3LX4A

Stepwise [fefe]-hydrogenase h-cluster assembly revealed in the structure of hyda(deltaefg)
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
426
structure length
407
Chain Sequence
LSHVQQALAELAKPKDDPTRKHVCVQVAPAVRVAIAETLGLAPGATTPKQLAEGLRRLGFDEVFDTLFGADLTIMEEGSELLHRLTEHLEAEPLPMFTSCCPGWIAMLEKSYPDLIPYVSSCKSPQMMLAAMVKSYLAEKKGIAPKDMVMVSIMPCTRKQSEADRDWFCVDTLRQLDHVITTVELGNIFKERGINLAELPEGEWDNPMGVGSGAGVLFGTTGGVMEAALRTAYELFTGTPLPRLSLSEVRGMDGIKETNITMVPAPGSKFEELLKHRAAGPLAWDGGAGFTSEDGRGGITLRVAVANGLGNAKKLITKMQAGEAKYDFVEIMACPAGCVGGGGQPRSTDKAITQKRQAALYNLDEKSTLRRSHENPSIRELYDTYLGEPLGHKAHELLHTHYVAGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fe-hydrogenase
publication title Stepwise [FeFe]-hydrogenase H-cluster assembly revealed in the structure of HydA(DeltaEFG).
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Oxidoreductase
total genus 142
structure length 407
sequence length 426
chains with identical sequence B
ec nomenclature ec 1.18.99.1: Transferred entry: 1.12.7.2.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02256 Fe_hyd_SSU Iron hydrogenase small subunit
A PF02906 Fe_hyd_lg_C Iron only hydrogenase large subunit, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lx4A01
3.40.950.20 Alpha Beta 3-Layer(aba) Sandwich Fe-only Hydrogenase (Larger Subunit); Chain L, domain 3 Fe-only Hydrogenase (Larger Subunit); Chain L, domain 3 3lx4A02
4R0VA 2N0SA 1HFEL 3LX4A
chains in the Genus database with same CATH superfamily
3STUA 5HOQA 1E1LA 1GZ7A 4BVFA 4YRJA 1JZQA 2R6ZA 4TWZA 3T1VA 2Z3VA 4A3SA 1QQTA 1UZUA 4FINA 2XKAA 4X62B 1FFGA 4HDRB 3THOA 3P2JA 3NHYA 1RKXA 1V5IA 1GPWB 2I2WA 4RPGA 1CS0B 1ENYA 1AS0A 2ZT6A 3ZWDA 5KWJA 2GBIA 3BMNB 2OCYC 4RPHA 1LSJA 2VZ0A 4K1LA 3D3WA 5L3QB 3M1AA 4FMDB 3UK0A 3TTWA 1B26A 1LPNA 5EQTA 5M34A 3HHPA 3L1JA 4C0JA 3F4BA 1W1IA 3ZS9A 4Q7EA 2DCUA 3AXTA 2DTDA 2R84A 2TMKA 4RETA 5AYVA 1EK5A 2ZJ1A 3SQWA 4TWBA 3U49A 5JLAA 5J2TA 4LQ4A 5FO0A 4I4TB 4ZV7A 1S3IA 1VBNA 2HU5A 3NATA 4L08A 3DG9A 4NQZA 4QATA 4YJDA 4EFLA 2RHLA 5CYOA 2PMWB 2ILVA 3TZLA 2RK6A 1L7OA 3VAYA 2ZBEA 1HYGA 5TS3A 2LTAA 4AJIA 5L51A 3EBOA 5LMCA 2ZSHA 5F5LA 3UTCA 1PR1A 5H02A 2BI4A 5DCLA 3VNQA 3E22B 2G04A 4WBXC 2Q0SA 1I7DA 3OA2A 3UFBA 3L07A 2OB1A 3HXOA 3T3NA 3V8QA 5JAQA 4TYYA 3ASUA 4V3BA 4K81B 4CG3A 3QKTA 2QN1A 4ZI5A 1JAYA 1A2QA 3I8SA 3LA6A 4ER3A 1YRLA 3N6RA 3G3EA 4D0LB 4EEZA 1E98A 2C8VA 2LWIA 5GV7A 2KLBA 3RODA 4K9MA 1Y37A 4XA8A 5DBGA 1M2EA 3F49S 2JLWA 5FUVA 3A26A 3RJTA 1SUFA 3NBUA 4C29A 2WJJA 4IIYA 3CXRA 5K6AC 1NZDA 1V25A 3WGIA 2PX8A 3V4RA 5J2UF 4YT4A 5ESRA 3JQQA 1E6EA 1G18A 3PCRB 3RRNA 3EDQA 4ABTA 4R6WA 1VJGA 5IC5A 3H8SA 1JE1A 1CT9A 3STVA 3QXJA 2JFYA 1CRLA 4PYLA 3TKYA 2A33A 1V11A 4DYDA 1ZC4A 1KKLA 1S2GA 1E62A 2I54A 1Q74A 2ZAYA 2ZP1A 4H7EA 4A5OA 5JVDF 3KWFA 2P75A 4XJSA 5D87A 2H1CA 4TL9A 1V8DA 1EVKA 3Q10A 1SCDA 1C3XA 2RE8A 1NF2A 5L7TA 4AD8A 5HWSA 1KE2A 1C9KA 2GN1A 2LZ0A 3JTMA 3UAZA 2OAP1 1NBEA 1SQ6A 3FTNA 2IYXA 4C03A 2GBLC 1UPUA 2DSNA 3W2EA 2WUFA 1EQ2A 5DW0A 4NJMA 3ZGOA 2QTVB 4ER7A 1LRJA 4P32A 4S2EA 2A5DA 2W37A 2NAFA 2YL2A 2HXSA 3AY6A 2X13A 3ONDA 1XVTA 4L1KA 4M9CA 4CKCB 1NMZA 3JRWA 3MTEA 1TM2A 4YAFA 3IKJA 3P0IA 2OLKA 3EF0A 5DYYA 2ZSDA 3T5CA 3KM0A 2ZM5A 1SUIA 2D8MA 2G9VA 1BWPA 1XU4A 4F96A 1QQ6A 1AA6A 5ICMA 3P94A 4HAYA 5J4VA 2OR3A 3B3QA 1DJMA 4JELA 4C9BA 1UBEA 1TCAA 1AMUA 3AL0C 2ECQA 3JALB 5F64A 2WHYA 1MF7A 3GPDG 4XRGA 5BSGA 1QIKA 2PO5A 1YF3A 3NOVA 3IV7A 2IXAA 2VAPA 2ZKLA 5FWYA 2J1LA 2QSYA 3NBKA 1RXSA 4PZPA 3JX9A 5JJCA 1E7WA 4QL3A 3M3HA 3TMYA 4C76A 1GL3A 2WKQA 4NG5A 5DYIA 5I9LA 5HQ3A 3DMDA 1NU6A 5L6LB 2XB2A 1U1CA 3AYZB 3EQ9A 1I4DD 3AK4A 1NN1A 1VL1A 3K05A 4FFSA 4P86A 1DKPA 1EIZA 2H59A 3C1AA 4G24A 3QFRA 3VH1A 5B6JA 1BSVA 1MIHA 1U0OC 3DCYA 2XT9A 4RVHA 1R5OA 4CZ2A 2BUCA 3H4TA 2UZIR 2XRFA 3SFTA 5B5SA 2C94A 1AIPA 2BTOA 2XB4A 2GM5A 4A2QA 1N2JA 1PYGA 1KSFX 1Z0JA 3EA0A 4YP9A 2D6FA 1XKQA 4G85A 2BZ1A 1V26A 3BHJA 4FX2A 1PNQA 5I7SA 1E89A 2IX9A 3FIJA 3DV9A 2A1UA 1JJFA 1B14A 2JVIA 2DM6A 2PZFA 2QTFA 1ORWA 1YCHA 3VYSB 4OOEA 1JDBB 1CW2B 2CCKA 3BRQA 3CB4A 1OASA 4B76A 4QECA 2XTMA 4Q93A 4ARVA 4N7BA 5F21A 4CM7A 4FE3A 2GK3A 2VDRB 3RAJA 5GVRA 2GJKA 2X23A 3ANMA 1D03A 5K8CA 2E4AA 1JA9A 4DA6A 1JGTA 1P4HA 3QGMA 2GZDA 4IJQA 2PUHA 2V5VA 4ZVOA 4IYRA 3HY3A 4FHEA 2FQXA 1ABBA 5KYYA 2QP9X 2UZ3A 3KU4A 2R86A 3C3CA 4RKFA 2DFDA 4MW0A 4OHYA 1PS8A 3ESDA 5H1YA 3W7VA 2GF9A 4CMEC 1RMTA 3SAJA 2ETVA 3U3RA 1UJ6A 4I1PA 3K2QA 3RSSA 2P4UA 1IZ7A 3EFBA 3EQ7A 2NMVA 4FGLA 3I1JA 5JVDB 5E8RA 2ADFA 5E6RB 5A5FA 1QUFA 5IBPA 1X1AA 2QYSA 1U2DA 2J3IA 2YZ2A 2R1ZA 4IV5A 1UJ4A 4MCAA 3T9FA 3V1YA 2I91A 2FHSA 4HZGA 4HMPA 4CM1A 2XR1A 4PRYA 1Q3TA 1XROA 4C5AA 1GKLA 2XRZA 2DWPA 2O0LA 2NT4A 2JK1A 1GU7A 1K7SN 2O06A 1BZYA 1G38A 4ZAGA 4KAAA 1ZJWA 3PE6A 4EJSC 5EY5B 5AVTA 3R7WB 2JHAA 1FVHA 1GV0A 1FUYB 2FJUA 2GTHA 1UPBA 2VP0A 3MVEA 3QX9A 2Q6OA 3PUZA 3RUDA 4CLEA 5KUTA 1JR3E 4C88A 2WM2A 3PHHA 4C0XA 1N78A 2CXOA 5JT1A 2BSQA 1JQBA 4JWTA 1PVDA 3R6LA 2ZRGA 4ONEA 3X1ZA 2CN1A 5FUXA 1UBTS 4RCZA 5SY4A 2HJVA 1T5BA 2ZYUX 2QA5A 3H2HA 2WKSA 4CV2A 3L7DA 3A1SA 2VHXA 4U5XA 2XQVA 3WOHA 5BNTA 4RTRA 5D3ZA 4U9UA 3K9HA 1DUVG 1EXNA 4LJ8A 1CEEA 5EIEA 4B85A 2XOKD 1I30A 3QF7A 1GA1A 4NF2A 5I9MA 2VJPA 3FSGD 5T6MA 3PTAA 1QVVA 3BL5A 4CF4A 5FA8A 4O4JF 2FDRA 1N1GA 4AN0A 2HHHB 4RHEA 4DHWA 4IKPA 1L8OA 3EDYA 2G83A 3CZQA 4CCYA 4YRIA 1RNLA 4MWZA 5MDHA 4BNGA 5G0SA 2GM4A 3QPVA 2O20A 2P78A 4Q3EA 1WD5A 4Q9KA 1OWOA 3KKKA 4HEQA 5EZSA 4EATA 3OOEA 1Q0RA 1UOOA 1NATA 4PSAA 1D6NA 1O08A 3H2YA 2HIGA 3L7LA 1T2AA 1L4EA 3A10A 1IZYA 1NC1A 2FZKA 3FDIA 3R8CA 3TL6A 4PQGA 1NQWA 1NW3A 1UXGA 2C7GA 1N6LA 3O95A 4R1LA 3U4AA 1JWAB 4URZR 4WFQA 1Q2XA 4IOJA 3EHEA 2A1IA 2VCYA 2VDPB 3SDSA 1KORA 1PL7A 2J6BA 1CC1S 1EH5A 3ZW7A 2OVFA 2IHUA 3R41A 1PF7E 5DSXA 3IT2A 4CN9A 1T5TA 3FOCA 4GGMX 4YXFA 4RZIA 2XXJA 4QYXA 5TPWB 3X1MA 1T9CA 1ZOLA 3ROPA 3ZU5A 3QUCA 1YS9A 3JQGA 1IUOA 2IBMA 5ITZA 2DX7A 4J1QA 5F23A 4UE2A 4RQTA 4YDRA 4AXXA 3TJRA 4W1SA 2FX2A 5LDDC 3IV6A 1JEQB 4RDCA 2FRXA 4K0RA 3O1HB 4E2XA 2QQFA 4CIVA 2PVSA 2X8JB 2I4RA 1O9BA 5K09A 3UWDA 2ZATA 1JFTA 2ON6A 4FD3A 3PEUA 4J0FA 5SICE 3RHFA 3CUSA 3FRHA 1K9SA 4AY6A 3SY8A 4UDOA 2R9VA 4JQYA 1G8KA 2BM0A 2J9RA 1KFJB 4P80A 4AMZA 5JRJA 3TVTA 2QLJA 3LUHA 3ETGA 4KNVA 3U31A 2E85A 1AUOA 1J56A 4M21A 4CNQA 3THXB 4IQFA 2DFPA 3TD9A 4UOZA 5KNBA 2WT9A 2ORWA 3CLUC 1DJPA 1E3QA 4OTZA 4Q9HA 5EJ9A 1FXWF 2B21A 4HH3C 4NE9A 3QSYA 1HYQA 4YAUA 3SN6A 2BFDA 2KHZA 4UAUA 4R3WA 4MITA 4V0QA 5E6SA 4LV5B 4KV7A 3EX7C 1EDDA 5IFKA 3RFXA 1OFHA 3NDRA 1PU2A 2VQDA 3CLSD 3FCEA 5H4GA 2E6KA 3EF3A 1U0GA 1W0KA 4K9KA 3W8NA 2IHNA 4Z0PA 1NE7A 4IJVA 5FI3A 3TO5A 4L4RA 1SR8A 3R8XA 5EMKA 3EIFA 4OXNA 2EZTA 2PZ8A 3LC1O 2GN2A 4NMMA 4NU5A 4QRDA 4FYWA 5DSZA 4IGAA 3PPIA 2V6BA 3CPHA 4MKZA 5LYJA 1Z3CA 3OUTA 3H65A 2VPZA 1WDMA 3G2JA 4JJ7A 3RKRA 4D8TA 2FW9A 5FHRA 2A9RA 2VHEA 4GLOA 3TINA 1XZQA 3QTTA 5IEBA 3EZ2A 5DM4A 4PE5B 5DRTA 2GZMA 3QLTA 1LBQA 3BRWA 2VWQA 5AJYA 3PFWO 4ZI2A 5LOVF 4K26A 1VKOA 3MWDA 3GJ4A 5EJFA 3ZZUA 4O4JB 2GCEA 2BELA 4H7IA 2O2EA 3NT5A 4QULA 4X60A 3UK2A 5B57C 4CR6A 1SXPA 3BSFA 1Y8RB 3CIOA 2P9ZA 3JV7A 4XR9A 1VMEA 2Q5LA 4BLVA 1USWA 1NVVQ 2JI4A 3C0KA 4MKGA 3TMAA 1EJBA 2GKGA 3QMVA 2FG5A 4ML3A 3QXXA 1VIMA 4KRGA 2C9CA 2GN6A 4MOWA 4PTLA 5L4SA 2IUSA 3FFXA 5CM2Z 2JATA 1UWVA 4DMUB 3EULA 1GU0A 4HS9A 4MLDA 2Q2VA 5CB6A 4LJRA 2WVJA 2NTNA 1UEIA 1L4NA 2W90A 4J0DA 4K86A 3GMSA 4QXPA 3E7DA 4TQ9A 2VOEA 1QE3A 4TT3D 4YUAA 1C7EA 1DO2A 2AUMA 4DA0A 1IM5A 4QQNA 1J49A 4B6RA 4MHOA 1E99A 1U3CA 2XODA 4YJHA 4XWOA 1YDFA 5JJ5A 2Z2XA 3QWAA 4PR0A 4M4SA 4M1WA 4OLBA 1TUBA 1E1DA 3IP7A 4HWSA 2ZI9A 4FKZA 4FILA 4ZOLF 5IKOA 1NV9A 1ZRHA 3AU8A 2Y77A 1NXWA 3AUKA 1QTIA 2NYRA 3OURA 1G6Q1 4A26A 5K8LA 4D25A 2OM6A 1CPYA 2PZEA 4FC7A 4GICA 2IOHA 4U3JA 1LSSA 3QWFA 3KCNA 1WU7A 5DM1A 5B58C 4E5UA 4HB4A 1I1NA 3OCUA 3WP1B 2W9XA 2N47A 3M5PA 3DMGA 1L5SA 3FYUC 3PB3A 1YOVB 1XTBA 4FDLA 5FWXA 3SM9A 1K4YA 3W77A 2CMKA 1JYFA 5LZ7A 4J90A 2ZVQX 4EJSB 2BAGA 4FB5A 3E5RA 2ZR8A 4NHOA 1XPRA 3PXUA 1GADO 1FVXA 4YAJA 5A4DA 4L16A 4YFYA 4ZI7F 1ZVVA 1C9YA 2Z3ZA 1P39A 4C6TA 4ZXPA 1WKCA 4RK7A 4BMOB 4CCAA 4TXLA 3VR6H 2I66A 1ZAYA 5ALUA 2VPPA 1HZZC 2EBFX 2RG1A 3A6PC 5EJEA 1KFKB 1JRLA 2Q4BA 4H2DA 4UQLA 4TZ0A 4AZ3B 3WKAA 2H3HA 1CZUA 2WNSA 3ORSA 3FLBA 2HM7A 5FOQA 5F33A 3C70A 4CLHA 4HAIA 3BERA 3VC7A 5HFJA 1SEVA 4K3UA 4LOIA 2OV8A 4RZQA 3USCS 1DRJA 1A9OA 1JEEA 1DQNA 1NFRA 4J91A 5FRDA 3ZHYA 3ZWQA 1K7EB 4BZZA 2IF0A 2P27A 9ATCA 3OE5A 3FSRA 3HCRA 3DOOA 5AICA 1E4VA 1E79A 1AQYA 2OK7A 1ZBQA 2PH7A 2ZDQA 1TMOA 1XNGA 3AGQA 3BKXA 1P33A 3SM3A 4QVGA 1RAFA 3KHTA 1VRWA 2VDNB 2HHJA 2OO5C 1SUAA 3I3OA 1JJAA 1VLVA 3M6IA 1S4MA 3IELA 3P32A 4TLBA 4ETWA 4N8DA 1OW3B 2O52A 3ZDEA 3QYJA 1W4RA 1YAHA 3B3GA 3GGDA 4AQ7A 3K0CC 2OZVA 4Z9YA 1IQPA 1E6MA 3VZBA 5DP2A 4BQIA 2ISSD 3GUUA 1CJSA 1BU8A 1PSZA 2BLNA 3EDOA 1VHQA 2QVYX 4YS6A 5LOVB 3UMYA 4H7DA 4X94A 1T91A 1SUCA 3IUMA 3G2HA 5HM6A 1G3QA 3ABSB 3FDXA 3PQ5A 3SI7A 5LP6B 3E9EA 5EWLA 2HCTA 3HABA 3QPUA 2OD2A 2RGUA 2X1HA 1U2RA 2AOXA 4PU0A 2FFAA 4AC9A 5K4HA 3AC0A 3L49A 2RGYA 1Y5NA 1CR6A 2AD1A 2ZAIA 4W5HA 3T9CA 1NIPA 5JXHA 2YUIA 2NYAA 1M74A 1PEKE 2RHGB 3C8MA 1NNUA 1UPXA 3NIDB 4CIYA 1Q0TA 3NHRA 4RDXA 3DFZA 3OPNA 4TL7A 3K32A 4Z7JA 1OTXA 1QVRA 2P9GA 2HREA 1OYVA 1QG2A 3LQKA 4TRRA 1G8HA 4HEJA 4GOMD 3P71T 4LHSA 3EGXB 5L3VA 3V8NA 4LXYA 3DEFA 3ZXIA 5KNCD 4UJ3A 4MRMA 2JGEA 2VK2A 3O73A 1CE8B 4ZPJA 1UFRA 1QR6A 4F91B 2DWOA 2ZU6A 1L7VC 2Z95A 3IERA 1PZMA 3GT7A 4A8JC 4PIPA 4BGUA 2ZDGA 4MS4B 3GVCA 4HOYA 4ZCLA 2Z8ZA 4MUNA 3GLHE 2COEA 3W5CA 4JVNA 4YT8A 2XSZD 5DLPA 1ZNQO 3VR2D 4KL8S 4OLAA 3P5BA 2O8FB 1ML4A 2ZZNA 4QPDA 2HMTA 4JHXA 3WG9A 4ODIA 1Y8CA 2JD1A 3MSCA 3DW1X 8OHMA 3A4TA 4RK0A 1YBAA 2OP1A 2X9VA 1A27A 2DQSA 3SP1A 1LC3A 3V7WA 2BVNA 4QBTA 1OU4A 2CNNA 2PKQO 4J0HA 1YDGA 4D3DA 1P3JA 2CDNA 3UOWA 1YUNA 2ODQA 4KH0A 3ZV3A 3O8OA 1ZPDA 1QDEA 2QMEA 2J6HA 5M3BA 1T4MA 4B1FA 3U9TA 3RB8A 2NP7A 1EX7A 1O54A 5CJPA 3LZCA 5CITA 3AVWA 1NXOA 5F2OA 1NAHA 3WNVA 2WM8A 3N86A 1R5NA 4XQEA 3T0IA 1LLDA 2J9XB 1U9ZA 4M6WB 4U63A 3HQ4O 4Y7CA 3GA7A 1VCOA 2ZB3A 2PYIA 4BGEA 5DYTA 1Y3IA 1Z2CA 3KB2A 4G25A 1JR6A 3COWA 3MMPA 4BU0A 3IQHX 1NI4B 1M10A 7ADHA 2EL7A 3VNAA 5BQ3A 4LBVA 4RHFA 5F5XA 4M60A 1OWNA 4IZ6A 3UA4A 3VDRA 4HUQA 2NTYC 1TKBA 2HK7A 2NT3A 2FCRA 4QTXA 4PW0A 1ZMXA 4EP1A 5HCUA 1EUCB 1ZH0A 3J7AC 2X8AA 2ZI5A 4M7RA 1NPTO 4XEHA 3HCPA 4LWQA 4BP1A 4DJ5X 4FDUA 3CUYA 1X1SA 4LVNA 3QX7A 5CHYA 1RTTA 4IILA 5DB4A 2JIQA 3E3AA 5TR9A 2VG8A 5HIAA 2WSSD 4B5KA 1TCBA 5K3DA 4P9NA 3WQRA 2QOEA 4N9QA 3DEZA 1HT3A 2C5LA 3D6FA 4GU5A 4E70A 4GWGA 5I8PA 4ZT4A 3B3AA 5JDIC 1PVVA 5AW7A 4MW1A 3DUFB 2BCJQ 3RFTA 3IP1A 3EPPA 1DAMA 4G9EA 4OXQA 4DXAA 4D2IA 8AT1A 5CU7A 3WLPA 1UMCA 2CYCA 2JGDB 3ZCTA 3V6LA 4HAOA 2PVCA 3HBLA 1KY4A 3TGPA 1M34A 3UO8B 3K8QA 1I6MA 5BUQA 4LHWA 4H16A 3WWOA 1J7JA 3QV2A 4YI5A 1VJDA 4D4LA 3K72B 3MNFA 1PEYA 2Y27A 3A6KA 2UZ4A 2W00A 1MOPA 4YREA 2JBHA 1T6XA 4EPVA 1YS1X 2CHEA 4PGFA 2C9BA 2HSDA 5FD8A 3PXEA 1DMSA 1UIRA 3G8DA 2FRVA 3LVQE 7REQA 2JAXA 3AF0A 3I6BA 4PYNA 1YIOA 3DWIA 4BECA 3ETEA 2IZZA 3FI9A 4IS3A 4MLCA 4XCVA 2H0RA 2ZYIA 5BYAA 1KFBB 3IS3A 4KQ9A 1XI2A 4ZGWA 4XUEA 2XMSA 3LX5A 3QVJA 1FW8A 3LO8A 1H0KA 1PZEA 3V34A 1YFLA 4FKMA 5E9QA 4PQRA 1PRYA 3D4IA 3EGOA 2O8BB 2AUNA 3A9SA 2OQVA 4P0QB 4N40A 1BA2A 1XDWA 3IEKA 2WOJA 1CP2A 4Z8XA 3ZYCA 5EJ6A 1IBCA 1HQDA 5FP0A 1CUSA 4RGBA 1MN6A 5DULA 4AVYA 1BGVA 1CZLA 1TMGE 3GOHA 3TTXA 3WIOA 3WOVA 4BX2A 1ETUA 1O94A 1JPUA 4HB2A 3DT8A 5FAKA 2F8SA 3K6RA 3QG5A 1P19A 4KHPB 1EE1A 1Y6RA 1T5SA 3MLBA 1QH9A 2O7VA 1IXZA 2VP9A 3K2IA 4WN9A 4C0BA 1KVRA 1ORTA 3GLHB 1IULA 2WYUA 4GXRA 2RBGA 3K5IA 3PHIA 1BHJA 1YJ5A 1ISFA 1NRJB 1NWCA 2YIJA 2ZQ5A 3FGOA 3VKUA 5BWMA 2C5BA 4D9MA 4WK2B 1EJ6A 2DHEA 3OEEA 4XR4A 4CMIA 1UXKA 1T8SA 5IJ0A 1A98A 4EG4A 3N2NA 1OXTA 2FE1A 5HILA 1VHJA 5HRUA 2BGNA 1UXHA 2FXVA 1TQHA 2QTLA 3JVVA 4YRAA 2O8DB 2I55A 5IHXA 4ND8B 2R3SA 2C4UA 1KXJA 2WD9A 4FJ2A 5HCIA 1OH5A 1E2EA 1TE2A 4C4YA 3AJ8A 2Q29A 2WHXA 3FR7A 3HA5A 4IDPA 4XPZA 5D86A 1MXFA 1TJ3A 2X7XA 5T57A 121PA 3D0OA 3TR5A 3VU9B 2IQ5A 3STWA 1KY3A 4O29A 4BUJA 3H11B 1CUDA 4BNXA 3COJA 2IEIA 5TVKA 3VR3A 2X9QA 1TAQA 3HJNA 2WB2A 4R9VA 2AZ4A 4XJVA 3FFTA 2QUHA 2ZJAA 3OY7A 4HZUB 2B8WA 4AJOA 1BXGB 3H9QA 1PKXA 1Z6QA 4EO7A 4UBLA 5ETJA 2B4TO 2VYND 3WJ1A 3ADKA 1R12A 4REQA 1H6BA 1TK9A 5C51B 2AUTA 1XPUA 3AW8A 3IUQA 5TV2A 3HH8A 4TQUS 5LB4A 4X61A 3RO7A 3D64A 3IUJA 2VH2A 2AG0A 3H2GA 1JT2A 1V6AA 1DC8A 5CGQB 4Q9AA 4CTMA 1PR2A 3QITA 4A8JB 4R8LA 4OFXA 4LX8A 3TW6A 4K6CA 1ULTA 3DUWA 3DXYA 5HZMA 3MLEA 4XIYA 1ISMA 1PGJA 3FJOA 4BP8A 3ANNA 4C4TA 4N76A 1MHPA 3H0EA 1EWQA 2O2DA 1KA9H 1HE2A 4BMXA 1OAOA 2GAFA 2FSHA 3VDQA 3DTVA 1XVAA 2HIHA 4HQ0A 5IVPA 2A0KA 1Z4LA 3LY9A 1U8XX 1G8GA 4ND2A 3L4KA 5C18A 1XQVA 1QYVA 4X7MA 3KR0A 4B6FA 3QV1A 5A6SA 5EQDA 2Z2KA 1AY0A 1RBYA 2ZBRA 3KQMA 3MJHA 4QXOA 2J5RA 3KWJA 2O2HA 2P79A 1E9VA 3MBOA 5D7NA 3OCXA 4MQEB 2OXIA 2FU5C 4OP3A 1IPHA 1JF8A 2R2GA 1ZFNA 5G3YA 4PXYA 4RF4A 1PD1A 3HU2A 1NJGA 4QXMA 3PUKA 4UVGA 5FI5A 5LC1A 2QN9A 1X1RA 3SNHA 5K51A 3OI7A 2H48A 2TSYB 2Q3DA 2WWFA 4QOJA 4DSZA 1N8TA 1QZUA 3VR5D 4G0VA 1V43A 3AG6A 4D92A 4EO9A 1I2DA 1OXMA 1PGPA 2JHPA 2R8BA 2ZE5A 3LVRE 4KRXA 4L76A 3W3AD 3ZWCA 5T3UA 1JQEA 3MQ4A 5AKJA 3F6CA 3HBAA 3W9BA 3VO2A 1IZ0A 3DW3X 3LQ2A 4H0CA 4R8SA 1EEHA 3AVPA 3EIQA 4UQOA 3NO4A 2ANBA 1XCBA 3HCCA 3KOWA 5JI2E 2JHGA 3H2JA 1QGUA 1TT5B 3MMNA 1GQOA 4EFKA 4CCWA 1CF2O 1M1XB 4J0KA 2GRAA 5CYGA 3SXUB 5HJEA 4UASA 2CLHB 1DWOA 1RQLA 2BT4A 2YOHA 4KACA 4RA9B 2ZE7A 1KO8A 4V02A 2AHRA 3BE8A 4IXNA 3SYNA 3UMJA 4C5CA 3H3FA 4FOOA 3LV8A 3A4MA 4UHCA 2NVUA 5K3FA 2VYQA 1NVTA 1PNTA 1SHZA 2IGBA 3RIEA 4BLPA 2WTUA 2OBBA 3FWYA 1BA3A 1H2HA 3OLWA 1EVEA 1IC6A 1H0HA 2LGJA 2ZWVA 5ITSA 1N8NA 3JVUA 4HY3A 2H08A 1FF9A 1WDWB 2YQ5A 3IQDB 4ID3A 1S0UA 3RTBA 1S2LA 1K68A 3GJRA 4QXRA 2EF1A 4OQZA 2DWUA 1EFPA 1TM1E 1T9GS 3UHOA 3WYAA 1KDOA 2ZUWA 4JXZA 5KVCA 1P6QA 4X93A 5JCJA 5KJ1A 1QDLB 4FFMA 2YCBA 4FQ7A 5I9BA 2P91A 5KX5B 3W5HA 3BFPA 1CFJA 4X95A 1W8DA 2VKTA 3GJTA 1N34B 3ZHXA 3LE8A 1BXRA 2CD9A 2PBZA 2O5RA 1I7NA 2WFLA 4WW0A 4FXOA 3AF1A 5H4HA 4DE5A 1NKSA 4JBIA 2OLEA 2YHAA 3ETCA 4HWKA 3WMFA 4BVGA 4Y30A 4X92A 1NRIA 1CUUA 2JFVA 1Q5PA 2E4VA 4DXHA 3BTUA 3PGJA 2K7ZA 2B99A 3LS2A 3RS8A 5AUNB 3NEPX 4NBWA 1TDJA 3OECA 1P2VA 3KEGA 1XGKA 5HHTA 1NN3A 4DNXA 1BYUA 1W88B 1B4DA 2XNHA 4HLCA 4GZ5A 4O4HA 4BLRA 1TIBA 1PZFA 3LT1A 4KGZA 4RH0A 2ZK7A 4BPBA 4KXYA 1T8PA 4JGBA 5ALEA 4WXRA 2Q5EA 1GNPA 1RC1A 3V2UA 2YV3A 3H87A 2FEXA 1KBQA 1ENPA 2I65A 3L02A 3BMXA 4K87A 2ZCUA 4WCFC 1NVUQ 3MINA 2JJYA 3N07A 5ANRB 3PQFA 4FEYA 1KDPA 4ZT2A 3CRRA 5I7EA 1K88A 4HP8A 3I73A 1Y4SA 4DKJA 4IOLA 1QORA 2DRIA 5FFNA 1AHIA 1HQYE 3RVRA 1P5FA 2HQOA 3BB3A 3OCCA 4GYJA 1B23P 1WZEA 1KQFA 2CDRA 2H2AA 3OJOA 3EQ2A 4NV1A 1TW3A 5D01A 1R2QA 1WY5A 3IE1A 1J39A 3VPBA 2NO6A 4TN1A 3U7IA 3KUDA 4EYEA 4J0IA 1I0IA 5BRJA 4FFBA 1P0FA 4MIYA 4KXWA 5FWNA 3R6GA 4NG4A 1W52X 4BJ5A 3E7XA 3IESA 3AIKA 1AGRA 4QUEA 4WY2A 3RLFA 3ZCPA 1Y42X 4RWZA 4EA7A 2JJ1D 5K3BA 4MJ3A 3UT5A 2VDWA 1X8JA 3TJZA 1OZFA 2RH5A 2R5WA 3P2KA 4IHJF 3KXDA 2PBLA 4AS1A 2OO3A 3R74A 2XCSB 4HGYA 3W3ZB 2PY6A 3OZSA 3JRNA 2VK8A 1U5BB 2QM3A 1CUBA 5K0FA 1IVYA 4U7TB 1V6SA 1X7ZB 2BMFA 3F98A 3WKEA 2I3ZA 1NVDA 1UMKA 3AG5A 3CC8A 3HDGA 3X44A 2O8CB 4M0EA 3NH6A 5FFMA 5CIQA 2RJ3A 4N39A 4Q4HA 4QPCA 4NEGA 3MJFA 3O92A 3EHDA 4FZRA 4P3XA 2ZJ2A 2CJYA 3G9UA 1TECE 4QUAA 3AEUA 4JA2A 3TR0A 1G8PA 2YY5A 3PIIA 3TSZA 4MARA 5KVSA 1QJ4A 1H22A 4DIFA 2YWXA 3MELA 3NDIA 2HRBA 3TFQA 3WRYC 4NATA 3BORA 5FI1B 4Y6LA 1QANA 4YQEA 3UGQA 4B9AA 1RLJA 2ZI6A 1NBMA 4OATA 1DJLA 2ZS8A 1ARZA 5C1DA 2QE7D 2XJ4A 4NICA 4UTVA 1YDMA 1CWUA 4GX5A 1XQ9A 4JOSA 2AFIA 1X74A 2D2EA 3IIKA 4PAGA 1MH9A 1MC1A 1E20A 1KL7A 2ATEA 3FYTA 4I14A 1L4BA 4Y2RA 2D3TA 1RPNA 2W4IA 1JSCA 2C7QA 1N6NA 1QDUA 4RMGA 1Q17A 4XTRA 2XV1A 4GM4A 4P81A 2QPLA 2VHZA 4PLTA 4MWSA 1L5WA 3JQAD 3SEQA 4D6XA 3IB6A 1IJKA 4QZVA 4BQNA 1HXHA 4D98A 3PD0A 4EUNA 1VE6A 3UUGA 2FPXA 2KS6A 1L8XA 4TV9B 1P2UA 5AM4A 4LMPA 3WNCA 1A8UA 1ECPA 2DTEA 2EZ9A 1M2OA 3EYAA 4R3NA 4I55A 3W1EA 3V8RA 4B83A 4DJJA 1MNAA 4S1VA 5FB3A 5SZJA 1YRAA 5B2EA 3B9PA 2ZREA 1JLKA 3UVEA 5YASA 4CEJA 2JGIA 3CKYA 2ZIEA 3EZGA 2OHJA 1D6JA 3P1JA 5JASA 2JLAA 1PHPA 3M6VA 4ER6A 5JFTA 1P6XA 4G0XA 4JODA 4HDNA 5TQJA 1W1UA 1UDXA 2I4IA 4E30A 3E9ZA 4IL5A 1B0ZA 1N2OA 5IT0A 2VT2A 5KOYA 1C4KA 4BN0A 2JK0A 2WTXA 3Q87B 3VPDA 4DMFA 5KDOA 1ORRA 2ZYGA 3WRVA 4BMZA 3B2NA 5EZYA 3EW9A 4H6XA 3AF2A 5KOHA 3D3QA 1W30A 4M54A 1QC5B 3QUAA 1SIOA 3I3SR 1GP2A 5CD1A 2PH1A 3PENA 4B7UA 2R00A 4FU0A 3C7AA 1KOGA 3DVLA 1I7QB 4EZBA 1XHFA 3SC2B 3QWIA 4WA8A 4LDQA 3WZMA 4BNIA 1KC3A 4DIEA 5AVYA 4IIDA 3T06B 3PEVA 3A2MA 2OHIA 3CEAA 2YHIA 1K8XB 2JFUA 4UFPA 3GJZA 1KRWA 3NB0A 1A71A 2YV2A 4QYSA 4IHJB 1VMIA 1AGXA 2GSWA 2LRHA 5F2EA 1TC1A 3DM9B 4CODB 3DULA 3WLHA 1LDBA 2E21A 1Z39A 4JP8A 4TV8F 4LPKA 2EG5A 1VYHA 2JFHA 2WUVA 3IH5A 2G4LA 2HHAA 4O2AF 3LUPA 4L72A 2BM1A 1W1WA 3WDLA 3O4JA 3MMXA 4OA5A 2FCAA 3QQPA 2PQ6A 1R8YA 2QTTA 2XA1A 2EF0A 2F1OA 1COWA 2H2HA 2WPNA 4HK4A 4XVUA 1YDWA 2JARA 3AL3A 4UFNA 2H65A 3JQ9C 3HVHA 4BMSA 5EEHA 3K0KA 1EK6A 1P7PA 1YS6A 2FWJA 3A36A 4G0QA 3HP7A 5EIBC 2QM8A 3LO5A 4FMBB 3HB9A 1IOWA 3T95A 4QAJA 3ZCXA 3BXXA 2ATVA 1MGOA 3VV3A 4N41A 4PAOA 3UK6A 3WFZA 2RKWA 3PQ8A 1HO3A 4REMA 2C07A 4MMZB 4XX0A 5DTQA 1XELA 5KTTA 2AQIA 4XLTA 2RHTA 1YQEA 2O7NA 4MV7A 3TWOA 3NKVA 5HMLA 4LJ6A 3SICE 4DCOA 2C84A 4FZ3A 1TYEB 2ODAA 2MSKA 1SU8A 4K6KA 1W35A 1LBTA 3OM9A 1ND6A 2AR0A 3KJEA 3HU3A 4MSUA 1NXTA 4OPMA 3UAWA 3U37A 5JYEA 4ND5A 1OH7A 2OQ2A 4UNNA 3ZBQA 1KIFA 1UCFA 3K4HA 1PT6A 2XUFA 4IVNA 1R50A 3DBRA 3KOYA 2EFEB 3QBDA 2CJFA 1DFHA 4WCFB 4AG3A 2WSIA 3GELA 2Z8XA 4C0LA 5JSUA 5KWEA 1OFGA 3CZAA 4P98A 5K8IA 1XDDA 1I2CA 2OP0A 2UVQA 2HUNA 3N0RA 1N0UA 4DQ0A 2Q0HA 5CVTA 3PUJA 3I01A 4O2BA 2VAXA 2FETA 3UHAA 3I5XA 3LXMA 1Q1QA 2F48A 3G9TA 4XB2A 2VHQA 1WXQA 2P7IA 4Y9UA 5D3QA 2ZTSA 4LC0A 3IMEA 3VGJA 4GDFA 4JVLA 2VF4X 3ELYA 5EYPB 2WIDA 3IDOA 4D8XA 3LQ1A 5ICCA 2Q2NA 3EXEA 3E1SA 1GPH1 1H05A 5DFAA 3DTYA 4LYYA 5HUQA 1MAWA 3K0BA 3QU2A 4KPFC 1HX7A 2GPJA 4CQNA 1BMDA 3AFHA 4JSRA 4L2IA 3BWYA 3VSCA 1DP4A 4OJTA 2PZJA 3VU3A 4HQFA 4L8FA 1WETA 3CR3C 1RPAA 1F5NA 4YRQA 5DK4A 4JB8A 1BTOA 5ALFA 4NLLA 1LX6A 4X45A 3DWFA 4DMGA 2IDZA 3L0ZA 1DIRA 3LP5A 3ESXA 1MOZA 4DM4A 3BA6A 3I04A 1P17A 1E2FA 3RVNA 2HMVA 3LCMA 2G77B 3PRKE 1Z0KA 2HN9A 3I58A 3DV0B 1Y1PA 2CDBA 2F67A 3WIVA 1WZIA 1DQPA 3B8HA 2CNWD 3N0WA 5CT5A 5LJLA 4C04A 4DCJA 3N8HA 4RKRA 5MN5A 1QQ5A 2ZRBA 3EWAA 4QO7A 2AMVA 2BW0A 2QTCA 3QLUA 4BAZA 4IIJA 2VQEB 2A5GA 5TJ9A 2VHYA 5D84A 3PS9A 1EWVA 4GOKA 3SX0A 3WYNA 1Y5IA 1YC2A 2VYCA 3FPEA 3UOAB 5ALRA 5E1MA 4YO7A 3TK1A 3RU7A 2AB0A 2R25B 4RV4A 1T8TA 1CB7A 5ALIA 4PNEA 4CPDA 2AMJA 3CG4A 4QNRA 1T2VA 2DE0X 4RD6A 1GYPA 3DZFA 4B5LA 4BX9A 1EXVA 3D8HA 3JWGA 5C5IA 3JAKA 3ASYA 5EMNA 1XYVA 2D4AA 2OZEA 4WKNA 3JU3A 1KE1A 1T8YA 1G5RA 2WF5A 3KWMA 1NMEA 3EVZA 2D3WA 3LPMA 4FIDA 2XGOA 2BMVA 1GQSA 2VEOA 3E48A 4G36A 4LYFA 4N5DA 3JR7A 4I3HA 4AQDA 1NR1A 1SFRA 3IUBA 3QE3A 5G4KB 4WOKA 1CUFA 1SCUB 1ID8A 3P0JA 1PFYA 4LIPD 3OETA 4DDMA 1X8KA 4JI1B 3ZDDA 1T3HA 5E1OA 2DLDA 2PYZA 1CUVA 1MR3F 1DFGA 2NO0A 4X8HA 3WSTA 4TYNA 1KO5A 2IXFA 3DR5A 1I4TD 2AI3A 3BKWA 4NBUA 5E2AA 4EUKA 5AVKA 1E6LA 5FLKA 1M2FA 4AZWA 1RP7A 2ZUDA 4NQRA 1CZNA 1R4ZA 4ZCIA 4JUIA 2QN3A 2MSDB 2HRQA 2XUAA 1X9GA 4JR2A 3EEBA 1OZAA 1U0LA 1VKHA 2FF7A 1U3UA 4DDWA 1MFPA 3OF2A 1DJQA 1Y33E 4C4PA 4DWVA 3DZHA 5AK4A 3V4ZA 2IYEA 1QHHB 2HI0A 1F9AA 3FCSB 1JMVA 1H85A 1QYCA 2PEZA 3N70A 5L3ZA 4A2WA 1FTNA 5BRNA 1H2WA 3TNFA 5TMBA 2XCLA 3DE7X 1DRUA 2X6QA 3EQZA 2AXNA 4JUBA 3M5DA 4MRSA 4QSHA 1PFGA 3TZEA 1NP3A 3NEYA 3LUFA 1D2MA 1RYDA 2EP5A 2DAPA 2UXCB 1JU3A 3OFSA 2JJMA 1UM8A 2CLMB 4L5CA 1K86A 1RYMA 2PXCA 4YV1A 4E94A 3UCEA 4XD7D 4DZZA 4DLNA 2ENUA 1FUUA 1MABA 2XBMA 2Q5QA 1X77A 1ZI8A 2GGSA 1ONSA 2NWQA 6PFKA 5JJKA 4UHFA 3RVKA 2AE2A 1YI8A 3WZ2A 4PSVA 3BZWA 1RJEA 2FN7A 1OLUA 2QKYA 2W2NA 2WFZA 1C1HA 3E5MA 2WTNA 4P4TA 3VKWA 2ZE6A 1F5SA 2HQRA 2PT5A 4HQRA 5KTNA 5AXDA 2RHDA 3KT6A 4ZI3A 3AM4A 4K5QA 1WX1A 2P5YA 4F92B 2FMXA 4XARA 5CP8A 3R0XA 1MZPA 1R0KA 4UM5A 5AIBA 3A4YA 1DCMA 1T5IA 3BSWA 1IL0A 2UV8A 3UA3A 2C77A 1UBHS 3BWDD 1AS2A 4D9JA 1Y6FA 4RELA 4LDAA 2AJCA 1PDVA 2V58A 4HSGA 2W2QA 3O6VA 4LF4B 3ZLVA 3BXGA 1H2AS 2A7QA 4MDYA 4Y2JA 2HXYA 4JP5A 1G41A 1GRNA 3A0RB 2X42A 3OT1A 1RBMA 4OGKA 5BQXA 2P1DA 3LPCA 2YZMA 4MVJD 5CFRA 4RJJA 5CBPB 3NC0C 1I5OA 4LGMA 1MB4A 2PMBA 2Y92A 3KPWA 3U4DA 1TRHA 4EPYA 1FLNA 9MHTA 2J3EA 1N36B 2CWDA 4G09A 4QOIA 3U56A 2QNIA 2V0CA 2AQKA 3C3DA 4L3OA 1K63A 4RORA 3AUAA 4J16C 3C24A 3ZHOA 1MO3A 3NT2A 4JI7B 1MG5A 1WU8A 2WNIA 3MT0A 1Q50A 3VZRA 4D4HA 1X38A 4CW7A 2O0JA 2A30A 3KBOA 2YBEA 4CIWA 1KJYA 1YL6A 1OSNA 3WJ2A 1PYDA 3OBIA 4PX9A 1TJ5A 4KXUA 3KR9A 4QHYA 3E9QA 4CLOB 1R0WA 1E2NA 3NMUF 1NQTA 3Q40A 1MB9A 4HDSB 4LC1A 3FHCB 5EPOA 5FUWA 4NONA 4F5DA 5MN4A 3EPLA 1QV7A 4US2R 1SD1A 4ZAWA 1S9DA 5JTUA 1PW7A 4JC8A 4ENPA 4DUPA 2IXBA 4A2CA 4JJGA 1MT0A 4ITRC 4QBHA 4BBJA 1JDPA 2GEKA 1KEUA 2G25A 1G7TA 3M2PA 5K0BA 3CSDA 2HA5A 1GDDA 1K27A 2I3AA 2Q6VA 3GA0A 4GUAA 4IJMA 1AS3A 1P9NA 2IDJA 2JH9A 2NZXA 4HS4A 2Z9BA 4MXDA 1WM1A 2BOVA 5IN5A 1S2DA 2GEFA 4Z7NB 4ZDJA 4KIWA 3HLYA 1HYHA 5JDCA 4RIHA 5LR6A 2J0SA 2BEKA 3NCHA 4OGFA 4YBZA 4L85A 1YJCA 1JDUA 2Y1KA 3HYTA 3ZQ6A 3DR3A 4NEHB 4INAA 5I7HA 1TQ6A 2KM1A 1U1EA 1JPVA 3FPGA 4HRAA 3DL0A 5EN4A 3E5HA 5C1IA 4E7OA 2FP4B 4L78A 4ZV4A 1UJNA 3AVOA 3M6AA 2XUDA 1Y1LA 2JIPA 1AV7A 2IEYA 3DC7A 3Q3IA 4AKGA 3K0SA 4Z1OA 2V96A 1BMFA 1OB5A 5BWBA 1TM7E 3G0GA 3DEKA 4S1NA 2XQGA 3RSLA 1DS6A 1ODKA 3MJEA 3OT4A 3GGCA 4DUGD 1QHNA 2ESRA 5IP5A 1QH0A 2A9JA 1RCUA 3W6OA 5A4IS 2OBLA 2HHLA 3EMKA 2XWQA 4H7PA 4NCKA 4KPUB 4MVJG 3GLFA 2G6BA 5KSYA 3SK0A 2P2SA 4D6PA 1QTRA 1JAXA 2FW8A 4B81A 2IE8A 4QUBA 1D4ZA 4IEEA 2REBA 4PPNA 4EB8A 3U2QA 2F4NA 3DOEA 2ODEA 3KZVA 2O6LA 3NV7A 5EXSA 5GZ6A 1IUKA 3THYA 4OQEA 5L4NA 2AEEA 3GFGA 4JYMA 3F6PA 1SELA 4KO1S 4LMAA 2C82A 1CDDA 4M22A 4KQEA 5FR2A 1IE3A 1SURA 3GEDA 2DFKB 5KHAA 4EKNB 1NYLA 3DDWA 4ACAA 1QWSA 4HNSA 2EFYA 1OXSC 2FZLA 2NU9A 4OAQA 3ILVA 3TB4A 1RM5A 1JJ7A 1Y3FE 1B42A 1II8A 2QQ0A 2PLNA 5DNVA 4I8XA 1KRXA 4HDMB 2Y0PA 3D1LA 1PLJA 2EYQA 1CUIA 4YVFA 3ZLTA 1L4KA 1SCQA 1ST2A 1UDBA 3UFXA 2ACVA 2V3WA 2XNDD 4PG4A 1JHPA 3FOFC 1AF4A 4FGSA 3AIIA 3T3EA 4AN1A 2OILA 3PR3A 1LTHR 3FJYA 4KPEC 3O9MA 4II2A 3IKLA 5J2TF 4NSNA 2J4DA 4BNZA 4BFTA 5F1OA 1DC4A 3K6SA 4JLSA 4ZVQA 4KMOA 3GGGA 4PAQA 4CQMB 1ECJA 4NZMA 3ZQJA 2G7MC 2VAMA 1CUCA 2QTRA 1KHTA 1VE5A 2ODPA 2ZSUA 3LBYA 3SZRA 3WMRA 1AZSC 3WWYA 5CM8B 3R5SA 3KHUA 1JXOA 1CUGA 1ZEJA 3TUIC 4E5DA 4WE3A 1CVLA 6ABPA 3ENQA 5C31A 5JNVA 3D1VA 5LQAA 1GFZA 3DEAA 1GUYA 1A9RA 2AN4A 2Q4DA 1N7HA 4X44A 3FWPA 1E3MA 3IR6A 1VQ1A 2QI9C 4FUTA 3OHPA 1ILEA 2GYUA 2H00A 1NBOA 4NAUA 1RZRD 1XDSA 3D7NA 1G8AA 4BLTA 3I8XA 1XZLA 5KQGA 4IZIA 2PUDA 1JFVA 5IH3A 5KVVA 1XTSA 1IUNA 4ZAVA 2G8LA 3MF4A 3QBEA 4BC1A 1DKRA 4WASA 1MB0A 1YHZA 2B2NA 3DV2A 3PNKA 4KDRA 1BDHA 4LF5B 3T4EA 1XJCA 4IOKA 4DDHA 1UKEA 1GZSA 3ACCA 4XGIA 1Q1GA 5EG5A 2FFQA 2ATIA 2RC6A 3MFYA 4BMCA 3RW9A 2OC9A 2Q99A 3P5SA 4L9WA 1GG5A 4O4IB 4EGJA 1AU9A 2NUTB 1H2ZA 2GZ2A 4MI9A 3WYDA 3G6KA 3GP8A 3L1VA 4ZARA 1B8UA 3OU2A 3U9SA 3HJFA 4GMDA 2IH2A 1Q57A 4JOQA 2PFGA 5BSTA 3FMIA 4DV2B 3WSWA 3UKJA 4G1VA 3ZLJA 1AHNA 3AIMA 3UWSA 3O75A 4CF6A 2R97A 2P6RA 2R6JA 1YR2A 1DSSG 3U9LA 3OE1A 3W2GA 2QE6A 2JDID 4J07A 2F3QA 2OHOA 3N0TA 4BB5A 5KBYA 1N7GA 2MIIA 2QX8A 1RRGA 5EMMA 3A1FA 3GRFA 1GTJ1 2JCBA 3W8RA 3ZDQA 1A5AB 2D5IA 1NUSA 2BGKA 2QX7A 1VSUA 3T1TA 2OBMA 2Q1TA 1U2DC 4MYDA 3KQKA 1YA6A 5D2CA 3RRBA 4L15A 2VI5A 1FA9A 1OTHA 1YB4A 1CNMA 1P1HA 4BCBA 1LLQA 5A7HA 3FI0A 3A8TA 5HXAA 3NTOA 3EC2A 1TQ2A 1M7HA 3WDMA 3AB7A 3FNHA 5HMMA 3MXTA 2XD4A 2X2PA 4EGFA 1OAAA 2PO7A 5C9ZA 1LNSA 1M1UA 3WMEA 1E9BA 4DIKA 4R0MA 3GT4A 3UOGA 3UEOA 4E4RA 2XVZA 1G20A 4K9RA 4XYLA 3IOCA 3MTDA 1NOKA 3S1LA 1LF5A 5LMUB 1P72A 1UJ2A 1JQJC 2LNDA 4AIRA 4AL4A 1U4OA 1E59A 4OHUA 5C7LO 3TAUA 2A5LA 3C1TA 1GVNB 3DDUA 1JT9A 2V5UA 5KQLA 4I3FA 5KWSA 2CBGA 4OKIA 1QPGA 3FRJA 5DMHA 3WGMA 3VH2A 3CF6R 1DCKA 2J3QA 2CLDX 4XIFA 3QY9A 4F97A 4EENA 2EWVA 1R37A 3ICOA 4WKCA 3BICA 4X3OA 3RYTC 3FB4A 1K8QA 2QRKA 2YMPA 1P62B 4CXMA 2PVPA 5H5JA 3RM3A 2HZ7A 2AR9A 1J1UA 16PKA 3ZE7A 4BNTA 3ZDAA 1PT5A 2HJWA 2EZ4A 1ZK0A 2QIPA 4DBLC 2WWHA 4JZYA 2D7CA 4EY7A 3E15A 4YT5A 1XO1A 4URUR 5K05A 3GLGE 4PLZA 4BGIA 1XZ8A 4LBYA 3ADDA 4ZT5A 1RXVA 3O8CA 1X14A 1TEZA 2H1WA 3ZIDA 1MJ5A 4WXEA 5BVHA 4RFSA 4M1YA 1E0AA 1VJ5A 2LCQA 1CZRA 4AS2A 5EUQB 1LK0A 1T9DA 3A4VA 3FSEA 3PCTA 1MO4A 5J9FA 2IZ0A 2EJBA 1IIBA 1Z2DA 3F7OA 4LY6A 1DELA 1W5BA 1PDOA 1P2DA 1ZH6A 2DFNA 3DMTA 3R6DA 4IWXA 4GZ3A 1P4SA 1J90A 2EFCB 3U1VA 3PPXA 4ILKA 4E33A 4IEIA 4B45A 4KRFA 3WGOA 1X13A 2R6AA 2IP2A 4Y6QA 1E9AA 1RPTA 2DUJA 2JKZA 2ZUTA 2HPVA 2O7SA 1H3NA 2AS0A 2QMZA 3C3AA 1JEYA 3O1IC 1Z82A 1V11B 3G1TA 5B6PA 1AGNA 1S01A 1JALA 1VHWA 4RPJA 1RRKA 2L2QA 3VX4A 4BVJA 1YOBA 4NBTA 2GEUA 4S35A 3O2SB 1IN4A 3D5TA 1MBZA 4EI9A 4TSFA 1PLLA 1R9MA 2G80A 2FPPA 3AUYA 3I72A 3HN2A 2DF8A 1H6AA 2R85A 3GMIA 2CHGA 2NU8B 5CEJA 4TMXA 1MD9A 1ZVKA 2CHQA 5AW4A 1J0XO 3Q6NA 4NJMB 3BEOA 1CERA 2ZSIA 1U7HA 1ZCZA 2I7DA 4OX9B 2JLSA 1WD7A 1VJ0A 4U7PB 1UT5A 2WK1A 5FAXA 3HL4A 1AG9A 3L43A 5FX2A 2QV7A 3FPKA 4IIEA 2C7RA 3VR4H 2CF5A 2WG2A 5ALJA 2BFFA 4X97A 4IXTA 3RR2A 3GAZA 3RJMA 1NQXA 4JDPA 4RQBA 3TX6A 2I2DA 5A4AA 1KI9A 4XIGS 1KYXA 2B94A 2BEUB 2YWRA 3H1AA 4FUQA 3GWGA 4HWOA 2IBSA 4GPBA 1YH3A 2EDCA 3FUXA 2C4WA 1B41A 2QRMA 3WYFA 2I78A 3DZDA 1ZYUA 5I7UA 2QENA 1RTKA 1XYYA 4FLMA 3KR1A 3FB1A 4MINA 4Q19A 1ZM4A 2HOQA 5FTJA 5HQ3B 2P65A 3OCZA 4CNBA 1YI0A 3KDSE 3U13A 3LBNA 2G36A 2INGX 3EK2A 3L6CA 5J4YA 2DGDA 1IZZA 5JC1A 2EP8A 3OWHA 1ZDMA 5ALXA 3FVQA 3O94A 2NO7A 4M89A 3NNSA 4XOIA 3KYBA 2FMTA 1UMBB 5CMLA 3RIYA 1N92A 2QW1A 2O57A 4H7KA 3FIUA 4P5DA 1HE1C 2VXYA 1V2GA 3UBMA 4QPZA 1CKEA 1HLGA 1KZ4A 5AKGA 4B32A 4ESHA 4M76B 1P2SA 1QLWA 3QWHA 3S1SA 4B33A 1YQGA 3NHFA 1B0UA 3FW1A 2E89A 2CKMA 2F7SA 1XRPA 1QFMA 2A1UB 4GX0A 1OBFO 1WNTA 2B4QA 1ICEA 3GEGA 4PGGA 4AMGA 4OB8A 1XG5A 4LOAA 1U31A 4NYMQ 1Z06A 4JCOA 2V3VA 1SGWA 1C3OA 1SZPA 1B74A 2YWBA 4MB2A 4BTVA 4RH3A 4XTCS 3SWWA 1ZICA 3AILA 3G17A 4HCJA 4MA4A 4RYLA 4QARA 1ZWKA 1K92A 5AM0A 4DFDA 3R0JA 2D54A 4PZAA 2AG8A 2FP3A 4NOJA 2CXNA 4B87A 2ZB4A 3EPJA 1BE1A 1S8OA 4Y2QA 1D1SA 1DAOA 2Z09A 1BDBA 1T0JB 1TKAA 2PGOA 5I4KA 1QYDA 1W4CA 4ZEWA 5KYYB 4DA4A 3DBHA 2CVQA 1Q0PA 1E4YA 3B1WA 3DKVA 3GR6A 2G07A 3JWJA 2QM0A 1L1FA 3Q8MA 1LK5A 3OZWA 1I13A 3GLGB 4F06A 4INPA 2DULA 4L74A 1KFEB 3FTCA 4AO6A 5JE8A 3H5AA 2X9GA 3PEFA 4LOKA 2F1IA 4FEGA 1ZI6A 3IEMA 3M2TA 1IN5A 1P5JA 2W6QA 4IRXA 1MLDA 1M6VB 1VKJA 3R0IA 1O7JA 4LFCB 2X8LA 1DXOA 1JG7A 1CJMA 1FY2A 3TRHA 1F20A 1R1DA 3F96A 4N01A 3L4BA 2KSQA 3OJXA 5A9SA 1EGVB 3QVXA 3PFKA 1TU3A 2PXAA 4BNHA 2B0CA 1GIAA 4P3OA 4QREA 5TX7A 1D0VA 1SVLA 3JQ7A 5CNIA 3ZHTA 1LJ8A 4DLSA 1EFCA 1PYOA 4Z4FA 1RWMA 5TEWA 5HK9A 3D0QA 1DHRA 2WYHA 1VPLA 3CNQS 3GVPA 2J4CA 4D9CA 4MJXA 4FYYA 1UWLA 5D5PA 3FGZA 4Y1RA 1DEAA 3EZNA 1V1RB 4WADA 1L5HA 2B25A 3QFSA 2OYSA 4UMEA 4AG5A 3W3AH 3E7PA 4D5EA 5JD4A 2DSTA 1HFKA 3LSTA 4P36A 5LYJF 4OQPA 5BNFA 5LMNB 3HS3A 4F3YA 3VSBA 3X3HA 1E92A 5L9AA 4RM2A 2EDAA 1UBSB 4IPTA 3EYWA 4Q1FA 2QP4A 1ZIYA 3JVDA 4ISCA 3FJ1A 4OMFG 1V48A 3S6JA 1H1TA 4X7RA 1MOSA 3EMBA 4F8JA 1IAVA 1PGNA 2XXBA 1T2FA 3OX2A 4H0NA 4P53A 1EFVA 4PFQA 4KBGA 3MHTA 1IZ9A 4CCYB 3KQSA 3MT9A 1I80A 4LY0A 3SQLA 4DREA 1FFWA 3CYFA 2XE6A 1YA8A 2YS6A 2CDAA 2PWBA 3EOZA 2J5KA 3VX3A 4IO0A 2ZJ5A 3C6KA 1SQ0A 3N2EA 3UB4A 1CY0A 4G89A 2WVAA 5HVNA 3MMZA 2V7XA 5JWHA 1HOTA 4YRGA 4JCCA 4YDQA 1V16B 4PLGA 1BDIA 1V3TA 2CLOB 2VPTA 1NJ6A 3NHMA 3RVBA 2GFHA 1BCRB 3EC7A 5IK2D 2I1QA 3OF5A 3FTDA 3TGWA 3U62A 4MS3A 1GGNA 4QQFA 5CXXA 1UMDA 5BOSA 3W1VA 2VTBB 4BQRA 1L7XA 3PBKA 5FF9A 1KJIA 4KG7A 4XOUA 4L7VA 2PGLA 3PK0A 4PNZA 3K9NA 2VP4A 1VKZA 3P2MA 4UBMA 4NCHA 4Z9FA 5FYDA 5JAIA 5ITZB 4F86A 1I2MA 2FSVC 5F9HA 1EBBA 3V8MA 4X91A 2G1AA 3UC9A 5KPJA 4E51A 1FNMA 1UANA 1W34A 2F43A 2KJQA 2QVCA 2VK4A 4BUCA 4XWWA 1ZX1A 2AWNA 2I3GA 1CLUA 2LXNA 2Q4EA 3N8KA 4PYIA 4EHHA 4X20A 2PD3A 3ZG6A 1E18A 3FSGA 2LD4A 4P4SA 4UKDA 1H0SA 3W6UA 1OLOA 3KZMA 2OKGA 5C34B 4MUBA 1BJRE 3STHA 5JNUA 3B36A 5J4LA 5DBOA 4DMCA 1I1QB 1VJRA 4Q0MA 4R51A 1F38A 3CLHA 4J1SA 1DLJA 4GSYA 1RQXA 2VATA 3I9V1 4FFDA 4MGIR 1C9DB 4GYYA 4DS3A 2ZRLA 1PJBA 1NQUA 3UXMA 2GO1A 3PPYA 6Q21A 1YGYA 3JSAA 4LN1A 3GXOA 2WJVA 4N1AA 2LIPA 2YHBA 3UJDA 2X6RA 3GH3A 4DCGA 4A2PA 1SVMA 4HVCA 3T6KA 1SQ5A 4XWYA 1F3OA 4B09A 1GN8A 1E1RA 4V0SA 4LRQA 5H82A 1CJBA 3RJ5A 5JC8A 1RACA 2I3DA 3KBBA 4YIHA 1SO8A 2WJAA 3ABIA 3MTGA 2IDKA 1DIOB 4HWTA 3UAOA 1X39A 4XM0A 4PC7A 3N2KA 3GOQA 3AT1A 3O4RA 4Y2GA 4QYIA 3SYKA 5DHAA 2QUZA 1OXKB 5KNDD 4FW8A 5H80A 2NP6A 1P60A 3I32A 1V8BA 2Q3CA 4UM9D 4ZIRA 2NSJA 1GA4A 3PC3A 2RJOA 2CKDA 4KO4S 1GO2A 4IVQA 1ZMBA 4GDMA 1IK6A 5LUAA 2W4QA 1U9CA 2ZIFA 4KK3A 2HJHA 1YA4A 4DSAA 3EBLA 3MWDB 4NCIA 4A27A 4MR8A 5F5NA 2GLTA 1HDGO 5EAIA 1Q0QA 3EISA 3FTQA 4MW7A 4AECA 2EBHX 8ADHA 3HM2A 4RTJA 1O9GA 4FR0A 4NZYA 1M1YE 2BUBA 3UWPA 2QRJA 1GPYA 2RGEA 6AT1A 2OPBA 3K15A 3IE0A 2J9ZB 1MIOA 3L5OA 4G9GA 4R8MA 4GC5A 5MF6A 4F5EA 4B3HA 5LA6A 1FJXA 4Q00A 1MH1A 2WVHA 1MFZA 2CL6X 2IYNA 4JJAA 1T6NA 3DVQX 4BMPB 4A6PA 4NTZA 4CQMD 1D1PA 2IH5A 1C3VA 1W8IA 3RT1A 2OQRA 1Y4AE 3GP3A 3WADA 5CFPA 3DWEX 4H15A 1V3UA 3AR5A 4TQAA 4JC4A 3T9BA 4Q15A 1Y1TA 3GJ8A 4GRAA 2Z83A 4EK9A 2Y6UA 5CB4A 5JHGB 1XA4A 2FPRA 3PZRA 3D7RA 2QQGA 3LFHA 3H2KA 5JEDA 1TF2A 4AURA 4ZXFA 4DMLA 3FKSD 4YJHB 4ZA2A 1TKCA 4J0JA 3R9XA 3T9DA 1Y9JA 4L4YA 3DEHA 5MGNA 1HFWA 6YASA 2L82A 3MTBA 5FOXA 3RRXA 2JC3A 4OHPA 3DE2X 3KK0A 2YJZA 3NHAA 4MVJI 1JDVA 3MRVA 4TUYA 1QIJA 4U3JB 3TZHA 1PNVA 2E55A 1IMOA 1GQRA 4EQZA 1C1DA 3Q7TA 1P5ZB 3F4KA 3G0DA 3EGWA 4KGVA 1A9QA 3VBEA 3GMDA 1G0NA 2XB9A 2VDJA 3OAAD 3WNBA 3MWJA 1GARA 2QRVB 2ZUUA 4DQVA 5FWXB 1T1JA 3A2NA 2K4MA 3AY3A 4EECA 2ZZMA 4MWBA 1E7SA 2CD7A 1FMJA 2P2CA 3FUTA 1E9FA 5LDGA 3G9ZA 4G5FA 2CV2A 1DRWA 3IMGA 5GWXA 2AJBA 4C6TB 3FOZA 1PX0A 1XXHA 2V7VA 1Q1BA 2XNJA 3BXPA 1O95A 4OAPA 2ZWAA 5ERGB 3S99A 4YUYA 1U2QA 1XMJA 2GHRA 2VS1A 3EDCA 2BFNA 1AV6A 1XRQA 1XLVA 3OLZA 3OPYI 4BFSA 1A69A 3NRBA 1W59A 1O94C 3EUWA 3THRA 4E1BA 5BUZA 4GOOD 1MVNA 5IZ4A 2OAEA 4FOLA 4R8VA 1R3DA 1L6IA 4KR2A 1ZMRA 2ZUBA 1DWPA 1YAJA 3JW8A 3K2EA 3JD1A 4H17A 4PHHA 4FI3F 1AMOA 2K2QB 1R5JA 2PGAA 3S40A 2X2FA 3H9EO 3PQ7A 2IUYA 4R68A 5L4LA 3G0CA 5GOTA 4IDBA 1O97C 4OQFA 5LQNA 3OZDA 4ZRMA 4FN5A 5ER9A 3RIHA 2R8RA 3ZXUB 1JIQA 4X41A 3ORQA 1OMOA 1CJUC 2VWHA 1PZGA 4UBKA 4CKXA 3NPAA 4YPOA 5JZBA 2CFIA 5JALA 4LV6A 3WQQA 1TTTA 5G0UA 1OPRA 5BQPA 4EQ6A 3KQWA 3U81A 1IIRA 4NFSA 3FROA 4D4JA 4NU6A 1KH1A 1HFJA 2SKEA 4KC0A 4YCBA 2X22A 2G08A 1VECA 2FSSA 2J9GA 2JFWA 1VL0A 4JX9A 4BNNA 4MI6A 3JYHA 4F6RA 1JQAA 2JFOA 1FDTA 1UAYA 2XCTB 1JIIA 2I34A 4BKOA 5B7QA 4HO1X 3PGXA 4TSRA 3AHIA 2W11A 4JL6A 4MUMA 4Z2YA 4BP3A 2H2GA 2AKYA 4OMCA 1N6RA 4MKHA 1GT6A 1YIDA 5DWDA 3VZCA 4DMRA 2R1TA 4C78A 5CA0A 3DP9A 1T8UA 3R23A 1T9HA 2BFMA 2VDUE 4K3VA 4TMFA 4MRMB 5EIWA 4U7FA 3GCXA 5J5AA 2HJGA 3GUZA 3ZY6A 1F2VA 1NY5A 3CPJB 3WIDA 1SWVA 1KMNA 4CF3A 3LQYA 4ZVRA 2QTBA 2XNCA 3W2TA 1M1YB 3L7CA 4MUJA 5EA2A 4EPXA 4G5GA 4GEKA 4BLWA 4MGYR 3G8CA 1OVMA 3G2IA 1AZWA 1KNQA 3P27A 1EE9A 1KK2A 1FFAA 4XYMA 1GTZA 1LBSA 2UZ1B 2XQIA 3DLIA 2VRBA 1AO0A 3AV0B 2B5WA 1H1LA 1OV6A 5HKLA 3V5NA 3WB2A 3G2LA 3VPSA 2FQ1A 3G2OA 3IODA 1L6RA 5AJWA 4AAYA 1ZQ1A 3DHEA 3QMWA 2FUG1 5BSWA 2C42A 1D4OA 4OQ4A 2F9MA 1F7VA 3UF0A 3CPEA 1YE5A 2Q8QA 2O59A 4QOSA 2BCGY 1U65A 1VYUA 3MD0A 3O2NA 3MWYW 3VVLA 3CMMA 1E2LA 3QJGA 1J0CA 1ZM9A 3LGSA 4OH7A 4B71A 1IWPB 3A6FA 2Z9DA 3SQMA 1YDHA 3SHFA 3UJBA 1W5TA 3CX6A 4R16A 2H0AA 2QW8A 5DEOA 5C7IO 1WZ2A 2R2AA 3OFKA 2GJ4A 1GGVA 2G0TA 3QZUA 2XMZA 4QYWA 1CQXA 3L7AA 4HDCA 5FPQA 1DINA 1WPXA 3KB1A 3TXYA 1J4AA 3PHCA 2R7MA 4MP8A 3B52X 5J43A 4EM6A 4HRYA 3HU1A 2BY4A 2Y1XA 3AEYA 4JQZA 5IAAA 3I92A 3A6EA 3H5LA 1MQ9A 5GM1A 3AYXB 3KPVA 3NDBB 4ZK2A 3UQZA 2NPFA 2GM9A 3AMVA 2RH9B 5BWNA 4HX5A 3HDTA 5KNCA 3DOIA 1REQB 1TO6A 3F5DA 1RABA 4C6SA 2ZJYA 3NYQA 4TVOA 1KR5A 4HUQB 4H3HB 1T26A 4JI3B 1AQ6A 1SC1A 1NW7A 3ROKA 3S2SA 2KB0A 5MFZA 1F2UB 1I51A 1W73A 3DQQA 2ZULA 4FOTA 5DLYA 1GR1A 1TEXA 5IJ9B 3EXHA 2X41A 1YQUA 4JFAA 3UIEA 3AVYA 4FEAA 2B8NA 3IB3A 3QU9A 3UCFA 5JUWA 1GTG1 4OMUA 3ST7A 4BNFA 4MAMA 1BROA 3OOHA 2X7JA 2MSCB 1YSCA 3L05A 3FNIA 4Q1VA 5DLQC 1FUIA 2C04A 4R81A 1M8FA 3GLTA 1NR7A 4G0YA 3B7GA 3QXSA 4G2TA 3HN6A 3PGA1 4I1YA 5AHRA 4CHGA 1E32A 2ZUEA 3FZQA 3LVBA 4J4TA 5U1PA 3DHWC 4ETIA 4WACA 2VPYA 1PX2A 4XUGB 5B2FA 3ZCVA 4RO0A 1UMCB 5G41A 1GCOA 2UKDA 4QTZA 4JX8A 3C15C 5HFAA 5JSYA 2MYTA 4CR7A 5HYVA 4AF8A 1VJTA 5TPZA 3EDMA 2EG9A 2TS1A 3BQNB 4OMDA 3W2HA 1P1FA 4OD0A 3SC3A 4FLFA 4H18A 3GC6A 1L4LA 1WUIS 1V95A 2IXGA 2YXEA 3GCGA 3NP9A 1FMCA 3LTEA 1L7AA 3I76A 2VYFA 3L1HA 1JG6A 3SMQA 1D2AA 1C9NA 1E9SA 1IG3A 5CA1B 3G1WA 1KAOA 4ZVLA 1KEVA 1OH8A 2WYWA 1WP9A 3PT9A 4F2DA 1IWOA 4MVJP 2BTQB 3BXOA 4YCNA 1A2OA 1IZ8A 3TKLA 5DN9A 1XHLA 3BIOA 1P1BA 1BWRA 3ND5A 4NBRA 3REQA 1U4SA 1Z5PA 4EVRA 7YASA 2IJGX 3AJDA 2PX6A 3CRW1 1CD5A 1E6KA 1BGXT 3UENA 4G3XA 3IEVA 4ZCRA 3QBVA 4ZDKA 2I4OA 2ECPA 2V7EA 2VT3A 3OJCA 4L3VA 1U28C 2C83A 3HR8A 3PEEA 1Q1NA 1FFBA 1WMSA 3HGTA 4R7ZA 3HVRA 1I4EB 4NP6A 2A8YA 3MIIA 4DMMA 2Y1OA 2ZROA 2QJWA 4DSUA 1WJGA 2EC5A 2KI5A 2RGBA 2ZZKA 4ESOA 5IBCA 3FOEC 2DQYA 2RB4A 1F8XA 1O96A 1V7ZA 2GEDA 3H9CA 3ONEA 2FEPA 2XMBA 1KPHA 3TEJA 1KQ3A 2GETA 3OLXA 1QHGA 4XH9B 1NM5C 1XAJA 3N7UA 1U7PA 1C4OA 2RAPA 4KO3S 2PNFA 3KOXA 4N47A 4ZU3A 5GVSA 2ZRFA 1UJ5A 2ANCA 5K0SA 1P7ZA 1FQOA 1WBJB 4QGSA 1HDXA 4CMIB 2R68A 4B4OA 2WIAA 1JG2A 5ALDA 1HE5A 3T5AA 4YT2A 3AZPA 2D2XA 4HH0A 4TWRA 4M9SA 3ESCA 1ULSA 4QGBA 3WGJA 4YMVA 1N25A 1VMAA 4WXPA 2H7CA 2WF7A 1FS5A 3ON5A 3Q4GA 1QXSA 4NABA 2GS9A 4TLDA 4DTCA 5JSQA 2FI1A 2EHJA 3KEMA 2BR4A 3PI6A 2P2LA 4N5IX 2XH8A 4NE7A 4WJZA 4R83A 1CR1A 3MWLA 5C1OA 4IR7A 4DV4B 4LISA 3DMYA 4Y98A 2P3QA 2PTGA 2QIOA 3DZJA 3QEOA 4QOGA 4BB0A 1IHPA 1UXOA 2PN1A 4BAUA 4WZZA 3H5TA 5ICFA 3F73A 1NW5A 3PUVA 4F4HA 2MYPA 4PSCA 4EYQA 2VXCA 3MAJA 1XK7A 2IYOA 4TXMA 3NBMA 1R6TA 5G1PA 1JFSA 1DQSA 1KO7A 2ES4A 4GRDA 4DDTA 3P26A 4UHBA 5C3UA 1LV8A 4D80A 3BMCA 2JAQA 1RLIA 3FG9A 4OHXA 3O8BA 3BCRA 1T15A 2W22A 3IDFA 4WY8A 1DFIA 1I4LD 1RW4A 5M5BA 721PA 4CFSA 2C1EA 4NZOA 4AY4A 1DAFA 1YV9A 3V46A 5I45A 3W0LB 4UU1A 1NRXA 2V4MA 3L93A 4KFUA 3PX2A 4M99A 2ZRNA 5JCZA 4JP1A 2GESA 3A11A 3HP4A 1DV1A 4URHA 3YASA 2AC2A 4COKA 3UICA 3GAFA 5DNDA 3V2IA 4BO1A 3QELB 1RI4A 1VZ3A 3S2FA 4HLDA 4O4HF 4R2LA 2A0XA 4UJ5A 3V4OA 4Y1GA 1XJ5A 3TKAA 4KIJA 4W8OA 1IEVA 4KSCA 3LWNA 1I6LA 3JQFC 4BVKA 2L18A 3M33A 5EIAA 2IHBA 5ED4A 1PKEA 1FYEA 1W5AA 2W98A 2C98A 2W83A 4K6HA 2FSFA 3EQ6A 4OLHA 4PYRA 3CO5A 5LBUA 4L02A 2PX5A 1EG2A 5DP1A 3NAMA 3EH1A 3K8ZA 3HU5A 2CFRA 3QOXA 4E11A 5E3JA 1WY7A 1YFZA 2VQFB 3ET4A 2Q2QA 2YYSA 4ETNA 4W1QA 1Z74A 5A7FA 4BVLA 5EKSA 2DPMA 4CM9A 2DQKA 3RYFB 2UU9B 4RZSA 2PBRA 4OQNA 5KYXA 1RAIA 3GXBA 3NC1C 3D7KA 3ZGVA 2AXQA 3TS1A 4FGUA 1VB5A 4JKYA 2PNJA 5CFZA 3SYLA 1G2PA 1TXGA 3OG9A 2QNBA 1E0DA 3G49A 2DECA 3JAWA 4TQGA 2X0JA 1OBVA 2GD1O 2I9PA 2RAUA 3LZ6A 3FOAA 3DBLB 3QKSA 2A0YA 1VA5A 3ABOB 3KU1A 4M1OA 4BO7A 4LJ5A 4HDOB 5KC9A 2FHPA 3MYRA 3TECE 3OZGA 2VXOA 2IGTA 3D6VA 4JT2A 5DX8A 3GVIA 4Q9DA 3PWTA 1ZW1A 2B7BA 1EEXB 4DA7A 3QW4B 4HH1A 2CXUA 4V0NA 3LGAA 2WDPA 3IKMB 1W0KD 3UJ9A 4LJ7A 1YB1A 4LX0A 1Q0LA 4JFRA 4W6QA 3DE1X 2XTAA 5HK8A 3B3JA 3KAJA 3BD8A 4WL0A 2O54A 4XYBA 1VTKA 2O7QA 2Z6VA 1ODSA 2FV8A 3CE6A 3T4UA 1J1IA 3M6WA 3VC2A 1EFPB 5HDBB 2CUNA 2VTEA 3ULKA 4ENVA 5IMSA 3AI2A 4IHKA 4KLRA 1IWBB 4DC9A 2KX7A 3HVKA 3HCWA 2NV2B 3VR5A 4PG6A 2J9FA 4ZDWA 1UBUS 1J25A 2UYQA 1BXRB 1GQYA 2WFLB 3BEDA 2C9MA 2QXTA 3CH4B 1WZUA 3NKLA 1XN4A 1E8MA 1J8FA 3LT0A 5B3JC 4RY9A 1H8EA 3R9KA 4ND4A 2W8ZA 1F1BA 1G291 1QTNA 2GNOA 1MRZA 3P0HA 1CDEA 5AM2A 2N9UA 1MB2A 1IXSB 1AD2A 4EZIA 4WDRA 3HRKA 1T35A 2WY2D 2AH5A 1CUWA 4WGGA 3ZCUA 1GSAA 4R0NA 4POAA 2OCDA 2HB6A 4CUJA 4YP5A 4I55F 4KSYA 2JFGA 2QTMA 2AYXA 2I2XB 2ZIXA 4O4HB 2WJ4A 5EFZA 2RHOA 3OWXA 1ZONA 2FZWA 2PSDA 3I5MA 3H7AA 3Q0IA 821PA 4KFTA 1H9BA 3DEJA 4HQOA 2B3DA 4NDNE 3MINB 2Q07A 3QG1A 4US0R 3PGMA 1DBQA 4JUFA 3F8TA 5BN5A 5LL6P 4NMLA 2ZYHA 1CY7A 2ZPAA 1UR5A 3FMVA 4MULA 3LZDA 2QORA 4DHEA 1C7FA 1K6MA 1ZM3A 3KTOA 3ZN2A 3E1GA 3G2NA 4G4JA 2CJPA 2GA8A 5AIAA 2XAUA 1BX0A 3GJQA 4ZGGA 3H5IA 3KXIA 5SV2A 4RSGA 5JS1A 5J4KA 5IANA 1ZMOA 3I9V6 2A84A 1SAYA 2ZYWX 3WHIA 3WRXC 2G3YA 4ZGBA 2NXCA 2JVJA 3MSXA 1ORHA 1HI9A 2O1WA 3UUFA 1C4WA 1CY4A 1FJHA 1II0A 4D45A 5CHEA 5T8KA 2OXTA 2OV3A 1NYRA 4D7AA 1N2GA 4KQGA 3NBAA 3DMRA 1ZHFA 3FDJA 3Q8LA 3LHIA 2DLCX 1XZEA 1M54A 2GZHA 2QVLA 3MUNA 3N7AA 2JJ2D 1M2KA 5BURA 2IYFA 4WGFA 1MW9X 4BB9A 5JQGB 4WX2B 2I29A 1GRRA 3HSKA 3KYCA 2F8MA 4COOA 1PI3A 1YMVA 1QPBA 1T5DX 5JNWA 1LY1A 2C2WA 1R7RA 4Y6SA 2D1TA 3IRUA 2JGNA 3PZBA 1YHYA 5E4YA 3AGPA 1ONOA 4O33A 1DBRA 2WEKA 3P2YA 3TL2A 1FNSA 1SKBA 2VNJA 4HJXA 3UJPA 4UTPA 1C8LA 3ZWVA 4C7VA 4ZCQA 4GLBA 4FSDA 3ZZ0A 4HT3B 1E79D 5LQSA 3OO0A 1NXXA 3M9WA 4Q4HB 1G98A 1N9GB 4V1CI 4QHTA 5AKYA 3ORRA 2XE4A 1XRLA 1TVKA 2WJHA 1DBSA 3AEUB 3VR6A 3REGA 4BE4A 4K46A 3R5HA 1EUQA 2ECKA 3LCCA 2WM3A 4PYKA 1HT0A 4D3SA 2VJMB 1UC5B 5C35A 3TD2A 1Y9AA 2ZRDA 4W1RA 2A9PA 1DRVA 2PRKA 4OK3A 4Q48A 1JAHA 2A2ZA 4UAGA 1M75A 1SB9A 2AV6A 2E4UA 3QEAZ 2W6ID 1KJZA 1CV2A 1Q20A 3CR7A 3REFA 4HQKA 3IEPA 1RHUA 2HJ9A 4H6PA 4IFTA 1OXUA 1FLDA 2QEQA 4MYUA 4BBAA 1DOZA 1Z7BA 3DO6A 2CLCX 2R6FA 1HYBA 1YB2A 2CNLA 3GDFA 2Q5CA 4N7MA 3WK8A 3NXSA 1E58A 4X8MA 4JU9A 2IS1A 4WPGA 5K3OA 1IMJA 1R6AA 3J81k 4DUYB 2BGMA 2WW8A 4M9QA 3RK0A 1A1SA 3WI7A 2EOAA 2BZSA 5GTDA 1F4PA 2P4SA 1FXWA 4PZEA 1MV8A 4HXYA 1TA4A 4UDXX 3CHYA 4PCLA 3RT9A 9LDBA 2WSBA 1RT9A 1VI5A 4LXQA 1LVGA 1UJMA 1LH0A 4X1IA 4UVIA 4ADSG 4BEVA 4ZJPA 4WJLA 1C30A 4I6EA 4XDYA 1W9HA 3NM6B 1U2GA 3AUUA 4M2LA 3BIXA 1VLHA 1OI2A 1UFQA 2QQ5A 3ANXA 3ROEA 3TXXA 1AXRA 1P77A 3O4VA 4YP6A 1SXJE 4HAUA 3M1IA 1XZAA 2C4HA 3IDQA 4CEJB 2XYVA 4R2IA 2IKQA 3Q88A 3R3HA 5AI9A 1KZ7B 5AK6A 2OXCA 3HVIA 2F3SA 1ZOSA 1QE0A 2WB4A 2IUUA 4PM4A 3ILHA 1DUIA 1YS4A 2ZYSA 4EUEA 1PTJA 1QPZA 3A3KA 2GK7A 3PSHA 1ADCA 1N5DA 3DQPA 3T7KA 5JH7B 2XCQA 4OKNA 3T1HB 5T41A 3BAFA 5DHFA 1E1QA 3O8QB 1KP2A 2AL7A 2R65A 2HDHA 3F4LA 5EZYB 3TIFA 2Z6UA 1Z0DA 4YX9A 2YOGA 5EFOA 5KOHB 2PKEA 2HV9A 2WAXA 3NPMA 5A03A 2CUKA 4UTXA 5IKEA 2PPVA 5HBGA 2PWPA 3R4CA 4HUTA 1U7ZA 1OGYA 3L4SO 3Q6IA 5THXA 4LF6B 5EPEA 3QLVA 3F78A 3E53A 1OC4A 1ZK4A 1QO0A 2GPBA 3JQAA 4YUVA 2OHVA 3R3VA 4D1YA 4BNYA 1JIXA 3GRUA 1JIJA 1QH8A 1XE3A 2Y93A 3DZ8A 1FTYA 2H4JA 3EVFA 4RLSA 4UVEA 3H1BA 2GCOB 3PL5A 2HEIA 4ZQFA 3AQIA 3R5KA 3S8EA 1T1GA 4IIJF 5CK5A 4BWFB 1Z5UA 1ZEMA 4FDTA 1H1DA 1ZGGA 3G2KA 5ENDA 1TQ8A 2FW6A 3AEQB 3SC6A 5B36A 2JVKA 4V38A 3MB8A 2PX4A 4OGWA 4JGGA 4KP7A 4RCYA 1VJ1A 1YGPA 1PV1A 4KYTA 4AU1A 1L1RA 2MHCA 2HU2A 1A5BB 2OCXA 4IIUA 1B8OA 3U4CA 4ND3A 3U3OA 2CL7X 2JCSA 5IAEA 3OFVA 4U1RA 3I64A 4CL3A 3CLTD 5E4FA 4PFJA 1NUUA 2NU6A 2JAPA 3BJIC 4WKBA 1OFUA 4LRTB 3TVDA 5FBRB 2B9VA 1P0PA 3B51X 5KU7A 5HGJA 1SVOA 2NSLA 1BFDA 5GP1A 5DN6A 3WQSB 3GLUA 4FDAA 2CYAA 2ZM6B 2H2DA 1HV8A 3PRJA 4TGLA 1K8YB 4TWJA 1NQAO 2JGRA 4QOEA 4DIOA 1NF8A 1JUDA 1XV5A 4CKWA 3KLPX 2W2PA 1IOLA 3EFEA 1PO7A 4IUYA 2XQFA 3F6YA 5A71A 5IFLA 3F74A 4IQGA 2JAUA 4MKFA 3KEFA 2JEZA 1SBYA 1VHLA 1DX6A 1QP8A 3D4LA 1HSZA 5A6VA 3L0OA 2DY1A 3DLAA 4UAJA 4OH1A 1ZL2A 3LD9A 2Y3IA 1KEZA 3CT6A 2A0UA 2RAFA 5E95A 2Q9UA 1A2BA 4FE7A 3JVIA 4MHTA 2XEXA 3EASA 3PXXA 5IKXA 2NNLD 2C96A 2HWXA 4O2BB 4IFIA 4C08A 2C2YA 1QNFA 4P8RA 1C1YA 3ROMA 3ICWA 5C5CA 2BGTA 4YJ3A 3FWKA 1AKEA 2QT9A 2C03A 1OX4B 4RF3A 5TJHA 3WFJA 1V4BA 221PA 3GFOA 5TMPA 2FUG6 3DDSA 5EUBA 5TC4A 3OP1A 2M1XA 4EMTA 1ZHOA 3JARA 2QMOA 2HWUA 3PIRA 5JJBA 1FIUA 2HK9A 4I50A 4BS9A 2MDTA 1P0IA 5BY2A 4S24A 3GD5A 3O9ZA 3NWOA 1WIWA 2O19A 1TOAA 3O1LA 4TLCA 3ECSA 1FSGA 3HI4A 4L2IB 1Q12A 4CV0A 4C2UA 5EGNA 1FSZA 2YFKA 2H1LA 1D9ZA 5HG0A 1ETHA 1SXJB 2X9NA 5LQKA 2GI4A 4PEVA 1JFFB 1SBIA 1TYCA 3X1WA 1K7XB 3ZGLA 1ESCA 1NSFA 1Y5LA 4LMRA 5DBHX 4IJ5A 1FQJA 1VPVA 2W70A 4RTKA 4WK4B 2QX9A 1C9EA 5LYYA 4ARUA 2UYYA 3QKIA 2H06A 3LWDA 2Q27A 3FM9A 2NVBA 2ISQA 3COVA 1TJYA 5CIYA 2B6NA 1U2EA 3OEED 4G0NA 4X9XA 1AO3A 3AUSA 1KP3A 1UKCA 1XZDA 2O2SA 2YVKA 3F5QA 3KL2A 2F3TA 4HGNA 4FYPA 1SQSA 4EIWA 3C1UA 3LXXA 2PS1A 3EZ6A 4UNPA 2ZAGA 4UVHA 2B4KA 4TYWA 5HPYB 1JH8A 2B1IA 5A5EA 2ZG6A 4CEIB 4I66A 2J6CA 4IZHA 1KQGA 2BHNA 1ZITA 2YRWA 2F55A 5CUQA 3HO1A 1NKVA 4M7WA 4D8VA 4DARA 3L0SA 1ZN7A 1SUBA 4RACA 2JLQA 4TVKA 2DPHA 2QZ9A 3FMOB 4V0ME 4MUFA 4PC6A 5ECDA 3SFZA 4ZHQA 4K40A 4DG5A 1WAMA 2GPNA 3JAKB 2GCGA 4I2NA 4U2CA 3GGSA 3U1TA 2ZCJA 4L5BA 4QX6A 1WHTA 4B84A 2VUIB 2XVAA 3Q2OA 4JA0A 1YB7A 3CNNA 5GONF 3HM9A 3IGFA 4EMBA 2QRUA 3LHKA 3PLNA 3GFSA 3AL2A 1DEOA 2H2WA 2Z57A 2Q7OE 4B3DA 2HMYB 3MQFA 1YK1A 4HWPA 4Q18A 2HGSA 1J8QA 5TNXA 1RXIA 1O8CA 1QIHA 3GZNB 3KJNA 1DTEA 2A7XA 4DIMA 5JS2A 1S89A 3BMQB 4MV4A 3OZCA 1ONPA 1FQWA 2QRGA 1GKIA 4FLEA 3DCIA 4ZV9A 2O5VA 2HLPA 3F3SA 2QN8A 4HGPA 3N05A 4PZ0A 1QHXA 5K03A 4U39A 2YJTD 1NSTA 3EVDA 3TX2A 5E9JA 3IBTA 1O3YA 4ZAYA 4CDMA 2OGTA 5IJZA 1FZQA 3EEIA 2QL7A 1AGYA 1QAQA 2IIVA 4PIVA 1K66A 3HFRA 1KI8A 4EW2A 1H9CA 1BKDR 2JCXA 2MT9A 3DTVD 3JYNA 5G0VA 1KS2A 4FPXA 1XLTA 4WESB 3GLFE 2VPWA 4KE9A 3WA6A 1Z35A 2NX2A 3AJ9A 5KSPA 1WSBA 3ZY2A 4FS8A 4ZVTA 3AETA 1U0FA 1ZESA 3NLLA 2WQZA 3MHPA 1Q1EA 3UMSA 1V47A 1XTVA 3RC9A 3URMA 4CLRB 1UKYA 3QTBA 1RQRA 1P9RA 3LUGA 1BJTA 1C7RA 1TT7A 2P6PA 5IVDA 3EXG2 5CFMA 5ED0A 4FOPA 1NJ5A 2FPWA 3H9UA 3BH0A 3FNBA 4MMYB 4ENWA 3LTNC 1EFLA 2VNIA 3L46A 3JZIA 1QS0B 2LVBA 4L6IA 4L9AA 4BMYA 3OP4A 3L8ZA 5EUMA 4B75A 2BHLA 2HNBA 3NM5A 2RGDA 1DBVO 1B7GO 4DAOA 3LVFO 2VJCA 1OB2A 3VZSA 4IBOA 4P1ZA 3K1TA 1SKUA 2IPNA 3KSRA 3LCUA 2VC2B 3BWEA 4ZODA 3RJ9A 3SD7A 3BL6A 3G79A 4ZO9A 3TL3A 1W7AA 2BWJA 2F64A 3TOZA