4IFBA

Crystal structure of sult 2a1 llgg mutant with paps
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
274
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfotransferase Selectivity at the Molecular level
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Bile salt sulfotransferase
total genus 95
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ifbA00
4UNRA 2HT6A 2GEDA 2QTFA 1JALA 1P75A 2O0KA 3TAUA 3R9WA 4ZI3A 4OK5A 3CIOA 4J0QA 3SC3A 5C1BA 4PO8A 2QGNA 3FOZA 2F55A 3ADDA 3THXB 2YKGA 2ZJBA 4DHEA 2W6ID 3HPRA 3QKUA 3UXMA 5FTMA 2ZRPA 5EP3A 5FTJA 3TUIC 3QF4B 1JAHA 4G1UC 2VPPA 1GUAA 2NPIA 1KMHB 5J4KA 2D3WA 4KSBA 2ZPTX 4QKQA 4TL7A 1RRPA 2ZYWX 3QBTA 3S1AB 4JLBA 3QI2A 3I4LA 5TVKA 2KSQA 2BM1A 2FG5A 2YV5A 1GTVA 1JI0A 1OXUA 3I8SA 1G5PA 1DAGA 4MYUA 3KQKA 1E9DA 1KZGB 1AS3A 4Z8XA 5KNBA 2Q9AA 1US8B 2VSXA 1LVGA 1XJCA 1D8TA 2J7PA 4NYJQ 3D31A 4IDOA 3CWQA 4B71A 4D4LA 2NO9A 4Z54A 4TLEA 2R6CA 1ZU5A 4NDZA 5CM8B 1N6HA 2IYVA 1TADA 1HQCA 1F2UA 3P32A 4HDOB 3PEWA 5FPTA 3R8FA 1P2SA 3THYB 4Q18A 4B44A 3PEUA 4P3YA 1F48A 2G1JA 1SVKA 1CKEA 3ZVNA 2HLDD 3I3SR 2IX3A 1ZYUA 2G9NA 1GM5A 3MD0A 2OAQ1 4N1AA 4GMXA 4RD6A 4RZXA 4XTCS 2WMOB 3BB4A 3MGCA 3KUDA 5FPHA 2OBLA 3KJGA 4ARZB 4G5GA 2IEZA 5JZVA 1U0LA 3AKDA 3CPHA 3AM1A 1AGPA 2P2LA 1N6IA 5TB5A 4X8OA 3QG5A 2R2AA 3CUEF 4A6XA 3PJRA 4MGIR 3Q9LA 4F92B 5JRJA 1T6NA 2IT1A 3RYTC 4A8JB 3WHLA 4HAZA 4CEHB 3IILA 3K9HA 2ZRKA 2GZDA 5LDDC 1SXJB 521PA 1E79D 3CLVA 2QSYA 4G5OA 5TV2A 4LGMA 5BQ5A 2F43B 4FMDB 3ZD7A 2F1RA 3I1FA 4TL8A 1P5ZB 4GMDA 2XAUA 1E9CA 4WVFA 3RRNA 2XJ4A 2V9PA 1P61B 1JECA 1XNJA 2BOVA 3BRWD 4LHXA 2GILA 2ZRIA 4KBFA 1NN3A 3LVRE 4NPHA 4W5JA 5SZIA 3FYHA 3P1JA 3OEHD 2ZUDA 3TIFA 2D4HA 2JAQA 1R0ZA 3H1TA 3KUCA 4XSHA 1P2UA 4BRUA 2VLIA 5AUNB 5JJKA 5HPYB 5KOYA 3BOSA 4RKEA 4II7A 1ETUA 2ZJAA 4OHZA 3PFIA 1XX6A 2FX3A 2IXEA 3RS3A 1OIVA 3PUYA 4EFNA 2VHUA 3B85A 3EIHA 3T06B 4D0GA 1B23P 5FOTA 1UBCA 1W0KD 2J0SA 4BQSA 3QKSA 3V4RA 5FH9A 4Q1FA 1TQ2A 4TTPA 5FOSA 5FUVA 2FJUA 3RWMB 2G88A 3NC1C 4DLWA 4PHTA 2PBRA 3FB4A 2FH5B 2EWWA 1XMVA 4TQ9A 4BFVA 1VG1A 4KFTA 3BK7A 3RSOA 4FIDA 2GVZC 2EFDB 4PAOA 5FUYA 1W48A 1Q57A 2FOLA 3U61B 1N5KA 2A5GA 4CEIB 2GJ9A 1S96A 1QHXA 1DPFA 5FFMA 2GF9A 4DLYA 1KDRA 3I5YA 3L8ZA 1IJEA 4GP7A 4NCKA 1QHYA 1KDOA 4YMVA 3GCGA 4LHVA 1IJFA 1XXHA 5KSYA 3DMDA 3ZIAA 4M2LA 4PSVA 1G16A 2GEUA 1SKYB 5KUTA 2RMKA 4P0TA 4Q4AA 3THXA 4B3FX 5DNYB 5LB4A 5FI0B 1FUKA 1V5WA 5K8IA 2GXQA 1CJMA 1UBEA 3QIAA 2YC2C 3A1TA 3LXRA 2IWHA 5HE9A 2WSSA 4QXAA 4B43A 2O0JA 4OQMA 3GQBA 2JCSA 2ZRDA 5CDFE 5FBVB 1NMZA 2Z5FA 3NHBA 2V54A 3UMFA 2GCOB 3HYRA 3U7FB 3LWNA 4M1MA 2IHBA 2XNDA 5L3SB 3DHWC 5FOUA 1T0JB 1CU1A 2IHYA 1YZLA 2CLCX 3AP3A 4EFMA 2BCJQ 2ZRAA 1NLYA 2ZU0C 3RAPR 2QROA 1G6HA 5H1YA 1GWNA 2YOFA 4IVRA 2DY1A 1PVOA 3BB1A 2QRZA 1EK0A 2W6JD 4LWZA 3CX6A 3G0HA 3FFBA 4BEJA 2DHRA 4D4KA 2AK2A 4P4SA 4M21A 1KI1A 1G20E 2C78A 2RAPA 3D3QA 4PSAA 2OFWA 5EJEA 1NSTA 3JZAA 4LV5B 1KI9A 2V3CC 1ZRHA 1YR8A 3N70A 3TVTA 3L0SA 1E2MA 3PV0A 3QPVA 3LVQE 3RVBA 1TEXA 3IHWA 1K8RA 3RDPA 1SVIA 5ELXA 2XNDD 4BZQA 3FKSA 4B73A 1M1YE 1SVLA 3Q72A 3ZZUA 1M7BA 4Q7JB 5BYJA 1RFLA 2F6RA 2G0NA 5DI3A 2J59A 2VP4A 5JEEA 3EZ9A 4YC7A 3VNUA 2WBLC 5HR5A 1G7TA 3TNFA 1OYYA 1NN1A 3UPUA 1AGRA 2W6JA 3EX7C 1IXRC 1T5LA 1RYHA 4QHYA 4CIDA 1QHNA 2GBLC 2AK3A 4EPVA 1VG9B 2FE4A 3GJ4A 1LS1A 1KY2A 1MOZA 2F9LA 4HB2A 4QHTA 1UAAA 3BJIC 5G3ZA 4I1UA 2PL3A 1Q44A 3KDSE 2O8FB 4V0LA 2VL7A 2D62A 3PR1A 3VX3A 5M04A 4PPGA 2QNRA 4ASUA 4K81B 1TU3A 2ZSBA 4DKXA 5AUQA 4H1UA 2ZM5A 4TT3D 1E9BA 2OXRA 3U4QA 1OFHA 2CJWB 3A4LA 4QGAA 4YDSA 5E7IA 3S1AA 1CBUA 1FP7A 2XITA 3NXSA 1CR0A 5GJVC 1KAGA 1II8B 2CK3D 5ANRB 2V8OA 5JWHA 3B6EA 3QPUA 1KTVA 2QT0A 1U0HC 1EG7A 4IDHA 4UNPA 5FOWA 5GVSA 1VCIA 4CT5A 3AVXA 1I2DA 2A5DA 2VBCA 2IXFA 2WICA 1ZCBA 3CPJB 5EZ6B 1I4DD 3GLHB 4IW3B 1XTKA 2EFEB 3TSOA 1P4SA 2BEJA 2WKQA 1RIFA 3MJRA 5AK0A 2NZJA 3FMIA 2PX3A 2X2FA 4ASUD 5KYKA 1TF5A 1NJFA 2ZAMA 2GCPA 3I72A 1DAEA 2AD1A 4PQYA 4AYTA 4X8LA 2QBYA 2CMKA 2ZAOA 2JLWA 2QE7A 3OEED 1E1QD 4B48A 1SHKA 4LDJA 3HDTA 3FPAA 1KIMA 5B2ZA 1LF5A 4ZKEA 1XXHB 2PH1A 2QU8A 4H9GA 1XEWY 2CLDX 2IYLD 2ZS7A 3P27A 1W36B 4I81A 3IKJA 3SJCA 5JEDA 1LW7A 1VG8A 1II9A 3UIEA 1IN8A 4PQFA 4TLCA 3X1WA 4DVGA 1ESNA 4RFSB 1T5IA 3T5DA 1JR3E 1DELA 2BKUA 1XMSA 2WWXA 1H8ED 2PZGA 4RD2A 5J40A 2O8CB 4HAUA 4TYNA 4FN5A 4NYIR 1OT3A 3FMFA 3K70D 1IQPA 4OHYA 3T1VA 1GRNA 2EQBA 3E5HA 2LCFA 4XSGA 2FEOA 3E1SA 2ZS9A 3PUWA 1E69A 2Z6VA 1GKIA 1ZJ6A 2F3TA 3VR3A 3SZRA 3U5ZB 1YZTA 5FPSA 2JLUA 3VHXA 1IOZA 1BIFA 1XTIA 4D0LB 2B92A 2PLFA 1IN7A 5DH9A 3OESA 2WM9B 2GJAA 1AS0A 2WMNB 4KYUA 2R62A 4UJ5A 5AJWA 4DEYA 4BECA 4US2R 4C30A 2J3EA 2SHKA 4Q9HA 4QNMA 3X1ZA 4QRHA 3PQCA 1LNZA 1OXXK 1HUQA 4B32A 4O2RA 4IVPA 2D06A 4V0MA 1QDEA 1S8FA 1WMSA 2RGGA 3AF4A 3F0TA 1RJ9B 4ABYA 4S2EA 4E22A 2N1BA 2P5SA 4D4MA 4C4PA 1GNPA 2BHRA 4JS0A 2PT7A 5TY0A 1OSNA 1KI6B 5FUXA 3K09C 1MRSA 5KPDA 4FD2A 3M1IA 4TMXA 2B8WA 1P60A 2C96A 5E4FA 5FBRB 3R9XA 2GETA 1ANKA 1CS4C 1XD2B 4GRAA 3W5JA 2IW3A 3VR5A 4C0QC 1OH7A 2P6NA 5JHHB 4GDFA 1W0JD 2QN6A 1N2CE 2JLZA 2JDIA 1G18A 2F43A 1ZNZA 4AY2A 4IVQA 4JVNA 1E2QA 3DDCA 2CCGA 4A4DA 2NGRA 3WP0A 2OCYC 3B2EA 2RGDA 4JKYA 5C4MA 3BERA 4POAA 2DFLA 4PC1A 1M34E 4LBYA 1OFIA 1NL3A 4BFXA 2BIFA 2QMOA 3ZS9A 2G6BA 4B6FA 5JS7A 1UEIA 2OSBA 2YVUA 4KITB 2AX4A 2CL7X 1COWA 3U3OA 3CH5A 4OBEA 2I1QA 4JL6A 4JYBA 4MDFA 2O8CA 4PC3A 1G4AE 2NZ8A 4LV8B 1G64A 1AIPA 2H17A 3THWB 4XWKA 2QORA 3FMOB 3OE7A 1OB2A 2GAAA 4W5HA 2GNOA 3A1WA 1BYIA 3KKOA 4C2TA 2ZI4A 2RH5A 1ZM2A 5FL7D 3VMFA 2PCJA 5DN6A 1XD9A 3Q85A 1MO5A 1FZQA 1HEIA 2ODBA 4NKRA 3ASZA 3MWJA 3FHTA 4LYJA 2Z43A 4FMBB 1QHHA 1PZNA 4AG5A 4XVRA 1Z83A 2FPMA 1KI3A 3KXIA 3SNHA 1RJ9A 1DAHA 2XOKA 2R65A 3E2IA 3OIVA 4JBYA 1SULA 1LS6A 2LKCA 3UMRA 4A1FA 4URWR 1JPJA 2FA9A 3KX2A 2QE7D 3OEEA 4RCZA 3PIRA 5HKKA 2BC9A 3EASA 4DC9A 1NMYA 3QXCA 4M1TA 4B47A 5KPJA 3CW2A 3BH6A 4HAVA 4OHVA 3KQNA 3RS4A 3KQUA 2IYTA 3Q7QA 2WV9A 4O3MA 2XTZA 4RCYA 4NBSA 1II8A 4HSEA 2I1VB 3I62A 2NTYC 2IUUA 2MSDB 2HF9A 2ZRFA 1N6NA 2R6FA 4RD4A 4W9MC 5F9FA 4BFUA 2RKOA 4TYYA 2VQSA 4Z1MD 2OEPA 3ZDQA 3VU9B 1TAGA 3W6NA 4D81A 1E2GA 3QXSA 3ND8A 4IDNA 3A1UA 4WAUA 4CEJA 3ZS8A 4ZDKA 3V00A 1BO6A 5DO9A 4BRWA 4PFSA 1FP6A 3NEJA 5KSOA 4GZLA 3CRW1 4YMWA 3CRQA 2REBA 4BLOA 2EFGA 1R0XA 4BFTA 1JR3D 4EJSA 2QA5A 3PENA 3AB3A 2ODWA 4A82A 5DE3A 3AGPA 2C5LA 5JLJA 4JSTA 1A2BA 2ZSAA 4DWJA 4D80A 2FMXA 1DEKA 1E1RD 4D4JA 3GJ0A 3ZQ6A 1GNRA 1YRBA 3EARA 4JLDA 1XTQA 3KQHA 2G3YA 4HZIA 1E99A 5FOVA 2YJTD 4M9QA 3ZVLA 3K0EA 1Z06A 3IO3A 4JIMA 2JJ2A 1QF9A 1Z28A 4Q9LA 3VFDA 3GJXC 2GVDC 3ECCA 4CW7A 4F38A 1DOAA 2JLRA 2ZRMA 1R8QA 4TWZA 2IS6A 5KTYA 3U2QA 4A2PA 4YONB 1T3SA 4R71A 5FR1A 4F91B 4O0MA 5LPNA 1XPRA 2Z4SA 1Z8FA 3ZIAD 1TPZA 1XTJA 4HLDA 1HT1E 221PA 4NYIQ 4WA7A 1JXOA 2BKEA 1YHNA 1PLLA 4IRUB 1FNNA 3ZJYA 1UDXA 1N25A 5SZHB 3T35A 2A3RA 3H4MA 4YMUA 5FOXA 4OK3A 2Z83A 3QY0A 4D82A 3RLFA 3HWSA 3LRPA 2DCUA 4Q7MB 3O8CA 4HB3A 5D3MB 3ZVMA 4H1VA 2ECKA 2AKAB 4KYIB 2UKDA 3GPLA 4WXPA 4HUTA 1XCMA 4RD0A 4LC1A 4IKEA 1AZSC 3ICQB 1W4BA 4TMWA 1ZD1A 4DB4A 3GLHA 1QVAA 5EXTA 5JJIA 4KXFB 4B3DA 1NBME 3WMFA 2G77B 4FW9A 3CF6R 2WWFA 2GXAA 1E4YA 4OYHA 2RGAA 5J47A 1FMLA 2ZVPX 2J41A 2ZR0A 1N6RA 3OFNA 3A4MA 1OH8A 2ZETA 3PXGA 2V6IA 1YJ5A 3KJEA 4Q47A 4JLKA 3HR7A 1QZXA 1JEDA 4DBLC 1E0AA 4DDVA 2J7PD 2OCPA 5DYIA 1ZMXA 1XXHE 4IHQA 3QF4A 2JJ1D 3DO6A 1DAKA 4EJSC 3IUYA 4ACBA 1E79A 3N2EA 5EZ5A 2JLQA 4I1VA 4HZUB 1G8HA 1OIWA 2J5XA 1Z0FA 2IF2A 4CF7A 2ANBA 3WNDA 3KB2A 2R9VA 3SBEA 4OQLA 1GSIA 1WP9A 2GESA 1I4TD 2OESA 1G7RA 1L7VC 3M4YA 2IXGA 1Z22A 1ZD9A 4OL0A 3CPEA 2OBNA 3EC2A 3D6TB 4AYWA 1C9KA 1XPOA 2YWHA 4LJYA 4DT1B 2H8KA 2OCAA 4Q48A 2IYYA 1F2UB 1X8LA 1US8A 2ZSEA 1Z6GA 3THYA 4MRNA 3AUXA 3TRFA 2QPTA 3E70C 1B0UA 1P3JA 4US0R 3CX8A 3EXAA 1HV8A 1R5OA 1KGDA 4HLUA 1QVRA 4ZCIA 3K0SA 2IEYA 2JDID 5CB8A 1WBDA 1UBGA 2FNAA 3L0PA 1VDZA 4DCNA 2UZ3A 4ZDJA 5FTKA 2B7BA 2BVNA 4GOJA 5DHFA 5EP4A 1VIAA 1S1MA 1L4YA 1U98A 1X86B 4CDGA 5KNDA 3AVYA 3GD7A 2N46A 2IYXA 4NONA 2Q3HA 3EPJA 4QJ3A 4HZUA 5B58C 1A4RA 6Q21A 3PEYA 3HR8A 2I3BA 2ZRNA 2CE2X 1HA3A 5C2JB 3PUZA 3LW7A 2G0TA 4DDWA 4TLDA 4DIDA 1R5BA 2Y8EA 4JJZA 3H84A 4WZBE 3RS2A 2GHIA 3BWDD 1GFIA 1N5LA 1GILA 3LBHA 1I2MA 1FL9A 4MYHA 4TL6A 3SJAA 4IFBA 3P4XA 4F93B 1KK0A 2HF8A 1D5CA 1T3LA 2RGXA 4Q4AB 1N0WA 3GJ6A 1XEFA 3CR8A 5AJXA 3ZYCA 3BH7A 2ZRGA 4DCSA 5EXXA 2VHTA 2IA5A 4QM7A 3EAQA 4V03A 2HLDA 5CYOA 1QHSA 3K9LA 1AJEA 2BJWA 3TR0A 4V0KA 5EP1A 4DB2A 1MABB 2XOKD 2WSMA 1DARA 1COWD 4HATA 3X2SA 3FDIA 1J8MF 3N2IA 4Q4LA 1P6XA 3REFA 2C03A 2D7CA 1Z47A 2ZYTX 2XXAA 2PX0A 5A4JA 1RRFA 5FPYA 4CT4B 3IEUA 1YZKA 3JZMA 1GAJA 4OHWA 1A7JA 2LWIA 3AUYA 4Q7LA 4EPYA 4AD8A 5EE3A 2KBEA 5DISB 1G7CA 1QHHB 1S9HA 5SZKB 1VG0B 3FFAA 2O8FA 3M6AA 4XVQA 1G3IA 2ZJ2A 2DB3A 3A37A 4FWIB 3VKGA 1AM4D 1ZUNB 5JJLA 3TW8B 2C98A 3B9QA 1XJ0A 1Z0KA 2ZRLA 4RD3A 4AK9A 4KCGA 1DADA 2HUPA 3HU3A 4BWYA 4TSFD 4AI6A 1HY3A 1GIAA 3T5GA 1L2TA 3GFPA 5L3QA 4U02A 1R2QA 3TBKA 1IM2A 2O5VA 3K9NA 3AKYA 3W3AA 1S0UA 2IK8A 1Z2AA 1KYIA 2BDTA 2EFHB 5EE1A 3OFND 4EUNA 2REXB 2QAGC 3SE0A 3GLIA 3OEHA 2B21A 4L9WA 1PV4A 4F4IA 3VNVA 2QP9X 4A2QA 4JVSB 3K0AB 3QKRB 4NYMR 5FTNA 2V1UA 1KAOA 4AC9A 4ERNA 2PT5A 4JT2A 1XCGB 1ZVQA 2WJYA 2CBZA 3SYNA 4EAQA 5DN6D 3U6BA 2ZE6A 4JL8A 4XVUA 2D7DA 2QENA 2ERXA 2VSOA 4LZZA 3L0IB 1TQ6A 1XJQA 2BMFA 1J7KA 5KSPA 1TU4A 1DAMA 1MH1A 1X8JA 2EWVA 2JIZA 4A0RA 4BASA 4EIWA 4Q1CA 4LHYA 4HB4A 2GJKA 2MSCB 2PZEA 2VF7A 3KKNA 3W34A 1CRQA 4ZCMA 1RPZA 1UADA 4PPFA 4IOKA 2RGCA 4BFYA 4RFVA 3TMKA 4BEBA 2BBSA 3RHFA 1XB2A 4ZCLA 1G8YA 4GNKA 2Q3MA 3RRYA 3D8BA 3RC3A 3VHLB 1FNMA 1VTKA 5TDHA 5CYPA 1U81A 5EQTA 3AF2A 5DYGA 2H57A 3T61A 5FL7A 1E0JA 3DMNA 2EVWX 2W2XA 4URUR 4C7OA 5HCIA 3UANA 1UF9A 1Z07A 1N6PA 3K09A 2ZRCA 2B7CA 3B9PA 4PZZA 1VMAA 5CJ2A 3OIWA 5EP2A 3SR0A 4FWTA 3NKVA 1WXQA 1AK2A 1SZPA 1E2KA 4EPXA 3AVUA 2Z0MA 4EPTA 3BD9A 1F60A 1W4RA 1N5IA 5CIWA 3KZ1E 1ZW6A 2D2FA 4PSKA 1T3HA 1NNEA 1YKSA 4D26A 2VP9A 4HDQB 2KJQA 2JLYA 3K1JA 1NN0A 2C8VA 1MABA 2X8AA 5BN4A 4TMKA 5K8TA 3Q8XB 4WW0A 1OJLA 3DL0A 4DLUA 3SU8A 1FTNA 1X8KA 4JSYA 4WIAA 3GFTA 2J0QA 3LFUA 4IJMA 1P62B 2XSZD 1S3SA 1OV4A 3QVVA 4NU0A 4MRPA 4UXIA 3TKLA 2L0XA 3MG9A 5J5CA 1YVDA 1R6BX 1DG1G 1RC8A 3C41J 1FUUA 2QG6A 3IPYA 2EFCB 1GKUB 2ANCA 3V9PA 3KXLA 2WJHA 1P9NA 1Q3HA 2X19A 3RRMA 2F1HA 1E6CA 4C7OB 2ZS8A 1E0SA 3TW4A 3LW8A 4IEIA 1E2LA 1W2HA 5AJVB 4DRZA 4A6PA 2E87A 1YR6A 2CHGA 2GCNA 4HUQA 2RCNA 4G5QA 2ZE5A 2VHCA 2O0HA 3ADCA 4W5WA 1K5DA 1BMFD 2RHMA 1R0WA 1TEVA 4AG6A 4A8JC 121PA 2W2TA 2CCKA 3W90A 4MGYR 2QQEA 4OHXA 3NEYA 4P4TA 3B78A 3GJ3A 3IIJA 4UNSA 4R9UC 4I1SA 3A4NA 1D9XA 5H8WA 2O8BA 1MT0A 1TMKA 1X3SA 3KB1A 2CL6X 1WCV1 2OT3B 5DI9A 3U44B 1JR6A 4JLJA 5DHAA 1WB9A 4BLSA 2ORVA 5IK2A 3LA6A 1G1MA 2P3SA 2PMDA 4G5RA 2C2HA 1BKDR 3KJIA 3A1SA 3U3MA 5EXPA 4HAYA 5JCZA 3B1YA 4B3XA 2R6GA 1LV7A 4DEXA 1W0JA 2VP0A 4JJKA 5LB2A 1E32A 4PTLA 2XEXA 1MV5A 2FSGA 2ZANA 3TQCA 2NMVA 2ZITA 2JLVA 4D0NA 4Z1MA 1YU9A 2MMGA 2DFNA 3FKQA 1ONBA 4KLNA 2QBYB 4FCTA 4DCUA 4UXHA 1W36D 1D2MA 4JLVA 3BB3A 1NIJA 4QBGB 3CNNA 4P31A 2E1RA 5IT5A 1S9DA 1AZTA 2VA8A 2R8RA 3AP1A 1BH2A 3Q5EA 3SJZA 1OB5A 3LLMA 1DE0A 3DM9B 4KVAA 3VR2A 1D2NA 5CJPA 3OHMA 2IF0A 5KDLA 3AF1A 4MRVA 4ACAA 5JS8A 4YXWA 2AWOA 2C9CA 2J0UB 2XB4A 3WY9A 1P9WA 2ZSDA 5CLQA 1ZUIA 2AFHE 2NQ2C 2MMCA 3D7MA 1MO4A 4AKHA 2A5YB 1HT2E 2HYIC 4DCVA 3AH8A 3J81k 4GOKA 5JSZA 4UJ3A 4PXAA 4GI7A 4GOXA 3IQXA 1NBMA 1CJTC 3BFXA 5E95A 3I61A 4KHZA 3RABA 1O3YA 5BYKA 3GEEA 1BS1A 3L82B 4DXAA 2V7QA 1G21E 3EA5A 1S3GA 3B1ZA 3FWYA 3RC8A 2QP3A 3I5XA 3DEFA 2RGNC 2Q9BA 2GK7A 3KL4A 1PLJA 4DCTA 4NMMA 2PMKA 5D3QA 4EQ6A 1E2IA 3C5CA 1ESMA 1W4AA 3T1OA 2IYZA 1T8UA 1EFRA 4I1OA 3BC1A 1KI6A 3PEVA 2QP4A 4RD1A 1SXJE 2ZJOA 1MO3A 2C9YA 1YZUA 1J99A 1ZC3A 1D2EA 1P7CA 2FZLA 2ZI6A 4KBGA 4DUGD 4BLRA 1U9IC 4NHOA 3RS7A 4NYMQ 1Z3IX 3DM5A 3PVSA 5EE0A 1FOEB 2AHOA 2QM7A 2QL6A 5HE8A 1ZD8A 2H18A 1JPNA 3EPKA 2BBWA 4JLOA 4URZR 3W5IA 4CYMA 4RFSA 1E1RA 5B57C 3TK1A 2WJJA 4BLTA 3WNCA 2NOAA 5TARA 3TJZA 3WBKA 1VPLA 2AKYA 4LX0A 4LJ5A 1AKYA 1SGWA 1Q22A 4RY2A 4UXJA 3AVVA 2A9KA 1X6VA 4C0HA 1AS2A 2V55B 2V7QD 1XTRA 3A36A 1Z63A 1MKYA 3CRRA 3U44A 2A30A 1KO4A 2Z4RA 4XTRA 3AVQA 1Y3AA 3CH4B 1NP6A 5GADl 4QC2A 2JATA 1YRAA 2GRJA 5BN5A 1DO2A 1NY6A 2HCBA 1U94A 1SKQA 2ZEJA 4GPTA 1D9ZA 3F3YA 1G3UA 1RRGA 1CR2A 2QAJA 2IYQA 4LJ9A 1XBTA 3JVUA 1UJ2A 2W2VA 3SFVA 2G83A 4BFSA 1Q1QA 3C8UA 1RVDA 3SDZA 4K8OA 2WKRA 3BH0A 2ORWA 3K53A 4PC7A 3CONA 5JWRA 3AF3A 3QENA 2C95A 4L8GA 2ZUCA 1KSHA 1F2TA 1G41A 2NO0A 3BE4A 3C16C 4DSUA 4LBWA 4ILEA 4TN1A 1G3RA 5F98A 1JAIA 2WAXA 1TL7C 2O52A 3QBVA 5P21A 4RJLA 2W00A 3NBYC 4AYXA 1XDBA 5FBQB 1CP2A 2XZPA 4DLRA 3TE6A 5A5GA 5JRZA 1NKTA 2ODNA 4Q9JA 4EJSB 1W46A 2H7VA 4V0NA 5F3WB 4QOSA 1JEEA 4OQXA 4DSOA 2KBFA 4QHSA 3GLFA 2HXYA 4C0KA 3OAAD 2J0VA 5H68A 5AUOB 1TTTA 1CF4A 1IAQA 1XZPA 5FBLB 5DLQC 1ZU4A 3FHOA 4FMDF 1UFQA 1XRJA 3REGA 4AURA 4Q66C 3LLUA 2JEOA 4M1SA 4LSGA 4YXWD 4TYWA 3R20A 2YOGA 4XWAA 4B76A 2HXSA 4FMCF 1NLZA 2RGNA 2ZU6A 3CWZA 3G5UA 2PCLA 2AWNA 4HYYA 3QPWA 3UKDA 3F8TA 4KODA 4PHHA 3K0FB 2GKSA 2WOOA 2QRNA 1W4CA 1OKKA 2FSFA 3QKTA 3N5CA 3KXKA 1Z0JA 1G3MA 4LYAA 1GRRA 3ADBA 4ESHA 1T9HA 2FFBA 721PA 1KK2A 1M8PA 2VHJA 4OK6A 3C4JA 2P5TB 1E9FA 3KKPA 2P6RA 1CJVC 1J2JA 2A2ZA 3OIYA 4M22A 5AJYA 4LJ6A 5K8UA 4L16A 3GJ8A 2CHQA 4QGFA 3X1XA 2AFIE 2VP2A 4IXMA 2DYKA 4QJ4A 4HLCA 4FCVA 1GKYA 3C15C 2HCJB 4I4LA 2FFQA 4IXNA 2ERYA 2JIZD 2C04A 2ZROA 3EIEA 3EC1A 2NIPA 2EW1A 4Q7KA 4XOIA 5BXQC 3CKLA 4JLMA 4GP6A 3U7HB 1KSGA 1W1WA 3U60B 4G0NA 2GBLA 2HT1A 4LCBA 3UMSA 1IBRA 3RRZA 1P2VA 5GJBA 1EFUA 4R98A 2BBOA 2X77A 1GP2A 4NCNA 4PHFA 3W8NA 2CCJA 4Q02A 4WXRA 4JVLA 3IGFA 2FGJA 3QXJA 4LC0A 5JFGA 5JHGB 1N0VC 1VHTA 3CR7A 1KJZA 1KHTA 4U00A 5G41A 4ZO4A 4V02A 5JCPA 5B64A 2BCGY 3SS8A 2RB4A 3MRSA 2IS4A 4LPSA 3O8BA 4IOJA 1EFRD 2D2EA 2ZREA 4RVCA 4MH0R 3VKHA 1SHZA 1Q3TA 2AXPA 3EPHA 1LF0A 2O8DA 4MQBA 4NL4H 1UKYA 4TLBA 2VEDA 3GLGA 5D3MA 5GVRA 3R7WB 1NLFA 4DDUA 1X1RA 3AP2A 3K0CA 1ZNXA 1VCOA 2I4IA 4TYQA 2WJGA 1U2RA 1NI3A 4M1KA 4MRSA 1R5NA 1GNQA 1VYVA 1OFTA 3T15A 1X1SA 3LQQA 4B6EA 1NIPA 2UVQA 4NZYA 2V1XA 5EE5B 3LXXA 2O8EB 4MUBA 1KDTA 1E2DA 3DZ8A 1TF7A 3DKPA 1E2JA 1FPMA 4L9SA 1R0YA 5KNCA 2ZR7A 2RHDA 2YHSA 4MDEA 1JNYA 3O47A 4C0SA 2ORIA 1E9EA 3I73A 2AL7A 4B75A 2XXAB 4R7ZA 1II0A 3LQRA 1R7RA 3OAAA 1EFHA 1YQTA 3OE7D 2A5JA 2QTVB 3ADKA 4JMPA 2ZQ5A 1CULC 1P73A 4RKFA 2NPFA 1UDWA 4QM6A 1F2TB 4B74A 4A9AA 4CEHA 4TL9A 3JVVA 4UNQA 3TQFA 1JB1A 4F7WA 2R6DA 3QE0A 5IRCD 3FHCB 4GZMA 4HAXA 1IY2A 1SXJC 4Q4HB 4KJZA 3DVLA 1IHUA 2VRWA 2FWRA 1EGAA 1BYUA 1OH5A 3SQXA 2A5FA 4TMZA 3VR4A 4C0BA 4PQRA 4XH9B 2OUKA 1VCMA 1L8QA 1YZGA 3CRMA 2W0MA 2W6IA 2CVHA 4ITRC 1NG1A 2PLRA 3QQ5A 4KVGA 3SHWA 2IS1A 1NJGA 1Z2CA 1W0KA 3NG1A 3ZGXA 2FF7A 3KQLA 3CBQA 2GWHA 3QSYA 5F9HA 1GG2A 5IDVA 1U90A 2IBMA 1ZM3A 4L4UA 1KDPA 4TQUS 4IOMA 2IS2A 1NVXQ 3WP1B 1NVVR 4KLZA 3C5HA 2XX3A 5DSZA 5HZHA 3QXXA 2NO7A 1AN0A 3ONWA 4US1R 4UKDA 1G3QA 1ZM9A 3AGQA 1W44A 3BIFA 1MO6A 3SHFA 1N6LA 3FVQA 4A0HA 2BEKA 4S35A 4B3GA 2WWYA 1QG2A 2OXCA 3X1DA 4DSNA 2GA8A 1M7GA 1Z08A 3EWSA 2ZJZA 1CTQA 4Z51A 3IPXA 5JECA 5DIFA 4M9SA 1XEXA 4LPKA 1KKMA 1KJWA 1XD8A 1JJ7A 1E0KA 5AWFC 1O87A 2IYRA 2W58A 1KMHA 4IFEA 4NCJA 5FUWA 4LRWA 1G8GA 1W5TA 3QOFA 2O8DB 3AKCA 3K0CC 4LJAA 3IHLA 4XD7D 2CK3A 4QBHA 5B30A 2YYZA 2J9RA 1GITA 1Y63A 2XSZA 4AKIA 1TUIA 4JVMA 1NN5A 5FTLA 2VIIA 2P65A 1GL6A 1C1YA 1XU4A 2W83A 5L3VA 2OAP1 3R9IA 3RSLA 1NF3A 1E4VA 3NBXX 1G7SA 2MSEB 1HH4A 3EWAA 2GF0A 4ZDWA 4ZDIA 2HYDA 1SXJD 2EYUA 5C18A 3SQWA 3RS5A 4Q00A 3UG6A 4AWXA 1E94E 3QVUA 3Q5DA 1M7HA 5L3RA 2CE7A 4M1YA 3I92A 3WYFA 3CO5A 2KE5A 4E07A 5A0FA 3SBDA 3ICEA 1VYUA 2VTKA 4G3XA 5KHOC 4LYFA 8OHMA 3ETLA 3U6KA 1EWRA 1N6KA 1XEWX 4NP6A 3RS0A 1GDDA 1T8TA 3BAFA 2DPXA 3DOEA 3GJ7A 4O25A 3IDQA 5E7MA 4PZYA 4Q1DA 5TXGA 4NCIA 3SN6A 4TMVA 1E9SA 2WPDD 4XWOA 3KKMA 1EESA 2OFXA 3A1VA 4YMTA 1R8SA 1YR9A 3LBIA 3R7WA 2YC4C 4WZ6A 3GLFE 4TYPA 5KO2A 3THWA 1E3MA 2ZRJA 4Q4JA 2ZYVX 3IIKA 3GLHE 1QHGA 4X8MA 2DBYA 1Z0IA 3IEVA 3KTAB 4ZV4A 4BPBA 4CGZA 3X1YA 5UKDA 2F3RA 1WE2A 4YDHB 4BUJA 4CVNA 5E3HA 2ZYUX 1W7AA 2GJ8A 1AQUA 3PCRB 4A36A 4OJQA 4YLGA 1W47A 4BZPA 5EUMA 4CEIA 2JJ2D 1CR4A 1XTSA 3B5JA 4A0GA 3LAWA 3HPQA 1E9AA 2C9OA 3EZ6A 2BBTA 1G9XA 2CL0X 3WRXC 2OLKA 1W36C 3MMPA 4E09A 3G82C 5L3QB 1N0UA 4C2UA 4JZKA 1OPXA 3O8RA 1U9IA 1G5RA 3CZPA 4OQFA 4ZPXA 1XF9A 2N42A 3ZQJA 1HE1C 1TX4B 1Z0DA 1NSFA 2AXNA 2WWWA 4KO8A 4HI0E 3VQTA 3A8TA 5G53C 4WBSA 4QFMA 3MWKA 2B6HA 2ZJYA 5H70A 2P6UA 2PZFA 2Q9CA 1U8YA 2GDJA 1KO1A 3NTUA 3PITA 1Z5ZA 3TUZC 1OXVA 2ZI3A 4ON9A 3SJBA 2REOA 3BBPA 2WWGA 4NYJR 2ZRBA 2KB0A 3NHAA 3BORA 1F5NA 4B3CA 821PA 1T0HB 2C77A 1WDTA 5JBQA 4JBWA 4LJ7A 1KJYA 2QQ0A 5IF9A 2J46A 4PHGA 4Q1EA 2F1IA 1S4QA 2GEVA 2QI9C 2A78A 1TQDA 2CNWA 5G3YA 2ZE8A 4N3NA 3GLGB 1K6MA 5FPKA 2IUSA 3TSWA 2WAYA 4R2IA 3EZ7A 3H0KA 2FPKA 1E1QA 5IHPA 2ZI5A 2IC5A 4OJKA 1R10A 4JLAA 4MKGA 5SZJA 2OLJA 4LY6A 1TQ4A 3NVAA 3WBJA 4XD7A 3QG1A 5J4LA 4Q4JB 4JL5A 4MITA 1ZM4A 1GL9B 2F9MA 5FL3A 2OG2A 1RRCA 1KNXA 2OE2A 2Q6TA 2WZQA 5JWOA 1VKJA 3FMPB 1XD2A 3LD9A 2O8BB 1DVRA 3WYGA 4QGHA 4DZZA 4FINA 5CB6A 1M74A 3TUJC 2IYUA 4DLXA 4GL2A 1U99A 5E7JA 3RNLA 4B33A 3VU9A 4C9BA 4CRWB 1KI7A 1KZ7B 1E98A 3CM0A 3ND9A 1ZP6A 2GCOA 4D2IA 1PLKA 1G19A 2HV8A 4HEJA 5BW8A 4CEJB 5DI3B 1OFUX 3CX7A 3FGNA 4Q9KA 2QPOA 4EKDA 5CLLA 4U5XA 3I8XA 4G01B 3KTAA 1KO7A 1TNDA 4LHWA 2JLSA 4EPWA 5LD2B 3HYTA 3B8HA 1ZCAA 1XMJA 3GMTA 4QJ5A 4JLNA 4C0LA 1SKYE 1P2TA 1VECA 4Q5IA 4QG7A 4TTRA 4EQ6B 2FFAA 1NVVQ 2CXXA 4MA4A 4LV6A 1YZNA 4Q03A 621PA 2GXSA 4JKIA 1E2FA 2JA1A 4TLAA 3HU2A 5IK2D 4DLZA 2A7QA 3MJHA 2FGKA 3CNOA 2EYQA 1G17A 5AUPB 1LB1B 3U7EB 4X8HA 3MSXA 4ZKDA 4EFLA 2QSZA 1CLUA 2CNWD 3SI7A 3W6OA 1S1CA 4P32A 5JSZB 4B2PA 3EZFA 1K5GA 2QM8A 2OV2A 3C7KA 3LX8A 1OXTA 3GFOA 3GLIB 4MRRA 5CDFA 2CLSA 5KSZA 1DTSA 1DAFA 4PO1A 2J0UA 4MYCA 1UKZA 4MGKR 2LKDA 2OM2A 4TT3A 4A92A 1KK1A 2BMJA 3GLIE 4A15A 1CXZA 2X2EA 4WOPA 3NIBA 2WJIA 4HLUC 1N6OA 3R8CA 3T34A 3V4FA 4ESVA 1TUEA 2C99A 4MKFA 3GJ5A 1DAIA 2H92A 5FBWB 1ZM7A 3UATA 2ZXUA 3NDBB 2XTMA 4LI0A 1CR1A 2ZIAA 5EXSA 1OE0A 4L15A 5BN3A 1WQ1R 2J7KA 1G6OA 1G4UR 2K5UA 1KSJA 2ASEA 4E5UA 3AKEA 2JJ1A 4M4SA 1XPUA 4LHZA 1Z6TA 5JI2E 1FQJA 2TMKA 3AVPA 2H1LA 3K8YA 3ZH9B 3BFKA 1Q0UA 4P33A 1LFDB 2DR3A 1E2HA 2Q21A 2VSFA 5HCNA 2DWPA 1E96A 3A58B 4LUCA 4BGDA 3WHKA 5FR2A 2ODEA 4MKHA 4BFWA 2QZ4A 3THOA 4DIEA 5KDDA 4TZ6A 2ZUBA 2RGEA 1UPTA 5HTKA 4U7DA 4V0OA 4HAWA 1Z6YA 2Q3FA 2QGZA 4URVR 2CHVA 1KI4A 4NTZA 1QHIA 3WNBA 4C3ZA 2BV3A 2GZHA 4E03A 1SVOA 2P0EA 4A0FA 2B8TA 4KI0A 4F4JA 1OF1A 5LD2C 1NY5A 4M1WA 1MRNA 5JMTA 1KI8A 1JJVA 4XJXA 1M2OB 4Y0VA 2CDNA 3K70C 4AIIA 1DO0A 2FZ4A 2FSHA 1WA5A 4PC6A 5GJCA 4KFSA 3H2YA 1WRBA 3Q3JB 1NRJB 4K46A 1NMXA 4Q01A 4F4CA 3A6PC 3KJHA 2VF8A 3ZZTA 3AQ4A 4PPQA 3IIMA 4OI2A 4WZAE 4XIGS 4Q4HA 1A82A 3LH5A 1GRQA 3EIQA 4NCHA 5DGXA 1S2MA 3DZDA 3W9YA 4FMCB 4KSCA 1KOFA 4TTQA 4QNRA 1OHHA 3K70B 4M1OA 1U0JA 3WYAA 4BZXA 1C4OA 3K0FA 4PX9A 2DWOA 4ZIRB 1CIPA 1G8PA 1GL7A 1IN5A 2VHQA 3NDPA 1JQLB 1BMFA 1ODFA 1IN4A 3B1VA 3QXHA 1U8ZA 1KMQA 1EFCA 3WMGA 1XEXB 1IN6A 1HURA 2CJWA 3ASYA 3NBZC 4KAXA 2PJRA 2EU8A 2F7SA 3W6PA 2ONKA 1D6JA 2FEMA 4B34A 2XJ9A 3MCAA 5KU1A 4JLPA 2YINC 3W8RA 2FDCA 1IXZA 1EFTA 3U4QB 1UKEA 1E2NA 2WWIA 421PA 1Z6XA 3AVWA 4Y0AA 2BJVA 2VH5R 3OZXA 1ZIOA 3NBFA 4I99A 2WSSD 2XTNA 3TVDA 1ZBDA 1XCPA 3U3RA 2J87A 1Z0AA 1H65A 3VAAA 4TSFA 1DBSA 2ZTSA 2V6JA 3WXMA 2WHXA 3IBYA 1N3BA 1SVSA 1GZSA 1W5SA 2WTUA 1ZINA 4B35A 2BM0A 2H16A 3BGWA 1G5TA 1Q20A 3NWJA 4JBXA 3U3JA 2AD5A 2D74A 2ZJ5A 4NH0A 2WKPA 3TAHA 1WBBA 4CZ2A 2BMEA 2CVFA 4DUGA 1HE8B 1EXMA 1KO5A 2P67A 4PAQA 2IWRA 4C0JA 5HZKA 2F1JA 1A2KC 4DLSA 4IOLA 1UKVY 1NKSA 3C14C 1RYFA 1XFAA 4P4SB 1KKLA 3NC0C 2WVJA 3B7GA 2J1LA 4RZUA 3UWOA 2JGNA 2QMUA 1Q1EA 3CF2A 4TZ0A 1SQ5A 3F5FA 3DKVA 2ZSFA 3SFZA 1SXJA 4KFUA 3KKQA 1IXSB 4V0ME 1EX7A 2NG1A 4PC2A 2E9SA 4PO9A 4DSTA 3LDAA 1PUIA 1OHHD 1G8FA 2WPDA 3LNCA 1ZC4A 1JXMA 3AVOA 2JLXA 3L2OB 4M9ZA 3FE2A 4ARZA 4Q9IA 2KWIA 2ONJA 1L4UA 4FXPA 4DLVA 3B60A 3VKWA 2QAGB 4UNNA 4O2LA 1U8AA 3TR5A 1M6NA 1PUJA 3KFVA 3LV8A 3MFYA 3M0EA 2QAGA 3NH6A 3VR1A 1YZQA 2FV8A 3CZQA 2YOHA 3MWYW 4MKIA 1OIXA 5CIQA 2VP6A 4LJ8A 4B3BA 5J4VA 3O8DA 4N0DA 3ZLJA 3CRVA 2YWFA 2J45A 3AF0A 1EWQA 4ZIRA 1OLOA 1I4LD 4Q19A 1LY1A 3SYKA 4YQFA 3Q7PA 4P4UA 1JBKA 3QUSA 5AR1A 3K9GA 1CJUC 1J90A 2ZRHA 4HDCA 2FN4A 3GP8A 3U7GA 4OI0A 1N5JA 3HP1A 4PR0A 1TF2A 1IY0A 1OYWA 3KFXA 3CF0A 5CITA 1CJKC 1GOTA 1SVMA 3GLGE 3TSZA 1NVWQ 3VR6A 3U3KA 3EZ2A 4OKSA 1DS6A 2AN9A 3B82A 4FI3C 1IONA 5EUQB 3OF5A 3GEHA 4GBMA 5GJWC 1T4GA 1VHLA 3B1XA 1Z29A 2VYFA 4DT1A 1OXSC 3OIUA 3LX5A 3P20A 2OFOA 3QKSB 3UK6A 1HYQA 2QUZA 3PUXA 1E9RA 1KK3A 2X1VA 4BLPA 2G1KA 3ZVRA 4LBZA 3MUFA 3LO5A 2OILA 4B2LA 3L8YA 2V4ZA 2ZI9A 3IQWA 4OI4A 4RZ3A 5BWMA 2UZIR 1P9RA 4PPNA 3VX4A 3IO5A 1W2GA 4QGGA 4YMSA 2FFHA 2ZI7A 3DOFA 4DJTA 2GXUA 4MYTA 2IUTA 4RZ2A 1KO8A 1AKEA 2AR7A 3ZZ0A 1KSFX 2W0SA 3L43A 1EX6A 4N0EA 1UEJA 3W3ZB 1CRPA 1F3OA 1FMJA 1OW3B 5K8LA 4NE2A 1V43A 4AKEA 4Q1AA 4Z8YA 3QEOA 4D25A 2XB2A 4AKGA 2OZEA 2XGJA 3SYLA 2ATVA 3FTQA 3T1QA 3BFVA 2PEYA 2PEZA 3PUVA 1H8EA 2HEIA 2IL1A 1WF3A 4QL3A 1E2PA 2GK6A 2OCBA 1YE8A 1G291 1ZAKA 4A8JA 4KU4A 1FFHA 1A5TA 3H86A 1JQJC 2FPLA 2Q0HA 3LBNA 5KDOA 1Q1ZA 4PANA 3CNLA 2YWGA 3AEZA 1BOFA 1E2EA 4LJ4A 5CM9C 3GLFB 3LY5A 2O8EA 1UM8A 1OKKD 1QG4A 4IEEA 4DDTA 5TMPA 4M9XA 1R4AA 2KI5A 5CK5A 1Q1BA 2ATXA 3TH5A 5J4HA 2WIBA 2NO6A 5L3SA 3RWOA 3P26A 4LYHA 4Q21A 4DLTA 2YNMA 4MUAA 3TGPA 4LK2A 3T12A 3PG5A 1RW4A 3IBGA 3SOPA 1Q21A 2GAOA 4QBFA 4MGZR 1ZUHA 2OHFA 4JYCA 4KFRA 2BMDA 2JASA 2R6AA 5L8VA 1XZQA 3AV0B 5J4YA 1PJRA 4BLQA 1ZNYA 4M0LA 5HKKD 2DWQA 2YZ2A 3QNUA 1RKBA 3MWLA 2VO1A 5C46F 2WIAA 4FCWA 4ZI2A 4BE7B 3T1TA 1JR3A 1XP8A 1UBFA 1IY1A 4M8NE 1OH6A 4W7SA 1NG9A 4G5SA 1AQYA 1FQKA 1XMIA 4PZLA 1FX0A 1Z6AA 3CB4A 1A1VA 1YR7A 2QPAA 2XZOA 1QBKC 2H5EA 4QBIA 3B13B 1SVWA 4TMTA 2XZLA 4GFDA 1FX0B 4IDQA 1H8HA 3VTKA 4D6PA 4IDPA 4Q1BA 3ZD6A 1J8YF 1ZIPA 1VIYA 1KY3A 3DPUA 1MR3F 1VCNA 5EE9A 2QMEA 4R2HA 3HU1A 3EA0A 1HTWA 2WOJA 3K0AA 3QKRA 2GTPA 4URYR 1RZ3A 3WRYC 1RE0A 4GT1A 1ELOA 1LTQA 2YWEA 2ZR9A 4EDHA 2DFTA 3QJYA 1W49A 5G40A 1T91A 2HJVA 3QF7A 3HJNA 4URXR 2IYWA 1VYTA 5F2EA 2GJSA 1GVNB 2DFKB 3UWKA 2VP5A 1KNQA 4OI1A 4EPRA 2WJVA 1XWIA 3B1WA 5LBIA 1KI2A 2PJZA 3EPLA 3BXZA 1FTSA 1NBMD 1QRAA 4HLQB 4JT4A 2HDNB 2GZAA 1DG3A 4UQOA 3UG7A 4LBVA 3GEIA 3QEJA 3EW9A 2QT1A 5C4GB 3MAAC 4GSYA 4HB0A 1H8HD 4BFZA 2FSIA 3I32A 1P72A 2ZVQX 4LOAA 3TLXA 5JI3E 4C0AC 3FKSD 2QMHA 2CEAA 3AVTA 1J70A 4B2IA 2RGBA 1CEEA 4PAMA 2OO7A 4KV9A 4TQAA 1NVUQ 4OQNA 2R44A 1AA9A 2ZJ8A 2BWJA 3BS4A 2QTHA 3WMEA 4L5BA 3L0OA 2QEQA 2NO1A 2FU5C 1ZNWA 5AJZA 1F6BA 2JJ8A 3P4YA 3EG5A 3MLEA 1FW6A 2WWHA 2XNSA 3NH9A 4M53A 3RANA 5FI1B 4A2WA 2ZE7A 1HQYE 4HUQB 2HJGA 2OBMA 2QY9A 3SEAA 4RSGA 1Q12A 2IYSA 5CK4A
chains in the Genus database with same CATH superfamily
4N3CA 1XEAA 3FH0A 1PX2A 1P75A 2Y1XA 3KT6A 2O0KA 3RSHA 3FW1A 1HDOA 2V7UA 3ODPA 1P2DA 3DVSX 2V97A 3PPIA 2W4IA 3K20A 5C1BA 4UPVA 2DH6A 1IVNA 2I33A 2ZJBA 1ZD4A 4JJIA 5K3AA 4L3VA 3UXMA 4DHEA 4YY3B 1XRRA 3RD5A 1ADJA 4MCAA 3BM5A 4XSVA 1JFTA 1WHSB 2R1TB 3OOYA 5EP3A 1D2CA 1XDSA 5HKOA 1U0EA 1O5TA 4G1UC 1A7KA 2NUAB 3S99A 2QXUA 3K6SA 1G63A 4H6WA 4JEHA 2A0FA 3FTEA 5AOVA 3T7SA 5J4KA 1MN6A 3ETHA 3ENNA 2D3WA 5CT9A 5JSQA 5CYFA 1QYCA 4WQMA 4Y2HA 3SYTA 3QBTA 3S1AB 2OK7A 4V1CB 4JGIA 5TVKA 3I4LA 5HQTA 2WNIA 1F3LA 2G4CA 1TZKA 2FG5A 1BQEA 4X7RA 1MQ9A 3RF6A 1OXUA 3I8SA 3LHIA 3H97A 2A1UA 4UOQA 3QBEA 2PRIA 4Z8XA 1JWLA 1UZUA 2PL9A 1US8B 1J23A 4UUAA 3K9QO 3G2KA 1C5KA 3D31A 3PE4A 1XCOA 1NDUA 1FCJA 3UW1A 3FPLA 2J5RA 1ZU5A 3CUSA 3VZDA 1F2UA 1D6MA 3AUTA 3IYLW 4P2GA 5FPTA 3S2SA 1TYAE 3FUXA 4Q18A 1ISHA 4P3YA 2GT1A 4Q3LA 2RFLA 1HXHA 1I13A 4OHOA 4NESA 2GZSA 5CH3A 2AE1A 2IX3A 1ZK0A 2FN8A 1MQ8B 5AI6A 5BP7A 4Y1RB 1PKEA 4RD6A 4XTCS 4X9XA 3JAKA 5LUBA 2WMOB 4EG0A 3IQZA 1AG9A 4KPUA 2X86A 1J8FA 3CU5A 3QVMA 1MJGA 1EE2A 2EL7A 1B7GO 2LR0A 5CYGA 1E1CB 3OF2A 5CT4A 4ARZB 2P5YA 1R0BA 1SBQA 2F59A 5JZVA 1U0LA 2PNFA 4MUEA 4PWYA 5BSHA 4IVNA 3OI7A 1N6IA 4BZZA 1WHTB 3JQCA 1WY7A 3CUEF 3ETCA 4QOJA 1DC6A 4QVIA 3PJRA 4ALNA 3HI4A 4AJOA 1J5PA 3G2JA 1E7SA 3MRXA 3PPWA 2R8OA 4A8JB 1ADCA 2B25A 2A1UB 2AMLA 1KFJB 1UXKA 2CD9A 2N0SA 4HAZA 3VYRB 3WR5A 3HB0A 3CINA 2GZDA 4PQGA 2Q0XA 2Q8QA 3GFVA 3INNA 5LDDC 1SXJB 3D2AA 1MX3A 3CLVA 4F9GA 4ZCQA 4EG3A 1NPDA 4JIGA 4LGMA 2DTDA 1ZVKA 4FMDB 2UVPA 4OB6A 3ZD7A 2OOKA 2REQB 3IP1A 4HMOA 2FPXA 1S2LA 3WFZA 3RYCB 2GPJA 2EKBA 1E9CA 2QLLA 1X9IA 5HDBB 4ZQEA 4BVBA 5ERXA 1QIMA 1O77A 3IQEA 1JECA 1XNJA 5LLDA 2ZRIA 4BN0A 4KBFA 1NN3A 2GHTA 3JY6A 1YONA 4O63O 3UGKA 4YJ2A 2XD9A 1PJAA 4BVEA 3OFKA 3O4FA 3ONDA 4I6EA 2DBZA 2Z9BA 1JU3A 3KUCA 1NUQA 1PNTA 1YL6A 1WXGA 4WT7A 4XSHA 5ARCA 3VHXB 4BRUA 2ONZA 2IITA 3LMKA 1ZGHA 1QV6A 3N9IA 5ENDA 3QW4B 4ID3A 5LLSA 4C3UA 1XTVA 3BF8A 4M0EA 4OVKA 4BKOA 4M7OA 1XX6A 4LWOA 4WA8A 4PLGA 3ICWA 1N57A 1UAYA 3PKJA 4HJRA 3C6YA 4JJEA 3B85A 4GO1A 1E3SA 3RJ5A 3T06B 3WGJA 4FHFA 4D0GA 5HGXA 4G97A 1B23P 3D02A 3LUFA 4EYEA 3QKSA 3U9TA 1MMFB 3IOCA 1H1TA 2ZDHA 3PXEA 3QU2A 1PFVA 2QVYX 3SWWA 5FH9A 4DR4B 4Q1FA 3OCXA 3MK31 1TQ2A 1KYQA 5JAPA 1KEUA 1SC9A 3BICA 5A4FS 4JJ6A 2FQWA 4DR2B 1K9SA 3FZYA 1Y7LA 2VUTA 1QH1A 4LYGA 5JC1A 1SOAA 2FH5B 4HSGA 3V42A 4ATNA 1PL6A 1T3TA 2EWWA 1JAXA 4TQ9A 3CNBA 1VG1A 2X5XA 3IV9A 3T3IA 2PY6A 3MOGA 3CRZA 2H31A 4FMPA 1U0GA 1PL0A 2XIJA 4PAOA 4IIFA 1TKCA 1N5KA 5BQPA 3VSAA 1I5OA 4BO3A 4PNEA 1U2DC 1KDOA 4YMVA 1U4NA 2FWPA 1T1SA 4FSXA 3E84A 1UBHS 3ZIAA 4PSVA 2Y1WA 1BZYA 1U7OA 4CKBB 5YASA 4MV5A 1N2GA 5DNYB 4EW3A 3WAJA 3RK1A 1QMPA 5EIOA 2ZTUA 3P5BA 1DX9A 1I3MA 2A1TR 2IWHA 2YRWA 1O58A 4V24A 2WSSA 1QIJA 5TF4A 1YHZA 5DBFA 5HG0A 3GQBA 1XV5A 2VJOA 3MUNA 3OO0A 2ECFA 1X80A 3PHGA 5EIFA 4D3FA 2ZRDA 2J3MA 2JVIA 3IA2A 1LJUA 3PNVA 2FY8A 4UDYX 2IP2A 2GCOB 4LISA 2IPAB 3IQGX 1LLCA 5DJ5A 4PN3A 2ODPA 3L77A 4OP3A 3ZKWB 2JB9A 1UWCA 2MHCA 3DHWC 1CU1A 4CKCA 4FQ8A 2RCYA 1NXWA 1YZLA 3WLFA 1SM4A 2DR0A 4EFMA 3NM6B 4ZOBA 3VC2A 3RRJA 1DO8A 3B6JA 4M9CA 4E4TA 3TLBA 2PGLA 3OUTA 4YJKA 3T4UA 3T5BA 5A4MS 2XCRB 4CFZA 1N7GA 2DY1A 3BB1A 4Q3CA 4F9EA 1XHEA 1O97C 4HTAA 1GXSB 1BXRB 1U4SA 1WABA 2C5AA 1CJCA 2ZJ3A 1WX1A 7REQA 3WK4A 3AFIA 4CQLA 4QSHA 3I12A 3FCAA 5DPMA 4BNZA 3GR6A 4MUKA 4V1CA 3KQQA 4XUCA 1X7YB 3RQIA 4I9NA 4PE5B 4ZAGA 8LDHA 1ZRHA 1YR8A 3QVKA 2O2CA 3FSJX 1JAYA 3RIEA 1CRZA 2YJ6A 5A05A 2ZG6A 4CM4B 3HVJA 3IHWA 2CSXA 1K8RA 2HW8A 2EX1A 2F64A 3OEYA 3IMCA 5H16A 2I4MA 5AVSA 1QQ7A 5DLYA 1TM2A 2JCVA 3EXFA 1M7BA 2DOKA 1RFLA 4UOEA 3C5VA 2VP4A 5JEEA 2PM8A 3H6GA 5E9AA 2CMFA 3EZ9A 4OXKA 4YC7A 4QTYA 3VNUA 2IZZA 3D59A 3UPUA 1NN1A 2DTXA 4G25A 1GCOA 1RMTA 3RC7A 2QRKA 1NM5A 4MJ3A 2XE6A 1FU4A 3FMGA 1D4ZA 3IOYA 1N2OA 4FTWA 2BUBA 1T5LA 4ZEWA 1I3CA 1QHNA 1Z8HA 5ALTA 4UD2A 3TI9A 1OZHA 1LS1A 1T36B 4HB2A 4OUDA 4QPNA 3Q5GA 5G3ZA 3KU4A 3G2NA 3OLQA 2PL3A 5M7EA 4D4IA 3DFMA 5FP0A 3KL2A 1NI5A 1NPTO 2GR9A 1C0EA 2KHZA 3AUJB 3IJRA 3NC4A 4GR5A 3U17A 3EGCA 5I4BA 4PGHA 1JEQB 1XR3A 3G89A 1MB4A 2QNRA 5A5VA 4ZYZA 1F8XA 4ASUA 1RWVA 1M76A 4CTJA 5JV5A 1TJNA 1U31A 4OOFA 2ZSBA 4XGQA 1SBNE 2V6FA 2ZM5A 4E7OA 4IG9A 1WD5A 1OFHA 1PO7A 2PMWB 3EFEA 1C81A 2E18A 4XARA 3M70A 3NXSA 2A9FA 4F91B 3BXGA 2O54A 5ANRB 3NAZA 2V8OA 3T9BA 3T3MB 1SXPA 1P3Y1 1G21A 2ICAA 1E3TA 3L7OA 4IRMA 4MX8A 4WLOA 3ROXA 1K92A 3ZEIA 1EG7A 5FOWA 2A0YA 1X7WA 3NJ4A 4CT5A 1I2DA 2A5DA 5E3JA 4DQUA 4KR9A 3UY4A 2PN1A 2C0QA 3CPJB 3DQZA 4XASA 1ISFA 3EHEA 4O4JA 2QN1A 1GN8A 1SIUA 3FPKA 3ZK7A 1PS9A 2YV1A 3WV4A 1LW6E 1H2BA 5IEBA 2O59A 4ZJPA 1MG0A 1O5OA 2C59A 5AK0A 3AR2A 3EGIA 1K8YB 2GKGA 1QLHA 3FMIA 3K8OE 4FYMA 1V45E 3KAKA 4IKOA 4CG0A 4IV8A 2Q99A 2X6RA 4IQGA 2KYRA 2ZAMA 3E9CA 4ECAA 3Q6MA 4XB1A 1BE1A 3I72A 2AD1A 4PQYA 4WLUA 3G79A 5FRDA 4QDKA 1RYDA 2R00A 5HJ2A 4PXYA 4EO9A 3L4JA 2JEZA 2JLWA 3DT8A 1E1QD 1TKRA 4GQIA 1LBHA 3R0ZA 4QQRA 4KW7A 4LVOA 4B48A 5LMUB 4LG1A 1H0KA 2DPGA 2CMGA 3SC2A 1L1QA 3Q8LA 2B5WA 4K0KB 2FZVA 1LDBA 4ZKEA 2YMQA 4FFSA 2ZS7A 4MKXA 5IX8A 4CKZA 4QXMA 2LW7A 4BS9A 4D9NA 4TV9F 3EGWA 5JAUA 1I2BA 1IN8A 3EODA 5DGIA 1RBQA 1RP1A 4DVGA 4RFSB 3IX7A 4TRMA 1FYFA 5ELLA 2BKUA 1XMSA 3LRTA 2PZGA 3HJFA 5J40A 2I6SA 1F4VA 4HAUA 4FN5A 4LY9A 3RR2A 4YMLA 3FMFA 3LYLA 3M3DA 1YVEI 3Q12A 4XFJA 3T1VA 1Y8RB 4KQWA 4Y2VA 3E5HA 2LCFA 5TQ2A 1PTJA 1QCCA 2OAEA 2ZS9A 3E15A 3E1SA 2Z6VA 3GPDG 1GKIA 1IZ0A 3C97A 3T0IA 4RJTA 3LPMA 1NUUA 3EVBA 4H0FA 3WK8A 4S1VA 2DWUA 5FPSA 1RAHA 3O9ZA 1BIFA 5TQ0B 1DB3A 4D0LB 1LQ2A 4ALIA 2GJAA 1PDOA 1ZA1A 2R62A 5A71A 1L1FA 5A4KA 4BECA 3X1ZA 3IE1A 2EKQA 2VRBA 3SZUA 4MUJA 5AKKA 4AY3A 4AQYB 4OA5A 4ZK6A 5K0CA 4NMLA 4F4HA 4V0MA 1Z75A 1WMSA 1A8SA 5I51A 5EXDA 1DJQA 1BH6A 4YUZA 4WNAB 1W0CA 4WK0B 3RVJA 4KWIA 3ZY5A 1HE4A 2P5SA 5EHXA 3DLIA 5G0UA 4D4MA 4C4PA 2Q0QA 1NRIA 5TY0A 5FUXA 1DCMA 3V2GA 2PKXA 2RGRA 1ZEMA 3M1IA 2B8WA 1P60A 4TMXA 4BDSA 3CBGA 5FBRB 2GETA 4KQKA 1ANKA 3R9XA 1OH7A 4GRAA 5JZMA 4NBUA 1BG6A 2Z2ZA 5A3SA 2P6NA 2DF8A 1W0JD 2XA9A 3GAMA 5ESDA 1N2CE 2JDIA 2DQKA 1TM5E 2P2DA 4TMFA 2D2VA 1XKTA 3CJQA 3HJRA 1E2QA 4YCNA 3F3KA 3DWIA 2CUZA 3SF8A 2CCGA 4MVJP 4A4DA 1QE0A 2NGRA 5J5VA 2H2IA 2EERA 4KGVA 4V39A 2BONA 4DM4A 2RGDA 1IPFA 4JKYA 3VNRA 1QP0A 1TO1E 3BERA 4R1OA 1G21B 2CEKA 4TXJA 1JT9A 1KBQA 3ZXUB 5JIBA 2A5LA 4R1PA 4LBYA 4F8EA 3W4KA 4PZEA 1X0VA 2P9ZA 4BFXA 5CD1A 1UJCA 3EOZA 2R1ZA 3I3OA 2YVUA 2OSBA 5JO0A 2AX4A 1CEXA 1BS9A 1CDOA 2G9UA 3D6FA 3H8WA 4WERA 3CH5A 5HBRA 3TJRA 1N7HA 2O23A 4RLHA 2EXXA 1O5IA 1W1IA 2XMGA 4LV8B 4RMHA 3PNSA 2X1LA 1NXSA 2R6ZA 1OB2A 1A27A 2GAAA 2XV1A 1Q84A 3D1LA 3NXKA 3WGGA 1L4KA 4R0NA 2ZI4A 2RH5A 3Q41A 1XA0A 1M1ZA 1X7ZB 2DHDA 3F46A 4X7BA 4ALKA 5DN6A 4EA6A 4JJ7A 1E6LA 1TT5B 5AKZA 5JCJA 3IODA 3GU3A 3B3GA 3NHUA 1NNI1 2ODBA 3AB7A 4AUKA 1UMKA 3ASZA 3MWJA 4N5HX 3ZIUA 3ZJVA 4L95C 4LYJA 5DW0A 1PWHA 1PZNA 1Y7IA 2R48A 4XVRA 3DPSA 4RXTA 4BTLA 3VJKA 4ITVA 4RPCA 1KI3A 1RJ9A 1CUCA 2R65A 3ZV7A 4LZOA 1SULA 3HXLA 4IKPA 4MYSA 4QO7A 3K2BA 3RBZA 1NW4A 4UHDA 4A1FA 4OB7A 3B20A 1L4HA 2FA9A 3MWDA 2A4MA 3GFRA 1HORA 4FFWA 3RTDA 1GUFA 3NHZA 1ZJJA 1EJ6A 1FP4B 4LTDA 1PEDA 4DR6B 3REOA 4DC9A 3UJ9A 2JGDB 3UMCA 1NMYA 3QPAA 4B47A 1VB5A 4H6XA 3E53A 4AJLA 2WC1A 2OHIA 4RX1A 3UJ3X 3KQNA 3C7CB 3NAQA 5FLXA 1X7YA 2IYTA 3P2JA 1M1NB 4NJMB 4O3MA 5TVGA 1AKQA 4C08A 4NPAA 1NVBA 3ND7A 2XF8A 3C7AA 2XXBA 2Q1UA 1PEYA 2GK4A 2ZRFA 3QX8A 1C1XA 4PF1A 5IW8A 3T5AA 2R6FA 2PXHA 5J2TB 1R3DA 1B3RA 3UCEA 4EW6A 1M6EX 3HYNA 2W6PA 3P2YA 3RVSA 4TLMB 1TAGA 3VU9B 3W9BA 4D81A 3ZJUA 2PWZA 3O91A 3WLOA 1V2GA 2W2LD 1RYZA 3QXSA 2ZFUA 1RWQA 2NXCA 5BNTA 5CP8A 5KTOA 3FNGA 4WBXC 1DQPA 2W6CX 3OE1A 4KHPB 4WASA 3GGGA 4PFSA 5CDTA 9MHTA 4J29A 3RAFC 2JAWA 1J21A 3CRW1 2V7BA 4CUKA 2EJUA 2NYUA 5AW2A 2REBA 4ZXPA 4J1SA 1EGVB 2A92A 3QU9A 2CLKB 1AT1A 1X80B 3LCVB 1XVTA 3NZEA 4TS3A 1DCFA 4MUMA 3PENA 1HNNA 1VI2A 1R4MA 2C5LA 4R51A 4YLYA 1A2BA 1JKFA 2O8NA 4HP8A 3TM4A 1E63A 2AN3A 3P0HA 4D80A 2JI8A 3TDMA 1FYVA 1POWA 1E1RD 2OQRA 4OGLA 3X1JA 3L7LA 3ZI7A 2I2DA 1JMYA 4R71A 4ZJUA 4IX1A 3ZQ6A 1GNRA 2MDTA 1TT7A 3E9RA 1XWWA 2JGMA 1XTQA 3AFMA 5FOVA 1E99A 1VGVA 3NV7A 3V6MA 5BV1A 1YVUA 1CUWA 4AX4A 1C1XB 5LC1A 1QF9A 2BI4A 1E5VA 4FYHA 2FKNA 4HFRA 4Q9LA 4WV3A 3B5IA 4TS9A 3VBCA 4BCCA 3R6WA 2ZSKA 3GJXC 2GVDC 2ZAYA 1QFSA 2AZMA 3BFPA 1L3IA 1Q15A 4CW7A 2I5PO 2J9ZB 4GOLD 1K7EB 4V0RA 4A23A 5ALYA 1VJTA 1NQVA 4IILA 4DLAA 5KTYA 1RRVA 1MH9A 2GWRA 5C3UA 2OYSA 1IIBA 2I6TA 2H07A 4OFZA 5FR1A 3ON5A 1YZFA 4QYWA 5AVUA 1Z8FA 3VJMA 1XLWA 2YVLA 2GN2A 3LPNA 1JVNA 2ZZNA 1Q7GA 1TPZA 1DKQA 1XTJA 3IHKA 4HLDA 4TUYB 4F2HA 7MHTA 2Q5FA 1BSVA 4IRUB 3PF9A 3H18A 3KG2A 4FJ1A 3C24A 1FNNA 1UDXA 3KOMA 5ITZB 1U5AA 1K98A 2PRKA 1PJBA 3BIWA 1A2QA 3WE7A 1QX4A 1P7WA 2ATIA 2E6UX 4FEYA 4O1IA 4OK3A 5AKXA 1SG6A 4KO2S 4D82A 3RLFA 2FRVA 3ZJTA 4Q7MB 4ETWA 3ZZNA 1D7AA 3VSBA 4HB3A 2G76A 3BULA 3HZOA 3I8OA 1M6YA 2EAUA 4HWRA 4KYIB 4XIYA 3PD7A 1ZESA 4XKJA 3FGOA 2L17A 3EVTA 4RD0A 4INJA 2UYYA 3RT9A 1AZSC 4B40A 3ICQB 1EXDA 3MOSA 3PYLA 4TMWA 4B8YA 1SUAA 4DB4A 1I4OA 5EXTA 3KKEA 5C7OO 4B3DA 3Q9UA 4BNLA 1NBME 1P45A 2HPVA 2K4MA 2WWFA 3HMQA 1ZGAA 2IZ1A 4U7GA 3RC9A 3WA6A 3KNZA 4O5OA 4HGQA 4AN4A 4U0KA 2ZBUA 3RG2A 1DMSA 4NG5A 1GEEA 3IS3A 2FN7A 1I3NA 1U7XA 5AHWA 5DNUA 1YJ5A 4Y9DA 3KJEA 1P91A 1U2DA 4Q47A 1PQPA 4HDSA 1ZFNA 3TD2A 1N5OX 1QZXA 1JEDA 2OC4A 1E0AA 3PI7A 4RMJA 3IA7A 5ICFA 4QRIA 4GEKA 5BQXA 1WHTA 2QUKA 1ZMXA 3PC6A 1A0OA 4IHQA 5F35A 2B36A 2V7PA 2JJ1D 4DAEA 1NPYA 2G5PA 1YWGO 1XDDA 1VJGA 3BGSA 5ITSA 4ACBA 1AV6A 1E79A 3HWRA 4IWNA 2J31A 3UGTA 1OBVA 2JLQA 4M9UA 2BTOA 4I1VA 3LYAA 1VPTA 1INLA 3ESZA 3JQBC 1A9TA 1SUIA 4AJIA 5JNSA 4UUMA 3NNSA 1C14A 4PLWA 4CKEB 1RKVA 1GSIA 1L8OA 3B36A 3LC1O 1SQFA 4YJFA 4ZU6X 3E22B 3USCS 4BVAA 4G24A 4H2DA 5AVJA 3IV6A 4PLHA 4DYDA 1MHTA 5GMOA 4HAOA 3L8DA 5CIYA 4MQ4A 1PFQA 4DT1B 2H8KA 2QTLA 2OCAA 3NONA 2IYYA 4MXDA 4Q48A 4U6NA 4UM9D 3I45A 3RU7A 2YW2A 5IG2A 1US8A 1VLZA 4P98A 1CK4A 5G4KB 1R0LA 2FAXA 2I9PA 3TRFA 3E70C 2YJ3A 3OZWA 1K7YA 3CX8A 5KOJB 5EFZA 4AZSA 4B7XA 1BX1A 3MCWA 5AW1A 1KYVA 2XWPA 1E2UA 3MS7A 4ZCIA 1GZHB 3TOCA 3JQ9A 4W1QA 1UBGA 2FNAA 1ZVJA 1EWYA 3NETA 3RADC 1WBDA 2FW1A 5F5NA 2Q5EA 3AERA 1GL3A 2HSEA 4IHAA 1Y8RA 1C3XA 3AG5A 2WDPA 2P1ZA 1V7CA 4GS5A 5C5DA 4J16C 1ULBA 4NOMA 1PNQA 1U98A 3GRFA 3JR7A 4CDGA 4X1KB 4RTOA 3EXG1 1TE2A 2DETA 2N46A 5TF0A 4NONA 1SU6A 3IVGA 5JPIA 2R1UA 2WTEA 1L7AA 3FWPA 4JUDX 4QJ3A 3HY6A 4ZYTA 3OQNA 3MB5A 4JN6B 5B58C 2JCXA 1KR2A 2PD3A 3DWFA 2AVDA 1RQ2A 3AESB 3PT5A 4NE9A 3N0VA 1HLPA 4DMFA 3E0XA 5C2JB 3LNTA 5C8XA 1GGHA 3ZXIA 1GQOA 2Y8EA 2R8PA 3SQDA 2CXUA 1GFIA 4N18A 3LBHA 4HAIA 1EM6A 2XD4A 1I2MA 2PS9A 3VNSA 4C4XA 4CMIA 5EVJA 6YASA 3B1KA 2DX7A 4W7HA 3DDZX 3GVIA 4J94A 4OGFA 2O7RA 4PV7A 1KK0A 1J00A 3TE7A 3ZE2B 4E11A 1N3IA 1T2AA 2RJ3A 3NNDA 4EMTA 2RGXA 4Q4AB 1Z7GA 2GFIA 4JWKA 1C2YA 4LWPA 4MVCA 3WNVA 1B8PA 1G8AA 1IPEA 3X1KA 4ZCTA 5AJXA 3F9IA 2ZRGA 3IKLA 2GOYA 1NXPA 3E7PA 3NP9A 2YMPA 3A1FA 2VHTA 3FDXA 4WLEA 3EAQA 3U1BA 1Y5NA 2HLDA 3HHPA 5CRIA 1R9JA 3K9LA 3PWZA 2WLTA 4N3AA 3TR0A 2WYUA 1X9GA 2YYYA 1AJEA 1TCAA 1G20B 2C29D 2H5JA 4YJ3A 1UKAA 5EP1A 4Z0NA 4KNVA 1DIBA 3FDIA 3KAJA 1ULTA 3N2IA 4G86A 5T64A 2C03A 2HL6A 3IP8A 5BT9A 1E6KA 2JLBA 2PX0A 4HX2A 1COZA 1RRFA 4CT4B 1PU2A 5BWBA 1PHRA 3DQQA 1YZKA 3WIDA 4CL3A 1MEJA 4OHWA 4NU6A 2QZ9A 3CEAA 2H08A 3UFBA 4AECA 2LWIA 4DLKA 3D8UA 1SKBA 4PLPA 3TPCA 2XUKA 2C7VA 2KBEA 5DISB 1BWRA 4CGYA 1G5FA 1U1FA 1UBOS 1QHHB 2P6RA 1UQTA 3KVNA 3PRKE 3ZQ4A 5L6LB 4JJGA 2ZJ2A 4BKRA 2O8FA 3SIPA 4C5CA 1B0ZA 1SC4A 1AM4D 1GEGA 1RHMA 3AI3A 2C98A 3B9QA 2WHQA 4JR0A 3RYFB 5FWDA 1BMDA 1IB0A 3NYIA 1SCNE 3DR3A 1K5PA 3L46A 2FPOA 3VC7A 5TT1A 2EG9A 1YR2A 1GIAA 2WYIA 1L2TA 1W59A 4L5YA 5KAMA 4P0QB 1K7SN 3M83A 4B8ZA 1RT9A 4HY3A 4OM7A 4RWZA 3GW8A 1UBSB 1IM2A 2GTIA 1HNWB 4LY0A 1UXHA 1CUBA 1HLFA 1KAEA 2A88A 2R6R1 2BDTA 2GO7A 4ND4A 1JYSA 1QB8A 2B1JA 2PX4A 2REXB 4CMEC 3IPLA 4NAVA 4TLLB 5IKXA 3TOSA 3GLIA 2B21A 2QW1A 2RB5A 4F4IA 3VNVA 1RHRA 3VV2A 2VAVA 3H3XA 4A2QA 3USZA 4BV3A 3QKRB 3C6MA 1KAOA 3NVMB 1G98A 2BE7A 4JT2A 5KKAA 1WF6A 4J16A 2D7DA 2ZE6A 4QVGA 3D0QA 4XVUA 1YUNA 5CB0A 1QCZA 2HK9A 3EDOA 3DFZA 1L1RA 1H85A 3L0IB 2C3MA 3QLJA 4QDTA 5F3DA 4DC0A 4PYNA 1X8JA 4NDAA 3TJMA 4XB2A 1CUAA 4J91A 2GCGA 3ZQKA 1V1RA 1JJBA 2PZEA 4HB4A 4UAJA 1U9JA 5JNTA 2ZDQA 5D5PA 3M6FA 4POOA 5DLDA 5AVXA 2KW5A 1NC1A 3AY0A 3S7TA 3ZV6A 1XWFA 4IOKA 4M8SA 3JQFC 3TMKA 2D3TA 4ENUA 4GWKA 1FDOA 2BBSA 3RHFA 1Y5LA 3WZMA 1TLLA 2YNMD 4WFQA 4KPGA 3KWMA 3Q7SA 3RRYA 1TZJA 1YDWA 5DX1A 1FNMA 4QECA 2J6HA 1HT3A 2Q5OA 3CNHA 1LDNA 1BW9B 2VAPA 3T61A 1B42A 4D3SA 1E0JA 5B1EA 1ZCJA 1U8UA 4XUDA 4C7OA 4FNOA 5A3RA 3ZOZA 1OLXB 5C37A 2QJTA 2E3JA 1F0PA 3NBMA 2C9BA 3ZYZA 2FMUA 2H63A 2ZRCA 2UZ1B 4P80A 2ZB2A 1CB0A 4U0JA 1CSEE 4E6PA 5CJ2A 3OIWA 3SR0A 1WXQA 1AK2A 1QFJA 1L4EA 2R5NA 3AJRA 4CG3A 1E2KA 2ZJ4A 3PHLA 4CETA 1N2SA 2QLJA 2QMYA 1F60A 1GT6A 4CQMA 1NNEA 3K5HA 2QV0A 2ACVA 1U7PA 1AX9A 1O03A 1NNLA 3K1AA 4TS1A 3VTFA 1NBIA 3Q0IA 2JLYA 1NN0A 2H1VA 3FPHA 1EIWA 3VR2D 4D57A 3WGHA 3Q8XB 4KB5A 5CNKA 1OJLA 3SU8A 5K8TA 4LF5B 1NGSA 3RGGA 3LFUA 2V0CA 4IJMA 1USWA 2IH5A 1XXLA 1X13A 1YB4A 3NTRA 4E2WA 2GQ0A 1XO1A 1RC1A 2P9CA 2ZGVA 2ZULA 4L57A 4MRPA 4UXIA 1I0LA 2L0XA 3MG9A 2NP7A 3GNQA 1R6BX 2XF2A 1RC8A 3C41J 1V9CA 2QG6A 5E6SA 1U2SA 4FGJA 2B9VA 1P9NA 2X19A 3LCCA 2F1HA 1A8QA 3M1AA 3MHPA 2IZ7A 4G41A 2ZS8A 2CXHA 3TW4A 3PNPA 3CVYA 4LFAB 3UN1A 4BNWA 3NIFB 1NE7A 4MWZA 2CHGA 3QMWA 2RH4A 4G5QA 1GRCA 3UJHA 2Y6VA 2V65A 5IXJA 1A96A 2RHMA 4JBLA 1R0WA 1EFPB 2QYTA 3FDZA 4RKWA 4A8JC 121PA 2IYPA 5E6RB 3MTGA 6LDHA 1W88B 4MGYR 1H66A 1QGUB 3F74A 1UMBA 3GJ3A 1FTWA 3NEYA 4OHXA 4QOFA 5C80A 4UNSA 5H8WA 4R9UC 4RXUA 1D9XA 1OBHA 1P74A 2VF5X 1X3SA 3FTNA 3ICVA 4GYKA 4HQLA 1AO0A 1WCV1 1QRUA 2XQIA 4G4GA 2IU4A 3KYDA 1WSDA 1AGNA 2ORVA 2JRLA 3LA6A 5A62A 3EF0A 4G5RA 5HGJA 5JE8A 1BKDR 3ROGA 4MCHA 3KVYA 4GQAA 4RF3A 3B1YA 1F0YA 1T8RA 4GICA 3TO5A 5CCXA 1LNSA 1VHDA 2FX2A 1YL5A 3VDXA 4OGKA 2W2PA 2VP0A 4PIMA 5LB2A 1KS2A 3WTBA 4BLUA 4PNHA 4RZQA 3TQCA 4X65B 5DNEA 2ZITA 3OPYB 2Z1NA 2OUIA 3FKQA 1DEAA 4TV9A 2QI9F 3VPBA 3DV2A 4NQRA 3RYHA 2VKQA 3DAGA 3FDFA 1W94A 5IKPA 3PC3A 4UVHA 1Q1AA 2OQVA 2EHJA 5IASA 4BCDA 3UOWA 3CNNA 2B99A 4P31A 5IT5A 4BGIA 2R8RA 2YXLA 1Y3HA 4HGNA 3RIXA 4C6HA 1CF9A 3OSUA 5GIOE 1DE0A 4KVAA 1Q7EA 3VR2A 4CF3A 2VRCA 3ZV5A 4DDKA 1ACMA 3OJFA 1X7GA 2ZJ1A 3TQIA 1J20A 1IAVA 1HYEA 1KC3A 4YXWA 2BRUC 3LDGA 3O4JA 2J0UB 1O54A 4RANA 4LNAA 3AHHA 3DDWA 3IB6A 3B3JA 1P9WA 3B38A 3P97A 4LQLA 4Y1RA 5CLQA 1L5OA 2AFHE 1Y98A 2XB8A 3FOBA 3BCSA 4YWJA 5LZ5A 3TBHA 5JOQA 4ZT2A 5L7YA 1DI0A 3JPYA 2XUAA 5CR9A 3RS8A 1EVIA 4BB6A 2A5YB 1C3JA 1GGJA 2GH1A 4H7HA 5AHOA 5ALEA 3BRSA 3SVLA 2BHLA 1M2FA 1ZBQA 3J7TA 2HQ1A 4BO7A 1N75A 5IBCA 2DGDA 5FCDA 2G36A 4GI7A 3IQXA 3F2IA 1M34A 3EEQA 3I61A 3RABA 3QVGB 3PFFA 1IHOA 1ZOLA 3GEEA 1C8LA 3L82B 3TQHA 5I01A 1NJ5A 3G5LA 4DXAA 1HZZA 4IDCA 2V7QA 1G21E 3NUQA 5D5QA 3TKYA 1MJFA 3FWYA 3DXYA 4CF6A 3DEFA 1C9JA 1BHSA 2JD0A 2PMKA 1Y42X 3TWOA 1EB9A 1GYRA 2H48A 5F1PA 1QQ5A 3ZHQA 4CLXA 3JRXA 1HL7A 1T8UA 1SUFA 2AFHB 2VHZA 3LQYA 4I1OA 4MWTA 4UC0A 4UMEA 5ICGA 3E9ZA 2BP7B 2ZYAA 1XDGA 2ZJOA 1XCBA 4N39A 4Z7JA 2C9YA 4RVNA 1JHXA 1J99A 1Z7YA 3CEHA 1RLUA 1Z18A 2V59A 1D2EA 3B1JA 1P7CA 4GM1A 5ILGA 3VZBA 3KKZA 4MW5A 5LZ7A 3TKAA 4KN6A 4DUGD 4NYMQ 1VIMA 4YAFA 3PVSA 2OAGA 1WW2A 2AF3C 3HKEA 5EE0A 5ULLA 3RPEA 1H4VB 3JQ8A 1FJGB 5IJ9B 1QKJA 1QTRA 1OT5A 4UHHA 4W5NA 3VSDA 1YGPA 3A6ZA 5EN4A 3AWDA 2TS1A 2FWJA 2XDAA 1YBFA 2R60A 4F3YA 3RV3A 3V1KA 3JD0A 3KYIB 2P9HA 4LIPD 2J6BA 1N36B 4RQUA 5TARA 1VLQA 1NUAA 3ZCXA 1E3LA 2OGZA 3OZUA 3WBKA 4F2PA 1VPLA 2AKYA 4X97A 4TZKA 4DN6A 1IMJA 1GZ3A 3BJEA 4O4IB 1SGWA 2RH8A 1Q22A 4QBTA 3T9EA 4NFHA 2XMQA 2QB5A 3H5TA 2R97A 2XI4A 4PLYA 4ZA2A 3IXLA 3T99A 1C4XA 2BEVB 1AS2A 2IPLA 2V7QD 2A9RA 3A36A 4MB2A 4G0XA 4OV6B 1IHYA 3CVVA 3CRRA 3D81A 4W4TA 1K27A 2A30A 1KO4A 2C2XA 2Z4RA 3HCEA 4OKNA 4XTRA 4DWOA 2P6OA 3AVQA 2KLHA 3QUCA 5ALQA 4Q7QA 1JIVA 3CLUC 4Q15A 2PUGA 3H7AA 3K1AB 3ORFA 3SP1A 2WV7A 3OTQA 2Z6QA 1FRZA 3T6KA 1MAVA 3C1OA 4EFDA 1DO2A 1NY6A 4M6WB 4XAQA 3KSUA 1L5KA 4QG3A 1XE3A 5K3OA 2H1OA 2ZUEA 1G3UA 1RRGA 4D8TA 1UR5A 4RDXA 3TINA 2HM7A 2ZB8A 3L0CA 2XQKA 5D6NA 5EINA 5IC5A 5JMPA 2W2VA 1S2DA 3DOCA 3H8JA 2IDKA 1Y4AE 3AV3A 2RD2A 2WKRA 3K53A 4PC7A 2WUDA 3AF3A 4NK5A 3QENA 2ZUCA 3SZ3A 3P9YA 1G41A 1W4ZA 5HXAA 3PHBE 5BV2P 3R7DA 2Q5HA 3O9VA 4DSUA 4NBWA 1G3RA 3M6XA 1XZ8A 5C35A 1BW9A 5F98A 4DV6B 2O52A 1TVEA 1BVUA 1FEZA 3B6KA 3RE1A 3VAYA 4OHMA 1G2IA 3BGIA 3MWDB 3NBYC 2XE7A 3GDGA 3PXXA 2YY7A 4WK6A 3RASA 4AYXA 1CP2A 3H2BA 2XUJA 1TMOA 1U2TA 1X2EA 2O5RA 1Z5NA 3LS2A 2ODNA 2ZUVA 3DMGA 4O4IA 4OJNA 4QXQA 1W46A 4RAOA 4V0NA 4Q9JA 3GAZA 4RFLA 5EZSA 3TLGB 4EJSB 5KYWB 4HWKA 3D3WB 1CIJA 1O95D 1T1EA 1X7XB 4C0KA 2B6NA 1KVQA 2OCKA 3FAZA 4J75A 1LPMA 3OU7A 5ENZA 3EF1A 5H68A 2CHUA 4D9GA 5F7OA 1P4JA 2FZKA 3FHOA 3DEKA 5K45A 1UFQA 3GJZA 1NV8A 1P6UA 1V1RB 2JEOA 4Q66C 2HA4A 3ZZMA 4YXWD 3Q4GA 2QWXA 1XRMA 4B76A 1M34B 3AZOA 3DTVB 4JNCA 3FPSA 3SMQA 3TW6A 4GX0A 3G5UA 4MEJA 3WISA 3OWXA 3TVYA 2AWNA 4S24A 4FC7A 1X1QA 4UTVA 2WQ6A 3Q7IA 4JB3A 3GG9A 3GMSA 3IAXA 3K5IA 1HSOA 4PHHA 5EOVA 1A9XA 4XYBA 2LDBA 1STOA 3KXKA 1E1MA 3AUSA 1EEXB 1UDBA 1HOXA 2JFHA 4KIGA 2Q29A 4ESHA 1T9HA 4BKPA 2YY5A 1D7OA 3DT9A 2DERA 3UV6A 4F6RB 2VHJA 2H1CA 2HD4A 5DGDA 3SIWA 5EHNA 1GUZA 3MNFA 1C41A 1IIRA 2P5TB 4LXIA 3WSWA 1DV1A 1SH7A 1ZI6A 1J2JA 2KMLA 4G0ZA 4I50F 4ZI7A 3HB9A 1JHDA 5BYBA 3NVDA 3QNMA 4RH3A 2V6MA 2ON6A 4F86A 3TNLA 3X1XA 1P0CA 2HA2A 1VI6A 4MHOA 4RS4A 4E1AA 3H9EO 3V7UA 5FUQA 4KWCA 3SD7A 4QJ4A 5ISMA 1AXEA 1S89A 1H69A 3Q88A 4HLCA 3H5LA 3KSMA 1LPBB 1TM7E 4XEHA 2WFMA 4LECA 5ENVA 3RIGA 4I4LA 2FFQA 3HM9A 4IXNA 4F5WA 3EIEA 2ZROA 4XM2A 4BC1A 4LJLA 4JLMA 1PWZA 3OOEA 3ANYB 4KX3A 3U7HB 2R751 4MIYA 2HHJA 2F8SA 3S5JA 2XMSA 1U9YA 1YRLA 4NLLA 1IBRA 1XZGA 4CT0A 1M73E 2ZBQA 4UTZA 1P0PA 1QAOA 1DDIA 3GRKA 4L9RA 4W8GA