4IFBA

Crystal structure of sult 2a1 llgg mutant with paps
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
274
Chain Sequence
b'SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bile salt sulfotransferase
molecule tags Transferase
source organism Homo sapiens
publication title Sulfotransferase Selectivity at the Molecular level
rcsb
total genus 95
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ifbA00
2AK3A 1US8A 3CRW1 2ODEA 3A1VA 3Q7PA 2O0HA 3A4NA 4KFUA 2P67A 4A6XA 4DCSA 4KSBA 4LJ8A 4W5WA 3UK6A 1XTJA 3RWOA 5L3SA 1ETUA 1W7AA 4B43A 1OFUX 1C4OA 3C5HA 5FR1A 2IYUA 3BFVA 1JECA 2IEZA 1GM5A 1HA3A 5CYOA 2RGGA 2FSFA 4Q5IA 1KJYA 5E7MA 1E32A 1QHYA 2VP6A 4JLAA 2WBLC 4MDFA 1E0AA 2F1HA 3QXCA 5K8LA 3B60A 1Z83A 2D2EA 4FD2A 4RCYA 1KK0A 3U4QA 4C0KA 4R9UC 1V43A 3PUWA 4CEJA 3FE2A 2PZFA 3KXLA 4Q1DA 2G3YA 2VSOA 2VSXA 3B6EA 2W2VA 3U61B 3PCRB 1YJ5A 3MJHA 1OH6A 3TUIC 1ZW6A 2GKSA 4NYIQ 1FUUA 4LPSA 5E7IA 4TSFD 2ZRJA 2BIFA 2J87A 5GJBA 1ZM7A 4GOXA 2O5VA 4GZMA 1OKKA 1TEXA 1B23P 2X2FA 1XNJA 3UG7A 4KFRA 3IEUA 1KMHA 2OFOA 1JR3A 3ND9A 4D0LB 1G1MA 4LYFA 2IK8A 1W47A 3RSOA 3CNNA 5TDHA 2YC2C 1ZUHA 5H1YA 3DVLA 2ZR7A 3TRFA 1CF4A 5KU1A 4Q1FA 1TPZA 2ORIA 5JS7A 3GMTA 2PT7A 5AR1A 4A2PA 3VNVA 1KO4A 3LV8A 1T4GA 1XEXA 3LQQA 3PEVA 4RFVA 5G40A 1R0ZA 1IAQA 4BASA 2RGXA 4NYMQ 2FDCA 4ZDKA 3PUVA 4X8HA 4JSTA 1RW4A 4A9AA 1XXHB 4Z8YA 3HYRA 2P65A 4LHVA 3SR0A 1HY3A 3P1JA 1TQ6A 2ZRDA 4EKDA 1F3OA 2QORA 2ZRIA 4GP7A 4TTRA 5C4MA 3IILA 5CJ2A 5D3MB 3GLFE 3VKHA 2QNRA 2W58A 3FDIA 3KTAB 4BFXA 2AD1A 5F9FA 2I3BA 2F9LA 2R62A 4LY6A 1II8A 1AGRA 1JQJC 3AV0B 2ZJAA 2J1LA 4JLJA 4POAA 1UEJA 1CR4A 2C04A 2ZITA 2GBLC 3X1YA 3QOFA 2FFHA 1NVVQ 4TQAA 5B57C 3QG5A 2F3TA 1ZJ6A 3KJEA 2FZ4A 4OQNA 3O8RA 1E9BA 4HUQB 4MKGA 4TMWA 3T06B 3TIFA 4DJTA 4OHVA 3OESA 1Z6XA 1Z3IX 521PA 4CVNA 4U7DA 3CF2A 4M1OA 5DSZA 1G41A 1GNPA 1F2UB 4P32A 5EP2A 5FPHA 1NVWQ 4EJSA 2VQSA 3PJRA 3MG9A 1SULA 1CRPA 2VP2A 1HT1E 5AUPB 4QHSA 4X8MA 1AJEA 2VSFA 1KI1A 3IHWA 3ZIAD 2ONJA 2G77B 2QENA 3AH8A 5AJZA 3VNUA 1N0UA 4LGMA 2YWFA 3T15A 1OW3B 1R0YA 1AZSC 2NPFA 2VA8A 5IF9A 3K70B 1FP6A 3C14C 1DBSA 2AK2A 5IDVA 2CK3D 2H5EA 3AUYA 1S9HA 4G3XA 1E2IA 2O8FB 3RLFA 4US1R 4HLUC 5CB6A 2Z43A 4IJMA 1KIMA 2R44A 1YZQA 1JALA 1BS1A 2GZAA 2Q0HA 4MGIR 3NBXX 1NSTA 2NO7A 4FMDF 4FIDA 5EXTA 3WHKA 3BH6A 3HU3A 2GRJA 1Z0AA 4QNMA 1NBMA 3P4XA 1EESA 1OFIA 4UNQA 3EC2A 2RGEA 3B85A 4KFSA 4Q7KA 4MKIA 5IK2A 5HKKA 4ILEA 5JWHA 5FBQB 4QM7A 1IOZA 4MGZR 1ZVQA 2IWRA 4DHEA 2IXEA 4DLSA 3GLHE 2QMOA 1Q21A 1E0JA 3FHTA 1ZNZA 4PSVA 3WNBA 3FGNA 1XBTA 2FPKA 2ZRHA 3AVYA 3QENA 4Q9HA 4PQYA 3RANA 1E9CA 2DWQA 3LO5A 5AUQA 3AF0A 4US2R 3RS0A 1SXJD 4V0MA 2HCJB 4OL0A 2GK6A 4ZCLA 3HYTA 1MO5A 4PZZA 5FI1B 4Q1CA 2VHCA 3NTUA 2CXXA 2NQ2C 2A9KA 2XNSA 3K9HA 3CPEA 3GLFA 1E1RD 2EFDB 1Z2CA 1DO0A 2H17A 4H1UA 2NOAA 3AF4A 1I2DA 4Q4AB 4M21A 3AKDA 4PFSA 4LJ7A 3K0AB 5BWMA 4A1FA 4U5XA 1RIFA 1VTKA 2DPXA 1LS1A 2XZPA 1UKVY 4R71A 4R2HA 2CK3A 4TL7A 1F48A 1TMKA 1NKSA 1NIJA 3N70A 4FCVA 5E4FA 3KQKA 2XNDA 5LD2C 2WKQA 4ZI2A 4FN5A 2A5FA 4LJ5A 3Q7QA 4B74A 4OHZA 1IQPA 1HYQA 1P9NA 4MYHA 4NTZA 3VMFA 2GJKA 2ZJZA 3ASYA 3QY0A 4ZI3A 3OF5A 2C77A 2CNWD 2LWIA 3DKVA 3H4MA 4LK2A 1QHIA 1KNQA 2CL6X 1LS6A 4LJ9A 4NPHA 3TH5A 1Z6AA 3MLEA 1N6RA 1WMSA 2GILA 2XB4A 4Q7LA 4HAZA 5JSZB 3MWLA 5CB8A 1T3HA 1HE1C 4CEJB 1EWRA 4Q4JB 1R10A 1ZNYA 3C15C 2A78A 2HJGA 4PXAA 3CNOA 2AFHE 4ARZB 4MA4A 1H8EA 2EQBA 3ETLA 1E0KA 2BBWA 3I8SA 5KUTA 1Z0KA 1IHUA 3FHCB 1M1YE 1P61B 3T61A 1TQ2A 3OIWA 1GDDA 5EJEA 3OAAD 3CB4A 4BPBA 1CIPA 1FNNA 2Z0MA 4EAQA 2DR3A 1TQDA 2EFEB 2BMDA 1V5WA 1JI0A 3K09C 1GG2A 3GLIB 1DAKA 1YVDA 4QFMA 4B48A 3AEZA 3AVQA 4ACBA 2GJ9A 4JVLA 3SQXA 1WE2A 2PEZA 4FWTA 3TW4A 4C0HA 1JJ7A 1UPTA 3T1QA 1UBEA 3AKYA 4BQSA 2KJQA 2WIAA 1JXMA 2D3WA 2ZRAA 4C9BA 1FL9A 5CITA 3R8FA 3M0EA 1U9IC 4HDQB 4LC1A 4IXMA 4EJSC 2VHUA 5HKKD 2C78A 4MKFA 1NMZA 3R9IA 4KI0A 5L3QA 4Q1EA 3CR8A 2P5SA 1O3YA 2OEPA 2QT1A 3CZQA 3CWQA 4PHTA 3VAAA 5LB2A 2UZIR 4XWOA 4DLZA 4FMCB 5JCZA 3SQWA 2BBTA 1R8SA 1NN5A 2G0NA 3QEJA 4ZDWA 3PENA 1IBRA 5K8TA 2YZ2A 2WWHA 2A7QA 3KJHA 2R6DA 4E07A 3H84A 3AF2A 4ZCMA 4DB2A 1R5OA 5HE9A 4QJ4A 3K0CA 4UJ5A 3SEAA 1F6BA 3LX8A 4Q4HA 4BEBA 4Z54A 1XMJA 4P0TA 5A0FA 1HUQA 3CPHA 3NHAA 1KO5A 1ZIOA 4CGZA 1Q20A 4PZYA 3A4MA 4WOPA 4ZCIA 2Q3HA 5JHGB 1Z47A 2KSQA 4EFMA 1CRQA 1N6OA 1N6NA 1F2UA 2QN6A 2ZJ8A 2QMUA 2RGBA 2E87A 3QEOA 4HB0A 3X1DA 3GJ8A 3CRRA 5CJPA 2X77A 4D82A 3EX7C 2PLFA 2H7VA 2PEYA 3HU2A 3WXMA 2JLXA 1U8AA 3NC0C 2W0SA 1W1WA 3MUFA 1M34E 2V7QA 1EK0A 3VTKA 3CRVA 1MO3A 4QC2A 3FB4A 4Q4JA 1II0A 1OXTA 3ICQB 4K8OA 1SKYB 4PO8A 5HZKA 2ZRNA 4NE2A 5J4LA 4G5OA 5BQ5A 3IQWA 4WXRA 4QBFA 3Q5DA 5EZ5A 3S1AB 3P20A 1S1CA 3DDCA 2WSMA 4HLCA 1S8FA 4QGHA 2FFQA 3U2QA 3WYAA 1KDTA 4BECA 4KLNA 4S2EA 1T5IA 3K8YA 3GFOA 2CJWA 5C18A 2QPOA 3QI2A 1RRPA 5CIQA 1T3LA 1CJVC 1KNXA 2KWIA 4Q03A 4ZO4A 2WPDA 5K8IA 1IONA 2QU8A 3QE0A 5DNYB 2J0SA 5CM8B 1W49A 2OUKA 4F7WA 3BRWD 4JBYA 1ZUIA 2ORVA 4PO1A 3G5UA 3UANA 4DLWA 4RKEA 5G3YA 3GLGE 2QMEA 1CULC 2GCPA 4M53A 2V55B 3QXJA 3HJNA 2VF8A 3LLMA 2ZE8A 1TNDA 1DO2A 1I4LD 3REFA 1EFHA 1W4BA 5DYIA 5AUNB 1TQ4A 4D25A 4HSEA 3B1ZA 4UQOA 1HQYE 1QBKC 3CH4B 1COWD 2QAJA 4E09A 3AVXA 3EZ2A 1ZNWA 4XWAA 3SE0A 2HT6A 3W8NA 2JJ2A 1WBBA 4NZYA 1FUKA 2RHMA 1QG4A 2FEMA 3WY9A 4M4SA 2Q3MA 5SZIA 1KHTA 4BFWA 4G5SA 4CF7A 3ADBA 3KKOA 1RKBA 2Z5FA 2CMKA 1QHXA 2AWNA 3BS4A 3C8UA 3ECCA 1E9FA 4JLDA 4DXAA 1GRQA 1IN5A 4YMVA 2Q3FA 1PLLA 3TLXA 4TMTA 3THWA 4V0LA 2KBEA 2AN9A 1ZM9A 3HDTA 2MMCA 4L5BA 4DDVA 3THXA 4MKHA 2WWGA 4KODA 2Z6VA 1GTVA 2XJ9A 2ZE6A 5FTKA 4DSNA 3MFYA 1BOFA 4RZUA 4WW0A 4PC3A 5H68A 3VHLB 5DH9A 3UWKA 4UNRA 2ZSDA 4LC0A 1UAAA 1KI3A 2W6JA 1GILA 3LAWA 3P32A 1MH1A 1SXJE 3LVQE 1E6CA 5KNDA 2FWRA 4LJAA 3U60B 1P2SA 2FSGA 4Q1AA 3F5FA 4Q00A 2JCSA 4OQFA 1ZMXA 4Q9JA 3IBGA 4TWZA 3RRMA 4MQBA 4L8GA 5EQTA 4PPNA 4IOMA 5FUXA 3CX7A 5EP1A 2C03A 5JCPA 3K70D 5EUMA 3LX5A 4ARZA 3PUXA 4B2LA 2VEDA 2IT1A 1UBGA 3O8BA 1Z0JA 4IDPA 5FL7D 5EE9A 4YLGA 4A0FA 3A6PC 3LBIA 1PUIA 2O8DB 1KAOA 1YZGA 5B64A 1KDOA 4HAYA 4G0NA 5SZJA 3FMOB 4XSHA 1KO8A 1GZSA 1U2RA 2IXFA 4HDOB 1E4VA 3BC1A 3E5HA 4RD1A 5CK4A 1KMQA 2ATXA 2NZJA 1OIXA 2J7PA 1ZYUA 3O8DA 2JJ1D 2C8VA 1SKQA 1HH4A 1DG3A 1TF5A 4PPGA 5TXGA 4PPQA 2J0UA 2WWFA 4O25A 1T0HB 2OT3B 1KZGB 2BWJA 4OHXA 4DCNA 1FMJA 2RMKA 1UDWA 1FQJA 4TL6A 4PANA 3T1VA 4S35A 3EA5A 4TQUS 1Z8FA 2OXCA 4RD6A 3QIAA 3GLIE 1NJFA 4JVSB 4D2IA 2QL6A 2G1JA 5D3MA 2JASA 3KFVA 3B82A 5B2ZA 1RVDA 4PAOA 4C0BA 2P0EA 1R0WA 3HR7A 4XH9B 2QTHA 3TK1A 2HXSA 2Q9AA 4AKHA 2FH5B 4HAWA 2GF9A 1A2KC 3BD9A 3EWAA 3O8CA 4JL6A 4TLEA 4CRWB 3EIEA 5AJWA 5E95A 2FZLA 4NCJA 3U6BA 3CW2A 3FVQA 3DO6A 721PA 4FMCF 4PC6A 2A5JA 2V6IA 3LVRE 4BRWA 4LHXA 5JSZA 1RFLA 4EPYA 1GRRA 4WIAA 1OKKD 3U4QB 4OI0A 3W5IA 2A5DA 2F6RA 4ESHA 1YKSA 2FEOA 3JZMA 4BUJA 4F38A 2BM0A 5DI3A 4EDHA 4A92A 3AUXA 4AKGA 3U7EB 1NVUQ 4EPXA 1H8HD 3K70C 1GRNA 2IUSA 1MOZA 3PV0A 2GCNA 2ZRFA 4IFEA 2FJUA 5AWFC 4B35A 2RB4A 4A36A 2YWEA 1YZTA 2CCGA 2ZVPX 3GFPA 3IIKA 1W36D 4RD2A 3DZ8A 4LBZA 1MT0A 421PA 1SXJA 4P4SB 1XF9A 2GA8A 3AF3A 4WXPA 2ZROA 2CE2X 3BBPA 1US8B 2F43A 1UEIA 3TSWA 4EQ6A 2VO1A 4DCUA 1NP6A 1W0KA 3P26A 2WKPA 2RKOA 2A5YB 4QOSA 3M4YA 4IOKA 3AVTA 3KZ1E 1XEWY 2ERXA 3ADDA 2IUTA 2QM7A 1ZBDA 1J99A 1CTQA 3DPUA 3TE6A 3ZVNA 2B8TA 2VTKA 1G8GA 2ZSFA 4UNPA 2VHQA 1YZUA 1S3GA 5FL7A 1EX6A 2XX3A 3IUYA 2R65A 4EPVA 1E98A 4KO8A 4BRUA 3GLFB 2B92A 2E1RA 3WBKA 1XXHA 4MGKR 4L15A 4JLPA 4NONA 2G6BA 1E9EA 2B6HA 3ZS9A 2IHBA 3C7KA 4B34A 4CDGA 2O8CB 4JLOA 1LB1B 2H16A 4JZKA 4A15A 3BFKA 3CUEF 2EYUA 2JATA 2ZYUX 2HDNB 1HE8B 1OXSC 2BM1A 3GJ3A 2CNWA 1QF9A 1T91A 3AGPA 2QRNA 4IHQA 4A2WA 2P3SA 3TR0A 3C16C 3VR3A 1IN8A 4DDTA 4YDHB 4XWKA 3AVUA 2QSZA 2Q21A 1GIAA 5CDFA 4CEHA 2AXNA 2R6FA 3SN6A 2WJYA 2QPAA 4XVUA 1BYUA 2HF9A 3FOZA 1FW6A 4CEHB 2XAUA 2HLDD 1P3JA 3I3SR 4O2RA 5HR5A 2ODBA 2QP3A 3J81k 2B7CA 1H8ED 1Q0UA 1E9RA 1NVVR 3SZRA 3WMGA 2QBYA 1VCNA 3LBHA 5KDOA 4R7ZA 1L7VC 3PXGA 3I1FA 2J5XA 3DEFA 4NP6A 1OB5A 3V4RA 4M9QA 2GXAA 4GDFA 1IN4A 3W5JA 4AYXA 1Q1QA 4M0LA 4QKQA 2RGAA 4TMVA 2QAGA 2OSBA 3HPRA 1MV5A 3GEIA 3K0FA 4GI7A 4I1OA 2D06A 1DAIA 3OE7D 4D4JA 3IKJA 1HEIA 3MJRA 5JHHB 1NVXQ 3OEED 2BCGY 2EYQA 4II7A 1LNZA 4AYWA 5JEDA 2JLSA 1P9WA 3ZDQA 3C4JA 4CT4B 2BV3A 3T1OA 3RWMB 1G64A 2WVJA 2A5GA 2GCOB 3KQLA 4WVFA 5AJVB 4BWYA 4BZQA 2UZ3A 1JPNA 3L43A 4M1TA 2W2TA 3ZYCA 4D0GA 1U0HC 1CKEA 1FZQA 1N6IA 4M9XA 4GOJA 4MRNA 1CR0A 2GJSA 1OV4A 1E79A 4TLAA 3RC3A 2QAGC 4LJYA 3THXB 4PAQA 4IW3B 2PZGA 3QKSA 4I1VA 3R9WA 4AG6A 3ZGXA 2F1RA 2XOKD 1NBMD 2P5TB 1M7GA 5AJYA 3TVDA 3WHLA 1DG1G 2ZQ5A 4QBHA 1OH8A 4V0OA 3WYFA 4KCGA 2NO0A 1CXZA 3B13B 1XEWX 2ZUCA 4IDHA 2WJIA 5BN5A 3E2IA 3A8TA 4KAXA 3K9NA 4B75A 3SJBA 2AKAB 1VG8A 1XTRA 1F2TB 4NYIR 2WAYA 5FOTA 3BFXA 2BOVA 2ZS8A 4OYHA 3U44A 1TL7C 1KO7A 2W2XA 3ZZ0A 2IBMA 3L8ZA 2W6JD 1YE8A 4PR0A 3ASZA 2ZYWX 1G21E 2YWHA 5TMPA 4HB3A 4M9ZA 1BH2A 4XJXA 4A8JC 4V03A 2D2FA 3D8BA 3W9YA 3QBTA 3FKQA 1KZ7B 5KYKA 2C2HA 2RCNA 3QNUA 4OQXA 1E2DA 2N42A 4KYIB 4HAUA 1TEVA 3UKDA 1FQKA 2GBLA 5CM9C 4DWJA 1LTQA 1VHTA 3THYB 3FKSA 2IYWA 2HEIA 4QJ3A 1Z5ZA 4EPRA 2NPIA 3VFDA 4CEIA 3WMFA 1K5DA 1G6OA 3E70C 2BBSA 4NU0A 4DUGD 3RYTC 2G0TA 4NMMA 5EE3A 1PLJA 3QPUA 3TNFA 3A1WA 4IDQA 1XP8A 3U5ZB 1SKYE 3NBZC 4LRWA 3SJAA 4GPTA 4OK5A 4QRHA 2O52A 1GP2A 1Z6GA 1XCPA 2ZSBA 1KI6A 4IVRA 2YWGA 3B1YA 2G1KA 5CLLA 4B76A 1ESMA 2BEKA 5J4VA 2J7KA 4B6FA 2HYDA 1KI4A 4D0NA 4Q47A 3LBNA 3PR1A 1VMAA 1RZ3A 2RH5A 3ONWA 1OYYA 1UBFA 1MRNA 2I4IA 1IXSB 4HZUA 1WXQA 2BMEA 1ZAKA 2ZPTX 5UKDA 2O8BA 1NMYA 4U02A 1W36B 5KSYA 3BB4A 3DMNA 2QI9C 5JLJA 3VHXA 2IS4A 1RC8A 1YZLA 2QP4A 4BFZA 3HP1A 2OFXA 3IDQA 1ZINA 3S1AA 4A4DA 1DTSA 3JVVA 2OLKA 1XD2A 2C99A 4RD3A 5FH9A 1DEKA 2FPMA 1AQUA 4JVMA 1BKDR 2QE7A 3R8CA 3VKWA 1PV4A 2C98A 2J0UB 4YDSA 3K0SA 2H18A 4WBSA 5JRZA 2PMKA 4LHZA 3BOSA 3IPXA 2HXYA 2Q6TA 4DLXA 4E5UA 1RJ9A 4DSOA 4ITRC 2G9NA 4PSKA 1IJFA 1E96A 3RVBA 2H8KA 3HR8A 1KKLA 2WHXA 2XTZA 2WSSD 1KO1A 2B7BA 1NSFA 2O8CA 3AKCA 2W83A 2OBLA 1Q44A 4DUGA 2BJWA 4YQFA 1P75A 3R7WB 1UDXA 5P21A 4WA7A 4UXJA 1D2NA 3CKLA 3KJGA 4P33A 2BKEA 2G83A 5DI9A 2VF7A 1YHNA 2WTUA 4CW7A 3FFAA 4HUTA 1U0LA 4N0EA 5G41A 3PUYA 5KOYA 4HLDA 1S3SA 1E2LA 1L4UA 3DZDA 1HTWA 2FU5C 4LZZA 5CIWA 1FOEB 2ZREA 5B58C 3DM9B 1CJMA 4F93B 4DZZA 1SVSA 1WB9A 4IOJA 1B0UA 4PTLA 5F9HA 2F43B 2UVQA 1T6NA 4KV9A 1U0JA 3Q3JB 4TMZA 1T8TA 2IF2A 1CJUC 5HCNA 5KSPA 1RYHA 1OXXK 4U00A 5AJXA 4NKRA 3JVUA 3LH5A 4C0QC 5GJVC 3X1XA 1EFRA 4I1UA 1NBME 2IW3A 4JBXA 1NY6A 2H57A 2PLRA 1KK1A 3CM0A 1ZIPA 2BCJQ 3FMFA 4LWZA 4MRRA 4XVRA 2GDJA 1M6NA 2IWHA 1YR6A 2VHTA 3U3RA 3SBDA 4QJ5A 4CT5A 2HF8A 2VP5A 4FXPA 5DI3B 3B7GA 1OHHA 3K9LA 3EPHA 1ONBA 1Q3TA 1MABA 2ZRCA 3NH9A 2ZI3A 1KI6B 1N0VC 2NG1A 2F1IA 5EE1A 1G3RA 1MR3F 4LHWA 2NMVA 1Q1BA 1G9XA 3NXSA 1OXVA 2ZIAA 3KB1A 1KY2A 2A3RA 2PMDA 3EZ7A 3LA6A 2PJZA 2OAP1 3LW8A 4HI0E 4OHWA 4ZKEA 1VG9B 2I1VB 3I8XA 2X1VA 2ZSAA 2CLSA 2P6NA 1SVLA 4JT2A 1WP9A 1VYVA 4C4PA 5JJLA 3SNHA 1N5IA 1SGWA 3KFXA 3MMPA 3QPVA 1AKYA 4TMKA 1M8PA 2GEDA 3AF1A 1RJ9B 2ORWA 2D7DA 2FA9A 4LV8B 3C41J 4GMDA 2Z83A 5H8WA 1UADA 2REBA 4OHYA 4TLBA 3EIQA 4BFTA 3ZZTA 1NI3A 4LBWA 4Q21A 4URWR 1I2MA 2F1JA 1E2KA 2OM2A 4OI4A 1ZUNB 1XRJA 1FX0B 4GOKA 3L82B 4PQRA 2QPTA 3X1WA 4JVNA 4GFDA 5JWOA 1CR1A 2ZE7A 2YV5A 2VBCA 1RRFA 2IEYA 1XPOA 4MYUA 5C1BA 5C46F 2IX3A 4ERNA 2YHSA 3LNCA 4D4MA 1IM2A 2ZYTX 2GCOA 3UXMA 3DHWC 2FN4A 2QA5A 3ADKA 3GJ7A 4JYBA 2OBMA 4M1SA 5FTNA 3VR4A 1F2TA 4DEYA 1KJZA 4Q7JB 1P9RA 2QY9A 4F4IA 5GVRA 4M1YA 2IYZA 3KKQA 1Z06A 1XU4A 2JA1A 3GJXC 1S2MA 1HT2E 4RFSA 1G3QA 1VIYA 2ZTSA 3FKSD 5FFMA 3U7GA 2HT1A 3U3OA 1EFTA 1AKEA 3GJ4A 1NNEA 2Z4RA 1W2GA 5BYKA 5TV2A 1RE0A 1W46A 2OV2A 1IXZA 3BB3A 2Z4SA 4FCWA 3CBQA 2Y8EA 3VR5A 3IIMA 1QRAA 1PUJA 4DKXA 4NCIA 1GL9B 2V6JA 1P2UA 2V54A 2DFKB 1SVWA 3L0OA 4FMBB 2BVNA 5TARA 3WYGA 4IKEA 4QNRA 4ABYA 2KE5A 4EPWA 3R20A 1GAJA 5FOWA 2AD5A 3KKMA 2AXPA 1P73A 3W6NA 4LV5B 1L8QA 4W7SA 1OE0A 2QROA 4KITB 2DWPA 2V1XA 1G8PA 1G7RA 3GLIA 5JFGA 4Q19A 4KSCA 3PITA 4EJSB 1CBUA 2XZLA 5KPDA 1TF2A 3VR2A 1J2JA 4TLDA 2CL0X 4K81B 1AK2A 1G291 4N0DA 5JMTA 2EFHB 3WRYC 3EG5A 1N5KA 2QMHA 4F4CA 2VHJA 2QTVB 4QGAA 1DOAA 1G5RA 2ZVQX 4Q4HB 4TYNA 4PHGA 5GJWC 3BGWA 4ZIRB 4C3ZA 2O8FA 3SU8A 5L3SB 3KUDA 4P3YA 4LBYA 5FPTA 3UMFA 1XMIA 1GSIA 1NIPA 4M1KA 2J0VA 2ZUDA 3FMIA 3AGQA 1EFCA 3SOPA 2WWXA 1VG0B 2AHOA 3TUJC 2MMGA 4LCBA 4LJ6A 1N6HA 4QGFA 1Z0FA 4WZAE 2DFTA 621PA 2BC9A 2ZRMA 3KQHA 1X86B 2FSIA 3MGCA 1Q1ZA 5FPYA 2R6CA 4OJQA 5HZHA 5FOSA 4NCKA 3FYHA 1GL6A 4BLSA 4TYYA 2ZETA 2ZS9A 1OH7A 3LY5A 1C1YA 1VG1A 2D74A 2N1BA 1GKYA 4TYPA 1X3SA 4Q7MB 2OCBA 3OFND 4BFUA 2C9OA 3B9QA 1Z0DA 3ZVRA 1DAMA 1LW7A 1E1QA 1E3MA 5DE3A 5FI0B 5ELXA 2ZE5A 4AKIA 3CZPA 5LD2B 2BMFA 3K53A 1SXJC 4PC2A 4I99A 4P31A 4TL8A 4IDNA 1QHHB 2FSHA 3I72A 2IHYA 4JBWA 4D4KA 3NH6A 4ZPXA 4TT3A 4O0MA 4C0AC 6Q21A 4JIMA 1P72A 4KJZA 4A0RA 4B2IA 2AFIE 3B8HA 4G5GA 4P4TA 5FTMA 1KI7A 1J90A 2WWYA 4DLTA 3TAHA 2H92A 2SHKA 3TR5A 3D3QA 3FHOA 1S1MA 1G16A 4Q4AA 4CZ2A 2O0JA 1G7TA 4C2UA 1XXHE 2AX4A 2C9YA 1LVGA 2GWHA 2I1QA 3MRSA 1KK3A 1FNMA 3UPUA 1VCMA 2O8BB 1UKZA 3IO5A 3BE4A 3KQNA 4ZDJA 3Q72A 1C9KA 3PEYA 2J9RA 3ZQJA 3UMRA 4Q48A 4W5JA 5AK0A 2J0QA 1LF0A 5KNBA 1ZP6A 1AZTA 3KB2A 2X19A 3CX8A 4RD0A 4Q9IA 1KTVA 4RCZA 1G7CA 3CPJB 1QDEA 2NO6A 5IHPA 2XB2A 2GTPA 3GD7A 4DCVA 3EC1A 1E2JA 1JAHA 3BAFA 1BMFA 1M7BA 2GZDA 4FCTA 4QHYA 4RSGA 5KO2A 3RS5A 3A1UA 1XPRA 2WMOB 1W48A 1XWIA 4HAVA 4QBIA 1G8HA 4BLQA 4D26A 1MO6A 1KMHB 1R5BA 2BEJA 2YC4C 4ZIRA 1G7SA 2VP0A 4DLRA 3RS2A 1XTIA 3FTQA 2J3EA 4B73A 4C0LA 3TAUA 5J4KA 1TAGA 1MRSA 4YMUA 1L4YA 3CF0A 4PC1A 4UNSA 2OG2A 4AY2A 1JR6A 3G82C 3PVSA 2IYXA 1EGAA 2AR7A 1LV7A 4HUQA 4LX0A 3LXRA 2OHFA 3QXHA 3ZVMA 2JJ1A 4OI2A 1YR8A 1XEXB 4J0QA 2XTNA 4B3DA 1YRBA 5J4YA 2MSDB 4C2TA 1X8JA 5JJKA 1R5NA 3REGA 4Q66C 2ZI5A 3I4LA 1AS2A 3BXZA 4LOAA 1R7RA 4RY2A 1COWA 1S9DA 2CCKA 3EZ9A 4A2QA 1A7JA 3L2OB 2ZJBA 5FBWB 3D6TB 3IBYA 5L3RA 1AIPA 4NH0A 3EIHA 1E1QD 2OBNA 4JMPA 1VPLA 3EPLA 4Z1MD 4PSAA 5KNCA 2ZJOA 2WWIA 2F7SA 2W6IA 1II8B 1YR9A 4QGGA 1GWNA 1JQLB 1N2CE 5GJCA 2ZXUA 3QJYA 5C2JB 1HURA 3SS8A 3HWSA 2F9MA 4LDJA 1XCMA 4HLUA 1KAGA 1W5TA 3NKVA 3TQFA 2IXGA 5BN3A 4PX9A 5LBIA 4ON9A 1A5TA 2FV8A 2EU8A 4N1AA 2NIPA 2WM9B 3BK7A 2OILA 3KXIA 4KVAA 4BLTA 3EAQA 4B2PA 1G19A 5JI3E 3RNLA 1YRAA 3EZ6A 1ZC4A 4MUBA 3SHFA 4JSYA 4DLYA 1NLFA 4BFYA 3RRNA 4LYJA 1QHHA 2IS2A 1JPJA 1NN0A 3P27A 2GHIA 4QHTA 5BN4A 2K5UA 1I4TD 2YOGA 1BIFA 1XZPA 4D4LA 1W44A 2XJ4A 4P4UA 3DM5A 4RVCA 4OQLA 3BJIC 5A4JA 4YMTA 1VDZA 1Q1EA 1AM4D 1Z0IA 4KBGA 1VYUA 2OXRA 1XZQA 3FWYA 3N2IA 1KSHA 2GJ8A 3CRMA 3B78A 3TUZC 2RGNC 5EP4A 4R2IA 1DS6A 1G20E 5KDDA 3WP1B 4L4UA 1IN6A 4Q9LA 1ZD8A 4WAUA 2FX3A 3EXAA 3VU9B 1E1RA 1OSNA 5H70A 1EX7A 1N0WA 2JDID 1HQCA 1GKUB 2AKYA 4URZR 4K46A 4O3MA 4TYQA 3CRQA 4DBLC 4ZDIA 1M2OB 1IJEA 3SHWA 1Z6YA 2LCFA 1GL7A 3K09A 4FW9A 2FFBA 1OXUA 2CLDX 1CLUA 4HAXA 1CU1A 2CCJA 1E94E 4LI0A 4Z8XA 1QG2A 1QVAA 1UM8A 1GITA 2PCLA 3VR6A 3IEVA 3O47A 3R9XA 5DO9A 4JKIA 1BMFD 4B33A 4NYMR 1KKMA 2OZEA 3OEHA 4AKEA 4DIDA 3Q85A 4PHFA 4MH0R 3R7WA 3SFVA 4P4SA 1T5LA 3NVAA 2IYSA 3RHFA 1K6MA 5L8VA 1QHSA 2B8WA 3UATA 1U99A 3NEYA 2BHRA 1JBKA 1UJ2A 2GVZC 2CEAA 2W6ID 3DKPA 3PEWA 1G3MA 1F5NA 3KQUA 2DFNA 5J40A 4TZ6A 1TUIA 1UF9A 2VL7A 5JI2E 3I32A 1G4AE 4HYYA 3ZS8A 4E22A 2XSZD 3AVOA 3SYKA 1F60A 1VIAA 4JLMA 4URVR 5TVKA 1FPMA 1XMSA 2O0KA 3SYLA 1U8ZA 4DC9A 1XB2A 2R6AA 4FWIB 3QXXA 4FI3C 5FPKA 1NN1A 3F0TA 1UBCA 3U3MA 3TSOA 1KK2A 1VYTA 2JLVA 3NIBA 3MAAC 2J45A 1Y3AA 3ADCA 3EPJA 4JJZA 4XSGA 1G5TA 2C95A 3B1XA 3NBFA 5IT5A 4YC7A 1CJTC 4V0NA 4A82A 3ND8A 3PEUA 4Q1BA 3AVVA 4G5RA 3TGPA 1P7CA 3QBVA 4JLNA 4GSYA 4L16A 2OCAA 4PAMA 5EUQB 1TX4B 1K8RA 4MGYR 1IY1A 4PZLA 3RABA 4A0HA 1X8LA 4UXHA 5KSOA 3MWKA 5DISB 3PG5A 2RAPA 4XIGS 2Q9CA 1JAIA 3QVUA 3T5GA 3OAAA 4YONB 2RGNA 3Q8XB 4A0GA 3B9PA 3SC3A 3U3JA 3UWOA 4YMWA 4V02A 3A58B 4L9SA 1G4UR 4KBFA 3T35A 1R2QA 3A4LA 1QZXA 3IO3A 1YZNA 5DLQC 4TT3D 3GLGB 4OI1A 1T8UA 5FBVB 4JT4A 2YYZA 1XCGB 1RYFA 1OIVA 3GFTA 5FL3A 2FFAA 3HU1A 3MWJA 1CR2A 1XPUA 2ZR9A 5DN6A 1WDTA 4AWXA 3B2EA 3W3ZB 4EPTA 3K0EA 2OESA 4LHYA 4EFLA 3LRPA 5FTJA 2ZI4A 4N3NA 2ZM5A 3ICEA 5FTLA 5AUOB 4C0SA 3OFNA 2Q9BA 2REXB 2FOLA 2R9VA 3JZAA 4DEXA 4B3GA 5E7JA 5GVSA 4TYWA 4KYUA 2ZJYA 4RFSB 2JEOA 2FE4A 4TL9A 2QGNA 2R2AA 5TY0A 1W36C 1AN0A 1XD8A 1S96A 2H1LA 2PH1A 5M04A 1NKTA 3N5CA 1J7KA 4AG5A 3K0FB 1X8KA 4B3BA 5FPSA 3EW9A 3EASA 2ZI9A 4CIDA 1A4RA 3KX2A 5DIFA 5KTYA 4TLCA 2GXSA 3QPWA 1ZM3A 2O8EA 4LYHA 1G3UA 3TW8B 4F91B 2ERYA 4XVQA 4H1VA 2V3CC 1E79D 1NLYA 2BBOA 3GJ6A 4PO9A 4URXR 4B3XA 1VHLA 3W6OA 5J5CA 2CL7X 4XOIA 4RD4A 2CJWB 3W8RA 5JJIA 2B21A 1JEEA 4NDZA 1D5CA 3OIUA 4ACAA 2J7PD 2CHGA 3CH5A 2ZRLA 1PJRA 3ZD6A 1NJGA 3LW7A 3UMSA 2JIZD 3M1IA 2V1UA 2OFWA 4DVGA 4B6EA 3AVWA 2XTMA 4B71A 1HV8A 1N5LA 2WOJA 5L3QB 2WAXA 2IUUA 3GP8A 1NMXA 3RS7A 2PBRA 1M7HA 3VQTA 2PJRA 1KJWA 4UXIA 2ZAMA 2ZYVX 1G18A 1KDPA 3WP0A 4DT1B 5CYPA 2WZQA 4MYTA 3LDAA 1T0JB 2O8EB 1H65A 3QKRA 2QZ4A 4GZLA 1Z63A 1GFIA 3QKRB 4QBGB 2DFLA 4IEIA 4Q01A 3KKNA 5IRCD 3ZIAA 1E4YA 4UKDA 4JKYA 2JGNA 1P60A 5JEEA 3ZVLA 1W0JA 1DAGA 2NO1A 3K1JA 4NYJR 4DLVA 2DBYA 1OLOA 5BW8A 2CE7A 3QUSA 2OLJA 4E03A 1U98A 2YOHA 2JAQA 1XTKA 4IOLA 1P6XA 3AVPA 4RZ2A 1XJ0A 4EQ6B 2KI5A 1WA5A 4Y0VA 5L3VA 4NL4H 5FBLB 3LXXA 1TU3A 3AB3A 2DWOA 5HPYB 1GUAA 3TKLA 821PA 1I4DD 1ZD1A 1OFTA 4Z1MA 2QBYB 1Q12A 2DB3A 5CLQA 3A36A 3AP1A 1ELOA 2HYIC 4URYR 3F3YA 2GETA 1J8MF 2QT0A 3GJ0A 2WWWA 2XITA 2P2LA 4W9MC 4TZ0A 3I5YA 2FG5A 3LD9A 1ANKA 1GVNB 3MWYW 1A1VA 2QG6A 1NG1A 3U6KA 2VPPA 1Q57A 3GJ5A 2IF0A 4G5QA 3U44B 3OIVA 4UJ3A 1E69A 1E9SA 2W00A 2QE7D 4XTCS 1ZRHA 3TSZA 4DB4A 1Z2AA 2DHRA 1P2VA 2RHDA 4LJ4A 5DN6D 4AURA 4UNNA 2CVFA 3MD0A 2DY1A 2WJJA 3GQBA 2BKUA 2JJ8A 3U3KA 8OHMA 4V0ME 3Q5EA 1N6PA 5C4GB 1OJLA 3H2YA 1O87A 2IYVA 1E9DA 2IL1A 4FINA 1TTTA 3U7HB 1TF7A 1WCV1 4NBSA 1KI9A 1QHNA 3MCAA 2GEUA 1WQ1R 4HZUB 2WPDD 5FUWA 1SVKA 5EXXA 4C30A 3RRZA 5TB5A 4GBMA 1GKIA 3Q9LA 4ZKDA 3OE7A 1W5SA 3RC8A 2WMNB 1GOTA 4M9SA 3WMEA 1TADA 1FMLA 2PCJA 2WOOA 2JIZA 1ZD9A 4OJKA 3K0AA 2ATVA 1KDRA 4HZIA 4YXWA 3DMDA 3GEEA 4B3CA 1OPXA 2FPLA 3SDZA 1E2QA 3KL4A 2IYQA 3SJZA 4BFVA 1DARA 2DYKA 1BYIA 1D2EA 2LKDA 4M22A 1RRCA 1PVOA 4JJKA 4EUNA 3A37A 2J59A 3L0PA 2EFGA 1Z22A 4NCNA 3X2SA 3AM1A 2ZSEA 3OEEA 2HCBA 2XEXA 2F3RA 1E2FA 3I5XA 1KSGA 2ZR0A 4Q18A 1Z6TA 4B32A 2ZU0C 4LPKA 1VECA 1XD9A 1CS4C 1YR7A 2YKGA 4OBEA 3AKEA 3FFBA 2GF0A 2QM8A 3K0CC 1XJQA 1RRGA 5JRJA 3TVTA 2P6UA 3CLVA 1SHKA 2KBFA 1ZCAA 4JLBA 4R98A 5HCIA 1PZNA 2EFCB 3ZD7A 2V7QD 4TTQA 1GNRA 2W0MA 2PX0A 4I4LA 1ZCBA 5EE0A 3EPKA 3THWB 3CONA 2E9SA 5HE8A 4ZV4A 1AS0A 3GCGA 5F3WB 1OB2A 4CEIB 3MSXA 2QQEA 3A1SA 3H86A 3WNCA 1AA9A 4LBVA 1MO4A 4IDOA 5G3ZA 5G53C 2C9CA 2ONKA 4JYCA 3UG6A 1SXJB 1FTNA 4HB4A 1XEFA 1P62B 1W4CA 3DL0A 3PUZA 4QL3A 2GAAA 1E99A 2MSCB 3LFUA 1U9IA 2ECKA 3EARA 3QXSA 4JLKA 4Q4LA 1W0KD 3T1TA 3L0IB 3LLUA 4GP6A 3L0SA 4RZXA 1E0SA 2GK7A 3NDPA 1VCIA 2R6GA 2A30A 5DYGA 5FUYA 3TQCA 1A82A 4LV6A 2WV9A 4IXNA 1KY3A 2VP9A 3W34A 5K8UA 3GLHB 4MYCA 4QG7A 3NG1A 2MSEB 5JZVA 1FFHA 4B3FX 3V9PA 1E2HA 1X1RA 2ZANA 4DLUA 4TN1A 2N46A 2IYYA 4G01B 2VH5R 4M1WA 2HV8A 1BO6A 1EXMA 4KU4A 2FMXA 2LKCA 1U90A 1W4AA 5KDLA 2EVWX 2GAOA 2JLQA 1MABB 2AL7A 2OCYC 2PZEA 2ZRPA 1SVOA 1Y63A 4MRPA 4ESVA 1JR3D 2D4HA 2GVDC 4F92B 1T9HA 4AIIA 4TQ9A 1EFUA 2XOKA 1TUEA 1N6LA 4H9GA 4PQFA 1K5GA 4BFSA 2EWVA 2XXAA 2X8AA 4A8JB 4KHZA 1IN7A 1OT3A 4GRAA 4A8JA 4QXAA 1OYWA 5IK2D 1UKYA 3IPYA 4HLQB 3ZLJA 5F2EA 1EWQA 5SZKB 4DDUA 2TMKA 1WF3A 2FNAA 4Q9KA 3GLHA 1IY2A 3SFZA 2V8OA 4I1SA 3KKPA 1OF1A 2ODNA 1ZNXA 1N3BA 1XMVA 2HUPA 2XGJA 1KOFA 1XX6A 2CDNA 4XD7A 4IVQA 4BZXA 2YOFA 1FTSA 3QQ5A 3OZXA 1ZC3A 3X1ZA 3CNLA 4DDWA 1KI2A 1SVIA 5D3QA 4NCHA 4XTRA 1E2EA 3QF7A 2QQ0A 3PFIA 4GMXA 4JL5A 2QRZA 3SYNA 2GJAA 4DRZA 2J41A 5FR2A 1ODFA 2QAGB 3KUCA 1DAFA 4B47A 4EIWA 1KI8A 4US0R 4AYTA 3BH0A 5EXPA 2D62A 1Q3HA 2FGKA 4IEEA 3PQCA 2IS6A 2JLRA 4IFBA 4KXFB 2L0XA 2PL3A 4OK6A 2JLWA 3BORA 4FMDB 2CVHA 2WJVA 3GEHA 2G88A 4HEJA 4TSFA 3KDSE 5DHAA 1UKEA 1N6KA 4IRUB 2QGZA 3HPQA 5DGXA 121PA 3THYA 3V4FA 1X1SA 3I62A 4Y0AA 4DT1A 3TMKA 2VRWA 5EXSA 5BXQC 1M74A 1Z28A 3NWJA 2R8RA 2ZS7A 1G8YA 4M8NE 2FGJA 1XFAA 4HB2A 1II9A 2O8DA 5E3HA 2ODWA 1AGPA 4KVGA 4Q02A 4HATA 2VYFA 4AD8A 3P4YA 2WJHA 1ESNA 1NRJB 1DAEA 1YQTA 2GXUA 2DCUA 3AQ4A 4JLVA 3LQRA 4ASUA 4BLOA 1RPZA 3OHMA 4JL8A 3AP3A 2REOA 5FOUA 3QKTA 2ZJ5A 3TJZA 2RGDA 1CP2A 1NL3A 4DSUA 5LB4A 4D6PA 4C0JA 2JLYA 1KSJA 1P5ZB 1LF5A 4L9WA 3RAPR 1SZPA 1UFQA 4MITA 2WKRA 3TBKA 3WRXC 4D81A 4WZ6A 1OH5A 4AC9A 4DSTA 4NYJQ 1EFRD 4RJLA 1YU9A 5CK5A 3ZJYA 4AI6A 2IC5A 4W5HA 1G5PA 1MKYA 1DADA 3D31A 1NY5A 1XTSA 4OQMA 3AP2A 1U94A 5A5GA 3U7FB 1IY0A 4M2LA 4URUR 2EWWA 5LPNA 2BMJA 4X8OA 2GZHA 4Z51A 1XD2B 3IHLA 3QKSB 1Z07A 5JBQA 3BERA 2XXAB 3DOEA 1E2MA 3I73A 3RS4A 1DVRA 1H8HA 1SQ5A 4GT1A 1SVMA 2HJVA 4CYMA 1NN3A 1YZKA 4TMXA 2ASEA 3A1TA 2NTYC 4JS0A 2ZRKA 1G17A 1JJVA 3SI7A 3FPAA 2KB0A 1G8FA 2ZJ2A 3V00A 4M1MA 3VU9A 1NG9A 2OE2A 4HDCA 4MRSA 1FX0A 3BH7A 2FF7A 4EFNA 3NBYC 3G0HA 5KHOC 1P2TA 1OFHA 3E1SA 2NZ8A 3T12A 4BEJA 4KFTA 3B1VA 3OEHD 1ZM4A 3WNDA 1SHZA 1ZU4A 5ANRB 3QKUA 2IS1A 5FBRB 1L2TA 3NHBA 4DIEA 5HTKA 2YNMA 4XD7D 3IQXA 3BWDD 1FP7A 1J8YF 2JDIA 3QF4B 1OHHD 2GESA 2GXQA 4TTPA 3VX4A 5EE5B 1E2PA 2JLZA 5BYJA 4QM6A 2QP9X 2NO9A 2XSZA 2RGCA 2QUZA 3RS3A 3ZZUA 4C7OA 4PHHA 3KJIA 5J47A 3SJCA 2QEQA 2ZUBA 3EWSA 4LSGA 3W3AA 1XDBA 3THOA 2YJTD 5JS8A 1XTQA 1J70A 3D7MA 3ZQ6A 3RSLA 1Q22A 1ZM2A 1QHGA 4KLZA 4V0KA 1Z29A 1R6BX 3WBJA 2IYRA 4WZBE 2CLCX 4X8LA 1W2HA 2BJVA 4BZPA 1JEDA 2C96A 3EZFA 3UIEA 4YXWD 2VIIA 2IYLD 3DOFA 5FOXA 4RZ3A 221PA 2OO7A 2ZI6A 3CF6R 2PT5A 2P6RA 2AWOA 4IVPA 3VR1A 1DE0A 2CBZA 2ZRBA 1WBDA 3KXKA 4O2LA 3C5CA 4OKSA 3F8TA 1X6VA 3BIFA 1R0XA 5DHFA 5KSZA 3QSYA 5EZ6B 3VKGA 2VP4A 1AQYA 2ANCA 3W90A 4A6PA 4OK3A 2JLUA 1N5JA 5LDDC 3ZH9B 1D6JA 3BB1A 3GPLA 3NC1C 4MUAA 1DELA 4MRVA 1D9ZA 1G6HA 1VCOA 2ZRGA 4B44A 5JWRA 3OIYA 1D2MA 1CEEA 1D8TA 1IXRC 3B1WA 3K9GA 5KPJA 2WSSA 4BGDA 1R4AA 3CWZA 1EG7A 1E9AA 3KTAA 3GLGA 1DPFA 5CDFE 4DCTA 2C5LA 3CO5A 2EW1A 3LWNA 1S0UA 1KSFX 1JNYA 1NF3A 1KYIA 2V4ZA 3B5JA 3H1TA 2XZOA 1WRBA 2IA5A 1DAHA 3N2EA 1E2NA 3IIJA 2D7CA 1U81A 1D9XA 1G3IA 1W4RA 3RDPA 3QVVA 2UKDA 2VLIA 3H0KA 3M6AA 2F55A 2WJGA 2QSYA 1P4SA 1R8QA 2WICA 2ZEJA 2ANBA 3EA0A 4NHOA 1LFDB 1VKJA 5SZHB 4GNKA 1JXOA 2BDTA 4YMSA 1W0JD 5GADl 1JR3E 4MDEA 3NDBB 2WIBA 4LUCA 1Z08A 3QF4A 3VX3A 3CX6A 3IGFA 4I81A 2A2ZA 3FMPB 2ZAOA 4PC7A 1XJCA 5JECA 2GEVA 3CIOA 3L8YA 2NGRA 1N25A 4BLPA 3I92A 2V9PA 2JJ2D 4C7OB 1TU4A 1LY1A 3NEJA 4LYAA 2QTFA 1CJKC 3SBEA 2OCPA 1NLZA 1QVRA 1AS3A 3T5DA 5EP3A 1ZU5A 1T3SA 2CHVA 2OAQ1 2XNDD 2PX3A 4GL2A 2GNOA 4BE7B 3T34A 3I61A 2ZU6A 4D80A 1A2BA 1GNQA 2X2EA 4F4JA 4RKFA 3PIRA 2ZI7A 2IYTA 1JB1A 4PPFA 4AK9A 1E2GA 2YVUA 5B30A 3W6PA 5FOVA 2YINC 1U8YA 1KGDA 5F98A 1S4QA 3CR7A 4BLRA 2HLDA 1PLKA 4G1UC 3RRYA 5J4HA 5FUVA 2J46A 1OIWA 3QG1A 2CHQA 4ASUD
chains in the Genus database with same CATH superfamily
2ICAA 2YIDA 3CRW1 3V7WA 4NH4A 4FEGA 2FX2A 1UM9A 3HVUA 4M0PA 1I5EA 1R0LA 3LUFA 4LJ8A 4LN1A 4RHXA 1K6EA 4A6XA 5AVYA 1EFPB 4QUKA 3RJ9A 3UK6A 4EO4A 3CU5A 1B8NA 1ETUA 5F5NA 1GUZA 1NJ2A 2XF2A 4J90A 5IAAA 4OV6B 1AUPA 3C5HA 5FR1A 5T6MA 4MQ5A 2VKTA 3WWYA 4H1TA 3RAGA 2IYOA 2VYCA 1Y1RA 1HA3A 1B8PA 3L7LA 4ZAYA 1HORA 2O2HA 3PSHA 2X4IA 1E32A 3C87A 4JLAA 1G6Q1 3QY9A 4MW6A 4NMHA 4X44A 5CNMA 3T5BA 2ORED 1I8TA 3G79A 1TZBA 4PGHA 2FJPA 1AHNA 1H9AA 4EUKA 4NBKA 1E7WA 1HDXA 5E6RA 1T9KA 4XGIA 3LQ2A 3A6DA 3JQAD 4NECA 4RM3A 1EXWA 2YV4A 3ENNA 4R54A 2HQRA 4QIHA 5BYBA 4G37A 1EM8B 1LVHA 2G3YA 2VSXA 1N36B 3FUCA 4NEQA 4DNXA 4NZPA 1YJ5A 3Q1LA 1IATA 2XUGA 4YCCA 4OSEA 2HDWA 2ZBEA 2GKSA 1NFRA 4JQOA 3TUIC 2R1VB 3CUVA 5LOVF 1UCFA 1NR1A 1V26A 2ZUTA 1VMEA 2ZM6B 1R0RE 4LMPA 3RC1A 2GAIA 3G2IA 1UT8A 1AKNA 4MZXA 1EP1B 1OGJA 1REQB 1ZM7A 3ZHCA 9ATCA 4GZMA 5DYTA 1Z5UA 4M7PA 3IODA 4ZU1X 3UG7A 1KYTA 4KH1A 4MR7B 3IEUA 1KMHA 2X0FA 2VWPA 1JAZA 1RKXA 3JAKB 1MA0A 1U8EA 1LSSA 5JSYA 1EFPA 1NQXA 4CM6A 3ND9A 5JR3A 3BJEA 3TG8A 1W59A 3ZJVA 4PLVA 3OLQA 1ZUWA 3SIRA 2ZW9A 3UB2A 1W47A 3DLIA 3FAKA 3CNNA 3UAXA 3G2OA 2C97A 1ZEMA 1Q7EA 5L51A 1BHO1 3GF4A 2H0AA 3W5CA 3IUEA 2QL5A 4MCHA 1ZZGA 1V95A 5CG2A 4L6CA 2FDXA 5JS7A 3UJ3X 2H65A 2Q45A 4MQUA 1KO4A 4GX0A 1ILEA 4ML3A 1U2DC 1EUCA 1JLLA 1XEXA 3NBUA 4OAQA 1R0ZA 1IAQA 1WNTA 3THSA 5I7OA 4ZDKA 4KQXA 1XF1A 1EHCA 3CNEA 1YZVA 4RO0A 1H0SA 1YBMA 4X8HA 5TPWA 4ND2A 1CFJA 4Z8YA 3WGLA 3QPDA 4CUJA 3EYWA 4XQCA 2DMRA 2DPHA 3KXPA 3P1JA 1TQ6A 3UBTA 1WDWB 1SUWA 1QP7A 2XRMA 1F3OA 2OCDA 3D3EA 3O4JA 2DULA 1N33B 3G9TA 3MOSA 3JQDA 3KTAB 2VLBA 1SQFA 2AD1A 1BAPA 2EOAA 1EWYA 2I3BA 2F9LA 1JQJC 4YECA 1FS4A 2ZJAA 2OXIA 1J20A 3CZ5A 1T1JA 3TEMA 2PKCA 3AHHA 2E49A 4X20A 3KJEA 1ZJ6A 2HIGA 3L1HA 4ROSA 4ARVA 1J06A 4MKGA 2X0JA 2O3SA 3HA5A 1ADCA 3ANTA 5DDIP 3B48A 1Z3IX 3IOCA 4CVNA 4U7DA 3BMCB 3R77A 5EP2A 2V97A 4WGGA 4RULA 2XWSA 1EE2A 3E9EA 4N3AA 2C31A 2VQSA 4KWCA 1U8TA 3PX2A 2BH9A 5AUPB 4FX5A 3L8DA 4EY5A 1GG9A 4HDSB 4DM4A 1KFKB 3T3OA 3LCUA 4N40A 5CR9A 2QENA 1GZ4A 4B3IA 4RPKA 3CTPA 2BUBA 1IIRA 5AJZA 4F3NA 4QDOA 2YWFA 3T15A 4NXMB 1Q50A 2NPFA 5IF9A 3H18A 1XDDA 2RHWA 1AK1A 1F0NA 1OXBB 3V8PA 3WKEA 2AK2A 2ZTUA 1H2RS 2I71A 1I2ZA 1L7PA 3AUYA 4MLZA 3GEMA 4X90A 4ER3A 3KR0A 5BSTA 4UUAA 4MI6A 5JNWA 1A4UA 2Z43A 4BWVA 3HDVA 3CJTA 4IJMA 1FP4B 1SURA 4CQMA 2C54A 1JALA 5B4UA 1BS1A 2GZAA 1NRWA 3GGDA 4MGIR 1M6VB 4XWGA 2D8AA 2CFIA 4FMDF 4Q9DA 4FIDA 1FTWA 4KGZA 1MJGA 4QNMA 2G5GX 5KYWB 4UFPA 2HL6A 1NBMA 2B94A 2QRHA 4CM4A 4H4EA 4UNQA 4KIJA 4B6PA 3EC2A 2Y27A 3GAZA 3D3WB 4MKIA 3ZC3A 2OVBA 3L1JA 5AVKA 2CNOA 4QM7A 1AGNA 1QPGA 1X7DA 4MGZR 3UMYA 3I8OA 4CHGA 3OBBA 1BDJA 1U3GA 4FB4A 1E0JA 1IFXA 2P4EA 3F7TA 5HRUA 3HUTA 1PW5A 3D0OA 4B3MB 5AI8A 4PSVA 5HIIA 2Y2UA 1FIUA 1XVLA 2H2IA 1J07A 3K2EA 2IBSA 4MUJA 4KQ9A 1DMRA 3V2GA 5KYXA 1E9CA 3KEGA 2GYYA 4G86A 2IPXA 5A1TA 3C8HA 3H9UA 3I2IA 4ZREA 4DRXB 1SXJD 4V0MA 4D9MA 5GZ1A 3PEYA 4RLHA 3C3DA 4FYIA 2P8SA 1C2YA 4GI3A 1ODCA 1FTQA 2Y76A 3HYTA 3EGWA 1ONOA 1IOVA 3H5VA 3OPYB 3S7TA 3GU3A 2ID8A 5AIAA 2VHCA 5CGZA 2QB5A 3C6YA 3NTUA 4CMIA 5I7FA 1CUVA 1XQWA 4A0QA 4FYHA 4F9GA 5TF4A 4UOZA 5GONF 1ZGCA 1Z2CA 2H17A 3EVTA 3H75A 2NOAA 4OBBA 4HZGA 3EXFA 3PDIB 2H1SA 1J21A 4YCNA 5LQAA 3V1YA 3UH0A 5DNAA 1KYQA 3K73O 2W9XA 4DIMA 4C78A 1YASA 4B3RB 4J2TA 1YL7A 1NVBA 5BSEA 4LQ4A 4DSAA 2XZPA 1E3QA 2E5FA 1Z5WA 3WQRA 2OD7A 1XYVA 2CK3A 4WK6A 3ZNQA 4X1YB 1FSGA 4FS8A 4B4OA 1IBCA 1M0WA 1NIJA 3N70A 1HM5A 1CRLA 5CLQA 2C29D 7ADHA 1BFDA 5I47A 1TLTA 2JI8A 2YJ4A 1RAAA 4PIPA 3PK0A 1HYQA 1P9NA 4MYHA 4BX2A 3GAFA 2LCIA 3ASYA 5E1DA 1G21A 1T34A 3B9RA 1RBMA 2CNWD 2DQZA 3B52X 3GT7A 3HCCA 3JWGA 1KNQA 3FGZA 4FDAA 4NPHA 4RK1A 4YRCA 1Z6AA 2BI4A 2GILA 1H2HA 4WCFB 4N3CA 2Y4OA 2REQB 1WO8A 2Q1UA 2ZAIA 4HAZA 4PICA 1NNI1 2BCEA 3M6XA 4CEJB 1L4BA 4K2AA 1WZCA 4LQLA 3C15C 3ZNPA 1R3UA 4PXAA 4HMQA 4D02A 3DLPX 1Q91A 4PGAA 1I5OA 1VXRA 2I87A 1QQBA 1COZA 3CV3A 3I8SA 4YFVA 4KUHA 5KUTA 1WSBA 3IOYA 1Z0KA 1IHUA 1IBMB 3G1TA 4NPCA 1P61B 1W94A 3T61A 1TQ2A 2HWWA 4EFDA 4WLNA 5ALDA 1ID8A 2XZTA 1GDDA 2JC3A 4XIFA 3CB4A 3LUJA 4TSRA 5CLHA 2ZBDA 1TKRA 1M75A 3QVLA 1NW9B 4YVFA 5DCLA 3UAWA 4ZOLB 1Z9BA 1FU4A 2DR3A 5B58T 4EAQA 2JG3A 3WWPA 4AJHA 3B1JA 1JI0A 3I5AA 5DRYA 4B4DA 1L5WA 4CLOB 1JIIA 4QFMA 1QH1B 1SUPA 3VGJA 2LUOA 5ALZA 4P5DA 4ACBA 3RSQA 2GJ9A 3HP7A 2RC6A 1WE2A 2PEZA 2Q5HA 3SF8A 3GUUA 4IXWA 4NSNA 4RPLA 1T15A 2X9GA 3TW4A 1L7QA 3T1QA 3ITKA 2QVBA 1ODJA 2KJQA 2GERA 2VUSA 3E5RA 2QPLA 5DXFA 1JEQB 1VLLA 3OZAA 4IIHA 3R8FA 3M0EA 3EEYA 2ZDGA 2EG9A 3AESA 3FF4A 3EVDA 4KI0A 2JVIA 1E62A 1O3YA 2P5SA 3N2NA 4R41A 3ZDRA 1ENPA 4WCFA 1Y5LA 4PHTA 3VAAA 3QVJA 3BWMA 3R0QA 3NHMA 1CK4A 2RK3A 3HXTA 4QEZA 5HZMA 2Z3ZA 4EMSA 4CCYB 4O4HB 2YN0A 3LZ6A 1YB5A 1R8SA 2YXBA 4EUHA 2C7QA 4CKCA 3SIPA 3VOBA 1IBRA 4RANA 4IRMA 1NX6A 1X0XA 1EGHA 4M0KA 2A7QA 3VU1A 3U16A 1R6DA 1AKMA 4R83A 1SQSA 3EXHA 3G89A 4AJ4A 5K0JA 4DB2A 2O14A 4O4LA 1Y3DE 1GGEA 4ZI7F 1R5OA 2O2GA 2KX7A 4U6QA 4UJ5A 2I03A 1B3BA 3TI7A 5DM60 2RBGA 2O3TA 1IM5A 4JY7A 5BR8B 3OZSA 2KLHA 1JS1X 1XMJA 3P9YA 3DE3X 5K0TA 2QRPA 3VOSA 3DC7A 3GVIA 3LKDA 4Q34A 3CPHA 3NHAA 2IXTA 1KO5A 1ZIOA 4JYMA 4TVSA 3G88A 1RHKA 3MZ0A 3MUOA 3FGOA 2BRUA 3KEMA 4G0XA 4BPRA 4WOPA 5LYJA 4QPNA 4QELA 3IA2A 4MRAA 3RBZA 4ZT6A 1JH9A 2GD2A 2KSQA 4Q3DA 4BJ1A 3D8NA 1CRQA 2FPRA 4LXYA 3QEOA 4UCQA 2I78A 5CJPA 3EX7C 3QHAA 2L18A 4LK3A 3PHHA 4KXNA 3RIGA 2HWKA 4KRGA 1B41A 1DRJA 1MTZA 2W0SA 3JYHA 1ZCFA 4LVCA 4C7BA 3MUFA 2O3UA 1TVMA 3URKA 4ZEMA 6ADHA 1YTLA 3HUFA 1TEZA 1PJAA 4WD3A 3IDZA 3W04A 3GN2A 4X0EA 1EIZA 1KDZA 4F2HA 2QTNA 4UEQA 2D54A 1RLOA 4J91A 4N8DA 1SKYB 1D0IA 4QYMA 3QZUA 5HZKA 5J4LA 1PAUA 3NHSA 3IT3A 1U6KA 1Y9JA 4MV7A 3GP3A 4GKKB 4DXHA 2EL7A 4N6GA 1FXWA 4UMDA 4Q39A 3IEMA 1U4SA 3EBOA 1LRKA 2IP2A 5JXJA 1AB5A 3NAGA 1OC4A 1YCHA 5B2FA 3ZLBA 5ER6A 2P2SA 4QGHA 2FFQA 2QTVA 3GYBA 5K0LA 4BECA 1ZEJA 4JJ4A 5EESA 1MENA 1PS8A 1N1GA 4L22A 4S2EA 1EINA 2YFYA 5AI4A 3TOVA 1O6CA 4MV5A 4LRYA 5HOQA 2QPOA 1H9CA 2ZJ3A 1CJVC 1U3UA 2VK4A 2WHYA 3K0HA 2WPDA 4Q03A 1IONA 1CUWA 3QE0A 4HQ0A 3COSA 3TDNA 3L7YA 3G02A 4O33A 1B6SA 4ETMA 1CJSA 4JK3A 2C8JA 3C3KA 3UANA 4FEEA 4RKEA 3TS1A 1CULC 2JI9A 2ESRA 1BG6A 1VSQA 3HYLA 4GWGA 5F77A 3GDHA 4UCFA 3WLKX 4B7XA 1TNDA 3EIWA 1YFJA 2R84A 4ZYLA 5I9MA 4E3WA 3L0BA 3O4HA 4ZGWA 4P3KA 2R68A 2HA6A 4Q7QA 4DJDC 3BFPA 4Q3OA 1DINA 3B1ZA 1OYVA 1HQYE 1DCMA 2ZT6A 2QAJA 3E8MA 1QS0B 3ELWA 3EZ2A 1OWMA 3KELA 4FVTA 3SE0A 3K5WA 4XX0B 3L7AA 2JJ2A 8ATCA 1YJ8A 3IT0A 4QJIA 1ISPA 4F3KA 1P0IA 4M4SA 1KHTA 5EGSA 3H9QA 3ESRA 3UJDA 1QHXA 3D6MA 3BS4A 1O2DA 3NAMA 2G0AA 3NEPX 4RQUA 3H65A 3EEIA 2GI4A 2QTGA 3FY4A 4DXAA 3ZX4A 4WHMA 4X62B 1GCOA 1PLLA 2C7GA 2HIHA 3MIIA 1I10A 3OSUA 4O59O 3P52A 4DL9A 4I7EA 4MSUA 2V4UA 3THWA 4V0LA 4M3NA 1ZM9A 3DR3A 2OVFA 2ZOSA 1TKCA 4CMAA 1WUYA 4XVCA 1JSXA 1V6AA 2WWGA 3THXA 2DP4E 2EEPA 4UBKA 4ZRMA 5FTKA 4DSNA 3FFTA 3MFYA 1UJ6A 4IUBS 3IQGX 3HY4A 4XGQA 5EL0A 3HCRA 5H68A 1TECE 3QPAA 1QANA 3E82A 2ZSDA 4LC0A 3OTHA 3Q9NA 3C1UA 3ESYA 3FIUA 2V74B 4TWIA 3CTMA 4ZC1A 3RKRA 1GILA 3ILSA 3P32A 3RT9A 5SV2A 3UVEA 1G8MA 3JQCA 2WU8A 4KPUB 2RCYA 2FWRA 3TIGA 2P1RA 4LF4B 2CFOA 2I4OA 5A06A 2LV8A 1Q17A 3BL5A 2JCSA 1H5UA 3TNLA 1Z4IA 3IBGA 5FEUA 2HMYB 2YW9A 1HXHA 3A06A 3DNMA 4TUYF 5ALWA 3RRMA 4D8XA 1XCBA 2C88A 4U2EA 4FGJA 2GFHA 1Y5MA 4OBXA 2R7NA 4IOMA 2P3LA 4TM8A 1S01A 2B1GA 2QD1A 4TTJA 4TUYB 3ZLTA 2C03A 3RKUA 1JVBA 3BIWA 4AW9A 2F3PA 4KXQA 2WUWE 3QX3A 1NLMA 2UDPA 1QPZA 3VYVA 3TEFA 2OP0A 2GBGA 2IT1A 4TXMA 3VR4H 5D8DA 1QGED 1BMDA 1H4VB 4AMVA 1MB0A 3GYGA 1HEYA 1KAOA 1KDOA 5SZJA 4G84A 1R4ZA 3FMOB 4NQZA 4X1KB 4UTPA 1N78A 3PVCA 1AKQA 2IXFA 4PIMA 2PWPA 3JWJA 4QUIA 4I9UA 5T5QA 5CK4A 5AKXA 1KMQA 2ATXA 1Z2NX 2MYTA 2EGGA 3ZU6A 2NZJA 3OE1A 4Y9RA 4WZAB 1B6GA 4NJOA 1R16A 2JJ1D 4NE7A 1SKQA 1HH4A 1DG3A 5AW2A 4BV3A 3TMAA 3NYQA 2R5NA 4RXTA 3A6HA 1EVJA 3C6BA 4W5OA 5TXGA 3LL4A 1K27A 3FPCA 3N0RA 3OVMA 3PHGA 4EZIA 3LTEA 5B1YA 4YP9A 4DDHA 2BWJA 2V59A 2RMKA 3DXFA 3PA6A 4UFOA 4WZBA 1WDKA 3HCEA 3N6XA 4PANA 3T1VA 5JVDA 4FHGA 5ECGC 1Z8FA 2OXCA 2D0IA 1VLHA 3D7KA 3GLIE 3F6RA 2ZGVA 3NV7A 2V0NA 2IHUA 4QYWA 4C0BA 1NYLA 2XIJA 1NMEA 2Q07A 1N1EA 3Q3GE 5ALFA 3TK1A 1PJ4A 4CEJA 1CQXA 2R1TB 1YHYA 1UBNA 1ADJA 3DV9A 3BD9A 3EWAA 1RD4A 4WKOA 3EIEA 2I4RA 1JKXA 4EOGA 3P9XA 3CW2A 3LTNC 2HMUA 1TYZA 1J5XA 4RVGA 1WABA 3MCUA 5FBKA 5CB0A 1ZJZA 4EPYA 1IOWA 4XI9A 1FFWA 1X74A 1XI2A 4JI3B 4CIAA 3GWZA 1E60A 2A5DA 3H13A 1PBNA 3IAXA 1YKSA 4IQGA 4CL2A 5MGBA 1QK5A 2ZQZA 1TEHA 4AS1A 3AOEC 4TVBA 2GN6A 2ZUEA 4S1PA 5C32A 1P1IA 1BEZA 1NVUQ 3D6AA 4AT1A 1H8HD 1KJ9A 3AUUA 3PI7A 2IXAA 1GYPA 3GCXA 4LC9A 4DIUA 1AO3A 3EB9A 1RI1A 2O2IA 2ZRFA 1RCTE 1JSCA 5FLKA 3REOA 4EEKA 1G8KA 1UOQA 1W36D 1N77A 3HL0A 2LE0A 2VUTA 3ITDA 1SXJA 3DFMA 5KTTA 1C1DA 2KW5A 1TMOA 4WXPA 3BBPA 3I9LA 4BGUA 4ALJA 1BEUB 3LG2A 4KQMA 2RD2A 2IP4A 3HGMA 4CMIB 4RGYA 2A33A 3STXA 2WE7A 4F2WA 4Y18A 5CDGA 3PSAA 4TQGA 3P26A 4YGXB 2FZ5A 1CZLA 4N5HX 1SPBS 3M4YA 5IBRA 1FQWA 2NQTA 4I4TA 1W75A 3KZ1E 5GINE 4BGIA 3UUGA 2ERXA 3A3KA 4LFCB 4E15A 1ZBDA 3LPLA 1CTQA 4JMLA 1VSVA 4PCAA 6REQB 1OFGA 4UNPA 2GR9A 3LYHA 1YZYA 5ER9A 2VHQA 3IUMA 4XQ9A 1K88A 1QXSA 4P7JA 2XX3A 4KN8A 3PXAA 4N54A 4UMFA 5FL7A 4BB5A 4DR3B 1ADGA 2R65A 4P80A 4EPVA 2D7JA 5EINA 1E98A 3DBHB 3C0KA 3NALA 1AMNA 2UYOA 1OFUA 1KZ6A 2E1RA 3AR9A 2PT9A 4E7OA 1XXHA 1J22A 4MGKR 1U3VA 1WJGA 3UPTA 2G6BA 5A5EA 5COBA 2WHRA 2XKBA 4HTFA 2WVAA 4X1OA 1Z26A 5TNXA 5B6PA 4WLVA 1PJBA 3CUEF 3ZV6A 2EYUA 4W99A 1KMCA 1DEXA 2ZYUX 5IAGA 3DOHA 1V4NA 1HSOA 2CNWA 1T91A 3OMWA 4GQBA 4EGSA 1IBKB 2IQ5A 3VR3A 1QWSA 4YDHB 1R0CA 3CH6A 5AKYA 1C29B 3F90A 1SNYA 3MD9A 5KHAA 2GM4A 2R6FA 1ABBA 1TB4A 1ZH4A 1A95A 5I9SA 4J0IA 3ZZMA 1BYUA 1N92A 4TV9B 4BMYA 3L4BA 3EQ8A 4DR7B 1P3JA 1YOBA 2Q1TA 3QU7A 2XUHA 4E6EA 5HR5A 2CF5A 2ODBA 2QP3A 1RPJA 3P71T 5CT6A 3EGXA 2B7CA 3ZYZA 3SZRA 3DYVA 1OUMA 1IE3A 1ZVMA 2L69A 3WO1A 3C98A 2QBYA 2DT5A 4TVOA 4O1IA 4R7ZA 3I1FA 2YMMA 3DEFA 4NP6A 3V4RA 5B4VA 2B34A 3G23A 3KLMX 4DG8A 5EWMB 1E8DA 1XAGA 3GBVA 4QKQA 4YV0A 4CKCB 2FAXA 2OSBA 4E08A 1MV5A 2SCUB 2R48A 4Q3BA 4GI7A 4I1OA 5FBZA 4D4JA 3Q8LA 1V7QA 3OE7D 4YJFB 4ZPJA 1HEIA 4LOIA 3WK4A 1NVXQ 5HFAA 1M2KA 2ZWIA 2AC7A 3NAQA 4LHSA 5YASA 5BWBA 1EXNA 3C4JA 3T7JA 5D1NA 1JNXX 2BV3A 1B73A 1FYWA 1I0LA 2WE8A 3R0XA 4MQ6A 4W6QA 3HR4A 4BWYA 2VYND 2UZ3A 1L5HB 5H5JA 4M8IA 4EW3A 1QFXA 4PAWA 2XW6A 4ZEXA 2GK3A 3EE6A 1U3CA 3N7TA 1S5PA 1PFUA 2NWQA 1BW9A 1FZQA 1D2HA 1P3DA 4R1OA 3DMYA 1Y6FA 1AV7A 1E1CA 4GOJA 1A8IA 3DH0A 4NCXA 1W6UA 2FXIA 3OJLA 2A14A 5B5SA 2B5VA 1PSDA 1KERA 4PAQA 5DM1A 2PZGA 2XWBF 3QKSA 3TOXA 3P0JA 4A7PA 3KG2A 5CXSA 4JUCA 3L8FA 3ZI4A 2UUPA 4NFSA 4B3JA 1N0IA 4JI5B 4TROA 1DG1G 3R8XA 3LECA 1OH8A 1VSBA 2HCRA 1WU7A 2XCQA 4GICA 4D97A 2NO0A 4GLJA 2ISQA 4WINA 3SD7A 3TO5A 3VR3D 3CCBA 4UFNA 1K6IA 2FRDA 1K98A 2YW2A 2V7TA 3E2IA 1QM5A 2OB1A 3MMZA 1CQJB 2AKAB 3Q3HA 4GRIA 4KAXA 4P3XA 4TRRA 3K4PA 2GKGA 1LRJA 1YH3A 4OQEA 5EQJB 1UZLA 3FWKA 1R9MA 2CJPA 2JAHA 3HJGA 4H1HA 1C3OB 5FOTA 5HX7A 1G0OA 2ZS8A 2ZZKA 1NJ6A 4Y6GB 1TL7C 3DMPA 2DE0X 4A10A 4H4DA 3CEJA 4DNOA 4F56A 4YJ3B 1YE8A 1AKVA 1IZ9A 1FFEA 2IEDA 4UTOA 1OILA 1SWVA 1TJYA 2YUTA 3ASZA 3KOUA 1AQJA 2CT8A 3M9WA 1POWA 1G21E 1NW5A 2YJ5A 3LZDA 5A0FA 2IGTA 3U7RA 4BKPA 1U63A 4GLBA 1E5LA 1DI0A 5FA8A 3FKQA 5KYKA 2F67A 2QMQA 3DB1A 1X7HA 3VJKA 1EVKA 2C2HA 4KXUA 4D4HA 4JI2B 1Y7PA 2W5UA 4KYIB 2N42A 2NX2A 3P7MA 1P74A 1Q2XA 1SUAA 3RVMA 1T5SA 1REQA 2H1IA 2X5JO 2F8MA 4DWJA 3F4LA 3BIJA 1LTQA 1VHTA 1WMAA 4HPJB 3X1KA 3CCFA 3ZWKA 2GPBA 2IYWA 1O96A 2FR0A 2HEIA 2XUKA 2N1MA 3PJFA 1Z5ZA 4HL6A 1CERA 3O21A 4RTQA 5CT4A 4I5EA 4H6VA 1G6OA 1HDZA 1JSZA 2BFDB 3C45A 4Z86A 3RYCA 3TNJA 4ARBA 2HSWA 4NMMA 1QGZA 5EE3A 1RAIA 5D2CA 5JROA 1W88A 1YF3A 2FZKA 4Q37A 1O6GA 4DYVA 3U5ZB 1M2VB 2I4MA 1QRTA 3DYBA 4ZTBA 2COUA 1Y1TA 1SCUB 2CFSA 1GP2A 2O52A 1ML4A 3PD1A 3VU0A 5I8WA 2F90A 4MV0A 5LU9A 2D2XA 5CLLA 2J7KA 3MOGA 1CDZA 5K6AA 4FGKA 2X2PA 4LDRA 4EDFA 2BR4A 4FILA 1UIMA 2Y4NA 2PZKA 3QGMA 3ZE8A 4E0BA 4MHTA 1CQWA 5DWVA 4MKRA 3S2SA 4E5VA 1RZ3A 2RH5A 3A7DA 4JGGA 3ONWA 5ERXA 1UBFA 1DV2A 1MRNA 3KYDB 1DJOA 1C9DB 1GPMA 3OJEA 5CJJA 1P5JA 5ALSA 2X1LA 5CHYA 1ACMA 4ARAA 5A6SB 4Z7OB 1GDTA 2JI6A 1A7KA 1NAIA 1WXQA 3M1LA 3PL5A 4TXJA 4R2MA 2Z2ZA 5DTRA 1SZCA 2YXEA 4PG6A 4Y1FA 2J08A 1TDJA 3A28A 3QU4A 1FSZA 1W36B 1PTKA 2VDVE 4AN4A 2O8BA 2QI9C 4MWEA 4C20A 1A9PA 5HJ5A 3O94A 2IS4A 1P80A 4W5NA 1WKVA 4BFZA 5CG1A 2A3NA 2OFXA 3AEUB 4DF3A 1DC8A 4PS0A 2RHGB 4XYBA 3SVZA 3HH8A 3LWZA 5LMCA 5IXYA 1UP7A 4RD3A 4CJXA 4D9FA 1O9BA 4DQVA 3U56A 1TO2E 4FHEA 1BE1A 2QE7A 4G8CA 3WGUA 1EFKA 2PJDA 3R8CA 2P77A 1E4OA 3KYCA 3RF6A 1N2SA 4YDSA 2JFGA 3K0SA 2H18A 2J30A 3LZCA 3R3YA 4XB1A 3TXAA 4ZVLA 1PR1A 4REQB 3OLXA 1MDFA 4DSOA 2Y05A 1H2WA 2G9NA 2LZ0A 4PSKA 3U0BA 4DYDA 3RVBA 1RABA 1N7HA 3NHFA 4D5GA 4BPBA 2YQ5A 1KKLA 4RADA 1XELA 2WSSD 1KO1A 3GIWA 5JNUA 4EH1A 2O8CA 2XCUA 1CUXA 2FZCA 2OBLA 4LDQA 1PKEA 1PGQA 4YQFA 1OVMA 1E58A 4DLLA 1Z36A 4WA7A 3W1VA 1D2NA 2XWQA 3CKLA 2B5OA 5LYYA 3EISA 5IYZA 4K86A 1PS9A 3ANLA 5DI9A 2RAVA 2VF7A 1QK4A 3WIVA 3LC2O 3DKKA 3EUAA 2JBAB 1DJNA 2Y1FA 5JYCA 1L7MA 3E58A 3ZEIA 2XGGA 2WTUA 4PPYA 3N2GB 4AMUA 3WB2A 2YRFA 1ITZA 4V3BA 4HWKA 1U0LA 2W6ZA 2FVXA 4N0EA 5IVDA 1UP6A 3DJYA 1G98A 4HLDA 1S3SA 4FUTA 5KOYA 2NTEA 4H1WA 1ZJWA 3VDMA 1X13A 3VDNB 2CB0A 1PNVA 1PU2A 3AI3A 3UN1A 1FOEB 2ZREA 1TYDE 3DM9B 1CJMA 4F93B 3EQ9A 3JTMA 1N2GA 2VDJA 4GUDA 3EYAA 4IOJA 5E1OA 3SDBA 2F43B 2UVQA 2ZATA 4K8RB 1K7YA 1CJUC 2C57A 3HA7A 3AOEA 1JA0A 1RYHA 1U1FA 2NXJA 4E6PA 3RU7A 2NPOA 5GJVC 1NZJA 5EHZA 3FSJX 1LQUA 2P9GA 1XZIA 2IHJA 1H2ZA 3CY6A 1WF6A 1XOIA 2H08A 3R7FA 2QVLA 3CM0A 4IJ6A 2IWHA 1YZFA 2GDJA 4F7DA 4MDYA 4WFQA 3UO8B 4CT5A 3IUSA 4DIKA 1HDEA 2CV1A 4IHAA 1BU5A 2VP5A 4FXPA 2H1HA 3B7GA 3BICA 3BZUA 1V7CA 4LZAA 1ETHA 1MABA 1QIJA 1KI6B 2NG1A 5A3VA 5AICA 1AD2A 3L7CA 2NMVA 5JNSA 4MRMB 3OO0A 4JP8A 2GD6A 3P2YA 3QYJA 4RTKA 1OXVA 3QLVA 3QVXA 3KKLA 1J0AA 3PQ4A 4LRSB 1T3TA 4DAOA 2PMDA 3KRTA 1VRVA 3EZ7A 1K9SA 4KN9S 4OHWA 4JSRA 4AX4A 1RU3A 1VG9B 4P81A 3SXJA 2I1VB 3KL2A 2X1VA 4F3YA 2P6NA 3EGEA 1EVYA 1VBMA 3BWYA 3I9KA 4J8PA 4XFKA 1VYVA 3S55A 3VC2A 4C4PA 3MMPA 1TLFA 4NJMA 2AYZA 1GQSA 1RJ9B 3AF1A 4EELA 2ILTA 1RBQA 2ORWA 3A1DA 2AI2A 1R00A 3ESBA 4MVJI 2R3SA 3C41J 1K7CA 4GMDA 2Z83A 4J2OA 1A8UA 2P9QA 2REBA 4NCBA 2ZTLA 2RI6A 4BFTA 4EG1A 2AQKA 3ZZTA 4LBWA 2R85A 3FLAA 4IH1A 5DOZA 3Q12A 3KSAC 1XROA 3RFFA 3W4JA 1DIBA 1FX0B 1LLCA 1W25A 2JIQA 1G21B 2W93A 2B20A 2OV4A 2WVHA 4GOKA 3QKWA 4D3XA 2N9UA 4YT8A 2AE2A 1QP8A 1W0CA 4GFDA 3ZHSA 1FSPA 2ZE7A 3KLOA 3GZNA 3O8OA 4TXLA 2Q5IA 3AR7A 3KOWA 5JJKA 3JQ6A 1DTWA 1OR8A 5E2IA 3B6MA 2L82A 5U1PA 3V1UA 4CXMA 3PKIA 2QX4A 2CHFA 2FN4A 2QTTA 2WW8A 3DB2A 3GJ7A 3D8SA 4HYTA 2F48A 3VR4A 3HXLA 4MW0A 1F2TA 2QJWA 3FNIA 4FR2A 4DQXA 2QQFA 4WK2B 3HVIA 3RT7A 3Q6NA 2BGWA 1ULTA 3X0DA 1K86A 2FMIA 2IELA 3WLAA 4BX0A 2WJAA 2M6SA 1G3QA 2XOXA 4RFSA 5JAHA 1QRUA 4KXXA 1DKRA 1HMPA 4G4IA 3ORSA 2FZVA 3KR1A 2ARKA 4N6NA 3SM3A 3SZLA 3GUCA 1S2OA 3U3OA 5AM3A 2WUVA 2PAFA 1EFTA 3HN7A 1AF4A 1NXSA 1P9LA 1U0NA 2Z4RA 2ZP1A 3EOBI 5DHUA 1KJQA 1RE0A 1W46A 2W71A 1ADBA 3DDOA 3FZYA 4N9QA 5D7NA 4ND1A 1GPYA 2PRSA 2QUAA 4FCWA 4JLWA 4PVCA 4ZODA 3DUFB 4QU5A 1QRAA 4K9SA 3OC0A 1QQ5A 4DKXA 2ZT8A 1ZO8A 1QH0A 4NCIA 3FZEA 5BSRA 2V54A 4ZEVA 1E1CB 3T3EA 2DFKB 5LQMA 3L0OA 2BVNA 3F7NA 3WYGA 1R74A 1UC9A 3CMMA 3N58A 2ZTHA 4LWQA 1JR4A 4FU0A 4QNRA 3AIIA 5DM70 1SFRA 4EPWA 3R20A 1GAJA 2H29A 2HN9A 3LRXA 5FOWA 1K6XA 3KKMA 4HEQA 5IBPA 3T3PB 2WU1A 4W7SA 3DLBA 4TXHA 2CN1A 5F35A 5JJCA 2V1XA 2HZBA 1G7RA 1FRFS 3GLIA 2H1VA 3QQPA 3UW3A 1G2QA 4Y6PA 4E33A 5CAEA 4ZJPA 4EKEA 3DV0B 1CZRA 4Y2JA 3M6FA 5BUZA 1QIMA 1Z35A 1BCSB 1SCIA 4OQ4A 4Y6RA 3AR4A 3TZBA 3HM9A 2PUWA 3GJSA 2EFHB 3WRYC 3EG5A 1N5KA 4TMYA 1WP4A 4X5OA 4W8HA 1T1SA 4GS5A 4F4CA 1Z8HA 5C9ZA 2GF2A 3KQTA 1JYSA 1RLMA 3NOQA 4EB6A 5KX5F 1G5RA 2H51A 1T0IA 1EK2A 1I2BA 3E2PA 2WFZA 3H11B 4U63A 4B85A 5JUWA 2HHJA 3ZCXA 3B8EA 1YB4A 3QOXA 4QVGA 1ZXLA 4MNTA 3FYSA 4JR1A 1NQ5A 3UMFA 3UV7A 4M1KA 3IL2A 2OV6A 2ZUDA 1VJTA 3AGQA 1EFCA 3SOPA 1IWOA 3VH4A 4EITA 1GU0A 1VG0B 1N6HA 3QP9A 1Z0FA 4L3OA 1ATIA 4O1MA 2DFTA 3ZDFA 2PV7A 1RKQA 1CY4A 1GUFA 4MJXA 3WQQA 1X86B 2RKBA 3DONA 1Q1ZA 2C5SA 2HRRA 1MVNA 1GA4A 2XCLA 1U2GA 3M6MD 5FOSA 4CETA 1UIRA 1GL6A 2HY7A 1A5SB 3D2LA 4ND8B 1DIHA 2N1BA 1SCBA 3HB0A 1PNOA 2CMHA 1H1LA 4MJ3A 4Q7MB 3KAJA 3IR6A 4NOLA 1KDYA 5G4LA 3VAZA 2CLLB 4GYJA 2VJCA 3B9QA 1HT0A 4ZP1A 2O7QA 1BJRE 2ZE5A 4MK4A 5G2OA 2IQIA 3SJUA 1J8FA 2OC4A 2FW9A 3JVDA 3OT1A 1VHJA 3ZHQA 3DO8A 4C4OA 2BGKA 3HZHA 4P31A 4TL8A 3NWEA 1RDFA 2HV9A 3CJQA 4D9BA 2FSHA 4JBWA 3NH6A 4TT3A 1GTSA 1BWRA 2O1SA 2ZIXB 4OUDA 1P72A 2EKBA 4B2IA 3DTTA 1RPNA 4KR6A 4IDCA 3QLEA 1CZUA 1ZMBA 5FTMA 5EJ8A 3LI2A 3KHKA 1OLSB 4RDHA 3TAHA 2SHKA 3JQEA 1XRSB 2O1EA 4M87A 3TR5A 4RIEA 5C7OO 2XA2A 4JBHA 3FCCA 4YS6A 4CZ2A 1P18A 1G7TA 3OG9A 5JTTA 1XXHE 2C9YA 1ZIDA 1T24A 2G70A 4C2UA 2I1QA 1CF9A 3DVAB 3UPUA 3D64A 4YX9A 2O8BB 3IO5A 3BE4A 3C48A 4OHPA 5IVKA 4CLXA 1Y4AE 3O1HB 4IHJB 1C9KA 3OX1A 4J7UA 2OCLA 2O2EA 3ZQJA 3IDAA 2I76A 4Q48A 5B4TA 3OQOA 2MSKA 5HIMA 4MP8A 4YWJA 1UM9B 3D81A 1ZP6A 4J03A 1AZTA 5KYTA 3CX8A 4Q9IA 2HSJA 3A2LA 1XTBA 3K31A 4PONA 1V25A 2HK9A 4N47A 4ENUA 1XCJA 1EUQA 4FBMA 2K2QB 4ZU6X 5KOJA 2ZIZA 2GTPA 3GD7A 4Q12A 4JC8A 3OEYA 1JWLA 1JAHA 3VXKA 1BMFA 4JI1B 1FPQA 1JEYA 3VSDA 4B3HA 3K4HA 4MQ4A 1YU6A 2JKZA 4O1HA 4Q3LA 3QSGA 4XUGB 3IP1A 1O4VA 3CHYA 5LC1A 2HQOA 1G8HA 1MO6A 1KMHB 2OWDA 5BVGB 3ICPA 4ZIRA 1P17A 1T2DA 3I28A 1ZPDA 4IMIB 1XTIA 1J2EA 2R5WA 3H6GA 1GGFA 4K5QA 4DRYA 4EGQA 1ZHFA 5MHTA 1E5XA 1YO6A 1MRSA 3TLCA 5F7OA 5JLAA 4UNSA 1NPTO 4CWAA 1MQ9A 2C1EA 3PVSA 3V33A 5IM4A 4XGRA 4QDJA 5F3RA 4AZ0A 1EGAA 2AR7A 1CSEE 2IVFA 3CLUD 3IT1A 2HNAA 4RU1A 4YP7A 1PE0A 2AV6A 4G97A 5IMSA 2A0UA 2IZOA 4C08A 5KQSA 3ZVMA 3WZ2A 1NW3A 3FNQA 5LQNA 2JJ1A 1RI3A 1NSYA 4OI2A 2DSNA 1EUCB 1XEXB 3C5VA 1JG4A 2ACWA 4J0QA 2XTNA 3FN4A 2BZ0A 1JQAA 4J1TA