3V4RA

Crystal structure of a uvrb dimer-dna complex
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
588
structure length
586
Chain Sequence
DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein B
publication title Crystal structure of the UvrB dimer: insights into the nature and functioning of the UvrAB damage engagement and UvrB-DNA complexes.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/dna
total genus 189
structure length 586
sequence length 588
chains with identical sequence B
ec nomenclature ec 3.1.21.5: Type III site-specific deoxyribonuclease.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 3v4rA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v4rA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v4rA01
1Z0AA 1RIFA 3ZGXA 3AVYA 4JJKA 2XNDA 4KO8A 3VU9B 5DI9A 1R8SA 1HURA 4A8JB 3OEHA 2R6DA 3KDSE 2VSFA 1GNQA 4KU4A 4QGFA 4ACAA 1GUAA 4GOKA 2VA8A 4D4LA 3GLGA 2OXCA 2J0SA 2FF7A 2ZRJA 3CM0A 2QSYA 3K0AB 3LQRA 4TT3A 5HCIA 3K0EA 2RGCA 2XJ9A 4KODA 4KLZA 3VR4A 1Q3TA 1JR3A 1ZCBA 1OF1A 2W6JD 1LNZA 1Q57A 3F5FA 5C18A 5DSZA 1KI4A 3UPUA 5CYPA 1CULC 2IXFA 2XTZA 2IYQA 2ZI4A 2ZE5A 3L8YA 1FNMA 4GMXA 4BASA 4OI1A 2H92A 2QNRA 2N1BA 3EX7C 3VR3A 4IFBA 2XB2A 2YYZA 2GJ9A 4AYWA 1K5GA 4ABYA 3EASA 3QXSA 3E70C 2W2VA 1DBSA 3BWDD 2D74A 1KNQA 1E9FA 2A5FA 4LHZA 3ZIAD 2BMEA 3TW4A 1LW7A 4NCNA 2ZRMA 3V00A 2VIIA 4D81A 2B7CA 2R2AA 1MRNA 2WJIA 5LD2C 5B64A 3NWJA 2SHKA 3TJZA 1ZU5A 2WICA 2VYFA 3NBXX 3WMGA 2WTUA 4EQ6B 4D2IA 3NIBA 5FTNA 4C30A 2AKYA 4NCIA 1EFTA 2JLXA 2ZSDA 4DIEA 2CL0X 3CW2A 3L0PA 4WVFA 4EPTA 2WHXA 3WNCA 4EIWA 1JNYA 5TDHA 3CRW1 4DXAA 2XEXA 4FD2A 2NPFA 4RZ2A 3T1TA 2R6CA 3Q85A 1G3MA 1Z6AA 5KPJA 4N1AA 1OXSC 3CB4A 5KHOC 4NBSA 4FCVA 4LGMA 4Z1MA 3B2EA 2PEYA 3P4YA 2QTHA 4OI4A 4OHXA 4YONB 2C5LA 1Q1EA 1KKMA 1IY0A 2C96A 4PQYA 2PX3A 1W0JD 1RJ9B 3TAUA 4A0GA 3NH9A 3SI7A 1NMXA 2GEDA 4WZAE 4U00A 1OXTA 3HU2A 4QBFA 1W4BA 1EFUA 1LTQA 4JJZA 2PH1A 3B60A 4BWYA 5TXGA 2VO1A 2CVHA 2J0UA 4G0NA 1UDWA 4GZLA 4POAA 4S35A 4TL9A 3Q72A 3GD7A 3H1TA 5B2ZA 1NN1A 3C5HA 3LLUA 1HA3A 2A5YB 3KKNA 5JMTA 5KOYA 2YWGA 3BE4A 3MD0A 2JJ1A 3KQLA 2REBA 3NEJA 1UADA 1IBRA 4Q9KA 3CF6R 4CIDA 4YDSA 4B3XA 5CB8A 3KTAA 3RRZA 3KKPA 1U94A 4W7SA 2ZSBA 1PVOA 2EU8A 2P65A 2FWRA 3CNOA 3I5YA 3T1VA 1YZQA 1XXHA 1MH1A 4CVNA 4LHWA 4OJQA 4WZBE 2FZ4A 3FWYA 4LOAA 5FPYA 1AS3A 1OV4A 1E32A 2DR3A 1OYWA 1GILA 1T5IA 3CWZA 1G291 4URXR 4HDCA 3GP8A 4NYMR 1F2TB 2PJZA 4V0ME 2GAAA 3A36A 2FFBA 1ZNWA 3MG9A 4JIMA 2I1QA 1IN7A 4EAQA 2JIZD 2JASA 3GJ4A 2RGNC 2W0SA 3PUVA 1FQKA 2JCSA 2BOVA 1DVRA 2IYLD 1KSGA 3KUDA 2GF9A 4C0JA 1WE2A 3SS8A 1F2UA 2IYYA 1XCPA 4DFCA 2QI9C 4JSTA 3KQNA 3EPKA 1D2NA 3AQ4A 1X8KA 1F60A 1OXUA 2ZRCA 3K09A 4RZ3A 3QPWA 3VNVA 3NC0C 1GM5A 2IBMA 3FMOB 1DELA 5G40A 3SJCA 4LC1A 1BH2A 2BBOA 5EP2A 4XWKA 4XSHA 5FBQB 4C7OB 5KU1A 1Q20A 1LS6A 1M7BA 1NJGA 1XWIA 1JALA 1Q0UA 1KI8A 3EA5A 4HYYA 4Q7MB 5FFMA 4ZPXA 4EKDA 2FPMA 4IEEA 4PPGA 3IBGA 4TSFD 2QA5A 4UJ3A 2OLKA 4M4SA 4WZ6A 3LD9A 2ERYA 2CNWA 2QPAA 4HZUA 5DGXA 4B33A 4IVRA 2PMDA 5KDDA 3T06B 4YLGA 721PA 2GETA 2QQEA 2J7PA 2Q9AA 3K09C 1ZM4A 4X8HA 2F1JA 3B1ZA 3QEJA 2W0MA 1M7GA 5DE3A 3SFVA 1D9ZA 5JJKA 2VHCA 1XPOA 3AEZA 3EPLA 1KJWA 3R9XA 1G7CA 3BH7A 4A8JA 2RHDA 4M1WA 2CCKA 3GEIA 4Q4HB 1MOZA 4PSVA 4BZXA 1Z0DA 1U90A 1XJQA 1HE1C 2OBNA 3K0AA 4QGGA 5CK4A 2NTYC 2CJWB 2VBCA 2ZVPX 4LJYA 2KBEA 4OQMA 1FOEB 3WMFA 4AWXA 2CNWD 3NBZC 3W34A 4Q7KA 2RHMA 3P1JA 1T0HB 4AKGA 3O8BA 1UBFA 3BAFA 4Q66C 3K9HA 2FA9A 5UKDA 2IYWA 1R8QA 2CE2X 1KI9A 3T5DA 2GAOA 3N5CA 4DCNA 4YMTA 2VTKA 2ZI6A 2QBYB 4KBFA 4QHTA 1G19A 4F91B 1H8HD 5J4HA 1XU4A 3OZXA 1BO6A 1CKEA 2F9LA 4ZCIA 2GESA 4DSOA 2Q3HA 3MWKA 2W6ID 4A8JC 1E9EA 1Q44A 1QVAA 3GJ7A 3DM5A 4JKYA 3SN6A 1XMIA 3KXLA 4OK6A 2JLRA 2R8RA 3I3SR 3F0TA 2PZFA 2B8TA 1W0KA 4O2LA 4A4DA 4TYYA 1Z63A 3RRMA 3KB2A 3ONWA 3PUWA 3BC1A 4OHZA 3FPNB 1NVWQ 5BN5A 3FPAA 4Q00A 4EQ6A 4GDFA 4HATA 5JI3E 2BJWA 5G41A 4KVAA 2TMKA 4OJKA 2CXXA 1KO1A 2WJHA 4A92A 1DAFA 4PO8A 4V0MA 1KO8A 2IYXA 5C2JB 2V6JA 4JYBA 4BFUA 2A9KA 1K8RA 4A9AA 4Q7JB 5FPKA 5HZHA 1T8UA 2F3RA 3A58B 3CNLA 1DPFA 1OIXA 3CR7A 4DBLC 1NVUQ 5JRZA 1G21E 5AJWA 5E7JA 2H8KA 4MYTA 3B82A 4DLYA 5FBRB 3RRYA 2C9CA 2ZRLA 4B6FA 4HAYA 3NG1A 2FZLA 2E9SA 1TQ2A 1RJ9A 2EFGA 4Y0AA 5HKKD 1DO2A 2GCOB 2GILA 2UVQA 3ZLJA 4IKEA 3PV0A 1E2PA 4KVGA 1WBBA 4HUQB 1TMKA 1BKDR 3F8TA 4EPWA 3VR2A 3PFIA 2NQ2C 2QG6A 3QNUA 5JS8A 1W1WA 2AL7A 3B1XA 4PHTA 1E0AA 2ZSEA 5TMPA 3REGA 2CLDX 3C4JA 4PFSA 4BFTA 1OHHD 2J0QA 5FUWA 3IPXA 1LF5A 3GEEA 1N5JA 4H1UA 5A5GA 4H9GA 5HR5A 5DI3B 1QG4A 4ZDIA 5EUQB 2CVFA 5CLLA 2D7DA 4P4SB 5FL7D 1Q1QA 2D7CA 1NBMA 2ZR9A 1OH5A 3WBJA 4MRNA 4ASUD 3TLXA 1P75A 1F3OA 2RKOA 1W36B 1ELOA 3HR8A 3Q9LA 3CF2A 4LJ5A 2O8EA 4BLPA 2ZSAA 1QRAA 2Z83A 1G5TA 1G8YA 2D2EA 3TR5A 4HI0E 4KJZA 4UXHA 3V9PA 4TMZA 1T91A 3TNFA 1CRPA 2DBYA 3P20A 4B6EA 3ZS8A 5JJLA 3B6EA 3LH5A 1A82A 3I5XA 5L3VA 3RS2A 2YHSA 1F2TA 1PV4A 2JJ8A 3JVUA 1DAEA 1XMVA 1KI6B 1XZQA 1XTIA 1ZD8A 5K8IA 2IT1A 5LDDC 4DSUA 3U5ZB 4I81A 621PA 2G88A 1FUKA 1G4AE 3X1YA 5L3QB 3BB1A 3B13B 4JYCA 3TGPA 4DLXA 2HDNB 4DUGD 1UJ2A 2EWVA 2VPPA 4PC6A 4Q1EA 4JL6A 2QAJA 1HE8B 5FPHA 4DDVA 2IEZA 4LHVA 3GFPA 3KJHA 4YMVA 4HB4A 5JZVA 2UZIR 3QKRA 2WIAA 3U6BA 2ORWA 2ATVA 2Q9CA 3DHWC 3CZQA 4G5GA 1G4UR 3B1WA 1E98A 1Z0JA 3GFOA 4F38A 3QF7A 1NVVQ 3KJGA 4J0QA 4NHOA 3UG7A 4MGKR 4Q9JA 3U6KA 4C7OA 2UZ3A 4UQOA 4HAXA 3DVLA 3BB3A 4MQBA 3C5CA 1G8HA 1NMYA 2AWNA 3I8XA 4HLDA 4US1R 2FSGA 2WWGA 4DJTA 4LX0A 1N0VC 2IYUA 4V03A 1GL6A 4MYHA 4DLVA 1AKYA 4HDQB 2VQSA 4QJ4A 2VL7A 2V3CC 5JJIA 3BJIC 5G3YA 4FN5A 4JVNA 3K9NA 3HJHA 4JLJA 2GWHA 4LI0A 3X1DA 3FOZA 2IYSA 1XTJA 2C04A 3PCRB 2PLFA 3Q5DA 3TH5A 5FR1A 1G18A 1OYYA 1VPLA 3AF3A 4P4TA 4PSKA 2AHOA 3CKLA 1Z5ZA 2VLIA 4R71A 3D6TB 2VHQA 4TMTA 2IA5A 4Q4HA 4YC7A 5H68A 3GQBA 4LJ6A 4Q4JB 1T4GA 4YMSA 2GK7A 5EXSA 1DOAA 4P32A 2W83A 3SNHA 2HLDD 2H57A 1JJVA 2CJWA 2ATXA 3AP3A 3NEYA 3CLVA 1KDOA 1NKTA 3QXJA 1Z0IA 2RMKA 1WBDA 3THYB 1E1QA 1SVWA 1DG1G 4YDHB 2C2HA 1OKKD 2QT0A 4Q4AB 2K5UA 1E4YA 1Z29A 2C77A 2IYVA 1KO7A 1QBKC 1SVIA 4GT1A 1LFDB 4O0MA 3BFKA 4WIAA 2QBYA 1XDBA 2I1VB 3FVQA 5HZKA 5CLQA 2P0EA 2OAQ1 2QZ4A 3U3RA 3I92A 1GKUB 2BC9A 2YC2C 2J1LA 4AC9A 1JPNA 2Q9BA 1X1RA 2RAPA 3PITA 1ZRHA 1KYIA 2ZYVX 4KFRA 3GPLA 1E2DA 3CUEF 5JRJA 1E94E 4QBHA 2PCLA 4G5RA 5H8WA 2CLSA 1C4OA 3ASYA 1W49A 1KAGA 3W8NA 3C16C 2A5GA 5KYKA 4D0NA 1N6NA 3CRMA 3CX8A 3UWKA 5BWMA 4PXAA 2ZUBA 3T1OA 2CCGA 1OB5A 4C0QC 3THXB 2XITA 3IPYA 2GF0A 4KYUA 2XZOA 2AK2A 3EC1A 4MGIR 5F2EA 2A5DA 3QE0A 3N2EA 4M21A 5IT5A 4IEIA 3QQ5A 2W58A 3SE0A 3WP0A 3K70D 2VRWA 2O8BB 4B35A 3X2SA 1VCIA 2HV8A 4GP6A 4GMDA 3R9WA 1DE0A 2G0NA 4LRWA 3NC1C 4BRWA 4GRAA 4LC0A 4BFYA 3MGCA 1EFHA 4AG5A 4IDQA 2ZU0C 3VKGA 1NY5A 4LHXA 2F1RA 5KUTA 3AM1A 2GCOA 4JBXA 1KAOA 5HTKA 3TSOA 3UKDA 5BXQC 4TTPA 4HUQA 3VAAA 3KB1A 4OBEA 4RZUA 5LB2A 3TIFA 4Q19A 1GRQA 1XP8A 1GL9B 1X8LA 5B58C 4I1VA 1TF7A 3HJNA 5F9FA 3U3OA 2GXQA 1NIPA 1WRBA 5EE0A 1T3SA 2AD5A 4PO1A 1XZPA 1D8TA 2QTFA 3U3MA 4BLTA 2QUZA 2ODWA 4URWR 4HLCA 4IVQA 4LSGA 1AN0A 2B6HA 3NHBA 1NNEA 2D4HA 3TSZA 1NSFA 5IK2A 4P4SA 2NO6A 2QPTA 1MABB 4B75A 5AJXA 5BQ5A 2KJQA 2YNMA 1HH4A 1KMQA 4DKXA 4QJ5A 3QY0A 2V1UA 1WF3A 1JAHA 2CL6X 5ELXA 4TYNA 3VMFA 2NO9A 4JSYA 1Q1BA 1QG2A 2QM7A 1W48A 4PAQA 2QMEA 1IOZA 3GLIB 2ODNA 1ZU4A 1HUQA 4RD1A 3R7WB 4TL8A 4XH9B 1ZYUA 4MKIA 3UANA 3BH6A 1FMLA 2FSHA 3AP1A 3W6PA 5IK2D 1FTNA 2MMGA 5FUYA 4ZDWA 1E1RA 4NYJQ 2BEJA 1EFRA 3PR1A 1CJMA 2BKUA 5HPYB 1KI6A 3Q8XB 2V55B 3B9PA 4Q9IA 2FE4A 2ZRIA 4V0OA 3ZQ6A 4D6PA 1GFIA 2ZJ5A 2EYQA 3FHCB 4FCTA 5L3QA 3U3JA 1I4LD 5DYIA 3VX4A 1W36C 1CS4C 2ZRBA 5EP1A 2ZQ5A 1DADA 2O0KA 3IIMA 5GJVC 2R6FA 4M9XA 1Z08A 1TNDA 3BORA 3DEFA 4BLSA 2ZJBA 3ZZ0A 2AKAB 1WCV1 3QVVA 2NO7A 2OCYC 2EQBA 3H4MA 3WHLA 1NVXQ 5ANRB 4IDNA 2IUTA 3PEWA 2ZM5A 2BBWA 3R9IA 4A2QA 1E1RD 5LPNA 2QMOA 4LCBA 1FPMA 3GLFB 2CHVA 5KSPA 2FFAA 1P7CA 1EX7A 2Y8EA 1TL7C 1R7RA 1XJ0A 2IW3A 2WJJA 4Y0VA 4LJ8A 5DHFA 4BZQA 1I4TD 1YZLA 3UWOA 2NZJA 2VP0A 4PAOA 1COWA 3FGNA 1E79A 4HB3A 5J40A 1ZVQA 4EPVA 2EW1A 1IM2A 4TZ6A 4TN1A 1P9WA 1XTRA 4L4UA 5FOWA 2NO1A 5JHHB 1X3SA 4LBWA 1TUEA 3RVBA 2QGNA 2GJAA 1QHIA 1SXJB 3CPJB 5FUVA 1AQUA 4HZIA 1JXMA 4DC9A 2QE7A 4XD7A 3BIFA 2GXSA 3V4FA 2JA1A 4Q1AA 1CJKC 1KDRA 5K8UA 3EW9A 2JDID 3QF4B 3GLIE 4DLWA 2HF9A 3QUSA 3SFZA 1COWD 2R9VA 4MYUA 4RCZA 3UK6A 5K8TA 1VG0B 2P67A 2GXAA 1NN3A 4RVCA 5CJ2A 4W9MC 2P6UA 2AFIE 2BCJQ 2AK3A 2WKQA 1Z6GA 3GJ6A 1XX6A 2PBRA 1U0LA 4A0FA 1FMJA 1KK0A 4JLAA 4CEJB 3U4QB 3CH4B 3THYA 4QBGB 3NTUA 3K9LA 4C0AC 4E03A 4Q4AA 2RCNA 3KKQA 1UPTA 4F7WA 2QE7D 4XD7D 2FPLA 1U81A 1TPZA 4DIDA 5L3SB 5EE9A 1P5ZB 3NHAA 3VX3A 2O8DB 1CEEA 4B73A 2A7QA 4AY2A 1M7HA 1E9BA 1T0JB 2XNDD 2HXYA 4B2LA 1GL7A 1JPJA 4NMMA 3ZVMA 2GNOA 2YOGA 4R98A 3ADCA 1P9NA 1SKQA 1VCNA 3OEHD 4NYJR 1DTSA 2ZRNA 4ILEA 2V7QA 2DCUA 2C95A 2OFOA 1GOTA 3DL0A 2IXEA 1YZKA 4EFLA 3HYRA 3C8UA 4TT3D 4OL0A 2ZRAA 3CIOA 4WOPA 3WMEA 3GLFE 1NLYA 4BEJA 1OSNA 5KSYA 1JR3D 1UM8A 2JGNA 1C9KA 4KHZA 3B85A 3AF2A 2ZS7A 4R2HA 3QKUA 2ZE6A 5TARA 5KSOA 1DARA 1G8GA 3THXA 2FJUA 1CU1A 1TTTA 4TL6A 1O3YA 4Q48A 3VHXA 1RRCA 4D80A 2A2ZA 4TZ0A 1TQ4A 4BLOA 1JEEA 4PANA 3TR0A 2OXRA 1GRNA 1W4CA 2QP4A 1KDPA 3DOEA 4UNNA 2ZI3A 3SQXA 1ZM3A 1T9HA 2Z5FA 3U7HB 4AKEA 221PA 2HJGA 1KMHB 2WWIA 4MITA 5D3MB 1G6HA 3OFNA 2R6GA 3FHOA 3CRQA 3ZQJA 4JLMA 1QDEA 1E2KA 1ETUA 4IDPA 4NYIQ 1G3RA 4K81B 1L4UA 4D25A 1XEFA 1I4DD 2LWIA 1E2FA 4A6PA 4JLNA 1VTKA 2C03A 1Z8FA 3AKYA 2AD1A 3NDBB 4ESHA 3ZVRA 3I32A 3D31A 2YOFA 1R0YA 3EZ6A 4KFTA 4LJ9A 4C3ZA 1G16A 1DAKA 2XOKA 4PQRA 3ZVNA 4A82A 3LRPA 1ESMA 3DM9B 3IILA 2REXB 4BECA 4U7DA 3SDZA 4V0LA 3RS5A 2WJGA 1TQDA 4IXMA 4PC1A 3OAAA 1ANKA 3OFND 1PLLA 5J4YA 1W46A 3UG6A 1MABA 1VIAA 4Z1MD 2FSFA 5BW8A 3IGFA 3AV0B 1NLFA 3I1FA 4HAUA 6Q21A 1FX0B 3K53A 1G20E 1W5TA 2RGNA 1UKZA 1JEDA 2QN6A 2F43B 2L0XA 1FP6A 3GLIA 2LKCA 1M8PA 3SYLA 2A30A 1UBCA 2ANBA 2QTVB 3ND9A 2XZPA 1SKYB 3R7WA 1XEXB 3G82C 5M04A 3CRVA 2BBSA 2ZU6A 3K0CA 4JLBA 4KXFB 2NGRA 5EXXA 2Q3MA 2JJ1D 3L2OB 2ZJYA 2ZYWX 2OCAA 3KL4A 5GJWC 3ZS9A 1ZINA 8OHMA 1A2KC 4IDOA 1ZNZA 1CR1A 3I8SA 3W3AA 1FQJA 4BE7B 5CITA 2G1KA 2WWFA 4Z54A 1P2TA 2PMKA 3MLEA 1N0UA 1B0UA 4D4JA 3KKOA 3NH6A 1SQ5A 4PZZA 1AGPA 2GZAA 5AUQA 5FTJA 4YXWA 1TQ6A 3TAHA 3WY9A 3WHKA 3MAAC 3HYTA 2IHYA 5BYJA 1Z28A 4M0LA 4RFSB 4XWOA 4TYQA 1E3MA 2HUPA 3MSXA 1KI1A 2JEOA 4B48A 4TLAA 2HT6A 4FW9A 3NKVA 2JLVA 1S0UA 1Z6YA 2PX0A 1TADA 3BOSA 3K0CC 3L0SA 3L8ZA 4PHHA 3GLFA 5EQTA 4C4PA 1VG9B 3DZ8A 4RKEA 1EXMA 1XMJA 2C9OA 4US2R 4QG7A 1QHSA 3DKVA 1N3BA 5AUNB 4CRWB 2WV9A 4OYHA 4P4UA 1OJLA 1YR9A 4B2PA 2EFDB 2OBLA 3RS0A 1IN6A 4G01B 3P26A 2QRZA 5CDFE 3CRRA 4URYR 4WXRA 4DEYA 1N6RA 3AVQA 4Q9LA 5DH9A 2FFHA 4PC2A 3OE7A 2O0JA 3UATA 4WA7A 3LLMA 3OEEA 1E96A 4FXPA 1ZAKA 4FMDB 1KO4A 2W00A 3U7EB 1XD8A 1G3UA 2GRJA 3PEYA 2ZR7A 1A2BA 1GZSA 1NBME 1P2SA 4GBMA 1EFCA 2A5JA 1P6XA 3QG1A 3QF4A 4LV8B 3AVWA 1P9RA 1KO5A 4F4CA 2VP4A 4M8NE 1SKYE 4UNQA 5DO9A 1C1YA 1G7RA 2ZEJA 3LBNA 3VU9A 4HAWA 3WNDA 3OE7D 5AR1A 3A1WA 2B92A 3EZ2A 1NF3A 3KJEA 3SZRA 4EFNA 4CEJA 2CHQA 3U4QA 1M1YE 1S3SA 2QAGC 1HQCA 3IDQA 4KBGA 4CW7A 2R62A 2IXGA 4MUBA 2QMUA 4D0LB 1UKEA 2KWIA 5L3RA 1QZXA 2OUKA 1EK0A 3FMFA 4UKDA 3ECCA 2X1VA 1OH7A 1QHXA 4DRZA 1CBUA 1S9DA 5L3SA 3L0IB 1SXJC 2J7PD 1S4QA 2QL6A 2IWHA 4OQFA 2OCBA 2IK8A 1PLJA 4GSYA 5JLJA 2CK3A 1SVMA 2ZRHA 1D9XA 3L82B 1ZNXA 4M1YA 2X77A 4JBYA 4PTLA 3TBKA 2IWRA 3H84A 5FTMA 5B57C 2IYTA 2ZROA 1Z06A 3A37A 3A4MA 3C14C 3I4LA 5KNDA 2YC4C 2MSDB 3MJHA 3P27A 3VTKA 2MMCA 4M1MA 1JBKA 4CT4B 5CM8B 3C7KA 1AJEA 3FDIA 3GCGA 4EJSB 2BKEA 4QC2A 2ZTSA 3DDCA 1H8EA 1N2CE 3S1AB 1L8QA 5KDLA 4WW0A 2GZDA 4FMDF 1YE8A 1U0HC 3E1SA 3LXXA 4G3XA 4I1OA 4JL8A 4XWAA 4LYJA 1WMSA 5KNBA 1Q12A 3AVUA 2WAXA 4C0BA 3W5JA 2KBFA 1KI3A 3LBHA 1W0KD 1KMHA 1KTVA 5D3MA 4RZXA 4PHFA 3EC2A 5FI1B 1OIVA 1P3JA 5EJEA 4FMCB 4BRUA 1LS1A 1OE0A 4DT1B 1F5NA 3K8YA 4A36A 1DS6A 2HCBA 3FKSA 4G5SA 1CRQA 3IO5A 1S2MA 3EIHA 1BYIA 4LK2A 2N46A 1M6NA 1II8B 1E9CA 1PZNA 1OH6A 3CONA 3QPVA 2R65A 1SULA 3KXIA 1AQYA 1NMZA 4PAMA 3TUJC 2ZPTX 2PLRA 2BMJA 5CDFA 3EWSA 4MDFA 1IONA 1CLUA 1CP2A 4C0LA 1BOFA 3I62A 1IXSB 1G64A 2ZI5A 2ORVA 4KI0A 3B8HA 1IQPA 2J46A 1S1CA 2WSSA 4IVPA 4LBVA 4RY2A 3VKWA 1GNPA 1IN8A 2GJKA 2ZYUX 5EUMA 5J4VA 2F43A 2J7KA 3SBEA 1VG8A 4MA4A 4PHGA 5BN3A 1A1VA 1GIAA 1XEXA 1OXVA 1YR8A 4GFDA 4TLDA 2ODBA 3IQWA 3W5IA 2BM0A 3AH8A 2ODEA 1G6OA 3AB3A 3QJYA 2H18A 4AD8A 2BVNA 2G77B 1NRJB 2KSQA 2P3SA 4Z8XA 2EFCB 1LV7A 1I2DA 4UNPA 1X8JA 3ICQB 4L16A 4OK3A 3AF4A 2B8WA 3AGPA 4QKQA 4ARZB 1TEXA 1NBMD 5SZKB 4HUTA 4Z51A 2J9RA 1TF5A 3FFBA 4II7A 4D82A 1P62B 1ZM9A 3Q3JB 1QHNA 2G0TA 1N25A 4FMCF 3RLFA 3BRWD 1W4RA 3BERA 5JWHA 4RFSA 2QT1A 1MO5A 2NPIA 3TMKA 2IS4A 1E9RA 1VYUA 2OFXA 5GJCA 1LY1A 1KIMA 1GAJA 1KJZA 4ZDJA 2NZ8A 5KO2A 3DO6A 1V5WA 1AK2A 3EZ7A 3LX8A 4P0TA 3DZDA 1Z47A 3SEAA 3M0EA 4DSNA 1VHTA 2IYRA 3CPEA 5DN6A 3EAQA 4G1UC 3VNUA 4EPRA 2G1JA 3H86A 2ZXUA 2LCFA 4XJXA 1T8TA 3JVVA 4XOIA 2DFNA 2XSZA 1VG1A 4WXPA 5FTKA 2IL1A 1KK1A 2XAUA 4MRRA 4CEIB 2VH5R 3WYGA 4DCTA 2D3WA 4NCJA 2XB4A 1J8MF 2AFHE 1VHLA 1G3IA 1D2MA 4IJMA 3IHLA 1R0WA 2WOJA 2ZUCA 4FIDA 1RRGA 4KFUA 1WDTA 4LV5B 4GI7A 4URZR 3MWLA 3T15A 4B2IA 3QBVA 2HXSA 1US8B 2DFKB 4OK5A 2XNSA 1XFAA 2FX3A 3QKTA 4P3YA 2XSZD 4I1UA 1R5NA 4PO9A 4C9BA 2BWJA 2J3EA 2C78A 4IXNA 2X8AA 2KB0A 3CWQA 1DAGA 2OCPA 3PG5A 3RS7A 5JHGB 4IOLA 5FPSA 1DAHA 2F9MA 2GEVA 3WRXC 2ZE7A 1W47A 3O8DA 2V4ZA 4TLBA 4B76A 1J99A 4JT2A 2ANCA 4D26A 1B23P 2J59A 4US0R 2D2FA 1N5KA 3SBDA 5DLQC 3QENA 3ZZTA 2J0VA 3IUYA 2F55A 4BFSA 3A6PC 4BFVA 2ZE8A 1U8AA 3IEUA 2CL7X 4B74A 2XTMA 2XXAB 4TMVA 1T5LA 3TQCA 2CMKA 1E9AA 3R20A 3QKSB 3T61A 4CDGA 1Z07A 4NPHA 1P2VA 1ZIOA 3CNNA 3PEUA 2EFHB 1P60A 1DEKA 2IF2A 1Q21A 2WMOB 3OIVA 4OI0A 3BBPA 4EDHA 5C1BA 1NLZA 3GLGB 3B5JA 4NH0A 2ZAOA 4U02A 5JBQA 4GNKA 4F93B 2A3RA 1E4VA 1E1QD 4I1SA 4NCHA 2IS6A 5DNYB 3W8RA 3QPUA 3VHLB 4JLVA 4EJSA 3O8CA 1MR3F 1DAMA 1R0ZA 4JKIA 4QHYA 1PJRA 4QNMA 2FGKA 3S1AA 4GL2A 4BPBA 1AKEA 1E9SA 2VSOA 4RD0A 3UIEA 2I3BA 3EPHA 3M4YA 2RH5A 3E5HA 1RFLA 1HEIA 2BHRA 2X19A 1RW4A 5KPDA 3LW7A 1PUIA 3P32A 2QM8A 4BGDA 1NVVR 2IS2A 3ICEA 3N70A 121PA 1KSFX 2ZJOA 4DB2A 2O5VA 1XRJA 3LBIA 1TU4A 4B47A 2DWPA 2ZITA 3ETLA 2QP3A 3I72A 4JZKA 2JATA 1D5CA 2X2FA 4JVMA 4DT1A 3A1UA 4FI3C 1NG9A 1TX4B 2UKDA 3MUFA 4ZCLA 4AG6A 5JSZB 4DZZA 4EJSC 2WOOA 3A1TA 1M34E 2B2NA 3AKEA 2C98A 1II8A 1Z22A 3FKQA 5AWFC 2V54A 3ZH9B 4YMUA 1FNNA 4TL7A 2WMNB 4PQFA 4F4IA 3DMNA 2IC5A 1CR0A 2HYDA 4R2IA 2N42A 2OILA 2WPDA 3GFTA 3V4RA 1ZIPA 4AI6A 1WXQA 3OIWA 2PL3A 2DWOA 3U44B 1BMFA 1D2EA 2IYZA 2OHFA 3K70C 5FOSA 1R0XA 2XJ4A 5FBWB 3TRFA 1EESA 4PC3A 4LY6A 5DI3A 4LZZA 2Q21A 4AURA 5JWOA 3WYFA 1XCMA 1VKJA 3KKMA 4TMKA 4MKFA 1P73A 3GMTA 1W4AA 2J5XA 5D3QA 2DB3A 1CR2A 5DYGA 3QIAA 3RWOA 1E9DA 3BS4A 1S1MA 3U60B 4DCUA 4PX9A 2JLQA 3LO5A 3X1XA 4OHVA 4Q21A 4IRUB 3RDPA 3LNCA 2VHJA 1XBTA 2PEZA 4DB4A 4BUJA 2PCJA 5JWRA 3IHWA 4ZI2A 2BM1A 3NBYC 3W9YA 3KUCA 4LHYA 3VR5A 2F1HA 4D0GA 3ASZA 821PA 4A0RA 1QVRA 1A4RA 3AUXA 3EARA 3KZ1E 1RRFA 4ARZA 4DLRA 3SJZA 1EG7A 2ZSFA 1YZNA 2EVWX 1ESNA 4GP7A 5G3ZA 1W36D 5JCPA 1XEWY 5IF9A 3DKPA 2YWEA 1U0JA 3K9GA 3AGQA 1MO3A 1X86B 4BLQA 3EXAA 1NKSA 2Z4SA 2ZI9A 3B9QA 2F7SA 3D8BA 3FTQA 4U5XA 3G5UA 5FPTA 4NKRA 1JR6A 1HY3A 5CM9C 4ITRC 1AA9A 2ZIAA 1NN5A 4Z8YA 4L15A 1IY1A 1VDZA 3QG5A 3R8CA 3AVXA 2OEPA 3T35A 4PPFA 1EFRD 1Z2CA 2ZRPA 1KHTA 2H17A 1G3QA 4Q1BA 5AJYA 3FMPB 2H7VA 5E3HA 4B3FX 2QGZA 2BJVA 3Q7QA 3WNBA 1YHNA 4EPYA 4URVR 4D4KA 2FEMA 2V6IA 5SZHB 4CEIA 2YJTD 4AKIA 4KFSA 2FPKA 4JLPA 2NG1A 1QHYA 1PLKA 4E5UA 1G1MA 5H1YA 3AKDA 1F2UB 1U9IA 1E2HA 1HT1E 1MT0A 2IHBA 2QAGB 4B43A 1DAIA 1IXZA 3QXHA 4ERNA 1P4SA 2OM2A 3GEHA 1XD2B 1ZD1A 1NJFA 4GPTA 3IBYA 2C9YA 3IO3A 1NY6A 2QU8A 4JLOA 4QRHA 4MGZR 1SHKA 1US8A 2ZUDA 3GJXC 4B32A 1KY2A 4OHYA 3FMIA 3MMPA 3LXRA 4X8OA 3GJ0A 2FU5C 3NBFA 2J41A 3LY5A 2RGBA 1E79D 3TVDA 2HJVA 4Q4JA 4LPSA 2FEOA 3KFXA 3B1YA 4XVQA 4BZPA 2Z43A 2WJVA 2AX4A 3BFXA 2I4IA 1ZMXA 1R2QA 4LUCA 3KXKA 1U9IC 3RWMB 1XPRA 2Q0HA 3SYKA 3K0SA 4HZUB 1U8ZA 1KSJA 2XXAA 3LW8A 4CZ2A 1GTVA 2NIPA 1HTWA 1PUJA 2OLJA 4MUAA 3U3KA 3QKSA 3ADDA 2WBLC 4A15A 3O47A 3KQUA 2HYIC 1OB2A 4ZKEA 1RRPA 1YZUA 3SU8A 2ZYTX 4LDJA 3WXMA 4A0HA 3EIEA 1N6HA 2PJRA 4OQXA 2HEIA 3AP2A 3UMSA 2QROA 1CF4A 3QBTA 3ZIAA 1II9A 3CO5A 3HWSA 5AK0A 3ZZUA 5JFGA 5F3WB 1KK2A 2GJSA 2ONKA 4DLSA 4F92B 2ZI7A 3CZPA 2OESA 2BIFA 3QVUA 4TQ9A 3CH5A 3B7GA 2D06A 1Y63A 1CJTC 2ZRGA 4Q1FA 4UXJA 3CF0A 3LWNA 1QHHB 3VFDA 2DWQA 4JVLA 5FOXA 1L7VC 5GVSA 2J87A 1Q1ZA 2FOLA 4HSEA 4ESVA 2XTNA 3X1ZA 4KITB 1XMSA 2VSXA 1XTSA 2V7QD 2O8CB 4NYMQ 3D7MA 4RFVA 4IOKA 2OG2A 2O8BA 2NMVA 3BGWA 4MRVA 1SXJE 4Q4LA 3LV8A 1TU3A 3AVTA 2IUSA 1ZC4A 2DY1A 3QOFA 2CBZA 2J45A 3PJRA 5JSZA 1T6NA 2ZJZA 4KLNA 5G53C 3RS3A 2GJ8A 4TYWA 1W0JA 3GLHB 1N6OA 3LDAA 1K6MA 4TLCA 2QY9A 3CX7A 1SZPA 3L43A 1NL3A 1E6CA 2JAQA 1BYUA 1EX6A 3BXZA 3FE2A 3GJ3A 1KZGB 1YR7A 2GZHA 4V02A 4JS0A 3U44A 1A7JA 4MKHA 5J47A 1LVGA 4QOSA 4B3CA 2QEQA 1X1SA 3DOFA 2ASEA 5JEEA 5L8VA 4TLEA 4ZO4A 1ZUNB 4GZMA 5HCNA 1RZ3A 4EUNA 3I73A 2IF0A 5HE9A 5EE5B 1UEIA 1BS1A 1E2GA 3U7FB 2H16A 4LJAA 1ZUIA 1JJ7A 1KZ7B 1U8YA 4TQUS 1UFQA 1YJ5A 4FWTA 2XZLA 2B21A 1G17A 3D3QA 2RB4A 3ADKA 2NOAA 4QFMA 5FUXA 4TTQA 1GWNA 5TB5A 3MWJA 1RYHA 2F1IA 2XOKD 1IN5A 521PA 1AS2A 4KAXA 4L5BA 1N6IA 4HB0A 2PT7A 3H2YA 5A0FA 4AKHA 1KI2A 3OAAD 4HB2A 4ON9A 4M1KA 1EWQA 3CX6A 3W6OA 4C0KA 3EZ9A 2GTPA 2ZANA 1JECA 1OFIA 1UF9A 1OLOA 1OW3B 2QORA 1A5TA 3DMDA 2JIZA 4Q02A 4Q9HA 1GRRA 2O8EB 4QGAA 1II0A 1BIFA 2FNAA 2VHTA 5CIWA 1RE0A 1KK3A 4NONA 2ECKA 4LYFA 5TVKA 2YOHA 1E2EA 3T34A 1G8FA 1IAQA 4DDTA 2FGJA 4ACBA 1YKSA 3SR0A 4NL4H 1NSTA 2PT5A 3GLHE 3AVOA 4DHEA 5GADl 1HT2E 1W44A 2BDTA 3HU1A 3SHFA 3H0KA 1R5BA 4IOMA 1OFUX 3KFVA 2G6BA 2OO7A 1Y3AA 3BB4A 3E2IA 1OXXK 1N6KA 4JLKA 3LA6A 1W2GA 2YWHA 1JAIA 4Q47A 4YXWD 2BCGY 1F6BA 2QAGA 3C41J 4MRSA 4A1FA 2HCJB 2QSZA 2NO0A 4UXIA 4TSFA 4NYIR 5E7MA 5TY0A 1XD2A 2F6RA 5EP3A 3REFA 1KSHA 1N5IA 2CDNA 3A1VA 3QKRB 4DVGA 3QI2A 2ZRFA 2ZVQX 1SXJA 4WAUA 4ZIRB 5GVRA 2QMHA 2WVJA 1ZW6A 1S96A 2VP5A 5LB4A 4FWIB 3SHWA 4O3MA 4P33A 3IEVA 2H1LA 1HQYE 3TUIC 4A2WA 3NDPA 2FSIA 1X6VA 2MSEB 2VF7A 4I99A 4XIGS 4E07A 5C4MA 4IDHA 3G0HA 2BMDA 5C4GB 4I4LA 5AUOB 4JBWA 5FTLA 1G7SA 1EGAA 4NDZA 2R44A 3SJAA 3SYNA 5IRCD 2O8FB 2D62A 1ZM7A 3A1SA 3OEED 5H70A 1OT3A 2WSMA 1Z6XA 4CEHB 4M9QA 1JQJC 4QM7A 4UNSA 5GJBA 1GDDA 1SXJD 1DO0A 2ONJA 1J70A 1JQLB 5B30A 5C46F 4DDWA 1IJFA 5KNCA 1TAGA 4TYPA 3B1VA 2B7BA 1G41A 3BK7A 4AIIA 2IS1A 2O8DA 1R5OA 1R6BX 1SHZA 4AYTA 4XVRA 3OHMA 4C0SA 4DDUA 3PUYA 3CR8A 4LBZA 3THWB 3VR6A 1H8HA 2XGJA 3MFYA 1G5RA 1AZTA 1UBEA 5E4FA 3F3YA 3IIJA 5JS7A 2W6IA 3FFAA 4Q1CA 2WIBA 1WQ1R 3KJIA 4LJ7A 1GKYA 4GOXA 5EXPA 1N6PA 1XTKA 3HPQA 1JB1A 3LVQE 4LWZA 3EPJA 5CJPA 1GITA 4MGYR 2EWWA 5AJZA 2GCPA 2C99A 2RGGA 1KI7A 4OQLA 3RSOA 4BLRA 5FH9A 1VCOA 1G7TA 4OKSA 4O2RA 2ZRKA 1WA5A 2OE2A 1SVOA 4CYMA 4M22A 4HEJA 2G9NA 5E95A 1QHHA 1RYFA 1M2OB 3DPUA 1MO6A 1FFHA 2CK3D 1IJEA 2VP9A 2OT3B 3PIRA 3B78A 1R4AA 2O8CA 4OHWA 3J81k 2YZ2A 1T3LA 3U61B 3IQXA 4MRPA 1YRAA 4KSCA 1Z0FA 2ORIA 4QNRA 1WB9A 2ZJ8A 4H1VA 3RANA 1IHUA 4NP6A 3K70B 1OFTA 2CEAA 2JLUA 3HP1A 1GKIA 2IEYA 3ND8A 2REOA 3FHTA 3GJ5A 3WBKA 2FFQA 3U7GA 1GP2A 4OQNA 4M9ZA 1H8ED 2VP2A 3GLHA 2GXUA 5HKKA 1MKYA 1GNRA 1T3HA 4L9WA 1IXRC 2E87A 2GA8A 2PZGA 5EE1A 3RS4A 4YQFA 3NXSA 3QEOA 1NI3A 4F4JA 1W2HA 5FI0B 3HPRA 1ONBA 3EG5A 4LYAA 1IN4A 3KX2A 5KDOA 3SQWA 2HT1A 2AN9A 1OHHA 3PQCA 4D4MA 2DFLA 4TTRA 5K8LA 3N2IA 4UNRA 3AKCA 4EFMA 1G9XA 2QPOA 4P31A 1XF9A 4NTZA 3LFUA 5FL7A 2FN4A 1FX0A 3FKSD 4HLUA 2P6NA 3W6NA 4ASUA 1KKLA 2OFWA 4YMWA 1UKVY 4KYIB 3RC3A 2A78A 1AM4D 4CT5A 4G5OA 3VQTA 2QENA 4QM6A 2CHGA 1FW6A 2JLZA 2VP6A 1RPZA 3WYAA 4L8GA 3R8FA 4BFZA 1E0JA 2WWXA 3JZMA 4PZYA 1Q22A 1MO4A 4DCVA 4HAZA 1VMAA 1L4YA 4Q03A 4Q5IA 2YVUA 1D6JA 1GVNB 2P2LA 4RD6A 2HF8A 3HR7A 2GKSA 5DHAA 3LX5A 4HLQB 2RGXA 2WSSD 1MV5A 2OAP1 1K5DA 4W5JA 2DYKA 2R6AA 2QRNA 1S9HA 4HLUC 4K8OA 1XD9A 5CYOA 4W5WA 3QXCA 1E2QA 421PA 3KQHA 2GK6A 4GOJA 4DUGA 1ZP6A 3ZD7A 2BBTA 2YWFA 3T5GA 2PZEA 3MRSA 2P5TB 3AF1A 3ZYCA 1G8PA 3TW8B 3RABA 4ZCMA 4BQSA 1VYVA 4RKFA 1U2RA 1U99A 2GVDC 4FMBB 4O25A 4V0NA 1P2UA 1UEJA 1J2JA 1FP7A 4JMPA 4IOJA 4N3NA 4Q7LA 3Q5EA 1G5PA 2IX3A 4QXAA 1UDXA 1XNJA 4DCSA 2QQ0A 2WKPA 1CR4A 1RVDA 4TWZA 3TUZC 3HU3A 3BFVA 2LKDA 1E99A 5CIQA 1Z3IX 4M53A 4QJ3A 1FTSA 4MDEA 2BEKA 4C0HA 1IY2A 1UAAA 4MKGA 4BFWA 2V8OA 3ADBA 2DHRA 1SVSA 3PUZA 2JLYA 1J7KA 4DWJA 4LYHA 5JEDA 3BD9A 2G3YA 2C8VA 4CGZA 3NVAA 2GEUA 5DIFA 3PENA 2YINC 1J8YF 4ZIRA 1E2NA 4M2LA 2ZJ2A 3X1WA 3LQQA 4M1TA 1TEVA 2GDJA 3Q7PA 4JL5A 1Z6TA 5EXTA 3T12A 4BFXA 5DN6D 3RC8A 3AVVA 5F9HA 5F98A 2DFTA 3T1QA 2VF8A 2O0HA 1AGRA 2WKRA 4B44A 4NE2A 1SGWA 2BV3A 3TK1A 1SVKA 1RC8A 1OIWA 1OFHA 2ZRDA 3W90A 5KSZA 2O8FA 2VEDA 2FDCA 1CIPA 4RD3A 3LAWA 1YZTA 2HLDA 1YQTA 3K0FB 4G5QA 2BMFA 1YR6A 4CEHA 4NCKA 2GBLA 4HAVA 3RRNA 3RAPR 4V0KA 3RYTC 1HV8A 3VKHA 1OKKA 3JZAA 4Q1DA 1ZUHA 3P4XA 3C15C 2O52A 4OI2A 3TSWA 3I61A 4QBIA 1M74A 3UMRA 2JLWA 5CB6A 4ZDKA 5TV2A 5EZ6B 1KNXA 1FL9A 2FG5A 3FYHA 4X8LA 2FMXA 5FOVA 3THWA 2YKGA 5EZ5A 5JECA 4LJ4A 1NN0A 3OF5A 3PEVA 1VYTA 4KCGA 4JT4A 5FOTA 3RHFA 2FV8A 2X2EA 4N0EA 4M9SA 4A2PA 1E0SA 1VECA 1FZQA 2F3TA 4NZYA 4M1SA 3VR1A 1MRSA 3M1IA 4LV6A 1V43A 4AYXA 3WP1B 5EP4A 5LD2B 3OESA 1AIPA 3M6AA 2GBLC 3HDTA 1J90A 1EWRA 4LPKA 3O8RA 1E0KA 4XTCS 2W2XA 3FB4A 1N0WA 3QSYA 2EFEB 3OIYA 3WRYC 1TUIA 4R9UC 3KQKA 1E69A 2ERXA 4XSGA 5FBVB 3PVSA 1TF2A 4L9SA 1Z0KA 4JVSB 4N0DA 4QGHA 1S8FA 2ZJAA 2XX3A 3IKJA 4RSGA 2VHUA 4RD4A 4ZV4A 4B71A 1ZM2A 4DSTA 3BH0A 2EYUA 2OZEA 3AF0A 4HDOB 4DLUA 2Q6TA 2ZREA 5J4LA 1NP6A 4MYCA 1I2MA 1JI0A 2IUUA 1ZJ6A 1CJVC 1QHGA 1LB1B 1YU9A 4DLZA 5CK5A 2CCJA 1N6LA 1YZGA 1GG2A 2GHIA 1P72A 5SZJA 3CBQA 3EWAA 4RJLA 4WBSA 3RSLA 3PXGA 2WJYA 4C2UA 4ZI3A 2WZQA 1N5LA 2G83A 4URUR 2AXPA 3EA0A 2RGAA 2GCNA 3TVTA 3EZFA 4PPQA 4MH0R 4E22A 3RNLA 2ZS9A 4X8MA 1P61B 2Z0MA 5E7IA 5JI2E 2JLSA 1Z83A 4FCWA 1E2JA 1CXZA 3PUXA 3TE6A 3FWLA 4S2EA 3IIKA 3K1JA 2V1XA 1W5SA 4B3BA 1KGDA 1UBGA 5P21A 3GLGE 2AR7A 2WAYA 3AVPA 1DG3A 1XEWX 2CLCX 4A6XA 2P6RA 1JXOA 1ZNYA 5FL3A 1LF0A 2Q3FA 1ODFA 2WPDD 5IDVA 2J0UB 4B3DA 1JR3E 2ZS8A 3SJBA 5AUPB 5HE8A 1BMFD 2WM9B 1FUUA 3QXXA 3LVRE 4IFEA 5IHPA 1VCMA 1ZBDA 1WP9A 2YV5A 5SZIA 3A4NA 1KJYA 1UKYA 1YRBA 3OIUA 2CE7A 5DISB 1RKBA 1XTQA 5KTYA 3KTAB 3MWYW 3UMFA 3A8TA 1Q3HA 2W2TA 2OBMA 1L2TA 2Z6VA 4PR0A 1YVDA 3UXMA 1XXHB 4RCYA 2QP9X 4FINA 4PC7A 3EIQA 4E09A 2WWYA 5BN4A 4XVUA 4W5HA 1HYQA 1ZD9A 4UJ5A 2P5SA 1Z2AA 5J4KA 1W7AA 2RGEA 2DPXA 4JLDA 1OH8A 2OSBA 2JJ2A 4QL3A 1AZSC 2AXNA 2MSCB 2WWWA 3ZJYA 4KSBA 3ZD6A 2ZR0A 4AK9A 1H65A 1F48A 1KDTA 5JCZA 1E2IA 2V9PA 4TMXA 4BEBA 1VIYA 1O87A 2KI5A 4R7ZA 2ZETA 4Q01A 3W3ZB 5FR2A 5A4JA 1CJUC 1QF9A 3A4LA 2FH5B 1KOFA 4Q18A 3MCAA 1XPUA 4IHQA 4PPNA 3TKLA 1AS0A 4EPXA 4PSAA 2H5EA 2JJ2D 2ZAMA 5AJVB 2KE5A 4DEXA 4RD2A 1CTQA 4LBYA 5LBIA 5EE3A 2JDIA 1ZC3A 2GVZC 4KV9A 3TQFA 1SVLA 4B34A 3THOA 3SOPA 4ZKDA 1S3GA 4TQAA 4TMWA 4IW3B 3ZVLA 3SC3A 3VMAA 1NG1A 1XJCA 3K0FA 3MJRA 5J5CA 3U2QA 1E2MA 2WWHA 1U98A 1KY3A 1XCGB 4M1OA 2AWOA 1NIJA 4K46A 1ZCAA 2Z4RA 1E2LA 2E1RA 4QHSA 4PZLA 1GSIA 3GJ8A 4C2TA 4DLTA 2RGDA 5BYKA 3L0OA 2OV2A 4XTRA 3CPHA 2W6JA 4B3GA 1XB2A 3AUYA 5FBLB 5FOUA 3ZDQA 4CF7A 1OPXA 1XXHE 1R10A 4NU0A
chains in the Genus database with same CATH superfamily
4LE2A 3AVYA 4JJKA 3RVSA 2FEAA 4Q1VA 4R8MA 1R8SA 4IFTA 1XTZA 3FNRA 1PKEA 1QVWA 5EIWA 4ACAA 4QGFA 4GBED 4AZSA 2J0SA 2C3MA 2OXCA 1H4QA 1MEEA 1O95D 2AEJA 2LTAA 4Z7NB 2JFHA 4TT3A 3I42A 2RGCA 2XJ9A 2VF4X 2OXIA 1XZFA 5CT5A 3X3HA 8AT1A 4HSGA 4TOIA 4BATA 3C7AA 4FKBA 3UPUA 1YC2A 1E3WB 1GARA 2AF3C 3A14A 3F5FA 5ER9A 4TUYF 1JKMA 2JK1A 1PR9A 3WJ1A 1PJQA 2DX7A 1NVTA 1NZDA 2NV0A 4J94A 1FSSA 4BYMA 2H92A 1XGKA 2N1BA 4H7JA 5IDXA 3QOXA 4JYAB 1C3EA 2Y6UA 2Q46A 2X1MA 1K5GA 5HKLA 1G20B 1V8FA 2PX4A 3QXSA 1CPYA 3QEBZ 1LJUA 3BWDD 2P5YA 3ZIAD 5I6DA 3U4CA 2H2HA 2BRUA 1LZKA 3U62A 1CUIA 1K88A 1Z36A 1ZH2A 2J3HA 2VIIA 4HXGA 4L4XA 4D81A 3PLNA 4JNKA 2WJIA 2XBUA 3UQYS 5LD2C 1GPKA 1KYVA 1Q3KA 1RM4A 2DP4E 2WYUA 5LQMA 1ICIA 2XYHA 4RA6B 3SYRA 1NURA 2WICA 2VYFA 4CKZA 3LUAA 3WMGA 4IHKA 4DIMA 3KRTA 4D2IA 2QUKA 5B1YA 2QZSA 4C30A 3PUKA 1WTCA 2FP4B 1NWHA 4JA2A 2FW1A 3T8YA 2JLXA 4HVLA 2SICE 1D1QA 3ZPXA 3AI3A 2CL0X 2FWNA 3FOCA 3ENVA 3JYHA 4CLDA 1Z6PA 4CL3A 1E3SA 4EPTA 1V7CA 2IPLA 1NYLA 2CZCA 2DJIA 3DBHA 3UBMA 1V9CA 3UCEA 2NN3C 3CRW1 4EFDA 1O94A 2IPOA 4QYWA 2QVBA 4RZ2A 1E5DA 3MWGA 1FS4A 2KMLA 3DBLA 2IXTA 2V7UA 1BEEA 1VJCA 5HS6A 3G85A 3UK0A 2PEYA 3P4YA 5T4HA 3IAXA 4D4GA 5C3MA 2OGSA 2ON6A 4JITA 1Q1EA 1B43A 2G4CA 4KXQA 3MB8A 1RJ9B 4A0GA 2WC1A 3SI7A 1NMXA 2R8EA 1HG1A 4FOPA 4YALA 3TS1A 4WZAE 2NTNA 5LC1A 4AS2A 1OXTA 4Y9UA 4RYLA 1XTPA 5LA6B 1EFUA 2W2KB 4BWYA 4P0PB 5I4CA 2L19A 2VO1A 4LZNA 1D04A 3AESA 4XX0A 4POAA 1RBQA 4C03A 1LLCA 2CXRA 3GUUA 4XASA 3DR5A 1JG2A 3GD7A 3A26A 3H1TA 3C5HA 3DXZA 4C22A 5JMTA 1E64A 2C4VA 3H9BA 2FPPB 1QAMA 5B1HA 2AG5A 2YWGA 3EXG1 4G9GA 3LTEA 3QPDA 4I08A 4QRDA 3C1TA 3PVCA 5A9TA 3K6RA 5EXEA 3VO1A 3UNXA 4LJKA 4MP3A 5JCOC 3CZ9A 1PVOA 1P3Y1 3DQQA 3JZIA 2BTEA 3CNOA 1YZQA 5DNEA 6GPBA 5DRTA 2VDMB 4HAOA 4FLMA 4CUZA 3AI2A 4OJQA 3LT1A 4D74A 5IKOA 1V5GA 3L4BC 5IJ0B 3DEZA 5CT9A 5FPYA 4YQZA 4UEOA 1T5TA 1UWKA 2B4RO 4GI3A 3P5SA 1AS3A 1OV4A 4MRAA 4R1MA 1PZMA 1A04A 3WHPA 4LRTB 1EXWA 2OQ2A 3NT2A 4GPZA 1I9CA 1G63A 1MGOA 1JQ3A 1NM5A 1PQWA 4UBLA 1Q7TA 2VPXA 5HF8A 4NYMR 4C21A 2PJZA 4P7FA 1GCIA 4YH1A 1BFKA 3A36A 5LXTB 1ZNWA 2QZJA 1ND5A 3AEQA 2JIZD 2QLLA 3IAM6 1TDJA 2M6LA 3LQFA 2W0SA 4R9RA 1MAUA 3D0OA 2P62A 1DVRA 2VF5X 2IYLD 3HO8A 1E1YA 3N2KA 1KSGA 3I9LA 4MROA 4L4SA 4X93A 1KFEB 2A59A 1NC1A 3CSDA 5ELMA 1BKSB 1HYEA 5LQSA 3RW9A 4Q05A 3AG6A 1UP4A 1XCPA 1ECPA 3CY6A 4DFCA 2QI9C 1C4KA 3FPLA 3HHEA 4HN4B 3EPKA 3UKJA 1GTG1 1A9OA 2VXOA 2BISA 3AQ4A 3B3QA 2GYUA 3P9YA 4AJIA 3K09A 4N54A 1GUDA 3SSAA 5L95A 3S5UA 3UOGA 4LN1A 1ZSVA 2WUFA 2IXAA 2FN9A 3CNQS 2CV0A 2BFNA 2IBMA 4Q12A 3B8EA 1BH2A 4G5FA 2BBOA 4TSKA 5LLTA 3TM5A 4FFBB 3BICA 3ISVA 4C7OB 4L08A 4OF4A 4F4HA 1YGYA 2EZUA 1GA6A 5KYVA 2ORYA 5CGQB 3TLGA 3WGIA 4R1UA 2HADA 3VYUB 1HYGA 1NJGA 2IUYA 2PAFA 4KXYA 4HT3B 1JALA 1Q0UA 2VOEA 2ETXA 5CEFA 2OPBA 3GBPA 3N86A 2EZ4A 5FFMA 2P91A 4XQGA 4E21A 4EKDA 4IEEA 4PPGA 4GQAA 5AVWA 3VA7A 2GD6A 4YJ2F 4JB8A 3QA9A 3WFIA 4M4SA 1NBOA 4D41A 2CBXA 2KW5A 2PL5A 3LD9A 2ERYA 1E61A 4B33A 4M8IA 1V3VA 1SC9A 4R5MA 4BLUA 3GIDA 1D2RA 3ORFA 4IMIB 5ARCA 2CBGA 4E5VA 3LL4A 4CBVA 3ON5A 2J7PA 2Q9AA 1ZM4A 2VDPB 3SFVA 2I80A 3QEJA 2P69A 4WLVA 2NM0A 4IJQA 1TYDE 1VKZA 2DLNA 3ASUA 3D1VA 4NABA 2H59A 1KJWA 5FDFA 2CDRA 1J9EA 3NDRA 3T5AA 1D2HA 2R7NA 1RXCA 1J8QA 1MOZA 4PSVA 4QPNA 4BJ3A 4BUCA 1N7HA 1Z0DA 1U90A 2WKSA 4TVOA 2PWAA 4G0PA 5K2MA 4PLCA 2AMJA 3FOEC 2QQGA 2VBCA 5EPEA 2ZZMA 2A9VA 2ZVPX 4LJYA 3NTRA 2TMYA 4HO1X 3DTYA 3UGKA 2OHXA 4Q7KA 4PGAA 3DT8A 4MVWA 4Q66C 2ATCA 2HI0A 3K9HA 1TYAE 2PD3A 1S7CA 1TT7A 1ZA2A 1CWUA 5BQ3A 3LU1A 1RXUA 1TUGA 4KPUB 3IAM1 5H0IA 2C7PA 3RVPA 1YKFA 4DCNA 4E4TA 1N2ZA 2WAMA 2ZI6A 1KE1A 1Q0TA 4PZUA 1VDMA 3KVRA 2MDTA 3FUVA 1G20A 4DN6A 4CF4A 1TO1E 2F9LA 4TRJA 4ZCIA 5CA1F 5J4HA 4ND1A 3CINA 2Q3HA 2E4WA 3KCQA 1O9BA 3V6LA 3LLSA 5A7HA 3L1UA 1X19A 4A8JC 4OKIA 3DA8A 1CZLA 1Q44A 1QVAA 3GJ7A 4IL5A 3GLQA 10MHA 4UQPA 5DX0A 3SN6A 1XMIA 4PFJA 2JLRA 2LIPA 2R8RA 3I3SR 3GJTA 1W0KA 4CMAA 3HCFA 1QE3A 3PFWO 3PUWA 3RRMA 3BC1A 2E6UX 4RA6A 5E1MA 1QWOA 2OAGA 1L7AA 1YZFA 1KXZA 3Q5GA 1SUEA 4HATA 2P9FA 5JI3E 1KJQA 5G41A 1NQXA 2FP4A 4AAYA 1NOKA 4M55A 4Z7JA 2WJHA 1MO2A 1BWPA 4Z5XA 4PO8A 4V0MA 4IHJB 3JSAA 5C2JB 3C7DB 2AJDA 4JYBA 4BFUA 1L7RA 3HRKA 4DLLA 3CVVA 1NC3A 2AOXA 3T41A 1QTQA 1Y37A 4ZYVA 1YHYA 1C7FA 4N48A 4JELA 2F3RA 4UE2A 5JY1A 1H1DA 3OJLA 3BSSA 1DPFA 4QBTA 5F1PA 5AXDA 3C3EA 3VZPA 1G21E 3ZU2A 6CHYA 4E5DA 1SBCA 4KQ2A 4DLYA 1X39A 2D1FA 3GZTB 5FV4A 2C9CA 3JPWA 4EYQA 1KPGA 2WRZA 3ABRB 4FIZA 2FZLA 2QD2A 1L7DA 3OOEA 4RULA 1RJ9A 1L5YA 4W1SA 3JQAD 1TLFA 4BKQA 1T1GA 1PG2A 4ZAGA 3QU7A 2QRKA 2GAJA 1RIIA 1CE8B 2JZCA 2W2KA 4IKEA 1G0NA 1VFNA 3OIDA 4HUQB 2YMMA 1TMKA 2EWMA 4XGQA 4ZARA 4TV9B 4HDAA 1QM5A 1BKDR 3R5TA 4MMYB 2YYSA 2NQ2C 5JS8A 1EGHA 2FFJA 2OHVA 1XU9A 2ST1A 4XWGA 3ZWAA 3EYWA 4G24A 3WWDA 3C4JA 3EUWA 2FPPA 3S44A 5JXWA 1CIJA 2E5WA 3JRWA 2AGVA 2DU8A 1V6AA 1C81A 4UVGA 4BS9A 4EGSA 3R3UA 1YE3A 3DL7A 2N75A 1UBKS 3I34X 5EUQB 1MC8A 5CLLA 3W2EA 8ADHA 2D7DA 1FB5A 2AOTA 2PKQO 5AJUA 1D1PA 2O7SA 3EBPA 2E82A 4UREA 1OH5A 2ECFA 2XMZA 4U2GA 3TLXA 1BXKA 4EEZA 1ONPA 4QLAA 4IIJB 4BNMA 2Q07A 4NPAA 1ELOA 2IGTA 1W36B 1NNSA 4LRYA 3E9CA 4LJ5A 5ALOA 1T0IA 4ENQA 1YSCA 3W5DA 3ZEIA 1U7OA 2Z83A 4BXOB 5F52A 4L9RA 3E58A 4RGVA 4Z3KA 2UDPA 3QLVA 3W8DA 4UXHA 3KQWA 2WWTA 2I6TA 1T91A 5D7BA 1YKGA 2ZULA 2R4QA 3DT9A 3P20A 3HVHA 4IQGA 3F90A 2XMBA 3ZS8A 5JJLA 4OXNA 4AM8A 4FFDA 2BZGA 4W5OA 1A82A 3FYUC 3I5XA 4NZOA 1AF7A 3KEQA 4MV6A 2PN1A 3B2NA 5I3CA 4UE6A 5LXTA 2HQOA 5JPIA 2VUSA 3JVUA 4E94A 1T6YA 3ONFA 4KDEA 1WUYA 1XZQA 2AEFA 2HIGA 1XTIA 3GFGA 3P9XA 4QICA 4DSUA 1SPXA 3L7CA 2WV7A 3QTLA 3BB1A 2Q4BA 4J1QA 1YTLA 4MUJA 4D8YA 4KN9S 2EWVA 2VPPA 4J7AA 2YJZA 4FWBA 1D0SA 1EK1A 4M36A 2PGAA 2IEZA 1UFRA 2O9JA 1MP0A 2R8XA 3VTFA 3GFPA 4HB4A 2UZIR 3IUBA 4ENPA 4MYSA 4CQNA 3H2JA 2ES4A 1WUJS 1ZH6A 4NSNA 4FKMA 3B1WA 1E98A 3E35A 5E4JA 3PXDA 3ZDEA 3D43A 1T9CA 2OV6A 1D6NA 4FFBA 3VZCA 3UG7A 4MGKR 4N7RA 4C7OA 3AT1A 1LC3A 4LJLA 1SURA 2XLBA 1GG8A 3DVLA 3I5UA 4I66A 3VBEA 4B31A 1CUDA 4MQBA 1JR4A 1CFZA 2C3OA 4K6GA 1RM5A 1G8HA 3RRBA 2IZ1A 3I8XA 2WSLA 4LJSA 5I01A 2H4WA 3SR3A 1UJ6A 3HYLA 3SZGA 4O29A 2MYNA 4LX0A 2W11A 2II6A 2FPXA 2RJNA 2C5BA 3D8TA 1M6WA 3ABZA 2C83A 5ALDA 3WG9A 3AC0A 5C8DA 4HNTA 1NBWB 4MGHA 2XMQA 4QJ4A 1B42A 2ICAA 4R9SA 2V3CC 3L0DA 3HR4A 2VK1A 3HJHA 2GWHA 4MS3B 3NORA 2QDXA 3DAGA 3OKCA 1JIVA 2BP7A 2C04A 3PCRB 1EP3B 4Y6PA 2NAPA 4N8EA 2PJDA 4HK4A 3TH5A 1CY4A 1MJHA 1IB6A 4P4TA 3CKLA 1MPXA 2FLWA 1PT7A 1CHNA 2Q5LA 3BL6A 3MNFA 4FHFA 4KQGA 4LE1A 4MP8A 5KOHB 4YC7A 4BQNA 3MELA 3U4IA 3MTIA 3KLPX 4LJ6A 4Q4JB 3WOVA 2GK7A 4BKOA 1MQAA 1DOAA 4P32A 2W83A 4C7JA 2IDJA 2YICA 5JFTA 4CKWB 4OREX 2ATXA 3CGGA 3OSZA 3CLVA 3PNOA 3R3VA 1ZVJA 1W6UA 3GDWA 1F14A 4QVGA 1Z0IA 5G2OA 1PYOA 3H5NA 1I13A 1E1QA 3D4BA 2GYWA 2C2HA 1GNVA 3DTTA 4G1BA 4IO1A 4Z4GA 1RWVA 2AG8A 1ACJA 2K5UA 1NPYA 3BWEA 4RF3A 2DJ5A 3UW1A 3ZNQA 4KPUA 4KO2S 2HHAA 3AY3A 2G25A 4EG1A 1KO7A 5LIRA 4MHTA 1YDFA 2JH9A 2Y1FA 1LFDB 4O0MA 2I1VB 1VBFA 1PJ4A 3HLKA 5CLQA 5BOSB 5A06A 2O05A 1C3XA 1J0XO 3DAFA 3OPVA 3PHBE 2BC9A 2ZK7A 2J1LA 4MAMA 4J0IA 3UB3A 1DC3A 4PAGA 4WE3A 2RAPA 2BM9A 4G65A 3EDOA 3OURA 4U9IS 5E9WA 1E2DA 2UYGA 2XOEA 1JLLB 4C05A 4QBHA 1YA4A 3B6IA 3FCXA 3H8JA 1GV1A 2BEVB 1J00A 1OBFO 3OQHA 4YAWA 3WNZA 1X1QA 4CLXA 4REMA 5I45A 2D6FA 4MLCA 1P4GA 3N8HA 1KAGA 3W8NA 3C16C 6AT1A 1OX4B 1XV5A 1CF9A 1RJEA 5L45A 2A5GA 1UT6A 4CNQA 1K6EA 2YX1A 2ZP1A 3P0RA 4UDXX 1VJRA 1NUPA 3NYIA 1N6NA 3EXEB 5B3JC 1SD5A 1MB4A 5CR9A 2ZUBA 4DJFC 1ZKDA 1JFSA 4IHJA 3ZZMA 2DECA 3V4VB 3JWIA 4FE3A 4B80A 3INRA 4EHDA 1F4LA 5TT1A 4KYUA 2EKZA 4K6CA 2XZOA 4AUMA 5LBTA 3RTAA 2VDWB 1P0PA 3AV3A 4M21A 4CM9D 5IT5A 1EX1A 2HHJA 4QULA 3WP0A 2VRWA 1SC4A 2O8BB 4LAFA 3X2SA 4B35A 2HV8A 1RC0A 1USGA 2NUPB 2YZNA 3PNVA 3S70A 2Y93A 5MGNA 1RSZA 3PJDA 3TLYA 1CF2O 4XB1A 1UOPA 3OECA 3PC8C 4LC0A 1BX0A 5BSMA 3CVUA 5JG7A 1L0BA 4AG5A 4IDQA 5B58T 4OVKA 4XWWA 1JN0A 3EMDA 1NY5A 4V38A 2PXCA 2F1RA 3S0JA 1EUCB 1KAOA 1U4OA 1QQAA 1CE8A 3MILA 4HUQA 3ZIDA 4KSYA 1MV8A 2A0WA 4TV9A 5CLIA 3TIFA 1GRQA 1XP8A 4J0GA 2PZLA 1VA5A 1ZI8A 1P1FA 1TF7A 4I1VA 4IFIA 4KN8A 5BSWA 1LGYA 2PSEA 1SXHA 2GXQA 3D81A 1HFKA 4HDSB 5B1IA 5EE0A 4NDAA 4DC1A 1D8TA 4MKZA 5INTA 4Q4DA 2QUZA 1QQ5A 1TQHA 1Z5WA 4IVQA 5KQRA 4NK4A 3NHBA 1U7DA 2OZLA 2YIVX 3GFVA 2W5UA 3R5FA 2N0SA 3ND5A 3RADC 1QLWA 4BNDB 3ZV7A 1E5QA 4B75A 2EC5A 4PE5B 4I46A 5AJXA 4IIJA 4MQ4A 3LBYA 4O1HA 4GVXA 2JFZA 1HH4A 2IIQA 3A9UA 2JCXA 4M38A 3O83A 4YP7A 5FNVB 3U3ZA 1DKUA 2H2DA 3R3YA 1WF3A 1VL5A 2F3QA 3LPNA 4BXOA 4JSYA 1P1HA 3MEQA 4RS4A 4PAQA 2PV7A 3H99A 4CWAA 4OJTA 2ODNA 4MDHA 1ZU4A 3V4SA 3QWIA 3LC7O 4Q7QA 1DDOA 4YRJA 1RYZA 1WPRA 4JUIA 4Z86A 5AO9A 4Y1EA 3OTGA 1OFUA 2IZ6A 2Q50A 2XCUA 2AFIB 4HWKA 1FMLA 4PO3X 1E6EA 5GOZA 3W6PA 1NXQA 2MMGA 1Z12A 1IHYA 1KFKB 3R3XA 4ZDWA 4RETA 4CUJA 3ZJTA 4BN0A 1A8UA 1EE9A 5T4EA 3I6YA 3TOSA 1BH6A 2CUNA 2EG9A 2V55B 3Q8XB 1DJPA 3B9PA 3KT3A 4K87A 3JAMA 2RHWA 2ZRIA 3B36A 5DEOA 4F91B 3ZGOA 3ZQ6A 1P1KA 3ABQB 2ZJ5A 4PQGA 4MVJD 2F3PA 3U3JA 1JIIA 5DYIA 1BGWA 1CS4C 3N0RA 1QFSA 4I5IA 2XWQA 5AQEA 4E2YA 4E51A 3ZGZA 1DADA 4DZRA 2R6FA 4M9XA 4CODB 1Z08A 1Z33A 4AUKA 6ADHA 2M9MA 3DEFA 3NWEA 4Y30A 2FZWA 2AN4A 1RJDA 1V4NA 4OUKX 2AKAB 3BDVA 1WCV1 4JFRA 5IVIA 3HVIA 2PWPA 3H4MA 2V3WA 4RW0A 3WLPA 4EA6A 3EOZA 4ZGWA 2NTJA 3D6VA 4RE6A 4XJVA 2BBWA 1WSDA 1Z17A 3TTSA 1UDBA 3O31A 4Q4CA 2GAIA 4KXMA 1B76A 1L4KA 1P7CA 1EX7A 2Y8EA 1E3JA 5DHFA 4Y0VA 5CVTA 1UANA 4O3FA 4C4XA 2GSWA 5DWQA 3KKKA 2P5UA 2QG4A 1JSLA 4FS8A 1Z8NA 4PAOA 3NIFB 5LZ7A 4INZA 2QRHA 3TJMA 4EAAA 1SC3A 4RK6A 1Z4JA 4DA9A 1PRYA 3DD1A 4NQRA 2C61A 2QW8A 1HSOA 2EW1A 1VJTA 3A4VA 1F6DA 3L77A 5K0GA 5LMUB 1RT9A 4EB6B 1Z37A 3OOSA 4FX5A 1MOQA 1KETA 3ESRA 2VJCA 1D5WA 1TUEA 2GB4A 4HS4A 4MS3A 2QGNA 3GRUA 3RBZA 1QYDA 2XUHA 3S2YA 2PSHA 1QHIA 3LLCA 1MTZA 1HSZA 3CPJB 1W94A 3NTLA 4U2FA 4DC9A 2QE7A 4XD7A 5IKMA 5L4NA 4KKXB 2GK3A 2O0LA 4ZEWA 2JA1A 5K8UA 3GLIE 3SFZA 3UK6A 5K8TA 1TO6A 5AKKA 4YJGB 4HEA6 5DMHA 1ZGJA 1TRKA 2O2SA 4KTVE 3GBVA 2GXAA 2VPWA 5AVTA 3OM9A 3BEDA 3L9WA 1H0KA 2OGWA 2VTVA 3MYYA 4CKWA 3K0HA 3OTWA 1C8KA 1NBEA 4CG2A 1KL7A 3HFGA 1ZR2A 4L3WA 1JAYA 5JH7F 5KI6A 4RK4A 1PWEA 5IVKA 3W8FA 3U4QB 1FMFA 3CH4B 5TVGA 2W6OA 3NTUA 2C1XA 3J7TA 4QDKA 3ZV5A 1RQXA 4C0AC 1ECFA 3IP5A 3K1TA 4JOCA 5HIJA 3U4DA 1JDVA 1N9KA 2FVXA 4ABTA 3HH8A 2QE7D 4XD7D 2FPLA 4ZREA 3F46A 2C5EA 2FQQA 1T2DA 1YZYA 4IIBA 3VX3A 3WSWA 1L4GA 2A7QA 1MIOB 2W6MA 2HIAA 2IPAB 5BOSA 4PR3A 3CF4A 4AY2A 1T0JB 4K6OA 2YJGA 2HXYA 2B9VA 4JWTA 4WKBA 2OA0A 2FEKA 4GPD1 1P9NA 3EUEA 4S05A 1JLLA 1N8KA 4ILEA 3TB4A 2V7QA 1MC5A 1YIAA 2BEVA 2NV6A 1UKAA 1GOTA 3DL0A 1YZKA 3DFKA 2Q7XA 1TE2A 5KHLB 5FLYA 5DN9A 5LUAA 2Z98A 3FPFA 2J3DA 5ISMA 1N1DA 1OX4A 2I62A 3ESZA 3G5LA 1PT5A 1L8OA 2UUPA 1VPEA 2XYVA 4NZPA 3VR4D 4DMGA 1JR3D 1Y7HA 3KVOA 1UM8A 1PDWA 2J6HA 1C9KA 4NECA 4G8BA 4PU0A 3PS9A 2HRZA 3X2FA 4LA4A 1YI1A 2XF8A 3QKUA 3GAMA 4IUDS 5TARA 2C2KA 1NV9A 2AJ8A 4HQNA 1DARA 4FXOA 1WXWA 3NHRA 3NQ41 3D4LA 3VR3D 1RBZA 5MDHA 2VHZA 2P4HX 2ZB4A 4LXIA 4MR8B 1S01A 3AB8A 3FHLA 2VDWA 2QTAA 3SLKA 2A2ZA 2PUHA 2QHXA 2FKNA 3V42A 4BMXA 4BO3A 2O1XA 2Y0DA 3HEMA 2RH8A 1G8JA 1JEEA 2VBIA 1T43A 3NI2A 3IDSA 4HADA 4HGQA 4ND3A 5EKXA 4CN9A 5HFNA 2H1OA 1GRNA 2NUPA 4UNNA 3PKJA 1IEWA 3WGVA 3ONEA 3D2LA 2JIBA 3TIXB 2HJGA 1WOMA 4MITA 4OXIA 4QUGA 1NW4A 2PUVA 1XNRB 3ZQJA 1NOIA 3DE3X 1YT5A 1LSSA 3GA0A 1EUCA 3VZRA 4BNGA 4NYIQ 2KM1A 1G3RA 4HEA1 1L4UA 3A4TA 4D25A 3WQHA 4NE9A 1E2FA 3G8BA 4A6PA 2V4UA 3LYAA 4JLNA 2AD1A 2B61A 3E48A 4ESHA 2QRJA 4G25A 2YBEA 5K0JA 4D8TA 3EZ6A 4C3ZA 4KFTA 5IWAB 1VP9A 1E20A 1DAKA 4HDSA 5IASA 2VF2A 2JLVA 1ESMA 4J0DA 2QTBA 4U7DA 4BECA 1LQ2A 4O63O 4RL6A 1YL5A 3NFRA 1XZGA 3ESCA 4XRGA 1CUVA 5C7OO 1FEZA 2PD4A 3OAAA 1Z5UA 2EIXA 2Z56A 4KW7A 4OP1A 3K71B 3DEAA 4J2HA 3WRWA 4BNDA 1T0BA 1W46A 3NHSA 3UAYA 1MW8X 1XRSB 1VMKA 5LBIA 4E6PA 4F4FA 3QTBA 3R5JA 2I8CA 1VLLA 4YFVA 2RC6A 1NLFA 6Q21A 4HAUA 1H6AA 1FX0B 5FNVA 1W76A 1DUSA 3STVA 2RGNA 1UPUA 1Z3CA 1M9NA 1NASA 3OTIA 2X8JB 4IF6A 1KMIY 4YJKA 3HFSA 5E6RB 5AJHA 2ZKIA 2LKCA 1M8PA 3NDJA 3SYLA 3L6BA 2A30A 1KZ4A 4HBGA 3K4PA 1LW6E 1YD7A 3G82C 4LXXA 3KTFA 1NXPA 2ISQA 3WGQA 4ZVMA 5C5DA 2BBSA 2PZKA 1WP4A 2AFIA 2HMUA 1F0YA 4KUGA 4JLBA 2QNBA 2JJ1D 4KNVA 3RT7A 3K73O 2D5CA 3FTNA 1M1YB 4FEAA 4FHZA 4TPKA 3WWPA 2XB8A 1QCZA 4OKNA 5FXMA 3ZS9A 5J58A 1Q1GA 5HILA 2CHEA 3KT0A 1CR1A 2D2IA 2GO1A 3A04A 4JDUA 5AXBA 3UAOA 1T2AA 3IHKA 4V2UA 2GM5A 4AXXA 1P2TA 3Q2OA 2WSBA 2W9XA 2GUWA 1O9HA 3HYNA 5DHTA 1ULSA 3QVSA 3ZWOA 1Y98A 3HN2A 3NHMA 4UTOA 3WQRA 4F6RB 3CZ5A 3V33A 4PZZA 1AGPA 2GZAA 3FGPA 1Z4LA 2X5KO 2RGUA 1QSGA 3COPA 5FTJA 1V9LA 4ZV9A 4BNFA 5BRAA 1A9ZA 1ORTA 1UPCA 1I6LA 1EUYA 1UK6A 5KVVA 3PI7A 2NTVA 3PHCA 2I1WA 4K3VA 2DTEA 4B48A 5ICEA 5KTOA 4BNWA 2AJLI 1Y8ZA 2HT6A 4YWHA 4FW9A 1GU7A 3NKVA 4EB8A 3K0CC 1Z6YA 1IG0A 2O6HA 1WSBA 1L3BA 2D3TA 4ZI7F 2YMLA 3EF3A 4FSHA 5LA6F 2R7AA 3TL6A 1UBSB 1Y1LA 4DCPA 1H3EA 3NAQA 4C04A 5AUNB 1ISFA 5GM2A 4FDLA 3UMMA 5IT9A 4UFOA 4ARIA 1QRRA 1G42A 3N6RA 1R74A 4OB8A 4Y1GA 1N8TA 3IQEA 4UNIA 3T5MA 5ICCA 3UKOA 1LSJA 5CDFE 3E9QA 4WXRA 4KO3S 1JG3A 4Q9LA 1N2CB 4ZJYA 1W581 4PC2A 5DH9A 5AW1A 2O0JA 1NQWA 3UATA 2A9RA 3VH3A 5K6AC 3NU1A 4M54A 3G0OA 4J3NA 4EB6A 4HPWA 2W00A 1B6SA 3B3AA 4KXXA 1YZ3A 2AC7A 4J4TA 2GRJA 2GSDA 2ZR7A 1GZSA 1L1EA 2QXUA 4J0CA 4RK5A 2R97A 1VLVA 3IE2A 1R0BA 2DBVO 1FUYB 3QEMB 3H5TA 3WLNA 5A5GA 1YFLA 4EKYA 1EFCA 3UB2A 4U4AA 1PJ2A 1EVZA 4M7PA 5CYGA 1KERA 2H2FA 3PPIA 1P9RA 2P9EA 1KO5A 3ONDA 4YJGA 4K8RB 1SKYE 3O4VA 5DO9A 4ENVA 2FZVA 2VBFA 4PGFA 4A6EA 3LBNA 1CUBA 2X40A 3VU9A 2GM3A 3K3PA 3ER8A 4OQQA 1HNNA 1XHFA 4BP1A 4J3FA 3ZEAA 3PQ8A 4ZC8A 3F78A 3NIGB 1NF3A 2IHNA 4Q15A 2CHQA 3LA8A 3EDQA 1S3SA 3U4QA 4BY9E 2HA2A 4YYZA 4KBGA 3H42B 2I2XB 2R62A 2IXGA 3ICCA 1K1EA 2QMUA 3UAWA 1ABFA 1GPNA 3EGCA 4HVCA 1R64A 1PAUA 3WI7A 2OUKA 2IELA 1AQNA 2GCGA 4UVEA 4YVFA 2X1VA 2VJQA 3DDUA 2Y92A 3GZNB 3PXXA 3S40A 4XTRA 1S9DA 4QDXA 4FFLA 4MNTA 4HN9A 2JD1A 1XAIA 3HDVA 1MIOA 2X1HA 3PQ7A 4NCXA 1WMEA 2H7CA 2IK8A 2ZBUA 1GZ3A 3BZBA 2L2QA 4N9WA 4KR6A 3O94A 3Q9UA 2CK3A 2XUPA 1V2GA 4L22A 1R18A 1SVMA 4GOLD 3FZGA 2E5LB 3PXEA 4PTLA 1E66A 4G86A 3HNRA 4LMAA 4ND5A 4KIUA 1N32B 5B57C 3H84A 4DV1B 2B3TA 2BFAA 1FFXB 3NIWA 3WWEA 1Z06A 3LK7A 5BSTA 2W6PA 3I4LA 4BQIA 5HIAA 2WA2A 3MN1A 4LDZA 3LBAA 4GH5A 1I7LA 2MSDB 1SG0A 4MLDA 3VTKA 4JIGA 4JBLA 3M3PA 3ZE2B 2VXCA 4XDGA 2Z8YA 4ARSA 3GCGA 3E2MA 2BKEA 3VZBA 4GX0A 4MR7A 4R8SA 1OI7A 2C2WA 1I3CA 3GRZA 2AOUB 1NTRA 3F6PA 3G9ZA 4MR8A 4X41A 3E1SA 1T9GR 4G3XA 1ZGBA 2HQSA 4I1OA 2CVQA 1XTBA 3ANLA 3F5MA 3OVMA 3RVRA 4GR9A 5EHGA 2EG5A 3DOUA 2WY2D 3W5HA 3ZWBA 3CW8X 4EO9A 3T9BA 5KNBA 2O2GA 1BX1A 3AEYA 4FFMA 2DR2A 4BJ5A 2JI9A 2VQDA 3MJEA 1QRSA 3NW9A 3RU9A 4RY8A 3UJAA 4E88A 3MINB 1GSOA 1W6RA 3EC2A 4BAZA 2VDUE 1P3JA 4X1OA 3SK0A 2L17A 3UENA 2LZ0A 2BGIA 3A3NA 2IKSA 1UZMA 3PTLA 3FKJA 4DT1B 3OPQA 1E60A 2HCBA 3ZWKA 1SU8A 5BNZA 5CDYA 1CRQA 3ZY3A 2CB9A 3IO5A 1CY6A 1KIAA 1S2MA 3EIHA 3TD2A 1M6NA 4F86A 1P39A 1PZNA 2WF7A 4LX8A 1OH6A 4QO8A 1CEXA 5IBRA 1THZA 3GPBA 4OUDB 1KZYC 2PD6A 4PAMA 2GX6A 2MYUA 1ZN8A 2PRJA 2PLRA 1FFCA 2P9ZA 4PGHA 1ENPA 4MDFA 1U2QA 4F46A 1IONA 1YB5A 4QOIA 2PLWA 1YZHA 4C0LA 5JSUA 3BL8A 5JCJD 3WMWA 5EY5B 1XFDA 2V98A 2QYOA 4G1MB 3R24A 4ZHSA 3HYSA 4W1RA 2H4YA 3SP1A 3LM8A 4X44A 2JGLA 3EOBI 3WC4A 1PT8A 2FWAA 5HRUA 2PKEA 1H85A 3FUUA 4KI0A 2O3QA 3B8HA 4M7WA 1IQPA 3RI3A 2J46A 3PKIA 2X8JA 3DP7A 2Z95A 1K7FB 1H1TA 5EUMA 1A88A 3D0RA 4GO1A 4MW0A 3WWZA 5J4VA 4RVDA 3S4YA 3OZGA 1F0NA 5IAAA 4PHGA 4J1NA 1TTQB 4XM2A 2DQSA 1GIAA 4IV0A 3ZQKA 1OXVA 4EHHA 1O6BA 1M10A 1RI2A 3DZIA 4TLDA 2BM0A 3HHPA 3K5HA 3I2HA 3QE9Y 1U3WA 1GGMA 3AB3A 4Q9AA 4TMFA 2O2YA 3RTDA 2HW8A 1XN4A 3Q8WA 3F2VA 3ETGA 1BU5A 1LV7A 1XNHA 1N1MA 2VUIB 2F8SA 3C3BA 4RPGA 2Y1GA 2ZATA 1M1YA 2I7VA 3R23A 4XGRA 3RU3A 4NMXB 3CLUC 4IAOA 1G5HA 4KQHA 1I2BA 4NZZA 4OK3A 4PLYA 2AN1A 1VA4A 2V03A 3AGPA 4HJRA 1TEXA 2AFVA 4K88A 4RHXA 1NBMD 5KCZA 1NU8A 5M34A 5HWSA 1VBKA 4HUTA 4GWLA 1QO9A 2IXDA 2J9RA 3PF9A 4WK4B 4Z51A 13PKA 5JCXA 2YWJA 1P62B 1ZM9A 3Q3JB 1NA5A 2AJCA 5A4IS 3FB1A 4EJ2A 2HKIA 3O38A 4F6RA 1EDOA 1JLHA 4BMVA 3VO9A 3ZC3A 3OSUA 1OY1A 3L7DA 3NWBA 4M60A 3SAJA 4FMCF 3U9SA 2OO5C 3DULA 3HADA 1OYOA 3BJZA 1JYFA 1C7JA 1E9RA 3LOUA 2HJSA 4G8CA 3RVKA 3ZE7A 3PUIA 4ZDJA 5KO2A 1I6WA 3PIDA 3DO6A 3LX8A 2WB2A 2YHIB 3I2YX 4S3MA 4A5SA 1Z47A 4C7KA 2VNAA 3M0EA 4UCFA 1BRTA 1Y1RA 1B3BA 3R6LA 1XL1A 4TV9F 3FFXA 2QL5A 4C7BA 2O1SA 3GGPA 2YUTA 4RFLA 3TRDA 4XOIA 1R3UA 1B0ZA 4JYPA 5DYYA 1ZN9A 3UGTA 1LTKA 4WXPA 5FTKA 3L07A 4HWRA 2XAUA 4EOGA 1N2CA 1QV7A 2VH5R 3L01A 4J8PA 1XO1A 3PC4A 4MRRA 5IAOA 1AUQA 1KQGA 1G8MA 2Q49A 3G0CA 1E5VA 3WYGA 4DCTA 1QAOA 5JYDA 4NCJA 2JBAB 3HDHA 1XSEA 2AFHE 4KR2A 1VHLA 1C0IA 1K7CA 1RACA 3IHLA 2OBYA 2WOJA 3QEMA 3U9LA 3KDAA 2O1EA 2CXTA 2OAEA 4RQAA 1F51E 1QIJA 2XUFA 1GT6A 4EKIA 3WTCA 4URZR 1E4OA 1MTOA 1QB7A 2HXSA 1ZGGA 4XDHA 1DP4A 1VI5A 4MQFB 1H9AA 3ADOA 1SEVA 4CF6A 3B2QA 5GWXA 3LZCA 2HAEA 5HSGA 2GD0A 5ALTA 4ITUA 2CKMA 2PWYA 4NJOA 2Q2OA 3PG5A 4KRXA 2BTOA 2REQB 3E3OA 1HOXA 3GJSA 2YVAA 4YRMA 3WSVA 3O3CA 4MB2A 2GS9A 2NSHA 1U02A 2ZE7A 4ZGGA 4B76A 1EHIA 2VPQA 1J99A 1TC2A 5LDHA 3Q0IA 1NMQA 2ANCA 3Q9NA 1D4OA 1RU3A 1N5KA 2D2FA 2RHTA 3ZZTA 3DONA 4BFSA 4AUEA 3EZLA 2OKCA 2XRYA 1N2EA 4BP3A 3GJRA 1KYYA 1U6IA 1U8AA 3I2IA 5BSRA 4ATNA 2HIMA 4UU0A 2ODTX 3EDRA 5B5SA 3U81A 4F4UA 4J6EA 1JH8A 3R20A 4GXTA 3T61A 4CDGA 3HXQA 2M6SA 1N2HA 1P6UA 2F67A 4NFSA 1DBIA 5H02A 3PEUA 4AZ0A 5AI4A 1SKUA 4DS3A 2FN3A 4XD2A 1HM5A 4QODA 3JQCA 3UPDA 3PC3A 1Q21A 3OE4A 4RVFA 2X9GA 2I6SA 4LNHA 3T7KA 3U56A 3DEHA 4BLVA 5C1BA 3JR7A 4AJEA 1RMYA 2XA1A 3B5JA 5FBKA 3UMVA 1JYEA 2ZAOA 1DAPA 2XCLA 3DSRA 4M7RA 2R86A 4QNNA 4XSVA 1M0TA 4BMSA 4I1SA 4QTTB 5MHTA 2WF6A 3RF6A 3ORRA 2PWBA 3D8RA 1WAMA 1F5SA 1DXHA 1LLFA 3GAFA 4KK3A 1NRXA <