4IFBA

Crystal structure of sult 2a1 llgg mutant with paps
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
274
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfotransferase Selectivity at the Molecular level
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Bile salt sulfotransferase
total genus 95
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ifbA00
3AVXA 3BIFA 1E0KA 1QHNA 2J46A 2AD1A 2AL7A 4W5WA 3U7EB 1CF4A 3C5CA 1DAKA 1ZIPA 1QHIA 2A5FA 1DADA 1JQJC 4ZI2A 1EWQA 2O0KA 1W0JD 4AG6A 2V54A 1G21E 3U61B 2QEQA 3OFND 2QE7A 4LWZA 3FTQA 3UATA 3A4MA 1E2IA 1DAEA 1ZUIA 3NC0C 5DI9A 2DCUA 1ZUNB 3L0OA 4B76A 2XB2A 5EZ6B 2N46A 4KBFA 1FMLA 4WOPA 1N5JA 3GJ7A 1NBME 2OILA 2J0VA 2QQ0A 1XCGB 2GCOA 4US1R 2QAGA 3K9HA 1P72A 5TY0A 5TARA 2Y8EA 3GLGE 4QHTA 2V8OA 4IHQA 1WF3A 4DLUA 3CH5A 4C3ZA 1WP9A 1QDEA 1YU9A 1JEDA 4F93B 2I1VB 1JR3A 1Q1EA 1XNJA 3TVTA 1G4UR 1ZP6A 5JRJA 1NMXA 4Z8XA 2CK3D 1Z07A 4JLJA 4PAMA 1OB5A 2F1IA 1FQKA 3QPVA 4A6XA 2XNDA 3D31A 4D4KA 1R7RA 4LHZA 1KAOA 5KOYA 221PA 4JVMA 1XEWY 1JPJA 5SZHB 3TR5A 4DDVA 3PUWA 1FPMA 1LNZA 2ZRDA 3GCGA 5FPKA 2NGRA 4A8JA 1JAIA 1U2RA 2ZJ8A 4URUR 3V4RA 4QJ3A 1VTKA 1EGAA 2UZ3A 3KQNA 4P4TA 1GSIA 1OH8A 3RWOA 2V7QD 2ZRKA 2KSQA 2CNWD 4PAQA 3R7WB 2GVDC 2ZI7A 3O47A 1F48A 3QUSA 2WV9A 3B1XA 2D2FA 4ZKEA 1Z0AA 2XNSA 1E9EA 3CNLA 1C9KA 1ZUHA 5GJBA 2FSIA 2FG5A 5G3ZA 1R5BA 4MQBA 2JLZA 5CDFA 3QKUA 3C14C 3TAUA 4YDSA 1W4BA 1R5NA 3VQTA 1UBEA 1IQPA 1NSTA 4TTRA 4GP7A 3BH6A 3U7FB 3B1WA 4BFZA 2ZRNA 1L4YA 4FMDB 4Q5IA 3K0AA 2RHDA 4L15A 4PQYA 4IVQA 4YXWD 4B71A 4EFMA 1Z5ZA 2ZRMA 1CR2A 1KY2A 2JJ2D 2Q0HA 3BAFA 1LW7A 1Z6YA 4TLDA 2YKGA 2HJVA 2W58A 1X8KA 4M1TA 5BW8A 2QORA 1QRAA 2ZR9A 2GRJA 4BECA 2PCJA 2QPOA 3W3AA 5JSZB 2NOAA 5SZKB 2YINC 1ZM7A 3BGWA 1KY3A 4DIDA 4JLKA 2B8TA 4EFLA 4KITB 1EESA 4RFSB 4BRWA 3QG5A 5KUTA 3HDTA 2BJVA 1P75A 4MRRA 1BH2A 1XP8A 3GQBA 1GOTA 4EJSB 3ZD6A 1DO0A 2ATXA 2NMVA 3KXKA 4Q7MB 2WJYA 3BJIC 1SXJD 1VYTA 1LF5A 2FFAA 3DPUA 1B23P 2BEKA 1ZIOA 5JCPA 1SVWA 3HR7A 2WVJA 4AC9A 1KMHA 4IW3B 3RRYA 2OEPA 4KU4A 2FZ4A 3H84A 4YMSA 3TSZA 3MWKA 1JPNA 2OUKA 2IW3A 5DO9A 4YMTA 2I4IA 3FDIA 2NG1A 3EW9A 1KHTA 2C2HA 2XSZA 3EZ9A 1ZC3A 4MRNA 3T1QA 4AYTA 1QG2A 2AXNA 2GJSA 4JLAA 3AVQA 3R8CA 1F3OA 3RVBA 3A6PC 1E2QA 3QF4A 5LBIA 4CZ2A 4FI3C 4EPRA 1X8JA 4PPNA 1UBCA 1II8B 3GJ0A 4FWIB 1JR3D 3LBNA 2XXAB 1Z8FA 3QEJA 2N42A 1W5SA 1Z6AA 3SJZA 2YWGA 2QT0A 4HEJA 4HDCA 1I4LD 4HDQB 3BD9A 5DYIA 1F2TB 3VR6A 2QGZA 1WDTA 1S2MA 4RFVA 2HLDD 4C0QC 2VHJA 3MAAC 1Z0KA 1J8YF 2F9LA 2WJVA 4Q1DA 4KLNA 1TQ4A 2QG6A 3KKMA 3I8SA 4ILEA 1NJFA 4D6PA 2F1RA 3CONA 2XITA 5FUXA 3G82C 3EASA 4FN5A 3X1XA 4DDUA 4I81A 3AP1A 4C2UA 3AEZA 4TLCA 3VU9A 2GA8A 3A37A 3ZIAD 3RRNA 3SC3A 1G8PA 3ADDA 4RKFA 4AIIA 4BFVA 4D81A 1UDWA 2GJ9A 5JI3E 2XJ9A 4A36A 3KTAB 3AF4A 1YE8A 3FVQA 4E22A 4OJQA 3ZZUA 2FH5B 5J4KA 2IYYA 5KPJA 3THWA 1DG1G 4FIDA 3CWZA 5A0FA 3WNDA 3WRYC 1QHHB 2ZTSA 4MA4A 3GJ8A 1NIPA 1ZNXA 2QMEA 3ZD7A 2BMEA 1NVVQ 4DZZA 2VA8A 4QGHA 2QI9C 5FOVA 3SJBA 1FFHA 5E95A 5JS8A 1YKSA 2IA5A 4PZYA 1K6MA 1H8HD 2WWXA 1DAFA 4ACBA 2VEDA 3FGNA 3LXRA 1NN1A 3QKRB 2ANCA 1O3YA 3BB3A 1OFHA 3OIVA 4HAWA 5FOWA 5J4VA 2GDJA 1OXSC 3K0AB 5FPYA 4B6FA 2YWHA 1XPOA 2XAUA 3KKQA 3TMKA 4V0LA 3GJ4A 2CHVA 2CLCX 3AB3A 1HT2E 2QU8A 4NYMQ 3VKWA 3B1ZA 1GRNA 5DSZA 3DEFA 1VECA 2IYUA 3EIEA 2XOKA 4OQNA 1KTVA 2A5YB 1EFHA 2ZU0C 5FUVA 3DM9B 2P5TB 3AF0A 3VKGA 2OXRA 5AUNB 3SFVA 4P4SB 1XMSA 1DOAA 2QBYB 1XTQA 5KPDA 2OXCA 1T8UA 2BKEA 3AVPA 4WXRA 4DLRA 2VTKA 3QOFA 3WP0A 2FPLA 1Q21A 2AK2A 2OBMA 4GOJA 3T12A 5C18A 2C98A 1WB9A 3A4NA 1J7KA 2D4HA 1NLYA 3OE7D 3I1FA 2C04A 1EFRD 4FCVA 1E0SA 4Q19A 4LRWA 4LBZA 2ZJ2A 3L43A 3VNUA 4F4CA 2AD5A 4EUNA 4PHTA 2FFBA 2BVNA 1XMIA 3LQRA 3VAAA 5FR1A 1AS0A 2DYKA 1YRAA 1MKYA 5FOSA 1GL6A 4TQAA 3IPYA 3AUYA 3FKQA 2CMKA 3H2YA 3NXSA 1YZUA 2BDTA 1E96A 2BMFA 4HLUA 4D26A 1JNYA 1HYQA 2Q3HA 1IJFA 2GEUA 2VRWA 3SI7A 1G3MA 4TSFD 5L3VA 4G5SA 1FP7A 1IONA 2W2XA 4Q03A 2JJ1D 3ZDQA 2BKUA 4EPTA 2GXAA 3TK1A 4IEIA 3TUIC 5H68A 1GUAA 2UKDA 3MFYA 1F6BA 4NYMR 1YZLA 4A0GA 5KDDA 5FBVB 3A1WA 1QHYA 2O8CB 2ZI9A 1P2SA 2GJAA 3IDQA 4N1AA 5AJYA 2WWFA 1JR3E 4M0LA 2WM9B 2ZSEA 1G16A 1KI1A 2DFTA 4FXPA 4XD7D 1Z63A 1GDDA 2ODWA 2ERXA 1P62B 4NKRA 2ZRBA 3VU9B 3Q5DA 3GLGA 4B2IA 4MDFA 2O8BB 2C5LA 3H1TA 4V0KA 1OJLA 4XTRA 4YXWA 3QXCA 3C4JA 2OLJA 1G6HA 2XB4A 4ARZB 3UG7A 3GLFA 3L0SA 2NIPA 3KTAA 5BWMA 1E9AA 2IHYA 4LI0A 4D2IA 1G8FA 4FMCB 5FL7A 2QAGB 4A1FA 1DS6A 1G6OA 2K5UA 2WHXA 1KO5A 4IOJA 4CEIB 5FBLB 3U44A 5JCZA 1RYFA 1OF1A 2YOFA 2HT6A 5K8TA 4TWZA 4QGFA 4LPSA 4FWTA 3EZFA 1OH5A 1FNNA 1E1QD 1XTSA 3Q9LA 4PO9A 3DMDA 2ZROA 3W8NA 2HXYA 1N5IA 2BC9A 2G77B 2NQ2C 2ZRHA 1TF2A 3L8ZA 4IXNA 3GP8A 4EQ6A 3CZQA 3B82A 3REGA 2HCBA 1JJVA 4JLBA 3VFDA 3JVUA 4E07A 5K8UA 4TYNA 2ZJYA 1NKTA 5JSZA 4US2R 2JLSA 1JQLB 2E87A 3FMIA 2BMJA 2YC4C 2ZEJA 2MSDB 3OESA 1COWD 1L2TA 2XOKD 2Q6TA 2IUSA 4K46A 4TL9A 3K0CC 2W6ID 4IDQA 3P1JA 2FU5C 1PV4A 1HA3A 1E2FA 3KL4A 1KK2A 3AF1A 3IEVA 1NG1A 1Z22A 1J2JA 1F60A 3LAWA 3LXXA 4QBHA 1W0KD 2BJWA 1H65A 4PHHA 5LB2A 4O25A 5JWHA 1WRBA 3W3ZB 4LGMA 4PZLA 1XJCA 3CKLA 5EE0A 3PIRA 2QNRA 4KSCA 2VPPA 1VMAA 4FD2A 1IOZA 1UF9A 3FPAA 1MRSA 3KX2A 4B2PA 3PUYA 1S96A 3BFVA 4Y0AA 1MOZA 4A2WA 2EU8A 2X77A 3X1DA 4UKDA 5G3YA 2O0HA 1U81A 3CBQA 2QSYA 2FSHA 1A7JA 2DFNA 2ZSFA 2GETA 4QNRA 1KK0A 3WMGA 5FI0B 5JI2E 3FE2A 2WWWA 4K81B 1UBFA 5JEEA 2CHGA 4P0TA 2LCFA 4RJLA 5A4JA 1KJYA 1Z28A 2PEYA 4RCZA 5JHHB 2ZM5A 1W2GA 2R8RA 2XZOA 4ON9A 3MGCA 4YMVA 3ONWA 1Z0IA 2ZIAA 4HB0A 4Q02A 2ZS9A 5FR2A 4MKHA 1MT0A 3K70D 4M8NE 2IYVA 2ORVA 1GRQA 3D7MA 4MKFA 4BE7B 5CJPA 2Z43A 2CE2X 2RGEA 1Z08A 2GCPA 4JZKA 3PJRA 2WKPA 4KFSA 1XEFA 4C0BA 3ECCA 2FFQA 4GZLA 5GJVC 5AJWA 1BMFD 4LY6A 3NVAA 1E79D 5FPSA 1OXUA 2QRZA 4Z8YA 4HYYA 1TEXA 4JL6A 5HZKA 1OKKD 1G3IA 1ONBA 1QVAA 1ZVQA 3W6OA 3THWB 2B21A 2WIBA 1O87A 1QHHA 4Q66C 5C4MA 2F43B 3T1TA 1TMKA 4IJMA 1KDRA 1VG8A 2LWIA 3D6TB 3QF4B 1XZQA 3DOEA 1SULA 1OLOA 3AH8A 3PITA 3PUVA 4NONA 4DHEA 4B35A 2J3EA 3T06B 4EIWA 2RB4A 4OQLA 3TVDA 1OSNA 1E2MA 3EXAA 1P73A 4OQMA 4ZDJA 1SHZA 4A9AA 3PEUA 1IBRA 1TPZA 2QQEA 4ABYA 4I1VA 4P31A 4PPGA 1ZM4A 3I62A 4FCTA 4JYCA 4DB4A 4XVQA 2DR3A 3KFXA 1E9BA 3IO3A 3TR0A 3NHBA 4DC9A 4EQ6B 2H5EA 2XEXA 3ZLJA 3NWJA 2G0TA 2RHMA 4OI4A 3ZIAA 2WBLC 3OE7A 1SXJC 5FUWA 4R9UC 1KOFA 1MH1A 4P4SA 4NTZA 4MH0R 1S0UA 4TQ9A 1FTSA 3NDBB 1EFTA 3IEUA 4R71A 1G19A 2O8DB 2PT5A 1TEVA 1KYIA 1R5OA 3IGFA 4BFWA 4PO1A 4KVGA 2CL7X 1J8MF 2VQSA 3C41J 3VHLB 4RY2A 1ZC4A 4LUCA 1W0KA 4B74A 1OYYA 3FFAA 5CK5A 1P6XA 2FGKA 5JBQA 4QJ4A 2ORWA 3MG9A 3SFZA 1KI3A 3GLIB 2IS2A 1Z6TA 5DNYB 1U98A 2ERYA 2HF9A 1JECA 4FMBB 1M8PA 2PT7A 4Q4AB 4XOIA 5CB8A 5CDFE 4ASUD 4AYXA 3M4YA 3A4LA 4QHSA 3TW8B 2Q21A 1Z06A 2V6JA 3D3QA 5AJVB 3ZS8A 2REOA 1SXJB 4M21A 4XWAA 3CPHA 4MYUA 2PLRA 4M2LA 1XEXA 4NYIR 4AK9A 3BBPA 2KWIA 2W0MA 4PC6A 5EXTA 1U0JA 1W4CA 4B3DA 4HLCA 3M6AA 1VHLA 1P4SA 2FA9A 1RJ9B 5EXXA 4WVFA 4HZUA 5A5GA 1AGPA 1GP2A 4Q4HA 3PEVA 4POAA 4HAUA 2HLDA 3RHFA 2ONJA 4A82A 1KGDA 5HE9A 4MRSA 1Y3AA 1BOFA 1IXZA 4MYTA 3U4QA 2H16A 2QAGC 1TU3A 1Z2AA 2QZ4A 2WJHA 2OBNA 3MWYW 4PQRA 3KFVA 3ZJYA 5L8VA 1BO6A 1E9SA 2CJWA 5DIFA 1OFIA 3OEED 3AKEA 1PLJA 4DB2A 4HZIA 3WRXC 1G7SA 2FZLA 3LBIA 4DVGA 3TE6A 2R62A 3TUZC 4PSVA 4II7A 1OXVA 4QC2A 1H8EA 1T5LA 3R9IA 2ZRFA 5IDVA 2R6CA 3MWLA 4OI0A 4N0EA 3DKPA 2MMGA 4Q7LA 1GM5A 4OYHA 1EFCA 4TT3A 5CYOA 1XTIA 2N1BA 3KKPA 4W9MC 4IKEA 1DELA 5JMTA 3CH4B 1UKEA 4RVCA 2W2VA 3UMRA 1G9XA 2MSEB 4IFBA 3AP3A 1VYVA 4UXHA 4IFEA 1XXHE 3SU8A 2ZJOA 5P21A 2ANBA 4JBYA 3UK6A 1W48A 4LOAA 4QG7A 2IYRA 4ZDKA 1T9HA 3I3SR 3PCRB 3U3RA 4X8OA 4HZUB 3U7HB 1XF9A 1GZSA 2AKAB 1U8YA 1GKYA 5C4GB 1XZPA 4EJSA 4URXR 2QRNA 1G8HA 2Q3FA 4A2QA 4IEEA 2JDID 1XB2A 2VSFA 5DE3A 3RRMA 1LS1A 4KYUA 4R2IA 5LPNA 3Q7QA 3LLUA 4LHXA 4NDZA 4NMMA 3UWKA 2DB3A 3V00A 1NVWQ 1H8ED 2WTUA 1JB1A 2J7PA 1VHTA 1G64A 2E1RA 2OCAA 2IWRA 2GXUA 1G3RA 2VHUA 3QJYA 2B8WA 1E4VA 5B57C 4FW9A 3SE0A 4UJ3A 4LDJA 2JLWA 3FHTA 3EWAA 3VR5A 3GLHE 2CLDX 2JLRA 1ZNZA 1Q0UA 4LYFA 5B2ZA 3DL0A 2XX3A 4GZMA 1E3MA 1IHUA 2YVUA 1WBBA 1KJZA 5AUOB 4WBSA 5FFMA 2TMKA 1T3LA 4TLBA 2B7BA 2ZI5A 1U99A 1S9DA 3CR8A 4FMDF 4KYIB 3QVVA 4RZXA 1YVDA 4MKIA 1G7CA 2EFDB 3IUYA 5KO2A 4B34A 2YHSA 3CX8A 2X2FA 1NL3A 2C96A 1CJTC 1E2NA 4Q21A 1ZNWA 4ZDIA 4D4JA 1G1MA 3CRVA 2ZR0A 2OCBA 1AS2A 5KDLA 4E5UA 4IRUB 3CIOA 2R65A 3CZPA 4TYYA 1E2HA 1TL7C 2VH5R 5AR1A 3RAPR 1BYUA 5BXQC 4DEXA 1SVOA 1UEJA 4A92A 3H4MA 4UNQA 1CIPA 3VNVA 1GFIA 4TQUS 2WWYA 3RC3A 4F38A 1TAGA 4D0LB 3CB4A 1ETUA 2WSSD 4U5XA 1CRQA 3I61A 3L0IB 4CW7A 4B3XA 1TQ6A 2NTYC 5EP3A 5FBRB 2QL6A 4UNNA 3B2EA 2KB0A 1KZ7B 3B8HA 1KK3A 4ESVA 3X1WA 3B6EA 3F5FA 3IKJA 5JEDA 4PC2A 1OIWA 1S1CA 3TQFA 4PPQA 2CVFA 3LFUA 4Q9KA 2OV2A 2DWQA 3BORA 3SYNA 2G88A 4Q9HA 4DLSA 3KXLA 5G41A 1US8B 1N25A 4TYPA 1IN8A 1JEEA 1M7HA 5JRZA 4BLTA 1KI6A 3K0CA 1RFLA 1KI4A 5CJ2A 4QGGA 3KKOA 2PZEA 1NKSA 1SZPA 1AN0A 4TL7A 5JJIA 1IN7A 1N0VC 2GTPA 5LB4A 3NTUA 1J70A 1F2UB 5HZHA 4OBEA 3U3JA 3EA5A 1X6VA 3SHFA 3CW2A 2AKYA 4DUGD 1AJEA 1EFRA 3MLEA 2BBWA 1G291 2BOVA 3GPLA 3R9XA 4DJTA 1RYHA 3KXIA 1KO8A 5E4FA 4US0R 1SGWA 2QM8A 4TMKA 1UEIA 2IS6A 2V9PA 1G3UA 3CUEF 1XPRA 1CR4A 2FOLA 3GLFE 1KI7A 1YQTA 3TBKA 1P2VA 4QJ5A 3NEJA 3E2IA 1KMHB 3FMOB 4QNMA 4A0FA 3GJXC 1X8LA 2GBLA 2VHCA 3GJ5A 4LJ9A 1NI3A 1QZXA 1R2QA 2D62A 4TMXA 4YLGA 1FQJA 1JBKA 1H8HA 2WAYA 2IXFA 4ZIRA 4BLRA 2ZYTX 2KBFA 3ASZA 1RRPA 2RGCA 3DDCA 1FNMA 1GNRA 3QEOA 4XTCS 1CLUA 5FTNA 1LV7A 2RGDA 3WYAA 2ZRGA 4TMTA 3FMFA 2AWNA 2D7CA 1RC8A 5JWRA 4B44A 4NBSA 4V0MA 4DXAA 1E69A 5FOUA 5GJWC 3BFKA 2ZJ5A 3QBVA 2OG2A 5FPHA 5B30A 3NKVA 4I4LA 1M74A 4B75A 2GAOA 2ZSAA 3RDPA 4BFXA 2RGNA 3I5XA 3EIHA 1ZU5A 2FPKA 5D3MA 1GKIA 5AUPB 3W8RA 3B1YA 2V55B 1W5TA 5KSYA 5KSZA 4QBIA 2ZYWX 2I1QA 2OFXA 3H0KA 2J87A 3AVOA 4Q00A 1BKDR 2AK3A 4CT4B 2ASEA 1X1RA 4TL8A 1XD2A 1XPUA 2RGBA 3W34A 4AG5A 1K8RA 3RYTC 4ACAA 3VR1A 5LD2C 3OAAA 2EWVA 2WZQA 4QRHA 2CNWA 4H1UA 1T6NA 2CLSA 2YWEA 2IS1A 2Z4SA 4HUTA 4EPVA 4DSOA 1W36D 3HP1A 4V03A 1IXSB 4DLVA 1TTTA 3QF7A 3VR2A 2PJRA 1ZM9A 1OPXA 1E1QA 2XZLA 4LJAA 3SEAA 2R9VA 4R7ZA 1D5CA 1E0JA 1OFTA 3CF0A 1E9FA 2OT3B 2QGNA 2W00A 2WWIA 1VCMA 2FV8A 4RD1A 5EQTA 5EUMA 3TW4A 1MR3F 1KSFX 1KSJA 3UKDA 4XWOA 1ZJ6A 1T3SA 1YZNA 3N70A 1XCPA 4A0RA 4DCVA 3NH9A 1KMQA 1G8GA 3BB1A 1R0ZA 1VG0B 1KO1A 1VCOA 2EFEB 3CO5A 1G7TA 3CPEA 4LV6A 8OHMA 1XXHB 5EJEA 2IK8A 1LS6A 2FWRA 4JVLA 2ZITA 4M9QA 4AD8A 3TSOA 1W36C 2W6IA 1KAGA 2G6BA 4B47A 3GEIA 2VSXA 1II8A 1NIJA 3FFBA 4KAXA 3L82B 1N6KA 4M9XA 4RSGA 3MJRA 2QP3A 3WBKA 1ZD9A 3BC1A 5L3RA 3O8DA 2IYSA 5E7IA 4F91B 1XD2B 1JJ7A 3FOZA 2Z83A 4Q7JB 2J0QA 2F3RA 5FPTA 3EC1A 1RJ9A 1Z2CA 2KE5A 4PC7A 3FB4A 2PX3A 4EPXA 3K1JA 1AS3A 1MO5A 4PFSA 3THXB 2PX0A 2QPTA 4JBXA 2VSOA 5KTYA 5CM9C 5TV2A 3TIFA 3K09A 4HB2A 1EFUA 1BS1A 4XVUA 3BS4A 1DBSA 1EX7A 4QFMA 1P3JA 1T3HA 4OKSA 1HTWA 1KZGB 2J5XA 3KQHA 3NH6A 2O8EB 4KHZA 2C8VA 3HU2A 3OEEA 1XX6A 3THOA 3TGPA 2PZGA 3ADCA 2VF7A 1KK1A 2CL6X 2FF7A 2XTMA 3CM0A 4BFUA 1AKYA 2DFLA 4JBWA 2F1JA 4DCUA 1HY3A 3ZQ6A 2JASA 1XXHA 2YV5A 1II9A 2ZVQX 3REFA 4JKYA 4KODA 3WNBA 1VIAA 3GFPA 3MRSA 5BN3A 4BLQA 1NLZA 4YMUA 1OIVA 2JIZD 2Q3MA 3RANA 4BPBA 1B0UA 1OYWA 4JJZA 4NCNA 5CM8B 1KKMA 4GI7A 1E9DA 2JGNA 4QGAA 4IVRA 5G40A 2RKOA 2H92A 4LHWA 3P4YA 1IN4A 5LD2B 3SNHA 4A8JC 4M9ZA 3A1SA 1KNQA 4OI1A 1A2KC 1NBMA 1RRFA 1FW6A 4GOXA 4AKGA 4JLDA 3W5JA 2VIIA 2CCGA 3K09C 5TVKA 1Q57A 1A5TA 2IEYA 1DAIA 2ZE5A 4Q1FA 4ASUA 3JZAA 4KCGA 4I1OA 4WZBE 1D2MA 4GFDA 1AQYA 1VG1A 4JLOA 2IXEA 4BLOA 2XGJA 4DCSA 5K8IA 2QROA 3KJIA 3WY9A 4OHWA 2RGGA 4WA7A 4DKXA 3LA6A 2DY1A 4NH0A 2YNMA 3IBYA 2QMHA 2FEMA 5BYKA 2HJGA 2ZETA 5KU1A 1NVXQ 3LW8A 3LVRE 2GZHA 4MGZR 3PV0A 1II0A 4CEIA 3BE4A 2IYWA 1WMSA 2OCYC 1SKYE 4IOMA 5FL3A 1SHKA 5TMPA 3QKSA 4Q7KA 2WJIA 2ZRIA 3NC1C 2EW1A 2YOHA 4M1MA 1YR7A 4ZO4A 2A9KA 1U9IA 2IYLD 2W2TA 2Q9CA 3B13B 3RS5A 1W44A 3OZXA 5JECA 4OI2A 2XTZA 3LW7A 1NMZA 2YZ2A 1E2JA 5GADl 1EXMA 1NG9A 5KHOC 4EPYA 1G4AE 3RABA 4KLZA 5FTJA 4B3BA 1GNPA 1UKZA 1MABA 1WXQA 2E9SA 5FOTA 2VO1A 3U2QA 4JMPA 3VX4A 4DEYA 4LBYA 4L5BA 3PR1A 4PPFA 1S4QA 3QENA 2P65A 4AKHA 5FH9A 2GVZC 3R9WA 1LTQA 2ZAMA 1CJVC 2ZSBA 4HAYA 1OW3B 3SDZA 3UIEA 4EAQA 1V43A 2IC5A 2Q9AA 4BFSA 5FOXA 3FWYA 5JFGA 3QE0A 3AQ4A 1NBMD 3CNOA 1Q1ZA 3SN6A 2GXQA 1CRPA 1M7BA 1G3QA 2ZRLA 1Q22A 2DBYA 2X2EA 3W6NA 5H8WA 2F7SA 2V1UA 4Z1MD 3UMFA 3P4XA 1NF3A 2OLKA 4GPTA 3TAHA 2NO0A 3K9LA 3HYTA 5CITA 1JI0A 3KQKA 3RS7A 3KQUA 4LJ5A 2P6RA 3VX3A 3THYA 5K8LA 4G01B 5ELXA 4ARZA 1W4AA 2O8EA 2BMDA 2JJ8A 4G5RA 3OIWA 4L9SA 4D0GA 1US8A 1NSFA 4MUAA 3WHLA 2ZI4A 5J47A 1DEKA 2UVQA 1WBDA 2RGXA 1UADA 1UJ2A 1U0LA 4WIAA 2H18A 2W83A 2WSMA 3S1AA 2PL3A 4K8OA 5CYPA 2HYIC 2A5JA 3M1IA 1UKYA 4LJ7A 1P2TA 3ZGXA 5KSPA 1SXJA 4TSFA 3BFXA 4YQFA 2JIZA 2A7QA 1RPZA 1TU4A 3IIKA 4S35A 3TKLA 1WA5A 4JSTA 1OFUX 4JLVA 4OK5A 4CVNA 1OT3A 3QKTA 2DWOA 1ZCAA 5F9HA 4WZ6A 4XIGS 3SJAA 2HYDA 1R4AA 1WCV1 4QOSA 4U00A 3SYKA 3MD0A 4Z1MA 5BQ5A 2BEJA 1OH6A 1D8TA 3VKHA 4C0JA 3PENA 1HQCA 5JWOA 5IK2A 2FSGA 4URZR 4LYHA 1CS4C 2BCJQ 1XBTA 5DGXA 1KSHA 1S3SA 5HPYB 4RZUA 1SVLA 1CP2A 1FZQA 1ZCBA 2CJWB 3LD9A 4IDOA 4TYQA 2XSZD 1XTRA 3EA0A 3KUCA 1FX0B 4CEHB 4MRVA 1NMYA 2WJGA 4LK2A 5E7JA 2GCOB 1KJWA 1R6BX 1DAGA 2H1LA 4NE2A 4BQSA 4NP6A 3UG6A 5GVSA 2R6GA 2PJZA 2V4ZA 1E2LA 4OK3A 2YYZA 2WKQA 1LF0A 2P67A 4JT4A 1HURA 821PA 1COWA 1SXJE 3DOFA 3R20A 2DHRA 2ZAOA 3L8YA 4LYJA 2OM2A 1Q3TA 5AWFC 1M2OB 4B43A 4CT5A 2IL1A 3FKSA 3OEHA 4JVNA 1N6NA 4M53A 1XCMA 2ZREA 3K8YA 4V02A 2IWHA 4DDWA 2PH1A 2GZDA 3GMTA 2R6DA 1PZNA 2R44A 3K0EA 1E94E 1W46A 4URWR 2ZXUA 3EPLA 1ZD1A 1RKBA 4RZ2A 1OH7A 3LBHA 2ODEA 3MUFA 4B2LA 2GF0A 4LHVA 2O0JA 5BYJA 4DLXA 2O8DA 2AX4A 4PSAA 4XWKA 4MKGA 4OK6A 4OHXA 4Q48A 3TNFA 2ZE8A 5B64A 3AVTA 4F4IA 2WWGA 2C77A 1YRBA 2H7VA 4B3CA 3NDPA 1GRRA 2QBYA 1FX0A 5IF9A 4CEHA 2VP2A 121PA 2IBMA 1ODFA 4TN1A 5DISB 1E1RA 2C9OA 4LPKA 2ZR7A 3GJ3A 1PVOA 1IN6A 1W0JA 2PMKA 4JIMA 3X1ZA 5JJLA 3CLVA 1U9IC 1GG2A 1U94A 4JLMA 1KDTA 1XMVA 1RW4A 2IYTA 2Z0MA 1OKKA 4RD0A 2IEZA 4GP6A 3THYB 1E2KA 4Q4AA 4NHOA 3E5HA 4RD2A 4OHZA 4MGKR 4C0KA 1XWIA 1OE0A 3GLHA 1N6PA 4V0ME 5DI3B 3AVUA 3MMPA 4KFTA 1SVIA 3IQWA 1G20E 3LVQE 1J90A 3UANA 2WKRA 3RSOA 4B73A 1ZYUA 4AKEA 4W5JA 3K70B 1CKEA 4YC7A 4NZYA 3PFIA 1EK0A 2ORIA 1CJUC 3IO5A 2NZ8A 1N0WA 1GWNA 4ZCLA 3QQ5A 4IOLA 3C8UA 4KFRA 1Q20A 4NCKA 1JXMA 1CULC 2GCNA 4Q4HB 5DN6A 2XNDD 4DDTA 2W0SA 4R2HA 3G0HA 3VTKA 4A0HA 2J0UA 2GBLC 2J7PD 4JLNA 1D2EA 1XTJA 2BCGY 1XMJA 2HCJB 4D25A 4URYR 2F1HA 2P6NA 2NPFA 4P4UA 3WYFA 4AURA 1NJGA 2IT1A 4UJ5A 4NYJQ 4PSKA 2G0NA 4HUQA 1S1MA 3LY5A 4JYBA 1GIAA 4CF7A 3AM1A 1M34E 1NN0A 1NN5A 2ZANA 2IHBA 5EE9A 1R0XA 5EXSA 4R98A 1XU4A 2OAQ1 2RGNC 3DHWC 5L3QB 1EG7A 4BWYA 4Q47A 1D6JA 4C0SA 1Z83A 5KNCA 3Q85A 2JDIA 1QHSA 1J99A 5EE5B 3PUXA 4PC1A 4ZDWA 5TDHA 3PEYA 1SVMA 2HXSA 1GKUB 1SKQA 2FMXA 2FPMA 2NZJA 2PBRA 1CJKC 1U8ZA 1CXZA 3OHMA 3FKSD 1E2PA 3OIUA 3OEHD 4QXAA 2C95A 3ZVRA 1ESMA 4DSTA 2FEOA 1ZM2A 3A58B 3PXGA 4QM6A 2IYZA 4XSHA 2IF0A 5F98A 2WPDA 3BH7A 3I32A 3ADBA 2Z5FA 5LDDC 2HF8A 3B9QA 2BV3A 3ZS9A 2QP4A 3EWSA 3NEYA 4D4MA 4DCTA 3AVWA 1N6OA 2ZU6A 3T34A 1DVRA 3LV8A 4H1VA 3GEEA 1R10A 1YJ5A 3N5CA 4A4DA 1L4UA 4GT1A 4DT1A 1HE8B 1Z3IX 1TF5A 2CHQA 1Q3HA 2J9RA 3CRQA 2CCKA 5KNDA 4O3MA 2NPIA 4HUQB 2AFIE 4KFUA 3CPJB 1I4TD 2QSZA 4DLTA 2GKSA 2UZIR 2NO6A 2BBOA 1Q44A 2X8AA 4XVRA 4DLYA 3U4QB 3AUXA 3TUJC 4LC0A 1G41A 2ZUBA 3K53A 3MSXA 4CYMA 4EDHA 1DO2A 1Z29A 1QBKC 1WQ1R 1NNEA 2VF8A 3CF2A 1G8YA 3NIBA 2EVWX 2JATA 3U60B 1W49A 2EWWA 4IVPA 2ZRJA 4MYCA 4JL5A 4QKQA 1DAHA 3EZ2A 3C7KA 2A30A 4GMDA 4Q1CA 2AXPA 1VPLA 3T5GA 3R8FA 3GLHB 1Z0JA 1UKVY 3C5HA 4N3NA 4G1UC 2QAJA 3QPUA 3SOPA 3DZDA 2ZE7A 2AR7A 1G5TA 3K0SA 4WZAE 1I4DD 2FX3A 2RCNA 2ATVA 2D06A 4M1OA 2YOGA 1VDZA 4PANA 5BN4A 4S2EA 5HTKA 2D74A 2REXB 3IIMA 4XSGA 2QTHA 4IDNA 4Q4JB 2Q9BA 4UNRA 3IIJA 2JJ2A 1GNQA 1AZSC 5HE8A 3I8XA 2FFHA 4C0LA 4M9SA 1RRCA 3HJNA 2A78A 2J0UB 4OQXA 4BZPA 1PLLA 5F2EA 2C03A 3A1VA 4U02A 4YONB 1L7VC 2O8FB 3IHLA 4L4UA 3RNLA 2P5SA 3AGQA 2JLYA 1XJQA 2H57A 1FUUA 2B7CA 1AIPA 3VR4A 3A1TA 1E99A 4LHYA 521PA 3BK7A 1Y63A 3O8CA 1NP6A 3ICEA 1N5LA 4HI0E 4HAZA 2GK7A 1VIYA 5EE3A 1X86B 2ZS7A 4B3FX 2X19A 3BB4A 3ICQB 4M22A 3WHKA 1T8TA 2EFGA 1ESNA 3VR3A 2ZE6A 3G5UA 5FBQB 1OB2A 2P2LA 1C1YA 3BERA 1F2UA 4BLPA 4BUJA 1P9WA 3LX5A 4NCJA 2ZI3A 5J5CA 4HDOB 2LKCA 3IHWA 4ZPXA 1E32A 5CIWA 5KNBA 2OCPA 3EZ7A 4MRPA 2RGAA 5JZVA 3QXHA 3M0EA 2FDCA 2ZYUX 3B78A 1OHHD 3LQQA 2ZRPA 2C9CA 4PQFA 4EPWA 1OIXA 2ZUCA 5JHGB 4PC3A 4FINA 3QVUA 3CX7A 2VHTA 4OJKA 3RC8A 5C46F 2VP6A 3AVYA 1R8SA 4AY2A 1DTSA 1YZGA 5CLQA 1FMJA 2QA5A 2ZQ5A 421PA 2G83A 2AN9A 2GAAA 2IXGA 4Q18A 2W6JD 2P0EA 4W5HA 3KJEA 1EX6A 3WP1B 2QM7A 5SZJA 4G0NA 4O2LA 1E6CA 1S8FA 1X1SA 1KI8A 4DSNA 1LB1B 1Q1QA 1VKJA 4TMWA 3RS3A 3AGPA 1AKEA 3MJHA 4MYHA 4Y0VA 4AWXA 2PCLA 1G5RA 4PHFA 4ZKDA 4KSBA 4NCIA 2C99A 4EJSC 5DLQC 4WW0A 1S3GA 3A36A 2C78A 2R2AA 3Q3JB 4DLWA 2QE7D 3ADKA 1E9CA 4L9WA 3EPKA 2P6UA 1LY1A 1N0UA 3V4FA 2XXAA 1GVNB 1TX4B 2QTVB 1TQDA 3CWQA 3U7GA 3NHAA 2IF2A 1Z0DA 4JKIA 4UNSA 3WMFA 4BEJA 1GL9B 2A3RA 4QHYA 1TF7A 2G3YA 1FUKA 1F2TA 4A6PA 3ZVNA 3QXSA 2D7DA 2ZJZA 2LKDA 2ZRAA 3EPJA 1Z6GA 4KO8A 5B58C 3K0FB 3QY0A 5DYGA 2HEIA 3RRZA 3P32A 3EAQA 3NBZC 4D80A 4I1UA 1YHNA 3BH0A 4E03A 4C4PA 5CB6A 1KI9A 2FNAA 1OHHA 2JJ1A 1XEXB 2ZI6A 1FOEB 3QI2A 4HSEA 3T15A 5HKKA 1NY6A 1SQ5A 2EYQA 2I3BA 5FUYA 4HLUC 1TUEA 1TQ2A 3GEHA 4I99A 1CJMA 1D2NA 1HV8A 2KI5A 4NCHA 2BIFA 3CRW1 4RD3A 3NG1A 2CL0X 4GSYA 5IHPA 2CVHA 3ZZ0A 5EUQB 4I1SA 1IJEA 1ZU4A 1ZNYA 2FSFA 3QKSB 1JXOA 3WYGA 1VG9B 3W6PA 4NU0A 1QF9A 4BZXA 2QMUA 2MMCA 4LBWA 4KJZA 5J4LA 3OF5A 5CIQA 3WNCA 4RKEA 4PZZA 4KVAA 4TMZA 3ZYCA 3TQCA 3LNCA 2OESA 3T35A 2XZPA 4B3GA 3GFTA 2QY9A 5HCNA 4DUGA 3KJGA 1KI2A 1PUIA 4JT2A 2O52A 1HEIA 3ND8A 2BBSA 2YJTD 3THXA 3LLMA 4LZZA 5JS7A 1RVDA 3QNUA 2OE2A 4BRUA 2ODBA 3Q72A 2FE4A 2OBLA 2QP9X 2QUZA 4O2RA 1HQYE 1VYUA 4DT1B 1N6IA 2ZS8A 3P27A 5M04A 2YC2C 4KXFB 4TLAA 1JR6A 3LH5A 3R7WA 4CRWB 1CBUA 2VP4A 1W36B 1X3SA 5HCIA 4M1WA 5AJXA 3RS4A 3B1VA 2GNOA 3FYHA 4UXJA 2QN6A 1IN5A 1ZMXA 5FBWB 1R0WA 1VCNA 3KQLA 1IY2A 1C4OA 1MO6A 2WJJA 2BHRA 1NVUQ 1XDBA 4TT3D 2IYQA 2JLVA 2CEAA 1N3BA 3AKYA 3E1SA 3T5DA 4HLQB 2OZEA 3T1VA 1G7RA 2PEZA 2R6FA 4DWJA 2B92A 1RZ3A 3QBTA 3QXJA 2J41A 5FTMA 2JLUA 1IY1A 4Z51A 3CR7A 4EFNA 2ZVPX 2ECKA 1E0AA 3AP2A 5JJKA 2QT1A 3O8BA 4WAUA 3U5ZB 4QBFA 5FL7D 2EFCB 1NY5A 3SR0A 3VHXA 1IAQA 4PTLA 2CE7A 4AKIA 1S9HA 3I73A 5IRCD 3CNNA 4GDFA 2X1VA 3KJHA 3N2IA 4MITA 1T0JB 3LO5A 2GILA 1ZRHA 4RD4A 4E09A 1E9RA 2WICA 3HWSA 2V6IA 1PLKA 2O8CA 2H17A 3NBFA 2XTNA 2D3WA 2Z4RA 3UWOA 3D8BA 4LX0A 4CEJB 1ZINA 4BZQA 1MV5A 2O8BA 1U0HC 2L0XA 3H86A 3TJZA 1N5KA 1P60A 1AGRA 1QHGA 2JLXA 4TZ6A 1XRJA 3GLFB 3EIQA 2O8FA 3OAAD 4CDGA 4DLZA 2RMKA 3I5YA 4C9BA 5DH9A 2OAP1 1Z6XA 1K5GA 5SZIA 1HE1C 4LC1A 4TL6A 3F8TA 3EX7C 3GLIA 3U44B 2SHKA 3SBEA 4ZV4A 5FTLA 4AYWA 1SVSA 4GNKA 4LJ8A 3B9PA 1XJ0A 1Q1BA 3UXMA 3X1YA 1ZW6A 1CR1A 3X2SA 1P9NA 2WOOA 5E3HA 2FGJA 1OXXK 3DMNA 1A1VA 1CEEA 1YR8A 2HV8A 1SKYB 2GWHA 1OV4A 2ZJAA 3B7GA 4NL4H 4ERNA 2V3CC 2GEDA 4W7SA 1K5DA 2CDNA 2KBEA 2MSCB 4NYJR 1UPTA 4JL8A 1TNDA 3C15C 3ZH9B 4A2PA 1RE0A 3MWJA 3EC2A 3LWNA 2GHIA 2JCSA 3FMPB 3TH5A 3J81k 5L3SB 1FTNA 2FJUA 4DCNA 2CK3A 2OHFA 1XFAA 1U8AA 2H8KA 3NBXX 2R6AA 3K9NA 2BM0A 3QIAA 1D9XA 1YR9A 2WWHA 4LBVA 1E98A 2ZUDA 1FL9A 3KDSE 2WPDD 4TZ0A 2OFWA 4FMCF 2GZAA 2ZRCA 4JS0A 3SHWA 2WIAA 4D82A 1E2GA 2NO7A 5E7MA 3CF6R 5G53C 4LV5B 3PG5A 3UMSA 1W4RA 3LDAA 4Q9IA 4URVR 1DE0A 3OFNA 1T91A 3JVVA 4M4SA 3GLGB 1P2UA 2RH5A 2P3SA 4V0NA 1AZTA 2J45A 3LX8A 4ZIRB 5DHAA 4BASA 4B48A 1XTKA 4PO8A 4FCWA 1AQUA 4KV9A 4P32A 1IXRC 4F92B 4LYAA 4MGYR 1BYIA 3RLFA 1N6LA 2AHOA 4YMWA 5GVRA 1KSGA 3ZVLA 2GEVA 3AF2A 4DBLC 4GRAA 1P61B 2BWJA 5DN6D 1E4YA 4H9GA 4L16A 1RIFA 2V7QA 2DFKB 5HKKD 1ZBDA 3AKCA 1ZAKA 4C7OB 3E70C 3U6BA 4V0OA 3HPQA 5KYKA 3ETLA 1MO4A 1LVGA 1GAJA 3SS8A 3K70C 3K0FA 2VP9A 2IS4A 1TADA 3U3OA 3O8RA 1BIFA 1CU1A 1HH4A 2PZFA 4M1SA 4LJYA 4ZCIA 5GJCA 3OIYA 1ZM3A 4OHYA 2OO7A 5F3WB 4KBGA 2IUTA 1BMFA 2F55A 1DG3A 2HUPA 4QL3A 3DZ8A 1E79A 1I2MA 2JAQA 2IX3A 4GOKA 2J0SA 4IXMA 1E2DA 4CGZA 4X8HA 4PAOA 3IILA 5D3QA 4ZCMA 1M6NA 2F43A 2VP0A 1QHXA 3FHCB 4PHGA 4HATA 4A15A 2EYUA 2EFHB 3DO6A 3TSWA 3GJ6A 2PMDA 3BOSA 4C2TA 4TYWA 4AI6A 1NVVR 2J7KA 1NN3A 5CK4A 4N0DA 1KKLA 3L2OB 2B6HA 1P7CA 2WMOB 3CRMA 4OQFA 3KKNA 1HT1E 2G1KA 1KO7A 3MCAA 2VP5A 1DPFA 2EQBA 2OSBA 2J1LA 3K9GA 3WMEA 1E1RD 2WMNB 4O0MA 3FHOA 2HT1A 2A5GA 4G5QA 4BLSA 4CIDA 3W5IA 4JLPA 2JLQA 4PXAA 1TUIA 4Q1AA 4TLEA 4A8JB 4JJKA 5BN5A 1G5PA 1N6HA 4HAVA 3RS0A 1G17A 2CBZA 1QG4A 2GJ8A 2GJKA 1NRJB 1U90A 5AUQA 1XD9A 3SBDA 3Q7PA 2WOJA 4RFSA 1YZQA 1A2BA 1KIMA 4F4JA 1GITA 3V9PA 1MO3A 3ZQJA 1OXTA 3QSYA 1JAHA 2JEOA 4MGIR 2JA1A 4HLDA 1FP6A 3IPXA 1AM4D 1IM2A 3PQCA 4RZ3A 4PX9A 1HUQA 3QPWA 4XJXA 4C0AC 3IQXA 1M7GA 4XD7A 1E2EA 3U3KA 2RAPA 5KDOA 4ZI3A 3ASYA 4Q01A 1N2CE 3L0PA 2OFOA 3Q5EA 1P9RA 2VYFA 5DI3A 3A1UA 2XJ4A 3UPUA 1KI6B 2KJQA 4HB4A 2G9NA 1DARA 4JVSB 3PUZA 4Z54A 4Q4LA 1Z47A 2REBA 1W47A 4M1YA 4GL2A 3QG1A 2A5DA 3HYRA 3PEWA 4LCBA 3NBYC 4TTQA 2IYXA 1IY0A 2PLFA 5AK0A 3SYLA 1CR0A 4RCYA 3AV0B 4HAXA 4F7WA 3KB1A 4BFYA 2CCJA 1T0HB 1XEWX 1KO4A 1EWRA 4D4LA 2NO1A 3RWMB 1GTVA 1T4GA 4RD6A 4Q9JA 1KDOA 4C7OA 4OL0A 4X8LA 4ESHA 2GK6A 1A4RA 2O5VA 3AF3A 5AJZA 4G5GA 4Q4JA 5J40A 5IK2D 4NYIQ 5TB5A 2AWOA 1YZTA 5EP1A 3CX6A 4D0NA 4IDHA 2C9YA 3HR8A 3SQWA 4Q1EA 6Q21A 2NO9A 1XD8A 4IDPA 3GD7A 4QM7A 1GL7A 5EP2A 3N2EA 4EKDA 2ODNA 2IUUA 2ZYVX 4NPHA 1WE2A 1N6RA 5EE1A 1UFQA 4XH9B 5L3QA 3ZVMA 2QMOA 4L8GA 3EPHA 5KSOA 4PR0A 1VCIA 3WBJA 2G1JA 3IBGA 3DVLA 4Q1BA 4BFTA 3P26A 1SVKA 3B85A 4P3YA 721PA 3AVVA 3EZ6A 4KI0A 1R8QA 3JZMA 3GFOA 1KDPA 5J4YA 1LFDB 4QBGB 4C0HA 5F9FA 3DKVA 5D3MB 3HU1A 4P33A 3P20A 3W90A 4U7DA 3EARA 3I72A 2F3TA 3U3MA 2D2EA 3B60A 1ZD8A 3F3YA 1YZKA 4Q9LA 5TXGA 4DIEA 2HDNB 4HB3A 5C1BA 2F6RA 1KNXA 2ZPTX 3QKRA 1JALA 5H1YA 3B5JA 1AA9A 1MRNA 4YDHB 5H70A 3RSLA 1I2DA 3F0TA 3C16C 3QXXA 4GMXA 2BM1A 1W2HA 1MABB 2FN4A 3KB2A 1M1YE 3I92A 1UAAA 4ITRC 2Z6VA 2ONKA 3PVSA 4MDEA 5UKDA 4IOKA 1ANKA 4LJ4A 4UNPA 5FTKA 4CEJA 2ZSDA 3A8TA 3SJCA 1L8QA 3ZZTA 1UBGA 4B6EA 1UDXA 3RS2A 3KZ1E 1W1WA 4TMVA 1T5IA 1QVRA 2WSSA 2BBTA 3SZRA 4B32A 1GILA 2VL7A 1CTQA 5IT5A 2GXSA 3EG5A 1P5ZB 1UM8A 4OHVA 2DPXA 1R0YA 2F9MA 4MUBA 4UQOA 3WXMA 5ANRB 3VMFA 621PA 1AK2A 5J4HA 4JSYA 2YWFA 2QPAA 2V1XA 2W6JA 4DSUA 5CLLA 1RRGA 3BRWD 2AFHE 2A2ZA 2VBCA 3HPRA 3AKDA 4UXIA 4LV8B 1A82A 3SQXA 4BEBA 5JLJA 3TLXA 5EP4A 2ZJBA 3BXZA 1YR6A 3BWDD 4C30A 3Q8XB 3U6KA 1G18A 2GESA 1DAMA 4J0QA 3CRRA 4G3XA 4LSGA 3DM5A 1F5NA 4TTPA 2VLIA 3TRFA 3GLIE 1V5WA 2QTFA 1D9ZA 3S1AB 1PJRA 5L3SA 3I4LA 3ND9A 5EZ5A 1PUJA 3HU3A 4DRZA 4GBMA 4B33A 1W7AA 5FI1B 2GF9A 4G5OA 1Q12A 2QENA 2DWPA 5EXPA 2CXXA 5HR5A 4LJ6A 4M1KA 2WAXA 3T1OA 2VHQA 2J59A 3T61A 1Z0FA 1NLFA 3W9YA 5C2JB 3KUDA 1ELOA 5DHFA 3LRPA 4BGDA 4X8MA 4WXPA
chains in the Genus database with same CATH superfamily
5ALVA 3QU2A 5ULLA 1E0KA 1QHNA 2C0CA 2AD1A 3U7EB 4P7GA 2CVQA 1Y1LA 4HDKB 1PHRA 2A5FA 3RK4A 3N5KA 1LLUA 3WX0A 4F46A 5JTUA 1C0EA 2V54A 1G21E 4Y67A 4TGLA 4Z4EA 1ZMTA 3KT3A 2PBFA 2QEQA 3OFND 3TDNA 3A4MA 1PQ4A 4HXGA 1E2IA 4BB6A 4PGHA 3KVRA 3NC0C 2DCUA 2QSJA 4MI6A 4Q9AA 5DM1A 3KTDA 2BGRA 1B3BA 1MQAA 3UJ6A 4F71A 1RQ2A 4KBFA 4WOPA 2OXEA 2XCLA 2NXCA 2A57A 2JNWA 3FG9A 3GPDG 3I2FA 2QQ0A 5E2BA 4M37A 5EHQA 3OJXA 3HYLA 4KIWA 4JFAA 2UZ4A 2Z95A 1P72A 5HGJA 5TARA 1YUMA 2VJAA 1SJ9A 2EATA 1SBYA 3MK31 4W5TA 1OZGA 2ZULA 4EYQA 3UPTA 4G0UA 3N0XA 1NQUA 1MX1A 3AM4A 5E4YA 1YU9A 2BFFB 3VDXA 4AY6A 2Q3DA 1Q1EA 1FJXA 3HS3A 4GM1A 2CK3D 1U4SA 1Z07A 4G09A 5DOVA 1YDEA 3DBHB 3H5RA 4A6XA 3GT0A 4FBLA 2XNDA 3D31A 3MPUA 4CM7A 3KSBC 5H82A 1QP7A 3EQ2A 2FR8A 5AK5A 3WGQA 3ZXIA 5JS6A 1YXMA 3F7MA 4Z9FA 3HNPA 3FOWA 3V55A 3JZDA 1E3QA 3ZWWA 1GPH1 1LNZA 1KZ4A 2JAHA 5JPIA 3UAWA 1U2RA 3V4RA 3GGCA 4JGGA 1VTKA 4QJ3A 2J4FA 4FGJA 4R41A 3KQNA 1CF9A 3FPHA 5GONB 1ZJYA 5KQRA 3RO7A 1ZX1A 2ZSJA 5AXDA 4XB6B 2PM8A 2GVDC 3BDAA 1JLMA 5K4HA 3ICOA 3N87A 4O4IF 3FF1A 3KTFA 1Z0AA 1E9EA 3OT5A 4YQYA 1ZUHA 4JNKA 2FG5A 1R5BA 2WR8A 3STUA 2JLZA 1MUUA 3QKUA 3C14C 3OT4A 4YDSA 3RH0A 3TAUA 3VM6A 4QAQA 1J2RA 5FPQA 3EIXA 4FT2A 2P27A 2NZ2A 1ORDA 3LKDA 3BH6A 1JKXA 1RWKA 4KEAA 4W9RA 5TDHA 1RHKA 2E1PA 1W29A 2OCKA 2X9QA 3JXEA 4HYTA 4W82A 1L4YA 1UJMA 5E7QA 1OASA 1FS6A 1E7SA 5EA2A 4X66B 4FMDB 2SECE 4L15A 4DDHA 1FSSA 3NKLA 4B71A 4ILKA 1JJBA 4N54A 5A4AA 5FWXA 3KV1A 1U8XX 2PMWB 2O2EA 2Q0HA 3R4CA 5EVJA 2YKGA 1KAHA 4H6PA 1X8KA 1M8JA 3AR4A 2D0DA 2ZDQA 3K2EA 5BW8A 3JQGB 3KIPA 2ZR9A 3DFFA 2GRJA 3N8NA 4NSNA 4JP8A 4BQQA 2PCJA 3W3AA 4ZYXA 5JSZB 2O23A 2NOAA 4NWIA 3GFVA 5AHRA 3HXTA 4R01A 2OHHA 4LN1A 3WI7A 1KY3A 3HM2A 3M6XA 1T8SA 3NTRA 1CZRA 3R3SA 4G5HA 5D00A 5TMEA 3FYUA 3HUEA 1F2DA 4ZO8A 3VSAA 4BRWA 5K3EA 2MOKA 1YUNA 5HDBB 5AQEA 4WK4B 3IEXA 3CZCA 4MRRA 3ENKA 5D85A 4H7JA 1L4LA 1WX1A 4IX1A 2HRZA 4MI9A 1ILEA 1I7DA 3OZ7A 1B76A 4EJSB 4RTRA 1HE2A 1HYEA 1H69A 2BMAA 3CCBA 1WDLA 2WJYA 3IKLA 4ND2A 4BVBA 4RU1A 1SXJD 1DX6A 5A3JA 1VYTA 1LF5A 1XVUA 3HL0A 1ADGA 1L5WA 1N1MA 2FFAA 4UMDA 3SDBA 3A3NA 3ZY2A 5ABPA 5KIAA 1GPBA 2BP7A 1R74A 1W5AA 4BNFA 5JANA 1WMFA 4DARA 4AC9A 1KMHA 4EI2A 9LDTA 1J1ZA 3ABOB 3TB6A 2R5NA 2VPYA 3ZDYB 2OGWA 3EXFB 5K2MA 3O95A 4EO9A 2OUKA 2IW3A 5A6VA 4YMTA 1KHTA 4AYTA 3K1AB 1F8XA 2D3TA 4MRNA 3T1QA 1Y8QA 4PG8A 4EI9A 5DLEA 1J42A 4L4RA 2IODA 4AWAA 5BQFA 4WXEA 1TCCA 4C0WA 1BOOA 4FI3C 4CODB 4X54A 1X8JA 4EPRA 3HCFA 4EJ2A 5JISA 2JI4A 1TIBA 1RCTE 4FB4A 2XCSB 1CB0A 2C61A 1F0YA 1KU0A 2N42A 5EESA 1W5SA 2C8JA 2SKCA 2OKGA 2P4SA 4CLOB 3KYDA 1R12A 1ZD3A 1I6MA 2P2GA 1P5JA 2NU9A 3BD9A 3MTDA 3VR6A 3B7WA 3D6UA 1KRHA 3TMYA 3UC5A 1D1PA 1PU2A 3JARB 3OOEA 3MAAC 3R76A 1YDHA 5BMVA 2PG3A 2PUHA 1IM5A 2QX7A 4Q1DA 3DEYX 3OM1A 1TQ4A 2QLNA 1O58A 1OAOC 3KKMA 4ILEA 4IY1A 4C21A 1MAAA 4GSKA 4NBKA 3VHLB 4K3UA 3CONA 3I9NA 3OY7A 3HBAA 2WG0A 3G82C 3EASA 4LWQA 3X1XA 4I81A 4UUBA 2FP4B 5K0LA 4RVNA 3AP1A 2P4QA 3AEZA 2V5UA 4TLCA 1N4DA 2XMDA 1TKAA 3DZGA 5GM2A 3SC3A 3WO0A 4D42A 4ENVA 4D81A 2Q28A 3DCYA 5JI3E 3I5MA 2XJ9A 5FA8A 2EIXA 3EGDB 3H5VA 2TMGA 1ZDMA 3FVQA 4E22A 4OJQA 3ZJ4A 1C9DB 4HXFB 4TPKA 1KH2A 3THWA 1DG1G 3SAJA 4K9LA 5J5VA 5J63A 3WRYC 2ZTSA 2PGOA 3F8WA 3CLUD 4MYSA 3OWHA 4UFPA 3ZD7A 2GCIA 2O7RA 1LXCA 3VVMA 4V0SA 4C7VA 2QI9C 2H7YA 3L7AA 4LAFA 4IXWA 5B7QA 4K6CA 5BRJA 2FPPB 1H2AS 4JUBA 4ZANA 1FFHA 5E95A 2FN8A 5C1OA 4XFDA 1QIEA 4K9DA 3UNXA 3KAKA 2H2HA 3DTVA 3A6ZA 3GGPA 1N36B 1XPJA 5JNRA 3CURA 4F3TA 4J1NA 1DAFA 2ZYDA 2WD9A 3FGNA 1BRTA 1EWVA 2OCDA 4K05A 3OIVA 5CXXA 5FOWA 1OFHA 2C88A 5FPYA 4YR7A 3HI6A 4QVIA 3P7MA 2YWHA 3FTPA 4KAJA 4QU8A 4A91A 1RCUA 4V0LA 2C2OA 2ZPUA 3MBOA 1HT2E 5EI5A 3Q7IA 3W79A 1DX9A 2MINA 4NFYA 2DH6A 2AG6A 2NAFA 2QIPA 5B12A 4MW1A 3UB2A 4DR6B 1GRNA 1XCLA 2DX7A 3NYIA 4OQNA 4R9VA 3UAZA 5H59A 5BNTA 3GLRA 2A5YB 4UHEA 3GLSA 4N48A 1B42A 5FUVA 1QRRA 3E9RA 2CDCA 3AF0A 3VKGA 8ATCA 1LGYA 2C1EA 3OE5A 2J5QA 2VZ0A 4W5NA 3SFVA 4P4SB 5JQGA 1PZEA 3EB9A 3HGTA 1TZ2A 4MEAA 4N5NA 4WKOA 3WIUA 3DLIA 4CG2A 3FOCA 5ICFA 1C30B 3LO8A 1U6KA 3QOFA 4BUCA 4OPMA 1XAHA 4DC1A 2DPGA 1Q21A 3FGOA 8MHTA 4GOJA 3T12A 2RBGA 2BH2A 1ZJ4A 1Y48E 4EVSA 4KTTE 3AT1A 3OE7D 1INLA 2C04A 1R6XA 1E0SA 4Q19A 3P0RA 4D8WA 1SUPA 3ETDA 3L43A 2DE0X 4EUNA 4PHTA 5HG0A 4MVJP 1CETA 2BVNA 2XYRA 3OTIA 3REOA 3TTSA 1YSCA 1IK6A 1Z0ZA 1EAMA 1PW7A 1YRAA 2DYKA 4G25A 5D87A 1QFJA 2C00A 3VUFA 5FWNA 1N1EA 1ARZA 5FOSA 4A27A 4U0JA 3M2TA 4TWIA 4P08A 1PSDA 3AUYA 3KRTA 3Q3IA 2CXHA 3FKQA 4GDMA 3H2YA 2FMHA 3EYAA 2DR0A 4W1RA 3VR5D 4RSMA 1YZUA 2BDTA 5DBHX 2FQ1A 4PN3A 3K4HA 5J1SB 1QMPA 3NM4A 1F4PA 3EEOA 1XZDA 1TE2A 4LXXA 4IIJA 4B4VA 3IUEA 1JKIA 2Q3HA 3JQBC 4MPTA 1Q16A 3F5SA 1RYZA 5I9LA 2WIKA 4UMEA 3A06A 1VQ1A 1VE6A 2FXVA 3SI7A 3OJCA 2HMAA 1IONA 5T4FA 5JZMA 4LNHA 5LXTF 2BKUA 1E1CA 1U3FA 4IILA 1DBVO 3GT7A 3QKIA 4WK0B 1SCNE 5CT5A 5CVEA 4ZZ0A 5FA5A 5H68A 3GH1A 4NYMR 4FJ1A 5T5QA 3RM3A 1YZLA 3JZIA 5HKAA 1EI9A 5KDDA 4YDRA 4Y18A 4B80A 4KOEC 4JEHA 1GQRA 1IOVA 2GJAA 3EQ9A 1ULTA 1U1IA 2WWFA 3HHEA 5CCXA 2WM9B 2XDQB 5H4HA 1JA0A 1ML3A 3ZQKA 3VC3A 1JR2A 1T2FA 1G16A 1Z63A 4H3VA 4ZVVA 3GC6A 3BULA 2R7AA 1P62B 5CVTA 2I4OA 1PZMA 1LDGA 2WZBA 2ZRBA 3QHPA 3QPCA 3LC7O 2FPGA 4GEKA 1ILWA 1KYTA 4ZQIA 1YL6A 4V0KA 1OJLA 4KIFA 3QEBZ 2LNDA 2XB4A 4Q3NA 3UG7A 3GLFA 5T6BA 3KNZA 4QXQA 3GGGA 1UMKA 1VDMA 1E9AA 4JVOA 4LI0A 3ZHBA 2QD2A 2G80A 1G8FA 2CUZA 2ZUUA 3EBPA 3L1JA 5BOVA 2AW3A 1BCSB 3ZN2A 4BBPA 2RHHA 3PNLA 4ECEA 3CMCO 1PFVA 2CVZA 2R1VA 3JSAA 5AKZA 4D3SA 4E7PA 1AU9A 1UIRA 3CS3A 5FBLB 3FTDA 3KHUA 3U44A 4C3VA 1N7IA 1LPBB 4MW2A 4NK5A 4EG3A 2Y77A 5EQDA 3TD9A 2YOFA 2HT6A 3IV6A 1XU7A 3ZCTA 4QGFA 1IBLB 3F4KA 2PKEA 5ECYA 1NX9A 1WMBA 2J6CA 4BNDA 2DC1A 1E1QD 1E6EA 1ENZA 3EMDA 3Q9LA 5E6UB 1JIJA 1RABA 2ZROA 3W8NA 6Q21A 2CV0A 2BC9A 2G77B 5KYWA 2IIPA 4ZZIA 1TF2A 4PCAA 2I1WA 4DSZA 3GP8A 3M70A 3OQPA 1SXIA 3QYPA 3REGA 5DWQA 3OTWA 4JLBA 1Y5RA 4O4LB 2PUVA 1EVJA 3KBBA 3D1JA 2ZJYA 2XEDA 2E6UX 3O73A 4HMQA 1RXIA 4UAVA 5JIBA 2QVXX 2CHEA 1Z62A 2YC4C 4F9TA 5LJIA 5F4BA 5C81A 2JIPA 1FB5A 2IUSA 1U2QA 2Q49A 1I01A 2GUWA 4TL9A 4PU0A 4DQUA 3ICQB 3I4FA 2W6ID 4G0YA 4C78A 2FU5C 4TOIA 1AMUA 5CCEA 3KL4A 1YOVB 3CVJA 4P3XA 5DK6A 2QM0A 1U1FA 3BFJA 3AF1A 3DP7A 1NG1A 3DDSA 2AJCA 3LAWA 1WUKS 4BNUA 1KMMA 4QBHA 1N8TA 1TCUA 2QRMA 4PHHA 3W04A 4CM8A 1X80B 2P6MA 1WRBA 1RP1A 2WF7A 3OFVA 1Q0TA 1PJ4A 2WF9A 3P2YA 2VHYA 5MFPA 1PYDA 1OXKB 3SF8A 1HBJA 4PZLA 1QGZA 1XJCA 3CKLA 4L5AA 5EE0A 3WRYA 2QNRA 2VPPA 1VMAA 3I42A 1K75A 4KXWA 1IOZA 1UF9A 1EE2A 3FPAA 4OSOA 5IEBA 4L1KA 3KX2A 4X20A 3L4KA 4X1KB 4CMBA 3M2PA 4CQLB 1MOZA 2X8WA 2EU8A 2J07A 3X1DA 4Z7QB 2AE2A 4NLLA 2OHOA 1T2UA 1NF2A 2V4UA 5GZ6A 4H60A 3ND5A 3CBQA 5GONA 3RK0A 1BN6A 4RGVA 4BQNA 4G24A 5IWCA 2C4MA 1KK0A 2HCTA 3JD3A 3GNQA 1ZEJA 1SCIA 5FI0B 1V8DA 5JI2E 3U7IA 2E48A 1LBTA 1S8OA 1UBFA 2X4LA 5K4AA 1N9ZA 3BJEA 4RVOA 4IIJB 4RJLA 2CLIB 2Q46A 1NF8A 4HFRA 5DBOA 2PEYA 3O8OA 4RCZA 1NYQA 1W2GA 3SHVA 4DDKA 4FHZA 5K6AC 2XZOA 1XTTA 5K5EA 1A8PA 3OLZA 1QTQA 3OCXA 3H7IA 3DPIA 1VB3A 2OLEA 2ZS9A 5FKJA 5ALQA 4MKHA 1RQNA 1JHRA 2IOHA 2JAUA 4FX5A 2GD6A 4YBRA 4MKFA 4RWZA 5CMLA 7YASA 2FK8A 2AUNA 2CE2X 3F7NA 2RGEA 4TXHA 4WX2B 4B4OA 1BE0A 3TLGA 4RQAA 5AW4A 3UHAA 1AA6A 4YJDA 2I4LA 3C4VA 3PQFA 5AJWA 1BMFD 1K08A 3GEMA 1Y9JA 3NZEA 5H3HA 4C7KA 5FPSA 3KYCB 4E70A 1SC1A 2QRZA 1C7QA 5CRIA 1BE8A 3BF7A 1UUFA 4CNBA 3S7ZA 3ANSA 3DXZA 2DZDA 1WXEA 2YRFA 5U4XA 4MROA 2ZK7A 4X44A 2F43B 1YF3A 3T1TA 1QIMA 1TMKA 1SHJA 1KDRA 3QF4B 1O08A 5KTMA 3CVOA 1D0SA 2X6TA 1QS0A 4WWHA 3DOEA 2R86A 2FE1A 2I2DA 1QB8A 4O4LF 3TCNA 1M34B 3AH8A 3M4NA 1L8OA 1YAHA 2Z8YA 2VATA 3E15A 2PBZA 2RB4A 3R0JA 4OQLA 5K8CA 2HJHA 5I4CA 1NXTA 4OQMA 1ZNQO 3R0IA 3DF9A 1YHYA 2DWCA 1QORA 3PEUA 3PNQA 5IBQA 1TPZA 5HXAA 4TXJA 4ABYA 4HV4A 2AN4A 2EG5A 2VN8A 1EXDA 4P31A 4PPGA 3VU1A 2VSYA 2XUAA 1ZOOA 2F8TA 1N8SA 1JSCA 4FCTA 4JYCA 4IIGA 4W9NA 3A9WA 5DNWA 3X2EA 4DB4A 1OYOA 5HA5A 1L4BA 1LDMA 1Y9ZA 4M8SA 4BQPA 1DZIA 2VK4A 1E9BA 3IO3A 2DQ4A 3HVHA 5FQNA 3WGGA 3NHBA 5E2AA 3DBLA 2F8LA 4B8YA 2BMWA 2RHMA 2WM3A 4OI4A 3TIIA 3RC2A 2WBLC 3FJOA 3OE7A 3WWCA 5FUWA 1UPAA 3BTOA 4B7CA 3EDMA 3O1HB 1EM6A 3AYXB 1KOFA 1MH1A 4LVCA 3W3AD 3ZK9A 3ZLTA 4NTZA 4C3OB 5JYCA 5LLTA 2IPNA 4Q7EA 3SEZA 1FTSA 4CV0A 3HRIA 3NDBB 4R71A 1G19A 1PVVA 2GUGA 3NWPA 3RUEA 3O21A 1EDDA 4QBKA 3OQ1A 4EUKA 2O8DB 1PTJC 3O7MA 4YJ2F 4KVGA 1PJ3A 3WZMA 1TO6A 2DKNA 5T8KA 3RRJA 3BIOA 4WZBB 4ZYWA 4EK9A 5CX1B 1UXKA 2C94A 2CFSA 2EZ8A 2EJBA 2VQSA 3C41J 2WSIA 1ZC4A 4IIDA 2VJKA 2I65A 4RY2A 3NTXA 1P31A 1W0KA 2VYVA 1E3TA 1OYYA 1XUOA 5CT8A 5DWDA 3R9KA 3S5UA 5CT6A 1NBOA 2JI8A 2XODA 4YP0A 3FFAA 4RJKA 2FLKA 5CK5A 5JBQA 1M73E 1U2EA 2R25B 1Y1TA 3BSYA 3F6CA 3E9MA 3SFZA 3L93A 3C3YA 1QIKA 3P9XA 2ZZKA 4UCQA 5AESA 1Z6TA 1TECE 1C4XA 1UIMA 4BVJA 2Q1YA 3FCAA 3CWCA 1JECA 3MGAA 4XOIA 2PT7A 3JQAD 3I6QA 5CDFE 1O96A 3TW8B 4UM9D 2G76A 1E62A 1R6DA 4UPDA 5ISMA 3ZS8A 4WK6A 1U63A 3AHEA 5HQTA 2HMYB 4ARSA 4MVJI 1W30A 1GTJ1 5J2TA 2V4MA 3P97A 1GV1A 2CLHB 1DCKA 1XEXA 2IKQA 3R7SA 4QD3A 1QE5A 4A03A 3RBAA 1GLVA 1U0JA 4XA8A 5IT0A 3LOQA 5BWBA 4RDHA 5F5LA 2FA9A 2ZWIA 1EE9A 1RJ9B 3W7VA 2BFEA 3B12A 4HZUA 2RGYA 4JD5A 2W43A 2R11A 2YXLA 3IIIA 4UHJA 4CIWA 4YX9A 4OYLA 1NUQA 3RHFA 4OAOA 2ZW9A 2AC7A 1M0SA 5ESDA 3CNBA 5HE9A 2PGJA 4MRSA 3H9UA 2IELA 2KM1A 3HUDA 3MWFA 3VDNB 3GDHA 2H16A 2HXGA 4LVOA 3DLCA 2QZ4A 2OBNA 3H18A 2Z9CA 5IC4A 5L8VA 3D02A 4WN3A 4JGIA 1XN1A 5KYYA 1ZFNA 1GHTA 2G06A 3I9V6 4HZIA 4OSEA 2YHAA 1Z74A 3TE6A 5BV0A 3TUZC 2PFSA 4G0QA 1CS0B 4PSVA 5H80A 2VXYA 1KH1A 3EF0A 1UPCA 3R9IA 2DBZA 2FP3A 3MWLA 4M87A 1RXWA 4OI0A 3LK6A 3AY6A 4N0EA 2HBRA 3FYSA 3E7PA 2E5LB 3NFYA 1HL3A 2JAPA 4NXNB 1Q0SA 2FI1A 4RK0A 1MC4A 3TR6A 5HJ7A 5KX5B 4JJ8A 5JCOC 2BELA 3UMMA 4XD2A 4RVCA 3HGQA 4RETA 5KZMB 1LSOA 4IFBA 4LHEA 3JQGA 3U1VA 3UMRA 2Y1XA 5I7VA 4UXHA 2WJWA 1RHJA 4IFEA 5IX8A 4F2DA 4BB0A 3KS9A 3UHJA 1QZZA 4O4HF 1YTLA 3UJAA 2XCUA 3V34A 4QATA 4NS4A 4U7FA 4QG7A 2IYRA 3JALB 1YB6A 3DT6A 3TX6A 3AR8A 3UUFA 3D59A 4HHEA 5HUHA 1EHCA 1OFUA 5PGMA 1C2TA 3L4SO 4X8OA 4MVJF 4XM2A 5E38A 4TVSA 5KOJA 5LLSA 2A9FA 3DEIA 4G67A 1V5IA 4MUEA 1MAHA 2PGNA 3D2LA 4B43A 4EJSA 4ZMBA 1UR5A 5IN5A 1DXYA 5AW5A 2YV2A 4IEEA 4E1BA 1FVOA 1BHQ1 5G0WA 1TM1E 1U1GA 1KJ8A 5DE3A 3UA4A 3PX2A 1IL0A 2P6PA 4J2HA 4AZ0A 4IMIB 2CXQA 3Q7QA 5K2OA 2DHCA 3UWKA 5JU6A 3VYSB 4AAYA 4E5DA 3FZQA 3W5BA 3EVCA 2D1RA 2JIRA 4JBLA 4N01A 3SQDA 4C06A 3KSRA 1G3RA 4LQ4A 3QJYA 3R24A 2CWDA 2Z2XA 2FWIA 2IZ0A 2KLHA 3LU1A 3SE0A 1SR8A 5B57C 2PE5A 2JLWA 3FHTA 4QPZA 4BOYA 3DL0A 4CKXA 5KHAA 4ZXFA 3U3ZA 5ALWA 4XRGA 4RTPA 1QQTA 1Q77A 3NOXA 2YVUA 1KJZA 2Y2UA 2XNCA 2YCLA 2TMKA 1BS2A 3MQ2A 1MC8A 1XMXA 4R8SA 1YE5A 4BV3A 4LXIA 2DTDA 3QVVA 4RZXA 2B6NA 1ZRNA 2Y67A 2HK8A 5ELLA 1AGXA 1FU8A 1GZ5A 2C29D 1T9DA 2QQFA 4KQIA 1IZ7A 4MKIA 3C8ZA 1CRZA 1PZXA 2P0YA 4I4TB 3CX8A 3VU8A 4CMEC 2HA5A 1G5FA 4Q21A 2WT8A 1GQSA 1GCIA 1S2OA 4XXHA 2OCBA 3TLMA 5JZOA 1PQYA 1NMQA 2DM6A 4J1TA 2V6MA 5TPZA 1H1DA 2GHQA 3CZPA 5EIWA 3HNOA 2I7CA 1JSZA 3V8BA 1W73A 3RAPR 1RXSA 1XKQA 1M83A 5A05A 5B53A 4A92A 1Q5PA 1E6UA 1UKBA 3OSUA 4UHKA 4QICA 4U63A 1T1IA 1DV2A 3C5VA 4JXJA 4PGGA 2EBUA 4R16A 4TQUS 1LJUA 3DMFA 1MA0A 4M49A 1TAGA 4TLMB 4ZRDA 4LJLA 3RRFA 1ETUA 4MS3A 4ES6A 1CRQA 4BWVA 1U4OA 3ANYB 2RHTA 2XD4A 3BMNB 3L0IB 4R83A 4CW7A 1WPXA 1KOJA 5A9RA 4EO4A 1PG0A 2EHDA 2PQMA 3I0MA 5KNCD 2QL6A 3RAEC 2APJA 2AZXA 1G8AA 4R9NA 4WXHA 5BR1A 4HWKA 1ZWLA 1K0UA 1MTZA 3IQFA 1SUEA 2O19A 4ZYVA 1OIWA 2DEUA 1PS0A 1AQIA 3BCRA 3T1YB 3M9LA 2RBEA 1K5HA 1GGVA 2DWQA 1SU6A 1W88A 3DT8A 1J9ZA 3ECSA 4DLSA 3TECE 3ENNA 2GB4A 4QUBA 4UFNA 4TYPA 4YP5A 1MVNA 1QO0A 2Q5EA 4BTVA 4RZHA 3H4VA 3IE2A 4KAAA 5CJ2A 1OAOA 2JCVA 4OA8A 4FDMA 4ZK6A 1SZPA 2YFHA 4TL7A 1IN7A 2FPIA 2WA2A 1MOQA 1ODKA 1F2UB 5ICSA 5DNDA 3RSFA 2XA2A 2Q1SA 5EINA 1M2KA 1X6VA 3RS9A 5ADWA 3F6RA 3VSCA 1T9KA 2HO4A 3PPVA 1EFRA 3OF2A 1ZY2A 1T5OA 3I9LA 4QDJA 2O2XA 4L4ZA 3CJRA 1NP7A 1M0WA 3ELYA 3R9XA 3MMNA 4WBNB 2VC2B 3KCQA 4U1RA 2CUKA 4US0R 2VF2A 2J9YB 4XFJA 1SGWA 5IUNC 3DZIA 4TMKA 4CDMA 3UFXA 1NULA 1UEIA 4N41A 2IS6A 2V9PA 3CUEF 2QD5A 4UHDA 1PFGA 1FNBA 1HO3A 2FOLA 5H7XA 1KI7A 4CCSA 1YQTA 2R7LA 3DTTA 3L8CA 4QJ5A 3WLOA 5LMCA 3TDMA 2FDRA 2SICE 5CNIA 3NJ8A 4IRXA 3E2IA 4EBFA 4QNMA 1IUNA 1OBHA 5E8JA 2GBLA 1PSZA 4K9OA 4MQ5A 1XL1A 3NW9A 4C7MA 1R2QA 4YEDA 3KAPA 1VKRA 2X76A 1FQJA 1JBKA 2WAYA 2R00A 2QX8A 2F4VB 2KBFA 3DJFA 1RRPA 2D00A 1HE4A 2G04A 2X2OA 2OBYA 3GK3A 3K8QA 3FFXA 4HKTA 1ZOLA 3U7JA 4TYMA 4DG5A 5FTNA 1WZ2A 3HXQA 2YQ5A 4LNUA 2AWNA 2D7CA 5DDIP 2OBBA 3EEQA 3SIXA 4KRGA 5HIMA 3LPLA 4DXAA 1XAJA 6REQA 4EY7A 1PZGA 4DA6A 3B9RA 3EUEA 1N2EA 5ICCA 3JD4A 5L40A 5FPHA 2H31A 1GA4A 2VKTA 3NKVA 4I4LA 5JNWA 1I7SB 4BFXA 1SH7A 2IXBA 4PYJA 1D1SA 3OHPA 1KYYA 3KZKA 3PI7A 4M0EA 4DG8A 2IHUA 3W8RA 3UZUA 3MS7A 2V55B 5KSZA 4QBIA 1BWQA 1IZYA 2I1QA 2BAGA 3DE2X 3MBKA 1V2HE 4JQYA 4Q00A 5BPFA 4MVCA 4Z0PA 4FMPA 4EO7A 4CT4B 3DCNA 5EXEA 4CF4A 1XD2A 2JGRA 3W34A 2P6OA 4AJIA 3AO0B 4NEGA 5AKKA 3TNLA 1VI5A 2WFLA 2EWVA 4UZFA 9ABPA 2REQB 3RU9A 3E9ZA 5CUQA 2C7RA 3AI2A 3IMFA 1BVUA 1ENOA 2CLSA 1YULA 2W8BA 3IX7A 1RXUA 1O54A 4LRXA 4QT0A 3FH0A 4DJJA 4EPVA 4HUTA 2GNAA 2G5CA 1VFNA 2XIJA 4OQDA 1TTTA 4RE5A 3QF7A 1SMKA 2CNKA 2PJRA 2A1UB 3OZBA 1T1JA 1K8QA 2E0IA 2PIDA 1E0JA 3RTCA 2JIMA 3TNYA 2WWIA 3NR2A 4U39A 4BMYA 4EY4A 4ETIA 2HK7A 3BTUA 3O5AA 4L72A 4RD1A 3PQ4A 5ER9A 1BSVA 1GD1O 1MR3F 3WA7A 1QQBA 4TKZA 1BFUA 1ZA1A 4WA8A 4XWOA 1YDFA 3KOZA 4G41A 1OJ7A 1ZJ6A 1DCMA 3TFWA 2JK0A 5I5EA 4D41A 4A0RA 3NH9A 4HDNA 4HDRA 3WV4A 3T5BA 1GXSA 3ITNA 1C9JA 3BB1A 1VG0B 1KO1A 1VCOA 4R2LA 4XSGA 1G7TA 4LV6A 2HWWA 4QVKA 2OXTA 3MAGA 4LZPA 2IK8A 2QLJA 1Y8QB 1CUAA 1TMGE 2XVXA 2O50A 1DX4A 2HMUA 1KAQA 3HSKA 3PC8C 4WI1A 2M98A 4M9QA 4BO6A 3TSOA 3PSHA 2G6BA 4B47A 3GEIA 1U5AA 2XD9A 3IVRA 3O83A 4U3JA 1YJCA 1NIJA 1OY1A 2YXPX 1CNEA 3PNVA 2J5KA 4EPYA 5JMWA 1JMKC 4M9XA 3EXEA 3H9CA 4RSGA 2QP3A 4UEKA 4EOGA 2IZ5A 3AY3A 4F91B 2IYSA 1XQXA 2WKWA 3C43A 10MHA 1NLUA 2VYCA 4O4IB 4Y2QA 5E0OA 3LUDA 5L45A 3EC1A 3M1LA 4FYKA 3W5AA 4J16A 3NHFA 1VPDA 4UZEA 3CUYA 4CWAA 2KE5A 1Z5UA 5BWNA 4B3MB 2XMCA 5FA6A 4DYHA 3TEFA 4HDAA 1AS3A 4EPXA 2PKCA 3H9BA 1VMDA 2F3SA 2QPTA 4JBXA 2VSOA 4ECAA 5KTYA 2PL5A 1MRZA 1N32B 5TV2A 3K09A 3BRSA 3CLSC 1EFUA 2POCA 4RHFA 3RIGA 4IHAA 5IVDA 3IOMA 6YASA 2D1SA 3BXGA 1T8YA 3E22A 4CLRA 1P3JA 2RGUA 1T3HA 2D6FA 1Y1PA 3R4VA 1KZGB 4LECA 3VC7A 5ITSA 5K3AA 1N2JA 1QFZA 1SVUA 3MCTA 3TE7A 2O8EB 3KKEA 3COYA 3HU2A 3TGPA 3THOA 1ACJA 2PZGA 5KJCA 4F8JA 1VIDA 1KK1A 3V6MA 3CGGA 2VBIA 4BFUA 1AKYA 1VBMA 2LE0A 4FGLA 2SNIE 5DW0A 2OA0A 1ZHFA 3VJRA 1EVQA 1SURA 2JASA 4GBED 1B6GA 5F52A 1T4CB 3BXOA 3G2KA 6NULA 3SQNA 1SIOA 2IZ1A 2PZJA 2RGRA 3TOXA 2WK1A 3K05A 4BLQA 5BV7A 3K94A 4YMUA 2JIZD 5AK4A 4UU0A 1S2IA 4FC6A 3RANA 5L9AA 4S0XA 5CLIA 1OYWA 4N03A 3SHOA 1NRWA 1U7UA 1MC5A 4QGAA 4P5EA 2RKOA 1OLSB 2H92A 1ZO8A 2QN2A 4HS4A 5LD2B 3SNHA 3LUCA 4M9ZA 1T36B 3F47A 3MTAA 4OI1A 3VNBA 2AOTB 4CLXA 3M3DA 4COKA 2OV4A 4CDRA 2E85A 3GN2A 1JLHA 4B0PA 2CCGA 2MYUA 2YL2A 3IPCA 4LX8A 5F7XA 4HBGA 2ZE5A 5HYVA 1Z75A 4FBGA 2B5VA 2WHQA 4KCGA 4I1OA 1Y34E 3OF3A 4WZBE 4Z86A 3R3XA 4QUKA 3AEUA 1JEQA 4JNCA 2LUOA 4BX0A 3HDJA 3PC4A 4DCSA 1CY7A 1GTG1 3M8KA 5GWXA 1ZCFA 3PVZA 3OUZA 2QN8A 4R1SA 3TGLA 1LPOA 3FZYA 3OHSX 3L8MA 1C3VA 3IR7A 5I3ZA 1JEJA 1V8BA 4NH0A 1SXQA 1JIKA 2GYYA 3IBYA 3WQRA 3AV3A 2FEMA 1L7EA 3UB4A 2HJGA 5ILOA 3QYAA 4HPJB 2IZZA 3LVRE 2HV9A 1YV9A 3LQFA 2WTNA 5K45A 4YACA 1JIVA 3OZRA 2IYWA 4RGQA 2EJTA 5JD6A 1SHKA 2GM5A 3NNNA 1AXEA 4OGFA 3E6AA 2EW1A 1ZVMA 1QS0B 3HN6A 4M1MA 4ZO4A 4U7JA 5DHTA 5ERGB 4TKUA 3R6LA 2YN4A 1OUMA 3A31A 4OLJA 2A0XA 2I54A 1WZNA 3B13B 2A0WA 1HRDA 5JECA 4R1LA 2J5BA 4QQKA 1HDXA 2N3ZA 2VJNA 4JT8A 1PAUA 1PCXA 2II6A 4HEA6 3U16A 3RODA 4PIMA 1UMDB 3KZNA 2H1FA 2CMFA 1ZVKA 3LM8A 3D1VA 1GV0A 3WJ2A 3RABA 4KLZA 4B3BA 2WVGA 1QZTA 2QR3A 1XI2A 5FOTA 3BEDA 3MOIA 4L5BA 4U3JB 2PD4A 2ZJFA 2ENWA 2J32A 2QF7A 3NHLA 1GLNA 4L3VA 2P65A 4AKHA 5FH9A 1VZ3A 2GVZC 1MX9A 3E0QA 2I6SA 3SDZA 1XDGA 4M98A 4ZOQI 4DRYA 5HKBA 3CNHA 1EGVB 4JN6B 1V4BA 3MYRA 5JFGA 1ZR2A 4EX6A 3FWYA 1CE8B 4LJRA 4CKYA 2YJZA 1DNPA 1G21A 3TMAA 4CQMD 2IDJA 2BTEA 3CNOA 4QU5A 1Q1ZA 3SN6A 5JY1A 4B83A 1CRPA 2M6KA 3S3TA 4K6OA 3CB2A 1Q22A 2DBYA 5TQVA 2OMEA 3VZBA 2F7SA 2V9ZA 4OL9A 1TD1A 3AUSA 4LISA 2JBAB 3UMFA 3NO4A 2QVYX 4MVXA 1AOXA 4GPTA 3K9LA 1L8LA 3HYTA 5CX1A 4D9GA 5CITA 1AH2A 3DMPA 3KQKA 3RS7A 3F6PA 2C92A 1YIDA 4J49A 2MWMA 3THYA 4CL2A 1ZEMA 5ELXA 2HDHA 1CUIA 1G42A 2QVLA 4MRMA 4L9SA 1QVZA 4RVUA 4MUAA 5CJJA 4YV1A 5J47A 1ISPA 4MVJE 3TZCA 2YY6A 5DHQA 2UVQA 3NAMA 1WBDA 1RRVA 3DKIA 2RGXA 4DE5A 1UADA 1VJGA 5LA6B 1PSWA 5AKJA 2X1HA 3GEPA 1V9SA 4X94A 2H18A 5G0UA 2G9QA 4TUYA 1P5FA 3WDLA 4K8OA 3PX7A 3EXG2 1OGYA 3LUKA 1Z0SA 3W77A 1TKBA 2JL1A 4XASA 5LDGA 2QYSA 1ZICA 3DYIA 3BFXA 4YQFA 3HO8A 2YVQA 4PW0A 1LX7A 1IOLA 2AKEA 4JJAA 3J7TA 4S35A 4XJSA 2W2PA 1WA5A 4JSTA 2Q5JA 5IFKA 2EL7A 5IP5A 3SKXA 2WZDA 3D5EA 5KMGB 3UKOA 3QKTA 2H0AA 2DWOA 4KE7A 4KXVA 4Z4HA 2HA3A 3NETA 1WCV1 1JG3A 4HNQA 4FYIA 4U00A 1KAEA 1OROA 4QO7A 4Z1MA 3SYKA 3ZXSA 1GG8A 1JLKA 2I3AA 3HLKA 5HWSA 4JODA 1GPWB 3PENA 1HQCA 4A8TA 4C88A 1PKEA 3SD7A 3H1EA 3G2OA 4LYHA 1CS4C 2MR6A 4PBSA 2VNAA 4KH0A 2QLBA 3E9CA 4U7PB 4UCXA 1M6EX 4NXMB 4RZUA 4E5PA 1V3UA 3O3MB 4HH3C 2F59A 2CJWB 1M2GA 3GRKA 2IPMA 1QX3A 4H1TA 4IDOA 1Z7GA 3KOMA 5ICEA 5E6RA 4DMCA 1OBOA 5LKRA 3OZDA 1FX0B 2GN6A 4ZAXA 2FMTA 3SICE 1CUFA 3S0JA 3S1SA 4DTIA 3O2NA 1KP3A 3NDJA 4NCXA 2TSYB 2WJGA 2IP4A 4C5BA 3I28A 4CM6A 1H9AA 1KJWA 1KDVA 5A2GA 2GEFA 4WOCA 4ZT2A 3V1LA 1L7NA 4Q39A 4BQSA 1XDSA 2XLBA 3I6YA 1SOVA 5EKSA 1WSWA 1GCUA 2Q4DA 3I34X 2QMZA 4MLPA 4X92A 5DM60 2WM8A 2YYZA 1C9NA 1W6UA 2FAXA 3MQ4A 3VZSA 2WKQA 4TKUB 2Y0EA 4JT4A 2GBFA 4REOA 4BJHB 4M3NA 3DOFA 1RJGA 4GC9A 4HDSA 2QTNA 1Y33E 2NTEA 3K2IA 5ERXA 3UENA 2QTLA 3KE9A 4DUYB 4MJLA 5IVHA 3HV2A 2YUTA 1JH8A 4JVNA 3V7NA 2FR1A 4DTCA 1L7DA 4KXQA 1S2GA 2Q0QA 5ECGC 1NTRA