4IFBA

Crystal structure of sult 2a1 llgg mutant with paps
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
274
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfotransferase Selectivity at the Molecular level
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Bile salt sulfotransferase
total genus 95
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ifbA00
1UBGA 4PSKA 4BFYA 4YXWD 1SVMA 1ANKA 1LB1B 2XNDA 2IYWA 4O0MA 1MO3A 2AWNA 4YMTA 1OXXK 4FMDF 4JSTA 5AWFC 3A1WA 3CH5A 4URUR 3R9WA 2X2EA 1VHTA 2GJAA 4URWR 2JAQA 1CF4A 1NSTA 2ZREA 3ZGXA 3CPEA 4Q4AA 2O8CB 3SJBA 2O8BA 1Z29A 2R44A 3RAPR 3THXB 1R8SA 3VU9A 1X8LA 5F9HA 3B2EA 3PUZA 2J5XA 2ZYWX 2QA5A 1OF1A 1U99A 1ZC3A 4MRPA 5TARA 2GF9A 2UKDA 2CHQA 4DDVA 1G20E 2QP4A 3WRXC 1A1VA 2KB0A 1YZTA 5JZVA 2CBZA 4IXMA 5DI3B 3GLIB 2EFDB 4C30A 2OE2A 1UBEA 3GFOA 3SQXA 1NRJB 1TF2A 5EXPA 1VCMA 2HV8A 4G5GA 4CGZA 2BMEA 2VHQA 4RZ2A 4JBYA 4Q4JB 4YMVA 4LDJA 4QOSA 3X1WA 3DZDA 3U3RA 3K8YA 3RANA 3X1YA 4C0LA 3TGPA 2W2XA 4CEJA 3K9HA 1HE1C 4P31A 3CONA 4F92B 2CE7A 4JKYA 2N46A 2G0NA 4JZKA 3O8BA 5G53C 4MYCA 1XD2A 3CR8A 4EFMA 1G6HA 4A15A 2A78A 2ECKA 3PUVA 4QM6A 3X2SA 1DVRA 1MRNA 3K0CC 1JPNA 1HT1E 3QQ5A 3QPWA 1RJ9A 3WBKA 3KQLA 3DOFA 3AKYA 3L8ZA 3U61B 3EPHA 2WOOA 4XWKA 1R5BA 2FFBA 1JR3E 2QGZA 4EPXA 4U02A 4HSEA 1I2MA 3A6PC 2OCPA 3P27A 1Q1QA 2YVUA 4RCZA 4UNNA 3P4XA 2ZRNA 1OIVA 4GFDA 2XNDD 1IN8A 1OYYA 2OCYC 4R98A 3SFVA 4KCGA 4IDQA 1HUQA 3NDPA 3J81k 4E22A 3RDPA 4DRZA 1VYTA 2HF8A 4HZUA 5CM9C 1U2RA 2C9OA 3QENA 3SN6A 1E9RA 2H16A 4O25A 4Q9IA 4FMCF 1EK0A 1LTQA 3THWA 2BBSA 2UZIR 3AF0A 1DAMA 4JL6A 4Q48A 2R65A 1X8JA 3ND8A 5CYOA 2JJ1D 2VL7A 2P6RA 4O2RA 2ASEA 5LB4A 2IYXA 2QMEA 1GNRA 2JJ2D 3VMFA 5M04A 3RRNA 2QSYA 1F2UA 2AN9A 4KU4A 3RNLA 1DG3A 4TYWA 1OFIA 2YHSA 5EE1A 3A8TA 1VYUA 2J0VA 3NHAA 2ZYUX 4KAXA 1G18A 2NZJA 1E99A 5EUQB 2WJJA 2EYUA 1G6OA 1IN7A 3CRRA 1E0AA 2O8CA 4RY2A 3CNOA 1HYQA 3C4JA 4NTZA 2GCOA 4NCHA 1N5IA 2QM7A 4Q21A 3B82A 1QHGA 2B92A 2ZSAA 3AF3A 4PSVA 2XEXA 5SZKB 2O5VA 1U90A 3PQCA 4WXPA 3C14C 1E94E 2O8FA 1JXMA 1Z2AA 5JWRA 1N6IA 4TL7A 4OQNA 4M8NE 1E9DA 1VG1A 5HPYB 4Q7LA 2XOKA 3HYTA 1SKYE 2G0TA 3UANA 1E79A 1XTKA 4N3NA 3W9YA 3GLFB 4IVPA 1FFHA 4QJ3A 1NKSA 3UPUA 4DSTA 1UEJA 4KVGA 2PCLA 4KSBA 2IYRA 4QBHA 5GVSA 1W2GA 2PT5A 2OLKA 2Q6TA 3K0FB 4TZ6A 2G88A 3LWNA 1MOZA 2WV9A 2CNWA 3B8HA 3OE7A 3N2EA 2MMGA 4LUCA 1U9IA 4GZLA 3DOEA 4LX0A 2LCFA 4OI2A 1QRAA 1UADA 2P2LA 3O47A 4WOPA 3OZXA 1Z6GA 5LDDC 3VHLB 4UNRA 4LHVA 4LV5B 2F3RA 3TQFA 1S0UA 2JJ1A 1W49A 3BD9A 1WB9A 1WDTA 3UMRA 2R8RA 3NEJA 3KL4A 3PG5A 3UATA 4KBFA 1OXUA 2FG5A 3H86A 4POAA 4DCSA 1NL3A 2YV5A 1Z3IX 1G7RA 4KFUA 4LWZA 4A4DA 5JSZA 2YWGA 4JBWA 5TB5A 2IF2A 2ZR0A 4PR0A 1FUUA 1N25A 1S8FA 2QAJA 2YWEA 4PQRA 2ZJ2A 4Q4JA 2JA1A 1YZQA 2WSSD 3UMSA 3L0IB 1OYWA 1G8PA 1RE0A 1H65A 4G0NA 1Q22A 1FP6A 4JVLA 4JMPA 4P3YA 3T1TA 5CJ2A 1U98A 3X1ZA 3KDSE 2WPDD 4FXPA 4G5QA 1CEEA 1BYUA 4V0MA 1RYHA 4XD7A 1OFUX 3K09C 4Q03A 1U8AA 1DADA 2NOAA 1L8QA 1DOAA 2GBLA 4I99A 1GTVA 1G17A 1E2LA 1L7VC 4LPKA 1G4UR 5KNDA 1WBDA 4DT1B 2VLIA 2I4IA 2R6FA 4LJAA 1GP2A 3RYTC 3LY5A 1WF3A 4M0LA 1DO2A 1NMXA 1OKKA 1W4AA 3LQQA 2EWVA 2G6BA 1V43A 3C15C 2BEJA 4Z8XA 1KI8A 1E9EA 4RKFA 5F3WB 2GCPA 3M0EA 1KI3A 1LFDB 3CB4A 1PLLA 1QHHA 2IXEA 3FTQA 5BYJA 3NVAA 4Q66C 4RZUA 5KO2A 4PQYA 3BERA 1E4YA 2IUTA 4A0GA 4HATA 1HTWA 1TF5A 1FZQA 1N6PA 4V02A 4BFTA 5KUTA 4JIMA 5FTLA 3U44A 4Z51A 3I1FA 2IYUA 4MRNA 2YINC 4GOXA 1TQ6A 1ZVQA 3EZ9A 4BLOA 5E95A 1AZTA 2BCJQ 2RHMA 3IILA 3MD0A 5G3YA 3S1AA 1T6NA 3FOZA 1Q0UA 4G1UC 4EFLA 4DLUA 1ZC4A 3IUYA 3IEVA 2QPTA 4P33A 3A37A 4GPTA 2OFOA 1GL7A 1NF3A 2H57A 4B3BA 4NCKA 5EJEA 1UBFA 2OFWA 4F4CA 3CNNA 4EPVA 4EQ6B 1SVOA 3JZMA 1ZYUA 3PUXA 4IW3B 1WA5A 2QTHA 1XXHA 5FOWA 2FPKA 2VSFA 3AKCA 2BDTA 2XJ9A 3DZ8A 1WBBA 1IY2A 3JZAA 4D81A 4C3ZA 3HWSA 1JBKA 5C18A 2OZEA 3LBIA 3TE6A 5IK2A 2REXB 1JJVA 1UFQA 3QXSA 4LHWA 4V03A 2J0UA 4LGMA 3EZ7A 1W48A 2YYZA 3T5DA 3BAFA 2ZI7A 1OT3A 2JDIA 2IBMA 4LRWA 4OI4A 1R0WA 3DMNA 4Q7KA 5IF9A 3OF5A 2F1IA 1RFLA 2RGCA 4PO9A 3NC1C 2O8DA 1MRSA 1ZP6A 1XJ0A 2B7BA 4MITA 1II8B 1QHSA 1XTQA 2C96A 4G5OA 5F2EA 5JHHB 1W36D 2HT6A 3QKSB 1DAEA 2ZEJA 3V9PA 4DLTA 1N0UA 1X86B 1W0JD 4B75A 1KI1A 2C9YA 3TSOA 4Q00A 2GJ8A 3F3YA 1CULC 3QXHA 3B60A 3QNUA 3KQKA 1MABB 2HXYA 1NVVR 5FH9A 1FX0B 2ZRAA 4OJQA 4V0NA 1IN5A 2QE7A 2DWPA 3TAHA 1NY6A 5FBRB 1CBUA 1E2NA 3VR5A 4KV9A 4C2UA 1JJ7A 5FL7D 3SJZA 1P4SA 4UJ5A 5AR1A 3DDCA 4MYTA 1J70A 4A36A 1BIFA 5EE9A 5JEEA 1E1RA 2J7PD 1G291 1YRAA 4MKGA 1U94A 2J41A 3KB2A 4AKEA 1OB5A 1KJWA 4LPSA 4DSUA 3BFXA 3OEED 4PAMA 1Q3HA 5DI3A 2F9MA 5FOXA 1ODFA 2A5JA 4XWOA 2IWHA 3CRMA 1G7TA 1KY2A 2D74A 2D62A 1SXJD 1X8KA 2HJGA 3V4RA 3KKMA 2ODBA 1GITA 1AQUA 1UJ2A 3AP2A 3NIBA 1AS3A 1P61B 5JS7A 2GXAA 4ZV4A 4IDNA 3VNUA 1G3IA 5FUVA 3QF4B 4Y0VA 1YHNA 3LNCA 3FPAA 4URZR 4FI3C 2WAXA 3RS5A 6Q21A 1M1YE 5HZKA 5DHAA 4BZPA 4FWTA 5HE8A 4ITRC 4TL6A 3KQHA 3NBFA 2IXFA 2PZFA 5E4FA 3W8RA 1E1QD 4KFRA 3QPVA 2XXAB 3W5IA 1VHLA 4OKSA 4PC1A 5AUPB 3GLGA 1DG1G 1HH4A 1PUIA 3N2IA 2ZQ5A 4H1UA 3GP8A 3G0HA 3FYHA 1OHHD 4R71A 2ZVQX 1DPFA 4GL2A 1KDTA 2D7CA 4MKHA 1R5OA 1S1CA 3BWDD 4Q7JB 421PA 4CW7A 2LKDA 4CZ2A 2QTVB 1GKYA 3DM5A 2H18A 1E3MA 4TLDA 1OH8A 1KYIA 3VHXA 1KOFA 3OAAD 2KSQA 4URYR 3T61A 5LD2C 5AK0A 1IY1A 4BEBA 1IQPA 1GKUB 3LX5A 1US8B 4M9ZA 2BEKA 3BH6A 1RYFA 1T0HB 2X2FA 1IJFA 3SHFA 5CDFA 1XCPA 1E6CA 2FA9A 3AF1A 2FN4A 4EFNA 2VO1A 2A2ZA 3MRSA 4QGHA 4RD6A 5P21A 4B32A 2GETA 2IK8A 4E09A 3SC3A 2E9SA 4LYHA 4EQ6A 2NMVA 2AK3A 3K70D 3KJIA 1OLOA 2DCUA 2YOFA 1MR3F 3QXXA 3Q5DA 1JR3A 2VP4A 4JS0A 3GPLA 1US8A 2NO0A 1E2GA 3QUSA 2OSBA 3SHWA 3Q7QA 3EPJA 4OK5A 2F55A 2ZS9A 1YR9A 4F4JA 2EW1A 4EUNA 5FTMA 2FX3A 4DCNA 2GZAA 4CT5A 5AJYA 4FWIB 5HKKA 3GFTA 2O8BB 4ON9A 1YE8A 2HYIC 3BB4A 2L0XA 2IHBA 4M22A 2YJTD 3SR0A 2Q9BA 3UWOA 3SE0A 4MDFA 2GDJA 5AJZA 1G8HA 3RWMB 1W44A 1XF9A 4IVQA 2C77A 3BOSA 3CRQA 4OI0A 1OHHA 4M21A 1GNQA 5CK4A 4LHZA 2BMDA 2CHGA 4BGDA 4HAUA 4YMWA 3KQUA 1Z06A 1TUIA 1G19A 2BV3A 1TQDA 2KI5A 4PFSA 3GLHE 2OAQ1 3WY9A 5G3ZA 3VR1A 2X77A 2Z83A 4BASA 4LHYA 1J2JA 1IBRA 4ZDKA 2GF0A 1R7RA 2QY9A 2CMKA 3U7EB 3U5ZB 5KTYA 2BJVA 2WKRA 4HLQB 4M1SA 5LBIA 4C0KA 3U4QB 4V0KA 1RJ9B 4EJSA 3Q8XB 4F4IA 2MSEB 3RWOA 3WNDA 5HR5A 3TK1A 2V6IA 4QXAA 1E2FA 1GNPA 4QBIA 3KTAB 3VQTA 3FHOA 4RSGA 3H1TA 5C4MA 5IDVA 3WMEA 2HF9A 4B71A 4I1SA 1UKYA 1X6VA 2DY1A 3BORA 4BLQA 5LPNA 3R8FA 1ZUNB 2DFKB 3NC0C 5GVRA 1Q12A 2D2FA 3CPHA 2WWGA 1LY1A 3BH7A 3ZD7A 2NTYC 5HCNA 4NPHA 4CRWB 1ZJ6A 2XB4A 1M34E 5D3MB 2HLDA 2ZJ5A 3QF4A 3PENA 4ZCLA 3OEHD 3OE7D 4TWZA 5DIFA 4II7A 3MGCA 4AIIA 3EA5A 5HE9A 2QZ4A 4HZUB 3TR5A 3I5YA 1IN4A 3ZH9B 4IEIA 2F43A 2DFNA 2PLFA 1KMHB 3CF6R 4Q5IA 3GLFE 2C04A 3MJRA 4IOKA 3SFZA 2BM1A 4KYIB 1P2UA 3I5XA 3ECCA 1G7SA 1HA3A 3DVLA 2BBOA 5KPDA 1PVOA 1QHIA 2GESA 2PL3A 4JLPA 4LV8B 5JMTA 1EWQA 2OHFA 2KWIA 2VRWA 4IJMA 2VQSA 4ERNA 2DYKA 2Z5FA 4E5UA 3WP0A 3QVVA 1S96A 2IC5A 4TTRA 1JQJC 4KHZA 2VH5R 2QBYB 2O8EB 1OXVA 2QAGC 1P73A 2PCJA 2ANBA 2VP6A 2XSZA 1JAIA 2IS2A 4CEIA 1SULA 1BO6A 2H17A 3DM9B 1KSFX 2FNAA 2MSDB 3R8CA 3AP1A 2QEQA 4JLDA 4DHEA 2GXUA 4JKIA 4Q18A 1DBSA 3HPRA 4TTPA 2CDNA 2IF0A 3NBYC 2GTPA 5H1YA 4L9SA 2DB3A 4DB2A 3AV0B 3QEOA 2C78A 4JVNA 4BLPA 4I1OA 2IUSA 1ZNXA 3LBNA 3KJHA 4PPNA 4BRWA 4ZCMA 4BUJA 1KHTA 3RLFA 4HAYA 3EIQA 1EFTA 1Z5ZA 4V0LA 4CF7A 3PCRB 2K5UA 2QMUA 3FGNA 4X8MA 4BWYA 1ESMA 5J4YA 2IA5A 4FCVA 5B58C 4Q1CA 4HUQB 1T8UA 2ZJAA 4MRSA 2FPLA 3PITA 3HDTA 3MMPA 2VEDA 4DCTA 4PC6A 2GZHA 2D4HA 1ZNYA 2PEYA 5SZJA 4B2IA 4DCVA 1G3MA 3ZIAA 3RSLA 1VIYA 4PO8A 2D3WA 3MCAA 3RS4A 1FL9A 1U9IC 4JVSB 4N0DA 3EG5A 3FDIA 1M6NA 2NQ2C 2BIFA 2XITA 2ERYA 1NLZA 1T5IA 1W4RA 1OH5A 1JALA 2QT0A 3I4LA 1FUKA 1TMKA 2WWXA 3TSWA 3AQ4A 1B23P 1HURA 2RKOA 1W47A 1CJVC 1NVVQ 4WZ6A 2JLYA 4NCIA 1E2QA 5FOSA 3QXJA 3DKVA 4V0ME 2OBNA 3IHWA 5CITA 2ZRPA 3QBTA 2RGBA 3F0TA 3KB1A 2J1LA 3NH9A 5JJLA 1OIWA 2OCAA 1COWA 4UKDA 1F3OA 2AL7A 3GLHB 1Z0JA 3U3KA 2WWFA 1J8MF 3V00A 4C2TA 3AM1A 1G41A 4WIAA 2PZEA 3WHKA 3FMFA 3NTUA 1L4YA 1ZMXA 3GQBA 1T91A 2MSCB 2IXGA 4TL9A 4W5WA 4QKQA 4Y0AA 3HP1A 1GOTA 4X8LA 2FOLA 1FQKA 4LY6A 3LFUA 1Z08A 1XMIA 1K5GA 4TYQA 1P75A 2Q3HA 3OIVA 4IOJA 1AKEA 3REFA 4A1FA 2Q3MA 2VF7A 2AXNA 5TMPA 5GJBA 2Y8EA 5CYPA 1AS0A 3U3MA 1PUJA 2PT7A 2CNWD 3C16C 1QG2A 4CEJB 1BH2A 5J40A 4V0OA 4AKIA 2V7QD 3IPYA 1XZPA 2XNSA 2ZE5A 5IRCD 1C9KA 4OQMA 1XEWX 4AI6A 4Q4LA 3HPQA 1NN5A 2BKUA 5DI9A 2BVNA 1QHNA 2PBRA 3B13B 4DUGA 2NO7A 4TLEA 1FOEB 4A8JB 1EFHA 1GILA 4OQFA 3RC8A 1W1WA 2QSZA 4L9WA 3U44B 3A4LA 3WBJA 3I3SR 2ZRCA 4HDQB 1Q1EA 1YRBA 3HR7A 2CJWA 2G3YA 4NCNA 4BFWA 5FFMA 2B7CA 1W7AA 4NH0A 1F2TB 3AVUA 2WIAA 4QM7A 1FX0A 2GJ9A 3X1XA 3FKSA 3K0FA 4HLUC 2CVFA 4I1UA 4QRHA 4UXJA 4AYTA 3SJCA 5BYKA 2Z0MA 1B0UA 2XZPA 3DMDA 2VBCA 1W0KD 4RD0A 4BE7B 2FZ4A 1T5LA 4B43A 4PPQA 2J7PA 4LBVA 4M4SA 5FI1B 2C99A 1DS6A 2G1KA 4IKEA 4B3XA 3AUYA 4JLMA 3R7WB 1PJRA 3K0AA 3QIAA 1EXMA 4BPBA 3WMGA 2RB4A 1GKIA 1R0YA 4ESHA 4TZ0A 2JJ2A 1KO1A 4DLYA 2QGNA 2PJZA 3EA0A 4M1TA 1R10A 3IBGA 1KK3A 1ZU4A 2J46A 3K70B 3TLXA 3CWZA 1EGAA 5EUMA 2JLXA 2P0EA 2GCOB 3B9PA 4BLSA 4XIGS 4JLNA 3PEVA 3UWKA 2N42A 2W2TA 5FPKA 2DWQA 3GD7A 4UXHA 4D25A 4IEEA 1SHZA 4DCUA 4MH0R 1YR8A 3G82C 2MMCA 2PMKA 5EXXA 3LVRE 3TAUA 3HR8A 2Z4RA 2AKAB 1O87A 2D06A 4HB2A 4ZI2A 1DAKA 4F7WA 1NNEA 3KXLA 5SZIA 4M9QA 4HEJA 4OI1A 1XJQA 1ZBDA 2Q0HA 5JEDA 4LJ7A 3V4FA 5J4KA 3G5UA 1R4AA 4NYJQ 2XOKD 3T06B 1CP2A 1E79D 4H9GA 2IYZA 2OXCA 1E32A 1Z6XA 5KU1A 3OAAA 2XGJA 1CKEA 1QHYA 1E2HA 3CZPA 4W5JA 2ZI3A 5D3QA 4OHXA 2JLQA 3ND9A 4Z1MA 2ONKA 3NDBB 3DEFA 1OKKD 3ADBA 4R7ZA 1IXRC 2R6GA 2XJ4A 3BE4A 4PHFA 4TMXA 1YU9A 1NI3A 1XMJA 5C2JB 4KLZA 4B44A 5TDHA 1XEXA 1Z0AA 1KIMA 3EPKA 1NN3A 3U3JA 1VTKA 4LK2A 3I61A 4A6PA 1H8EA 4FMDB 3LA6A 4G5SA 5FI0B 5JCZA 5ELXA 3I8XA 1HT2E 4BLRA 1JNYA 3DL0A 3B1XA 2V8OA 2IEZA 1RRGA 1MH1A 1UDWA 3TIFA 3N70A 4XTCS 2ZRFA 3TUJC 2EFHB 2NO1A 2N1BA 3HU1A 3FWYA 1UDXA 3SYLA 3PUWA 3W90A 2QRNA 1KZ7B 3CH4B 3SI7A 3P32A 4B73A 4DB4A 4DLXA 3H4MA 4R2HA 4CEHA 4HUQA 1X1SA 5FUXA 3CRVA 1XX6A 3K53A 3RSOA 1G1MA 4RFSA 2OV2A 2ANCA 5FUWA 1XTRA 4PZYA 2IS4A 2G83A 3D8BA 1HQYE 3R20A 4ILEA 2RMKA 3O8DA 2C2HA 3H2YA 3BB3A 1AA9A 1KI4A 3CRW1 3AVPA 5GJWC 3GLGB 5FTJA 1BMFD 2QRZA 2ATVA 4FW9A 2F9LA 3QXCA 1GRRA 2WWHA 4D4KA 1KJZA 4N1AA 3K70C 4YDSA 1MV5A 1CS4C 1KI9A 1Y63A 2WBLC 1KO7A 5L3SB 1NMZA 3K0EA 2WOJA 4GRAA 5FTKA 3W6PA 1E2JA 3FHTA 1T4GA 1OW3B 2JLVA 4EDHA 4HI0E 3I62A 1S9HA 3HU2A 2FGJA 3GJ6A 5K8IA 1W4BA 1NSFA 3I72A 3GLIE 3KKQA 4M53A 3A1VA 4R9UC 3RS7A 1Z0FA 4MYHA 1C1YA 1AJEA 3C7KA 3WHLA 1AGPA 5KNCA 4K8OA 4BFSA 4P0TA 1Z6AA 3DPUA 1XDBA 3A4MA 1IXZA 1LS6A 2Q9CA 1F48A 1LVGA 2ATXA 4TMVA 1C4OA 2YNMA 2ZJ8A 4Q9JA 2CCKA 4Z8YA 1W0JA 4GMXA 4TSFD 4Q1FA 2ERXA 5SZHB 3QEJA 1KI6B 2R6CA 1CJTC 4MQBA 1S4QA 2JASA 5DHFA 3EW9A 5EP4A 3E2IA 5KDOA 2IYYA 1RPZA 2IS6A 1P5ZB 2O8DB 1D9ZA 2BBTA 4TLCA 1TEVA 2IYTA 3PVSA 3ETLA 1RRFA 2YZ2A 3TVDA 4TMKA 4XJXA 1Z0DA 2XX3A 4P32A 1LS1A 1Z6TA 2BCGY 2O0JA 2HLDD 3AKDA 1R0ZA 2O0HA 4QGAA 1SVLA 3OEHA 5EQTA 4D82A 1N0VC 2P5TB 2VP9A 1IHUA 4YC7A 4G5RA 3UXMA 2PMDA 2ORIA 4NMMA 1E9BA 3T34A 3M1IA 2OBMA 3B1VA 1A82A 4B47A 2ZITA 2CEAA 1WXQA 2QP3A 1FTNA 5A4JA 2VHJA 2W0MA 1E2DA 5GADl 4L5BA 4YXWA 5L8VA 4U7DA 3GLIA 2FWRA 1P9NA 3DO6A 3QG1A 1J8YF 2R6AA 2IYQA 1OJLA 2ZVPX 4CT4B 4HB3A 5JFGA 1N2CE 3TUZC 1DAHA 1VDZA 4UXIA 3RRMA 2AD1A 1SHKA 2VP5A 1ZNWA 2BJWA 4Q1DA 4B6FA 3B1WA 5JHGB 4NKRA 2G1JA 1G7CA 5KHOC 2F3TA 2ZAOA 4BECA 4AKHA 3MFYA 3IQXA 2GRJA 2P5SA 4IDPA 1ZM2A 4PTLA 4OK3A 1ZD9A 1ZUIA 3ASZA 2RH5A 4DLVA 2B21A 1E2EA 1KKMA 1BS1A 5J47A 3LLUA 2BWJA 4FD2A 3QE0A 3ZS8A 4B3FX 2XTMA 2IX3A 2XTZA 1P6XA 4GDFA 3GLFA 3VFDA 3AEZA 4MKIA 1LF0A 3MG9A 2NPFA 2FDCA 3AGPA 3SYKA 4EJSC 3D7MA 3C5HA 2W6JA 1XD8A 4JYBA 3WP1B 3LV8A 3PR1A 4IDOA 3W3ZB 2P67A 3OIWA 1OIXA 5FR2A 1XD9A 4QC2A 1WCV1 4MGYR 5HTKA 3ADDA 3IIMA 3QKTA 2V1XA 3Q72A 1S9DA 5HKKD 4TYNA 1GUAA 2FSFA 1CR4A 3O8RA 2ZI4A 3F5FA 4NYMQ 4DKXA 4HLDA 4ESVA 4F93B 2VIIA 2IW3A 1SXJB 4IFBA 2BM0A 3ASYA 2FMXA 3QVUA 3RS0A 1KO5A 1PLJA 1KSJA 2WWIA 4KODA 4DIDA 1S3SA 2QORA 3JVUA 4RFSB 4XSGA 4D0GA 3CW2A 4TMTA 3CBQA 1IN6A 1XPUA 1AK2A 4FIDA 2CXXA 5G40A 2JLZA 5C4GB 3T12A 1AQYA 1G5RA 2FFAA 2IL1A 1U8YA 3THWB 3HU3A 1E9AA 1E9SA 2DR3A 4MUBA 3VKWA 1G8GA 2DHRA 3QKRA 1NP6A 5JWHA 1U8ZA 4I1VA 1NBMD 1GZSA 1QVAA 2GNOA 2CCGA 1L4UA 4CEIB 1XB2A 1W5TA 2KBFA 4DZZA 1P9RA 2ZUDA 3GLHA 3KFVA 2J45A 5FPYA 5HCIA 2WWYA 1JXOA 1QVRA 4YLGA 3I32A 2BMJA 3THYA 2HUPA 2IYVA 3K1JA 3KUCA 4KITB 2CLCX 2J0UB 2CK3D 1KI6A 1KGDA 4HZIA 3W6OA 1QBKC 3IQWA 3B1YA 3GJ4A 3U6BA 1T3LA 3LLMA 2OXRA 4MRVA 1QF9A 5KDDA 2GHIA 1FNNA 2P65A 4M1KA 5G41A 5BXQC 4NP6A 2A30A 2JIZD 2Q21A 2JJ8A 2F43B 3D3QA 2PZGA 4WZAE 3THOA 3KUDA 2O52A 5KDLA 4A0RA 2ZSDA 2V9PA 1P3JA 1VMAA 4PHGA 3QKRB 1E69A 1S3GA 3FMPB 3Q5EA 4IXNA 1TEXA 4PSAA 1VCIA 2WTUA 2WJIA 1UKZA 4JLKA 4XVQA 2HDNB 5CDFE 4XD7D 3CR7A 3EC2A 3AVTA 4RD3A 4LBZA 5EP3A 1P2SA 5F98A 3T5GA 5ANRB 1TX4B 2GJSA 4QGFA 1NJFA 3CF0A 3CPJB 4LI0A 5EE5B 1Q21A 4L15A 4LJYA 4A92A 4LJ4A 3ZVLA 2J0SA 1XPRA 4DSOA 3QSYA 1A2KC 2P3SA 3W5JA 3EIHA 4X8OA 4LHXA 3PXGA 2XB2A 4ASUA 4RD2A 1W0KA 2OG2A 1N5JA 3CIOA 4TT3A 5JRJA 2JEOA 4ZCIA 1WRBA 2VP2A 3OHMA 2WAYA 2A7QA 4G01B 5TV2A 2GEDA 2P6NA 2D2EA 2PX3A 1ZINA 2IS1A 4IFEA 1N5KA 3EC1A 4WXRA 1SZPA 3BK7A 3T35A 5DE3A 1ZNZA 5DN6D 1P2VA 4MGZR 4HAVA 1F2TA 4OHWA 1Q44A 3LXRA 2ZI6A 3MJHA 5CM8B 3SBDA 3UK6A 4M1OA 5F9FA 2QQ0A 2EFCB 1GAJA 3QKSA 4WVFA 4TLBA 4CDGA 1SVSA 2LKCA 1D5CA 1YKSA 1D2EA 1RRPA 5H68A 3KFXA 3SS8A 5B64A 2W0SA 3B6EA 4M1MA 4DJTA 3P1JA 4PANA 4A6XA 4KI0A 3EXAA 3GEEA 4DVGA 5JECA 2FF7A 3GJ0A 1FW6A 2PH1A 1ZD8A 2AKYA 4AWXA 4HDOB 2W00A 2UZ3A 3AB3A 3RS3A 3UMFA 2QPOA 3BFVA 4TQUS 2ONJA 5HZHA 4DBLC 5AJVB 4MA4A 1VG8A 3VR3A 3EZ2A 4LYFA 4S35A 3ZS9A 3NEYA 4JVMA 2X19A 3TQCA 1ZU5A 1E0KA 1TTTA 4Q19A 1Z0IA 3KQNA 1IAQA 3L8YA 1CR1A 2I1VB 4BFUA 2I3BA 1RVDA 4Q1EA 1FMJA 3VNVA 2GKSA 4BFVA 2VYFA 2JLUA 3B85A 4MUAA 2GCNA 3SQWA 3DHWC 3ONWA 3H84A 1II9A 3OEEA 3FFAA 4GZMA 4XH9B 5BQ5A 1T3HA 1XTJA 1E2PA 2A5DA 2A5YB 4L4UA 4BQSA 3U4QA 1YZLA 4ASUD 4PXAA 5FBWB 3GJ8A 4TL8A 5BN4A 4DC9A 1H8ED 3MWJA 3IHLA 4ACAA 2HYDA 2ZJBA 3FKQA 4YMUA 3EZFA 4IRUB 2ZRHA 5AUOB 1GG2A 4JLBA 3UG6A 2B6HA 2ZU6A 4HDCA 4LBYA 5KNBA 3U6KA 2KBEA 4JYCA 2W6IA 1CXZA 4A9AA 5JLJA 2E87A 5KPJA 4KFSA 2ZETA 1KNXA 2H8KA 5KSOA 2E1RA 1F5NA 5L3SA 1S1MA 2CE2X 3RRZA 4JLAA 5A5GA 3I73A 5KSZA 5C1BA 4D26A 3HJNA 1W4CA 4EAQA 3RHFA 4OBEA 1CRPA 4A2WA 3AVOA 3QBVA 4K81B 2ZRGA 1YJ5A 5EP1A 1JR6A 2ZJZA 3BH0A 5AUNB 1KI2A 1NN1A 4OL0A 1CR0A 1VCNA 2D7DA 2BHRA 2Q3FA 4PQFA 3RABA 4BFZA 2QQEA 4PC7A 4GP7A 1LW7A 4GOJA 4L16A 2YOGA 3VR2A 4W5HA 4A0FA 4P4SA 3DKPA 1P2TA 4HLCA 4LC0A 1Z6YA 2JDID 3SYNA 4B2LA 1DAFA 2VTKA 4QL3A 4B3GA 2VPPA 3P4YA 4MKFA 3EX7C 4XWAA 5TXGA 3A1UA 3B7GA 2A3RA 4C0QC 2AHOA 3ZVRA 1QHHB 3CO5A 4LZZA 3NXSA 3R9XA 1TU3A 3KKNA 4Q9KA 2NPIA 2J3EA 2UVQA 2CCJA 1FTSA 3PV0A 5GJCA 1CJKC 2RAPA 5JWOA 4ACBA 5K8LA 3K0AB 1KTVA 2IHYA 5CLLA 3D31A 4ZIRA 5BN5A 5KOYA 1MO4A 4P4UA 1KKLA 1DTSA 4RD4A 5BWMA 2XAUA 1OSNA 1TQ2A 5FOVA 5JRZA 3PEUA 2YOHA 4G3XA 1WE2A 3LX8A 5H70A 2RGNC 1W5SA 1OV4A 4DLSA 1QHXA 1VYVA 2RGAA 2ZANA 4ZDWA 2WMNB 4WZBE 2FFHA 2WZQA 4YONB 3AVXA 4HLUA 4DDTA 3LW8A 1E98A 3EAQA 5BW8A 3IIJA 4BFXA 2W6ID 1KK1A 4GI7A 1G3UA 3PEWA 4B2PA 4DLWA 1NIPA 1EFRA 2JGNA 2RHDA 2PEZA 5KYKA 5CJPA 1M7HA 5FBLB 8OHMA 5FPSA 1XWIA 3R9IA 3ICEA 2FSIA 2H1LA 1JQLB 1OFHA 2ZUCA 4TTQA 3I8SA 2FE4A 4CIDA 2ZM5A 3ZD6A 1VPLA 3IDQA 1GVNB 1NLFA 1KDPA 4UJ3A 2DWOA 821PA 2GXQA 4TYPA 3TW8B 1Z2CA 2QN6A 1KSHA 2ZRKA 4QHYA 3NKVA 1RRCA 5CLQA 2ZSBA 1R5NA 1ZM4A 1FQJA 3WXMA 5L3RA 3RC3A 2XXAA 1YR6A 3MWLA 3SBEA 1XEXB 1OB2A 2C98A 2FH5B 2LWIA 2YC2C 4GSYA 3FE2A 3LD9A 1AM4D 3FMIA 1KSGA 1L2TA 4ARZA 4AKGA 1XMVA 2FFQA 1QDEA 2B8TA 5DH9A 121PA 1FPMA 1D9XA 2WPDA 3D6TB 3U7HB 1MO5A 1W46A 3B1ZA 2F1HA 3TSZA 1N3BA 3T1VA 2ZJOA 1BOFA 3AVQA 4OYHA 2G77B 4DDUA 1T0JB 2QE7D 3AGQA 1MKYA 1PLKA 2ZYVX 4LYJA 2AX4A 2W6JD 3AUXA 4Q9HA 1T8TA 4NZYA 3U7FB 4C7OA 3ZZTA 4EIWA 4GOKA 2ZSFA 4QFMA 3GCGA 4NYMR 4Q1AA 5D3MA 1DE0A 2GA8A 3QG5A 3TKLA 1CR2A 4PO1A 4NYIR 2ZUBA 4CVNA 2C95A 2OFXA 3T1OA 1CTQA 5CK5A 3M4YA 2YWHA 4QGGA 1M8PA 521PA 1K5DA 1FMLA 2AK2A 2VP0A 2Z43A 1BMFA 2OBLA 3LW7A 5EE3A 1OXTA 4PC2A 4B76A 3KTAA 5IK2D 3BRWD 3IPXA 4RJLA 3NWJA 1ZRHA 2OO7A 3N5CA 1XU4A 2ODWA 2C03A 3KJEA 4KLNA 1Y3AA 4WAUA 3T15A 3IO5A 4ZO4A 3A58B 3QKUA 1UBCA 3VKGA 1E1QA 4TN1A 1IXSB 3CLVA 1FNMA 3VR6A 1UAAA 3A4NA 1DARA 2WM9B 1Z07A 4B3CA 1R6BX 3TRFA 2A9KA 2JLSA 3ZZUA 4ZDJA 5L3VA 5FPTA 2J9RA 1GRQA 3IKJA 4QHSA 1KMHA 1Z63A 3AF4A 1EX7A 4UNQA 3QOFA 4D4JA 1VCOA 4DEXA 2XZLA 4A2QA 4KBGA 1G5PA 2IYLD 2RCNA 4C0BA 1XPOA 4Q01A 4RFVA 2PLRA 4HAZA 5J4VA 5DO9A 4C0HA 1IY0A 4C7OB 2ODEA 1VIAA 3VX4A 1ONBA 4B6EA 4DT1A 4LJ9A 4NDZA 5FL7A 3E70C 3CZQA 2DBYA 1P9WA 4RD1A 4TMWA 5FPHA 4KFTA 3OFND 1ZD1A 4KVAA 3ZLJA 2DFTA 2FEOA 4Q02A 3W8NA 4URXR 1NMYA 5DYGA 4EPYA 2R9VA 1XEFA 1DAGA 5FOUA 2V4ZA 3BJIC 4ZDIA 2NO9A 2P6UA 3PEYA 4A0HA 3THXA 4B34A 1SVIA 1U81A 1NG9A 1Z28A 1AIPA 2R2AA 4XVUA 2WJVA 2FV8A 4PPFA 4OQLA 4QHTA 3KX2A 4TQAA 1NVXQ 3L0SA 5KSPA 4MGIR 4TYYA 1XRJA 1YZKA 4JT2A 4XSHA 1KNQA 4XOIA 1CIPA 2GXSA 3EASA 2V54A 1R8QA 1Q20A 2WKPA 4QBGB 1CRQA 1NBME 4C9BA 1ZCAA 4YDHB 4HB0A 3E1SA 5JJIA 4Z54A 1I2DA 3TBKA 2QPAA 5EZ6B 1EG7A 4D0NA 2XTNA 1ZAKA 4P4TA 5AJWA 721PA 1MO6A 4UNSA 3QF7A 3LVQE 2ZRIA 1G8FA 2C5LA 2AR7A 4FMCB 4BEJA 1ETUA 1DELA 2BBWA 3U60B 4IOMA 1M7BA 1SKQA 1Z0KA 1ZUHA 2VHCA 1E1RD 3C41J 1TPZA 1KZGB 1OE0A 3K0CA 4XVRA 2IEYA 2HCBA 2JATA 1VG9B 3CM0A 3PUYA 3ZVMA 3FB4A 2EU8A 3EZ6A 3ZIAD 4AD8A 3EARA 2OESA 2QTFA 3PIRA 4DWJA 1GIAA 2WIBA 4B3DA 4ARZB 2GJKA 1EFUA 2ZS8A 5E7MA 1TAGA 1NJGA 3LQRA 1AKYA 5JBQA 2GK6A 3MLEA 3Q3JB 2NO6A 4JBXA 3WNCA 4J0QA 2HXSA 1XBTA 5IT5A 4Q4AB 3C8UA 1UF9A 2TMKA 1XZQA 1XTIA 2RGGA 3GFPA 1EESA 2ORWA 2GILA 3OFNA 2RGEA 1N6RA 4DIEA 4EPWA 3U3OA 4OJKA 5J4HA 1CJUC 1EWRA 4E03A 1A7JA 1NN0A 3AVWA 4ABYA 1OPXA 2EVWX 2J59A 2QAGA 3VX3A 3SU8A 2B8WA 2QT1A 1NKTA 2V3CC 2XZOA 4QJ5A 1N5LA 3X1DA 2WWWA 1GM5A 1ZIPA 5E3HA 1U0HC 1W2HA 5E7IA 2FSHA 1IM2A 1M2OB 1YZNA 4KSCA 3AF2A 2VA8A 4TQ9A 1Z83A 4TSFA 3BFKA 1X3SA 4MRRA 2CLSA 2HCJB 2ZE6A 4ZKDA 4PHTA 1DO0A 5TVKA 1D2NA 4D2IA 1R2QA 1ZCBA 3L2OB 5EXSA 1XJCA 3B78A 1DAIA 5AJXA 1TUEA 2VHUA 2ZTSA 3TUIC 4PX9A 3VU9B 1ZW6A 2QP9X 2ZSEA 2YC4C 3AP3A 1AZSC 2R6DA 1ZM9A 2V7QA 3MWYW 3ZJYA 4JL5A 3U7GA 3CNLA 1J90A 1XCGB 5JI2E 3KXKA 2O8FB 2VSXA 4LSGA 3ADCA 621PA 4UNPA 1CJMA 2ZRMA 5DSZA 5TY0A 4D0LB 3GJ3A 2CL7X 3K09A 4QBFA 4OQXA 1RKBA 4F91B 1O3YA 2IWRA 1N6OA 5IHPA 2OT3B 1HQCA 1P60A 3VR4A 1VG0B 4MYUA 1EX6A 3S1AB 2F1JA 1WP9A 4LV6A 1NG1A 2F7SA 4HUTA 3TNFA 3ZQJA 1KAOA 4AC9A 1UEIA 4D4MA 4BLTA 2REBA 3FVQA 4N0EA 1OH7A 3FKSD 3GJ7A 4Q9LA 2ZS7A 4FN5A 1U0LA 3L43A 3NH6A 1E0JA 2CL0X 4KYUA 4LBWA 1D6JA 2Z4SA 1G5TA 2WJGA 3O8CA 4B48A 1I4DD 2CVHA 3R7WA 1P72A 4S2EA 1NIJA 1ELOA 4U5XA 2YWFA 1MABA 3LAWA 4JSYA 3CF2A 5DLQC 1F2UB 5B30A 2FGKA 3JVVA 1TU4A 3REGA 2KJQA 2FSGA 4Q1BA 3VTKA 1P7CA 1KMQA 4NBSA 2CK3A 4UQOA 2ZAMA 2EFGA 2ZXUA 1HEIA 1Q3TA 3W3AA 3QY0A 2QU8A 5DISB 4C0AC 2W83A 2X8AA 2ZI5A 4PZLA 3SOPA 3T1QA 3P26A 4RCYA 4M9SA 3VAAA 2CLDX 2ZE7A 4TT3D 3FFBA 2FEMA 3M6AA 1KK0A 5CIQA 1SVWA 1HY3A 4JLJA 5JI3E 4BZXA 5L3QA 3L0PA 3LH5A 5JS8A 1KJYA 4NYJR 1JI0A 1E9CA 1AN0A 4MDEA 4W9MC 4A8JC 3RS2A 3CWQA 4O3MA 4NL4H 2V6JA 3AH8A 1N0WA 1Q1ZA 2Q9AA 1N6KA 2ORVA 2IYSA 2QL6A 2AFIE 2F1RA 4URVR 1IONA 4Q4HB 2WJHA 1XXHE 1P62B 1GFIA 2ZROA 3C5CA 4PPGA 4B35A 4OK6A 3CX8A 3KXIA 5UKDA 1E2KA 1HE8B 1NVUQ 4RKEA 4GT1A 3PFIA 1BKDR 2ZRBA 3K9GA 3TH5A 4Z1MD 1K8RA 3ZVNA 1COWD 1PZNA 1A4RA 1E9FA 2RGNA 5GJVC 2EWWA 4KXFB 2CHVA 2NZ8A 4A2PA 4NYIQ 1G4AE 1GL6A 3OIYA 5AUQA 2IT1A 2ZRJA 2NG1A 1UKVY 3RRYA 3U2QA 1II8A 1JEDA 2BOVA 3CX6A 3GJ5A 3SEAA 5L3QB 4AY2A 1NY5A 1I4LD 1MT0A 3TVTA 4EKDA 4GP6A 1N6LA 1SXJA 1XCMA 3EPLA 5J5CA 5EP2A 1A2BA 1ZM3A 4QNRA 5B57C 1OFTA 1M74A 1Z8FA 2ZR7A 4NU0A 4PAOA 4AURA 4B74A 2AD5A 3WYAA 1OH6A 4LC1A 3WYGA 4LOAA 4W7SA 3EWSA 1RW4A 3PJRA 4B33A 3A36A 3NBXX 2R62A 3W6NA 5A0FA 3WNBA 2GAOA 4D6PA 4LCBA 2FU5C 2JCSA 4LJ5A 4Q4HA 3E5HA 2XSZD 3W34A 1W36B 1KI7A 2FZLA 2AXPA 2JIZA 3WYFA 1ESNA 1YVDA 2RGDA 2WMOB 3LO5A 3BBPA 1F6BA 1KK2A 1XMSA 1N6HA 4DUGD 3LDAA 3BC1A 2AFHE 3KKPA 1AGRA 3CKLA 4TLAA 4D80A 2V55B 1ZIOA 5E7JA 2IUUA 1E4VA 3SNHA 3Q7PA 3HYRA 1JECA 4US1R 2VF8A 1E96A 2ZPTX 3NG1A 4GMDA 4NHOA 1XXHB 3UIEA 4AYXA 4DLRA 1AS2A 1J99A 4FMBB 5FBVB 221PA 3B9QA 4EPRA 1D2MA 5EXTA 4A8JA 4LJ6A 5FOTA 2EQBA 2OAP1 2ZJYA 2O0KA 4PHHA 4FCWA 2J0QA 4M9XA 1VECA 2JLWA 4US0R 3TR0A 2WVJA 2ZRLA 2CJWB 2NGRA 1RIFA 4CYMA 4C0SA 1KDOA 3L0OA 1SKYB 2WICA 4ZI3A 2ODNA 4IVRA 1WQ1R 4IDHA 1G3RA 5FR1A 2GEVA 3CUEF 2J87A 4M1WA 1X1RA 1R0XA 3IO3A 2QMHA 1GSIA 2FJUA 2OILA 5FTNA 3MUFA 3QI2A 2EFEB 1BYIA 2A5GA 1H8HA 2HT1A 4ZKEA 2X1VA 2BMFA 2QM8A 3BXZA 2H5EA 1KY3A 3IIKA 5KSYA 1K6MA 1KDRA 1LNZA 4JJZA 1QG4A 4US2R 1FP7A 3BS4A 3NBZC 1UKEA 2O8EA 2DFLA 3K0SA 3THYB 4PC3A 3MWKA 1RC8A 4AG6A 3TW4A 1SXJE 5DN6A 1XTSA 4E07A 4OHZA 1Z47A 3UKDA 2WSSA 2J7KA 4C0JA 2QBYA 1XNJA 2HEIA 2QAGB 1RZ3A 4IHQA 2GZDA 4HAXA 2V1UA 3UG7A 5H8WA 1VKJA 2QG6A 2WKQA 1T3SA 1S2MA 2ZU0C 2GBLC 5CIWA 4Q47A 4CEHB 2OEPA 2OCBA 3A1TA 2G9NA 3KJGA 1IJEA 1SVKA 4LJ8A 1JAHA 2ZRDA 2JLRA 4BRUA 4YMSA 5K8UA 2QENA 3Q85A 3GMTA 4OHVA 4RZ3A 1NLYA 3LXXA 4K46A 2HJVA 4MGKR 5JCPA 4OHYA 4KO8A 3WMFA 2CL6X 3VKHA 5FL3A 5K8TA 1G3QA 1E2IA 2GAAA 2BKEA 3BB1A 2QNRA 3I92A 1SQ5A 2PJRA 1G16A 4O2LA 4EPTA 4NONA 4HB4A 5FBQB 5EE0A 1TADA 5JSZB 1EFRD 1G64A 1KO4A 4PAQA 5DGXA 2VSOA 2I1QA 3GJXC 5JJKA 1Q57A 4JL8A 4AG5A 1JEEA 1XEWY 2RGXA 4IOLA 3AVVA 1U0JA 4TMZA 4GBMA 4X8HA 4HYYA 4QG7A 4RVCA 3K9LA 1CU1A 1TNDA 2C8VA 2GEUA 4JT4A 3A1SA 2AWOA 4QJ4A 2YKGA 4P4SB 3OESA 1CLUA 1H8HD 1SGWA 4RZXA 4XTRA 1N6NA 1Q1BA 3FHCB 3OIUA 4I81A 1E0SA 2H7VA 2F6RA 3ZQ6A 2SHKA 3ICQB 4YQFA 3RVBA 2OLJA 2KE5A 2GWHA 1KO8A 5DYIA 2BC9A 3IGFA 4FINA 5DNYB 1NBMA 3AVYA 3NHBA 1UPTA 1E2MA 4WBSA 2QMOA 4KJZA 1GRNA 3K9NA 1GL9B 3H0KA 4NCJA 4AYWA 1UM8A 2VHTA 2Z6VA 2ZIAA 4LYAA 3B5JA 4ZPXA 1W36C 4BZQA 4M1YA 3ZZ0A 1DEKA 3IEUA 1LV7A 1XFAA 4JLOA 5B2ZA 2W58A 3KZ1E 1YQTA 2C9CA 4AK9A 2GVZC 4F38A 1LF5A 1TL7C 4JJKA 1JPJA 2WHXA 2WSMA 4L8GA 4PZZA 1JB1A 4QNMA 2ZE8A 1EFCA 4M2LA 2ZR9A 4DEYA 3GLGE 2OUKA 2W2VA 1JR3D 1OXSC 3LRPA 1XP8A 4U00A 4H1VA 5CB6A 4FCTA 2DPXA 1ZM7A 2EYQA 1J7KA 1YZUA 3FMOB 3KKOA 4WW0A 2ZYTX 4GNKA 2WJYA 3EIEA 3SJAA 1IOZA 3LBHA 3IBYA 3SDZA 5FUYA 2OM2A 1HV8A 3TMKA 4DDWA 5C46F 1PV4A 1V5WA 1WMSA 3CX7A 3L82B 4ZIRB 5LB2A 3MSXA 1A5TA 4WA7A 1KAGA 2A5FA 3ZYCA 4C4PA 2GK7A 1NVWQ 3GEIA 4DSNA 1YZGA 3GEHA 3P20A 3EWAA 2PX0A 4I4LA 4DXAA 1QZXA 4R2IA 3BIFA 1SXJC 3MAAC 4JLVA 3QJYA 1YR7A 2QROA 5J4LA 3Q9LA 5CB8A 3ZDQA 1D8TA 3F8TA 3QPUA 1G9XA 4A82A 3ADKA 5EZ5A 1I4TD 1M7GA 4DLZA 3TJZA 2QUZA 3BGWA 1GWNA 1TF7A 4HAWA 2H92A 3SZRA 1GDDA 5LD2B 1Z22A 4NE2A 4Q7MB 1XD2B 2ZI9A 3WRYC 5BN3A 4EJSB 1G8YA 2NIPA 3AKEA 2REOA 1TQ4A 1T9HA 2QI9C 1G21E 2FPMA 1II0A 1F60A 4D4LA 2GVDC
chains in the Genus database with same CATH superfamily
3ELBA 4WNCA 1ANKA 4TXLA 1QH8A 4WN9A 2O5CA 2VJBA 1Z62A 2IYWA 3G8BA 3O31A 4QWWA 4WEQA 4X7BA 4X7RA 2AWNA 3ANNA 3SQDA 4S05A 4MS4B 1OXXK 1ZI6A 1F06A 2X41A 3C3BA 1K5PA 4JSTA 4WGFA 3R9WA 5EMKA 1RZVA 3F74A 3IJPA 4O2BF 2PSSA 1XC7A 1T0BA 3SQNA 1NSTA 3ZGXA 1GPBA 5KC9A 3KV3O 1X42A 3SJBA 3LY9A 1Z29A 2R44A 4IX9A 4MW6A 4ZXFA 3THXB 2ZKLA 1EU1A 3TBHA 5HM8A 1G38A 2AE1A 2H4HA 3BCRA 5CP8A 1I6MA 2QA5A 2B4AA 1X9IA 1YR2A 5TARA 1IUKA 4RLFA 3WZLA 5I7WA 3OC6A 3ONEA 4FE3A 2GF9A 2UKDA 4DCGA 4DDVA 2F2TA 3N9IA 1C5KA 1D8AA 2VRCA 1XA4A 3OQOA 5TX7A 2CBZA 2GM5A 2RJ3A 2ZSHA 5E1OA 2E4XA 1T5TA 2D00A 3QYFA 2YZNA 5AO9A 2EFDB 2Y27A 2ZIWB 3AV3A 2OE2A 1NRJB 2FSVA 3RBAA 4BBZA 3FI0A 1L9XA 4E1VA 2KQUA 1W96A 1N2XA 3FHLA 2FEXA 4JBYA 4Q4JB 4LDJA 3X1WA 4KR3A 1E4EA 1U1EA 3HBLA 3NTQA 5A04A 4AN1A 2HA2A 3TGPA 4MLDA 1E6WA 2AN3A 3WL3A 2Y3IA 5TC4A 4Y6GB 5CA0A 3QU4A 3GQVA 3UQYS 3CONA 4F4HA 4F92B 1Y37A 2DHQA 4JKYA 5JS2A 1VB3A 1ZSVA 3BIJA 4J0JA 3PTAA 3BWEA 3PZBA 4YO7A 4BP8A 1A96A 3CJTA 4ES6A 4CLRB 5TRTA 3OQ1A 1SIBE 3UH0A 4E15A 3X2SA 1KEWA 2UUCB 1MRNA 3NAQA 1VGVA 1EUZA 3C6KA 3WBKA 3KQLA 2P9HA 1KH3A 4G67A 3AKYA 3OPXA 3L8ZA 3TW0A 3EPHA 3RAFC 3M2PA 4R01A 4TZKA 5HIMA 5DW3A 3H5IA 3HHPA 4U02A 4HSEA 3W5UA 3A6PC 3P27A 2I62A 2YVUA 2QV7A 2IOHA 2PGNA 5I9LA 3DHNA 2Q99A 4G0WA 5EHGA 4BVBA 2JHGA 2ZRNA 3P0HA 2Q07A 2VDKB 3H1EA 3PFNA 4OQEA 3L6DA 5SICE 1IN8A 2HNAA 4R98A 3W2FA 4NZNA 4MGEA 3A10A 1Y6GA 3IQEA 1LFAA 1CR6A 1ZWLA 4KK4A 1UIMA 4PZAA 1D3AA 2CN1A 4QU5A 4F2GA 5JC1A 1NE7A 2Y6VA 2P0AA 3AUSA 4MQFA 4P7JA 4DXDA 4B82A 3SN6A 1QIIA 3EFBA 3LT2A 2VDLB 4NHEA 2HHJA 4ZD6A 3HVHA 4PSDA 5A5VA 1EHIA 4FMCF 1LTQA 4FOTA 5E4TA 1EK1A 1DAMA 4JL6A 2OXIA 1ZHOA 1T9KA 1QANA 4Y6SA 2P6RA 4JZYA 4WE3A 2QMEA 3PCTA 3K5HA 1E3TA 3WHIA 3VMFA 1KU0A 3K2EA 4EM6A 1XV5A 3NHKA 5BRNA 3O4RA 4K88A 4NOJA 1MJGM 2YHUA 1V5IA 2RGRA 3A8TA 3TDMA 3VKFA 4X20B 3WBFA 1E99A 2WG0A 3N2GB 3R41A 1G6OA 1VIMA 5IM4F 2KYRA 4RQTA 3HR4A 3C4JA 4NTZA 1NDQA 1YDMA 5IC6A 1P5HA 1JIXA 1M83A 2GTIA 3OCVA 3R7LA 3HACA 4GBJA 3GA0A 2A9JA 4TWRA 4KOEC 3WGJA 3WTBA 1Q0PA 5T64A 2O6LA 4RMNA 4PSVA 4X1IA 2XEXA 3ICCA 4WXPA 4Y8VA 5SZKB 3UPTA 3R3VA 4P7FA 1AY0A 3LUAA 3HB1A 2O8FA 4TV9F 5JWRA 2A94A 3L01A 3PNPA 1P0CA 1ZJ5A 2Q1SA 4GMGA 2FPPB 4TL7A 3C48A 3EDOA 1NWHA 3TRIA 5K05A 2BAGA 4OQNA 1E9DA 5H59A 5TMEA 1N8KA 2QRJA 3HYTA 4NULA 5CFRA 1QHEA 3GLFB 1S8OA 4DC1A 3TCKA 4QJ3A 1XGKA 2ZZKA 4K28A 5AI0A 1K0UA 4MI1A 5DNAA 2H1FA 4KSBA 4IHAA 5JFOA 4N4AA 2QPLA 3VDRA 4D9CA 3UW1A 2Q5OA 1RLTA 2IGBA 2AOWA 2Q6TA 2OLKA 3IDOA 3K0FB 3RRJA 5KYYA 1FLAA 3RVQA 2NTEA 2N0SA 1FU4A 4H7KA 2QNIA 2FMHA 3STYA 1E5LA 4LX0A 2P2LA 1ZUD1 3DE2X 3I23A 1YE5A 4X1KA 1IU9A 3LUJA 3P2OA 5ALZA 2OORC 3AHHA 1KC3A 5KKAA 3GEGA 1KY5A 1Z6GA 3R9KA 1RTTA 3OHSX 4LQ4A 2W42A 1SO8A 4CMEC 1UC4B 4LHVA 5K4AA 2OV3A 4Y2YA 3TQFA 2JJ1A 1JG4A 1W49A 3BD9A 1A8IA 1WB9A 4PWYA 2Z6QA 3PJEA 4P2BA 3O6VA 2Q50A 4QASA 5DF1A 5AQEA 4U9IS 3KL4A 1YV9A 2DC1A 2FOIA 4L73A 1LWOA 1EB8A 1F6DA 3EXHA 2PS1A 4POAA 4QQKA 1Y0BA 1N4DA 1Z3IX 3B7PA 4HADA 1A27A 5JSZA 2DSNA 2YWGA 4JBWA 1W87A 1L5ZA 1RXSA 2Q4DA 1BMTA 1OLSB 2G6TA 5TB5A 1FUUA 5B4VA 3D6MA 2IU0A 2GM4A 1SD2A 2ZYIA 4YRQA 3O0TA 3UMSA 1OYWA 1SZCA 1XWWA 5AQ1A 3JR7A 2O3UA 4JVLA 3ZN2A 2G40A 2OCIA 5AIBA 3DAHA 1R3UA 1U98A 4NV3A 3Q88A 4M0EA 3EXFA 5GONA 1CEEA 5HGXA 2AKEA 3G7SA 1ICIA 2V97A 4Y9RA 1UFVA 3NYIA 5A4DA 1AZLA 1S8AA 1FLVA 4Q03A 1U8AA 3KC2A 5TQ0B 5DNCA 2UYGA 5AHWA 2GBLA 1VLHA 2GN2A 4I99A 3PHLA 1LX6A 1G17A 4Y2TA 4BBJA 1G4UR 1DKMA 2GR9A 3MGAA 3W9SA 2X86A 4DDMA 4DT1B 5KNDA 1WBDA 1AE1A 4LJAA 3LX4A 1GP2A 4RK7A 3U7QB 4BO1A 4X65B 3DFKA 1N7GA 4BWGA 2ZVDA 2W6QA 4CWAA 1NYLA 2A0YA 1KI8A 3O3MB 4RKFA 5FD8A 4AN4A 5F3WB 1PV1A 3NGXA 4EECA 2JFVA 1GXSB 2LW7A 1UZMA 2ZXFA 4O08A 1HNZB 4GPAA 3CB4A 4IIJF 2IXEA 2WABA 3GPIA 4N8EA 3NVAA 4RZUA 5TQJA 4UD6A 2PIDA 5IJZA 5BR7A 3LHDA 1L4NA 4GZ6A 1N6PA 5JDIA 4DGQA 5JVDA 5FTLA 1H85A 3U44A 1N1GA 4ZRMA 1JLRA 1A5AB 1GL3A 1WVIA 2GBGA 3HM9A 1ZVQA 3EZ9A 1IY8A 5EWLA 5AHXA 3TRHA 3CLSC 3GYBA 4BGVA 5KNCH 2PUBA 5E95A 4Z2AA 4BMSA 2KM1A 4II3A 3ESBA 2RHMA 3P9KA 3RC9A 4JB8A 3S1AA 2JKZA 2BGWA 3VC3A 4BMVA 5B6IA 3OP4A 1Q0UA 2IXBA 4EFLA 3FOZA 3LPCA 4DLUA 1AX9A 4OFWA 2QPTA 3A37A 3E7PA 3V46A 1GL7A 3FUUA 4E5PA 4AQDA 4GKAA 4QUDA 2JFQA 3H2KA 1N9GA 4LNHA 1K9SA 1ZBQA 3MAJA 3GGDA 4B3RB 1C8VB 1E58A 3HP4A 2QTHA 2VBFA 1XXHA 3T5MA 4ZHSA 5SY4A 4F9TA 1X87A 4QBTA 1USGA 2VSFA 1FCJA 1PE0A 3AKCA 2C7VA 3CS3A 3DOCA 4DMRA 4MEAA 3T6KA 1R50A 3N0WA 1Q7CA 1RAIA 4F9GA 4O0LA 2AMJA 1FYVA 2E4YA 1JBKA 1C4XA 2WSYB 4BMZA 4BNIA 4DW8A 1O57A 2I99A 2QTZA 5EIOA 3IP9A 4LHWA 3MJVA 2ZB8A 5M34A 5LCXA 2YMLA 3BAFA 2JDIA 1EFVB 3BFJA 2IBMA 4E4TA 3H5TA 3WLLA 5E9QA 2Z6UA 4LRWA 4GKKB 1C2YA 3DMNA 3FCUB 5FWDA 3QI7A 3N8NA 2F1IA 4BATA 2BHLA 4QUHA 4MLCA 4IV8A 2G08A 2MDTA 2O8DA 3DV9A 1ZP6A 1P1HA 3WGTA 2Z8XA 1II8B 4GZ3A 2Q8PA 4LE1A 1KZHA 2XHEA 2RH9B 3BDVA 3EVAA 5NULA 1V11A 4O4IA 1W36D 5FLKA 4ZT7A 2HT6A 1YBVA 4ZVSA 3IE1A 1EVJA 1DAEA 4TS1A 1MD9A 2G8NA 1BG6A 1H2AS 4X1YB 2NXJA 1MC1A 3V4ZA 1PKEA 1N0UA 1HR0B 5FLXA 1O08A 2C9YA 3STVA 3ZD9A 3FVVA 2VZLA 1A9XB 2FWBA 4UAGA 4PZUA 1ECBA 3F3YA 2UVPA 3VR0A 4QDJA 2H6EA 3B60A 3N05A 2PWPA 4X45A 4EB6B 3KE8A 1I3CA 1XCOA 2B4TO 1ORIA 4KXMA 2WFZA 4H3SA 3FSGD 1EDEA 4KC0A 4OJQA 4V0NA 3KT3A 3TOSA 5CDGA 2ZTHA 3O4VA 3LU1A 1T6BY 1NY6A 2ZPAA 3L6OO 3P2IA 5AI6A 4CHTA 3S40A 2BEVB 2Y1LA 1JJ7A 1SIUA 3SJZA 4JENA 1Z34A 4MUFA 1TU0A 4AZ3A 4D3DA 4F21A 5K8VA 3FIUA 1KWGA 4X60A 3RSFA 5EE9A 3ZU2A 5IAAA 1YRAA 4PBRA 3V5NA 2J41A 1OUMA 1ADGA 3KQWA 3VO2A 4LPSA 4IEFB 3WB2A 3OEED 4PAMA 1OZHA 3IUEA 1ODFA 2DUJA 3CUYA 2Y1EA 4XQCA 1V1MB 2PU5A 2RIPA 5DZSA 4XARA 1H2WA 1RWPA 2D74A 1QR2A 1SXJD 5FRDA 3KSUA 2QYTA 3H75A 4GX1A 3OJFA 5ED4A 1AQUA 1UJ2A 3DP9A 4I1RA 3NIBA 1ZPDA 1E3SA 1OD6A 3EFOB 3R3YA 4DADA 4YPVA 1O96B 2I22A 4YCNA 4MUGA 4IDNA 2HD4A 4KPUA 3CX3A 4OA5A 5FUVA 1KHHA 3PRJA 1YHNA 1Z7BA 3T41A 2I91A 1JFLA 1M1YE 6YASA 3AR3A 3KPJA 5JNVA 2JFFA 3HLYA 3E1GA 3LOUA 2VXCA 1E0DA 4J91A 2OYCA 3WWZA 1Y5LA 3NBFA 5EE3A 3JPYA 3SK0A 2IXFA 5E4FA 3W8RA 4RKQA 4BBAA 5A4AA 3TPCA 4GOMD 3W5IA 1VHLA 2QGFA 1BTOA 4UEJA 4DIFA 3GFQA 1KZ1A 3L02A 1HOXA 5EYPA 1ODSA 1HSZA 4HH4A 1VDMA 4KQ6A 2W48A 2ZZNA 2R66A 3R09A 3Q3CA 1KQPA 5F5XA 2FVYA 1KDTA 4PLHA 4MKHA 3BWDD 1S1CA 4XWOA 3HN2A 2QTVB 1XZBA 1PIWA 3DM5A 1C0PA 4B4OA 4P4NA 1D2RA 2VA9A 1E3MA 2XY4A 2QT9A 2I4LA 3GROA 2KSQA 3WKAA 3CZ4A 4HLNA 3TZBA 4OATA 3F2IA 4L74A 5DX1A 5A4MS 3EVFA 1IBKB 5LP6A 1FEZA 3L8CA 2JJYA 4ENRA 1US8B 2C1XA 1TLTA 3ED5A 4M9ZA 1RYFA 3SHFA 5A03A 1DC8A 3Q6IA 1XCPA 3H16A 4JI2B 3VTZA 3ZIUA 2FA9A 3AF1A 4MP6A 1YH3A 1PEKE 2FN4A 3T4EA 4EFNA 3BXOA 4QGHA 2Q5JA 4FOSA 3CE9A 1A9QA 1R9GA 3BHNA 1YIDA 5J9FA 4J43A 5GAJA 1WP4A 2B1RA 3L0CA 4AO8A 4DUYB 2E9SA 4M88A 2J6BA 2B3DA 2DUNA 2PE5A 2I4NA 3IVMA 3K5WA 4EQ6A 1CF9A 5D5PA 4IGKA 1UBJS 4G89A 2NXCA 3I04M 4HAOA 4OB8A 4XRRA 2GA9A 4LZNA 4R1SA 4UBKA 1VBKA 2ZULA 4KNVA 3BIXA 1OLOA 2ZUEA 3QFHA 3OPVA 5DHUA 2D1FA 3DBHA 5HS4A 1XQ6A 3QX9A 3TEJA 1US8A 2NO0A 1E2GA 2Y1KA 3IXLA 4HOYA 3Q7QA 2XH8A 2H1VA 4PQGA 2IDKA 3HB4X 2F55A 4XB6B 2PY6A 2ZS9A 1JDBC 3RKSA 3UT5A 4A16A 4NJMB 1Z4LA 5KYVA 2KW5A 1R64A 3OZFA 1F6WA 5D2CA 2I6FA 3ROFA 3UGQA 2X9NA 3KPWA 4QPCA 4WY8A 2I6GA 3GFTA 4NE9A 4HNVA 1YE8A 2BFBB 3UV7A 3ND6A 1JLHA 2BEWB 4Z0HO 1F8GA 3K2QA 4KTTE 2W4IA 3SE0A 1A9SA 2H3HA 3O3CA 1RJEA 5AJZA 3L93A 4EYEA 5KVSA 1XF9A 4MDFA 4IVQA 3DH0A 2F4VB 4YRTA 5TF0A 3GFFA 3U1VA 1E6KA 4RK4A 4HRAA 1Q2UA 2AXQA 3EA4A 4M21A 1RWMA 1SXHA 3PXAA 4LHZA 5F1OA 3C2QA 1PK7A 1QRTA 3Q7SA 3F1LA 4HAUA 1Z06A 5G4KB 1CVLA 1Q84A 5I8PA 3REQB 1M6VB 1SNYA 3E1KA 2NU8A 1JHOA 3LUHA 3PGKA 3GLHE 1J7JA 2OAQ1 1N2IA 5DYWA 2XDQB 2K4MA 3WY9A 1RWNA 5G3ZA 4E11A 3VR1A 4PSUA 2X77A 2H7YA 3LZDA 4ZJUA 1HBJA 4FP9A 4EHNA 4PX5A 1PAUA 2GF0A 1R7RA 1U7ZA 2VK1A 3KAKA 4KIFA 4G1CA 4ZI7F 5KTYA 1Y6FA 2BJVA 2WKRA 3GQBB 2B1IA 2QYSA 2X0RA 5ESDA 5I7SA 5KQLA 3U4QB 2B4QA 1JEYB 4J76A 3DAPA 3HXKA 1O5TA 2ZWPA 4IY1A 2MJLA 4GI2A 3WNDA 2YWDA 3PBKA 5HR5A 3ETEA 5DEOA 2AOUB 3LVBA 1GNPA 4QBIA 3KTAB 3VQTA 2QTLA 4YRFA 3H1TA 1GTL1 3G0GA 4F4UA 2FPSA 4EZBA 4B71A 3MS4A 1PFGA 3HP7A 1QP8A 4KUEA 1NUSA 4GVPA 3ZE1B 3R8FA 3GX1A 5GVRA 3GZNA 5HJ7A 3F73A 4LGVA 1H2BA 4RF4A 1Q12A 3SLGA 2VJOA 3F5MA 2D2FA 4D8YA 2WWGA 3EXEB 1VMDA 2ZCVA 1FDOA 3QNMA 5ILQA 4BGIA 3CEHA 4BNWA 5BUQA 7MDHA 1CRWG 2NZYA 4NIMA 3D9QX 2V7WA 3RBXA 1VE7A 1TVCA 4MV6A 1ZJ6A 4ZQFA 5BV7A 1M34E 1XLUA 5D3MB 5M5BA 3HLTA 3OEHD 1O0CA 4I9NA 3V2HA 3IPAA 1RHRA 2J4FA 4IXDA 3AEUB 3DFUA 2PBLA 2WQZA 1IN4A 1KZYC 2CNKA 2ODQA 2DFNA 4JX9A 3AC0A 3MJRA 5ALFA 3IE0A 2B0CA 2VF5X 3OTOB 3P0IA 5JAOA 1LSUA 3I5XA 3OH8A 4B79A 4OTZA 1G7SA 2I6TA 1MXFA 2YJ4A 3JD3A 5DRYA 4CIVA 1RYYA 3A70A 4P54A 5JMTA 1Y42X 3KUUA 1BU8A 3N2ZB 1OBHA 3A4TA 1E7WA 2ZIVB 1G8JA 3NEAA 5MFZA 4F3KA 3E3MA 5LQRA 4ZJYA 2CJPA 2XE7A 4MB6A 2ZBGA 3S55A 1A76A 1PBNA 1WUKS 3VZPA 5SYMA 3WQBA 1P73A 2VP6A 4MVXA 1VI2A 1YASA 2PA3A 2IS2A 4YUWA 1LTKA 3VH3A 3QVKA 4A23A 5FAKA 5JJBA 3DM9B 1GGNA 2XUFA 1U6JA 3R8CA 2JH3A 3E4DA 3ID6C 3S68A 2QEQA 5JQGF 1O8BA 4H6VA 1SUDA 4JKIA 4RVUA 2I29A 1MJFA 1CNMA 1UK6A 3JZDA 3JVIA 4YR7A 2WJZB 4IV0A 4J9VA 4MUEA 1QO9A 1AF4A 1LXCA 3MBOA 2MCFA 3V55A 2IYEA 5B4TA 1WAMA 4W7IA 1I8TA 3QEOA 2Q3DA 3I5MA 4EUEA 3PB3A 1ZNXA 1JFRA 3KJHA 1M67A 5FULA 4YJHB 3KEOA 2A1UB 4ZCMA 2X58A 3FOEC 1KHTA 5EWMA 3P71T 4PSCA 5JISA 2V65A 3EIQA 2KLHA 4V0LA 3PCRB 2R7KA 5BOSB 4CKEB 1JSLA 1KRXA 5DTJA 1X38A 5BSFA 3WO0A 3TOCA 3C3XA 1W88A 3DZBA 4MRSA 1GSAA 3BF7A 3W2IA 4CM4A 1A9OA 4O29A 5WRFA 4E94A 3L8GA 1M6HA 1AB5A 3K32A 2GZHA 3CGWA 2O2ZA 3JQPA 2F59A 2WR8A 4C6RA 4DG9A 3ZIAA 4BP9A 3EIUA 8MHTA 4IQ0A 3MCAA 3RS4A 3PGVA 2YR0A 6ABPA 4JVSB 3FDIA 4Q3NA 4QTTB 1M6NA 1EAYA 1NVBA 1ZK2A 2P7HA 2ERYA 1NLZA 2HFJA 4EATA 2GVNA 3CRZA 4I6JA 4CCYB 1JALA 2QT0A 4MVJM 4MUNA 3F4KA 4HWKA 4M9UA 1KJJA 7ADHA 3ZWCA 2OOSA 2CFCA 1C1HA 5CH5A 4CQMD 4S12A 4XFJA 2V0NA 4KQHA 4ZTBA 1U3CA 2HMYB 2Q0SA 2TS1A 1ZL0A 1X7ZB 3QXJA 1GN9A 1WO8A 2GZRA 3DKVA 2SNIE 2P9GA 3JALA 3IMGA 3FHJA 4NEGA 2QLTA 3F0TA 4UMVA 3IEPA 4JEIA 1ETHA 1AGYA 1KP9A 2OCAA 2BKVA 3UWDA 1BC5A 1F3OA 4H7FA 2AL7A 3ZHZA 5FJIA 1AB6A 1M72A 4UHEA 3Q2OA 3QLEA 2P40A 2RK4A 3F47A 1X19A 1EBUA 3AM1A 4B8WA 3HC7A 1L4YA 2P9BA 4CM1A 2CD7A 4ZVNA 4Y0AA 1TKCA 2G07A 1GOTA 3HYCA 3PGJA 2HRCA 1NBIA 4LY6A 1K5GA 1C9MA 2AF3C 3W06A 1P75A 2BSAA 2BISA 2YJ6A 3E4CA 4IOJA 4P1ZA 3BMNB 5CAEB 1M1YB 4A1FA 2VF7A 3W2EA 1JLMA 1U2QA 2EHDA 4GKJB 2YXBA 1O97D 1C0LA 1Y89A 1AS0A 2I78A 2P8SA 1PUJA 2PT7A 5ALUA 3VHRA 3C16C 2P2ZA 1FFXB 2Y2VA 1BH2A 4JLWA 2H1WA 4ENVA 1T4DA 2I66A 3U7QA 2V7TA 1YQDA 1XZPA 3F7NA 1CUDA 2ZE5A 3F67A 1C9KA 3ED1A 4OQMA 2H2WA 5GOTA 4D9KA 1BSVA 4A6DA 4EB8A 3C39A 5LN1A 1NN5A 2BKUA 2GZMA 3EXG1 5JCOC 2BVNA 2FW0A 1UC8A 1H05A 1SC4A 1DRVA 1ODKA 1T1IA 1W9HA 3QFCA 3R6TA 5JSYA 4BVAA 4DUGA 3B6MA 4JEMA 4TLEA 3V4OA 1U28C 1O94A 1YONA 1GILA 2PKXA 4N03A 4RK1A 4B4KA 2CNLA 1Z7YA 1CVIA 3I9OA 4NESA 3U44B 3GRFA 1BW9A 3WBJA 2ZRCA 4FGZA 2WA1A 1Q1EA 4F85A 4NENA 1JG7A 2IE0A 2Q2OA 1E1YA 3FVWA 4J29A 4NCNA 5JXGA 3MIIA 3FCAA 1V7CA 3H6KA 4IF6A 4G4SO 3D5EA 3N6RA 5C80A 3AJ8A 3CJRA 3LZ6A 1Y3HA 5BSKA 2WIAA 3TM4A 1E3EA 1QNFA 4IDBA 2XMBA 3FKSA 1NP7A 2GAJA 2Z9DA 5CH8A 3VJLA 6ADHA 5CD1A 1CZNA 3IAXA 4JAVC 1MB2A 2CVFA 3F3KA 4X61A 2PAAA 2PQ2A 3NANA 4QRHA 1RYNA 4AYTA 4DNQA 2NAFA 2XB9A 4RVFA 5DLEA 2PH3A 3S2EA 3DMDA 4NZ9A 4FX5A 2VBCA 1JH9A 4RD0A 4FPXA 4BE7B 4HNQA 1T5LA 2X0KA 2PZAA 2EP7A 3O8LA 3IFSA 4KQJA 4HX2A 3HCDA 3M3PA 4IGIA 4R7GA 4DARA 2FMTA 5KYXA 5C8YA 4WRRA 1CSEE 1PJRA 2LPMA 3QIAA 1PS8A 4DBLE 4K9RA 3D6AA 2VDRB 2COKA 4JGIA 4QXPA 4YCJA 1R0YA 2X5OA 4AZVA 1ZH4A 1WETA 4WXYB 5BSHA 4WZAA 4G24A 1ZCJA 2ZAIA 4YRJA 7REQB 1RCUA 3DB2A 1R4ZA 1CUXA 3TNDA 4Y1FA 2ETXA 3K1AA 4NBRA 4WACA 3Q9NA 4BV8A 1ECFA 3IT3A 4GR4A 4DIBA 1IZYA 1KEZA 3H0CA 4XIGS 2QW1A 3INYA 1NQVA 3T7SA 5DNVA 3MTAA 4DR1B 2DWQA 5EZYA 3F9CA 4UXHA 3LBYA 4HF7A 5DM0A 4D25A 4ZICA 1X1TA 3I1YA 5TE9A 2JVKA 5IJ0A 2ODPA 4LOHA 4RYDA 1ECCA 1JMVA 1EQUA 3RSCA 1K98A 1PTJC 3ZZ1A 3FYTA 5AW9A 1Y9AA 3PI6A 2R97A 3ROZA 2J9XB 3ANSA 3DUWA 3QOWA 1M0SA 3ITEA 3L1HA 4CV1A 4Q4CA 4P98A 3S1LA 2P4UA 1DAKA 1VL2A 1NNEA 1AUQA 4OI1A 1CQPA 4G8JA 1XJQA 1ZBDA 1QYWA 1G8MA 2X42A 5H02A 1OFGA 1K97A 5JEDA 1T6XA 3G2IA 1L7OA 3U40A 3ABOB 2WY2D 2JG3A 4JA2A 5J4KA 3MINB 3OKCA 1R4AA 3NM4A 2P9YA 1RPTA 4G25A 3X1MA 2MSNA 3HMQA 1YJXA 1OC2A 5HUQA 5ITZB 1E32A 3CLTD 1Z6XA 5LLTA 3OAAA 5K3SA 4WTOA 4UAJA 5JATA 5ECYA 1FXWF 2PN1A 3DQZA 1CKEA 4O8CA 5FOQA 2ZI3A 4OHXA 2C5AA 3VDNB 3ZBTA 3ZH2A 1H0RA 4LXUA 2GBFA 1ZXBA 1IXRC 3OZVA 3WQSB 1I5RA 1QIJA 1YHYA 2V98A 2VRBA 5FFNA 3PD7A 4CKZA 5DLYA 4BV3A 5C2JB 3ZDBA 1XEXA 2I4TA 3OWOA 3EMVA 3T3PB 5IJ9B 2VEOA 4JFRA 3IUPA 3LUCA 1XI2A 1VTKA 5ALIA 3OQPA 1FTGA 3GARA 5AK3A 1CS0B 2Y4OA 2JGMA 3NBUA 2QLLA 4TX1A 5FI0B 4NJEA 2B20A 1R16A 1HT2E 1QS0B 4W1RA 3ZHYA 3GUUA 4I5FA 4BLRA 5ES4B 3DL0A 5EJMA 4F1WA 2D2XA 3B52X 1HO3A 2IEZA 1I6LA 1Q77A 3TIFA 4PYJA 3NBKA 3IPRA 2EFHB 1HTBA 1IDOA 3HU1A 4F2PA 1WUIS 3OZBA 1PQPA 2OGUA 1LCIA 2QRNA 3O94A 2W43A 1KZ7B 2IEGA 1JMYA 3N8DA 4HX5A 2HCRA 1LJUA 5FHQA 4ETIA 3QVGA 2FWMX 3GJSA 1X15A 1NKVA 4R2HA 4AECA 3W05A 4HUQA 4TM7A 3T4PA 4P80A 2WNHA 1NUPA 1XX6A 3FSEA 4L7QA 5FUXA 1ST3A 1M2FA 4AP5A 4AZ0A 5FUWA 1QZUA 3I9LA 4OXQA 3SZGA 5KNBH 1NPTO 1ZY2A 3RCBA 1YF3A 2G83A 3D8BA 1HQYE 1U5BB 3BE5A 4ILEA 3EEOA 2AZXA 1Q6YA 2HIHA 5KI6A 4QDXA 3ROGA 3CRW1 3AVPA 1GTMA 2I34A 1Q83A 1EFAA 2C0CA 3KV1A 5J63A 1BH6A 3EQ7A 1YJQA 1NU8A 1HLDA 3TQIA 1FMFA 5H81A 2JZCA 4YDSA 2C4TA 1MV5A 1CS4C 3V7NA 4BAUA 2EZTA 3E9NA 3LUKA 2WBLC 1J8VA 2HM7A 1KO7A 4K9OA 3IJRA 2HFKA 2BM8A 2WOJA 1EVEA 3BKXA 3QE2A 5CB4F 4HNTA 3FHTA 2JLVA 1OW3B 1Z0UA 3EMKA 1W4BA 2ON6A 1FQOA 4PV7A 3PQ7A 3I2FA 4OPMA 4MYHA 1TKBA 4MIEA 1Q1GA 2DKFA 4C05A 1AJEA 3WHLA 1W5BA 1CQJA 2I71A 2O05A 3HXTA 4HYEA 1SK9A 3NS7A 3A3KA 3TZEA 4BFSA 4XR4A 2WYIA 5ETJA 4D9FA 1R4MA 3A4MA 4LKRA 4YP0A 1LS6A 1LVGA 2Q9CA 4Q9JA 4FOOA 1QQ5A 1IB0A 4GLOA 1W0JA 4IQ4A 4TSFD 3E3LA 1SUIA 5CT5A 3QYPA 3PC2A 4QDTA 3STTA 3QEJA 2PHZA 4DM7A 1XXLA 2RI1A 4GWLA 1POWA 1GPYA 3B3QA 4R1PA 2ZIXA 1GFSA 3VOSA 3EW9A 4A10A 1AKRA 1C8KA 1E62A 1NUQA 2IEAA 4M36A 3TTXA 4M8KA 5ITZA 5KJ1A 2IS6A 1PJZA 1XO1A 2JARA 2Q4BA 3QHAA 3HL4A 4M98A 4LF5B 1KRWA 2G4VA 1VE5A 2Z2IA 2VUIB 1TEVA 3EUFA 4I2VA 1FP4B 4TMKA 2H63A 5I51A 4GDMA 1XTUA 5KCZA 1N5OX 4I1IA 4QECA 2Q2NA 4QYWA 5E9AA 2Q1TA 2XGMA 3DF9A 3NC4A 5K8CA 2P5TB 4JB0A 5IASA 2HPZA 5JYDA 3DZKA 1H4VB 1YNSA 1T2AA 2C5FA 2HA3A 3UNXA 1S5PA 2ORIA 4J07A 1PQWA 1NXVA 1JUDA 3IA2A 3OY2A 3DZHA 1H3EA 3F3SA 3CA8A 3PC6A 5K6AA 1P81A 1UIRA 1P1BA 2G71A 3SYRA 4NCAA 2NV2B 5E1DA 1E5VA 3GLIA 3A26A 3KZCA 5L8VA 4PLWA 3DC7A 3QG1A 1GTJ1 1J8YF 1FRNA 3HFSA 1MJ5A 1XMOB 1H2XA 4FBGA 1HGXA 3DJYA 2ZVPX 1P7VA 1REQA 3H2ZA 2XLCA 1I1OA 4QYXA 1N2CE 4CT4B 4DAOA 4Q9AA 3TUZC 2IH4A 4JYPA 3ZHXA 1EWVA 1NJ1A 4MW1A 4I14A 5J2TA 2BHSA 1MJGA 1SBTA 4H3HB 2G1JA 1EA5A 1W59A 4NKRA 4UCQA 2IH2A 4R6XA 2O4CA 4WCFC 5C81A 3FDJA 3HG7A 2GRJA 4IDPA 3GC6A 4N82A 3C6YA 2EDCA 4JU8A 3RUEA 2RH5A 3HVRA 3AJEA 4Q93A 2FVXA 3G68A 5JBNA 4FYVA 3PYLA 5F51A 3H5LA 2P77A 3OFJA 1YUBA 3QE0A 4L6AA 3TF5A 4C20A 4ZOLB 3O3NB 1HYGA 3IT2A 4X6XA 1O5OA 5KAPA 1BN6A 3G5TA 4GD3Q 4D26A 1JJIA 1JRLA 5CU7A 4EGAA 1BXKA 4UVHA 3HCBA 4OQDA 4MKIA 1ZI9A 4P82A 3RFXA 3ZHSA 5JADA 4CCAA 2F9FA 4EJSC 3C5HA 3KKZA 1XD8A 4JYMA 3RH0A 2QTAA 1U8EA 2VPYA 4IDOA 1C8BA 5EKXA 2P67A 1O4VA 3W3ZB 4UMDA 1PZHA 1ONNA 3URKA 4MGYR 4RXMA 1M0WA 3IIMA 4TYNA 1TAHA 3GLUA 2WK1A 3O9ZA 2IUYA 5HKKD 3IUQA 2JL1A 2QRVB 3EQ8A 4UVEA 3L6BA 2KX7A 3O8RA 3F5FA 5AVRA 4HLDA 1ZJYA 4F93B 4UU7A 2IW3A 1T5HX 3ETDA 3F5DA 2BM0A 3ASYA 4FI3F 3RS0A 2FRXA 5KU7A 3J7AC 3DKRA 4W8HA 1E2BA 5D5HA 3FLMA 5TS2A 4DIDA 1PV2A 1S3SA 2QORA 2V3VA 3JVUA 3DBIA 4WZBA 4XSGA 2D1SA 3T95A 4K7JA 1CHNA 1BDJA 3MSCA 4N0PA 4UBOA 4YJFA 2EBHX 1KVQA 4D45A 1ZK3A 1Z4PX 1GQYA 1K68A 1ULZA 2EBUA 3GV0A 2EFJA 2GK4A 3DL7A 4CDMA 2PTGA 4N54A 2UZAA 4ZOBA 4C7VA 1I3NA 3CUWA 3E58A 2YVKA 3IJEB 4PF1A 1E3IA 3WL5A 2FFAA 3SXJA 4EA9A 3THWB 2OGZA 1TMYA 1Y9EA 3HU3A 3LWBA 4V39A 4HQ6A 2DHRA 3ZXXA 1U8ZA 5LOVF 4I1VA 3BEOA 3AG6A 3DL4A 2CFTA 1GZSA 3OD5A 1DGQA 2GNOA 1MC4A 2G8LA 2GN6A 4YRBA 1S01A 3DCNA 1WSBA 1N0IA 4Y6PA 4RA9A 3D4BA 3GLHA 3PF9A 4BXOB 4ICIA 4JXXA 1K7EB 3JCZA 4IX1A 1JXOA 2VDWA 5HCIA 1PR5A 3K70D 3C3MA 3HFGA 3S44A 5FO1A 4E0BA 3TTWA 2P9FA 2QAIA 3RR2A 3F6PA 3K1JA 2CLCX 4MV8A 1KGDA 4OIMA 2NU9B 4WADA 1QBKC 1IDN1 1OGIA 1OZFA 2VH1A 3IQWA 3M6IA 1TZJA 4WN3A 4E4YA 2Z1NA 1GQOA 3DEIA 3LLMA 3OZSA 4MWZA 1MFPA 2OXRA 5KTTA 5CURA 3TRJA 1IN1A 2GHIA 3USES 2H65A 1FNNA 3BTOA 4QUIA 1FVHA 3FRIA 4MS3A 1EJ0A 4BO3A 2P65A 3IP5A 4CDNA 5C1DA 4D98A 2JIZD 4I3FA 3G5AA 4BC0A 4DA9A 3ZJTA 5CDUA 2PZGA 5JSQA 3VPXA 3Q98A 2TMDA 3HCNA 3THOA 3FBWA 2PT6A 4A0RA 1CLEA 2ZSDA 4YWJA 3FNHA 1NZDA 3E27A 1ZN2A 2QN1A 2OUIA 3GN1A 4UHJA 2NU6B 1E69A 3OMXA 3QKRB 4DSZA 1S3GA 1H1LB 2B69A 3WLMA 2HIAA 3K8OE 1TD1A 4NPAA 4PSAA 4MUXA 2YUTA 3H11A 3CN7A 4WLUA 4C4XA 5HTOA 1Q14A 3SVLA 1UKZA 4JLKA 5ALRA 5KVCA 4PE5B 2HDNB 4J90A 4GX2A 4L50A 3WK9A 5A4IS 4DA4A 1QRDA 1P2SA 4GC9A 2R4QA 1J5EB 4DBZA 5D87A 3AXTA 3B1FA 3ZHBA 1U7DA 5FYQA 1Y4ZA 3VOAA 5BPHA 5IVKA 4U2GA 4EY4A 4QGFA 4B6JA 3RK1A 1CJSA 3AB7A 3CPJB 4LI0A 3SC6A 1LBSA 4BNDB 4CUJA 4EI2A 4A92A 4CTNA 2JIOA 2XYQA 3ZVLA 4KNYA 2WILA 3WLAA 2J0SA 3C1AA 2HH9A 3GAZA 2W6NA 4GGPA 4H6PA 1YWGO 2TECE 5JLAA 2ISCA 3TDNA 3W5JA 3KWFA 3EYAA 3G59A 2EARA 4LHXA 2C83A 1W581 1RD4A 3BWYA 3FNIA 3ZW7A 1ZUWA 2DBQA 2IU4A 3QIVA 4ASUA 1RKQA 4BO9A 4LC9A 2FJPA 5LM3A 1SUEA 4HDSB 1P74A 2VP2A 1Q16A 5DYTA 2QOEA 2DUUA 2WUFA 2GEDA 1FXSA 3OLCX 1XNRB 2YHAA 3VJRA 1ZINA 1Y1TA 4N9WA 1BDMA 3SS9X 1G59A 5ECDA 4C5CA 5KQMA 2ZUFA 4QYSA 3EY4A 1SVNA 1T34A 1ZGGA 3G6WA 5LQCA 2JAPA 4MGZR 4AJJA 4OH1A 3HYNA 2C94A 2DKOA 4HAVA 2B30A 3HZHA 4OHWA 2V7PA 1DQSA 1JFFB 5COBA 2HMAA 4OYRA 4KTVE 3KJFA 3SBDA 2RFLA 5AW0A 2QQ0A 4KWHA 4K6HA 4TLBA 4CLOA 4KE9A 2PSFA 4JIGA 1YKSA 4KZPA 3NJ8A 1Q95A 3SF0A 1NZFA 1TJ4A 3SS8A 3A9TA 2W0SA 4GBED 4K26A 4NZPA 3P1JA 4H6WA 3OC0A 4KI0A 3QP9A 1RKXA 3EXAA