4IFBA

Crystal structure of sult 2a1 llgg mutant with paps
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
274
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bile salt sulfotransferase
publication title Sulfotransferase Selectivity at the Molecular level
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ifbA00
2B8TA 1E9AA 2CVHA 1DELA 2BJVA 2OILA 1QHSA 3A6PC 2O0KA 1M1YE 2H18A 2IEYA 3T61A 1VG1A 5JCPA 4BFYA 5A0FA 2I1VB 1GM5A 1NSTA 3PEYA 2ZYWX 2XTZA 3B1ZA 1W2GA 2ZUDA 5J40A 4A2WA 4EFMA 1GNRA 4CRWB 2IW3A 4BLRA 3SQWA 1FQJA 2HJGA 2GK7A 2ZIAA 4NCKA 4US1R 3LBIA 2FV8A 2WMOB 4IRUB 4Q1BA 1I4LD 4TYPA 2GBLA 2O8FB 3LVQE 3LLUA 4U00A 1US8B 1ZM4A 1MRNA 5J4KA 1Z0IA 2O0HA 4KSBA 4PFSA 1GL7A 1GSIA 5A5GA 2KBFA 3AKYA 1PUJA 2QZ4A 3TQFA 3GJ3A 3SE0A 4DWJA 5FTNA 1RPZA 1K6MA 1YJ5A 2ZVPX 3U3KA 1XTQA 1VCOA 2P2LA 3LD9A 2PT5A 1KJWA 3QG5A 2BMEA 1KI2A 1W2HA 2H92A 4Y0VA 1N6OA 3Q3JB 1O3YA 2PT7A 5JECA 4PSKA 3THWB 1FFHA 1YR7A 3IQWA 3MGCA 1ZIPA 3ASYA 3FKSA 4MDEA 3T06B 4BLSA 2BCJQ 2VHCA 4F91B 2WWFA 2FH5B 4ZI2A 2O8DA 1SHZA 4LYHA 2C2HA 1XB2A 3R9XA 1Z6YA 1HTWA 3REFA 1E99A 1NKSA 4ZCIA 3LXRA 2X19A 2E87A 1EK0A 4NYMQ 1SXJD 2XZLA 4G3XA 4CIDA 1TMKA 1RZ3A 1JECA 5FI0B 4EJSC 2FF7A 3N2IA 1HV8A 4FIDA 4C0BA 3ZD7A 3RHFA 1HY3A 3DM5A 2WTUA 3FHCB 4Q9JA 4NCNA 1JEDA 5DO9A 5EXSA 2H57A 1X1RA 3P20A 2Z43A 2BVNA 1SVMA 3NTUA 3TR5A 2A2ZA 1E0AA 2MSCB 1QF9A 4B3XA 2XXAA 1XJQA 1VCNA 1XTRA 1CXZA 3I5YA 1G7TA 2IYUA 1FX0A 3B60A 1XXHE 4JT4A 3FHOA 1U9IC 1KK2A 1T4GA 1A4RA 2PL3A 2JJ1A 2QPAA 1G6OA 2CK3D 4AG5A 5IHPA 2JATA 2JJ8A 3I73A 3WXMA 4PHHA 4MGIR 2QBYB 1RE0A 1G9XA 4WXPA 3N2EA 2WJJA 4KCGA 4Z54A 3EA5A 4JMPA 4N3NA 3S1AB 4IVRA 521PA 3I8SA 4QGAA 4OHVA 5E3HA 1IONA 3RS7A 4B32A 3AVUA 1EXMA 4NYJQ 2VL7A 2P6UA 3PVSA 4A9AA 1E98A 4JBYA 3QVUA 2IS6A 1D6JA 2NZ8A 1SVOA 4QJ3A 4POAA 2ERXA 2OFOA 4DLTA 2GAAA 3KQUA 4JLAA 4OK3A 3GQBA 5JJLA 2BBTA 4OHWA 4LZZA 1SXJC 3AUYA 4EJSB 1II0A 3CRQA 1N25A 1W0JA 2ZEJA 2ZRDA 4D25A 4MGZR 2DY1A 2QSYA 4Q7KA 1PUIA 1W5SA 1W47A 3VFDA 2ZJYA 3FE2A 3NBFA 2PBRA 2W58A 4EPWA 5EXTA 3RSOA 2A78A 1OKKA 2QMUA 3VAAA 1UBCA 1X8JA 3C8UA 5BQ5A 4M2LA 3THOA 2Z5FA 3A58B 4AK9A 5HZKA 2BKUA 1OFHA 1F2UA 2QGZA 4BECA 1Z0JA 1BYIA 2LKDA 1X8LA 2E9SA 1IAQA 2ZJ8A 3G5UA 1AKEA 4JL5A 5EJEA 1A82A 2FSFA 3SHFA 5DHAA 1ZINA 4LJYA 1E0JA 1P2VA 3GJ8A 1U8AA 3BB3A 4OJKA 1NKTA 5HTKA 4HZIA 3SOPA 4LBVA 1E9EA 2VHJA 4UXHA 3TIFA 4IOKA 3T1TA 5JRJA 4EKDA 1NIPA 4YMVA 1MO5A 2FFAA 3ZDQA 2V7QD 4TT3A 4ZKDA 3TRFA 1U99A 3OIUA 4E03A 2F9MA 2C9CA 3TSZA 4M1WA 2B8WA 4LC1A 3ADCA 1G8HA 2PX3A 1DG1G 2VBCA 1ZBDA 4KFTA 1FTNA 3KFVA 3SBEA 2QAGC 1SXJB 4QC2A 1H8HD 3IHLA 2JAQA 3QQ5A 1ZVQA 1AN0A 2N1BA 3NDBB 3O8CA 2P5SA 3CF0A 3QKRB 4HEJA 5JHHB 2MMGA 1RJ9B 2WKQA 3OEEA 4LUCA 4KVAA 4QHYA 4B2PA 2ONJA 1OHHD 3IGFA 2P6RA 3VU9A 1Z6AA 2PZFA 2ZUBA 1RYHA 1X8KA 2V8OA 3K0AB 2IA5A 4M9ZA 1WQ1R 2IYRA 2Q21A 1JXMA 1KSHA 3MWJA 2R6AA 4RJLA 3LVRE 1R5BA 2IS1A 4YMUA 4JL8A 2ANBA 1TNDA 4XOIA 2QGNA 1DOAA 2X2FA 3IKJA 4QM6A 1Q21A 5FPTA 3GLFE 4AWXA 2HUPA 2WAXA 3QOFA 4OI0A 2ZRBA 1WXQA 3H2YA 4DLRA 1COWA 2IYQA 5CM9C 5JS7A 4S2EA 5A4JA 3I5XA 4RFSB 1CS4C 3NXSA 1GKYA 2NPIA 2F7SA 4CEJA 2VP4A 4A2QA 5AUNB 3PITA 1EX7A 2CDNA 4KV9A 4EPTA 4Q5IA 4EAQA 1G3QA 4P3YA 3D3QA 3QVVA 4BEJA 3FFBA 3U7GA 1TX4B 2ORIA 1OH8A 1KO5A 1XJCA 4KBFA 4CEIB 1NBMD 2J9RA 3CNNA 4BFUA 5EUMA 4QGHA 3NHBA 3AEZA 2EW1A 3WMEA 5TXGA 3KZ1E 5DE3A 4JKYA 3ZH9B 4UNRA 1FP6A 1KO1A 4A1FA 2GILA 1XNJA 2ZJOA 4IXMA 3LFUA 3CKLA 2DPXA 2R44A 4KODA 5CM8B 3AVQA 1DAKA 4FMCB 2CMKA 2AN9A 3KXKA 3P32A 1ZP6A 2WWXA 3CNLA 1Z5ZA 1QRAA 1Z29A 3BK7A 4QRHA 4V0ME 4B73A 4BZXA 5KSYA 2AXPA 4XVUA 1W1WA 2AWNA 5JSZA 3HPQA 3W5IA 3PEVA 2V6IA 2QAJA 5D3MB 2FN4A 3EW9A 2OFWA 4LHVA 3K1JA 4YXWA 2ZQ5A 1IXSB 1PZNA 2J87A 1G7RA 1T5LA 3ECCA 4RY2A 1UDXA 1YQTA 1YZUA 5HZHA 4FCVA 1G5TA 3ZIAD 2EFEB 4BZQA 4NYMR 1P9NA 1YR6A 4ILEA 2D2EA 1SVLA 3RANA 3BFXA 4AKHA 1P5ZB 4C30A 2WSSA 1ZCBA 2VF8A 4DB2A 1Z8FA 5EXPA 5KDOA 1R5NA 1I2MA 1NLZA 1M2OB 3EG5A 1QHXA 3IHWA 4KVGA 3T34A 4G5QA 1W4RA 1WDTA 3FOZA 3W3ZB 1R8QA 4CVNA 2Q0HA 4HLUC 4BFSA 4RD1A 4WIAA 4DXAA 3VX3A 4D0LB 3ZQ6A 4OJQA 3AVTA 3CX7A 4GRAA 3MUFA 5JWOA 5FOTA 1NP6A 4TSFA 1G7SA 1JR3E 2F43B 1N0WA 4CEHB 1L2TA 3WY9A 2XOKA 1RYFA 4QL3A 3U4QB 1MRSA 3K0CC 3DMNA 2V55B 1SZPA 1LY1A 1R4AA 1YU9A 2WKPA 4QGGA 5DSZA 3TSOA 4Z1MA 3KXLA 4AYWA 1VHTA 4IOJA 4IOLA 4NYJR 3PEWA 2BBOA 1S96A 1Z07A 2P6NA 2WIBA 4P0TA 4PHGA 3TLXA 1EFHA 1Y63A 4GSYA 1DAHA 1NSFA 2C03A 4M1TA 4R7ZA 1D9XA 1YZKA 1IY1A 1HQYE 2IEZA 1LFDB 1XMSA 2ZI7A 2OCAA 3M4YA 3UMFA 3W5JA 1ZUIA 5BYJA 4AC9A 2J7PA 1P9RA 2SHKA 3A4NA 4OK5A 2N42A 3LBNA 3OIYA 1DAEA 2YYZA 3V4RA 1E9FA 2XTNA 3R8FA 3U3JA 3THXB 3BGWA 3KKOA 1M6NA 3UATA 4OK6A 4NHOA 2W6IA 4BE7B 5FPYA 4B34A 1FL9A 4QJ5A 4IW3B 4MKIA 5IK2D 1XCGB 4PPGA 5CDFA 2A3RA 2CLDX 4OQXA 2IS4A 2ZR9A 1XDBA 1XXHB 1M7BA 1L4YA 2CCKA 2WJGA 3O47A 1G1MA 2R2AA 4GP6A 4UNPA 4FD2A 3U3OA 4Y0AA 3NG1A 2V54A 2ZI3A 1ZJ6A 2BKEA 1EFCA 3PG5A 4GZMA 5FUWA 4NYIQ 1TQ4A 1XCPA 2FSHA 3C15C 5EE5B 4A82A 2CCGA 2CXXA 4OQLA 4QM7A 1NIJA 1ZRHA 2NTYC 2ZRPA 1W36D 3CH5A 4U02A 5SZJA 3ZQJA 4B3CA 5L3SB 1BH2A 4DCUA 4EQ6B 4BFXA 1AS3A 3W8RA 4M1KA 5GVSA 2XNSA 3IBYA 3NDPA 2QEQA 3OFNA 3ZVNA 1UAAA 1OLOA 3RS5A 2QNRA 2DB3A 2IUUA 4NCJA 4W5HA 1OH7A 3DVLA 4MITA 2JCSA 6Q21A 3AVWA 4JYBA 2H5EA 1T9HA 4KLZA 1IOZA 1J8MF 4FMBB 2OG2A 2QI9C 1S9DA 2REOA 3KJIA 2NO0A 4BEBA 3FDIA 3R20A 3A4LA 4JLJA 2VP6A 4DSTA 2ODNA 1GP2A 4FWTA 4RCYA 3X1XA 2VPPA 2H7VA 4MYUA 4TL8A 3K70C 4TLEA 2MMCA 1DBSA 3U5ZB 1U8ZA 2G6BA 1VYTA 3BD9A 3BC1A 3D6TB 3SJAA 2FDCA 5G53C 5GJBA 1OT3A 3B6EA 1T5IA 3W9YA 5BN5A 2R6GA 3BFVA 3ADKA 4D81A 2ZSBA 4P4SB 2BOVA 4LV8B 2XSZA 4KXFB 4OHXA 2J0UB 3NH9A 3RNLA 3UMRA 2YWHA 5CK5A 3SEAA 3D31A 3PUXA 5DLQC 3CLVA 4LWZA 1LW7A 1QHYA 2B6HA 4LPSA 3V9PA 3BIFA 2C9YA 3VTKA 4RSGA 4HAVA 4S35A 4AKIA 3V4FA 2GEDA 5HCIA 4CT4B 5L3VA 4WXRA 4M9XA 2Z6VA 4KO8A 5JBQA 2KJQA 2JIZD 2OSBA 3MWYW 5FOUA 1N6IA 3PXGA 3AVVA 3BERA 1RKBA 1UDWA 1E2QA 1VPLA 3AKEA 4JLBA 4TMZA 5EE0A 4B2IA 1VCMA 3QBVA 3ICEA 2GCOA 2W6JA 4O0MA 4BPBA 1JI0A 3CM0A 3ZVMA 4PO9A 4EFNA 3K0FA 1KKLA 1YZTA 2ZRCA 1QZXA 2AHOA 1ZU4A 4JBWA 4C3ZA 1SKQA 1G3MA 1JEEA 4JYCA 4RD0A 4DLVA 1TEVA 4IFEA 1I4TD 2BBSA 5HR5A 1RFLA 1X6VA 1EFUA 4KFSA 5AJZA 3QF4A 3DMDA 4TL7A 3GLFB 2OV2A 1Q22A 1GL9B 4LGMA 3GLHB 4QHTA 2VHQA 3BH7A 5FUYA 2ZS9A 4A2PA 5DYIA 3ND8A 2A5DA 1BMFA 2XAUA 3H84A 2VLIA 4DLZA 1W36B 1KI7A 2WHXA 2OBNA 1Z6XA 1G3RA 2OCYC 2QTHA 1K8RA 4AKEA 5KOYA 4RZ2A 2OO7A 1S8FA 4I4LA 5LD2C 2HCJB 2J0QA 2QROA 1PLKA 4IDHA 4BLTA 2PCJA 4MRSA 4TTQA 3RAPR 3W90A 4TN1A 3SU8A 1XD2B 4DSUA 4QJ4A 1E2JA 3OAAD 2R62A 2IYLD 2VHUA 2ZSFA 4GZLA 1M7GA 4Q4JB 5FOWA 1KI3A 1P75A 4ZDIA 3QY0A 3G82C 4E09A 2BMFA 2RGNC 3QKUA 2ZE6A 4HZUA 1KK1A 3KQHA 3E1SA 2G88A 2QM7A 1UJ2A 4PHTA 4UNNA 2IYYA 3TW8B 1AK2A 2CJWA 1XMVA 2FEOA 3QPUA 5KPDA 3GLIA 1JB1A 4URWR 1ZUHA 2YOHA 3BB4A 1V43A 2FPKA 3QI2A 1NLFA 3UANA 1E2IA 3RRYA 4C7OA 1J2JA 1DVRA 2NG1A 3TGPA 3P4YA 3DO6A 3HU2A 3SNHA 1UM8A 4EPRA 4YONB 2BEJA 4G0NA 4LYAA 1H8EA 4Q4HA 3B9QA 2ZYVX 4F4JA 3A1WA 2O5VA 5IF9A 3FMOB 4BRUA 4RZ3A 1XMIA 2EYQA 4NP6A 4R9UC 4ZI3A 5FH9A 3MD0A 2ZRAA 121PA 1ZM2A 2B92A 4PPNA 5FBLB 3LQQA 4PPFA 1EWRA 2NMVA 2BHRA 4LI0A 1OXXK 1D8TA 2CHVA 4DLUA 3GFPA 5SZKB 2CL7X 2Z0MA 2IXEA 4Z8YA 4LCBA 4Q21A 4DDVA 2QU8A 3PJRA 5IRCD 4V02A 1JJVA 4KITB 2QSZA 1KI6A 3SYNA 2HV8A 4LYFA 3KQKA 3P26A 3VR5A 5LPNA 2A30A 1MR3F 2GXUA 5L3QA 4AURA 2OXCA 1ZNYA 2GVDC 4Q4AA 1DTSA 1E79A 2R8RA 4LY6A 3BAFA 3L8YA 3LRPA 4NYIR 2RH5A 3B1WA 3D7MA 1OH6A 3CPEA 4TLAA 1JR3A 2VIIA 2A5GA 4TQUS 5F9HA 5EP1A 4JLDA 2OBMA 4FCWA 2FGKA 2GJKA 4KAXA 5L3RA 3RSLA 1C9KA 1VDZA 4PO1A 2NO1A 4XVRA 4A8JB 4BASA 4DCNA 1QHIA 4OL0A 1A2BA 4DRZA 5JCZA 2XGJA 3F5FA 3I1FA 3KKQA 3Q5EA 2FOLA 4YDSA 1Z83A 2OCPA 2RGDA 3W6PA 2V6JA 1Q1EA 1HH4A 1YZQA 3BRWD 5TMPA 2IX3A 3C16C 3K0EA 4JSTA 4QOSA 1MABA 5TARA 3Q85A 3B1VA 5KHOC 2IXGA 2XEXA 5GJVC 2BMDA 4LBYA 5BW8A 2GXQA 4B33A 2R6DA 4Q01A 5EP2A 3SFZA 5DHFA 1WA5A 2DFTA 4O3MA 2Z4RA 3AKCA 1W0JD 3SI7A 1GKUB 3BS4A 4NBSA 4M4SA 4OQFA 4XSHA 3NBZC 4HUQA 4F92B 4P4TA 1W49A 2QENA 5DYGA 3PQCA 3QBTA 1ZC3A 3SZRA 1XBTA 3EZ6A 2ZE5A 3UG7A 1CIPA 1Z63A 1E9RA 5C2JB 1U98A 4PHFA 2YHSA 3K09C 4HI0E 3U3RA 5J4LA 2EFCB 3C5CA 4IVPA 5FBVB 1R2QA 2OUKA 2ZI5A 4HAZA 2P3SA 721PA 2MSEB 4Q9LA 3ND9A 5AUOB 1F60A 5H8WA 5G3YA 5FBRB 1E9BA 3NIBA 3ZLJA 2EFHB 4TL6A 4UQOA 3AUXA 2X2EA 1E0KA 4TT3D 1VMAA 4GNKA 2BIFA 3LX8A 2O8DB 4CGZA 4LHZA 5FBWB 3P27A 1HQCA 5CLQA 4A6PA 5B30A 2ORVA 3MAAC 2O8FA 2XJ9A 3QIAA 5EXXA 3FYHA 3EC2A 3KQNA 1JQJC 4OHZA 4DDUA 3ADBA 1DAFA 1Q1QA 2Q9BA 1HURA 4DIEA 1BOFA 2ZXUA 1KI1A 3QSYA 3HYRA 2G1JA 2R6FA 1A2KC 4C4PA 1XEFA 3KKMA 1Q1ZA 5AR1A 1AM4D 2WWGA 3OEED 5KSZA 1Z2CA 3NKVA 1GRNA 1XCMA 5E4FA 5FPHA 2C77A 3EPHA 2O8CB 5CITA 1Q1BA 2VP9A 1E9DA 5KNBA 3TSWA 2AK2A 2XXAB 3RWOA 2NIPA 3T1OA 1P6XA 3WP0A 2NO6A 5CDFE 3THWA 5K8LA 2A5FA 4LPKA 4XD7D 3SJCA 1FUKA 1OB2A 5K8UA 1KY2A 4JIMA 1D9ZA 2ERYA 3C5HA 2W83A 3AQ4A 4LC0A 4TMTA 1E1QD 2XZOA 1P9WA 3KJHA 5ELXA 4L16A 1T91A 2GJAA 2P65A 4BFZA 5EQTA 2IWHA 1IN6A 4DEYA 3I92A 5FL7D 1ESNA 3QEJA 2HLDA 2I4IA 1LV7A 4ERNA 1XJ0A 4CF7A 2P5TB 1HEIA 4B35A 5ANRB 1KK0A 1GG2A 4HDOB 4ASUD 1E3MA 3PUZA 2RHDA 1RRFA 3QXCA 4KU4A 4MGKR 3PUWA 4O2RA 5CJ2A 2YV5A 1E2NA 2ZSAA 4TTPA 4A4DA 5HKKA 3AV0B 3CX8A 1ODFA 2C96A 2D74A 5FUVA 3MG9A 1XD9A 5LB2A 4FWIB 5JS8A 1N6HA 4DC9A 2HXYA 5P21A 1G4UR 3EIEA 3M1IA 4B3DA 1P61B 4F38A 4PC6A 1KDOA 1NJFA 1W4AA 2YNMA 1OSNA 4DVGA 1KDRA 4MA4A 5FFMA 4L9SA 4LV6A 2ZROA 2FZLA 3NC1C 1NVXQ 1F2UB 4ZDJA 1QHNA 3M0EA 1E9SA 4C0AC 1G4AE 2EWWA 2ZSDA 5DN6D 2D62A 4UKDA 1WP9A 2OAQ1 2EFGA 3B82A 4BLOA 5K8IA 4LSGA 4PAQA 3FMPB 1ZNZA 2NO9A 2ORWA 4EFLA 1XTIA 2GDJA 2ANCA 4WOPA 3ZS8A 3QEOA 3UG6A 1AJEA 4EJSA 4WBSA 1L8QA 3UIEA 2BJWA 1G20E 1KGDA 4PAMA 2OCBA 3JVUA 5BYKA 821PA 5KPJA 1UADA 2FA9A 2AKAB 1E4VA 4U5XA 3FKQA 5C1BA 3EIHA 3OIWA 2G0NA 3I8XA 3OZXA 4X8MA 1AZTA 2ZPTX 5C4MA 1QHGA 2OAP1 1E94E 5BN4A 5F9FA 2BM0A 1II8B 5JI3E 1KSFX 1UEJA 4HDCA 3ICQB 2NOAA 1U9IA 4P33A 4ZPXA 3L82B 3LQRA 3QKSA 1F2TA 4H1VA 4IVQA 4LRWA 3CX6A 4MYCA 3DKVA 5EE3A 4PXAA 3VU9B 1NNEA 2WZQA 1EFRD 4GDFA 4HYYA 2ZJAA 2XOKD 1GITA 1T3LA 1XPUA 1DG3A 4JVLA 4PSVA 3T35A 3HU3A 4CYMA 2H17A 1HA3A 1EFTA 4YMTA 2W0MA 4Z1MD 2PJRA 1YHNA 2KE5A 1G8FA 1E69A 1RIFA 2ZAMA 1U90A 2BM1A 4Q00A 5GJCA 3E2IA 5KNCA 4US0R 1XZQA 1K5DA 2FSGA 2VP2A 3KDSE 4X8OA 4D2IA 1QDEA 1W4CA 2ZJ2A 2WOJA 1Q57A 2NZJA 4CT5A 4TMWA 4ZIRA 5JMTA 4TTRA 2KI5A 3LH5A 5H70A 2ZITA 1N5JA 1SXJA 3KKPA 3UXMA 4LJ9A 3TUIC 1Y3AA 4W5JA 4D26A 2YWFA 1EGAA 2QE7D 2Z83A 4V0KA 2LKCA 4TZ0A 1OIWA 5J47A 3KTAA 3IO3A 2WJYA 1RJ9A 221PA 3IBGA 2BC9A 4R98A 4C0SA 2DWOA 2PH1A 5FPKA 4HAYA 2ZANA 5B2ZA 3K0AA 1P73A 1TPZA 3DZ8A 3EASA 4DJTA 2ZI9A 3F8TA 2OE2A 4ESVA 5DNYB 4MYHA 4OQMA 2DFLA 4G1UC 2QN6A 2B7CA 3SYLA 1IHUA 4RFVA 2AXNA 4OHYA 2ODBA 3RVBA 1W0KA 1A7JA 3WYAA 4FMCF 1TF2A 3KUCA 3SS8A 4EPVA 1BS1A 1G3IA 3KUDA 4G5GA 5B57C 5JSZB 3GLIE 5JRZA 2QMOA 4RFSA 2W2XA 1CLUA 4L4UA 3LLMA 5HPYB 1E2DA 5M04A 4B75A 4DZZA 3WBJA 1CJTC 1RVDA 1OFIA 2NQ2C 4BZPA 3JZAA 3IUYA 4NZYA 2CE2X 4MH0R 1S1MA 1KNXA 3NEJA 3EPKA 3I32A 3U44A 3OFND 4HSEA 4NCHA 2F3TA 2H1LA 3A1UA 4JT2A 2GXAA 5BXQC 4LHYA 2QAGA 1XTSA 2RGCA 1KMHA 4LJ7A 1CJMA 3DDCA 3ADDA 1O87A 5F2EA 1CULC 1L7VC 2ZRLA 4M9QA 4TWZA 2WPDD 3SN6A 3W6OA 3W8NA 1DAMA 3JZMA 4AYTA 2YWEA 1NL3A 2IC5A 1Z08A 1KDPA 3Q7QA 1ZM7A 1GNQA 2KB0A 3AP2A 1E32A 4HLCA 4EDHA 4HB2A 1BYUA 5AWFC 1P72A 3AGQA 3GMTA 3CONA 1OXUA 4UJ5A 2WJVA 3SBDA 1MO4A 2XJ4A 1KI9A 4H1UA 4TMXA 1CP2A 2FE4A 2CE7A 1OFUX 3IO5A 4E07A 2GETA 2CVFA 1TQ2A 2P67A 2DYKA 1Z0FA 1QHHA 3D8BA 3AGPA 4J0QA 4TYNA 2XB2A 3M6AA 5JFGA 4DHEA 1R8SA 5AK0A 3THYB 5FTJA 3CR7A 1OIVA 4L15A 1VECA 3BJIC 3R7WA 1ANKA 3FVQA 5LBIA 3R9IA 4OBEA 4BFTA 1F6BA 3AVYA 5FR1A 1MT0A 4EPYA 4ON9A 1KAGA 5E7IA 3PCRB 1HUQA 2JLVA 4A0RA 1H8HA 4FINA 1CBUA 3OE7D 4P4UA 3EXAA 1G6HA 3B85A 4AY2A 4JSYA 3TJZA 4DT1A 1GRRA 2V1XA 2ASEA 5AJXA 2F6RA 4ZV4A 3KQLA 2QL6A 4RKFA 5L8VA 3V00A 1LF5A 2XB4A 3U4QA 1GUAA 2VH5R 3OESA 4KSCA 1G8GA 2IUSA 3AF0A 3HR8A 4NPHA 2GWHA 4TQ9A 5GADl 2JJ2D 2CNWA 2ZR7A 1UKEA 2ZRFA 3SQXA 4TYWA 3T15A 1N0VC 3RS0A 2OFXA 2DHRA 3WRXC 2QUZA 3LY5A 1S3GA 3DOEA 2WIAA 3WMFA 3DEFA 4L5BA 1BO6A 2PEZA 3IILA 1ZNXA 1U0LA 5KYKA 421PA 3HP1A 5CIQA 2GCPA 2FFQA 3LAWA 2WWWA 3DOFA 4JKIA 1AZSC 1VCIA 4PC2A 1JPJA 2OLKA 4KJZA 2J1LA 2V1UA 2ZE7A 2V3CC 4A15A 3C4JA 5FOVA 3VR1A 2IF2A 4HAXA 4F4IA 2I1QA 3HU1A 4QXAA 5K8TA 2X77A 1X86B 3OEHA 5D3QA 2YZ2A 4URYR 1LS6A 1BIFA 3KJEA 1NBMA 2ZRHA 5SZIA 1KAOA 4HLUA 1LVGA 2QPOA 3RRMA 2Q3MA 3C7KA 1IY0A 2NGRA 2D2FA 1LTQA 1ZCAA 2PLFA 4YDHB 3TMKA 1U0HC 4XVQA 3CRVA 4Q47A 1SVKA 3PEUA 1E1RA 1KMQA 1Q0UA 1NG9A 4D4KA 2HF9A 4PQYA 3K0CA 2F1IA 4B3BA 2IYSA 3DHWC 3FMIA 3RYTC 3U7EB 3GLGA 3K0SA 3Q8XB 3VR4A 1J99A 1S9HA 1T6NA 3PR1A 3RC8A 2QORA 3HDTA 1XF9A 4D0NA 3CUEF 4A0HA 3CR8A 4HLQB 3B8HA 4QHSA 4US2R 5AUQA 1ZNWA 2GK6A 3LW8A 2PX0A 3QPWA 4E22A 4V0NA 3TKLA 3EZFA 1HYQA 4BRWA 4C2UA 3TH5A 1UPTA 1C4OA 4GMXA 4LHXA 4NTZA 5E7JA 2QY9A 3ZIAA 5H1YA 2HEIA 4W9MC 1N6KA 1PLJA 4X8LA 3CWZA 4PC1A 1XRJA 2O52A 2AFHE 4ARZA 3PENA 3CF6R 4TMVA 2JDID 3A1VA 4JVNA 1Q3HA 2KBEA 2PJZA 5JJIA 1OW3B 2AKYA 1UKYA 1W36C 1OXTA 2G9NA 3LW7A 4URZR 1AGPA 2EYUA 5J4VA 4B71A 1CRPA 4OI1A 1Z6GA 2IF0A 3FTQA 1D5CA 1DEKA 3CPHA 2CLSA 3LWNA 4G5RA 1XEXA 1II9A 1KY3A 2QG6A 3BORA 4HATA 3UWKA 2FZ4A 4Z51A 2F55A 2GEUA 1G16A 4O2LA 1D2EA 2GCOB 3K9NA 5JI2E 4PQRA 1KK3A 1U2RA 1KO8A 2F3RA 2GJ9A 2ZU0C 3N5CA 3SR0A 2X1VA 4JLOA 4XSGA 3TUJC 3J81k 2J46A 2P0EA 1VIYA 1JR3D 1OXSC 2GCNA 3KX2A 2XNDD 2VA8A 2UZIR 5HE9A 4M53A 2ZM5A 2XZPA 3KKNA 2ATXA 2OM2A 3QF4B 4Q1EA 1CR2A 3I72A 4DSOA 2G3YA 3EX7C 4FW9A 3GJ6A 4I1VA 4IHQA 4JBXA 1G17A 1E2HA 1TAGA 3TQCA 2ONKA 2EU8A 1SKYE 4CW7A 4MKGA 1XEWX 3IEUA 4JVSB 3K8YA 2UZ3A 8OHMA 1AS2A 3G0HA 4PTLA 1OFTA 4NE2A 1D2MA 1FOEB 5C46F 2O8EA 5JHGB 1LB1B 1NN3A 3Q7PA 2VO1A 1SULA 1F48A 2WKRA 3RLFA 1KDTA 4M9SA 4ZKEA 2VRWA 4PPQA 1YVDA 1ZMXA 4M1SA 2QTFA 1GNPA 1ONBA 4DDWA 1U0JA 2W2TA 4Q1FA 2LWIA 1G21E 3TNFA 4HZUB 1KTVA 1X3SA 4ACAA 3GLHA 4C0LA 3CZPA 2AFIE 1E2EA 2CJWB 1KKMA 4XTCS 1DO0A 3O8DA 2FMXA 2RHMA 3VKGA 3MJRA 3T1VA 2CLCX 1ZD1A 2ZRMA 3A4MA 2C95A 2Z4SA 3OIVA 3WMGA 1N3BA 2IYVA 2QP3A 3A36A 5JEDA 4C7OB 4IDPA 4FMDF 1N6PA 3MCAA 4I1OA 2REXB 3CBQA 4HB0A 4MQBA 2QRZA 4G5OA 3B2EA 3AP1A 4A8JC 3ETLA 2PMKA 4FMDB 1T3SA 4YQFA 3EWSA 1XD2A 3WBKA 3W3AA 1A5TA 3HYTA 4Q4HB 4WA7A 5EZ6B 2QRNA 3UKDA 1G5RA 2A9KA 1GL6A 3FKSD 2J7KA 2OT3B 4LYJA 4V0LA 3P1JA 1GILA 3WP1B 4RZXA 3U7HB 2YKGA 3RC3A 1ZM3A 1SXJE 3OHMA 1W46A 4A6XA 3RDPA 5CK4A 4JLMA 5E7MA 3MFYA 4AIIA 4B6FA 2ZJZA 2ZRKA 2GJ8A 1KI8A 1ZW6A 5J4HA 2Q3FA 4JZKA 2JLQA 5KDLA 4DLWA 1NMYA 4OQNA 1HE1C 2A7QA 1W48A 3VNVA 3SC3A 1SQ5A 2G0TA 2VF7A 3MWKA 3T5GA 2GHIA 2B7BA 5L3QB 4IOMA 4JJKA 4LV5B 5TVKA 3TAUA 2RCNA 3X1DA 4Q4AB 3U61B 2GTPA 1AGRA 2RKOA 3IIJA 4JLPA 2GBLC 3GJ7A 4LK2A 4NMMA 4Q1DA 1NI3A 2GKSA 1I4DD 3IIMA 2MSDB 2YC4C 2IK8A 4DKXA 1UBFA 1GKIA 1Z06A 3BH6A 2VSOA 3LV8A 1J70A 2PZGA 1KO7A 2QT0A 3NC0C 2PZEA 1S1CA 2JJ1D 5B64A 5DI3A 4A92A 3GFOA 4BUJA 3B5JA 1W4BA 2TMKA 1VYVA 4HB4A 5BWMA 3QG1A 2VP0A 2QTVB 2JIZA 1G8YA 1Z47A 3F0TA 5KO2A 2HLDD 2AK3A 2G1KA 5EZ5A 1QVRA 2X8AA 4G01B 4B44A 3I61A 4MRPA 1M7HA 5BN3A 2RGNA 3KFXA 2V9PA 1MABB 4OI4A 5C18A 5GVRA 4C9BA 1NVUQ 5KTYA 4DLYA 2C99A 2OZEA 5JWHA 2DWPA 4LJ8A 2IUTA 4MGYR 3HR7A 4Q48A 1CR0A 3CO5A 3KXIA 2CHQA 3SDZA 3QXJA 3DPUA 1FNNA 4HUQB 3RS3A 2Q3HA 3QF7A 3AB3A 4LJ6A 1R10A 3BFKA 4IDOA 5JZVA 3GJ4A 1ZYUA 2H8KA 3CZQA 4JJZA 2O8BA 3B1YA 3DKPA 5F98A 1VTKA 2QP9X 4TYQA 1GTVA 1IM2A 1PVOA 4QBHA 4W5WA 1OKKD 1GRQA 1YR9A 3TVDA 4URXR 1VG8A 4II7A 4DSNA 3B13B 2GVZC 5LDDC 4RD3A 5TV2A 1NJGA 4QBFA 4PANA 1Z0AA 4ZO4A 1AIPA 4ACBA 2C04A 4Q66C 3EPLA 2A5JA 4MKFA 2YC2C 2IYXA 5EE9A 1G5PA 1XEWY 1CRQA 2QMHA 2DBYA 2RGBA 3QENA 4UXJA 3VKWA 3UWOA 3LO5A 4D4LA 4GFDA 3O8RA 3OAAA 1MKYA 1UBEA 4M22A 4C2TA 3B7GA 3VHXA 5AJVB 3IEVA 1XPOA 1GDDA 2C5LA 1JAIA 4ABYA 1IBRA 1CR1A 2ZJ5A 5FPSA 1JXOA 2RAPA 4WZ6A 4QGFA 4LHWA 2VP5A 5FTMA 2HT6A 1ELOA 4MDFA 2J59A 1US8A 1UKZA 4Q9KA 3CRMA 3HWSA 2F9LA 2WVJA 1E4YA 1FP7A 5FOSA 3CH4B 1WMSA 4RD6A 4D6PA 2VSFA 4BFWA 4EUNA 5AJYA 4WAUA 3I3SR 1G41A 4MRNA 1XWIA 2BBWA 2V4ZA 2VYFA 1FW6A 3AF3A 3SJZA 4B3GA 4ZCMA 3FPAA 1IN8A 1IN5A 1KJZA 4IDQA 3WYGA 3Q72A 4NKRA 3MSXA 2C9OA 2E1RA 2J41A 5FTKA 3REGA 1AQYA 4MKHA 4B76A 1FX0B 2FU5C 5EUQB 3EIQA 2NPFA 4B6EA 3U6BA 3UPUA 2HDNB 2AD5A 4D82A 1OH5A 1E2KA 1T0HB 4KLNA 1COWD 4FXPA 1OXVA 1TU4A 1R0WA 1U8YA 4BFVA 2JLYA 1PV4A 3QXXA 4P32A 4K8OA 4BLPA 1KIMA 3L0IB 1R5OA 1KOFA 1KHTA 2JASA 1NBME 3L0PA 2DWQA 2O8CA 1KSJA 2RGXA 2GZHA 1P3JA 3QKTA 3K09A 4KI0A 3ZS9A 5CB6A 4G5SA 4IFBA 2VTKA 5G40A 2ZJBA 3NBYC 4TLBA 4L8GA 3MLEA 3VR6A 2AD1A 2ZVQX 4DB4A 4M1YA 1W0KD 1E96A 1Q12A 3SYKA 4XTRA 1EX6A 1NN5A 5CYOA 4I1UA 3EZ7A 3LXXA 4IEIA 5CIWA 3L0OA 1U81A 3GLGE 2WWIA 3IDQA 3FGNA 1FMLA 4BQSA 2G77B 1ZD8A 1NRJB 1Q3TA 1OF1A 3L8ZA 2CL0X 2FX3A 2ZI4A 2QBYA 1JJ7A 1P2TA 2WOOA 2F1HA 4FI3C 4PR0A 2RGGA 4DUGA 1KSGA 3K9LA 3S1AA 2JLSA 4HLDA 1SKYB 4O25A 1RRPA 3GP8A 3WYFA 3FHTA 1UF9A 4LBWA 2EFDB 4PC7A 4YXWD 1Z6TA 1LNZA 2VHTA 3GEHA 1KYIA 1TF5A 1YZLA 1XU4A 2GNOA 4JL6A 4D0GA 5AJWA 1TEXA 3QE0A 4LJAA 2ODWA 2ZRGA 2GZDA 1GZSA 2EWVA 4JLNA 1N2CE 1UKVY 2FWRA 4HUTA 2WSSD 4QFMA 1RC8A 3VR3A 2CBZA 4TLDA 5C4GB 2UVQA 1Q20A 4OI2A 1OB5A 4GL2A 3GCGA 1DS6A 1VYUA 2FGJA 1I2DA 3N70A 1FPMA 4JVMA 1KNQA 1CU1A 1G291 2HXSA 2KSQA 2ZI6A 3H86A 2CHGA 3OF5A 1JBKA 1Q44A 4GOJA 4K46A 3QKSB 1F2TB 4MRVA 4TL9A 2JLZA 1EWQA 3PIRA 2Y8EA 1WCV1 2IT1A 4C0JA 1C1YA 1P4SA 3PFIA 4QG7A 4TSFD 2C78A 1S0UA 3MRSA 2JLUA 2ATVA 1XP8A 2IHBA 2ZRIA 2HJVA 1DO2A 5JJKA 4B3FX 2OEPA 2IBMA 2PLRA 3W6NA 3AM1A 1E2FA 3R9WA 3GFTA 2J5XA 1AS0A 2FEMA 4M21A 1KO4A 5GJWC 2GAOA 4QNMA 4ZIRB 2GZAA 3MWLA 5FTLA 4B2LA 1QVAA 2BCGY 1UEIA 5JLJA 1II8A 1P2UA 1NVVQ 2BMJA 3BWDD 3A1SA 5TY0A 3AF4A 4DCSA 4CEJB 2J0SA 3KTAB 1GFIA 3K53A 3ZGXA 5J5CA 4PQFA 1OPXA 2ZE8A 3QKRA 2J7PD 3QUSA 3TVTA 5UKDA 3HPRA 1ETUA 1CR4A 1QG2A 5CJPA 3CW2A 4GP7A 1TUEA 5FOXA 3A37A 1MOZA 2CNWD 3SHWA 3QNUA 4XD7A 1ESMA 5KUTA 1FMJA 4K81B 1GVNB 2W6ID 4ITRC 3T1QA 2FNAA 3H1TA 3O8BA 1WE2A 3EPJA 2F1RA 2R65A 3GLHE 1E1QA 2VSXA 4HB3A 2BEKA 1J90A 4HDQB 1NF3A 3BBPA 2CK3A 2D7DA 2OHFA 2ODEA 2C8VA 4PAOA 2EVWX 4ESHA 1SVWA 5FL7A 4TMKA 2QQ0A 1VG0B 3NHAA 1TU3A 4Q03A 3X1ZA 2GEVA 3OEHD 4Q4LA 3L0SA 3CIOA 3U44B 4ASUA 2RGEA 1OJLA 4M1OA 1KZGB 1R6BX 1JNYA 1S2MA 1SVIA 2QAGB 2R9VA 4W7SA 4DCVA 2YJTD 4CEIA 1KMHB 1BKDR 4F93B 1CEEA 1S4QA 1ZD9A 4WZAE 5EE1A 3AF2A 1IXZA 1E1RD 3RWMB 1JAHA 3VQTA 1VHLA 4QKQA 2JEOA 2GESA 2N46A 1HT2E 2FPMA 3H4MA 5JWRA 3F3YA 1NVWQ 2YOGA 3LDAA 2YWGA 1FZQA 4DLXA 3LNCA 3VHLB 3ZZ0A 1OE0A 1IJFA 3GEIA 4Q18A 2IHYA 5DN6A 3GEEA 4NH0A 3P4XA 2DFNA 3K9GA 5D3MA 2C98A 3U2QA 1ZUNB 2QPTA 3DZDA 4GT1A 1YRAA 1QHHB 4LBZA 1AA9A 3VNUA 3FFAA 4M0LA 4OKSA 4F7WA 2DR3A 1GAJA 2QMEA 1L4UA 2G83A 1CJUC 2UKDA 4JLKA 4MRRA 4N1AA 4PSAA 1X1SA 1Z0DA 2QQEA 3TW4A 2GXSA 2JA1A 5KU1A 1YZGA 1P2SA 2XSZD 3R7WB 1N0UA 2RB4A 4BWYA 1P62B 2V7QA 2JLWA 2JLRA 2OESA 2BV3A 2WJIA 1K5GA 3FB4A 2R6CA 1FQKA 4C0HA 2WSMA 3FMFA 3WNDA 1XZPA 1YE8A 4XJXA 5B58C 1XX6A 3GD7A 3TK1A 4F4CA 4V0OA 2LCFA 3X2SA 1D2NA 1E0SA 4IDNA 1IXRC 1T8TA 5F3WB 3CPJB 3RRZA 4DT1B 1JR6A 1E9CA 2GF9A 1MO6A 1TQDA 3L43A 2Q9AA 5LB4A 3A1TA 1EFRA 3U60B 3KL4A 4LX0A 1HT1E 5DISB 1E2PA 3IPYA 1OHHA 1TADA 2Q6TA 3WNBA 5JEEA 2F43A 3C41J 4QBGB 2W6JD 2OXRA 2J45A 4CEHA 3VX4A 2WMNB 1QBKC 3THYA 3NH6A 4KFUA 1CJKC 3Q9LA 1WBDA 4AKGA 3CB4A 3E5HA 3PUVA 4GI7A 1YRBA 2H16A 3RS2A 5AUPB 1VG9B 1V5WA 2IXFA 1RRCA 1FNMA 2RGAA 2FFBA 1SHKA 2CL6X 5DH9A 4I81A 4RD4A 4Z8XA 2QE7A 3U7FB 3BH0A 3ZJYA 1DAGA 2ZRJA 4TQAA 1TUIA 4UNQA 4GPTA 1UFQA 3BE4A 1XTJA 2IYTA 1BMFD 1R0ZA 1HE8B 2PMDA 2W2VA 3GJ0A 1P7CA 3LA6A 1N6NA 4NCIA 3RABA 2WWYA 5KNDA 2FG5A 2FSIA 2XITA 3K70D 4LJ4A 4X8HA 1EG7A 1OYYA 4DCTA 1XTKA 1SGWA 2WAYA 3I4LA 2B21A 3THXA 5KSPA 4RCZA 1R7RA 5CYPA 1AQUA 4B74A 3AKDA 4L9WA 1FTSA 2GRJA 1WF3A 4XWAA 4E5UA 1OIXA 4NONA 3L2OB 3GLGB 1XXHA 2A5YB 3EZ9A 3U6KA 4IXNA 2HYDA 4EIWA 3IPXA 5FR2A 4AI6A 4R71A 1A1VA 1T8UA 2XTMA 2DCUA 4TLCA 4RD2A 5FBQB 5DGXA 3GJ5A 3NEYA 4TZ6A 1B23P 2Q9CA 1Z2AA 3QPVA 2JGNA 5L3SA 4YMWA 3AVPA 5E95A 4EQ6A 1NY5A 2AR7A 3EARA 2PCLA 4JLVA 4MYTA 3K9HA 1N6RA 3NWJA 1IQPA 4R2IA 2D7CA 1E2GA 4NDZA 4B43A 3PV0A 4ARZB 3CRW1 1NVVR 1NY6A 2W0SA 4FCTA 2IYWA 2WPDA 3MMPA 2ZYTX 4LDJA 2ZUCA 4BLQA 3GPLA 4A0GA 1H8ED 1E2MA 1H65A 3TUZC 3QXHA 2YVUA 3VR2A 4C0QC 1G7CA 1FUUA 5FUXA 1XPRA 2KWIA 1YKSA 3AH8A 1MV5A 1GOTA 4LJ5A 2D06A 621PA 4U7DA 3ZZUA 4CDGA 5SZHB 4PO8A 4UNSA 3VMFA 5G3ZA 4ZDKA 4IJMA 4CZ2A 4Q9HA 3RS4A 1XEXB 1IJEA 1DPFA 1Z0KA 4Q7MB 3WRYC 4JS0A 4OYHA 4URVR 1B0UA 2FFHA 1W5TA 3EC1A 3EA0A 3DM9B 3H0KA 4NL4H 4EPXA 2CEAA 1IY2A 1E79D 2FPLA 3B78A 3U3MA 4P4SA 4D80A 4AYXA 3K0FB 3SJBA 3FWYA 2J0UA 3X1YA 2IL1A 4M1MA 2ZR0A 3ZYCA 3AP3A 2J3EA 1JALA 3ZZTA 2YOFA 2ZETA 2WICA 2WWHA 1N6LA 1DE0A 4YMSA 3T12A 3NVAA 3WHLA 4P31A 3VKHA 3TAHA 3OE7A 1NN0A 1OV4A 3PUYA 1PLLA 1YR8A 1QG4A 2D4HA 3IIKA 5CLLA 1MO3A 2O8EB 1G3UA 2O0JA 5IT5A 2REBA 2OBLA 4YC7A 2IS2A 3MJHA 4HAUA 4MUBA 2QA5A 3RRNA 1KJYA 3ASZA 4FN5A 2J0VA 4WVFA 4I99A 2GJSA 3K70B 2JJ2A 4UXIA 3Q5DA 4KYIB 3AVXA 3EZ2A 4ZCLA 4RZUA 1XD8A 1TQ6A 2NO7A 4MUAA 1R0XA 3TE6A 2YINC 3TR0A 5IK2A 2ZAOA 1S3SA 4DBLC 4TYYA 3R8CA 2K5UA 2L0XA 4Q1CA 1E2LA 3UK6A 3EWAA 1W7AA 4M8NE 3GLFA 1G8PA 4PZZA 4WZBE 4Q1AA 4BGDA 4XWOA 1GWNA 1N5LA 4Q7LA 4A36A 3AF1A 2WV9A 4YLGA 1MH1A 4ZDWA 4Q02A 2CCJA 2AWOA 3X1WA 3GLIB 2QP4A 2W00A 1ZC4A 2ZTSA 4URUR 5EP4A 2HT1A 1OYWA 4B47A 3ONWA 3I62A 3HJNA 1AKYA 5HCNA 2XX3A 2ZREA 5IDVA 1CJVC 1F5NA 1ZM9A 2AX4A 2BDTA 1Z22A 1XMJA 2ZYUX 3AVOA 5EP3A 2JLXA 2F1JA 4PX9A 1R0YA 4V03A 1T0JB 4XH9B 1DARA 1WRBA 1KI4A 1M8PA 5KSOA 4N0DA 5H68A 1UBGA 1SVSA 1ZAKA 3GJXC 1NG1A 4C0KA 4PZLA 4D4JA 2ZSEA 3LX5A 4DDTA 2HYIC 4H9GA 4IEEA 4Q4JA 2ZS8A 4DEXA 2QT1A 2RMKA 1G64A 4WW0A 1DAIA 2GF0A 1XFAA 1WB9A 2OLJA 2I3BA 3T5DA 1U94A 4V0MA 1Z28A 2WJHA 3KB1A 4KHZA 2PEYA 5CB8A 1KI6B 1CKEA 3CWQA 4LOAA 4UJ3A 1DADA 4RKEA 1NN1A 1JQLB 3UMSA 3KJGA 4GOKA 3JVVA 1TL7C 2IWRA 2AL7A 2EQBA 5TDHA 3BXZA 1KZ7B 5FI1B 2QM8A 1LF0A 1M34E 3ZVRA 1IN7A 3IQXA 4B48A 4KFRA 3W34A 4NU0A 4PC3A 1CTQA 2JDIA 2ZRNA 1JPNA 1PJRA 1N5KA 4AD8A 1CF4A 1LS1A 4PZYA 5LD2B 3LBHA 5DI3B 4Q7JB 4QBIA 1VIAA 4A0FA 1RRGA 3TBKA 3NBXX 1ZIOA 4RVCA 1P60A 1ZU5A 5DIFA 2HF8A 3QJYA 4DIDA 3B9PA 5HE8A 3CRRA 4IKEA 1GIAA 1W44A 1NMXA 1VKJA 1WBBA 1EESA 2GA8A 2VQSA 2WBLC 2VEDA 1F3OA 4GOXA 3A8TA 1N5IA 4N0EA 1IN4A 2BWJA 1M74A 4I1SA 3ZD6A 4Q19A 1YZNA 3CF2A 4XIGS 3E70C 2FJUA 1RW4A 5DI9A 3C14C 2DFKB 2ECKA 3WNCA 4KBGA 5HKKD 2XNDA 2D3WA 1G18A 3QXSA 3EAQA 1TTTA 4GBMA 4HAWA 3SFVA 5G41A 1G19A 4GMDA 3WHKA 4KYUA 5KDDA 4D4MA 2ZU6A 1J7KA 1E6CA 2O8BB 5FL3A 3BB1A 1T3HA 3B1XA 4A8JA 2HCBA 4QNRA 2WM9B 4DLSA 4R2HA 5TB5A 2ZS7A 3KB2A 5J4YA 3DL0A 4Q9IA 4DUGD 1J8YF 1TF7A 3BOSA 1Z3IX 1NMZA 2IYZA 3CNOA 4AG6A 4XWKA 1NLYA 3ZVLA
chains in the Genus database with same CATH superfamily
1V9CA 3FYUB 4BV8A 3LDGA 4F96A 2JK1A 3U81A 6NULA 4O4JF 4F71A 3PNOA 4EWLA 4JT9A 1SD2A 5GZ1A 2Q3EA 4IIGA 3L79A 4PYMA 3PEYA 2ZYWX 2PA3A 4RJJA 1YDWA 4O4JB 2WVAA 3O4GA 4I19A 1ZOPA 2CLMB 3OQIA 1GNRA 3U3DA 1W19A 1YSCA 2YJNA 1XFDA 4YS6A 2HWYA 1W59A 3WA7A 4JC0A 5KC9A 1M1ZA 2WQZA 4BLRA 1YIAA 1FQJA 3VR3D 2GK7A 2QRPA 4NOMA 1Z6PA 4OGGA 2QKYA 4IRUB 3U26A 3UHFA 4ZQIA 1RJFA 1U3DA 1JA1A 3LVQE 1X1EA 4PN7A 3OT1A 2GGSA 2TMDA 3W6UA 1US8B 3TECE 4ZGWA 4QPJC 1RZVA 4YRLA 1Z0IA 1D8AA 2O0HA 1O6FA 1N92A 3H83A 1XPJA 2I2CA 5A5GA 1GJRA 2ET6A 2ZDQA 5F5NA 3M5DA 1NXSA 1UFOA 5DYWA 2C8KA 3D3EA 4R51A 3D3WA 5EZQA 3P5BA 1KJQA 4AB1A 4WBNA 1DIHA 5JJBA 2BGRA 4IUBS 4PYKA 6REQB 3TZCA 1I4EB 2AJLI 3NX4A 3U3KA 2QYHA 1XUOA 3IAS6 4JHLA 5BSWA 1HYBA 3DE4X 3L4BA 4YFYA 2JBAA 2A9QA 1NR1A 1XU7A 3FVWA 3I9MA 4B4UA 4YRSA 2FMHA 5JECA 3VPGA 3ZCPA 4CHTA 1FFHA 2Z4TA 3MGCA 1ZIPA 2XVXA 2IZ0A 1NW8A 3ASYA 3FKSA 4TMYA 4JI6B 4UUAA 1F17A 1XN1A 2FH5B 1SHZA 2R6JA 4LYHA 3TOZA 1URPA 1V2GA 1J07A 1KIAA 4OPMA 1UK6A 1GQSA 2O48X 2VPTA 3N6VA 2FUCA 1QGZA 2EW2A 2OMKA 3AUTA 5TX7A 1M10A 2X19A 4BIMA 1T1JA 3AY7A 4H35A 4NYMQ 1SXJD 4CN9A 1X7XB 3SKVA 3TQIA 4CIDA 2XZLA 1TMKA 2C4HA 5FI0B 1SPXA 1KA9H 3N2IA 3RHFA 5K6TA 3L02A 2WMDA 1JLMA 3E27A 3FHCB 4IIBA 3VC7A 1HM5A 4EJ2A 2WTUA 1MOPA 3OLVA 1GHTA 2Z43A 5B1YA 1Z8HA 4W1PA 2PMEA 2FYTA 1GPJA 3MSCA 2A2ZA 4EZEA 1LLCA 1N7JA 3UQYS 3GA5A 4GD3Q 6CHYA 1BQ4A 1HSZA 4GHWA 2XXAA 1BDBA 1J2EA 2POCA 3PVZA 4NFHA 4ZU3A 1B4DA 5C52B 4JEHA 3WWYA 3OPYB 1NBEA 3OG9A 3L6RA 4M46A 5I4CA 3INYA 4YAJA 4S3MA 1YVEI 5E8RA 3FHOA 1BCRA 3IELA 3RVMA 5JQWA 3WQQA 1A5AB 2JJ1A 1G6OA 3QA9A 2C0CA 5ER9A 1BQEA 2Q7OE 1G6KA 3KELA 3NRBA 5PNTA 1KVUA 1BG6A 1G9XA 4LXUA 1M0WA 1I9CA 5JSYA 4R8KA 3FDXA 1RCFA 1RKQA 4N3NA 4FLFA 4MNTA 3V4LA 3GYBA 2AZDA 1JXQA 2B82A 2NQTA 3RTDA 4OHVA 4PFJA 3M4XA 1G5FA 3JQGA 4PICA 1EXMA 1U7OA 2O54A 3OURA 4XUEA 3U49A 4A0QA 2ECOA 4H7HA 1JDVA 1NWHA 2JFVA 3PVSA 2VJOA 5BPHA 4H59A 4JBYA 3DZJA 1P44A 2XF2A 3WIEA 4CM9D 1EFVB 1JVBA 2IS6A 1SVOA 3ZXXA 4C7OA 2F8SA 4M6WB 1M0EA 3ZGYA 4B84A 2OFOA 3IP3A 1Q16A 3KQUA 4NQZA 4OK3A 2WFAA 1E5XA 2BBTA 2YH2A 3W3AH 3IODA 4FT4A 5TR9A 2PZJA 3MJSA 1MJ5A 2BGTA 3X0DA 4EJSB 3M6UA 5A0TA 1N25A 1W0JA 1Y3IA 3BBLA 1G8SA 1TTPB 1WPQA 5ALWA 2DHCA 3VPFA 5C5IA 1W47A 4G23A 1TTHA 5GONA 1TJPB 5DYYA 2O0MA 3ZV7A 2W58A 3IEIA 4GLOA 3OM0A 1RP7A 4JGGA 5U4QA 1UBCA 1PL8A 2NTVA 5AHXA 5BQ5A 3UGJA 3M81A 1LGYA 5HZKA 2CZCA 3ZK9A 2ZSIA 1M1XB 4HVAA 5LQDA 5JAQA 4QDUA 4TV8A 1IAQA 3NYRA 2FRXA 5K01A 1K7EB 1ZINA 4LJYA 5HKBA 1P2VA 2LXNA 3DT9A 3MJVA 4QEZA 4FGKA 3T41A 3LDFA 3N0XA 3PXAA 4LBVA 1TVKB 4Q7QA 3OTOB 2YZGA 4EKDA 2XYVA 4YMVA 4OHBA 2G07A 1BWSA 3CBGA 2V7QD 1ADFA 1KYQA 4OQYA 3TRFA 3ZUPA 1CQIB 2WTMA 3OIUA 4ED9A 4F11A 4ARIA 3BTOA 2QTCA 2C9CA 3DVAA 3RLIA 2VTBA 3OCZA 4OQ4A 4PTYA 3M2TA 1SZJG 1E3SA 4CMIB 4N01A 2I7VA 4GW3A 2VVTA 3MBOA 1DG1G 1UBJS 4KFTA 2YS7A 3DNPA 5KJ1A 4QECA 1YVPA 1J9EA 1KY5A 4XWTA 1F0NA 1TCCA 1U4OA 2QAGC 1SXJB 3CZCA 3W78A 4F9EA 1B26A 1TI7A 3IEXA 3QQ5A 5TF4A 1OJ7A 1JU4A 2XWSA 3VDRA 2P5SA 3S2IA 2FJPA 1GUZA 4HMPA 3QKRB 2QTZA 2MMGA 2FW0A 4KVAA 4B2PA 1GQOA 1NE7A 1SRRA 4RBNA 4ZQEA 2P6RA 4KR3A 2ZUBA 3NR2A 3SE7A 2IA5A 3H4IA 5CVDA 5CDTA 4Z86A 3GYGA 3HVHA 3ZE6A 3MWJA 1E4OA 1ITZA 4BMOB 3LVRE 2ZTVA 4RY8A 5D51S 2IS1A 3CGWA 2GBIA 2ZYHA 4XOIA 2R3SA 1CZNA 4B6OA 4QM6A 3QWIA 1M34B 5A9SA 3AJDA 3GLFE 5AW0A 4P92A 3TMYA 1E6WA 5HZMA 4AWXA 2AI2A 3SXJA 4OHKA 1PTJC 1RYNA 3L7BA 4XAQA 4N41A 2AX3A 2VPWA 4IDEA 5CM9C 4CE6A 1E3DA 2B4RO 5K0NA 4QOEA 5JS7A 3KEOA 1CS4C 3I5XA 1GKYA 3DBHA 3DOOA 4ZYUA 2VP4A 4ND6A 4WY5A 3RC9A 2SCUA 4LWPA 2W2KB 3RJMA 3PITA 4BNKA 4KV9A 2VXCA 3JAMA 1ZOIA 1F4VA 3C3YA 4Q5IA 3ROKA 1EK2A 4EAQA 2H7XA 3E9NA 3QVVA 1XYYA 4BEJA 4P34A 1HDRA 3FFBA 3U7GA 4BJ3A 1OH8A 4DNQA 1E8MA 4ZO7A 1NBMD 2OWDA 4BFUA 5CW2A 1V4NA 4KXVA 1L5FA 3WMEA 5TXGA 2XUHA 3EGIA 1J5XA 4BNTA 3PWZA 2V6FA 4JKYA 5EFOA 4PG7A 1KO1A 1Q2XA 1OI2A 2QJTA 4F7DA 2XGOA 2EJUA 4IXMA 4NXMB 3LFUA 2VK4A 1T5TA 3W5BA 1DAKA 1TO1E 3SMVA 3WJ7A 1N1EA 3TTXA 1ZP6A 4ALKA 1QP0A 1Z29A 1UDCA 2OYSA 2RAUA 1G5HA 1PJ2A 2D59A 3E2MA 5A04A 5JSZA 3WKAA 3MUOA 3AU9A 4NU5A 1F0YA 1N9GB 1U3TA 2OK7A 1NZJA 1UXJA 2QAJA 2IH4A 1ODJA 2GMWA 2N47A 4KXQA 2EJWA 3CUWA 2FN4A 2GNAA 4NICA 5KJCA 2ZYDA 1L8XA 3OTGA 3PU6A 5K3FB 4COKA 4P86A 4BP8A 3K2IA 5LQJA 1IXSB 1C9MA 2AZ4A 4YQZA 2CXTA 4N8DA 1G7RA 3ECCA 4RDIA 2HV9A 2VHXA 4GC9A 5IXJA 1UDXA 1M1YB 5K51A 1C7RA 4DDMA 3WNVA 3IKTA 3OPNA 7GPBA 2NSYA 1KYYA 2EFEB 4KAFA 3L8MA 4M0UA 4LFAB 4NYMR 3SK0A 4KN9S 1GFZA 4C7JA 2A33A 4OBWA 4Z5XA 3KYCB 2VF8A 1NUUA 5EIEA 1VE1A 4ALLA 4ZQHA 3GCXA 3VDMA 1XDZA 3I39X 4ZTBA 1N1DA 4B46A 1M2OB 3EG5A 4RHCA 2NTNA 3IHWA 2P90A 3TRDA 5KKCA 1WDTA 2XMSA 5LWQA 4RMNA 5DFAA 4CVNA 1C0IA 2Q0HA 4MUKA 4ZO8A 4R01A 4BBJA 1TK2A 1OA0A 1U7ZA 2AC2A 4WIAA 5A62A 4DXAA 3ZWWA 4TTAA 4EEZA 3EOBI 4JYMA 3ZQ6A 5JAPA 2E6KA 2QD2A 2IRWA 4QOGA 4PR3A 1JEQB 3CX7A 2FUEA 5G1OA 3L1KA 3BD6A 3I5AA 3MUFA 3BKXA 5FOTA 3LOPA 4TSFA 1G7SA 2R8XA 3OLXA 3OKFA 3P9XA 1KR2A 2QVYX 2CVPA 1RYFA 3ORYA 1P29A 2QU7A 3GEMA 4PXSA 4QL3A 3N9IA 3PXUA 1SZPA 3E2PA 3FDZB 1ZIYA 1LY1A 1R4AA 3B53X 3LKBA 1ZSYA 3ONNA 4J1NA 3TSOA 3Q5GA 1Y9EA 3NAZA 4WH0A 4AYWA 2C1EA 1CY7A 4KDEA 4ZYWA 2OD2A 1S96A 3GNSA 4P0TA 4TTIA 2GVNA 3S44A 5K09A 1XAHA 1NSFA 3OLQA 1X7GA 3MWDB 2AR9A 2HHLA 1JXAA 1U6IA 2W6ZA 2V0GA 3DEHA 3QWBA 1YZKA 3K9WA 1E7MA 3UMGA 1WMFA 1HQYE 4FN4A 1I3KA 1XMSA 1EX9A 2G70A 2OCAA 2WZDA 3M4YA 3SZUA 4BMXA 1TKBA 1ZUIA 3EIWA 5ESWA 4F72A 1M2FA 2Q0XA 1X74A 4OLAA 4BDTA 2ZG6A 1NLUA 1QIMA 2LBPA 1FRZA 1SOAA 3EFEA 2C2ZA 3LXMA 4QD3A 1DAEA 3DF7A 3VV2A 5JAZA 3NBUA 3V4RA 1E9FA 2MDTA 1JQKA 4L7QA 3UCXA 3GD5A 3EXHB 4D3SA 5A5VA 3FWKA 5TRTA 3HXMA 3O6VA 3DW1X 3IIEA 3KKOA 4A2CA 4HS9A 2BY4A 4RK5A 4AZSA 1AO0A 1OCEA 4BE7B 4X1KB 3QM1A 3VVLA 2VDWB 3ZY6A 4B34A 2HIAA 2ZUSA 4IW3B 1Z4OA 3FRHA 1RACA 3WXBA 2A3RA 1APBA 2IS4A 4JLWA 1ZHHA 5L4SA 2C7GA 1ZL0A 3NV9A 3Q9UA 1L4YA 1KQ3A 1YB4A 3NNSA 3PT9A 4FE4A 4GP6A 5MN6A 1DWUA 3NW9A 4KQ2A 4OLBA 4FD2A 3U3OA 3STUA 2YDYA 2V54A 1KJ8A 3P9QA 3PG5A 4L0MA 2C4MA 3IUPA 5FUWA 4MPTA 1TQ4A 4NYIQ 3ROQA 3W77A 5JYCA 5IT9A 1HYHA 3CH7A 4RTRA 4QM7A 4NBTA 1M72A 1T5OA 2ZRPA 5ESDA 1W36D 3JWEA 4U02A 5SZJA 5FLXA 1F9EA 3HO8A 5ENDA 4B3CA 1BH2A 3BREA 1E20A 5KREA 5L3SB 1TMYA 2B5OA 4BFXA 1JHQA 3R7DA 4EYKA 4QU9A 1EA7A 4GOOD 3DV0A 3O4RA 4WCFB 4YNBA 3ZVNA 3T9BA 4AP9A 1GZ5A 2QNRA 3SVTA 3IAFA 5B1SA 4DA8A 1PGQA 4WECA 3CX3A 4MUGA 4OA8A 4AICA 2I5PO 3DVLA 4OSPA 4MITA 2DC1A 2HMSA 4TZKA 4L5CA 4BNYA 6Q21A 1NQOA 1Y1SA 4JYBA 2H5EA 3SZLA 2PX4A 1AUQA 1T9HA 4ZOBA 5CH5A 4KLZA 4MR8A 4FMBB 4UAGA 1ZZGA 4Q7EA 3RTEA 2QI9C 1S9DA 2REOA 3IB3A 3KJIA 4QLOA 5BWBA 6LDHA 1A9QA 3A4LA 4K3VA 1GRVA 4UCQA 2ODNA 1XR3A 3FGPA 3RUDA 1GP2A 1FEZA 4X5OA 5ITZA 1JG6A 4MYUA 4YR7A 4NBWA 3K70C 4TLEA 2MMCA 2C7RA 1V4BA 4QTYA 4IHKA 2OTCA 3U5ZB 4L1KA 4Z7JA 4NDNE 1X3LA 2G6BA 3D6TB 3E7DA 5KYUA 4JITA 3JZIA 1R4NA 1DBQA 1OT3A 1YGPA 2WT4A 1T5IA 2IY7A 4MV7A 4E5PA 5BN5A 2PNJA 1IRIA 2HREA 3NT4A 6ABPA 5BNFA 4BQPA 2ZSBA 3WAKA 1O9BA 2XXBA 1Z7BA 4ZVUA 4OHXA 4AO8A 3RNLA 3UH1A 1K92A 3LBYA 3CEPB 3DR3A 3D31A 1JYSA 2OBBA 2WSBA 2ZIEA 3CLVA 1LW7A 4LWZA 1OGJA 5KHAA 1QHYA 2B6HA 3STHA 3V9PA 5IFLA 1A0OA 2ODPA 4BOYA 4DR3B 1DJMA 4G63A 5LN1A 2G4LA 3H8VA 4OFZA 5BYBA 3VYRB 2VNIA 4HS4A 3SX0A 4RS4A 1LLUA 4M9XA 10MHA 1CW2B 1VOTA 2CF6A 2KJQA 2PU7A 2JIZD 1EINA 1R50A 2E21A 4HC4A 3ZNNA 4C2TA 4MB6A 3PXGA 1K0UA 1N2JA 4I6GA 2YBEA 3BERA 3AR7A 3GLSA 4L57A 1Y34E 4EF6A 5C4IA 3AKEA 3OU7A 1VL0A 2PMBA 3VU1A 1VCMA 3PC6A 4ECEA 4GM4A 2I7XA 4RH1A 1NOKA 2XMDA 2PUFA 1C8KA 4O0MA 1D7OA 4ZZIA 2VKQA 1ZISA 5A3VA 1X7YB 3HXLA 4R68A 3F6YA 4C3UA 1KKLA 2AN1A 1TO2E 2ZRCA 4MB2A 5I5GA 4G0WA 2WT9A 2C58A 2IHJA 1JEEA 4RD0A 5IBQA 4U4AA 4XCXA 3E9DA 4H7EA 3C45A 1RFLA 2XODA 3RK4A 4BKQA 2WTAA 5G0UA 2FCAA 3GROA 1KVQA 2V6GA 5AJZA 3QF4A 3UMYA 3VC2A 5AVZA 3DVQX 4W6QA 1XRQA 2E89A 2M6RA 2NXNA 4QIHA 4W5RA 3ZHZA 4QHTA 3SEQA 3AFMA 3BH7A 4DIOA 1UBKS 4A2PA 1EK1A 4ZOCA 5DNWA 2XAUA 3PNPA 3KE9A 1W36B 4KXLA 2GLUA 4HQLA 3E15A 1SWVA 1EZ4A 2AE1A 3E9EA 3PHBE 3Q7TA 2OO7A 3UYKA 1UOOA 2QROA 1Z35A 2R6R1 3OBIA 1E3EA 4I50A 4IDHA 5JXJA 1LDMA 1KAEA 4QUJA 4TN1A 2A9RA 1Y1RA 3M6WA 1VMEA 4PG4A 5C8YF 2R62A 3KJQA 1MNQA 4BLVA 1E5DA 2QJOA 3I9KA 4G0YA 4I5FA 4MHSA 5BXYA 1P75A 5BNZA 3QNMA 1T29A 3G2IA 4E09A 1WUHS 5C8YB 2BGLA 3ESRA 4I46A 3G0BA 4LQDA 4RJKA 4CTJA 1QYXA 3G9TA 1GNLA 5AK4A 5JYDA 1Z75A 4UNNA 2IYYA 5C35A 4FNGA 2HK9A 3SSAA 3OJXA 3IOMA 4X20B 1AF4A 3OQJA 4WI1A 1VRCA 3ETDA 3HYSA 3HS3A 1CZUA 1EGHA 4MYDA 4R1NA 5KYYB 5LNK1 1BVHA 2P2YA 3E82A 2YOHA 3QI2A 4TLLB 1NLFA 2VSYA 3RRYA 4Q37A 1KE2A 1S2DA 1J2JA 1IATA 3OTIA 4C6TB 5CDGA 2ZTMA 2A1UB 3HH8A 1UH5A 3A3KA 4JUBA 4AJEA 4XI9A 4Y1FA 3ZZNA 4RENA 2CLEB 3E9YA 2C92A 3QLJA 3V1UA 3GK3A 4HQOA 3HU2A 3SNHA 4RTSA 2QTBA 1M6EX 1ADBA 2M32A 3MQFA 3FMVA 3GOHA 4BCDA 3KFLA 4TS3A 2BEJA 1XQXA 3ANMA 2OGWA 1FFSA 4Q4HA 1RFGE 4D56A 1Y9JA 2O5VA 3ABZA 3FMOB 4MV5A 5BSGA 1XMIA 5C1DA 3QHPA 4ZI3A 2J5BA 3H11B 3MD0A 2ZRAA 3ZU3A 3FWNA 1IUPA 2B92A 3H1GA 2Q29A 5CXQA 5JVDA 2CD9A 1OXXK 2XYGA 3IBTA 1V16B 3AEUB 5K8JB 1U0TA 5LB4A 2IXEA 3Q6NA 4DDVA 2C7OA 3ZC3A 3ZE8A 1G60A 1JFFA 2GPAA 1JJVA 5IW8A 1HDOA 3SYNA 1M8FA 1GXSA 1KEVA 1RWNA 3P26A 5HUJA 5LPNA 1RRKA 3RKSA 1MR3F 1ONNA 1NONA 2GXUA 1U0BB 2GQ0A 5AHOA 1YBAA 4MV6A 2GVDC 4LTNA 4Q4AA 4YP1A 4ZARA 1LNSA 1DTSA 1YDHA 4FR2A 5CFQA 5IKEA 3FNIA 2R8RA 1S6YA 3L8YA 3FF4A 1EVKA 3BGIA 4NYIR 2RH5A 3BJZA 3JATA 3GAZA 3CEMA 3I9V6 4IRXA 4J16C 4IIHA 3VR6D 5JTUA 2VDNB 4YCCA 1BKYA 1UOQA 3KT6A 3R2JA 2IHZA 4YRPA 1P45A 1NM5C 3FLAA 4IWNA 3PNYA 1BGXT 1U1EA 5EQDA 3JYLA 2CDRA 2NO1A 1SIWA 4GYJA 1DOHA 4AP6A 2BFPA 5JUWA 4MS3B 3ZWAA 1DCKA 1JPUA 2A5LA 3M6IA 3RKUA 3F4LA 3HXQA 1E7QA 2B1JA 2D5LA 1SEPA 2E1PA 4L2IA 3IMKA 5AOCA 3KKQA 3VM6A 1Z7YA 5B7PA 4YDSA 3DL4A 1YRLA 2QL9A 5I7OA 3IMGA 5BORA 1LU9A 1WHTB 1BCSB 1YS9A 1Z83A 2HO5A 3VR4H 2OCPA 2RGDA 3VSAA 5HM8A 2KM1A 2V6JA 1Q1EA 1HH4A 1YZQA 4JDUA 2Z8ZA 4XDYA 3T54A 4EX7A 4WTOA 5TMPA 2IX3A 3K0EA 3LE8A 2XNCA 3M6MD 3HZZA 4D79A 1MABA 2MINB 4PAWA 3DB2A 4EECA 3B1VA 4Y2PA 5KHOC 2R60A 1T3ZA 5A3RA 1O5OA 4ZI7F 5JRDS 3C3CA 2GUGA 1X1TA 3KQYA 4BX0A 2R6DA 1ZH4A 2XUZA 4D02A 4EY4A 5EP2A 3WFZA 1IHOA 1WA5A 4FYJA 2HQBA 2DFTA 3KCNA 2Z4RA 1Q0RA 3EVGA 4ZI7B 5BUCA 4MV4A 3QJ5A 4NBSA 5IJ0A 1W6RA 2QENA 5FHRA 3D5QA 1TQ8A 1C9JA 1ZC3A 2BFBB 4IUDS 4JBLA 4JU8A 4G0UA 2ZE5A 4NJEA 1WD7A 2VYVA 5FDFA 3R3JA 1ZH6A 1E9RA 1ZY2A 1PL7A 3HWX1 4KLAA 3RHZA 4CM1A 2BR3A 4K6MA 4KFCA 1KU0A 2X0FA 4HI0E 1LBIA 1IDN1 4Y2TA 2EFCB 5FBVB 2VAVA 1FYVA 4V39A 3V4OA 4YMGA 4DOMA 2W6NA 3JQDA 5ILGA 4CIXA 3AQIA 4HAZA 5AKGA 4KR0A 2EJBA 2MSEB 2X13A 2P4SA 2QVBA 3CTMA 3CHYA 2AYYA 2WNSA 1Z5GA 1W5EA 4ICIA 1HC7A 5G3YA 4H6WA 4RGBA 3SC2B 5KI6A 2EFHB 2EJVA 4UQOA 3VTAA 5ALHA 3AUXA 4IYJA 4AZ3A 1E0KA 4QTZA 1FS6A 3DE7X 4FOTA 4TT3D 2JJYA 1JDUA 2BIFA 5LOVA 2O8DB 1X77A 5EJ6A 2JL1A 3OT5A 3AY3A 3P9ZA 3L7AA 1U3CA 1XK6A 2ORVA 3GA7A 3QIAA 3KQNA 2P3OA 4AAYA 1AK9A 1H6CA 2CDBA 4AJKA 5LYJF 2BFEB 1Q1NA 3RKRA 1KPIA 4C4XA 4V24A 3MEQA 4ZVMA 1Q1QA 2Q9BA 4R8LA 1HURA 4XUDA 3QSYA 2ADFA 1SG0A 2FLKA 2ZW9A 3G7NA 5HEKA 3WGZA 5LYJB 4H0NA 2ZBRA 1XEFA 3KKMA 3WQSB 2BSQA 1Y9AA 5TQJA 5KSZA 3THRA 3GBPA 5EJ5A 2N0SA 4J7UA 1K2VN 3F5DA 4BQQA 4M7OA 1P4HA 1AUVA 1DJPA 1INLA 2VP9A 4CM6A 2DERA 4P08A 5IJXA 1NQWA 4BNGA 1BSVA 3I9JA 2YWJA 4ZI5A 3U31A 2DBZA 2O2SA 1T8SA 2HQSA 2WZBA 4FCCA 3THWA 3CLTC 4G5FA 1R8YA 2A5FA 4LPKA 3SJCA 2QTRA 5I9IA 4Y3UA 2WHPA 5B6IA 5K8UA 4JIMA 3HCNA 5LM3A 2YTZA 3C5HA 3EZYA 3AQ4A 1FFBA 2QTNA 4MHOA 5IULC 3GP5A 3G2HA 5MGBA 1E1QD 3LXUX 4G85A 1PZFA 4UULA 4BATA 4ZQFA 1U7DA 3STYA 5AM1A 1RRVA 1T91A 3CSDA 4P35A 3MWEA 4NVRA 2P65A 5EQTA 2ZBPA 4JEIA 1WV0A 1VI2A 4HQFA 3OZTA 1C2TA 2K4MA 2J33A 4YFVA 2HLDA 3QEMA 2XT0A 2JZOA 4ERNA 3BJMA 4Q93A 4RK7A 4IIUA 5ANRB 3ANYB 3S70A 5U1PA 1GG2A 4L08A 5AVRA 4M49A 4YRZA 4B45A 1T1EA 3QXCA 4MGKR 3ZKWA 1V7QA 2H9IA 4GVPA 3MZ0A 3GQBB 2KMLA 1CUEA 2HA5A 2X7JA 3NBAA 4OP3A 3UFXB 3PFGA 2QB5A 2V3WA 4C4AA 3CX8A 1ODFA 2C96A 2J6BA 1P8AA 3UKJA 3VZBA 4H16A 5CR9A 3H2ZA 2FPPA 1W1IA 2HXYA 5FJJA 1OWNA 3NHYA 2PGDA 3Q3IA 1G4UR 5D8DA 3H6KA 5DBOA 1KKUA 1P61B 4QDXA 3ER6A 2X1HA 1KDOA 1NJFA 1A71A 4JJAA 3WWZA 3OX4A 2CZQA 4RESA 3ZDRA 4N82A 4OFBA 4ZDJA 1QK5A 3I0NA 3NV7A 1G4AE 3KXDA 3LTEA 1OZAA 4MEJA 3C48A 2D62A 2ERCA 3NATA 4MSUA 3DBRA 1OASA 1UK8A 2NO5A 3RSCA 2NNWB 1TK9A 1Q84A 1DBVO 4IIJF 2DE0X 1BHO1 4PAQA 1XCOA 1ZNZA 1QUEA 2ZWPA 1ST3A 1BWRA 1NXOA 3BWBA 3KHKA 4UPEA 1Z2DA 4UEKA 5HW0A 3IQHX 4IDCA 3ZS8A 2EJCA 3BXPA 4WEQA 2PPLA 1L8QA 2J30A 1KARA 2UDPA 4PNEA 2QN3A 5BYKA 821PA 1UFKA 1XVUA 4L4YA 2FA9A 4XLTA 3FKQA 4FFBA 5ALPA 2DUWA 3MWGA 4AP5A 3EIHA 3OIWA 1DMSA 2G0NA 1GQ2A 2FW1A 1L3CA 3USZA 2ZCJA 3JTMA 1G21A 1YTUA 2QPLA 2IXTA 5J3JA 4KGVA 3FLMA 4ZQGA 1QHGA 2OAP1 2AOWA 5F9FA 2LIVA 2X4DA 4ZCQA 2X15A 2X58A 4JJ4A 1KSFX 4J1SA 2NZVG 3KOOA 1FA9A 1UPCA 1IFXA 3I8OA 1P2FA 2NOAA 3JD2A 1PSWA 3L82B 3LQRA 3AUJB 1JHZA 3DKVA 3NOQA 4PXAA 4V38A 5AJUA 4CKCA 1NNEA 2REQB 1EFRD 3DF9A 2HA7A 1XPUA 1QIGA 2RGRA 1AO3A 4J4TA 1IUOA 1VE5A 2RKWA 4CYMA 1JDBC 2H17A 2PG3A 5DNEA 3NOXA 3R5FA 4LMPA 3N8KA 4YRQA 4LE2A 4X92A 5IEJA 2PJRA 1YHNA 3P2YA 1CDOA 1UQRA 1YB5A 4LCEA 1M83A 2NUPA 3W2FA 4GPIB 1WZ2A 1LCIA 2ZAMA 4RYDA 2BM1A 3T9EA 4LXGA 2CMGA 3MNFA 5JH7B 4US0R 1QQ6A 1G8MA 1TD9A 3KPJA 3V6LA 4ZOQI 5DN9A 1NW3A 4Y30A 1H85A 4FGZA 4GXRA 2DEUA 4D2IA 1NF9A 1W4CA 2ZJ2A 4G9BA 1Q57A 2NZJA 1JFRA 4CT5A 4KTTE 3SFTA 1U2DC 3QVLA 1T5DX 2HQOA 5CFZA 4LJ9A 2HRZA 1IPEA 4W5JA 3EUWA 4D26A 2OM6A 4WZZA 1FE8A 3VH1A 4TZ0A 4WN9B 3TBHA 1OIWA 3LIIA 1NULA 2WJYA 3LHSA 4IBOA 4R98A 2I29A 2GAJA 2O2ZA 2BFNA 4OAPA 5U4XA 3AUSA 4HAYA 4OMUA 4EY7A 3Q1LA 1P73A 1TPZA 1PWZA 3R6WA 3EASA 3KWFA 1J9ZA 4ZT6A 3VYTB 3L1HA 2N75A 3N2KB 1ISSA 4NIMA 1L4EA 2V03A 4FYYA 4MYHA 1VRVA 4OQMA 4G1UC 2QN6A 2GEJA 1IHUA 3TCXB 2XT9A 1L5SA 1W0KA 1QONA 1IXKA 1OU0A 1I14A 1SK9A 3KUCA 1GKLA 4E2ZA 1BW9A 1Z7GA 5CA1A 5ADHA 1CYDA 2FOXA 1E3LA 1BS1A 5B57C 1KBZA 2Q62A 5A4MS 5GMOA 4B9AA 4BV2A 1VL2A 2C8JA 2VDPB 1A8HA 2OBXA 1GR0A 3LLMA 3UCFA 1E2DA 1V9SA 1LLQA 2B83A 1GCOA 3GCZA 2PWPA 3W4IA 1DBIA 1EWTA 1NLMA 2OGSA 4BKPA 5BYAA 2HLHA 2WILA 2WTBA 1OLXB 2Y77A 1KNXA 4U7JA 1SELA 3RYHB 4B09A 3HG7A 3OFND 4HSEA 3Q0EA 3MCZA 4F60A 4YIKA 2DLDA 4CLEA 2GXAA 1A97A 5K0FA 4GDMA 1VI6A 1X1DA 1XTSA 2RGCA 3SC6A 1B8VA 1U80A 2C7QA 4I2NA 4LJ7A 4F06A 1JMKC 1A76A 2Z9DA 4KR2A 5SICE 5E9AA 5F2EA 2VJQA 4RVHA 3ADDA 2ZRLA 3ZCQA 3W8NA 2NADA 1ZJWA 4GOLD 1PR9A 4OHUA 1V6AA 4BPRA 3QYPA 1X15A 1Z08A 4K0RA 4REMA 3UAWA 4RF2A 3EQ7A 3RVLA 4LOJA 1WS6A 1NAIA 1ZJ4A 2JS7A 4G5HA 3ZV3A 4EDHA 2ECFA 1ZMTA 4NMLA 3E22A 4QULA 3NQ41 3EEYA 4CF5A 2QW8A 4DBLE 2GD6A 3ET4A 5HGJA 2EBHX 1FXUA 4HGOA 5AM0A 1E59A 3TOCA 3OE5A 4Q6WA 1ORTA 3TZLA 5B3JC 1EM8B 4X0EA 1WD5A 4I8IA 2X7HA 3DMGA 1C7FA 5EUCA 4I1IA 2PRKA 3D8BA 3ESXA 1SCBA 3TOSA 2ZBDA 4J0QA 1AV7A 3M6AA 5M2QA 2QYOA 1KP9A 2E2WA 3COSA 3JSXA 3N8HA 5AK0A 2XCUA 3EGCA 4MI9A 5F4BA 5FTJA 1KE1A 1NUHA 1QRSA 3CR7A 3PZRA 4OATA 5DNAA 3V8NA 4N5NA 13PKA 3BJIC 2HRRA 3DEJA 3NWBA 5BSVA 5LBIA 4DABA 1NFQA 1YCGA 5ALGA 4ZVPA 4QFDA 3ZPXA 5IF3A 1DEOA 1LVHA 2A9VA 2B61A 2Q5IA 4MUHA 5DOVA 5EMHA 4C6HA 3IC5A 4QNNA 5B5SA 2DHEA 1CQXA 2E4AA 4EPYA 2DTXA 2PGNA 4LE1A 4ON9A 1W94A 5JFOA 1PJ8A 1L7RA 5E7IA 5KYWA 2BEWA 3ZD9A 1NUSA 2MR5A 2FEWB 4KK4A 1DV1A 1ZCZA 4GLFA 2PTHA 3B85A 3EXAA 4PYNA 1A9RA 2WYWA 2A57A 2XYPA 4JSYA 3TJZA 1GRRA 4FPXA 5NULA 2FVXA 3K2QA 2RHJA 3QSGA 5TF0A 2ASEA 5AJXA 3I0MA 3V00A 3GJSA 3HXOA 4RABA 4ZYVA 1C9EA 3HDHA 3U4QA 4OU5A 4KSCA 5GADl 5EHNA 1X70A 3HR8A 4MOWA 2GWHA 1B2LA 4FEYA 4DV4B 2JRLA 1F20A 1GZ3A 1PG5A 2P0YA 1UKEA 2WUWE 3FNFA 4UUMA 4QEKA 3D4NA 4UTXA 3MT7A 3DOEA 3K16A 4MRMA 3QFCA 4GR5A 3WZLA 3DEFA 4HDSA 1BO6A 1M73E 2PEZA 3IILA 4RTJA 1OREA 1ZNXA 4CCYB 5KYKA 1EZ1A 2I4MA 4TUYA 1L8AA 5CIQA 1Z45A 2JK0A 3LAWA 3N3AC 3DOFA 4FFSA 3KVOA 4PC2A 3N7TA 2GHQA 3O8LA 2O2YA 3VC3A 2R0QC 4P80A 2ZE7A 3NYWA 3TO5A 2V3CC 1ZRMA 5I5EA 5FIUA 3EVEA 4HAXA 4F4IA 1PT6A 4RORA 4BMCA 3U7JA 5I7UA 4DJ5X 1U4NA 5LLTA 1ECLA 1E5TA 4QXAA 2FFJA 1X86B 3OEHA 3WIVA 3ZI4A 4BAUA 5JS6A 1PJ3A 4DUYB 1XVIA 4BNLA 4BNVA 4HRVA 3FIUA 4GOND 3BQMB 5SZIA 3Q4GA 3X3HA 2A0WA 4HLUA 3OE1A 5AVKA 3RRMA 3WRWA 2Q3MA 3C7KA 3TTTA 1TECE 4RA9B 2PLFA 5DM0A 1U0HC 3R3VA 4Q47A 3PEUA 5KMGA 3H18A 4DR2B 2OHHA 1GYRA 2CB9A 3FZNA 1KPGA 3NKLA 5DVZA 3VISA 4AJ4A 4ARBA 1KMQA 5C7IO 5I7WA 1DTEA 1NG9A 2HF9A 3K0CA 2F1IA 4IINA 4XQ0A 1QYCA 4EY8A 2XQFA 3FMIA 4RZQA 1O08A 1ADGA 1MW9X 1NHGA 3ZK8A 2FRVA 3EXEA 1T2FA 5M3BA 5CCDA 3HE3A 2GCEA 2VYND 4RLHA 4WD3A 4DLPA 5C9ZA 1E2BA 1V96A 2LDXA 1NDHA 3AM4A 3GG9A 1VA4A 3MGAA 4HLQB 1MEJA 3BWMA 4YUAA 3G2NA 4H3KB 4TRNA 3A1CA 4US2R 1M1NA 2NN3C 2OC9A 5BSMA 1ZNWA 3B3GA 3U7IA 2GLTA 1BMTA 1Y48E 2PX0A 3QPWA 4A16A 3ZHSA 4ZOLA 4ZMBA 3EZFA 1DUSA 3LO8A 3R41A 4H31A 4RL6A 4BRWA 4IJKA 4OG2A 4LHXA 4NTZA 4JI4B 2ZZMA 1YONA 4UMEA 5E7JA 3G7SA 2HEIA 3URMA 3A6GA 3KR2A 5JZSA 3W1VA 2FPIB 1EUDB 1MPTA 1KYZA 2P7HA 2O52A 3JRWA 3PQ3A 2JHAA 4UFNA 3ROGA 4A26A 1OTHA 4ARZA 4BB9A 2HNAA 3SZ3A 3CF6R 2I7DA 1M2WA 3CH6A 3JY6A 5MFPA 4M83A 4X71A 5E6UA 5GZ3A 4JVNA 4WN3A 5CHEA 1P17A 2PJZA 3A10A 1OW3B 2DX7A 5ECGC 1T5BA 2AKYA 4NS1A 4RV5A 4TRRA 2BHSA 2CLOB 2ID9A 2ZTUA 3UF0A 5DU2A 3HRIA 3NDIA 1R0LA 1QGYA 2HJSA 4KNYA 1CRPA 1Z6GA 2X6RA 1EDEA 3FTQA 3G5LA 3HB1A 3MB5A 2E0IA 3H0EA 3RVJA 3MFQA 4GPAA 5BQFA 4HTFA 5JD5A 1KY3A 1T1RA 4REQB 4BL5A 3O84A 3DS8A 5E1OA 2F55A 1Y3DE 3QPBA 5A5EA 4NXNB 2GCOB 3K9NA 3MF4A 1UJBA 2NVOA 4BB6A 1KK3A 1V1MB 3P9YA 4L72A 1EP1B 4UTRA 3UAXA 3DO8A 4TKZA 2GJ9A 3SR0A 3U62A 4NEHB 2X1VA 1G5QA 1MHTA 2JCBA 1H3NA 1LTHR 2J46A 2P0EA 2GCNA 1UL1X 4LVUA 2DJIA 5JMOA 3R6GA 1QWOA 4M0DA 2XNDD 1QGUB 2VA8A 4JNCA 4M53A 1OXBB 2ZM5A 2NT3A 5CVUA 1NFFA 3G1TA 3JD0A 3PTAA 3KKNA 3G85A 5BW4A 3DP7A 2F8TA 2ATXA 2YXLA 4Q1EA 1CR2A 3F1LA 2GFQA 3JQQA 3RR2A 1KTIA 4HK4A 4EH1A 4G4IA 2QYTA 4IHQA 3E9RA 3QPAA 3DFFA 3D7LA 1L4LA 3DKRA 1YH3A 4PRLA 4NSNA 4CUJA 3DYVA 3NGLA 5HGXA 3I76A 1UBNA 1NDQA 3C8ZA 1J25A 3IEUA 1AS2A 3LS2<