3PKZA

Structural basis for catalytic activation of a serine recombinase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
124
structure length
124
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVEMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIRILAMVSEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords Recombinase Sin
publication title Structural basis for catalytic activation of a serine recombinase.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 49
structure length 124
sequence length 124
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pkzA00
5C32A 1ZR2A 5C31A 2GM4A 5C35A 3PKZA 5C34B 1GDTA 2R0QC 2MHCA 2GM5A 3GUVA 3LHKA 2RSLA 1ZR4A 3G13A 1HX7A 3LHFA 4BQQA 1GHTA 3BVPA 3ILXA 3UJ3X
chains in the Genus database with same CATH superfamily
3B12A 4Q3DA 3LCUA 2GZ2A 2HZ7A 2IDKA 1WVIA 3WLAA 1AKNA 3OQNA 2N0SA 3GDOA 5CK5A 1ML3A 1TQHA 1UMDA 3H9UA 3ZIAD 2HUNA 1V5EA 2CB9A 2HA3A 3U2QA 1YRAA 2IWRA 2AH5A 1LK7A 3V4PB 2DB3A 1PG5A 2BSAA 2F9MA 1NAHA 1B6TA 4PAMA 4CMKA 3ER8A 2P2LA 3DL7A 1P3JA 4KO1S 4MB6A 4L02A 2OFXA 2J7PD 1NUHA 4LY0A 5K0SA 3GLGA 2CDBA 2E7ZA 2X1HA 5D87A 4GRAA 3STUA 2CFRA 4NZMA 2CHFA 2O1SA 4YP5A 1ZCFA 1L8QA 2ZRHA 3IQFA 5AO9A 5A2GA 1JS1X 3KYCB 3VR1A 2GMWA 1JHMA 4PFKA 3IT3A 4EG1A 4RTLA 5BVGA 4Z4EA 2TMYA 1GGKA 2X9VA 3K09C 2CVZA 3JQ8B 5GOTA 5KYUB 1G2IA 1PK7A 1QG0A 3KFXA 4PZEA 4UULA 4B6GA 3DTVD 1ML4A 5IAJA 3AVXA 2X9LA 1BXRB 5LU8A 3PRYA 4JR1A 5K3FB 1HDOA 5LD2C 5HJ2A 3ICQB 3IHLA 3G0IA 3RJMA 4JQYA 2OHOA 1BO6A 3EA4A 2NO1A 3T7AA 4BKUA 1SKUA 1DGQA 1X14A 5E9JA 1A3CA 2V0NA 4BMCA 1BEUB 1QBKC 1P0CA 4KGZA 1ZHOA 4JXJA 1BYUA 1JA0A 3OQIA 2WIJA 3MJSA 1HE5A 3BERA 2I6FA 2AFHB 3NHBA 1CQJB 1EJ6A 1T25A 3NBXX 2PEYA 4UW9A 1U5BA 2LCQA 5HJ7A 1G17A 4ZV4A 4JI0B 3H1EA 3Q7EA 4CETA 2I29A 3AF5A 3A4NA 3NATA 4C4OA 3MT9A 3UHAA 3ND6A 2YZNA 4QG3A 2O0MA 3EIFA 4OMCA 1T1IA 2QMHA 3FF4A 5K3AA 5T64A 5BT8A 4TLEA 1DQYA 4HDKA 3DPIA 2QTZA 4GPEA 4X54A 4LE2A 2W6JA 4RK7A 3SYRA 2IH2A 2YFHA 4K40A 1FJ2A 5K8CA 1E99A 1NVVQ 2FPOA 4EZBA 2WOJA 2F7SA 4KX5A 5FUVA 1XTPA 3ILXA 3MF4A 2FB9A 3CLSD 5LP1A 1EVJA 2R8OA 3WGHA 2ZWIA 1PT5A 2Y1GA 4FCCA 1EFHA 5EUQB 1C3VA 2I4IA 5LLSA 1P6XA 4BZXA 4K5QA 4WN9B 2XKJE 2XSZD 5F7JA 3S2ZA 4KZKA 3OBBA 2YVUA 2H85A 4KXFB 4MKHA 4OGWA 2FSPA 1USUA 2I55A 3SJ7A 2CNKA 5HIJA 4IIEA 5AVKA 4HLCA 2EP5A 4X41A 2FQWA 1OXKB 3M6LA 4EG8A 4D9CA 5J9FA 3ZV7A 1J9EA 1OAOC 3LX5A 1TKCA 1Q0RA 1ZC4A 3I5XA 1SK8A 4K9PA 3OECA 1INLA 3IV7A 4NCBA 1A1VA 3I2HA 4IV8A 1Y7IA 2VEOA 2FEAA 2WWXA 3M3PA 2XMQA 4JSYA 4UUBA 2XODA 1CWUA 5LYJA 4HWSA 1G8FA 5LLDA 4DEVA 2WIBA 3OM0A 1QQ5A 4GMFA 1NM5A 4O4IA 5GONB 3COZA 4HUTA 2FMTA 3IKMB 5JS2A 1CZNA 2ZSFA 4J1NA 5EZ5A 4RHYA 3T4XA 3ELWA 5FYQA 5K99A 2R00A 5KREA 4RTNA 3PWSA 1BWRA 1WLSA 2XCTB 1P2TA 1Z0KA 3L8DA 4NS1A 2PBRA 2WA2A 5I4KA 1N0UA 4YFVA 1RYYA 4M9RA 4ACBA 4CG2A 2JL1A 1SNYA 3PPYA 5IT9A 5IVKA 2AWOA 4PX3A 1KERA 1CY4A 1XA3A 1A8SA 3I53A 1NLUA 2IPAB 1MVNA 1VE1A 3D3WB 5K1ZA 1WW3A 3GJZA 1QC5B 3LT1A 1KZ9A 4HJXA 1D2NA 2FPGA 1JEYB 4ZZ0A 2I6UA 5DKFA 4QA9A 1HDEA 2DFVA 4WKCA 1PRYA 1U3VA 3U81A 3FLBA 1WY7A 3OEEA 2C1ZA 1P0MA 3MCAA 1IYZA 4B74A 1W5AA 4KHPB 5GIPE 4CL8A 1LY1A 4US1R 2C95A 4ZD6A 1KI3A 3F46A 5J2TA 2XYPA 3R5XA 3H1PA 2WA1A 3GMIA 3ZCXA 4XVQA 3D59A 3RFTA 4X84A 4G67A 2I2FA 3OJFA 1YWGO 1GKLA 3BTVA 4YXWD 2C88A 4LK2A 1DC6A 3O8DA 4JLUA 1Q0SA 2IYPA 1Y1LA 2ZIFA 3WK6A 2ZVJA 1YVEI 4TXJA 3H87A 1QU3A 3VYSB 3VBCA 5LVAA 3GFVA 4OUKX 1GZ3A 1H22A 2OFOA 4GR5A 4PQEA 2JI7A 2WNHA 3P26A 1QH9A 3C16C 4MRAA 2FU5C 2WFZA 1XTUA 1IOWA 4BFSA 5L7YA 4LZLA 3D7MA 1QVZA 1QHIA 3HRHA 1ZMBA 3L8HA 2YIVX 3OOSA 2Z2JA 1QRDA 3DMTA 1QAQA 3QPAA 3QLUC 1WVMA 2OHJA 1RAAA 4KQCA 5F9HA 1U6IA 4Q4JB 1B6RA 3E3OA 1FP4B 4CEIA 3CUWA 2VQDA 4G84A 1TA0A 1QNFA 2VNAA 3IDOA 1EIWA 1Q1BA 2PZMA 4C5AA 7GPBA 3FWYA 5LQJA 2LTAA 3IAAA 1R27A 3RC2A 2YX1A 2EX4A 1X0XA 1KDVA 3TIXB 3FCUB 3PUJA 4NL4H 4M9QA 4PZ0A 5CT6A 2GA8A 1ZGZA 2IL1A 4IGIA 4P4SB 4G9EA 3VGJA 3AVUA 1KO7A 3AHEA 4LDNA 1H66A 1QO0D 2HF8A 2QE7A 5LZ5A 5KVCA 2ZIZA 2DWUA 1VMDA 4PYOA 4ADSG 5CFNA 1M5UA 1LDEA 1DAEA 1M2NA 1J1IA 4Q01A 2EZUA 1UC8A 5F77A 3F6CA 3NWBA 3RSLA 3EAGA 3FFTA 3M5WA 4FYXA 1CY0A 2I4NA 4Q4CA 3UK7A 2PD6A 4EY8A 1R9JA 5FLXA 5EEGA 2Y1KA 5J5AA 3GYBA 3COYA 1YJCA 3Q3IA 1BHSA 3KZNA 2YY7A 3AHIA 3BREA 4PYIA 3EPJA 5I9BA 4ISCA 1T5SA 1ZH8A 2P9GA 3UXMA 1U2GC 3PD7A 3SE7A 5CDUA 2C0QA 3CNEA 1NY5A 4BIIA 5H16A 2Q0SA 2VVTA 5ITZA 3B3GA 4EY3A 1AO0A 1PV2A 2MINB 3E8SA 4M0KA 2HBQA 4P5DA 3S6JA 2F8TA 3M5PA 3TCKA 4F97A 3IGFA 3ZOZA 3K20A 1A04A 1QZUA 4X91A 3AR2A 2JHPA 2LXNA 4IIBA 1R2QA 1E62A 3TRIA 4CT0A 2FNAA 4DKJA 3V7YA 1KPIA 1O94D 3PFGA 4TYYA 4JBWA 1W29A 4DLXA 5AW2A 4KMOA 5ICCA 2FN7A 3ZWCA 1XNQB 1S1MA 2V6FA 3U44B 4N18A 1ANKA 3ZWKA 2HPAA 1SPXA 3LP5A 5C4GB 5BWLA 1LLFA 2XE7A 4C7VA 1RBYA 1KDTA 1XYVA 3RIGA 3PNVA 2DBQA 3C8MA 2P6RA 5DNUA 5JPCA 4WK6A 2H0RA 1CF9A 2BBOA 2BPOA 1JEQA 1LLDA 5G0SA 1RM3A 2HO5A 2ZRAA 4UHHA 2II6A 4GOMD 2H1RA 4PVCA 4JI4B 3EY4A 4L4YA 3FOEC 2H9IA 3WDMA 3FMIA 2CHGA 2OBNA 3IP3A 4DIEA 3PTZA 3RH0A 2NAFA 3F67A 2PKCA 2RGCA 4XX1A 4P31A 4MWBA 3ZHYA 1U90A 3O1JC 3CRRA 1D07A 1OWLA 2Y1CA 4Q24A 2WU4A 2XDYA 3CLUC 4XR4A 3ZX4A 4ZI7B 1NI3A 4KJZA 1QYIA 3UG7A 2ODPA 3ELYA 3PEEA 5LYYA 2FX5A 4QBHA 5KTTA 3I62A 1HL3A 1U3CA 3GEBA 3FD8A 2JEYA 2R86A 3QHAA 2D1QA 3Q40A 4AQ7A 1YZHA 3A6ZA 5JD4A 4BPBA 1J0DA 2HV8A 1P6QA 3DAHA 3PJFA 5F33A 1SD1A 3NT5A 4E2ZA 1VHTA 4TMYA 5EYPA 3MQ4A 1V35A 3DBLA 5IUKC 3HA2A 1J25A 1TQ8A 4P9NA 2NU8A 5LUAA 3OPVA 3TZLA 4R6WA 2EYQA 4ITRC 1O89A 4KXLA 2ZB4A 3RHZA 4B7CA 1P75A 2PZAA 3CNQS 4YEDA 1QF7A 3A6JA 1EA7A 2DWQA 3CINA 2R6AA 3EG9A 3JAKB 4Q0MA 4WWHA 5ES3A 4ALMA 1VHQA 4X1KA 2NU9B 3A1VA 2ODAA 3UJ9A 4M9UA 1ZM9A 3I37X 4LF9B 4HOYA 3NU1A 4LGMA 3SZOA 2RJOA 3N53A 1PKXA 1RMYA 2P68A 3DTYA 3OM9A 1UUFA 3T9BA 2QRVA 1X7ZA 3WKDA 1NZJA 1YB1A 4WNIA 3B2NA 4AU1A 5IMSA 4XM0A 1O97D 4GLFA 3S0JA 1YONA 1RW4A 2H54A 2JH9A 2P9ZA 3EIHA 2GK6A 2Q8QA 1C7JA 2WD8A 2RGNC 2GQ0A 3ASUA 4MGIR 5HYVA 3CX6A 1VE7A 2DBVO 3OKPA 4FJ2A 4Q1VA 5T8KC 4XWOA 4J1TA 2A9RA 2V6MA 5FTMA 4B3BA 1OLUB 3EE6A 3I9V1 4M49A 1P62B 1CEYA 4FGZA 4Y6LA 2AFHE 1ZC3A 2YRWA 5ICGA 4GGPA 3JWHA 3K0KA 4RA6B 3ZWWA 4FE7A 1H8HD 4FBGA 5KYXB 2VP6A 3RC9A 4I1VA 1VZ2A 2AN5A 4NECA 4P80A 5FA5A 4Z3KA 2BFEB 2ZRCA 2O59A 5I7WA 3MWLA 4HAZA 3DE5X 1WKVA 3PGA1 3C3CA 1KWGA 4ZT3A 1C4KA 8OHMA 2N47A 1Z47A 2PT6A 2Y1WA 3HZOA 1ZGCA 3AERA 5IK2A 5JARA 1TUBA 1OFUX 3I2YX 4KJXA 5F4ZA 5HJ5A 4O25A 5LD2B 5CX1B 2OO5C 1XTQA 1NR1A 1SCDA 2PZJA 4OQDA 1IBMB 2IZ1A 2BMAA 3L7OA 3IEVA 1DI0A 2QD2A 3S99A 1L7MA 3SEFA 3ZD8A 4D97A 1Z74A 5LP6B 2JLAA 2EWMA 4FKMA 1QJCA 2YBDA 4NENA 4RPCA 2DVMA 2J9YB 2XUIA 4IJKA 4R4JA 4BDSA 4BQNA 2J0VA 3PPXA 4HDSB 1COWD 5E2AA 4NU5A 3K16A 3BWEA 4LK3A 4NABA 4OHFA 4OQEA 4GX5A 4ZO7A 1O3YA 3QRWA 3IODA 1SVSA 3B3FA 4DAOA 5CB0A 3SFTA 2G5PA 1WUJS 4TMFA 3EMVA 4XYBA 4CMJA 3ZZNA 3I9JA 2I4MA 3I92A 3LC2O 5F4BA 1Q1EA 3WWZA 4JU8A 3WLEA 2G5GX 1XVAA 2HT1A 3FUVA 3DE2X 4TMWA 1Y34E 4ZTZB 4Y6SA 5K3BA 4F4UA 5JDIA 1YB7A 4E7PA 1VYHA 2GRUA 4A0GA 3R9WA 4JC0A 1ZRHA 4YWJA 1LW7A 2REOA 5F12A 3VKWA 4AJIA 3F3YA 2OQRA 3IO3A 5LDHA 3X2EA 4ZOLF 3ZXYA 2ERYA 3LDGA 4QQRA 1N2CA 2X2FA 3HYNA 4WMLA 4TLDA 2ZBUA 2Z0MA 2A84A 3WG9A 4GGOA 2R96A 1SVNA 4QO8A 1OR8A 2QP3A 1IVSA 2HIGA 4PM4A 2XNHA 2CL6X 1ODJA 1KJQA 3DNPA 3PXEA 4BDTA 3JQRA 3FCYA 2WD7A 5MN4A 3ZDDA 1VYVA 4RZ2A 4L22A 1K3FA 3ONNA 1VJDA 4R9RA 4OX9B 5IEBA 3MT0A 5BRJA 4LVUA 1YQGA 1YB4A 2C7BA 3TL2A 5HDBB 121PA 3OFJA 2VHQA 2R8YA 1R6BX 1YE5A 3WLRA 4UFPA 1ES9A 1PFQA 1WL8A 2Y0EA 3AJEA 4UHEA 1OVMA 2HL6A 4RCVA 4AF6A 2V7GA 3P9XA 4DV6B 5AVSA 4PGGA 4FMPA 5BNFA 1MAWA 4B4UA 4MJLA 5J63A 1VRCA 1MB4A 1OZHA 1SOMA 1MB3A 1TM2A 3AFHA 3JALB 4UNPA 5HCUA 1CIVA 3KIPA 1QRSA 1R6DA 1WMFA 2PWZA 4FU0A 1FK8A 2VI5A 3QLTA 2F8MA 1ULBA 4MZXA 4V03A 4AUMA 3L0YA 5BV2P 5BQOA 4ZEXA 4NE7A 2A1UA 5KTKA 1M8JA 5KNBD 2BJVA 1CC1S 4JJKA 4HNVA 3K1AB 2Q5HA 4KWCA 4U2BA 1S2GA 4LYYA 3CMMA 4EHFA 4WESA 1ZP6A 2ZS8A 4LXXA 1CVRA 1QFMA 5B6IA 1ODKA 3VR4H 1KIAA 4CM1A 4Z49A 2OCLA 2AW3A 5JSFA 3LTNC 1DKMA 3PS9A 2CJYA 5EE3A 4HSEA 5GGXA 2ERXA 1II0A 2N75A 1CUDA 2CXNA 2YJ4A 3AF2A 1F5SA 2FVYA 3AETA 2ZBFA 3M81A 3ROMA 1NVAA 4XWWA 2ZBVA 2W6OA 1PIWA 3B6MA 2EKPA 1MU0A 1V1RA 2I7XA 2RHWA 2TRSB 4HS4A 2J0QA 3DMPA 4DWVA 1HE4A 1WV1A 4YRIA 3R5SA 2FEXA 3KKNA 4B0PA 1G5TA 4RWZA 3GCZA 1FE8A 2WHPB 2P9CA 4C14A 2XE8A 3GH3A 2CLIB 3KKOA 4P32A 5KPJA 4CKBB 2AX4A 2QUIA 2D1SA 4JI5B 1DAOA 3M82A 3CEPB 4B5LA 5FPKA 3NIWA 5LZ2A 1HDCA 2FUKA 3C8ZA 4PXYA 4U7PB 2E5FA 3WB9A 3ZH9B 3NC1C 3SAJA 2FZGA 1ULZA 2GYYA 3WNDA 1JHXA 5BQ3A 1RRKA 2ID4A 3K0EA 4QEKA 3VTFA 4B3FX 2R4QA 2VLIA 2EZ4A 2IHUA 1QP0A 1QCYA 4KR7A 1VI6A 3H9JA 2Q1YA 2AYYA 2YWDA 4LQ4A 4D8XA 5ALQA 4P5PA 4UCWA 1D9ZA 4EEZA 3IDZA 3IAS6 5DNDA 5AD1A 1PNRA 3HL0A 4NF2A 3TE6A 1M34A 1WSWA 3AKCA 3DJFA 6REQA 3X1MA 3UW1A 2Y67A 1FFXB 3NJRA 3A1TA 4OGFA 3WJ1A 1D3AA 3HZHA 4FSDA 2DP4E 3WB0A 1IEVA 1HT0A 4GRIA 5C46F 4XFDA 4DV3B 4ECAA 4YJ3B 5E38A 3THWA 2AK3A 3OTWA 2Q1TA 1Q7EA 1J0EA 1N2HA 1VB5A 2JLSA 1F1JA 3FCOA 1FQKA 3K1ZA 3KTAB 4FFNA 4KE8A 4PXAA 5JSZB 4KIJA 3QITA 4LV5B 4JKYA 4HB3A 4KACA 5E7QA 3ZHTA 1FJGB 4M1KA 5JI3E 1D8TA 1OAAA 1DMRA 1HQDA 1JLLA 2BKAA 1EBBA 3I0ZA 2DLDA 3HZZA 4KUHA 4OHBA 1XA0A 2WPNA 4AP5A 3V4FA 2NIPA 3STXA 3WL8A 5H82A 8ATCA 5G0WA 4AF7A 3DZ8A 5EJ4A 3LHDA 3QPBA 4YCJA 3A3KA 1SM4A 3NH6A 1Q7TA 3WNVA 1TW2A 4RH1A 1GQOA 1CZOA 4W1SA 1KOLA 4F4IA 4L74A 2WILA 1K68A 5AHKA 2F1RA 4DJFC 5HJEA 1Q92A 3U4MA 1EBUA 3G88A 1A2BA 5KIAA 4MIYA 1M6VB 3TLCA 4QDXA 4CUKA 1Z2CA 2EG5A 4ZHSA 4CMGA 2F2TA 4Q02A 2BVNA 4KNWA 4D0RA 3WGIA 3PLRA 2FOXA 2WKSA 3R8FA 1Y81A 3UBMA 3ONEA 4EUHA 1XTRA 4I4IA 3EXIB 3G0HA 5CW1A 1L5OA 3LG2A 3ECSA 1B26A 1SCQA 2H4JA 2WZCA 3LDHA 4IDOA 4D3SA 3WYNA 1ZW1A 4OBBA 3QPDA 4PR3A 2D5BA 1R0ZA 2ZQ5A 4AURA 4P7BA 4QTUB 1FVFA 4TMKA 4GM1A 4BTVA 3IUBA 4AKSA 4EG6A 3U7JA 1JNYA 2A9VA 2C2GA 3DBHA 1AF4A 5CFLA 1SKBA 2G7MC 1PFUA 3SJCA 4LI0A 3D2LA 1BXKA 1V7PC 2P9EA 3NWPA 4BEWA 3QWBA 1J56A 1K08A 1ZZGA 2WW8A 2ZS9A 3RFCA 4XD7A 1E2FA 2E1PA 3NIDB 4DV5B 1QR6A 2A57A 4GYYA 3TM5A 3W4JA 3HBLA 1U98A 5I9LA 2AR9A 1Q15A 1N78A 5K8IA 5A5EA 1FW8A 1T6YA 4FGSA 1FA9A 5EMJA 1NY6A 5BW8A 4DLSA 2JJ2A 2IK8A 1SUCA 4QGAA 2CD7A 1H8EA 1NQVA 1R15A 1REQA 3E22A 4OVKA 3SVZA 4DZRA 3E9DA 5I7UA 1NN0A 2DR0A 2AW5A 4F0JA 5IWCA 2XNKA 2DX7A 5EMNA 3K6SA 4M1QA 4Y2UA 5D5HA 4TZ6A 2OWEA 4JL5A 3OHSX 4FZ3A 4EG4A 5CVJA 1DRJA 4WJZA 1W96A 1VHLA 4RK1A 3ILSA 4YQYA 1CJVC 4D3YA 2ZIVB 4EAQA 2JVKA 2NZYA 4K88A 5ADHA 4EZEA 2B34A 1MPXA 1LVUA 3B6ZA 3JASA 4QD3A 1WD7A 5FDFA 1GQ2A 1YB5A 3D9QX 1E60A 5DV9A 1X1TA 4BE9A 4MJ7A 1XWIA 2A1TR 3PHBE 4HFJA 2ZCVA 3H6KA 3JYOA 5KYGA 4Q4AA 2JLQA 5TV2A 3I4FA 2HMWA 2H2FA 1UMCB 1NXWA 1PSDA 1ZOOA 5EIHA 2PCJA 3EC7A 1ZW6A 2FZKA 2QW0X 5DI9A 4P54A 4ZYZA 1TZKA 1IUPA 3IR5A 1TMGE 1FMCA 3RGGA 2DR2A 4IH4A 1X94A 2HYDA 3ICVA 3QWIA 4N8DA 1EUYA 1CSEE 3WLLA 4XDYA 1I1HA 2NU6B 1Z25A 2CE7A 3P9ZA 4QDOA 1Z39A 3TD9A 5ISMA 1M6YA 2NZWA 1FUUA 1Z5UA 2HDWA 1JSLA 2XOKD 3A4VA 3LTEA 5TR9A 3WC4A 5FNVF 2V54A 4BPRA 1QU2A 1Y80A 5B1HA 3D1JA 1V3UA 4QUBA 3ZKWB 2D5IA 3C1UA 2B36A 2I3ZA 3QOXA 4BLOA 4FHCA 5K05A 4IIGA 2P41A 2WQ6A 3PCRB 2O07A 5EVCA 3TKAA 2AN4A 4DPKA 3ICWA 4A2QA 4DWWA 1MQAA 1N75A 3ZDCA 3CTPA 4RHTA 3GVXA 1E2UA 2H1IA 3EH1A 5CM9C 3KHUA 2DT8A 5F1KA 3LOPA 1FNDA 3QKRB 4EHBA 1H2FA 5L51A 1E3SA 1E1CA 1QG2A 4YUYA 4H27A 1H2WA 4FJ0A 4LOJA 4WRRA 5HHTA 2RK6A 3AM1A 1G66A 3N07A 4E5MA 3Q8KA 4LXHA 1C1YA 3M4ZA 4HQ0A 2MR6A 2YWRA 1K5HA 1Q0QA 2BE9A 4H4EA 1GA6A 1SEVA 1RPAA 2XQGA 5KX5F 4YJFA 1KVQA 1R9MA 2YNMD 3FDFA 2ZWOA 4CM7A 3NBYC 4ZJZA 2VHZA 1VL1A 3WFIA 2WEKA 2IE8A 4L4UA 4DY6A 1KOJA 3EOBI 4BNTA 3BFJA 1S8AA 5I3ZA 3LPNA 3RWMB 3W7AA 1SBHA 1T2CA 4JEUA 2X23A 3D2CA 4OAQA 1XP5A 3VVBA 1HYQA 4RDXA 2FWJA 3HLKA 1O95D 2ZI7A 4X1IA 4WBNA 1EP9A 1PR9A 2DWPA 4FT2A 1UZAA 3GJ0A 5IVIA 5J59A 1NYQA 5FL7D 1P6UA 1Q0ZA 1MDFA 2BFFB 1C9YA 2BEVB 4NZZA 1A8IA 1U2DC 4R6XA 3QYAA 5DN9A 4JI6B 4RY9A 1Z36A 3MMNA 5EC8A 3TQHA 1IU9A 1RCFA 4OHCA 3RS0A 5K03A 2X14A 1ZR2A 2JKVA 4JUCA 5LZ7A 1R0YA 2JLUA 1A9YA 2GLXA 3DUFB 2RGWA 4ENUA 3TSYA 1ZN7A 3IERA 1QRRA 2H1OA 4MR9A 2Q6OA 2P4EA 1N4AA 4BXOB 4FNAA 3M33A 4Q3NA 2ODTX 3L7NA 4HXYA 3FJYA 2FPWA 4M46A 3P0EA 1GL9B 2XMDA 5HX7A 3DDZX 5FWYB 1TJPB 3DEZA 4DL9A 3GRVA 3AUTA 4PPFA 5GWXA 4BZQA 2HRBA 2QUZA 4ZMRA 1AXGA 2FE1A 1ESEA 1ZAKA 2D7JA 3CISA 3L49A 5I7SA 3QFCA 1R8QA 3VR5H 3FNRA 3BN3A 3UJCA 1ORWA 4L9RA 4BNWA 5B4VA 1AS3A 1YIDA 1FFEA 2ENWA 2VF8A 1C0IA 3P27A 4OHVA 4UE2A 5K0BA 2VDVE 4EFMA 3U1VA 1ECCA 1NIPA 3AINA 3OOHA 1AB6A 3V4VB 1I13A 1XWFA 4C0WA 1AKVA 1RXIA 3R2JA 4BVBA 4ZKEA 1FU8A 1QOQB 4M6WB 4MW2A 4BP1A 1OHHA 3RDPA 4Z4QA 2W6ZA 1IEQA 2PD4A 4KKXB 4LJYA 5KOYA 2E6KA 1I5EA 1ECPA 5KAPA 3WV4A 2PKXA 4M98A 4QYSA 4Q9HA 5A4DA 4YP0A 4A8TA 2HWKA 1Q7RA 3KQLA 3GQBA 1BN6A 1G5RA 1Y6JA 1JH8A 5DYGA 5JD3A 1SELA 1R0RE 3OX4A 3DBRA 4CNBA 1LTQA 3K0CA 4IHJF 5B3JA 1RRFA 1NF2A 2CLCX 5IBRA 5LXTB 1JPUA 4P4GA 3LT0A 3QTLA 4NNOA 3EVGA 3TQIA 3BL5A 4PYQA 2FQQA 3H8VA 4R8LA 4BEBA 4F3KA 5DNYB 3U56A 5MHTA 3IMFA 4FMCB 2AKAB 4R01A 4TT3A 5DIFA 3VH2A 4DIUA 1ISJA 5K0LA 3KB6A 4TYNA 1HDIA 3BMXA 1E6WA 2NPIA 2JG3A 3VOBA 5CA0A 3EMBA 4HX9A 2ZPTX 2A0XA 3QX7A 3R7BA 4GS5A 4I55F 1HG0A 2QRNA 4XAQA 1KO8A 3OD5A 4NBWA 4CQMB 1O1YA 3GOQA 4FHDA 5B64A 3G0BA 4C5BA 4DABA 1CPYA 1RVDA 3ZI0A 3WQSB 4DSNA 1FYVA 2YJ6A 5MDHA 1Y1TA 3Q6IA 5CJJA 4A2PA 1L4FA 2UVQA 4W5TA 1H0SA 1ZNZA 3P9RA 4HH4A 3AESB 1ZOLA 3WYAA 2A86A 2DHEA 3GAZA 1KKUA 3WGNA 4B83A 2E4AA 3PXAA 4I9HA 4A26A 1NN3A 3D3EA 3FWKA 3HE3A 2Z3WA 2ZUVA 2POCA 2XT9A 5TEWA 3FSJX 4QXAA 1PTJA 2CDCA 1RWOA 5M29A 3B9BA 1HT3A 4TXHA 1Q83A 4HB4A 1YQ9A 5FORA 1F9AA 2VUTA 4TKUB 3BG5A 3N05A 4YJ2F 3Q3JB 3SXJA 2YQZA 1W8DA 1VKRA 2YIMA 5JDCA 4WZAB 3ZGXA 1L0BA 2ZWVA 3VU0A 3RADC 2XCOA 1MT0A 2CVHA 2D0DA 3OJEA 1YK1A 4YTEA 1AIPA 3OY2A 1RLOA 3BAZA 3GAFA 1BX0A 4GSKA 3ZK7A 4ND8A 4DRYA 1ZJZA 4K7JA 4YRFA 1BW9A 2R751 1E2QA 3WQRA 4GKJB 2VCHA 5ECYA 1VOTA 4LDJA 1E4VA 3P2MA 5E1MA 1V9LA 2BKEA 1Z7WA 5CFRA 1O0CA 2V6BA 5ULLA 1FXWA 4CRWB 4DNPA 5KNCA 5CB8A 5IAEA 5JC1A 1YTUA 1DADA 3AF6A 2H5EA 3AVVA 1F20A 1G5FA 4A0FA 3A6KA 1SCKA 1A8PA 2HEIA 2ZZKA 3NIFB 5HE9A 3RUCA 1NMYA 5GVSA 3H1TA 4RFSA 3EX7C 1IUNA 3JQFA 4IKOA 3D6TB 4P83A 4HAYA 4Y6GB 1Z0ZA 2GEJA 4DE5A 1BVHA 2R62A 4ZOBA 1CVIA 1Y8AA 2ATCA 4RF4A 3SX4A 2FPIA 4BJ6A 1YF3A 3BB3A 4HTAA 3RPEA 2V7UA 3AVQA 4LGVA 1Y9JA 3HSYA 1ZINA 4PTZA 3GQVA 1LEHA 2XNCA 4MP8A 2VK4A 1JQKA 4I4TF 4FWTA 1CS0B 2EJUA 2BE7A 2PMBA 3BMOB 3H16A 4C03A 1RE1A 2BGMA 3D7NA 5B2FA 2CN1A 4KL8S 1XKLA 1YJBA 2OHIA 2X6QA 5F2OA 2PS3A 4A2CA 2ECOA 1M6WA 1TIPA 4C04A 2YXLA 1XB2A 3IIMA 4DMMA 1RXSA 1K86A 3GF4A 3IIJA 4DQLA 4LHEA 3C7AA 3NHSA 1G3MA 4F5YA 1N5DA 3RWBA 2C2OA 3VHRA 3KTFA 2PVSA 1M2VB 3EFOB 3FI0A 1P19A 3NRJA 3D8SA 3RK1A 1Z4MA 4V39A 4I46A 3HBFA 1UDAA 3LT4A 4RPGA 4KXQA 3R5FA 4LYEA 3UOAB 5HQ3A 3OZVA 1THMA 2GPNA 4JC8A 5IAAA 2C4TA 1KR2A 3H17A 2XXJA 2IXBA 3ZU3A 4MEJA 4FOTA 4I3FA 5F35A 7ADHA 5L4NA 1DKQA 2YWXA 5CPBA 5M2QA 2XDQA 2C84A 1U0FA 4QXQA 4A6DA 1B3BA 2J6IA 3R6GA 1EQ2A 5HFNA 1YCDA 2GHTA 1TEXA 2VJCA 3LCJA 3F96A 1PFYA 4D0GA 5IASA 3WIEA 1LK5A 3MGKA 1WQ3A 4D41A 3RU2A 1YGPA 1IN6A 2WF7A 1B76A 1Y7LA 3M70A 4XFJA 2CSUA 4B2IA 2JFQA 2CVFA 2F9LA 2JW5A 2YQ5A 3HJAA 3TFOA 4EZIA 2H7VA 1PR5A 4MRMA 5AVXA 1AC5A 3KSZO 1ZUNB 3JTMA 1PUIA 1N5JA 1TZBA 1GZUA 5FPHA 1M6NA 1WXXA 1RIFA 3FCSB 1KC3A 4AZ0A 1Y9ZA 4NMLA 5BN3B 3PX2A 3PRKE 4JLNA 4MWSA 2HT6A 4YECA 5EY5B 3K0HA 1T8TA 4DB4A 3WADA 2X0KA 2CMDA 3PQCA 3L02A 3VTKA 3PQDA 1TVCA 3D81A 2C59A 2KSQA 3U62A 5DLYA 1PFVA 1Y3BE 1SK9A 4QOGA 3IILA 1GUZA 2ZSKA 5CURA 3I61A 1FF9A 1XE3A 4V2UA 1NURA 3LBNA 1G63A 4JGIA 3IQHX 1ZOSA 1TM5E 1E0DA 2BMFA 3K7EA 4KZPA 1F2DA 4GX1A 2UU9B 4YO7A 3MTAA 4LZPA 1SURA 2QG9A 1W0JD 2RHBA 4KGXA 5MFZA 4WL0A 4ZALA 3HN2A 1LS1A 1QB8A 4G5OA 2CZCA 2YHUA 4HX2A 1SBZA 1NVGA 3OZGA 3K5WA 4FP9A 1KDYA 4NWIA 1HRKA 3KHTA 3Q1LA 1X2BA 2GH1A 2X5NA 4BNHA 4RUKA 5ER9A 1M1UA 2ZVQX 4EX6A 5KCMA 2WOOA 1N5RA 1ZMOA 1X9GA 2Q4BA 1RJWA 3N2ZB 4UUMA 2C2ZA 1KJIA 4W5OA 1T3LA 1L4HA 1M67A 2BM8A 3E27A 3H18A 5FYDA 1EGVB 2W98A 4UQOA 4BNYA 2MSNA 4L07A 4XUGB 5KQSA 3S1SA 4UU7A 4H59A 2NZ2A 1EFCA 2PR2A 3H3FA 1HFKA 1IPHA 3OT1A 2XBUA 1XD9A 2ZTUA 3JVDA 2XT0A 4D92A 3ESXA 4FFMA 2HZBA 2YTZA 3ST7A 5HGXA 2Q6LA 2PQ6A 1ESZA 3AUAA 3QVVA 3ZH2A 2QQ0A 3NDJA 4F21A 5ADWA 1M2GA 2FEMA 4E6PA 1GR0A 3V00A 4DV1B 1AZSC 3D6VA 5H7XA 1DCTA 1IVNA 1XBTA 2HJ9A 3GLQA 3PA6A 1YFJA 1VG8A 2HU5A 1MB0A 4DCSA 1GGJA 2I3BA 3C6ZA 4DQUA 5LA6F 1EFUA 3DSRA 2Z30A 2OORA 3OF5A 1G2QA 1U80A 3F5DA 3OMWA 2B1QA 5MGBA 3PITA 3OPYB 2CGEA 4B3SB 3ZZMA 2C7PA 3VX4A 4GPBA 2EQ5A 2G0TA 1VJ1A 3DMRA 4PNPA 4KO8A 4Q12A 3SI7A 5AM4A 1SWWA 1LD3A 4NHEA 1IXZA 3GUUA 1U63A 4EG5A 3UWOA 2BTQB 1C3OA 4EEXA 4BMYA 4OFBA 2W2NA 2JNWA 2PO7A 4NEGA 1YS4A 4EPXA 2DZDA 3MOGA 3V6LA 4AMYA 2AZTA 1RLJA 4CTOA 3J81k 4E03A 3HUTA 3NC4A 2ZJYA 4IJ6A 1J1ZA 2VT7A 1UEXC 2CNOA 3DJYA 3EUWA 3BTOA 4N0PA 1XAIA 4Z4HA 1E2EA 4JOCA 4LDAA 5FBKA 4EJFA 3GBSA 1XLTC 4XYEA 4IVNA 1SRRA 1U7TA 2GBFA 2OAGA 4ZYXA 1Z5OA 3U60B 2PX5A 4ERNA 1JN0A 2UUOA 1XSEA 4OHRA 4WTOA 4G01B 4QPNA 1MEJA 5EWMB 1H6DA 4FHGA 3RROA 1A5AB 2LKCA 2P65A 3WGGA 5A03A 5GM1A 2DPHA 2PX2A 3JQBA 3ROZA 4ZV7A 3GXOA 1S2OA 5CT4A 2QUKA 2ZYTX 2AG6A 2RJNA 3SLGA 1V5FA 3U13A 3WNBA 2VYVA 3EXEA 4YCMA 1KRWA 4I50B 4DNQA 4YB8A 5EXDA 4A10A 2CNDA 4JP3A 4YCNA 1ICIA 3STVA 2XGGA 1FSSA 1EZ1A 1Y89A 2FXVA 4XQGA 3FTEA 2PBLA 5HG0A 2ZSJA 1S01A 4ZOAA 3RE1A 4B40A 3WIOA 4MKZA 4LOAA 4EPWA 1KMNA 1KEEB 4RV9A 1E3WB 4PYRA 1GRRA 2GKSA 3NOQA 4ND7A 1TTPB 1I9GA 1YQDA 1IHPA 2I62A 1YE8A 3AFMA 4E1AA 4PQYA 2L18A 3R0VA 3RTGA 4EJSC 1LVGA 2P5YA 1QFSA 4WXEA 2MYTA 5I9TA 1DAPA 1OXTA 1V5GA 2CJXA 1E2IA 3THOA 4BQEA 1Q74A 3Q12A 2RONA 2HPVA 5AJWA 2VPTA 1B93A 2IXEA 8MHTA 2DTDA 5TMEA 3R3JA 1PZGA 1WPXA 3PGVA 4CV1A 4OU4A 4P38A 1EXVA 5FLKA 5LBUA 2HLHA 4YMUA 1LQUA 1JHDA 3FROA 4BP8A 2XI4A 2XTNA 3GA7A 1CG6A 1M83A 1JJ7A 4LF6B 3VSCA 1VMKA 3EDYA 3WBKA 3LBIA 2D2VA 1OH8A 1PSWA 3F6BX 1E1RA 2XYVA 1NBAA 4GBED 2GDJA 3EBOA 3ZE1B 4CR6A 5DLQC 1NP3A 3CBGA 3KJZA 3Q8MA 1QMGA 2XTZA 1RR6A 1TGVA 3RSGA 3PPWA 4UE6A 4IZHA 1AKQA 3PEVA 2A0WA 2XQVA 5E3HA 3DOEA 3OC0A 1NBHA 1TMOA 2QPAA 5TQ0A 4B9AA 1E2PA 2OBBA 1P1KA 2PWYA 1A7UA 4C43A 2A7QA 2AMFA 2H29A 3BMCA 3PF9A 1GCIA 1BCRB 4MROA 1SOAA 3OWOA 3O8CA 4IRUB 4EUKA 1JFRA 4W1RA 1MRZA 5JBNA 4X1YB 1ENOA 4YAOA 2A9QA 2ZROA 1GJRA 2BHTA 3KJHA 4IRXA 4UQPA 4WZAE 3GEDA 3RVKA 1NFQA 1QTIA 2WAOA 3ET4A 4H3KB 2E0IA 1UIMA 3MMZA 4Q03A 1Y4SA 4W9NC 3QF7A 2PKYX 5ALNA 3VR3A 5J4YA 1B2RA 2X0JA 3CO0S 2H06A 4EGSA 3UJ7A 3HBJA 2CWWA 3BEOA 3GELA 3RF7A 3GWZA 1A2OA 4N8SA 5AOAA 1YR1A 5SZJA 4TVBA 1QIDA 2G0AA 1NQAO 3JZAA 4QGBA 2CC2A 4RZIA 1XALA 4EPVA 3DW3X 3X1YA 5JG7A 3ADPA 4HUJA 4I9FA 2PN1A 2A58A 1AOXA 2QMQA 2YOFA 2NLOA 1WMEA 3GPIA 3MAJA 3O38A 3MOIA 4FGWA 2VBFA 4LSZA 5EKUA 4BFTA 3QVGA 4HN2A 4EKNB 1QYWA 3HUFA 4M8IA 1K8QA 1HYEA 3AY3A 2ZUWA 3KKQA 4NDAA 4QATA 4QXMA 1U3WA 2UZ0A 5HUHA 3GFRA 3RKUA 3DLCA 3OKFA 4JBHA 3USZA 4YPVA 1KMHA 2QZ4A 2HJWA 1D03A 2X5JO 1X1AA 3OKAA 2VK2A 1OYOA 2G9ZA 4FCWA 4G65A 4WK0B 3U80A 5AHRA 1HF3A 1FNBA 1SG9A 4MWCA 4WX2B 4AJHA 1HR0B 2QD1A 3BHIA 5H0IA 1TGYA 2HA7A 3LDUA 2ZULA 3MLAA 1I7NA 1LH0A 1E58A 2ZT7A 3K4HA 3B7PA 4IGAA 3T4PA 3AWIA 3GPCA 2XNDA 1PYOA 2Z2ZA 5A0TA 1HO3A 3GJSA 4LHSA 2GZSA 3UEOA 3HWWA 1G8SA 4ZQBA 1F8FA 3N6RA 5CUQA 3UYLA 4W99A 3A25A 5AVZA 2JLXA 1RJ9A 4U6NA 1RNLA 4HNAA 4Z6KA 4OFXA 5DTIA 2YWGA 1Q22A 3H5LA 4PHCA 4G2TA 4DXAA 2C4VA 3IP6A 4ZQFA 2XB8A 3DNMA 4H08A 4IHAA 5CH8A 1HUQA 1OWMA 4YP6A 1B15A 1N32B 4JLMA 1AS0A 4LSGA 1J07A 1UCFA 3GEHA 3W04A 2NUAB 1EVIA 3LKDA 2BHNA 4WNAA 3AUXA 2ZJ8A 1NBME 3AYZB 3IE0A 1VMAA 4EHDA 5A4AA 1E2GA 1YE3A 5EWLB 1BFKA 2QX6A 4MW1A 2ODBA 3FHJA 3PL1A 3SQOA 1I0IA 3VU8A 1KK0A 1DKLA 1LBQA 1W73A 5B6PA 2PGDA 1S1CA 1N2OA 5D2CA 2GZMA 2FJ0A 4MA5A 2OZEA 4G8CA 3TWOA 4A6EA 2PCLA 2ZFUA 1QQ6A 1UBUS 1QDEA 2BEUA 2ZYHA 3WIBA 2WUGA 5DZSA 3CIFA 5ENVA 1CZHA 1K6MA 3LGXA 3VHXA 2B35A 5C5IA 1IB6A 1XVIA 5DB4A 1UM9A 1RPJA 5EXSA 4Z7JA 3T3EA 1W94A 1WB9A 1JI0A 2JATA 3URMA 1ODTC 1XG5A 4X44A 3I6MA 1XF1A 1XN1A 2N46A 1E5TA 2WIAA 1TKRA 4PSCA 1R0LA 1MABA 2V7QA 3FDZB 2VG8A 4E5DA 4DG9A 3LCCA 1GU1A 4JEHA 4K9MA 4R7TA 3WKEA 1VMEA 1HV8A 1Z33A 2GD2A 4MV5A 5G1OA 5B3AA 2QAGC 3O93A 3NANA 1ULTA 1AU9A 1GIAA 4LOIA 4MR8B 4RMNA 4PYMA 4CI0B 4N4AA 2WG0A 2GF0A 1U7DA 1ZD2P 4MAMA 4OI0A 1Z0DA 4LNHA 1YOVA 3LFTA 1QPBA 4NNJA 1KTIA 3MC1A 1H2EA 5DHRA 1AQ6A 3FXAA 4LWOA 3O4HA 4PAOA 5ECGC 2VSNA 1PR4A 1E5LA 3EZGA 4BEJA 1PW5A 2WUEA 3ZCPA 2GN0A 1KEPA 2O2SA 3D2AA 3DE7X 3NGXA 2J41A 2Q7DA 3X1KA 3WLMA 1ORDA 2QI9F 2J48A 1YZ3A 3BJIC 3AONB 1U2RA 3TTUA 4DM7A 3RTAA 2J0SA 3B1FA 2P6UA 3QOYA 1YVPA 1JKFA 1N5LA 3R6TA 4FDMA 4MULA 4YUZA 1BSVA 1NUAA 2WIGA 2XBMA 4AS1A 4ZYLA 4M1TA 4DCCA 1QX3A 5TGDA 2R8XA 1EWKA 2G72A 2VF2A 4EJ6A 2NTEA 1WCV1 4P0PB 1GPJA 1R64A 4TXMA 3ZD9A 4DYHA 4URVR 4TUYF 3E9YA 2J3EA 4FGKA 3CUEF 1ZBDA 1CUSA 4FDTA 4LMRA 4D46A 4EB6B 1Y4UA 3QEOA 5DOZA 1Z75A 1E2KA 4JL6A 1CE8A 3AEUB 3L7MA 4M9XA 4MQEA 4Z9XA 4WOPA 1BWPA 3RAGA 1Q77A 1KYIA 1ZGAA 4EJ0A 3HMKA 1AQJA 2IFTA 5GJVC 1GHTA 5HS4A 2Q3CA 3RAJA 2FW9A 2QL6A 3H5WA 4HLDA 2WWIA 5CIWA 2CDNA 2GF2A 2WQZA 3M5DA 1SULA 3NJ4A 5REQB 4EW1A 1QQBA 4KQIA 1P60A 1T3TA 2ZW9A 1IN8A 4XH9B 2CXPA 3CR8A 4ZP1A 5AYVA 3CNLA 4E5VA 4UTNA 1KZ7B 2BKVA 4FSHA 3NTLA 4N12A 2RHGB 1B0AA 4XTRA 5FL3A 3WMEA 4UM7A 2RAPA 1MGPA 1RBQA 4RKFA 5C7OO 4NJMB 3N58A 3W5IA 5E7MA 1PVOA 1MOZA 2XIJA 1NF9A 5BQ5A 3BSYA 1MHTA 3FI9A 1TLFA 2J30A 3DTNA 3SBDA 1N2XA 4PS1A 3PJGA 1JECA 2OHHA 2FN3A 3PVSA 4Y7CA 2VH5R 4BQFA 4KAFA 5F7OA 2ACWA 2GLTA 3RVMA 2WYIA 4RYDA 4EKIA 5J5VA 2W00A 2L17A 2EHJA 5JCZA 3AF0A 4KN5A 4O2AF 1OB2A 3ZHXA 3AGPA 2BDTA 3N0WA 4JROA 2O8BB 3B7WA 3M34A 1C8VB 3DO8A 3Q7RA 1NKSA 1Y9AA 5KPDA 2PUJA 3CXRA 1XPOA 4LJAA 3A14A 1LPOA 3BBPA 3D6FA 3I3SR 1BMQA 2JH8A 3BH7A 1CR1A 3I2JA 2FPUA 4ZEMA 3E3LA 1PK8A 2Q5JA 2WLSA 1AK2A 3A3OA 1JBEA 4K8OA 4MLDA 3ROFA 1XEWX 2QU8A 1XJCA 2PXXA 3A2NA 3GEPA 3LX6A 3NO4A 1A98A 4PFJA 5EUCA 1F9EA 1ZN9A 2CSXA 5THKA 1UBSB 4I3GA 4GOKA 3BVPA 2PSEA 2VYND 3K2BA 3FPGA 3FFXA 4JIMA 5AJXA 4AZ3B 3PT9A 1CJCA 1P9NA 2BZ1A 4IH9A 3FYUA 4NYMR 3VPAA 4DCTA 1NNUA 1W0KD 2NVUA 3I8SA 1NIJA 4NG5A 2WVGA 4KPYA 1CK4A 3KVYA 3KKEA 4P7GA 5CB4B 5KTRA 4IXDA 3HB1A 4G1MB 5CLQA 4KN8A 3TLMA 4W5QA 3O7MA 2FPMA 2O2HA 3B36A 1U6KA 4LZNA 5AMXA 4B8WA 1C9DB 3OM8A 1ZVJA 4OFWA 2VDQB 1L5RA 2IZZA 3LXRA 3O47A 3OLCX 3UK6A 5KOHA 2CNNA 5JI2E 1GO2A 1XF9A 3L82B 4Q6WA 3OE1A 1IWBB 2HXGA 2Z98A 5E6UA 1NOJA 1T1RA 4EW6A 4F12A 2E4UA 1EGAA 3MJRA 4C3UA 4YYZA 3I6ZA 3DNFA 1NM5C 2ZVDA 2PA0A 2PK3A 5BQFA 3LJKA 4W5WA 4Y6QA 3AEKA 5EJIA 2CVQA 3TL6A 4DMKA 1J09A 1CUZA 3I5AA 4R1SA 2ACEA 2R00C 4RPLA 4F56A 4MW0A 3BIJA 4EF5A 3HDQA 2OXRA 4DR3B 2DFDA 1D7OA 4MUYA 4S1PA 5CHEA 1IK6A 1DLJA 3DF9A 4I5EA 5DBEX 5DM0A 2IHJA 4TWRA 3OEHA 3VNRA 2VHUA 2XCQA 1MJGA 3A0UA 3G8YA 3VPBA 1XNRB 3NT2A 2HPZA 1H85A 2ZTHA 3ICPA 2ID8A 2BIFA 4ETWA 3ZBUA 3G7NA 2A59A 4HDRB 3D0OA 4UUNA 3R5KA 4J3JA 4BMPB 1AK1A 2BFDB 2QP9X 1AA9A 1S7GA 3K6KA 2OV6A 3QV1A 4L5YA 4PZAA 4Q7QA 3PHJA 1DIOB 4ZVKA 3O4FA 5DN6D 1AHPA 2BJHA 1OLSB 3KT3A 1TVMA 3DMGA 4HGNA 5FUWA 4QEZA 3SNHA 5EXTA 2WM3A 4EKEA 3KE9A 3F98A 1KFJB 2EJBA 3HLTA 5CFMA 2AE2A 2PV0A 2C92A 2OECA 2M32A 3GK3A 3SLRA 1K7YA 4LDQA 2DWOA 1PEAA 2DKOA 4U7WA 4PG8A 5FR2A 1V4BA 1X8XA 4JBXA 4HYTA 4OATA 1BRTA 1N6IA 3PFHA 1T1SA 3PBKA 3KKZA 1N9GA 1NF8A 1PJAA 1VMIA 5DGXA 1U4NA 3CH7A 2ZSHA 4FI3F 4CLRB 4CQMD 1T6XA 2PA3A 3A3PA 1LNSA 1ZLXA 2HMYB 2PSSA 3K32A 1CU1A 4HS9A 3VR0A 3V2UA 1QLJA 3CVVA 1V25A 2E5WA 3FHOA 4GLOA 4TYWA 2QJOA 3V2HA 1P4SA 2QMYA 2XRFA 1A71A 2ZBEA 3H5RA 3QNMA 4RZ3A 1QH8B 1VCOA 4LOLA 1OROA 2C58A 3MBOA 3VMMA 1I2DA 3HCFA 1TX4B 2VSXA 2HLDD 3UV7A 5FWDA 2DCUA 3E9MA 3ETCA 1KAGA 1NOIA 1JU4A 1YS9A 1X2EA 2IUFA 2XUDA 1THTA 3TW4A 3SHVA 4JEMA 2R48A 2WJVA 4JFRA 3VNBA 1GFWA 2R1TB 2R9VA 1Q7GA 3EQ2A 3SEQA 5CYGA 4UXIA 4IICA 1KP9A 4REQA 4CQLB 4EELA 1DIBA 3B48A 3TM4A 5A6VA 2O05A 3P4XA 1U7ZA 1GZ7A 2OOKA 5EZYB 1A76A 3E9ZA 2YZGA 1QIKA 4IXTA 3GFFA 3T5TA 2C82A 2PNJA 2OUKA 3O4JA 1VSUA 2AQHA 2H1HA 3OE5A 4B1FA 1BCSA 2Z58A 3D3JA 4KYUA 2FQYA 1K6XA 4DCNA 4X6UA 2CUKA 1X7YA 5I48A 4LBYA 2B92A 5BUQA 2V55B 3WO1A 5DXAA 5IZCA 2ZU0C 1UAGA 1XZIA 2WE8A 3EQ7A 3FVTA 5D6NA 1QYCA 3UB3A 1F0PA 1XLUA 2MT9A 3OU2A 4M8SA 1AKWA 2QV0A 2C5SA 4AB1A 2PKRA 4HEA6 3B8EA 4I5DA 4IJVA 1CYEA 1O4WA 3SZUA 3STTA 1WF3A 1VA5A 2H8KA 3W8DA 3AB7A 1J97A 2VNHA 2E4WA 3LQ4A 5KBYA 1RZRD 1I7PA 3CW2A 4IX1A 4YJKA 5LKRA 1D2CA 2H5LA 2JJ1A 1T4CB 4EUFA 2WB2A 1MAAA 4EPRA 5FPTA 2I66A 6CHYA 3OIUA 1SZCA 1KVUA 2C8JA 2CT8A 4M1ZA 4YMIA 1XA4A 2HQBA 3KPVA 3OPNA 3HYCA 1DKPA 3UHFA 4JI2B 1UBLS 3TPCA 5EOVA 1Z73A 1VLMA 4KXWA 1WMAA 2B0CA 4KHZA 2O2EA 5K51A 3NASA 1NWHA 3G2KA 2KJQA 5AKHA 13PKA 4MKGA 1HXHA 5AUNB 5JH7B 1UXKA 3H2SA 1SCUA 2BRUC 1KI7A 1T5OA 2OK7A 1D6NA 3S2FA 2C61A 3WFZA 4NC9A 2HSJA 3Q87B 1M74A 3OI7A 4R68A 5DYNA 2A30A 2HSDA 2ZUSA 3QVXA 4DGQA 1W1WA 4NZOA 2B25A 3AP3A 4B6SA 3G6KA 1KU0A 1TUIA 4EW3A 2Q4EA 2AXEA 1N3IA 2FSVA 2VDLB 5DGTA 4N9QA 5JJBA 1G3UA 3HKDB 4KQMA 4EJMA 1ZEMA 1HORA 1NATA 1U2ZA 1NBMD 1G9SA 1DRWA 2YIDA 1Y8ZA 2Q0XA 2LV8A 3ZIDA 2WPDD 5B5SA 4YFYA 2HXSA 4FYHA 3JU3A 2PX6A 2ZTLA 3I2FA 2NXNA 5I8WA 4AJ2A 1GD1O 3RASA 1YZFA 5LNK1 2VPYA 1QO7A 3U7QA 1PK9A 3KOMA 2WHRA 3S1AB 3I01M 4JYAB 2VF7A 4ETNA 1E8NA 2C42A 1OJ7A 3M6WA 3R0QA 4C6TA 1XEXB 4X24A 4ENSA 3M3HA 2FW0A 3E03A 4HADA 2KX7A 3CPHA 4F93B 1TEZA 2MCFA 2C5AA 2P91A 1C9EA 2QAGB 3HU5A 1AQLA 1XDDA 9MHTA 4G1EB 3K30A 3KJXA 4HWRA 4EA8A 5JWOA 2OHFA 2ZB3A 3ROXA 4D44A 3O4RA 4C7OB 3RAEC 1N5KA 3T4EA 2QZJA 3ZE8A 2QN3A 4II2A 3I04A 1E20A 4OHZA 5A9SA 3SX0A 5D8DA 3UV6A 1CW2B 4OXIA 2GHQA 3OICA 2PGXA 2RFLA 4ZPJA 2OCIA 5F64A 4Z1MA 3O75A 1XD8A 4II3A 1JDPA 1FZQA 3TR0A 1XTBA 5KKCA 3ZQJA 2OGUA 2NXWA 3DV0B 4E12A 1GAEO 1YA4A 1FDSA 1M76A 4FFOA 4Z53A 1V39A 1SKQA 3G1WA 1NVUQ 4QNMA 1Z0IA 2A0FA 4URYR 521PA 1NG9A 1YJ5A 4BZZA 2XMRA 5T3YA 1MNQA 3CRVA 4MRVA 4PX5A 2R6DA 2O2ZA 4YAGA 1UMDB 1D0IA 5FO1A 1UT8A 1ULSA 3N2KB 3JYHA 4G07A 4IIHA 3WLNA 4A8HA 4JI3B 1XP8A 5A0FA 3M49A 2NZJA 1LDGA 1MO6A 3GP8A 3LCMA 3RV3A 2Y1FA 2ZE7A 4OQQA 3QX3A 1Z4LA 1G8YA 2OAQ1 2RGXA 4QU9A 1P1HA 1EVEA 5JCJA 3OQOA 2G28A 3I1YA 4D45A 2ISSD 2Q07A 1WP4A 5HTOA 3GLGB 4X97A 1PNOA 2ISQA 2Q2OA 3QKSB 4XYLA 1Y6GA 2NQ8A 2VWGA 3D5TA 3DL2A 2L82A 4QQ8A 4UCQA 5H9WA 2XCSB 1J0CA 1P5HA 4IINA 4KQXA 4PPNA 5KMGA 3MRVA 3AC0A 2XZDA 4R51A 5F23A 5EWJA 1GKIA 1F7UA 1BJRE 5LDGA 1J7JA 4D9HA 4R2WA 3DO5A 3EGIA 5BVGB 3WNZA 1SUDA 3N8HA 5T4FA 5EP1A 3K9BA 2GCEA 5DBOA 1E9AA 1TF2A 1W46A 4AYWA 1GTJ1 3TBKA 4BLTA 4DLLA 4YT8A 1E4OA 1R8JA 2ZJOA 1J8VA 2GSWA 5IMBA 2WM9B 3TLGA 5CAEA 1PWXA 4HDCA 3RBVA 4RU1A 4G0UA 3OY7A 3EHEA 3MNFA 4HDMA 4UU0A 2AJ8A 4UBLA 5ALDA 1V1JA 2YRXA 5TSDA 1Y3FE 4NV0A 3TMYA 4S0XA 2DE0X 3STWA 4Y2TA 3R0XA 1G0NA 2ST1A 2IIPA 4MW7A 3L8EA 4XRRA 3I32A 3LO5A 3JQGB 3GJ8A 5CT9A 5IN5A 2IH4A 4RANA 3FUCA 1U5BB 1A9XB 3O7WA 3AF1A 3UVEA 5AUQA 5I7FA 1GG8A 4PEVA 2MSLA 1B1AA 1PHPA 2XB2A 4B82A 3UAWA 5JXWA 1JRLA 2BM1A 1M72A 2D59A 2G36A 5I7HA 4BMVA 1EZ4A 4HDKB 5LN1A 1D6SA 2GM5A 2X3FA 4C20A 1I7QB 4YNBA 4IQGA 5JDIC 2Z9CA 1UIRA 5EP3A 1DJLA 1BTOA 1KNQA 1E9SA 1U7XA 2VYCA 3M2PA 3I1JA 2ZJ6A 5I7VA 1Z2NX 4QGHA 4MTLA 2I65A 5AVOA 4YRNA 4DLTA 3EEQA 3MUOA 1JLMA 3QXSA 4ZOLA 2OG1A 2ZJFA 1HRDA 3WO0A 2EWWA 1VJRA 3B38A 2ZZMA 5FI0B 3VI3B 5CEEA 3LKVA 5KYWA 2XMCA 5DGHA 1CBUA 3REOA 3R0JA 1ZO8A 4AMGA 1JHPA 2HA2A 2WSSA 4GKVA 4E4TA 5FXMA 4EBFA 1KARA 4ML3A 4YK7A 1NVMB 4OQZA 2PH1A 1IJBA 4O2BF 1SVUA 3LUAA 4KXXA 3U3MA 3USCS 1VFNA 3ZK8A 1O9GA 1YRQA 1V47A 3QIVA 4IM7A 5JUWA 4HPWA 4N48A 2GCOB 4AN4A 4I1PA 2ZCJA 2DY0A 1E1YA 4IGFA 4B3IA 1EDEA 2PZEA 5H3LA 1RJEA 2Y9PB 2JJMA 3OE7A 1JZQA 4NK4A 1AQUA 2CEKA 2OXCA 4A8PA 1MV5A 4G5GA 5L3ZA 4CDRA 1OJLA 4S24A 5LYJB 1EG2A 2BHRA 4WERA 1V0JA 5AI8A 3KVVA 2WWYA 1PR6A 4FGJA 2O7RA 2I9KA 3A9CA 3DKVA 1RYMA 1Q17A 1XVVA 2PEZA 5DBFA 2H2AA 1KI1A 2HA0A 3B2EA 3MIIA 3AF3A 3BFXA 1U3TA 2ZUEA 1P72A 1T1JA 3RYFA 2ZBQA 4ZT5A 3PC2A 1RM0A 1UDWA 1IOZA 4QEDA 4C4RA 3W1EA 1NMEA 3HA3A 5NLLA 4H15A 2I3GA 2ZI3A 5T6BA 2XLCA 1G6OA 1QB7A 1RWPA 1TAGA 1XNHA 2OT3B 4IX9A 4MVJF 5G40A 3O3MB 5A5DA 2AR7A 4YLEA 4HKTA 1ULHA 2QZ9A 2DPXA 4L3VA 2EX1A 4UM9D 1FLAA 2OMKA 2SCUB 3DKRA 2FPGB 1C2YA 1L7OA 5G1NA 1Z83A 1QS0A 1WDWB 2ZVPX 5LQMA 2B4QA 2J9XB 1NN1A 1WCWA 3GCWA 1GCUA 1F2UA 5B58C 1C9NA 3N8GA 4X8MA 5B37A 1NE2A 2ZR9A 3A1UA 2QQ5A 3WRWA 3LM8A 4EA9A 3E1GA 3MWGA 5T4BA 4ENVA 5JCPA 5FLEX 5K09A 2JD0A 1Y1QA 2ENUA 3Q72A 1IHDA 2KPOA 3O5AA 5DNEA 1VA4A 3OF3A 3PYXA 4NYIR 5ENZA 4QYTA 3MM4A 4MRSA 4AY3A 3RUPA 4OP2A 5KNDH 1Z4PX 3ABSB 1PTKA 4E7OA 1FLDA 3CEMA 1U1CA 3BIOA 1ZQ9A 3CCFA 2QN1A 2D0IA 1I6KA 2WF9A 3BTSA 3FKSD 3HJCA 3W9SA 1M8GA 3DZGA 1PYDA 1E6UA 3QM1A 2P5SA 3FLEA 4OXRA 3U49A 1G19A 1V1MB 3TSAA 1GNRA 2Z43A 3ZW8A 1HZZA 3QA3E 1TMKA 4FLFA 3TJMA 4XCXA 1J20A 4X3OA 1N7JA 3EXHA 3HI6A 4FOOA 3GDWA 1P18A 4UFNA 3IQEA 2ZIAA 1VECA 2D4AA 4Q21A 1IATA 4KC0A 3HBNA 4EAAA 1OVGA 1T8YA 4Q7JB 5CLHA 3TPFA 2O3JA 3A26A 4EA6A 2ZRJA 4KR0A 4JY7A 1VKJA 4IIDA 3I6YA 3M1AA 4DMHA 2YW2A 3TNDA 4LZAA 3JAWA 4EL0A 4CL2A 4CEIB 3WOHA 3R7DA 5ECWA 3KQHA 2VP5A 3RSZA 2VPXA 1SUSA 5CP8A 3T7SA 3QE9Y 1HEUA 1ODSA 1XL1A 3O9VA 1OI7A 2CHQA 4ROSA 4ZVLA 5LMNB 1DBSA 5ILGA 3TG8A 4B0OA 3VHQA 1PL6A 3H42B 1W1IA 4JUFA 2ONKA 4JXXA 2TS1A 1MQ8B 4M0DA 1A9SA 4Z2AA 2VJQA 3L1UA 4OQ4A 1LZLA 2KMLA 1U28A 3N1UA 4GIBA 2JLBA 4IDHA 1G8HA 1QHXA 2Q49A 4C3OB 3P8ZA 4H31A 4TVKA 4QKQA 6PFKA 3IAEA 3TW8A 4JGGA 3ZJTA 3IKVA 1LDNA 3QELA 3NHWA 3AEQA 4MUXA 4KPUA 4DKXA 4PC2A 2H2WA 2P67A 1Z4IA 4NESA 2V8BA 5ALWA 3A27A 1OTYA 1L5SA 1VYUA 5TJ9A 2FR8C 1YBFA 3NBQA 2QLTA 5BNWA 2XYGA 1NXTA 2ZYGA 4TTRA 4HGRA 1E77A 3S40A 4F8JA 1RI2A 2LGJA 4ICIA 4KYTA 5AHWA 3K31A 1ZIPA 2YJTD 3DHNA 3O1LA 1WP9A 3LRPA 5DO9A 4Q6BA 4ARZA 1NMSA 3FTPA 5ITZB 3SZRA 3ZQ6A 1RC8A 4ENRA 3FCXA 2ROQA 3CYFA 3QE2A 4MCAA 3EXG1 4PHHA 3EUFA 4P1ZA 1XAGA 3QLJA 4CMIB 1GPYA 3MTBA 4KGDA 4DRXB 2PKQO 4B6QA 1Y4DE 2LNDA 2VTDA 2VH1A 3PC3A 1DTWA 1SUFA 2LD4A 2GXQA 4KXNA 4ETIA 1GRNA 2PZLA 3PUVA 2CEAA 4GP7A 4R1LA 3FM9A 2BGLA 2BR3A 1VP3A 4OOFA 4X20A 4DIKA 3A6DA 1BJKA 1PJ2A 4IXMA 3ZJVA 3F5SA 2CLHB 3IQIX 1ZSYA 4R1NA 1U8AA 3V1TC 1WHSB 2Y71A 3DDNA 4LW8A 4P35A 5BN4A 2IKQA 4AFNA 2ZUCA 3R1IA 3OWXA 1EXNA 3FX2A 5FI3A 1CRZA 4XPZA 2Q9BA 3SSOA 4NBRA 3V46A 5KYKA 4CDMA 4ND3A 2DUMA 3FPAA 4BFUA 4G89A 1WPGA 1EB9A 2VPWA 3H5TA 2GWHA 2NVBA 4L0QA 2PNFA 2MU1A 1DJNA 2IEZA 1ONBA 2FR0A 5FKJA 1P2VA 4L95C 1J00A 2VDUE 5ECDA 5FI5A 4YMVA 2RHCA 3ANLA 3U9LA 4GC9A 3EWIA 2P9JA 2ZUDA 1KRXA 1YR7A 5KDDA 3O3NB 4DUPA 1D5CA 3MGBA 5F3WB 3JTEA 4JX8A 2VS1A 1Y3HA 1Y1PA 1W7AA 2OKCA 4QFMA 1NAIA 2W58A 4BU0A 4BZWA 4GQAA 3G2JA 5EYPB 4X45A 3SF0A 3AJ8A 5FFNA 3HPRA 3DBLB 1V4VA 4JJFA 4DDKA 4KQ9A 2VQEB 2OV2A 1GZ5A 1NQXA 1UKEA 3I6BA 4GVPA 1L5QA 4MITA 4AY6A 1T29A 1GZHB 2IEDA 3M6AA 1N3LA 1Y4AE 2WFAA 3T3DA 3WICA 1V8OA 2PZBA 1D2GA 1UZMA 3DBOB 5JIBA 1JLKA 2JIBA 1XDZA 4IJQA 5KINB 4UTPA 5TIIA 3GLGE 1RIIA 2W2LD 3EG9B 1W48A 4WZ6A 3SOZA 4YUAA 1IMJA 4X1KB 1XPRA 2DAPA 3HJTA 4REOA 2AXQA 1USWA 2Z08A 2AYXA 2WKPA 2Q6IA 3KWJA 1GPNA 2Z95A 4YRDA 4DHEA 1WPRA 4ZI7F 1L5VA 4PSKA 4R3UC 4BJ5A 4K81B 1P2BA 3EEIA 4MZDA 1DIAA 1HI9A 2QRVB 2R4TA 3I2KA 4V3BA 5FNVA 3DP7A 2ZJAA 4F5DA 4AG5A 1QAOA 2I7CA 2NZ8A 2R66A 3GRZA 3IT1A 3ODGA 4L9AA 2KHZA 4OM7A 5LWQA 1Q11A 1LS6A 1OXUA 2Y93A 1DFGA 3DEFA 2K87A 4NULA 4ZVRA 2G1PA 3T41A 1O87A 3F3SA 3DFUA 1YU9A 2Q2QA 1TJYA 5SZKB 1L4GA 4B34A 4B7UA 4QYWA 2IY9A 2WG1A 2XXBA 2ZB7A 2WVJA 4MQFB 4PG4A 4J2OA 2EATA 2JVJA 4QJIA 3ZEAA 3IURA 3K0FA 2VT6A 1MJHA 2QJTA 1RRVA 2IY7A 3LRXA 1MJFA 3RLFA 4D82A 2PKQP 2QN8A 2FN4A 1OT5A 3KJNA 1XZQA 5AJHA 3ZW7A 2Z1NA 3G0GA 1P7PA 1R6AA 4NEHB 3A2KA 3R9XB 2QGFA 2CF6A 4EECA 3DMHA 1KIFA 3GFSA 1J0BA 2C3YA 3TK1A 5KX5A 1QIMA 1TYZA 3NOVA 4ZANA 2VP3A 3C7CB 3OOYA 3K8YA 4OUDA 2ZYDA 5DGDA 2JCBA 4RTQA 5E8JA 3W90A 1ZRNA 2D3TA 4QGFA 3AERB 1U8TA 3VDRA 4V02A 3LY7A 5C34B 5FEUA 1EQAA 5ALVA 2B1RA 3A7DA 3HCOA 4Y6PA 3DO6A 2WJZB 2VAMA 3OMLA 5I7RA 3PWKA 1OI3A 1E0KA 1M1NB 1UK9A 1KZGB 4X3CA 3DZBA 2ZI6A 2J9ZB 3K5IA 1WZUA 2YXEA 4OXYA 1QGAA 4MGEA 3AUUA 5DJ5A 421PA 5A4IS 4LF5B 5IHPA 3BJZA 1DB3A 4OY3A 2EV9A 4R2IA 3W6PA 5E0OA 1NFFA 4P2BA 1K9VF 1OW3B 2NUTA 3NMUF 2QZSA 1OGJA 2MYNA 5KYTA 3DVLA 4FT4A 2OP0A 1A4UA 2JIZA 5IAGA 6Q21A 5C1OA 2QM3A 4JX9A 3PFKA 1LJLA 3CZ5A 1V11B 4CIYA 2QZZA 4Q9AA 3TUIC 1BROA 4JLVA 1EUZA 4RGVA 2PSDA 4E4YA 1A9OA 5AXBA 1SWVA 1TKBA 1XRPA 2OV8A 1X86B 2PMWB 3GRRA 1LBTA 1J42A 1DAFA 2XNJA 2H51A 3P9CA 4K9LA 4UATA 4CV0A 1CQIA 1W9HA 4BNLA 3OO0A 4QYIB 2IT1A 2FY8A 3OAAA 1AQYA 1XMPA 2W2PA 1IDN1 1VE9A 2VSQA 3KLMX 3QXXA 5LP6F 1EAMA 3F71A 4M9ZA 1B1CA 3MG9A 4ATNA 2RC6A 3RS3A 2QRQA 3VPCA 5IM4F 2Y4NA 2ZI9A 3SF8B 3GEEA 2F9FA 4ZOCA 3DKKA 3IOBA 1IXSB 1DQPA 2I71A 2C9ZA 2P4SA 3LNTA 1W0CA 5ITVA 1J1UA 1XCMA 2FGKA 3PFCA 3RHSA 3EQ6A 1IUKA 2GHIA 1P5FA 4HO1X 1B0ZA 3G5UA 4QRIA 2G63A 4A8JA 2RCNA 1DAHA 2XEDA 3G9ZA 3R09A 1P39A 3IC5A 3P0RA 2J0UA 3CF0A 4BBAA 1YRBA 4FFDA 3HHEA 3OT5A 1N6PA 4BX8A 4IIJF 4P3PA 2E37A 2IY8A 3UNXA 2D13A 3BHJA 1BU5A 3V4OA 3V1KA 2HU2A 1P4RA 1UBTS 2ZIGA 4F4FA 4JVOA 5IX8A 2XWPA 1UXJA 4WZBA 1WTAA 2ICAA 3WRXA 4UE3S 2P2CA 1ENYA 4ASUA 3K0CC 4DQ0A 4FXOA 3M9WA 4NIMA 4CVNA 4IHJA 5B3JC 1N5IA 3DLAA 4MVJM 3R74A 4AK9A 2H57A 2O0LA 3UV3A 3A28A 4N49A 3WI7A 4DM3A 1KZ6A 1GQQA 4XVRA 5AW5A 3GLHA 4FX5A 4YR7A 2G4VA 1SCBA 2F90A 1RQRA 4D9NA 2Q5QA 2V1XA 2XCLA 3HDYA 3NBKA 3SFVA 3U7RA 1OX4B 1JHOA 2Z09A 4JJZA 4WKOA 5A4FS 2DPYA 3TSCA 4I55A 5LDDC 3ENNA 4E94A 2CLDX 3BYZA 2Y6VA 1RQXA 4DSAA 1W5SA 4URFA 3T3PB 4GPZA 1QH1A 1IULA 2GBLA 1EWQA 1V1RB 1FNSA 1SC3A 3LPDA 1DEKA 1GDHA 1I0ZA 4FFBA 1RXYA 2C5GA 2Y66A 4RF5A 1GL7A 3LFHA 4HI0E 4NJOA 9GPBA 2UYGA 1E69A 1V8DA 1K7CA 4MNTA 2EW2A 1PTJC 1KC1A 1ZA1A 2FG5A 1AKEA 4IQ4A 4QFBA 5AWFC 3LL4A 5DWQA 4ZGBA 1ZCBA 2G8LA 3PX3A 3ROQA 5IXYA 3MHPA 1O0BA 1C8LA 4DQXA 5HEKA 3HEBA 1NV8A 3ZCVA 4YJ2A 3KAKA 5JDCC 1TF5A 3EARA 4ARUA 1KI4A 1XQ9A 3I05A 4L1KA 2J6HA 2CHEA 4RTPA 1TO6A 1JVSA 2W2QA 4YJHA 5JAIA 2HHHB 1U0GA 1UFOA 3BZBA 3V4SA 2AE1A 1DC7A 3QVMA 2JK1A 3QBEA 1T4BA 2OVFA 4NZ9A 1JG6A 3MS4A 4A1OA 4D4LA 2Q4RA 5JZ9A 3KDAA 3ZXUB 4DFDA 1XLVA 2MSCB 3NP7A 4L0CA 4L0MA 1M34B 3AM4A 6REQB 4KRYA 1D2MA 4R8RA 3AG5A 4EHHA 1E4EA 1DBPA 3SGLA 4BCDA 4KO3S 1EAYA 1MQSA 2HA5A 1WB5A 2XVAA 3NHZA 1O96A 3QP9A 2YICA 2JA2A 4K9SA 4M60A 3SHFA 3THWB 4MQUA 1YUMA 3X1XA 1LRLA 1AO3A 4KXVA 4Q4HB 2G40A 4G1FA 3JQFC 1WW2A 1A8HA 4H1UA 4WA8A 2YL2A 3NETA 5EKDA 4BRWA 2RH8A 1HG1A 2QKYA 1V6CA 2R5NA 3HDHA 3I2GA 1Z6QA 3IMKA 3QLVA 5TVGA 5IJ0A 1VB3A 4J1SA 3R76A 3ROGA 1G4UR 1JLLB 1D1QA 1P31A 2EGHA 2R8BA 3DCNA 4J7XA 1KAOA 2O2CA 1NXXA 1XTIA 2QE6A 3JQEA 4DDMA 2N1MA 5C1DA 1DQRA 3K4QA 1Y7TA 1O54A 2ZIUB 1C1XA 5HR5A 4I4TA 1FDIA 1M2FA 1KFEB 1HNWB 5IYZA 3ER6A 5THQA 1VP9A 3CW9A 4C01A 2PS1A 3CB2A 5I8ZA 3RVOA 1FTNA 4H0CA 3UXYA 2CYBA 3CF4A 4C21A 1WUIS 2QM0A 3YASA 4DMGA 2E18A 5HKKD 4LC1A 4GMKA 3A1EA 1YL6A 3RJ9A 1CY8A 1AE1A 5E6SB 3SZGA 3DT6A 3TDMA 2WFLA 3CVYA 1H9CA 3EXG2 9ATCA 3QFSA 3RUFA 3BD8A 1DOAA 1SXJA 1XRNA 2PYDA 1R8XA 4O59O 4Y8VA 4BFLA 5JSUA 1XELA 1CHDA 1AK9A 1Q57A 1VTKA 2OWDA 4XB2A 5CXUA 4MARA 3ZHZA 4X7PA 4BCCA 4YMGA 1T9GR 4R9VA 5IFKA 3GO4A 1XMSA 2EXXA 1NW5A 3H1GA 3JRWA 1OBOA 2FRDC 3FNHA 5EIBC 3TMAA 1ZD8A 5CDHA 2QLNA 4UBNA 3I2IA 1C3JA 1HEYA 4FPXA 1FFDA 2EFHB 5HTKA 2YJGA 2PQ2A 3BSFA 1A5TA 4BMNA 3W3ZB 4P6VF 3RHFA 2FDRA 2ZU6A 1YIOA 4V2IA 4ZAVA 4WFJA 4MDHA 3RC8A 3DCJA 1JKJA 1U3GA 1A96A 3DBHB 3RYIB 1KI8A 3BRCA 3TE7A 1Z5ZA 3LHKA 3NUZA 5H81A 4JUBA 2ZI4A 3WQBA 2FR1A 3ZDZB 4YQFA 2PX4A 3JVIA 1T6NA 1ZG3A 1BMFA 1L7NA 4NNPA 2B8JA 5CYPA 3X2SA 2C20A 4I19A 4R2KA 2VRCA 4ARAA 2I6SA 1S2MA 4EYOA 5BMVB 3H2ZA 3ZCRA 4PINA 5P21A 3SSMA 2QYHA 3EEFA 3GGJA 2Z5VA 3OC6A 4YC7A 5DULA 1GEEA 3SWWA 3QX9A 3L6OO 2FSHA 2HO4A 4KE7A 1HMPA 5DYTA 4KBYA 4CG1A 1REQB 3MJFA 3R3ZA 4LY3A 4GU5A 4OX9Y 3TD6A 3GT7A 4YAKA 2PJRA 2IQ5A 4W5RA 3GDFA 5IJ9A 4GR9A 4KBGA 4FC6A 2OD9A 5KVAA 1XEWY 3OJ0A 1GRCA 1C2TA 2X5KO 3O8OA 4G1VA 4AKHA 3LYLA 2H2GA 4L85A 1EUDA 4RJLA 4L8FA 1V8ZA 3ZCTA 3K3PA 4RZXA 2AOVA 1IZYA 3JASB 4CM9A 3ETHA 3SNKA 2VXYA 1Q1ZA 1BU8A 2PR7A 3IDSA 1X7DA 4NVRA 2AZ4A 2DUUA 2NWQA 1G55A 2NUBA 4YLGA 3AJ9A 1VCMA 3VYUB 1Z6ZA 4DGSA 2Q62A 2PJZA 4F9FA 4Q4AB 3MD9A 5K3OA 2AI3A 4L5AA 1W36C 4MDYA 2BZSA 3ENZA 4UTVA 2WVHA 3SIRA 4K3UA 2BP7B 3S5UA 4BU1A 1OKKA 3C3BA 3SOPA 3TZHA 1Y3CE 1P2UA 5AVVA 2JH3A 1PQUA 2NUPA 2FEPA 4KLZA 4AYTA 2QRGA 3G2NA 3MJDA 5THXA 3DDOA 3CKKA 3LQKA 1M6EX 1WQ4A 1XVUA 3AB8A 1EVLA 3H1AA 2QLBA 3PEFA 3ESRA 3M1IA 1UPUA 2GD1O 2BI4A 3PNMA 4FZRA 3TZCA 2C04A 2IEIA 1ADYA 2VHYA 1C29B 1FRZA 3ISJA 4RD2A 3VNQA 3WWPA 4RENA 3CR7A 4YDSA 5EHZA 5KYNA 1ECFA 4ZVSA 3PQ5A 4IOMA 5DBIA 4MCIA 2XVXA 3W2EA 4DJTA 3B6EA 3AEXA 2B20A 4QJBA 1T2VA 5DXFA 5SYMA 4ENQA 3H3JA 2P8SA 2WKRA 3RODA 3A9UA 3A32A 3P45A 5FPYA 5LBTA 4OBEA 2BUAA 1Z5VA 1AB5A 1UXHA 3UHJA 2IEYA 3UIEA 3TUZC 2HV9A 1TJ4A 2DWCA 3EOZA 4UMVA 4MOWA 2CZGA 2JIDA 2G70A 2Q3MA 2Q21A 4EO9A 3ZY6A 4HBGA 1OZGA 5EJ7A 3HVRA 1T24A 1R50A 5F1YA 1H1TA 2YJ5A 1LPAB 4J0EA 3ZIAA 5KSPA 1Q14A 1E1CB 3QUQA 4UMDA 5BMOA 4Y9RA 1RAFA 1AMUA 1DG3A 4X65B 4GZ6A 4XDZA 5F2KA 5GY7A 5LA6A 4BO8A 4C78A 1T2NA 4L08A 2J7PA 5LIPA 3A11A 1TOAA 2QN9A 1C3LA 3WZLA 1WXFA 1L4EA 4TSKA 4E14A 3J81A 1EHIA 1E7SA 1L4MA 1L4YA 2DHDA 4MPTA 5C8YB 1EEHA 4LRSB 4X7MA 4XIIA 3IJRA 2WHXA 1YS1X 3IOCA 1JWAB 3C7DB 4G0VA 2O8DB 2PPVA 5EE0A 1M2KA 4RADA 3F8WA 3LK6A 1N57A 1OC2A 2WJHA 2ZYUX 3ETDA 1RJDA 4GMHA 4KPGA 3TRJA 1YDEA 3QPVA 2WDPA 4RV5A 1OZFA 5B3LA 4RMHA 3PWZA 1XQXA 5SV2A 3M2TA 2DEUA 1Y37A 4HVLA 2HX1A 3DTVA 1F6BA 1CQPA 3E48A 2UAGA 2ILTA 4O2LA 3H2YA 1YTLA 3L8GA 1MOPA 4I4NA 1NRWA 2IZ5A 4U7JA 4YI5A 1T9CA 1U1DA 2D0PB 2D00A 4M54A 1KL7A 4X1IB 4WBNB 4TWBA 1ID1A 4NHOA 5ARCA 5BO5A 4QDZA 1P77A 2VDOB 3B5IA 3D43A 3EWNA 3BOSA 1J8DA 2J45A 3FFBA 3IEPA 2D4HA 4XFKA 1TLLA 3ORYA 4WQMA 2XVZA 4PLTA 4B2YA 3ONFA 4BWVA 5A3JA 1MCZA 3GEIA 4YRGA 5BN5A 2B5OA 5CA1F 2R25B 3JQBC 5AH0A 1KO4A 1E7MA 1VCIA 3LA8A 3PFWO 1GV0A 2W6PA 4QTYA 3M3DA 1ZKMA 3PGXA 4NAUA 4MR9B 3SQNA 5BY2A 1X6VA 2C77A 5A71A 5A4KA 2VQFB 4K1LA 4HTFA 4PR0A 5EERA 1R00A 1J5PA 1QIFA 4TV9A 4EFLA 4KQKA 2HXYA 1CUBA 1Q0PA 3G59A 3C87A 1XCGB 3ZC3A 4ED9A 1D7AA 1RKVA 3BEDA 4FFSA 2IPOA 4YCBA 1LPMA 3OX1A 1L4LA 1H23A 1WKCA 3OZRA 2XZOA 1M1ZA 3ZHBA 3G85A 3DWGA 3BCUA 3OPMA 1XZDA 4JBYA 2M1ZA 1NVKA 4QAQA 3AHDA 4RWEA 1Z22A 5BRNA 3A0RB 3QSYA 2J3KA 2QXUA 4QXPA 3SY8A 3TOCA 1WVGA 2XSZA 2ATVA 4GLJA 5DFAA 1D0VA 1T9BA 3IO5A 5H3HA 1I3NA 4UEQA 3DFFA 5TQ2A 3K96A 4HNSA 3EXAA 5JXJA 3A1NA 5ERYA 3F9RA 4RLSA 1XU4A 4KAJA 3AM5A 1OFUA 4IUDS 1PZMA 2B2XA 1BVRA 1WDMA 4XWTA 4PGAA 1GOTA 3MRSA 4P36A 5G4KA 8AT1A 1LBSA 3GQBB 3Q15C 3ETGA 3DBRB 3H5NA 3AT1A 1E6MA 1ZDMA 4IJWA 1GWNA 4NY1A 4B44A 5KTSA 1CDZA 1IEXA 1PGOA 2LVBA 4M0MA 3W5JA 3A9VA 4E21A 5HZKA 5KO2A 3ZCUA 1YZNA 3N2YA 3UWMA 2WWTA 2CBZA 2F3PA 2H7CA 4ER6A 1PQPA 4PZCA 3U3ZA 2O5RA 4BP3A 5A6SA 5LOVF 4I2VA 3KJGA 4QOJA 5JXIA 1R0KA 4U02A 1Y9EA 3KXLA 3JD0A 1IIRA 4CMCA 5H59A 1EFDN 1Z8DA 2JS7A 4EI9A 3H2HA 3CG0A 3M4JA 1YRLA 2BJWA 3JAMA 2Z6QA 3W5HA 2FUNB 3UT0A 3EZXA 3WL7A 4WKPA 1AG9A 5JLJA 1U1EA 3C6XA 3ZU2A 1LZKA 1DDIA 1IQRA 4TKVB 1S96A 5L3QB 4I1SA 1M34E 3OTIA 1CUYA 4Y7DA 5DW3A 2FAXA 4KDFA 4ZHQA 3I42A 4L15A 3T5MA 2OLKA 2EKQA 4MO9A 4RMGA 1L5FA 4V0MA 2RB5A 2J8ZA 2Q5LA 2R65A 2AG8A 1ICEA 2YWBA 4HWTA 4K86A 2W9XA 5E0KB 4HUQA 5LXTF 1NVFA 2ZAGA 3CPJB 3AKEA 5TX7A 2FKNA 1Y5MA 3T7JA 2VJOA 5JBIA 4A15A 3ZD6A 2NTYC 3C2QA 3ILYA 2ABWA 5DSXA 1P44A 3HGMA 1ZXBA 3CVUA 1SBYA 2RC5A 4Y0NA 4JMPA 3PPIA 1L4UA 1OA1A 5CLFA 2E21A 1GKYA 2O8EA 1XN4A 3D64A 3WWOA 1BW9B 3O6VA 4BX3A 5BNTA 4H7EA 1UDRA 5IXSA 4O4JB 5HA5A 2A67A 5BR8B 2ZK7A 1RQ2A 4M8LA 3FOCA 3PNKA 1UJ5A 1KI9A 2FSIA 5JNRA 4B80A 1ENPA 3K2IA 3O8QA 1B8PA 5K3EA 1ODLA 2QL9A 3UY4A 4HMQA 4GQBA 3D4IA 1SU8A 4IIXA 4C4XA 3JWJA 2YH2A 4DR4B 4EITA 1YI1A 3BRQA 5BOSB 2O7QA 4OK5A 3NDRA 3PCTA 4D56A 4EYSA 5EMKA 4RFSB 1W6UA 1R88A 2ILVA 1I3OA 1UQUA 4QTZA 1T2UA 3DCYA 4BGIA 2IP2A 4GC5A 2SICE 3UMGA 5IM5A 2F43B 4U63A 4YRQA 1K4KA 4LYAA 2FPIB 1DQZA 4FC7A 5EKTA 4EMTA 3H11A 4RTMA 1P3DA 2GB4A 2R5WA 3NPMA 4GGMX 2ZEJA 3SX2A 1BNCA 4ID9A 1HETA 2B4AA 2C3MA 4EG3A 4NICA 5IH3A 1U4OA 5JNWA 4DTIA 2BFBA 1QO0A 3DXZA 1J70A 2O3TA 4GH5A 2BBTA 1WZNA 4Q3AA 3GJ7A 2YQ4A 3TXAA 5FFFA 3JQ7B 1K2WA 1TU0A 1I2ZA 2DQSA 3EF1A 3WLPA 4TS4A 1F8XA 1EGQA 4NXMB 1O0SA 2YVAA 5B6JA 1L7DA 3NM5A 2BF4A 3F6RA 4M76B 1GSAA 4D5EA 3L8YA 3H1BA 2JCSA 2Q3DA 3UT5B 4XRGA 2V7EA 2EKDA 3OIVA 3NV9A 4X7BA 1ZMXA 4F2DA 1G4AE 1Z9BA 1EDDA 1K92A 2I2DA 2O5CA 5K2MA 3EPPA 3A4YA 4A36A 4RVHA 3C6BA 3G9QA 1AKYA 4RQAA 1A9RA 1ZD1A 5HQ3B 1BH6A 2KBEA 5LIRA 1GM5A 5L7TA 4XJTA 2DPLA 3ZZ1A 2Q1UA 2A6PA 1UOEA 3EA5A 1VKNA 2AEFA 1JR6A 5JRZA 1I14A 3PDCA 1J5EB 2D2EA 5AI6A 1N36B 1G8KA 1AKMA 1B8UA 2PRJA 4EY4A 4GL2A 3Q4GA 3Q6MA 1L7VC 4PQRA 1R0WA 3VNSA 3NS7A 3F4KA 5LQDA 4LWZA 1JQDA 3QVTA 4FGLA 1AZWA 2IC5A 5EXXA 1YB6A 4XASA 3ICCA 5FOTA 3TQFA 1EGMB 2H48A 2ZRGA 2VJDA 2B4TO 2X8BA 1RXUA 4S0ZA 4UU1A 3L0CA 1AT1A 3A70A 4I5FA 4Q3LA 3O4VA 5BPHA 3OIGA 4H6WA 1E3IA 1H2RS 1XXLA 3QOWA 5BSVA 1F0YA 4AZ0B 3QPCA 5ALUA 1A82A 1IY2A 1UWLA 3EPKA 1TFRA 2KE5A 3VV3A 2HHCA 3C24A 3WSVA 3C0KA 1XZCA 1Q21A 2IZOA 3MW8A 3UGTA 2I80A 5ALTA 2F1JA 2C9BA 1DAMA 2EU8A 1N6LA 2VSOA 3IEXA 3TI9A 4FOSA 2XDWA 4GPIB 4KEA