4ROTA

Crystal structure of esterase a from streptococcus pyogenes
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
268
structure length
268
Chain Sequence
NLYFQGAMASIAIEYHSVVLGMERKVNVIYPDQSEIPKKDQGDKDIPVLYLLHGMGGNENSWQKRTAIERLLRHTNLIVVMPSTDLGWYTDTAYGLNYYRALSQELPQVLAAFFPNMTQKREKTFVAGLSMGGYGAFKWALKSNRFSYAASFSGALDFSPETNLEGNLGELAYWQGVFGQFEDPDLDKHYLKNMVAESDGKTKFYAWCGYEDFLFATNEKAIADFQAQGLDIDYHKGHGKHEWYYWNQQLEVLLEWLPINYQKEERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase A
publication title Crystal structure of esterase A from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
total genus 80
structure length 268
sequence length 268
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2014-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rotA00
2H7XA 1CUAA 5T4FA 5C7YA 4PSUA 3G0BA 3TRDA 2PUHA 2GZRA 1JJBA 3P2MA 5AJHA 1A7UA 3H2KA 4EY6A 1XZJA 2VJBA 2HA7A 4FBLA 2HHAA 1W1IA 1XZGA 4MWTA 4EA6A 1EVEA 4UHEA 1KU6A 3R3WA 2WHQA 1R3DA 3R40A 1U8EA 5AM5A 1ODCA 3G7NA 1MX1A 3FVTA 1LGYA 1TCAA 3TGLA 2PL5A 4RGYA 4EY4A 3ICWA 1UK6A 1PFQA 1X2BA 5ALQA 5LZ4A 1QTIA 1Q0RA 1O6FA 4OYYA 4OYLA 3HACA 2RGUA 4Q3KA 2XUIA 4Y9SA 1BCSA 2VJAA 5AKZA 4E46A 4DNQA 4Y2TA 4CCYA 1R9MA 1XRMA 4FKBA 3FLAA 2I78A 3M3DA 3H04A 3IUQA 1EDBA 1XZIA 1QIGA 2BGNA 3E4DA 3O4GA 3BDIA 2PU7A 1D07A 1EINA 2WUGA 1ACLA 3GELA 1AUOA 4JYPA 2XQKA 4WCVA 3C70A 2GYWA 4PF1A 3IUMA 1K63A 2RHWA 2WIGA 4BTLA 1ODTC 2P8SA 4P08A 2HU5A 4YX9A 2XUAA 5JANA 3BDVA 2H9YA 3VVMA 1H23A 2QRUA 4Q82A 2B4KA 3I2KA 5AKEA 4UHFA 4BC0A 4C4YA 5C81A 2QUBA 1LPOA 1LNSA 3TEJA 3WLAA 2ZYRA 4KAAA 4BE9A 4LYEA 3HZOA 1HKHA 2PUJA 3H1BA 2QM0A 2Q0XA 2OCIA 3G0CA 2WIDA 4GDMA 1LPNA 4INZA 4K6KA 2AJBA 3I28A 3IIIA 3FYUA 4FDMA 3V1MA 2DFPA 3H2IA 3G9TA 3QMWA 2HADA 4C01A 1NU6A 3EF3A 5JZSA 4BC1A 1X70A 1OILA 1J06A 1QIFA 3E1GA 3HXKA 4XVCA 4W9RA 1XZLA 2C5FA 4FFWA 1XRPA 1P0MA 1L7AA 3RM3A 4KAFA 1THTA 3PI6A 1MTZA 4UBLA 3VXKA 2G5TA 1XZDA 1QIEA 2WG0A 4OSEA 4EBBA 1CIJA 1DX4A 1ORVA 2WTNA 4MQLA 1SCIA 4WFJA 1UKCA 2BJHA 4XIIA 2RAUA 3WYNA 1O6GA 2XQGA 1CUYA 3CCBA 4QEKA 1ZD4A 2V98A 4C88A 1XZEA 3I6ZA 2WTMA 3I2HA 2Y6VA 1HPLA 1ZIYA 1JKMA 1A8QA 4CIBA 1CQWA 4G4IA 5HF8A 2JGEA 4FTWA 4UBOA 4ZREA 3W06A 4DGQA 3DOIA 1YS1X 2CEKA 3OURA 2WFMA 5ALSA 3IUJA 5A2GA 1IUOA 4K6GA 2Z8XA 1WOMA 2C7BA 3STXA 4A23A 4AZ3A 1CEXA 1C4XA 1C7IA 2O2HA 1N5MA 4L72A 3DL4A 2OPHA 1KU0A 4OU4A 1EA5A 4Q05A 2GBFA 1FJ2A 2GZSA 4H7DA 2XQIA 3B5EA 1ODSA 2DSNA 3BIXA 5H3HA 1N1MA 3LIPA 4QDTA 2WM2A 4M0MA 5ALTA 1MX5A 1QO9A 1VXOA 5AOAA 1BCRA 1ZOIA 5JYCA 1OCEA 2QJRA 4X92A 3VKFA 3AIMA 3STTA 3IDAA 1ISPA 2V96A 2QOEA 3WMRA 4Y2YA 2OCGA 4K6HA 2EDAA 2QJWA 5LZ7A 2BFNA 2WHPA 2CBGA 5ALXA 3U0VA 2XMDA 1CUJA 4LXHA 5HK8A 4ARAA 5K3CA 4AX4A 3HABA 5F4ZA 3UMJA 2VAXA 2QVBA 4QDUA 1EB8A 3M83A 4J7AA 4BVLA 1K4YA 2OXEA 1CUBA 4QDZA 4B0OA 1U65A 1W52X 2PM8A 3R0VA 4ETWA 3D4LA 2WFZA 3WI7A 3W9BA 1THGA 5AH0A 1T2NA 1H2ZA 4IHAA 4KEAA 4QLOA 5E2IA 2QKYA 2JGFA 3I6YA 5AK3A 3DDUA 1VZ3A 4FFVA 5HFNA 5AI5A 1HL7A 1R1DA 4DNOA 1YS2X 1GT6A 5HKAA 5LKRA 4ITVA 3EIOA 4ZGBA 4H7KA 5FOQA 3SX4A 2J4CA 1IUPA 5CBKA 1EVQA 3ZWQA 3MUOA 4AXBA 4Y7DA 3N0TA 4OB7A 2FJ0A 3ZI7A 5HCUA 2X8BA 4RNCA 2C0PA 3W04A 3STYA 5KREA 2C4HA 1B41A 5A7FA 5FLKA 1XQXA 3WK9A 3QVMA 2HU7A 3WJ1A 3JYHA 5AKGA 4J0KA 1LBSA 4I19A 3C6ZA 3A2NA 1E89A 5BWBA 2WHPB 4BB0A 2OQVA 2E3JA 1XZAA 4BDSA 1QO7A 4A16A 1CPYA 4WDRA 2JIDA 4Q1VA 2VJDA 3HYSA 4ZRDA 2DHEA 4LXGA 5LYYA 4X6YA 5D6OA 3OC0A 1VXRA 5LLSA 4GW3A 2ECFA 4LYDA 3TJMA 2XE4A 4DYHA 1JMYA 2AJDA 2BKLA 1Q83A 1DWQA 1CUZA 1VE7A 1N8SA 1P0QA 5HQ3A 2X5XA 1EK2A 5AKJA 1QFSA 2DCMA 1WM1A 2PSEA 4N8EA 4AN0A 4B80A 4X6XA 1UT6A 3PFCA 3STUA 5EIEA 2AXEA 5DNUA 3OOSA 3C8DA 3FBWA 4ZI5A 2HDWA 3DEAA 1XQVA 1Z68A 1DT3A 3FVRA 3PF9A 3PF8A 3VDXA 4ZXFA 2PSDA 2JGLA 5I9IA 3T52A 4OD0A 3I1YA 2WLSA 2VT6A 4X6UA 1U2EA 1EXWA 1XLVA 4H7HA 4BRSA 1GQSA 1H2XA 3D5EA 2Y6UA 3LIIA 1AMNA 4HAIA 3QYJA 3DOHA 5FV4A 3F8SA 2VF2A 5CMLA 2DHCA 1XZBA 4BZZA 1HBJA 5ALUA 1DWOA 1CUXA 4U2GA 2BCEA 4V2IA 1GKLA 3U1TA 4B85A 5K3EA 4X00A 1CVLA 2I3DA 1ACJA 1FSSA 2XMGA 7YASA 4GEGA 3F96A 3NWOA 1SCKA 2D5LA 4KJXA 2WJ4A 3EBLA 1QIKA 4UBMA 1P0PA 5BOVA 5HQ3B 5D7BA 2JEYA 1RWQA 2QMQA 2X76A 4QA9A 3R41A 5CURA 3S8YA 1OXMA 3QPAA 4MEAA 3AINA 5AK4A 3FWHA 2ZSHA 1UOPA 5I7UA 5AI8A 1WPRA 4W1QA 2GYVA 2QR5A 2JBWA 3JW8A 5AI4A 3WL5A 3JWEA 2ZJ6A 3SC2A 4BDTA 4BVKA 2GBGA 3W2TA 3K2IA 2JF0A 5LP1A 2HA4A 4FLMA 3RKSA 3AUKA 4ZV7A 5ALNA 5IH7A 4N5HX 4EHBA 3G9ZA 2YASA 3O4HA 5LIPA 4B7ZA 2JGMA 5SYNA 4Y2JA 1UKAA 1QLWA 4NMWA 2Z3ZA 5BV7A 1W75A 2OAEA 5FDFA 1UK8A 1Y37A 5IVKA 3HLKA 5JADA 4HRXA 5JZBA 4X90A 2IX9A 4N8DA 1ORWA 2XMZA 4X91A 1WB6A 3D2AA 2XMRA 5T4BA 3HSSA 3MGAA 4F60A 2Z3WA 5T4EA 4TVKA 1K5PA 1QFMA 4J0IA 3WKCA 4OB6A 1TAHA 2O7RA 4PQEA 4C4XA 3LCRA 2BUBA 3F9CA 4JNCA 3FLBA 1L7QA 3H18A 2ZYIA 4U2BA 5DLPA 2XUGA 3R3XA 5AK6A 4IQ4A 2V9ZA 4P93A 2K2QB 3WL8A 4B81A 3L1IA 4U2CA 4Y2QA 1QJ4A 4CFSA 3V48A 2AJLI 2HA2A 3QH4A 1W76A 2WJ3A 1RP1A 2GBCA 5DJ5A 3WYDA 1IZ7A 1QTRA 1HQDA 3KWFA 4CG1A 5JD5A 1E3QA 1MO2A 4BCBA 3W9UA 5HF9A 4WFIA 3F97A 2XUKA 3ZPXA 5FP0A 3FNBA 1LLFA 2ROQA 4X93A 1XRNA 3QITA 3G0GA 3MVEA 5ALGA 1TK3A 1E66A 4BP8A 2QXTA 4KE7A 3IUNA 4W1SA 5DNVA 2PSFA 1UWCA 3DNMA 2OGSA 3D2CA 4Y2VA 3HI4A 3R3VA 1SOMA 4MJ3A 1ZI9A 1FFDA 2IITA 2WIFA 4GLBA 3WL6A 1BEEA 2JGJA 1R9NA 1K6EA 4JUIA 1HDEA 4LHEA 3H1AA 5JAUA 2DQZA 4L0CA 3D3NA 4MWSA 4KE8A 5ALIA 1TRHA 1UFOA 3OG9A 4J0JA 4GWLA 5EI5A 3QMVA 2XUOA 1YA4A 5DTIA 3S2ZA 4UFNA 5ALWA 4X94A 4P92A 1CUVA 3BL8A 5FUMA 3AFIA 3WK7A 1ZJ4A 1IUNA 1F6WA 1CFJA 5EHXA 3A2MA 1CUSA 4U2DA 4LXIA 5IVIA 1YCDA 1E8DA 3FYTA 3WZMA 4P9NA 3G8YA 3I2GA 5HZGA 3Q8WA 3DJYA 1XKTA 2EEPA 3I1IA 5JD6A 5ISMA 2ZYSA 1DINA 5FPQA 4QZVA 2OGTA 1VLQA 2CZQA 1GGVA 2QS9A 5LZ9A 1WPXA 2WHRA 5ALFA 1JJFA 3SK0A 3QM1A 5ALMA 3PDCA 2WSLA 3PFBA 1JU4A 1CLEA 4B9AA 1LZLA 1CUEA 4E14A 2XMSA 4FBMA 4AB1A 4F5ZA 4H7JA 1U4NA 4DSAA 1UK7A 1BRTA 1YAJA 3WA6A 3D59A 5KWIA 2OCLA 5AI9A 3DKRA 3ZLTA 4H77A 4QDXA 1XRLA 3A6ZA 2J3DA 5DYYA 4DMHA 3RK4A 4KE9A 4EY8A 4B84A 1R4ZA 4W63A 2XUHA 1VZ2A 2HA0A 5IKXA 4UBIA 3BXPA 1YAHA 3GUUA 3G9UA 1WB4A 5KBYA 1I6WA 4X85A 4FNGA 1MAAA 3LP5A 1CUCA 2CB9A 1CUGA 3GROA 5A7HA 4CG2A 4JEIA 4DNPA 3KOOA 3K9BA 4BCDA 5CT8A 4HVTA 2XQFA 5AHXA 5AO9A 4GXNA 3BE8A 4RE6A 3CN9A 2VSQA 1C7JA 1EDEA 3E3AA 2O2IA 1EI9A 2BAGA 2WQZA 4Q3LA 1JJIA 3NGMA 5E4TA 4BCCA 4L3WA 1CV2A 2OQIA 1GQRA 3H2GA 5IVHA 1H22A 3CXUA 4X3CA 4QWWA 4XX1A 4MYDA 3QMMA 5C8ZA 2ACKA 4G8CA 1QIHA 5CXXA 1QONA 2WJ6A 5ALYA 2R11A 4F21A 3FCYA 1AKNA 4C6HA 3M81A 3CN7A 3FCXA 4B0PA 2XLCA 4HZGA 5DYWA 5JAOA 1SC9A 3E0XA 3KDAA 2PKYX 2CKMA 1T4MA 3BJMA 5DTJA 1FFCA 4OPMA 1YR2A 3GBSA 3KSRA 3IURA 4FMPA 4DSZA 2XUDA 3WZLA 1IMJA 4Y2UA 5ALLA 4LKOA 4D9JA 4NVRA 1XQYA 4AMYA 3WK5A 2ACEA 3DS8A 4BRZA 2ZYHA 5JATA 1ZI8A 3OM8A 2H1IA 2ORYA 5EIAA 2NW6A 1AX9A 3FYUC 4FWBA 4L9AA 3HC7A 5AKXA 3WIBA 4JH0A 5LZ2A 4FLEA 5D3ZA 5LZ8A 4HS9A 4C87A 5AIBA 3K6KA 5C8VA 2W22A 4RPCA 3WWEA 2XMQA 3R3YA 1EH5A 5CH3A 2G63A 3WQHA 5K3AA 3NOXA 1YASA 5ALPA 3WK8A 1F8UA 4XWGA 1BN7A 1E5TA 3BF8A 3ILSA 5ALRA 4WY5A 3AIKA 1R88A 3H17A 1MX9A 1PJAA 1AQLA 2EDCA 3ESAA 5LKAA 3G0DA 3X3HA 3DCNA 4DNFA 4UPDA 5E4JA 2ZJFA 3DYIA 3L1JA 2I3ZA 3C43A 2WUDA 5EHNA 4DMCA 3O9MA 1Q0ZA 4PV7A 4G9EA 1ZD2P 2XUQA 1IVYA 5T4HA 3G0IA 2WU4A 5HFAA 3PE6A 4N5IX 3UUFA 3ESDA 4IH9A 4J0DA 4PSCA 3C87A 5AKIA 5A6VA 5AICA 1MNQA 4B9EA 5CRIA 3O4JA 2VAVA 1ZIXA 2PPLA 2RIPA 3O9VA 5JAPA 4UFPA 4BVJA 2FUKA 3LLCA 4ZWNA 2JGKA 1ZD3A 3RARA 3NUZA 1UKBA 3O95A 5AM1A 5AP9A 4NS4A 1AURA 5K3DA 4BAUA 4C89A 1SCQA 3BWXA 4YPVA 2Y2UA 5HF6A 4FNMA 3A2LA 3GA7A 4PW0A 1GPNA 1LPPA 2WU3A 5SYMA 4FLFA 1KEZA 4HXFB 1UK9A 4BYMA 4QDOA 5ALEA 2VJCA 2WFLA 2PSHA 4A5SA 3G02A 5JARA 3V1KA 4U2EA 1J2EA 2HU8A 1CR6A 1EHYA 2VATA 1XKLA 3H2HA 3O0DA 5AI0A 3DD5A 4GECA 1YA8A 4Y2PA 2HFJA 1ZI6A 3OPMA 2O2GA 2IIVA 4UBKA 5A71A 2XUJA 3EQ9A 2PBLA 2HFKA 4G1FA 2C5GA 4TGLA 4I3FA 2G4LA 1VA5A 1VKHA 2HA6A 5HK9A 5K5EA 5CT6A 4H0CA 2CJPA 1VOTA 5BWCA 4PO3X 4HTAA 2YYSA 1BU8A 3F98A 5JASA 3EQ8A 2XUPA 5CTAA 1GPLA 2XB6A 3HJUA 5AI6A 5JD4A 5DNWA 5K3FA 2ES4A 2OCKA 4HRYA 4OB8A 3VISA 1FFAA 2XDWA 1XRQA 4U2FA 4Y2RA 2VTVA 2ONCA 4HXEB 2OGZA 1TCCA 5CXUA 3WIOA 2VA9A 5YASA 3AZPA 4DM7A 5AM2A 3C6BA 5ALOA 4MQMA 2CMFA 3AJAA 1AGYA 4MYSA 1EB9A 2V97A 1MPXA 3GFFA 4YASA 2Z5GA 4O08A 2WFLB 5HKBA 2AJ8A 1QOZA 1ETHA 2JGIA 3V9AA 2AJCA 2HIHA 4S0XA 3Q0TA 5AIAA 1DX6A 3B12A 4HXGA 3H2JA 1M33A 1DTEA 2DHDA 1YSCA 2FJPA 1QZ3A 1ZD5A 4BBZA 2J4FA 3MUNA 1J1IA 5D3KA 3FSGD 3C45A 1XZKA 2PVSA 4EUSA 2HA3A 1CUWA 2BUAA 1TQHA 5KWJA 3ESCA 4H7FA 4WFKA 5IVDA 2Y2VA 5DWDA 5EHQA 3H0CA 2RONA 4QE3A 3R3UA 4J03A 1LPSA 1Y7IA 5JALA 1WHTA 3CCCA 4GBGA 4UHCA 2QZPA 4AMZA 3OTQA 3PUHA 2WG1A 4X95A 5K3FB 1CQZA 3WL7A 2YH2A 3WJ2A 4CIAA 2XI4A 4UUQA 4UHHA 2R8BA 3STWA 2JEZA 4UBNA 3ZLVA 2HL6A 3AZOA 4H7EA 1JFRA 5J3JA 3G9XA 5LZ5A 3DLTA 1Q84A 1QIJA 1DQYA 4X71A 1XLUA 4G5XA 1FFEA 4IH1A 1VA4A 5AKHA 3HEAA 1JI3A 1CUDA 1HLGA 1ZGCA 3WKAA 2OLEA 4WDQA 1L7RA 4EZIA 4Z49A 1QIDA 2UZ0A 1LPAB 4MXDA 2XMBA 3DQZA 5EFZA 4J0CA 5CT9A 4CCYB 3PUIA 1BS9A 5ALKA 2DQYA 4BZWA 3VVLA 3ESBA 3IVMA 2ZSIA 1AC5A 1QE3A 3LS2A 1UOOA 1VE6A 3I2IA 2XLBA 2QT9A 3O4IA 4OCZA 2CUTA 1LBTA 2W6CX 3QPDA 2Z8ZA 4H35A 4FOLA 3IB3A 2B20A 2WUFA 1MU0A 2G5PA 4KE6A 3WK6A 1EX9A 2O7VA 4EB0A 4X7BA 4Y2SA 1XFDA 4OU5A 1LPBB 1X2EA 4Y2XA 1JT2A 2PSJA 3KWJA 4KRYA 3WWPA 1NX9A 3WWDA 4RE5A 1K8QA 1USWA 1J07A 1XRRA 3HRHA 4ROTA 1B6GA 4OUKX 2PU5A 5CW2A 3C5WP 3VJLA 3FOBA 3T4UA 3EQ7A 4TPKA 3FAKA 4KAJA 5AM3A 1VJ5A 2XUFA 3C6XA 4E15A 3C5VA 3WWOA 2VEOA 3WKEA 2YXPX 3I2JA 5A7GA 2BUCA 2VT7A 4CCWA 4AN1A 3FYUB 4BTVA 1CRLA 1FFBA 3V1LA 1ZJ5A 5AM0A 4UHDA 1G42A 1QGED 3QPCA 1LZKA 3WA7A 1UOQA 1Y7HA 2WKWA 4QLAA 4UFOA 2LIPA 2XT0A 2BGRA 4PNZA 5AKKA 4AO7A 1E8MA 1MJ5A 1H2WA 5CT4A 1TIBA 4DIUA 4BE4A 3I6MA 4KACA 4KR0A 1W4LA 1TKRA 4ARBA 5C8XA 1RYYA 2WIJA 5CH8A 3PICA 1LPMA 2RI6A 2GYUA 5CT5A 3WWCA 1CUUA 4CI9A 3D7RA 5AK5A 5EGNA 3FSGA 1QIIA 4JYMA 5AOBA 5AOCA 1G66A 1XZMA 2WG2A 2ZVDA 3DYVA 4H18A 1XLWA 1G5FA 1XZHA 2QXUA 1S8OA 4J0GA 1P0IA 5ALDA 3ICVA 2GBIA 1ZICA 3C8HA 3SWWA 3AILA 4BP9A 4G8BA 3RLIA 3M82A 1AZWA 1GKKA 1A88A 4W1RA 1NU8A 1WB5A 4FHZA 1MAHA 1F0PA 4XJVA 4WJLA 3ANTA 4NZZA 5E4YA 5K3BA 3VJMA 1XROA 5FXMA 4AO6A 1H2YA 1WCYA 5FKJA 2Y1KA 3IULA 2J3QA 1YB7A 5JIBA 4H7IA 3A70A 4AQDA 1BEZA 2FX5A 2I03A 5ALJA 1YB6A 2HRRA 4F0JA 4PSDA 1TCBA 4KYVA 2ZJ7A 4AO8A 1WHSA 1MNAA 5ALVA 4KRXA 2H7YA 4QNNA 4K2AA 4DMFA 3I2FA 3D2BA 4E11A 1UXOA 1GZ7A 1DT5A 2VQ6A 3UUEA 4QWMA 5FRDA 3BF7A 3IA2A 3VJKA 1XQWA 3GZJA 5JZ9A 1IZ8A 1MT3A 5EIHA 3WK4A 5AKYA 1DWPA 3IBTA 6YASA 3ZV7A 3QZUA 4M0FA 4DTCA 4G9GA 1A8SA 3WKBA 2C58A 3F67A 1XZFA 4LIPD 4BATA 3STVA 4DMKA 4M0EA 1A8UA 5JAHA 4C4ZA 1PV1A 4Q3OA 4WY8A 2HM7A 1DU4A 1EK1A 4BAZA 1CUHA 4G4GA 2OG1A 5FPPA 1G4HA 1CUIA 5AM4A 1GPKA 5AKLA 4N8SA 5A62A 3B3QA 5CH5A 5EHZA 3N2ZB 5ALHA 3DL7A 3V1NA 2HA5A 4X97A 1QIMA 1BROA 1EDDA 2D0DA 2HRQA 2QUAA 4J0HA 4W1PA 1JU3A 2OAGA 3QBJA 3C6YA 1R50A 2WUEA 2RHTA 1JMKC 1ZGBA 3YASA 5ESRA 4AZ0A 3KXPA 4GI1A 4IH4A 4EY5A 4B6GA 2B61A 3BJRA 1UZAA 2WIKA 5HF5A 4BAGA 1BE0A 5ALZA 4CG3A 3AIOA 4IO0A 2XQJA 3R3ZA 4GHWA 5I8PA 3WKDA 2QTBA 2H7CA 1F0NA 3ANSA 2B9VA 4UHBA 3ED1A 1E8NA 2XMCA 2DR0A 3H19A 2C0QA 4UBJA 4B82A 1SFRA 4ZV9A 3KD2A 1CUFA 4J3JA 4G4JA 2PX6A 4MEBA 3DKKA 3AZQA 4G8DA 1GXSA 5DYTA 4I4CA 1MN6A 1BN6A 3L1HA 3BIWA 3ZLUA 3FLEA 1N5RA 3D0KA 3W05A 4B83A 4YK7A 1XZCA 4Q34A 4DLNA 4K5QA 1W6RA 1DQZA 4EY7A 2WILA
chains in the Genus database with same CATH superfamily
5G1OA 1NUAA 1V7PC 4CZ2A 1XA4A 1TQ6A 3ET5A 1M75A 3Q40A 4E2XA 4M0DA 3KJXA 3LXXA 3WB0A 4ZAFA 1RAFA 5JI2E 1W93A 2FSVC 2PUHA 1O1YA 1JJBA 1P80A 2AOUB 4YV2A 2C2GA 4ESVA 3BC1A 8GPBA 2W2MA 1JDJA 1DFGA 3QIAA 1A7UA 1WXIA 2Q1UA 1XZJA 3FMGA 3O8BA 4ER5A 1JX6A 4CDNA 3LDAA 4H0NA 4U7FA 5K0FA 4KGZA 4PC3A 4XGKA 5FD8A 4B6QA 1FP2A 2OA0A 4CM5A 4MKZA 4QJBA 1GPBA 4TTQA 3HV2A 1E9RA 1ZQ9A 2EWMA 3UFXB 2ZIGA 3R3WA 4US1R 5EKTA 4DAOA 1RJDA 4IXMA 1R3DA 1WQ4A 1NPTO 3R40A 1JHXA 3QE0A 1EP2B 1TKBA 2NO9A 4UHKA 2Q9CA 3TW6A 3PEYA 2QLTA 2VQ3A 5HTKA 1UWVA 4YC7A 1SUBA 3CNLA 1ONBA 1LGYA 1MV8A 4MVJI 1RZVA 4YRTA 2HZ7A 4D1YA 5KPJA 2ZM5A 3KB1A 1ZH0A 2K6GA 4MYRA 4EY4A 3NJRA 2QUZA 3CJRA 4PAQA 3S2SA 3ICWA 3IBSA 3AKCA 2VOEA 4BPRA 2HBZA 1VG9B 5JXGA 5LZ4A 2ZT7A 2PZEA 1OBHA 3HXPA 1Y1KE 4B87A 4FDLA 3RHZA 3AF3A 2J30A 4CF3A 4RMNA 4KQCA 1I0IA 2YZ2A 3LWDA 5IUNC 2WZBA 4Q3AA 3UJHA 2ODTX 3L6CA 4UC0A 4JIMA 1G3MA 5B4UA 3HGQA 4Q3NA 4IUDS 4Y9SA 4K81B 3U5ZB 1KP2A 4BVEA 2DWUA 4OXKA 4ZEMA 2VQSA 3EC7A 1Z4NA 4OJMX 2HWWA 4CTNA 2VJAA 5LQJA 2OYRA 2CE7A 1HFJA 1D2AA 3MMSA 2AX3A 4MDYA 5IAKA 2OV1A 1DKPA 4P82A 4R7TA 3X1DA 1U7TA 3KQHA 1RBQA 2G7ZA 4CCYA 1R9MA 1TJNA 1AF7A 1NM5C 4IJUA 1D2HA 5K8IA 2I78A 1FYFA 4PIMA 2F64A 3V8VA 1JEDA 2X0NA 4XDGA 5DBFA 3WMFA 3H04A 4CMKA 4EW3A 1TPYA 5IXJA 2XVYA 3IUQA 621PA 4E0BA 1XZIA 1RBYA 4LX8A 3NP7A 3EZ7A 4MGHA 1U94A 3VQTA 1QIGA 3E4DA 4K88A 5FBHA 2O05A 3BDIA 2YZNA 5JZVA 1AQ6A 3IXLA 1DC3A 2FEOA 1OYVA 2WUGA 3KZKA 3HDYA 3GJ8A 3NFYA 3TX2A 3BE5A 1C80A 5FWAA 1TLTA 2J41A 5FT9A 3WZLA 2I22A 1IJBA 3GELA 4BNNA 3IOEA 4Y6QA 3A4NA 1DC5A 1MEEA 2H11A 2GO1A 2OO5A 3AYXB 3D3EA 5CM9C 3WV4A 4O1MA 4WCVA 4PF1A 1U0EA 5K3SA 3WGKA 4ZD6A 4YXWA 4CU2A 1WABA 1PR1A 3HCPA 1NPDA 2X86A 5NULA 2PKCA 2WIGA 2H52A 4E09A 1PD1A 4G0WA 1O6BA 3C7AA 1WUIS 2BFCA 4H6PA 4MQ4A 2IQ5A 3WBKA 4A6PA 1ODTC 4AJNA 4E94A 2P8SA 4NX2A 3VH4A 1XG5A 2YINC 1I7NA 4JP3A 2AT1A 3U39A 4G1UC 2GN9A 2IHYA 4JBGA 3FR8A 4CW7A 2X2OA 1RYZA 1VJTA 2EZ9A 2VA8A 3CLRC 3EWIA 5CEEA 3M0EA 1WE2A 3WGHA 2B4KA 1NN5A 4UCFA 1A9PA 5AKEA 1QOPB 4HQLA 5CLHA 2CLMB 4HUQA 3RLFA 1VTKA 4C4YA 1A96A 1A2OA 5WRFA 3UMFA 3VI4B 2HSWA 3CU5A 3DAGA 1DTWA 1U7UA 2I62A 4FOOA 2XPCA 4HYQA 2OZLB 2F9MA 1K68A 3TEJA 2W37A 3CM0A 5LP6B 4Q9HA 3BAZA 4YT4A 1E0SA 2PT5A 4PZ0A 5IANA 2JLUA 5HIAA 4D9BA 2ZFUA 2HK9A 4KAAA 1N2CA 3K5WA 3M1AA 1RYMA 3A31A 4LYEA 4M55A 2KBEA 4NE2A 1GUAA 1TX4B 4FEAA 4KLAA 5JBIA 1ULSA 2PUJA 3NDJA 3H1BA 4G0NA 4Y0VA 4ESHA 1DAKA 1Z88A 3DO6A 2MDTA 3AHDA 1OUMA 1J90A 1E4EB 3T1TA 5E0KB 5I9SA 5K2OA 1KRHA 5CPBA 4II2A 2WRZA 1JDUA 1YL7A 4K6KA 5LD2C 2JIMA 6GPBA 2AJBA 5KNBD 1N9GA 1FY2A 3SSAA 1U2PA 4E03A 2ATCA 2AXNA 4R54A 1ZMXA 3UPUA 4OVKA 1ZISA 4NMMA 4F2HA 3AEZA 4KNYA 2V1XA 2IZ0A 2J5RA 5MGBA 4JGBA 4Z1OA 1T15A 4EITA 1WULS 5EPUA 4X61A 4U39A 3S81A 4PFJA 1BW9A 1GFZA 3HKBB 2HADA 4YJKA 2HAEA 1LLUA 4MCHA 4E07A 1GRCA 2GFIA 3ZJTA 4R9VA 1M6NA 5FOTA 4HGRA 5TGTA 3KDPA 4L16A 3UJPA 4BC1A 9ATCA 4P1ZA 5A9TA 1ZC3A 1JVSA 5ULLA 1QP4A 3RSHA 1J06A 3D0RA 3DFMA 1Z2PX 4U63A 3RRXA 2JH8A 3HXKA 3RVDA 1WZCA 3I53A 4BLOA 5C3UA 1OH8A 1GKYA 1KPIA 1ZS9A 1XRPA 4WKGA 1YU9A 4TV9F 1YR6A 1Y9DA 2PD3A 3AH8A 3DLAA 3FOWA 3L8ZA 1OX4B 4GRDA 4RF2A 2B9EA 1THTA 3QFHA 1HRDA 3O8OA 4HWSA 4O8ZA 4B8ZA 4FJ0A 4IZOA 4PYOA 4HSEA 4REQA 4K46A 4ENTA 2IS2A 4W9MC 1W19A 4KQ6A 5KKNB 2JKZA 4MA0A 4HDAA 3OUZA 4JP2A 2FFAA 4B71A 4LV6A 1CIJA 5E3IA 3MOGA 4DUGA 2DSTA 2X6RA 2WTNA 4LHVA 4MQLA 2HBRA 4L6IA 1P81A 2IWHA 4NBUA 4ND6A 3VR5A 3ZBPA 4UDXX 1O6GA 2QD1A 4I1UA 4HG2A 4CMEA 1ZD4A 4LZNA 2ZZNA 1P39A 1XAGA 5CXQA 5DIFA 4DV4B 3K0AB 1NDHA 4P38A 4QPZA 2R1ZA 3I2HA 1RRPA 2Y6VA 5JBQA 2WSSA 4X64B 1KGSA 1C50A 2WQ6A 1X1QA 3BGOS 1Z82A 1C3LA 1G9TA 4EFMA 3A1DA 3ZCQA 1W1WA 3ANNA 5F1KA 4TLDA 1RC1A 2BJWA 2EKQA 1GPAA 1D4OA 1TEVA 3HZZA 3QPUA 4PQFA 4ZAVA 3F4KA 5CB6A 3O8NA 3CE6A 2VN8A 3FVVA 3F73A 4URHA 5HF8A 2GAOA 4CMCA 4JBLA 5IBQA 4LF8B 2AH5A 2EAUA 4Q9DA 4F3NA 1MV5A 4YCBA 3W2IA 4AZSA 2CEKA 2VLBA 1JFTA 1Y81A 2WAMA 5CEJA 1C4OA 2EW1A 3PIRA 3HB1A 4Z6KA 3KXIA 3OE7D 3R1IA 5A2GA 4FQ8A 5M2QA 3FPKA 1MORA 2AR0A 2IXAA 1WOMA 4BNMA 5U1PA 3KZOA 4YAOA 1VL0A 4XWWA 2P11A 3CW8X 3D3WB 3IQIX 3GEGA 5CX4A 4I55B 2HJHA 2Z98A 4HNHA 3KTAA 2VBIA 1BDHA 1C7IA 1HTTA 4XWTA 3V4FA 2VCHA 3REQA 4DREA 2P6RA 4NC9A 1L4BA 5G0WA 4M1TA 3FKQA 2OPHA 1KU0A 1A4RA 1ST2A 4MS1A 5C51B 1W36D 3LCUA 2JI8A 4LS3A 2QX4A 4ML3A 4TWZA 1Y63A 3PR1A 2XQVA 1KJWA 4TWJA 5JJIA 1LDEA 1FJ2A 2GZSA 4GVXA 3ZKWA 4DCGA 3OZDA 3ILHA 1BE6A 2F4NA 3C1UA 3VPHA 4YCLA 4YMHA 2QRKA 2L19A 1U9IC 2DSNA 5K1ZA 1ZMOA 4UVHA 4BECA 1PZMA 4QDTA 3AY7A 1Y33E 3HJNA 2QN9A 3QEMB 1LK7A 3TVDA 2Y0PA 4FK8A 2AWOA 4IM7A 3OD1A 4FHGA 5C37A 4M0MA 1VXOA 2N42A 3F6CA 4MW2A 3UUGA 4G0YA 1BCRA 4TT3A 1SCJA 2GMWA 2C1XA 3C74A 5BVGA 5F5NA 1W25A 1RI3A 3I76A 4JBYA 1JB1A 2JBAB 5EZYA 5KYTA 1OJ7A 3AEKA 1S9HA 4X92A 4CI0B 2AF3C 4Q4HA 4ZHQB 3GEBA 1A5AB 2A9JA 4NF2A 2PN1A 5KYUA 3FG9A 2O5EA 2ORED 5C7OO 3MXTA 3B78A 1ZR2A 1DJMA 2QOEA 2ZS7A 1N0VC 4MYUA 3V1YA 1VPTA 5JSZB 3PXEA 4MS4B 1VKNA 2YTZA 4D81A 5LZ7A 1KSFX 4JJAA 4JT2A 2CBGA 4JUBA 4W8OA 3UENA 3HHEA 4D44A 4DHEA 2XMDA 4ZJZA 4TN5A 4EO4A 4ARAA 1KIAA 2SKCA 4JI6B 4CGZA 3K8ZA 3L9XA 4AX4A 3G5MA 3EX7C 5J2UA 1Z5GA 2VAXA 1QCZA 1DRWA 4BJ3A 1LU9A 2E4YA 3LUAA 3NIFB 4J94A 1TTTA 2OXEA 1VHJA 3HCDA 5FNVB 1H93A 5HDBB 4MQFB 4D25A 1U65A 3OZBA 4B3DA 5AW7A 1IG0A 2WSIA 3EZFA 1BOOA 3WGZA 3LDUA 3RS4A 2EFEB 4EEZA 2PM8A 1VRVA 2CFRA 1Q0SA 1CFZA 2HSZA 3VR3A 2I7VA 4XGNA 2HJ9A 4J6EA 5B55A 1THGA 5BXYA 2R5FA 2RAPA 1D0SA 4CUZA 1QHSA 1H2ZA 3ML1A 2I7CA 2P90A 4O2LA 3TTYA 1N25A 3RHFA 4L75A 4F9TA 4G37A 2JD2A 1ADBA 2CBXA 4FCWA 4YP1A 1U2DA 1YL6A 4JJEA 2JGFA 5H4HA 3B1WA 1KSGA 4EKIA 3FCAA 5B6IA 1AHIA 3QKRB 5HFNA 2FE1A 4M7RA 4HH1A 4D8YA 4I9FA 1HL7A 1R18A 1KQNA 4JL8A 4DNOA 1A5ZA 1YS2X 4QUDA 2KX7A 1GT6A 3PHGA 4HFNA 1JXAA 2G1UA 1M6VB 3EIOA 4LDQA 4PFQA 3EB9A 2Q9AA 4TTIA 1WMBA 4ZGBA 2H2FA 2FN7A 1G3UA 4E6EA 1R0RE 2VYCA 2DU8A 2RGXA 4TXHA 4JA0A 1E9EA 2OQRA 1OFGA 4FN4A 4Z9BA 5AUNB 5FA8A 1A0OA 1EVQA 3H2YA 1LI5A 4PTZA 2NQTA 3ZWQA 2M98A 4RVDA 4M0CA 4AXBA 4CLOB 2QY6A 2R47A 2WT8A 2C88A 2C5EA 1H1LB 3S8EA 3RIMA 3VM6A 3WS7A 1AKEA 1GPMA 4OB7A 5IN5A 1E61A 2FTKE 3E3MA 3KLNA 4XDZA 4XSGA 5HCUA 3C3KA 2FOIA 4AJEA 3K73O 1F1BA 1YRWA 4XWAA 4JR0A 2JAOA 2C0PA 3HCNA 4LPKA 4OOFA 3ICQB 1GTMA 1TMYA 2A67A 2H92A 2I4OA 3RVQA 4EQ6A 3QLEA 4R69A 4WNIA 4YAFA 2PGXA 4V0ME 3O38A 1B41A 4JT8A 2YJ3A 3BHMA 4Y9RA 2PCJA 5FLKA 1RI4A 2HMTA 4ZKEA 3WK9A 3V3TA 5A03A 5KVVA 4FGZA 1I13A 2AUTA 2IBMA 1SKMA 3OMLA 4NONA 1CJKC 2JLQA 2I91A 4O63O 3VNBA 3LG2A 4ZALA 1VHDA 4KPUA 1LBSA 2Z3VA 4ARCA 2A0WA 4TRNA 1F9EA 1DIAA 3S28A 4EKGA 4QHYA 3A2NA 4DJ5X 1KWGA 1G64A 1O96A 1GL3A 1SH7A 2WHPB 3I6QA 3IJRA 4PLCA 4S1TA 3CTPA 5CA0F 5FPKA 4BB0A 1EGVB 2X8WA 2VHYA 2E3JA 3G68A 3H65A 1XZAA 3OLZA 2OQVA 3AXTA 4DSOA 1TFUA 1Z5OA 3VSDA 3EGXA 4P83A 1NLUA 5BPHA 1UKYA 3ONWA 3KT6A 1CPYA 4Y2GA 3UFBA 4YBRA 2VDVE 4GGMX 5BMVF 2Y68A 4DR5B 4AP9A 2J31A 1K9VF 1JLKA 2O0HA 1SXQA 1IQRA 3ZWWA 1JA0A 2C9ZA 1HT0A 1SPBS 2DHEA 3HA5A 1X3LA 4ND3A 3TRFA 4EF4A 1Z36A 3X1YA 4BX8A 1W4CA 2P3QA 3C5EA 3OC0A 3WJ7A 3F7OA 4GW3A 3FFTA 2ECFA 4LZZA 4ERXA 2BFDA 1JMYA 1E0DA 1JKFA 2J87A 1K27A 1Q83A 3I4CA 4RH1A 1DWQA 1Z0DA 4BNLA 2II6A 3TZHA 2G9UA 4KI7A 5JR3A 1CUZA 5MGNA 4OQEA 1W48A 4PINA 4XDYA 4ZOCA 3V8NA 1N8SA 4G0XA 1PR3A 4RDXA 1NXPA 5HQ3A 3UKOA 2X5XA 2NPOA 3B3AA 4D02A 4HBZA 4YRKA 1ZITA 2VNIA 1EK2A 3QLVA 2X2PA 3ROXA 2ENUA 1UAGA 3B1FA 1YB1A 1YZGA 2FLWA 2GK4A 2JIQA 1WM1A 2NQ8A 3C3AA 1NVUQ 1U8XX 2WF6A 4ZCPA 3ZI4A 4CQNA 2BRUA 1HZZA 1NVVQ 2GSWA 1RXIA 5LLTA 5I6DA 3NH6A 4B80A 2A5YB 3ZDYB 2VZ0A 5B2EA 5LC1A 3IEVA 3B6MA 1UT6A 2QRLA 4G4SP 3PFCA 3H87A 4ZQIA 5A5GA 2MSEB 5C7IO 5I7HA 1D6JA 4G36A 5EIEA 1D4ZA 3PQEA 5KJ6A 1LSOA 2FGJA 4B76A 1ESZA 2ZUSA 3B3JA 2VPIA 3JARA 3KSBC 3UBTA 1Z16A 1GT91 4I4TF 2C04A 2I6QA 4J29A 4Q5IA 4ZI5A 2HDWA 3ETCA 3O1JC 1X1EA 2VUHB 3FIJA 5FAXA 2JFXA 3ZD9A 2IP1A 3T99A 1DT3A 1QVRA 3MD9A 4OI0A 1YZFA 2NSLA 4FPXA 5LQSA 2ZREA 4R1QA 4ZXFA 2PSDA 1QM5A 2BM1A 4B31A 4BMXA 4BO5A 1EVKA 2J6HA 2ZQYA 3R6LA 1AZLA 2AOUA 2Y27A 3T52A 2EZUA 4B8YA 1TYZA 3I1YA 2WLSA 3NXSA 1J23A 4HGZA 4WERA 3TVYA 1M73E 1YDHA 2ZUEA 1U2EA 3BB4A 1ML4A 1NIJA 1XLVA 1RE1A 1TDJA 1A95A 4RTNA 1M6HA 1ZFNA 3N28A 2O06A 3TAUA 1QGOA 5C4MA 1N6HA 4R7ZA 4U4AA 2WNSA 2WE8A 2HQ1A 4EEXA 4KMSA 4Y6LA 5AVZA 1WB9A 3LIIA 3QLJA 2ADMA 1YONA 3IC5A 4L9WA 4HAIA 1RMTA 3W5BA 3M3HA 3DOHA 3BDAA 5AVWA 3T3HA 3KJNA 4FR0A 1OFVA 2JIRA 2YIDA 5D3MA 3VHRA 1K3FA 5H81A 4ZEOA 3VTZA 2ZBVA 2Q28A 1HBJA 4HFRA 4NENB 1OU0A 2WA2A 3EPRA 3SSNA 3K1TA 4CMIA 5I7SA 3H5LA 1TT7A 4AJ2A 5AW1A 3RAJA 4PCAA 5BPFA 1PQYA 4U00A 4LMBA 4PRYA 2QQ5A 4XSHA 5BRJA 3DSRA 5KYVA 1PJ4A 2CVZA 2MHCA 2WTBA 4NESA 1OWNA 2FR1A 4H6VA 4NK4A 4H1HA 2B7BA 4FUQA 1SBZA 2NIPA 3WIUA 3ZGOA 4BLVA 3BKWA 3KTOA 3R76A 5FBLB 1U0BB 4QEZA 1B0UA 1OXVA 2VWHA 4HGPA 2Q5EA 3SC6A 1MW9X 2Y1LA 4IDEA 2QD3A 3NWOA 3OHMA 1CRWG 5CM2Z 4YI3A 2WU0A 1DNPA 3SC4A 2FLKA 4Z7JA 1KYXA 2AEFA 3GD5A 5TX7A 1M1XB 3CLHA 3ITDA 4UVEA 1DLJA 2YQZA 3JQ8B 1MFPA 3OUTA 1JLSA 2J8ZA 1MG5A 1P0PA 1L5GB 3SQXA 1YBAA 3F9RA 2GYYA 3M5DA 2AW3A 2QWXA 4NCKA 4WACA 3C3PA 1LXCA 3GHHA 4RESA 5HM6A 3DYBA 2FGKA 1M2VB 4DQKA 3IA7A 1FCJA 3T1YB 3L0YA 4QA9A 5GVSA 4BQRA 3DP7A 3OOWA 1UT8A 4TSFA 2ZUFA 3MWKA 2DJ5A 4BQSA 4L4RA 3S8YA 1JKIA 3HY6A 3CYFA 3CKMA 3OBIA 3LSTA 4JB2A 4Q3CA 5GOTA 1F8YA 3UJDA 3WDLA 3ZCPA 3W7BA 3NNNA 5BNWA 5FJJA 5DVZA 1BGVA 2ZSHA 3NKFA 4BJ1A 3U4CA 3NONA 3Q7SA 5BOSA 3T7JA 2CNOA 3F6YA 3LQ4A 1WPRA 2AHRA 5FOWA 4JR1A 1Q1ZA 3NHLA 2GYVA 4R8LA 3AY6A 3O91A 4LXXA 4S04A 3B7WA 2AKEA 3HEMA 3FGPA 4I8IA 1ZZEA 4MAAA 3RF6A 5I7VA 2FJUA 3ANXA 4B34A 4MWEA 1MB2A 2Z6VA 4QOEA 3L6RA 1BWQA 4G0OA 1X1BA 5FOXA 3UICA 4R0MA 4Q9JA 3B1YA 4PTYA 4JXZA 5MDHA 4TWIA 2XKKA 1KPGA 3JQPA 4K6CA 4ZQBA 3WL5A 4LGVA 1Z5WA 4ECAA 3QE2A 3JWEA 2ZJ6A 4YBZA 3TDMA 3EXEA 3MCZA 1YIOA 3SFVA 3ZW9A 4BVKA 1E5LA 4P8RA 4BMPB 2WKSA 2GBGA 3BEDA 4S1PA 3TXXA 1X1RA 3BXGA 4P80A 5CIQA 4YPOA 5EE5B 4AI6A 1Y6RA 1GTZA 2HA4A 5CIYA 2CUNA 1OHHA 2IPLA 3RFVA 1JSXA 2A59A 3IVXA 3RAPR 3RKSA 2A9KA 2D74A 3KAPA 3GWGA 1T2EA 1CEEA 3K0CC 1HTBA 3G5TA 2OZEA 3PRYA 4EJSB 2VYQA 4PGHA 3NHMA 2ZB4A 1KIFA 1YMQA 4JBHA 4IDDA 1I3CA 2R4UA 2OOKA 2ZRIA 4B7ZA 2JGMA 4MTLA 5A3VA 5FA5A 3SZLA 5SYNA 5ETJA 1O95C 1UKAA 4KSBA 1QLWA 2GGSA 2LGJA 2FUCA 3TQHA 4G5QA 1V2HE 1Z08A 2AEMA 1C9JA 3LHIA 2I2WA 4QYIB 5FV7A 5FDFA 2Y4NA 3USCS 4JAVC 2AL7A 4L7VA 5B1SA 3TKAA 3ETLA 1I2AA 3HTXA 2DVMA 1X8XA 4WSOA 4UCXA 4ZPXA 3KSZO 1KOGA 3T5MA 1ECJA 2CNLA 4X91A 2R6JA 4QJ3A 2W2TA 2V7GA 2EIHA 3QJGA 3D2AA 4GDFA 4AICA 2CNWA 2Y1FA 1V9SA 3NWBA 5B3KA 3K70C 1PFUA 4D41A 3MGAA 3AOEC 1CW2B 4WLOA 1RPNA 2PS3A 1QYRA 1HQKA 4X6LA 3JQGA 2O7RA 3QXSA 4I1IA 4KQ1A 1SC4A 4EKDA 2ZJ8A 4IGKA 2FUEA 3IMGA 1TJ4A 1PK8A 4K7JA 5HA5A 1QG6A 4ZTBA 2WTUA 3FLBA 3H4IA 3A1UA 1VPLA 1YI8A 3FDXA 3NUGA 5DLPA 4BX0A 4XM1A 1THZA 4AFNA 3LJKA 4CMGA 4L4UA 1AUXA 4IQ4A 2C8LA 2W43A 1OX4A 2WEKA 5SZHB 5KVQA 1W6UA 2H9IA 3TIVA 2WJYA 3IX7A 1L5ZA 3A1EA 1EVJA 2D3WA 1BKYA 1NHGA 2VYNA 4GM4A 3CZ4A 3AHCA 5HFJA 4B81A 5H8WA 3UGQA 4KVGA 1YZHA 3O9ZA 3UAVA 4MUAA 2VJMA 3R20A 4JELA 3SR3A 5DB4A 3GCDA 1W76A 4AJLA 5DMXA 3A1TA 2CK3A 4OA8A 3KBOA 3HK2A 4OAPA 5TPZD 3WYDA 4D3XA 3R9WA 1NBME 1R6UA 3TG2A 4CQLA 1WX1A 1HQDA 3GL9A 3BE4A 4D0SA 6REQB 3KWFA 4QTUB 4JVOA 1E3QA 1IN4A 1I2MA 3FUWA 4D3DA 4EHHA 2Q2QA 1T6YA 1ILWA 4BCBA 1WETA 2O23A 4JA2A 4R81A 4UVDA 4JYZA 1SURA 4RV9A 1E3SA 4U9HS 4B46A 3ZJVA 4R1TA 2RGBA 1SOUA 4IEEA 4R8KA 1FNCA 4RSRA 3MTIA 4MWGA 4XCVA 2C4KA 1PF7E 1EVLA 4WFIA 3TBFA 2JHCA 3F97A 3WYGA 1EUDB 4NEQA 3FPFA 2XUKA 3FGNA 4YJHB 3RWBA 3ZPXA 3A4MA 2QLLA 5FP0A 4MARA 3TCNA 1LX7A 2ROQA 4II3A 1Z35A 3RVNA 5CJPA 1XC7A 4P3YA 2ODBA 1PGJA 1N78A 4INPA 1QH8A 2H1OA 2QQFA 3L6BA 5ALGA 3RKUA 3PZBA 3KSMA 1TK3A 4BP8A 4PLVA 3U9SA 1FUEA 2VFAA 4EGQA 1R8QA 3C3XA 1ULBA 4QRDA 1E6EA 1ZUIA 1GPJA 1ZW1A 2GHQA 3DULA 1TZCA 4W1SA 4P22A 2WVJA 3L0BA 4CHGA 4D97A 4D56A 5K8TA 1UWCA 1PVOA 2QRVA 5ENZA 1PX2A 2FZ5A 3I1FA 3LVBA 1VIDA 2J0VA 3B1ZA 3KJFA 2Z6QA 4DLZA 4EG8A 1K5DA 3NYQA 4N03A 1Q2XA 3R3VA 3WVNA 5FJIA 1A76A 1ZQ1A 2V58A 3K0FB 4ZFNA 1GV0A 1M1UA 1SA0B 1FS6A 1IXKA 1ZI9A 2I8CA 3MT9A 3DOCA 3PIIA 5F64A 4KQ9A 1FFDA 1KTVA 4IWNA 2HEIA 2IITA 3F0TA 1V1RB 1JEQA 2XKBA 5C2JB 5T41A 5C8YF 4GLBA 1USVA 2IH2A 3WL6A 1HT2E 1BEEA 1K6JA 1SUSA 2QLFA 1RM0A 1R9NA 1ONSA 4BB6A 1ADYA 1WEKA 3JQAA 4U1RA 5KOJA 3QPBA 4BQPA 4L2IA 3EWNA 2J67A 4L0CA 4B3GA 1P19A 4YUVA 1K8ZB 4E32A 3DOFA 4ZEWA 3W0LB 2HCFA 4MVJD 2JI9A 1NV8A 5CHYA 3S7ZA 5HW0A 4PE5B 2ZIVB 3WQSB 1RIIA 1UFOA 2F1JA 3OG9A 4R1UA 5DHSA 2PEZA 2ONJA 3PNYA 4EG3A 3B1XA 3UT5B 4F06A 1XCJA 2JBAA 2M6RA 1MJNA 2VHXA 1B2LA 1X6VA 4JEUA 5JJBA 1W8DA 1WXDA 1XEAA 2PXCA 3KYJB 4LFAB 4AG6A 3OU6A 1NQTA 5G3ZA 4B3JA 3D7SA 4P92A 5HZHA 1P2SA 3GYBA 3QPWA 5FUMA 2Z9BA 1VFNA 2L82A 4TQAA 1IUNA 1AT1A 3SHWA 3WK7A 3NVKI 1JZTA 2BM0A 4INAA 1JDVA 1CUSA 2JGDB 1F0KA 3TOXA 3THYB 3NJ8A 4LXIA 2BKEA 2I4NA 4PQGA 3GQVA 4AL4A 2FZVA 1KJ9A 2CZCA 5ICSA 1E8DA 5F35A 3LGXA 5IT0A 3K9FC 5TR9A 1JT9A 5G0TA 4EJFA 2PH3A 4B7CA 1GILA 3D0QA 3G8YA 1P61B 3BXZA 3VSCA 3EUFA 3TZQA 1DX9A 1YHZA 3Q8WA 3DJYA 2GQ0A 3OI7A 4UREA 5BP7A 4RY9A 1BVYF 3I1IA 4OMCA 2V3WA 5ITZA 3COVA 3LQKA 2JRLA 3QJ5A 2DBYA 5ISMA 1POXA 4N49A 1AHPA 3LHSA 3C3BA 3EIFA 3OTGA 1J2UA 1KK2A 1YE5A 3ZDXB 9MHTA 4EA7A 4NH0A 1T8SA 3OIFA 5FPQA 4GQIA 3W79A 1T1SA 1HDYA 3FZEA 3CQ9A 1U8AA 1GAQA 5KYWB 1C1DA 3G59A 2QS9A 2WNHA 4NI5A 2PVCA 3AB7A 4PO8A 3ULKA 3P2OA 3E5RA 2EJCA 3EUWA 2H2WA 3GGSA 3IQWA 1JJFA 2GAIA 1K7CA 3OETA 3SK0A 3UJAA 1GRVA 1WHTB 2FI1A 4RSMA 3RANA 2TMDA 4KO3S 1F7UA 2WSLA 3PFBA 1FSFA 1I32A 2VNSA 4S1NA 4ZANA 2Z57A 1E2IA 2WFAA 3X1JA 4CETA 1R9GA 3QKRA 4CIWA 2FFHA 2N0SA 4FEYA 3OQHA 1H4SA 3INTA 2CT8A 2H3HA 3ITEA 1KMQA 3MK31 4QARA 4AB1A 5I4IA 1KI6B 4TV9B 1GNVA 2NNWB 5L3ZA 2C3YA 1XCOA 4CLXA 8LDHA 4C7XA 3MEQA 1AN0A 4UXIA 2KW5A 5JO0A 2P40A 2XUZA 4H3VA 4XLLA 1YAJA 4UE2A 2CXUA 4NNPA 1XTQA 5AI9A 2JLWA 2A1TS 4PHFA 4Q4DA 3KQLA 2CL0X 1SEVA 4H77A 4EPRA 1FVHA 1R6VA 3O2NA 1DADA 2P1RA 2WI8A 3EVCA 2WHYA 3ANMA 5DK6A 3IUPA 1DC8A 1ZUHA 3OJOA 4MZXA 1XRLA 1L3BA 5BN5A 2FG6C 4L1KA 3VKGA 2XF2A 2UDPA 2CHVA 2J3DA 4UU1A 1H1LA 1U8YA 4Y3UA 4MUMA 3U1BA 1XPOA 4UMFA 4B5KA 1N8KA 3IOYA 5JCOC 2FPRA 5D85A 3SSMA 4WZBA 1R4ZA 4O3FA 4BO3A 4KLNA 4MS3A 1S02A 4DA9A 2YRFA 5TMBA 5IKXA 2I80A 1Y3CE 3HO1A 3BXPA 2JIPA 4JLWA 4BVAA 1T0JB 1V4BA 3GUUA 1DJNA 2B92A 2O8NA 4WWHA 1MLDA 4XR4A 1YRYE 2DPYA 2VDNB 3EZLA 5DH9A 3MELA 4W6ZA 1ZJ6A 3CH6A 3JTMA 4NEGA 4D9MA 1XDZA 1SC6A 2GEVA 3OZEA 3RC2A 4EAAA 2IE8A 3ZTYA 4WESB 1CVRA 3GUHA 1EJ6A 3KEFA 1R15A 4X1YB 4HUTA 3FHTA 3LP5A 1ODLA 3LE8A 1CUCA 2CB9A 1PGNA 4R2IA 4UVIA 1NYQA 3HXTA 5H16A 1SBNE 3EQ2A 1P4HA 1RKXA 1OJLA 3INGA 3OJXA 2UYCA 4EECA 1OX6A 4YTEA 1CJCA 1DXYA 3N2KA 1YWGO 5HTOA 4CG2A 2HR1A 4H9GA 1OWMA 4RJLA 2O8FB 3THXA 2OAP1 1XI2A 3K1YA 4HZUB 2R8RA 1N9KA 5CT8A 4DDVA 2HLPA 5KWVA 2YS6A 2O1SA 3MAAC 3IOBA 1JFSA 3UWSA 3VSBA 1OXXK 3GG9A 2ECOA 3R9IA 2BHTA 2J85A 2NU6B 3SOPA 2PLAA 2ZR0A 3DAOA 1IN8A 4PVCA 1P7VA 5A3SA 2QORA 1M2GA 3CZQA 4H6WA 2EXXA 1TM3E 3DCIA 4J4TA 2FB9A 4CL3A 2HYDA 3DA8A 4N7BA 1IZ9A 5GAJA 5JI3E 9GPBA 3I04M 3HDQA 3U44A 2JLBA 2QF7A 1L5KA 2RKBA 3U60B 2OVBA 2WQZA 4A0GA 4PHGA 4Q3LA 5T7BA 4HX2A 4Z9AA 4DDUA 4RD3A 3UWMA 3AI2A 2ADOA 2QRZA 4ENUA 2NUPB 2FF7A 4NJMB 1G18A 2VDMB 1XT6A 3KE8A 1QPZA 3GLIA 4DLKA 4CEJA 3OZCA 1YRHA 4JQOA 3ZEIA 1XA3A 1NW6A 4YDHB 4R0VA 3NT4A 4R2JA 5FOVA 1DQPA 3Q87B 2V7EA 3HVKA 4MHOA 3MYYA 1Z5UA 2Q5CA 3AKEA 3ONNA 4NCIA 1ISIA 3R0JA 4K3VA 1R66A 4QQNA 3INYA 3QXGA 4QWWA 5K6TA 2ZE8A 1UM9B 2K7ZA 3TOSA 1Z74A 3TW4A 5JSQA 1CJBA 1TMGE 2BKVA 3FSRA 4DWWA 1ZOOA 1EJBA 1XYYA 2OVFA 2YZKA 1T9DA 2QL6A 1R0CA 3H99A 3K9WA 3ETEA 2PX5A 4UZFA 4OY3A 4DIDA 4ARUA 5JPCA 1KERA 2OO5C 3L18A 4MLZA 2WJ6A 5DN9A 1DCMA 3MA0A 1JFFB 4PLFA 1J0DA 3PEFA 4Q21A 4NBLA 3TF5A 2KQUA 2R11A 3H5AA 1E1CB 4KFTA 4US0R 4F21A 1SKAA 1WZ2A 4R51A 4N48A 3KLMX 4PZCA 3PFGA 4GAEA 3USES 5K03A 1MIHA 4EENA 2OGUA 5DBGA 4YJ2A 5AWFC 3MTEA 3FCXA 4C7OB 1JQBA 1PZFA 3OKFA 1WU8A 3HZRA 2BTQB 5AMXA 3B7PA 1CDZA 2Q9BA 1SC9A 5DYWA 3V6MA 3BD8A 4UDOA 3GGJA 2W6QA 4B35A 3VOAA 3VRHA 1J0EA 2CY0A 3D6NB 1R9JA 3I0ZA 3BJMA 4QOFA 3SJUA 2ACVA 4OPMA 3E81A 1ML3A 3AFGA 1W8IA 2KI5A 3CG0A 3K8OE 4LI3X 3HKDB 1W59A 3DE2X 4HEHA 4YT5A 4YMTA 4A8PA 4FMPA 4DSZA 1SWVA 2GN6A 3G9QA 3LPAA 1E7WA 3RU3A 4B6PA 1YR3A 1RVDA 2FQ1A 2XUDA 3AW8A 4K9KA 3EXIA 4AUNA 1Z75A 2KSQA 4NBRA 1XHLA 2CNDA 2JZNA 4LJ4A 3NANA 1SU6A 4Z1MA 4TZKA 5ALLA 1Y3BE 2V7QD 1O08A 3HJBA 5KSOA 1GVHA 1ZMBA 4PN3A 2BBSA 1XQYA 2P4EA 4DKXA 1EMDA 5C4IA 1YD7A 3G85A 4GOND 4RV4A 1CX9B 3CZ9A 2PBZA 5DTMA 3U26A 1OFHA 2CDCA 1FX1A 4XLTA 1W49A 3W8NA 4UXHA 1NVWQ 4JSTA 5E6RB 5LSAA 2KB0A 4DIKA 1HE1C 2H1IA 2QSJA 3C3CA 3N6RA 5LCXA 1BA3A 2Q3FA 3IAEA 3OE1A 2NW6A 1AX9A 4CVNA 2ZB2A 3DVLA 2WJPA 1RWOA 1GFIA 4ZT2A 4NENA 2LD4A 4QU5A 3N70A 2ATEA 2I6XA 1PUJA 3BICA 1NBHA 4GBMA 4L9AA 4ND4A 3TDKA 3WIBA 4Q16A 1FYEA 3VPFA 5CVDA 1CXZA 5EIBC 2JLVA 5LZ2A 3GBPA 4GKBA 4BFXA 4D9HA 1E1QD 2QIOA 4E70A 4IL5A 1NT2A 2CL5A 2O2CA 4BWYA 4MV9A 4ONEA 4WUTA 1L1RA 2ZYVX 3R7BA 3BJZA 1WNFA 4HS9A 4CM4A 5AIBA 3R6TA 4MKHA 5BUZA 3Q41A 3GNLA 3LF1A 4X1IB 1XXLA 3D9QX 3RS3A 3DFIA 2M6SA 1CHDA 2XMQA 1ZK2A 1EH5A 1UXGA 4BPBA 2FUNB 3COYA 2RHHA 2JH3A 2ZYAA 5M5BA 3U61B 1M2KA 4CR8A 3T3OA 3NOXA 4JWTA 2HLDD 3U5TA 2J09A 4JLPA 3WK8A 2RK4A 1X9HA 4P7KA 4V1CI 1QG2A 2YZMA 5J4KA 2JFYA 1JQLB 4K05A 1VFPA 3PXDA 5DHFA 4F91B 4KAXA 4ZU1X 5FPSA 3ILSA 4GI3A 4C0HA 1VSBA 1QQ5A 4BIIA 4E6PA 2VK2A 3L84A 5JTUA 1MX9A 5JJLA 4RLHA 3PEWA 3ESAA 1N2IA 4HLDA 2JBHA 2L17A 3G0DA 2H5JA 1JSLA 4QFMA 1GARA 1R0BA 1AIPA 3M6LA 4K9DA 5J4LA 3A4VA 1X7XB 1TAUA 4BVHA 2P62A 2AN4A 4CKXA 2FWRA 2Q3JA 2QDXA 4MVYA 1KO5A 1QMPA 1UBCA 3HJHA 2BL4A 1V5EA 3NWPA 5E4JA 1XELA 3DYIA 1MO6A 3L1JA 1BVRA 2MIIA 3L7AA 3RSLA 2I3ZA 1WY5A 3BXHA 4RAQA 3DCYA 4EHFA 2UXCB 4D8TA 1IJFA 2V6BA 1JLRA 2E85A 2H2HA 2XNDD 3MCUA 4J2OA 1T2VA 3MJ4A 5D87A 5AW2A 4MOWA 3G0HA 1Q0ZA 3D4BA 5CA0B 1NRJB 1Y5MA 3COSA 3PCTA 5IDWA 3HCWA 3HU2A 1AN9A 3OP4A 4IXNA 2H4ZA 3K4QA 4DV2B 1C3XA 2F2TA 4ZP1A 3DWGA 1JDPA 4ASUA 2CEAA 2P2YA 2RHOA 4N5IX 3T9EA 1U5CA 1AMNA 3UUFA 1B2RA 1OAAA 4J0DA 2PNJA 1N75A 5BMVB 1QQTA 2YCLA 1JPJA 4HH3C 4TUYA 1QS0A 3EE6A 2C20A 3UJ6A 2WE7A 1DQSA 4TRJA 1GR1A 1P0CA 4R2MA 2PLRA 1GADO 2CGEA 3N3BC 5AICA 4YRSA 5CVTA 2VCEA 4B9EA 1LK0A 5ED4A 1I0ZA 2F1KA 4JI8B 4LTNA 1Z4OA 3NHRA 4M87A 1ZIXA 3EZ9A 4FGJA 1EP1B 3GJ6A 2ZULA 1CNFA 4TROA 3F6BX 1FVOA 1SBYA 2AMYA 3WDKA 4DLRA 3ZVMA 1PIWA 3MPOA 4KX3A 2OV2A 3U4DA 4EJSA 4LBVA 1KDPA 3RS2A 1N92A 2AN9A 1LF5A 3AV0B 3MXOA 3IEMA 3V6LA 1FNSA 4UUMA 3KZCA 3RARA 2HF9A 2R6CA 3W4KA 1BMFA 2NU7B 1Z8HA 2OR3A 4QRHA 1IJEA 1AURA 4BFCA 5J4YA 4BAUA 1EE9A 1SCQA 3DT8A 4LDZA 4QYIA 3D5TA 1KMHA 5T64A 4XVRA 3GRKA 3HGMA 1DCTA 3GV0A 1RLTA 3URKA 1SXJC 2Y2UA 3Q85A 4N47A 2O1EA 4HYEA 1H0HA 2YV2A 3UMGA 1J2TA 3EOBI 5JS2A 1Z0UA 4NOKA 4PW0A 2RI0A 3LT4A 3HBNA 2RC5A 5KC8A 5KJ1A 3T9AA 3Q6IA 3RREA 1OI4A 2KLBA 3DMGA 4BBJA 4YT8A 3HMQA 1HDRA 4FLFA 4PCLA 3A10A 1BFDA 3UGJA 1YR7A 2EVWX 1KEZA 1NZFA 1SBTA 4URYR 3QJYA 4I4TB 1PBTA 1UK9A 1ZSVA 3PUKA 3EG9A 1G5QA 2ZRHA 3IQFA 4HI0E 1TW2A 2PIDA 5KNCA 3ZY2A 5JS6A 2J3EA 2WBLC 4ALIA 4MX8A 2ZIXB 1WDMA 1XBTA 2AZMA 1NR5A 2FPUA 3KLBA 3EZ2A 2PSHA 4PVDA 3IPYA 4Q03A 2CXHA 5EWJB 2JASA 3V1KA 4XASA 3VZPA 2IHJA 3PFIA 4E4RA 1RRCA 1ZH4A 2XECA 1BXZA 1XKLA 4FBGA 5IBCA 3FZNA 1GNSA 1XMVA 1DI0A 3O0DA 4FC7A 5FWYA 3GMDA 2N3ZA 1NQOA 1RACA 4QVKA 3OFVA 2WMOB 1HT1E 3PENA 5CM8B 4ZXPA 5ERYA 1OBOA 4RDHA 1S2MA 3DE4X 2Z8YA 3Q10A 1JR4A 1ID8A 3N76A 2H5EA 5TEWA 1J5XA 2X77A 3EVZA 1XJ5A 3FPEA 3SSOA 2AW5A 5K0SA 5GADl 3HB0A 3SHFA 4HNUA 2O8EA 2P9ZA 3OFSA 3LP8A 1SQSA 3LC1O 3EGDB 2IIVA 5IFKA 3GCGA 5AJYA 1P1KA 4YLEA 2XUJA 5KS2A 1X7YB 2C8VA 3S1SA 2XXAB 1HNWB 3WZ2A 4I3FA 2G4LA 4MCIA 4F86A 1HG0A 1FJHA 1RD4A 3G2NA 3Q7EA 4JLNA 3ZH2A 2HMVA 1XTSA 1JHUA 3QKSB 4LHZA 4Z4QA 3NR2A 3WLOA 4TLLB 3T9DA 3HPRA 1H3NA 4FFBB 5K5EA 5ABPA 4BNFA 4Z0HO 1I6MA 5TSDA 1RQLA 4TLEA 4RJJA 3WY9A 2IF2A 2CF6A 3JZIA 1NGSA 5MF6A 2ZYDA 3RH0A 1IUKA 3D8UA 3THWB 5F7JA 2HMYB 3U7RA 3IGFA 2YN4A 4D9EA 3TNDA 3SP1A 4WCFA 3TLZA 3V7YA 3URMA 1GA1A 1J6UA 4ECEA 5CTAA 1BNCA 4O4HA 1O8BA 2ZSKA 4O4LA 2PR7A 5C1BA 3HJUA 4R01A 1Q0PA 1E60A 3LPCA 4JI1B 5EZ5A 5CFNA 5ESXA 3F74A 2DCUA 2EF0A 3S3TA 4O02B 1KVUA 4RKFA 3FHCB 1FRNA 2V74B 3NBZC 1TJYA 2XB9A 1PGOA 3PNSA 1FFSA 4HRYA 2C7VA 2YFKA 1FFAA 2SHKA 1GGEA 4MKIA 3WB1A 3K0FA 2AOTB 3RIHA 3AU9A 4Y2RA 3CLTC 2VTVA 3ZVKA 2PWYA 1XMSA 2NXNA 1ZINA 2OGZA 3WHPA 3NVMB 1TCCA 4A2PA 3AUXA 1CNEA 1NZJA 2PUDA 3KPYA 1TCVA 4GGPA 3V4SA 4YMSA 1TQDA 5ALOA 3UCXA 1B15A 1W88B 3Q3EA 5AVXA 1AV7A 2VUIB 2EX0A 1JR2A 2LKDA 5D3QA 3SQDA 4OREX 4LE1A 2PX4A 1XZ8A 1TO2E 1MW8X 3TSYA 2B8NA 2D13A 2R1TB 3DAPA 2P3SA 3OEEA 4JUAA 3A9VA 1VHTA 3QYAA 5EJIA 4AG5A 4GEKA 2O20A 2Q3HA 3D02A 3JWPA 4Z8YA 1Y42X 1PW7A 1U28A 4RCZA 3HA3A 3TD9A 4EO9A 2AJCA 4XWKA 1VIVA 4AMGA 4ZEVA 4HNTA 4JL5A 1LW6E 1WDWB 1XMIA 2CD9A 3H84A 4PWZA 3LWBA 1PR0A 4HXGA 2C9MA 3RUAA 1LJ8A 4PS0A 1UKVY 1I4OA 3H2JA 4PANA 4B6EA 5JCXA 1W7AA 4KITB 4EABA 4QPJC 4KH0A 4BYGA 1BXKA 4BMCA 1QHYA 5J58A 3NHBA 3ZBQA 1DOHA 2ZEJA 2FMUA 1XQ6A 3Q2KA 4EUFA 4F85A 1OA1A 1QZ3A 3C48A 2Y71A 3DEIA 3OJ0A 4BWVA 1CY1A 1N5KA 3IEKA 3WLKX 1J1IA 3GHYA 3NTUA 1DO8A 1O3YA 1QKJA 4QU0A 1P5HA 1L7EA 3C45A 4EF5A 4ZDJA 3H97A 4OO3A 1UBTS 5B3AA 2AG6A 2K5UA 3TD2A 4EUSA 2HA3A 2PUVA 2QUKA 4GX0A 2BUAA 1MZPA 1TQHA 3EF1A 1GG9A 1PHRA 2QLBA 3HPQA 5KAMA 2OLJA 4K26A 4BO9A 4BMVA 4DLWA 5IVDA 2Y2VA 3ER9A 4KG7A 2R8EA 2WJGA 2ILVA 4COKA 4MMYB 3IT2A 3TLYA 2W4MA 5JDCA 2C9OA 3BWYA 5EHQA 2YWDA 4OIFA 1USKA 1JIVA 2WYOA 1R0XA 2LKCA 3SM9A 5IUKC 3OH8A 3Q5GA 1FSPA 2RH9B 1JR3D 5BR7A 4MR8B 2PKQO 2XTJA 4TL9A 3LX5A 3GJ7A 5JWHA 4QKQA 2AJTA 4WVLA 3L7CA 3R3UA 4JGIA 2VZLA 4J03A 4QUJA 3OCZA 3ESYA 2FUG6 1Y4ZA 3QLVC 4YREA 1FFXB 3H05A 4GYWA 1WHTA 4KSYA 4RJKA 1KI7A 4ALMA 4ZN6A 3PC8A 4UHCA 2IGBA 4NWIA 4IQGA 3LPDA 1H6BA 3L7JA 3PUHA 2O3SA 2WG1A 3PA6A 3AVPA 3DQQA 4DUPA 3LO5A 1NC1A 4K6FA 2CV1A 4G2NA 1FRZA 3KCQA 4KPGA 1A4IA 2VF7A 2HNAA 2WJAA 1KI6A 1O95D 3HRKA 3STWA 2VJYA 3JWHA 1R12A 2JEZA 5BT8A 2FSFA 4B75A 4KPYA 3CLSC 5L3VA 2ZANA 4X41A 4Z86A 4D2IA 4W9NA 2YIJA 2CLHB 4G9BA 2PMCA 4BXOA 4C08A 1GTJ1 5BQOA 3L77A 4R68A 3SPXA 1MUUA 1B0PA 1NSTA 3DLTA 3L0CA 1EUCA 1QIJA 3IMKA 4DEVA 3PPIA 4Z53A 5IC6A 1DQYA 5LQNA 1RSZA 4RJ2A 5F7OA 5INTA 4D9FA 4OHZA 3K70D 4JS0A 4RMJA 4TKLA 1FFEA 1E58A 1TK2A 4HAZA 4LRUA 3RUFA 3ZWDA 2OO7A 1XD2A 1V39A 1E6WA 3DWEX 3PHJA 3SZUA 3EIXA 3KU4A 2W8BB 3IAS6 1K8RA 1ZGCA 2EWWA 1BS2A 1RI1A 3L6EA 3ZWMA 4BGDA 1L7RA 2QV7A 4DEYA 1Y1LA 4IIFA 4GVLA 1B8NA 1U98A 4QYWA 5DSXA 1RXEA 1SU4A 2Y67A 4NRDA 2QP3A 1QIDA 1RBZA 4KL8S 4WBNA 5D00A 1P62B 2XMBA 1K1EA 3NGLA 3OZAA 4HNVA 4C76A 3NHSA 1YF3A 1VJ1A 4IIJA 4EP1A 3BH6A 4WESA 3BJEA 2PWBA 2QLJA 5LJLA 2OE2A 1OLXA 3LQYA 3W7AA 4DYVA 5IHXA 4Q3EA 1N6LA 1WQ3A 1KAMA 4EJMA 4CR6A 5EXDA 1N5DA 3QX9A 1QQAA 2OORC 2J9FB 1N2HA 1JKJA 1EE2A 2VBFA 1OD6A 1XL0A 3TEFA 4KXWA 5C1OA 3IVMA 4Q4JA 1C1XB 4FGSA 1H6CA 1JXQA 3H4TA 5CEFA 3C3JA 1AC5A 2IP2A 1QE3A 4TMKA 5G3YA 5C1DA 1QCCA 3N5KA 3ONEA 1UOOA 2NU6A 5CVVA 2XOKD 1IN5A 2KJQA 2XLBA 4GBED 4TMXA 2DPLA 3ZH9B 4OCZA 2X5KO 3L49A 4JZYA 1LBTA 1YS6A 1U7PA 3I64A 1CIPA 4MVWA 2QYHA 3MJRA 5JROA 4IFTA 4MP6A 1OXBB 3GI1A 3U3OA 2UU9B 2A9QA 3GGPA 5LBUA 1SQGA 4YGYA 2HJVA 1CQPA 1DOZA 3AF4A 4IG4A 3TLEA 1G2IA 3IB3A 3WHIA 2C2WA 5A06A 3BMNA 2HNBA 3DFKA 3HL0A 4Q39A 2G5PA 2OY0A 4KE6A 3PEUA 3U48A 3ZX4A 4ETNA 3O8RA 3CW2A 5KWSA 4UMEA 1Y3HA 5DHRA 7REQA 4JQSA 2Q3LA 4AQ7A 4GD3Q 2CDBA 3DV0B 4OU5A 1J9EA 1KQPA 1OV6A 1YDGA 2ZJ4A 1PR6A 4NV1A 3CVWA 3K72B 2ISQA 4J91A 3WFIA 2PQ0A 3WMGA 1JT2A 1T5TA 3QSGA 5KCMA 4US2R 1OWOA 3R7SA 1PWEA 2DLNA 3R7LA 2QTZA 3WWPA 3L7KA 3D6FA 2IYRA 2P9BA 3R4VA 4BMSA 5JT1A 1K8QA 3ZV3A 1KFKB 2GPWA 1PR9A 2ZOSA 4BLSA 3HRHA 4E88A 4F3YA 1P60A 3T0FA 2GPBA 4I5IA 3TMKA 1B6GA 3AVYA 1QU3A 2J7PD 2UUCB 3JSXA 1L3CA 4OUKX 5B3JC 4P3KA 1E1CA 2WHXA 1JAXA 5FUVA 2GUGA 1I7DA 1E5VA 2GCGA 2WDZA 4S1WA 3SDSA 2LV8A 2X19A 1GZUA 1I4LD 3NU1A 3T4UA 3EQ7A 4XQGA 3JYPA 2VXCA 2AFIB 3PT5A 4C7OA 4GLLA 1GPWB 1IWPB 1R5BA 1VE3A 2XUFA 3I01M 2JHAA 2WD9A 3C6XA 4RMHA 2FUG1 1OW3B 3GQBA 2ZUDA 1SCAA 2P0YA 3BRSA 1P29A 4GNKA 3WX0A 1Q91A 1R16A 3ON5A 4CKWA 2PGNA 3DEYX 4ANFA 3DMDA 4L27A 1P9LA 4G86A 1VPDA 4MIKA 1W4RA 1VP3A 4WRRA 4CCWA 4DG8A 4YMUA 2QW1A 2ADFA 3FYUB 1NWCA 2EKBA 5LP6C 2QVCA 4DYDA 3M4JA 3QOYA 3HBLA 1FFBA 4LRTB 4C3OB 3S2FA 3ZYZA 4F38A 4KREA 2IHVA 3OE5A 4BNHA 3HJAA 2CXSA 4DBLE 4JASB 1U0RA 2RK3A 4MVJM 1KBOA 4MWDA 4W6QA 1JSZA 4CTMA 2DUNA 4LG1A 721PA 3KAJA 1AO0A 3SR0A 2YX1A 4PWYA 2YWXA 3KOWA 1V35A 2IV2X 2NV6A 5E7MA 4XPIA 4CT0A 4FDAA 4F1KA 2PAFA 4HHEA 3TG8A 3WA7A 4IYJA 4DE5A 1XZQA 1SQ6A 2JAQA 2R96A 1FDSA 2FMHA 1UOQA 2GX6A 3GLVA 3JD3A 3L1VA 3T3EA 2C3OA 4F2DA 2JH9A 5LMZA 1K8YB 5AJZA 4CFYA 3VO9A 4QLAA 5G02A 1TECE 5EMNA 1DV2A 1THMA 1TQ2A 2LIPA 4PNZA 4L78A 3V8RA 4WY2A 5AKKA 2VTEA 5G53C 5LQCA 3CFYA 3JCZA 1R4AA 3DPSA 1ESDA 3MB5A 4AO7A 5K01A 5H3LA 1O9BA 5DI3B 5DHQA 1G8SA 2EQAA 4ROSA 1VDZA 2BFAA 3I6MA 2XCQA 4C0LA 5B5SA 3GDFA 2NP7A 1E94E 4IG9A 2VP9A 4KR0A 4ZC8A 1EFVB 2C31A 1PZHA 3FHJA 4TQGA 4TXJA 2I2CA 5JNUA 1XDSA 1DVRA 2ZB3A 4Z9FA 1YQQA 3EH2A 3IT0A 3E3OA 4P7JA 2XRFA 3LPNA 3NKLA 3P32A 4QSHA 4H1VA 3QUCA 4PYJA 4B3RB 2B1IA 1DIOB 1Q50A 1JE0A 4FC6A 5DYIA 4N41A 1PK7A 3F7TA 3Q3IA 4MIOA 3RRZA 3ZUPA 4HN9A 2Q7XA 2RI6A 1NI3A 4ZQFA 3WLMA 5JFOA 4RF3A 5F33A 3JQQA 1Q44A 3H75A 5IM5A 3FSGA 4QBTA 3K96A 4R3WA 2WWYA 3TX6A 1JAHA 1UKZA 4IMRA 3Q9SA 5AOCA 5ANRB 3A7EA 3WMWA 4YWHA 4NG4A 3B3GA 3A2KA 3FKJA 3G2HA 3VYVA 3QF4B 2XWBF 4QG3A 3X43A 1DQRA 1LV8A 2HIMA 2WG2A 2ZVDA 4H18A 4FE4A 2MYPA 4MWZA 3PX7A 4L5CA 1G5FA 2BJVA 1KAHA 3CWQA 4L5BA 5E9WA 2OD7A 5KYXA 5T57A 1YDMA 4PZZA 3IUSA 2Q7OE 4C7JA 1TD9A 3GFRA 3QTLA 3BL6A 1F8FA 1ZWLA 3FVQA 4BFSA 3P9RA 4LJAA 1ZICA 4IVNA 3L0DA 4FI3C 3KHTA 4M6WB 1Z9BA 5CA1B 3AILA 2V65A 1RQRA 1Y5LA 3D6MA 3D4PA 5E6UB 2CUKA 4UPVA 4BB5A 4G8BA 1SULA 3BG5A 3IIKA 3SG0A 1KI8A 3FE2A 1POWA 2FQQA 1A88A 4W1RA 1K7YA 1CVIA 4RY8A 5LDDC 1VMIA 3QYPA 1P2GA 2O07A 2YR0A 5LBTA 4RKRA 5DOVA 2BEKA 3GMSA 1RAHA 2YWEA 3IBYA 4RFSA 2VAPA 3MLBA 2NSYA 1HLPA 4JB0A 1FDIA 5KYYB 1VI5A 1U0HC 3HU3A 4MUBA 5BMVA 1CDDA 1ECLA 3R3HA 1RJGA 2RMKA 4NBKA 5CIWA 1W34A 1NMYA 1B6SA 3IV9A 2ZPTX 4BO4A 4BBAA 2YHIA 1JHOA 1KY2A 1L4UA 2V7UA 2WP0A 4BN5A 1US8A 1ULUA 4G1BA 1ZKDA 4KXMA 2I76A 1Q7CA 3LGSA 3FPSA 4H15A 3R7FA 5FKJA 4D8UA 2A78A 2LP4Y 2Y1KA 1TUEA 2P9GA 3MD0A 1OH7A 2WR8A 1UJ6A 3EHEA 2CBZA 2BONA 2J3QA 4TWBA 4C5AA 1YB7A 1JXMA 3DZJA 4CM1A 2P6MA 2WB4A 3PKIA 3Q7TA 3GVIA 2YICA 1Q0UA 2WPDA 1RHQA 1K7XB 2HTFA 4JI0B 3AL3A 3OLYA 3BD7A 1GYPA 5C1PA 3KZMA 2BCJQ 2I03A 5ALJA 3SF8B 2VDWB 5DU2A 3TSZA 5IHPA 3C39A 3F47A 4TV8F 1G6OA 3VOSA 3BERA 3EDOA 3O2JA 3VR4H 1G0OA 4DIEA 1TCBA 2WU8A 4KDEA 3IHWA 3ZKAA 3L7BA 1DZIA 1FPMA 1RYBA 4AO8A 4B1FA 5KNBA 1ZZGA 4UM9B 1T0UA 1N32B 3AB3A 3ZDRA 4H1WA 4RQAA 4K2AA 1MQ8B 5DBHX 4RA6A 3EVTA 1AQIA 4QQFA 3BB3A 3R7AA 4ZVTA 2QTVB 4AK9A 4DMFA 1RWVA 1I14A 1SOWA 2LUOA 3OFKA 1T0HB 3O74A 4MGKR 2HCBA 1T0PA 1GZ7A 3R0IA 1DT5A 4I9NA 3UUEA 1IBCA 3N8NA 5KQMA 3P9IA 3OC6A 4LJLA 4EW1A 1PKEA 2FPXA 3IA2A 5LDHA 5TT0A 4JJIA 4I1OA 3VJKA 2QRHA 4PAGA 5CYOA 3DCJA 5B53A 5IBRA 1F51E 1NVAA 4DS3A 4PCUA 1FDVA 1EYZA 4NYJQ 4JU8A 1ATIA 1NJ5A 1UBJS 3TAXA 4ZHSA 1L7XA 1MT3A 5AFSA 1WNTA 5BSRA 2VTKA 2JKVA 1PAUA 1YQGA 3O21A 3JQBC 3WK4A 1TTPB 2ZUVA 3JVEA 1NVEA 5G0SA 2IOQA 1WIWA 5HCNA 4B40A 1DP4A 1QDLB 2GNAA 2I3AA 2OXFA 4EM6A 1J9GA 3F5DA 3SEQA 1ORTA 4MLDA 4N82A 5EQFA 4G9GA 1Y6JA 4DLVA 3PNQA 1MAWA 6Q21A 5TJ9A 4MRMA 2CCGA 4QECA 1OWPA 3OCUA 1CJSA 1K08A 7ADHA 5HWSA 3N7AA 4HPWA 4CIVA 4GPIB 1JHDA 4LRQA 1HE5A 4YXWD 5BR4A 4LNUB 3FYDA 4FGWA 1MQAA 5JAHA 1PV1A 4XX0B 5A6SB 4WY8A 1QHHB 3I52A 1KC3A 2HM7A 3ICCA 1QGAA 3VNRA 2I8LA 1EVIA 4NARA 4BAZA 3EGDA 3TO5A 4TKVA 1FP4B 1T10A 2H8GA 2OG1A 3JZDA 3QNMA 3RIYA 1ZWKA 2IY7A 4JVMA 4QBIA 5FPPA 2P2SA 1DAEA 1E79A 1G7SA 2B4YA 5AM4A 2R6GA 5DWVA 3ESXA 3Q8KA 2PR2A 4LZJA 3DAHA 2C5AA 2I2AA 4FYWA 2GVDC 2G9RA 1J8VA 3QKSA 3V1NA 3CKKA 1QX3A 2XY4A 1WXGA 2HA5A 1MHTA 3OZIA 1XWIA 5DHUA 3ZWXA 2ZT5A 3QELA 4QELA 1BROA 1XDBA 4NS1A 2JATA 2RHDA 3CX4A 5F5XA 2PKWA 1IEWA 2PV0A 2BFFB 1RQNA 5DGCA 1LTHR 4GMHA 5I7WA 2NXCA 2OMEA 2CCJA 3N7UA 2F1OA 3KTDA 3OJEA 3OPNA 2PMEA 1D1PA 4JI5B 3O75A 3TPCA 4JDPA 4HMQA 2J0UA 1VMKA 1L4EA 3Q0EA 1QWSA 1M6WA 3TN7A 3VYUB 4MV8A 1E63A 4GIBA 1NXQA 3A1NA 2JFOA 2OZVA 2CDNA 3E15A 4GSLA 4H1TA 4IOKA 3T5BA 4F3KA 4OX9B 3EMVA 3GUCA 3TQCA 3S29A 1KY5A 3QEKA 1WHSB 3DM5A 4F5DA 3T7RA 1T3GA 2F4VB 1JMKC 1FFHA 3ZD7A 1KORA 2VSFA 1A5SB 4JSRA 4AZ0A 2WJHA 4GG1A 4Q6BA 3TAHA 1VSVA 2AOTA 2W8ZA 3H9UA 5TVGA 1MQ9A 3VGJA 5F2KA 2WWGA 9ABPA 1XKXA 1FXWF 2ZJZA 4ZTUB 4TM8A 3EEFA 4KO1S 2PIAA 1S9DA 2ONKA 3KJEA 1V16B 3NWJA 3OCXA 1R5OA 3QOFA 2B61A 1Y6ZA 3NHUA 5EIBD 4EUKA 2SECE 4H2DA 2VDKB 2A86A 1CJTC 1WXXA 2O19A 1OBVA 5D01A 3OKCA 1N6IA 1ZR4A 1NQ5A 1PZGA 3MYRA 4MV7A 3RAEC 1QCDA 1BE0A 2AHOA 5ALZA 5FUXA 1AKUA 1L7NA 3CVUA 2XB8A 4Z0NA 3I9FA 3W2EA 5HR5A 1YGPA 3R8CA 4Q66C 1SG0A 1XCLA 5I8PA 2P5TB 2VHJA 3WKDA 5F9MA 1BDJA 3A3OA 5AW8A 3FMIA 1ODJA 3EBPA 1F0NA 1YK1A 2HB6A 5EP2A 1UC4B 5J1TB 4JLMA 4B4UA 3D6JA 4R9NA 3CS3A 3KK0A 3EDCA 3QWIA 1Y9JA 2RBKA 4MW1A 4YN3A 4EG5A 1WSWA 2WD7A 3V4VB 5SZKB 3H19A 1RHUA 3ACDA 3A6GA 4MV5A 1K5GA 1H85A 3IE0A 4JBNA 2G88A 1MAVA 4M0PA 4MULA 3WSTA 1P4RA 2ANCA 2ZBUA 3DE1X 4GKKB 1TM2A 4DUGD 2BGWA 3VR4A 4S05A 4V03A 2VYFA 2PS0A 3DWFA 2XA1A 3EC1A 4DPLA 5AXAA 3FCUB 3PRJA 2ZRAA 1I01A 2YRXA 2QROA 1QK5A 1GXSA 1NSYA 3IBCA 5DYTA 4I4CA 1MN6A 3LNCA 5DHTA 3MGCA 1BN6A 5GJCA 1G7RA 4GS5A 4MW4A 4NJOA 2IYUA 1KSJA 3KKEA 3VPXA 2O8CA 2WSSD 3L1HA 5EJAA 4N5NA 5CDSA 1D3AA 2B0JA 4TLAA 3ZLUA 5IJWA 2NZYA 5JYBA 2XODA 4MROA 4Q24A 1A9XA 3GPLA 1QHFA 3UATA 1YS9A 4YAJA 3T54A 4UEOA 4BQOA 2AZDA 4CL0A 2HBQA 3PJEA 1E62A 1DKOA 1YNSA 4F9FA 4NOLA 1TVKB 2DJIA 1FUKA 3F9IA 3WAKA 1JH9A 3JATA 1XZCA 4C4PA 1G21A 1SG9A 2DECA 1HNNA 3PUXA 5HM8