3LX4A

Stepwise [fefe]-hydrogenase h-cluster assembly revealed in the structure of hyda(deltaefg)
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
426
structure length
407
Chain Sequence
b'LSHVQQALAELAKPKDDPTRKHVCVQVAPAVRVAIAETLGLAPGATTPKQLAEGLRRLGFDEVFDTLFGADLTIMEEGSELLHRLTEHLEAEPLPMFTSCCPGWIAMLEKSYPDLIPYVSSCKSPQMMLAAMVKSYLAEKKGIAPKDMVMVSIMPCTRKQSEADRDWFCVDTLRQLDHVITTVELGNIFKERGINLAELPEGEWDNPMGVGSGAGVLFGTTGGVMEAALRTAYELFTGTPLPRLSLSEVRGMDGIKETNITMVPAPGSKFEELLKHRAAGPLAWDGGAGFTSEDGRGGITLRVAVANGLGNAKKLITKMQAGEAKYDFVEIMACPAGCVGGGGQPRSTDKAITQKRQAALYNLDEKSTLRRSHENPSIRELYDTYLGEPLGHKAHELLHTHYVAGGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fe-hydrogenase
publication title Stepwise [FeFe]-hydrogenase H-cluster assembly revealed in the structure of HydA(DeltaEFG).
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Oxidoreductase
total genus 142
structure length 407
sequence length 426
chains with identical sequence B
ec nomenclature ec 1.18.99.1: Transferred entry: 1.12.7.2.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02256 Fe_hyd_SSU Iron hydrogenase small subunit
A PF02906 Fe_hyd_lg_C Iron only hydrogenase large subunit, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lx4A01
3.40.950.20 Alpha Beta 3-Layer(aba) Sandwich Fe-only Hydrogenase (Larger Subunit); Chain L, domain 3 Fe-only Hydrogenase (Larger Subunit); Chain L, domain 3 3lx4A02
2N0SA 1HFEL 4R0VA 3LX4A
chains in the Genus database with same CATH superfamily
2XVYA 2C0PA 4TS9A 3ZJTA 1GGKA 3MMZA 4GD3Q 4EX6A 2Z9CA 3E9ZA 1K6MA 2HDHA 4UUNA 5F35A 4I4TF 4O5AA 4L3OA 2XNDD 2VAXA 2ZYUX 3PPIA 5D1NA 2GK4A 1DC8A 2JFUA 4BHTA 1YUMA 3HO8A 3TW8B 3K2BA 1LUAA 1NI4B 4GSKA 1QHHB 3L1UA 4N7MA 4V2IA 4ZI7F 3QE0A 3HU5A 2BGLA 3OZGA 4BDTA 2K7FA 1ZN9A 1FJ2A 1DKRA 1MX5A 1LWNA 3GEDA 1AKVA 2XXBA 1DJNA 2E5LB 5IJ9A 1VKZA 2ZJ4A 4XCQA 2NM0A 3F8WA 4ZDWA 3TM4A 4D96A 1TJ5A 3MJFA 4NLLA 3ZZUA 2OTCA 1KZYC 1SUFA 1P4GA 3E84A 3QYPA 3K73O 2JI8A 3ESAA 4Z3KA 1Y8ZA 3G3EA 4QAJA 5BSEA 1SY7A 1WZ2A 3HB7A 1JP7A 3QH4A 5TVKA 3BICA 4E22A 1TVEA 2AQKA 3GQBB 5U4QA 2CB0A 4RGVA 1V6SA 4IGEA 2WF6A 1R6TA 1R4MB 4GBGA 4FW9A 4CKCA 3FVQA 5EZYF 4BGVA 4R7TA 4D79A 2JDIA 2YZ2A 3G88A 1F2VA 2R87A 3BEDA 4F2DA 2EJUA 3Q2KA 3Q9LA 4DLNA 4D3FA 3CZCA 3B1ZA 3BK7A 4HQOA 4G5XA 3TQIA 4EFLA 2WSBA 3PUJA 4AJ2A 4IP0A 4FYKA 1GADO 3VYRB 1LJUA 3BB4A 5PNTA 1IM2A 1Z4NA 3KWFA 5DP1A 2R86A 4Q4HB 4KR9A 3N76A 4TT3A 5AW9A 2ZI3A 1ZLXA 4S1VA 5K0TA 4ZOBA 1VYHA 1R6DA 3GLUA 3S7TA 1NVVR 3ZE8A 7YASA 2YJGA 3OCZA 1XTJA 4U5XA 4GM0A 3TO5A 3MWYW 5CT9A 3WK7A 2PQ6A 4IIJA 4L9RA 1WXEA 1T2VA 1WPQA 2Z58A 3ED5A 1ZNYA 3MUNA 4I9FA 3ETLA 5H1YA 5C7LO 3VR6D 1WEKA 4LRYA 4Y7DA 3W9YA 2DWCA 4HRVA 1I3NA 3JAWA 3PL5A 4D4HA 1ZIYA 1DDOA 1YE8A 4TLCA 3RKRA 2IHUA 4CFYA 2A0WA 2D7DA 2GLXA 2IPNA 5THKA 5AUNB 4YV0A 1ILEA 4QBHA 3GBPA 4DT1B 4Q00A 3GVXA 1PZFA 1N7JA 3KSZO 5HKKA 3R8CA 1YB1A 2OVFA 3NKVA 1DFHA 4UQOA 1ZOIA 2O1XA 3GLQA 4MI9A 2H2HA 2ZEJA 1SCKA 1JJVA 1SAYA 1Q15A 4IS2A 4ARVA 4R8VA 2X3FA 4U7PB 1SBCA 3W5IA 1BA3A 2ATVA 1V5WA 1VP9A 2BFFA 2HMSA 2ORED 2VDWA 3E81A 3EJ6A 5LLSA 5K6RA 1OTHA 4WUTA 2PGDA 4LVOA 1FCJA 1YI0A 4W1SA 4QG3A 3IH5A 1YR6A 4OQMA 1HRDA 4BLQA 1NOJA 2H5LA 3CF4G 4WX2B 2OD9A 3F6CA 1Z2DA 2VK8A 3ESDA 4LHEA 3VH1A 5GTDA 2HQSA 3GLRA 4W82A 4CMHA 1CSEE 3C4VA 3O3NB 3WTBA 1X1EA 2FR8A 1OX4A 1E5VA 4O4HA 2GR9A 2CNKA 2R11A 3ETNA 2M1XA 4MR9B 3HO1A 1FVFA 1XELA 2OQIA 5M29A 4F5YA 4FB5A 4RYDA 2JAPA 3F96A 5C4GB 1P3JA 1RI1A 2C54A 3HR4A 3WX0A 2ST1A 5KDLA 5CA1F 1L9XA 2BKLA 2VUUA 1MCZA 4FVTA 5CFPA 3LKVA 3OO1A 4HFRA 4HI0E 2GRUA 2ZREA 3L9XA 4N5NA 1SH7A 4BV2A 1CF9A 3JR3A 3EDCA 1QUEA 3CXUA 1C7FA 3CYFA 4F56A 2C0CA 4LMAA 4TV9A 1P44A 3TI7A 2CVHA 4D6PA 5HQTA 5EFOA 3QX8A 2C4VA 2CV2A 1WXXA 2WNHA 1ADBA 3OKFA 4NPAA 3P9YA 4OB7A 4Q1CA 3CMMA 5EYPA 1OVGA 3J7TA 4EO7A 4CM8A 5K0CA 4DPKA 5K8JB 3O94A 2ADMA 5DMXA 1FLAA 2C9BA 2W11A 3HYLA 1YD7A 4OHWA 1T15A 1VBNA 1X70A 3CWQA 3NTXA 4AK9A 2PMCA 4MQ6A 4PF1A 1YRLA 1BEZA 5GIOE 2CJXA 4PZEA 3C3PA 1P60A 3GUCA 4EYEA 1WB9A 3HL4A 1YS1X 1IBRA 3VVMA 4PCLA 1JKXA 2Y05A 3BQ9A 1JLHA 2R79A 3UVEA 2NT4A 2OFPA 1E2BA 1W0CA 3OCUA 3O8OA 2PUFA 3LBNA 5HA5A 1P7ZA 1J8QA 1NFQA 4KHZA 4RVOA 4IOKA 4ZDJA 2RJNA 1W7AA 1EFVA 1GN9A 3GLHE 3PXGA 1W0JA 3WK8A 4PLFA 3T7IA 1MIOB 3FUXA 3AFHA 5A7HA 3UMBA 2PRYA 3ER6A 3ZDDA 4J76A 3TLAA 1UJ6A 2WVGA 3NTRA 3CIOA 3D64A 5B7QA 4FIDA 4TXMA 1NXPA 3DUFB 3IUSA 3B52X 4EP1A 1YRAA 2O1SA 3ZBTA 1VI6A 3WRXA 4Q3LA 3HVJA 3SHFA 4K7JA 4Q1FA 4WCFB 2WYHA 3FR7A 3IUNA 4DSUA 2IH5A 1P2VA 1MFZA 3FE2A 4WZBB 2WFLB 4EGFA 3M4ZA 4DR4B 1GAEO 4FHEA 1CFJA 3KKQA 4HAXA 3HXKA 4QBTA 2C4KA 2RHOA 2QVXX 3ZE9A 4EJMA 4ZV4A 1CUEA 1JEDA 2AD5A 1ABEA 2Z43A 1CUCA 2G63A 3FYCA 4CMEA 1HQKA 1AX9A 4H0FA 1DBQA 1WNFA 1IL0A 2GZSA 2NQ2C 5C3UA 2ATEA 4UCQA 1E2EA 5H3CA 1AQJA 3S1AA 2NPFA 4X54A 3U4AA 4HMPA 1MG0A 2UUAB 1FYEA 1L4EA 4G41A 4DCPA 1OHHD 2E2WA 1VKOA 3T38A 1T3LA 4Z9BA 2VDPB 3SIWA 3S5JA 5GAJA 5IZCA 4YAUA 3OZRA 3Q2OA 4ZGWA 3SIPA 5K3EA 5DP2A 3RUEA 2GTIA 3UJAA 4QDXA 3C15C 1P5FA 2YR0A 2H7VA 4FGSA 3IKMB 1TUBB 3EGWA 2J3DA 2JC3A 3BXEA 3AU9A 1R5BA 2IYQA 3GY0A 3O21A 4HPWA 5DX8A 1E0SA 1R15A 2WLTA 1W1WA 2W9XA 1E4EA 3AR6A 4UVIA 4XM1A 2P1ZA 3EVGA 2H16A 3U17A 4ER3A 3FRHA 3PDUA 1NVBA 2P6UA 4Q05A 3ROTA 1ZFNA 2Y2VA 1SB9A 3B5EA 1NUQA 2IUTA 1BXRA 3ZCPA 3B9RA 1ORWA 5HBGA 5L8VA 4Z53A 2NYAA 3OT1A 1QHGA 1TC2A 1Y7TA 2B6HA 3PI7A 4Y6GB 2Z9DA 1QQTA 1XTBA 1ZSVA 4RU1A 4V0ME 2NTNA 3BJZA 2VSXA 5ECYA 4CLOB 1R50A 1S3SA 2ZW9A 4QPJC 3W5HA 1A8HA 4I9NA 3ZY4A 4DV1B 4XGQA 4HJRA 4ZT2A 5KO2A 1MW8X 3T1HB 4GI3A 1Y4UA 4Y1RA 2VJDA 3CZ4A 3LUJA 4COOA 4KITB 2PJZA 4IHJB 5A4AA 4D3XA 2PUGA 4G67A 4YRZA 1LRLA 2HK7A 3ID6C 4Z8YA 3NV7A 5C37A 5LQMA 5BVGA 4QZVA 1UXOA 1V9CA 4LZJA 1L8OA 4XB1A 4E2XA 4MS1B 1RJEA 2QPOA 5JS8A 4CIWA 5JLJA 1WMAA 2AR0A 1BMFD 1T8PA 1TZKA 4KQGA 4JT8A 2XD4A 3FH0A 1V1MA 3P0EA 4JITA 1NJGA 3FFXA 4K28A 3SDBA 1QLJA 3V00A 1JDBC 2O05A 3ITKA 5DM60 2EZ4A 1U28A 3BWBA 4IJUA 5BR8B 2FEAA 2P8JA 4Z3DA 3VC1A 2NAPA 1BXGB 1WR8A 1F3LA 3KPYA 1UK6A 2ZRJA 2H51A 4Q5IA 3O7MA 4X7RA 2OHGA 5DNVA 3ICCA 4BGEA 1QP8A 3QKSB 5TPWA 4KH1A 1FQWA 3VZSA 4FI3C 1NQOA 1UAAA 3IL2A 2HJWA 3M5CA 3W4JA 1YZTA 3NZEA 2XTAA 5E9WA 1IEXA 3LE8A 3RHFA 1KMMA 4KXMA 3U81A 2NAFA 3NKLA 4WY2A 4C6HA 1UOPA 5HF9A 4D9HA 3MWLA 5FOSA 5BWOA 3MINA 4YPVA 1K7XB 1ZIXA 3WIBA 1IUKA 1XRMA 4HRAA 1KFCB 3EZFA 2RHGB 3OPYB 2X40A 3KM0A 4WCDA 4J8PA 2C9MA 4FZ5A 5D3QA 1U8XX 3KWMA 3KJZA 1HZZC 4KB5A 4BNJA 4C0JA 3VUFA 1A4XA 3HBNA 3JYQA 4XJTA 4WHMA 3WADA 2EL7A 3G8CA 4MUHA 4BE4A 1T6BY 4ENUA 3A2LA 3COSA 5J47A 1O1YA 3A6LA 5CURA 1E59A 4P0PB 2OOSA 2P9TA 2K4MA 1UBLS 3UWDA 1VHWA 1MABB 2RSLA 3Q15C 4MR7B 3ZEIA 3E7PA 4JIMA 1KK1A 1JU3A 2VJBA 2ECQA 2GCOB 4TTTS 3D81A 1V11B 3VTZA 2VHQA 2Z08A 3U4HA 1OFGA 2I22A 5A7GA 1GVNB 2D1YA 2CV1A 2BL4A 1HETA 4FSHA 2QU8A 4ALMA 2HU8A 2D7JA 2JIOA 4EG0A 1N8SA 1PU2A 3TW8A 1BHQ1 1C8KA 2QL6A 1QHHA 2FWNA 2WHPB 2IY8A 3OI7A 4OGKA 1XNGA 4XA8A 3S68A 4B7AA 1Q0QA 4GWLA 4PTLA 4WNYA 3SNHA 4NBKA 3DMGA 4RHXA 1ESCA 5ELXA 1YDHA 3VAYA 5MN5A 3P52A 2WINI 1AK9A 4QICA 3OLCX 3SSMA 3TD6A 2ZYAA 1UIRA 3ZZ1A 2OP1A 4MO2A 2AKEA 4N47A 2NP6A 2GEUA 4CLEA 1QF7A 1Z25A 4RMNA 3CMCO 1KJQA 3HGMA 3GFGA 3GT4A 4RULA 3GQBA 1SQ0A 3B85A 5I7EA 1M8GA 2JGLA 5C4IA 4E2ZA 1JAXA 1R4MA 2LE0A 1BH6A 1ZVKA 2AMFA 2RHBA 4Z2AA 4IDHA 2QM3A 2Q1XA 5KJEA 4BWVA 1RPJA 3SYNA 1WQ3A 2I1VB 4EJSC 5CYFA 1KVRA 1NOKA 2ZIEA 1U7HA 1V9LA 2ZUWA 3IEKA 2C1XA 4MP3A 4UBKA 5CU7A 3BIFA 4KIJA 4EAAA 4C4XA 5EUBA 4OI2A 2ZOSA 3CRRA 5FDFA 5KHOC 3THOA 4A2CA 4Y2GA 1CUYA 1WOYA 2BWJA 1IY1A 1G59A 3BCRA 5B1HA 1N2IA 1OCEA 5TPZA 1V5IA 4F11A 3IP8A 4Q4HA 3ZU3A 4TL7A 1E3QA 1J1IA 4HNAA 2F3PA 2C9OA 1CJVC 2H5JA 2OSBA 5CFOA 1LDMA 2X9VA 4A2WA 1J49A 4TYPA 3PFGA 4WNIA 1Z6XA 3D4LA 4JA0A 1U8UA 3QITA 4OHOA 2L19A 4CHGA 3ICQB 5F5LA 3EIOA 3CS3A 2DUUA 3FJYA 3LT4A 4MVXA 4CI0B 2ZRLA 3L4BC 3N0XA 4FOLA 1RM4A 5DEIA 3SZGA 4N49A 3C70A 3FGNA 4N8SA 1YR7A 3P20A 1NI3A 3NV9A 4D8UA 1FZTA 3OLZA 3V6LA 2DFPA 2YNMC 3WQBA 3EVAA 4KXXA 3VDXA 4EF4A 4HN2A 1B23P 4MWZA 3RYHA 4X24A 1K2VN 1E96A 2JLCA 3Q72A 3SKXA 2WU8A 4PGHA 5H82A 5JR3A 5I7VA 4CCWA 1U99A 1OD6A 4LGCA 4XLZA 3SI7A 2XUAA 1P4JA 2OY0A 3D4PA 2FW9A 4DT1A 2QGFA 1Y8QB 4CQMD 2ODQA 1P8AA 3P97A 4OQLA 1AD2A 4P3XA 1TUGA 3GX1A 3FFBA 5K0ZA 2VLIA 3RS4A 4JU9A 4ADSG 3PF8A 3NHZA 3H4MA 2X76A 3MRVA 4GRAA 1TKCA 1HUQA 1EHIA 2AJLI 3AP2A 2JIMA 3CNLA 3EVEA 2Q3EA 3OZWA 3P2MA 4DVGA 5C1PA 5FWAA 1IK6A 1JZSA 4QA9A 3QOFA 3EQ9A 4FWBA 2BBTA 2L17A 4GUDA 3VGJA 3ZV6A 1TMKA 4P7KA 4B8ZA 3STUA 2OV8A 1VE9A 1R0YA 3AERB 1YBFA 1B73A 4KKVA 1GUYA 2PL5A 3R7NA 1PNTA 1PL8A 1ZGZA 2ERXA 1JYSA 1QRDA 2CBZA 1BFDA 3NDJA 3MBIA 2H2DA 5IULC 3ZLTA 4I2NA 2YC2C 2Q8PA 3VR0A 1R37A 3KB2A 3KQHA 1XD2B 4FLEA 4INPA 1LXCA 4MR9A 1ND6A 3FFAA 4IR7A 3TLYA 1P5RA 1NBMD 1UR5A 5FV7A 1L4GA 3CPJB 3WISA 2OE2A 1QU2A 3E48A 2TMYA 2Q4DA 4JP8A 3LT0A 4C2TA 2C7RA 3CISA 3AU8A 1R12A 4D9CA 2XEXA 5AK4A 1M3SA 3AR2A 4BL5A 4DWOA 1OF1A 3ZKAA 5LQDA 4DCCA 1RM5A 3RBXA 3T99A 1CR6A 1N8KA 4DV0B 2ZYGA 4KIFA 4NG4A 1P1FA 3IOEA 4B74A 2Y1DA 1W5TA 3WMFA 4QT4A 3IUQA 4U2EA 1UJ4A 2Y1EA 1Z63A 5CDYA 3DZGA 2BMAA 4EITA 1Y48E 1WP4A 3O31A 4LKRA 5HGJA 3TEMA 1RPNA 1KU6A 4O1HA 4HH1A 1M66A 5EP4A 1JQAA 3GEGA 5BN1A 1CYEA 3T3GA 1E77A 4XIJA 1D7OA 3LLMA 4H7JA 1FXWF 4ZPJA 3RVSA 3I1JA 1LU9A 2ZBUA 4D4JA 2J3HA 4LE0A 3RLFA 5EXXA 3K3PA 4GBED 5K2MA 3WICA 1LA2A 5A7FA 2I71A 4YCCA 1A50B 3B6JA 2FEWB 3EZ7A 5G41A 1DO8A 5IT5A 1N6OA 3KE9A 2EFGA 5CLFA 1L4LA 3RLIA 1R9JA 2TMGA 1U0JA 3G8DA 2FXVA 3HG7A 3MQ2A 1WF3A 1K1EA 3HGQA 4PPNA 3TMAA 4D9JA 5JSUA 5KX5B 1SVIA 3D3JA 1E5DA 1ZGCA 2A7XA 2I3ZA 4L16A 3UY4A 2FG5A 3MJCA 1XRQA 1MIOA 3D2AA 2B8WA 4Q12A 4ZOLB 2NU6B 2YZNA 4B5KA 1Q44A 3R3XA 2IOHA 4REMA 3RC2A 3LXUX 1CV2A 1CHDA 1GR0A 4A0QA 4DTCA 3F1LA 3I9NA 4KFTA 1L4HA 1EFTA 1Q0PA 3WNDA 4G1UC 4H7DA 4NS4A 4Y2SA 2QRJA 2CMKA 3DUFA 1ZM2A 2O2CA 3HYNA 4JVNA 4WY8A 3FR8A 1JPUA 1ID8A 5A2QA 2F59A 2Y1KA 2VTKA 3UH1A 4WCFA 2IPOA 4UE3S 3D8UA 1BQ4A 4WZBA 5A4FS 2FRDC 2ZBGA 4INJA 3RS9A 2WFLA 3H2SA 3Q7RA 4G4SP 4UZEA 3ZE2B 4XRGA 5A3JA 1DDGA 2FKAA 3ABQB 3DG9A 1Q7CA 4M99A 3F67A 3DUWA 4LXIA 4RV5A 4Q9LA 4CG2A 1ZU5A 4X3CA 1L5YA 2J5BA 4PLCA 2VCHA 1N5KA 3NGXA 5FO1A 2RC6A 3LNTA 1YZHA 1ZGGA 1V3TA 2WSMA 4HLUC 3PCTA 1CY2A 2NSDA 5B1DA 4OH7A 3LY5A 1I3MA 1RDFA 1PV1A 1VMIA 2E49A 2ID9A 3HN2A 3I52A 3ABZA 1WUJS 3E3MA 2RGRA 4UBOA 1Y33E 2J08A 3D1LA 3LNCA 2OYSA 3SP1A 2MYPA 1LBHA 3EFHA 3R5TA 5CGZA 4R5MA 4YMHA 3D6MA 4URFA 3VTAA 3U16A 2QN1A 4PR0A 4AY6A 3GJXC 4KFCA 1JMKC 2VJCA 4C0LA 3VR3A 2X6RA 3KO8A 3UKJA 4US2R 1P45A 1KI7A 3ENWA 1U0EA 3UG6A 4B83A 3ZK8A 2YS6A 4A0FA 1JX6A 3IIEA 4Z4CA 1J0XO 2CYAA 2QX9A 4LDNA 4CCAA 1BX0A 1PAUA 2HN9A 2QL7A 3GMDA 2XF2A 1IHOA 4KAXA 1QWOA 4P4NA 2WQ6A 4I08A 2A5DA 2IU6A 1TUBA 3EE6A 5JQWA 1V2HE 2QE7D 2FEMA 3ET4A 1K7SN 2FFJA 4WIAA 5M2QA 1XLVA 4U6SA 4MVJH 3W1VA 4B43A 1DV2A 2BKEA 2WR8A 3A2NA 2O0KA 3TNFA 1U2ZA 2DWPA 1GZ3A 1V8OA 1JR6A 2HQ1A 4I1UA 1KZ9A 4AF6A 1MEEA 3UAWA 3PXAA 4ZCIA 1M2WA 1JR2A 1LVUA 2I4OA 2J4FA 4QBIA 4DLXA 1M6VB 4Z4FA 4MW4A 4UPDA 2A3NA 3EMBA 4MVYA 4JQCA 4KRGA 5AICA 1SOMA 1U31A 4HB4A 4BRUA 1PEDA 2MHCA 4LJ8A 4PAWA 4A0GA 1UANA 3BT7A 4O2LA 1Z13A 2QZ9A 1FXUA 2C07A 1TT7A 5L3SA 5JCZA 3IUBA 4W7HA 3OE1A 3HCNA 4QIHA 5BNZA 3BF7A 4JP3A 3RAEC 1HZJA 1NVXQ 1H22A 3M6WA 1F2DA 3IQGX 4PG4A 3RUPA 1OFUX 2E3JA 4IHJA 4BMOB 1RXUA 1OX5A 1H4QA 4LG1A 1N7IA 4KW7A 3LU1A 4R2MA 2BKAA 5DTIA 3WZ2A 3KZMA 1UBUS 3IPXA 2CLSA 1O2DA 4NU6A 3SHVA 4A91A 2VWHA 4MS1A 3BERA 1FUIA 3SM9A 4LXUA 3KDPA 1EXMA 4K9NA 3PHBE 4UM5A 4AS3A 3ERCA 3VR5D 1LDEA 1VIAA 3OLWA 2XYVA 3UEOA 1DELA 3HXPA 2ODPA 2FR1A 2MTBA 1PDOA 2CJYA 4EPVA 4Z9FA 4JIGA 5JMTA 1WU8A 2FLWA 4IQ0A 5DW3A 1TE2A 3CRMA 5EIFA 2R8YA 1C9DB 3EC1A 3PA6A 4RPJA 2O1EA 2Q27A 2J87A 2Z5VA 5GMOA 4AM8A 1BXGA 3CEJA 5C8YA 4UBLA 5EESA 1AO3A 5FFMA 1X92A 1GPH1 4B2IA 4C6SA 2CF6A 3NWOA 4LYDA 2EZUA 5I8ZA 3K6KA 2H8KA 2YW9A 4MGYR 4AJEA 1BGXT 1Z0FA 1IM5A 3BGOS 1XLTC 3QKTA 4GMFA 5K3CA 1ZH0A 4XFKA 1HGXA 2P4HX 4RSMA 1C3VA 1QKIA 5ELMA 3TTXA 1XX6A 1PR1A 4ZMSA 1YV9A 1SIOA 1PV4A 1GLVA 1XA0A 2PIDA 3CTPA 3QOWA 4MGIR 4JLNA 1C4XA 1Z5UA 2C82A 2Y0BA 3CRZA 3VSDA 4BX8A 1J06A 4MKHA 1OROA 1NHGA 1C1DB 5L6LB 1YS9A 2VA9A 1E3SA 4TMYA 3H2IA 1TJ3A 2M9MA 4ZAXA 4EMBA 5HZMA 1LB1B 1FLDA 1G8PA 2H4JA 2WJYA 4PSDA 1QHYA 1KJ9A 3QXJA 1SXJD 1VA5A 3K94A 4M1TA 1Q1ZA 4TRNA 1N9GB 1RYBA 1Y8CA 4YUVA 3ZNOA 2VRCD 4DDWA 1I7LA 3BE6A 3LWZA 1EA7A 2O8NA 1U0GA 3IJ5A 3FKSD 5EKUA 4AMUA 4X93A 3OZBA 3WJ2A 2F8SA 1FNCA 2POCA 1MABA 1CJCA 1XJ0A 1EIZA 1XT6A 4MR7A 2Q4RA 1IG0A 2J3MA 3KD3A 3U9SA 1RXWA 3RNOA 1JG4A 2RFLA 1P0QA 2B4RO 3O93A 4JT9A 4R8LA 1JIIA 5JWHA 2GCOA 2HU2A 1NATA 1V11A 3KQTA 2NVWA 2XQFA 5G0VA 1HLGA 3T0GA 3WNVA 1DLJA 4IH1A 4RCZA 3RSFA 4EJFA 1E9SA 2VYVA 3VVBA 3ZGOA 2QL9A 1LTKA 5K09A 4HX5A 5EP1A 3CLUC 3ROMA 4GQBA 1K6XA 4QOEA 3TIFA 1TKAA 2JVIA 3HTXA 1M7GA 1UKEA 3P0FA 1CFZA 5CDGA 3L82B 2J8ZA 1U9IC 2ESRA 3ZGZA 2OCIA 1QBGA 2VYNA 2WHPA 2QRGA 3HA7A 4QRDA 2NNLD 1JKJB 3LZDA 1RWMA 2HQOA 2DPMA 4RL6A 3UANA 4K2HA 1YR9A 3L02A 5HFNA 4BFYA 3RS3A 2EEZA 2ZUCA 3SE7A 1DC6A 1MJFA 2VHXA 4JC4A 3BKXA 4UPVA 3NHRA 2HLNA 2ZE8A 2LDBA 2PMWB 5AMXA 5AVJA 1LLCA 4CDGA 2W6IA 4A6DA 2XYQA 1Q0HA 2J31A 4UZSA 2FSGA 3E5MA 4L4XA 4NK5A 3CTMA 1YHNA 5AXBA 3D7NA 1O54A 2E4YA 2HHHB 2BGUA 3GI1A 1KI9A 3L8ZA 4R2JA 2JFZA 1PJQA 2D2EA 4JNKA 4FNGA 4NCKA 4IMRA 5EXPA 4UVGA 4Z6KA 4M83A 2WF7A 5C8DA 1H23A 1V37A 3MCVA 2UVQA 1GGEA 2ILVA 4CT0A 1APBA 4DA4A 1DO0A 3GJYA 1KI3A 4KI0A 2IYUA 1KP3A 3F5SA 2BPOA 4R1QA 4YHBA 4N3AA 1AKQA 2OB1A 3JWHA 3NNDA 2NSHA 2ODEA 1KO4A 4LA4A 1IWOA 4MRAA 4IIGA 5IG2A 3CONA 1FRZA 3L7LA 3MM4A 2BFOA 4ZIRB 5BSUA 2YXDA 5E0KB 4F4FA 4ND2A 3EC2A 1Z5WA 3R4VA 5IM4A 5CNKA 3ZBQA 4EL0A 1Z8DA 2VRBA 3A1FA 5JCOC 5CFRA 2IZ7A 3HUFA 1VCHA 4XVRA 1RQRA 3R7FA 2FCAA 4DDMA 4YP1A 4OBWA 1FNBA 3UNXA 4RXTA 2VDQB 4PLYA 4M8SA 1QBKC 2CXPA 4ZEVA 1GYPA 4UMEA 1K98A 4LMBA 1NXTA 1DC7A 1P91A 3BH7A 3NCTA 1CUHA 5E38A 5L3RA 1MO3A 1IJKA 3SMQA 5HJ7A 3RAFC 3B1WA 1UDXA 2AL7A 1DCKA 1DS6A 4D0GA 1MTOA 1IRXA 1XMXA 1ATZA 4EYSA 3EPJA 2OBBA 2HNKA 4GR9A 4JB2A 3GLHB 4HZGA 4NJEB 4PBRA 4WVLA 4F3CA 1G66A 2WK1A 3FZQA 1AN9A 1M2OB 1YQTA 2Y66A 4B7XA 4NYJR 3TRIA 3PXEA 5CVTA 4EGJA 2H1LA 4PGAA 1VBMA 1Y8QA 5HKLA 2DQYA 1F1BA 3DL7A 3GB9A 4E15A 4M53A 4NZOA 3U0VA 4CIDA 3HA2A 3FMGA 3GP5A 3QXGA 4CIVA 2R00C 4YWJA 5IVIA 3VU9A 1T9CA 4C0KA 3ND8A 4PR3A 2PJRA 3MS7A 3SLGA 3GVHA 3ITNA 4KWHA 3WJ7A 4MGHA 4RDXA 1A5TA 2AQIA 2B4AA 1AKMA 3AERA 5ALOA 2IDJA 5DSZA 2NSJA 2YXBA 3BE8A 4KAFA 3L0SA 3FI0A 3FSGA 1KF0A 3OX1A 2CXHA 4YP5A 3N2GB 4DREA 2XMQA 3NHJA 1NP7A 4MZXA 2HJ9A 2NZXA 4ZO6A 5AKIA 3R0QA 3WGOA 5FL3A 4JBIA 4M55A 5JAHA 4OIMA 1V7PC 3U3ZA 1X1AA 2HIAA 2YHIB 2X5NA 3LUGA 5F52A 5FI0B 4KAAA 2IEZA 4ROSA 3EN0A 2EW8A 5E4JA 2CVPA 6CHYA 1JSXA 1VLVA 1XTSA 1F0YA 3C7TA 3GWGA 1M2NA 4HQLA 1FX0B 1SQ5A 2WKPA 3ETJA 1PDWA 3QTTA 4JYCA 4D1YA 1KDYA 3GPBA 3RF7A 1X8JA 4W8GA 5J2TF 4Y30A 5K2OA 1YB4A 3KXLA 4OHUA 4XSHA 4Q3NA 5CH8A 2WTBA 3NJ4A 3WGVA 1WMBA 3AF5A 1LKZA 3LYLA 1HDEA 4MQMA 2R2AA 4MUGA 4OXYA 3G82C 4YCAA 1RYZA 1WCXA 2RI6A 1IK4A 2WPDA 4I1YA 1E4VA 2AW5A 4YQEA 3S5UA 1JR3A 3T1NA 3TFOA 3LL4A 1ZIDA 1SRRA 1XTPA 1GTG1 2ZTUA 3BWVA 3GDWA 1MAHA 2EAUA 5GVSA 1VYVA 4LWQA 1I4LD 1XZPA 4I5DA 4JI3B 2TS1A 3BPSA 1N5DA 2NZVG 4L50A 4NCHA 1GPUA 3ZU4A 4MV3A 1XRJA 1LFAA 3GDHA 2QK4A 2QZSA 5CW1A 3WL4A 3O73A 1Q11A 4XEHA 1QIIA 3DOUA 2BT4A 2WJZB 3RBZA 1U3DA 2ZBVA 2P3LA 2VPWA 1XPUA 4NHEA 3UJCA 5K7SA 5L6MB 2C2WA 3F2VA 4ZMBA 4YHHB 2Q6TA 4UEOA 2OUKA 2AB0A 3A0RB 2QRVB 1FIUA 4UFPA 4ZCSA 4CNBA 4LDZA 1BXKA 4PG7A 4QELA 1K4MA 5KX5A 5DNEA 3LKDA 3O1JC 4L6CA 2QD3A 2H0AA 3FHJA 4QJ3A 1SVKA 2OORC 1J33A 1FP4B 1Y89A 3KR9A 3QLJA 4TMXA 5G1NA 3BDVA 4ZOLA 3VV2A 2IXDA 2NU6A 5H8WA 1IUNA 4B1FA 3VQTA 3W8FA 2R8ZA 2BFEB 4RBNA 4G5SA 4I55F 1B7GO 1T4BA 1H66A 2AMYA 3DVAB 3P5BA 1F12A 2XUDA 5CLIA 3X3HA 6Q21A 3PX2A 2J7KA 3CNEA 3A3PA 1ETHA 3QVMA 5AJWA 3TZQA 4LSMA 4IH9A 4C20A 1C8VB 4NV0A 1A9ZA 2RGAA 2GYUA 1WKVA 4KYTA 4Q3KA 2VQ3A 3ZYZA 4P5DA 3Q3CA 1NJFA 1L0BA 1VHTA 1QFJA 3AVTA 1XXHE 1Z7YA 3D59A 4GXRA 2WVAA 2WP8J 4MJXA 1ZRNA 2X23A 3EB9A 4LGYA 4E09A 2CUZA 2HO4A 4DHWA 1Q3KA 1SPXA 2HF8A 1R4NB 2XTMA 1TO2E 1QUFA 5U4XA 3SOZA 4D92A 1NYQA 1VJ0A 4DCUA 5IFLA 5IS2A 2G7MC 1Q1BA 4QGGA 3V8BA 4RADA 1KEWA 1UPFA 2N1MA 2PYDA 1TF2A 1FFAA 2ZYSA 3EVCA 3PUZA 2KBFA 4DQVA 1B6SA 3N07A 2PJUA 1C41A 3NHAA 4GPAA 1Y6JA 3UYLA 5JHGB 1MFPA 1JHXA 3LC2O 3BFJA 1QWSA 4LYHA 2DLNA 1WG8A 2AFHE 2JFFA 4PG5A 4EHDA 5IF9A 4R05A 4BY9E 1JEYB 2ZYTX 3LPDA 3BILA 2ZB4A 2GM3A 4WT7A 3IHWA 4XWKA 2WV9A 4QT0A 3ED1A 3WA7A 2IF2A 1UJBA 2IYYA 1OV6A 2D1FA 5EJ4A 4PX5A 1UK8A 3OIYA 3UAZA 2A67A 2NN3C 1BFUA 3I5XA 1BG6A 1GKUB 1E6KA 4MEAA 3ANTA 1IBCA 1K9SA 1Z0UA 2FF7A 1T6YA 2QLJA 4R2IA 5FA5A 3HS3A 5DGCA 3P5SA 4DC9A 1M6VA 5KJFA 2BKUA 3BAFA 4G8BA 4EW1A 3GFFA 1JJ7A 1FZQA 3PXUA 4LXQA 4UKDA 5EHIA 5JPDA 4BRWA 1QK3A 4AZ0B 1VCMA 4KVGA 4ZI3A 1J99A 2O19A 1NVKA 1HT2E 2GZDA 2WTAA 5ADVA 1EFAA 4C7BA 1HQCA 2JEOA 2QUIA 2M6RA 2VP5A 3MQ4A 4WWHA 2PCLA 1EH5A 3PNKA 3LKBA 1L1RA 3PG5A 1JDSA 2WICA 4PGMA 1W44A 2FRVA 4MEJA 1VC2A 2HYIC 1Q21A 1DZ3A 2GJ9A 3B12A 2IYRA 3IQEA 3S6JA 1B8OA 1IHYA 1PBNA 5DLQC 2J5QA 1G5PA 3DPSA 5ALEA 3E7WA 1JQLB 5FOWA 4PHHA 1W48A 2IDMA 2C59A 1VKHA 1X0VA 1KEEB 2AFIE 3M83A 3RQIA 1QFMA 2EJWA 2QLBA 4HG2A 4BYMA 4Y9UA 4MW2A 2P9GA 3K09A 2MWMA 3RF6A 5H9VA 2R6R1 2A88A 4FUTA 3TQCA 1Q2UA 1GCGA 1CEQA 1HRKA 3WAGA 3VPCA 4YCNA 3OOJA 2FV8A 1ZOPA 1BOFA 1DBIA 2AG6A 1C5KA 2QS9A 4ZPXA 2FEXA 4A8JC 2GCEA 2OR3A 2XSZD 3I9FA 4CFZA 1B14A 2ZRHA 3C3YA 3R6WA 5HZGA 1HNXB 1SHZA 1CQIB 1DB3A 2F1OA 3A27A 4NE7A 4A7PA 1BRMA 4OJMX 5IAGA 4N7BA 3RIXA 2C92A 2QQFA 3G2JA 4XZ3A 3RJ5A 5GADl 2XWQA 1Z82A 1LRJA 5EGNA 2Y0PA 4S0XA 4Z0PA 4HTAA 5KYKA 1IU9A 2Q4TA 4KO2S 1J56A 1OI3A 3L93A 4Z4HA 1DOZA 2C95A 3FTEA 4PSAA 3WL3A 1T9DA 1S3FA 3TB4A 4C4OA 2BZSA 2XH8A 1C1DA 3U3JA 2XODA 1KIAA 5JAZA 1HOXA 4QBKA 1T3TA 2WHRA 3QFHA 5KTOA 1JH9A 3FPFA 4C5CA 1Z5OA 2CXQA 2VHJA 2Q3HA 4J6EA 1DFIA 4HNHA 2IQIA 5H5JA 3RJZA 3VNQA 4AKHA 4I50F 5C5CA 3AFOA 1ODTC 4Q7EA 4TTVA 3DB1A 3U31A 3VPHA 4D45A 1Q95A 4UUOA 1N9GA 3MB5A 2A1IA 3EQ2A 3K8ZA 3T7EA 4KP7A 4A8HA 1QAQA 1PX0A 2O6HA 4DEYA 1UMBB 4K9SA 4NFLA 3FPAA 4CDMA 1P6QA 4MULA 4KWCA 3WLQA 1N0WA 1RLJA 3PEWA 4L7QA 1DE0A 2LKCA 4PICA 4Y2HA 1AQYA 1DUSA 3M1IA 3JPWA 4RSHA 4LPKA 1OREA 1U0NA 3PVCA 5I6DA 4C2BA 1SXPA 3F3KA 5GONB 3OEHA 2ZM6B 1H9AA 4CR8A 2YQ5A 2XWJI 4Y1FA 2EP8A 2HPAA 2W2VA 3GUVA 2CL6X 1P2FA 4NRDA 4P2BA 4XR4A 3ST7A 3WSVA 2BM8A 2IKSA 1B93A 3VH2A 1UT8A 2PWBA 3CN7A 3QV2A 1E64A 4YDSA 4HSEA 2C4HA 3UFBA 4YUYA 2DY1A 2PT5A 1PQPA 2A84A 3WV5A 1TPZA 5TC4A 1ZJ6A 2LCQA 1JL3A 1I2CA 4LYJA 1NNSA 2NXWA 2VEDA 2QHXA 2PKXA 2FSSA 1JKJA 4KMMA 4U1RA 3KSDO 3O84A 3OPVA 3RSCA 3WIVA 4ALJA 1BVHA 3RU3A 2ZB8A 3E15A 3UTDA 5FULA 3A6KA 3EIEA 3FIUA 4FMDF 5T8KC 2WWWA 4BV9A 3B13B 2BDEA 5CVEA 2O4CA 3ZY3A 4F6RB 1G0OA 2YZ7A 4R4JA 1TIKA 5IC6A 4F4CA 3QUBA 1V6CA 1L7OA 1YCGA 4WXPA 2ZBFA 3ZQUA 1NX6A 1U3CA 5JHHB 1RRGA 5ITWA 2V74B 2Q29A 2XTZA 2R62A 1C7IA 5DYYA 1YZUA 1V8BA 2QPLA 2HUNA 1WUIS 2ZT7A 4CCYB 2GN6A 3KVNA 4GPTA 4QSMA 2ZWVA 3SKVA 4NCAA 3T41A 4PFKA 1F60A 1MV8A 1YS7A 2ZSBA 4JZKA 4OJKA 1P0FA 4Y9SA 4KPYA 1DSSG 4XAQA 3CPHA 3CVOA 3R3YA 5DGTA 1E1QA 5HJ2A 1XDGA 5KNCA 3W5DA 1EFKA 2VNHA 3NATA 3NHKA 2AOTB 1P17A 2FQ1A 4PHFA 2GM4A 4LC9A 1PJ4A 1NW3A 4ZIRA 1AGXA 2GBLC 3QLVA 4OSEA 3TTWA 4DLTA 1Q83A 1YI8A 3RFVA 2G88A 3MPUA 2XOKD 4NCBA 1SVWA 4GOND 2HJHA 3TCXB 1HZZA 3F1KA 3CGWA 3FYTA 2HJGA 4IM7A 4JKYA 4FOOA 4OQYA 5SICE 5BMVF 4PYOA 3AFNA 1W5BA 2HFKA 4JUCA 4XPIB 4F2GA 4LBYA 4PVDA 2ADFA 3RFTA 4MYCA 1GUFA 3H7IA 3SXPA 3VTKA 2HTFA 5FQOA 1P8JA 5I47A 2GHRA 3PR1A 3HYSA 2R48A 1XTTA 4X1KA 1XDUA 1RWKA 3BFVA 4AJ9A 1P39A 3HKBB 2G40A 5JS1A 2XQGA 1USGA 2MMGA 3L8GA 5BN4B 3KD2A 3RS0A 4ZYWA 4QFMA 1DIAA 3DZKA 4NJEA 5E6RB 3GLHA 1WUYA 5JCXA 4AJLA 4HGQA 3X1KA 2QPTA 1L5VA 1M2OA 2OXRA 5LUBA 2C7QA 5CRIA 3KSAC 3CUTA 3AFMA 1UFVA 1P7CA 1ZBQA 5KTRA 3NTUA 5KKAA 2FOLA 1ATIA 5IAEA 4WXHA 3ZK7A 2WDPA 1TQ4A 1LSUA 2CGEA 2A59A 2WAAA 1MO6A 3BD9A 5A0FA 5AVVA 3AEQB 4UASA 4QM6A 2I6TA 2I6FA 2BGRA 1ORHA 3G23A 4FGLA 3H9GA 5CD9A 2OLJA 3AVXA 1YKSA 4HB0A 3LGXA 3ZHBA 2PU5A 3T3NA 2D0DA 1SVSA 1X7ZB 8AT1A 1Y42X 4YCJA 4B6JA 3CZ5A 2VJOA 1LLFA 3N2GA 1QXSA 3B2EA 3DC7A 1XQXA 3WLAA 1I0ZA 3NBFA 3R6DA 3TQRA 1JW9B 3HYTA 3UK7A 4CRWB 2QB5A 1D2CA 1T9AA 1IVYA 1PT6A 2R9VA 1FQOA 4AULA 2B1RA 3CC8A 4HNRA 3RSSA 2I87A 4NDZA 4D44A 4BBAA 2EX1A 4O6VA 5E9JA 3C3BA 4IQFA 2F6RA 4CLHA 2ZAYA 3M6XA 2BCEA 1ZI6A 2JCGA 2OXTA 4NEGA 5M7EA 3Q41A 2GPNA 3SJCA 2IK8A 1C30B 3LLSA 1T2CA 1I2ZA 2F8LA 1BQ3A 1VMEA 3U9LA 4WAUA 5LP6F 4W5HA 4EVQA 1T2AA 5IBCA 3QXHA 4B2LA 3OT5A 1TX4B 1RJ9B 1RRKA 1U0LA 2CDCA 1YONA 3E3AA 3AY0A 3ZLVA 2GHTA 1KSGA 4XVCA 5JQGB 2R5NA 5HS4A 5JXIA 3T3IA 3QEBZ 2OO5C 1TEHA 2X0RA 4JA2A 3BFXA 4JHXA 4D43A 4HDMB 1LPAB 4H60A 3G59A 1T5SA 1XNJA 3A2MA 2ZYHA 3NVAA 2BISA 2OM2A 3L7MA 4C14A 3VISA 4KTVE 4O4LF 3NJRA 1O7JA 1G18A 4BP1A 2O3RA 4HS4A 3F7NA 1M9NA 3GZTB 2R5FA 2X7JA 2GK3A 4AN1A 3U3MA 2HSJA 5K99A 1YSCA 4S1OA 2XMGA 2XRMA 1MEJA 4PLGA 3SAJA 5FHRA 4CKYA 1E3TA 2QRVA 1QR6A 1OXMA 2YNMA 2IX9A 1GUZA 3IVCA 3MUEA 1VSQA 3I04M 3P9KA 4QJ4A 4MUNA 4NH4A 521PA 3WMXA 1UQTA 4B84A 4HK4A 4CPDA 3X1ZA 2IYSA 4KN6A 3ZHXA 2FZCA 1FP4A 3IP3A 5AIAA 1QGOA 8ABPA 3Q0TA 2IE0A 5KUTA 1GR1A 2D8AA 3Q6MA 4JBLA 3RVKA 4ZJPA 2O4UX 3SQDA 1V7CA 2Q5HA 2BFEA 3DYBA 4KN5A 2JEYA 3FVRA 4W1RA 4D41A 4E7PA 1GT91 3RRXA 5CDUA 2MMCA 4MUIA 1OT5A 3DVAA 5DFAA 5DNWA 2Z1MA 2VDNB 4L57A 4U9UA 1U90A 2X7HA 3CLSC 2G9NA 2XI4A 4HAVA 1XCGB 1Z0IA 2CLOB 1KDTA 1KZ7B 3PUVA 2JRLA 5FH9A 1IRIA 3DLAA 1ML4A 3KB6A 3M4JA 4TXJA 1HG0A 4Y2JA 4WGGA 3EXHB 1R18A 1ZUD1 2N47A 4O25A 4X66B 1X2EA 3UPTA 1HDXA 4IJVA 2DU8A 1JG1A 1HYBA 3GROA 3L2OB 1WSAA 1J90A 4Q34A 3ROGA 3UICA 3CVVA 3K8YA 1Z3IX 4II2A 1LVHA 1R4NA 1TTTA 3CH4B 4MV0A 4B46A 4BZWA 1IZ9A 1WS6A 4X3OA 4XB2A 3RAJA 3DLBA 3N74A 1TYEB 2FVXA 3O47A 4TWBA 1JSLA 4ON9A 5HIMA 4XGRA 5BSRA 1OYVA 4US0R 4HYEA 2FSFA 1JN0A 3ZLUA 1NQTA 2KE5A 5FT9A 4DYVA 3IEPA 2QTGA 4GVPA 1R3UA 1L7MA 2ZJ2A 3LUCA 5CJPA 5AW3A 4L9WA 5E1OA 3ODPA 2JJ1A 4BS9A 3K70C 4LXGA 2I1QA 1AHHA 4MMXB 1DG1G 2NACA 4GQAA 1JEYA 2V0GA 4BJ1A 1NI5A 4O0MA 1UXHA 1YCFA 3QWFA 5A4KA 3USCS 3IDZA 1C1XB 4IYJA 4U9IS 3WL6A 2ONYA 1XZBA 1MRSA 1EX9A 1HFKA 1PFKA 3C6QA 3QYFA 4G4SO 4L28A 5K3BA 4UC0A 3V1MA 2ISSD 1L4KA 1MQSA 1O87A 2GXSA 4EGSA 1LI7A 3OH8A 1D6MA 3W6UA 2Z2IA 4LBWA 4GMGA 4B47A 1RRFA 3DWGA 2FFAA 1LEHA 2I4MA 1I7PA 3D1VA 3LQ4A 4FBGA 5ER9A 4KXQA 2F3UA 4IWXA 5JAMA 2JASA 1TZ2A 1QH9A 2R85A 1E2DA 3F4LA 1OKKA 4AZ0A 1Z7WA 3AY6A 1RM3A 4E94A 1B15A 2HIMA 2ZUDA 2OD2A 1YR3A 2RG1A 3TQFA 1O58A 2IBSA 4EELA 3A6GA 3QU7A 3RTCA 4FC6A 3TN7A 3ZHTA 3FDFA 3M6UA 2HEGA 2J9RA 1EWKA 3F98A 4AKTA 5JW6A 1IY2A 3P32A 2DR0A 4ZVSA 3UUFA 1MTZA 2QUAA 1XXLA 2V6JA 1ODJA 4OP3A 2JD0A 2PFSA 2WF8A 4WESB 1NMXA 4KK3A 4IUDS 2I6XA 4RTSA 2VS1A 4CF7A 2LDXA 1DIGA 4YBZA 3FJOA 1HEIA 2ZYIA 4C4AA 3BXOA 4Z1MA 1A27A 4Y2TA 4BC0A 1KEEA 2G6TA 3G2MA 3H2ZA 1NVVQ 3KEQA 1NSYA 3O9VA 4OSOA 2FRDA 1AQLA 3B1XA 3ND9A 1SURA 4NIMA 1F6BA 2OCDA 4I1OA 4JCCA 3SSNA 1M0EA 2HGZA 3IO5A 1MXFA 4LOJA 4Q39A 4Q82A 5SV2A 4YV7A 1S7GA 1U2EA 3U5TA 4WL0A 1RXVA 3U1BA 1JHDA 1N8TA 3JQRA 4HLUA 4BMDA 5BY2A 1NBIA 2BEVB 4V0NA 3GCDA 1QG0A 4S2EA 1WD5A 2V4UA 3A9RA 3EVBA 1TTQB 3A1NA 3HCAA 4EGAA 5KQGA 2F4VB 1T5HX 3VKGA 3KXIA 1CQIA 2B6NA 3P96A 1WUKS 5ITVA 5DT2A 4BNWA 1GL3A 2P9FA 2PQ2A 1XL0A 2CV0A 1CF4A 3MAJA 3EULA 3ZWMA 3GU3A 5FTNA 3UAXA 1A8QA 4ASUA 3WGGA 1GPNA 4S1TA 1RBMA 1Z2PX 2OGWA 3S4YA 2JFNA 3KQVA 1DPGA 3LPLA 3PEYA 1MVOA 5HMLA 1YL5A 1ULTA 4JP5A 5JPIA 3VR6H 2QU7A 1LV7A 5DK4A 4TVSA 3DFKA 2REXB 2CSUA 1EUQA 3PL1A 4DSNA 4JSRA 2NIPA 5DBIA 3JSXA 1E2PA 1FU7A 1CLEA 3E5HA 1KK3A 1Z12A 1DDIA 1E98A 1Y6ZA 2FG7C 5E8JA 1G17A 1W96A 5G3YA 1O94C 2O48X 2C5AA 1RC0A 1SVLA 1QV9A 1NW4A 2Q45A 1K7FB 1VL1A 2PRJA 1UMBA 4U0KA 3EQ7A 1JG6A 2C1EA 1MT0A 3OEYA 2F3SA 3UK0A 1RWVA 3EVFA 3KEMA 5ED4A 3MCTA 1H1DA 3RD5A 4NCJA 5DPMA 4E03A 3RFXA 3W2GA 2EERA 5D5PA 3SU8A 5GONA 4CGZA 1U0HC 2IELA 4YP6A 2YHUA 1HG1A 5KOIA 4MW0A 1G1AA 4RPKA 4G1BA 3EFOB 3WS7A 3KKOA 2IYXA 1NVDA 4D0LB 4FFBB 1WXDA 4JJIA 4NBVA 3B6IA 4DR1B 1DBPA 1HE5A 1ZS9A 4KO8A 4LCEA 1C9YA 5E3IA 1YVDA 3IQDB 2WE8A 1L7PA 3OHMA 1GQQA 2NYRA 5K4HA 3KELA 4XWWA 2HNAA 2OBMA 1KSFX 4X8MA 4MDEA 4KE6A 1P75A 3DVSX 3RTDA 2GF2A 2IHJA 2Z95A 4DEXA 2DHEA 2G9ZA 3FHLA 3ILHA 3R9IA 4R98A 4UUAA 1NR5A 1CUBA 2XGOA 1M1ZA 2NO0A 1UKZA 1ENOA 1M7HA 3R0ZA 1OTYA 3STHA 5CB0A 2BFAA 2PRKA 2TMDA 4BKRA 4DDTA 4LOLA 3QHAA 3PE3A 1PG5A 2CNBA 3RH0A 3FSRA 1EIWA 4JXZA 1AJEA 3H8VA 4RPIA 4UVDA 4CCYA 5J5CA 4DCOA 4BQOA 3ZDCA 2J1LA 4AT1A 1CEXA 2P65A 5BWLA 3O4GA 1IHPA 4HNGA 4KVFA 3NHYA 1XLTA 4C07A 4MWSA 3R5FA 4LY3A 3MGKA 4KXLA 4Y98A 4HP8A 2PS9A 4GP6A 2YZMA 4ZYUA 4K1XA 1JLLB 1GYRA 2YMMA 4JOSA 5EMHA 1JT2A 3H6HA 2BW0A 1EFDN 4G1EB 3SOPA 3DL2A 4LIPD 2CD9A 3CNOA 3E9NA 4HX9A 4UHEA 2AOTA 4OI4A 3I30X 3EEOA 3U0BA 8ADHA 5KOJB 4PQGA 4Q9NA 4GI5A 3ONEA 3C98A 5IBRA 1EXVA 1XJQA 1WJGA 3N1UA 3O2JA 1E7RA 4GEKA 1QRTA 2WA2A 2OXIA 2GRAA 1JEOA 1I2MA 3KG2A 4XPIA 4X97A 1UZUA 3URMA 3CE6A 5A04A 3MGGA 3FYUB 2HRZA 1RMTA 5I9NA 4QNMA 3TGWA 1MH1A 4WA8A 4B45A 4PGGA 3HKBA 1DHTA 1E8NA 1A69A 2WNSA 5KHAA 3RRZA 4D9KA 2DLCX 5BN4A 3M8KA 3SQXA 2Z8XA 1ZHOA 5ALLA 3BA6A 4RPHA 3ZS8A 5BSWA 4M4SA 1D0IA 2CKDA 2YJ5A 4XYLA 5AVWA 5K0GA 2GBPA 1BJTA 5I51A 1ECGA 4N3CA 4R9NA 4F2WA 4HTFA 1O0CA 2QNRA 3Q98A 4HAZA 1PO7A 4HLNA 3TK1A 4ED9A 2DQSA 4KQXA 4BO8A 3WAJA 3LWBA 3O8RA 5IKOA 1PG2A 4N0DA 3YASA 1VLHA 4FFPA 2D0PB 2ZCVA 4G9BA 5ALKA 2VAPA 3RG8A 4H77A 1DX4A 3F0TA 3FNFA 5JOQA 4FQ8A 1G5QA 2GF0A 1RLOA 1X7ZA 1EUCA 4BB9A 4JQSA 3AVUA 1XXHB 4ML3A 1D4FA 3DKVA 3IEUA 5IFKA 1F5SA 5KNDA 1JXQA 1EBFA 2CK3D 3E9RA 2RE8A 4G09A 1J21A 4UNQA 5CX4A 2Z2KA 3NHPA 3PGLA 4KSYA 1OYOA 2PANA 4QDTA 4AZWA 3EZ9A 4B3MB 2EJCA 2WJ3A 3FETA 1EVYA 1CUGA 1XDZA 3AOGA 3HWRA 3QBTA 3VOAA 3LCRA 5FEMA 3K9GA 4L5CA 4GFDA 1NJ2A 4QO8A 1YUNA 1A8IA 1WKBA 3NHSA 3R20A 1A7UA 3ZUPA 5LDDC 3I72A 2AEFA 3ROFA 1VSTA 1C30A 1KHTA 1R00A 3BHIA 1C0KA 3D6VA 3EEFA 5JDCC 1TYAE 3DV9A 3I34X 2NU9B 5I4KA 4D9FA 3QNWA 1O3YA 1RCTE 3ZU6A 2AFHB 2AUNA 2QZPA 3OZXA 4L5AA 3FNEA 2PQ0A 2QQ0A 4HXGA 4LJSA 4QTZA 3VFDA 3C3KA 1KOJA 4R6WA 2R8XA 5C1BA 1RJ9A 2ZUSA 1AMNA 4MIOA 4MO9A 4L22A 3S7ZA 4UTNA 1KY3A 3QY0A 5JQGA 1I2AA 2HXSA 1XQ1A 4Z7OB 3LTEA 5IUNC 1NYRA 1Y0BA 4K9LA 4JYZA 3FN4A 3ZHUA 1UKCA 5LB4A 3FMPB 4Z9YA 5JCOA 1W76A 3OPMA 3O6VA 4UVHA 2JAWA 3PNBA 4F93B 4N5IX 4P08A 3IVMA 5EXSA 5G0TA 4TT8A 3QVJA 4AZTA 2O8EB 1AGYA 4U7WA 2INGX 3O74A 1Q22A 1QR2A 1T2EA 1JILA 2B30A 3GVCA 4XWGA 1N57A 1I10A 3H1TA 3ISVA 3JRWA 4N12A 1T2NA 4RFVA 3UGTA 4L0MA 2IXBA 2Q7OE 4JI5B 4I3GA 2HA4A 1HYQA 2ZG6A 1FSPA 4CM7A 1Z39A 4N0PA 5BW4A 4X1IB 1ZCBA 2FMFA 5FJJA 1NQAO 4MQLA 1SG6A 2PRIA 4E51A 1B26A 1P7WA 2ODWA 1MX9A 2YUTA 2BTQB 3F9RA 1W8DA 4PV7A 4DMCA 1R9GA 3NW9A 1GN8A 4Y6SA 1KGDA 2RJ3A 1P77A 4IHKA 4BFUA 2DFTA 3W3AD 4DV4B 2R00A 5NULA 2J3JA 4MUYA 1JJIA 4QHYA 3W05A 5KVCA 1H4SA 3HP4A 2DOKA 4AKGA 1PR6A 2OCBA 3ADDA 1GZUA 4FPXA 4H27A 3BZBA 1P4RA 3R44A 4RIGA 1Z2CA 3L7AA 4KG7A 3UBMA 3NT2A 4FLFA 3HN6A 1CUAA 3B7GA 3CUUA 5SYMA 2H2GA 4M0EA 2JLRA 4KLAA 3WDMA 4FYXA 2C4WA 3EXHA 1R6XA 3QV1A 4HLDA 5EWJB 4EKGA 1VIMA 1GUBA 1B8PA 4E1BA 3F6EX 5EVCA 4ZCLA 1M8FA 3SQOA 1DBWA 3Q3GE 4QJIA 2VK4A 1RACA 1TFUA 1W2HA 2G9QA 5CTAA 4HFNA 1YRBA 4XQ9A 4AO8A 3E0QA 5IHPA 5LMZA 3I2IA 2FYTA 1I1QB 1SK9A 4XDHA 3L8DA 5DB4A 4LVNA 4PLWA 3R23A 3IP9A 1GCAA 3VKWA 2ZJ0A 2OKCA 3ZEAA 1UZNA 3NTQA 2D2XA 2O2IA 1DX9A 3QVSA 6NULA 5J4HA 4XWTA 1TMYA 3NS7A 4Y6RA 1IN1A 2V65A 1V1RB 3IAXA 2IF0A 5DWDA 1G3QA 1W36D 4YJ3F 5ANRB 2P6RA 2FUKA 1MO5A 5JH7B 2WMOB 1I4OA 1AZSC 3NLLA 1GNRA 4EO9A 4IO0A 2GPAA 1DI0A 1QE5A 2G8LA 3QEOA 4KI7A 2UXDB 1TQDA 3IURA 3W8EA 4X62B 3IBTA 5ERGB 1KQGA 4HVAA 2J4DA 2B7CA 1SC4A 3RVBA 3HCWA 3QVKA 4B6FA 4KNYA 1S4QA 3A10A 2EBUA 4DR7B 1V7ZA 3OD5A 3LHDA 1C1XA 3M6VA 2E0IA 3I73A 3N8KA 4A5SA 1Z56C 4I8DA 4OXXA 4PXYA 1IXKA 1ZK1A 3AY7A 1JMYA 3LKZA 4JVSB 4BZZA 4DCSA 2QVGA 2YYAA 2X2FA 2RGNA 3PZBA 1SELA 3IUMA 4FMCB 3LCVB 5BYAA 2N0SA 3H2JA 4C4SA 2C2OA 1CY6A 1C0PA 3UN1A 4C4TA 1K5DA 3CINA 3LVFO 3NORA 4CG1A 5C9ZA 3HB0A 1KP9A 2NV6A 5AW5A 4DLYA 3FLBA 1DFGA 3IR5A 3E35A 1KI8A 2OAQ1 1ZD2P 1GV0A 1ZWKA 2DETA 2PSEA 4TVOA 5TLSA 2RCYA 2G1PA 4NCNA 1GNQA 4F4UA 2B21A 3WTCA 2H4ZA 2PKCA 3I0MA 1PKXA 2I7DA 4DQ0A 5BT8A 5ETJA 1O9GA 1Q91A 1Y9DA 3EIQA 1U7WA 3Q5DA 1AUPA 5FORA 4W1PA 5AI4A 3RS7A 1A9YA 1JEAA 3W2EA 1ZNWA 2XB4A 4UW9A 5EHZA 4L9AA 3SVTA 4WESA 3GXOA 4QFBA 5D7NA 1GTL1 2AN9A 3CEPB 3LDAA 3USZA 4QHTA 4WSOA 3AVVA 4KWIA 3EAQA 3ZH9B 1WABA 4RZQA 2QX6A 2XDQB 3K0EA 4LYFA 1NLFA 4UXHA 3PE6A 4G85A 4O2BF 5GJCA 5A3SA 5J4YA 5BW5A 4ICIA 3ZDFA 3EWIA 5JROA 1C8LA 4IV5A 5BQXA 3ZJVA 1ZJJA 1FQJA 4DUPA 2P0EA 4F04A 2X0JA 2HD4A 2QR5A 5LIPA 2H9AA 4WBNB 2BEVA 4QVKA 2GFHA 1J97A 4MMZB 1IVNA 4P81A 3HVUA 2AD1A 5FUWA 4NYIR 1UJMA 4YECA 4C0QC 3URKA 1DRWA 2ZR7A 4YQFA 5EIBD 1JWBB 3SFVA 2L42A 4DA8A 3HJCA 1M10A 1HBJA 1BSVA 1X7DA 4E4RA 5GINE 3PS9A 1YOVB 3A6FA 4QWWA 2G4LA 5HF8A 5BSKA 1QU3A 1KZGB 2QV0A 2C2ZA 1E0AA 1S2MA 5KNDH 2UYCA 1FP1D 3FNGA 3K70B 2CNWA 1NPYA 2PUWA 3TD2A 2FMKA 1PSWA 1Z35A 1AT1A 3B3JA 4YRLA 4LI0A 2FY8A 4WGFA 2D4AA 3UK2A 3U49A 5C1DA 5LNK1 1LV8A 3NGLA 1GQFA 1RHKA 4OFZA 1XQYA 1NPTO 4LRTB 4MRMB 5LXTF 4OLBA 1XB2A 1P4HA 1OILA 1NBOA 2B83A 1YAJA 3UJ3X 4FJ1A 1YB6A 4ER0A 1D9XA 5I48A 3C24A 5KWJA 2ZBEA 4ZZ1A 3GLTA 1N6KA 2A4MA 2YZKA 4GPZA 4OD0A 4L07A 5HOQA 5HIKA 4M0DA 3V1KA 2KWIA 5I5GA 4M60A 4Y2PA 3OLVA 4BVFA 5ILGA 1VB5A 3ANMA 5DV9A 5AOBA 2AMLA 2YOGA 4P4SB 3AH8A 1T0HB 3QVXA 1QQ6A 3RSHA 2XMSA 4MV8A 1PJSA 4C08A 4KQ1A 4N5HX 3EGXB 4QLBA 5HTKA 2A8YA 3DDZX 3TSWA 1GILA 1KS2A 4NBWA 4B7CA 1QGDA 2F00A 2R2GA 3EFOA 1RJWA 1XZIA 1QP0A 2JCSA 4FFBA 4LSWA 1XCOA 4Y0NA 5FYDA 2J32A 4ZAGA 3BDIA 4QUJA 4AX8A 5LN1A 1TQ8A 1VE3A 1JPNA 3EY9A 4I66A 4JXJA 4KACA 4KWTA 2OWDA 3ICPA 1T8TA 1G3IA 1TXGA 3NT4A 5HWSA 3C6MA 3B20A 1E18A 1A9PA 5E1MA 1P0CA 1RYYA 3BWEA 5F1KA 3VZPA 1RCUA 4ZVUA 3WL5A 1EWVA 4FFNA 4LRXA 1QTNA 1VFNA 2M2IA 1MJ5A 2PD6A 2JBHA 4H6XA 1TLFA 4QBGB 3OFND 3EFEA 2W6OA 4R7ZA 4J75A 1K06A 3KB1A 5JBIA 3TLKA 5JC8A 3ZWPA 1NZJA 1U80A 3QE4A 3F7MA 5EZ6B 5FBHA 2R8OA 4CMIB 3WOHA 1ODFA 3LY7A 4D0NA 2JZCA 5JJLA 2VOEA 3DFFA 3RTBA 2NZ2A 1QRAA 1UPCA 1B6RA 1GJRA 3C7DB 3JYLA 3ZY6A 1NRWA 1TI7A 1SOVA 1XZQA 3UJ7A 3RIYA 3LOPA 2C8JA 4QYTA 3M0EA 5LNK6 1N34B 4QDUA 4NJOA 3GEPA 2O2XA 2XDWA 4EENA 2DBVO 4GI1A 4UE6A 3FSEA 1JLLA 3OZ7A 1FMFA 2HI0A 4DNXA 2NZWA 1DQSA 2B8JA 2H07A 4BQIA 3EBOA 1FS4A 1JPJA 3UQYS 2WWTA 2VOJA 2DTXA 3DE0X 3HR7A 3LQRA 5I9IA 4IG9A 3WSTA 4QKQA 4NK4A 5KOJA 4WOPA 2H63A 3LPAA 3OZSA 5H7XA 1V71A 1H8HD 1EE9A 1Q7GA 3O91A 4INAA 2GBCA 3F97A 1GT6A 1TRHA 4R8SA 2C78A 3KKLA 3DE7X 2JFPA 3NM5A 1JKFA 4X1YB 3TRKA 3UFXB 4AF8A 5EJ8A 5A9RA 4IDQA 1UKBA 3ANSA 4FCWA 4DJDC 1QPZA 1GL6A 4L8FA 1U0SY 3FYUA 1DHRA 1WPRA 4GT1A 4DB2A 4RJ2A 2LGJA 2PV7A 4V39A 2XV1A 3F74A 2I55A 3NVDA 4AF7A 2P69A 2PA3A 3BRWD 3WFIA 3BD6A 2V7EA 4KNVA 5F3DA 4E08A 3TQHA 3JU3A 4BP8A 3IAEA 4AY5A 4G0UA 3G2PA 3U7EB 3PEUA 3AESB 3JD3A 1K6IA 3GT0A 3EWSA 3F9IA 4Y67A 2W4QA 1DADA 3KU1A 5HNKA 3HABA 1HSOA 3LQYA 4GXNA 1XN4A 4ZP1A 2PXAA 3COYA 1NBME 2IIVA 4PZPA 2C5GA 4E11A 3QMWA 3GAAA 4N6NA 2CCGA 2OZEA 1UBSB 4EKYA 1S8AA 2EARA 2W37A 4BMZA 1M2JA 1SCAA 4ZCRA 2ATXA 2CVQA 2PKWA 3T6KA 4Q3OA 2VXYA 4C01A 5FUBA 1B0UA 1SCUB 4EHNA 1GCUA 2O50A 3AR3A 2R8BA 2XVZA 3MEQA 2C8LA 2VKTA 2B4KA 1ZUWA 1IPHA 1JRLA 1O77A 1LJ8A 1D9ZA 2QVLA 2VAMA 4JMLA 5DHUA 3SFTA 1UF9A 3U2QA 5EHXA 3OX3A 1XXHA 3VR4A 3EF0A 4FN5A 4BFVA 3FM9A 5T8KA 3RK1A 2DUMA 5AO9A 3ZQ6A 2CVOA 1KH1A 3ZI4A 1BVUA 4DWJA 1PUIA 3R0IA 1FSFA 4M0LA 3OIWA 3V80A 3CUKA 4ARCA 3PLNA 1WCYA 3OAAD 1D6SA 3FTNA 5L95A 3Q1KA 1USUA 5GM2A 4U00A 3L7JA 4QWMA 3TRDA 4RS4A 5JCPA 5IVKA 4MARA 1RAEA 2FH5B 3EARA 4B40A 1UJNA 3HCBA 4DJTA 5FL7A 2HFJA 4OAQA 2YIDA 4ZEWA 3IKTA 4M7WA 1W1IA 5SZHB 5LYJF 3LGAA 1QIFA 1G5HA 2NU9A 3WGHA 4OJNA 4B35A 5FX2A 2Z6QA 1YFZA 2NLOA 1NR7A 2AFHA 2P3SA 1I4DD 2SNIE 3FUWA 4KLRA 1TLTA 1OI7A 5T57A 1P1HA 2QX7A 4CLOA 4PWZA 1LX7A 1QB8A 1L4MA 1XF1A 5B4TA 1HFEL 2DHQA 3R6LA 3OM9A 1U8EA 5AKZA 3S8YA 4P54A 2HUPA 4BIMA 3PC4A 2ECFA 2IKQA 2DYKA 2O8BB 4JQZA 3JV7A 3VRHA 1UC5B 2I1LA 1W581 3ZDBA 1F48A 3OE4A 4M0PA 1A9TA 2I4RA 3RO7A 4YASA 1ODLA 1A9QA 3M9XA 4GYJA 4RIEA 5I5EA 1HO3A 1UAYA 2WQZA 1OSNA 1P1IA 2ZJFA 1WB4A 1X94A 1XEXB 2CXUA 1O4WA 2ZUVA 4GR5A 221PA 2I4TA 2IPLA 3MJSA 2JI9A 4QOHA 4B34A 4J6FA 1Q0TA 3HJUA 1VJRA 2PLNA 2FFQA 2PBFA 3UGQA 4CI9A 1GPBA 4NBRA 4R83A 4EHAA 4OLJA 1WCV1 4Y2QA 3H1AA 4X1IA 2HBZA 1HYGA 4RIFA 3W34A 4EKNB 3O90A 3MTQA 4NNJA 1J8VA 2JCYA 1T4DA 3LCJA 2BTQA 3ZC3A 4EYOA 5KVSA 1S4MA 3DLHA 4FKMA 2I2BA 3KL2A 3DM5A 4E5VA 3CR3C 3RGWS 3H75A 3QF4B 4I7EA 5CNMA 4O4JF 2X6QA 3WGTA 2EP5A 2FFBA 3WDKA 1R1DA 1FC0A 1LPMA 1S02A 1XD9A 4L5BA 1B1AA 4XPZA 4MINA 1L8QA 4LXHA 1O5OA 3V8QA 3KB8A 4RNCA 1MT3A 3B5IA 4URVR 4D02A 2PS1A 3GH1A 3I92A 5IT9A 4L8GA 2XUIA 4HGOA 1TD9A 1E0DA 1Z18A 1D4OA 2GZ1A 3X1JA 4QHSA 4WD3A 1QYVA 2HXYA 5JASA 3HNOA 3HHPA 1S2DA 4R2KA 1FOEB 5EWJA 3SIXA 4M8LA 1RKXA 5CYOA 1CLUA 3M2PA 4GMDA 1NXWA 3WYEA 4GDFA 3H9QA 1XNQB 2BE7A 5I9LA 1N2BA 3FD8A 2E4VA 1FLVA 4MIEA 3I3SR 3L6OO 5JZSA 4ZHSA 1E3WB 5E9AA 1F0KA 1GWNA 1OWLA 3UYKA 5A3RA 4R84A 3PC2A 5B4UA 4H3VA 1C3OB 5KJCA 1H2EA 3ESRA 1SVMA 5K05A 3NBAA 4QASA 3AWDA 3H42B 3EDRA 2CT8A 2PRZA 4CV0A 4V38A 1WO8A 2NO4A 1YCDA 5B1SA 1PNVA 1J20A 2Z56A 3AHFA 3VOBA 5JH7A 1PR5A 3HCOA 2ODTX 2XF8A 3ONFA 3Q6NA 4OL0A 3DWEX 4X7PA 3SY8A 5LMNB 2OHHA 2FPWA 5BUQA 2XVMA 4YT5A 5I3ZA 1CQWA 1VG0B 2ZVPX 1FSGA 1RJGA 4ONEA 4P53A 2Y99A 4E12A 4GSYA 2PR7A 4ZQEA 4ETIA 1OBVA 1VE1A 5AVXA 4EB8A 3I37X 5L40A 2JLQA 4Q19A 4TUYB 1DTWB 1NNLA 4TV8F 1PWZA 3KV3O 4MWDA 4A23A 5CG1A 3IPAA 1KC3A 1DCFA 4P84A 2HREA 4GLOA 1FE8A 1LCIA 3KR2A 1M2GA 2V9CA 1M8PA 1LS6A 4UU8A 2C03A 5TNXA 2WKQA 1GTRA 5I3CA 3DXYA 4M9SA 4L0CA 1MJHA 4MKGA 1D7AA 5IH7A 4BWYA 1Q12A 2QVCA 2DFDA 4BASA 4CMBA 2O2ZA 3K0CC 2P4UA 4D80A 1R16A 5A1JA 3K0SA 1GDDA 4DE5A 4EJ0A 1SOWA 3EISA 3R3ZA 2EOAA 1KK2A 2PMDA 2YX1A 3H86A 4QUEA 2BMVA 4ATNA 2QGNA 4ABYA 1SUPA 1THMA 3EGIA 1D1PA 4KH0A 2RBKA 4BC1A 4KQ6A 3W5CA 1CYDA 121PA 3AXTA 2J3KA 2BI4A 2ZBQA 3MCAA 3I05A 1FUEA 5M3BA 4OI0A 2JAHA 3R3SA 4L4UA 3C87A 1CUWA 3OM0A 4N6OA 2FW1A 1R6AA 2XDQA 4YCSA 4QYWA 3DAOA 4J7AA 3DBOB 4BVJA 3CX4A 2BFBA 4L0QA 4UAUA 2NTVA 4C7XA 4EPRA 3UXMA 3R4CA 1UFOA 2W48A 2ZRFA 2LPMA 4AMBA 3MWEB 4GWKA 2QR3A 2X9LA 2RGBA 2ZRNA 3B36A 1NJ1A 4LDPA 2WWHA 3VXKA 1IQ0A 3O9MA 3PGJA 2G67A 1AB5A 4WBNA 5BUCA 1SXJE 2CZQA 1FMCA 2HSDA 3IVAA 3LLUA 5IVPA 2PFKA 4GOLD 1DGQA 1ADCA 1T9KA 5DNCA 1ADGA 3MLEA 2UYOA 4S05A 1YQWA 2H31A 2GDJA 3AV0B 1BJRE 4HWOA 5B2FA 1JHRA 4NYJQ 4ESOA 3TM5A 1MW9X 2GETA 5CHYA 2P9YA 4BP3A 3A9UA 1YOVA 3K1YA 3RUIA 4D0RA 4TYWA 2J41A 4OHFA 1G19A 2WF9A 2HDWA 1MJGA 3JR7A 2B7BA 1F6DA 4N3NA 5ER6A 2QIPA 1C80A 2WAYA 1QFXA 1KEZA 1Z07A 3IRVA 1N2GA 3PNMA 3VYTB 4NXNB 3W77A 1Q1GA 2XIQA 5J4VA 2H85A 1P33A 3EWNA 1GZSA 1QIJA 5AVKA 4LNUB 2VSQA 5EMLA 1XN1A 3CNBA 3WLEA 1HOTA 4PBTA 4DIUA 1H1LB 3RC9A 5D3ZA 4MRMA 4OLHA 4KVZA 4O1MA 1JG7A 3C1AA 2I1WA 3IKJA 4LUCA 2C4TA 1UMDB 2JDID 4MWTA 5KKNB 4KFUA 2HK9A 2ZT8A 3P2IA 4BQNA 4PYMA 1K86A 2QIOA 5JJ5A 5KYYB 1DJOA 3SZLA 4GWGA 3B3QA 4UXIA 5JG7A 3EXIB 1T3GA 5LDGA 3VM6A 3KVOA 4KO3S 2R6FA 3BG5A 3AHCA 5FLXA 2NVUB 1N3YA 5GZ1A 2EJVA 4LF9B 2VP2A 3VOSA 5FTMA 4BECA 4Y9DA 1D2NA 5DCWA 5GJBA 4P4SA 2B9EA 3QHPA 1YAHA 2X0FA 4RC9A 3LFTA 1E3EA 3O0TA 2NU7B 3UW3A 4TT3D 4RZHA 3GN1A 2QPAA 4WXRA 4YACA 1ZAYA 1ECBA 1C9JA 2YHBA 1Y3HA 2H4YA 3N2ZB 3NAQA 4MIKA 2GUGA 1Y7HA 4OF4A 3VNSA 4Q7QA 1GG5A 2Z1NA 3IIMA 2YWDA 3A25A 1NMYA 3JQGB 4AZ3B 2HCJB 5H0IA 2GZHA 5IT0A 2QMZA 2RB4A 4IZIA 2WZDA 4OYHA 4DA6A 3WFZA 5HVNA 2C5LA 1KIFA 1Y1TA 1X9IA 4JJ7A 5LPNA 3KOXA 1EDDA 1T4GA 2Y4NA 4L27A 3FRJA 4J4HA 1YQUA 4EFMA 2GCPA 1RWPA 1ZNXA 3GDGA 4HQFA 2DUNA 2ZRMA 2BFNA 5TT0A 4F1KA 1XMJA 2K7ZA 3DVLA 5CXSA 1JDZA 4DDUA 1C0EA 5HKKD 3EG5A 4NFHA 3FNQA 2DUJA 5JSFA 1JE0A 4PVCA 1RXIA 1QIDA 3DOJA 3DVRX 5I8WA 1MOQA 4CMIA 2BUAA 3FOBA 2R751 1WE2A 5GZ3A 1RHQA 2XCUA 3DT9A 2CNLA 3NTLA 1XF9A 2GHIA 2H2AA 4Z4IA 2FEPA 2BR4A 1I9CA 4F6CA 3FTFA 4WOJA 1OBOA 1PNQA 3EXG1 4AURA 2PS0A 1ZONA 1S3IA 3T5BA 3FI9A 3O95A 1XDDA 3KQQA 4EY3A 5KZMB 2FGJA 3L8CA 5BN5B 1KEKA 4AI6A 1U3WA 3WB2A 1U2QA 3DA8A 4R8RA 4X85A 5B1EA 4FCCA 4FWIB 3G8AA 1Q0RA 1YS2X 2V7WA 1YGYA 4HLCA 3THRA 4BNUA 4DM7A 2RJOA 2X1VA 1B16A 1COZA 1GKIA 4MJLA 1Z2NX 2ANCA 2JAOA 2P9EA 3GUZA 3MK31 1E89A 3STWA 4DLVA 5JLAA 4OLAA 2ZI5A 5F1OA 4D4GA 2V7XA 3C74A 2LCFA 2FDXA 5IUKC 3UFXA 4X1YA 1DUIA 2I3BA 4RCYA 4F12A 2JBWA 4M6WB 4IVNA 4J4TA 2WG2A 3SBXA 4N41A 5DSTA 5I45A 3MOGA 5HMMA 2GN4A 2X1HA 4YMGA 3WZMA 1EP2B 2G5TA 3D31A 4M98A 1Y3AA 2Z09A 1T4MA 3PQEA 2DQ4A 4XX0B 3SVZA 3PBKA 5C31A 4NZYA 3AF4A 4WQMA 1DRJA 1NVFA 1R4AA 2UAGA 5HE9A 1Z2EA 1OX6A 2IOFK 3AESA 3E8MA 3PDIB 2Y0EA 2FUG1 4FEEA 1X80B 2ID7A 3LCUA 1RCFA 2MSEB 3IX7A 3ETGA 4RZUA 4ACAA 1QE3A 3M6IA 1BMQA 1UM9A 4MS3B 3HRHA 3QKIA 4Z7QB 1Z6TA 1DVRA 3KSBC 1POWA 3ZLBA 1KAEA 2IS4A 3LD9A 2K87A 3LMKA 2FZEA 3Q7IA 4DEVA 1G38A 1E3MA 2NZJA 4NU0A 2B2CA 3K0KA 4XJSA 3B3GA 3ND7A 1SCUA 1JAZA 2A9RA 3WRYC 1B8VA 4ZHQF 1ZD1A 2WKWA 3IUEA 2W2KA 2PSSA 3GEMA 3L8FA 4Z9AA 3QFCA 1S8NA 5BQFA 4RZIA 1D5CA 2IS6A 3C39A 1K3FA 1W0JD 3EQ8A 4RDHA 4BYGA 5KYNA 4NEQA 4TXLA 2JRCA 3HRIA 2Q28A 2R65A 1SXJC 4II3A 3HJRA 4YI5A 3WY9A 1O6FA 2Y68A 3GV0A 3H5OA 4M0FA 4P4GA 4WOBA 1AKNA 5JE8A 5BMOA 1KERA 1XU7A 4LJRA 3G7UA 2M6KA 4F3YA 1P3DA 1YRWA 1FFYA 1PTJA 2PKQP 2XYGA 3IDAA 3KUCA 4B6EA 4ZK2A 2H1IA 3SYTA 2BI7A 1PD0A 2OO7A 4RUKA 2ENUA 3GR6A 1U8TA 3FHTA 1ZN7A 1FNSA 3O4VA 1HF3A 1U1FA 1YJCA 4IFEA 3B1FA 4I6GA 4MKXA 2X3UA 1HX7A 2BOVA 4B6RA 2VUHB 5FFFA 3DO6A 1EP9A 1R8QA 3BK1A 4LFCB 3LBIA 1B3BA 1J22A 2GJSA 1A2QA 3I01M 1OVMA 5DHSA 1OY1A 1DT3A 3TL2A 1E2LA 4AIIA 3AKZA 3KKKA 3L84A 1G6KA 3QYJA 3CLTD 3ZHOA 1T6XA 5H59A 2LTAA 1RQGA 1IN6A 3SHOA 1N8NA 3DR5A 4F5EA 4WDQA 4J7XA 4AG5A 2FN9A 1VGVA 3MJ4A 1VMKA 2FUG6 1ZRSA 2ZKLA 3D3QA 3I2HA 1BE8A 4AP9A 5F51A 2KM1A 2UU9B 1XEXA 2FG6C 2YYSA 1RBYA 5HIJA 2DPYA 2I6UA 5DHPA 2PEYA 4B09A 4D4IA 2IYEA 5K8CA 4H35A 4JI4B 3AVOA 5ADUS 2TYSB 5BOVA 1DU4A 1WMFA 4U5QA 2H1CA 4DG8A 3S70A 1N6LA 5JMOA 2WWFA 1U1GA 1JJAA 2E1RA 3OCCA 2GYVA 1SMKA 4CL8A 1TCUA 4LN1A 2I6SA 3EIUA 1K08A 1J70A 4Z4GA 4YRJA 5LP6C 1NY5A 2CXRA 1QK5A 2HRBA 2PNFA 1U6KA 2YQ4A 3PP8A 3C3MA 5D1HA 4DMMA 1JFFB 2JFQA 4E1VA 1KE1A 4KREA 5JVDF 2PGXA 5HIAA 1L4UA 2YYZA 3DMYA 3EYAA 3IHKA 4GDMA 2GEKA 4WI1A 1OR8A 5BQ5A 4ETMA 1TUIA 2WD8A 4XW2A 1ZJ4A 1XWWA 2XOXA 2X8JB 3LCMA 5HG0A 4YUWA 5M5BA 1BU5A 2JGIA 4HGNA 3U7QB 2D06A 2ID4A 5CA0B 1IDN1 2FP3A 3RRFA 3RT7A 3UMJA 9MHTA 3BEOA 3UUWA 2CXSA 3PC3A 2ZXEA 4J0QA 3SSAA 3LRTA 3JTMA 2XB9A 2YUIA 4UUBA 4YJ2F 4GECA 3VKUA 2EW1A 2ZPTX 3REOA 1LK5A 1N5IA 3TTYA 3QW4B 4WLFA 2GVNA 1YHZA 1G0NA 1YIDA 2W4MA 1G4HA 1NVWQ 1JDTA 3RYCB 3ZTTA 1E3WA 2ASVA 5JBQA 2VHZA 1UXGA 1CZNA 4PZZA 1C3OA 4UNIA 5C7IO 1JTVA 2WF5A 2CXOA 5CM2Z 3LUPA 5FTKA 1WCIB 1XZJA 3QFRA 2WWVD 5D01A 3UB2A 4LQDA 1I13A 4ZC1A 1PL6A 3Q8MA 1O57A 4JX9A 5JUWA 3JQFA 5FFNA 4EA9A 1MA3A 5JDCA 4FZVA 4UTOA 2P68A 4HH3C 3T9BA 3ZD6A 3CZAA 4OQXA 4A1OA 1EVZA 2H06A 1FUKA 3BGWA 3FOWA 4ZI2A 1ENPA 5FUYA 4JY7A 1Y4SA 1UODA 5B7NA 1KH3A 4KV9A 4CMCA 1H2WA 1NNUA 2QE6A 1TCVA 2O2YA 4ZYXA 2O5CA 2XNDA 1B42A 1A4IA 2R4UA 2ZJ6A 1P9RA 2BEWA 3OF2A 2WV7A 1E0JA 1QFYA 2GLTA 4GOKA 4YWHA 2HRCA 4TUYA 1DTWA 1Y63A 3OOYA 1II9A 1FU8A 2WLSA 4GXQA 5TX7A 5G2OA 1JDPA 3DTYA 1M34B 5BNFA 1OOEA 3FSJX 2VJAA 4C87A 4LF4B 4HMOA 2OAGA 2QUKA 3U5ZB 1SUAA 3ZBUA 1Y5MA 3ONNA 5ALPA 4EG6A 1A8PA 2J9GA 3NYRA 3NIBA 5J2UF 4U7GA 4FNMA 3R9WA 4OOEA 2PVSA 1ZMRA 1AQNA 5ILOA 1ZESA 2QZ4A 3CX3A 1N5RA 1Q0SA 4Y1EA 1YU9A 2RARA 4DY4A 4GICA 3BAZA 2Z5GA 1U2DC 4YRAA 4JHLA 1YA6A 3QEKA 1XE3A 1UBJS 2PS3A 4MKIA 1AXRA 3U39A 1FX1A 1O97D 2AI1A 2Q3DA 2R6AA 2P0AA 3D8NA 5EKTA 4IDPA 1I80A 1VSUA 2HDOA 3DNPA 4BBJA 4O4IF 1Z6PA 1OFIA 1W94A 4C4ZA 1LI4A 2AX4A 3BHMA 1JQBA 4MVJI 1OZAA 5JC1A 2XR1A 1FK8A 1OBHA 5G4KB 3M9WA 5BR7A 1KFEB 4Y3UA 5K1ZA 1NIPA 4L95C 5LBTA 4B31A 4HUTA 1CR0A 5KIAA 3N5CA 2PH3A 2D2FA 2ZPAA 4N9WA 3JVIA 3HSKA 3LT5A 4K6OA 3N2IA 1P62B 4GX5A 5E7MA 4G8DA 3WKAA 4PHCA 7MDHA 5JPCA 7ABPA 4AO6A 3E1GA 4RHUA 1FXWA 1FDIA 2AS0A 2ZRAA 3NBUA 4LV5B 5J43A 1SXIA 3FBWA 4C6RA 1EM8B 1WF6A 3WMEA 3GLGE 4YDRA 1L5HB 3W04A 2AC4A 3ESCA 4J94A 1NAIA 2DULA 3EA4A 4IJKA 3DGEC 4NABA 2PD4A 1CUFA 4M87A 3GD7A 4Q7MB 1XZEA 5JSYA 1QIMA 1YHYA 4G65A 3G1WA 3W7VA 3WHKA 4DCVA 1GFZA 4G0WA 1ILWA 3IDSA 3OCYA 1GZ6A 4KTTE 2OVBA 3DPIA 3R3JA 3D8SA 2IEYA 4LOIA 3P4YA 4PSVA 1JR4A 4JQYA 4K87A 4S24A 4GO1A 4V0QA 3V8EA 3GLIB 3OZVA 5B6PA 3D0OA 1GZ5A 2WB4A 3ROQA 4NSNA 4OFXA 1C2YA 1JG2A 1TF7A 2YJTD 3QQ5A 4X0EA 1I5RA 2EZ8A 3O4FA 5AUOB 2IHVA 3E27A 2YN2A 4A5OA 2VF8A 4PPYA 1IG3A 5AKJA 3FVVA 4BO9A 2OV3A 4LNUA 1PR3A 2ATCA 5JTTA 3QRWA 2CJPA 2PZAA 5TMEA 1HDRA 2G72A 1H1LA 3O75A 2VCEA 4GI7A 4JLJA 3TL3A 1Z0KA 5I4IA 1NQVA 4A26A 5JS6A 3JYOA 1O6BA 1UMDA 3VZRA 4KMRA 3SJUA 4LF6B 4L5IA 4OBXA 3HK2A 2ZJ8A 1I7DA 5DYIA 1DIBA 2FSHA 1E7WA 2HWYA 2HHJA 2FZKA 3LK7A 3T4UA 5EJ9A 2BMWA 3EXIA 4D97A 4LF7B 5J5VA 3GP8A 4ARZB 5L9AA 3AM4A 1H2RS 3MIZA 3T9EA 5FNVB 3V46A 2NVUA 3GAMA 2CBXA 3DF7A 1P4AA 3KOYA 2IYAA 3CW8X 4Z51A 2X0KA 3CCBA 5TPZD 5BXQC 1DAGA 1I7QB 4OK3A 4D74A 1DKLA 4N7JA 3BB3A 4D5GA 1BTOA 1FDVA 4P7FA 2NU7A 2O3UA 3GT3A 3IAM1 5B6JA 4R71A 2K2WA 3RBVA 5BYKA 1X9HA 3KEGA 4CM4B 4ENSA 2FPSA 1AS3A 4IOLA 4KR7A 5A9SB 4DMUB 1P81A 1WP9A 3V1TC 1DKUA 1ACLA 3JQGA 4NS1A 3R40A 1QGED 3HM2A 2QGZA 3BMXA 2B2XA 4AZ3A 4BNHA 4JJ6A 2WB2A 4JJKA 1BRTA 2OUIA 1HH4A 3TL6A 3C5EA 1KVUA 2V0CA 2X5JO 3ENKA 4D3SA 3GAFA 1SCDA 1UBOS 4TLDA 2CWWA 2XCOA 3W7BA 3V34A 4QU5A 2Q6KA 2W2XA 4S35A 1RE0A 1Z5GA 1Q1QA 1XZFA 3M9LA 4Q1VA 4BATA 4YPOA 3AVWA 1QHFA 2P6PA 1VPLA 1A5BB 3AUAA 2QW1A 2ORIA 3L07A 4CR6A 1L5GB 4C3ZA 5H3LA 5JY1A 1T0JB 1RYEA 3EH2A 4YGXB 4J90A 3AF6A 1ZZEA 2AMVA 2SICE 3UAVA 2WTNA 3R1IA 4JP1A 1JPVA 2A0YA 2H59A 4QYIB