4IFBA

Crystal structure of sult 2a1 llgg mutant with paps
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
274
Chain Sequence
b'SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bile salt sulfotransferase
publication title Sulfotransferase Selectivity at the Molecular level
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ifbA00
1UBCA 4JL6A 2JLWA 3KKNA 4A2PA 4M9ZA 4E07A 1RJ9A 2P5SA 1N3BA 2AXPA 3L0OA 2W2TA 2D06A 3KTAA 1DVRA 5EZ6B 1COWA 2NO6A 5TVKA 4KFSA 3TVTA 5L3SB 1Z6TA 4KFTA 3GLIE 5E95A 1JJVA 2C9YA 1EFHA 2OFXA 5CIWA 1KJWA 2ZI7A 5TDHA 4HAXA 1AS0A 3FYHA 3GJ6A 1PZNA 2F3TA 2DFLA 3C5HA 3BIFA 1OH6A 1PV4A 4RFSA 1N5JA 4PO9A 3EWAA 5BN5A 1NVXQ 1YVDA 3VR3A 2A5GA 3B60A 1RZ3A 4IHQA 3PUYA 1TUEA 4D0GA 4US1R 3O47A 5FPHA 4P4UA 4Q5IA 3SJCA 2JJ8A 3OIUA 1QVAA 2VQSA 1HYQA 3KJGA 2JLSA 3L0SA 1Y3AA 5FTJA 4PANA 4ABYA 4KYUA 4NKRA 5AUNB 1QZXA 2OE2A 1JR3D 4LHWA 4BLPA 4XWKA 3OIYA 2ZM5A 2ZXUA 1H8HA 3CKLA 5FFMA 4DIEA 1KO8A 4U5XA 1HV8A 1T3LA 1KHTA 3MFYA 3ADBA 4EPWA 1M74A 2ZAOA 2R62A 3EA0A 3EZ9A 4JBYA 2ZE6A 3CRVA 4MYHA 4PO1A 3B9QA 2XOKA 3C4JA 2WSSD 4FWIB 3KQUA 2QTVB 3KTAB 4HEJA 1IONA 1G9XA 4NYJR 4IOKA 2OILA 3QG5A 4P32A 1YZNA 2WM9B 4N0DA 3KZ1E 2JLQA 5H68A 5FTNA 1FX0A 1A4RA 1MV5A 3CBQA 4MRPA 4Q00A 3RS7A 4ARZA 5DHFA 2R6AA 4CYMA 2J0SA 2J41A 4B73A 2C9OA 4V0OA 1NF3A 3IUYA 3LBIA 4KAXA 1G17A 2BM0A 1ZD8A 5JHGB 4AYXA 3A1VA 3RDPA 1LW7A 4MYCA 3KKQA 5DSZA 4MDFA 5FR2A 1KIMA 1Q57A 1XCPA 1GG2A 2GVZC 1YZQA 3H0KA 4PSAA 4OJQA 3KJHA 4OQMA 2OAQ1 1K5DA 1II8A 1OHHA 1U9IA 3RRNA 2H92A 4OYHA 4FMCF 1GNQA 2D7DA 4Q18A 3NHAA 5FI0B 1ZJ6A 3N5CA 3OE7A 3BRWD 2C5LA 1AZSC 3GLFE 2FSHA 5FPTA 4GP6A 2J59A 5HCIA 2IT1A 1ZCBA 1XNJA 4DLSA 4PSKA 4ESHA 4M1SA 4A8JA 3I72A 3FMPB 2ZRIA 2OEPA 1FQJA 2FGJA 3GCGA 3L43A 4IDNA 3MD0A 2J1LA 3SYNA 3TMKA 3I92A 2GF0A 4IKEA 1SKQA 2IUSA 2A7QA 4BPBA 2WWGA 1XJ0A 3SHWA 4DT1A 2KB0A 1FX0B 1DS6A 3QPUA 2PZGA 4ARZB 2H7VA 3FPAA 3ZS9A 1G291 3AF2A 3FHCB 4B6EA 5HCNA 2GJSA 4Q19A 4DLUA 1ESNA 1CR1A 1GL9B 3CRW1 1X1RA 4FMBB 5D3QA 2NO0A 2G1KA 1KTVA 1RRGA 2IUTA 4JT4A 1SVKA 2HT6A 2NIPA 4D80A 4TYWA 2VBCA 1S9HA 4QBIA 1MO4A 2W00A 1VYVA 3EZ2A 2CE2X 2IXGA 2KBFA 4RD1A 4UKDA 5IDVA 4ERNA 4GL2A 3CRQA 3ETLA 5AK0A 1UFQA 5BW8A 1L4UA 3QJYA 5EP1A 3WMEA 3AVPA 1I4TD 1CR0A 3NC1C 2P67A 4ZIRB 4Z1MA 4B3FX 5J4HA 1EWRA 2ZU0C 3CNLA 3RNLA 4P4SA 3ADCA 1F2TB 1T4GA 3GFTA 1OHHD 4AG5A 3QOFA 3JZAA 4FIDA 3T15A 3R8FA 4K46A 4KVGA 3KFXA 3WRYC 4Z51A 3GFOA 3RRMA 4V0MA 1S8FA 1U0LA 4TMXA 4A8JB 5KPJA 3O8BA 3GLGA 3A4NA 3OAAA 3OE7D 1G7CA 2QRNA 3U7FB 1TF5A 4NCIA 3SFVA 1ANKA 4KBFA 3NC0C 3Q7QA 2YC2C 4Q1AA 3LXXA 5JFGA 1U98A 1SHKA 5KO2A 4NDZA 3I8XA 1Z2CA 2CE7A 1M2OB 3NTUA 2YOFA 3U7HB 4IOLA 3HR8A 4AY2A 1E1QA 2QUZA 3KKPA 4Q1BA 1E32A 3SNHA 1KK2A 3V4FA 3LFUA 1VG0B 4URXR 1OIVA 4XTCS 1P2VA 2BKUA 1R0XA 2OXCA 3HP1A 3LDAA 2VHQA 2CHQA 4DLWA 1G6HA 4TTQA 1M7BA 4MUBA 3HU2A 4PQFA 2C8VA 1ZNZA 1O3YA 1F60A 4FMDF 2W6JA 2OFWA 4LJ6A 2NTYC 3BFXA 2P65A 4DSNA 3RS5A 2A5DA 3V9PA 1XJQA 2JLXA 3ICQB 3LX5A 5EE0A 5GVRA 4MRNA 2XSZA 1XMSA 4JL5A 3GEIA 1BMFA 1GRNA 1YZGA 2F3RA 3L8YA 2DY1A 3GLHE 4XVUA 1RFLA 4P4SB 3ADKA 2CNWA 2ZRBA 5FOUA 1E2QA 4Q9JA 4HZIA 4P33A 4NYJQ 4TL6A 1XXHE 4KLNA 4BFXA 4PQYA 4YC7A 4DSUA 2ONKA 4DUGA 3GLGB 3AVQA 1ZC4A 1J70A 3OEEA 2OESA 3B8HA 4HDOB 3BORA 3DO6A 2D7CA 1XTKA 4PAQA 5EXXA 1XPOA 4CIDA 3CIOA 4OBEA 3TR5A 4ACBA 2PLRA 2QQ0A 3KJEA 3OAAD 4GZLA 4UJ5A 2TMKA 3WRXC 3BB3A 3EG5A 3RC3A 5FUVA 4D2IA 2WPDA 1JXMA 1Y63A 2FH5B 1V5WA 1E9EA 3BD9A 5C2JB 5L8VA 1S1CA 4KFUA 1Z6AA 2EFEB 3RRYA 4IW3B 2KWIA 1SVMA 4Q1CA 1SVWA 3A1WA 1YE8A 2DYKA 2ZJ5A 1GL7A 5CLLA 3NDBB 1CTQA 2D2FA 2Z4RA 1DAHA 2MSEB 3NH9A 3BBPA 2OO7A 3DPUA 2VHJA 4OI1A 3CF6R 1A7JA 4RZ3A 2ZI4A 1N6PA 3KXIA 4TMTA 2W6JD 1OLOA 2XAUA 2YYZA 3D6TB 1HE8B 3D7MA 2GXQA 4RKEA 3DDCA 3TGPA 5EP2A 3WYFA 2CVFA 2XSZD 3BGWA 2H18A 2OCYC 1BMFD 3HJNA 3IIJA 4M9SA 3S1AA 1LFDB 3K0CC 4FN5A 4B2LA 4DCVA 1OXVA 1TF2A 4GOJA 1TL7C 1IBRA 2J0QA 4DLVA 3HPRA 3H84A 2IBMA 1XBTA 4D4MA 4LJ9A 1VIYA 2GVDC 3FKSD 1DAIA 1UKEA 1E79A 4GP7A 2JLYA 3TIFA 2WMNB 2PZEA 2V1UA 1G21E 3U3JA 4DUGD 3SZRA 2W6IA 3R9IA 2CCGA 2ZREA 2IYZA 1DO0A 2YZ2A 3B6EA 3RC8A 2Y8EA 2ZR7A 3QEJA 1A2BA 3HYTA 4MUAA 2AFIE 2H5EA 2V6IA 3TBKA 5HR5A 2DPXA 4DDTA 6Q21A 4YQFA 1W5TA 5B58C 2HLDA 4L8GA 1DAMA 4QXAA 3W34A 2XX3A 3GLIB 4Q9LA 4D0NA 4UNSA 2IYXA 3TUJC 4DCSA 1XMIA 4Q1DA 4C0BA 3EZ7A 2H8KA 2O8FA 2QSZA 1JALA 3ZZUA 5FBVB 5FBLB 4OJKA 3IKJA 2ZTSA 1DAEA 3IBGA 2IL1A 3KQNA 5AJVB 1OSNA 5JS8A 1W2HA 3U7EB 2WAXA 2O8BA 3AUYA 3FMOB 3S1AB 2J7KA 4B6FA 1GWNA 4EPTA 3LQRA 1EFUA 4O25A 4PZLA 2YWEA 3CW2A 4RD0A 4KVAA 5CYOA 2AWNA 3AQ4A 4TLCA 3TE6A 4C7OB 2J3EA 3UK6A 4PFSA 1N0VC 5EE5B 4EPXA 1KI9A 1NKSA 4XJXA 4C0HA 3T5DA 1AM4D 2GXUA 1U0HC 3EWSA 1HT1E 4Q4HB 2WMOB 5FTMA 4C2TA 1Z07A 4TL9A 3UXMA 3KB1A 1XEXA 4ZDIA 4MYUA 4NTZA 4OK3A 2NO7A 4WA7A 1NJFA 1WCV1 5K8UA 4NZYA 1E79D 2IEZA 2ZJ2A 4UNNA 1XEFA 3CH5A 3ZS8A 5DI9A 2HDNB 4KODA 2YJTD 1JQLB 1KI7A 4PC3A 5EE9A 1W4BA 1A5TA 2FF7A 1EXMA 1AJEA 3ZIAA 4XWOA 3QPWA 2XTZA 4AI6A 1KK3A 3CO5A 2G3YA 3VKWA 2DBYA 4E09A 2F55A 2IWHA 2CEAA 3G5UA 4A92A 3B1XA 4KBGA 4M22A 3CM0A 4MRSA 3QSYA 2XZPA 1FMJA 3CONA 2YOHA 3I32A 4IJMA 1RPZA 5CB8A 4XSHA 5GJBA 4B48A 1WP9A 4NE2A 5EXTA 1MO3A 1E94E 1ZUIA 1G6OA 1DADA 3BH6A 2ORIA 2GXSA 4ZKEA 4LJ7A 1R0ZA 1Z0IA 3PG5A 3VTKA 4N1AA 5SZHB 1E2IA 3ZQ6A 4A6XA 3TR0A 4XTRA 2O8BB 2FPMA 2ZEJA 2D74A 2RKOA 2BMDA 4HYYA 2IYLD 4JYBA 4PC2A 3K09A 2HEIA 4OI2A 2R6CA 1IHUA 1ZM9A 2ODNA 3C15C 3WMGA 3LLMA 2A5JA 1DPFA 1Z6YA 2PCJA 4DSOA 1T8TA 3KQHA 4HB4A 3U6KA 2HJVA 1XEXB 3OESA 3W3AA 3NHBA 3FTQA 5KSZA 2IX3A 4U00A 4A9AA 3AF1A 4TQAA 2PEZA 3RWMB 1KK1A 1XX6A 3D31A 2QBYA 2GKSA 1P9NA 4PHGA 4IVRA 3FE2A 1J8YF 1N0WA 1PLJA 4TMWA 4K81B 2KI5A 3K0FA 1IXRC 4X8MA 4M8NE 2GZHA 1OV4A 4PPFA 3REFA 4A0HA 1RYFA 4LHVA 1WF3A 4V03A 5BQ5A 1Q20A 4FMCB 1NN1A 1TNDA 5EXSA 1UDXA 2YV5A 4ZKDA 4F92B 5JLJA 1T0JB 4LDJA 2UVQA 2NO9A 1SXJE 2Z4SA 4LRWA 4TZ0A 5FL7A 3P27A 3QVVA 2ZS9A 4PZYA 1WBBA 2MMCA 5JCZA 4JSYA 2GK6A 3ND8A 3B1WA 2EQBA 3BK7A 4LK2A 4MGZR 2R8RA 2AL7A 2C9CA 3C16C 2CL6X 3B85A 2F9MA 4RVCA 4PPQA 4QBFA 3NXSA 4CGZA 2O8CA 2NMVA 2FNAA 2CLSA 2PBRA 3UPUA 3WYGA 1XWIA 2DHRA 2QAGA 2FU5C 1F6BA 4Q02A 1EWQA 2FSFA 2HV8A 1WMSA 4N0EA 3TW8B 2YNMA 2NGRA 8OHMA 1D9XA 4HB2A 2VPPA 2DB3A 5P21A 5HKKA 2XTMA 3MUFA 3W90A 1W4RA 4EAQA 1RW4A 2V8OA 3F0TA 4Y0VA 3IPXA 1YR8A 4HB3A 2QA5A 2MMGA 1JXOA 1KO4A 3AEZA 2AD1A 4RD2A 1FNNA 2PL3A 2WICA 4TQ9A 4JL8A 2QBYB 1AN0A 1JAHA 2ERYA 1EX6A 4LJ8A 1GVNB 2OBLA 1C9KA 1VYUA 5JI3E 3ZD6A 3OEHA 2PX0A 3MJRA 1VTKA 1OIXA 3PITA 1I2MA 1ZUHA 2OG2A 1W44A 4A15A 3A37A 5AUQA 3ZD7A 2ZYVX 1HE1C 4KLZA 5A0FA 3QUSA 3B5JA 2IWRA 3BC1A 5DYGA 4F7WA 2BBTA 3PFIA 3QG1A 1NSFA 3FVQA 5F9HA 1E2LA 1E2GA 3K0AB 4MRRA 5FOWA 3AVTA 3PUWA 1E2FA 4JLMA 3IIKA 3U44A 2WIAA 2YHSA 2DWQA 1KSHA 4RD6A 3SBEA 3I61A 4YDSA 4A4DA 5HZHA 2B7CA 5FL7D 1M6NA 1NL3A 2XJ9A 5BXQC 3C14C 1Q1QA 1EFCA 1U94A 1NBMA 2BJVA 2CLCX 1YZLA 3AP3A 1OJLA 2IUUA 3K70B 1BKDR 4KSBA 4BZQA 3T1TA 1U8ZA 1G8FA 2ZRCA 4Q1FA 4GI7A 3EPJA 3GFPA 1M7HA 2ZRDA 2GJKA 1XXHB 3Q72A 4PHTA 3K70D 1E9CA 1FPMA 3RWOA 1W36C 1DO2A 3AV0B 1NG9A 1P2SA 1XU4A 1XMJA 1F3OA 3IQWA 2FEOA 4MH0R 3UMFA 3ZLJA 5H8WA 1E6CA 1Z5ZA 1OXXK 2CHVA 3RRZA 1R2QA 3QENA 3DVLA 4ZCMA 1SGWA 1LS1A 4G1UC 4DWJA 3VU9A 1X1SA 5AJXA 2G0TA 2Q0HA 3L0IB 3OEHD 5L3SA 2REXB 4B44A 4A82A 4JSTA 2E87A 3IQXA 4KO8A 4BLOA 4DSTA 3CX6A 1I2DA 4BRWA 2LKCA 2ZSDA 2HXSA 3AF0A 4GOKA 4JMPA 3X1DA 4EPRA 2ZI9A 2QROA 2ZYTX 3W6PA 4MGIR 4EQ6B 1ZIPA 2AN9A 4H9GA 4TTRA 4F38A 1BIFA 2XNDD 4BFVA 1KZGB 3U3MA 2Q3HA 3BS4A 4LCBA 3SS8A 3AGPA 3PUVA 1ZD9A 3P26A 4P0TA 4W7SA 2BBWA 2DWPA 1W2GA 3RABA 3GEHA 2C78A 1LB1B 4LY6A 1BS1A 1KNQA 2C03A 1DAKA 1FFHA 2VSOA 2WSSA 4AIIA 4D82A 4EFLA 5DI3B 1A1VA 2ZJBA 3TW4A 1IJFA 3PJRA 1DAFA 1TMKA 1GUAA 4NYIR 4B2IA 5KYKA 4O0MA 1FZQA 2I1QA 2G88A 2G1JA 3ZVRA 2RGBA 2JASA 4Q4LA 1N5KA 5D3MB 2BCJQ 2CK3A 3W9YA 3K9HA 1Q12A 2WJHA 4M1KA 3T5GA 2P2LA 5JCPA 4HLUA 3VU9B 1Z0FA 5SZIA 4DEXA 4G5OA 1EFTA 1G5TA 5IF9A 2FE4A 2A9KA 2C99A 3AKYA 4D4KA 2H57A 2V4ZA 2ZETA 4BQSA 3GJXC 2GBLA 2QEQA 2YWFA 2PCLA 5HZKA 2PZFA 2QTFA 1N6KA 4JKIA 3KKMA 2VEDA 3KDSE 4M53A 1SXJC 1Z0JA 5F3WB 2N46A 1QRAA 1RIFA 4YLGA 1CRQA 1MH1A 4O2RA 1K5GA 4D81A 1OXSC 1QHIA 3FDIA 1B0UA 3G0HA 4A0RA 2AFHE 4DLXA 1BYUA 1E9SA 2WJIA 1Z83A 3CPJB 3BXZA 1VDZA 1ZCAA 4TYNA 2BBOA 2NOAA 3HPQA 1KYIA 1W7AA 1R5BA 4OQXA 1N5IA 5JWOA 1T3HA 3EX7C 1S3GA 1JR6A 2ZRGA 3GJ0A 2OAP1 1KDRA 3RSOA 3RS4A 1T9HA 5AUPB 4YDHB 4LYJA 2IF2A 2DFKB 4IXMA 4HLQB 1U9IC 4MKGA 2ZYWX 4QJ5A 1XEWX 2R6GA 4WW0A 2ZSFA 5FOTA 2J45A 4GZMA 2JEOA 4IOJA 4JVLA 3V4RA 2J7PD 2WJVA 4BWYA 1E4YA 4M1YA 2J9RA 3DMNA 4HAUA 4JIMA 5FUWA 3FOZA 4YXWA 3SOPA 1GNPA 1TEXA 1GTVA 3BERA 5AJZA 1D9ZA 3QIAA 4L4UA 5KUTA 3UMRA 1W0JD 2CK3D 1KAGA 1D8TA 1Z6GA 2XITA 4QGHA 1C1YA 3O8CA 5J4LA 1KAOA 4ZPXA 2WV9A 1KY2A 2N1BA 1J2JA 5DO9A 1OYWA 1VHLA 2IHYA 4Q1EA 3A58B 4Q01A 3NBFA 4QKQA 1EFRA 1TX4B 1BH2A 1SHZA 2CVHA 2OCBA 3DL0A 1AS2A 1LF5A 3IEUA 4R98A 1HY3A 4RD3A 3UMSA 4UQOA 5IRCD 3MWYW 1LNZA 3HWSA 2C96A 4BFWA 2WWYA 3CPHA 1IXSB 1KSGA 1W4AA 1S0UA 4CRWB 1RRCA 4ZIRA 1R0WA 2ANBA 4TL8A 1IN7A 3PUZA 2ZE8A 1IN8A 2RGEA 1OIWA 1F2TA 1Q3HA 4OKSA 2WHXA 1NJGA 1RVDA 4HATA 4HB0A 4NP6A 1ZVQA 4LC1A 1UKVY 1XJCA 4H1VA 4RZUA 4YMVA 2KJQA 3AB3A 3AF3A 1E9BA 1YRAA 2F1RA 2QMOA 3ZQJA 3K0EA 5BN4A 1NN0A 1YR9A 3RS2A 2GEVA 1K8RA 1E69A 3KXLA 1EG7A 3BOSA 3MWKA 2ZRMA 1D2EA 4WVFA 4UXJA 3FKQA 1OH8A 2XZOA 2GJ8A 3MRSA 3W3ZB 1VCIA 4M1WA 1LF0A 2REOA 4C0LA 4YXWD 2FDCA 3RHFA 5HTKA 3HU3A 2AD5A 3E1SA 2IYVA 1HUQA 2V55B 4PXAA 3QF4B 5KPDA 4OHYA 3HDTA 2WBLC 2HUPA 1DAGA 2ZAMA 3IO3A 4PHFA 1D2MA 2QI9C 1P6XA 3LO5A 3SEAA 3T12A 3X1YA 4ZI2A 1N6IA 3BE4A 1E1RD 2FEMA 2RMKA 3DHWC 3X1WA 2RGCA 4B35A 4JLBA 1JBKA 5E4FA 3PIRA 3KB2A 1EFRD 5FBQB 1NN5A 3LD9A 2CLDX 2AR7A 4KFRA 4XVRA 4G0NA 4NYIQ 3W8NA 1PJRA 3CB4A 2KBEA 3MGCA 1KDTA 1D6JA 1MKYA 5EE1A 4GBMA 1OB2A 3IGFA 5EZ5A 1G7SA 2QP9X 4CT4B 1X6VA 2ZYUX 3EPHA 1YRBA 1OW3B 1MO6A 1S9DA 3SYKA 1XZPA 4HAVA 4M21A 2IS2A 3REGA 3GQBA 2VP0A 1R10A 5JS7A 4U7DA 2P3SA 2VSFA 3U6BA 1N0UA 3CRRA 1TU3A 2ATVA 2O8CB 2FFAA 3ND9A 3UWOA 1CP2A 4AK9A 1NY6A 2QG6A 3QXCA 1W48A 4LYHA 1OFUX 3IEVA 2OZEA 3LNCA 5H70A 2G0NA 2ZS8A 4C0SA 1OH5A 3OIWA 3QKRB 2OCPA 4TLAA 3W6NA 3B13B 1DG3A 3WP1B 4R7ZA 1I4DD 1CJKC 1VIAA 1XZQA 2IYUA 4MKHA 4DCUA 3QE0A 3EARA 4OHXA 3CF2A 4HAZA 5DH9A 1HURA 4QG7A 1G8HA 4Q4JA 2FSGA 1E2MA 3PEWA 3THXB 4JVMA 2PT7A 4KJZA 5CJPA 1M1YE 3Q5EA 4UJ3A 1J8MF 2AKAB 4DEYA 1IN5A 1TEVA 1P7CA 2VHUA 3SQWA 1S4QA 3QKUA 2BM1A 3RS3A 1CJUC 1KNXA 3MG9A 4HAWA 4Q47A 4BFZA 2YOGA 2B7BA 2JA1A 2R65A 2GEDA 3FKSA 3V00A 5JWHA 4JVSB 4NBSA 4Y0AA 1IXZA 4E03A 2C77A 4K8OA 5IT5A 1CU1A 3DOEA 2JLUA 4F4CA 4IOMA 2CL0X 4AKEA 2CL7X 5JWRA 1TF7A 2VL7A 1IN4A 3VHXA 2R2AA 4DLYA 2O52A 3EA5A 1Z8FA 4EJSC 1ZC3A 3KJIA 3L82B 4F4JA 4PPNA 1FMLA 1HTWA 2WJGA 2FX3A 1DTSA 4LJ5A 3R7WB 5FUYA 5TMPA 2LKDA 2C2HA 4UNQA 3LH5A 3QBTA 4F4IA 1KSFX 4CEIA 1ZNYA 4M1MA 1NVUQ 3B82A 821PA 4Z54A 2ZU6A 4IEIA 2V7QA 1E2KA 2WKRA 4HZUB 4L9WA 5B64A 5FR1A 5DNYB 4MGKR 4F93B 1TQ2A 3GLIA 2QT1A 5L3RA 2FJUA 3ZDQA 2P6UA 2G6BA 3LQQA 4Q4JB 1CJTC 2FGKA 1Z28A 4QJ4A 2YKGA 2VO1A 2JLZA 3GJ3A 2OLJA 4M9QA 2Q21A 2O8EA 3OIVA 4TSFA 5FUXA 2QZ4A 3LVRE 4GNKA 4IDOA 3IHWA 3T61A 2BC9A 4BZXA 1YR6A 3K9NA 1G64A 1WXQA 2J5XA 2O8DB 1V43A 2ZIAA 1ZU5A 2KE5A 3QF7A 1EESA 5ELXA 3GJ4A 1Q1ZA 2ZANA 1TQDA 2C04A 1QHNA 2OXRA 1OFIA 5LB4A 2GCOA 2RCNA 4LWZA 1AKEA 2FFQA 2ANCA 4C7OA 2F43A 3CZQA 2BBSA 1XB2A 2BMEA 4LOAA 5CDFE 4IEEA 2Z83A 4MA4A 3ZZ0A 2W58A 3NIBA 3DZ8A 2VIIA 3CWQA 4PC1A 4Q4HA 3I5YA 5G53C 4PHHA 2WWFA 4OHVA 4UNPA 3B7GA 4HUQB 3SJAA 1ODFA 3W6OA 1NLYA 4PAOA 1G41A 1XTJA 2IYRA 3CH4B 1KDPA 4R2HA 5FOVA 1KZ7B 3THYA 4CEIB 1R7RA 1U90A 4G3XA 1QBKC 1YZTA 2NQ2C 3MJHA 4GT1A 2XNSA 3NDPA 1IAQA 4M1OA 1W0KD 4B75A 2VA8A 4A0GA 1BYIA 3NBZC 1DG1G 1MOZA 3EIQA 1KO5A 4V0LA 1GKIA 1QG4A 1ZYUA 2B6HA 2FMXA 2V7QD 4X8OA 3ICEA 2QENA 5A4JA 1ZP6A 3FHTA 2EFDB 2XZLA 5CM8B 2G83A 1WE2A 3U2QA 3H2YA 2O8EB 4XD7A 5DLQC 4KITB 4URUR 5BYKA 1IOZA 1CR4A 1W46A 2Q9CA 2P0EA 1QHXA 4LV6A 3NWJA 3WY9A 5EUMA 3TQFA 1UJ2A 2IEYA 1SQ5A 4TSFD 1GITA 3QKTA 1NLFA 1U99A 3EZFA 1BO6A 1XPRA 1KI4A 2GCOB 1JI0A 2CMKA 1AKYA 2F43B 1KK0A 5TXGA 1CKEA 3T34A 4WAUA 4QBHA 4ACAA 3K0CA 2HCBA 1E99A 5G3ZA 4BASA 5E3HA 3GLFA 1JR3E 1GKUB 3NG1A 1Z08A 4B3XA 4LI0A 2GK7A 5G41A 4MYTA 2R6DA 1NRJB 1DARA 3THYB 1KKMA 4GPTA 2IYYA 3U3RA 4DIDA 1P73A 4HI0E 5JJLA 2V9PA 3DOFA 4HSEA 4JS0A 3LV8A 2BKEA 2WIBA 2ZRJA 4BUJA 4F91B 4L15A 5EUQB 3NH6A 4DB2A 3B78A 1MT0A 1SVIA 4I1OA 3VR5A 4M1TA 521PA 2DR3A 2ZJOA 2F6RA 2V3CC 3A1TA 2V54A 4C30A 2XB4A 3UG7A 3JZMA 5CB6A 3QKSA 3PUXA 4MGYR 2AK2A 2JGNA 2P6NA 1S96A 1SULA 3EXAA 1N25A 1WQ1R 3VMFA 3ASYA 1F48A 4ILEA 2EYUA 3P20A 1XTSA 4XD7D 2O5VA 2EFCB 2ZITA 1MRNA 2FG5A 4LV5B 3AP2A 2AKYA 2BV3A 4ZCLA 1OFTA 1N5LA 1ZM7A 2NG1A 3LBHA 1ELOA 2MSDB 2ZUDA 3F8TA 4TTPA 3RS0A 5KNCA 4B3GA 3WP0A 4GRAA 2B92A 5JSZB 2FWRA 4RFVA 2PMKA 3GLFB 4DRZA 3NBXX 4EPYA 3A6PC 2BHRA 4R9UC 3SHFA 3T1QA 1ZU4A 3B1ZA 4P4TA 1E2HA 2GETA 2GAOA 4AURA 4FCVA 4H1UA 4DLRA 3AKEA 2QAGC 3MAAC 3O8DA 2FOLA 3A8TA 4TYPA 4ZI3A 1NP6A 1M34E 5FOXA 4AWXA 4LX0A 4RZ2A 4Q9KA 5EXPA 1MR3F 2OM2A 5GVSA 3CPEA 1NMZA 2JLVA 1TU4A 1ZRHA 2HF9A 1AS3A 4EPVA 2GWHA 2MSCB 3QKSB 2EWWA 2QQEA 1G20E 2CCJA 2CXXA 3K0AA 2BMFA 3EPLA 2GILA 5JBQA 4D0LB 2WWHA 1YJ5A 4NCJA 2YINC 4AYWA 3MMPA 3T06B 3L2OB 1S2MA 2IF0A 5DE3A 1J7KA 1G3RA 3GLHA 4QJ3A 3VNUA 2X8AA 1AGRA 1SVLA 1UEIA 4Z8YA 2GZDA 1AA9A 4LHYA 5KDOA 1XXHA 2BDTA 2SHKA 4L5BA 3BWDD 1T5IA 1ZM2A 2VTKA 3CUEF 4WZAE 5J4YA 3QQ5A 1R6BX 2Q3MA 4D6PA 2ZSBA 3JVVA 2F1JA 4BLTA 3RVBA 5JEEA 1T3SA 5KNBA 1VKJA 3IPYA 1E0JA 1G18A 1G8YA 3C41J 2GESA 2JDIA 3ZZTA 5JHHB 4LBYA 4C4PA 3E2IA 1MO5A 2IS6A 4QOSA 2ZRFA 2VRWA 2ZE7A 4E5UA 3M6AA 1UM8A 2EW1A 1XDBA 2J46A 4RD4A 1Q44A 2O0KA 1Z47A 2RH5A 2X19A 3T1OA 4DCNA 3WNCA 1AIPA 3QI2A 2CJWB 3TUIC 2XNDA 1IM2A 3HU1A 1G19A 3PR1A 4NYMQ 2ZI6A 2QPAA 3EAQA 4TT3A 5DIFA 1PLKA 2IYWA 4EQ6A 4TQUS 4QNRA 1YZUA 3TKLA 3KFVA 2QMHA 2OHFA 4LUCA 1PUJA 4B34A 1E9DA 3GLHB 2G77B 5AR1A 1KI6B 4URWR 1G3UA 2C98A 4LPSA 4CEJA 1QHHB 5TY0A 3AKDA 1P5ZB 2WJJA 5L3QB 2IYTA 3UG6A 1U8YA 2BIFA 5DI3A 4B43A 2A5YB 5GJVC 3Q85A 2ECKA 5DN6A 5ANRB 4RZXA 3U60B 2OFOA 1G5RA 2W2VA 1N2CE 3W5IA 2FZLA 3AVVA 4ESVA 4KCGA 1E3MA 5D3MA 2RGNC 1ZUNB 4JT2A 4V0ME 3FFBA 1OXTA 1OXUA 1P72A 3I4LA 2VH5R 4YMWA 5C18A 3LVQE 3GLGE 2ODBA 3VX3A 3WBKA 1IY0A 5TARA 4AG6A 2JDID 1CLUA 4AKIA 2IC5A 1W49A 2QTHA 1CJVC 3NBYC 3P4YA 3GP8A 4A2QA 3I73A 4I81A 5HE8A 5FTKA 3AVYA 4FCTA 3H4MA 3VAAA 5M04A 2W0MA 1Q3TA 4QNMA 3TNFA 4B47A 4OL0A 4HDQB 4HLUC 1IN6A 4OK5A 2YVUA 2ZVPX 5AUOB 1P62B 3QXXA 4EIWA 3TSWA 4POAA 3PEUA 1R5NA 3U4QA 4D25A 4TT3D 3EZ6A 5G3YA 4CDGA 5JI2E 4Q4AA 2ATXA 3R20A 4DZZA 5FBWB 1TQ4A 4CEJB 1GZSA 4QM6A 4B71A 1P4SA 3U3KA 3CX7A 3B1VA 1RE0A 1G3QA 4TMKA 5BYJA 4V0KA 1L2TA 2J7PA 5FI1B 4NPHA 1GFIA 4QBGB 2VP9A 2ODEA 2VHTA 1W4CA 1AK2A 4LZZA 2IS4A 2J0VA 1JPJA 1S1MA 1NMXA 5FPYA 5JMTA 4IVQA 3U5ZB 3RANA 1W0JA 1U0JA 2V6JA 5AWFC 3E70C 2JJ2D 5DN6D 2O0HA 5LB2A 2QM8A 1KO7A 1NN3A 2VLIA 2ZUCA 2GF9A 2WKQA 3PEVA 4PSVA 1II0A 3PEYA 4EFMA 1UBFA 4W5WA 5CM9C 1O87A 2FSIA 4HLCA 4QRHA 1GILA 4CEHA 1F2UB 1NY5A 4D4JA 2AHOA 3TAHA 3ZGXA 2JJ1D 1OB5A 2AK3A 1VG8A 3AKCA 2JAQA 3ZVNA 4LYFA 4GSYA 1GIAA 4ZDJA 3IIMA 1Z3IX 3OFND 1ZNWA 4DBLC 1II9A 4KSCA 3U4QB 1G4AE 3AH8A 1RKBA 4Q4AB 1SKYE 2I3BA 5C1BA 1CR2A 1ZIOA 3K53A 5FL3A 1KI8A 3ZYCA 2IK8A 2XXAA 4NH0A 1Z06A 3BH0A 1NVVQ 5KSYA 2FN4A 3CR7A 1Z0DA 2EFHB 4I1SA 2ZUBA 2R9VA 4Q66C 4A2WA 1HT2E 1UF9A 4JLOA 3AM1A 1W36B 1E98A 5KTYA 1CF4A 2EYQA 2BVNA 1G3MA 5JJKA 4FCWA 1CJMA 1XF9A 1NKTA 1FNMA 1ZAKA 1HA3A 2A3RA 1Q21A 1AGPA 2P5TB 2QM7A 1W36D 2RAPA 1LS6A 2Z5FA 5J5CA 1E2DA 1QG2A 2ODWA 3LW8A 1T8UA 1N6OA 1SVOA 4NL4H 3TUZC 3ZVLA 4A8JC 2GXAA 2RHMA 4TLBA 2CDNA 4LBWA 1QF9A 3TLXA 4CEHB 1KMQA 1E1RA 4M9XA 3QF4A 4CT5A 4LPKA 4TMZA 4GDFA 5G40A 4PTLA 1NG1A 3D8BA 1RJ9B 2ZJAA 1XEWY 1P60A 3VFDA 3J81k 4WIAA 3I62A 1VG1A 1SXJA 1R5OA 2QP4A 2ZJYA 4IFBA 4LHZA 3ZH9B 2D62A 4KI0A 3T1VA 4P3YA 4DDVA 1G7TA 5JECA 4RSGA 2RGDA 5JRJA 3T35A 4ON9A 5KNDA 3IBYA 4LC0A 1GNRA 3X1XA 2XXAB 4FXPA 3TK1A 3VR2A 4A1FA 2FPKA 1Z2AA 3W5JA 5CK5A 1YZKA 1COWD 1R4AA 3MWLA 3RYTC 3EPKA 4EUNA 2OBNA 5C46F 4RFSB 5LD2B 2F9LA 4CVNA 5JJIA 3BB1A 2R6FA 1XTIA 5TB5A 1XD2A 2WZQA 3B9PA 2I4IA 2WWXA 2B21A 3B2EA 3MWJA 2HYIC 1KI1A 1FUKA 3AUXA 4XVQA 1ZD1A 1CIPA 1ZM4A 4RCZA 4WXRA 5B57C 5GADl 4LJAA 4BFTA 4CF7A 3BB4A 2O0JA 3SQXA 4NHOA 1LV7A 2EWVA 3Q9LA 5B30A 5FH9A 2AXNA 4OQNA 2NPIA 1KDOA 3BJIC 3PVSA 2REBA 3JVUA 4U02A 5DHAA 3DMDA 2XJ4A 4X8HA 3QKRA 4O3MA 4B3CA 1H8HD 3OZXA 3I8SA 1KSJA 2VF7A 1WRBA 1G4UR 2PEYA 3FMIA 3KXKA 3Q5DA 1G1MA 2ORWA 4B3BA 2ASEA 2HCJB 2D4HA 1M8PA 1YR7A 2WAYA 3CF0A 3EC2A 3WMFA 2CHGA 1SXJB 3RLFA 3LBNA 2HT1A 1FW6A 3THXA 1GOTA 5E7MA 2GNOA 3LA6A 4G01B 2XOKD 2QGNA 3OF5A 1DEKA 3NEYA 2P6RA 3KQKA 2QGZA 1Q22A 1VPLA 2PJZA 4PPGA 1JEDA 1G16A 3VR6A 1SXJD 1YQTA 4DVGA 1UADA 2QORA 3BFVA 1TTTA 1KMHA 2ZR9A 3VQTA 2Q9BA 3SDZA 3QEOA 3TSZA 3B1YA 1NI3A 2JCSA 1XCMA 4G5RA 1XD2B 1DBSA 1OYYA 1T6NA 1TPZA 1GSIA 2IXFA 4JJKA 5KDLA 4TYYA 4XWAA 2EVWX 2ZE5A 3QY0A 4OQLA 3PCRB 3QXJA 1G3IA 4XH9B 3E5HA 1T5LA 2IXEA 1II8B 4HAYA 4BRUA 4JLPA 3FB4A 2FZ4A 3GMTA 4PZZA 4P31A 2L0XA 1ZNXA 4A6PA 3I1FA 3KQLA 1R0YA 4TL7A 3R7WA 1AQYA 2OT3B 4Q9IA 4PAMA 2ZQ5A 4I1UA 4Q7KA 3FFAA 1G7RA 1QHGA 4Q48A 1KKLA 2YWGA 4EFNA 4US0R 3LY5A 3KKOA 4HZUA 1FTSA 1UKYA 1CEEA 2ZS7A 4FWTA 4B33A 2FFHA 4LHXA 2BCGY 3LW7A 1U2RA 4L16A 1P3JA 1NIJA 3CZPA 5UKDA 4TZ6A 2C95A 1CRPA 3G82C 2J0UA 3GJ8A 3D3QA 3GJ5A 4DT1B 1W1WA 1EGAA 2WSMA 3M1IA 1E4VA 2GJ9A 2Z0MA 3MLEA 2D2EA 1GM5A 1YU9A 3GJ7A 3U3OA 2F1HA 4LV8B 5IHPA 4PC6A 1KI2A 4TN1A 1ZW6A 2UKDA 2VHCA 4L9SA 2O8DA 3H1TA 3C7KA 3F3YA 3SJBA 5BWMA 1KMHB 1ZMXA 3EASA 3QXSA 4QHYA 1OKKA 3ZVMA 1AZTA 1U81A 2AX4A 2FPLA 1E2PA 2BMJA 2PX3A 1P9RA 3O8RA 3VKHA 4J0QA 2YWHA 4BECA 1NMYA 4BLSA 4W9MC 1H65A 3P32A 3UANA 1JNYA 1P61B 4LGMA 1H8EA 1E96A 2V1XA 3PXGA 1OE0A 4HUQA 4B3DA 1OPXA 4URYR 3VX4A 4AYTA 4C9BA 1UKZA 1G8GA 2J87A 1M7GA 1QHSA 1P9WA 1W0KA 2GDJA 2I1VB 3LAWA 3N2IA 4QGAA 4QL3A 4DXAA 4AD8A 4YMTA 3SJZA 3K8YA 1HH4A 5EQTA 1JB1A 2EU8A 4Z1MD 2GCNA 3NKVA 2PH1A 2E9SA 1GDDA 4LBVA 3TH5A 3AGQA 2NPFA 1P75A 2NZJA 4KYIB 2HYDA 4HLDA 4LJ4A 4YMSA 2OLKA 2JATA 2QPOA 4RJLA 1R8QA 2QL6A 4KXFB 2NZ8A 1DELA 2PJRA 2J0UB 1XMVA 3AVXA 1YHNA 2IW3A 4UXHA 4V02A 1E0AA 4BEBA 5KU1A 1PUIA 4QFMA 4BFUA 3M0EA 4PR0A 2ONJA 1DE0A 3A36A 4JYCA 5CYPA 3R9WA 3EIEA 2BWJA 721PA 5A5GA 1E1QD 621PA 2Q3FA 2ZI3A 2HJGA 5KSOA 1QVRA 1VCOA 5DGXA 2GCPA 4Z8XA 2FFBA 2X2FA 1XD8A 5CIQA 2QY9A 4DDWA 2GJAA 1XFAA 5HE9A 2WJYA 2ZJ8A 3LWNA 2XB2A 4NONA 1OKKD 4QC2A 1NBME 1FP7A 1QDEA 4BEJA 5TV2A 2PT5A 3DM5A 1SVSA 3PENA 4GFDA 3SE0A 1RRFA 2BEKA 4EJSA 5FPSA 4C0KA 1ZM3A 5FBRB 2ZRNA 5J40A 2LWIA 1H8ED 2GRJA 1I4LD 1JAIA 3IDQA 4DJTA 4LJYA 4R2IA 1GKYA 2QMUA 3ONWA 1FTNA 4C2UA 2ZRLA 5K8TA 4URZR 2CNWD 3BAFA 3F5FA 3IO5A 4FD2A 4ZO4A 3UKDA 4AKHA 1D2NA 2QRZA 5C4GB 4IVPA 1QHYA 3CR8A 4CW7A 2Z6VA 4RCYA 2F7SA 4UNRA 1EX7A 3P1JA 3OEED 1KY3A 4NCNA 3VHLB 5F9FA 2RB4A 2VF8A 3AVUA 3MCAA 1XRJA 5E7IA 2E1RA 1KI3A 4Q7LA 1N6NA 4MQBA 4TLDA 5KDDA 2DFNA 1L8QA 4DC9A 2ZROA 3SYLA 3N2EA 4FINA 4IDQA 4II7A 1W5SA 4D4LA 1J99A 1ZBDA 1X86B 2OBMA 2WPDD 4WBSA 1IQPA 1FL9A 2ZI5A 2VP2A 2AWOA 1SKYB 4MRVA 1Z0KA 4PO8A 1E9RA 4NYMR 2VP4A 4DCTA 4DKXA 1KOFA 1P2TA 1HQYE 4DLZA 4X8LA 1MABA 2WOJA 4QHSA 2A2ZA 1IY2A 2GZAA 3C8UA 1TQ6A 4CZ2A 5JSZA 4YONB 3WHLA 1VYTA 2QNRA 5C4MA 3AVWA 3TVDA 4A0FA 5IK2A 3K0SA 1CXZA 3U61B 2WVJA 3AF4A 2HF8A 1HEIA 5JEDA 1X8KA 4XOIA 421PA 121PA 1WDTA 4BLQA 4EJSB 1IY1A 3FGNA 3ZJYA 4IDHA 5K8IA 2X1VA 3K09C 1EK0A 1N6HA 4GMXA 1G8PA 1NLZA 1ETUA 3HYRA 3THOA 4OHZA 3SC3A 5JRZA 5KSPA 4NMMA 3TSOA 3UWKA 4EDHA 1XPUA 2XEXA 4US2R 4M4SA 2PMDA 2WKPA 4ZDKA 3LLUA 3UATA 3U7GA 2OCAA 1ZINA 4KV9A 4YMUA 2ZPTX 3EW9A 5CLQA 1NNEA 1L4YA 3L8ZA 2UZ3A 3C5CA 2ORVA 5SZKB 4ASUA 4PQRA 4ZV4A 4Q03A 5AJWA 4R71A 1GP2A 4BFYA 4JBWA 1E9AA 1ONBA 2X77A 1E0KA 4TMVA 2BJWA 3WNBA 2OSBA 1VECA 2LCFA 2QN6A 2DWOA 1U8AA 4JVNA 1OFHA 4G5SA 2W6ID 5AJYA 1NVWQ 2B8WA 4OI4A 5FPKA 1KJZA 2GHIA 2ZRHA 3KL4A 3ADDA 1Z63A 2KSQA 2YC4C 1UDWA 1WA5A 2A5FA 2WOOA 3MSXA 3EIHA 4MKIA 1VCMA 5CJ2A 4B32A 5F2EA 1WB9A 2W0SA 3Q8XB 1MABB 4OK6A 2HLDD 4GOXA 1KGDA 2WWWA 2O8FB 4BGDA 3Q7PA 3TAUA 1K6MA 5CITA 5H1YA 1UEJA 3QPVA 1VG9B 5L3VA 2QPTA 1LTQA 3K9GA 2CCKA 4BZPA 1PLLA 2ZSEA 2WWIA 2QMEA 4XSGA 3QXHA 3K70C 3OHMA 4HDCA 2XGJA 3RAPR 5IK2D 3SN6A 2RGXA 3KX2A 3R8CA 4FW9A 4JLNA 3AP1A 4JKYA 4JLDA 3A1UA 1E0SA 1E2EA 1OF1A 4JJZA 3SI7A 2F1IA 5DYIA 3VKGA 2EFGA 2IHBA 5EJEA 1VMAA 4D26A 3ASZA 3CLVA 4PC7A 4DLTA 4KU4A 4EKDA 2H1LA 2DCUA 3THWA 4WZBE 5JZVA 2GA8A 2IYQA 3PV0A 5LDDC 2CJWA 4LSGA 2ZJZA 5GJWC 1VCNA 5FOSA 3WNDA 4C3ZA 2QSYA 5K8LA 2OUKA 4ASUD 1VHTA 1Q1BA 2GEUA 3CWZA 3A4MA 3I5XA 1JJ7A 5LPNA 3VNVA 4I4LA 4JBXA 1BOFA 2ZVQX 1GRRA 5EP3A 1FUUA 2RGGA 4Q7JB 1J90A 3ZIAD 4ZCIA 1UBGA 3LXRA 1N6LA 2VP5A 5J47A 1T0HB 1R8SA 1KI6A 3UIEA 1E2NA 1CULC 1SZPA 4LBZA 3VR4A 3R9XA 4MITA 1QHHA 2CBZA 2VP6A 4IDPA 4TWZA 5GJCA 5L3QA 2BEJA 2Q9AA 3RSLA 4C0AC 4BLRA 5BN3A 4RKFA 1LY1A 3KUCA 3TJZA 1IJEA 2JIZA 3TQCA 1AQUA 4QHTA 4B74A 1B23P 5DISB 2WTUA 1GAJA 3A1SA 4UXIA 1NIPA 3ECCA 1NVVR 5CK4A 3NVAA 1FQKA 4Q21A 1RC8A 2ERXA 3PQCA 4G5QA 5LBIA 1X8LA 3W8RA 4DB4A 1Q1EA 2VYFA 4WXPA 2H17A 3NEJA 3P4XA 4AC9A 3GD7A 1E2JA 3TRFA 1Z29A 4V0NA 1ESMA 3IILA 5E7JA 1L7VC 3THWB 4A36A 4I99A 3H86A 4NCKA 4OHWA 3X2SA 4B2PA 3WXMA 1TADA 1KJYA 3DKPA 3K0FB 4QM7A 2QE7A 4DDUA 1TAGA 4LYAA 4URVR 4S2EA 2PLFA 3FHOA 3EC1A 4Q9HA 5J4KA 1T91A 1CBUA 5EP4A 1UAAA 2ZSAA 2A30A 3GEEA 1S3SA 2QAJA 2UZIR 3QBVA 1P2UA 3CNNA 1XCGB 4MKFA 1US8A 5B2ZA 2RGAA 4IRUB 2GTPA 4BE7B 4QGFA 1C4OA 1WBDA 4XIGS 2OV2A 5CDFA 3I3SR 2JJ2A 4IFEA 5HPYB 1OT3A 1UPTA 4B76A 1X3SA 1JEEA 1E9FA 2RHDA 4QGGA 2R44A 2QU8A 3KUDA 4E22A 2QAGB 1Q0UA 3LX8A 1FP6A 4IXNA 4M2LA 4TYQA 4JLVA 3SR0A 3DM9B 2JIZD 2DFTA 4NU0A 2K5UA 3K1JA 3N70A 221PA 2QT0A 3DZDA 4JZKA 2FV8A 4RY2A 4W5HA 2X2EA 2JJ1A 5F98A 3DEFA 3WHKA 3SFZA 3IHLA 1RYHA 3LRPA 4GMDA 4KHZA 3SBDA 1GRQA 3QNUA 2ZRPA 3OFNA 1F2UA 4M0LA 4OQFA 1A82A 5HKKD 1JPNA 2ZR0A 2ZRAA 4AKGA 4MDEA 3CNOA 4FMDB 1KO1A 2Q6TA 1UBEA 2JLRA 4DHEA 4JLKA 1D5CA 4BFSA 4C0QC 4C0JA 4JLJA 4ITRC 4WOPA 1JQJC 4ZDWA 5SZJA 1DOAA 2GAAA 3SU8A 1TUIA 1A2KC 2GBLC 3VR1A 2IA5A 3FWYA 2NO1A 1PVOA 3AVOA 2QE7D 3M4YA 3HR7A 5J4VA 2VSXA 4JLAA 2IS1A 4TLEA 2IYSA 5KHOC 1OH7A 2N42A 1US8B 3FMFA 2ZRKA 2XTNA 1N6RA 4FI3C 1HQCA 1F5NA 3CRMA 3U44B 3Q3JB 2W83A 3BH7A 1X8JA 1Z6XA 4HUTA 1RRPA 1NSTA 2G9NA 1CS4C 2H16A 4OI0A 1JR3A 1JECA 1XD9A 3QVUA 4W5JA 1XTQA 2A78A 4Q7MB 1FOEB 1Z0AA 1MRSA 4N3NA 2FA9A 5KOYA 3WBJA 1LVGA 1XTRA 3WYAA 1YKSA 3GPLA 2B8TA 3L0PA 5LD2C 3CX8A 2QP3A 1GL6A 5FTLA 1NBMD 2D3WA 3X1ZA 3DKVA 2RGNA 2W2XA 2BOVA 4S35A 4PX9A 5EE3A 1G5PA 1Z22A 4NCHA 1XP8A 4G5GA 3K9LA 1W47A 4O2LA 3BFKA 2HXYA 4I1VA 4WZ6A 2Z43A 3A4LA
chains in the Genus database with same CATH superfamily
4JL6A 5HWSA 3LX4A 2FVXA 4M9ZA 5HIIA 4AN1A 1MZPA 1H1LA 4H0NA 1A3CA 1YNOA 2IY7A 3RVSA 4ZT5A 3VPHA 5KOJA 4CIAA 2D06A 2OV3A 4ED9A 4EG4A 5IKPA 5EZ6B 2NO6A 2C9BA 1QIKA 4CF6A 2AJBA 2IP4A 2WU3A 1JJVA 1RZUA 3A9SA 4C05A 2OFXA 2VSYA 5CIWA 1KJWA 4R8KA 5AM1A 4Y18A 5TX7A 4YCNA 1JWAB 2ZDQA 4HAXA 5JCJA 4JFAA 3ZCXA 3K1YA 3I9LA 3ROQA 1E6MA 2CB0A 3BIFA 3C5HA 3EVDA 2IU3A 2PFKA 1SRQA 1OLSB 2DX7A 2YZMA 4RFSA 4TROA 1FU4A 3WWDA 1EU1A 4F9EA 1CFJA 3NM5A 5EIFA 3SBXA 2I3GA 3UMCA 2IDJA 4RVUA 3RFVA 3K0BA 5AVUA 3SJCA 1RDFA 3WLPA 4ZGBA 3NUGA 2JJ8A 1C9NA 4MYDA 3ZLTA 1ULTA 3KJGA 3L0SA 1ZOPA 5KC9A 2XBUA 5IHXA 2WTEA 3TGWA 1W88A 4LHWA 1JR3D 2VJLA 4ZVKA 3L77A 3K4HA 2X8WA 1Z5VA 4DIEA 5FV7A 1HV8A 3N74A 1I3NA 4L9RA 3ADBA 2BFMA 3RFTA 1C7RA 2J6BA 2VTEA 5A04A 1M34A 3EA0A 3GUHA 3UK0A 3ZHYA 3C6BA 3VZQA 3TECE 2PY6A 2O3QA 2W8ZA 3CRVA 5E1OA 2C3YA 4PO1A 2Q6KA 3RSFA 4CDRA 2V8BA 1GUYA 3FETA 5D85A 4Q3KA 5B1DA 1YK1A 3KQMA 1LDGA 4AS1A 2ZUEA 4JI7B 2QJOA 1GZ3A 3GRZA 3KTAB 1IONA 2Z56A 4HEJA 4NYJR 2OILA 4N0DA 1MAWA 1NFFA 2JLQA 1NHWA 3CBQA 1MV5A 3G88A 4MRPA 4GW3A 4ADSG 3IVGA 4ARZA 5DHFA 5LP6F 1AHIA 3A70A 4TV8F 4I4IA 2IW1A 4E70A 3LBIA 3R41A 1OILA 1E63A 1HKUA 2RHOA 5CH5A 4CE6A 5JHGB 3QA9A 4NG5A 4YFVA 4ZOQI 2D8MA 1LW7A 2Q1TA 4O4LA 4A91A 1PO7A 3ADPA 5DSZA 4MDFA 1SKMA 5JCJD 1K6XA 1GG2A 1R9MA 3ITEA 1DCMA 2IDKA 4S0ZA 1UIRA 1UQUA 1EI9A 3RF7A 1NURA 3C8MA 4OIMA 2Y1OA 4R9RA 3SK0A 5EYPB 2HLPA 1QOPB 2WYIA 1OHHA 1H2HA 2CEKA 3JQFC 3LQYA 3RRNA 1ZK2A 1ZCFA 5IDQA 1DJLA 2P1RA 3IEPA 1JILA 3DR5A 4Q18A 3GYGA 5CPBA 1X7YB 4RDIA 5AI0A 5AI4A 3NHAA 1SKUA 3DCNA 1ZJ6A 3OCXA 3VH1A 3PWTA 3FG9A 2C5LA 1J0AA 3MQ4A 1XALA 4R16A 4D42A 1NZJA 4GQIA 4GP6A 1AV7A 2VNKA 2C4WA 3C3AA 3JVIA 4M3NA 2GH1A 4O4IB 4I2NA 5DM4A 3M1AA 4DLSA 1QKJA 4PSKA 3KP1A 5HP4A 1Y9AA 3ZX5A 3C97A 4QPNA 2FWIA 2VN8A 2G9RA 1DT5A 4ZC8A 1DJOA 2OEPA 2RHWA 3WYDA 4BVEA 4X94A 4X93A 1WXXA 4R1SA 1QNLA 4IDNA 1GKKA 4ENWA 3NVKI 3NBKA 4IKEA 4P5EA 2BZ0A 3DYIA 1CYDA 1NMSA 2AN4A 1HMYA 4JEHA 3GH3A 1J5PA 2KB0A 4RIHA 2OXEA 1NUTA 2WYWA 1EFKA 4HTAA 2FPRA 1EP2B 3PD1A 3ZY3A 4HLNA 1M6YA 3QE4A 1HYBA 1OCEA 3L8MA 4B6EA 5HCNA 3CISA 3D8SA 4Q19A 1KRHA 3IELA 4WOCA 5K3FB 4DUYB 3G9TA 5IZCC 1CR1A 3SQDA 3CRW1 2YVLA 7YASA 2NO0A 2W2QA 4JT9A 3F90A 1SEPA 4W9NA 1JEYA 2IUTA 5ALOA 1SVKA 4D80A 3OWXA 1Z7BA 1UWCA 2QJRA 3ZHXA 4HWOA 4MKZA 4MW0A 3EZ2A 2ZZNA 2EQAA 4LIPD 4HYEA 2GM4A 2DBRA 1XAHA 4X20A 5DLEA 4UKDA 5LA6B 3UHFA 3ETLA 1K5PA 4JLWA 3D2LA 2Q7DA 1TJ4A 1B14A 1CY4A 3LM8A 2COUA 2ZB2A 2PYDA 3QJYA 2N0SA 4FFBA 1I4TD 3NC1C 2BFCB 3IH5A 5FEMA 2P9CA 5LXTB 2EF1A 4ZIRB 1QZZA 3DS8A 4N6GA 4XAQA 4ZWNA 2WABA 4P4SA 1A9TA 4AG5A 3R8FA 1OHHD 3LE8A 4FIDA 2YCLA 2IKQA 3N7UA 3IAEA 1RYNA 4K46A 1EVJA 3RKRA 1SHUX 3GFOA 3SF8A 4Z51A 3M6IA 4V0MA 1UXGA 1KMNA 4TMXA 1SQSA 3O1HB 4PQFA 2GA9A 4DJDC 1G8JA 3A4NA 1MNQA 2C1ZA 2QRNA 3OAAA 2QVCA 4JI1B 3ZDZB 2BFWA 3TPZA 4BVBA 1W36C 1Q0SA 1RXUA 1TM7E 2CVPA 3JWPA 3RT9A 4KBFA 3TTTA 2WYUA 2FWBA 2YC2C 3E3AA 3F6BX 3G8DA 4Q1AA 4YGYA 2HRQA 4DQKA 5LMUB 4M0PA 1XNQB 1ZZEA 2HIMA 4L73A 1JJAA 3E9CA 3NTUA 2X15A 2X1HA 4FX2A 2VCEA 5JPDA 4AY2A 1E1QA 4C7KA 1A88A 1NATA 4Y67A 2D1FA 3ROZA 3MCUA 3SNHA 3WLSA 2OB1A 2VRCA 5E8JA 5IAJA 4YROA 3V4FA 3DA8A 1H3FA 1O4WA 2RK4A 4U39A 2PMEA 1QANA 1W96A 2ILVA 4BP3A 1R0XA 1Q11A 4X62B 4G0OA 3TKYA 1EDDA 3TB4A 6GPBA 1W5FA 3CLHA 1LKZA 4K1XA 5FWDA 3DFZA 1O3YA 1P1HA 5CCBA 3O9MA 1LLDA 5A3SA 2NTYC 3BFXA 5EIEA 2Q7XA 2WF9A 1PZFA 3ICQB 4N82A 5EE0A 3PUHA 4MRNA 2XSZA 4RTNA 4F1JA 1XMSA 2IFTA 3S40A 1P81A 3BXGA 1QFXA 5ENVA 3E3MA 5H3CA 1WNTA 3L8YA 1XIVA 3E22B 3W1VA 2DY1A 2BW0A 4XVUA 1RFLA 1Z2PX 4I14A 3F7NA 2L19A 3O3MB 4P81A 4EF5A 4TWBA 2CNWA 1P6QA 4Q9JA 3S2GA 1A9YA 2PM8A 4RF3A 1XXHE 3DUFA 4YC7A 3WL5A 4AMVA 4DSUA 3JTEA 3ZC3A 2XCQA 4GR4A 5DFAA 3AVQA 1Z39A 1ZC4A 1J70A 3DDNA 5KQSA 1XVIA 4KR0A 2I6FA 3T9EA 1C3OB 3R5TA 1M0WA 4KQJA 3PLNA 1XZEA 4PBTA 4RYLA 3SQMA 3WYNA 4FHFA 3NEPX 1WAMA 1XPOA 3CIOA 5DBOA 3MLBA 3UCXA 3OAAD 3IP1A 4GZLA 2TMKA 4ZZIA 1I2CA 2GX6A 2IKSA 4QOIA 3RC3A 1Y8QB 4J75A 1YNSA 2WPDA 3LXUX 5EKTA 4ALMA 2ONYA 4LX8A 5C2JB 5L8VA 1JQKA 3FVRA 1ENYA 5FWXA 2NQTA 2FMIA 1Z6AA 1RWVA 2EFEB 4P53A 2B4KA 3RRYA 4X95A 5JS2A 3OM1A 4IYRA 2KWIA 1SVMA 3CVOA 1WV1A 4CIXA 1MQAA 3QLUA 1YE8A 5CLLA 2FZCA 1CTQA 1C8BA 3CZ9A 3T3PB 2D2FA 1JSZA 4CR7A 4ZQCB 4FS3A 1BMTA 2QRVB 1QQAA 1L7QA 4NEHB 4KE8A 5CVVA 1OWMA 2VBIA 2OO7A 1X1BA 4DV2B 1IL0A 2NO4A 4J0HA 3ZY6A 4NFHA 1F4LA 1MB2A 3HKCA 2Z5VA 2I1LA 1XLUA 2UVPB 2BGTA 1MOSA 3C1OA 4D4HA 2YYZA 1GU0A 2OHXA 3F9IA 1O08A 2W93A 3DDCA 3R0IA 3TNYA 4BDSA 3LHIA 2P91A 2CVFA 2XSZD 4LOJA 3H0CA 1NMQA 3IIJA 3RASA 3S1AA 3K0CC 4BV9A 2A8YA 1T25A 1TF2A 2BGUA 2JJMA 1EDEA 2IEGA 2UAGA 4GOJA 1IBRA 1IE3A 2OECA 4NV1A 4UHHA 2DJ5A 5LLTA 2J0QA 3HPRA 1U7TA 4LJ9A 1K75A 1VIYA 2XUDA 3O8QB 4E13A 1DAIA 1UKEA 1KC3A 4PV7A 1BMDA 1QHFA 3RYIA 3U0VA 2WFLA 2B3DA 4RK5A 3WYCA 5HZMA 3MJVA 1A5BB 3FROA 1UJ5A 1PKEA 3BCUA 4OB8A 4F45A 2O9JA 1YL6A 1LW6E 2ODTX 3VR4H 1DO0A 3ZX4A 4E46A 2PUEA 4LF8B 1U0EA 1YUNA 2Y8EA 2ZR7A 3HYTA 3QEJA 4H7PA 3SBOA 1KMCA 4BFLA 5K6AA 3TBKA 3PNSA 2YWXA 4XYGA 1BE6A 2B1JA 2NXEA 4DDTA 6Q21A 1MOPA 1AOXA 4L50A 3DVQX 4L8GA 3Q7SA 3DNFA 3W34A 1A0OA 3D43A 2INGX 2NZUG 1L7AA 4GYKA 1FYDA 4UNSA 3TRIA 4LDPA 1ORVA 1XMIA 2HHCA 4R1NA 3MN1A 5REQA 2RKWA 4C0BA 4CLDA 4OHCA 3H3FA 2QSZA 4GLOA 4LSZA 5C31A 1A9OA 2JGMA 3LQ1A 4E2ZA 2AJTA 5FBVB 5A9SA 2OZPA 4ZJYA 1ZDMA 4M7WA 3KLMX 3ID6C 5BRNA 3QFFA 3TOCA 1ENZA 2XUAA 2EZUA 3ZZMA 3O74A 5F7OA 1OSNA 3DXZA 4K2AA 4DR4B 3A26A 1W2HA 2RONA 5KJEA 2JK1A 4P2GA 1QWSA 4B6FA 3OTIA 3N0XA 4G0YA 3GLUA 5CYOA 4C7OB 1PS8A 3AV3A 1PR5A 1K1EA 4PFSA 5EE5B 4EPXA 4DKJA 2NO5A 3DTVB 4I1RA 3RK1A 1KBZA 4YCJA 1U0HC 1NXOA 4BIIA 4Q4HB 3RF6A 1QC5B 2WMOB 4Q3DA 5FTMA 5LP6A 3GRKA 4C2TA 4TV8A 2XY4A 4AZWA 2HBZA 2XMQA 1Z25A 4R8VA 4BKMA 3UJAA 4MYUA 4RA6A 3HH8A 5FORA 1NJFA 4NDNE 4OB6A 4BO6A 4JC5A 3S7TA 2EATA 2KMLA 2WD7B 2WJ3A 3WDMA 4AJHA 4P54A 1PE0A 2HDNB 2RBKA 2ZT8A 2P4EA 2BCEA 1JQLB 4ROSA 1FUEA 2YZNA 3GZNB 4M0KA 1W4BA 1A5TA 1KAQA 3GJYA 5CFMA 4EM6A 1K6IA 3QPWA 2YXPX 3PDIA 1RJWA 4NMWA 4M7PA 2AE1A 3MB8A 4B3RB 1FP4A 3JZIA 3BF7A 3O1IC 3PJFA 1W85B 1ZI8A 4A92A 3PFCA 3BDAA 2PGXA 5AHKA 1D2RA 1VJ5A 2FN7A 3CM0A 4TKUB 3BE5A 4RV5A 1IBCA 3T3OA 3EQ2A 5JO9A 3CONA 4WI1A 3I4CA 2YOHA 4IMIB 2NM0A 3CVYA 1RPZA 3VMMA 3ZXUB 3PC8C 4E2FA 2M6KA 5GJBA 1WP9A 1M76A 1KBQA 4Y7CA 5EXTA 1E94E 1QH1A 4BB5A 4F9GA 3BKXA 3FI9A 1VL2A 3BH6A 5CW2A 5AVXA 2ORIA 2DE0X 2Z6UA 2FFRA 2ZYSA 3MIIA 4OD0A 4XQEA 3UC5A 1N5OX 3ZQ6A 2ADOA 3RVJA 4QYIA 2WU0A 1Z88A 4ZRNA 3SWWA 2YHIB 2O8BB 3HN7A 2BEUA 1YBFA 4GRDA 2BMDA 1Q7TA 4KGDA 4FEYA 4EDFA 3SHOA 1NRIA 1RWQA 1GPMA 3MYYA 2HEIA 2DKOA 4XVHA 1ZVVA 3HYSA 4LVOA 3LZ6A 4MW6A 4V0QA 3L1JA 2ODNA 3EDYA 4PYLA 1DG9A 3UA4A 3VYWA 2AN1A 1GGJA 3LLMA 3WMGA 1WHTA 1ODKA 1T8TA 2RAFA 4YP9A 1N0HA 4YCLA 1OFGA 3QPDA 1VP9A 4RM3A 1K3TA 5A0TA 3L8FA 1M2WA 4X66B 2TMGA 4U2GA 5BV8A 5K3BA 1JA9A 3FTQA 5KSZA 4U00A 5EHXA 4A9AA 2G71A 4YJ3B 1DEXA 3RWMB 5ADVA 2Y1GA 3WGTA 4K6MA 3SXUA 3GXOA 5T3UA 1GL3A 1P9NA 2GKSA 4RTRA 5IG2A 3FE2A 3PF8A 3JQ7B 2ZT7A 4RY9A 5AM3A 1R9NA 1JS1X 1L9KA 4MW4A 4JI4B 4X8MA 2VNIA 3FUUA 4Z86A 1G6KA 3WNVA 2VDWB 1U28C 3V1NA 3DEIA 5ICSA 1IDOA 4TZTA 5B37A 4A0HA 5J5AA 4V03A 4FBLA 1Q20A 1WNFA 3EXFB 1TNDA 3IEMA 4Q1VA 1M1UA 1DXHA 1ZKDA 3ZU2A 4ZVSA 1ACJA 1L5NA 1T0JB 1Z13A 2NTVA 2UUPA 2UVQA 2NO9A 4LDJA 3CGWA 3WGLA 4B80A 4Q3BA 2J9YB 1W0CA 3S2ZA 4TZ0A 3FNRA 3DP9A 3P27A 3QVVA 2ZS9A 3PSHA 4II2A 4TS4A 2MMCA 5G4KA 1KYWA 4UM5A 3RW9A 1E62A 3KEOA 5KREA 3ND8A 3B1WA 3PS9A 4F2PA 3C16C 4OXNA 2AV6A 2HMUA 2VJDA 4KDEA 4XR4A 3WYGA 3UPUA 3UUFA 5B6IA 2QAGA 2PZMA 3A05A 1F6BA 3G13A 2FSFA 2PT6A 4QTZA 2VNAA 3AG6A 1LEHA 3QYFA 4EGSA 1LBSA 5L95A 1E3SA 2MINB 2ZSJA 4HB2A 4Q3OA 1Y1RA 4EUKA 2HK7A 2X7JA 3SCZA 3FSGA 2XTMA 3W90A 5KNCD 3TCKA 1OLXB 4EAQA 2JA2A 1COZA 3CQ9A 3F0TA 1T10A 4Y0VA 3IOYA 1G1AA 4HB3A 5AW0A 4KRGA 2OC4A 3CURA 3MGBA 5U1PA 4S1WA 3S5JA 1EFDN 2EG9A 2PL3A 3M3PA 5B3JC 4JL8A 4RVNA 1AN0A 5K0CA 5LIPA 2WFAA 2QBYB 1EX6A 1QIIA 2BD0A 2X40A 4A03A 3QOWA 2OBLA 4DJ5X 4MB0A 4B3BA 5JI3E 2C4HA 2ZBPA 3HABA 3OPYI 4H16A 1I2MA 1ZUHA 4D8WA 1FDWA 1Y5IA 4MV8A 5CEFA 4WLOA 5BQFA 3V4ZA 5JE8A 4A15A 3KR9A 2OVFA 3WHPA 4ZN6A 2G1AA 3H2BA 1SVUA 1HNXB 5LMCA 3U62A 3BC1A 4FIZA 5DYGA 1YE5A 4CI9A 2QN7A 2Q1YA 1SD1A 1B8UA 1SU8A 1E2LA 3CG4A 1DBPA 3H83A 5FOWA 1BHJA 1X7ZB 2GBGA 4C6RA 4AKSA 3KYBA 1V5EA 2XA2A 5K05A 1FRFS 1T3TA 2WIAA 2WSBA 3LC1O 3JZFA 4OKNA 4RD6A 3R44A 2IDMA 2VK2A 2VF4X 1PX0A 1M6NA 5BXQC 5KYXB 3OFSA 3G6WA 2O8CB 1NBMA 3VSDA 3A6HA 1OJLA 1HTTA 1U11A 2ACEA 2Q5EA 4IR7A 3R9KA 3DLHA 2CMGA 3RIYA 3IP7A 4GI7A 3EXEB 5D5QA 5L7YA 4L85A 2H5JA 3GFPA 3J7TA 1XXHB 2YYYA 4PHTA 3H4VA 1FNSA 1Z4LA 1FPMA 2GFHA 1NYRA 1DO2A 3KSRA 3PQ5A 4YP6A 3RWOA 5KYTA 5MFPA 5HX7A 1TC1A 2VJOA 5KVQA 3EXIB 3N8DA 1XPJA 1R0KA 2RDMA 4UHEA 3KOYA 4MH0R 4PYIA 2X3FA 2G09A 2B4RO 4K86A 4W1PA 3EF0A 1LI5A 3ZHOA 3II6X 4JBLA 13PKA 4MO9A 1OXXK 3LS2A 2CHVA 2HTFA 3QENA 4F04A 3RYFA 1T2VA 1P7PA 3HHEA 5JROA 1TVMA 4G1UC 5B3AA 1H05A 1WMEA 1XJ5A 3T0GA 4BMYA 2WZCA 2G0TA 2NXCA 2Q0HA 1JZTA 1SUBA 4LTNA 5EPUA 1NQOA 2FSSA 2REXB 4KQHA 3MWGA 2ZUWA 4YP5A 3TZKA 3BMCA 1IB6A 1Q19A 2E87A 3DC2A 3R23A 2PGJA 1K2WA 3CX6A 5H16A 3T7EA 4FCCA 4BLOA 1IWOA 4C88A 2VTBA 3CUKA 1KOJA 5E2IA 3HY4A 4KWIA 2LKCA 2ZSDA 1DAOA 3RVNA 1HZJA 4XQ0A 4DLAA 3P45A 4JMPA 1OUMA 2FW9A 3L41A 1YDWA 2ECFA 2OO3A 4EPRA 2YCBA 2X4GA 3CUUA 1LTHR 2FRDA 1ZIPA 2FOXA 2JLAA 3BREA 4F38A 5HQ3B 3TVYA 2DH6A 1RC0A 3GY0A 5B7QA 1KZGB 3U3MA 3P0HA 1A8UA 3OFVA 1RLOA 4I9HA 4KNVA 1KZ4A 3NYWA 4WK6A 5AM5A 2IXAA 3BS4A 4LCBA 3FTCA 3SSMA 1S89A 4J1SA 4KRFA 3O2NA 2CYBA 3ZV4A 3KM0A 4Y1FA 4XZ3A 1W2GA 2DM6A 2OK8A 3K35A 4M86A 3AEQB 3QE3A 1TPYA 2Q49A 2RIPA 3O1LA 2VSOA 2XHEA 1UC8A 1FFHA 2BY4A 2DPYA 3AUTA 3CBGA 3CW9A 4TVKA 5AKLA 5HRCA 4XUGB 3GI1A 4AMYA 3AM5A 4CIBA 5CNIA 3V97A 4ZHSA 5KQLA 2F59A 3TW4A 2LR0A 5E9AA 2NSDA 2A6PA 1P77A 2UVDA 16PKA 1EKXA 1FZQA 2I1QA 2R8EA 4J6FA 2AOUB 1YHYA 2G1JA 4JCCA 2JASA 1RM0A 3PC2A 4Q4LA 5JXGA 5CBPB 2CK3A 3T9FA 3K9HA 2WJHA 1GAQA 4WECA 3TZBA 3PLAE 4DA7A 3SP1A 2GPBA 4EVSA 3GRCA 1EFTA 1A4UA 1T8RA 3OLCX 1I36A 1JSXA 1XQ9A 2H51A 5T4FA 2FE4A 1CY1A 2A9KA 4IO1A 1EYZA 1CUYA 2B5OA 2H57A 2HMWA 5A9TA 3VDXA 4B83A 4UBOA 5F35A 4W8OA 1FDSA 5JFTA 1FE8A 3G2LA 1VKHA 5IVKA 2QEQA 2YWFA 2HHHB 3P2KA 3BXEA 4HWKA 5HZKA 4WY2A 1BX1A 1C30B 5JAZA 4MI1A 5DLYA 5JLAA 2VEDA 4I5FA 4N8SA 1Z0JA 4ZAFA 4B81A 5DM60 1O8BA 3K9WA 1QRAA 1MH1A 1BEUB 2OR3A 5I7EA 1DKOA 2JD1A 4D81A 2Y0CA 2WC1A 2BFDA 2BL4A 2FW7A 5ITZB 3OWOA 3U1BA 2HK8A 1JFRA 3UHAA 3CLKA 3VNBA 3WL4A 5CLFA 5IEJA 1RM4A 4OBBA 4OFBA 1TA4A 3WV4A 4L8VA 4EY5A 2BBOA 3S2SA 3E27A 3LBYA 2MWMA 1R5BA 4OQXA 1N5IA 3EQ9A 1A9QA 1C1XA 4FFDA 4JFRA 2CSUA 4JUCA 1WZCA 3SKVA 3LY9A 4W5OA 5IKEA 1Y8CA 2O5RA 1T9HA 3W6UA 4CV3A 1MDBA 1KWKA 4LYJA 3ZWBA 5CR9A 2NU6B 4X60A 4E5DA 1OMOA 2DFKB 4HLQB 4MKGA 2ZYWX 4QJ5A 1XEWX 1NQXA 4EHAA 3FX2A 1C7ZA 2JEOA 4IILA 3FHLA 2VJCA 4JVLA 3V4RA 2J7PD 1T5SA 2WJVA 3E03A 2FSUA 5FUWA 3DMNA 3QU7A 4WZBA 2QJWA 3SOPA 3ORQA 5FQOA 5HRAA 3NKLA 4OGLA 2O2DA 2CNKA 4FOOA 1VJ1A 3HCRA 3IKVA 1EB9A 3AI2A 3QIAA 1T5DX 4BO4A 3UMRA 1W0JD 1YKFA 2CK3D 1GUBA 1KAGA 4O2AB 3EW7A 4AX8A 3O8CA 1GU1A 2CXPA 3AO0B 4IJ5A 4WERA 1YVEI 2X9QA 4QBKA 5H4GA 4PQEA 1JYFA 4ZPXA 1KY2A 2N1BA 4UE2A 1VHLA 4Q1EA 4Q01A 2O2YA 2VAXA 3A58B 3NBFA 1EFRA 3RODA 3MD9A 4BC1A 4K6GA 4JYZA 5JASA 2CVHA 3V5NA 1QSGA 1KZ6A 4DR1B 1QU2A 1AS2A 1LF5A 2FQQA 4M99A 4KUGA 1LX6A 3WC4A 3I01A 1VJRA 2B4TO 3UMSA 1NC1A 4UQOA 3UFXB 3MWYW 3HWSA 3M9WA 2C96A 3UGQA 2A1TS 2DTEA 1XP5A 2Q27A 3CPHA 4G4JA 4BFWA 3T7IA 1GQFA 1XQ6A 4JH0A 1D0IA 4I3HA 4MR9B 1RRCA 5ECWA 4KIUA 4BU0A 4KMRA 5AXBA 1IN7A 1VE9A 1A7KA 1OIWA 1XTVA 2GKGA 2YYAA 3H99A 5CH8A 3RUHA 3U4GA 3ESCA 4KR3A 1NJGA 3BMNB 3KR0A 1ZPDA 1N7IA 1DV2A 2H2AA 3AY7A 3TLAA 2O8NA 1QFSA 4OG2A 2VJMA 3VISA 2PBLA 1XJCA 9LDBA 3KFLA 4YRAA 4HH3C 2KJQA 3WLEA 5CFQA 1V8OA 2QLMA 4G6ZA 2BF4A 1NN0A 3OPNA 3VZCA 2F3SA 2QTBA 1RHJA 1PJ4A 3SM9A 1JFLA 1O6CA 1VJGA 5SY6A 3REOA 3HCOA 1JU3A 3ZDRA 3MWKA 3K9FC 1D2EA 1SQFA 2F3PA 1K86A 2JJYA 1T34A 3L8CA 3MTEA 1T36A 4HDKB 4OSEA 4XM2A 3WGZA 1I5RA 2EJUA 3NHUA 2Z9CA 3PX2A 5AKEA 1MMFB 3EBOA 1CY2A 4FSXA 2REOA 2ZR8A 4DNOA 4QUGA 2AD5A 3E1SA 3SVZA 1T9KA 1M2KA 2PRSA 3R6LA 2AUNA 1YGYA 1GGMA 2W71A 5MN4A 1UBKS 1Y6JA 4NF2A 4YJGB 1ST3A 3IO3A 4PHFA 3PNKA 2QI9C 3FVVA 1D7AA 1PR2A 3X1YA 4YJFA 10MHA 1EXWA 3FFTA 4ZI2A 1LA2A 2RGCA 5FI5A 1J0BA 4BO3A 1JBKA 1DJQA 3TM4A 1H22A 3ZW8A 4ZAXA 4FZVA 1EFRD 1IEWA 3OUUA 4YHBA 4NULA 1B93A 1H6DA 3A3OA 2R4UA 3MCTA 4WX2B 4PRZA 4DSZA 5AJUA 2HPAA 4NYIQ 3B3FA 3W8NA 4RHEA 2GDZA 4JUBA 3I8OA 3CVXA 1S8NA 2FP3A 2H00A 2P90A 1Y80A 3QMMA 4GBMA 2K7ZA 3IAFA 2AEFA 2VF5X 3IGFA 4CXMA 4PS1A 4Q12A 3EPHA 2PXXA 3K9BA 3OJXA 1MO6A 5ECYA 3LOUA 3SYKA 4LFBB 2CLMB 4TM8A 2XKKA 2PMWB 4JJGA 4WA8A 2VP0A 4LISA 3B8EA 4AQ7A 3GGPA 1N0UA 3O0TA 3QWAA 3ZE6A 1FJGB 3R8XA 5IVPA 1DDGA 3B53X 3TDMA 1Z16A 3EC7A 2A92A 4LZAA 4PGGA 1PEAA 1PDWA 3UWOA 1V11A 4AK9A 1NFRA 3ZWVA 2OTCA 2OXFA 5IUNC 5K4GA 1UAGA 2XUFA 3ABZA 3VVLA 1NY6A 4HVCA 3F78A 1ZO8A 1OZHA 4LSMA 1UMBB 2VJNA 2D1TA 2OHOA 4BNKA 1KYQA 2YYSA 4I08A 1IOWA 3VHQA 4C0SA 4KE7A 4NEGA 4Y6QA 5LFAA 2LDBA 4Y30A 4D43A 1Z38A 1JH8A 2CY0A 3HJRA 4TLAA 3W6NA 1DG3A 2BTQA 2G67A 4UDNA 3PVZA 3WP1B 2IYUA 5IMBA 1VIAA 4ECAA 1XKLA 4JOQA 4OHXA 5AKKA 1RQXA 4DMCA 5A62A 5KJ6A 1TFRA 1MRZA 1G8HA 4BB0A 3QVMA 1HGXA 5F77A 2OGWA 3BMOB 2PX8A 1CZRA 2OHHA 2R7KA 3QWBA 1U1IA 3RR2A 4GICA 4M6WB 2DSTA 3Q5EA 4K2HA 4LZLA 4UJ3A 3D6VA 2AKAB 1JWBB 5D6NA 4XJVA 5K0NA 1IN5A 4IQ4A 3JWHA 2SICE 4PRLA 4RQUA 5T8KC 3TD2A 3SQWA 3PPXA 1CQIA 4PNZA 1XRPA 4UW9A 5IJZA 5BVHA 4K88A 2DULA 3R3HA 4I4TF 4PQGA 5FLEX 4WFQA 3KZKA 4ISCA 5H82A 3RU7A 1NVMB 4CQMA 3C5WP 2GEDA 3QWFA 1K6EA 3UOGA 1A9SA 3C3WA 3D81A 5JWHA 3V00A 4E5NA 1C29B 4JVSB 4MJLA 2BEVB 2UYQA 3DO8A 2C77A 4LFCB 4E03A 4Z4QA 3PC4A 3RO7A 1CU1A 1L3IA 1V16B 4IFTA 4Q3CA 3MTAA 4IOMA 1HDOA 3QVGA 1E3WB 5JWRA 4PTYA 2CDCA 3VV2A 1GPH1 1BQ4A 2P35A 4UM7A 3RUIA 3GUCA 1FDVA 1M2HA 4C78A 2XZTA 2O52A 4F4HA 1M1XB 4OAOA 4EJSC 5KINB 3ZY5A 2Q2OA 2QQFA 3V6LA 2OZLA 4F4JA 1WW2A 4BY9E 1HTWA 4CM7A 2WFZA 4YJKA 3I6QA 5FUYA 3UW1A 4U3JB 2YW2A 5AXDA 2FPIA 3KSDO 3A3YA 4XE5A 1V6AA 1HC7A 2NUAA 2VYQA 3B82A 4QU9A 821PA 5JAMA 3HO1A 5F3DA 1A7UA 1VM6A 4AZ3A 2HRRA 2J32A 4ID3A 1Q7EA 2WKRA 1B6SA 3KEQA 1HORA 3OM0A 4L9WA 4KO4S 4I3FA 5DNYB 1SR8A 1KE2A 4MGKR 1E2BA 2QG9A 5HGJA 3GLIA 2QT1A 5L3RA 1FQOA 3AERB 2PR7A 3GLTA 3ZDQA 4P93A 3Q15C 3MXOA 3IBSA 2MYUA 3FCAA 1USWA 2V7BA 1P1BA 1CJTC 1SC4A 3FWNA 4F84A 2WTMA 5JCOA 5JCXA 2VO1A 2YV1A 2FKNA 1PTKA 2OV6A 4M9QA 4PIVA 1CRWG 3OIVA 4TSFA 1YDGA 1W30A 4FGKA 4IDOA 1MC4A 4H4CA 3G2JA 1J24A 4BZXA 1YR6A 1G64A 4AZ0B 2VF2A 1JDVA 1DIGA 2O6LA 2WE8A 3QF7A 4C14A 5CEJA 1UEXC 1JHDA 1V3UA 4FUTA 5HFNA 2WQZA 2PKXA 2VZLA 4LXGA 2ZANA 1KETA 3KHTA 4Z49A 2C04A 3D8UA 1QHNA 2OXRA 1OFIA 3SSOA 1AB6A 2GCOA 3TEFA 1AKEA 1P7YA 1YC2A 5D3ZA 2BBSA 2BMEA 2VUTA 4D74A 5B36A 3I1IA 2GD2A 1ZQ1A 2Z83A 1HG1A 2HSWA 2QUIA 3NIBA 5FYDA 4HGPA 4PC1A 1LBQA 3OOYA 4GPD1 3C39A 2NU7B 4PHHA 2WWFA 2WIGA 5AK4A 3M5PA 2SKCA 3LWZA 1SU7A 1NLYA 4IVNA 2VHWA 3CH4B 2VHVA 4A73A 4CUJA 1Q5PA 3THYA 4ENSA 4DY4A 1U90A 4TKVA 5CDTA 2G5TA 3FUTA 1BU5A 1QBKC 3O8OA 3STHA 4RAQA 3TRDA 1YZTA 2NZXA 3RD5A 1QV9A 2QX6A 4GT1A 4JR1A 5IVDA 3WL3A 1KPGA 2XNSA 1A9XB 1IAQA 4AJ2A 4B75A 1EVYA 1V1RB 1DG1G 1W76A 2I7DA 3EIQA 3WK5A 1CUZA 4KXXA 4KQGA 5I8WA 1N5RA 3NHFA 4X8OA 1T4MA 2FMXA 4XPIB 3QX7A 2UU9B 3SC2B 3SLRA 1UBHS 4EJ2A 2Q3DA 4B17A 3RIHA 1BX3A 1ZN8A 2XZLA 3OTGA 2H0AA 3H2YA 2O8EB 4DY6A 1DKLA 3X1KA 3PNYA 3DEZA 4O8ZA 1R37A 1AQ6A 4URUR 4BAUA 1QK3A 4HQKA 4NU6A 2Q9CA 3LCRA 4EI2A 4LZNA 1E1CB 5BMVF 5JADA 1SCUB 3LCMA 1DMSA 1UJ2A 2HK9A 3A3NA 3TQFA 4CWAA 1XLTC 4EYKA 1RVV1 1YRWA 4OU5A 3AJDA 2P2YA 2YIMA 3NU1A 4TSFD 5BVGA 2QD3A 3DGEC 4H27A 3EZFA 3GNSA 4KPEC 2EX0A 2WYOA 2G25A 4BXOA 1AKYA 2KLBA 2G04A 3DQZA 3F5DA 4RBNA 5GWXA 3OZBA 3WSVA 4ACAA 1FFXA 4WBNB 1T9AA 4K9OA 3UH0A 1D4ZA 1GFWA 4JC8A 1HDEA 3FRIA 1AXRA 1JR3E 1QZUA 1N4DA 3JV7A 2PKEA 3NPAA 4KQXA 4B7UA 3OCUA 4FXOA 1MPTA 1V25A 3M33A 4MWBA 4B3XA 1KJNA 3BULA 1CW2B 1NRJB 3PC3A 3LPNA 1SY7A 1DNPA 5BWNA 3TLJA 4X61A 5TMEA 2IYYA 1QJ4A 5ALHA 4FDMA 3AJ8A 3U3RA 4RMJA 2II6A 3KVRA 4ZQIA 5EMLA 5JJLA 1TO2E 3JAWB 4W9RA 3NWOA 2BKEA 4KE9A 1CE8B 2I4LA 4MVXA 5EUQB 3T7CA 2JVIA 3ZDDA 3PRJA 3INYA 1RI4A 3FGZA 4D6XA 2ZK7A 2RD2A 2Z58A 3VR5A 4M1TA 4A8TA 2W2MA 1V7PC 521PA 1H2YA 2DR3A 3LIPA 2ZJOA 2F6RA 3A1NA 3A1TA 1YZFA 2V54A 2XB4A 2Z30A 2RH4A 1U0SY 3HG7A 3I6IA 3G23A 3HEAA 4MGYR 3ZV6A 2AK2A 1CUWA 1OT5A 2IHNA 2XUPA 1SULA 3WG9A 3GT7A 4AP5A 1IQRA 2G9UA 4R7GA 4F60A 1R18A 1F48A 3M83A 1M6WA 3P20A 1EZ1A 1Q91A 2HFKA 3C5EA 3STYA 2O5VA 2P5YA 2FJ0A 1MRNA 4MAFA 4BKRA 1RXWA 3AP2A 3BQNB 2EZ4A 3KAQA 5AIAA 3VTFA 4ZCLA 3H5VA 2NG1A 1PL6A 1SHTX 3SR4A 2Z6AA 2P2DA 2C3PA 1QVWA 2HI0A 2MSDB 2YDYA 2EBHX 3OO0A 4NOJA 4YI5A 4D96A 1IHYA 1I6MA 3WP0A 1DIAA 4F06A 1CVRA 5JTTA 1HG0A 4RETA 3AIMA 2FWRA 3GLFB 1F9EA 2BHRA 3U4IA 1LFAA 3LC7O 1DB3A 3IUPA 2IV3A 3NUQA 4J0FA 3T1QA 3KKKA 4YIKA 3H42B 4NBVA 3OQNA 1UBUS 1G5QA 5DHSA 1E2HA 3MAGA 2GETA 1H42A 4JJIA 2ZDHA 1W93A 1WSAA 3HE3A 4DLRA 5A0VA 4BJ1A 3MAAC 4UU0A 3QOXA 2FOLA 4CG1A 3EIXA 5CFRA 1HFWA 1X2EA 4TYPA 4ZI3A 1NP6A 3K0HA 4NECA 1M34E 2SCUB 4TTJA 3T7SA 4AWXA 4BVFA 4ZT2A 4LX0A 4RZ2A 4UOQA 1FTYA 1X3LA 4K28A 4Q9KA 1EDBA 3DWEX 4HX9A 1J8FA 4KQMA 3FPJA 1CVIA 1Z34A 3U9TA 4DIBA 2W2PA 4BWVA 1GSHA 2WE7A 4LEIA 5FOQA 3CPEA 4C6TA 1ITZA 1EIWA 2PWZA 4M7RA 1K08A 4XM1A 3DVAB 3S7ZA 2YR0A 4BNNA 1OGIA 5BSVA 2IIQA 1PBNA 2I67A 2VDQB 4ITVA 3BRQA 4JEMA 3WKCA 3EB9A 3CZ5A 3RV4A 1AGNA 2CCJA 2BUAA 2EERA 3H11A 2LVBA 2PD4A 5AOBA 1KFEB 3I9MA 2CHEA 4AUNA 4RTMA 5AXAA 3L7CA 4DBLE 3EPLA 1GZDA 3OPYB 5JIBA 1UR5A 1FCJA 3R5KA 3NV9A 2WWHA 3JW8A 1RQNA 2UZ1B 4KPYA 1UCFA 4DQUA 3CLTD 1QPZA 1YB5A 4AYWA 4RQTA 3L2OB 3J7AC 2IF0A 1VGVA 1X14A 4UVHA 1G3RA 5J2TB 2I8LA 3EY4A 1DWOA 2Y2VA 1EP3B 4OUDB 1FRNA 2HMYB 3IVRA 4ENRA 3DE1X 3B6KA 1GGEA