FA 3GVCA 4PZDA 4YRAA 4Z6KA 2FMUA 2PZJA 4ZHSA 5COQA 5JSFA 1GAEO 2AE2A 5EN4A 1PZEA 4AJLA 1N8KA 2Q1UA 3GPIA 1ZK0A 4L4SA 2D59A 2EJWA 5ICSA 2EW8A 3FHLA 5MGBA 1PX0A 6LDHA 3PYMA 1V3VA 4PLWA 3GUCA 3ETDA 1EUDA 1EUZA 1UDBA 4RLHA 4IBOA 3ABIA 3RUEA 4CV0A 4YAKA 4GMGA 1ZUD1 4CM8A 1DC5A 1ZK3A 4EBFA 3F1LA 1IOLA 4TKMA 3U62A 3A06A 3O4RA 1LLUA 1P45A 3GMSA 5CEJA 1IB6A 3IS3A 4MIEA 4MVJM 5A04A 3KRTA 3QP9A 3RSHA 4CR7A 2IEDA 1MFPA 4JJFA 2PGJA 3Q2IA 5TQVA 1LNQA 3WGIA 2I99A 3DAFA 5IXSA 4CM4A 4EI2A 2GR9A 4GMFA 4KP7A 4E12A 1PR9A 2X0IA 2Q45A 3LF1A 3E6AA 4Z3DA 5KWEA 3U49A 3JQ8B 2P4HX 1HDZA 3BXXA 3WTBA 3OH8A 1Z7EA 2PA3A 3E5RA 2VNAA 3RC9A 1SC6A 2G76A 3ONEA 4TZKA 3T7EA 1TT5A 3UVEA 1EK5A 4NBUA 5CPFA 5AVOA 4CMEC 8ADHA 1A27A 3E48A 1NFRA 1OMOA 1LU9A 1NFFA 3OSUA 3VVBA 4CQMD 3H2ZA 3QWHA 3QSGA 1UZMA 5FFFA 1IHYA 1V35A 3RROA 2HU2A 3UH1A 5CEEA 1RJWA 4BNGA 1YS4A 3JSAA 1C0IA 4AJKA 1KY5A 5J23A 4J9VA 1YBAA 5IN5A 3ZWMA 2POQX 2FPPA 3LC7O 1S6YA 3HDYA 4E13A 2IYOA 3MJTA 1HDRA 1DIBA 3F4LA 1X7DA 4NK4A 4YT4A 2FZWA 3A28A 1E3JA 1T26A 6ADHA 1VSUA 3EMKA 3Q3CA 3GVPA 1NASA 4GX2A 4OYRA 4O0LA 4UEKA 3WBBA 4FQ8A 4DPLA 2ZTUA 5FI3A 2XXBA 4YA6A 1QORA 3ZWVA 2C59A 2XPCA 2CSUA 1EQ2A 3BTSA 4NBTA 5KNLA 1NX6A 3D3EA 4O5OA 4W7IA 5JLAA 2X23A 3IP1A 3PEFA 4JCOA 4PLCA 4JXKA 3VTZA 3WX0A 3S55A 1ZSVA 5G0UA 4IUYA 4G5HA 4WEQA 3NGLA 1UXKA 2IYPA 2V6BA 3I6QA 5ICMA 3TDKA 2XOXA 2DKNA 1CDOA 4RQTA 3GLQA 4IZHA 2VT3A 4EEXA 3EZYA 5EL0A 4JIGA 5CPBA 2QRJA 4PCVA 4R4JA 4CLOA 1E7RA 3EK2A 1H6CA 4R5HA 2BGKA 1P1FA 3G1TA 5HTOA 3ST7A 1NTOA 5G0VA 1E5QA 4HY3A 1NM5A 4CMHA 4BNJA 1WDMA 3BMCA 3ZHBA 5B37A 5BSHA 4F3YA 1UAYA 3EVTA 4IJKA 2B37A 3DWFA 4I5GA 5FEUA 2HK9A 3GR6A 2I76A 2X7HA 2HSDA 1UZLA 2ILTA 5LC1A 3ON5A 3WGTA 2ZTMA 1L7DA 1PJCA 1PJ4A 2Y1DA 1GDHA 1A9ZA 2YDYA 3NV9A 4YB8A 5CDUA 1JKJA 9LDBA 1HDXA 3CINA 4XB2A 3TZHA 4RJTA 2W90A 1N1GA 4WOJA 5KJEA 1A9YA 3PTZA 3GZ4A 3NT5A 5A03A 5AXDA 4WKGA 1EE2A 3H9EO 2ZYAA 1ZO8A 5IJZA 3IIEA 4O59O 2NU8A 3CTMA 3WGQA 3L6EA 3DB2A 3INGA 3Q9UA 2DPGA 3GN1A 1Q1NA 1ZK1A 4KWIA 3X2FA 2W98A 4D42A 2Q46A 3HFGA 4NBRA 3RVDA 3FSRA 3RJ5A 4DIOA 3UCFA 1MUUA 4BNIA 4UVDA 2F00A 4WEOA 3L6DA 4GSKA 3WOHA 5L40A 1NPDA 1MC5A 3ZNOA 2EV9A 2H1SA 4Z0PA 2DFVA 3VH1A 1KVRA 4KTVE 1B15A 3COSA 4Z9FA 4CM5A 3DMTC 3OECA 2Q4EA 3O03A 5JAQA 5IAAA 1YJ8A 1P44A 4LRTB 3FF4A 1XG5A 3D3WA 3MJSA 1LLQA 2CMDA 2QIOA 3F9IA 4BO9A 1GFSA 3DMTA 1GEEA 1Z73A 2NSDA 4BNFA 1K3TA 1LJ8A 3C7AA 5CDGA 1C3VA 4OO3A 3TPCA 3W8DA 1IPFA 3SXPA 1Y5RA 5ILGA 1PGPA 3FN4A 3NDIA 3RKUA 3U3XA 4LK3A 2D1YA 1UH5A 1LTHR 5C3MA 1LRJA 4OXYA 4R68A 3E9MA 3AY7A 2VNSA 3DQPA 2X1HA 5F21A 2X4GA 1DC4A 1YJQA 2GN8A 4IIUA 4IPTA 4XB1A 1YONA 2UUPA 4K1LA 2QHXA 4UUNA 1PQPA 2HK8A 3NEPX 1DHRA 3GG9A 1ZJYA 3BIOA 3RUIA 5ER6A 1P0CA 1VSVA 3G1UA 2Z5LA 1A4UA 2OUIA 1WMAA 4LW8A 4B4WA 4K28A 3VPFA 1K6IA 1KVQA 3F47A 3UCEA 1E5LA 4CM9D 1KBZA 4EW6A 2O7SA 5IZCA 4FDAA 1B2LA 1JAYA 2A4KA 1U3VA 1GY8A 1ISFA 3JD4A 4Q9NA 3WYEA 2YW9A 4HP8A 3D3WB 2BI7A 2JD0A 1HE3A 1O8CA 4IDFA 1DC6A 5HWSA 4BO5A 1EVYA 4NJMA 3I9JA 2B5WA 3L4BC 4QXMA 2CD9A 3KSZO 3LZ6A 5DOZA 3RAJA 4XJSA 1YB4A 2YZ7A 4HWKA 2EKQA 1ADCA 3PJFA 1JWAB 3CE6A 3U4HA 4DVJA 4E32A 1BW9B 3MOIA 1FK8A 1YE3A 2VHYA 2BGLA 1DIHA 2XF8A 4W4TA 1A71A 1WDLA 4FFPA 4ZU3A 5AQ1A 2AXQA 1E6WA 2YV1A 3ROPA 4PG8A 4ZJUA 2OFPA 3GN2A 4O1MA 4AFNA 1UUFA 1SBYA 2JD1A 1HEUA 1U2GA 4GKVA 1VL0A 2NTJA 3C7DB 1E7YA 4HFMA 5ENDA 3JYOA 3GQVA 3ZW8A 1JA9A 2JFFA 1H9AA 3IJRA 2FSVA 3HADA 2IRWA 4YCAA 2AEFA 3NDJA 5L4SA 1Z82A 3CSDA 2VYND 3W6UA 1T2EA 3RUDA 2B83A 3I9OA 4L0QA 4AJEA 4GX0A 4Y6PA 4NBWA 5TX7A 2EEZA 4KQXA 3TSCA 3D64A 3LK7A 5I9NA 2AQKA 2YHUA 1XSEA 2WYUA 3HN2A 2ZYGA 2EKPA 3WGGA 4YTEA 2PTGA 3LT2A 4X54A 2NQTA 1UXGA 4B4VA 1HYGA 2CVZA 4OOEA 5L95A 3DBVO 1P0FA 3TF5A 2HKIA 2P91A 1QYWA 4YJHB 4Q39A 3I1JA 4NQZA 4QTZA 4W99A 1E3WA 2FY8A 3EZLA 2DLDA 3O26A 4RZIA 1NPTO 4LN1A 1MC4A 2ZATA 4OOFA 3VZPA 3NTRA 4ONEA 3D5TA 3WXBA 4CMEA 4TRNA 4D7AA 4U0KA 3AK4A 4ZQGA 4YRBA 1H9BA 3QVWA 1WWKA 1BDMA 1LDMA 3S2IA 1EEHA 4MDHA 4CMAA 4IS3A 4BKQA 5JS6A 1K89A 1VPDA 2EF1A 1W6UA 4L4RA 1YRLA 2GN4A 1T24A 1TA4A 4BKRA 5KVSA 4U8GA 3BAZA 4XEHA 3ZV6A 4MVJD 2GRAA 5G0SA 1E77A 4BUCA 2YV3A 2O3RA 4B7XA 2X5OA 3DOJA 1YBMA 3STHA 3ITDA 2HAEA 1F0YA 1YL5A 2PH3A 1P1IA 2B36A 1XQ6A 2YYYA 2YHIA 2PZMA 4ITUA 5AXCA 2HMWA 3NJ4A 2NACA 3ZWOA 4BNHA 4CPDA 2TMGA 3HNPA 1WDKA 2VWQA 4ILKA 4ND4A 5AOVA 4R54A 3ZHYA 2IZ1A 1M76A 2A9FA 4XYEA 4YXFA 3ZCXA 4I5DA 5T8KC 3AM4A 3RCBA 3V2UA 5BNTA 3RBZA 3DHEA 1ZIDA 4TMFA 2IDZA 1E6EA 4AICA 4RORA 1UXHA 4BS9A 3ZV5A 4D0SA 2Y0EA 3K31A 3Q11A 5C5IA 1U4SA 5JAMA 2J5RA 2VZ8A 4QT0A 4GVLA 1P74A 4M49A 3GAFA 4Z9YA 1E3SA 3WQSB 3ASUA 1NR1A 3PQEA 1Y81A 4YQYA 3JQ9C 4CM7A 5K6AA 3ZV4A 1DDOA 4XQ9A 1FMCA 2HJRA 3FTNA 1ENPA 3AJRA 3CH6A 2OORA 1VI2A 2PH5A 4UVGA 3WQQA 4WLVA 3ENNA 2D2IA 3M1LA 3WSVA 4EUHA 1LSOA 5BSGA 2E6UX 2J3IA 3VOSA 3AI1A 3VDQA 1J5PA 1N7GA 1LC0A 2X9VA 2C82A 2R00A 3GC6A 4K26A 1SAYA 3U4CA 1ZEJA 4JBIA 1CIVA 1FDTA 3IDSA 1D3AA 1O0SA 2X86A 5CDYA 3INTA 1PL7A 3OEWA 4E5KA 3PP8A 4C7KA 4R69A 4RPHA 4CJXA 4YT8A 2VWGA 2IE0A 1SCUA 1NR7A 1Q2XA 1X13A 1I10A 2CVQA 4Z0HO 2D5CA 5I7EA 3C1AA 1I36A 2HMSA 5JDCA 2QRKA 3GGPA 5GMOA 4D41A 1U7TA 4RCVA 2GDZA 2P9GA 1LDNA 3NTOA 4FB5A 3BTVA 3A14A 5KKAA 2HMVA 4OL9A 4IJWA 4YAIA 4LVCA 1H5QA 5GY7A 2Y68A 2DFDA 1KVSA 3IOYA 5JY1A 4IGFA 2EXXA 4J2HA 4XIYA 5IFLA 5H81A 3Q2KA 3DZFA 4II2A 4WCFB 1CERA 1GUZA 3GNTA 3OQ1A 4MKXA 1JW9B 1ISMA 3FI9A 1KC1A 3DZJA 2VT2A 2Y1OA 3W8EA 4ALJA 1XKQA 2G0TA 2Y1GA 4DXHA 1O89A 2DBQA 2ET6A 3CEAA 1JN0A 3JQAA 4JLWA 5TJ9A 3GY0A 3RD5A 3WG9A 1ENOA 4H7PA 4DIBA 1KEPA 3DOCA 4J1SA 2JJYA 3Q0EA 4AJNA 4FJ2A 4BNUA 1SZJG 3HQ4O 2PKRA 3QJ5A 2I5PO 4HADA 3BHMA 2C2YA 4HNGA 4RVHA 1TEHA 4ND1A 1P31A 1EBFA 5C7LO 5HM8A 3PHLA 1P1RA 4FC7A 4TWRA 2WYWA 3KSUA 1JDJA 2C07A 3QVSA 4D3FA 3B1FA 3NYWA 3CZRA 3HFSA 2Z1NA 3LU1A 1SOVA 3C3XA 4DLAA 3C1TA 5I9LA 1B8UA 1MGOA 1SO8A 3GGOA 4OAQA 3MTJA 1WNTA 1XYGA 4MVJG 4N5LA 2VUSA 5LDGA 4MPDA 4EUEA 3VZQA 4UEOA 4MP6A 4R3NA 5IF3A 4LVUA 5JCJD 1NQ5A 2JCVA 2Q1TA 4ZQFA 3W1VA 4ALNA 3GVIA 5KJCA 3DMYA 1ISGA 3TQHA 4QUKA 3LT1A 4UVHA 1W4ZA 4B8WA 1LQTA 5G0WA 3H5NA 3JQFC 3PWSA 3ZU5A 1EMDA 3AY6A 3LLSA 2FOIA 2WE8A 3PZBA 4OIMA 4NR0A 1YQXA 2O2SA 1GCUA 1R4NB 3N7UA 1O5IA 4I9UA 2IXAA 1D8AA 1V3UA 3FTPA 5T57A 1NWCA 4QO7A 4U7WA 4DREA 2HO5A 3C7CB 1QLHA 2FHSA 4BKOA 2Q99A 3L4SO 1VJTA 4Q3EA 3JQAD 2JD2A 3TZQA 2ZQZA 4OXNA 5L45A 1U5CA 3N74A 1WPQA 2GZ3A 2VYNA 4PG6A 3RJ9A 1ZJZA 1W73A 1NQTA 4MVJI 4UAGA 1MXHA 4CLDA 3F6YA 4XRRA 3L0DA 1VRWA 1NHWA 5G2OA 2EGGA 3BMCB 4KTTE 3SC6A 4J0EA 1ARZA 2WJPA 2DTXA 4C4OA
chains in the Genus database with same CATH superfamily
3AEYA 2P2LA 1BS1A 3FGZA 4ZQBA 3I2HA 1ZONA 3TDMA 2PY6A 5KIAA 2WFZA 2QORA 3B78A 4KDCA 3O75A 3U13A 2BF7A 4Q6BA 3GB9A 3DXYA 4BHTA 4YRMA 3WRXA 4E7OA 3CR3C 5MN4A 2X7XA 1F8XA 4E1VA 4UVIA 1R9GA 3AINA 3BSYA 4EQ6A 4KAFA 3I4LA 4V0KA 2R751 1RYHA 2G1UA 2AK2A 2ADFA 1XEAA 3B48A 3H5IA 5HQ3A 3AF2A 3U6BA 4F56A 4IQ0A 4IEIA 4LNHA 1GYRA 3HCBA 1C1DB 3HVJA 4FX5A 2C88A 1AKVA 1VKOA 5I5GA 1RKBA 3VX3A 2M6SA 1TZ2A 1XRMA 1LBSA 1I32A 3EXG2 1L7QA 5HF5A 3U7QA 1UXOA 3OAAD 2XF2A 4KZPA 521PA 2OQVA 2EZTA 3JAWA 4RMIA 1EFHA 3P9NA 4AVYA 5MF6A 3GWZA 2VTBB 4LF8B 3LHIA 2ZUSA 3D1JA 3WL6A 1IAVA 2PKYX 1KJWA 4K6FA 4V03A 3E27A 3GGGA 3X1MA 3OM8A 3EXIA 3PS9A 4HNRA 1FOEB 4MLZA 1R4ZA 3ELWA 1G8HA 3OWOA 4J03A 3R7AA 1CRPA 4YQFA 4RTLA 3AWIA 1ISJA 4B6QA 4M22A 3SM9A 2VXCA 2R62A 5CVTA 4EPTA 2OD7A 4IHKA 5BN5B 5TB5A 4PZCA 3RADC 4JLOA 3NMUF 3A05A 3H18A 1Z5OA 1LBIA 3VC3A 1KYWA 1UBLS 5IDYA 1R8SA 4LSWA 1I0IA 2ZZKA 3HB9A 3OIVA 4GQBA 4MW2A 3SR4A 4NZ9A 4R1QA 3VJKA 1I7QB 1G0NA 2IHTA 3A6KA 3PRKE 1Z4KA 5I7HA 5ICGA 1POXA 3H2KA 1GZHB 1GOTA 1UINA 3KLOA 3MBIA 4LJSA 3UJBA 4EMSA 5GP1A 1YVEI 4ZOLF 4A16A 1W4BA 2CC2A 3P9ZA 4JENA 4R2MA 5TQ0B 1E4VA 2P9EA 4J4HA 3DZBA 3OE7A 5I9MA 4JKYA 2KB0A 1XWFA 2NNWB 3RUPA 5CLIA 3WZLA 1COZA 1V8FA 4BAUA 4DIFA 3ROTA 2IYWA 4X61A 5CJ2A 3RS8A 1U7UA 4PLHA 1R5BA 4MX8A 1H2EA 1Y80A 4TN1A 4X5OA 5JCOA 4YCLA 1R9NA 1R37A 1T8YA 1N25A 4LSGA 1O9BA 3UTDA 4KR7A 3V1MA 4YV1A 2F3TA 3H9UA 4MQLA 2ODEA 1NUPA 3ZW9A 1UP7A 1GGEA 3ABRB 1ADBA 4DCVA 1OFUA 2HT6A 4IIHA 4TOIA 4KXXA 3VPHA 4K8RB 3PVZA 4MR8B 5A5DA 1XD2A 1IQ0A 2B94A 2G4VA 4BNIA 2BFFA 3HKBA 2GT1A 4RKYA 3S81A 3ZLJA 2GPJA 1QGYA 2ATVA 4YHBA 4F8YA 3FNEA 3L9WA 1A8PA 3EJWA 3FMIA 4R2LA 3N2NA 4LF4B 2X4LA 4L5JA 2ZI3A 4I5EA 1NDUA 4ND5A 2WZCA 4JEHA 2HF9A 4LHWA 4XYMA 2PHZA 2JNWA 1MU0A 3VJLA 1HETA 4II3A 3WMWA 5K03A 2WD7B 2ZBPA 5KCMA 4NVRA 3SICE 4NYIR 5E95A 5FUYA 1DXOA 1VKJA 4G4IA 4BQOA 1F6BA 4OQEA 4HNHA 1R5NA 2EC5A 2WW8A 2WTAA 2ACWA 3M6VA 1JSCA 4GEGA 4BFUA 1XOIA 4C4RA 1H4SA 1IM2A 1ESEA 2BFEA 3KLMX 4MMYB 3RVSA 4G84A 1HZZA 3FUXA 1TAQA 4G1BA 4KO4S 4NPCA 3RBVA 2Z95A 3O9VA 5FWDA 4LWZA 2LBPA 2ZIVB 4F97A 1LCIA 4PSCA 5LYYA 2JK0A 4YRFA 3WHIA 4X6LA 1Q0HA 3NPMA 5IARA 1ZH6A 1PT9A 4G0ZA 5JQWA 3I0MA 4PO1A 1DAMA 1T5HX 2ZSEA 3AETB 4MP8A 4WCFA 1E1MA 4OXIA 2ZBRA 3JZMA 3M6UA 3OLYA 3K53A 3NM5A 4DLZA 4N3CA 4BNNA 1FX0A 3RWOA 3VMMA 5JHGB 2P6OA 2BN4A 3OMXA 2X1MA 3B7PA 3EZFA 5L3ZA 2RAFA 3X1XA 2JAUA 4EB8A 3OD5A 4PO3X 1PU2A 1YA8A 3N59A 3NVKI 2O57A 3E9DA 4UNPA 3RSCA 3H9JA 4JWKA 1TECE 4AIRA 4EO7A 4XVRA 4J3FA 1Z5VA 4M0UA 3ZIAD 1J9EA 4LE2A 1P19A 4HHEA 1YBVA 2H54A 2G4LA 1SKQA 2V8OA 2XB4A 5SY6A 3GEBA 3OCJA 4XVHA 4YIKA 5KTNA 4QYMA 4LGMA 3IELA 1FTQA 1ZBQA 2GLXA 4DEYA 1WF3A 3ROGA 3E22A 2IU6A 1W96A 2PXXA 4RD1A 1U63A 3KVOA 2E85A 5AI9A 1MOPA 2XV1A 2GYWA 3I39X 1I1QB 4JBNA 2C0QA 1ZH8A 1N5KA 2I2FA 1QH1A 3DDCA 4KKXB 3ML1A 2RJNA 2O4UX 5ER9A 1XTUA 3ENWA 2IHZA 2JZNA 3QOXA 3RYTC 3SBOA 2BGWA 4U9IS 1DXQA 3K15A 3P45A 4WPGA 5KQPA 4RFLA 3UN1A 4ZICA 3JARA 2WEKA 1GPJA 1OHHD 1ZH0A 5IKXA 3ESAA 4GWKA 2FEOA 3KZ1E 3M2PA 3NTUA 4G07A 4JJ7A 1YZNA 3B9BA 3S2UA 1J0CA 4DAEA 5A1TA 5B1EA 3SFVA 3X3HA 5E8RA 1VRCA 1L1EA 3ILSA 4CEIB 3CB2A 2GETA 2J3HA 3B6IA 1KMNA 4ND8B 3NUQA 3GJ4A 3JATB 5A4KA 5CD1A 3VPAA 2J0UB 4DLSA 3D6AA 2BFNA 3HCPA 2GYVA 2CK3A 2EVWX 1DEOA 3LVBA 4J49A 2CDAA 3HJCA 4HQ0A 4U6SA 5ALYA 3TTTA 2JDIA 3MS7A 5DGIA 2C98A 4A2WA 3IUYA 3M9XA 5DMXA 4EG4A 1Y8ZA 5MN6A 4C03A 1GPLA 2YY6A 1E2NA 4ZEWA 1A9XB 2RSLA 3TR6A 4YUZA 4LBZA 4MVJP 3LCUA 1QHFA 3KWLA 3NWJA 5JS7A 4X44A 1U2EA 3R7NA 5GM1A 3I3OA 3PC3A 2P8SA 3HCOA 2HV8A 1U3WA 4CIDA 2CHFA 1WKBA 1Y82A 5LR6A 4QVIA 2XUQA 3RGGA 4J6EA 3UFXA 3R8CA 2DXIA 4KE8A 2PZAA 4JWTA 1LDBA 3IR5A 5AXAA 1T9AA 5AFSA 3LA6A 1QX3A 2EZUA 5JPDA 4RMJA 1SXPA 1AF7A 2DLNA 4X9XA 1XQWA 1NBME 4YI5A 2OKCA 2XHEA 3T4PA 4NXMB 2QTFA 1SUWA 1P3JA 3EDQA 1AU9A 5KKCA 3ND6A 3F5MA 4MO2A 2XZOA 3EC2A 1R16A 1OXSC 4HWOA 1VC2A 4BLOA 4X24A 5E6UB 5LP6B 3S8YA 4HYYA 1TQ8A 1GRCA 3QPAA 3AUFA 4IXDA 4NY1A 3O38A 1D09A 2E5FA 3BS4A 1P1HA 1OBFO 5DP2A 3JALB 2VTDA 1EDEA 2OAP1 1BFDA 2O5EA 3AUUA 5HF8A 2AN9A 1R66A 2Q0XA 3VAYA 4WNAA 4C6TB 5H02A 4HUQB 1RSZA 3C3WA 3V4PB 3V9PA 4TTSA 2NLOA 4MS1B 1JVSA 4OBEA 4FNAA 3K6RA 4ZD6A 3JWEA 4PSDA 3IYLW 1GLVA 2AZMA 4E94A 4ZYXA 2JAHA 3KUKA 2OQIA 2PKQO 3K9LA 1FTYA 1BHSA 1L8XA 3HWSA 2JEYA 3KLNA 4IXWA 1VLZA 1B0ZA 3EW7A 1XZKA 1I6KA 4TTRA 2X0RA 3TRDA 2BGNA 2PD3A 3IGFA 1U0OC 4JFRA 4L4YA 4C3UA 3BCRA 4XQGA 2HMTA 4JUAA 4C0BA 4B3GA 2WV9A 4DXAA 4J0QA 3LDGA 4PX2A 1B0UA 2H7YA 4R1UA 2HCJB 2YVKA 4MK4A 4AN1A 4OQPA 4LDNA 3KR9A 4H3SA 3IQIX 3EEYA 5L8VA 2TMDA 3UEOA 1EZ1A 1PD1A 4JLSA 4R16A 4JI0B 1TYBE 5BP7A 4Y2TA 2GM5A 3HP4A 1C4KA 1D1SA 1BFUA 5DCUA 1FRNA 3CF4G 1KXJA 1DC7A 4AQDA 4Z4HA 3PXXA 3JASB 2H11A 3RNLA 3W3AA 4OPMA 4UVEA 5AVSA 1EFVB 1YQWA 2F7SA 3FH0A 3G13A 4M89A 5E7QA 4KBFA 1K5PA 1THGA 5A9SA 4W5QA 2JIPA 3DWEX 3HB7A 4UNIA 1KDVA 1E98A 3KJZA 4PPGA 1N9GB 3JQ9A 4IY1A 4N3NA 2Q1SA 4FE3A 5JS8A 5EXSA 2F4NA 1P4SA 4DYHA 3EPRA 4HVCA 2JCYA 3T8YA 2JLAA 2QOEA 3OESA 4ARZB 1ZMRA 4IIVA 4F2WA 4EHAA 2XD9A 3CSSA 1RBMA 5FKJA 1M2OB 2VLIA 2DCMA 4GW3A 3RSSA 4Z3KA 4IUBS 1QAMA 3F6SA 5SZJA 1EDBA 1H1DA 4FWIB 1GTRA 4EPWA 3CVXA 2CJFA 1F2UA 5DX0A 1MEEA 2WWRA 3EAQA 5JYCA 4MRSA 4UEQA 4DV7B 1KGSA 3DBIA 3OFVA 5I9SA 3VH2A 1V47A 4YLEA 4X7PA 3HWX1 4HDKA 3L0BA 1OI2A 5AKLA 1K08A 2O05A 2BYTA 4AKTA 5IZCC 4IOKA 4ZAYA 3ABOB 4OCZA 3ZV3A 1Y7HA 4Q3LA 4LGCA 5EJEA 3CIFA 4HQNA 2ZK7A 4CM3A 1UBNA 1P6UA 2AHRA 3HM9A 2B6HA 4QUAA 1N33B 1FLAA 3DTVD 3VR4H 1NMSA 3JPWA 4YAFA 3WWPA 1SQ6A 3DF7A 2N1BA 2JHFA 2OP0A 3JTMA 4NYIQ 4G8DA 4CT4B 4DFDA 2C3PA 3TLJA 3MZ0A 3ICOA 4Q3CA 4M9XA 4R8VA 4F93B 1R6BX 2CLKB 4IQ4A 4TMZA 4IDBA 4PC7A 4LZAA 1VE6A 2AA3A 1W9MA 4M8LA 1KOLA 3RI3A 5FPYA 2G9RA 1I4EB 2RGGA 2WIBA 5L53A 1MRZA 1WUHS 1ZGZA 3CRRA 3ZC3A 4ODIA 1S4MA 2SCUA 1WMFA 3MSXA 3QVOA 4P3PA 5DW3A 2XYVA 1WDTA 4RHUA 1T0IA 4QL3A 2AMLA 1QVRA 4LEIA 4M7OA 2F55A 2OCBA 3DG9A 1BCRB 4ZU1X 5LSAA 1XLWA 1YB7A 1HOXA 2R48A 2XUFA 2QMUA 2Q3FA 5BWMA 1MAWA 1LWNA 3L6UA 3CWCA 1EFLA 2GJ4A 4GPTA 4U2GA 3BB1A 4KSYA 2CBGA 3SJ7A 1EG2A 2AG0A 2FH5B 4EB6B 4W5TA 2PXAA 4HDMB 1A5ZA 1Z8FA 4TN5A 4XOIA 2HNAA 1NI3A 1N2SA 3CUSA 3RS7A 3NUGA 2O8FB 2J87A 3UGTA 2HV9A 3MCVA 3K3PA 1QQTA 4XM1A 4BNXA 1VCIA 3KSRA 4AMVA 3AY3A 1PWYE 2W0SA 1XO1A 1JLKA 1IL0A 2PRKA 2JIQA 2UAGA 1NXVA 4ZK6A 2VP3A 1U2DC 1R18A 4TXJA 2PE5A 1Y7IA 4Q02A 3W5BA 1YD7A 1FSGA 1JDBC 1Q0UA 3LQFA 4AJ9A 3IBYA 1X19A 2CXXA 3NRJA 4DEVA 2R4TA 1JH8A 2L82A 2JHPA 2ODBA 2PJUA 5KWVA 3G17A 2EKDA 2EX0A 1BXGB 2ENUA 2CGEA 3O6VA 4TWAA 5FOQA 2O8EB 2QEQA 3BBLA 1MB4A 3NATA 4LIPD 2O1EA 1Z28A 4J1QA 3IAS1 1N77A 1YZQA 1Z8HA 4PFJA 4YAGA 4AMZA 1HZJA 4GKAA 3DB1A 4XD7A 4FW8A 4XOUA 4CF7A 3ERCA 2VJPA 4FFVA 1E6CA 4NE2A 1RXWA 4YP7A 3NAQA 3OC6A 2Q2WA 3QE3A 5CM2Z 1XF1A 4C04A 2QL5A 2RGBA 3E3LA 4ZJPA 1OLUB 1SBQA 4BE7B 1Z13A 3ZWNA 4V1CA 3GU3A 1KI2A 2HYIC 1KP2A 3RO7A 4RV5A 2J0SA 2GCOA 1L7XA 1SQFA 3OLXA 4KFRA 3ZDQA 1SBTA 2G5TA 1ODLA 2QMQA 2FSVC 2XXAA 2NXWA 1T9DA 1ZCZA 1FPQA 2OGUA 4FMCB 4CODB 2R6DA 1JIQA 1VL1A 3F7MA 4OGWA 3D0OA 4HI0E 4Q4LA 3C24A 5EHIA 3SQXA 4MKZA 4YAJA 4NCBA 5TVKA 1QCCA 4PYOA 1PZFA 1VPTA 5A5FA 4BB9A 4X20A 1OA0A 4HWPA 4OA8A 4M55A 5IJ0B 4FHGA 1NMQA 2P90A 1IIBA 1YUNA 1ZD1A 2P0EA 3D4OA 1NATA 5EJAA 2VJBA 2GHQA 2FPUA 3AHJA 4ZVLA 3H9BA 3MMSA 3UFBA 4AZTA 3JTEA 1IU9A 1AJEA 3AV0B 4IOMA 3SC4A 3QPUA 4GSLA 3BYZA 3IUBA 3E35A 1E9SA 2XTNA 1CEYA 2BFCA 4HFRA 2OLJA 3E1SA 4RLFA 3DDNA 1XJ5A 5JPIA 3R3YA 4B32A 5KJFA 1M6EX 2XI4A 4XW2A 5JVDA 1RP7A 3ULKA 1QR2A 1PYOA 4CV2A 2O2ZA 3KNZA 4N5MA 4UASA 5IPFA 1QANA 3R5JA 4L74A 3SX4A 3WK9A 1D8TA 4C4OA 3ZZMA 1FCJA 5JNRA 2DBVO 5FJIA 1V7PC 4S1NA 5TVGA 4M37A 5L7YA 1EHCA 4JU8A 1Q83A 3DT8A 3DVLA 4KIWA 2X42A 2BL4A 4RDCA 2NAPA 1EFVA 5TDHA 3CN7A 3KHKA 4JJIA 2Q6KA 1PJQA 5CW2A 2JJ2D 4CCYA 2DHDA 3E2IA 4DQKA 3Q8MA 2Y0CA 1RQXA 3JARB 1H8HD 2NN3C 1FMFA 3B3JA 4WFKA 4EGFA 1F3LA 4UUBA 2QR3A 3PDHA 4A1FA 1I6MA 3D6TB 4ZC1A 5DHFA 1F4PA 2CZCA 3DBHB 4U2EA 3V48A 3V1YA 1PZXA 1NXPA 1WW2A 2YWDA 3Q1LA 4BIIA 4ZMSA 3V32A 3QVVA 4HVTA 1SUBA 3DOHA 1VCHA 5DI9A 4EKDA 2GPTA 3H3JA 1Q19A 1XZDA 3II6X 3TNYA 4YX9A 5IHXA 4PXYA 2FPGB 3L5KA 3NS7A 1KMHA 2Q4BA 1UKBA 4M1QA 1OBCA 3CR8A 1JU3A 3I9KA 4Q01A 2WNSA 3RRNA 3KZCA 2YN4A 2FHPA 2YRWA 4FQ5A 5K4HA 2UYYA 1X8JA 3MCZA 1KPHA 4II7A 2CMGA 1ZU4A 3RYHB 4XIIA 5ARDA 3RBXA 1KGDA 2HCTA 1DAPA 3NCHA 3KXIA 3A36A 3JQAB 3LT0A 2X0JA 5ELXA 3HJNA 4UUOA 1U0LA 2WJWA 3DW1X 5BQXA 3O21A 2PRZA 1RXYA 3FPLA 3D8UA 5E6SB 4DHEA 3F0TA 1ZBDA 4O6VA 821PA 2C84A 3TVDA 1E92A 2AI1A 2FW9A 4NKRA 3EZXA 4A6XA 1Z6TA 5K3BA 4LF9B 2QQGA 1C1YA 5KTSA 1FNMA 2BEJA 4H4DA 5AWFC 3X0DA 2CDCA 5IEBA 4FE4A 2ZROA 1GCIA 2FFAA 5FWYA 2LR0A 3U5ZB 3SX0A 2NAFA 1HO3A 3PI6A 4I19A 4R05A 2WPDD 3QKUA 5FO0A 4EJ6A 3GFGA 2R85A 2XW6A 3OJOA 1GSAA 1MB2A 4GYYA 4UKDA 1LB1B 3VDXA 1PEAA 3C8ZA 4MCIA 2WSSD 2VHXA 2NP6A 4JLBA 2QTWB 1NLUA 2VH2A 1YDMA 1UPCA 1UT8A 4BC0A 4GFDA 3ZDCA 1XNJA 4OY3A 5F76A 3OIWA 1G21E 1NN0A 1QH9A 2JJ1A 3BERA 2ZETA 4I1VA 5K1ZA 5I48A 1N92A 2FW7A 1P33A 4D97A 4YYZA 4INJA 1KFJB 3T94A 1TJ5A 1H5UA 3TX2A 2J67A 3E1KA 2G40A 1E7SA 1JR3D 3EVNA 4ARIA 4U5QA 1X1EA 1DQRA 3AEKA 3HRHA 4MJ7A 4ZQCB 3Q7SA 2RGCA 3RTDA 3VNSA 4B71A 1C3XA 4G5FA 2WG1A 3PFGA 4MVJH 4A7PA 1SOAA 1EZZA 2J3KA 1FJGB 3OZGA 2JLVA 2ID8A 4Y6RA 5IAJA 1OT5A 2B25A 3K09A 3GROA 3H1FA 5AUNB 1HYEA 1W36D 1SBNE 1U2ZA 4DC1A 1JZSA 1ZI9A 2CYCA 3OLCX 2GJKA 2I6FA 3QBDA 4UHEA 4US1R 2TECE 5A4IS 4FWTA 3B82A 4BUJA 3BC1A 1VYHA 1KY3A 2R4QA 3OU6A 2Y1XA 1R4NA 4F86A 2OCYC 3AVVA 1J33A 1X80A 1VHJA 1GZ3A 3N8DA 4KW7A 1KVTA 1DAOA 2ECPA 4YAOA 1GA4A 7AT1A 2DQKA 2HMUA 4RTJA 2PUGA 1XZAA 2BY4A 3V7WA 4DS3A 5KOHB 5KU1A 1HM5A 3BOSA 5FPPA 1SKBA 5EFOA 5B1YA 4BCDA 2R86A 3JD2A 4O02B 1TVKB 2FE4A 4XB6B 1UQRA 1MVOA 2A57A 1KK3A 2GVNA 3AGPA 3FNFA 1MFZA 3ONVA 1D7OA 3B20A 3U9LA 3WY9A 2ZWOA 4CMBA 2C7GA 3OHMA 4NFSA 5BW5A 4KPEC 2ZUCA 2OXTA 1PKXA 2BLNA 5LD2C 1FL9A 1XRQA 4QU5A 3TTSA 2DLCX 4TRJA 1EESA 3RYIA 2GILA 1DBQA 3EE6A 1RM3A 4Y2PA 2V9PA 1PO7A 5GZ6A 1PWEA 3Q3EA 5JPCA 4DA4A 1ZUNA 1GKKA 3DBRB 3BQMB 3HGTA 1YZ3A 5AM2A 4CDMA 5J58A 3RK4A 4W6QA 2FWMX 3WYGA 4BUZA 3DGEC 3HO8A 2G6BA 3RFTA 5LKAA 3R9XA 1ZL0A 1GGMA 5CVDA 1XAGA 2XOKA 5JYBA 2P35A 1UPUA 4KH0A 1YR9A 3OJ0A 3ACCA 3DHNA 3SNKA 3LUHA 1XL1A 3L02A 4AY2A 4QM6A 1JR6A 4MLPA 2CMFA 2HF2A 2DRIA 1XXHE 4OM8A 4A6DA 3PDJA 3HWRA 2R79A 4JK3A 1NV8A 1C0KA 3R23A 4RDHA 3PGXA 4GAEA 1K8RA 3DMPA 4OXKA 1DI0A 2BMVA 2HJ9A 1Q3KA 3PE4A 1WPGA 5AESA 3DHWC 5TQ2B 3KSMA 1RI4A 4CMGA 4AP6A 4HDKB 1RKUA 4DXDA 1TT5B 3EVEA 3ORQA 3ANMA 4PGFA 4TQUS 3DONA 3KDSE 4G1VA 4WESB 2Y6UA 1Y8RB 2IBMA 2VF7A 5K2MA 4KE9A 2FRDC 2ZVPX 1ZN9A 4W1PA 1T3ZA 4LNUA 3R5SA 2QX8A 5BMVA 1TXGA 3UB4A 3A6ZA 2MU1A 2FUCA 3L8ZA 3P7MA 3UT6A 5BR7A 1GTVA 2HDHA 3KKOA 2XNKA 2GNAA 1RWPA 4JSTA 2POCA 1F14A 1S8AA 4M87A 5DCLA 4C4XA 5JUWA 4I55F 1C4XA 2VVTA 4YJ3B 4ND7A 3MXOA 2M6KA 1P2GA 3DBHA 3IEXA 3U4DA 4WY5A 2ZYUX 4IKEA 3CVWA 2XMRA 3E8XA 1HKUA 2OGWA 5FA6A 1ND5A 2IJGX 1RRPA 3GRRA 1INLA 2JCXA 3UF0A 3LLVA 4QOHA 4YJFA 4C9BA 5DHUA 5ITVA 4DJ5X 2D6FA 1DO2A 1TRHA 4JU9A 2AXEA 4GLBA 4D9IA 1C4OA 2QYSA 4L4XA 5JMTA 1JG3A 3GDOA 1VMKA 5HRAA 2LP4Y 3FB4A 3V2GA 5CFOA 3KJEA 2B6NA 4MCJA 4EJMA 1AC5A 4K03A 2WA2A 3A6PC 1UQUA 2B2NA 5TE9A 2WPNA 1DFHA 3U26A 3K20A 2R25B 4BGUA 2HHHB 4YAWA 3SZLA 4YAEA 4ACAA 2ZAIA 4P84A 5FYDA 5GVRA 2QLBA 2V4ZA 3K6SB 4QYIA 1R88A 4RPLA 3SYTA 3V7NA 3AONB 4R40A 2AFIE 3JQPA 2CNBA 3A1DA 2LKCA 5LPNA 1UFVA 4HH4A 1WDWB 4YJ2A 1GAXA 4QPZA 1V43A 4EA7A 1KZ7B 2OZEA 3OLZA 1SUCA 1ZGGA 3HXTA 3QJYA 4FSHA 1ORDA 4KWTA 5DFAA 4TLLB 3T3IA 1ULAA 3G88A 4XVUA 5KTYA 1PWXA 3QMWA 3S70A 5A2GA 2ZJ4A 4TRRA 3W90A 1BDJA 1FQJA 4X1KA 4GWGA 3ZI4A 4NOJA 1PQ4A 1TQDA 2ZAGA 2E48A 4F5DA 3AF0A 2HOQA 3Q9NA 2I4LA 4MWSA 1U6KA 1WETA 4JI7B 3OE5A 5B58C 3U80A 1O6FA 3IRUA 1X15A 3U48A 5FDFA 3AL2A 4IH1A 3ICWA 3K0BA 3WQHA 3RC8A 4WVFA 1K68A 1YOVB 2BM8A 5EQDA 2P1ZA 3ESCA 3GPDG 2B30A 5FUMA 2IYZA 4BLQA 1CRWG 4J1TA 5CJPA 1GUDA 3KJHA 1X3SA 1JHRA 1MV8A 2J9FB 3FBTA 3A4TA 3ORRA 1Z0FA 4H6XA 4LY3A 1PJZA 1Q11A 4AWBA 1UDCA 3I37X 3F5FA 4P8RA 4URYR 4C3ZA 1JKXA 1XLTA 3VRHA 4WBNA 4MYHA 4M99A 1FB5A 2OFWA 4LI3X 4MV6A 2PMEA 4EG6A 4DDWA 2F8SA 4DCNA 2D2VA 2XAUA 4LC0A 5G3YA 3DQZA 2OWDA 2GN9A 3SEFA 4N7RA 2WYOA 2JFHA 5G3ZA 2DJIA 3ZWXA 2EWWA 1WR8A 4DE5A 4Z51A 3LP6A 3KT8A 5EKUA 3KJQA 2OSBA 1C3JA 2C7VA 3R4CA 5LA6F 1SPXA 2BTOA 3IHTA 5F1PA 4B3XA 3SNHA 3TTWA 1GGNA 1XCJA 3K2QA 3EISA 5AUQA 1NQAO 3SFTA 3ZNOA 2OR3A 3FX2A 2C9DA 2O0LA 2A9QA 2JATA 1GTZA 1A88A 4D4LA 2FSHA 1BRMA 5GOTA 2DULA 2PRYA 5KJ6A 5FBRB 1M6WA 1OC4A 2C8LA 4IRMA 5CXQA 5IU6A 1Q3TA 2YJNA 3HUDA 2KQUA 3SF8B 4MQEA 3FIUA 4B6SA 3EVZA 1ZUNB 2D5AA 1ACLA 3DBRA 4Q18A 3VZRA 1SURA 2J32A 3WL3A 4BMPB 2YCLA 5JNLA 1I2DA 2FZCA 4LECA 1TLTA 3MT0A 1V16A 1X1TA 1ZHFA 4O63O 4WKNA 2PS0A 3K1TA 2MSLA 3DLTA 1QRDA 4ZVNA 4OHFA 2RE8A 1XRSB 1J8QA 2IUTA 2TS1A 4JLUA 4RM2A 4HAYA 5B1IA 1CYEA 2Q9AA 5K0ZA 2ATIA 1SUAA 1Z5NA 3AUTA 1WXXA 2BJWA 1FSPA 5A9TA 4Z4QA 2WM3A 1H23A 2GHRA 3IMFA 1N9KA 2RG1A 4FCWA 4WXHA 3SX2A 4C29A 4DCOA 2OV2A 3KK0A 2B2XA 4PYLA 1EE9A 2J85A 1SU4A 3KT0A 4Q48A 5C8VA 3CYFA 1FLDA 3T9CA 5HIJA 2ONCA 3EGCA 2E82A 1VP9A 2R5WA 3RG8A 4DA7A 1TO6A 4DWOA 5M34A 1XKTA 2IZ6A 2QRVA 2R6GA 4E4TA 2Q0HA 3JATA 2GASA 2W2MA 4CQLB 4KODA 3W04A 4WXMA 2WKPA 2J7KA 2JFPA 4LYHA 2ZW9A 1JKMA 3RSGA 5EP1A 1R3DA 2A35A 1OASA 2ZG6A 3AIOA 3TJRA 4FWBA 4F2PA 4HRAA 4J7AA 3QXHA 4JLMA 4XM2A 6NULA 4Q3AA 3D6MA 1ESMA 3P94A 4DF3A 3BHIA 1ABBA 2WTMA 3MK31 4P38A 1WXDA 4L6IA 1L1FA 3FOFC 3PQ2A 1G20B 2VDRB 4M86A 1KK2A 4TWBA 1GO2A 1YA6A 1XCMA 5FO1A 5LMZA 2ZTLA 2NQ8A 1GLGA 1PF7E 3CF2A 4B09A 5J5AA 1ILEA 1MQ9A 2VHQA 5IUNC 1IZ8A 4DBZA 2YZMA 3FTQA 2B34A 2MSNA 3MQ2A 1GJRA 1PL0A 1RAIA 3JQ7B 5IASA 3ETGA 3QKSA 4I36A 4WERA 4KV7A 2YOGA 4P7GA 1R9JA 2IW3A 5EGNA 3W7BA 1U5BA 1S5PA 1K97A 4DLTA 3DJYA 4IDOA 4D44A 2ZUWA 4Y2HA 1D1PA 1Z0KA 4EWLA 4JXZA 5AXBA 4BJ5A 3JQCA 3UH0A 2X5XA 1FIUA 3KU1A 5JYEA 2X2FA 4RKWA 2DT5A 3G2KA 2I2WA 1T0JB 1ISSA 3ANTA 2E1PA 4L02A 2I29A 1VLQA 1FFCA 2I0FA 1Y3IA 3A70A 2Z09A 3IEVA 2JBHA 2GJ9A 1CVRA 1SU6A 2QMHA 3BK2A 3D4NA 2GWRA 3GNLA 4QODA 5I7AA 3SE7A 3SJUA 4YMGA 3IMGA 1XX6A 2DWOA 4RK7A 4G4JA 3PNPA 5KVQA 1Y1LA 3VHRA 1DO0A 2XADA 5I3CA 1MAVA 2WE7A 5KQSA 1H1LB 2O52A 2JPDA 5JFGA 3UTCA 4G0VA 4HDRA 4YCBA 3U31A 2F3PA 5F3RA 5JC8A 2A7XA 3IIIA 3M83A 5HOQA 1LK5A 2ASEA 2R2AA 3EPHA 2DY1A 2ZVDA 4J0CA 5DIZA 1CF9A 4JI3B 5IWAB 5GIOE 4EARA 1AMOA 3V1LA 5AJTA 3TVYA 3PLAE 2HJSA 3N8GA 3N2GA 1BJTA 3QQ5A 1JLLB 2RH4A 2W6JA 4OK5A 6REQB 3HA7A 4QU9A 1JIJA 5CLQA 1ISPA 1M8FA 5BV7A 4DA6A 4DMHA 4MKRA 2V03A 3ZCVA 1UJ4A 3KUCA 4NF2A 1QYCA 1XYYA 1KARA 5KHAA 1J23A 3IA7A 1U5AA 4EX6A 2RHHA 3ROKA 2ZR0A 2ZYRA 1A50B 3ODGA 1E2DA 3W5DA 3NKLA 4A03A 3J81A 2H9YA 1SGWA 3Q5GA 3ONDA 5LBTA 2O3TA 1HYHA 1T4DA 1A7KA 1MBZA 1WPXA 5JBQA 1JVBA 1MD9A 3D54D 3Q72A 4FP9A 4BOYA 4UEJA 3IHKA 1CX9B 3SQLA 4MYRA 4IICA 4M9ZA 3OEHA 2P2CA 1GPYA 1V26A 1R0SA 4XDGA 3WNDA 4AUMA 1EXWA 3AF6A 4KPUB 3EHDA 1N5IA 4B9EA 4JLDA 4WLEA 4MSUA 1X74A 1Z4MA 1W87A 5JDIA 2JA1A 1CTQA 2RH5A 4HRVA 3WHKA 3PLNA 4REQB 1GQYA 3QHAA 3F7NA 4G36A 4YJDA 5G4KA 1ZHOA 1AN0A 1OLSA 1WCXA 3EVCA 2W4MA 1U9JA 2FDXA 2CDNA 3HFJA 4MWBA 3P19A 3TBFA 1SHTX 1IXZA 1IE3A 2I7TA 4QO8A 1VHLA 2IODA 3LBIA 1S2OA 1UMBB 4LX0A 3S2SA 1TD1A 1Q7CA 2E4VA 2HHCA 2Z3VA 3EQZA 3QVLA 4MJ3A 1X6VA 4QECA 5TGDA 3BWYA 3RRYA 1HFWA 3SP1A 3UW3A 1CQWA 3G9TA 3H16A 3EIQA 2PD6A 1KQPA 4E08A 3MAJA 1QPGA 3CKKA 1P5JA 2VL7A 1B73A 2W22A 4R98A 3VPSA 1T4MA 5DBFA 1QMGA 3KL4A 3NBYC 3RYFB 1IXYA 4DG8A 2GZDA 1M2HA 2ZRLA 3EVDA 1UK8A 4JA2A 1Y5MA 2FR8A 2P4SA 3AL3A 4PIPA 3ZCQA 4DNFA 5FWYB 3MYRA 1DS6A 4L9RA 4EHIA 1VIMA 2XZTA 3MRSA 1RIIA 3THXB 2C5EA 2QZ9A 5F33A 3K9HA 4AN4A 4J75A 1BSVA 4H35A 5KNDD 1MP0A 1M2JA 1PDWA 2G83A 1N4AA 3W9UA 5C1OA 1SELA 5J1TB 1PEKE 1X3LA 2ODPA 4D9CA 1XIVA 3K1YA 3AR7A 5IW8A 3TFQA 2B4RO 1WUJS 3D1LA 1ZWLA 2RJOA 2AG6A 3NEAA 1H2BA 2V65A 4WUVA 2G7ZA 1YCHA 2C20A 1UWLA 2PX8A 5C8ZA 2YHAA 4G9EA 2CY0A 1V11A 5DGHA 4JC4A 2NXCA 2QPLA 5EERA 1PYGA 5DP1A 4KR9A 3GD5A 3R3JA 3KYCA 4H7DA 3NC4A 3T95A 1IZ9A 1DRWA 3Q1KA 4G97A 4LI0A 4QARA 2X3UA 2XY4A 4IXMA 3OEHD 4JELA 2EJCA 5D1HA 2WKQA 1VMIA 2XHZA 3UJ7A 4B3CA 2XSZA 2VDKB 4RV9A 3RUHA 2H4YA 2QBYA 1PV2A 3UMBA 3WISA 3LT4A 5CIWA 4UXIA 5CFLA 1E18A 3QVGB 2GPWA 2XMCA 1LKZA 3GFFA 1F0KA 1VA4A 3BGOS 3MRVA 3O3MB 1SQ0A 4JL6A 4YJ2B 3UG6A 1WEKA 4WGGA 1ZGCA 3G7UA 3C6XA 1DPGA 1VZ2A 2LTAA 2WU1A 2O7VA 4ITRC 4JBLA 4MV5A 5FV7A 1E1NA 1EXVA 4H60A 3WB0A 2CNOA 4Q7QA 3A6JA 2G1AA 3A6LA 4JP3A 2QYOA 1UEJA 2W2LD 3KD2A 1HZZC 3CO5A 4B6JA 5LQUA 3FNGA 4BX2A 1YI0A 2G07A 2DTEA 3ADOA 5WRFA 1WB9A 1P4RA 1CE8A 2V6FA 1JDBB 4R51A 1S7CA 2IDMA 5FWAA 2CLFB 4EY4A 4HPWA 1ESZA 4K6GA 2C8KA 3RHTA 2EBWA 5JAZA 3K9WA 1QHSA 1OF1A 3BRSA 1F2TA 2YYSA 2H07A 4KUGA 4RZSA 5AI8A 4CDRA 3T5BA 1TEZA 2IH4A 4DMLA 3R5XA 5BNIA 2IZ5A 1S8FA 4JJKA 3LWNA 5DI3A 1B23P 4ER0A 2HRQA 1CV2A 1XTQA 1YJCA 1I3NA 5JYDA 4F4HA 3NJ8A 1SUEA 2YHBA 1OXBB 4RWEA 4RVNA 4RTNA 1K06A 3G8YA 4XFJA 4FILA 2GZHA 1XA3A 1SEVA 3GX1A 4EG3A 4ID9A 3EBPA 3D5EA 2P5SA 4DLUA 2GARA 1QFJA 1PL6A 4DJEC 5TNXA 1QKKA 2DKFA 1H6DA 4XUCA 2TMYA 4FDUA 2PV7A 2MSCB 1CVLA 5DASA 3UMJA 5B64A 3I6IA 1DWOA 1PL8A 5I4CA 5EJ9A 4Y2VA 3MRTA 4MI9A 4RHXA 1J0XO 1NW3A 1P0MA 5JWHA 1JUDA 3EC7A 1FUEA 4MHOA 2I7CA 2W2LA 3GBSA 4IWYA 2PS9A 1GA1A 1JQ3A 3FYHA 3HPRA 4JGBA 4AO6A 4E4YA 1ZAKA 1SCUB 5JXGA 3R76A 3AHFA 3BREA 5BT9A 4KXFB 2PBLA 1LI5A 4MRRA 2WAXA 2WHPB 3STTA 4CQMA 1JEYA 4A36A 2FR0A 1U9CA 2QVXX 4CM9A 3CRW1 2G9NA 4KK3A 2XA2A 2HPHA 3RTGA 2VP4A 4H1HA 1RM0A 4TKZA 3P5SA 2NZUG 3IB3A 4QQRA 4MW0A 5JY6A 2H1OA 3EJ6A 1E6MA 1BE1A 2IUFA 4J07A 1SU8A 3NXKA 4GI5A 5BXYA 1T0HB 2F3SA 4TUYB 4AZ3B 1GEGA 1E8NA 2ZB8A 4RA6B 1E60A 2BM9A 4IJ6A 3IQFA 2IOQA 2BBTA 1JQLB 3HHPA 3O90A 1FYFA 2RKOA 4PBRA 4DGSA 4ESOA 1P61B 4KYVA 2FWBA 3BL8A 4HH0A 3CRZA 5CNMA 1QKJA 2UUOA 5BN4A 3L79A 4XX1A 1X0XA 1OFHA 3L1JA 3LLMA 4A9AA 4KDEA 2CLCX 1WXHA 5BWCA 1VE9A 1XZIA 3RPEA 5FRDA 1XLTC 2WFLA 4X3PA 3MMNA 2PX4A 3GNQA 2H51A 4RADA 5CXXA 4Y9RA 2GCIA 1WSBA 3ZGVA 2BFOA 5INTA 1GPKA 4H17A 2IEIA 5MN5A 4MYCA 5JAIA 4G4SO 2FF7A 4IDEA 4D25A 2QR2A 2QSUA 1SQSA 5DHSA 3FYUB 4ZAWA 3CPSA 3RKSA 4X7BA 3H6GA 3KIPA 2OFFA 4N1AA 4FFWA 3RHFA 5E8JA 4D5EA 2C04A 3A6EA 1AKUA 1HE2A 2XWSA 3KQQA 2RFLA 2CB0A 1AGNA 4J4TA 3KBOA 4JC0A 3WRXC 1CP3A 2E4XA 2I3ZA 5GOZA 5HUJA 5KOIA 4Q5IA 1FZTA 2FF5A 1M1NB 1WOYA 4QGGA 3O2JA 1U2SA 5AKYA 3DC2A 1OBVA 3I9NA 4WBNF 4ARBA 3EB9A 4FFDA 1M74A 3G8AA 3LCVB 5FPKA 2PUCA 2IZ7A 4RQUA 4BRWA 5EOVA 2XNDA 4NJMB 1CF4A 4UTVA 4BO7A 1CUYA 1XE3A 2RI6A 3IBTA 3AKEA 2OWEA 5FWNA 2ZI6A 3FPJA 5BOSA 3KXKA 2LDBA 1ML4A 4I8DA 2SKEA 3U3RA 1JXMA 1ZVVA 3PFWO 3ZYZA 1W19A 2WILA 3MLBA 1RYYA 1R6AA 1ULZA 1HRDA 4FOTA 4RHFA 1TU3A 5HJ2A 3V8NA 5ADVA 4G0MA 5JDIC 2QUKA 4PYNA 2HIGA 2FSIA 3AUSA 1T4BA 1CJTC 3N0XA 3W5UA 3QKTA 1O7JA 1VQ1A 2ZYDA 4LMAA 2DECA 4OQLA 1FFXA 1N8TA 3CW2A 1EQUA 1GQRA 1X8LA 1YRQA 2ZBEA 3MINA 4K0RA 4YUYA 2NNLD 2W2TA 3BILA 4QT4A 1A72A 1XF9A 13PKA 2NO0A 2VS1A 4WNYA 1KSJA 2IPAB 1NUTA 1OLSB 2AIRA 1P3DA 3L6BA 1JZTA 4MB0A 5B2EA 1AHPA 4BKMA 3WFZA 4CL3A 2GLUA 4JQCA 4MQ6A 1GADO 4REOA 1BVRA 2AYZA 4JI5B 5IHPA 1A5AB 1PJ3A 3CM0A 3COVA 1S2GA 4RVOA 5L3RA 2ORWA 3RVBA 3A9TA 1GNQA 3B6ZA 1S4QA 3BD8A 2AOUA 4N01A 1MQSA 1D07A 1QO0A 2HB6A 3WIUA 1WHTB 2O8BA 1NVVQ 2WTNA 2YWRA 5FL3A 5JXJA 2HIMA 3IVAA 4Q4AA 4ESEA 2FUKA 2X9NA 4KMOA 3SK0A 5C1PA