3V4RA

Crystal structure of a uvrb dimer-dna complex
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
588
structure length
586
Chain Sequence
DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the UvrB dimer: insights into the nature and functioning of the UvrAB damage engagement and UvrB-DNA complexes.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/dna
molecule keywords UvrABC system protein B
total genus 189
structure length 586
sequence length 588
chains with identical sequence B
ec nomenclature ec 3.1.21.5: Type III site-specific deoxyribonuclease.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 3v4rA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v4rA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v4rA01
3KKQA 4JLAA 4CDGA 5DH9A 4LY6A 3TK1A 4BASA 1YZNA 1Q3HA 1GILA 5JHHB 3I5XA 2JLSA 2IEYA 4ILEA 1AKEA 1NLFA 4YDSA 5DI9A 1GOTA 3GLGE 2KBEA 3I8SA 2P6NA 2DFTA 3AKDA 2IYZA 4OJQA 2FGJA 4ZCLA 3QKRA 3BFXA 4K46A 2ZANA 1N6OA 3TUIC 3QXSA 5JSZA 1DAHA 1OH8A 1UDWA 2P65A 3EWSA 1P2TA 2RHDA 3MMPA 5HE9A 3V9PA 1C1YA 1E79A 4Q02A 1Q1EA 5B64A 2IS1A 2N42A 2QE7A 1N5LA 4DCNA 4D26A 4OI4A 4LPKA 2IBMA 1E2MA 3OEHD 3MJHA 4V0MA 4Q7KA 2FSHA 1RRGA 3BERA 2IYYA 4HB0A 4TQ9A 1CU1A 3UWKA 1AQUA 5H8WA 3EX7C 2QENA 2J0UA 5FR1A 4QG7A 1P72A 4LHVA 4URVR 2ZSFA 3DOFA 4UNNA 2IS6A 5AUOB 3FPNB 4I1SA 4JVNA 3BE4A 5EE9A 3G82C 4LPSA 1BIFA 1A82A 3ZQJA 4DCSA 4MITA 1OH6A 1EGAA 3TLXA 5IRCD 1IN6A 1JXMA 2KWIA 2A2ZA 2AWOA 1UADA 1PVOA 1J8MF 1QHYA 3T1QA 4B3CA 1BS1A 1OLOA 2W6ID 4KAXA 2R6FA 4ZCIA 1OV4A 4IOLA 2ERXA 4KJZA 1RC8A 3THWA 3WXMA 4QBHA 2AFHE 3QF4A 2GCNA 3RS4A 5JBQA 5H70A 4Q9HA 4U7DA 2OCPA 3THYA 2L0XA 5BN5A 3SFZA 4M1KA 2P6RA 1HA3A 4V03A 2DBYA 1SVSA 3M6AA 4OKSA 2DR3A 3F3YA 3RNLA 4CF7A 1S0UA 1NN1A 4YMUA 5J4VA 1ZAKA 3U7EB 2DHRA 1G3MA 3QY0A 1M7BA 2NTYC 3CRRA 1OYYA 1P2SA 4RD1A 1ESMA 1N2CE 4HZUB 4O2LA 1ZRHA 721PA 3BJIC 1ZC3A 1W5SA 2QM7A 3X1WA 3HU2A 3W5JA 3THXB 1WRBA 1UKVY 5HR5A 3I8XA 1WB9A 2VBCA 1N25A 3A36A 4BFWA 3PUXA 4KI0A 4JBWA 1G7SA 1NRJB 4JMPA 2Z43A 2ORVA 5SZJA 1NG9A 1VYUA 3UG6A 4JLMA 3GLHA 2NZ8A 3EZFA 3EC2A 1NLYA 4TWZA 4Q00A 4Q66C 1IQPA 1XTKA 3BS4A 5FTNA 3R9IA 2AKAB 4Y0AA 1JBKA 2Z0MA 1COWA 2Q21A 2VHQA 4JS0A 3A6PC 1LS1A 2UZIR 3AH8A 3EC1A 3OEED 4DRZA 3U4QB 1NKTA 2LCFA 4JLJA 3LY5A 1S9DA 4IEEA 3WMFA 3HP1A 1GKUB 4M9SA 1ZM7A 2W58A 1SXJD 3KFXA 4FCWA 4PHHA 4RCZA 4E22A 3ZD7A 1T5LA 1UM8A 4HLQB 4RKFA 2G0NA 2ZAMA 1M7HA 4MQBA 1KO4A 2ZQ5A 3M4YA 3VR2A 4BLTA 5J4LA 4RZ2A 2P2LA 2AK2A 4BE7B 4GPTA 3ZVLA 1YR6A 4ERNA 1IONA 4JVLA 4WZBE 3EPKA 1YHNA 2VLIA 3AGPA 1P2UA 4YXWD 3CX8A 4HLUC 4WAUA 4OHWA 1G16A 3R9WA 1GITA 2X2FA 2XAUA 2V7QA 3QG5A 4IDOA 1RRCA 5EXSA 3P27A 3C7KA 3VU9A 4G5SA 1BO6A 2WMNB 2YOHA 3GLGA 2ODEA 1N5IA 2FSGA 4QBIA 4A0GA 3K0FA 4B33A 3T12A 5KU1A 4EPRA 4M9XA 3PUYA 3RAPR 4PSKA 1DAMA 1P5ZB 2EFEB 1MV5A 3NTUA 2H7VA 4P32A 2W6JA 3CLVA 2IYSA 4EJSB 1G1MA 3VR5A 4ZPXA 4KODA 2ZM5A 2IYVA 4LJ7A 3WNBA 2WIAA 1NL3A 1VHLA 3P32A 1KZ7B 2QORA 3Q5EA 1GM5A 2Q3FA 1DAGA 1UJ2A 1PUIA 1ZIOA 1SGWA 3KQHA 3GJ5A 3MG9A 4ZIRA 3T1VA 1N6IA 4KFSA 4M9QA 1VCNA 4CW7A 4URXR 2BBTA 4Q9KA 4TQAA 5GJCA 3NXSA 4OI2A 2XZLA 3Q8XB 4GMDA 1IN8A 4AKHA 1E9EA 3LQQA 3B5JA 3D6TB 3ECCA 4R9UC 3HPRA 1IBRA 2B7BA 1FUUA 3LLUA 1KZGB 3SBEA 2OV2A 2VL7A 1G8FA 4A15A 1P6XA 3ZIAA 4LUCA 4MKFA 1G41A 2ZYTX 1XCMA 1QG4A 1W0JD 4Q1FA 3FHTA 1TUEA 3PUWA 2O8EB 4GZMA 3MUFA 4C0LA 2VQSA 3VTKA 521PA 1DEKA 1KGDA 2AL7A 4LC1A 2WWWA 1UKZA 2WZQA 4D4MA 3NBZC 4BFUA 5B2ZA 3ZJYA 3W34A 3WNCA 1N5KA 2QQEA 4ACBA 4EUNA 2WJGA 1E9AA 2UZ3A 2WJHA 5DHAA 5CK5A 1QVAA 1G21E 4BGDA 5AUNB 2CHVA 2AR7A 1BKDR 2VSOA 5IK2D 1MT0A 1XTRA 3ICEA 4GP6A 3OIUA 2WJIA 2ZI7A 3QXJA 4HLUA 2GVDC 1OHHD 4FCVA 3B82A 4JKIA 3N70A 4IJMA 3X2SA 1W36B 1E4YA 4IHQA 2IT1A 3UMRA 3QBVA 5AK0A 1R10A 2XOKA 3AV0B 621PA 4A8JB 5JJLA 3FPAA 1P9RA 4P4UA 2OXRA 2CK3D 3QEOA 1A1VA 2QROA 2F6RA 4QC2A 4RY2A 2QPOA 1KK3A 2QMUA 2RMKA 2GJKA 1N6KA 2PEZA 2WICA 5FTKA 1GSIA 1J8YF 1OIVA 5CLQA 3GJ7A 2V7QD 3SS8A 2X77A 2Z83A 3E1SA 5BYKA 1Z5ZA 1BH2A 4HATA 2FNAA 1RRPA 3ZS8A 3QVUA 4QHTA 2ZI4A 4B32A 3QJYA 2WTUA 2AX4A 4LBVA 5DGXA 1MO3A 2MMCA 4QFMA 3ZVNA 1L8QA 2R6AA 2VIIA 1OT3A 1J2JA 2ZI6A 1IXRC 2ASEA 3GLGB 5EUMA 4RKEA 1D5CA 2IF0A 4CT5A 1WCV1 3LA6A 3TR0A 4DSNA 3B6EA 1NY6A 5L3QA 3AVOA 1DS6A 6Q21A 1CR4A 4X8MA 3SZRA 4GMXA 3A1WA 1V5WA 3GLHB 3AVUA 2KSQA 1N3BA 4RSGA 1DAFA 1NKSA 3QKSA 1NG1A 3KQNA 4LYHA 2GWHA 2BMJA 3LO5A 4MA4A 5JCPA 4OI0A 4Q03A 4DDVA 1JI0A 3QPUA 4LHXA 1QDEA 4C4PA 5JFGA 2Q0HA 3EA5A 1GL9B 1YR8A 2J46A 4RZ3A 3T61A 2QN6A 4EPXA 4RFVA 1GRNA 2OEPA 5J4YA 1W49A 1US8A 3EAQA 3ZGXA 4LYFA 1IY0A 1J7KA 2R6DA 4NYIR 4Q1AA 1KK0A 1E2QA 2VHTA 3GFOA 4ITRC 5DYGA 2JDID 2IYTA 3ADKA 5CITA 1CJTC 3C4JA 5CJ2A 2ZU0C 3AF3A 4FINA 1XPRA 2WM9B 2QRZA 3TIFA 2GK7A 2QMOA 1WA5A 1E6CA 4US1R 3B8HA 4QJ5A 1TL7C 1JPNA 3IIMA 5CLLA 3SYNA 2O8DB 5DN6A 2GXUA 1T3SA 4JSTA 4W5WA 2GF9A 3WHKA 4B34A 2Q3HA 1OPXA 4NBSA 3GLHE 3GLFE 4B3FX 4TTRA 2QTFA 3FDIA 1HT1E 2ZJYA 4CVNA 3IUYA 5TXGA 1ZVQA 2V3CC 4DVGA 1GTVA 2REOA 3AB3A 4HLCA 4B2PA 5KSOA 3B85A 1Z0JA 2JIZD 4TQUS 3FHCB 3KJEA 1E98A 2ZJBA 4GI7A 4MKHA 3WP0A 1FTNA 2WSSD 4JLVA 5KNBA 1JR3D 1CXZA 1M8PA 2ZE7A 3OIYA 1HUQA 4XTCS 3FMFA 3RS0A 1P9WA 1N6PA 3B1XA 1JR6A 4JJZA 2W2VA 5KNDA 4G1UC 5FOSA 1DO2A 4AD8A 4CZ2A 1LW7A 3PCRB 2GK6A 1Q20A 5J47A 1NBMA 1RPZA 4EFNA 2X8AA 4B6FA 2QU8A 1ZP6A 5LB2A 1AN0A 2IUTA 2G1JA 2BCGY 2QNRA 3W3AA 4P4SB 4IKEA 3AKEA 5KTYA 4UNQA 3AGQA 4DHEA 1DE0A 3ADCA 1E0KA 1K6MA 4MGYR 2ZIAA 3TSZA 4XSHA 1OIWA 4ZDJA 2VPPA 5SZHB 3KXKA 2LKDA 1S1CA 1KNXA 3QF7A 3A4LA 3RC3A 2HT6A 1ZNXA 1JR3A 2WKRA 3TAUA 3BH0A 4HAVA 1U8YA 2XXAB 4KFUA 4C30A 5KYKA 2NO7A 2CCGA 5L3VA 2F9MA 3KTAB 2GXQA 2ZJ2A 3CPEA 1FMJA 2QT0A 4LV6A 3I5YA 2ZUCA 1X8JA 2QE7D 2QI9C 2XSZA 3PJRA 1OIXA 2J1LA 1CLUA 4PHTA 4QBGB 4QHYA 3HU1A 3UPUA 2AK3A 4GL2A 2E87A 4XH9B 1S1MA 3K0CC 3FMOB 3ZDQA 4PPGA 1DADA 1YE8A 1F5NA 1A5TA 3CF0A 1T8UA 1IJEA 1G8PA 3IILA 1NJFA 4HDQB 2FSFA 3CIOA 3TH5A 4GDFA 1P73A 1QZXA 1QHHB 2YNMA 4DCTA 5DE3A 3CWZA 2MSDB 2C8VA 1DARA 2KB0A 4C0KA 3MCAA 5E7JA 1LNZA 3V4FA 4A8JC 4MGZR 2PLFA 4BZXA 1E2NA 4B3XA 3CPHA 1XEFA 4GOXA 2RAPA 2OESA 2CNWD 1DAIA 1SULA 5JS8A 2EU8A 3U6KA 2YKGA 3WBKA 4Q1DA 2PT7A 2PMDA 1XXHB 3KXLA 2WJJA 2CL0X 3BC1A 1U2RA 3FB4A 5FOTA 2WHXA 1T3HA 2EWWA 3RANA 4DBLC 5K8LA 2JDIA 2ZRJA 2GDJA 2OILA 3RSLA 3MWKA 2GJAA 2J3EA 2H1LA 3I73A 2W6IA 4DEXA 1W0KA 3B1VA 2ZEJA 1R0YA 3NC0C 4JJKA 1E2EA 1IY2A 4US2R 5FOUA 3H86A 1ZUHA 1P4SA 1OFUX 3VHLB 4TL8A 4JL5A 4LRWA 4KITB 2QAGA 3L43A 5FL7D 2RGEA 4EQ6A 3OZXA 4DEYA 1AGRA 2A5GA 3SJCA 4A92A 1WMSA 4Z54A 2ZSBA 2V4ZA 2GETA 3K70C 1H65A 3I1FA 2OE2A 3IQWA 1IM2A 3QKSB 1MKYA 4TLAA 1W7AA 1ZU4A 3VHXA 1G7CA 2VEDA 4E5UA 4NZYA 5ELXA 1KDTA 2ECKA 2FE4A 4DLYA 3D8BA 1FQKA 2MSEB 1FX0B 4NYMQ 3BB3A 5E4FA 1PV4A 1E0SA 2RGXA 3DKVA 3ADBA 3K9HA 4UNSA 2FWRA 1SHZA 1VHTA 1NSFA 1Z2CA 2FF7A 2H8KA 2VRWA 4KHZA 2H16A 4OL0A 3U60B 4OQNA 1FP6A 2QZ4A 5H1YA 4BWYA 1KY3A 5CDFA 4DDWA 5B58C 2PT5A 4BLOA 3ZQ6A 2QP4A 1U0HC 2C9YA 5EJEA 4GOKA 2OCBA 2WOOA 1EWRA 1U0JA 2ZYVX 3RRYA 2W00A 2O8FB 1FMLA 1H8HD 2IXGA 3B1WA 3JZAA 1KJWA 3LBIA 4C2UA 1DAKA 2FPMA 3QE0A 4QKQA 5FBWB 3VKHA 4B43A 2NO0A 2QQ0A 3R8FA 2QBYB 3AF2A 2J7KA 1A7JA 4MGIR 1ZCAA 2QT1A 3NBYC 5JJKA 4CEJA 1ESNA 4OYHA 1DBSA 2ZAOA 2AXNA 3GCGA 3JVUA 3NEJA 1D9ZA 3D31A 3DZ8A 1I4DD 2PZEA 2QA5A 5CK4A 4B6EA 121PA 4P3YA 4BEBA 3A1SA 2F3RA 3FWYA 1UDXA 2BBOA 1JNYA 2AHOA 4A82A 2RGAA 4TTPA 4LWZA 1OYWA 2D7CA 2J0VA 4NYJQ 1SVOA 2ZS8A 3NVAA 2ZVPX 1OB5A 2E1RA 1YR7A 2FH5B 1IHUA 2CXXA 2GZHA 3KQUA 1XU4A 1SVKA 3AKYA 5DISB 1GRRA 2GEVA 3KUCA 3HDTA 4HEJA 4QNMA 4QXAA 4X8OA 4C9BA 4C7OA 5CIWA 3LW8A 1KI2A 3I32A 4EPTA 1JXOA 4IOJA 1F2UB 4DSOA 4R71A 4F7WA 4TTQA 1F2TA 821PA 3RABA 3KTAA 1EFTA 2BBSA 1EFRD 5JRJA 4URUR 1VYVA 1XD2B 2JJ2D 3BB1A 3HJNA 3KQKA 3SR0A 2IXFA 3REGA 4B73A 1NN5A 1W1WA 1CRQA 1F2TB 1XF9A 2C99A 1M2OB 1S8FA 4BLQA 4S2EA 4F93B 2ZUBA 2H5EA 5M04A 4XSGA 4XOIA 4Q1BA 4C0BA 1XMSA 1JALA 2IWRA 4D0LB 4LI0A 1ZMXA 4TMZA 1U9IA 1N6HA 2GAAA 4C0SA 2IUSA 4D2IA 4II7A 1F60A 4PQFA 4B44A 3GFTA 3DHWC 4LBZA 4FWIB 2JJ1A 3EIHA 1W47A 2F1IA 2XTNA 3ZVRA 4BLSA 4QHSA 2HDNB 2JLUA 2IXEA 4PHFA 2RGBA 3B2EA 5BQ5A 1R5BA 3AP3A 3RLFA 3GEHA 1KY2A 1XZQA 1HTWA 4BFTA 3D7MA 3F8TA 4AURA 4YMSA 3BGWA 4CT4B 5JECA 3B60A 4EFMA 3K1JA 3LBNA 4MGKR 1CR0A 3BAFA 4PSAA 1ZNWA 3SDZA 3OEHA 3THOA 2OFWA 4JBYA 3WYFA 1M1YE 3GEIA 2Q6TA 3I4LA 2BKEA 4YDHB 2BJVA 2CJWB 5DLQC 1NLZA 1OXTA 5CJPA 3THWB 5ANRB 2ZRHA 2GF0A 2CK3A 4BECA 2J59A 4R2IA 5JI3E 4G01B 2KI5A 2X19A 5E3HA 1KNQA 4QOSA 1G7RA 4BRUA 4DFCA 2PH1A 1TUIA 3HYTA 4QRHA 3GLIE 3ZZTA 4NDZA 5JWOA 4LJ6A 1VCMA 4TLBA 2R9VA 4JBXA 1K5GA 2A78A 1HT2E 3TE6A 2ZRPA 3TBKA 3GLFB 4G5GA 4MH0R 2CVFA 2XTZA 4PC7A 1E2KA 2BOVA 1KSFX 1HY3A 4IEIA 3TGPA 4PPQA 2WPDD 3AVXA 4TYQA 4DC9A 5DN6D 1KI7A 3RHFA 3VR3A 4CEHB 4R2HA 1IJFA 1Z0AA 1G8HA 3ND9A 1RVDA 2GCPA 5FR2A 1S96A 2PLRA 4BLRA 1Z2AA 5E7MA 3A1VA 4M0LA 1E2HA 1MABB 2ODNA 2ORWA 2VP2A 3HJHA 1VG8A 2XOKD 3AVQA 3P4YA 1BYIA 3RS2A 5FOXA 1UKEA 4YMWA 3U3MA 4WA7A 2CLCX 3DMDA 5A5GA 1Q22A 4QGAA 5C18A 4TYWA 4D81A 1W44A 2BMFA 3ND8A 3PXGA 1ZM2A 4Q7LA 5JZVA 1NY5A 1XXHE 1QHIA 4K8OA 4XWAA 1Z0IA 3RYTC 2GTPA 5DYIA 2CMKA 2MSCB 4D4JA 3QSYA 2GCOA 1YZTA 1M74A 1FPMA 1XMIA 2RHMA 3U3JA 5HKKA 1ANKA 1M7GA 2BC9A 5K8UA 3SJBA 3TJZA 5EE0A 5C4GB 4E07A 3EZ6A 3AVWA 2VP5A 4A0RA 3GLIB 4A36A 3NBXX 4JYBA 3UG7A 2XITA 1N6RA 1XEWX 4AKEA 3KX2A 1Z0DA 4E03A 5C4MA 1NSTA 2WWFA 1XPOA 2F43B 4PO1A 2VH5R 3LV8A 5TVKA 1NVXQ 3SE0A 2HT1A 1TEVA 1EX7A 4TLEA 1GFIA 4RCYA 4CEJB 2LKCA 3KQLA 1CJVC 1QHXA 2J9RA 4U5XA 2VF8A 1FZQA 2C2HA 2J41A 2ZTSA 2ZRNA 1JR3E 1KAGA 2DWPA 3G5UA 2B21A 2J0QA 2WV9A 3HPQA 3K0EA 3IHLA 5KDDA 2LWIA 4ZDWA 2O5VA 2AWNA 4YC7A 4KVGA 1P2VA 1AQYA 2DCUA 4AI6A 2ZRBA 4Q01A 1YZUA 1E32A 1N6NA 1W46A 2AXPA 3ONWA 1KI6B 4D82A 3UANA 3W9YA 5FTJA 3PG5A 2J0SA 1E9SA 1GDDA 1EG7A 4RD3A 2XZOA 1CJMA 1W0KD 2BEJA 2P5TB 1RFLA 4NE2A 1U99A 1GNQA 1KI6A 1W5TA 3FOZA 1OFTA 2SHKA 4EAQA 3NIBA 4CEIA 3CNLA 1J99A 2GEUA 1KO8A 1NI3A 1XMVA 2CE2X 2EVWX 2GHIA 3MFYA 5IK2A 4LSGA 2O8DA 2XTMA 3FWLA 2FEOA 2R2AA 3KKMA 1NVWQ 3QEJA 5JLJA 2QM8A 1I4LD 1JQJC 4PSVA 2FFQA 3LH5A 3BK7A 4Q7JB 4CRWB 3Q9LA 3SBDA 5JCZA 1XEXA 4TSFD 2D3WA 3C14C 3LLMA 4JLNA 4X8LA 1SVMA 3VX3A 2O0KA 3IBYA 3PEUA 1E0AA 4PQRA 1N5JA 1TQ6A 3OAAD 5EE5B 2IYQA 3AVVA 4JLPA 1G3QA 3CF6R 2F3TA 2AN9A 2QSZA 1KKMA 1W0JA 4EDHA 1KJZA 3WP1B 4D0GA 1S2MA 2QP9X 1W4BA 2HF9A 4M53A 4KYIB 1E1RA 1KMHB 5AJZA 5BWMA 3A4NA 2BIFA 2P6UA 3MWYW 2QSYA 1TU3A 2DFNA 4A9AA 1DAEA 4KFRA 5E95A 2REBA 1GAJA 1DO0A 4MRNA 4PO9A 3WYAA 1OFHA 1EK0A 4BQSA 1XFAA 3U3RA 2BJWA 4V0KA 2ZSEA 1W4CA 5KSZA 2WSMA 4Q4JB 3LX8A 2P67A 2W83A 3IEUA 2IYUA 3R20A 1UKYA 1KSGA 2VHCA 3BB4A 1K8RA 4RVCA 5G41A 2XXAA 3BXZA 4MRSA 4N1AA 3DM5A 1JAHA 4BRWA 2ZRDA 1OXVA 4TSFA 3CRQA 3LWNA 4AY2A 4LC0A 4QNRA 2WKQA 4YQFA 1A2BA 4HUQA 5FUXA 4NMMA 3QPWA 2WIBA 3G0HA 3VX4A 3SQWA 2WPDA 4ZI2A 5EZ6B 3KJHA 3A37A 1UAAA 1D6JA 2FJUA 1TPZA 3VR1A 4AYTA 4R7ZA 3K0AA 1G5PA 4MDFA 2EFHB 1HV8A 3GJ4A 3T1OA 4DLXA 3I3SR 4BFYA 2C98A 3H4MA 1MO5A 4YXWA 3TRFA 1SHKA 1B23P 3AP2A 2D62A 2IYRA 3QXHA 2FSIA 3CZPA 4IOMA 4LHYA 1OXSC 4Q4AA 4A6PA 2A3RA 4W5HA 5BXQC 3U4QA 2PX0A 4HDCA 2BMEA 4RD6A 4NH0A 1J70A 1OFIA 2V8OA 3KKOA 3N2EA 1TQ2A 2G0TA 2VYFA 4C0QC 3VQTA 1FX0A 1RYFA 1CKEA 4PZZA 4DXAA 3EZ9A 3WNDA 4PPNA 3UXMA 4DCUA 3K9LA 2UVQA 5A4JA 2GJ9A 5EP4A 4B47A 3T06B 2YYZA 4NTZA 1DELA 5IF9A 1E2JA 1XTSA 2OAQ1 1U94A 1TQ4A 3K53A 2FFAA 3DL0A 5FPKA 4YONB 1AKYA 2HLDA 4C0AC 3IHWA 3GJ8A 5F2EA 3H2YA 4LOAA 4BFZA 3GJ6A 4B3BA 2IHBA 2JJ8A 2ZETA 5FUWA 4YLGA 3CRVA 2GA8A 2O0JA 1HE1C 2P5SA 2HXSA 2B8WA 4C0HA 3LXRA 4A2PA 1QG2A 2Q3MA 4GRAA 3Q3JB 2ERYA 1UFQA 2ZYWX 1R8SA 2A5JA 4LJAA 3QPVA 4DDUA 1T5IA 5GVRA 5KPDA 4IXMA 4Q4AB 2G83A 4PAMA 1ZD9A 4QJ4A 4BFSA 1QHGA 1XEXB 1G5RA 2FDCA 2YC4C 3KFVA 5KDLA 3SI7A 3OAAA 3PEWA 3O8CA 3ZIAD 1GKIA 3TW4A 4EQ6B 1RE0A 1XXHA 2ZJ5A 2FV8A 3QKUA 2HUPA 3X1ZA 1VTKA 4KFTA 3I72A 5FTLA 2OUKA 3AUYA 1LF0A 4Q4HA 4UNPA 1VG9B 2R8RA 3EZ2A 3H0KA 4PFSA 5FH9A 3B1YA 4CEIB 2DPXA 4DWJA 3IKJA 3K8YA 3DZDA 4KO8A 1NIJA 4P31A 4DUGD 3IIJA 1AZSC 3T35A 2XJ4A 2IC5A 1SVIA 2IUUA 4ABYA 2D4HA 5GJVC 1XD2A 2WAXA 5J5CA 3W90A 4HAUA 1NMXA 2CVHA 4B2IA 2BHRA 2Z4SA 2WWIA 4L4UA 5CM9C 3LVRE 4UXHA 1AGPA 2N46A 1RYHA 2CE7A 4UJ3A 1O87A 4LJ5A 4UKDA 2ANCA 2CCJA 3A8TA 4OQLA 4MYTA 3NHBA 1VYTA 3NKVA 5TY0A 2QG6A 4HI0E 3QG1A 2JLZA 2RGNA 4QGFA 3KJIA 5B57C 2PL3A 4A2QA 2IL1A 4Z1MD 4DZZA 1IXZA 3EG5A 4I4LA 2V55B 1E1QD 4LCBA 4CGZA 1OXXK 4LX0A 3PV0A 2G6BA 2Y8EA 2C5LA 2DYKA 2ZE5A 4NPHA 3QIAA 1GKYA 1LFDB 3CBQA 2YINC 4M22A 5EZ5A 2NQ2C 5SZKB 4G3XA 1NBMD 1P60A 3N5CA 2HYIC 2QAGC 3FYHA 4ESHA 2VP0A 3NG1A 1R0WA 1R0XA 5CM8B 1AIPA 1SKYE 3FFBA 4FIDA 3ASZA 4PO8A 4C2TA 4RJLA 2ONJA 1Q3TA 3WBJA 1R4AA 3B1ZA 2JLYA 2O8CB 2WSSA 3GFPA 3X1YA 5L3RA 3RDPA 3TSOA 4AKGA 4H1VA 3FKQA 1D2MA 4JKYA 1U81A 3RRZA 3HR7A 4Q48A 3R9XA 3GD7A 3NDBB 3DKPA 3LX5A 4QGHA 2GXSA 1MABA 4L9SA 4MRVA 3BRWD 2IS4A 4M1OA 4PR0A 3NHAA 4B71A 3R7WB 1G291 2H18A 3PR1A 2FMXA 5DI3B 1UPTA 5AUQA 1CBUA 3TUJC 5BYJA 1J90A 3A1UA 4L9WA 4KSCA 1L7VC 3WMEA 1W2HA 4DT1A 3TSWA 4IVRA 1EWQA 1AM4D 2JJ1D 3C8UA 5EE1A 4TL9A 1XNJA 2ZJAA 5J4HA 3AVYA 1UF9A 1KSHA 2PCJA 1YQTA 1GG2A 1KI3A 1KI8A 2G88A 2GBLC 4O25A 5F98A 1U8ZA 2EW1A 4NCHA 2VP6A 3HU3A 2PX3A 4WXPA 2J7PA 3QF4B 3LW7A 3EW9A 3K09A 4Z51A 5FL3A 4JL6A 1SZPA 4OQFA 2XNDA 4D25A 2YV5A 5CB8A 4Q9LA 1JAIA 2BCJQ 5J4KA 3IIKA 4HB3A 2DFLA 1D9XA 3EPLA 1Z47A 3TMKA 1XP8A 2GRJA 3T15A 1GIAA 4HDOB 4TL7A 1KK2A 3NDPA 3Q85A 2CLSA 4HSEA 4RFSA 4XD7A 4XVQA 5CIQA 3K0CA 1YJ5A 1G9XA 3L0SA 2NG1A 3AVTA 4D6PA 2WWGA 1E9FA 1OH5A 3AQ4A 1EFUA 5EP3A 1KI9A 1KMQA 1XTQA 3AF4A 3DM9B 2ODBA 1IAQA 1NVVQ 2YVUA 2IYXA 4HZIA 2QPAA 3U61B 3O8DA 3FKSD 2J87A 1B0UA 3F0TA 8OHMA 2I4IA 4GNKA 5C2JB 3TW8B 2BM1A 5K8IA 3X1XA 2EFCB 4I1VA 4BZQA 2EFGA 1OE0A 2QRNA 4N3NA 3FTQA 4ZI3A 2FGKA 1HQCA 5AJWA 2G9NA 1BYUA 2JASA 2REXB 3LAWA 3UMFA 1Z28A 3BOSA 5KPJA 1YZKA 3SJAA 3UMSA 4FCTA 5EQTA 2IWHA 3ICQB 4EPYA 1XD8A 4OBEA 1RZ3A 3ZZUA 1P62B 2IYLD 2OXCA 5GVSA 4WIAA 3BIFA 2ZR7A 4AKIA 4BLPA 1RKBA 3TAHA 1OXUA 4PZLA 2QL6A 1NIPA 1C9KA 3C16C 3THYB 4ZV4A 4KBFA 1JJ7A 5FOWA 1OW3B 1SXJE 2OBLA 2WWHA 1ZD8A 3RS3A 4W5JA 4TZ0A 3K09C 3U44B 2C77A 1R8QA 5EE3A 4TMVA 4D4LA 4KLNA 4BZPA 4M1WA 1E9BA 5FBRB 3NH9A 4H1UA 3TVTA 2FZLA 4M1TA 4C0JA 1GP2A 1JB1A 1TF5A 1I4TD 1TNDA 2W2XA 4V0ME 1E9CA 3IPYA 3Q7PA 4IDPA 4PZYA 4LYJA 3VFDA 2H57A 2H92A 4HB2A 3WYGA 2ATXA 4B2LA 2I1QA 3ZZ0A 2HV8A 2VSFA 4L5BA 1E1QA 1COWD 3DPUA 3T5GA 2ZRCA 4EIWA 1S4QA 2ZJOA 2GESA 2K5UA 4JIMA 1QBKC 3RRNA 5JHGB 4OHXA 4QBFA 4DB4A 4TYYA 1KI1A 3H1TA 2JLWA 3IQXA 4DLTA 3CNNA 1CTQA 5FPHA 4FWTA 4JVMA 1G8GA 4F4CA 1SXJA 1D2NA 1RRFA 5BW8A 2A5DA 1Y63A 3WHLA 2G3YA 5DO9A 5FBVB 3BFVA 1VIAA 2NIPA 2QGNA 1HH4A 1T6NA 4PTLA 2OCYC 5G40A 3TUZC 2TMKA 1WBDA 1TF2A 1KDRA 1R7RA 5AJYA 3LDAA 2QPTA 1P3JA 4FN5A 1XEWY 2XNDD 2OFOA 2QAGB 1OB2A 2IK8A 3DMNA 3L0OA 3W8NA 1G3UA 5HKKD 4MKIA 2KJQA 1BOFA 3I92A 2C04A 2W0MA 3RWOA 4ARZB 3KL4A 1XD9A 2A5YB 4UXJA 4FMCF 2V6JA 3SOPA 1ZD1A 3OHMA 3SJZA 3UK6A 3VNUA 1U98A 5UKDA 1WDTA 5TB5A 1XTJA 2R6CA 4TN1A 2RGNC 4RD0A 4V0NA 4XTRA 1T3LA 2CNWA 4GFDA 3B7GA 2KE5A 1XZPA 2FOLA 2IA5A 3U3KA 1N0VC 4ZKDA 4POAA 4LZZA 2ZXUA 4KU4A 4M4SA 1PLJA 3KJGA 4N0DA 1Z3IX 1I2MA 2GJ8A 4L8GA 2VP4A 1OSNA 4HAZA 3CR7A 3OFND 4BPBA 5D3MB 5AJXA 1E94E 3NH6A 3Q72A 4MDEA 2J7PD 2QTVB 2ORIA 4B76A 2NO6A 3T34A 1E9RA 1GRQA 2O0HA 2YHSA 2ZS9A 5E7IA 2NO9A 2X1VA 1Z06A 5SZIA 1E9DA 2ZJZA 4C3ZA 1AZTA 1G7TA 2NGRA 3A1TA 2HXYA 2W6JD 3ZD6A 1ZM9A 2CDNA 3O8BA 2OBNA 4MRPA 4IFEA 2FFBA 4Y0VA 3LFUA 4GZLA 4K81B 5FFMA 3PEVA 4ARZA 5JEDA 5CYOA 3VMAA 2HJGA 4A6XA 2E9SA 4LV5B 1MOZA 1CR1A 1Z63A 1Q1ZA 1ZU5A 1XDBA 1Q21A 2O8BA 5DSZA 5A0FA 2ZRMA 1IN7A 2YJTD 5FL7A 2RKOA 3FFAA 3MD0A 4FMCB 3OIWA 1T8TA 2GAOA 2XJ9A 2YWEA 1RIFA 1SKYB 3F5FA 2WOJA 5DHFA 1X8KA 2XX3A 3VR4A 1ZCBA 3ETLA 2WWXA 1YKSA 3QVVA 2PZFA 1S9HA 2JCSA 2QMEA 2ZROA 1ETUA 1F48A 3HWSA 4MUAA 1G6OA 2EWVA 4LJ8A 1AS2A 1P7CA 3KUDA 4A2WA 4DLUA 2CEAA 3L8YA 1F3OA 4PANA 4Q18A 1FP7A 4ZDKA 1MH1A 3W6PA 3K0SA 4OJKA 2AFIE 4Z1MA 2BKUA 3AVPA 4ZDIA 1OKKD 3SHFA 3K0AB 4US0R 2QY9A 1Z0FA 3ZH9B 2IHYA 5F9HA 2C95A 2EYUA 3IEVA 1LF5A 1G19A 2D7DA 3Q7QA 1G4AE 1YRBA 2BV3A 4EPVA 4EKDA 3TNFA 4BEJA 4Q9JA 3RVBA 4NL4H 3OEEA 3AUXA 4OK5A 2ZRIA 1T0JB 1ZNZA 5KSYA 4P0TA 2XGJA 4Q21A 5FPSA 2ZRAA 4PX9A 4M1YA 2PCLA 1YZQA 1XX6A 4YMVA 1E2LA 3CH5A 4JLOA 1SXJC 2C9OA 2N1BA 2PMKA 1UEJA 4EPWA 2VA8A 4PQYA 1W4RA 2YOFA 4PPFA 4Q4JA 1RW4A 1X86B 1UBFA 2H17A 3U7HB 4XVRA 5AR1A 1S3SA 5D3MA 3BBPA 1PLKA 4S35A 2FX3A 3U3OA 1CEEA 3L8ZA 4UQOA 4JYCA 1Z6YA 2RGDA 1YZLA 3DEFA 5TV2A 3SN6A 3M1IA 4JVSB 1KMHA 2FU5C 1NN3A 3W3ZB 1W4AA 1KSJA 3AKCA 4FMBB 1JEDA 2F55A 1EXMA 1LS6A 4IVPA 2QTHA 3WY9A 1YU9A 4H9GA 4JLDA 4NYJR 1QHHA 4WZAE 1Q1BA 3A4MA 2P3SA 3RS5A 1EESA 5EXTA 1DG1G 1NJGA 2GJSA 4V0LA 1CIPA 1G3RA 2C78A 2HCJB 2FA9A 1NBME 5FBLB 5HZHA 5F3WB 1H8ED 3THXA 2OO7A 2R44A 4NP6A 2HLDD 3MGCA 3R7WA 4JL8A 1OJLA 1X1RA 4IVQA 3Q5DA 2ZREA 3CPJB 1XWIA 1LVGA 4IRUB 1ELOA 5AUPB 1YRAA 1HQYE 5JSZB 5TDHA 5JMTA 3UKDA 1NP6A 2JLXA 2ZSAA 3GMTA 1E69A 1FQJA 4JSYA 4AC9A 1T91A 3LBHA 3A58B 5G53C 1MRNA 1KI4A 2DWOA 3SC3A 1XB2A 3AF1A 4MUBA 4Q1EA 1Z6XA 1CP2A 1VECA 4F4IA 1EX6A 4F4JA 3V00A 5DI3A 5HZKA 3MRSA 5CDFE 1II8B 2J45A 4ESVA 3W6OA 2I3BA 3OE7D 2JA1A 5KHOC 1JECA 4NCJA 3I61A 1P75A 3TQFA 3PUVA 1OHHA 3CUEF 5JS7A 1AJEA 4TMWA 1XJ0A 2B6HA 4DB2A 1KDPA 3LVQE 2B92A 4QGGA 3GQBA 3D3QA 2O8CA 3L0PA 4ASUA 1KKLA 2HYDA 4LK2A 1GVNB 4N0EA 421PA 1Q57A 3GJ3A 1SKQA 1EFCA 2C03A 4DCVA 5H68A 1RJ9A 1M6NA 2A9KA 2B8TA 4Z8XA 4G5RA 1F6BA 3OESA 3SYLA 3TR5A 3SHWA 2J5XA 2YOGA 2HCBA 3U2QA 5D3QA 4CEHA 4X8HA 4HAYA 4G5QA 4GBMA 2GVZC 3OIVA 2B2NA 5TARA 2JAQA 3L2OB 1HEIA 5KO2A 4DSUA 1X6VA 2V6IA 1ONBA 2UKDA 1R5OA 2GBLA 3C5CA 3W6NA 1X3SA 1T4GA 4KCGA 1GL7A 4R98A 2XB2A 3RS7A 1DPFA 2FG5A 4MYUA 1ZYUA 2QGZA 1II9A 3QI2A 1OH7A 3NEYA 4TLDA 2Q9CA 4DLVA 1IN5A 4FMDB 2YZ2A 3BH6A 2BDTA 1QHNA 2CCKA 2ZRLA 4XJXA 5FPYA 1L2TA 1YR9A 4HAXA 3O8RA 1R6BX 4FMDF 5K8TA 1V43A 5CB6A 2O52A 4F91B 2XSZD 3PQCA 4DJTA 2PEYA 3UATA 4A1FA 1XMJA 2XEXA 1WXQA 2WBLC 3IO3A 5IT5A 1VKJA 4URYR 1G64A 1H8HA 2ANBA 4QM6A 4O3MA 2OFXA 3B13B 2ZVQX 4TMXA 1I2DA 2VTKA 3MWLA 4IW3B 2RGCA 4P4SA 1Z6GA 5FOVA 3EZ7A 5HE8A 3FVQA 5G3YA 4WVFA 1IY1A 4Q19A 5FTMA 5KNCA 3VAAA 4D4KA 1GNPA 5HCNA 4QL3A 2JLVA 4MRRA 2XZPA 4ZCMA 1E96A 3CRW1 2NOAA 3E5HA 4LBWA 1OF1A 2JGNA 1ZW6A 1TADA 2JLQA 1SXJB 2BEKA 4LV8B 1Q12A 5B30A 2DB3A 2VP9A 4A0FA 2QAJA 1QVRA 2IX3A 4DIEA 4TYPA 3JVVA 4JLBA 4KVAA 4NU0A 3E70C 3TVDA 1T0HB 3CRMA 2JEOA 2GILA 1VDZA 1H8EA 3H84A 3OF5A 1R2QA 3UWOA 4DLZA 4IXNA 4RZUA 2BWJA 1W36D 4L15A 4MYCA 4O2RA 1LV7A 2A5FA 1F2UA 1M34E 1XRJA 2CJWA 2FN4A 3K9GA 1TU4A 1UBGA 5FUYA 1PJRA 3E2IA 2GCOB 2V1XA 2Q9BA 2CHGA 2ZUDA 3FMIA 1Z8FA 3QUSA 4YMTA 5EP2A 2ZI5A 4Q1CA 2ZS7A 2D74A 2PZGA 4ZO4A 3EA0A 4PHGA 3U44A 5HCIA 4IDHA 4I99A 2DFKB 3EASA 5KUTA 1W36C 2FPLA 3KZ1E 3IGFA 1HYQA 2NPIA 4LGMA 3X1DA 1DVRA 1N0WA 3VKGA 1Z6TA 2F1HA 1KTVA 2GZAA 2VO1A 4OK3A 4D80A 1WQ1R 1E2PA 2O8BB 2BVNA 3OFNA 3B9QA 1XBTA 3P4XA 4TMKA 3U7FB 3HR8A 3RSOA 4IFBA 3WRXC 3FKSA 2RH5A 4EJSA 1KAOA 4IDQA 1K5DA 4TLCA 4MKGA 4NKRA 4UNRA 4OK6A 3ZLJA 2XNSA 3V4RA 3EXAA 3U7GA 1GZSA 5LD2B 1G5TA 1WE2A 2JLRA 4V02A 1D2EA 4KV9A 4F38A 3EWAA 4LBYA 1E1RD 3HYRA 4XVUA 3NC1C 4PC3A 1FOEB 4ASUD 4GSYA 3C5HA 1Z6AA 4PC2A 1ZJ6A 2IEZA 3IO5A 3PFIA 4A8JA 5HPYB 4C7OB 3DVLA 3FHOA 4WXRA 2Z5FA 4NCNA 4G5OA 5EXXA 4AG5A 2AD5A 3OE7A 3S1AB 2O8FA 4L16A 3GEEA 5F9FA 4B48A 1Z22A 1ZM3A 4NYIQ 3B9PA 3GPLA 3VU9B 2RB4A 1U90A 3ZVMA 1SVLA 4KLZA 4O0MA 5L3SA 2YWHA 1FNNA 2QMHA 4RD2A 2EYQA 4DLWA 2WJVA 2BMDA 4B75A 4WBSA 2ZE8A 4NONA 3VMFA 4PAQA 2OSBA 1CRPA 2IS2A 4ACAA 5IHPA 2F43A 5LD2C 3BD9A 2ZR9A 1PLLA 2I1VB 2OLJA 3LQRA 4IOKA 2D2FA 3QQ5A 1KJYA 3QKTA 3SEAA 1E0JA 5EP1A 3S1AA 2BM0A 2NO1A 2OAP1 2VF7A 4G0NA 5FPTA 2PJRA 2WVJA 3GLIA 2Q9AA 3CR8A 4V0OA 2JATA 3DO6A 1NMYA 3CX6A 1W48A 3ADDA 2ONKA 4PC6A 1JPJA 1CJUC 2CBZA 4URWR 2W2TA 1G4UR 4Q4LA 2ODWA 3BORA 3GP8A 2YC2C 2AD1A 3FGNA 1C4OA 3QNUA 3CKLA 3QXXA 1ZM4A 4M1SA 2W0SA 2ZR0A 3TQCA 2OZEA 4QM7A 3BFKA 4NHOA 2GZDA 4KBGA 2ZRGA 2NMVA 1EFRA 1PZNA 2FEMA 3LD9A 5KSPA 1ZIPA 4LJYA 1KO1A 4FD2A 3MJRA 4JLKA 3MLEA 5FI0B 1QF9A 4OQMA 3EARA 1VIYA 1Z83A 1ZUIA 1LTQA 2QP3A 4P33A 4W7SA 5KDOA 3AEZA 1Z29A 4JZKA 2GEDA 1ZBDA 4ZKEA 1WBBA 5JI2E 4Q9IA 1D8TA 4M9ZA 4B3DA 2NZJA 2QUZA 1SQ5A 5DIFA 4DUGA 2OT3B 1R0ZA 1AS0A 1KO7A 3CWQA 5LBIA 4AK9A 2CHQA 2Z4RA 4ZIRB 1FFHA 4DDTA 1TMKA 1NN0A 5L3QB 5DNYB 2FPKA 1VG0B 1R5NA 4URZR 1FTSA 1HE8B 1IN4A 1TAGA 5JEEA 2BBWA 2GNOA 4LJ9A 4KXFB 1XCPA 2PBRA 3PVSA 4NYMR 4J0QA 2WKPA 4IDNA 1FNMA 3RWMB 1NVUQ 3SFVA 3SU8A 5TMPA 3LNCA 3U5ZB 1XJQA 4CYMA 4OHVA 4HZUA 4HB4A 1CS4C 3CF2A 4TT3D 2GKSA 1JJVA 4LJ4A 4M8NE 2EFDB 1G8YA 5JWRA 4XIGS 4ON9A 4AIIA 2R62A 3BH7A 1E99A 1HURA 1VMAA 4HYYA 1OKKA 2HF8A 3EPJA 3KXIA 4B35A 5JJIA 1U9IC 3KDSE 1SVWA 1T9HA 4LDJA 4DT1B 3DDCA 2VHJA 2QEQA 5GJWC 1KIMA 2YWGA 1AS3A 1LY1A 2Z6VA 3GJ0A 3SQXA 2RCNA 4LHZA 2ZI3A 3KKNA 5L3SB 4UXIA 2ZJ8A 4M21A 5C1BA 3FMPB 2FZ4A 3GJXC 1G3IA 1A4RA 3C41J 3KKPA 1VG1A 2ZSDA 3M0EA 1LB1B 1U8AA 2C96A 2IYWA 4OI1A 4AG6A 1FW6A 1QRAA 4Q7MB 1Z08A 2ZU6A 3JZMA 3AP1A 3K9NA 4FI3C 1MR3F 1A2KC 2CL7X 1W2GA 1G17A 4E09A 4BUJA 2MMGA 221PA 3T1TA 1WP9A 2FFHA 4I1UA 2IF2A 4TT3A 3WRYC 3WMGA 3GLFA 2G77B 2GXAA 1CF4A 2OLKA 2OHFA 4DSTA 2JIZA 5HTKA 4OQXA 3TKLA 4B74A 1G18A 4OHZA 2F7SA 3K70D 4HLDA 2J0UB 4KYUA 2YWFA 3CB4A 2OG2A 1EFHA 1TQDA 1UBEA 5GJBA 4AWXA 1Y3AA 2B7CA 3IBGA 4KSBA 1N0UA 1IXSB 1GUAA 2A7QA 4DKXA 1CJKC 1BMFA 2O8EA 1P61B 1KDOA 2XB4A 2ZRKA 4FW9A 1ZC4A 2D2EA 3RC8A 2VSXA 3PEYA 1CULC 2X2EA 5AWFC 1E4VA 1XJCA 1S3GA 4XWKA 1IOZA 4TMTA 1E2FA 4WZ6A 4AYWA 2IW3A 4NCKA 3REFA 1VPLA 3CZQA 4F92B 5EXPA 2WAYA 4HUQB 4BFVA 3L82B 5C46F 2P0EA 1US8B 4HUTA 2HEIA 2DWQA 2JJ2A 3NWJA 3R8CA 3SYKA 1L4YA 1N6LA 4GP7A 1P9NA 1KK1A 3K70B 4UJ5A 5EUQB 4CIDA 1Q44A 2WMOB 4HAWA 1WF3A 3PUZA 4XD7D 3ZS9A 5LB4A 2QBYA 1BMFD 1NVVR 1DG3A 1UEIA 3LRPA 1E2GA 3QKRB 5AJVB 1ZUNB 1E3MA 4Q5IA 2R6GA 3O47A 5KOYA 3B78A 4JT4A 1Q0UA 5GADl 1DOAA 4PAOA 1NNEA 1L4UA 2V54A 4M2LA 3CX7A 4M1MA 3CW2A 5LDDC 2EQBA 5L8VA 2R65A 4TL6A 1TTTA 1MO6A 1U0LA 3PITA 4EFLA 1NF3A 1YZGA 4LYAA 4Q47A 2V9PA 3BWDD 3NBFA 4A4DA 4GT1A 4WOPA 2F9LA 2G1KA 4U00A 2AKYA 2C9CA 5IDVA 4RZXA 5FI1B 3CO5A 3I62A 1AK2A 1G6HA 1XTIA 4I81A 3QXCA 4Q4HB 2NPFA 4JT2A 4RD4A 4Z8YA 1GL6A 1ZNYA 1Z0KA 1TX4B 1UBCA 2CLDX 3VR6A 1PUJA 1E2IA 5G3ZA 3T5DA 3MWJA 1DTSA 1E79D 1XCGB 2F1JA 5FUVA 2VHUA 2OBMA 1KOFA 3ZYCA 4NCIA 3ASYA 1II8A 5J40A 1II0A 3KB2A 3LXXA 2OCAA 3IPXA 3N2IA 5JWHA 1JEEA 1ODFA 1KYIA 5JRZA 3MSXA 5P21A 1FL9A 1TF7A 2F1RA 3P1JA 2CL6X 3QBTA 4WW0A 4I1OA 3SNHA 3P26A 4D0NA 2ZI9A 2ZYUX 2ATVA 2OM2A 3VKWA 5CYPA 1O3YA 4RFSB 4DLSA 1ZINA 4DLRA 4TYNA 2ZRFA 2V1UA 4PXAA 3CONA 1X8LA 1GWNA 3DOEA 1JQLB 3U6BA 4P4TA 5BN3A 4QJ3A 1TEXA 1MRSA 3IDQA 1YVDA 1GNRA 2HJVA 4BFXA 3VNVA 3CH4B 1G20E 1FUKA 2KBFA 4MYHA 4EJSC 5BN4A 1AA9A 4GOJA 3QENA 4A0HA 2D06A 3C15C 1KHTA 4U02A 3RRMA 4TZ6A 5LPNA 4B3GA 2ZE6A 4LHWA 1NMZA 3PENA 1Z07A 1VCOA 3EIQA 3MAAC 3W8RA 2ZITA 4W9MC 3AF0A 3CM0A 1RJ9B 1MO4A 1XPUA 3QOFA 2A30A 3KB1A 2WWYA 2DY1A 1E2DA 3AM1A 1CR2A 2ZPTX 3UIEA 1KO5A 2WJYA 1VCIA 4PC1A 3PIRA 5FBQB 3W5IA 4OHYA 4FXPA 4XWOA 3FE2A 1Q1QA 2RGGA 1X1SA 3J81k 4AYXA 3EIEA 3K0FB 3CNOA 3P20A 1QHSA 3EPHA 4DIDA 2PJZA 3L0IB
chains in the Genus database with same CATH superfamily
2GBCA 2X22A 3KKQA 4MI1A 3TK1A 4LY6A 5FTWA 4IWNA 1N2OA 4FOPA 4UEKA 5ALLA 5T4BA 2XCIA 3RU7A 3VISA 4BASA 1T0UA 5JYEA 1Q3HA 2WRZA 4HQLA 1FRFS 1VJ5A 5LIPA 1T34A 2HA7A 3LF1A 4K9SA 3R4CA 3TNJA 3CLKA 2G8LA 3GFVA 4TV9B 5EI5A 1WCXA 5G4KB 2VXYA 3CWCA 1GPBA 1FLVA 4CN8A 2IYZA 2YXEA 1L7DA 5HQ3B 1NT4A 5E0OA 3DDUA 5U4XA 1PZFA 5JSZA 2BLLA 2Q3JA 1UDWA 1P2TA 2RHDA 3QA3E 1YGYA 2GPTA 1C3XA 1E79A 1NXPA 5TR9A 2IS1A 1JYFA 4HUJA 4D26A 3WA6A 1QGED 1E2MA 3IP5A 4NESA 4OPMA 3KO8A 4YH1A 1Z4LA 3H75A 3OLVA 5EHNA 4XQ9A 3K4QA 4V0MA 2VZ9A 3OT1B 3GFQA 1UKBA 2PKYX 2UVPA 3TAXA 3UWKA 2X86A 4OGKA 1AQUA 1HE4A 3VTFA 3OQVA 3EX7C 1M34B 3MW8A 3T5CA 4ZK2A 3FTCA 4P84A 1O6BA 1PVVA 1JWBB 4URVR 2C7RA 3HBMA 4AN0A 4EYOA 1JE0A 5FKJA 5AUOB 4ZYWA 3MJFA 4PYRA 4I1SA 3GG9A 3AEUA 5EE9A 2EHDA 5CCEA 2AQKA 3SQNA 4NE7A 1PR6A 4DCSA 2Q4RA 3Q12A 3TZLA 2EW2A 1EI9A 2Q49A 1KAEA 5CFOA 4DRYA 2KWIA 3ZV6A 4YJ2F 3B3FA 2A2ZA 1X42A 2P62A 3FPHA 3PGKA 1ODTC 4B3CA 5CVTA 3BGSA 2W6ID 3IJEB 4KAXA 2RAUA 4ZCIA 3O03A 4IOLA 3CCFA 4RAOA 2FSVA 1RC8A 3HMQA 3KJQA 2H52A 1NYRA 1QFXA 2AFHE 2E2WA 4IEFB 5CXUA 3S8EA 2RCYA 2W93A 3M1YA 4U7DA 2OHGA 2C7QA 3FYSA 4M1KA 4NOMA 3EQ8A 1JEOA 3CB2A 1DWQA 4ZOEA 1L5RA 4V03A 2YMQA 4CKBB 5D1NA 4LKRA 4AUKA 4ENRA 1NN1A 1YQGA 2AR0A 3E05A 2QLMA 4O5AA 1ZAKA 4YMUA 1UUFA 1AO0A 1JHPA 2PD4A 5K0TA 3HN2A 2UUCB 3G1WA 1D04A 1YBFA 3QY0A 1Y3FE 4W9RA 2FQWA 3ABSB 2H1FA 3AFOA 5KYVA 1ESMA 4ISCA 2K2QB 1D6SA 1YACA 2X6RA 4KE6A 1ZDMA 1TECE 4R9RA 5CNJA 2JPDA 5EWJB 3V1TC 4IS2A 4Q34A 4X1IA 1ECFA 2TYSB 5HR5A 4TOIA 4F9GA 1N25A 3WDKA 5LYJB 2QMYA 2QN7A 1QJ4A 1X7YB 3ENKA 3DMPA 1JFFA 1CQIA 2XZTA 3AHJA 2C7OA 2O2XA 2ORVA 4H6XA 1YB1A 1RQNA 1CVRA 2C42A 3GAMA 3L0BA 2Q4BA 4KTVE 2WJ3A 1L5NA 3ZHTA 4AJLA 4KOAA 4KQKA 5KYUB 4FS3A 4PZPA 4G0YA 4Q66C 1CUGA 1QIMA 3R9IA 3JQPA 1XK7A 5C7OO 2Q21A 3K0HA 1HFWA 1RI5A 5LQJA 3ZK7A 3U4QB 2G06A 2LCFA 2WD7A 3BYZA 4LNUB 1T2FA 2FR8C 3R6TA 1ODIA 4O2AA 3CNEA 1EK6A 4RMNA 4B3SB 1EWTA 2BFBB 1CYEA 1T5OA 1BVRA 4EUSA 1ULTA 1ZM7A 3EFOB 3HDQA 3LUBA 2QRGA 2W58A 4AVYA 2ZPUA 4PHHA 3IDSA 1T5DX 2QTZA 3M4ZA 4U8HA 4X20A 2ZAMA 5IN5A 4ER6A 2IZ6A 3L6RA 4L2IB 4BLTA 5J4LA 1ZOOA 5KJCA 4BE7B 3JPWA 1R6DA 1SBHA 3IKLA 3UUEA 1M1XB 3ZVLA 4EDHA 2G28A 1YR6A 2RIRA 3DTVB 4G81A 4JVLA 3HI6A 4LOIA 5CNIA 4ERNA 5C8XA 4BNMA 4XIYA 4Q9DA 1BWQA 2XXJA 1P2UA 4MR7A 3V7FA 4DNFA 4EJ6A 1UFKA 4JX9A 1ZOPA 4P3PA 5DW3A 1LJ8A 2I3ZA 4FC6A 2WKWA 1G16A 3E9RA 4RVGA 4U7JA 3W5VA 4IDOA 2GN2A 4TRRA 1G8JA 5F78A 2YXNA 3EIUA 3P27A 2BUCA 3ZWOA 4WKNA 5AYVA 4R2MA 4WFKA 3MHPA 2ODEA 1VE6A 1DKQA 2Z2KA 2FPSA 4H16A 3K0FA 4A0GA 4YX9A 1T9DA 1QV9A 2DKFA 2J9GA 3T7SA 1YCHA 3PUYA 4PSKA 2EFEB 1P5ZB 1XA4A 2K2WA 4KNWA 3WK4A 5ALFA 3VZSA 4EJSB 1Y1KE 4BDTA 4N5DA 3VR5A 4Z7NB 4IY1A 1C14A 2I34A 3NHWA 2WD7B 2ZM5A 1QK5A 1WMAA 4KJXA 2I9KA 4R5HA 3WGQA 5IJ0B 1SQ6A 1VHLA 2HL6A 3RUAA 3Q5EA 3WQSB 3KG2A 1O89A 3C4VA 2R751 4HR7A 3WRVA 4LF6B 2QI9F 1SGWA 1TKCA 2NNLD 4QZVA 3T1VA 1S5PA 1HO3A 1UDAA 4KFSA 1Z4KA 4M9QA 4MEJA 1Y33E 2LPMA 1E60A 2JBAA 4Q9KA 3HSKA 2PT9A 5M3BA 3ROEA 4KR6A 4J75A 2A0XA 1OAKA 3FBTA 3O4IA 1IN8A 4Z86A 1ZJWA 3LQQA 4KV7A 5DSTA 3PPYA 2XQFA 2FFRA 1LK7A 1WPQA 2DF8A 3ECCA 3PFFA 2ZJ0A 2B7BA 2J08A 1O9BA 2RC5A 1LEHA 1A8SA 4F56A 3OHSX 3ZWQA 3E0XA 1EP3B 1D4ZA 1IEXA 4Z9YA 1P6XA 4F04A 1XN1A 2WFZA 4XW2A 4JQZA 2ZYTX 1GHTA 4ZOLA 1AQIA 2CB9A 3I58A 1ULBA 4Q1FA 4U2CA 2O8EB 4GZMA 2OHXA 2JGMA 4C0LA 3E22B 3OCUA 3VTKA 1RWVA 3ZHZA 1CV2A 1EXDA 1AXRA 1VL8A 2RAFA 1LPOA 5JTUA 4BLWA 1SUIA 4GXTA 3TW8A 1GKLA 4O4HF 1BQ4A 4ESOA 4WNAA 2DEUA 4JJIA 4QYIA 1SRRA 2G8NA 4TV8F 2QM0A 3GJTA 1UAGA 4TWBA 1THTA 3BDVA 3D7NA 4ACBA 1UK6A 3KNZA 3LT5A 4GC5A 1KIFA 1N1DA 1P1RA 3AESB 4N8EA 1C9NA 4PFJA 5CK5A 5DHAA 5F4ZA 3F7MA 3IVAA 4GDMA 4BNYA 4BGDA 2R11A 3C7AA 3VDRA 2OCLA 3TL2A 1BKDR 1GTJ1 3G0BA 2HRDA 2MYTA 3Q5GA 4NJEA 4UE2A 4DV0B 5K51A 3K1ZA 3KM0A 3OIUA 4LQCA 3VYRB 3GIWA 2GVDC 1MPTA 2PUAA 3PPWA 3EY4A 1W36B 4Z4IA 3X2SA 5LKAA 1VSQA 2R4UA 2I4MA 2IYPA 4PZCA 5H81A 2Y71A 2RBKA 3O4FA 3QMPA 2AN4A 2XOKA 2QUJA 3AV0B 1PNOA 3Q3HA 3TOZA 5D01A 2IY7A 3I34X 4BO8A 4BCBA 1M2JA 2OXRA 2B1JA 3QEOA 3PQ6A 3VC3A 2QROA 2ZZMA 2HA0A 2TS1A 3JSAA 2C61A 3OUUA 1D0SA 2ENUA 2RHCA 2QPOA 4G9GA 4PGGA 4QC2A 3SXUA 1FJGB 2QMUA 5H9WA 1N7IA 1TKBA 1YJ8A 4BKRA 2RMKA 4PLCA 1N6KA 2WICA 1GSIA 4XZ3A 5DPMA 1WSDA 1W35A 1XDSA 2Q0QA 1J8YF 4G8CA 4W5RA 1PTJA 4ND8B 3SX4A 3LLSA 1QM5A 3ETCA 4RV9A 3W8FA 4YPOA 2I33A 2V7QD 3SS8A 1SBIA 5H4GA 2Z83A 4TKZA 3ORRA 4HATA 1BRMA 3T0GA 4C87A 3I2KA 4HBGA 3ROKA 2VWGA 3E18A 1FP2A 5JBIA 1RKXA 2WTUA 4B32A 2ZI4A 2QZ9A 4KW7A 1IUNA 3A6GA 4WCFA 4NBTA 2O3QA 2AX4A 4FQ8A 1MO3A 4OA5A 6LDHA 1L8QA 1TJ3A 5CBPB 1H5QA 3L49A 2OV4A 5HTOA 1J2JA 1ZI6A 3D8TA 1NM5C 3SDBA 2ASEA 1UC8A 1V39A 2YVLA 3BSSA 1MOPA 3D54D 3H1FA 3C1AA 1PX2A 4RA6A 3QXGA 1RXCA 1D7OA 1HZZA 4CT5A 4C01A 2NXJA 3UAZA 4DRXA 4EX6A 5L3QA 1RLTA 4CL0A 1T6ZA 2VSQA 6Q21A 2O1EA 3SZRA 3D5EA 2OGWA 2M6LA 2YZMA 5LXTF 2H2HA 4KRFA 2Q5EA 1ORHA 4O33A 4DNOA 2NP7A 2KSQA 2CT8A 4FHEA 4MI3A 3WLNA 2XOXA 1XCJA 1UZMA 2GKOA 3QKSA 3SSMA 1Z4JA 5FP0A 3FGPA 1DWUA 1QGDA 4IV5A 4ZU6X 1JI0A 1IE3A 4LHXA 4J7CA 4COKA 3OD1A 2Q0HA 3D7LA 1UBNA 1KEVA 4UPDA 3T61A 1C7QA 4EPXA 4C4YA 3EPPA 4KR3A 4BV9A 3UC5A 1IB0A 2C5EA 4ADSG 1Q6ZA 2GZRA 3EAQA 3KT0A 5LJLA 4CUKA 3PDIA 4D57A 3BK2A 4NYIR 1WZ2A 1H85A 2B61A 3SX2A 4PQGA 1C3OA 2VHTA 4ITRC 3OVMA 5LQDA 1LC0A 2AZTA 2V4UA 2NVUB 3SXJA 4MW1A 2H85A 1P3DA 4DY4A 1AMNA 3K1AB 3OECA 5CJ2A 2DCMA 3TRKA 3WS7A 2QRZA 3ZLUA 3N6VA 3F96A 5DIZA 3WIVA 1E6CA 1PGOA 3B8HA 2AOVA 3G9UA 1JPNA 4J6EA 4QJ5A 2GN6A 3K35A 3SYNA 4W82A 4CMAA 4CUJA 1LW6E 2O8DB 2GXUA 1AKWA 1T3SA 3QMVA 3RS8A 4NBSA 3GLHE 1ENZA 1CZUA 1K88A 3MOGA 5J2TB 1D8AA 4CVNA 4I6GA 1LBHA 3WWZA 5TXGA 1JDPA 3D4LA 5EHGA 2V3CC 2VTVA 3JRNA 5KB3A 1GTVA 1H4TA 3PQ7A 5BRAA 3DG9A 2EERA 1MMFB 4LF8B 3AI2A 2RH9B 3OSZA 1C81A 2VHEA 3QFRA 4AMBA 2ZJBA 5JASA 2A35A 2WHYA 3AJ9A 1U7WA 4G65A 4JQOA 1FTNA 1UQRA 2WSSD 1Y9ZA 4LY9A 2X0KA 1E3TA 3L01A 3OIYA 1HUQA 3ECSA 3FMFA 4XTCS 3PQ5A 2IOFK 5KNDA 1KOGA 2HU7A 1QH1A 5FOSA 1KDZA 3FY4A 2NZXA 5FA5A 2DBZA 3RUEA 2XD9A 2IODA 2GK6A 1Q20A 1CUCA 1SCQA 3TEFA 5J47A 1FXSA 4IDEA 2XT0A 3DZHA 1A9SA 2AQIA 2FUEA 2B78A 1CUZA 1UK7A 4EFNA 1EG2A 4B6FA 1ZGJA 1ZHHA 4BNIA 1VMKA 1DTWA 4ZOLF 2OHOA 2EBFX 2IUTA 3UYKA 2YVQA 3AKEA 4NQZA 3DFUA 1IMJA 1M5RA 3RVRA 2VP3A 3ORFA 5FLYA 2JS7A 1DRKA 1K6MA 2VRCA 3BMNB 4L6AA 1K2VN 3NZEA 4MGYR 5CT6A 4ER3A 5SZHB 4ZDJA 2DLCX 2QD2A 2LKDA 3A4LA 3RC3A 4YJDA 2R2GA 2LNDA 3WMRA 2BL4A 1X7HA 4QARA 4EI8A 1M34A 5IZCC 3RYCB 5H3HA 3ZWKA 1ADBA 2JZNA 5EZYA 3HNRA 5L51A 2GXQA 3D5TA 3IL2A 2PGXA 5CX1A 1MC1A 4QJIA 3BJZA 3SYTA 3E3MA 4YIHA 2I67A 4RCVA 5G0UA 1DAOA 2IQ5A 2QE7D 1F2VA 2QI9C 3WNVA 3RJ9A 4XR9A 4DSZA 3PJRA 1SU6A 4GLLA 3ON5A 4PHTA 3S70A 1CQJB 1V3QE 4QHYA 3Q8KA 3UVEA 3L5OA 4HGYA 2FPGB 1MA3A 4I8IA 1W73A 3IIEA 3LJKA 1PEAA 2R7LA 2FN9A 3P7MA 3T3IA 2H4ZA 3ZDQA 4PPGA 1O4WA 1UBKS 5DGIA 2NAFA 1J5EB 4PQEA 4UEJA 1A5TA 5DOVA 3CF0A 3T8YA 1XLUA 4RL6A 1I1NA 3UNXA 3DE2X 3CPSA 2Y0DA 3P97A 2XZDA 4TSKA 5FBLB 5K0GA 1TTHA 3CIOA 4JODA 3TH5A 3C87A 1QHHB 1NR5A 3SS7X 3CLSC 4ROSA 5DE3A 4DCTA 2I80A 1JKFA 2C8VA 3F5MA 5G40A 2YNMD 1DARA 1SMKA 2H9IA 1LTHR 3LQKA 4I4CA 5EQDA 5FHRA 3SIWA 4PCUA 4UMEA 1QZUA 2CY0A 1DBVO 2AG8A 3V4FA 4A8JC 4AJEA 4MGZR 3AO0B 5LQRA 4KQIA 3FB1A 3GFBA 1JU9A 1E2NA 4BZXA 1Y4SA 4GOXA 5FWAA 4D3DA 4ZN6A 5IM4A 4BWVA 5C5DA 5DGTA 3QY9A 4J0FA 3WLEA 1QP0A 4WJLA 3FPEA 1PZXA 1XXHB 2WJJA 2DSNA 1S8NA 2FWPA 3ZTYA 4CQMB 4L8WB 4XPZA 2HN9A 4G23A 4NOKA 5FOTA 2RD2A 1IUPA 1VLQA 3RANA 3HKEA 1RAGA 1QUEA 4DBLC 2JDIA 2ZRJA 3P9RA 2GDJA 5K8LA 2AE2A 2AI2A 3RSLA 1C4XA 2J3EA 4JUIA 2OENG 4YAOA 4EABA 5ILQA 1ACMA 2W6IA 1A4XA 4DEXA 1J0DA 3VHQA 4AJJA 1TTQB 4RZIA 2ZEJA 3I52A 5CEEA 2OOKA 1T4BA 4PV7A 1DOZA 1HQKA 1IY2A 4UZSA 4YUWA 4US2R 5LOVA 3H86A 1XWWA 4RSRA 4B81A 2FEWB 1Z62A 2ZYDA 3P9QA 4Y6OA 4Z0TA 4MUGA 1KETA 2NUPB 3DW1X 2B98A 2JGDA 4JL5A 2DVMA 3VTZA 4P53A 5E6UA 4EYGA 1EX1A 4KITB 1RYBA 3OZXA 3TNDA 3TZKA 1NWCA 2CJPA 4U5QA 1E4OA 1X94A 1P5FA 2A5GA 3SJCA 5JH7F 4DR2B 3IR7A 5ADVA 2V4ZA 3KT3A 2CLKB 2GETA 3DZCA 5ADWA 1R3DA 4CKXA 1CPYA 3QKSB 5TJHA 4BQOA 2H2IA 1AB6A 2VEDA 3PDWA 1XZCA 1UODA 5CW2A 1KDYA 4E5UA 2PA0A 3A6DA 4EYKA 4BVFA 2VRNA 4DLYA 4XJSA 1FX0B 2W8BA 1F0PA 4NYMQ 3BB3A 3MMXA 4V24A 3VPDA 1M73E 3CA8A 4P34A 1BJRE 4PZAA 1Z16A 3RVMA 4BX2A 4U2GA 5CR9A 2VRWA 2XR1A 3U60B 3UAOA 1ZOIA 1NDUA 2YR0A 1UDRA 5H1YA 5B58C 2ETXA 2PT5A 4RESA 3E7XA 1L1FA 5IVKA 2GLXA 4N7MA 1U0HC 4INZA 4OTZA 5DNDA 5EJEA 3H8WA 2O8FB 1Z7YA 1EWRA 1PEKE 1U0JA 5L9AA 3A10A 1IZZA 3GZJA 2VZ8A 3IB3A 1Z5PA 2G7ZA 2IXGA 3B1WA 3PS9A 4KDFA 1W30A 1DAKA 4IF6A 4FOOA 3WMWA 4B80A 5LWQA 4MGHA 5FBWB 3DMYA 4RVUA 4YCMA 2CNNA 3PC4A 4IIJF 2H00A 3B3JA 2QBYB 2VS1A 5DU2A 4ZRMA 2JKYA 3KSZO 2J7KA 4MGIR 1R66A 2SNIE 1JP7A 1KKUA 2Q8NA 2WSLA 3LDHA 3IR5A 3RR2A 4RPHA 5J5AA 5LZ2A 3DCYA 5EIWA 4L5JA 5CVUA 1P8JA 1RI1A 1UH5A 4I5DA 4OU4A 1BD4A 2NXCA 4MWBA 3R7DA 5K0ZA 121PA 3IT1A 5ISMA 2R1VB 3INGA 3FCOA 4XQGA 2ARKA 3MRXA 4OSEA 3AUUA 5L7YA 2VJKA 3OJCA 2DHQA 1RIIA 1Z88A 2BW0A 3ZXYA 4BO3A 5A9SA 5C8DA 2FH5B 3E7PA 3Q7EA 5BNZA 5T4EA 1OB5A 2D13A 3AKYA 1GRRA 2GEVA 4X8OA 5BOSB 2IE0A 3LW8A 2PR7A 3FHJA 2QK4A 1JXOA 4IOJA 1F2UB 4OG2A 5CX1B 2P77A 5DP1A 4DG8A 4F7WA 2GVNA 3KTAA 3TPCA 5HVNA 1EFTA 3VM6A 3DBIA 2V4MA 3IYLW 2DT5A 1XD2B 3AM3A 3OC6A 2JJ2D 5DXAA 4CG0A 4DG9A 4WL0A 1BZYA 2D5IA 3REGA 3FPGA 3Q3GE 2P4EA 1DXYA 1UZLA 3I09A 3DAFA 2OV6A 2ZUBA 1RAFA 4PCLA 4WERA 4A5SA 1JDBC 1USUA 3G5LA 5JJIA 4Q1BA 4NU8X 1YJCA 1XMSA 5ECDA 1YR1A 3BXGA 3D2BA 4UUBA 4W63A 4Y1RA 1DGQA 3UAGA 4J76A 1N6HA 2B4YA 2GAAA 5HZMA 3BIXA 3GIDA 4YRGA 3GVHA 4DILA 1PJQA 5F52A 1A7AA 1K4MA 3BILA 2WPNA 3DHWC 4FWIB 4A6EA 1RJWA 2AJBA 2CN1A 4GWLA 1SXGA 1UC9A 4JGBA 5K7SA 4BLSA 3OCJA 5BWLA 4QO7A 1E6MA 1NW8A 2YIMA 3B2EA 4IIHA 4RK0A 5BQ5A 1T3GA 1NE2A 1IWOA 1JH9A 3W6ZA 2X8JB 3F8TA 4AURA 1F14A 3BGWA 4CT4B 3B60A 1JNXX 1R12A 3LBNA 3H9EO 1K63A 4RY8A 3VKVA 4K6OA 4CCYB 5DM70 3RW9A 2HC9A 1T9GR 3BIJA 3OEHA 3UFBA 2WM8A 4L2IA 2A3NA 1M1YE 1V5IA 2V7VA 2WU8A 3IHTA 4DIFA 1VGVA 3NTXA 4PN3A 3QSGA 3TRJA 5A03A 4IHJB 1UZUA 5ANRB 4P2BA 1P91A 4X66B 2WQ7A 1VJCA 3ZHUA 3I64A 3J7AC 2IFTA 3GGPA 4HTAA 4S1PA 4D44A 1K7EB 1SU8A 3K0KA 3GX1A 3M34A 5CDTA 4KIFA 3JAWB 3MWFA 1G7RA 1ZVMA 4ZI7F 1ES9A 2PH1A 2AHRA 4QRHA 1JAYA 1L3CA 1QPZA 4RF5A 3ETHA 4MWCA 1LPAB 1OZFA 5ULLA 1U65A 2ZDGA 3EGDB 4TLBA 5AVZA 5AW6A 5JZ9A 2A78A 1JG7A 1HT2E 3TO5A 1JMKC 4RX1A 3RBAA 1IOVA 1RWPA 2GTHA 4PBTA 2PNFA 3TBKA 5KNLA 2XTZA 5HHTA 3TGPA 2WAMA 2PSJA 1JVBA 4MARA 5DN6D 3KAPA 2Z3ZA 1DC8A 5E8RA 3VOAA 1I3CA 3VR3A 4R2HA 2G1AA 1IJFA 1RBQA 3AERB 4UBJA 4JI7B 1B93A 1RVDA 2YL2A 4FTWA 2VUHB 1SD5A 3QGMA 3KAJA 4QUEA 2GM5A 1S96A 2Q9UA 3E9EA 2QL9A 3L0DA 3Q7SA 5FR2A 4YWJA 1E2HA 1MABB 4AZTA 2ORWA 4DKXA 2XOKD 2MU1A 5A9SB 3RS2A 4Y1GA 1DEXA 1DTEA 2JFHA 2VFAA 2M98A 2WG0A 3LY7A 1J23A 1BHQ1 3KSUA 4ZCRA 4IO0A 1BH6A 1OLUB 2BFNA 4DJ5X 2BFCA 3NIGB 4TKUB 3RTAA 4YRSA 4ZJZA 5F23A 3JQFC 5JH7A 2HGZA 4FIZA 3PXGA 4FHFA 5AHOA 1AV6A 4J0CA 2ZB3A 1SKBA 5DNCA 3WL5A 1QHIA 4K8OA 1EFPA 4UQPA 4YBZA 1O9HA 5DP2A 3VSEA 4TTIA 4UVEA 3IE0A 3ROXA 1RWQA 5L7TA 5DYIA 1MENA 3G59A 2CMKA 3HKDA 2XRFA 2ZBRA 5IMSA 4Z9AA 2HREA 4DMMA 4PFQA 1I0LA 2ADFA 3RVLA 2V5VA 3U3JA 3AHGA 1ANKA 2BC9A 4G1MB 3BRWA 4JIGA 2EDCA 2JJYA 2Q5OA 2IDKA 3SJBA 2JI6A 4E07A 3AVWA 2QV7A 1GL3A 1PW7A 2CLFB 1LK0A 1DJPA 2CXPA 2DQSA 4XWTA 3NHUA 4AJIA 3TN7A 1DQNA 2RHHA 1GNLA 1QAQA 4FSHA 5EZYB 5D6OA 5D1HA 3M6WA 5IWAB 4REOA 1QS0B 3EIFA 4J43A 4CM6A 1KQOA 3KX2A 5EJ5A 3BF8A 3DC2A 5E2BA 5C4MA 1NSTA 1DV2A 3AY0A 1YVRA 3PGJA 4BN0A 1N5MA 2VH5R 1Z4QA 1R8JA 1Y1QA 3OO1A 5E4TA 1BFDA 1DWOA 5TVKA 3TW0A 5C51B 1UJBA 1QRTA 3F7NA 1BFUA 2HT1A 1TA0A 3EIOA 1VJGA 4JGIA 5C1PA 3PB3A 1V4VA 3I23A 3TQRA 1XUOA 2WG1A 5FI3A 5CD9A 1J6UA 1AKTA 1G21A 1TM3E 2C2HA 3RV4A 3WKDA 3A11A 4HPWA 1HFKA 2YTZA 2AOWA 2CXUA 2WV9A 1IPFA 4GYKA 4E11A 4JAVC 3HPQA 3GHHA 3M4JA 5KDDA 4Z4FA 3VR5D 1ISIA 4TQGA 3BKXA 3BJEA 1GGJA 3A6KA 1AQYA 4V1CB 2ZRBA 2OTCA 1ZWLA 1W46A 4CV2A 3P0IA 1KI6B 3NWPA 3UANA 2C0QA 5IU6A 5H9VA 3GVPA 1RQXA 3A1NA 3HBLA 4TV8A 2DZDA 2DUMA 3PG5A 4F8JA 2J0SA 1E9SA 3TX6A 1FA9A 1XLWA 4Z3KA 3T7AA 3VUFA 3FSJX 1CJMA 4BNGA 1ZN9A 2WSYB 2DGDA 4C07A 4ZQBA 1XVVA 3HVJA 5KBYA 1RFLA 5CRIA 4DNPA 1TQ8A 3EG9A 5JBNA 3MB5A 4KWIA 3PRHA 2H1SA 4EL5A 3NIBA 2R84A 5BMOA 1MXFA 1J99A 1O8CA 1NNSA 2GEUA 1UMKA 1U28A 1R0LA 2GHIA 2CE2X 2FG6C 3FYUA 4GXQA 4P36A 3GRVA 4G9BA 1ST2A 4OM8A 5DGDA 3J80A 2FEOA 1I4LD 3WJ1A 4GM0A 2FFQA 1EHIA 3BK7A 3WWCA 1V35A 3SBDA 1XEXA 4TSFD 5AVUA 1T1JA 1LRLA 1E0AA 3NBKA 4PQRA 1N5JA 3OAAD 2NVUA 5GIOE 3RRXA 1C4KA 2IYQA 5IAAA 3UHOA 3UBTA 3EVGA 4GP9A 3HCCA 3ADPA 3CF6R 1CUEA 3F46A 4NF2A 1AURA 3HB7A 4HKTA 4X0EA 1LPNA 1JA0A 2M2IA 1ORVA 2O2SA 5I3CA 1SC4A 4ZYYA 1R5JA 2LIVA 4M53A 3SLKA 3TZ6A 5FAKA 5GM2A 1TYDE 2BR3A 1KORA 3N2GB 2HRCA 1K8QA 3PI7A 5K3FB 4RF3A 3N76A 4MKZA 2FLWA 2YUIA 4DQUA 1DO0A 1U80A 1LA2A 1KFCB 1MB4A 3AETB 1VIMA 4WZZA 2W48A 3ENNA 3LOUA 4PLFA 3X1KA 2EW8A 3VU0A 4JR2A 4C2BA 2P67A 4XQEA 5AW1A 2W83A 3HNOA 4P5DA 5CYGA 5CFLA 1CY8A 2PVCA 4TV9A 1RM5A 3V6MA 3V4VB 3OWHA 1NF8A 2FZGA 3GJSA 2H63A 1TZ2A 3BXZA 2C2KA 3PX3A 5G1NA 5H7XA 5REQA 4EB6A 1NQOA 1SURA 2FEKA 4XYLA 2DBQA 1OC2A 3IQZA 5BQFA 3BPSA 1EQUA 2ZRDA 4TSFA 1I7NA 4M7RA 4RA6B 5TE9A 4L7QA 3MPUA 1GTRA 3LCUA 3L7DA 4YQFA 1A2BA 3LUDA 1GPNA 1V41E 2A6PA 2AOTA 1ESDA 2YJGA 4NMMA 4RE6A 5KJEA 4RETA 3ZBTA 2A4KA 3EODA 2DTDA 4B8YA 4FBLA 3T99A 4GSKA 1YA8A 1C8LA 3ISTA 4MCAA 2NU6B 3WKCA 1TPZA 4U7TB 3ZJ5A 4BO2A 4DR7B 1LDYA 4TTTS 1G5PA 2EFHB 5JXIA 2F9FA 5FO1A 3U1BA 4QT0A 4BFYA 1ODKA 3VPFA 2C98A 1LTKA 3TRFA 2YIVX 4E4RA 4HHEA 1H2WA 3OJEA 5KJFA 2D62A 1EP9A 1MB2A 1WEHA 2IYRA 4NCAA 2ES4A 4UAJA 1UPXA 3AONB 4X5OA 3PE4A 2A3RA 4EA7A 3U4QA 1YOVB 4GOND 4GOOD 4W5QA 1RWWA 2O0MA 2PX0A 3PU6A 3LUFA 1J70A 1O6FA 2VYFA 3FPLA 2VDVE 3RC7A 5CEFA 1L4FA 2XUHA 3PUIA 4O2BA 4PZZA 1C7EA 2UVQA 3I53A 5DNAA 3VJMA 4ER5A 2I4NA 2VPZA 5EP4A 1P1FA 5FRDA 1YI1A 5IF9A 4CGYA 4IXTA 4DY6A 4IJKA 4IJQA 1I3KA 1C8BA 1L4EA 2A1IA 3DL0A 3KD3A 2HMUA 3KYBA 3NOQA 5JAMA 3OTQA 1V8FA 1VJ1A 3IHWA 3GJ8A 2UYQA 5F2EA 4CG3A 2IV7A 3EDYA 1B1AA 1YV9A 4KUHA 3LVBA 4DMFA 2M6SA 1QRRA 4ENUA 1VLJA 3EQZA 2JGFA 2ZYIA 1CNFA 3CRVA 1N0IA 4I1RA 2O0JA 3VYTB 1YT5A 5ALDA 1ZSVA 1PVDA 1CDZA 3H5AA 1TJ4A 2B8WA 4B83A 2Q3MA 1JIXA 3Q3JB 3M2PA 3WRXA 2HJRA 3MILA 1RXSA 3O7MA 3U7IA 4GLOA 2X0JA 4DDUA 1L7OA 2FRDA 3TLYA 4YK7A 3T4EA 3OZSA 1YVPA 1V11B 1ESCA 2BJHA 1VM6A 4PAMA 1ZD9A 2CB0A 3I04M 4AB1A 1YDMA 3KFVA 1SELA 4MRMA 2VR1A 2WR8A 1RWOA 1RZRA 4EQ6B 5AJTA 2FV8A 2VBFA 3H2SA 4OIFA 2P9CA 2IU6A 3D8HA 3L84A 1PF7E 4KFTA 3AUYA 5DWDA 4M60A 1X7GA 5ECGC 2BHLA 3I9V1 1JRLA 1VG9B 4NMXB 3H0KA 4OKIA 4Q12A 5LZ5A 1TDJA 5A4IS 1BCRA 3QRWA 1M2WA 3C8DA 2DPXA 3M9XA 4EGCB 4CEIB 4IWYA 4DV1B 3F5SA 3DZDA 4KO8A 4P31A 2EEZA 3PLAE 4ZEVA 1N78A 3K4HA 1G20A 1WUKS 3A32A 2D0DA 2QVZX 1M3SA 4LHSA 5BWCA 4LWPA 3U4AA 2IC5A 3AEUB 4UCXA 3EJWA 5JS2A 5EHQA 2IUUA 3VC2A 3Q2KA 1I6MA 2QLBA 2SICE 2WJAA 3EVDA 1PDWA 3A6JA 3KLMX 3NI2A 5J5CA 4C0WA 3L04A 4QUIA 1GPDG 1TLFA 1I5RA 2PJUA 2XA2A 2JCVA 2OP0A 4L4UA 5CM9C 1RYHA 4AJ2A 4UJ3A 4MR7B 1LI7A 3AR8A 4UKDA 1YB2A 2ANCA 2JIPA 3A8TA 3U9SA 1AKUA 3NHBA 1SXQA 1CEYA 3V42A 4ZXFA 1ADYA 1X3LA 5JAUA 3DDZX 4P92A 3QLTA 3HWWA 2GRUA 2L17A 4IZHA 4MW6A 1P4JA 1YK1A 1KJ9A 1VPDA 3RTBA 1MFPA 2XI4A 2B2CA 3PDCA 4X6YA 4XE5A 5GGXA 3WDLA 4E1BA 4Z1MD 3GD5A 4DZZA 1IXZA 2GOYA 1QO7A 2P9JA 2BFBA 2R96A 4Q3LA 3ND6A 1E1QD 3WWPA 4AG3A 4CGZA 3EVNA 1OXXK 3VR6D 3PV0A 4BYMA 5K3OA 1N2XA 2G6BA 2ZE5A 4WUVA 4D5GA 2FSVC 3W9BA 3PT9A 5J2UF 1YB6A 4GOLD 1RHRA 1LFDB 3CBQA 4M22A 5EZ5A 5SZKB 1WAMA 4F6CA 2I3GA 3WYCA 2IEGA 3QBDA 4ESHA 3H5TA 5LN1A 2WJ4A 4ZVOA 3ISVA 4XYMA 1U7TA 5ADHA 2XCLA 1GSOA 1HFJA 2RHLA 5JJCA 3AKZA 1CS0A 3ASZA 4PO8A 2W2OA 1O0SA 1OMOA 4JKOA 4RJLA 2ONJA 3QFFA 3VR2D 1CF2O 3P2EA 4KPUB 5LNK1 2HCFA 3B1ZA 4IAOA 1KVRA 4M0PA 4EF6A 1GN9A 2C9DA 4JEIA 3IKVA 3TSOA 3WK6A 2K4MA 4AKTA 3SQMA 3JASB 4D45A 2EJVA 3DB2A 4JKYA 1U81A 2DH5A 3HR7A 4IG4A 1GQQA 1RBZA 4I1YA 4EY6A 1Y0BA 2O2GA 4ZK6A 4QEZA 4ZOBA 4PTYA 5L4NA 1OZHA 2WG2A 3DDHA 4QGHA 4LJLA 3E27A 4JLUA 4L9SA 3JQAB 1I4WA 1PN3A 4KAAA 3CLHA 3NHAA 5KKCA 3GWGA 4N0QA 2CUKA 1Z35A 2WJPA 5AUQA 3ICWA 3TUJC 3HLTA 3EQ9A 4YYZA 1Y6FA 3U13A 1A9OA 1Q50A 2FRXA 1L7VC 1X0XA 5TMBA 2GPNA 1W2HA 3CN9A 3WMEA 1ZEMA 3TSWA 1NVDA 4IVRA 4DT1A 2QUIA 3BT7A 1AM4D 3C8UA 4QUJA 5J4HA 2FPPB 2IUFA 3HZHA 3M3PA 2PCJA 4FDAA 4JFRA 4B4KA 2EZ8A 4BMPB 4TWIA 1Q77A 3E22A 4HQFA 3I9NA 2NZUG 4FFOA 4I4IA 4EATA 5KKAA 1EE2A 4G0VA 2J7PA 2GERA 10MHA 3LHFA 7MHTA 4H1HA 5HILA 5JCJA 4QQKA 4G6ZA 3F3KA 3N8DA 4G4SO 3OO0A 4OQFA 4MPDA 5JPCA 2V7WA 4Q9LA 2BCEA 4N5MA 3GEPA 4KGXA 3TMKA 4XGRA 5I01A 3COPA 1KGSA 5SYAA 1FU4A 1KK2A 2TMYA 3NDPA 2CLSA 2O2IA 3OBBA 4HDKA 2ZT5A 4I5GA 4MQUA 3L0SA 3GRFA 1RXEA 2HB6A 3R6LA 4D6PA 1XZBA 3BMQA 4BHTA 1Q19A 3QEKA 3ZLBA 4N47A 1DP4A 1L6IA 1XO1A 1HQDA 3LZ6A 1ATZA 2GN1A 2EKQA 4MIEA 3OIFA 5U1PA 1GPAA 4YCLA 1KMQA 1XTQA 2Z04A 1X9IA 3AF4A 1IAQA 1NVVQ 2XWPA 2YVUA 3DM9B 2YMLA 2QPAA 4XLTA 3RFXA 4F11A 1AA6A 3F0TA 3KOYA 1U8FO 2Y1DA 4TV9F 4D9MA 1BDJA 3HB5X 2EFCB 4X7BA 1UXIA 4BVBA 2QRNA 1CZNA 1OE0A 2R25B 3FTQA 4ZI3A 4NFYA 4L3VA 5B2EA 1QO0D 2IPMA 3VJKA 3GLSA 4L78A 5AK3A 3WNQA 3T1NA 3OQ6A 5KPJA 3TTSA 3KE8A 4NBWA 4BTLA 4OMFG 3WI7A 3UMSA 2F2TA 4KRYA 5BNWA 3T4PA 2QG4A 4MQFA 3DCJA 1PW5A 1LLQA 1P2BA 2QVCA 3BDAA 4OBEA 4CL8A 3KETA 1OWNA 1CE8A 2IYLD 3NONA 5GVSA 1OD6A 4WIAA 2ZR7A 2XUAA 2HQ1A 1NJ2A 1RKBA 3TAHA 2YHAA 5CNKA 1M1NB 5A4AA 5M34A 1C9KA 2X8WA 5CXSA 2HU5A 2D2XA 2N3ZA 4KBFA 3F5DA 4F21A 4ZV4A 3THYB 4YDQA 3HKBB 2WWHA 2Q5FA 4LDNA 4PRLA 4UBOA 4GX1A 1ZD8A 3RS3A 2N9UA 3CF4A 3S2YA 4YRJA 1ZZGA 2C77A 4MUKA 4BJ5A 5EE3A 1T0IA 2P9TA 3HH8A 1BDMA 4D4LA 5FORA 4BZPA 3QX3A 1PE0A 5NLLA 4RZQA 1Q0QA 2A9FA 1JVNA 2HRQA 3L02A 4OAOA 2KYRA 5CB4A 3RAEC 5A4FS 1V2HE 3L8FA 4GPZA 4M1TA 4OH1A 3FF1A 3JASA 3B12A 1VHDA 5ALIA