4ROTA

Crystal structure of esterase a from streptococcus pyogenes
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
268
structure length
268
Chain Sequence
b'NLYFQGAMASIAIEYHSVVLGMERKVNVIYPDQSEIPKKDQGDKDIPVLYLLHGMGGNENSWQKRTAIERLLRHTNLIVVMPSTDLGWYTDTAYGLNYYRALSQELPQVLAAFFPNMTQKREKTFVAGLSMGGYGAFKWALKSNRFSYAASFSGALDFSPETNLEGNLGELAYWQGVFGQFEDPDLDKHYLKNMVAESDGKTKFYAWCGYEDFLFATNEKAIADFQAQGLDIDYHKGHGKHEWYYWNQQLEVLLEWLPINYQKEERLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase A
publication title Crystal structure of esterase A from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
total genus 80
structure length 268
sequence length 268
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2014-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rotA00
4NMWA 1CQZA 2C4HA 1XFDA 4EY8A 3K9BA 2HA2A 1UK6A 2RIPA 4W9RA 1QIMA 1SCKA 1XLVA 2PL5A 1K5PA 3FLEA 1UOPA 5CBKA 2XMDA 4X94A 5CXUA 1E3QA 5CXXA 4WDRA 4B80A 5DNWA 3WZMA 5ALNA 1XZFA 5DNVA 3MUOA 2QOEA 4H18A 3FSGA 4EY4A 1BS9A 2DHDA 3AZOA 4Q1VA 3UMJA 4KAJA 1EB8A 1P0QA 1F6WA 5YASA 5D6OA 5ALFA 4P92A 4B6GA 3DNMA 3WYDA 1XZBA 3D2BA 4QEKA 4XWGA 2JGJA 5ALEA 2WG2A 2XMSA 1MN6A 4UBOA 7YASA 1XZCA 2OG1A 4BVKA 2HU7A 1XLWA 4EUSA 3I2KA 4IH9A 5F4ZA 3ZLUA 1H22A 1DWOA 3GZJA 5ALDA 1Z68A 4G9GA 1CIJA 2HIHA 3MGAA 3SX4A 3IVMA 4D9JA 1WB5A 1CLEA 3G7NA 3C45A 2BKLA 4BYMA 1TCAA 2VTVA 2AJLI 3IUQA 3KOOA 2I03A 5JAPA 1YAHA 1QO7A 4K6KA 3WWEA 5FOQA 2HHAA 3H17A 4Y2JA 1EINA 4W1SA 4BTVA 2WUGA 4BC1A 3FLBA 5ALUA 3GFFA 1CR6A 1ZOIA 1Q0RA 3AIOA 1MNQA 3FAKA 4I4CA 5JALA 3OC0A 2OPHA 5HQ3B 1XZKA 3BWXA 1H23A 2PKYX 4RGYA 3OOSA 5AKJA 3C87A 1CUDA 1A7UA 1NX9A 2OQVA 2BUAA 5A71A 1CUAA 5C7YA 3A2MA 4JNCA 2GBGA 4PSUA 2WJ4A 4X7BA 2AXEA 5A7HA 1CUSA 2XUGA 3Q8WA 2WFLB 3LIPA 3AFIA 2PSFA 5K3EA 5JADA 1ZIYA 3H2IA 3WQHA 1XRMA 2BJHA 2XMCA 3EF3A 1VE6A 4QWWA 1HBJA 2BUBA 5HF8A 5CMLA 3EIOA 5CH8A 3D3NA 3QMVA 1EDBA 3WJ1A 2I78A 3KXPA 1CUWA 4C4XA 1CRLA 2C0PA 2H7YA 3I28A 3WL5A 5D3KA 3D2CA 2ZYSA 4F60A 1FFEA 3TGLA 5ISMA 4BCDA 4ZWNA 5ALSA 1GKKA 2XMGA 5SYMA 1EXWA 2DR0A 5EIAA 2Q0XA 1QIDA 4QDUA 1QTRA 4E15A 3LP5A 4N8EA 1U8EA 5A6VA 1UK7A 1MX1A 5BWBA 3E3AA 4HVTA 1QO9A 1LGYA 2WIJA 2ZYIA 1ZIXA 2QKYA 2OCKA 4LXHA 3S8YA 1XKLA 2HDWA 1QIFA 3ICWA 3WL7A 5C8ZA 3NGMA 4W1QA 5DLPA 5FPQA 5HFNA 4FBMA 2JGLA 1DX6A 1ZI9A 3PE6A 2XUKA 3H1AA 2JBWA 3HLKA 1XRPA 4UHDA 3IULA 5AKEA 2XUPA 2XLCA 5EI5A 1ISPA 3R3VA 2YH2A 4KE8A 1EI9A 4UFOA 3I2HA 2DHCA 3HI4A 3VJMA 5K3AA 5DYYA 2R8BA 1TCCA 3AIKA 3R3UA 1QLWA 4BB0A 3UUFA 4HXGA 4E46A 3FLAA 4FHZA 3R3XA 3V1LA 3T52A 4Y2QA 1JMYA 3IBTA 5FRDA 4GDMA 4Y2XA 4QNNA 4WFKA 3D4LA 4DSAA 5K3FA 5IH7A 2GYVA 1VXOA 3C5VA 5K3FB 4Y2SA 1ZD5A 2FJ0A 3DL4A 2ACKA 5FUMA 2OCGA 2O2IA 3NOXA 3GUUA 4H7JA 2WJ3A 3IURA 5CT8A 1G5FA 1HLGA 4OU5A 1U65A 3H04A 2AJDA 1BN7A 3RLIA 4FDMA 1DT5A 3H2JA 1E8MA 1OILA 4N8SA 4C88A 3DLTA 1W4LA 1EDDA 5DWDA 4Z49A 2J4CA 1L7AA 3FCXA 1R9NA 3VKFA 3ICVA 5E4YA 1QIGA 4P93A 4BE9A 2XUAA 3QVMA 4X85A 4K5QA 1QONA 4LKOA 5JAUA 1A8UA 1SCQA 3I2GA 1WPXA 4NVRA 4YK7A 1CUJA 5AI6A 1EH5A 3R3YA 1CUGA 1W1IA 1XRQA 3QYJA 4DMFA 4MQMA 4FMPA 1TRHA 1JFRA 3WWCA 1DINA 3PUIA 1YAJA 5E4JA 3Q0TA 5KREA 1GQRA 5HF9A 3TRDA 1PFQA 5CW2A 5CT4A 2WHRA 3STVA 3H0CA 2CB9A 4X71A 3FCYA 1XZDA 3G02A 4Y2PA 1EHYA 2HM7A 5AKKA 4L72A 1THGA 2PSDA 2JEZA 3HRHA 5ALRA 1YCDA 2Y6UA 4B83A 4AMYA 4IH4A 1A8SA 1EK1A 2WIDA 2ZJFA 4MJ3A 3AZQA 3L1JA 1E5TA 5AKXA 2WU4A 4N5HX 1UOOA 2YXPX 4DIUA 1TCBA 4XX1A 2WFZA 2HFKA 1UXOA 1NU6A 4CG3A 3O9VA 3ZI7A 1MO2A 2XUHA 3OTQA 5CT9A 1BEZA 1WB4A 4LYDA 2XUIA 2VF2A 3BJMA 3S2ZA 1P0IA 4AN0A 4HXFB 3QPCA 4RNCA 1YS1X 2QJWA 1R88A 3B5EA 3STYA 3WA6A 5T4BA 2B61A 3DKKA 5C8XA 3IA2A 1LZKA 3B3QA 2NW6A 4NS4A 2WILA 5BWCA 1H2XA 5JIBA 2DCMA 1RP1A 1WHSA 5I9IA 1JMKC 2JGEA 3L1IA 2XMQA 3CXUA 1E8NA 5EIHA 1AGYA 1AUOA 2YYSA 1QIKA 1IMJA 3P2MA 5AM5A 5DYTA 1J2EA 1C7IA 1T2NA 2W22A 1N5MA 4CFSA 4AZ0A 5LIPA 4FLMA 1CV2A 4BCCA 1BEEA 3KWFA 2OGSA 5ALZA 1JKMA 4PNZA 4AO8A 1BRTA 2I3DA 1UT6A 1USWA 2UZ0A 4F21A 5AI5A 2VJDA 3CCBA 4AB1A 4TPKA 3G0DA 3WWOA 1UFOA 1QFMA 4UPDA 1UKCA 2HU5A 3GELA 5ALMA 2XQKA 1CUXA 1JU3A 1X70A 3WK5A 4FBLA 4FLEA 1TKRA 4DNOA 1UWCA 4C6HA 2DFPA 4KACA 1CEXA 5AH0A 1F8UA 4DM7A 2CJPA 1N5RA 4F5ZA 4HAIA 3DKRA 2VJAA 3PF8A 5CURA 5CH5A 3DS8A 2VATA 3LIIA 1ZGBA 4H35A 1ZJ5A 5AK5A 1QTIA 2VJCA 2XUQA 4QDXA 1BN6A 3I6MA 3H1BA 1QIEA 2HADA 5AOBA 5FP0A 3IB3A 3MVEA 3BXPA 1RYYA 1TIBA 1CUIA 4RPCA 4FOLA 4QLOA 1Q84A 2ZYRA 4Y2RA 4U2CA 1EVEA 2C58A 3RK4A 3WYNA 4I3FA 3BIXA 3G8YA 4X3CA 4OYYA 3C43A 4J0IA 3E4DA 2ZVDA 4JYPA 4BRSA 5FLKA 3EQ9A 4UFPA 3WKBA 4IQ4A 4UHFA 3ESAA 3ZWQA 2J4FA 2DHEA 1R4ZA 5ALGA 5JAOA 3FVTA 1MNAA 3D5EA 2Z5GA 2Z8XA 1YB6A 1WCYA 4YX9A 5JZBA 2ORYA 3G0IA 4BAZA 2XMZA 2PSEA 4J0JA 4G5XA 4HRXA 1A8QA 2HA7A 2RHTA 5ALQA 3LLCA 1E89A 5FPPA 1TK3A 3NUZA 3V48A 1MX9A 1KU0A 4H7IA 1YR2A 5AM0A 4J03A 4DSZA 5CTAA 4LYEA 4HZGA 2VJBA 2O7VA 4G8CA 3WKEA 5T4HA 3O4JA 5AHXA 4B85A 2QXTA 1VZ2A 1LPAB 3WJ2A 2VEOA 1CUZA 3WK9A 2B20A 5AKHA 1LPPA 1R50A 5ESRA 3STTA 5A7GA 2OQIA 4X91A 1KEZA 4G1FA 2LIPA 1QIJA 3VISA 4X6UA 3W04A 1JJIA 2G4LA 5ALXA 3C6XA 2ECFA 1CUBA 3EBLA 5JANA 4AO7A 4GXNA 3FYTA 4O08A 3IUMA 2H1IA 3R3WA 4K2AA 2XQIA 3QH4A 4KE9A 5ALHA 3WWDA 5I8PA 4X95A 1HL7A 3IDAA 3I2IA 4L9AA 1THTA 1ETHA 3WL8A 1W76A 2VT7A 5SYNA 4Q3KA 5T4FA 3FWHA 1JI3A 3F8SA 2XDWA 2OGTA 4KRYA 1VJ5A 4OUKX 4MWTA 1UKBA 4G4GA 3GBSA 3N0TA 4PV7A 1CUCA 1DT3A 4WFJA 3O4IA 4UHBA 2WTMA 5HK9A 1K63A 3WZLA 5J3JA 3BF8A 1AMNA 4DMHA 5JAHA 1JT2A 2HRQA 4BAGA 3WIOA 4AQDA 2J3DA 2QS9A 2GZSA 4AO6A 1XROA 5DNUA 2GBFA 2XUFA 1MX5A 2XUOA 3F98A 5AOAA 1UK8A 5K3DA 1K8QA 1VOTA 1VA5A 4GEGA 1DU4A 2DQYA 2ZJ6A 3C8DA 2GYUA 1CQWA 5KWJA 5AM4A 3WKAA 5JYCA 5LZ7A 5AKGA 2WG0A 5C8VA 4WY5A 2JGKA 2ZYHA 3AINA 3DJYA 1XRRA 3WMRA 1G42A 5AO9A 1NU8A 2PSJA 4X6XA 4P08A 4GBGA 4U2BA 2QM0A 5ALJA 4ZI5A 4HXEB 3HEAA 1R3DA 4Q05A 1QJ4A 4X6YA 2OLEA 4BP8A 2XQFA 3L1HA 2G63A 4RE5A 4OB7A 4OU4A 4IHAA 3PICA 3QMMA 1CPYA 4A23A 3W2TA 1AC5A 3QBJA 1FFDA 2V97A 2HRRA 2V9ZA 5LZ9A 2PPLA 1CFJA 2Z8ZA 2HA4A 4C89A 4W1RA 3DCNA 1F0NA 1WHTA 3HYSA 5LZ4A 4LIPD 1GKLA 2HA0A 2G5PA 1H2WA 1XZJA 3ESDA 1C4XA 3IUNA 1FFCA 4BDSA 4Q34A 5K3BA 3UUEA 1DQYA 1MAHA 4MXDA 5ALKA 1HKHA 1XKTA 4ZRDA 3ANSA 5DJ5A 4DMKA 4BC0A 1L7RA 4DYHA 2ROQA 3G0CA 4L3WA 4W1PA 1QIIA 5KWIA 3PFBA 4BCBA 1XRLA 2XQGA 2PX6A 2PVSA 1EX9A 3OG9A 1XZGA 1VLQA 3V1MA 2WU3A 3FYUC 3A6ZA 4W63A 3D59A 1R9MA 5LKAA 3V1KA 1XZLA 5AI4A 3F67A 4EB0A 4LHEA 5EHXA 5KBYA 2JGIA 3YASA 2RI6A 1IVYA 1CUVA 1JJBA 1XQYA 4MQLA 2FUKA 4CIAA 4X00A 3M82A 3ZPXA 5AP9A 4PF1A 2XQJA 4KEAA 4EHBA 4JEIA 1TQHA 1XZMA 5AJHA 1GZ7A 2BAGA 2BGRA 5EHQA 3SK0A 4ITVA 5LZ5A 4EZIA 1A88A 3ZLTA 1MT3A 2ES4A 3OM8A 2QTBA 1GQSA 4DNPA 5T4EA 3STUA 4WJLA 5AKYA 4J7AA 4YASA 3R40A 3VDXA 4J0KA 2IX9A 1QFSA 4CCYA 2OCLA 4CCYB 1J07A 4H77A 5AM2A 4M0FA 2JF0A 3STWA 2C7BA 4J0CA 3TJMA 1ZJ4A 3BDIA 2BFNA 3I1YA 2WUFA 1GPNA 5JD6A 4QDTA 4AMZA 1BCSA 2QXUA 3SWWA 4A5SA 3HACA 1GXSA 4EY5A 2IITA 4G4JA 1XQWA 2W6CX 1VXRA 1EDEA 5JZ9A 4UBLA 1SFRA 4ETWA 4G9EA 1VKHA 1WOMA 1OCEA 5JZSA 2WHPA 2WHPB 4GHWA 2WSLA 4UFNA 4KAFA 2CBGA 4C87A 2XB6A 1B6GA 1LBTA 4GLBA 4CG2A 1LPOA 5AI9A 4AX4A 1D07A 3QPDA 4FNGA 3O95A 3VXKA 3H2HA 2X5XA 2JIDA 5A2GA 1FFBA 3NWOA 2OAEA 2HA5A 3U0VA 5ALOA 3M3DA 4X97A 1LNSA 3E1GA 1B41A 3W9BA 5K5EA 5AM3A 4MWSA 4QDZA 3O0DA 3G0BA 2Y2UA 3VJKA 4DNFA 4GWLA 1IUOA 5AOCA 4IO0A 1DTEA 2VA9A 3ZV7A 2PU7A 4Y7DA 3O4GA 2EDAA 4HTAA 2C5GA 4EA6A 3TEJA 2O2GA 2WQZA 2XE4A 3WL6A 4QA9A 4ARAA 1ACLA 5ALIA 4DMCA 3VJLA 5D7BA 2BCEA 4JUIA 4L0CA 1LPNA 3DYVA 3WKDA 3PI6A 3HJUA 4BVJA 2WM2A 1T4MA 1X2BA 4ZREA 5FV4A 3G9UA 1N1MA 3GA7A 4UUQA 1BCRA 1DWQA 4IH1A 1SOMA 4ZGBA 2QUAA 1ZD4A 4XJVA 1LPMA 3FBWA 2AJCA 3FYUA 4K6HA 2HA6A 2ZJ7A 1EK2A 3FYUB 5IVDA 3C70A 3LS2A 1MAAA 2XMBA 4XVCA 3VVLA 1X2EA 3G9TA 5BV7A 5CT5A 4N5IX 5ALWA 5ALLA 4ZV9A 4JYMA 3CN9A 2K2QB 4LXGA 2WLSA 3AIMA 1AZWA 3JYHA 1XZAA 4QE3A 3M81A 3E0XA 1E66A 4A16A 3R0VA 4NZZA 4KR0A 5JARA 1HDEA 4ROTA 2Y6VA 3H19A 4G8DA 4CG1A 3F96A 1YA4A 4DTCA 5LLSA 1QGED 4H7EA 2XT0A 3FNBA 2H7XA 2VAXA 2EDCA 3C8HA 3I6ZA 4AXBA 4QZVA 4J0GA 5AM1A 4TVKA 4M0EA 3F9CA 5AK3A 2P8SA 1J1IA 1EA5A 2WIGA 4INZA 3DL7A 3BL8A 2Y2VA 1Q0ZA 2JGMA 1ORVA 2QRUA 4E11A 2V96A 1WPRA 4GW3A 4XIIA 3KDAA 2XI4A 5CRIA 1DWPA 4WFIA 5HZGA 4BBZA 1JJFA 5ALYA 5A62A 1I6WA 4U2DA 4BVLA 5EIEA 1N8SA 1S8OA 5K3CA 1CUFA 5EGNA 1XQVA 5LZ8A 1GPKA 4X90A 1IZ7A 4RE6A 3ANTA 5FXMA 1UOQA 4F0JA 3C6ZA 1YA8A 1LPSA 3OURA 1U2EA 1ACJA 5HCUA 1H2ZA 3G9XA 3JWEA 5LKRA 3V9AA 1W52X 4OSEA 5AIBA 3O4HA 3IIIA 3I2FA 5JD5A 1MU0A 4BATA 4Y2TA 5CH3A 3QPAA 3X3HA 4B84A 3AJAA 1LPBB 1ZD3A 4V2IA 5AKIA 3ESBA 1LLFA 2CEKA 3K2IA 5JASA 2HL6A 2DQZA 3SC2A 5AK4A 3WLAA 1O6GA 4KJXA 4OCZA 3W05A 2H7CA 1YB7A 1FFAA 2PM8A 3DD5A 1AX9A 1BU8A 1Q83A 3PUHA 2PUHA 1G66A 2OAGA 4EBBA 2AJBA 2PUJA 5HF6A 2RHWA 1AQLA 2E3JA 2AJ8A 3M83A 2ONCA 4B7ZA 2IIVA 1SC9A 3A70A 4FLFA 4FFWA 3RM3A 5IVHA 1VA4A 5LYYA 5HQ3A 2ZSIA 4PSDA 4ARBA 4OB8A 3R41A 4UHHA 2PU5A 4UBJA 1DQZA 4BDTA 2Z3WA 1QE3A 1MTZA 4YPVA 4GI1A 1K4YA 2D0DA 4C4ZA 5H3HA 3H18A 3QMWA 2C0QA 4AZ3A 3FOBA 2QT9A 2C5FA 2FJPA 1W75A 2VQ6A 5DTJA 2WUEA 2WFLA 3DDUA 3KWJA 1YASA 3AILA 4OYLA 1FJ2A 5HFAA 4MYDA 5DYWA 3O9MA 3QZUA 4GECA 1XRNA 4PO3X 3R3ZA 1W6RA 1SCIA 4J0DA 2VSQA 3I2JA 2JGFA 3EQ8A 4MEBA 2QVBA 4J0HA 2RGUA 5HK8A 2B9VA 4N8DA 4FTWA 5AICA 4BZWA 4UHEA 2H9YA 1P0MA 3EQ7A 4QWMA 5AK6A 1U4NA 4PQEA 5AIAA 4H7FA 2WJ6A 3K6KA 5FDFA 3AZPA 6YASA 4AN1A 3I1IA 4KAAA 1J06A 4S0XA 4CI9A 3ED1A 4FWBA 3RARA 4Q3OA 1F0PA 2WKWA 3C6YA 1ODTC 2ACEA 3FSGD 1ODCA 4ZV7A 4UHCA 3PFCA 2Z3ZA 1FSSA 3B12A 4CCWA 1ZI6A 3D2AA 3WK8A 4QLAA 4DGQA 5JD4A 1EB9A 5EHNA 2WIFA 4TGLA 3STXA 3N2ZB 2DSNA 2O2HA 4HS9A 1TAHA 3I6YA 3WA7A 3JW8A 4C4YA 4BZZA 2WFMA 3QITA 3FVRA 1CUHA 3HABA 2G5TA 3F97A 1XZHA 3HSSA 1IUPA 2O7RA 3KD2A 3MUNA 4WDQA 2XUJA 1LBSA 4Y2UA 4CIBA 1Y7IA 2GZRA 2QZPA 3HZOA 4EY6A 2HA3A 4OD0A 3ZLVA 4B0PA 4BE4A 1VZ3A 1UZAA 3C5WP 4PSCA 1R1DA 2R11A 5E2IA 1RWQA 1ORWA 5AI0A 4X93A 2OCIA 3BJRA 1CUUA 5ALPA 3H2KA 3DOIA 3ILSA 5AKZA 4X92A 4OB6A 4MEAA 2QR5A 2FX5A 4B81A 1KU6A 4JH0A 3LCRA 1YSCA 1ZI8A 4FKBA 3GROA 4UBMA 3ESCA 5AKLA 1Y7HA 1GT6A 5C81A 5E4TA 5IVIA 4U2GA 3WI7A 1L7QA 2OXEA 3BE8A 3QM1A 4G4IA 1HQDA 5FKJA 4Y2YA 4KYVA 2VAVA 5JATA 1XLUA 3D0KA 2XMRA 1O6FA 4B0OA 5EFZA 3AUKA 1AURA 1CUEA 3WK7A 5IKXA 3G0GA 3DYIA 4K6GA 2HFJA 4FNMA 5AI8A 1BE0A 1E8DA 2YASA 3WK6A 2GYWA 3H2GA 2JEYA 4LXIA 3BF7A 4PW0A 3BDVA 4DLNA 4KE6A 3KSRA 1BROA 4B82A 5HKBA 5CT6A 4U2EA 2WHQA 3PF9A 1PJAA 2BGNA 3W06A 1CVLA 1AKNA 5LP1A 2BUCA 5ALTA 1IUNA 2WIKA 5LZ2A 4E14A 5EHZA 2XLBA 3RKSA 4Q82A 4OPMA 4Y9SA 4UBIA 3G9ZA 1XZIA 2GBIA 2CUTA 4H0CA 3BIWA 4BP9A 1JU4A 1UK9A 2VT6A 1QZ3A 1MJ5A 2B4KA 2HU8A 5I7UA 5HKAA 1XQXA 3HC7A 4BTLA 2QUBA 3DQZA 5HF5A 4EY7A 2WG1A 2CZQA 4WCVA 4B9AA 5A7FA 2QMQA 5ALVA 1K6EA 4QDOA 2RONA 3D7RA 4FFVA 1C7JA 3OPMA 2RAUA 5DTIA 2PSHA 4UBNA 3C6BA 2J3QA 4H7KA 4P9NA 1OXMA 1DX4A 3U1TA 2CKMA 3WIBA 4MYSA 3DEAA 2D5LA 1ODSA 1H2YA 4Q3LA 4G8BA 1LZLA 2WTNA 4KRXA 1ZD2P 3W9UA 1P0PA 1WB6A 4M0MA 4B9EA 5D3ZA 2GBCA 4H7HA 1VE7A 2QJRA 3CCCA 1ZGCA 3WKCA 4J3JA 2CMFA 1QOZA 4H7DA 2V98A 1ZICA 1YS2X 1XZEA 1WM1A 4BAUA 1MPXA 3WWPA 2X8BA 3DOHA 4UBKA 2PBLA 2I3ZA 5BOVA 1EVQA 4Y2VA 2X76A 3T4UA 3VVMA 1CUYA 3WK4A 1GGVA 1GPLA 2Y1KA 1G4HA 5IVKA 3CN7A 1UKAA 3IUJA 4BRZA 4KE7A 2ZSHA 4ZXFA 2OGZA 4DNQA 1M33A 4I19A 2EEPA 1HPLA 1QIHA 4WY8A 2WUDA 4U2FA 4HRYA 3V1NA 3HXKA 4C01A 3A2LA 2XUDA 3A2NA 1IZ8A 1Y37A 3PDCA 1PV1A
chains in the Genus database with same CATH superfamily
3DDCA 1IAQA 4NMWA 3RKUA 1JXQA 2TYSB 2FZ5A 2CXOA 3MC1A 3OI7A 5KNCH 4PBRA 3K9BA 2HA2A 2RIPA 2YVQA 4RV5A 1V8ZA 5LLDA 3BMCA 2HBQA 4HUQB 1PEAA 4OQPA 4G56A 4MDYA 2JKZA 1GPJA 4G3XA 5KOJA 1IDOA 4TVSA 1CG6A 3TYXA 3KRTA 2WZBA 4MVWA 3CX4A 2R7NA 4CR6A 1A7AA 4E1VA 4LTMA 3KQHA 3URMA 1PZFA 2YHBA 1GAJA 3Q15C 2IY7A 4LJAA 4BMXA 3ER8A 2IIQA 1JT9A 3QE4A 3JQ8A 3NTQA 2FWIA 4KP7A 1SULA 3C41J 1TT5B 3ONEA 1O97D 3P27A 4HOYA 5FEMA 1U80A 2VDKB 2GZDA 1SHLA 4I4IA 2F3TA 1UMCA 1JQ5A 3HR7A 5IC6A 3WB1A 1QZZA 2PH7A 2C84A 4MS4B 3U81A 2FSIA 2YWBA 1E4VA 3CPHA 4D4HA 4URUR 4LTNA 4PAGA 2XMDA 4HVAA 4X94A 3QKRB 4CE6A 2POQX 4AJKA 2QE7D 5CXXA 1R6TA 1URPA 3B2QA 2QSZA 3TQTA 1NIPA 1U2PA 3O8OA 1E1RA 1V5FA 1KZ4A 1M34A 3G68A 3BJIC 1ETUA 3KAKA 4YDSA 2I8CA 2XGSA 3SD7A 5JTTA 6LDHA 4AP9A 5A6SB 1NXTA 3DONA 4ZDWA 4C7OB 4Q3CA 2FZWA 5BN4A 1JEEA 3C6KA 4ACBA 4CYMA 1NV9A 2WMYA 2PGAA 1KOLA 3SJAA 4BMPB 4YRQA 3LXRA 1BS9A 1Q7EA 3AZOA 4Q1VA 1IJKA 3NHBA 3QBVA 2R7LA 1FP4B 1LX6A 3QUSA 3UYKA 3L8YA 1EB8A 1I7LA 4MWEA 1F6WA 1JIKA 1LTHR 5IPFA 3BD7A 2HMVA 4WADA 3AY6A 4TYMA 5FOXA 2ERXA 3TL3A 4P92A 4JKYA 4CN8A 5ER9A 4B6GA 3TFOA 3WYDA 3ITNA 1HDZA 4XWGA 2C4UA 2JGJA 2WG2A 3B9PA 1GZSA 3LNTA 4I5FA 4TYYA 3KWLA 2AOXA 3HYLA 1M54A 2WMOB 3E0QA 3S27A 1FX0B 3BB3A 1COZA 1GHTA 1GUDA 5JS1A 3OQ1A 2JATA 3C7AA 3ELYA 3R5XA 1SA0B 5EN4A 2W2QA 4BFWA 2H2GA 3PFWO 1RMQA 4OG2A 4D44A 4QARA 1XELA 4TWAA 2D1TA 4NV1A 2A0YA 4YRCA 2OK8A 3PGXA 3KJXA 4HR7A 4NCNA 3EPKA 1NT4A 2YJNA 4MV3A 1H22A 5B58T 3GAAA 4JHLA 2GM5A 1SRQA 4GQBA 1BRMA 2OCPA 2ODNA 2HGSA 4C6TB 1Z68A 4KIUA 1ISFA 4GOMD 1CIJA 4YWHA 4QGGA 1Z4PX 1DFHA 2VVTA 5EMNA 3SX4A 5KJFA 1BHO1 1CLEA 1WB5A 2B36A 3ITEA 2FR8C 3C45A 4F85A 2HGZA 4RVCA 4KDFA 3FPJA 4Y1RA 3MTBA 4MHOA 3HA3A 3QA9A 3RRXA 1EFHA 3THOA 2QX9A 3SJUA 4N47A 1A76A 2QTLA 3SC2B 4YJ2A 2GNOA 4RWEA 2B6HA 2VJYA 3NKVA 1L7NA 3K8QA 1A4IA 3RVMA 4BVGA 4MUEA 2Q1TA 4ZALA 2P5YA 5MFZA 2M9MA 1WU8A 1VYUA 3WHKA 1ZN2A 2EBFX 3FOFC 2HHAA 1T3GA 4DZTA 4GO1A 5KQRA 3CBGA 4ZU3A 1G5PA 3GFPA 3FLBA 4WKPA 4J4BA 1W19A 1WAMA 2C96A 5NULA 4FGUA 1CR6A 4UAUA 5IDVA 3C4VA 3U7QB 2B1JA 1EWYA 3AIOA 4MLPA 1ZR4A 1GP2A 5GOTA 3LDHA 3KB6A 3T3NA 3TLGB 4L5AA 5JALA 3QIVA 2HJRA 4E2WA 1K5DA 3FROA 3OC0A 1AKEA 1P1FA 3O7WA 1EFPB 1RC1A 1DDIA 4IZIA 3SQLA 5HQ3B 3R9XB 5JYBA 3DLBA 3BWXA 3MWJA 2ZU0C 3PFIA 1H5NA 3H16A 1D1SA 3Q4GA 4RGYA 3FGNA 4C29A 4I5GA 2VS1A 3PPVA 3GQBB 4LTDA 3WGGA 4LQCA 4O4HF 3IR6A 2Z8YA 4MUXA 5DHSA 5FOTA 5FPSA 3TOSA 5U4QA 1R5JA 3TL2A 2BUAA 5BSGA 5A71A 1N9ZA 4Z4CA 1LJUA 2X2PA 1IY8A 1XMXA 3CX8A 1U0OC 4HWTA 4JNCA 4XIFA 5BYJA 2HD4A 1X7HA 3F6CA 4FEYA 1CR1A 5KX5A 2WJ4A 2FXVA 2KX7A 4XVQA 2GGSA 3J7AC 1VPDA 4D9KA 2ECQA 4C7JA 4WJZA 2WD7A 2X5NA 2AXEA 2BCGY 2C95A 1ZZEA 4PYKA 4OFZA 1UXIA 2ZZMA 3CEAA 3RABA 2PTGA 1CNEA 1W4ZA 1GUBA 2XSZD 1UBJS 1UKEA 4J6FA 4QX6A 1AQUA 3L7AA 3AXTA 3QV1A 1U90A 5GOZA 5J1TB 4Y67A 2DKOA 1ZIYA 1AK1A 3WJ7A 3H2IA 4TM8A 3WQHA 4RZQA 1Y9AA 2R7AA 4UCWA 2BJHA 2W2XA 2VDOB 1J8DA 1AV7A 1I2MA 4OIFA 4CMGA 1E3DA 1KP9A 1Z88A 4LF6B 4XGNA 1C30A 4ZI3A 2YQZA 2ZDQA 3FF4A 1YJXA 1Z2EA 4KDRA 4QWWA 5IARA 2QVCA 2JFGA 1SXJD 1U0LA 4UUBA 5E1DA 2HN9A 1TO2E 2QTZA 3NASA 3AW9A 4KFUA 1YU6A 1Z4NA 2HZBA 3EJWA 4GZLA 4OI4A 1JLSA 2C8JA 3F9RA 5C0OE 1YL6A 1JDBB 2N9UA 2I4NA 1RWOA 4AKEA 1KARA 3L4KA 2H59A 3L7KA 5HTKA 2ZT8A 2PXCA 3GAFA 1G3UA 2ZTUA 3H8WA 3HVIA 4XOIA 1YZGA 3REFA 9LDBA 2E85A 3EDMA 1O97C 1XPRA 3AUFA 1NC3A 1JG7A 4QUGA 3T1NA 1CUWA 2ZYTX 3HH8A 3UV7A 1QYVA 2PRYA 3U44A 2IEGA 2NTEA 3CTPA 3IIJA 1NJ2A 4Q9LA 4K9KA 3TDNA 4NFLA 3UV3A 1RWMA 2B92A 1Y5RA 3MK31 2OHFA 3NI2A 4OJTA 4L2IA 1B73A 1Z5VA 2DSTA 4WK0B 4ZQEA 2C20A 1QCDA 3GW8A 4P0PB 2MOKA 1D2MA 1CY8A 1W47A 5D3KA 1GGJA 2Y1WA 3H3JA 1K6IA 1A0OA 3D2CA 4RDHA 2P2NA 5DGHA 1G20B 1V3TA 2MYNA 2IBMA 4F60A 3H3FA 1FFEA 5E8JA 1FNBA 1GUYA 1Z36A 3V4OA 3NANA 2K6GA 1E98A 4EYGA 2Y0BA 2B21A 4HXYA 3TGLA 1PCXA 4BCDA 1ECPA 2JNWA 2QTTA 3KYJB 3SBDA 1U0FA 2CKDA 1KK3A 1OLOA 2AHOA 2ZKLA 2PGJA 1SNYA 1EXWA 3NHWA 4I46A 1C81A 2HSGA 2K2WA 5CB4B 1QIDA 1G5QA 3MT7A 4E15A 2D2FA 5LR6A 3EZ7A 3FDZB 1USVA 1ONSA 1RI5A 3NEPX 5I7FA 1P7PA 1U8EA 4A0HA 4YR7A 5A6VA 1UK7A 4PS0A 4NZMA 2AI2A 2G4CA 1B0UA 2A78A 1DB3A 4M9SA 1TVMA 3EVTA 3TW8B 4KR2A 3ZHQA 4TWZA 2IPXA 1EE2A 4Y30A 2ZB2A 1U7OA 1SQ5A 4IDNA 4M8LA 1U7UA 2BZSA 3N75A 3B5IA 4TLMB 4H7PA 1YL7A 3S8YA 1U2SA 3L0SA 3GQVA 4DMMA 1U2QA 3K94A 1D6NA 1G18A 1QIFA 4O0MA 1W2HA 4BGIA 3A9WA 4Q1DA 3WL7A 1RT9A 4XARA 5BR8B 2HMTA 3GXOA 1MC1A 3KB1A 3MAAC 4WOPA 2ZYDA 3NGMA 3IEUA 1TMOA 4FFBA 3LUHA 2EBHX 1OI3A 4AWXA 2GSDA 1RM0A 4EG0A 1IHYA 1Y0BA 2BE7A 1LDMA 2ZRHA 3A3KA 3JD0A 2A9KA 4PRLA 3UXHA 4XPZA 4JC5A 2JGLA 1RD4A 4KL8S 4B75A 1BAPA 4WESA 3VHQA 5LYJA 5TJ9A 4JOQA 5FHRA 5KYYA 4C78A 2O59A 2VF7A 3IQFA 2VJQA 3ZU5A 5JCJA 5EEGA 4CTMA 5KYVA 3T5TA 2XHZA 4O4IF 4Q4HA 5EMLA 2JBWA 5AVWA 2A1UA 1T8UA 3GB9A 4J2OA 1XRPA 2PGIA 4BRWA 1H5QA 3VHRA 3EQ6A 3IULA 4FHFA 4W4TA 5C1IA 3OUTA 3H7IA 5M3BA 3VR4H 5HPYB 1WMEA 1GY8A 1Z75A 1ISPA 2Q5FA 3ILVA 3WGHA 2PS0A 4Z3KA 3R3VA 3QQ5A 4MGHA 1SKUA 4XSGA 1EI9A 5DSXA 3U17A 3IUBA 3SSMA 3PUKA 2FPLA 3K05A 1YV9A 2R5FA 3U9TA 4MIYA 4HDKA 4ZI7F 4W9MC 3GLVA 2HJHA 1TM5E 3D6VA 5K3AA 4D26A 1UXGA 1SOAA 2XHEA 3JQBC 1XCGB 1Q7BA 4Q3DA 4WLFA 1RVV1 3KOUA 1QLWA 1GFIA 3R3UA 3PKIA 1T0BA 4JB2A 4BB0A 4UQLA 2ORED 3S2EA 3PUWA 1X8KA 2W11A 9GPBA 4LXXA 3EN0A 4EO4A 3CINA 1ZJYA 2XDYA 1ZL2A 3ZJYA 1KVQA 3OSUA 4DDVA 3BUSA 1QGYA 3T52A 3TSOA 3V1LA 2W4IA 4RNDB 4EVRA 4C5BA 4QNNA 4PYOA 3D7MA 4LBZA 5CYFA 3FUXA 3IIEA 4LNAA 4Q1EA 3N07A 4FE3A 5K3FA 3SSAA 3OCUA 3TECE 1WZ2A 1PQWA 2HHHB 1IBCA 5DM1A 2OAP1 3HU1A 1YZUA 1ZD5A 2FJ0A 3PGKA 4G41A 3PQ6A 1Z0KA 4I0WB 5DNYB 3U7FB 1GILA 1KYTA 2POCA 3AQIA 4HBZA 4IV5A 3WQRA 4P0QB 1U63A 1N2SA 3CR3C 1RLMA 2HRBA 4MUKA 1NN1A 2OCGA 4I6GA 1U2GC 4PZCA 3T9BA 1S2NA 5FPHA 3NOXA 3W6UA 1IWPB 3E9MA 1U3VA 1S02A 2ZIGA 1Q15A 2NXEA 3INYA 5AVUA 4NAHA 1G5FA 3G5MA 4R2JA 3X1XA 6AT1A 1YS6A 4CTOA 3H04A 2AJDA 1BN7A 1NONA 1WMAA 3B1VA 3D8TA 3H2JA 3RLIA 4AIIA 4YCLA 4ARSA 4N8SA 1WU7A 4C88A 5D7NA 4IS3A 4AM8A 4R71A 3C14C 3O1LA 1P2FA 1W4LA 4PANA 3QIAA 4E5NA 3NMUF 4Q1BA 5BOSA 2PGDA 3L6UA 5DP2A 2J4CA 4NU8X 4CMEC 5IAGA 1H4QA 4S1OA 1L7AA 4IFIA 4JSTA 2WWIA 3VKFA 3KZVA 1H9AA 5FF9A 2MINB 3TSAA 3ICVA 5KSZA 2DULA 4K6MA 1N1DA 2EFEB 2NXWA 1WXGA 2DLNA 4F12A 1AY0A 1NUHA 3MBKA 4KIGA 2C1EA 5LYJF 4J07A 4FOTA 4EQ6A 5BR4A 5HGXA 2AE1A 5JUWA 3BQ9A 4GX2A 1SXJC 3CG4A 1BVRA 3MOIA 5H8WA 4POOA 3BXXA 5EVCA 2JVIA 1OFVA 3RSSA 2XBLA 3THYA 1G55A 4K46A 4AULA 4XB2A 3ZNNA 4ZO7A 1ECBA 2IPNA 1CJSA 1SCQA 1UBTS 2VBCA 4KYUA 3I73A 4MLDA 5DGCA 4D0RA 4LV5B 5TLSA 4PCAA 4D9HA 4MQFA 2AW5A 1OMOA 1W1IA 1ULZA 2GN2A 4TSFA 2GH1A 2FPGB 3QYJA 4DMFA 4MIEA 4DRXB 3NHRA 2GAOA 4OQYA 4ZYYA 1CZUA 3N8GA 1KHTA 1PK9A 2R85A 4R2HA 2N46A 2FQQA 3CPEA 3EXIB 3U7IA 1WKCA 3R6LA 2JS7A 1OT5A 3WRVA 1DINA 4TVOA 4OHZA 1NM5A 4RFSA 3PUIA 1YAJA 3L04A 5E4JA 3BL6A 4K88A 4RGQA 3ER6A 2ZIFA 3ZXYA 5DNEA 4B4DA 1R74A 4DW8A 4GU5A 3WQBA 4B4VA 2OZEA 1AHNA 1E6WA 3GRPA 3TRDA 3E22B 3A8TA 4BNKA 2QX4A 5DHQA 5AW8A 1DHTA 4UMDA 2WHRA 3STVA 3TLMA 5JH7F 1POWA 3BBLA 3GFGA 4YHHB 1XZDA 4PEVA 1AKUA 3RVLA 1IXZA 1RPJA 1C80A 1ZUD1 3PKZA 4P4SA 5AKKA 2YKGA 2WJYA 1THGA 3GT3A 1TPZA 2OC9A 1TZMA 3VV3A 2PSDA 3I62A 1EA7A 1XMSA 2B6NA 3IJRA 2JEZA 4TTQA 2KBEA 1QK4A 1X80B 1JQLB 4BIMA 4RTPA 3R5JA 2ADFA 1YCDA 2PUDA 1IZYA 4CQLA 3NM5A 4CF4A 2C2HA 4AMYA 1GSOA 1ZSNA 3LVFO 1M5UA 5EUCA 2XF8A 4KODA 5AVQA 1A8SA 4HQRA 2OFOA 2VT2A 4QBTA 4TRMA 2RHCA 4XD7D 4HEA6 5E95A 3MQFA 5HWSA 2PWAA 1WLYA 3LVRE 4WCFA 4K9LA 5HQJA 1SHZA 2OWEA 1MFPA 1PR1A 1RYEA 1E9CA 3CEPB 4KIWA 4X1IA 1MIOB 2A4MA 2ZFUA 3TX2A 2ON6A 3L1JA 4NQRA 4WERA 3I5AA 3G2IA 4DJEC 4EUKA 5HZMA 3G82C 4KQWA 3V9PA 1LVUA 3RYFB 3RUPA 5HKKD 3QP9A 2JFUA 5DXJA 3TH5A 1ECJA 3LDUA 1L1FA 5AJUA 3SC6A 2BFOA 5DOZA 2A9OA 4F4IA 1W5AA 3HP7A 3GRFA 1OZHA 2HFKA 4QJ3A 2JFOA 2HK9A 1PR4A 1S0UA 3MMNA 4P34A 2BEJA 4JXZA 4IKEA 1YBVA 3L77A 1BEZA 5CT9A 3ELBA 1U9IC 1GNQA 3TXAA 5FV7A 3UB4A 3AKDA 2BWJA 2NUTA 4TN1A 3BJMA 4HGNA 3B70A 4Q3NA 5BV2P 5KUTA 1USGA 2NT4A 4URZR 1B26A 4YT4A 4G23A 5TC4A 2CZCA 4NZYA 4RNCA 4OFWA 3LM8A 4A4DA 1S8FA 5C2JB 3ET4A 1XHEA 3L41A 2Q07A 3ZHCA 2UUBB 4II3A 5K3OA 1R88A 3OZUA 4HZUB 1I01A 2EKBA 3B5EA 1D2GA 3TG8A 1TJ3A 3DKKA 1IXYA 2O57A 1Y1TA 3WBBA 4U02A 1RCUA 3CX7A 3IA2A 1FYDA 5EWJA 2J3JA 1LZKA 3B3QA 3JYNA 3OCWA 4OYRA 1AB5A 3A1VA 3BPSA 5F77A 2GUWA 4NS4A 3VH4A 1OKKD 4C0HA 4DUPA 1ZGZA 4HDNA 5JIBA 1JLLB 3SIXA 1G21A 4Y1GA 3V8MA 1R5NA 3N8IA 2PJDA 3DV9A 4BN5A 1WHSA 1DMRA 3SZUA 3DZIA 3COYA 4RA9A 4PO8A 1EU1A 1B3RA 1G7CA 2IODA 3AUAA 5DTEA 3QNUA 4BBAA 5LA6B 2F64A 5J40A 3W5SA 2XMQA 2SKCA 1P6UA 3EVGA 4WNAB 3FOWA 4LF5B 4R9UC 4WBNF 5EIHA 3SS8A 1RC8A 1AGYA 1PW7A 2HSWA 4CLOA 1NTRA 4QPNA 1EYZA 1O6ZA 3R5TA 5DFAA 5GJVC 4INPA 1YZVA 1A2QA 4LSZA 4MJ7A 4GI5A 4TN5A 1ZP6A 2MT9A 5AM5A 4MV9A 2QTGA 4CG1A 2W22A 3KSAC 1DX9A 5C18A 3JD2A 2Q7XA 2BR5A 3LO5A 4YFVA 3VOSA 1I4DD 4CMCA 3WGUA 1H2EA 1X0XA 5P21A 4PNZA 4AO8A 4CCAA 4FB4A 1N25A 1QJCA 5HMMA 2VQFB 1QNFA 3WIVA 2UZ0A 3W1WA 4GWGA 1MRNA 2P2GA 3EGWA 3REQB 3HLYA 2V7GA 4HDSB 1V11B 2FFBA 3EZNA 5EYPB 1VLMA 1RWNA 2XWPA 2ONYA 4F2GA 1G64A 1XAGA 5SZIA 2RGWA 2AYXA 1UKCA 3AWIA 2HU5A 3A0RB 1JDSA 4FNOA 4GWKA 3ZIDA 1N6IA 1V5EA 1YQ9A 3RWMB 5LB2A 4F6RA 5ALMA 3SE7A 1RJ9B 2XQKA 1ADGA 1JU3A 4JA2A 3OHMA 5DBOA 5HGJA 2XZOA 1NSTA 1M1ZA 2IKSA 2NTVA 4U6QA 2DPXA 1GN9A 1TKRA 4HX2A 1C4KA 4OBXA 4OKIA 4HDCA 1QKIA 4YGXB 3VAZA 4FGSA 3BFXA 5FLXA 4G63A 4IOMA 1JJ7A 2H1HA 2I7TA 2MWMA 2V4MA 1C3OB 3PUXA 4KACA 1RQRA 4E12A 1CEXA 1RYMA 1A5TA 1ISGA 1PZXA 1JVNA 3R7AA 1F8UA 1SK8A 1Z13A 5KJ1A 3DVSX 4DA0A 1DIAA 1EEHA 2ZYVX 3CF2A 5F3RA 1VGVA 2CJPA 5JJLA 4HNAB 4GR9A 4BWFB 3DF9A 5CLQA 4QYIB 2EQBA 2WVGA 4MW7A 1Q0QA 1XEXA 5CURA 1E6EA 5CH5A 1W36C 1YCHA 3DS8A 1QGOA 3HDVA 3AGQA 2N0SA 4H6VA 1TA9A 5JBQA 2K7FA 1O87A 1LDEA 1Q1QA 1S8AA 1L5HB 2FN3A 1BW9A 1IIBA 3NAZA 4CLRA 5JZVA 4XIJA 2FUEA 3IHLA 1E1YA 1I94B 2IH4A 4LUCA 4GOKA 3KJFA 1QTIA 3W4JA 1R37A 2VJCA 1XCPA 3OWHA 4FGWA 4JLSA 4O1MA 3Q3VA 3I6BA 3UWDA 2JLYA 3L1KA 2PJRA 1L7EA 1E1CA 1NLZA 3B1JA 4I55F 1T9GR 2PV7A 2W83A 1JF8A 5B1DA 3RU9A 2PUBA 1R16A 1SZPA 2F7SA 2SKEA 4Y18A 3NGXA 4QEZA 3AF0A 4TXLA 3PZBA 1K75A 5FYQA 1CULC 2I65A 4AMUA 3ODGA 6REQA 2GPAA 4GXQA 1NVDA 3LTNC 3MVEA 2NNWB 3BXPA 4IJWA 3RVBA 4G86A 5JC8A 3L7LA 2OMEA 2ZWOA 1A8HA 5CFRA 2XNSA 2G71A 3JQAD 5JLAA 1IBMB 1Q84A 2GCIA 2ZYRA 1MT0A 3BA1A 3HY3A 2DPMA 3E03A 4Y2RA 4YMIA 4DLUA 2XTJA 4L5BA 4JL5A 3LRXA 4XQCA 3PPIA 3T3IA 3PDIB 1DGQA 2JHCA 2BP7B 1WLSA 2VSOA 3QK7A 4US0R 5CLIA 1RACA 2WB2A 3TQHA 2FMXA 1V25A 5ESWA 4XYBA 1X1QA 3EGOA 1CZNA 3AI7A 3D6FA 3UHJA 3IC5A 4M7WA 2PZLA 1M6NA 1U2DC 3EZFA 3QFCA 4WUVA 3G8YA 5TPZD 5I01A 2FRDA 5IMSA 3VOBA 1UC9A 2JI9A 3G49A 3WIUA 4EMSA 3RC8A 3UJ9A 5JG7A 4L4SA 3T1VA 3EXHC 4J0IA 1AUQA 1JQEA 1Z08A 3VNSA 1NMXA 1JYFA 2YN4A 4JYPA 3WGYA 1VLHA 4EW6A 4QUBA 2DPGA 3I61A 5J5AA 3OF5A 5FLKA 1HK7A 2QROA 4E7OA 1P1BA 2FETA 4OH7A 3V33A 1Z2PX 2REQB 1DKRA 2REXB 4UFPA 1P17A 2ZUVA 3BRWD 4WY2A 4J16C 1PR6A 3WKBA 5FAKA 1N0VC 4HGOA 4UHFA 5T7BA 4KBGA 2ZYGA 1I4OA 1L5OA 1R4ZA 2I3GA 2WDPA 3EE6A 3AMVA 4F97A 3U19A 4EATA 3OP4A 1CS0A 1A77A 2Z3VA 1X14A 4UXHA 1AXGA 4HB3A 3JQ7B 1ZVMA 1N9KA 5EKSA 3OT4A 1P2DA 1UF9A 1GTRA 2HWKA 5EJIA 5BNZA 2WQ6A 3A4LA 4GP9A 5H02A 2WWYA 4X3OA 4OXRA 3CNOA 2WSBA 2ALJA 4CDRA 2GFHA 4DLSA 3VR5A 4TL7A 2ORYA 2YZNA 1XX6A 3G0IA 3G85A 3KV1A 2XMZA 3SHOA 5A1TA 1BC5A 1T25A 1SHTX 4J0JA 1Z37A 3RTAA 4EB8A 4P3PA 3GLGE 2X2EA 3EMDA 3R5FA 3UT0A 1UCFA 2Z6AA 2O05A 4HRXA 5KYGA 1T9HA 2RHTA 4R98A 4M36A 4RHEA 4B4WA 1IXRC 1HE4A 2IEAA 5CFZA 5AVYA 5K4HA 3A6JA 1U8ZA 4NONA 1UDWA 1T4CA 4PZ0A 4E3WA 1K97A 2XAAA 3KQVA 3A1TA 2AI3A 2AS0A 3JR7A 3NOQA 3QKSA 4KMOA 4MCHA 4L8WB 1UAGA 3O21A 1FQOA 3V48A 1YB5A 1SVUA 3P20A 4R8RA 1YR2A 4G85A 1VHQA 4H3KB 1RKBA 3EDOA 3KL2A 5IULC 3QE3A 2JLVA 4E6PA 4MW1A 1N0UA 4DSZA 4DT1B 4LYEA 3A1CA 1LBHA 1WULS 4UMFA 3TB6A 4R3UC 3ZY3A 4LRYA 4GMDA 3WKEA 5T4HA 4N12A 1ENYA 2GD0A 3HKDA 2ZSFA 3O4JA 3SJZA 4B85A 3TB4A 4X7PA 4BZXA 2BGIA 3U5TA 3ELDA 5M5BA 4DCPA 2QDKA 4OREX 1QYIA 3O8QB 1ISSA 1YS7A 4L3VA 2AG1A 4DB4A 2FPUA 2D1RA 1LPAB 1NRIA 3WJ2A 4D45A 1CUZA 2VXCA 2QAGC 2B20A 4L7QA 1LPPA 2EYUA 2P6PA 3QLVA 4LAFA 4XKJA 1FYEA 4OM8A 1NJ6A 3HFSA 3W5BA 4KTTE 3O2NA 1E2FA 1NA5A 1SOUA 3L0IB 1NX6A 3NH9A 4GLOA 3STTA 2ZLBA 4R8SA 2O1XA 3BFPA 4MB2A 5B3KA 3O5AA 2C5SA 3HVJA 4KLZA 3IILA 1KEZA 3ZI0A 5KC9A 2LIPA 1EFVB 1QIJA 3IAS6 3LXUX 1T34A 4DR4B 1MGPA 2FG7C 1FTQA 3LDFA 3JRNA 4ICIA 3WNVA 5IDQA 1XDBA 5H83A 2WT4A 2NP6A 2ECFA 2ZXUA 2VHXA 4HRVA 3SLGA 1JRLA 1P75A 1NYRA 5IDXA 3EVEA 4AROA 2FPRA 3SIRA 3RG8A 4B47A 4DC9A 4OQQA 4D9IA 4YJ2F 2HMAA 2QYOA 2AFIE 1OYOA 4OUDB 4M0CA 1X1EA 5GIOE 2VSFA 3FKQA 4X95A 3OX3A 2DKFA 2HJGA 1R2QA 3LBFA 3N70A 3IUYA 1RAEA 3BAFA 4C0SA 2OHOA 4YB8A 1G9XA 9ATCA 4Q3AA 2NZUG 3IDAA 4C0WA 1C3JA 3I2IA 4DLLA 3T3OA 2PUTA 2QX6A 1I4WA 5FUBA 1THTA 2QR3A 5DVZA 5GJCA 5KWEA 3UK6A 1W76A 2SNIE 4M9RA 1AZSC 2YWXA 1RXWA 3OUUA 1R27A 2V65A 2WF6A 4Q3KA 1JHAA 2VSNA 2YFYA 5T4FA 3RS0A 1RYZA 2OMKA 3ZTYA 4EGQA 5JNTA 2XDWA 1MUUA 3FE2A 3MCZA 4G0YA 1Q1NA 4OAOA 4TLBA 3ZU2A 3CB4A 4L0QA 5ES4B 1OBOA 1G5HA 2D1FA 1ST2A 3M3PA 4NG4A 3C3BA 4MWDA 3E9EA 4G89A 2G25A 4PC6A 4F11A 1ZXLA 3ETGA 3GBSA 5BUSA 3DDHA 2B3DA 2HK8A 4KO3S 3FNGA 2A9JA 3N0TA 1YB4A 3OE7A 4HK4A 4HO1X 6NULA 4H17A 1KSJA 4RACA 2W93A 3LGSA 4WFJA 3K72B 5AW4A 4C2UA 2WTMA 1QHFA 1V39A 2P62A 5HK9A 2GETA 3DE0X 1K63A 3O9ZA 2QV0A 3B20A 4QSHA 4GYKA 5D8DA 4YXFA 3SXUB 1I2AA 3H5NA 5J3JA 3DV2A 1XXHE 2V45A 1GM5A 4U7WA 3BF8A 3DAGA 1BVHA 5CYGA 4WUTA 1ZMOA 3VNQA 3JAMA 4KQIA 1CJKC 3AV3A 4MYTA 4NNPA 4CUZA 1Z4JA 5KX5F 4DLPA 2Q9UA 4ZZ2A 4P31A 2QMOA 3L0DA 1YQQA 2QS9A 4A6EA 4E32A 1C8BA 2FUG1 2OILA 2CDNA 3HHEA 1QVZA 2GVZC 3T7TA 3V8BA 1J8VA 1G0OA 4MKRA 5I7WA 2ZE5A 2XUOA 3RO7A 5FWNA 2GFIA 5AOAA 2J41A 3G7UA 1BDBA 1H1LA 4QRHA 3ND7A 4BO3A 2BKUA 4Q02A 4BO8A 3Q10A 2LTAA 3LC1O 3SQMA 2PBZA 1KWKA 3K0EA 3BXEA 1K8QA 3D31A 1O0SA 3PVCA 3JQQA 3O6VA 1N2CA 2A9VA 4DR3B 2IEYA 2QTCA 1KI3A 2H6EA 4TMXA 1WPGA 1DU4A 2DQ4A 4Q48A 2I34A 1O5TA 3RBVA 1LH0A 3COSA 3C8DA 3KNZA 1GIAA 5KJ6A 5KYUB 4BQPA 2EQ5A 2P1ZA 3EC2A 3P0EA 2Q1XA 4DV5B 5K0SA 1B43A 1SKAA 4R5MA 1Z4IA 4EENA 3RAJA 3OWXA 5L3VA 5L53A 4W5OA 1WUKS 5TR9A 5C8VA 3GRYA 5IT0A 2GZ3A 3K9NA 2AC4A 4MQ6A 2B30A 5CD9A 1HX7A 2ZYHA 2UVQA 4LXYA 2I7XA 1NQAO 3AINA 1IBKB 3DJYA 1H2HA 1HT3A 1XRRA 3L8FA 3QKWA 3LGAA 4MW4A 3WMRA 3DVAA 4YP0A 1WD5A 2XNJA 3IAHA 4MVJM 3LQKA 5AO9A 3HXPA 1NU8A 5AXAA 1CDOA 4KZKA 3KD3A 3BK2A 2OZLB 4X6XA 4F93B 3DCJA 4GPAA 2H07A 2ZROA 2QP4A 2RGXA 4GBGA 4FD2A 2QM0A 4RSMA 5IYZB 2EJWA 1D8AA 4M38A 1NUSA 1Z0UA 2FV8A 1P7YA 4JR1A 1QJ4A 2ERCA 1L4HA 2WMDA 2OHGA 3CUYA 4OA8A 2Q49A 3PFFA 4BP8A 1ZJWA 2DH6A 1RRPA 3HP1A 3U40A 4MP6A 4WTOA 5C34B 3MUEA 3B9QA 4OB7A 1DCFA 1L5FA 2NXNA 1JXAA 4OU4A 4DJ5X 4Z3OA 1GZ5A 3QMMA 1XEAA 4A92A 1I6KA 3DZKA 2QUJA 3VPHA 3W2TA 2AZDA 4TKUB 4UTOA 1WBBA 1DEOA 1LDNA 2OV6A 1F8GA 1H42A 3HA7A 1K3UB 2PPLA 3DO6A 5LZ9A 2P9HA 2ZCUA 2VLBA 2XZDA 3E1KA 3HXMA 2A3RA 4AYWA 1DRJA 2GEJA 3KOMA 1ILWA 1RAIA 3UK7A 4NZ9A 3Q2IA 1I30A 2NU9B 2IHNA 4F2PA 2XA2A 4DC0A 1HQKA 2AMLA 1WHTA 4TTIA 2BLLA 2FMKA 4DA8A 2B82A 2XT9A 4QPCA 3GDOA 5LZ4A 2PO7A 4DR7B 2Q4RA 2WABA 1PI3A 2DETA 4RANA 3GIWA 3UZUA 1EAYA 1XTKA 3IUNA 1X7WB 2YRFA 1X86B 1UDBA 3VQTA 4Q34A 3A7DA 2O2XA 4FD3A 3QELB 4DY6A 1ZS9A 1LCIA 2EFGA 4WJKB 2I6GA 2OUKA 2G1AA 5DSZA 3HB1A 1SXHA 1NI5A 2AA3A 3AEZA 4HZIA 1HZZC 1J8YF 1KH3A 4G2TA 1P45A 3NATA 3QOFA 1FFWA 2E4YA 3EPJA 2VQEB 1HF3A 1LK7A 4CV3A 1T6ZA 1TZJA 1VL1A 1WXIA 2IHZA 3R2JA 4WWHA 5FNVA 1FJHA 4DARA 1C5KA 3HZZA 4PC3A 2Q7DA 5AVVA 1OASA 1U28A 3FWYA 5B4VA 1U6KA 1GADO 1BKSB 3DM5A 4JODA 1M8KA 2E5WA 5JTUA 1IVSA 5G0VA 3NP9A 2Z98A 3JQ9A 4BCBA 3CLSD 1FVFA 1T43A 1N2EA 4TMTA 3B8EA 2PVSA 4HGRA 4LOLA 1F6BA 2JJ8A 4ASUA 1UJ6A 3HXLA 2X5JO 3JAWB 1OZGA 3QFFA 4XLZA 3KQSA 4DLRA 4PZ9A 2CT8A 3AM1A 4GLLA 3VC7A 1GAWA 2O0MA 4RCYA 2C8KA 4OK5A 2EL9A 4LJ5A 4YWJA 4W5TA 3RNLA 3A6ZA 4XIYA 3RC2A 2XZLA 1K8XB 1V7PC 2CHEA 2VZEA 3PNVA 4QT0A 3U80A 1KDVA 5LKAA 1JWBB 1R9MA 4KXNA 5C5EA 4YCMA 1EIZA 1Y8RA 2ODWA 1N57A 1XZLA 2XJ9A 3CSSA 4KKXB 4L5CA 3PXAA 2RGYA 2WZCA 2ZIUB 3K09A 4LHEA 5DULA 2ZSAA 3L05A 1TI7A 5IK2D 3ESYA 4TV9B 4HNVA 2BGUA 4UJ5A 1HKUA 2BTQB 4WA8A 4BMZA 3H65A 5IAEA 2C03A 3BTVA 1XXLA 2QQEA 2RGBA 2XNHA 2ZYAA 1JLRA 2ZS8A 3MMPA 2X9VA 4QFMA 2RKOA 1JJBA 2WINI 3MWDA 1XQYA 4UTXA 4YJ3B 1AGNA 3DSRA 1NP3A 3I39X 5JDIA 4FR0A 1AHPA 3AUTA 1PGOA 2I55A 2BZGA 5BQFA 2ECPA 5DBIA 5K3SA 3M82A 2ZUCA 4LHYA 3RUAA 4H6XA 2BFEB 1UIRA 3HWWA 3PGVA 4PF1A 4AZTA 4ZCPA 2D2EA 3LPCA 3GLFE 3V4FA 3A1NA 4RIEA 5D85A 4YRKA 3A58B 4KEAA 1H0HA 1E2GA 1WR8A 4JEIA 4NMHA 1MVNA 3KPYA 2GNAA 1L5VA 4L57A 3ORRA 3NO4A 2XNKA 1PL8A 4LE1A 4FBGA 1QP7A 4HH0A 4QU8A 4TS3A 4NBKA 4LYGA 1ZQ1A 3O3OB 3NKLA 4N0MA 4B4UA 1A9PA 1WXEA 2A86A 2BHNA 2D2IA 3H9QA 3L40A 5EP2A 1PLKA 4ITVA 1B7GO 4F3KA 5H68A 4C4SA 1N3LA 4HGPA 4TZTA 2GPSA 1MT3A 2OBBA 5EZSA 2ZRMA 4F3YA 3LWZA 5IXYA 5FPTA 4GYWA 4RPLA 4A10A 2QNRA 3FF1A 5ERGB 1IXSB 3ORFA 4O4LB 4X1YB 5DW3A 3WGMA 2QTBA 3BD9A 3R7LA 5BUCA 3K2EA 5JV5A 2OV1A 4WJLA 1D03A 4YCAA 1ZBDA 1VFPA 1ZMBA 2FMFA 3NIDB 4YASA 3KUKA 3VBEA 5EY5B 4ZZ0A 2GFQA 3R40A 4DMUB 3WFIA 4E4YA 5EE0A 4J0KA 2IX9A 5IWCA 4WA7A 5K6RA 4D4JA 4DCNA 1U8UA 4L95C 4YAWA 2OCLA 3OFNA 1DAKA 2C29D 3VR6H 1NKSA 1U1GA 5AM2A 1HORA 3A6LA 1NVKA 2JF0A 3STWA 1RWBA 1EFUA 2X86A 1DHRA 3LX4A 3NAQA 4R01A 2C7BA 3F7TA 4GBJA 5GJWC 4B76A 4YUWA 5JECA 3VPSA 1ADFA 1Z83A 3KSZO 4H3SA 3U3MA 2ATVA 5A5DA 3T5GA 2HSJA 4JT8A 1GCUA 3WX0A 2BFNA 1CQJA 3KQPA 4GPTA 5I9SA 5LQCA 3HXQA 2FPXA 3AOEC 3DFIA 3HGQA 5AW7A 1A04A 4W5NA 1XDUA 2XXBA 4O33A 3QVGA 1EM8A 2H65A 3G8DA 4NHOA 3ZIUA 1OYYA 4BJ5A 1AMUA 3SSOA 4XUGB 1V1JA 1XP5A 1GV0A 1Z6YA 2ZITA 1GXSA 1K3FA 1USIA 2YW2A 4KWEA 4UCFA 1ZN7A 1NLMA 1YJQA 2I62A 2YHSA 1XQWA 2H1CA 1M34E 4YXWA 3G89A 4RJLA 2AI1A 4EGFA 1PJ4A 1D2RA 1GTMA 1PQ4A 2Z1MA 4PBTA 5BMVA 3HKBB 2XVZA 5GVRA 4B2PA 1KOGA 3DT6A 2FOXA 1XTIA 3N6RA 2GPWA 2OZVA 1VKHA 3L82B 4G9EA 4YJFA 2WHYA 4Z9FA 4GM1A 3BT7A 1XQ6A 3OTIA 1G17A 1G5IA 1Y7LA 1Z2DA 1LQ2A 1GFWA 2P90A 3I8OA 4MP3A 3MJVA 3U1VA 1MO3A 2EYQA 4J9VA 4PGHA 1H1DA 2I3BA 2WHPB 5I7AA 5IFKA 3TTVA 4KGVA 4EG5A 1DOAA 2PH5A 2FWMX 4EF5A 2IE0A 3RGGA 4JAVC 5T57A 4W5RA 2VXYA 3NEAA 2IGTA 1B6GA 1H4SA 4U8GA 1E92A 1O03A 3L6EA 1W6UA 3HCNA 4GLBA 3FA2A 3EPRA 3ZGZA 1J7KA 2OECA 4XWWA 2QEQA 1U0GA 3CEMA 4ESEA 4WK4B 4I1VA 1U7ZA 3JAKB 4D9JA 5AVJA 5EJ7A 4WLUA 4FFRA 2W6NA 4QATA 4AX4A 2GRJA 3N05A 2PGOA 3PWTA 4YRGA 4HNQA 4QHSA 1X13A 5AVOA 1WXQA 1D07A 1K4MA 4FNGA 5FWXA 4AYXA 4IBOA 5FL3A 2X5XA 1K0FA 5A2GA 3I9KA 3S2UA 1W93A 3NWOA 4JR2A 1WDLA 4PYNA 3RRZA 4B32A 3BGDA 2HA5A 1Z28A 2V7EA 3RWOA 1L7VC 4HFNA 1I1QB 1L4UA 2ZIAA 5CTJA 5ALOA 3ZCVA 1FOEB 3KKKA 3BSSA 4TWBA 2I4LA 3QVLA 3V1TC 5JNUA 1CCWA 1WDTA 2H4YA 4L8YA 3JATB 2ZK7A 2RGNA 2GRUA 3KKQA 3PTZA 4LDRA 1E2IA 1XLTC 2PBRA 4QPDA 5AW0A 2QAJA 5A0VA 2JDID 1ZG3A 1OXVA 2M6LA 4P6VF 3CLSC 5AM3A 4WL0A 521PA 3G0BA 5AVSA 3Q8LA 3DTNA 4C4TA 4FPXA 2VTEA 4A0SA 4GWLA 1A9TA 2H57A 4Q7MB 1NQ5A 4IO0A 3PUZA 4XM0A 1TVKB 4LRXA 3L7BA 2P9CA 3NDRA 1ZBQA 1QH9A 4ZT5A 3UW3A 4Y7DA 1MEJA 3D1VA 1JEQB 1C1DA 4I1OA 2ZUDA 3MTEA 3MJEA 2B3TA 1QU2A 3QX9A 1IM8A 4PONA 2WQZA 4FOOA 1A98A 3INTA 3HNPA 3QQPA 1YUMA 2IV7A 2P0AA 2VP9A 2O07A 3M8KA 4FDLA 4PYQA 3O93A 3WSWA 2FZEA 1R4NA 4AY6A 2X0JA 4ESOA 4ARAA 1EGAA 1PEYA 4B3RB 3VJLA 3M1LA 4II2A 4D5GA 4JYCA 4OQNA 1KETA 2I3AA 5C53B 1RABA 2CLHB 1ZRNA 3VU3A 4M9CA 1TTHA 1YZHA 1JKJB 4R05A 3PI6A 1XMQB 3DPUA 3V1YA 2HF2A 2V7BA 3ONFA 3CGGA 3QFSA 1X2BA 2PV0A 2F62A 4P35A 4BKPA 2VQSA 4J0EA 4ND7A 4J3FA 1PG5A 1WSAA 4M9QA 4MIKA 1DWQA 4YBRA 2H1VA 4IDBA 3ND6A 2XCUA 4CM3A 5JDCA 3OKPA 1AM4D 3RUFA 1LBQA 1RQNA 5HMLA 2LGJA 1HNXB 3L7MA 4P83A 3GRZA 5DOVA 3NJ8A 2V3VA 2PKRA 3GMIA 4PO9A 3FYUA 3ZTTA 1ZD1A 2J9FA 1OI2A 2WM8A 3G0HA 2Z04A 2WC1A 1RCFA 1QQ6A 3I32A 4J3NA 4U1RA 5G0UA 1OZFA 4MR8B 4Q4AA 1BDJA 1F5SA 1CQIA 2FFJA 1ZQ9A 2R00C 3OLWA 3RLFA 4A8PA 1ZSVA 5KU7A 1MAAA 2ZQYA 3R0JA 3COPA 4U39A 2ZJ1A 4XFJA 5A3VA 1UBNA 2IKQA 2VK4A 2ZRBA 4ME6A 3VVLA 4BEJA 4M7PA 1DUSA 1QB7A 3KUCA 3CKYA 1RRFA 3H8SA 4NBRA 2KBFA 5ALWA 2VSYA 1EVKA 1FK8A 1X74A 3BMOB 4JYMA 2ID9A 1B8VA 4MWBA 3TL6A 1E3WA 5G3ZA 1Q1AA 3QUTA 4W9NA 1XZAA 5ITZA 1N7JA 2OB2A 3MOGA 3LKDA 4Y9DA 4C6RA 4DQDA 4DTIA 4DLZA 1GUAA 3WQQA 1OPXA 10MHA 1MO5A 2ZRKA 4UEOA 1SXJB 1N5LA 3IS3A 3LW7A 4OLHA 4TSFD 3R0VA 3RUHA 1ZSYA 2AZXA 1COWD 3P4YA 5JARA 1HC7A 4HPJB 3CH5A 1CY6A 3I8XA 3NDPA 4FDUA 4BNXA 1MTOA 2W71A 1AQNA 3EQZA 4ZT6A 1E6UA 3CONA 4ZPXA 1EXMA 4TTPA 1F7UA 5H7XA 4QU5A 4WNIA 3ZE0B 3OQIB 1VLJA 2ECOA 1KEVA 3A04A 4ILEA 3DOEA 4M1OA 3RC1A 3V00A 1RYBA 1NQVA 2PRKA 4NDZA 4RH1A 1RFLA 4LOAA 2H7XA 3KFLA 5JFTA 1NG1A 4CEHB 1TK2A 1WPQA 3ANXA 4JELA 4A27A 1FRFS 2FVYA 3NRBA 1EBUA 4HUQA 5CUQA 3RI3A 5JNLA 1E96A 3VX3A 1ZW1A 4NQZA 4AXBA 1O58A 3L5OA 1GQYA 3QHQA 1IDN1 2O5VA 3MT0A 4UHJA 2H4HA 5TT0A 1G7RA 1PNOA 4W8OA 1NJGA 1MOZA 4M0EA 3JSXA 2JHGA 1F4PA 4X9XA 3EDQA 1QMPA 3KCNA 4BNDA 4K3VA 3BX1A 3IP3A 4NH4A 1OIWA 2CL7X 1TT5A 1J1IA 4V0KA 5AK3A 5KOHB 4P4GA 4Y8VA 5LQUA 2WIGA 1Z5OA 1CRZA 3BTSA 4HLUC 3DMGA 3A1DA 4INZA 4IRMA 4EKGA 2NV0A 3R7DA 2MSCB 2JAXA 2QTFA 4HEHA 3ZJTA 3M6WA 2JGMA 4EGSA 1KQFA 1J8FA 1OWMA 3QG5A 1FTNA 4ZQGA 3BMNB 4XJTA 4Q9JA 4XZ3A 3QSYA 3FOAA 2DR3A 3EQ2A 4TXMA 3KO8A 3MUFA 2V96A 4MUMA 3SR3A 5K0CA 1WPRA 3U4AA 4ZYUA 4R1SA 5JJBA 3KYCA 4J76A 4XIIA 3EC1A 2QD4A 3KDAA 4B71A 3G1WA 4MRMB 3E1SA 1DWPA 2LPMA 4BLWA 4E31A 5A6SA 4FSDA 3EOZA 4R2KA 4C7OA 4BBZA 4MR7B 4EUFA 1E99A 3U3XA 5A62A 2P5UA 1KGDA 1PD1A 5EIEA 3TKYA 2Q6VA 3BK1A 2ZUWA 1CEYA 1VYTA 2ZCVA 2GAJA 2XYQA 4XB6B 2I9KA 1FP4A 2G0NA 1XQVA 3I9JA 1GPKA 1Z2OX 1Q0HA 1FS5A 4UNQA 5FXMA 3QX7A 5IXSA 1R0ZA 1XGKA 3ZJ4A 3FFWA 2BY4A 4LJ6A 2R6R1 1REQB 3NHAA 5KAPA 1JQ3A 2LR0A 2Y76A 4LHZA 4KXVA 4RIHA 3Q1LA 1NV8A 1L7PA 1U2EA 2FY8A 3I9MA 5EPOA 3TIIA 5JJKA 5HCUA 2JLUA 3G9XA 4R6WA 3D0QA 1HURA 4FB5A 3AVWA 4I4TB 1PVVA 1FX0A 3WV5A 5LKRA 4RIFA 1W52X 1RDFA 2Q6LA 5EP3A 3V9AA 2EW2A 1F0YA 4AN4A 1GZVA 3X1KA 2FHPA 2ZJ3A 4QAQA 1SA0A 4ZV4A 5E6UB 2PIDA 2G3YA 3D9QX 3NXSA 4V02A 1KZ9A 3TMKA 3TQRA 3GLSA 3I34X 1U3TA 3KHTA 3HADA 3Q6IA 4CLXA 4YCSA 4KREA 3TVYA 1SBZA 3BJZA 5K0GA 2RGGA 2IZ7A 5EIWA 2JIZA 3AR7A 3JZFA 3U7RA 5BYKA 3BWMA 4DKXA 3QPAA 5CEJA 1G2IA 2JZCA 2RHGB 4PHGA 4U7DA 3AVXA 3NHSA 2D5BA 3CHYA 3P1JA 4C6TA 4DRYA 5ECDA 4IO1A 3DMRA 3L46A 1K86A 2GJAA 3ZXSA 1T1IA 2JZOA 2CEKA 4HNHA 4HWRA 5TX7A 3K70D 1GN8A 1W35A 1NWHA 3JQCA 3GJ3A 1X15A 4QYMA 5FPYA 3TCKA 3OUZA 3GG2A 3KZCA 4OMUA 3KR9A 1J25A 5JASA 5E3IA 2QYTA 4D4LA 3INGA 5CA0B 4C5AA 1IHXA 2DQZA 3CW9A 3SC2A 1L9XA 2WQ7A 2IXTA 3GK3A 5L3ZA 4ND8B 3UJ7A 1G8JA 4JLVA 3BKWA 4ZRMA 4BRUA 2GHIA 5DPMA 2PM8A 3R9IA 3ZHVA 5LD2C 4IXDA 1O54A 4NCKA 1AX9A 1SC4A 2V4ZA 4CV2A 4XH9B 4F5WA 4YR9A 5CXQA 5J4YA 2Q4OA 1K7SN 1MF7A 1PJCA 2GK7A 2OAGA 3D6UA 3MRXA 4XI9A 5AR1A 1CSEE 4W5QA 1YMQA 3W4IA 3PK0A 3EZ9A 2ZBDA 1BO6A 2CLCX 4GP6A 3ABRB 4RF3A 3U7QA 1B1AA 2AJ8A 5TEVA 2ONCA 4XR4A 4BEWA 2ZB7A 2A14A 3KKPA 3WOHA 3KVNA 4EO9A 4ZTUB 3GLRA 4C0XA 4JXJA 3FNHA 3GX1A 4FFWA 3UGTA 1FDTA 2C7QA 1O95A 1EFPA 3R9XA 2C2OA 4HAYA 5HQ3A 5L3SB 4KK3A 4TZKA 2ZSIA 3W7VA 4ARBA 1I3KA 2OSVA 4XPIB 3DOUA 1NW3A 4DJDC 2VRCA 1SOVA 3DEJA 1UWLA 3MYRA 3W34A 1VYVA 4FYWA 1GG2A 4ZANA 3GQBA 3AC0A 4BKMA 2XCQA 4BDTA 2MCFA 4YMGA 5B6JA 1L5MA 4MNTA 5DU2A 4GI1A 4NENB 3JQDA 3M4NA 4CN9A 1P1RA 4KFSA 1V6CA 4F2WA 1ZMRA 2Y77A 2Y4OA 5SY4A 4D9GA 2GAAA 3DLPX 4US2R 2P6RA 5DRTA 2R0QC 2ZKIA 3C5CA 4KVAA 2RI0A 1HDCA 4ZT3A 5E9AA 4NU5A 3O8NA 3CNNA 3C8MA 3HUEA 2BBWA 4GH5A 2EG9A 2VYVA 1JVBA 1BVYF 1EUQA 1JAZA 1MA0A 1GRRA 3U09A 5F5NA 4NYIQ 3ZK9A 3UW1A 4DXAA 3RF7A 3RCBA 4AVYA 4KR3A 3HE3A 4IDCA 3GVHA 2R96A 4FT4A 3RTBA 3AHCA 4ZHSA 2W2VA 3O2SB 1IQUA 2WA1A 2HQ1A 4B44A 5EJFA 5KWVA 1T29A 2QZSA 3UGKA 1M7BA 1GDTA 1YASA 4FEEA 3D7NA 2BONA 4IQFA 3KM0A 3N1UA 1AUXA 1WEKA 2W6ZA 4S0ZA 4V3BA 3I45A 3K15A 4ZGGA 2DZDA 2MSLA 4IFEA 1JEJA 4G5YA 1F5NA 3Q85A 1U8FO 5DYWA 4CDGA 3THRA 3O9MA 3TLKA 3VA7A 2F17A 3U7JA 3NUGA 1G7SA 4GECA 2IZOA 2PT5A 2X40A 3RRYA 1XRNA 2P7IA 3FB4A 4PO3X 2YC2C 4GL4A 1U6IA 1K4KA 3ROZA 1SM4A 3COVA 4RS3A 2EG5A 3M4YA 4YP7A 3B89A 3SVZA 3ZWWA 1G8SA 2PJZA 4HQFA 3TTXA 2J0VA 4OB6A 2WV9A 2TMYA 4IJ5A 3K0FB 2IXGA 3I23A 1HWYA 2DUUA 3X1YA 4ZOQI 4L6AA 1ITZA 2FWAA 2ISSD 3BE6A 2FLVA 3P71T 2JJ2A 4HKTA 5F23A 2ID8A 1I0ZA 1ULTA 2RGUA 2AWOA 2FZKA 2R84A 1CZRA 2PFSA 4N8DA 3OZTA 4FTWA 1DBQA 4UHEA 2H9YA 3KQUA 4UEJA 4DDTA 3H1PA 1E0SA 3QFRA 3IGFA 5THKA 1PX0A 1JG3A 1P80A 1YMUA 3EQ7A 4NMLA 4QOGA 4QWMA 5C3UA 2RH8A 3UHPA 1GITA 1LSOA 4JN6B 3ZK7A 1C0LA 1Y8AA 3I64A 4FS8A 2FW1A 4NK4A 1TQDA 1RJDA 1AA9A 3F6PA 2W48A 3N7AA 2EHJA 1H0RA 2WJ6A 4AMBA 5FDFA 5LBTA 1QQTA 3B82A 4AN1A 1M1YB 3PV0A 1JIJA 3AUXA 3I1IA 5E3JA 4FFMA 4LFCB 4HV4A 2F4VB 4S0XA 4MPRA 4NBTA 3NORA 4EI2A 3N2IA 1YZFA 1SUBA 4G5FA 3RC7A 3A9CA 3EXHB 1G2QA 1U5BB 4G0QA 3M1AA 3RARA 1Z5WA 2BFDB 4ZQBA 4Q3OA 5JEDA 3FHLA 1M5RA 2F48A 3C6YA 4L5YA 1VIAA 3JRXA 1JWLA 1I2BA 1L7BA 5F1PA 3U4HA 1WMSA 4NOKA 2LNDA 1CY0A 3TW8A 1WX1A 4UHCA 3VR2A 2P9GA 2R9VA 2XZTA 1NKVA 1AXEA 2Z5FA 1BWQA 4RMIA 2A9QA 4YCJA 2PJUA 3F6SA 4PC2A 1ILEA 4CCWA 1EJBA 3ZQ6A 4E03A 3LX8A 3HO6A 2JFZA 4O4IB 2QG9A 4DCUA 1XU4A 1OWNA 1JSXA 2X1MA 4NCAA 1HZJA 1JPNA 5JAMA 1KXZA 2I0FA 3LXXA 2C4MA 1ONNA 1V43A 3ACCA 1EB9A 1OF1A 1YR9A 2ZATA 4BB9A 1G21E 4C9BA 4IDGA 1J0XO 4HS9A 2ZBFA 3H9JA 1V8PA 1Y6FA 4MAAA 1UP6A 1TAHA 4HT3B 4JT4A 3WA7A 1W29A 3JW8A 3TPZA 1UXJA 2X6RA 3QUCA 5DT2A 3K70C 1IM2A 1Z6AA 1RIFA 2AZTA 4ZI7B 3BDAA 5H4HA 1M7HA 5L45A 3ZWNA 3GPIA 5AVKA 1VJCA 2V6FA 1QSGA 4HFRA 1QF6A 3QBDA 3FVRA 3RU2A 1CUHA 3OFSA 5FBWB 1XD2B 5LJLA 2I87A 5E7IA 4RK5A 1ZH0A 4CKWB 3QGMA 1HRKA 1A71A 4BGEA 2AZ4A 1TX4B 4RJJA 1RW4A 1CRQA 1HFKA 2YZ2A 1X77A 3AEXA 3HVUA 3LY7A 3WR5A 5JOQA 3P8ZA 5K2OA 4IOLA 1L3IA 3MUNA 2ZRGA 1Y89A 4GSLA 1NP7A 4Y2UA 4N03A 4D1YA 4K9DA 4CIBA 1OQAA 1ZA1A 1Y4AE 3LTEA 1OLXB 2HA3A 3V46A 2HO4A 1PL0A 1J9GA 4OD0A 4MROA 4RYLA 1YQGA 3HL4A 1G6OA 4IIHA 1SUPA 4EK9A 4QJ4A 2YIVX 5FA8A 2CK3D 4I1IA 4B0PA 2QIOA 4RGVA 4E5MA 1G8FA 4BE4A 1U7TA 4CMKA 3MYYA 4L28A 4C3ZA 5IDYA 5E9QA 1SIWA 4HUJA 4EJ6A 1L4MA 4IL5A 1TEZA 4J0QA 3SLRA 5C1PA 3IBSA 3HUTA 1H9BA 2EP7A 3NR2A 4LBYA 3V34A 4NMXB 3E5MA 4D8VA 3R0ZA 5C8DA 1YS9A 2KPOA 4IGKA 4N3CA 4JUFA 5HS4A 5T3UA 4ZVLA 4DQLA 5C5DA 1GSAA 3H2KA 4JJKA 1J8QA 1ENZA 2IJGX 2PD3A 1HI9A 3IVAA 4KWCA 1U3CA 3BB1A 4XQGA 1G291 5J5CA 4UE3S 4BNTA 3PNOA 4PAWA 1YRLA 1D0VA 1N8KA 2BI8A 4DQ0A 1E7WA 4BO7A 4LJ8A 3I5MA 4WK6A 4X92A 2JLZA 2HPVA 1OH6A 5JMPA 1NR1A 1J0EA 1CZKA 5KU1A 1JEDA 1YJ8A 4L02A 2H4FA 4RF2A 1V8FA 3DO8A 4MEAA 2QR5A 1DBWA 2W6PA 2ZJ4A 5BSFA 2J0UB 3ICEA 5F12A 4IWXA 3S29A 5LYJB 4Q93A 3UGQA 2WPDA 5HYVA 1KU6A 4XGIA 3K0BA 2XTNA 2YN2A 4JH0A 3LCRA 1NF2A 2CCJA 2HTFA 3KAQA 4KO2S 4PY2A 4K0KB 4FKBA 3GROA 1JHPA 3EG5A 3LX6A 3C16C 3WLPA 3LKVA 4OHPA 4TYQA 1E6KA 5CYPA 2XTZA 3NT4A 3FSEA 3Q2OA 4DILA 2BMJA 3K35A 1GZDA 4RSRA 1M2HA 2HJSA 4B6PA 4HP8A 4JWKA 5AKLA 1AF7A 2YJ5A 1NZJA 3IQGX 1UJNA 3OE7D 3PQ2A 4LY0A 1TYBE 3HDTA 2BEUA 3HKEB 1ELOA 4G26A 3NRJA 5EQJB 4DCCA 4Z1OA 1SO8A 2E5FA 2O3RA 1MB9A 3QXHA 1WZUA 3MLBA 1HM5A 3S1AB 1QP8A 3MWFA 5I5EA 4XAQA 3D4IA 4TL8A 3OJLA 3R0XA 2EWVA 2BFMA 4H3HB 1E60A 1VKRA 3RF6A 3ZBPA 4B09A 1XZNA 3CUTA 3V4ZA 3GH3A 3CMCO 1N8TA 4IYRA 3VZCA 4ER3A 2BCJQ 5KQPA 3N2GB 5TJHA 4U9IS 5JH7B 5BPHA 5JATA 3PQ7A 1KJWA 3GAMA 1XG5A 1SCUB 4KX3A 1XXHB 3AR2A 3X1DA 5HRAA 3L02A 3AFNA 1ST3A 3AU9A 4ZAXA 3QVVA 3UFXB 3M1IA 2QI9C 4B0OA 3L1VA 3KLBA 4YAIA 1HDOA 2G8LA 2ZI7A 1VL2A 4KUEA 3VDQA 4FU0A 1W73A 3OOWA 3ZQKA 3GJ5A 1AURA 1HSZA 3MN1A 4D8XA 2O8BA 3JQAB 5IKXA 3G0GA 4MEJA 4M3NA 1D2NA 2P40A 1GLVA 1NVWQ 2YVUA 2NAPA 2WJGA 3DYIA 3E22A 3NTVA 1GQQA 3Q98A 1YIDA 4MGYR 4YS6A 4EYEA 4A0QA 4AWBA 3BIOA 1XZQA 2CFRA 3IELA 3UK0A 2CGEA 3VI4B 5C4MA 1HE2A 1BE0A 3WK6A 3M49A 1Y4ZA 1Z5NA 2FQXA 2I2AA 3WGZA 1NXWA 1SN7A 3C7DB 1BCSB 4YP1A 1U3GA 2VA8A 4MYUA 1PG2A 2DEUA 2GPTA 3ABOB 5FWYA 4O6VA 1JPVA 2J67A 1XV5A 3WYEA 4BNMA 5FL7A 3R7BA 1O5OA 2I4IA 2JFWA 4KE6A 3FVQA 3KSRA 4XEUA 5D3QA 2F8SA 2OR3A 2HPAA 2WDZA 3NNDA 1F38A 4ER5A 1H0SA 1KPHA 1JG1A 2H1WA 2WHQA 3PF9A 3V7NA 1X42A 4OKNA 4LSGA 3HBLA 2IYAA 5CEEA 4LDJA 2X9NA 2C94A 1B6TA 3MILA 4MR9B 3FKSA 2P8JA 4GE3A 3HSYA 2YV3A 5LP1A 2HX1A 1M2VB 1VPTA 3KIPA 3P9QA 4PYIA 3UJCA 1D7OA 4JLUA 3WL3A 1XPUA 4FYJA 1ZFNA 3RYFA 2IXBA 2ZAIA 1KEKA 3K92A 1E0AA 4E14A 2PZFA 4OHKA 4X24A 2HWWA 3BGSA 5BNIA 2Z4RA 1EFTA 3NAGA 4UBIA 3ROXA 1RPTA 1QR2A 4MARA 3NV7A 4QFCA 3RQSA 1KL7A 5BMVF 2WAAA 4JC8A 2F9FA 3K5WA 2VT6A 1NLYA 1SXGA 2E87A 2QN1A 3LRPA 2C9MA 1KMHA 1QZ3A 4L5IA 1RQPA 4EVIA 3FVVA 2HU8A 2WUVA 2VWPA 2EIXA 2CSXA 1XQXA 2X0RA 5DLQC 2WV7A 1HFEL 3L43A 1NUQA 2YXBA 4QQRA 1S3SA 2WYVA 2J30A 2QR2A 3K9WA 1G8MA 3SQXA 3PJRA 3CUWA 3ZD7A 3DMTC 2Y27A 2NU8B 3G5TA 1X1RA 4HMOA 1QCZA 4HZUA 2Z08A 3OT5A 1L3CA 1LRJA 1XVAA 1R4MB 4IX9A 1XL0A 3BZWA 3RRNA 5KINB 2QD2A 2CCGA 2WNHA 2YVLA 2NU6B 2R7MA 3AM5A 3DEHA 3EHDA 4P0TA 4QQKA 4K9PA 3D7RA 4RQBA 3IT0A 4FNAA 4WBNB 5ALVA 4GFDA 3WYBA 1DDOA 2IF0A 4B45A 4ZFNA 2VQ3A 1BXGB 3C6BA 1IK4A 4GZMA 4M89A 3F3KA 3AFHA 3LFHA 2WMNB 2VPYA 2Q46A 2R8XA 3OKFA 1D3AA 3AEKB 5JXGA 1E7QA 1OY1A 3QKUA 4IXWA 5EE3A 1DX4A 5LA6A 4EJ0A 3U1TA 5H3CA 2H18A 4JGGA 3VR6D 2YX1A 3DB2A 3NBUA 3QOXA 4NE7A 4WNAA 1SCNE 1X6VA 2DP4E 2G1KA 3GDHA 4ZD6A 4R0NA 4BN0A 3PLNA 4J4TA 3DEAA 4RCVA 1SBIA 4MV6A 4RMHA 4UAVA 4A6DA 3PX2A 4TQAA 4Y6SA 1UUFA 4ECAA 4HWOA 2NO5A 5HG0A 3ITDA 3TZ6A 3QUQA 2UAGA 4UD6A 3AB8A 1B16A 2AH5A 5T8KC 4WW0A 5L4LA 1KAHA 2XNDA 3X1WA 3LUCA 4TYPA 1SUWA 2WJPA 3IOYA 3F8WA 2QL9A 3MJHA 4DVJA 3BMXA 4G8BA 1LZLA 2P35A 4LNUB 4K9QA 1FNCA 2EGHA 1ZD2P 1XI2A 1H05A 4QNRA 3W9UA 3WS7A 4DQUA 1P0PA 1NQXA 5E4FA 2GWHA 1FQKA 1TB4A 3KU4A 4HDSA 5ICEA 2BFPA 4B9EA 4Z4GA 2JLCA 2BI4A 4XYEA 5EYPA 1W48A 4TT3A 4RTNA 3FDIA 4DEXA 4M9XA 5K8IA 2GBCA 5FB3A 4FYIA 4JKIA 3CLUD 4H7HA 1IJBA 3GRAA 4IM7A 3SNKA 1T4GA 2D3WA 4N7JA 1GPYA 3TAUA 3D6JA 2OCBA 4GX5A 5LDDC 1ONBA 1N2HA 4WPGA 3WGJA 3WKCA 4E4TA