3LX4A

Stepwise [fefe]-hydrogenase h-cluster assembly revealed in the structure of hyda(deltaefg)
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
426
structure length
407
Chain Sequence
LSHVQQALAELAKPKDDPTRKHVCVQVAPAVRVAIAETLGLAPGATTPKQLAEGLRRLGFDEVFDTLFGADLTIMEEGSELLHRLTEHLEAEPLPMFTSCCPGWIAMLEKSYPDLIPYVSSCKSPQMMLAAMVKSYLAEKKGIAPKDMVMVSIMPCTRKQSEADRDWFCVDTLRQLDHVITTVELGNIFKERGINLAELPEGEWDNPMGVGSGAGVLFGTTGGVMEAALRTAYELFTGTPLPRLSLSEVRGMDGIKETNITMVPAPGSKFEELLKHRAAGPLAWDGGAGFTSEDGRGGITLRVAVANGLGNAKKLITKMQAGEAKYDFVEIMACPAGCVGGGGQPRSTDKAITQKRQAALYNLDEKSTLRRSHENPSIRELYDTYLGEPLGHKAHELLHTHYVAGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fe-hydrogenase
publication title Stepwise [FeFe]-hydrogenase H-cluster assembly revealed in the structure of HydA(DeltaEFG).
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Oxidoreductase
total genus 142
structure length 407
sequence length 426
chains with identical sequence B
ec nomenclature ec 1.18.99.1: Transferred entry: 1.12.7.2.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02256 Fe_hyd_SSU Iron hydrogenase small subunit
A PF02906 Fe_hyd_lg_C Iron only hydrogenase large subunit, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lx4A01
3.40.950.20 Alpha Beta 3-Layer(aba) Sandwich Fe-only Hydrogenase (Larger Subunit); Chain L, domain 3 Fe-only Hydrogenase (Larger Subunit); Chain L, domain 3 3lx4A02
3LX4A 4R0VA 1HFEL 2N0SA
chains in the Genus database with same CATH superfamily
4E15A 3H5OA 2A8YA 1WBDA 1VBFA 3DDOA 1R6XA 3PZBA 1NW5A 4N3AA 4OGGA 3REOA 3Q5GA 5CVVA 3WSVA 3FNHA 1ZJYA 3EXIA 4BQSA 3O9MA 5TMDA 3LV8A 4AN1A 5DWQA 3DQQA 1RXSA 1A9XB 2B25A 2C2ZA 3F8TA 4IKOA 3ZVLA 4D4KA 4EUFA 4N48A 1BEUB 2J1LA 2VT2A 2WM2A 3EPPA 5G0WA 2DBZA 4AKHA 3LK6A 4LZWA 2RAFA 2VPWA 4B7UA 4YMHA 1NLMA 4CF7A 4HAYA 2X0EA 4AY5A 3U4CA 3BUSA 2RH5A 4GOXA 2HSJA 1U2PA 3DVAA 3L3BA 3RIYA 4ARVA 5CEFA 5HS6A 2AEFA 3NBXX 3W06A 1GFZA 4XEUA 3ZY3A 1IUOA 5A2GA 1N5RA 3W1EA 4HYQA 4FFRA 5LLSA 5A4KA 4DJAA 1I13A 1ZIOA 3D6TB 4PLTA 2PL9A 3ZCXA 2P9FA 2ODTX 3P0RA 5HKAA 2W2LA 3CZRA 4OHVA 3T38A 4BMXA 1VIDA 4II3A 3WWYA 2OSVA 5TDHA 2FJPA 2XWBF 3WWEA 3DBLB 2IDKA 2PUVA 1XBTA 4YRSA 4PINA 1QIHA 3PWZA 4KEAA 1Q0UA 1YZUA 1BJTA 4X20B 4N01A 1PN3A 1SVNA 1C0IA 4NFSA 5EUMA 1B6SA 1G8SA 3OPMA 5FFNA 2OYRA 4IH1A 4CL3A 3R0QA 1G18A 1Y8RB 2B0JA 2J3MA 3CC8A 4Q7MB 3TQFA 3VZCA 4LAFA 2PTHA 4MW7A 4PZ9A 2E5WA 1MJGM 1IPFA 5DN6D 2HLNA 1Q3TA 1A9ZA 5HEKA 3OAAD 2DG2A 4XJVA 1PNOA 1N7JA 4ISBA 1LNQA 4AWBA 4QICA 4AZWA 5KCZA 1JI0A 1OYVA 1ZU5A 5I45A 3CT4A 1N8TA 1QB7A 3OF3A 5C32A 3JR3A 1R0RE 3OQPA 5PGMA 5JH7B 1W1UA 4NECA 4TKVB 5DHAA 4MYDA 3IIKA 4J7XA 2VHZA 1LPOA 3UYKA 3VR2D 3MWKA 1BGVA 4MQEA 4Y0AA 3ZWWA 1FVHA 3NIFB 5FORA 1BXGA 5HM6A 1JJVA 2XYVA 4S04A 5FOTA 2XYHA 4B0PA 5K6TA 3H86A 2QORA 3K2QA 1E92A 2NZ2A 3ESYA 3KE8A 1IHXA 5DDIP 5H59A 3EZGA 4I5DA 3D81A 2IT1A 2A9JA 3H2KA 3KKNA 2ZR8A 5CHYA 5JCXA 3KEOA 1H23A 2EXXA 3FRIA 3RVSA 2WF5A 1EXVA 1PS0A 1RIIA 3GFOA 1NR1A 3CPSA 1F1JA 2FWNA 3O90A 4QRIA 4Y7DA 4TYWA 4U9UA 3ZWPA 3P52A 2D1QA 4GYKA 1ML3A 2J9ZB 1WR8A 1Z73A 4FYVA 1KEEB 5A7FA 1PZGA 4CCYB 1R5JA 1RMYA 1LH0A 3KQQA 1BHQ1 5CR9A 2GEJA 1Y4DE 2VZ8A 3ICWA 3M2PA 3TVDA 1WP9A 2JBWA 4D56A 2CJXA 1ZUNB 3AIKA 5ILOA 2KI5A 2YDXA 3FETA 3LA8A 3A58B 4E5MA 3HABA 3RS4A 2JVIA 3HKDB 3NBQA 4M87A 1TQHA 3E8SA 4C0WA 4D4LA 3LRPA 5KJ1A 4WBNB 4CETA 1VG8A 2D06A 1WBJB 3AESA 5KCMA 3O3CA 3DZCA 1JDSA 4W9RA 3AEYA 5CVCA 4C78A 1ECGA 2HDNB 1MO3A 2C7GA 4I4TA 1FW6A 4ZANA 1QGED 5AVYA 1ICEA 4IIJA 5I9TA 5DLPA 2RGBA 2RGYA 1PCXA 2W6CX 4W5RA 1RWNA 1ZMBA 3ROMA 1U5AA 1OLXA 1NJ8A 4EGCB 2CZCA 1MNAA 2WV9A 3IA7A 4RZ2A 4NMWA 5HZHA 3EVCA 1XB2A 2G1KA 4NX2A 1R0XA 3OEED 5AW0A 1WLSA 1AXRA 2VRWA 2ZUUA 5DBFA 4DA6A 1XQ1A 1KI8A 5JAPA 4CKXA 4DCNA 2XMGA 3LCMA 5ARDA 5F23A 2EL7A 2WYWA 4GLBA 4JQSA 5HGXA 3S2UA 5KVCA 1EHYA 2OQRA 1I0LA 3OQOA 4MYSA 2XEXA 3FLBA 3QNUA 4JUCA 5CT5A 5A04A 2O8BA 1H2YA 1B93A 2J9RA 2NZUG 3KZCA 1CIJA 3WL3A 1V48A 1JKJB 1E2FA 4BC0A 2IBSA 1VKOA 2OV3A 3PEEA 1VQ1A 1YC2A 2Q2VA 1CJTC 5IAOA 2XWJI 3KT8A 1I30A 1N0UA 1ZH2A 1D3AA 3FWZA 3PQCA 4EKDA 1RFLA 3CF6R 3U09A 1YZLA 3ZV3A 2I4RA 1X70A 4C4PA 1CS0A 2QJFA 4P3XA 3P4UA 4ZAVA 4UMFA 2RHMA 2QRVA 1HL7A 3UQYS 4H3HB 4PWZA 3FJOA 2YYSA 3QG1A 3OJ0A 5K7SA 3BBPA 1YRQA 3V32A 4DRYA 4DPKA 2O7SA 3SX0A 4Q0MA 3RS9A 4Z4IA 2V5AA 2OCBA 4CIDA 4QOGA 5CB4B 2W2PA 1FFCA 5J63A 3A3YA 1ECBA 2QRMA 4HGYA 1G42A 1JLMA 4KW7A 4M9UA 2A5JA 4UQPA 1C3VA 2R6HA 3NTOA 3W79A 5KNCA 1RD4A 2HO5A 2VH2A 2Q5LA 1WXFA 3NATA 1RRKA 3LWDA 4KWTA 4BBZA 4DKXA 3IPLA 1Y6RA 1O9GA 3BB3A 5HK8A 1GNQA 4MULA 2HKIA 4OFBA 4W7HA 1Q92A 4NHOA 5HRUA 1ZJWA 4XYLA 2FEWB 3DKRA 3OQJA 3QW2A 1M6VB 4B87A 4X61A 3OMXA 4KOAA 2ZLBA 3S5UA 3GJTA 2HHLA 2OYSA 2VKTA 1YBHA 1ONPA 4AT1A 1H5NA 1AQJA 2VJBA 3T7EA 3WQRA 4ENVA 2NZ8A 4AC9A 4G37A 4ND7A 3RVMA 2A1IA 1NFRA 2YN2A 4I2NA 3HJHA 1SK9A 5J2UA 3WYGA 2HMUA 1THMA 2C8KA 2W6ZA 3L8HA 5EP1A 1RZRD 2GN9A 3GGGA 5C1IA 1YSCA 1P2GA 2BSQA 1RRVA 1XJCA 1OREA 1JR3D 1XCMA 1ZN7A 3RPEA 3ED1A 1IXKA 1T8WA 4RKWA 3DHNA 4KAAA 3H3XA 3DAOA 4PWYA 4QXPA 3VHLB 1FNBA 5KJEA 1K4KA 1TGYA 3L7CA 1XDBA 3GMTA 3WO1A 4FHZA 2JEYA 2FTKE 2OBYA 2PS3A 4XH9B 2QT0A 1BN6A 2CUZA 2ZTMA 4YCLA 2JLVA 3C1OA 4B47A 1TM5E 2I29A 3ZLTA 2AE1A 3B85A 3OZAA 3UWSA 4G81A 2IZOA 1L4MA 2ZUCA 1XG5A 3CHYA 3QH4A 5FJJA 5EXTA 2YN0A 4DTCA 1QIMA 3L6DA 5MHTA 2I22A 5CB0A 3QX9A 1TT5B 2CC2A 5B36A 4YP0A 3RIEA 1VLMA 1LWNA 2ECFA 3W2HA 5IM4F 2ID9A 2IOFA 3ZWXA 1YCHA 5C8YB 3O2QB 3OHSX 5HR5A 3JQ9C 3TLMA 4M49A 3CUUA 3RYFA 4EMTA 5FOUA 3CVWA 5IDXA 4ZOEA 3OY2A 1KEZA 2M98A 2D4HA 3RTBA 3GIDA 3IX7A 2IEYA 4IG4A 5C3MA 2XBUA 3K6KA 2BFFB 5CRIA 1S89A 1FIUA 3L93A 2H48A 4I3HA 2PWAA 1ID1A 1KH3A 3TAHA 2H4HA 5F3RA 4N9QA 4RPLA 2NO4A 5HGJA 5JATA 1NBOA 5LXTB 3FX2A 3EYWA 1GUDA 2WTBA 2ZGVA 4G1UC 3V48A 3RAJA 4AYXA 5BWMA 2A78A 1KIFA 4DLSA 3I3SR 4EHJA 3UWDA 3E9ZA 1EVQA 1HDIA 2OAP1 2VYNA 4DPMA 3GCXA 5LVAA 1ZK3A 16PKA 2YHUA 2BY4A 3GARA 5D51S 3AVWA 4REQB 5A3VA 4P9NA 3LBAA 1EFHA 2W2NA 1JIQA 2GBCA 4YLEA 1JEQB 4EHAA 4N3NA 4U7TB 1G8MA 1CVLA 3MCZA 1Q91A 4AQYB 3LDUA 4R71A 2FVXA 5CEEA 2XCIA 4PLFA 5IBCA 2JIDA 2NVOA 2X3FA 8ATCA 2W42A 4HB0A 2IS6A 4P92A 2O8CB 2PWBA 3HR4A 3K5PA 2IPLA 3L8FA 3MOIA 1L7DA 3VNRA 4HTAA 2DR2A 3MJ4A 4Y2JA 1LJUA 4WZAE 2OLKA 2RHJA 3K1ZA 3HJTA 3I2YX 4L8FA 4YROA 1M2KA 2WHYA 5FRDA 1J9GA 1DCKA 2IHTA 2YVUA 3AMVA 5I4KA 3FCXA 4DBVO 5KSYA 2QYOA 2XUFA 2YHIB 2HWXA 3LXXA 1XZNA 4AWXA 2RGDA 2Y1DA 4YAGA 5JMPA 1MQSA 4KKVA 2G9NA 4AIIA 1C0PA 2C9OA 2JHCA 4C6TA 3GPIA 2ACEA 3B6MA 2LP4Y 4P34A 3B1YA 2YN4A 4X7MA 1AKNA 3D3KA 2B0CA 4EVSA 3QTBA 2GEDA 3PCXA 2PBZA 2FRXA 2OAGA 2QU8A 4JMPA 2ONJA 1GQ2A 4A0RA 4RQUA 3C4VA 4Z7OB 5KYWA 5HPYB 3G0OA 1ZIDA 1S6YA 2W8BB 4ZHSA 1WQ1R 5AJZA 3TLKA 4J43A 3FPBA 2F1OA 4NNOA 2C1EA 2VUSA 1GY8A 1V11B 1XHEA 3C4JA 3GVCA 4I55F 3WJ7A 5SYNA 1O95A 1E20A 2O59A 2GD0A 1QMGA 4Y1RB 5FWDA 1U0GA 5K3BA 1USGA 4YP6A 4EB3A 4CCAA 1GQRA 1U3GA 1J0DA 2WYOA 3HLYA 2PUBA 2VPZA 3H7IA 3K9HA 5LC1A 2FJ0A 1WLYA 2GZAA 5CDGA 4WECA 1RYYA 3PJGA 4TROA 1Y7PA 3M6MD 4DG8A 2IHNA 2O4UX 2KLHA 1OAAA 1Q74A 1QO7A 2NSJA 2RHRA 2HMWA 3A2MA 3BFVA 3FHOA 3Q6MA 3U7EB 2CFSA 1W4LA 5EE0A 2EW2A 3LC7O 4B3IA 3K0HA 3DMYA 5A05A 1TTPB 2JFZA 2P3LA 2AS0A 2I67A 2G17A 4FDMA 4G07A 1N2XA 4HWKA 3SBXA 4B84A 4DN6A 1Y4SA 2XWQA 1RJGA 2AF4C 2FMFA 3DEKA 3PGVA 1YFZA 4WNIA 1P45A 3O4RA 5BP7A 3U39A 2VT7A 3NHAA 3L07A 3C5HA 1ZBQA 3ZH2A 1CUCA 3T1NA 4DR2B 4RZ3A 5IYZA 1G1AA 4FYMA 5A4JA 1Y82A 2Q1UA 3EWAA 4R8KA 3JASA 1N32B 4BATA 1XEXA 1G5QA 2GZHA 4I1IA 3PQDA 2QW0X 1WDTA 4P4TA 2P41A 1IN6A 3R7AA 5FPPA 3WP1B 3IODA 1BMFA 2OCGA 3GFQA 3KSAC 1EFKA 1OLSA 3PNMA 4LOKA 4M8LA 1D2AA 3AFOA 4HDOB 4COOA 3H1TA 5G0UA 4YRDA 1SUBA 4QTUB 3LPNA 5EHGA 3ZV7A 4DG5A 4PY2A 2H06A 4U3JB 4KTTE 4RYLA 2HJHA 3OFSA 7REQA 3FZEA 2OT3B 1GPH1 4CM8A 3F3SA 1QDUA 1K06A 3H8VA 3M2TA 4GVPA 4I4NA 4M1ZA 3S8YA 5BN5B 1K7EB 2HDWA 1KQPA 5FPTA 1UPAA 4FLFA 1P5ZB 3QE0A 1YZGA 4CHGA 1XD2B 1GKIA 1SBZA 3GJ7A 4CEHB 1YE3A 1U7ZA 3A3OA 5HJ7A 1W4CA 1TM1E 3FCUB 2VDNB 1BC5A 3AUYA 3RT7A 2H1VA 1YZHA 4QUIA 2CUKA 2JPDA 1N6LA 2R6DA 5DH9A 5EINA 4BCCA 2O8EA 3PDWA 2P62A 5DMHA 2P9ZA 3ES9A 3P5SA 3PIDA 1SK8A 3ICPA 2O3QA 5B2EA 2K2WA 4B2LA 5JAMA 3F2IA 4G5GA 1E7WA 3DVRX 4HNHA 3Q2IA 4Y2SA 2JNWA 2RKOA 5IK2D 2PJUA 1WX1A 1A27A 4AF7A 3NUGA 4GOLD 2AQKA 4MJ3A 4QBFA 1C9DB 3SG0A 3KFVA 1C1XB 3D0QA 1OXTA 1R0ZA 1XMVA 1DMSA 3DNFA 3I2FA 3KBBA 3NEJA 1NW4A 1E64A 1P9RA 3B7GA 1NL3A 1N1DA 4EATA 5K05A 4JZKA 4DIOA 3F6RA 1TKRA 1ODKA 4NOKA 3H9JA 4FYKA 2ATCA 5CGZA 2J7PD 4L57A 3PUJA 4R2MA 4MUEA 4XEHA 1WCXA 4W9NA 4MV6A 1B2LA 1L6IA 2VP2A 3FB1A 3OT1B 1OBCA 2BMDA 2W0MA 4H0CA 1XTKA 5DSZA 4XLLA 5HCNA 3JRWA 3C85A 4HNVA 4PVDA 1J39A 3V2IA 4JB0A 5AW8A 5JCJA 3GZ4A 4N54A 2ZBRA 3N2NA 4PU0A 3RVOA 4GH5A 4QUHA 2G82A 2PFKA 1ODTC 3PXDA 4GX0A 3T9EA 5L3SA 4XW2A 3QFFA 3RK4A 1YRAA 3G8CA 3PSHA 4FVTA 3B7WA 4K9SA 1T1RA 3CRRA 2GN6A 2JAPA 1GWNA 4V02A 3HO1A 2FOIA 1ZNYA 4FKZA 3S6JA 4Q00A 3D3JA 4H59A 4WI1A 3K0EA 3K9QO 4N9WA 5FOXA 5BSRA 2HZ7A 1D03A 1NDQA 2YYZA 3HKCB 3QY0A 4ZQFA 3ETCA 3NASA 2ZE7A 3CLTD 4UU1A 4UM5A 2HGSA 1EFPB 1DXYA 4W8HA 1F2TB 2W6MA 3TN7A 3V7YA 4BO2A 2ZATA 2XUGA 1PZFA 3RYHB 1ECCA 1KC3A 2VP4A 3U80A 3V7NA 4Z4FA 2VQ3A 3D7SA 3GL9A 1MT0A 4WGFA 4X95A 1GG2A 3EARA 4YALA 4C0XA 2BGLA 5JVDA 4LW8A 2Z5VA 1Y0BA 3WHPA 5HHTA 4C2TA 3GOQA 1P2FA 4ZEVA 3TLAA 4P7KA 3IBCA 1Q20A 2AL7A 3C3YA 1CQPA 3BMCB 1K8RA 3HGQA 3IC5A 3LL7A 4Q4JA 3SXUB 4XDZA 1YRYE 3RKSA 2PG3A 1QX3A 2CVQA 2BZ0A 1EDZA 1ARZA 1T4DA 4DA9A 2AXEA 2F4NA 1G41A 3BTOA 3KT0A 4E07A 2XUHA 2YOGA 4FK8A 4X3CA 5HA5A 1Q77A 2ZYAA 1U28A 1R6AA 1YIOA 3RUCA 2WB2A 2FMHA 3MWDB 4MR9A 2X3UA 4C0QC 3WDMA 4CL0A 5GP1A 4EENA 4YRTA 3PHCA 2PHZA 2VJAA 3H9EO 4F5WA 3KT6A 1SVKA 3FFWA 4L3OA 3RLIA 2MINA 1Q0ZA 4WL0A 2BLNA 4FPXA 4ZVPA 1DL5A 3L9WA 1YQGA 4FUQA 1RAAA 1T3HA 4QREA 1HQKA 3JQRA 4XB6B 3V8RA 1SBIA 1BOOA 3PLRA 3PZRA 2PCLA 5B4UA 1QF9A 2G63A 3TDNA 3BMNA 3F6SA 3OOSA 4AKTA 4U9HS 4GRDA 1ECJA 4HQKA 1XQYA 2G7MC 3SKXA 2OP1A 3FBGA 1C14A 6CHYA 1Z38A 5F1KA 5JW6A 1I9CA 1L7MA 1PGQA 4PZCA 4DSOA 3JQ7A 3I09A 4MR7A 4FSXA 4Q01A 1WCV1 2FCRA 2NSHA 2OAQ1 3DYBA 3BB1A 3PXXA 4IJ5A 3RIXA 3VAYA 4W9MC 1XA4A 5H9VA 1K92A 1Y33E 2HRZA 1IHPA 1I7QB 3IAHA 4NZNA 2DJ5A 2BCEA 2YXNA 3NKLA 2I91A 1Z7BA 1NURA 3ORSA 3LBIA 4NR0A 1UOOA 3I0ZA 1ATZA 3A6JA 2LWIA 4NDNE 4QPPA 4LBYA 3WYAA 2OOSA 4Q7KA 2F6RA 1PT7A 2ZVDA 3CEMA 3EXG1 3TIXB 5GONF 4LQLA 1XZLA 4BNXA 2ZTHA 4JVNA 4CIBA 1B76A 4NABA 1D6NA 1K08A 1UK9A 2GLUA 2WWRA 1PHRA 4JGGA 4XLTA 3S1LA 1GT6A 3PE3A 2W0SA 2PQMA 1YS6A 3KAPA 4K9PA 4YECA 5FQOA 1Z5OA 1G7SA 4GBGA 1KVUA 2JAXA 3GGOA 1TMYA 1QYRA 3AVQA 4DLLA 1PR2A 1GTMA 1HE3A 2SKEA 5EXXA 2DCUA 5E1MA 2EKQA 1GSOA 2GJ4A 3H2YA 3JQGA 3KJXA 3PPXA 4Y6PA 5SYAA 1RI3A 4XM2A 5REQA 2ZAYA 3SR4A 4F5DA 2P6RA 3LUDA 3GUZA 5C18A 1J1IA 2PZLA 3AFIA 3PFBA 4YCNA 3H5AA 2HCRA 4HUTA 3TRKA 1JLKA 1XROA 1UC9A 4QVKA 5T3YA 3L7OA 1QM5A 3PHGA 2ZVQX 4HUQB 3OOWA 2C2BA 1TA9A 4XYMA 4ZCRA 2F3TA 3Q7IA 1VL6A 2QPAA 3ZV6A 4ACAA 4HLUA 3OF2A 2DUMA 4UUNA 1QZUA 2MOKA 3A6FA 3ROEA 4FYHA 1WABA 4NI5A 4W4TA 4WXYB 4Z9YA 3NOOA 4MKFA 1N2BA 2J67A 3WLHA 3U16A 5COBA 1FFDA 1R8SA 4YRGA 1H8HA 2V59A 1ZK2A 1G8HA 1MX9A 2ZS8A 1HL3A 3N3BC 3ETDA 3KP1A 3GV0A 3RUHA 4C05A 5B6PA 1ENOA 5HTKA 2FZWA 4TQUS 2IYPA 2BMAA 3T5DA 3UH0A 4Z3OA 2OXEA 3BXFA 3E27A 1GL6A 4BN0A 2JG3A 1Z4LA 3LGAA 4U6SA 2WV7A 1SOWA 1Z4OA 2WEKA 1TZ2A 3GA5A 4XVRA 3ZI4A 3GWZA 2A67A 2J5BA 3R9WA 4G0ZA 2PD6A 3GDFA 2IUFA 3JZDA 3Q87B 4IUDS 2P2DA 3CZ5A 4O4HB 1I7NA 4R83A 3WGKA 3WA7A 1EVZA 1X7WB 4MLDA 3T1TA 4BBAA 5LR6A 3V8EA 7MHTA 2QSZA 3LWNA 1WPRA 3VU9B 1FTYA 3HB7A 4E5PA 1YD7A 4XWAA 3GC6A 5BVHB 3A25A 3TFQA 3G2KA 5BR4A 1SUEA 3WAJA 5CCDA 1Q16A 1CDDA 3RG8A 2NZVG 4I1VA 1U2RA 1EP2B 3FNGA 4U2GA 1SA0B 3EIQA 3AVTA 4QYTA 5EJGA 3SS8A 3UUEA 1RBYA 2C1ZA 2OCPA 5KHLB 1P2TA 2E5LB 1GKUB 5A7HA 4B3XA 1P2DA 3CNBA 2DSTA 2PT9A 1W96A 4YRKA 4RC9A 2SHKA 1SXGA 1CQJA 2VZEA 4G4GA 2A9RA 1U6KA 1XA3A 3F67A 3HB1A 1J23A 4I8XA 5KINB 1NC1A 2IX3A 2X76A 4Z2AA 4A15A 3O5AA 4HSGA 1JKFA 4HZIA 3GF4A 2QBYB 3OY7A 1IMJA 5D00A 4TKMA 3I5UA 4Y9RA 1L5VA 1A5TA 3HVJA 1UMDA 2ZOSA 3LY7A 3HTXA 3G0GA 4X64B 5IUNC 3IULA 3KCQA 2Y1KA 3HV2A 4ZAYA 5CA0B 1JMVA 4X1YA 6Q21A 1QP8A 2J6BA 4P2GA 4B82A 2GS9A 2IS4A 4PC2A 2JHAA 3NRCA 1QE5A 4C03A 5I6DA 2P6UA 4E7PA 3AB7A 3CW8X 1I7LA 3ECSA 2QG4A 4JLAA 3BKWA 1XU9A 2L17A 1YR3A 4WLFA 4IHJA 1YR8A 1RLUA 5KTMA 1XMXA 3UMJA 1B42A 2EV9A 2IIBA 4GKKB 1A9RA 3IV6A 3UXEA 4HXGA 4NBVA 1D8AA 1UJMA 2IXFA 1N5KA 2H29A 3DTVB 1HYHA 2F3RA 1P4GA 4K6OA 1KFJB 4DRXB 1G2OA 3TGPA 3DCNA 3MC1A 3QOXA 1A96A 1MAAA 4IRXA 1C4XA 4K40A 2G72A 2NPFA 1VG0B 1NI4A 4FKMA 4QTTB 1W48A 3OLZA 4KE8A 2W2KA 3OQIB 3UZUA 3WLIA 2C99A 3EHDA 4XGNA 4KGZA 3WLKX 2GUWA 2JGEA 2FZVA 2D1SA 3NTUA 3INYA 4TXMA 1F7VA 3KSZO 5FAXA 1V7QA 5JO9A 4TXLA 3A6HA 1KU6A 3CX3A 3WSWA 3EX7C 3SMVA 4F85A 2ZXEA 4KC0A 2KHZA 2GK4A 5KO2A 3CTMA 3ILXA 4L08A 4RV9A 3NBFA 3P9SA 1BTOA 4K2AA 4QDTA 5KYTA 1AK2A 3B38A 3AEKA 2XNKA 2GGSA 2XNCA 1WHTA 2VNHA 4HADA 1C1YA 2ZQZA 3DVSX 1QFJA 1DB3A 2FEKA 2GK7A 1O95C 4V3BA 1C7ZA 3X1YA 1SOUA 1M0SA 4DILA 4XWWA 3LAWA 3MHTA 3RSHA 2FUCA 2ID7A 5EIAA 1GPUA 3PRKE 3SN6A 2AZMA 3OX1A 1W88A 5KDLA 1DI0A 3QWBA 4EL5A 1QOPB 2GR9A 2I7VA 4EELA 1EM8B 2GJ8A 4YQYA 4AYTA 4CR7A 1B2RA 2VQDA 5G4LA 2VA8A 5TQ2A 4BV3A 4FR0A 4EA8A 3CWZA 1M8PA 1J70A 4PAGA 3OIFA 3BG5A 3FUXA 3I4CA 4A1OA 4DMFA 4EPRA 5B7NA 1M67A 3K6JA 3UMYA 3C6XA 5DLEA 1Y3BE 2QXYA 3PV0A 1ZOOA 1IBSA 4EUKA 1UBRS 3SOZA 1NW8A 5H1YA 1VLLA 1XTSA 5DYNA 2WWHA 1DUVG 1XDZA 2R5FA 4HX5A 3FFAA 3PF8A 4R2IA 5AUQA 1KI9A 3STUA 1SXPA 1NMQA 1A50B 3PC8A 2QR5A 1XQWA 4O4JA 4DSZA 1P0MA 5DWVA 3UH1A 4E14A 1U8CB 3G59A 4RL4A 1GPYA 3WGHA 1ZP6A 2R4TA 3SC6A 1SQFA 5ALOA 3W04A 4FONA 1A97A 5FTWA 4KOEC 5IEBA 3ASVA 3LGSA 2YICA 1IEXA 4Q03A 1N3YA 1FS4A 2A0UA 4Y98A 1GTZA 3E53A 1ORTA 2ONKA 3OQBA 3BXEA 3DS8A 5TF4A 3SS7X 5EIBC 3FBTA 4KVGA 4DNXA 2Y0BA 4LYYA 2E87A 4NBUA 1BDMA 2VHJA 4U7HA 5A71A 5PNTA 1EIZA 3SICE 1IZ8A 5HDQA 3VDXA 4CCWA 3RRXA 4GVLA 1B0PA 4NK4A 1RXYA 5DMXA 3WC4A 4R9UC 5E1DA 5IDYA 4XB2A 4CI9A 1USUA 5B2ZA 1L9XA 1ORWA 2GPYA 4KFRA 4UFPA 3EA0A 2RHLA 4DUGD 3OZUA 1KMHA 2L2QA 2ZYSA 3ESDA 3PSAA 5I7RA 4DR5B 5EWJB 3QE9Y 2EGUA 3GBPA 4H4CA 3VV3A 2P5YA 2FFHA 2W6IA 3MGAA 3UW3A 3MBKA 1VE9A 3LQYA 2B4YA 3VOBA 2PWZA 2ZIWB 4QUAA 4AS1A 3OZVA 1IEVA 3RD5A 1BVYF 3K0FB 1T4CB 5JWRA 3PDIA 1CIVA 3T7KA 4QAJA 1A1SA 2BFPA 4INAA 4ZO8A 3PUZA 4Z1MA 4F3NA 3PR3A 3NDRA 5A9SA 1A5AB 3QVLA 4G9EA 1EGQA 4DRZA 1KJZA 1OC4A 1Z47A 5IAJA 2WG2A 3OQNA 5EMKA 3SZMA 4BHTA 1Y7IA 4IHAA 1CJVC 1XALA 3P0EA 4OHCA 3RTGA 3BJRA 4DQLA 3I9KA 2O4CA 4JI0B 2YMQA 4MVJF 3MYYA 3BRWA 3H19A 4TX1A 2J3EA 4EAAA 5KSOA 1ZCAA 4A0QA 2DXIA 2Y1GA 2CXTA 5LA6B 2RH4A 3PIRA 3WK6A 4JKOA 3O1HB 1N6PA 4BJ6A 3QP9A 1XDSA 4IKPA 2ZCUA 2YOHA 4YAIA 2R8PA 2VBGA 3DOIA 1DBVO 1ZUD1 3KJEA 2M6SA 1QSGA 2QZZA 1E8MA 1LK5A 1HKUA 2VVTA 3G89A 4KQWA 4LBVA 3T1QA 2OK7A 2WZDA 1BKSB 1JH8A 4W9NC 2PX0A 3K53A 3ROZA 1N2CE 1W9MA 4RACA 4Z4GA 4GLFA 2HX1A 2D0OB 1XIVA 5AFSA 4R1UA 4CLOA 1G0NA 2XCUA 3EFOB 4QHYA 4LN1A 1G6KA 4GPAA 3L79A 3HEAA 2BV3A 4YRRA 5TE9A 3GCDA 1W85A 4B85A 4M1EA 2P35A 4ZYUA 1NE2A 4FT2A 2GO1A 2R2AA 3LKVA 2HF2A 3M83A 3TTTA 5I8WA 4YHHB 3JTEA 2O8DA 1LZKA 5FV7A 1G3RA 3MWEB 3O8DA 3ZTTA 4BRWA 1XRNA 3GLKA 4CL2A 2SNIE 2G77B 3QXHA 1OHHA 3U44B 5AKLA 3EF1A 5TMPA 4N18A 4D9BA 2VJLA 3QKTA 5BORA 3WL8A 2A5GA 2Y99A 5AO9A 3E9MA 1Y6FA 3MINB 3OIYA 4NFLA 1QPGA 4LXHA 4B34A 3R5JA 3KD3A 5IH3A 4TTPA 1FFEA 4DCTA 1LTQA 1X94A 2XQIA 4NU0A 1NOIA 2FZCA 3OZDA 1G16A 2CJPA 2ZJFA 3FPKA 1LS6A 2H5JA 2J0EA 5EZYF 2ZIFA 1QO9A 1M6NA 1TJ3A 4P81A 5G4KA 4ZTBA 3WGLA 3LRTA 3R7FA 3E23A 4BMCA 1RC0A 2MSNA 5TGTA 1NXXA 1AIPA 4IDDA 3JQ8B 4F96A 2REXB 2WHQA 2HFJA 3L43A 1SKUA 1AB5A 2J48A 1PWHA 3KOOA 3LLSA 4KQIA 1SHZA 2D00A 3DDCA 4RVHA 3N86A 4MQBA 1CJSA 2JGMA 1RAGA 3CKMA 3NIGB 3TQCA 2O3UA 721PA 3EEIA 1BHJA 1IDOA 1YZKA 3FYHA 5F7XA 1IB6A 2JFNA 2R9VA 4CCYA 1JHPA 1KAGA 3UK0A 4IS2A 4UW9A 4EGSA 5JASA 4GECA 3KHSA 2V7XA 2BTQB 1S01A 4G6ZA 2POCA 4HPWA 3UWKA 3ZDEA 1G5PA 2AA3A 4D9FA 5LQCA 3HACA 3UOWA 1DEKA 1T15A 2GESA 1E59A 1DOHA 3EIXA 4IMJB 4AMGA 1UKAA 5BN4B 2IUYA 1V41E 2O3RA 3TMAA 4ARZB 4DV0B 4BXOB 1IC6A 1VPWA 5I7FA 4JQCA 5AVRA 3O8BA 4QQKA 3PQFA 1U7DA 2XHEA 1S1MA 1SU8A 4L28A 3GT3A 1EJBA 4LMBA 4RTQA 4CMHA 4ZN6A 2RC5A 4X7BA 1O96B 2HFKA 2VSQA 3UAXA 5BV1A 4B6OA 4EH1A 4LBWA 1I1NA 4HDKA 2EEZA 3GJYA 1C29B 1PJSA 2QMYA 4J0JA 3I32A 2CFOA 4LJ7A 2EYQA 2IUSA 3DLCA 4NJEB 4QULA 3HN6A 4UHJA 4F84A 4PG8A 4LHXA 2QF7A 3D8RA 2QG6A 3IDAA 4BIMA 5JRDS 4CM3A 2ZCJA 1DBIA 3VR0A 4WY2A 4XE5A 3CMCO 2QTGA 1OFGA 3DC2A 5ALSA 3RABA 3TNYA 2PLNA 3EQ6A 3CH4B 1M34B 2OCAA 3L6RA 3FVRA 1XK7A 1F0NA 1ZGHA 2Z4TA 3G9TA 4O1MA 2Z6AA 3TQSA 2ECPA 4KDCA 3W1WA 3CXUA 1FFXB 1FMCA 4GOJA 3DDWA 3LUJA 3V9PA 5KYKA 1A9SA 3HB4X 4V3CA 3PQ4A 1VYTA 1HOTA 3IS3A 2CXOA 4L0MA 2C29D 3CURA 3PG5A 5LP6F 2HQ1A 3U3RA 3DAPA 1P77A 1M8FA 3LP8A 1JKJA 1PJCA 3KVNA 4FGZA 2G36A 2PH3A 2W48A 1CZUA 3CH6A 1FYFA 3FKSD 3L7BA 1BMTA 1PO7A 4PLWA 4WCFA 3U7FB 1U80A 1N2CA 1VJ0A 3ULKA 5NULA 1XCPA 2OHXA 4BLQA 5AW7A 4BFZA 1QF6A 3BK7A 2OY0A 3L8DA 4HB3A 3TSYA 1FJGB 4D5EA 2DOKA 2EKDA 1N4AA 3LSYA 4LS3A 5BSHA 1G4UR 2V5UA 1D4FA 4YUVA 3AFMA 4YPVA 5I5EA 1H9CA 4J4HA 1OGYA 4TMKA 5EWMB 2IY7A 5FL7D 2C4NA 4NDZA 4JFAA 2QAJA 4EY8A 4F12A 4IIHA 4O1IA 1NBMD 1WDKA 4FW8A 1GCOA 2A4KA 5CB4A 1VM6A 1O5IA 4RJ2A 4D9KA 4LNAA 4U2KA 5DCYA 2NXJA 3SM3A 3P45A 2B8TA 1Y6JA 1HETA 1ZRHA 2IDJA 1HDXA 1X86B 3U4IA 3G8BA 4TVKA 5F2KA 3RLFA 4BVJA 5JFOA 2JGAA 3N8DA 3ZHQA 5CMLA 2X5KO 2XKKA 2H7VA 3DL4A 4I9NA 4JASB 2JATA 2VSYA 4WEQA 3LDFA 2V58A 4HLUC 2ACVA 1BX3A 3DP9A 5ALIA 4JI3B 1DQRA 1Y1KE 3SKYA 4EX6A 2CCJA 4GI2A 3MFYA 2A1UB 2QMEA 1EWVA 5E9WA 4ZCLA 3M9LA 1GGEA 4BLVA 2ZJZA 4D99A 1SM4A 1Y1LA 2GAIA 2XOXA 3AB3A 4H3SA 1P1IA 5ALYA 2EBHX 4M86A 3ZZ1A 3QUTA 1TIKA 3JVVA 5B1HA 4LF5B 1IN1A 3HDGA 3GNLA 4KLNA 4MUXA 1DIHA 5DW3A 1ZPDA 3KJHA 5JARA 4DNQA 4IZ6A 5BNFA 4BJ5A 1CQIA 4JA2A 3PEWA 4A6EA 2P0AA 2Q2NA 3IA2A 4AURA 5CLFA 1G66A 3LF2A 3QI2A 4DDMA 2OCLA 4URVR 2HWKA 3IAM6 4A10A 3Q3CA 3N53A 3L7JA 1GA4A 1VXOA 3RRNA 2FZKA 2WINI 4MS1B 3S8EA 3G49A 4N0MA 3O4VA 3NWBA 2M1ZA 4I8DA 5FHRA 3ZZTA 3AEQB 3A1WA 1X39A 3PGKA 3OPYA 1JEJA 3CVYA 2FWPA 1JIJA 2EZTA 1TQ8A 1R8QA 4CKBA 3GDHA 3DEFA 4Q3CA 3NIBA 2AJDA 4QG7A 5F73A 5THXA 3F74A 3AKCA 1YGPA 4MW5A 3UPDA 4D80A 5LOVF 2JIQA 5K6AC 2P8SA 4GLLA 2XMDA 4G5HA 4II7A 3HB0A 4KO3S 1MC1A 1GPBA 2ADMA 5C34B 3HU3A 5HF6A 3PICA 3WHLA 1H6CA 3ICOA 4GS5A 3R3ZA 4R8RA 1BA3A 4LVOA 3K8QA 1WTCA 3MPOA 5DX8A 4A73A 2R44A 4IIYA 4KE7A 2R8XA 1JUDA 2PZ8A 1W36B 1Y9JA 1Z34A 3SY8A 4MS3B 5ENVA 1HMPA 3VDQA 2YVLA 4O4IF 3W0LB 1KFKB 2Y67A 1RXIA 4OXIA 4LK2A 1N1GA 4O8ZA 5EJ8A 4BNTA 5EKXA 4H6PA 1QWOA 2J6IA 2J6CA 5D3MA 1T9GR 1V5WA 3HVUA 3HBMA 1GQSA 5AVTA 3HGMA 4IWXA 1R3UA 1NF2A 4RGQA 2ALJA 2Z1NA 4FDLA 4RZIA 5AR1A 2BHRA 3TW0A 5I7HA 2QA5A 5BUZA 2F67A 3PXEA 4V0LA 1UJCA 3WLJA 1QX4A 4M53A 1IJFA 1XFAA 2WVJA 1KDZA 1Q1ZA 3R5HA 2X6TA 3HYCA 4K1LA 3S1AA 1XHLA 1EDEA 6ABPA 2V7BA 3D6AA 4JBHA 1LNZA 5E6UB 1JR6A 4RK6A 2MIIA 4QJ4A 3IESA 4REQA 4IGAA 1VSVA 1XELA 3O1JC 4KIWA 1YOBA 1K2VN 5I9NA 2IYWA 3WOHA 4AZ0A 4H7KA 1MB9A 1I24A 3WBJA 2IHYA 3L7YA 5MDHA 4C4RA 4PX2A 2BGMA 3FMGA 4X60A 1A7KA 1H85A 1P5JA 2W98A 1J07A 3DV0A 3CUYA 2OAEA 3FPGA 4DMLA 1L4LA 1PR3A 3PHBE 1WSWA 2OILA 3ROKA 2HDHA 2G0NA 4JJIA 3LUFA 4QLOA 3KL4A 1QCCA 2FV8A 2WWIA 4OHOA 5E6RB 3JQAD 1QAMA 3VHQA 4MR8A 1OMOA 5GVSA 5LZ9A 2C96A 3JWIA 3HO8A 4PTLA 4QJ3A 3PF9A 1BCRA 1JG2A 2ZQYA 3VR6D 4HXFB 1XNHA 5DHPA 1RXEA 3QYAA 4LJKA 3FVQA 3KZVA 4OSEA 4F9FA 4NE2A 4UCWA 2W4MA 2OKGA 2HD4A 4XVHA 3JZMA 4R2HA 4TGLA 1EVJA 2WJPA 4U0KA 4XDYA 3OUTA 4EHFA 4RTRA 3A1CA 4GOMD 3VDNB 3UA3A 1IQRA 4YJKA 2C5HA 3RVBA 4IUYA 5G1NA 4MROA 4AY3A 4FJ2A 4F2WA 3HG7A 5AVQA 1AMOA 4GEKA 3UCEA 3IJEB 3OZIA 1JU4A 3FVVA 4RZQA 2VP5A 1AKRA 3O3NB 3ANMA 2ZVPX 2PH1A 1U3UA 3WGZA 4PE5B 2VJYA 3OWHA 4V1CA 1HDOA 2B5VA 4B76A 4F7WA 5IKEA 1F2UA 3OUZA 4BZQA 1QP4A 4Z3KA 2H85A 3PC8C 2BGTA 4LTNA 5AHKA 5C80A 3T95A 5U4QA 1ETUA 4UNNA 1VA5A 3ANTA 3T9BA 4DM3A 4ND4A 4EB6B 5BV8A 1W0JD 3F7TA 2AHOA 4DREA 2F4VB 3VNVA 1H3EA 2JARA 2AOTB 4JYCA 4R81A 4CEJA 1ICIA 2QUAA 3WLSA 1S9DA 1HDCA 4E7OA 4QM7A 1UPCA 2P1ZA 3BD7A 1MGPA 3TIIA 3H5NA 4HMPA 3G5UA 1BE8A 2C5GA 2QRZA 2KW5A 4BJHB 2N42A 4FFDA 4OA8A 4O2AF 4AJEA 2QUBA 3KDPA 3JQCA 3TTVA 2C2MA 4DUZB 1G7TA 1UR5A 4HRVA 3N9IA 3GRVA 3A37A 4JR0A 4NH4A 1B7GO 1OYOA 2WP0A 3KWFA 4RCYA 3DW3X 3EPLA 3BDAA 1GYQA 5TGDA 3HU5A 1EDBA 4HAZA 1MDFA 1DE0A 2J41A 5L8VA 2I1LA 5JCOA 1B1AA 4BNJA 1OFIA 2ORYA 3DBOB 4MIEA 2DERA 4EF6A 1VHTA 2I8LA 3FTNA 2F1JA 3ESBA 1F17A 2GEBA 2RGUA 4MJLA 3SX4A 3VHRA 1Y8CA 3IAM1 4YN3A 2OZLA 5EP2A 2IPMA 4MUKA 3PIIA 2PSHA 1HX7A 3W5UA 2ODBA 4TMWA 2X1MA 5DTJA 4NXNB 5JPIA 3WYBA 4FN4A 1CZHA 3H75A 2I6XA 1ZIPA 3CTPA 1ZRSA 4HQFA 4BB5A 3P5BA 5KNDH 5KOHB 2DWCA 3AEUB 1RE0A 2A84A 2CDNA 3V46A 1J8MF 2WMYA 2YXDA 2Z30A 3R6TA 3H84A 2KLBA 4MI6A 1E1CA 3PFWO 4P5DA 4W5HA 3R20A 2O7NA 4W99A 4UQLA 3ZC3A 1N6NA 1Z26A 1WB6A 3B9RA 2DBYA 5LNK6 3KFXA 1OE0A 2BP7B 4RXTA 5C3UA 1OZGA 1VECA 2VXOA 2CNBA 4WK6A 2FFJA 1SKYB 3QUAA 4FFBB 2JCSA 3MLBA 4M7WA 3L8GA 2YX1A 1MHPA 2H31A 4KPFC 3EC1A 2PXCA 4A1FA 1XGKA 2IZ7A 4DEXA 4HOYA 2O1XA 5BQPA 1WW3A 3KTAA 2INGX 2CEAA 1M2NA 3TKYA 1H4TA 2BC9A 2HF8A 3GJQA 2HU2A 4I55B 2PE5A 5L53A 3PI6A 1C1DA 3A32A 3BE8A 3HL0A 5LP1A 1PNVA 1PLLA 3PXCX 4O1HA 2QUIA 1H2RS 2B69A 3K16A 2PXAA 3HCBA 2CE2X 2QK4A 2VIIA 4RD1A 3FDZB 3AUKA 1Z88A 3WVNA 4CHTA 3J80A 4KXVA 2OOKA 4MSUA 3AF6A 1B41A 1ZAKA 5IT4A 2HLHA 1LLCA 4KIUA 4OXNA 1UBTS 4ZI7F 1V3TA 4KK4A 4ZYTA 5E9AA 4O2BA 1PKXA 2HK8A 1U3CA 3C1AA 2IXEA 1HT3A 3KUUA 1E9VA 2HLDD 3FIJA 5H70A 1PYOA 3O2NA 1PJ2A 4MKZA 2G5CA 2H2IA 3NYRA 3OT1A 4UVEA 1RRFA 3DCJA 3UMMA 5DN6A 1UIRA 3OAAA 1GA1A 2J5QA 4QEZA 2BE9A 1GTJ1 1QRDA 2FOLA 3ACDA 3FJYA 5AI8A 2YZ7A 1JHYA 4LV5B 2O5EA 1Z2DA 3ZZUA 4TV8A 4J1TA 5E3HA 1YKGA 3EZXA 1A4UA 2WOOA 5CH3A 1Q15A 2WJVA 3L01A 3TNJA 2NUPB 3OE4A 4R9RA 4OATA 1YZFA 2J4FA 5DCWA 3PENA 3VR2A 4F3TA 3OZBA 3E9DA 1Y34E 4DMCA 2GHRA 1QANA 1RAFA 1IRXA 4V0OA 2HBYA 3O8CA 3BHIA 4DLNA 1T8RA 1KOLA 3DONA 5D1NA 4ONEA 1Q7TA 3ADBA 2Y66A 4D25A 1E3EA 3OZCA 4K9QA 3QA9A 2R47A 3PKIA 1K86A 2J5KA 5CNMA 3U9SA 1JB9A 1ONOA 5HJ5A 3E15A 2CMGA 3R6WA 3EAGA 4AP5A 3AF1A 1YJCA 5A6VA 3LT5A 2GWRA 3NPMA 5C7IO 2XYQA 2H65A 5C8DA 5CDYA 3SIPA 2EVWX 3QPVA 1PU2A 4G65A 4C4AA 2ZI3A 4J0EA 3PCTA 2GSWA 3TPZA 1EEXB 2FXIA 3NAMA 5EMJA 4AJKA 2EWVA 2RC6A 1AKVA 5KJCA 3Q9UA 4QQ8A 1XZ8A 5L40A 2X9QA 5J4HA 1EQAA 1UOEA 2Y1WA 4NCNA 3MZ0A 5AW1A 3IT3A 3N2KA 3B1ZA 4G0YA 3W5CA 5IJ0A 3OQ6A 1QP0A 3C3DA 2C0CA 1I7PA 4JJEA 1ZYUA 2VNKA 4ANFA 2EBFX 5I7UA 4O2RA 2XGSA 1C80A 3H97A 2PKWA 4CM9D 5L95A 3EPKA 1MJFA 1CUUA 4G36A 2V3CC 2J45A 2C0PA 1A88A 5A4IS 1WWKA 5JRJA 3UT6A 2QTVA 4MVXA 5DKFA 5EMNA 2EF1A 2G9RA 3NJ8A 3CF4G 1WQ3A 3G3EA 1JE1A 2DFNA 3RADC 4FBLA 1QR2A 1IN4A 1REQB 3HNPA 2A30A 1J2EA 2IDMA 3DE7X 4LF7B 3NOQA 3AJRA 3TQOA 5IG2A 2NX2A 3ETEA 5A5FA 2C2YA 2C04A 2NVWA 2QENA 3I01A 3LFHA 3RW9A 4RWEA 1IQUA 1P7CA 5FB3A 2GVNA 1I3KA 4CI0B 1SHKA 1NQOA 3CZQA 4X8MA 3OLXA 4CM6A 1IK6A 4DABA 2P78A 2EFHB 3KDSE 4RVOA 4TZTA 4X1IA 4B40A 3OEEA 4QUEA 1U2GA 3RS7A 5J3JA 1FYWA 1H0RA 4WCFC 1AV6A 2B8EA 3KEQA 3FR7A 2EAUA 2Y1XA 3TRIA 1F2DA 1K5DA 2GHTA 3PPIA 4HYEA 1I9GA 4ESHA 4RMGA 4C88A 4C29A 2DR0A 2Y4NA 3EPJA 4MZXA 5E38A 3UN1A 3NNSA 3T8YA 2A9VA 2GXSA 1WIWA 2YFKA 4WOJA 5E95A 3QKRB 5CAEA 5CXQA 2P30A 1Q7CA 4O4LA 1K75A 2PX2A 4Q3DA 5B2FA 10MHA 2WZQA 3A6KA 3F9CA 1JT2A 4G5OA 4WY5A 1F9AA 3QUQA 4RK0A 1C7IA 3LECA 2Y8EA 4YMGA 3VR4H 1DFIA 2Y1CA 2QV0A 2R1TA 1BYIA 1ZFNA 3X1MA 1A5ZA 1Y81A 2HADA 3JD1A 1IUNA 3AR7A 3MTEA 1KETA 3KSMA 4AZ3A 4BKMA 2PUAA 2HBRA 1FU7A 3NAZA 4MYRA 1P4AA 1KHTA 2V74B 3HJCA 5DYGA 2AQ8A 1J00A 4A16A 5KJ6A 2WA2A 2X0JA 3EGVA 3QXGA 3V1LA 4F2GA 2R6ZA 5B1DA 1NSYA 2PNJA 3ZDZB 4L3VA 4HY3A 2J85A 3Q6NA 5AW6A 3L92A 1FNMA 4M1MA 1II8A 3LRXA 3UVEA 1SVLA 4O02B 1NHWA 1SKMA 4DDWA 1QC5B 1RYBA 4F06A 4PGMA 1RYMA 3GEIA 4WFKA 5J43A 3G6KA 1G7CA 5FP0A 1JQLB 2ZSFA 1WB9A 2ZUEA 5LM3A 3GEPA 2YXEA 4ZC8A 3K35A 1T2DA 4RQAA 1Z12A 4C0BA 3BJMA 1LS1A 1CRWG 2J3IA 3DUFB 3E9EA 2XIJA 3N59A 2IZ0A 4C4OA 1NOKA 2JJQA 4H1UA 3ZZNA 2QMQA 4X24A 1KYTA 2D3WA 4YNBA 2VEDA 1YA4A 3QJ5A 2G0AA 4R1PA 1PQ4A 3TOVA 4DW8A 4EO7A 4IJVA 4M9ZA 2FPLA 1RZRA 5MN4A 2GAAA 2OXTA 5AK5A 1BDJA 4L22A 1S02A 3O8OA 3QBTA 1L4UA 2YJTD 3ZBTA 3DBHB 2B6HA 3CLUD 1PR5A 4UTZA 5AVOA 1RCTE 3RARA 4E33A 3EGDB 3PYLA 4P4LA 3PEFA 4RF2A 3VISA 3UKDA 3OECA 1GSAA 2AG5A 2IEIA 4OJKA 2NP7A 2V9PA 5ITVA 1Q5PA 3ZIAD 1LEHA 4EAQA 1MW8X 3T06B 4HNGA 1PP4A 2A35A 1CNMA 1A5BB 1X9HA 4FQ7A 3EUFA 1U1IA 2HR1A 3L4EA 4OKIA 1MB0A 5ELLA 3KPVA 2DH5A 3P9ZA 2G1PA 3ELUA 2PYIA 2ZE5A 1R0KA 1N7HA 3I6QA 4RMJA 1FPMA 1R5NA 1GL7A 2NWQA 3O38A 3LLCA 1JA1A 5AI5A 5B57C 2OFXA 5BVHA 1V71A 2WJAA 3K32A 1D5WA 2VG8A 1W6RA 3OIDA 3SP1A 2XOKD 3BQMB 4JT4A 1OUMA 4MV7A 4EY3A 4OA5A 1P5RA 3P2IA 3E2PA 1TJ5A 2EJVA 2DHRA 3D8BA 5G3YA 1GNSA 1VL5A 2VHQA 3IBTA 4OGFA 5ALWA 5F12A 2QWXA 3FDXA 1PG0A 5DNCA 3N58A 1NF3A 2JH3A 2MSWA 2UU9B 5GONB 3GQVA 1NQWA 5A4MS 3WAGA 2X13A 3HUTA 3OOJA 3GLQA 3EG9B 4R9SA 2H0QA 2QTHA 2G0TA 2V1UA 4UATA 1JEYA 3LYLA 1LK7A 2F1RA 2HJGA 3MJSA 2Z6UA 1ISIA 1PFGA 2H9IA 2XUDA 4LSGA 3R7WB 4PX3A 2HM7A 1NPTO 2ANBA 2GPBA 2JFXA 5TRTA 2VF8A 4DVJA 1DT3A 4UAUA 1T0HB 4GGMX 4DXHA 3BEOA 1WA5A 3W4IA 2Q28A 3G68A 2D3TA 4CG1A 2PL3A 5K0CA 2FP4A 3VNAA 4JLNA 3WZLA 4W1PA 1QCZA 1FFYA 3E4DA 5BMVF 2AYZA 2YVAA 2UVQA 4IQ8A 4KLZA 1B8OA 2IEGA 1EWYA 3SQMA 2H18A 4R7ZA 5DJ5A 2B94A 4S1NA 4UHHA 4WAUA 2AX3A 1KMCA 1YR9A 5K3DA 1TAQA 3ENKA 3Q9SA 3IUSA 1GTG1 5EEGA 5B53A 4XAQA 2WSLA 2XKAA 4F92B 5DGTA 3WWPA 1SEVA 5LMNB 5EIHA 2DY0A 1L5YA 2BFBB 3JAKB 1S2IA 3QELB 2NQ8A 1P19A 3N8HA 4UEOA 5I9LA 3OLQA 4EW1A 2PRIA 1LY1A 1X1CA 5HQ3A 4CJXA 4D9MA 1MEEA 3PQ5A 1EFAA 3ZXYA 2KB0A 3DTNA 4OREX 5FF9A 2QX8A 4KR3A 3A05A 3C4QA 3W6UA 2I66A 4IIUA 5AUPB 2CUTA 2ZIXB 5KQLA 3A14A 4IFTA 5F1PA 1U4NA 9ABPA 4NQRA 3CVUA 1UZAA 2VP0A 1QRAA 3IPCA 3NM4A 3CN7A 3OQ1A 4HG2A 4A8JA 4C0HA 1WMFA 5FUBA 3S2GA 1Z56C 2ZITA 1MB2A 1DBSA 4HDMA 2XNSA 4ZAZA 4EEZA 3ZLVA 4N76A 4A0SA 1DADA 4I9FA 4QPZA 1ZG3A 4C22A 1OTYA 3COJA 1LF5A 2ST1A 3GZNB 2QGFA 1M2OB 4JLJA 1ZN2A 2X9VA 3P20A 4G3XA 4F72A 4R84A 3HN2A 4XKJA 4A5SA 1WVGA 4QXOA 1I6KA 4S24A 3EDMA 3KK0A 3PC6A 2EJBA 3N87A 5H80A 4S05A 3KZXA 4RLQA 2V45A 2FPXA 4YYZA 2O7RA 3FWHA 5EPUA 1CYDA 2YIJA 3WYDA 2WBLC 1FZTA 1NW9B 1USIA 2OXCA 3AY3A 1JYSA 4MNTA 3FCEA 3U7IA 4DC9A 3DMDA 2FUNB 1XFDA 1SVSA 1QVRA 2QP3A 3FCYA 3E48A 3QHQA 4IMRA 4U7GA 3VZDA 1HXHA 4NENB 2G5PA 3GT0A 4HVAA 3VSBA 4UOEA 9GPBA 2NMVA 1SKQA 2Y0EA 4P36A 3WZ2A 2A5FA 3L4KA 3A9WA 3TUIC 4DCCA 2WKSA 1DSSG 3NOVA 1Q57A 2ZFUA 2O7VA 4OUDA 1SRQA 1DKUA 1Z4IA 2F64A 4B48A 5AJUA 4A2PA 5JCOC 4OHUA 3DXZA 1FUIA 4Q1CA 1FRZA 3ZQJA 3DVLA 2RI0A 4JCOA 1XK6A 2YBDA 3IQXA 4QAQA 4DCSA 2QLBA 3V3TA 5C1BA 2FP3A 5FNVB 1BD3A 3PFCA 4FNGA 1L7AA 1X2EA 1Z4MA 5AM1A 3PA6A 4FWBA 1SCKA 3F2VA 5TV2A 2ZM5A 4W8GA 1GPLA 1HEIA 4JJAA 4C2UA 2JFVA 1NN1A 3L49A 3HV0A 3SBEA 3KD2A 5DSTA 2O8FB 1T2EA 3FDFA 3UCXA 1FVXA 4HDNA 3UG7A 1DUIA 2B99A 1Y5RA 1S2OA 4MKHA 4PR0A 1G9SA 4OAPA 3BGOS 3ZQUA 4WRRA 1BGWA 2YL2A 4WZZA 3DFUA 3H2IA 2O2HA 3KUCA 1Z07A 3NV7A 5C4MA 2TECE 2QD1A 3GLGE 5IW8A 1XZDA 3VH2A 3KQKA 4JL6A 3WNDA 2HRRA 1AHIA 4RELA 3M5WA 4CT5A 2P9JA 4YEDA 4LDRA 2XRZA 1ZVJA 1H6BA 3GYGA 4OKSA 3UGQA 2E85A 3QPAA 4N82A 3IV9A 4CFYA 3M9WA 3M6IA 1JHOA 1P1BA 2VNJA 4MKRA 3F8WA 1U0OC 2Q8QA 4A8TA 5TR9A 3FGPA 4GU5A 3NRBA 2DHQA 3EVAA 1QH8A 4FR2A 5TQ0A 2YWEA 1E9FA 1LDEA 1J8FA 1QF7A 3CXRA 1UJNA 1KZ4A 3FSEA 3FG9A 4ZALA 4JEMA 4D7AA 2EERA 5LA6A 2LBPA 4KYVA 3MTQA 3VR3D 2Q7XA 2FPUA 1JPVA 3V8VA 5M2QA 2PZJA 4TLEA 3ZDAA 3NDPA 1XLVA 2NN3C 4QODA 4X6UA 5IK2A 3AZOA 1JFRA 1XO1A 1E3SA 1CUWA 2OUIA 3K2BA 3K4PA 2CWDA 4IIEA 4M0DA 3SQWA 1HOXA 2CF5A 2H1IA 3E5NA 2ODNA 3DXYA 4WINA 4BNFA 3UKJA 8ABPA 2C7OA 3BXGA 4QXAA 1MQ8B 3BQNB 1NIJA 3KJZA 1QFZA 1GOTA 2PSJA 1A3CA 2J7PA 3CSUA 4JGIA 5DX0A 4J1TC 1YS4A 4D6YA 1QLHA 2QPOA 4QDUA 4TRRA 5ECWA 4M9RA 3RGWS 4GC9A 4RE6A 4IOJA 1VLHA 1DRKA 1EGMB 3V3KA 3HYLA 2BT4A 1NVVR 3VHXA 3P2YA 4P35A 1J2UA 1E3QA 3L2OB 1XTTA 1P4RA 3UMFA 1XQ6A 3SF8A 5C5EA 2FPPA 1JBQA 1LCIA 1NQVA 1M5TA 4JELA 3OU7A 3T0GA 3W7BA 2BMFA 4TXNA 4YQEA 4ZJZA 2XUKA 4PPYA 2ANCA 1MOZA 1AE1A 4LV8B 3ZY5A 4G1CA 3Q9NA 3W6NA 1M1XB 4KJXA 4CIAA 1Q0QA 1OAOA 3MELA 4GL4A 4KITB 3V2GA 4JQZA 3ODPA 4JVMA 3KJFA 5BW6B 3RSZA 4NSNA 3LPMA 3AETA 3EGCA 3RVJA 4P4SB 1R4MB 4RTSA 3SF0A 4KGVA 5C8ZA 5A9TA 4DARA 1YAHA 4L9WA 3FMPB 2Q5HA 4U7FA 1DWOA 4KXYA 4S1WA 4I4TF 4F4JA 4RQTA 1E2DA 4WA7A 4IIJF 1MGOA 1XCGB 2H1CA 4JL8A 5JC8A 2WSBA 4LMAA 3G13A 3S55A 3FHTA 1Z39A 4UKDA 2QRPA 1CR2A 4OJQA 2I3ZA 5LLTA 4NZYA 4CQMB 2Q4EA 2RFLA 1FE8A 2GJAA 2QKYA 3M4NA 3MAGA 1RLOA 4NBNA 5K3AA 4AKIA 1CUJA 1GZ7A 3OFND 1QKIA 2HI0A 4BKQA 4KQ2A 4ZCMA 2A9FA 1X80A 1UXJA 2BM9A 2YRXA 5EJIA 3RK1A 3RO7A 3VH1A 4A03A 1E18A 4KDFA 1FJXA 1UK7A 4HWPA 2FR0A 5ICCA 1B3RA 3WLMA 1ISJA 3RS0A 4DA0A 1DGQA 3B9BA 2OZEA 3EC7A 3PHJA 3QU7A 4ISCA 1QH1A 3PI7A 2ZT7A 4RABA 4FM9A 5EIFA 3GLGA 4BU1A 1KRWA 3VVLA 1ZR4A 5K3OA 1DU4A 2W22A 5KX5A 1U2GC 4AROA 3GFBA 3PHHA 1TYBE 2AW5A 2O57A 3LY5A 2JB9A 3HDVA 1DAGA 3B12A 3FDJA 2R8RA 4UD6A 2NACA 2W4IA 2PGDA 2HEIA 1RXUA 4PO8A 1ONNA 1PK9A 1UWCA 2POQX 3KPYA 3WKBA 5FEUA 5A0FA 5J4VA 4MPPA 1SUCA 5AK0A 4O33A 3THOA 4I4CA 5BYKA 4O25A 1E6KA 1TJ4A 4YJFB 3E22B 5ICFA 2X8BA 1PS8A 2Z58A 3NKFA 1YUNA 4YX9A 4Q7EA 1FFXA 1N8NA 3TK1A 2IHZA 1IN5A 4ZGBA 1VKJA 1KH1A 2CDBA 2QVXX 2ZJYA 4XUEA 1L0BA 1YOVB 2Y6UA 3HR8A 3QVKA 1NXTA 3ZNPA 4CUZA 3KKKA 3QRWA 2R0QC 4QUGA 2YKGA 1H4VB 1EYZA 3GRAA 2WG1A 3IFSA 4LFAB 3IR5A 2WWTA 1D7OA 5DE3A 2LCFA 4PG6A 4P6VF 3PHLA 3JX9A 3PNKA 2QTFA 4H3VA 3RWOA 4CG2A 5ICMA 4AW9A 3CEPB 4Q9AA 5HKLA 2GHIA 2XV1A 3GQBB 1XL1A 4ND6A 4E88A 3AY6A 1L7EA 3HY4A 3KQTA 5G02A 3WMGA 4XPIB 5IH7A 4NYJR 1IDN1 2OZVA 5J2UF 3BH0A 3H05A 1SBCA 1NN3A 1GKLA 1CXZA 1XPJA 1YU9A 2A3RA 2NADA 3EGXA 3OZSA 4M36A 4PS1A 8LDHA 4TLMB 3WNQA 3RG2A 1GUZA 2PT5A 3ZWVA 1Z17A 4C2BA 3EGWA 5BY2A 2COEA 1XF1A 5FTMA 4Q7QA 4QNMA 2YWJA 4G1BA 3CB2A 1DARA 3H87A 4BP1A 1NVWQ 3ETHA 2TS1A 5B4TA 2PRJA 1FUUA 5IKMA 4PFKA 1OF1A 1BJKA 1OV4A 2CJFA 1GCIA 2OZPA 1EK2A 2EKBA 3R3XA 2YY7A 2OBNA 3V8PA 1MJNA 5HE8A 2IE0A 3AR3A 4FZJA 1SQ5A 1C3OB 1R0BA 3OCVA 5LD2B 1QV9A 2DFDA 3QW4B 4XIYA 5JQWA 4I6GA 1DP4A 2J3JA 4HCJA 4QU5A 4YV2A 4HVCA 4FZRA 1NVMB 3FOCA 4GMGA 4KE6A 3EXFB 5HQJA 1UFOA 3GFFA 5IUJC 3SWWA 4BFYA 5FO0A 4JOCA 2COKA 4IGIA 5IANA 1YZQA 3B1XA 2QXTA 1H1TA 2FX2A 5BSFA 1HYQA 1V1RB 3UNXA 5LSAA 2ZUTA 1VI2A 4JXJA 3X44A 3A10A 1GVNB 2ZS9A 1FRNA 1G21A 1GVHA 2A59A 4Q4LA 5T64A 3VMMA 2C5FA 3NWJA 1O7JA 3OLCX 4UUMA 4QNRA 2C88A 5IJ9B 1CY1A 1HI9A 3PP8A 3IMKA 4KN6A 4F4IA 1BRTA 4XXHA 3CJTA 2VKQA 3HCNA 5F1YA 4M38A 1DIRA 3AI3A 4ZHQA 3ZS9A 3JYLA 5EG5A 3B5IA 3GNQA 2V6GA 3U37A 1VA4A 1DDOA 2MU1A 3EZ2A 4EO4A 4FZ5A 2A9OA 1JW9B 1TO6A 1YGYA 3BX1A 2H5IA 3CVJA 3N8IA 3QJGA 1HZZA 1XMPA 5KQSA 5LP6B 2YR0A 4ZARA 3ZHYA 2FLKA 3KZNA 3JWJA 1PG2A 4XR9A 3I12A 3TXYA 2VOJA 4RTMA 1SBTA 3LFUA 4BQIA 4R3NA 2VTEA 2AOWA 3RTDA 3RHZA 1BX0A 3D2CA 1IBMB 1NYLA 2W4QA 3B78A 1AHPA 2AXNA 4J0IA 3W8NA 4RLHA 4TT3D 2NZJA 4ZTZB 3C7AA 2UYYA 3P0HA 1O03A 3TTWA 4R16A 1TCBA 1GR1A 5IN4A 5ENDA 4A23A 3WRXA 1UPXA 2JD0A 3KOYA 4MIKA 3PEVA 5BV7A 4HNAA 2JH9A 2PBRA 1LQTA 4F93B 3S81A 4YONB 1M5UA 3R3SA 3ZNOA 2WKQA 3CRZA 5JHHB 5CFPA 1FSGA 3JQ6A 5EIEA 4L4RA 5CFMA 1VHWA 4HDRB 2JIMA 2Q6VA 4GPZA 3OWXA 2IF0A 1EZZA 5D7NA 1Q2XA 4D3FA 5J47A 2CK3D 1K9VF 1FOEB 3DOCA 4UREA 4OI0A 4Q02A 1YQEA 4MAAA 4Z49A 2FPGB 3BDIA 3QX7A 1X1BA 2GNOA 4ILKA 3W8FA 1JZTA 4I36A 3SYRA 4IEFB 2GF0A 4MQ6A 3X1KA 1FQKA 3R7BA 5LYJF 3TG2A 1SUIA 2BM8A 1SKYE 1UZLA 2N0SA 3NGXA 3UENA 3VJMA 1WDMA 2IY8A 3IVAA 2HYDA 4D3YA 4QBTA 2BFDA 4KUEA 1HK7A 4I0WB 2ZUFA 2R6CA 3DLPX 1NLYA 3U17A 1HRKA 5FTLA 2QIPA 3QEOA 1GKKA 3WLLA 3HMKA 5KEIA 5FL3A 4INPA 2ATEA 5F2EA 2HUNA 4S35A 3TW8A 5LUBA 3TZKA 2XSZD 3UF0A 1V4VA 3AC0A 5HP4A 2NTYC 4E0BA 4JI5B 5JPDA 4A8JC 2B4TO 1SVWA 5C1DA 1RKUA 3C3AA 3FOEC 3MJTA 4OB7A 4XFDA 7ADHA 2SCUB 3R9XB 4N3BA 1FUYB 1KJ9A 3VBCA 2WHRA 4UOQA 4L9AA 4E2FA 3DHVA 5B55A 4DV6B 4CNBA 3L7IA 4ZQCB 4LCBA 2KSQA 4PYRA 1XTBA 3CF2A 8GPBA 5K20A 1LJ8A 2IGBA 2JIZD 3NTXA 2YVKA 5AKJA 5JAOA 5JJBA 5LOVB 3I42A 3G9QA 1JMKC 1IQPA 3AZPA 4FB5A 4KO2S 5BWCA 3GEMA 5H9WA 2C59A 1WVMA 2GD1O 2YMMA 1NOJA 3KAJA 4KX5A 2BEVB 3WISA 1Z28A 2PN1A 4KK3A 3QU5A 4IOLA 4MQMA 4ZAXA 4YXFA 3KXKA 4O0LA 2FWBA 2W5UA 2BFOA 4UBMA 3H2BA 1OKKD 4RQBA 521PA 4LRUA 5IYZF 2D1TA 1KO7A 5GQSA 1WY7A 3T4EA 1S3IA 3KVRA 4CQLB 3UXYA 1RBZA 4GMKA 4O4IB 3EMDA 1E94E 1CIPA 1JWAB 1MOPA 1SHTX 1WCYA 2LVBA 2ZJ4A 3PPYA 3K8YA 4I66A 4RL6A 1JDZA 2PSSA 4Q3OA 5I4BA 2PGNA 2B7BA 2IYTA 5DHQA 1XE3A 2ZRNA 1VGRA 4BNHA 2GASA 4OXQA 2VK1A 4Q1EA 1HSOA 1J25A 1Z8NA 2VAXA 2ZJ3A 4QL3A 4CLRB 1QHYA 2F9FA 2H4FA 1VI5A 1UFQA 2IITA 4QFBA 1Z82A 4KLRA 1IWOA 2JGKA 3OCZA 2F59A 4TYYA 1DOZA 3BTSA 3HHPA 2XYGA 3NC0C 1DKOA 1XHFA 4GBMA 4QPDA 4JDUA 3EASA 3NKVA 3C15C 1ZOSA 1N1MA 1HT2E 1W7AA 1UBLS 4F4HA 4FXOA 3GRRA 1V3VA 3HB5X 4NBLA 2QS9A 2XCRB 4DV4B 1TQ2A 1S8NA 1R9GA 4IIVA 2Z2ZA 1CF2O 1Z9BA 1ECPA 2R1VA 3AYXB 4WFQA 4NWIA 4BZWA 2FY8A 4RTLA 4HEHA 2ZK7A 4HPXB 4LQ4A 5EJ7A 1IVNA 1KYZA 3V8QA 1ZK1A 1XXHB 1PT8A 1GNVA 2XBMA 2VT3A 4IJ6A 2C9DA 3P4YA 4K9KA 1RNLA 4YAUA 4A91A 4DUGA 3LMKA 1HH4A 3FBWA 1VJ1A 3NNDA 5CW1A 3TLJA 1HBJA 1DCFA 2PMKA 3I04M 1RDFA 1P4SA 1PK7A 2Q6KA 4Z4CA 1CE8B 2VS1A 2W83A 4NCXA 1SCNE 4UCQA 2FPKA 4WZBA 1L5OA 1WNFA 4PSCA 1JDBB 1DQPA 4TVBA 3A6PC 3H2ZA 2Y05A 2F8MA 1EVEA 4JSYA 1EESA 3T35A 2MCFA 1YMUA 1CDOA 2BD0A 3GLFB 2ZT6A 2NW6A 2VJMA 3ND9A 1S2DA 1THGA 1DAIA 2C20A 2H1RA 1AGYA 2OMEA 3OSUA 4JEHA 4WX2B 5DIFA 1IVYA 4F3YA 3T1OA 1BHO1 1XZEA 3SC2B 4A5OA 1CLEA 1TD1A 3CA8A 4FI3C 4NZPA 2QN6A 4OL0A 1TF7A 3FNFA 4Z7QB 2P5UA 2YC2C 5CDTA 2O2JA 1AK1A 1NNSA 4BO9A 2F00A 1E2KA 5E2BA 2AX4A 2W58A 3TIVA 2N9UA 2WMDA 4Y2VA 1XPOA 4KSBA 1PLJA 4JLDA 5FR1A 3NUQA 3V33A 1CNEA 4LF6B 2P6NA 2MYUA 3R3HA 3Q3IA 4Y2XA 5DHFA 1DIGA 1S0UA 3D7NA 4K86A 4KMRA 4N5NA 3ZU4A 2CL0X 1AQUA 3A11A 1TKBA 2I2AA 4DDTA 5KIAA 4WBSA 4CMIB 4Y1GA 3GX1A 1FJHA 1PD1A 4RKFA 3QEAZ 3MBIA 4KMSA 5E7QA 2G7ZA 5JXWA 3Q3JB 2Q4DA 5CNKA 3HRKA 2CUNA 2R65A 3I2KA 4HXEB 3QA3E 3QWAA 1UMCA 2OFPA 1TMGE 5HYVA 3SZLA 4ZRNA 3TFWA 1RWMA 4UFNA 4XWYA 5LB4A 1GD1O 1NBME 2Q2WA 4R8VA 5J59A 5ARBA 5JTUA 2DSNA 3KYIB 4YIHA 3E0QA 4R3UC 1PX2A 4JR1A 4MCHA 3WB9A 1J5EB 2FGKA 3DZBA 1OAOC 2X42A 4RJJA 4Z9BA 3V9AA 3W5AA 4G8JA 4NV0A 1KVRA 2JKVA 2WJYA 4HWGA 4B7ZA 5JVDF 4Z54A 1VG9B 2P79A 3WFJA 2F55A 2CYBA 3BF7A 4MEAA 3B5EA 2OP0A 3KKPA 5C1PA 3REGA 2AFVA 3CLTC 4JX8A 3RFFA 3RRBA 4LGCA 3X2FA 4BP3A 2XJ4A 4CF5A 1U0FA 2HSDA 1PNQA 2VHYA 3PFHA 1COWD 4OP1A 4YMWA 1J0CA 3AVVA 3W2FA 2VP3A 1AUOA 1E1QD 4KQGA 2QAIA 3SQOA 1B8PA 2PMWB 3NP7A 4B83A 1WHSA 2IS1A 3PFFA 1T9HA 4TWRA 1K63A 1SXJD 2NV2B 3DMHA 3OC6A 4WY8A 3RJ9A 1A76A 3JCZA 3LDGA 1JLRA 4RF3A 1L4BA 4RF4A 3EG5A 3VSEA 3QHAA 2PAFA 4YH1A 3CNNA 4OQ4A 4D26A 3CS3A 3JQEA 3ZWAA 1Q83A 2UKDA 3GP3A 4IX9A 5T3UA 5KB3A 2PUDA 4KBGA 4KQFA 4KV7A 4D0LB 1KXZA 3KEFA 3PGMA 5F35A 1VE3A 3LUHA 4UUPA 1HG1A 4QEDA 1U5CA 3KSRA 3NNNA 121PA 2VCEA 4WLVA 2X7JA 2AXQA 2NPIA 2MSDB 4U63A 5JG7A 3DZJA 5E9QA 1PYGA 2CXXA 2QL6A 3MWLA 2FPIB 4UTPA 1EXWA 4NCHA 1P6QA 2EIXA 4L51A 4Q15A 4DA7A 4NV1A 4B4UA 1P39A 1M1ZA 3CU5A 2BM0A 3GP5A 2ZWIA 3HFJA 1DX9A 3BFKA 2Y68A 4YWHA 4B6EA 3DPUA 1Y9DA 2QDKA 3KZOA 3IIMA 1QHSA 3ET5A 1S2NA 4FJ1A 1S7GA 4XWGA 2QQ0A 4YI3A 4UXHA 2X3YA 4R8LA 3JVEA 4X45A 1NM5A 2WAXA 3SOPA 1M2VA 1EP1B 3PHIA 1X7DA 4G5XA 1W6UA 1YBVA 3LUAA 3A0UA 2HAEA 1K68A 3OM0A 2XXJA 4ZI7B 2IY9A 5TXGA 3ASYA 4X92A 2FW6A 4L7VA 1LPAB 4L76A 3AUFA 5IX8A 4MVJH 1BDIA 3FFBA 1EWRA 2GXUA 4RHFA 5JS1A 4AG3A 6PFKA 2DWUA 3GAAA 1E2JA 3LJKA 3WYEA 4OMFG 4YPOA 3TDKA 3DJFA 4EP1A 3SYMA 3CCCA 1JE0A 4D0SA 1GGNA 2EEPA 3LNCA 4RS3A 3HA3A 4BEVA 5JZ9A 5KDOA 4JJ7A 4QSHA 1DAHA 3BB4A 2HHJA 4CG3A 4TM7A 4LF4B 1EUZA 1QGDA 1EGHA 3GBSA 4EX7A 2CL5A 5G3ZA 4DAOA 1ST2A 1FFBA 1PDVA 3A4YA 3FKSA 3FZGA 4N6GA 4WJZA 3TKAA 1L7RA 4Q66C 5FAKA 2ZANA 3MGGA 1XZIA 1SQSA 2XD4A 3CEJA 3D1VA 3VI4B 1BDHA 4WKPA 5FX2A 1Q7RA 4S0XA 5CGQB 3ER6A 4WLUA 2E37A 2YYYA 5BT9A 2Z83A 4YRPA 4EQZA 5K03A 5KSZA 1CYEA 5FL7A 3Q98A 2QD3A 2D6FA 1QZZA 2NM0A 2DUUA 3IGFA 3QEMA 3KHUA 1NBMA 1HEYA 4IVPA 4JBXA 3RODA 4FJ0A 1NAIA 3A9VA 2IYUA 4GXNA 3SXPA 3T4XA 5IT9A 2F43B 3AQ4A 1Y4AE 1D5CA 3N6RA 4KAFA 4RK1A 3AIMA 2WD8A 3BCRA 5FWYB 1SC9A 4UXJA 3UA4A 6REQB 5CURA 1AJEA 4IEEA 2V4UA 1QHFA 3AILA 3W3AD 5BRJA 1AB6A 4L8LA 3SHQA 3KKQA 3K09A 4YJHB 2OV4A 3ZIDA 2ODQA 3FYTA 3E7PA 4BZPA 3UV3A 4YRJA 1F9EA 1GG5A 2CHFA 2O48X 4JYBA 3EIWA 3H3FA 3LP5A 4EJFA 1UP6A 2BCJQ 2J07A 1G17A 2C9MA 4PHTA 4I08A 3FJ1A 4RHTA 1BG6A 4OSPA 4OJMX 4TYPA 4D97A 1Z45A 5IXJA 4B2PA 4OBXA 3RAEC 1EHIA 2ZR7A 1NXVA 2A5YB 1ZCBA 4JJKA 4RAOA 3K4QA 5BOVA 4BGEA 1WF6A 1H4SA 4K9DA 4HJXA 5B6JA 3KV1A 1JWLA 2XQFA 4B3DA 3ZJYA 3RYIB 4UOZA 1DC6A 3IEKA 3OFKA 5EI5A 4DCUA 1JU3A 3N2EA 3ZIUA 4TKZA 1HZZC 1R7RA 4ITUA 2QRNA 1FDOA 1U4SA 3BRCA 3IHLA 2I2CA 2PCJA 4WE3A 2R8ZA 5AOVA 3QOFA 4LV6A 1K4YA 4P8RA 1CUYA 2PX5A 3JVIA 2XT9A 4E08A 1N9GA 4GOKA 4KU4A 1F0KA 4ZT3A 4AM8A 3QXJA 4L85A 4YCJA 2A0XA 1EK5A 5KOJB 2C00A 4FMDF 4AJ1A 5LDHA 1T9GS 4KLCA 3R76A 2HSGA 2D8MA 1VCOA 4BNMA 1KMQA 1KXJA 3RANA 2H11A 1AZTA 4M8NE 1X87A 3BE5A 3WRXC 1G3QA 4WK4B 3OESA 4C4ZA 4OLFA 1PHPA 1OXKB 1MD9A 3DG9A 4IHJF 4N6OA 3QVTA 3HY6A 2QM3A 1PFVA 4UE6A 1UXIA 2OLJA 5AOAA 3NGMA 1K27A 2H4XA 3T3GA 4EECA 4PCAA 3LQQA 3ILYA 1VSTA 1VIMA 3PUHA 5HKKD 2Z4SA 3UK6A 2I7CA 3ZE0B 5D1HA 4F97A 4L8YA 2VUHB 2A94A 1ENZA 1G1MA 3V8BA 2WU3A 4D5GA 3O1LA 5HF8A 4YR7A 3RFVA 2CEKA 4TPKA 3VH3A 5A06A 5IDWA 3OUUA 4Q4HA 2DHDA 2IOYA 2ZYRA 4WJLA 2BYTA 3UWOA 4CUJA 4IYJA 3ONFA 1LJLA 1SBNE 1DG1G 1C9JA 421PA 4AULA 3LCUA 1L5SA 3FDIA 5CFRA 3KR9A 1MA0A 3WKAA 1UBFA 1YQDA 4MUJA 3V6LA 4EG5A 1KEPA 2HNBA 5ITZB 5FBQB 2ZJ7A 1XMJA 5C1OA 2OG2A 3JQQA 1EAMA 3KXIA 4NICA 1ZINA 3MWYW 5DK4A 4EFDA 2NV6A 1Q2UA 2RBGA 4CGYA 1QRTA 4H6XA 5J2TA 2O1WA 2GD2A 2VK4A 3DOFA 3OETA 3B6EA 4EABA 3K8OE 5EWLA 3GIWA 3Q7PA 1LI7A 4MIYA 5ECYA 1JDUA 2QZPA 1B23P 1N7GA 1LI4A 2K6GA 5SY4A 2O2EA 5KNBD 4ZOLA 5B3JA 1F1BA 1V1MA 4PIMA 4FGUA 3D4OA 1LZLA 4JSTA 4DGQA 3M4YA 3NHJA 4G41A 5IC6A 3JQAA 1K8QA 1SU4A 2XJ9A 3MNFA 5CB6A 1EG2A 1U1FA 3L8EA 3OIGA 4D6PA 3CSDA 1AO0A 2J9FA 3TDMA 3K4HA 1T5OA 2GFHA 4BQFA 1J2RA 1SC3A 2QMHA 4OI4A 3VR6A 4BASA 4DZRA 3T7DA 1V39A 3AI1A 1PVDA 2ZSBA 1N2IA 1KQ3A 1JNXX 1IL0A 1VHLA 4HEA6 4ZHQB 4O4JF 3L0DA 2GA8A 1RRPA 4P54A 4RS4A 4HTFA 2ZAGA 3IO5A 1YO6A 2D7JA 3DXXA 1JTEA 3SZUA 1MG0A 2AZ4A 3THWA 1PV2A 3TB6A 4PHGA 1ZSVA 1IUPA 2IYNA 4IW3B 1M2OA 4XQ0A 3ORQA 3RSQA 4REMA 4EA9A 1Z2OX 3X1JA 1HR0B 3UTDA 1BXRA 3CZ9A 3LWZA 4URHA 5DXJA 5JBNA 1Q1QA 4P84A 5IF3A 3VV2A 4ALKA 4URWR 4EG0A 1YR7A 4Z8YA 4UBJA 3R9IA 3RBAA 1IB0A 1NBHA 3HXQA 1KK0A 5TJHA 5AK3A 1ZMRA 1LC3A 2GJ9A 4KPUB 1DAMA 1PF7E 1S2MA 2D5AA 2HMTA 4YRBA 1E3IA 1NBIA 3CGGA 1W0JA 2W2TA 1KI3A 2DGDA 2HTEA 5ESRA 5CU7A 3G2HA 3V1NA 2VK2A 3KZKA 4DADA 2JC3A 4XLZA 2XZTA 2FQWA 5GJVC 2LDXA 3FNBA 3TG8A 1K0FA 3VGJA 5FEMA 5KTRA 1CR0A 4K3UA 2FFBA 4K0RA 3SYNA 3EY9A 3T15A 5KWJA 1P60A 5C8XA 1UJ6A 3A1DA 4C3UA 1VDZA 1E4OA 2XNJA 3FZYA 4M54A 1XRQA 4ND1A 4NVRA 4CKEB 4EKNB 2DQKA 3BK1A 4V2UA 3TO5A 5FNVA 5BMVB 5EJ5A 2RK3A 4UUQA 5DGCA 1GEEA 1FSFA 3N3AC 3FTEA 1Z2EA 1ZH4A 3ETNA 2OQ2A 4RHXA 4DFDA 1PS9A 6NULA 3PXGA 1HA3A 2YHBA 1ZL0A 1NXSA 4Z0NA 1QQBA 3AG5A 2O8FA 4HWRA 4E32A 3R0XA 4MVJE 2Z98A 2ZBPA 3L06A 2UYHA 1SWVA 3HCRA 4ZVRA 4WN3A 3PBKA 4FNMA 5DI9A 3C74A 3QLJA 4TL8A 1ESZA 1TYCA 1L5KA 4KACA 3V7UA 1Q1BA 1QFXA 1OGJA 3OZGA 1GAQA 1XZJA 1WZEA 2HPHA 3QUBA 2QSYA 4L72A 1P1FA 1R6DA 1G5TA 2C8LA 3QBJA 4EQ6A 4YAKA 1Z5NA 3JAMA 1A9YA 4ZXPA 3WGNA 2Q0SA 2CMKA 3INNA 1A2QA 3EBOA 2BZ1A 3F3MA 3QLEA 2QLFA 1PVVA 1OI2A 1XD9A 1T1JA 1X92A 1US8A 4ON9A 3R5TA 3R8CA 4BQRA 2AEMA 3C3MA 1CJUC 3C70A 1SBQA 2B61A 3WGIA 4BAGA 3PTLA 4KFSA 5TNXA 3ZKWB 2CZQA 3QLVA 4YFYA 3R5KA 1JHXA 3KQSA 4NZOA 1U6JA 3P2EA 4YDHB 1XWWA 4RIEA 1T9KA 1RXVA 4IR7A 1XSEA 1KE1A 4WW0A 1JQDA 1U1GA 3PGJA 4PFJA 4Z4EA 4KQXA 3ABZA 2VWQA 5JH7F 4KN5A 1XTJA 4O5AA 4AP6A 1QJCA 3UMVA 2WD7B 2J3QA 3PT5A 1KH2A 4L7QA 4V0SA 4C08A 5JISA 3AWDA 3QMMA 1Q7EA 1YR2A 2XNDD 4D0GA 1TU4A 4RTPA 3MBOA 3OCYA 1OYWA 3HB9A 4GWGA 1I51A 2EJUA 1X7XA 1QGUA 3IAUA 1PL6A 3N70A 2XX3A 1VKRA 4MRPA 5D6NA 3SC3A 1NNUA 2R3SA 3EXIB 2UV8A 4OK6A 5K51A 3TZCA 5BOSA 2HLDA 1IULA 1O0SA 1N9ZA 4LRXA 1TA4A 5AI0A 3E8MA 1KZ6A 3MRSA 2HGZA 2J30A 5H7XA 4KWEA 2ZKIA 2NXEA 2R8YA 5JE8A 5TT1A 4EJSA 2PR2A 3OX3A 4NU8X 5DGIA 2P67A 1N2JA 3DR5A 2XLCA 4E3ZA 2DC1A 4QELA 1T2UA 5L3QA 3DVAB 2Q4OA 4RJTA 3TQTA 2I2BA 3EVDA 5AJHA 1HNZB 3F49S 1V6CA 1DRJA 1GR0A 1N8KA 2PS9A 2VJDA 3GT7A 2FH5B 3PEYA 1OR8A 1RQ7A 1O97D 3L1HA 3RAPR 2Q1YA 1H6DA 1II0A 2XW6A 3HS3A 3IT1A 4BY9E 1TAGA 3D6JA 2HREA 4GP7A 3DNMA 3LPLA 3JSAA 4JYMA 4CIYA 3F7MA 4LDZA 4RANA 3VC3A 3IEPA 1X77A 4M0LA 5JYBA 1YS1X 2RONA 4LRTB 4C5BA 1FMFA 4JVSB 1ORHA 1XTIA 1OA1A 3L1IA 2EFDB 2QGNA 1QYIA 3QVXA 2DQZA 3BXZA 1YT5A 5EJ2A 4DLUA 4F38A 3VXKA 2BEKA 3BHMA 4YJ2A 3E18A 4MVCA 4CLEA 4EVQA 4HQ6A 4HEA1 1A8SA 1ODJA 3FYCA 5EC8A 1KYIA 1CZKA 4XM1A 4Z2YA 2RGEA 4J7CA 5DN9A 5F7ZA 1ISHA 1LFDB 2ZR9A 3HWSA 4QZVA 4G97A 4BMSA 4YCSA 2B9VA 2DPHA 4FCCA 4HS4A 4UJ3A 1JVBA 1WPXA 3OP1A 5HE9A 4DWOA 3N8NA 4DYVA 7AT1A 2AUNA 5DP2A 3OD1A 4DCMA 2TMKA 5E4TA 1NM5C 1IHDA 4FOSA 5HMMA 2IS2A 1Q21A 3BGSA 4FGKA 3CINA 4A82A 4CM9A 1ZEMA 1NE7A 1W9HA 4EJ0A 5FBHA 1HDGO 2GDJA 4N7JA 1UP4A 3SSOA 3NV9A 4AU1A 1MKYA 1ZISA 4YRIA 7MDHA 1XEWX 2BMVA 1M7BA 1UXOA 1D07A 2GHQA 1Z83A 4MQEB 5BQFA 1VRWA 5BYBA 1BXGB 1MA3A 1TD9A 1U8UA 1YQWA 4BVEA 4GMFA 4KWIA 4LJ8A 1X1DA 1RQXA 2ZIVB 2ZS7A 4QGFA 4YP5A 2X86A 2VDPB 1SOMA 3MF4A 4E5SA 5JD6A 4EMUA 2JLZA 3W9BA 4KFCA 4JI2B 4M1TA 3DL7A 1X0VA 4G5RA 2MHCA 3PFNA 4PQRA 3CNOA 1HQCA 1UC8A 1T6BY 5FFMA 5FTNA 1MH1A 3LZ6A 5BWOA 2J0SA 2WFAA 5CB4F 4ZTUB 4TYQA 5KI6A 4L4SA 3SFTA 5C52B 1H0SA 2B78A 1Z3IX 2W6JD