3PKZA

Structural basis for catalytic activation of a serine recombinase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
124
structure length
124
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVEMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIRILAMVSEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombinase Sin
publication title Structural basis for catalytic activation of a serine recombinase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Recombination
total genus 49
structure length 124
sequence length 124
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pkzA00
5C34B 1GHTA 1ZR4A 2GM5A 3LHKA 5C32A 2MHCA 3GUVA 1GDTA 5C31A 5C35A 2RSLA 3ILXA 3UJ3X 3G13A 2GM4A 3PKZA 4BQQA 1ZR2A 3BVPA 1HX7A 3LHFA 2R0QC
chains in the Genus database with same CATH superfamily
1KBQA 2PA0A 1T9DA 3F2IA 1NBOA 3F5DA 2Q8PA 2YIVX 1VIDA 1Y9DA 1JU9A 1JDJA 1XU7A 2G5PA 3BSWA 5CT4A 2PH3A 3WIBA 4C0HA 5CDGA 5CLJA 3G7SA 2IBSA 1IOVA 1EFCA 4QX6A 4GZ6A 4Q39A 4V3BA 5C8YF 1F4PA 2R7MA 4NE9A 2VYCA 2H63A 3K73O 3LT2A 5LYJA 4X90A 3RRXA 2H4XA 2QMYA 2RHWA 1MX5A 2JEYA 4ND8B 3RJ5A 721PA 2Q6VA 5F12A 3E9DA 3EFOB 3LQ2A 2CHEA 4LOLA 4B85A 2G9NA 1VJ0A 2NO9A 4ERNA 2ODNA 4N0PA 2IP4A 3THXB 2UYOA 4WN9A 1J0XO 1U9CA 1P1HA 1U6JA 1ZGGA 2DFTA 3HFRA 4J43A 4P5PA 5DX8A 5EP4A 5AOVA 5J5AA 3ZDZB 3H04A 3HXPA 2HF2A 3HDYA 1ZSVA 1JEDA 5LKRA 4RJ2A 2Z95A 1P77A 2I8LA 2OZLA 1YDWA 2QNIA 5BR7A 2VH5R 1M2GA 121PA 1TA4A 3LS2A 1CP3A 5AKYA 3HFGA 1QQ6A 2BEWA 3MLBA 5DYWA 4I99A 1TM2A 2IIVA 2I54A 3OIYA 3L0SA 4O63O 4F04A 2XCLA 1KC3A 1RACA 3WNDA 4ER3A 2PIDA 4AZ3B 4HN4B 4XVRA 2ZR9A 3K0CC 5EJFA 2V7TA 1DCTA 3FKSD 1EB9A 3ZZ0A 1PLJA 1TM4E 4RFSB 2GZSA 4DA4A 3WRYC 3Q8WA 4KVZA 4JYZA 1FJXA 4YAWA 5BYAA 1Q0ZA 1Q1QA 3DBLA 3CLRD 2Z57A 4JCCA 2IPAB 4LZWA 2I2BA 4UAUA 5HBGA 1QQBA 1OUMA 4IS2A 1RNLA 5GP1A 3WRYA 1NT4A 1J0BA 1WXQA 5KYTA 3UGJA 3ONVA 4K9DA 3EDOA 4BVKA 3AT1A 2GO1A 3LY5A 5BUCA 2Q29A 5AW3A 4HFJA 1BROA 4QVIA 3TOVA 2N47A 5E6RA 4OFZA 4OV6B 1T5IA 2YVLA 2G36A 3OLZA 5DEIA 5CJJA 3H4TA 5EQJB 3I53A 2Z58A 3MJVA 4A36A 2C84A 4FGLA 1EINA 1O1YA 2GA8A 3L02A 4S1NA 4CUKA 5AFSA 4AG3A 2JI9A 1V3TA 1XWIA 3E5NA 3FETA 3BIXA 1NJ2A 3OWXA 5KTYA 5BOSB 5KU7A 1RYEA 1ULHA 4PC1A 3PBKA 4US2R 2GK7A 3BQ9A 4P4TA 1JB1A 1E8DA 4CWAA 4ENTA 3ZGNA 3WFIA 3HKEA 5JATA 3DTTA 3PRKE 3DCIA 2BHLA 2XWSA 2COUA 2O2HA 4IQFA 2CUKA 3DOHA 5HIJA 3RRJA 3UXHA 2WF8A 4MGZR 5K4AA 2AQKA 3QELB 3P2YA 5CB8A 4UREA 3ND7A 2C59A 3OD1A 4L22A 1N0WA 2CLFB 2Q5CA 5K45A 1GGMA 1VJGA 2C5AA 1N1DA 3D2CA 3QBEA 4LRYA 3TN7A 4RQAA 5KNCH 3Q8MA 4EF4A 3EEFA 4K6KA 4UU8A 1B8UA 1JDVA 5JEEA 3BVPA 2J9RA 2Z4TA 4QBKA 3JQFA 1U5BB 2DWQA 4ZQGA 1BVYF 1SVWA 3BULA 1X2EA 3TFOA 5BR8B 2G77B 4QEDA 3NUZA 1VJTA 3C1UA 1M1YB 4KPGA 5I7WA 3HM2A 3O4JA 3NEYA 3COYA 3F4KA 2HU2A 2VHZA 3NHAA 4KFUA 3LVBA 1JDSA 3FN4A 4XR9A 4B2YA 4CQJA 4EKIA 4JIGA 2X0IA 2CFCA 2GAAA 2MSCB 2V7PA 2X0KA 2XX3A 2ZTUA 3VC7A 3QXJA 4CIDA 1IB6A 1P45A 1XPJA 1QDLB 2W58A 3NBMA 3NHBA 1YBHA 2NYRA 4TMFA 3MA0A 5IVDA 4XCQA 4BLSA 4F9TA 1XTBA 3FUWA 4RIGA 4XSHA 2F6RA 3RYHA 3U19A 1ZMXA 3PGJA 1REQA 1ULAA 2EP7A 2I6TA 2GKOA 2QTBA 3E8XA 4I50B 2W2LA 2OR3A 5IP5A 5K3CA 3WL6A 4J75A 1MR3F 1SQ0A 1PL6A 4IIGA 3H1GA 3OU6A 3W8NA 3PFHA 1L7OA 3ZGZA 1ETHA 4GSLA 4ZAGA 3Q3EA 2W83A 13PKA 4MS1B 5DWDA 1SOWA 4B3IA 1XR3A 5FBKA 1F06A 1UZLA 2FZKA 2OUKA 4GL4A 3PE3A 4JLNA 1DAEA 3R0QA 4L2IB 4Y67A 3VI4B 4CV3A 5JCZA 3O8NA 1BE0A 5F76A 1Z08A 4DJTA 4HNTA 1FVXA 4M7PA 1S6YA 3SBXA 4J76A 2FI1A 4R7ZA 5I9NA 5JSHA 1ST2A 4IKOA 4Q48A 2DWCA 3HB4X 3I9KA 2WIFA 3G88A 3IVRA 3V1UA 4Z1OA 1NI5A 3ZCQA 3IAFA 3UATA 3QVOA 5HGJA 3MB8A 1VLQA 1FDTA 4GLJA 2CMHA 3WYNA 3MCAA 3ZHQA 3SJAA 2E4YA 2GD6A 3OI7A 3W5SA 1PWYE 3L3BA 3PPVA 5ALRA 1AJEA 2JH8A 2TS1A 2WA1A 3U62A 3TLXA 3EVBA 1T8PA 3KPYA 1GTG1 1U0BB 2LWIA 4XFDA 1ZUD1 1VSVA 4MICA 4A4DA 1X6VA 2JLYA 4Y3UA 4EHFA 4N4AA 1RPZA 1Z6GA 2QTRA 3DL0A 2Z43A 3HLYA 4TQAA 4AKSA 1NYTA 2H7VA 2C9CA 3DMDA 1OX5A 2BHTA 2BIFA 2RHHA 3A06A 3DMNA 4NFLA 1Z7GA 3N58A 3RSGA 3WLJA 2F1OA 4JJEA 4TSFD 4FC6A 1YBVA 3MBKA 4C0KA 4EYSA 4KXXA 5BV8A 1FJHA 3L07A 3QV1A 4O5AA 3UHJA 1ZA2A 2PR7A 3K72B 3TIFA 1ZISA 1VL6A 3E03A 1USUA 4DV1B 1A8UA 2ZB7A 2MU1A 2NSDA 3EPKA 2QP4A 1N0HA 2HXYA 5CFQA 3QA9A 3H2KA 3OLXA 4DCCA 2IS2A 3OVMA 2D5BA 4B45A 5DW0A 4R2JA 1XNJA 2F1HA 4TT3A 5CM8B 4J2TA 2Y93A 3NXSA 3W8RA 3EUFA 2HCJB 4FYMA 5C53B 1SXJB 1LUAA 2GFIA 1PVVA 2IEYA 3BXEA 1RYFA 3FTEA 2GPJA 1OIWA 1U7PA 1EUDB 1SA0A 1XN4A 1U0LA 1EIZA 3OG9A 1W93A 3ZZTA 2PUGA 3A10A 4JLDA 1UCFA 2PPLA 3OLWA 4QQ8A 4DG5A 1G42A 4YV1A 2H48A 1ST3A 2OM2A 2XYQA 2WE8A 2W4QA 3AP2A 4JI6B 3WYBA 3U7QA 1JFSA 5F7XA 1ILWA 3I5YA 1KPHA 5C9ZA 4EDFA 4UNSA 3QWIA 2DR2A 1SO8A 1UMDB 5JROA 5J2UF 2QTWB 4OK6A 5KKAA 3IQWA 4P4SB 4ZK2A 5DNCA 4MVCA 5IJZA 1T0IA 2OYCA 2J5RA 1WZUA 3D6MA 5TS3A 5K3EA 3SWWA 2P9ZA 4X94A 1CG6A 3USCS 5D3MB 2UAGA 1Z0DA 3AU8A 4ZALA 2FU5C 3A70A 3ASYA 4MWOA 1Z7BA 1ZY2A 3UAZA 4EBBA 2EW1A 1SJ9A 2JA2A 2VXBA 3I2IA 5JYBA 2XTNA 3V2HA 4WBNF 5LQMA 4E30A 3K15A 1FZTA 1Z33A 4JUDX 1GNTA 2E4UA 2B2CA 2W0SA 4N03A 1I5OA 1B42A 1I3MA 3H2IA 5GADl 1SCUA 5KZMB 2PV0A 1S1MA 2X7XA 3IAUA 5FOQA 4P84A 3DE3X 1BCRA 3PFBA 3M89A 4ABTA 1XA0A 2AR0A 1KDRA 3H75A 1Y7HA 3L8CA 3HBLA 1LPMA 3NS7A 3Q40A 4MW6A 4U9UA 5LLSA 2AZTA 3IPXA 1FRNA 1XCJA 2FXIA 1TC2A 1W34A 2PMDA 1IHPA 4FIZA 3V33A 4BC1A 1PJ2A 2ZYGA 4FDLA 4G1UC 1ZXXA 4ZQCB 1KMIY 4HWGA 1G8KA 3RSHA 4BMOB 2CVOA 5BNIA 2UKDA 4BXOA 1KGSA 1WZEA 1ESZA 1QAMA 3EVNA 3FIUA 4ER0A 2QUZA 5K0FA 3LOQA 2B99A 5JHHB 2HMWA 3O82A 1N92A 1MENA 1UBJS 2R2GA 3GLKA 5D5HA 4DUGD 4C4AA 1TRHA 3WHKA 1WD7A 1I2MA 3Q10A 1A97A 2FE1A 3AL2A 1NW3A 4BVHA 3HCCA 4EJFA 1UXKA 2H06A 3IOBA 3ZJTA 3D8BA 2ZAYA 5BORA 2GPYA 2HLNA 1P7PA 2O8CB 5JC8A 2IH4A 1S96A 2MJLA 4BEBA 1RHKA 3DEIA 1PBNA 1QXSA 4R98A 4O4HA 4UVHA 3LQKA 3GNLA 1FFWA 3VR2A 4C4PA 1I4LD 2GF2A 3C3KA 3MLAA 4UVDA 4JC0A 3WLEA 2WFLA 1LPOA 5IDXA 2PS9A 1ZW6A 2ZVQX 1SVIA 3OZWA 1Z22A 3K1YA 2W93A 4Z9YA 5LCXA 3O8RA 1SXQA 4WZBA 1CY2A 3MTIA 4JK3A 4RS4A 1CNEA 1FXWA 1GKYA 1I2ZA 2HF9A 5BQOA 4L4UA 3RGWS 2HEGA 4FYYA 2Y1DA 2RCYA 2ZBUA 4LHSA 4D0SA 4KE8A 3DV0B 1QV9A 1O4WA 2DT5A 3L49A 5EPOA 4YJKA 1WU7A 3EIWA 4W4TA 3CCFA 2VP3A 4J9UE 3EVFA 3ZV4A 3RFXA 3LUFA 3QX7A 2IHKA 3F5FA 5DHQA 3EC2A 1CJBA 1XVAA 4LZOA 2I4OA 4EZEA 1G8MA 1O94D 1PNVA 1V39A 1W0CA 2WWFA 3FMFA 3K2IA 2BF4A 2QIOA 4MWEA 4YYEA 4L07A 1KEZA 3RS5A 4X24A 4HGQA 4MP8A 3A9UA 3EIQA 3RSCA 5JD4A 1M67A 3UFXA 2F00A 3HVKA 3RBXA 1G38A 2VVTA 4AUEA 2YJTD 3EXIA 3FNEA 4K2AA 1R16A 1CULC 4YAUA 1YNSA 3CXUA 3S7TA 4MRMB 3OHMA 3VR4D 1DOZA 4F5EA 1S3GA 3EEIA 4JIMA 1X74A 3JAKA 5DI3A 3DS8A 5T4FA 4ND4A 4QEKA 4LSZA 2HF7A 5B1IA 1EJ0A 2OILA 2Q50A 4ZU6X 4Q15A 2CEAA 5AM0A 3AWDA 3I52A 3WQQA 3L6RA 4LJ6A 1K7SN 1OLUA 2X1MA 2ZYAA 3D8SA 2Y3IA 3NHYA 1LLDA 2A0XA 5AW0A 2UYCA 5HJ2A 2RHGB 5G4KB 3DD5A 4ZKEA 1T5DX 3PEYA 4E6EA 3PT9A 4AI6A 2OBMA 3L9WA 4RXMA 3OMLA 3M2TA 1B8NA 3RYFA 2JFHA 1J2RA 3NJRA 4X6YA 4WJKB 1DEXA 1AMUA 4RVDA 4C0QC 2P7HA 1R4MA 2FA9A 1FS6A 2CMDA 3PNBA 5GV8A 3MTJA 4YGXB 1E9CA 3ZI0A 2PO7A 4KR7A 3G2QA 2H85A 2HCBA 4JI1B 1OC4A 1GTSA 3DVRX 1I3LA 4J91A 1OLSB 2ZDQA 2IKQA 2ZRQA 3F3SA 4H3SA 2RGGA 4YWHA 3KVVA 1A9SA 2IE8A 4OF4A 3O1LA 1UPXA 2XADA 1G21E 2NVUA 1QO7A 2R87A 1MIOA 1CUIA 1E6KA 1NQWA 3GMSA 1JV2B 3IHKA 4MVWA 4QLOA 1KVQA 1I9GA 3GA5A 3F5MA 1A1SA 3IAXA 3P52A 3O0TA 2BBSA 3G6WA 3MGBA 4HYYA 1HGXA 3RD5A 3DZGA 4YBRA 3W9BA 1GL6A 1ZD4A 4HJXA 4JDUA 2P4QA 4BTLA 2CYCA 3VR6H 1EK6A 1VHQA 1DJPA 3TKAA 3QM1A 4HK4A 4TSKA 1JI0A 5DIZA 5FO0A 3S1AA 2RE8A 1NOKA 1VKJA 2FXVA 4EQ6B 3H19A 5LWQA 3VJKA 4FB4A 4YRSA 2V5VA 3R2JA 3U7FB 1C1YA 4PAMA 1RWBA 3QOFA 3ZU2A 2J6HA 4EZIA 2XCRB 2BGUA 4QC2A 4F84A 4B6FA 4LK2A 4DPKA 1FNDA 2XXAA 1BWPA 4CNQA 2PN1A 3QF7A 1WXGA 4QOHA 1GQOA 4AJHA 1KTIA 1OWPA 1YNOA 2HMAA 1SCJA 3W3AD 4L57A 1V5GA 4QG3A 2QMZA 3FSGD 3IQEA 3HCBA 3N70A 1BRMA 3DL4A 1PLKA 4RVNA 3A4LA 1Y48E 2AV6A 3NHKA 3DGFC 4BTVA 4F97A 1G8HA 3JD3A 4YRNA 2GN4A 1U98A 2YIJA 3DOIA 821PA 4F92B 1VHLA 5HQJA 1QZXA 1ZNQO 1XTSA 2J5XA 2Q4OA 2GVZC 1M0TA 5FUXA 5MN4A 1GGVA 4NMLA 4OXIA 5FEMA 2VH1A 3LSYA 3UXEA 2OPHA 3WWEA 2HAEA 2FDCA 3KR1A 5JJKA 2JFXA 4QUIA 2VCEA 2O1SA 2OBNA 1OB2A 1ZIYA 4CM4B 3AKEA 4LBYA 5TMBA 4C22A 5JBQA 3TW6A 2Q0HA 4GZ5A 4NR0A 2PMFA 3U26A 1TADA 4PX5A 2P90A 4IDFA 3RVNA 2IYFA 5B4UA 2XPCA 1BXKA 2EL9A 5FL3A 4KITB 1T5OA 1A3CA 3DBOB 3N6RA 3FGZA 3FYHA 2FWBA 1L0BA 1TZBA 1USIA 4ZAXA 3ZGXA 1QIJA 4JL8A 3AFMA 2PRSA 5IJXA 1AGYA 3Q3VA 3N2ZB 2O05A 4D6YA 4AUNA 1FJGB 1BTOA 4JA2A 4WXYB 2YJNA 4E5PA 1DBQA 1GDHA 3A1EA 3QLUC 3R3VA 3EXAA 1AQYA 3M8KA 4IUDS 5CA1F 3C6QA 4UJ5A 3VTFA 3I0MA 3CBQA 4Q3KA 4ZYVA 5I9MA 4CM9A 4DTCA 4KG7A 4PYLA 2J3HA 1T0PA 2GF0A 1OIVA 2FN8A 5ENDA 3TZBA 4RPCA 3T38A 2AKEA 3U31A 3Q7SA 3ZCPA 3QLUA 1U7HA 3PR3A 3T7RA 1PUJA 2D8AA 3C4QA 3JYPA 2EARA 1V9SA 1DKRA 1UOQA 3BOSA 3HCFA 5AJHA 3FOEC 4E07A 3X2EA 3QJGA 1X9GA 5DGHA 4UDNA 1ZD3A 3KJQA 4QUBA 1U4OA 2GJ8A 4CMEA 1FQJA 2QUIA 1U0HC 4G25A 5D00A 2XLBA 1NC3A 2WB4A 4IDPA 1GNPA 2ACVA 3KKKA 3L8EA 2UYYA 2J33A 3HO6A 2YICA 1WTCA 5I3ZA 3EBLA 1W46A 2ILTA 4YDSA 5DHTA 1BN7A 5JXGA 1OU0A 2P67A 1BMTA 3MTEA 1KJJA 4PONA 3SOZA 3UMFA 4EOGA 5JVDF 3IR5A 4O08A 2VAXA 4UM8B 5DVZA 3GB9A 4PXAA 2HHAA 3LI2A 3D7KA 3D3KA 4HSEA 4EYOA 1SHUX 3GLFE 5CA0A 3TM4A 4DJDC 2HLDD 3LDFA 4UBOA 1RR6A 3IVMA 1R0KA 1T3SA 2IYRA 4OMDA 3VU9B 4AULA 4KV7A 5ALFA 3U3XA 4BP8A 2B4RO 2GXQA 4LY3A 3TD6A 4RQTA 3FSEA 2WIGA 3ADPA 3FB4A 4DA8A 1C7IA 1L8XA 2PL1A 1MH1A 4N3BA 3TR0A 3UN1A 4QO8A 2Z6AA 3PGKA 3A4TA 2FW9A 3Q2OA 3X0DA 1MW8X 2A7XA 4PICA 1TCAA 4Q01A 4UAGA 2PX4A 1VC2A 2FMTA 1FA9A 1A5TA 4LTDA 1ULSA 1JLRA 1L6IA 5HUHA 2H4YA 1DEHA 3A37A 3TW8A 1Q91A 5B3LA 4IIHA 4MR8A 1A4RA 4Q3LA 3OZTA 1WHSB 2OZEA 5HR5A 3HR8A 5MGBA 3N0TA 4K2HA 1M8PA 4CIXA 4D3YA 1TE2A 3EY4A 4QSHA 2J9YB 3TKYA 4GI2A 2XMBA 3C3JA 1XD8A 1OILA 1EXMA 5LP6C 3AGPA 4X8OA 1KNXA 5L4SA 3CE6A 5KYXA 3P0EA 1BD3A 4F12A 4M6WB 4N5NA 4QTZA 1P0MA 1ATZA 2R4TA 1KEVA 4FINA 5BPFA 4WIAA 4IHQA 4LYGA 1DARA 2CSUA 1P19A 3O91A 1GRVA 1GPMA 1V6SA 4RLQA 1SC6A 5EIOA 1BHO1 2RGNA 2Z09A 2XTAA 1QQ7A 3RCBA 3G0CA 3EGDB 1CQJB 3KL4A 5HTOA 3BZUA 4J29A 2QQEA 1RZUA 1JUDA 2WTXA 3IVAA 2SICE 4H7PA 1L3BA 5JS2A 1NP6A 4MEBA 4YI3A 1WCWA 2APJA 2VEDA 4TMVA 1TCUA 5EZYA 1JKJA 3GJ7A 1ZM2A 2V7QA 4ITVA 4D9FA 2WR8A 3O2JA 3QVJA 5COQA 4JI3B 1SBTA 4L5YA 1H4SA 3RHSA 1AHHA 2XAAA 3JWGA 4P3KA 4CN8A 1YJAA 1LKZA 3FPLA 4OJNA 1GFSA 1U7TA 1P1IA 1YMVA 2R8OA 4HADA 4DNFA 2IS4A 3KXDA 1W76A 4NJMA 1FX0A 5IS2A 1DV1A 1TOAA 4P31A 1L7BA 1TCCA 2HHJA 3C41J 1MC4A 3CTMA 3MWDB 2LIPA 2O0HA 3OT1A 4D96A 5EJ9A 5ITZA 1G9SA 3DUFB 4IWXA 4DG9A 1NJ1A 3R7WB 2JF0A 3SNHA 4KX5A 4YUZA 1JHDA 1WX1A 1YFLA 2J4CA 1QYVA 2I1QA 5EJEA 1ZMRA 3DXFA 5FNVA 1ZONA 4B6SA 4IIUA 4JBWA 3UYLA 4HMPA 2N42A 1DQSA 2ZJ1A 3IESA 1VSTA 2GM3A 1PV4A 1K2VN 3EMKA 3KEOA 1U3DA 4GI5A 4DS3A 5DM60 1P8AA 4ECAA 5C1PA 3DEYX 2XZTA 3SX2A 3BMNB 1O6BA 1GVHA 3G2OA 3HYNA 1UBRS 4AJ4A 5L7WA 1X8JA 4IBOA 4DJ5X 1NURA 1P33A 3VPCA 1FU8A 3QFTA 3EGEA 4BKMA 1CZLA 4BQFA 5AM3A 3QVWA 3NTXA 1TQDA 4FYIA 1UMCB 2YASA 3MJDA 2UZ1B 3HU5A 4IFIA 3U1TA 3WMFA 2IKSA 1PQPA 2L18A 3I64A 3R76A 3UCEA 2PKQO 1CJTC 3RC8A 1NUPA 2NTNA 3CWQA 1ZK1A 3FWYA 1EQUA 4V0RA 4FR2A 1ZMOA 1L5HA 1XEAA 4E4YA 1QOZA 3CW8X 3BFVA 3EY9A 1AGRA 3PZBA 4P82A 4RH1A 4KFTA 4EYEA 1RM0A 4NESA 3T7SA 2Q0XA 2OHJA 3LGXA 4NCJA 3H9UA 4XLLA 2KS6A 3E35A 2BOVA 5GVSA 3CSDA 4RTJA 4B34A 1I1NA 4A26A 1FDOA 2R6JA 1Z18A 3SD7A 3TLGA 2Q1WA 3TVDA 1RC0A 1ZN2A 2KMLA 1CZNA 3JARA 1U65A 2HTFA 2IDZA 4OSPA 5JAQA 3RTDA 2O8FB 3ZDDA 1IUNA 2VT6A 1M2VA 1HDIA 1DJNA 1QS0A 2VBIA 3GFBA 3KAJA 3TQTA 4DY4A 5JFTA 3R3YA 2QROA 3OY2A 3ME5A 4HXFB 4B5KA 5KQLA 2FWJA 2NXWA 3P4UA 3ORQA 2FG5A 4Z4EA 1QRRA 3ZV7A 4B8WA 2QJFA 4AX4A 2B4KA 4C7BA 2WPDD 3HDVA 1HR0B 4WH0A 1ZK0A 2C58A 3K8QA 1MKYA 5IVIA 3W1VA 2YWDA 3KJIA 4BNHA 4XWGA 3R9XA 2FFQA 1VCHA 3KKMA 2J7PD 1IN4A 3MQ2A 1D9XA 4KGXA 4ER6A 4C2TA 1U8EA 3K32A 4LJRA 2CV0A 3LO8A 1M1ZA 1BMFD 4JD5A 3DDHA 2A67A 2IEZA 2QYTA 3TMAA 2BHRA 1X87A 1YCFA 4PFKA 1TQ4A 2BJHA 4B8ZA 2VRCD 1WW3A 4FFRA 1DZ3A 1IG3A 1LZKA 1SBQA 2GLUA 2L17A 2WF7A 4IGKA 4OHRA 3PTLA 4PSCA 4FYXA 4WTOA 2QWXA 3S2SA 3WGLA 2VT3A 3NXKA 3JYOA 2ATVA 2C1EA 3I37X 3IP6A 3OCWA 5JAPA 3RYIA 1KI9A 2EJUA 2ERYA 2ZAMA 3OU2A 4CRWB 2F17A 1DIAA 2MTBA 4G09A 2Q27A 4DBZA 2WQ6A 2PGNA 1H0RA 2BH9A 2A4MA 1LV8A 2B1IA 3QEMB 1J90A 2X42A 1BS2A 1KEEB 2AR9A 2JLBA 2RI0A 3HZOA 3OP1A 4Y2HA 5I4CA 5IU6A 4N48A 4M83A 2LTAA 4MWGA 3P5BA 1W88B 4Q4HB 4IOKA 1JYSA 5IJ0A 3SBDA 4YRTA 4IDQA 1B6TA 1H5QA 1SCQA 1NPDA 4BB6A 4Y9TA 2DKFA 3VBEA 2I76A 1WOYA 5T8KC 2G1UA 2I2DA 1D5WA 2G63A 2CNBA 3B6EA 4K28A 3AHCA 4ILEA 1H9AA 1L4UA 1LLCA 1E1RA 2H29A 1SCKA 2FN4A 3KLMX 5J5VA 4RTKA 2GYVA 2L69A 2ZIGA 3EG9B 4J2OA 3ZW8A 3S1LA 3T5BA 4X8MA 1APBA 3E3NA 3F90A 4TKVB 3WOVA 2H2HA 2O2JA 5T8KA 5L53A 4PQFA 2PMCA 4GOXA 5I01A 1JDZA 1JS1X 1IAQA 2LVBA 3X1KA 2NU8A 3LT5A 1NI3A 1V6CA 1W29A 1C7RA 5THQA 3V8RA 3VVLA 2GHIA 2OD9A 1R0ZA 3MJSA 3PQ5A 1W35A 3TTUA 3VZSA 3REOA 4EWLA 5I7SA 3RI3A 4YFYA 1COWD 4RLFA 3EGXA 4N39A 5ED4A 4HDMB 5LJIA 3THWB 5DHPA 4LOKA 2HU7A 1Z5UA 2O14A 3DAPA 4OH7A 4K1LA 2VHTA 1ZK4A 2AX3A 3HB7A 4UEKA 4XGKA 4ZOCA 5A2GA 5L4LA 2PWZA 1KI4A 3B20A 1T6XA 4C29A 1QIEA 2Y0BA 1IY9A 2V9PA 4FCCA 2HIGA 3ZCXA 8ABPA 4AROA 1XMQB 5I3CA 1G21A 2XTJA 5ALGA 4JP3A 3V4RA 4FYPA 1CF9A 2JEZA 2C9MA 3AJDA 1PJTA 1NXPA 5ALPA 2QGNA 4ZAZA 3T9FA 1FBNA 3B53X 1G20A 3ORRA 3CTPA 4UUQA 4R9UC 1M2JA 2C0PA 1C3OA 4Q16A 3FWHA 5DXFA 3U4CA 1IY2A 1QGDA 3PHJA 3VUEA 3WLMA 3NYRA 3SX0A 4XDHA 5HXAA 3DKPA 2ODPA 1O9HA 1N2CE 2ODAA 3KDAA 3DEKA 3ZCTA 3CUYA 4JL6A 5BO5A 1EIWA 1QRTA 4U7HA 4LF9B 1F2TA 5KQRA 3B85A 2FX5A 1U6KA 4I9UA 1B0PA 1KVTA 2AK3A 2A0FA 2J41A 1BQ3A 1JHXA 4TKLA 3KR9A 5THXA 1P2UA 3GRRA 4OOEA 1J33A 3H5VA 4KYIB 4S1TA 4ZGGA 2I6SA 4OXNA 4R1LA 2JW5A 1YZYA 2DH6A 1NI4B 3EN0A 2O1WA 5AP9A 9MHTA 1THZA 4JBGA 1SOAA 5LXTF 2ZWAA 1PG0A 3UGQA 5ED0A 1TU3A 1CTQA 1XCGB 2CNDA 2WWTA 5TNXA 3ZDAA 3TRFA 1GUBA 1C41A 4QBFA 1K27A 4OHMA 4NE7A 3P96A 1H2XA 1ADJA 5BOVA 4QXMA 1ZA1A 1PK8A 5JSFA 2J85A 1TD9A 3WLQA 1W0KA 4K6CA 4WFJA 4LZLA 4J0JA 2PT6A 4A6PA 4A0QA 3NBUA 1VJRA 5BUSA 1QRDA 1GZ4A 3N53A 1ID1A 3HYRA 3MUNA 3PNMA 2Q5LA 4TWIA 4Z3KA 4UU1A 5A7FA 5HZMA 2EWVA 5IZCA 3K8OE 5KOHA 4I4IA 2VYFA 1Q1ZA 3GZNB 3RNOA 3MAAC 1DFIA 4HRAA 1BVHA 1KIMA 1KFEB 3IDQA 5KSYA 4Y1RB 2AHOA 3OJLA 4Q4DA 3W34A 1Q77A 2GN6A 2JDIA 3G0IA 1WCIB 1RLTA 4EKYA 5A4DA 4XIIA 4BZWA 1XKXA 2RKBA 4DRYA 3N2EA 4LXGA 5LLDA 1CB0A 2HLHA 5DNDA 1WBBA 4QOJA 5HS6A 4UU7A 1E2DA 1YMUA 2AZ4A 3M6AA 1P2TA 3QTTA 4MUBA 3K5WA 5CX4A 1OJ7A 3LXRA 3IKTA 2ZRKA 2GWHA 1ECLA 3CNBA 4GWGA 1K6XA 4OXQA 3OQNA 2IHTA 1XN1A 3HKBA 4H0FA 1DUVG 4NQRA 3S68A 3L8HA 3KOWA 4BL5A 2I34A 5GPBA 4ZFNA 2QBYB 1QJCA 2RIRA 4CCYA 2XUDA 1KHHA 3HDQA 4U1RA 3ICPA 2C7GA 1M0WA 3WSVA 1KSHA 4D92A 1QAQA 3B1FA 3C6MA 4HAZA 1Z07A 3LT1A 4PLPA 4WXMA 3RHZA 3FMVA 3WL8A 3ZWXA 3WGVA 5A4KA 2YINC 3MFYA 4PX3A 3F67A 1GG2A 1G8JA 1R9MA 1CJVC 3JXEA 1QC5A 3U39A 4KXNA 3OQIA 5JPIA 3C70A 2AN1A 4QDKA 1EVZA 4B0PA 2JLXA 4Q3DA 1IEQA 3PNSA 1KO7A 2PSFA 4U4AA 2YYZA 1VYUA 3NHJA 4RO0A 2C57A 2Q9AA 4P5EA 1MOZA 1CNMA 4HHEA 4EG8A 3WGUA 2PGJA 1JQBA 3QUSA 3V8VA 2NU7B 5BPHA 2Z4RA 2BFWA 1E2PA 4G67A 4MA0A 5D86A 3JZFA 3SHFA 3BM5A 4YFVA 1UK9A 3TI7A 3DVSX 3K5PA 2YMMA 1L3IA 3W6ZA 4KSCA 3REGA 4H7IA 2VDPB 3UT5A 3R5TA 2FHPA 2R96A 3GLFA 4CEIA 4DKXA 1H8HA 3I42A 5CNMA 2C2ZA 4EYQA 3E2MA 3N7AA 5KWIA 2FZWA 4HQ6A 4AYXA 3NNSA 3FDXA 2X2FA 4G5SA 4I2VA 2ZKIA 5BUZA 4XTCS 1QTQA 3RUHA 4JXZA 3UJAA 3QFRA 2QL7A 3CLKA 1QH1B 1JTEA 5ICGA 1PR3A 5ADUS 1TYZA 5B36A 3G9XA 5HKOA 2HHHB 1SCAA 3ANMA 1UUFA 2YY6A 3W6PA 3AL0C 2E5WA 1DWQA 3FVTA 2QN8A 1TO6A 5F7JA 3SLGA 1W25A 3VPAA 4CTJA 5AM2A 3AVXA 2YZKA 1O54A 2GRAA 2WFAA 4ISCA 1DL5A 1UKVY 3BXZA 4WXEA 2W11A 4AICA 2BGRA 4FX2A 4M37A 4W8GA 3W79A 1U1EA 3G2IA 2PNFA 1TCVA 1FTSA 3WO0A 5LYJF 1K4MA 1QHNA 3FJYA 4S04A 1XNGA 2OCIA 3H1AA 3RU7A 2YQ4A 5EHZA 1R0RE 4NOLA 1KVSA 3DMRA 2N0SA 3IPRA 4D42A 2DERA 2F67A 4B2LA 1BAPA 4TS4A 5DZSA 2W2QA 2VSNA 5TARA 1V5EA 3WIDA 2OFPA 3GJ3A 1VBMA 2D4HA 3T7CA 3AOGA 5E6SB 1C3VA 2JVKA 1BO6A 4HNAB 1VCMA 4OGKA 4FFMA 2GTIA 3PC2A 4G5XA 3M0EA 2B4QA 1Z2PX 4K86A 3AB8A 5FPTA 3M6LA 4NL4H 4BMVA 1A9OA 5JSUA 5KYNA 1J49A 4JXXA 4I1PA 3HB9A 2DUJA 1SUAA 2DWUA 3J7TA 3PYMA 1L7EA 4F7DA 2O2YA 2JHPA 3GEBA 3IJEB 1S8AA 5CBPA 1W85B 3OBIA 2FFBA 1PS9A 4CKEB 5IFKA 1W19A 2ID4A 3MT7A 4H31A 4Q9HA 3VKHA 2W6JD 1HL7A 1VG9B 5FCDA 2V55B 1DAFA 1G3MA 5FTJA 4EITA 3OX1A 5ALIA 4N8DA 4FFSA 4MVJH 4I5DA 3TQSA 1E7MA 5JQGF 3TTXA 4NFYA 2QZZA 2WAMA 2D5IA 1EDEA 3ORYA 2CCKA 4TKMA 1VECA 1T34A 2VDNB 3K1TA 3ZZMA 2ZQZA 1EWTA 2A2ZA 4RZ2A 5C18A 4HQNA 1IZYA 2GEKA 5FV7A 2C97A 4B3BA 1PHPA 1AQIA 3FMPB 4IGEA 5BSGA 5BW6B 4XOIA 1RZ3A 4MUYA 5HSGA 1JH8A 3LH5A 5LOVB 1Y7LA 5JH7A 3KLBA 2ZIZA 3NIGB 4HYEA 3CNLA 3FOZA 2IOYA 3TTVA 1E98A 1CY0A 2ZWOA 4CF7A 1YA6A 4MYHA 1E9FA 3S55A 2P6OA 1Y1SA 3P0FA 4XVCA 3BHMA 1ZJYA 2WUWE 5KQSA 3DE5X 1I7SB 4KLNA 2IZ7A 3K6SA 2Y6UA 3STYA 3EOZA 1M74A 3FOFC 4WJLA 1H4VB 1WCV1 2X8JB 5C8DA 3LV8A 3BJZA 4YRKA 4NNOA 5DIFA 4MKFA 2LCIA 4QE3A 4WDRA 2IY7A 1EFRD 4UFNA 2FUG6 4TM8A 3QU4A 1OR8A 3WADA 4DNPA 1CLEA 4LJLA 5BWBA 2G71A 1MC5A 2NVWA 1ZIXA 3CZ9A 3P19A 2WFMA 4A0FA 4JB3A 2XZLA 3LUAA 1ZD9A 3PPIA 2LDBA 3VKVA 2DY0A 3H5TA 4DLXA 2RDMA 1LH0A 2EBUA 3C43A 4HUQA 3U4MA 1UK8A 1PL0A 2OLJA 2X5XA 1G6HA 2C07A 2BUAA 4GPZA 1XZBA 3QK7A 4HVTA 3PT5A 3QI2A 2AC7A 4JBXA 5EHGA 2PZEA 3GUCA 3QLTA 1FF9A 5ITVA 2FMHA 3CPHA 2W70A 3V5NA 4ALMA 2QD4A 5KNBA 2FSGA 3GAMA 4EFLA 3VSBA 4YJHB 2QT1A 1BXZA 2AWNA 2OYSA 4RBNA 5THKA 3RRBA 3QPCA 1NBWB 3L6CA 3OICA 5JS1A 4NJOA 3T4XA 4QYSA 3GLGB 1LF5A 3AM1A 3UJDA 2FGJA 5JISA 1QSGA 3KJFA 3U4IA 1VB5A 3F7TA 1I1QB 2A5DA 2YHIA 3CX6A 5HOEA 4AJ2A 4GGMX 4XD7A 4QJBA 5FR2A 3ES9A 5GIPE 2H2IA 5ALHA 1NLUA 4FFPA 4YCNA 2G9UA 3FNFA 3TUZC 1PL8A 4GH5A 2QZ9A 3B6KA 1H2ZA 2V7VA 3Q5DA 4XWYA 2OC4A 4C2UA 5T57A 3CSSA 4DRXB 1D0VA 4ARIA 3CUVA 2V4MA 3NATA 2SKEA 1I3KA 2UZIR 4DPMA 3O90A 4B81A 5G1OA 2YMPA 2VPQA 1UPAA 2BELA 2LR0A 3PYXA 4KAAA 4KRFA 5JCJA 5I6DA 4S0ZA 1T9CA 2LCFA 4LZZA 3JD0A 4B3CA 4ZI7B 4ZYTA 1P9RA 5JJBA 4DB4A 3JQRA 1ZGAA 1A71A 1T2CA 3JWHA 4KKVA 1GCIA 4FLMA 4HGPA 1XK6A 5JY6A 3VAAA 3DE2X 4BNXA 2F9FA 4YHBA 5TXGA 2JARA 3WYGA 2FPWA 4AXBA 1FLNA 1P91A 4OHVA 1BRTA 1H1DA 3U4DA 3UBMA 1ECFA 1RI1A 1Y7TA 3LHSA 4Z4CA 1II8A 3DW1X 3TLBA 4MQFB 2P62A 3NALA 5AVZA 2ISSD 2MSKA 3D31A 5E38A 1G0NA 1RLUA 4CF6A 1QB7A 2WJHA 3H4MA 2XBUA 4L4ZA 4TS9A 5KU1A 2B6NA 3QMMA 1V5IA 4GYWA 3D8NA 1I3NA 2ZZMA 3CPJB 3DBRA 1KOLA 3NPAA 4F45A 1E96A 2RFLA 2G6BA 4C4YA 2WD8A 1HE4A 3KUCA 4HUJA 3T7EA 5CJ2A 1E60A 1EXWA 4PGHA 4H4DA 2B3TA 1GNSA 1QTRA 4XQ9A 4YAJA 3ZCVA 2WD7A 4CU2A 1XZ8A 3U16A 1N8TA 3EXHB 4IKEA 2PJDA 4MW9A 2JJQA 1D3AA 1XQ6A 2FFJA 3QVMA 2GBIA 3ZQKA 3ZWCA 2Q2OA 4UD2A 4D4IA 1E58A 4LHYA 4EX7A 3OT5A 4MVJF 1JG6A 3BC1A 2AG1A 3FSJX 5TX7A 3QF4B 1KE2A 4EB6B 2Q21A 3R3XA 1OA1A 4IWYA 4X8HA 3KKOA 3KYCB 2Z8YA 4ZHSA 3REQA 4FGWA 3WBBA 1MMFB 4R31A 5FOTA 1E7SA 3SEZA 2WWWA 3W04A 4YHHB 1KI3A 1NMYA 4ESVA 4OKIA 1AUXA 2O7SA 2PKQP 4KWTA 4X1IA 3V2IA 3BMCA 5E4JA 4LXUA 5J1SB 4QUAA 3GD5A 1B4DA 4QRDA 5EKDA 2VTBA 3FVQA 2WP8J 2YNMC 1TI7A 4C6SA 3R5JA 1UWVA 1AKRA 5C34B 1Q74A 3RF6A 3O8CA 3ELBA 2GEBA 1PF7E 2GZDA 2JGIA 3TXXA 2ZJZA 5EGSA 1JVSA 2CHQA 1NVMB 1ZNYA 2YNMA 3DBVO 2IYXA 2ZUEA 3HMQA 3I4LA 1IPEA 3NPMA 2TMDA 3C4VA 2ZVPX 3NDJA 3VRHA 4UVGA 3QX9A 4I81A 4PRYA 4L28A 2ZIFA 3MCZA 4FMCF 1QGYA 2Z3ZA 4JC4A 1S2GA 3IAM6 3W3ZB 4DLWA 3ER8A 3NOVA 4LNUA 3OHSX 4MGHA 3VHXA 2MWMA 4FGUA 4F3KA 2O5VA 3HADA 2VZ8A 3LPCA 1N2SA 3IE1A 2ZWMA 3OPXA 3DFIA 4ATNA 2JLCA 5A7GA 3A26A 5JD5A 2IEBA 2AW3A 3WYEA 3L05A 3GQBA 4EI2A 2MSLA 1H3FA 2ZETA 4K46A 3T5PA 4KR6A 1O97D 4NH4A 3ROZA 4LHWA 1OT5A 2VRNA 3N1UA 1KSGA 5F52A 4GPTA 1NG9A 2ZROA 1N6IA 4KWIA 1N2CA 1LFDB 1P3JA 2F7SA 4RKQA 4FBMA 5CW2A 5CCXA 3FCOA 1NXVA 2ATCA 1PFWA 1NXQA 1Y3DE 3AF5A 4UMFA 2O52A 3IV6A 5EUBA 1YJBA 2CXNA 3ECAA 4IQ8A 5HM6A 1ZVVA 1BN6A 4II3A 2KBFA 3AESA 5DM4A 1SXGA 2OBFA 3NO4A 3E15A 3AVVA 4Q02A 1NN5A 1RXEA 2I03A 3IOEA 3PXCX 3LX4A 2EBWA 4IQGA 4A5SA 5AJUA 2HK7A 4OGWA 5ALNA 3U7EB 2XKBA 1XJ5A 1DHTA 2P40A 5ALQA 4GIBA 4MQLA 1WWKA 1O6ZA 4Q5IA 4QXOA 1MRNA 3UWDA 2W9XA 2GWRA 4ZIRB 3HO1A 1FQOA 4B73A 1ENZA 3DL2A 4LXTA 4HCJA 1JAIA 2YFYA 5CDFA 3MQFA 3OEED 4U2BA 3IAHA 4RS3A 4YGYA 2BFBB 5EXSA 4OXYA 1V25A 3TKLA 3TOZA 1KP9A 3EYWA 1L1RA 3QPAA 1KEUA 4HDSA 4KP7A 4PCAA 2OQVA 2H5JA 4ZYXA 4BNTA 1LB1B 1YJQA 3FF1A 4S1VA 4EL5A 5GM2A 2W5UA 1A72A 3CVXA 3T7AA 5KJ1A 2D2XA 3MILA 1POWA 4GPD1 1IK4A 1RZRA 2UUAB 2BH2A 2V97A 3OZVA 4FR5A 4KIJA 3FPJA 2XD9A 2ZRPA 3NBQA 4HNRA 5B1YA 1Q20A 3OLVA 2FPGB 1V1MB 4ACAA 4HATA 4IDAA 4Z7QB 2NTVA 1U6IA 1RJ9A 1FXWF 4NRDA 5BW8A 5IANA 1K9SA 1R3DA 4LSWA 1LBQA 5DM0A 5JV5A 3V00A 5CIWA 3SC2A 3VGPA 3GNSA 1M7GA 2A59A 3Q6MA 3DONA 3RIEA 3T5TA 3PB3A 1TL7C 1G3UA 4YCAA 5ARCA 5TC4A 1MVLA 3JVDA 1A27A 1KRHA 3WNQA 3I2KA 1OLXB 2R5NA 1ZITA 3ZIAD 4QSMA 1QHFA 3PXGA 2WIAA 3L0OA 1JHZA 1SG6A 3K4PA 1Y8CA 4K40A 4MX8A 4ZTBA 3ROGA 4K7JA 5DRTA 3UK6A 1TVKA 1G3QA 1ODTC 3EZYA 5ABPA 3N74A 1Q14A 3TSOA 3VOTA 5AVSA 2DTXA 5KNDH 1U8TA 4LWPA 2B8JA 5AKHA 5IABA 4KIGA 4EY6A 4PIPA 1JE0A 5H59A 2HIAA 4J16A 5HZGA 4F5WA 4UMEA 1ONSA 3E9RA 2NSHA 5E1DA 4NU8X 3E0QA 2KYRA 1GIAA 2RBGA 4EVRA 1B14A 4CM6A 2JFBA 1V37A 3CPEA 1NE2A 2AW5A 4BMYA 2ZG6A 2BFAA 3QUAA 3GVIA 5BWLA 1GO2A 1G5QA 2HA2A 1G60A 2R65A 2C99A 3Q5EA 1P44A 2DPHA 1SR8A 2ZXEA 4DMMA 4AZ0A 4AKIA 2WSSD 1QIHA 2ZI6A 1O57A 1PT6A 1C8BA 4XUCA 3TSCA 1RQPA 2P77A 2ZUWA 4YACA 5M3BA 1HSZA 4L8FA 3LHDA 3M1IA 3KKZA 5DX1A 4ENWA 3LW8A 5KIAA 5HCNA 3W5VA 4JJ8A 4EVQA 3IEPA 3IEIA 4ER5A 4XIFA 5ESDA 3C6YA 2WKPA 3GGGA 5FPSA 5B37A 4R0MA 2BTEA 2UYGA 2GVDC 4JENA 5EWJB 3CLSC 2WUVA 1KYZA 2HSZA 1BGVA 3ILYA 4YREA 5E3JA 1OB5A 2PBZA 1XQVA 2B8EA 4O6VA 1VYVA 1K8QA 4LZJA 1GRRA 5T6MA 4IWNA 4Y98A 5TPZD 2NXCA 1P1CA 3GIDA 4UBJA 2H1WA 4DMHA 1DDIA 1G5HA 4K1XA 4KAJA 4QATA 3OT4A 1P1RA 1X3LA 1X7DA 2DP4E 2PXXA 4R6XA 1Z6PA 3VZCA 1FFAA 5BW5A 1OWNA 2CKDA 1E5TA 2Q5JA 2RJ3A 3MIIA 5CD1A 5FHQA 3WYDA 4QQKA 2NTEA 1GPNA 3B9PA 2A9RA 4WKBA 4ZANA 3C6XA 4KIWA 4M7RA 3TGLA 3RAJA 2D5LA 1MPTA 4CQMA 1OU4A 3MHPA 4QULA 4DR5B 3GHYA 1RWOA 1Q16A 2CXQA 2JJYA 3JSXA 3PGLA 4URFA 2P79A 1VYTA 2BLLA 4UVEA 3WK9A 5K9ZA 4PC3A 1MV8A 3KP1A 4HDKB 3V48A 2CJPA 4WERA 2JGDB 1Z2DA 2QLTA 3NC4A 5JDCC 1KAHA 1XP8A 1HT2E 2DYKA 5MHTA 1K4KA 1PNTA 3CT4A 1F6WA 3SFVA 1ZIOA 2DGDA 1E32A 2ZIAA 3H3XA 4BFWA 4QKQA 4I55F 1MIHA 3G8BA 3HV0A 3A2NA 2CXTA 4ZZIA 3GK3A 4M9CA 4DQ0A 5I4BA 4MS4A 3H65A 3RK1A 4CTMA 4RD2A 1UZNA 1B8VA 1XD2A 4UNRA 3PIIA 4XCXA 3Q7PA 3V4SA 4YAGA 5DLDA 5KI6A 1GZSA 2NNLD 3OZSA 2V7GA 1DG3A 1N3IA 5EIBD 1PYDA 3EEOA 2V7WA 3QP9A 4AMBA 2ZPUA 1KZ7B 4TZKA 5JMOA 3G79A 1AQNA 5AXDA 5ADVA 3E1GA 1F8XA 4HH0A 4BECA 5GONB 3FWKA 2VWGA 2CMKA 2AOVA 2DJIA 4LQ4A 1TTQB 5IC5A 2YY5A 4KPYA 4W1SA 2J45A 5HF9A 2Z8XA 4NYJR 4PBTA 4RPJA 2PQMA 3GP5A 5ECDA 5AW8A 1S3IA 1ULBA 2JVIA 2YWBA 3T4PA 4DJFC 1J8DA 5DTMA 3ZJ4A 1H6CA 4YRZA 1GU7A 1YKSA 3IERA 3L7AA 1BHSA 2RAUA 5CFLA 3X44A 3ETLA 3VSEA 1X7WB 4F6CA 2VPPA 3WQHA 2FPXA 1MAVA 3GGSA 4BFVA 4HLUC 3FPAA 3DZCA 1XRLA 2XUZA 3HV2A 5CAEB 1NVDA 1CK4A 2F3PA 1XALA 4UBLA 2J3JA 3U7GA 3VH3A 1OZFA 2QX9A 3EXFA 3T3GA 5BN1A 3UA4A 4ALNA 3ICQB 5KVQA 1QO0A 1E61A 3GRYA 5AKKA 2JJ1A 4ALLA 1ZJ4A 4RAOA 3EIXA 2KX7A 2RIPA 1IVNA 2WHXA 3WMRA 2XVXA 1TC1A 2R48A 1H1TA 4IH4A 1SIUA 3NIWA 4NARA 1OBOA 1LXCA 2GCOB 2HY7A 3IUJA 4BB9A 1E2BA 1AN0A 1N2BA 5B58T 1F0YA 2PIAA 4HOYA 4MQEA 3DXZA 3TIVA 3CKYA 4BU0A 2YHSA 3A58B 4AAYA 4PN3A 5BSUA 1AT1A 1VMDA 2DPLA 4RTQA 4MV0A 2VP5A 5C5DA 3FCSB 2VXCA 1Y9EA 2CVZA 1ZQ9A 5HYVA 2PWBA 1D4FA 1KBOA 1Z88A 2JPDA 2ZRCA 1AU9A 1IHDA 3NKLA 3G1WA 3OEYA 4K8OA 4LTMA 3VR3A 1IBSA 1YBAA 2ZWIA 4X92A 3UQZA 3F78A 3WICA 2AZDA 3T7JA 4IRUB 1M3SA 2ADFA 2CMGA 3P9XA 1MOPA 3HBJA 3BWDD 1T36A 2H57A 3KT8A 3FHJA 4P98A 3LK6A 4BYMA 1K0FA 2FEPA 3GJRA 3GFTA 5LBUA 4EHIA 4MIEA 4AJLA 5B7NA 1Y1LA 1ACLA 4EB3A 2O2XA 1N5OX 4OQQA 3EWNA 1KTVA 1XTJA 1M2WA 4YTEA 1UJNA 3O03A 4HNSA 5GM1A 2CNLA 4H6XA 2BMDA 1QYXA 4NBSA 3H7IA 1OXVA 2Y1XA 3AHGA 1A96A 1JXQA 2ZATA 3TINA 3NT4A 4KO4S 2ZU6A 3QKSB 2VPYA 1SKYE 3IULA 2PVPA 5I7FA 5DCUA 1KQOA 4ZGBA 4QDOA 3HB1A 4O4IA 3BKWA 3LCUA 2B1GA 3T3NA 3FZNA 1SXIA 1SUBA 4FUQA 5DT2A 1R0BA 3ZJ5A 4EKGA 1VDMA 2QPTA 4FW9A 3R7BA 5JR3A 4RSHA 3IQZA 4QBIA 1ZOOA 2FEKA 4LPKA 1G7CA 4NZ9A 1JAZA 1GPBA 4LMPA 4DJAA 2GTPA 3OKPA 4NDNE 5AI5A 1GVNB 1GUDA 3RVQA 4RANA 1OYOA 1FQKA 1NYLA 3DEFA 3KKNA 4CEJA 1BXRB 3RS8A 2MR6A 3J80A 4YT2A 1QYDA 1P7CA 1F0NA 2DY1A 4YH1A 1TJNA 4DEVA 3FTQA 3D4BA 1MHPA 2R68A 3P8ZA 2EATA 3L82B 1R88A 1RAAA 3MM4A 4OJMX 4OHKA 1DAIA 5DLEA 2OO7A 1OAOA 3OZAA 3AUJB 1QH0A 1CUYA 2BJWA 3PJRA 2BFEA 4BX9A 1C2TA 3KJNA 1U7XA 1UOOA 2YQ5A 4LQDA 2JD2A 2E4VA 4Y6RA 2VSFA 4CLRA 1PQUA 4FBGA 3ETJA 4MO2A 3K0KA 5T4BA 4DDWA 2OZLB 2KBEA 3M6IA 1VOTA 4G5FA 3TG2A 2O5CA 2A4KA 3G5MA 4P32A 4D0LB 1BC5A 1KVRA 1T2VA 1W2WB 1NY5A 4I8IA 4B75A 2BEWB 3K0HA 3UNXA 5LP6F 4U63A 2GNPA 2V6BA 3P9KA 2ST1A 1LVHA 3EVCA 1QGUA 2RHTA 1B43A 1DJQA 2IU6A 3KLNA 4YJ3A 1KVUA 3LUKA 4Q7QA 1BU8A 3GFVA 2R6DA 5K8CA 4R0VA 4V2IA 4V1CI 1NMEA 2VRWA 3PK0A 4MPPA 5BXYA 1YQEA 1X7YA 2WW8A 3C3AA 4G1VA 1A4UA 2A9KA 4TXLA 4BKUA 1PNRA 5EZYF 4JR0A 3F96A 2V58A 4DLLA 3QW2A 5DHFA 2QAIA 2WM2A 4UXJA 1Q5PA 1VRVA 1Z0FA 3DBLB 1IJFA 2JS7A 2BCJQ 1K7CA 4PU0A 5HNKA 1IWBB 5FEUA 1YD7A 2HPVA 1LCIA 2EXXA 3JATA 3JQ9A 4O29A 4Y2TA 4H18A 4YNBA 4A16A 3NGMA 4F38A 2EFGA 1MFZA 2XH8A 2QTMA 2O8NA 5EINA 2C88A 3MK31 4F60A 2FJ0A 3L46A 2XRYA 3KKPA 2HQ1A 1PDOA 4MRPA 3WV4A 3E4CA 3K09A 3BK2A 4L5BA 1ITZA 2NAPA 1Z2OX 5T41A 5E6RB 3W05A 1U9IC 1HEUA 4YRIA 4F0JA 3A6EA 3DLTA 2ATXA 3ZGLA 3HL4A 3UWKA 3H1TA 1N0UA 1KGDA 4U7FA 2FEXA 1X1EA 3ZI4A 2V3WA 2W2LD 1QX3A 5KTNA 1XTIA 3EOAI 1EX7A 1IBMB 2VBGA 2C4VA 4HSGA 4E3WA 4EPRA 5SZKB 4QAQA 1JEYA 3DLAA 1T9GS 1QH8A 1SVUA 3H0CA 2J7KA 3UV7A 3KQHA 2EKZA 1ONPA 2C2XA 3L4BA 4J2HA 5DM70 1RPJA 1Y42X 1R66A 2EJCA 3B9QA 2AMJA 5KQMA 1LQTA 4MW4A 3KJHA 1V7CA 3Q0IA 1WY7A 2JKZA 1R2QA 3WNCA 3VPFA 2YVKA 2OY0A 1IUPA 1XZHA 1PP4A 2GJKA 3OM0A 1NY6A 3S29A 2ZE8A 3UMSA 1E5XA 2CWDA 4P7GA 1PQWA 3A4NA 4MKXA 2A5LA 2Y1FA 5I9SA 1HYQA 1JKIA 5HK8A 3P9SA 4WCFC 3ZPXA 1OZHA 5PGMA 3TDMA 1PS8A 2ZCUA 5KTTA 1WJGA 4NZYA 1PFVA 1Z8DA 3O6VA 4PEVA 1XZGA 4K8RB 4BVGA 4BIMA 3H9CA 2A1UB 4C76A 1HURA 2FNAA 2W90A 2WE7A 3CO0S 3OEWA 4MV4A 4WCFA 1VLVA 3ZXSA 2XT9A 4ARSA 2QRQA 4MAFA 4E5VA 3JQGB 5CVTA 4GM4A 3LCVB 1JHQA 1U02A 5AHRA 4IIBA 2DCMA 2VSYA 1QIFA 1O0CA 7YASA 1QAOA 1RBMA 3L18A 4PF1A 3QBDA 5TDHA 3L1HA 4NHEA 1NFRA 2QLNA 5JANA 4QZVA 3KPJA 2BT4A 3T3IA 4BNKA 2PAFA 2D5AA 4A8JC 3RU2A 1JLMA 1QZUA 4W1QA 1XCMA 3PQFA 1GG8A 1P6QA 1P4AA 1OASA 2X8AA 3LA6A 3L7MA 2WYIA 4J1QA 4QASA 4RL4A 3RYHB 5A3JA 5MN6A 1KHTA 1REQB 3MCTA 2JGFA 3PF9A 2O2EA 1JFFA 4Y2PA 5FDFA 3WRXA 2C00A 4EJMA 4B6OA 4G0NA 2NZ8A 5J63A 4A8JA 4CKCA 4DCPA 4POOA 4LRWA 4MWCA 3VNQA 4TT3D 3ABRB 4ZCRA 3IDZA 3O2SB 3CUSA 3G2PA 3RTCA 3ITEA 1M72A 4OFWA 4PHHA 3T4EA 4CYMA 3O3CA 1I2BA 1QUEA 4DLRA 3ND5A 4G5QA 3WL5A 3WWPA 1M5TA 1II9A 1ZM7A 2WNSA 2AD1A 3B1YA 2AZMA 4WOPA 2JLUA 1AURA 4QFCA 5ALTA 4O2BF 1U99A 4XEUA 4ZCMA 1Y8ZA 4LZPA 1Z68A 5G40A 1MXHA 1AF4A 1E0KA 4UU0A 1VL5A 2W2KA 1RLIA 2P9CA 4C1BA 2Z0MA 5KYYB 4OU5A 4NLLA 3U60B 4EHLA 1A4IA 3F2VA 4MW1A 4FGJA 1NAIA 1CRQA 2BGGA 3HBNA 5TF0A 1SAYA 4XWAA 2YS6A 3EEBA 1HG1A 2VCHA 3FVRA 4X7MA 3STVA 3PC8C 4EY8A 1Q6ZA 4KQ6A 3A6PC 4M1MA 2GBLC 3PDJA 1K0UA 3RBVA 3ABOB 3SF8A 1GA4A 3KOOA 4MUXA 1SXHA 4ND7A 3BERA 3SZ3A 5HF8A 1VIYA 4WSOA 4DMFA 1OX4A 2AJDA 1HETA 1VB3A 1S2MA 3D7RA 1N6NA 4JOCA 4KN5A 1HE8B 2IXAA 3MMZA 1L4BA 2BM8A 4MW5A 4O2AA 5HMLA 1D1QA 3T94A 1I6LA 4J6EA 3PEFA 4V0KA 1T6BY 2OTCA 1GA1A 4MMYB 4ZOAA 2B94A 1V45E 4E2FA 2UYHA 3GJSA 3HN6A 4W5NA 2FZVA 4RSRA 3HJFA 5LIRA 1G64A 4IIDA 1I7NA 1PT5A 4BN4A 2W2OA 1KORA 3RIGA 3D1LA 1ZRMA 5JT1A 3GJXC 1LVGA 2K5UA 2PXAA 4EF6A 1UZAA 4QJ4A 4KUGA 3QU9A 4QG7A 1YHZA 3ZE8A 5LWHA 4G0VA 1BU5A 3DP7A 1VLMA 6CHYA 1SA0B 4B47A 2JGRA 4BC0A 2F55A 2IWHA 3KSDO 3I2FA 1TJYA 2O6HA 4PXYA 3NEJA 1MB4A 1QHIA 2E4AA 3JAWA 2CYAA 2QR3A 1LTHR 2I2FA 1NQXA 3O92A 4JNCA 3ZE0B 3DTVA 3B5JA 1Y1KE 3SPXA 4HDRB 1NKTA 4LJ8A 1LQ2A 1PG2A 4FHFA 3OO0A 5C8XA 4HDNA 3GCGA 1A7KA 2W6IA 3IT1A 2L42A 1ZGCA 3WMGA 4H0CA 2IS6A 3RS4A 2VDWB 2FMKA 4B3DA 1WDWB 4IV5A 5EQDA 2ZYUX 1W44A 3O8OA 1B1AA 4XQCA 4YRCA 1VE3A 8AT1A 5CVEA 1J0CA 4NMMA 2WJZB 5BQPA 2O8DA 3OKFA 5LA6F 3VR2D 1NNEA 2C7OA 1NLZA 1RRGA 3PEUA 4HAVA 1OREA 2P6UA 4E2YA 4DDKA 3AUSA 1VKZA 4GDFA 2H9AA 1E5LA 3O83A 3D8UA 3B38A 3OTWA 4PIMA 5ALZA 3CF0A 2Y1CA 2BUCA 4NNPA 4DLBA 2VAPA 4DWOA 4XJVA 2KW5A 4PX9A 4TS3A 4UQOA 1UADA 2G9ZA 5JRJA 1SCUB 2IY8A 3SQXA 1W5EA 1U8AA 1P7VA 1SHJA 5JALA 3V1MA 2ZS7A 2H16A 2V6IA 9ATCA 5HKKD 1QFYA 4TRMA 5K8TA 3HP7A 3FDZA 4I9FA 1YI0A 3B51X 3GJQA 4AMGA 3SE0A 2QPLA 2C5GA 5EC8A 1QOQB 1Y3FE 2LXNA 2QM0A 5J2TA 4BXOB 4IZIA 4NCHA 1RI2A 5G3ZA 2Y9MB 1Q17A 3HRIA 3F6PA 3PGA1 1WMBA 3DVQX 3BDIA 1XMVA 1C7JA 3WLFA 2JI8A 3ZHSA 4WJZA 5K2OA 2FZCA 2IU0A 5A06A 2COEA 4IH1A 1AXEA 4NSNA 4A8HA 4TYNA 3IUSA 2QLMA 2P2CA 3CWZA 3IMGA 1NVVR 2JJ2A 3BMQA 3OH8A 4ZOLF 5HEKA 4BE4A 4JR1A 1QONA 3E1SA 4OBBA 2C98A 3PFFA 1N3BA 1SHKA 1PFQA 2ESRA 2FYTA 2W6CX 2PNJA 5K0SA 3WHPA 1KKLA 3LL7A 3WK4A 4WFIA 2ZBEA 4AZVA 5BWCA 5K0TA 1SEVA 4O4HB 3KELA 4Q03A 1KNQA 2WLSA 3D3WA 4NH0A 4QPJC 5DGXA 5EGNA 1PQYA 4QOFA 3RG8A 3RVLA 2NUPA 3DWEX 1HDXA 2H92A 2YN0A 1E6MA 1EVJA 2WFLB 3ESXA 4C0XA 3HB5X 2I2XB 4JU9A 1PK9A 2CUTA 3WIVA 3DUWA 3OIFA 1SC3A 1GNRA 3GFPA 3KUDA 1BMDA 4K6OA 5DGIA 3E0XA 1NF9A 2H9YA 3GLRA 3KSAC 1JEQA 1ZAKA 1D2EA 2OQ2A 2YJ5A 1DX4A 1R3UA 1J2UA 1Z6QA 2FP4A 2WZQA 1AE1A 2IEDA 3CB4A 1BVRA 3K4HA 3I3SR 1RQNA 2PZLA 4IDNA 5DLYA 5E0OA 3CRW1 2WKQA 3QXHA 4X3PA 4F91B 3ILHA 1ZCZA 1MPXA 1HYBA 1QHHA 1JMKC 3NBXX 4RK0A 4C0WA 1M1NA 1PJ8A 2IP1A 4GM0A 1L7AA 1YKFA 1OYVA 2X58A 2GM5A 2TYSB 1DMSA 3MFQA 6GPBA 4JL5A 3Q2IA 3IX7A 3KSUA 3LBHA 1NATA 2C96A 1XGKA 1K68A 3UFXB 4GG1A 3RWMB 1NRJB 2ZRGA 4B46A 5CEJA 3RQIA 3NIBA 4QJ3A 4BNUA 3EXIB 1QP7A 2HUNA 4RDIA 1GV1A 3IGFA 3VYRB 5EHIA 2R1TA 3L0YA 4NU0A 5ILOA 2G5CA 1ML3A 1RLJA 1T4CA 3JAKB 3RE1A 3IOYA 4CLDA 2C2YA 1YQ9A 1JF8A 3LHFA 4HQFA 1XT6A 2IHVA 1JI3A 2MYTA 4M0EA 5KCMA 1QV7A 5SYAA 5KX5A 1BE1A 1CETA 4ZQIA 3PX7A 3FWZA 4NEHB 3CZPA 1OLUB 2NXNA 3OPYA 2FW6A 2ERCA 2R3SA 3AVPA 3F3MA 1DIGA 1KFBB 1MX3A 5K20A 1EUQA 4RPKA 5JZ9A 1R27A 3VR1A 4B5LA 2X4GA 1XZQA 4AKTA 3OTHA 3RYFB 2AX4A 2VDKB 1R4AA 1CR0A 3COSA 2PAAA 1MABA 3TQOA 4B48A 1RJFA 1V8FA 1NE7A 2VP0A 1R4MB 1N1MA 1CEQA 1Y6JA 2Q9CA 1FPMA 4G0OA 4KAFA 3RV4A 4YCDA 4O4JF 1EG7A 4YJDA 3W9UA 4AK9A 1FFDA 1XCBA 1IZ7A 3UOWA 3VKGA 2H0AA 3LQRA 3O38A 1X94A 4QA9A 3U4GA 2PH7A 1NA5A 5G2OA 2BTOA 3KT6A 1KI1A 3TOCA 2AB0A 1I8TA 4Q9NA 3T41A 1EJ6A 1YZGA 2NYVA 1U0FA 1VHDA 2V5UA 2NVUB 1EVKA 4PPYA 1MIOB 1XVLA 2AC4A 4J0EA 1SG9A 3RFUA 1DAHA 4JYPA 4Y2SA 2O2DA 3B1ZA 1R74A 1JR3E 3K94A 3E7PA 3ANNA 1BXGA 4NV3A 2ZJYA 3BA1A 3F0TA 1RKXA 4MROA 3BGOS 3R7NA 2NNWB 3SBOA 3NONA 3KIPA 2PX0A 3KDSE 4BNIA 4XGNA 3D7SA 2G6TA 3HFSA 2IYQA 4FYKA 4QUHA 3CNNA 2AG8A 2ZVJA 1RW4A 1VE7A 2XOEA 3H16A 3SEQA 2OL4A 3VOBA 4F2WA 5B3JC 1YR9A 3UJCA 2WFZA 2BBTA 1ABEA 1A50B 1NKVA 1B0ZA 1QIKA 1TT7A 3L1JA 4KFSA 4CM9D 1R50A 3S40A 5I4KA 4HH3C 4MYDA 1W59A 2BHNA 4L8YA 3VKUA 4L5IA 3ZE1B 2ZRAA 1CUSA 4I6GA 4KH0A 4L9RA 4PYOA 4XH9B 1EHCA 3GRUA 3V2GA 1ZD2P 2OOSA 2WM8A 4XPIB 1D4AA 1BHJA 2ACEA 3OCVA 4ZQHA 3UG7A 1WUIS 1W2GA 3BE8A 4PE5B 4FFOA 1W52X 4R5MA 3SIWA 2AE1A 5K8IA 3ZNOA 1ORRA 4N65A 1B3BA 2CGEA 1SBZA 1W8IA 1Q7RA 4LQCA 3TZHA 4DSUA 5IF9A 3AEQA 1DTWB 4XIJA 4XB6B 2PANA 5BT9A 3W6NA 2P8JA 2XUGA 2OGZA 4YUXA 4W5QA 5LU9A 3OQOA 4P3PA 2WSBA 3FUTA 2DMRA 4RPLA 1FS4A 2XB4A 1OTHA 1T5TA 5JD6A 3IPLA 3OZGA 4UTRA 4KDEA 3Q6IA 4D97A 2QN9A 4D4JA 4YY3B 3HDJA 1T6ZA 3HDHA 5CYFA 2W8BA 1BA2A 4CV2A 4ZYZA 2X3YA 5IH3A 1TPZA 3L1VA 4M36A 3RHFA 4CVNA 5DNVA 2XUAA 3V34A 4O33A 4Q4JA 4UHCA 3RUAA 1PGPA 2QRLA 3AB7A 4GS5A 1N3LA 2V6JA 3PHIA 4G0ZA 4MNTA 4DV0B 3PR1A 5JH7F 2VQDA 4FT2A 1M66A 2NZ2A 2PS1A 1T8RA 1ZOLA 2YJZA 4RHTA 5TEVA 1N32B 4QFBA 3PU6A 4ITRC 1TUBA 5B6IA 4IX9A 3AETA 3IP9A 4F85A 2BGKA 2LW7A 1KFJB 1LI7A 3FI9A 2ZJFA 3V1LA 5A03A 1JQDA 1BG6A 2TRSB 2Z2IA 3B5IA 3FNQA 4CTKA 2GAIA 3AHEA 3W6OA 1Z0KA 5MDHA 3SY8A 2NV6A 4RHCA 4HLQB 3T7IA 2H5LA 1IZZA 3AF3A 4IHKA 1J99A 1RM5A 1NJ8A 2YVQA 4LHEA 3NDPA 4J0KA 2I3AA 4FS3A 4F6LA 7GPBA 3G0BA 3RC9A 1FYEA 3ANXA 1HQCA 2NOAA 2F3UA 3ZYCA 4E5YA 4MUKA 1K89A 5JJIA 1VKRA 3BICA 1E6UA 2GETA 3VZDA 4E12A 4PLZA 5GIOE 4Q1VA 1A5SB 3GUYA 4QWMA 1USWA 2OK8A 1KZ6A 4JJ4A 4LK3A 2Y8EA 1E3JA 2LUOA 1CHDA 1R1DA 1L2TA 1JJVA 3CEMA 4L6CA 3G59A 3IA2A 4QELA 3LY7A 5B7QA 1LK5A 1Z62A 4YT8A 5AIBA 2XCSB 1MX9A 3PHLA 4JUCA 1X7GA 4W9RA 4JI2B 3GDHA 1AKYA 1WXWA 1Z16A 2AJCA 1Z35A 3PCXA 2H1OA 5FF9A 1UKBA 1ESEA 3IR7A 3SC6A 4F4HA 3M81A 1A8IA 2EFHB 4EB0A 2ZIXA 4PO3X 4Q3EA 5CA0B 3FLAA 4FJ0A 2A9VA 3D4NA 1JWBB 3JWPA 4MTLA 3I2HA 2Q5FA 4DSNA 5KKCA 2QTLA 5JS6A 4CMJA 1R0SA 2AI3A 4EL0A 4RCYA 4RPHA 2ZB3A 3DG9A 4BVLA 3GGOA 4JU8A 5B4TA 3JPWA 4HRYA 3UM9A 4HS4A 2IS1A 2BGJA 5REQA 1QM5A 5CR9A 3ZU4A 1G5FA 2Z04A 3KJZA 5HHTA 4CQLB 2A88A 1XTTA 4JSTA 1TM3E 4EUKA 2BV3A 4ZXFA 2ZI7A 5H80A 2C5HA 1DO0A 3RUFA 2QOEA 2QX7A 1F2UA 2L0XA 3GMTA 3TW8B 3DHVA 3OZUA 2XV1A 1R4NA 4Z4GA 1TF2A 1N9ZA 1UP4A 3B6JA 5EJ6A 2BZ0A 2X23A 3KB2A 4YRLA 5DFAA 2PZGA 1RT9A 5K3SA 5JZVA 5J40A 1QU2A 4P2BA 3VU1A 1N5JA 1YZVA 2GYWA 4L3OA 3ZY6A 3HZHA 3PDUA 4G89A 5D87A 1Z0UA 1CUFA 2AUTA 4M49A 5KYKA 1PTKA 2NSJA 3BEOA 2PKEA 3BMOA 2VNSA 4PSUA 3SICE 4Q9LA 2DBRA 4M8LA 3TQFA 2O2IA 2QB5A 5BQ3A 3WK7A 3Q41A 4H7JA 2AF4C 1E66A 2QVZX 1GD1O 1SNYA 5FA5A 4DA0A 2QRJA 2WHPA 3A1FA 2DTDA 2NIPA 1CQWA 3IT2A 3P45A 3MWFA 4LAFA 3TTYA 2MSDB 1TPYA 3BXXA 3IALA 3IKMB 3L7KA 4MHTA 3CN7A 2EEPA 1I7QB 1A76A 4Q1CA 5EIEA 1JKJB 3GVHA 3K9NA 4OP1A 2WNIA 1BZYA 4MGKR 5CT8A 5IULC 3WK8A 2P0YA 4B3GA 4M98A 1N25A 1JDNA 2EQBA 3N07A 2XTMA 5IDVA 1CF2O 2VO1A 2C9DA 3H6HA 4JEIA 3KEFA 4FDTA 4EABA 3NDBB 3TLMA 3VU3A 3JQAA 4RIEA 2HF8A 2X19A 3KPUA 3OQMA 1UXJA 1JFVA 4HRVA 3UJBA 4NJMB 2A8YA 1MF7A 2GBPA 1PE0A 1P9WA 5FWAA 3PQ4A 3N8NA 4EPXA 2JIBA 1PCXA 1JALA 4IHAA 4BFSA 3WGHA 3ZW7A 3IMKA 4N3AA 4ZCIA 2PS0A 3DJYA 3OT1B 2OP0A 3GFOA 3KOUA 2ZYVX 4L8LA 1DCFA 4OSEA 4WCVA 4Y2GA 5E4FA 4C3ZA 4YRRA 4E6PA 3G0OA 3TLAA 1OY1A 2Y76A 1M5RA 5KBYA 3LDAA 4RMHA 5E6UA 5D7NA 1I51A 4DANA 1KQNA 1U31A 5FNVB 1AGNA 1BW9B 2Y1WA 3AILA 3EIEA 2PMEA 4R1TA 1J8YF 1HFWA 3KWMA 1E9SA 2A9OA 2GAJA 1XDDA 3BSYA 3SU8A 3MELA 5AW4A 5K0EA 1EFVA 1OFIA 1EZ4A 3L1KA 4L8VA 4ZEVA 1FFCA 5AKJA 3S2IA 2RK4A 3T52A 4D81A 2HFJA 3ISJA 4XEHA 3ZLJA 1SMKA 3K5IA 3UTCA 3WAKA 2PWPA 1Q21A 3PGMA 4LYFA 1T8TA 1DEAA 1V9LA 5BRNA 4KTTE 1CS4C 1YUMA 2C04A 5BUQA 1YZ3A 2YV3A 3ZZUA 5JRDS 2OMKA 3PDIA 4GF5A 5I51A 1U0OC 4ARAA 3QVLA 4E21A 3B3GA 1G18A 2VHXA 4GLOA 3R41A 3T9DA 1U8XX 1L5HB 2WVAA 3GT3A 4H7EA 3ZDQA 1FBTA 3CLUD 1BCSA 4HKTA 1I3OA 2HJHA 3NWOA 2H3EA 4DIFA 4RJKA 2CEKA 1NF2A 3AKCA 4N3CA 5CNKA 1WCXA 1UDCA 3NRCA 4FFDA 4KK3A 4UARA 1GSOA 2GOYA 4XLTA 4CDNA 1KYTA 2XA1A 4QVKA 5EIWA 3QYFA 3TLGB 3DDZX 5GVRA 1SUCA 1LLQA 3H1PA 3JR3A 4HLDA 1CRLA 4GVLA 4MO9A 4QHSA 3JARB 2NO4A 1XYYA 2E85A 4YIKA 1R12A 5CPBA 4EG4A 1M2VB 2CFTA 1OF1A 3V4ZA 3A6DA 3I62A 3WL4A 4L27A 1K8RA 1NBIA 1TAUA 3QHPA 3UPUA 4KXUA 3OOYA 3L4JA 3GRCA 4YVFA 3EQ8A 1E1RD 1OVMA 2WTEA 4DCMA 3ZHRA 1KC1A 5LP1A 4Z3OA 1ZZEA 3GBVA 2G3YA 3HJGA 3R0JA 5AKZA 3DZHA 4DCJA 5KUTA 1X92A 4D3ZA 4A0HA 3SJZA 5LZ7A 5BN5A 2W6NA 2QIPA 3AM3A 4LWOA 2XA9A 2XE6A 1ZGHA 2VF7A 2X1LA 4YCSA 4UEJA 4ZC8A 3RB8A 2E7ZA 5E0KB 4P83A 1KKUA 1KS9A 4NBUA 4YC7A 3FOAA 3JZIA 5IDYA 3LYUA 1YU6A 3K8YA 3DLIA 4BN0A 4GKJB 4JROA 4M88A 3R5XA 2CDAA 4RD3A 3ZU3A 4AUMA 3NI2A 3HUFA 3H86A 1VKHA 4D8TA 4EJSC 3WLIA 1Q1BA 3BCRA 3AIKA 3DHEA 3TNDA 4QIHA 1MGOA 1JG2A 3DTNA 1VG0B 1ZXBA 4ZARA 2DQZA 5CLIA 1D03A 4INOA 2GQ0A 4ZYUA 1ULTA 4LRSB 1RFGE 4HEQA 1G59A 4HTAA 1O94A 2H1IA 5KWVA 1H42A 3SLRA 1V71A 1Z83A 1M2KA 3IE2A 1LWOA 1ORIA 5FLKA 3RYIB 5C37A 1NNUA 4QDZA 1FSZA 4RC9A 4W9NA 2I7XA 3K5HA 4P4LA 4DPLA 3C85A 3UUWA 2WG2A 2JCBA 2NPOA 3OBBA 3D3EA 4F11A 1JQJC 4DMLA 1M2NA 1NSFA 3F47A 1SWVA 1X1TA 2VJOA 4H27A 4BIIA 1JW9B 4Q66C 1AKWA 3S44A 4OAQA 4HBZA 4B80A 5IJ0B 4N8EA 4EMBA 3RYCA 4M86A 2A57A 4QU0A 1C9EA 3VDXA 1QZTA 1GZ6A 4ZVSA 1BS1A 2X3FA 3INNA 3N2GA 1PR5A 4Y2YA 1GSAA 3TZKA 2MR5A 4YJGA 1UZUA 2YV4A 5AXBA 5TR9A 2G83A 3SYLA 3W4JA 4EG0A 4UJ3A 1CY4A 1GV0A 3E5HA 2BGNA 2DHDA 4PG8A 3AHIA 3I1JA 1RWNA 2Z9BA 1EGMB 2KLBA 2ZSAA 3AERA 4X6XA 4IXTA 4U2DA 3QWBA 4KN8A 4TL9A 2DSNA 3K4QA 1KWKA 2NU8B 1PR2A 2HRQA 3HA2A 1TEZA 2FRVA 4CIVA 3SHOA 4LC1A 2JZNA 3L77A 2H1LA 4QPNA 3SEAA 1PJ4A 3BRCA 5HWSA 1M8KA 2GAFA 4W9MC 5TQVA 3ZZ1A 2XUJA 1GCUA 2X76A 1YRQA 4EX6A 2JLAA 3EGXB 3OCXA 4EHDA 4OX9Y 2ZUSA 4BX2A 2F1IA 1Q0TA 3TB6A 1FYXA 1M34A 2Y68A 4BFYA 1W0KD 2DTEA 4LX8A 4M55A 5JTUA 1IJEA 2XUOA 3G17A 4L72A 3KS9A 3QWFA 4LX0A 1U5CA 4P0TA 2REBA 4BKPA 4YMTA 3IS3A 5J3JA 3NHFA 3NYWA 4UE6A 1G21B 1UPBA 1XZIA 5B58C 4KPEC 5KMGA 1IEWA 4OBWA 1Q44A 1JIXA 3AHJA 1JG1A 1JR3A 3I8XA 1SM4A 2WIDA 2O23A 3GI1A 1L9KA 2OVBA 1EK2A 3HGTA 3K1ZA 3KVNA 1TX4B 3OF5A 1Q1NA 2VHJA 1C3OB 2JDID 4MYTA 1MH9A 1NW9B 3UK0A 4JASB 1RWVA 3RAGA 2DQYA 3TLEA 1CFJA 3P5SA 4Z49A 1T2UA 1UM8A 2ZTVA 4HPWA 3AFIA 3OZDA 5ERGB 3IEVA 2VATA 1PWHA 1EESA 1YRAA 5HIKA 1WCYA 4GKBA 2IH2A 3AM4A 1WKVA 4AY5A 2EKLA 1OE0A 2JAWA 4WESA 1F2TB 1N8KA 2XHEA 1JPJA 4G9GA 1X70A 2D59A 5DN6A 5FOXA 1E2EA 1TXGA 1QYRA 3W3AA 3GUUA 3KZCA 4IVQA 5KTRA 4IV8A 4F8EA 1OXXK 2Z6VA 1IN8A 2GJ4A 4KQ9A 3BWYA 4Z51A 4R3WA 1GZUA 1CP2A 3T3EA 1EGHA 2WF6A 3VH1A 1QR6A 4B84A 4BMZA 3GAAA 4X7PA 5DBGA 3M9XA 3OE4A 4WLOA 1MAWA 1GITA 4NJEA 4ASUA 3Q6NA 4DADA 1AC5A 1L8OA 2QUJA 4U3JA 2J59A 4B2PA 4Q05A 2FMIA 1U7ZA 1BGWA 3UA3A 1DKNA 1FP4A 1GR1A 3TDNA 3IAM1 5E1MA 3U7IA 2ERXA 1UJ5A 4J1TC 3E9EA 3FD8A 4FDUA 4C9BA 5G0VA 5IASA 2JCGA 2FTKE 2DFNA 3CUWA 1XQ9A 4DVGA 1GAXA 3F49S 1YK0A 3KCQA 3LCRA 3UHPA 4DIOA 2XMQA 5AUPB 4MV1A 1GKIA 1SK8A 5KOHB 1S5PA 1JHUA 3MTQA 2IELA 3ZY2A 4A5OA 1F60A 1R6DA 3FYUB 3JALA 3WE7A 2E5LB 1JX6A 1M73E 3IILA 3DW3X 1H8HD 5ENVA 2CNKA 2YWFA 2OKGA 2H0QA 3SFTA 4D9JA 1WDMA 4EYGA 3L8YA 3H87A 3ZXXA 1XVIA 1SY7A 5IHXA 2QAGA 4OUKX 4XGRA 3V1NA 5JQWA 2DECA 1QTIA 1TF7A 4OA8A 5C8YA 2HA4A 4OI2A 2HYIC 4ZEOA 4R8VA 2AEEA 1OHHD 5FL7A 3FUUA 1E2LA 3ASUA 4GMDA 5EIAA 1DJLA 3ZCSA 4DYDA 1P62B 4I6JA 1ZH6A 3VO8A 2GMWA 3EZXA 1PZXA 2H17A 3QQPA 4J7XA 2YX1A 1P1JA 2X8WA 1E2NA 3C7DB 3HKBB 5FT9A 3UZUA 4DUZB 1DKUA 3ULKA 3RSZA 4BAUA 4F21A 4CCYB 1A8HA 1F0PA 3IQDB 2PUFA 3RSQA 3DZBA 3UYKA 1C8LA 1CR6A 1E3SA 2BKXA 2VIIA 1F5NA 4AN1A 3PRJA 3I8SA 1ORDA 1ZZGA 4OLJA 4FS8A 3NHWA 3WDSA 4DM7A 2ODEA 1KK1A 2QI9C 4DWWA 2ZRHA 2JATA 2KSQA 2XQFA 1J0DA 1JKXA 3IBCA 3IP1A 3OQIB 4HEHA 2Q3DA 4LYJA 5T6BA 2D7JA 4U6NA 2FMUA 4RPIA 5JIBA 3SQDA 5MN5A 3V6MA 2XMRA 3ISVA 2XW6A 5K03A 1VJ1A 3RSSA 3ZDBA 5E9QA 2WJWA 3WGGA 1G41A 3U17A 2XT0A 2NP7A 1RQGA 5M04A 1HMYA 4G8CA 3OD5A 2EF1A 3C3YA 4PHGA 3IEMA 4GVPA 1NPTO 2FQYA 2JJ8A 4V0LA 5KSOA 3UT5B 1T3ZA 3AQIA 3HRKA 4ZT4A 4CQNA 3GLFB 3ZNPA 1GLNA 3U0BA 1K6EA 4DM4A 1QQAA 3FTDA 4MGIR 4AG5A 4CEIB 4BMXA 1T29A 1W4AA 1UFKA 3K1JA 1QRSA 1PJSA 3PHBE 3EGCA 3AMVA 4O1HA 5FTNA 3VBCA 3X2FA 1Q0LA 2GSDA 1AV7A 3CYFA 4M60A 3GJ6A 3QYAA 2ODBA 4O4IF 4TL6A 1JBQA 4RWEA 4HLNA 2VAMA 4UQPA 3QPBA 4LXHA 5JO9A 3UMYA 3U7HB 2UUPA 2B7LA 3EB9A 4ROTA 5KSZA 1E7RA 3GELA 4YAIA 3MWEA 1OI3A 2VHQA 2CW5A 4WGGA 2C3PA 2H0RA 5JTTA 1H4QA 1WZIA 3U0VA 1O77A 3ZVKA 3ZCUA 2V03A 4HNQA 5JI3E 3WKDA 4BZPA 4N7MA 3KVYA 3OPMA 4V38A 3KEQA 5C3UA 4YRQA 3BFKA 3GT4A 4GI3A 5ARDA 1TK3A 1NU8A 3LNTA 1WQ1R 3MJRA 4BFLA 3SC4A 1NRWA 1IBLB 4HDQB 2WP0A 4R1SA 1N6OA 1QGZA 2R00C 2N9UA 4LV8B 4QYMA 5K0GA 4Q1EA 5HDBB 4JJFA 3FNGA 3ZD7A 4MI9A 2BM0A 1V1RB 4QECA 3QUTA 3M6VA 3WWOA 4WLUA 4HLCA 4C4SA 1NQTA 1TFRA 2R00A 2CMFA 3AFGA 1VZ3A 3AI2A 3IIMA 3OLYA 4OOFA 4AJOA 1RWQA 4B6JA 5FLEX 1WF6A 1Y63A 3A1NA 3P71T 2A5FA 3HEBA 1V4BA 1VLLA 4HGRA 4XYLA 5CBPB 5F1PA 1LX6A 3IV9A 2ZB4A 1M2OB 5GV7A 1L7QA 5EMJA 1Y9AA 3TLYA 4JBNA 4AJ1A 1U3FA 4EBFA 3M4JA 3LPLA 1GQSA 3CZQA 2LGJA 5KNBD 3ZV5A 2HX1A 3UAYA 3GNQA 1VPLA 1QRUA 1JAHA 3O75A 3F4LA 4GM1A 4BUZA 5HMMA 1HTWA 4E5KA 4R68A 3TNFA 2PX2A 2JD1A 2WOJA 4GE3A 3TCKA 3C16C 1E18A 1FP1D 1X8LA 3X1MA 4P3NA 2GPBA 2SCUB 1W9HA 1EI9A 2LBPA 3EZ7A 3O8DA 1DXYA 4XD7D 1GFZA 4KXQA 4KWHA 4B7ZA 2E48A 5C52B 2HSWA 1Z0ZA 4K88A 3A9CA 3TRHA 2ISCA 1MQ9A 2Y0DA 1F3OA 2VFAA 4TX1A 1ORVA 2QD5A 5EESA 3C3EA 1GTJ1 5EJ7A 1MEJA 2OE2A 3H1EA 3SMVA 2D2EA 1SB9A 2FF5A 1CUCA 2QDXA 4IIJF 2FSSA 4GL2A 2YHBA 1Q84A 3K6SB 1QVAA 3KHUA 2I4IA 2DKOA 4B8YA 1PVOA 2HPAA 2AL7A 2Q5EA 4QOSA 1LNSA 1VBKA 1JA9A 4OPMA 3UJHA 1W4RA 4LJSA 1NUSA 5TB5A 5KWEA 4A6XA 2FW8A 2IF2A 2VDJA 1C5KA 1MRSA 2FRDA 3TM5A 1PJ3A 3UWMA 1XLWA 4MIYA 3TBKA 1XNHA 3NZEA 1TUEA 2I99A 3AR5A 2D1FA 4EHKA 1ORWA 2P0AA 4EY5A 2O8BA 4NCIA 5IKPA 4EFDA 3IHWA 4IDHA 4NPAA 4GKKB 4I3FA 1A88A 2EFYA 4HUQB 2XNSA 2R6CA 1AZSC 3SR0A 3EF3A 3PCRB 4H4CA 2EHDA 2OYRA 1EWQA 3U37A 2WHQA 3NNDA 5DN9A 2D0PB 3CG4A 3DC2A 4NFSA 5LQDA 2PX6A 3ZWVA 1BDHA 3R0XA 1DP4A 2ZAGA 2N1BA 4MULA 1BOOA 3WTBA 4ZXPA 1KYXA 1YS1X 3H99A 5A5VA 3IP3A 1B16A 1P2BA 4B0OA 2C42A 2Z2XA 3UB4A 2W42A 2PA3A 2UZ3A 4ONEA 1XU4A 1MQAA 2XTZA 3AP1A 1A7JA 1G6Q1 3AHHA 1L7XA 2ZJ6A 2YHIB 4DR2B 4L78A 3CW2A 4XW2A 3DOUA 3VOAA 3RUDA 5IWCA 4IFEA 4UEWA 1HT0A 1MG0A 4KSYA 2LIVA 3IB3A 3P4XA 4UD6A 2YRXA