3V4RA

Crystal structure of a uvrb dimer-dna complex
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
588
structure length
586
Chain Sequence
DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein B
publication title Crystal structure of the UvrB dimer: insights into the nature and functioning of the UvrAB damage engagement and UvrB-DNA complexes.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/dna
total genus 189
structure length 586
sequence length 588
chains with identical sequence B
ec nomenclature ec 3.1.21.5: Type III site-specific deoxyribonuclease.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 3v4rA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v4rA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v4rA01
4ILEA 3AP1A 3GMTA 3ZJYA 3CRRA 4KU4A 5JFGA 2AD5A 1FP6A 1R7RA 1XEWY 1S9HA 1FOEB 2OHFA 2WJYA 2XZPA 3PUYA 1AM4D 1PJRA 1L7VC 4HB0A 1ZC3A 2AFIE 1TL7C 2A78A 2B6HA 3BD9A 4ZI2A 2YOFA 2QBYB 5JWOA 1T5LA 1ZC4A 3C41J 2V7QD 2EW1A 3LWNA 4Z8YA 1E2JA 2FDCA 5HPYB 4Z54A 4LK2A 2B21A 3M0EA 2P3SA 2RAPA 4P31A 2ZRAA 4LC1A 5FL3A 4ASUA 3GCGA 1VG9B 4V0OA 3ZVRA 2DWPA 3FB4A 3C16C 1JPNA 2G0TA 1E9SA 1OH5A 1L2TA 3IIMA 1VG8A 2QROA 1NSTA 3P27A 3P4YA 3Q3JB 3ADDA 4US2R 1G3UA 1T9HA 3BFKA 1QG4A 5KO2A 1PUJA 3TUIC 1E9BA 3E2IA 4TWZA 3TW4A 2I1QA 3CF0A 2GZHA 2KE5A 2AR7A 3CRW1 1ZD9A 3F0TA 1KK0A 3NBYC 4ZV4A 1G3QA 1C1YA 1R0ZA 1E2QA 1K8RA 4A92A 1P6XA 3HR8A 5EP3A 1X1RA 1EFUA 1R5BA 2F7SA 2HLDD 2OXCA 4M1WA 5DSZA 4F7WA 4BLPA 4EPWA 4NYJR 3I5XA 1A2KC 1JALA 2ZU0C 4W5JA 4ERNA 2H8KA 3MRSA 4JJZA 5BWMA 3HYTA 4TMVA 4NE2A 2F9LA 1CP2A 2Q0HA 1S9DA 4LJYA 1X1SA 1NP6A 1KKMA 2V4ZA 4N1AA 3WHKA 4CT5A 3AVWA 2J3EA 2J7PD 3G0HA 3T5DA 3CONA 3P26A 2ZS7A 3A1VA 2D7DA 1Q3HA 3KQUA 2ZAMA 3I73A 1T0JB 1U0JA 3N5CA 3RWOA 1GP2A 4BLQA 3QPWA 5HCNA 4ZCIA 1IBRA 1KY2A 4JLNA 1G1MA 2AWOA 1G3MA 1VPLA 3A1SA 1ZIPA 5ANRB 2OCBA 2OAQ1 4PAMA 1E2PA 1VG0B 4Q5IA 4A8JC 2AK2A 4BFZA 2ZJYA 1Z0FA 4BE7B 2VIIA 3PCRB 4BZPA 1SVKA 3I32A 1PUIA 4Q00A 2FH5B 3SQXA 1BMFA 2JA1A 1KSHA 3LXRA 4AYXA 3CWZA 3WMFA 4FN5A 4NCNA 2CHGA 2Q21A 1G5PA 4K8OA 1PVOA 1ZNZA 3PVSA 2XB4A 1IOZA 2YC2C 2W6JD 3OEHD 1W2HA 4IEIA 2ZJZA 2ZSFA 5IT5A 2R2AA 5KNBA 1J7KA 3GLHB 1E1QA 3AVUA 4KVGA 3I72A 3KTAA 3NBFA 3LLMA 2JJ2D 2ZI6A 4QFMA 4UNRA 4PR0A 4F4CA 3W9YA 3L43A 2ORIA 3T12A 3U6BA 4LJAA 3O8RA 1KTVA 4LI0A 4UNQA 2XXAA 2ODNA 1R8QA 1II9A 1T3LA 4FCWA 5JECA 3VNVA 3X1WA 3ZD7A 3FPNB 3TGPA 1TF2A 5TV2A 4YXWA 1Z6AA 1JAHA 3CUEF 2JDIA 2FX3A 2WJJA 2P65A 2GXQA 4FMBB 1G5TA 4Q1BA 1DAFA 5DHFA 3W90A 2D2FA 2IS1A 1OIVA 4BLOA 3L0PA 3SHFA 1S1MA 2XJ9A 4DLYA 1PZNA 2QA5A 4M4SA 1GUAA 4US1R 1NN5A 2RKOA 3BC1A 3V4FA 2ZEJA 2VSFA 4GP6A 1F2UA 4HLDA 4O2LA 2GVZC 4ARZA 1G7CA 4URVR 2GWHA 4IJMA 4RZUA 5TXGA 2G1JA 2CNWA 2H16A 3AF2A 3AGQA 4OI1A 2Z0MA 2VP9A 4DFCA 2F43A 2WJGA 3K0EA 3IO3A 5AK0A 1E79D 1TQ4A 2C8VA 4KCGA 3NEJA 1LF5A 4G5RA 2JLZA 1LNZA 1V43A 4URWR 4YMUA 1K5DA 4LPKA 3Q9LA 4MGYR 5LD2B 4B2IA 2FFHA 3NC1C 3QXJA 1DPFA 1P75A 3RRMA 3AVXA 4FIDA 1G17A 4G5SA 4MYUA 3NVAA 3I8XA 4LOAA 1RE0A 2ATXA 3T35A 1DO0A 4LHWA 3IIKA 5KDLA 1G6HA 4DLWA 5JLJA 1IN6A 1GL9B 5BYJA 3LA6A 4HSEA 3K09C 4JLDA 2PH1A 5KNDA 1C4OA 4BFYA 2IK8A 4NMMA 4ZCLA 2ZE7A 3L0IB 2MMCA 1HQCA 4KJZA 5EXPA 1X8JA 3GEHA 2YWFA 3RS3A 4HAUA 4W9MC 2AN9A 3GPLA 3ND9A 2KJQA 3WBJA 1XZQA 1W49A 1T8UA 1DE0A 5FTKA 3HJHA 3VKWA 3RABA 4OJQA 2GBLA 3BIFA 4Q03A 3OIUA 1YZGA 2HUPA 3UANA 2XXAB 3PENA 2GF0A 3G82C 3WNCA 1KSFX 4WZAE 4EFNA 4IOJA 1GRQA 1YR7A 2ZETA 4KSCA 2ZPTX 3H86A 4LCBA 3U7EB 4D82A 5GJWC 1G8YA 2QNRA 3ECCA 4TMKA 4LYFA 3THYA 4JJKA 4D0LB 4KSBA 1A82A 3B85A 3SI7A 2FGKA 3TVTA 1UM8A 3SHWA 3ZVLA 1SHKA 4C9BA 4KFTA 3TRFA 1X86B 2WSSA 4D81A 4EDHA 1T91A 4ZKEA 4AG6A 3RSLA 5H1YA 1XZPA 3WYAA 1F2UB 1Q0UA 2Q3FA 1AN0A 1QHYA 3PFIA 2HXYA 2JAQA 4ARZB 2OESA 4DBLC 2OV2A 3DKVA 2FSFA 4NBSA 3CZQA 3OEEA 1OKKD 5FL7A 3SE0A 4L9SA 2RGNA 3VX3A 1IXZA 3RVBA 2O0KA 5B30A 3U7GA 1KO5A 1W0KA 5HTKA 1XMSA 3C15C 4CDGA 4BRWA 2A3RA 4DLSA 1FUKA 2PEZA 2F43B 2ZM5A 1U8YA 1CR4A 4PC2A 1MRSA 5J4LA 2IWHA 4Q7JB 2G77B 2XZOA 5CB8A 1N6PA 2WMOB 2B8TA 4JVMA 3TQCA 1UEIA 2WSMA 5JS8A 4LJ6A 4HLCA 4LV8B 4MH0R 4IVRA 5FPSA 1XCMA 4M53A 5F98A 2Z4SA 3B1WA 4TL9A 4MUAA 2EFCB 4HDOB 3K0CC 2OLKA 1N0UA 1W48A 2GRJA 1CS4C 1QHHA 2ZYUX 4FXPA 1I2DA 1TF5A 1J2JA 1N6NA 4Q1DA 4AI6A 1ESMA 2F1IA 2R6DA 4HUQA 2R62A 1P2UA 1W4RA 1EX7A 3GJ3A 4X8LA 5BXQC 1AS0A 1XNJA 2WIBA 3X2SA 2QTHA 2BKEA 3UWKA 2JLWA 3VMAA 4PPGA 4DCSA 3VHXA 3PIRA 4DCTA 2IYZA 3L82B 2EFDB 2G9NA 1GOTA 4A0FA 3AB3A 1RVDA 3LO5A 1RRGA 5TDHA 1SVIA 1NVXQ 1WBBA 2XOKA 2IWRA 2FF7A 1XJQA 2ZVPX 5HKKA 1NMYA 3A6PC 4M9XA 3ADBA 4H1VA 2VP4A 5AJWA 5L8VA 2JATA 3KXIA 3SNHA 1KZGB 1MO5A 1NVUQ 2F3RA 4EKDA 4TYWA 2O8CA 2AXNA 4MKFA 2XSZA 3GFPA 2FV8A 1SXJD 4Q1CA 4JL5A 2BM0A 4W5HA 3O8BA 3FMOB 1JQLB 1IM2A 4AD8A 3UPUA 4BZQA 2H57A 5L3RA 1BYIA 2KBEA 4CT4B 4GP7A 3THXA 4W5WA 3MCAA 3MG9A 1JR3E 4QNMA 5FBRB 1OV4A 1SULA 3AVOA 3PUXA 4B33A 2BDTA 2O8BA 1R0XA 4M1OA 2CL6X 4ABYA 1Q1BA 2J1LA 2PX3A 3AUYA 5EE0A 4Z1MD 421PA 5E95A 1DAHA 3PUVA 1G41A 1R6BX 3W6PA 1ZM3A 1N5IA 1ZM2A 4ZDKA 3N70A 3B60A 1X8LA 2BIFA 1TTTA 1AA9A 3CLVA 4DC9A 3TH5A 3DKPA 3AKEA 4QXAA 3SDZA 4I99A 3BH6A 3UATA 2GNOA 2W6IA 2REBA 1D9ZA 3UWOA 2YVUA 4OHZA 3FFAA 3WYFA 4DSTA 1YZKA 4ON9A 2AL7A 4NKRA 3U60B 2GJ9A 2NMVA 4BFVA 4V02A 2IL1A 3OAAA 3OE7A 4AIIA 4E07A 3VR4A 5BN3A 2IS6A 2J0VA 5J5CA 8OHMA 4MUBA 5FFMA 2I1VB 2FU5C 4GZLA 2IYLD 4R7ZA 1RPZA 4Q1FA 1GDDA 1SVSA 2QN6A 3QBTA 1GRRA 3PXGA 2FSHA 3SOPA 2C9OA 1H8EA 3O8CA 2CMKA 1QHHB 2ZJAA 2OCYC 3K0AA 4DKXA 2J9RA 3H1TA 5A4JA 3B5JA 1NF3A 2A5DA 2VQSA 4HUQB 1VKJA 2IF2A 4KITB 4HUTA 5KOYA 3TK1A 3U6KA 2FGJA 2E1RA 1E2KA 1DG1G 1XCGB 3KB2A 3IHWA 1BOFA 3GJ4A 5EQTA 2XTMA 3IUYA 4NU0A 3D3QA 1GNQA 1H8HA 1TMKA 2ZI4A 1GWNA 2JCSA 2JLVA 1JR3A 2CBZA 4MYHA 1CJUC 1E9DA 4TYPA 4H9GA 1MV5A 2N1BA 4TTQA 3U3KA 2IYXA 1P5ZB 2Q3HA 4LV6A 4L15A 2V1XA 4JT4A 5JWRA 1G8PA 3EW9A 4ZDIA 1NBMA 2QPTA 2DFTA 2WIAA 2Z43A 3B13B 2O8CB 4OHYA 2DY1A 1IHUA 3PQCA 1OE0A 1O3YA 4URYR 4BFWA 4LSGA 1H65A 4A6PA 1FL9A 1KSGA 2OXRA 5AUQA 2EWWA 2JIZA 2FEOA 4JZKA 4PHFA 2Y8EA 3GEEA 5H8WA 2ZRJA 1M7BA 4LHYA 2J0SA 4L16A 1Z83A 2EFHB 3VQTA 2ZUDA 1OPXA 4QHYA 1YJ5A 2F3TA 2O8BB 3SN6A 4MYTA 3MLEA 2ANBA 1IJFA 4A15A 2PT7A 1KGDA 4Q9LA 3RC8A 2WAXA 1JQJC 1U98A 4TMWA 2BCJQ 1W0JA 1OHHD 3LAWA 3PEVA 2HYDA 4JMPA 3FYHA 2RCNA 2ZXUA 1R2QA 2ORWA 4BLRA 1CULC 2FMXA 1RKBA 4ZPXA 3FMFA 3WHLA 3B9PA 1G3RA 3UXMA 1N6KA 4URXR 2MSCB 3QF7A 1CR1A 3BH0A 4F4IA 2A5GA 1OXVA 1XB2A 3AVYA 4I4LA 3U3RA 2WAYA 2FN4A 3NH9A 2YINC 5G3YA 4LHVA 3Q5DA 2ZUCA 4NP6A 3M6AA 3T15A 3BB1A 2KI5A 2QMEA 1G7SA 1T3SA 3LDAA 1NY6A 5HCIA 3OFNA 2XJ4A 2YHSA 1BKDR 4NCHA 4PC6A 1P60A 1T0HB 4UQOA 2O5VA 4L5BA 4TLBA 4YONB 1AQUA 4UXHA 3THWA 1UPTA 2PCJA 3K0AB 1Z5ZA 2JASA 2PZFA 3MWKA 2ZRBA 4D6PA 5A5GA 4C2TA 4US0R 2VHQA 5DIFA 5KUTA 1A2BA 2QPAA 5JS7A 1E4VA 1NSFA 2C98A 3S1AA 3HP1A 2G6BA 2MSEB 2IHYA 4M2LA 4MKHA 3LVRE 4QHTA 5FTLA 2G0NA 3CW2A 4UNNA 2DFKB 2HCJB 2XNDA 3AF0A 3KXLA 4GT1A 1GM5A 2QGNA 2QRZA 4LUCA 1CU1A 2P5SA 3FHOA 4LJ4A 1RRCA 1R5NA 3TUZC 4MQBA 2PT5A 1N6HA 2F1HA 1RFLA 1XX6A 3BFXA 4NTZA 4D26A 3ASYA 4ZCMA 4CEIA 1EGAA 2QAGC 1UDWA 1O87A 3EA0A 5J4YA 3U3MA 4B44A 2ZSAA 4TMZA 2NO9A 4AK9A 4A2QA 2IS2A 2ZRCA 2YC4C 2C77A 3QEJA 4I81A 4LV5B 2Q9BA 3IEUA 2IYUA 1Q44A 4GI7A 1E9CA 2OO7A 2JJ8A 4JLKA 4RFSA 2GCOA 1T3HA 3EC2A 1HEIA 3R9IA 4DLRA 1VECA 4JBXA 3EAQA 2CLDX 3TUJC 3CX6A 2GK7A 3MJRA 2C78A 4LBYA 3SFVA 3GJ7A 3EARA 1E0SA 1CXZA 5D3QA 1WCV1 3KKOA 2GJSA 2GILA 2QEQA 2GESA 4TSFA 1UKVY 1NG1A 5EUQB 1D9XA 4B6EA 4M9QA 2BVNA 4GBMA 5AR1A 2OFXA 4PAOA 5D3MA 1U9IC 2WWYA 5BW8A 3SFZA 4MDFA 3BBPA 3OIWA 3SU8A 1GG2A 2YWGA 1ZP6A 4NPHA 2DFLA 1WB9A 4M1YA 1CTQA 4R98A 4KAXA 3GJXC 1US8A 2IXEA 1YHNA 3WBKA 4CRWB 2QI9C 2FFBA 4KI0A 1C9KA 1M2OB 1FMJA 1S96A 2CE2X 4JLJA 3R7WA 1U99A 3W8RA 4QBGB 1UDXA 2HDNB 4HB3A 3K70B 1CIPA 4FWIB 4OJKA 3THWB 4A9AA 1EFRA 3K9GA 2G88A 3MMPA 3AEZA 2VBCA 1UBFA 1KMHA 3CNOA 4M0LA 4IDHA 4U02A 4B2LA 5F9FA 5FOTA 4D25A 1EFTA 2IUTA 3A1TA 3PUWA 5DE3A 3S1AB 2B8WA 3QXXA 2RGEA 3V00A 3HWSA 2FPMA 1Q1ZA 5EXSA 3TMKA 4RD2A 4FINA 3X1DA 1CR2A 1D6JA 1Z6TA 4TL8A 4BLSA 2OCPA 5EXTA 2WJHA 2QORA 4XD7D 4ZIRA 1GVNB 3IIJA 4TQAA 2ZSDA 4DLZA 1UBEA 1Z6YA 2BMDA 2KBFA 5C4GB 4FMDB 4IXNA 4M9SA 5UKDA 3LBHA 3W34A 3ZIAA 1G8FA 1P9WA 3WMEA 3K9HA 5BN4A 1ZD1A 2HXSA 3NDBB 4HLQB 5AJZA 1HA3A 1ZUNB 2C95A 4BASA 1UKYA 4CEIB 2ZRLA 3KUDA 2GJKA 3RS4A 2BBWA 4A1FA 1FPMA 1DS6A 3CPHA 2ZIAA 1IXSB 1DADA 1R8SA 3CH5A 1NVVQ 2XGJA 4QG7A 2ZE5A 4Q48A 1IY0A 3VFDA 3OF5A 4KFSA 1SKQA 1HT2E 4E22A 1S3GA 2NGRA 1F60A 4NONA 4RFSB 2GCOB 3W5JA 1JB1A 3T1VA 4YMSA 2ATVA 4KYUA 2YWHA 5CM8B 4MRRA 3TAUA 1GTVA 4JL8A 4PFSA 4ZDWA 3VU9A 4I1SA 2V8OA 5FOWA 3BB4A 4URZR 3QSYA 3HR7A 1F2TA 1SXJC 5FTNA 2RGBA 3SQWA 4JL6A 3AVQA 1ZM9A 1OIWA 3D7MA 2AKYA 2OLJA 4KFRA 4M1TA 1ZNXA 2DCUA 4AY2A 1YZQA 5D3MB 2D3WA 1BO6A 4PAQA 2W00A 4QJ4A 4DSUA 2ORVA 1ZMXA 1KDTA 3UG7A 4OI0A 2PLFA 5KTYA 1KZ7B 2NTYC 3BB3A 1GZSA 4O2RA 4B34A 3B9QA 3HDTA 4RZXA 1LB1B 4W7SA 3ADKA 4BFTA 1E4YA 4PC7A 2EWVA 2QZ4A 1UBCA 4B6FA 3U3JA 1US8B 2ZTSA 3DPUA 1E69A 1TNDA 4JLOA 1N2CE 3I4LA 4GDFA 3R7WB 2O8EA 5P21A 2XEXA 3TVDA 4IOLA 3UMSA 2O8DB 2W2XA 1DELA 3B2EA 4IDQA 2QP9X 4FW9A 3RANA 4DSOA 5SZHB 1X3SA 4G01B 1KI6A 2JLRA 4TQUS 1HYQA 3HU3A 4X8OA 4CEHA 1OFUX 4JSTA 3QXSA 1D8TA 4UJ5A 3RWMB 3RYTC 4MRNA 5C18A 1S1CA 1KMHB 4A2WA 2ZJOA 1NVVR 1UADA 3IHLA 4EQ6A 1G3IA 1VCOA 4PTLA 1PV4A 5FOXA 4GL2A 4JLMA 2BBOA 4DIEA 4A4DA 4EUNA 4RCYA 5KU1A 1P3JA 5GVRA 4JYBA 2VO1A 4YQFA 2QM8A 1ESNA 3LD9A 2HYIC 4NHOA 4LX0A 4G1UC 4PXAA 4LYHA 4ZIRB 5TVKA 5EUMA 2MSDB 3AKYA 3W6OA 3RLFA 4EFMA 1OH7A 1VCNA 2ZRMA 3WNDA 4CIDA 1TAGA 1NL3A 4EPYA 1EXMA 1G8HA 1S0UA 2PLRA 5E4FA 5F3WB 1ZM4A 1E1RD 1KI8A 1NIJA 2QG6A 4LJ8A 2ERXA 1TADA 3IBYA 4OQMA 4PZLA 3TE6A 1G20E 5FBVB 5SZJA 1P9NA 3E5HA 2IEZA 3LFUA 5H70A 1N6IA 2R44A 5M04A 2IBMA 1BH2A 3FKSD 1EFHA 2OUKA 3KUCA 5CDFE 3QG1A 5GJBA 2QE7A 3U5ZB 2IYSA 4CGZA 1KDPA 2VL7A 2VP2A 3H0KA 1Z47A 1XMVA 1KO1A 3MWLA 1E2NA 4AKGA 2RH5A 3IDQA 3VU9B 1TEVA 5C1BA 2P2LA 2WKPA 1JPJA 3MD0A 4WA7A 3KB1A 3HYRA 1W36B 4OHXA 4LBVA 3KFVA 3I3SR 2JLSA 4Z8XA 4A8JA 3MJHA 2X2EA 3K1JA 4I1UA 3JZMA 2ZR7A 5L3SA 2PL3A 5AJXA 2W83A 3SC3A 3GJ6A 4Q9IA 1N5LA 5JCPA 4D4JA 2TMKA 2CLSA 2IYTA 5FPTA 2RGCA 2ZR0A 4DUGD 1OXSC 2ZI9A 621PA 1XPUA 5DI3A 3NBXX 5JHGB 4PO1A 2FPLA 1WMSA 1FZQA 5KPDA 3ICEA 3NIBA 4C7OA 5KDDA 3BS4A 1E0KA 1UAAA 2O8EB 4KVAA 3RAPR 2CK3D 3DM9B 3I92A 5DN6A 3EX7C 1KJZA 2B92A 4B3CA 1Q57A 4IKEA 4MYCA 5DYIA 1KI6B 2R6CA 1KDRA 1M1YE 2YJTD 4Q4LA 4GMXA 4CEHB 4P33A 4O3MA 5DNYB 1JJVA 2KSQA 3LQRA 2V55B 3P20A 3FMIA 1PLLA 5JSZA 5E3HA 3EZ9A 1HE1C 4NH0A 4XVQA 4EQ6B 4PQRA 2V1UA 1DAIA 3U7HB 2VSXA 2V54A 3KTAB 3C14C 1U8ZA 3VKGA 1MR3F 3OHMA 5CDFA 3PV0A 1YKSA 1YVDA 1WXQA 4M21A 1ZUHA 3ZS9A 2ZRFA 5F9HA 2HT1A 3CB4A 1E3MA 2N46A 2ZE6A 3ZGXA 5KSYA 2H92A 5KSPA 2B7CA 1GL6A 3EASA 2R6GA 3WYGA 2GETA 4R9UC 4ZKDA 4PSVA 2IS4A 4ASUD 3NHAA 4HYYA 1GNRA 4IVQA 1Y63A 4MRVA 2BCGY 3BAFA 1KAGA 3PUZA 1RRFA 5J4HA 3QPUA 2P0EA 3H2YA 5FOSA 3KKPA 4WW0A 3LW7A 2YNMA 1XD8A 2IYQA 2QMUA 3EA5A 4C30A 3TSZA 4BFSA 4KLZA 3I62A 1AZTA 4NDZA 2QT0A 1Z3IX 3TBKA 3L2OB 2Q3MA 1Q3TA 2ZJ2A 3EC1A 1B23P 1JAIA 3NBZC 4QGAA 1XJ0A 2V3CC 1XEXA 2RHDA 4TLDA 1XTQA 2C04A 3LV8A 4RFVA 3H4MA 4E03A 2ODBA 4TN1A 3U2QA 3ZVNA 1XPOA 4MA4A 3M1IA 2ZI7A 4WAUA 4EAQA 5GVSA 5J4KA 3GLGE 2PMDA 3V4RA 5IF9A 2AXPA 2VH5R 3R20A 3UMFA 2VEDA 1GILA 3EPKA 2WMNB 2VTKA 1E0AA 1XPRA 2OG2A 3RNLA 1W5SA 4M1SA 4A8JB 4HEJA 4CW7A 2BHRA 4FCVA 4Q9HA 5L3SB 2QENA 2IHBA 2WWWA 1XP8A 3K09A 2GAAA 3QIAA 4JSYA 4IOKA 1QZXA 4Q01A 3F3YA 4YDHB 5FBQB 5KNCA 5LPNA 1ZINA 5BQ5A 2V6JA 3U7FB 3CIOA 4DJTA 2REXB 4UKDA 5FUVA 4U7DA 2BOVA 1U8AA 1KHTA 2IC5A 4IW3B 4OK3A 1EK0A 1A1VA 5DI3B 2ZRGA 1E2FA 1W46A 4Y0AA 4A0GA 1RJ9A 4C7OB 1G291 4DT1A 2XTNA 5IK2A 4BUJA 5DHAA 4LJ5A 3JZAA 1T4GA 4M8NE 4XWAA 1BMFD 1KY3A 2P67A 1MH1A 1IN7A 5KSOA 2ZRNA 5SZKB 3IPYA 1KOFA 4C4PA 1RYHA 4O0MA 3A4NA 4MITA 3OESA 4V03A 2WWGA 4QGFA 4ACBA 5JSZB 3VR5A 4PC3A 1XF9A 1S3SA 4LBWA 5HZKA 4YMVA 1N3BA 3LY5A 1XRJA 3ZZ0A 2UKDA 5E7JA 1E1QD 1NMZA 1VCMA 1NI3A 1G4UR 2WOJA 3RS0A 4C0BA 2REOA 1OXTA 2DWQA 2WHXA 3CNLA 1N0WA 2P6UA 4NYIQ 3RDPA 3AKCA 5F2EA 5CB6A 3SYNA 4AYWA 1VCIA 1YR6A 1IXRC 3FWYA 2FE4A 4YLGA 4HLUC 4B35A 1SVOA 4LPSA 4OK6A 4BEJA 4YXWD 3GLGA 1P73A 1N5KA 4B76A 2JDID 1FW6A 2X19A 3MGCA 4C0HA 4YMTA 3RSOA 3THYB 1KI9A 1Z0KA 1EX6A 3CH4B 4L9WA 1OT3A 4QHSA 1E2EA 2ODEA 1SVMA 3CR7A 1KYIA 4PQYA 4HB4A 4WBSA 4TL7A 4QM7A 4X8MA 721PA 1M74A 1NBME 2BV3A 3AVPA 1Q22A 1QVRA 3IO5A 2WPDA 3BERA 4LJ9A 2FZLA 4LJ7A 2H1LA 2E9SA 3EPHA 2IXGA 1P2VA 4IEEA 4C0QC 1DBSA 5K8IA 2BM1A 1SVWA 4LWZA 4F93B 3LRPA 2BC9A 2C96A 3IGFA 1MO4A 4TLAA 4D0GA 1AKEA 2CNWD 4IHQA 3G5UA 3K0CA 1KI1A 3SR0A 2H7VA 3NXSA 4AYTA 3WXMA 1Q1EA 1U81A 1FTSA 2PZEA 4A36A 2OBMA 1ZJ6A 2O8FA 1N6OA 2X77A 1XTJA 3ZS8A 1OSNA 3GEIA 1Z07A 4S35A 5C2JB 3RS2A 1OF1A 3Q85A 1OXUA 2R9VA 1G16A 2OEPA 4LC0A 1Q20A 1NRJB 4YDSA 1R0WA 3I5YA 3ASZA 2R6FA 3PEUA 3LNCA 3ADCA 1OYWA 1MT0A 4GMDA 1W1WA 3AP3A 2ZI3A 4Z51A 3X1ZA 1LF0A 1XMJA 1E32A 4NYIR 3CM0A 2GAOA 2YOGA 4B75A 2PBRA 2J45A 1QHIA 1EFCA 1A7JA 1KI2A 2W0MA 3KJHA 3L8ZA 5EXXA 5FOVA 3D31A 4EJSC 3PEYA 1RJ9B 3MUFA 4DT1B 4D0NA 1D2EA 4NYMQ 2A9KA 2NO6A 2AFHE 2MMGA 4YC7A 1FFHA 1S8FA 3LBIA 1DO2A 2BBSA 1KDOA 1TU4A 2NZ8A 4HLUA 1ZM7A 4P4TA 4QBHA 3JVVA 1N25A 1LFDB 1I4DD 2CHQA 4LHXA 1VTKA 1XMIA 2WBLC 2QQ0A 3TKLA 1SVLA 2D7CA 2QL6A 1K5GA 3K0FA 1IONA 1ZRHA 4JIMA 4TLEA 1NJFA 3AGPA 1OYYA 3WRXC 3VKHA 1GNPA 1QHXA 1EESA 4Q1EA 2ONJA 4BFXA 4N3NA 3L0OA 2BBTA 3B78A 3ZZTA 4O25A 4Q02A 3QQ5A 3GLGB 2V7QA 2J41A 1D2NA 3KJIA 4FMDF 5DYGA 3THXB 3NEYA 3W3ZB 4JBYA 5KYKA 1W4BA 1CBUA 3BK7A 4B73A 1COWD 1SKYE 4PPFA 2D06A 1UEJA 3DM5A 4OQXA 1P9RA 3AQ4A 2Z6VA 5K8LA 1KI7A 1YZUA 2PCLA 2R6AA 2EVWX 2YOHA 4KHZA 3X1XA 3E1SA 2WSSD 4JVSB 2X1VA 4BZXA 3EIQA 4CVNA 4DIDA 1R4AA 1MO6A 5EE3A 1E9AA 4DCUA 2LKDA 1AS2A 3C7KA 3IILA 1PLKA 3WMGA 5JEEA 4LBZA 3WP0A 3Q72A 5FR2A 4C0AC 1Z6XA 3D6TB 1SHZA 5L3QA 3OEED 4GNKA 5FI0B 3IPXA 5FL7D 2ZRDA 4UXIA 3FVQA 4NYMR 1ZU4A 2FNAA 2HF8A 1W0KD 2HLDA 3KQLA 2WTUA 2F55A 1XXHE 1XEWX 2O52A 1IJEA 3AV0B 2IT1A 2XX3A 3AVVA 1ZCAA 1GIAA 2DPXA 2J87A 1XU4A 5FTMA 1CRPA 1GKIA 1IQPA 1ODFA 4DHEA 3DOEA 5JI3E 3CX7A 1T5IA 3T34A 1J8MF 3GLIE 3HU2A 4BRUA 1II0A 2J7PA 2WM9B 4MDEA 2ZREA 2VPPA 4C0SA 1F6BA 1P2SA 3KZ1E 1I4TD 4B47A 1XWIA 1OFHA 5JI2E 1XD2A 3QNUA 4DWJA 4EPRA 2ZRIA 1TQ2A 2GXSA 2IF0A 1J90A 3EZ6A 1CRQA 2JLXA 2EFEB 2XNSA 3ICQB 1AS3A 4XJXA 5ELXA 1E2DA 4HAYA 4WXPA 3TJZA 2VHJA 4EPVA 4JVNA 2ANCA 2XOKD 1KJWA 1L4YA 2CJWA 3L8YA 5HKKD 3WNBA 3DZ8A 4TL6A 1ZD8A 2AWNA 4S2EA 3QOFA 1HQYE 1Z63A 1TPZA 1KAOA 3DZDA 1KKLA 2W6JA 2DHRA 3A37A 3OEHA 4TQ9A 3R9XA 1DG3A 1BYUA 4QM6A 3AF1A 1MOZA 2XSZD 4V0ME 1QHNA 1YR8A 3K0FB 2ODWA 5K8TA 5GJVC 1YZLA 1ZU5A 2KWIA 2WKQA 1PLJA 2JJ2A 2PX0A 1NN1A 1OH8A 1CKEA 3F8TA 2FZ4A 4D4MA 1TQDA 1G4AE 1UKEA 1BIFA 1KNQA 4B2PA 2GZDA 3DDCA 4KFUA 1YRBA 1YZNA 1XXHA 5EZ6B 2NIPA 4BGDA 1U90A 3SYKA 3BGWA 4OYHA 4JKYA 4AKIA 1E98A 2AK3A 4B74A 3KQHA 3KKMA 2VF7A 3LX5A 1AGPA 1KI3A 3HU1A 3ZZUA 2CE7A 4BEBA 4M1KA 4FMCF 2K5UA 3DO6A 4JYCA 3EWSA 3V9PA 3GLIA 1WQ1R 2F1RA 4BWYA 2W6ID 1GAJA 2ZI5A 5L3QB 5GJCA 1E96A 3KQKA 1U0HC 2R65A 4WOPA 3CBQA 1KO4A 1XFAA 3AUXA 4BPBA 1D2MA 4IDPA 2WWXA 3U44A 1M34E 1R5OA 1RIFA 3OE7D 3OAAD 3A1UA 1G8GA 2DR3A 2JLYA 3FOZA 1TQ6A 4NCJA 1OB5A 1ZAKA 4JBWA 4J0QA 4B3XA 4KBGA 4RKEA 1E79A 5DO9A 1LS6A 2C5LA 2O0JA 3UK6A 2DYKA 3N2IA 1L8QA 2WWIA 3QVUA 4I1VA 3FTQA 3VR6A 1G5RA 4FCTA 4OQNA 2GVDC 2ZYWX 1Z29A 1H8ED 1FNMA 4OI4A 1ZVQA 3VR2A 2ZITA 2ZANA 3LBNA 1ZCBA 3U61B 3GJ5A 2W2VA 1DAEA 5FPKA 3M4YA 2QAJA 3FMPB 1VDZA 1WA5A 4V0MA 1YRAA 1XD2B 3RHFA 4C0KA 2VA8A 2OE2A 1KIMA 2ZJ5A 2QAGA 2JJ1D 2BEKA 3AVTA 1V5WA 1VYVA 4QKQA 2I3BA 1XTSA 1G18A 5JBQA 4RVCA 1H8HD 2BWJA 4NYJQ 1JR3D 3J81k 5LD2C 5G40A 2B7BA 3SJCA 2GK6A 1TUEA 3VAAA 1WRBA 2FWRA 2IX3A 1SKYB 2RGAA 5LBIA 4MKGA 1E2LA 3QJYA 1NBMD 3GLHA 1KMQA 3CO5A 5DI9A 4A6XA 4DZZA 1ETUA 2FA9A 1QF9A 4BQSA 3QENA 4BECA 1QDEA 3KXKA 2WWFA 2HV8A 1XJCA 4IRUB 4UJ3A 2JIZD 3EPLA 2W0SA 1JXOA 1NMXA 2Z83A 5AJVB 4LGMA 5B2ZA 4RSGA 1U9IA 2ZRPA 2J5XA 3I61A 1GL7A 2GCPA 1XXHB 2QSYA 1MABA 3QUSA 4DEXA 3AF3A 3JVUA 1NKTA 3NHBA 4TYQA 1IN8A 2PJRA 2XZLA 1CLUA 4G5QA 4XVRA 5AUPB 2RMKA 4I1OA 1W0JD 3B1VA 1P72A 4F4JA 4LY6A 4PO8A 1R10A 3GLIB 3KJEA 2D62A 3MFYA 821PA 1SXJE 3IBGA 4XOIA 2YKGA 3PJRA 4F38A 1AQYA 2H18A 1JI0A 1OFTA 1OKKA 3BORA 1F48A 4Y0VA 5H68A 1X6VA 3U44B 4TT3D 2HJVA 3DVLA 5TARA 3REFA 4P3YA 4M22A 3DOFA 5K8UA 2RGGA 1MO3A 4WVFA 1KO8A 4RCZA 5IHPA 2Z5FA 2WWHA 2DFNA 4JLAA 2OSBA 3ZDQA 2FOLA 3FHCB 1E6CA 1T6NA 3OFND 3RRZA 3AH8A 1I4LD 1YZTA 4QC2A 3QKUA 2IUUA 2F9MA 3E70C 3K70D 4RD4A 4PHHA 1P61B 2BEJA 3QPVA 4B3FX 4OHVA 1E2GA 1XBTA 4X8HA 2YV5A 2WKRA 3HPRA 1WF3A 1ZW6A 4NL4H 1CR0A 1OXXK 2GA8A 3K9NA 3RS5A 4HAWA 4B3DA 4DB2A 1SQ5A 2NQ2C 4MGKR 2QAGB 4AG5A 4H1UA 2VSOA 1I2MA 1DVRA 4U5XA 5FPYA 2PEYA 4ESVA 3CWQA 2XNDD 1FMLA 1IAQA 3KX2A 3LW8A 1CF4A 2IW3A 3TNFA 4E09A 3EG5A 1UKZA 2C03A 3LX8A 4DLUA 3I8SA 3ZD6A 3NH6A 4Q4HA 4QL3A 4L4UA 4HAZA 3BJIC 1AIPA 3QKTA 4OHWA 5AJYA 5J4VA 1P2TA 5FOUA 3AM1A 3KDSE 4UNSA 4B3GA 5JRZA 1ANKA 3LH5A 2CCKA 5G3ZA 3TQFA 3EZ7A 3DMDA 3LQQA 5JWHA 4FD2A 3AP2A 5JMTA 1XTIA 1SXJA 1NLYA 1VYUA 3FGNA 1Z8FA 3CZPA 5FBLB 4QBIA 4TZ6A 1W4CA 2IA5A 4FMCB 2NG1A 2NPIA 3DHWC 2RGDA 3NKVA 4KBFA 2ASEA 5CK4A 1GRNA 2AD1A 1SGWA 4HI0E 4IDOA 4II7A 4POAA 5KDOA 1MABB 1E99A 1G21E 4LDJA 1QBKC 4TMXA 2B2NA 2QMOA 5JEDA 2EFGA 4HZUA 3A36A 4DEYA 2OFWA 1F3OA 4PHTA 1WDTA 2FFAA 4Z1MA 4NCKA 4YMWA 5EZ5A 1F2TB 3AF4A 1JXMA 3CF6R 4EFLA 2CXXA 2GBLC 4TSFD 2NOAA 2WICA 4PX9A 4BLTA 1JECA 3ND8A 2IUSA 4B32A 1ELOA 4A2PA 3TSOA 1A5TA 2OZEA 5EP4A 3CPEA 3EIHA 1ZBDA 3K53A 4QBFA 4RY2A 3A8TA 2EU8A 5SZIA 1E0JA 5E7IA 4MRSA 2PJZA 2YWEA 4CZ2A 2D2EA 1F5NA 5HE8A 5G41A 3ZH9B 1E2IA 1E2MA 1XCPA 2BMEA 1XEFA 1MRNA 1NIPA 2C2HA 3P32A 4M1MA 1QRAA 3NG1A 4PSAA 1EG7A 2QUZA 4Q18A 3THOA 5JHHB 1X8KA 3MAAC 1M8PA 3B8HA 1FTNA 4Q9JA 2QP4A 3FFBA 5CLLA 2BMJA 2A2ZA 1M6NA 4PPNA 5BYKA 3QXCA 4IFBA 1EFRD 4Q9KA 1DARA 2FPKA 2G83A 2RGNC 4UNPA 3TW8B 1ZNWA 1GSIA 2GJAA 3OIYA 3GFOA 3EPJA 2FG5A 3C5HA 3D8BA 1SZPA 3FPAA 4HATA 2FSIA 4QJ3A 1NLFA 4ZO4A 5EP2A 1FQJA 2VHTA 3A1WA 4DDUA 2VP6A 3REGA 4C3ZA 4Q47A 4R2HA 3R8CA 4RD3A 3WRYC 5JRJA 3QBVA 4MKIA 1VIYA 4URUR 4TTRA 4WZ6A 2N42A 1OH6A 2A5JA 2HCBA 2PZGA 4KXFB 5FI1B 3RC3A 3SJZA 3SZRA 4ACAA 1U0LA 1HUQA 3K9LA 3QEOA 121PA 4Q4HB 1KO7A 3ZIAD 4AURA 1DAKA 1N6LA 1VHLA 4JS0A 1IY1A 1LV7A 5EJEA 1TU3A 1OFIA 3FKQA 2JLUA 4HDQB 3VR1A 1KK2A 2AX4A 3BOSA 3O8DA 3R9WA 4QNRA 3AKDA 4EPXA 2VHUA 2F1JA 5TMPA 2WVJA 1SXJB 2C9YA 3U4QA 1G9XA 1N0VC 2J46A 1AZSC 2ZRKA 2UVQA 1KSJA 5IDVA 2CLCX 2ZROA 5CK5A 4TYYA 1JEDA 4PZZA 2CL0X 4CYMA 1KJYA 3T1OA 4DLXA 2OILA 1ZNYA 2QY9A 3RRNA 3GLFE 5BN5A 3QF4A 4OQLA 3GD7A 3TIFA 1TF7A 3BXZA 4HZUB 1W5TA 4LZZA 1COWA 1NLZA 4N0EA 1Z2CA 4C0JA 4HAXA 3ZYCA 5C46F 3FDIA 4CF7A 5J47A 2UZ3A 1W36D 2D4HA 4OBEA 4AC9A 1HURA 2EYUA 2QPOA 2XTZA 5B57C 3K0SA 4KLNA 5LDDC 5LB2A 3O47A 1NNEA 2GXUA 2QMHA 4P4SA 1TEXA 3EXAA 1BS1A 4QGGA 4D4KA 1OHHA 3GJ8A 4GRAA 4A0HA 4RZ3A 5JJIA 4QJ5A 1OLOA 1LW7A 5A0FA 1TUIA 2QU8A 3UMRA 2AHOA 5CLQA 2Q9AA 2P6RA 1CJTC 4HZIA 2L0XA 2ZYTX 4MGIR 1UFQA 4NCIA 4M9ZA 2A5YB 3W6NA 5JCZA 3A4LA 3VHLB 3ZQJA 3ZVMA 3EWAA 2E87A 3TR0A 4GOKA 3ETLA 2QSZA 5IRCD 2QTFA 1AK2A 3SS8A 4CEJA 2NO1A 1RYFA 2BMFA 2HEIA 5EE1A 3P1JA 2ERYA 3QXHA 3TR5A 1Q1QA 3UIEA 1QG2A 6Q21A 1DTSA 2QM7A 5CIQA 1VG1A 4OI2A 5CJPA 3PG5A 1WE2A 3F5FA 2EYQA 2BJVA 4OK5A 3X1YA 4AKHA 3BH7A 2GHIA 5JJLA 3PR1A 2J0QA 1UF9A 4GZMA 3LXXA 3GJ0A 3DL0A 4Q4AA 2V6IA 3CF2A 3NDPA 2DWOA 3BFVA 1DAGA 4HDCA 3DMNA 1CEEA 1RW4A 2A30A 1Q12A 4WXRA 4P0TA 4B48A 3CR8A 4AWXA 3KKNA 2W58A 1NY5A 4PSKA 5DH9A 2H5EA 3QKSA 4JKIA 2CVHA 1NKSA 2CCJA 3MWYW 3GLFA 3VNUA 2GEUA 3P4XA 5AUNB 4JLBA 3QG5A 1HH4A 1YR9A 2VRWA 1M7GA 3SEAA 2OT3B 4DDWA 5KSZA 5JZVA 4OQFA 4F92B 4A0RA 3LVQE 3RRYA 2QT1A 3HJNA 4IDNA 4XH9B 2ZJBA 3U4QB 1NN3A 4IOMA 2IXFA 1OIXA 4LRWA 3KFXA 1AGRA 1LS1A 3L0SA 3N2EA 4Q7KA 1VMAA 2QE7D 2CHVA 2GKSA 1XEXB 4PHGA 2GCNA 4KYIB 3SYLA 5KPJA 3Q7QA 1FNNA 4MGZR 1FP7A 2IEYA 1B0UA 2HF9A 2OFOA 4GOXA 3QF4B 4D4LA 1J8YF 4ITRC 2ZYVX 1MKYA 1E9RA 3B1ZA 4AKEA 1WP9A 2NO7A 2XITA 4Q7LA 1Z2AA 3K8YA 2P6NA 3MSXA 4EIWA 3TSWA 2HJGA 1P7CA 2ZE8A 2GXAA 4TLCA 5HE9A 4P4SB 2ZU6A 4RKFA 3UG6A 3C8UA 2NPFA 3LLUA 4DB4A 1Z06A 4V0LA 5FPHA 3FE2A 2LCFA 3Q5EA 2LWIA 1IY2A 1KK3A 2Q9CA 3NWJA 1II8A 1W2GA 2OBNA 5EE9A 2G1KA 3QVVA 4RD0A 4LYAA 4XSGA 2ZR9A 5HZHA 2WJIA 1JEEA 5TB5A 4XWKA 1XD9A 1WBDA 3B1YA 2VP5A 1W44A 1NG9A 4R2IA 4K81B 4B3BA 1LTQA 4PZYA 1AJEA 4KO8A 4G0NA 2Z4RA 1CJKC 4P4UA 4CEJB 4L8GA 4B43A 3CRMA 5CM9C 5DN6D 2ZQ5A 1KK1A 3GFTA 2X2FA 3U3OA 4C2UA 4OL0A 3QKRA 2A5FA 3VMFA 3GQBA 2FEMA 2OM2A 5KHOC 2WJVA 4JLPA 1G7TA 2ZS8A 1P4SA 1CJVC 3A4MA 4Q4AB 1NN0A 2ZRHA 4DRZA 5CYPA 2ZUBA 2EQBA 3KKQA 1HTWA 3SBDA 4D2IA 2JJ1A 1FX0A 1S2MA 1T8TA 4XSHA 5L3VA 4QOSA 2J7KA 4Q1AA 3QKSB 5DLQC 2YZ2A 4DXAA 1NVWQ 3QE0A 4DDTA 4ZI3A 2H17A 3K70C 3GLFB 1NJGA 2GEDA 1IN5A 1W7AA 4V0KA 2QQEA 4XD7A 1XTKA 4RD1A 3W8NA 1CJMA 2OAP1 4LYJA 5CIWA 2DBYA 3ZQ6A 1AKYA 3C4JA 3SJBA 1GKYA 3OIVA 1S4QA 2O0HA 3MWJA 1KNXA 2P5TB 4DCVA 3CKLA 1EWRA 1N5JA 1VIAA 2C99A 3QI2A 1FQKA 3B82A 4XIGS 5CITA 1GFIA 4WIAA 2LKCA 4PC1A 2WOOA 1Z0IA 1N6RA 1P62B 4IXMA 2FJUA 4TYNA 4PANA 1JR6A 2VHCA 2ZJ8A 5FH9A 1ZUIA 2GDJA 2QRNA 2GEVA 2GTPA 1J70A 1Z6GA 2ZSBA 2QTVB 5CJ2A 4Q7MB 1VYTA 2I4IA 5AWFC 1OB2A 5HR5A 1QHGA 1HY3A 2SHKA 3IQXA 2VF8A 2O8FB 4HAVA 1M7HA 4G3XA 1QHSA 2ZS9A 2XB2A 4KODA 1EWQA 4XVUA 4EJSA 2J0UA 4G5GA 4DCNA 1OW3B 1Y3AA 1G19A 1JJ7A 4XTCS 3OZXA 1UBGA 3TAHA 1LVGA 3GP8A 4FI3C 4TTPA 2BKUA 3ONWA 2PMKA 4B71A 4DSNA 5FTJA 1G6OA 3KQNA 3Q7PA 1Z28A 2D74A 2W2TA 4MRPA 3TLXA 2FFQA 4Q4JA 1II8B 1LY1A 2NO0A 2FSGA 2ZAOA 3KL4A 4K46A 4TT3A 4U00A 2IYRA 1R0YA 3T1TA 1VHTA 1YE8A 2BJWA 2GJ8A 4V0NA 2A7QA 2V9PA 5J40A 5FBWB 4EPTA 1GITA 2CCGA 2CVFA 1J99A 4QRHA 5IK2D 5FUXA 1Z0DA 3BRWD 3PITA 2GZAA 3W3AA 1D5CA 4PPQA 1UJ2A 4GFDA 4QGHA 3KJGA 1DAMA 521PA 3IKJA 2XAUA 3B6EA 1RRPA 3QKRB 3BE4A 1W47A 2RGXA 5AUOB 2IYWA 5CYOA 4RD6A 3SJAA 5JJKA 2ONKA 1KI4A 3HPQA 4TMTA 3FHTA 5B64A 2VYFA 5FR1A 4R71A 4RJLA 2KB0A 1Z22A 5LB4A 1FX0B 4HB2A 4Q66C 3WY9A 1DEKA 4WZBE 5E7MA 2QBYA 2YYZA 2OBLA 4ZDJA 3IEVA 2IYVA 4F91B 3CRVA 3B7GA 4GSYA 2RB4A 2CDNA 2QGZA 4KV9A 2CL7X 1DOAA 1E94E 2C9CA 1A4RA 1Z0AA 1RZ3A 5FUWA 1L4UA 2ZSEA 3CX8A 4DVGA 1E1RA 4JLVA 2G3YA 4JT2A 4N0DA 2X8AA 1U94A 2WPDD 3GLHE 3RS7A 4Q21A 3IQWA 3VR3A 4DDVA 3QY0A 3FKSA 4OKSA 4FWTA 2JEOA 1XDBA 2CEAA 1GKUB 2WV9A 3ZLJA 4TZ0A 1OJLA 4E5UA 1TX4B 2R8RA 2VLIA 4A82A 1XTRA 2QP3A 5EE5B 3CRQA 4BFUA 1W4AA 5GADl 1JNYA 1E9FA 3T06B 3T61A 1ZIOA 4PQFA 4IVPA 2ECKA 4DLTA 4LHZA 4EJSB 3T5GA 3VTKA 1RC8A 2J0UB 4XTRA 1G64A 1FUUA 3A58B 1E2HA 4RZ2A 3R8FA 3CNNA 2Q6TA 3B1XA 3UKDA 221PA 4Q19A 5B58C 3SBEA 3EZFA 1E9EA 1Z0JA 2JGNA 2WZQA 2NZJA 4C0LA 5EP1A 1Z08A 5FUYA 1U2RA 3EIEA 1K6MA 4XWOA 5DISB 2JLQA 4Q4JB 4NZYA 4UXJA 3CPJB 1ZYUA 5G53C 2AKAB 3W5IA 3PEWA 4DUGA 3NC0C 3NTUA 1W36C 5C4MA 1G7RA 1ONBA 3DEFA 2J59A 1HT1E 2GF9A 3Q8XB 3VX4A 3WP1B 1HV8A 2F6RA 3BWDD 1QVAA 4JVLA 4D80A 5DGXA 4IFEA 4PO9A 2DB3A 3T1QA 2O8DA 2ZVQX 3C5CA 1IN4A 2IYYA 2CK3A 2RHMA 3FWLA 3I1FA 1YU9A 4GPTA 2CJWB 4GOJA 5TY0A 2OCAA 2UZIR 4G5OA 4DLVA 2HT6A 3EZ2A 1Q21A 3H84A 1JBKA 4P32A 1HE8B 1YQTA 4ESHA 2VP0A
chains in the Genus database with same CATH superfamily
2VH2A 1V37A 3G7SA 3MWGA 4P6VF 4EG6A 3GMTA 3ZJYA 1P7PA 3WTCA 3CRRA 3GNTA 5JFGA 2AD5A 1DV1A 2DLNA 3ESXA 1R7RA 2E55A 2E82A 1AM4D 4YNBA 2MYTA 1YQDA 2LPMA 3I30X 2RJOA 1Z26A 2H1SA 4EB3A 5I6DA 3MB5A 4ZI2A 5D1NA 3AL3A 3C41J 3LWNA 1K6XA 1A3CA 2HI0A 1E2JA 4PLCA 2KPOA 3NTQA 4BBJA 5BQFA 4UBKA 4XGQA 1HEUA 3QUQA 1ULHA 3A6HA 3LF2A 3CF4G 1YNOA 1JXQA 2DLCX 3F2IA 3GCGA 2FMIA 4K6GA 3AFIA 3ZVRA 2DWPA 1PGPA 4QE3A 3OCUA 1E9SA 1QLHA 2C4MA 2XMQA 2QYOA 4QT0A 1MXFA 4UHHA 1XVLA 1OH5A 5AVOA 1L2TA 1RPNA 1VG8A 2QROA 1RU3A 2XUOA 3MJDA 4DYHA 5IAOA 3WQHA 2Y77A 2P7HA 1OI7A 1G2OA 4F9EA 4ZOBA 1WD5A 3QWBA 3I04M 5JO0A 1PUJA 3ZHXA 1VPVA 4BXOB 1ZKDA 2IGBA 3E2IA 4EHHA 2I1QA 1FTWA 4C78A 4H6XA 3HB1A 1JHAA 5CCDA 3CRW1 1ZD9A 3HV0A 4FGZA 2PFSA 1XE3A 3CO0S 3F0TA 5BNWA 4I5FA 1R0ZA 4KRGA 2ISQA 4ZQHA 5F51A 3ORYA 2V7EA 1T9AA 5JG7A 3WZLA 3TTYA 4AROA 1G8AA 3KAQA 1EFUA 4F7WA 2FQXA 2OXCA 4S3MA 4OHPA 3SHQA 3URKA 1X39A 5BRNA 5D87A 1JALA 1UT8A 1HFJA 2IV7A 1F1BA 5DV9A 4P7BA 3JASB 1ZIDA 4JGGA 3DE1X 4MO9A 1J5PA 4NE2A 2L42A 4NV3A 3DC7A 1RAAA 3GX1A 4K9RA 4UMEA 1OWOA 1CQPA 2GM9A 1PZXA 1KYYA 1QOZA 2JH9A 3OURA 1X1SA 4YV2A 4QTTB 1NP6A 5KJ6A 4N1AA 4BV9A 2NV2B 4CT5A 4X6UA 2JAOA 3W2EA 4E3ZA 5AW0A 3PZBA 2KX7A 3VAYA 1K4YA 2O1SA 4JJFA 4P2BA 3K1YA 4XQCA 3C1OA 1BN7A 3L6RA 3I73A 1T0JB 1ECPA 1PV2A 4TVKA 4O3FA 3IHKA 4U9UA 3TTSA 1YCFA 5KSWB 1Y5IA 2GSWA 4X45A 3MINB 3ND5A 4ZCIA 3CWCA 7REQA 1NRIA 3DE6X 5FYQA 3W3AH 2RH4A 3GYGA 4ZAFA 4DY4A 2O2ZA 4L8LA 4RPHA 2SKCA 2XTJA 2CXRA 2J32A 1ZIPA 3M1LA 3DULA 5D86A 4E5DA 2GZ1A 1VG0B 3T7TA 4E4YA 1Z0FA 4P3XA 3W0LB 5A0VA 1SVKA 4RKWA 2MINA 1UM9A 3A6EA 4Q00A 3H65A 5SYNA 2OV3A 1KSHA 4K0KB 3X1JA 1OC2A 4AYXA 1XNRB 4OSEA 4X20A 1X70A 1SUCA 2CHGA 3IP1A 4IH9A 4ZYTA 1G5PA 1PVOA 5I7RA 4NBNA 1P45A 2W6OA 3CLTC 1ZH6A 1IOZA 4QBKA 3OEHD 5EGNA 5LYYA 1LU9A 2NU7A 4UTOA 3HXQA 5KNBA 2R2AA 2HTEA 4MQLA 3HLKA 5TQVA 5F7JA 3AVUA 3I72A 4WGGA 3B7PA 3R9XB 5JADA 3NBFA 4QG3A 4WNCA 4DAEA 4C4ZA 3K0BA 5FHRA 3W9YA 1J0BA 1ZQ9A 4R0NA 1MAHA 2ORIA 3T12A 4C07A 3ZH2A 2H1CA 2A67A 5E6SB 4BWVA 4WNIA 2JGJA 1R8QA 1II9A 4IMPA 3F9RA 4D9NA 1TFRA 3DOHA 3X1WA 2OSVA 3FPNB 3R3UA 1E1CA 3KYCA 5J59A 2Q0QA 1Z6AA 2VDWA 4RS3A 3CUEF 5REQA 3GT3A 3N75A 5HF6A 1S02A 4UVEA 4FMBB 2WU4A 4Q1BA 5LQRA 1Y5RA 4J03A 4DC0A 2ECOA 4DZRA 3EGDB 3TM4A 1E4EB 2YY7A 4YGYA 4BLOA 1X2BA 3SHFA 4EGSA 4BJ5A 3H4VA 5AKZA 4MV7A 3NO4A 4UCWA 3PI7A 1GUAA 4ZEVA 3JZDA 1USGA 3BC1A 3PGJA 5KYXA 5IH3A 4PCVA 4LTNA 4HDNA 4WD3A 5EJ4A 4BBAA 1R18A 3BGIA 3K5PA 1WW8A 3G7UA 1G7CA 1RJGA 3GWGA 2VK8A 4URVR 5AW3A 4RZUA 4AZ0B 1GAXA 1HDRA 1UANA 2VQ3A 3O03A 4XX0A 5C35A 1Y34E 3AF2A 1LPOA 1LJUA 3AGQA 4AJIA 4NCBA 3H9UA 1O97D 5AI8A 2VP9A 3RQIA 2QZZA 1JT9A 3IO3A 1Q14A 4KRXA 1WU7A 3TZKA 4KCGA 2Q6OA 5I8WA 3NEJA 2ZYSA 4JHLA 1UZMA 4BB9A 2ADMA 2QR2A 4URWR 2OHOA 4R9VA 3IALA 3HKBB 4L3WA 1U3VA 3ONNA 2NSHA 4JVOA 3C7DB 4CCYB 2WT9A 1BFDA 4R1OA 1U6JA 2PIDA 3FKJA 3I9LA 1H0KA 3I04A 2V96A 2EHJA 3C6BA 3LC7O 4HFJA 4MICA 1NVEA 5F1OA 3KZKA 4ZZIA 3V1NA 1O6FA 1SCUA 3QXJA 3MTAA 1H6BA 3RRMA 3ZGNA 4WINA 1V5GA 4ONEA 1OWLA 4G5SA 1R88A 1WL8A 3KQQA 5I45A 3I8XA 4H7PA 4LOAA 2AI1A 3I5AA 2ATXA 4JR1A 1MW8X 3FNFA 1M83A 2DPYA 3IIKA 3L7DA 1PGNA 2FG7C 2AFIB 2ESRA 1V47A 3GJTA 1IN6A 5CT5A 4LXGA 1UBKS 1CY2A 2HLHA 3GUUA 4RTKA 3CEHA 4HTAA 5IKPA 3ZTYA 3AHIA 2NUTA 1IDOA 3C6KA 4W8OA 4BFYA 5LXTF 1X42A 4CTMA 3CX3A 3HCFA 3X44A 5JYBA 1H2HA 2MMCA 1ZVMA 4IKOA 3ZU5A 1HQCA 5HOEA 4KFCA 4KJZA 2OAEA 2PUBA 1X7GA 3RS3A 4I9NA 5HF5A 4W9MC 4H16A 3EZXA 4KAJA 1NVDA 1SXQA 1ZXBA 3IR6A 3DD5A 3ZDZB 1DE0A 4RE6A 4PAGA 5FTKA 3HJHA 1QGED 4OJQA 5KYWB 1T4MA 3DWFA 3FPCA 1YZGA 2QQGA 1Q2XA 2WWTA 3KYIB 4ARVA 4JT9A 4CF5A 3IR7A 4EW1A 5HRUA 3EMVA 2GF0A 4P7JA 4MK4A 4R1MA 5ES3A 1C50A 2O6HA 3Q2IA 5ECYA 3VVMA 4DN6A 3H9JA 4IOJA 2ZETA 4V0SA 6AT1A 4XCXA 2O7QA 3F49S 4NJEA 3BFPA 1QU3A 4YRTA 1C80A 2X1LA 5I7FA 4TMKA 3TSAA 3SI7A 4BKRA 1UM8A 3ZVLA 1VPDA 2WT4A 4KIFA 4S1WA 2JZNA 3V1TC 1Y4AE 2YJZA 4UCQA 1UZNA 2V6GA 2A58A 1X86B 2PLAA 3BGOS 3O31A 4IV0A 1X0VA 3ZE1B 3FVRA 4ZKEA 1C30A 3IQIX 3CXRA 1WHTA 1XZPA 1F2UB 3HB4X 4P82A 2HXYA 4XIFA 3GEDA 3O9ZA 2WTMA 3SSAA 4ARZB 2IITA 3DKVA 2FUG6 4FJ1A 4EGCB 1SCIA 4AW9A 4FNMA 2XB6A 3SE0A 3NJ8A 4FIZA 1WV1A 3U7GA 1PEAA 1UH5A 3DMRA 1XMSA 2A14A 3C15C 5FNVF 2A3RA 4BRWA 4DLSA 1YB1A 1R9JA 5AHOA 4WCDA 1U8YA 4XYBA 4RHYA 1P5FA 1IHOA 2Z2JA 1MVLA 3Q9UA 4HS9A 1E3SA 2IWHA 1O57A 2G77B 3E48A 1E61A 4X41A 1NGSA 4C43A 2R1VB 3LUGA 1W93A 1A5AB 2CVZA 2WSMA 3G2NA 2VZ9A 2XZTA 4JOQA 3C3YA 5AOBA 4LV8B 1WUTA 2FEXA 2Q4DA 3P0RA 3MBIA 5FPSA 1XCMA 1A04A 3ZBPA 4M53A 4G4GA 3T7KA 2YMQA 3EZNA 4QYMA 3N2YA 3K0CC 2OLKA 1N0UA 1XYGA 5A3QA 1P1JA 5CB0A 3H0CA 1TF5A 1J2JA 1XQ9A 3W8FA 3Q7SA 4G25A 2IYPA 4Q1DA 4P7GA 2NWQA 2R6DA 4HUQA 3TGLA 4LVCA 1SCDA 3TXAA 3AUSA 1K5HA 3GWZA 4EEZA 4IQ0A 3BPSA 1JHQA 2JLWA 3OCVA 1KVUA 1QOPB 1PEDA 4PPGA 1JTEA 4WI1A 5IMBA 5LZ9A 2YV3A 2ARKA 2O06A 4WWHA 1NUTA 5K0BA 3ITDA 3LCVB 5J5VA 4YI5A 2EBFX 2HSEA 3LO5A 3OCWA 1RRGA 3UFXA 1WBBA 1JTFA 1DAOA 4G1EB 2DPMA 2IWRA 4TS3A 1X7DA 4JJ6A 2ZVPX 3U9LA 4L74A 1Z8NA 5HKKA 1NMYA 1LLDA 2E7ZA 2JFPA 5FBKA 4GPZA 3EVCA 1O08A 5KCZA 2H8GA 5TPZA 2XQKA 2VP4A 3I83A 4AS2A 5L8VA 2JATA 3U40A 5T4HA 1IDN1 1WZNA 1KZGB 1MO5A 2Y9MB 2F3RA 4FPXA 4GKVA 4X1IA 4F5DA 1DEOA 3HKDB 2XSZA 4N65A 4YRCA 4MHSA 5K9ZA 2CV0A 2FV8A 1E3WA 4IDBA 2OQVA 2MU1A 3A7DA 3FCCA 3S2GA 1CSEE 1LWOA 4JSRA 4AD8A 1PQ4A 2YVQA 3SC4A 4HDSA 1L5FA 2GX6A 3PRKE 1NFFA 4F3NA 2C7GA 2X9GA 4XUEA 4GP7A 1KZ6A 4W5WA 3QOXA 1KQ3A 1JR3E 2LXNA 2HDOA 2ZJ6A 3KKLA 1KFBB 4BO3A 4NE9A 1JBQA 2QTMA 2CL6X 5ERYA 3JALB 1A8PA 4IHJA 2PX3A 4UZFA 3LDFA 1PDWA 4I55B 5E4YA 1VHQA 5EE0A 3IT3A 2H0QA 1SNYA 1GNLA 4C7KA 4RHEA 2PL5A 3RYFB 3DZGA 3W6PA 1AOXA 2OXFA 1N5IA 4TLMB 1X7ZA 2I4NA 4B0OA 4BPBA 4K26A 1IL0A 3QEKA 4KK3A 2NTNA 3N70A 4J2TA 5KQGA 5DM60 3F6PA 1YKGA 3WADA 3TH5A 4EF6A 4KQMA 6ABPA 1O0CA 4C03A 3V3KA 3BH6A 4D8UA 3ZOZA 2GNOA 4YX9A 3RADC 1D9ZA 3UWOA 1WLSA 1A98A 2DC1A 2UZ0A 2XPCA 1Q15A 3FFAA 4MR9B 1L5MA 2AL7A 3W5HA 3BMOA 4PX2A 2GJ9A 3M4XA 3RAJA 2NMVA 1Y7HA 3T9CA 4LF8B 3GLRA 3OE7A 1C5KA 4IX9A 5LBTA 2C5EA 3QH4A 1V8ZA 5BN3A 4OGWA 3EBPA 2J0VA 5JALA 5KTSA 3HN6A 2FPIA 4PLHA 2YZNA 3OZTA 3VO2A 4E7OA 3RBAA 2JFFA 1KL7A 1Z13A 3OHSX 4RCVA 5GOTA 1SVSA 4ES6A 1SU7A 2QN6A 3EQZA 1J23A 2H2AA 3H42B 3EF1A 2JFYA 2ZIEA 1QKKA 3R0XA 4UOEA 3GMSA 1TUBB 1X38A 1C8BA 2JJYA 1IOWA 3PEEA 5F77A 3BL5A 4AWAA 4CQLA 1PL6A 1YOBA 5E3JA 3YASA 1LPPA 1RBYA 2QE6A 1PTKA 1Y80A 5BT8A 1U3WA 2L2QA 3AETA 3QVJA 3V1KA 4LF7B 3F7MA 3HY6A 3HSSA 1QHHB 4H1HA 2ZJAA 1WR8A 4YAJA 5BT9A 4DKXA 2J9RA 1P7ZA 1QTNA 3CEAA 5K4HA 1EHYA 3DO5A 2FRXA 1PFQA 2R87A 1IOLA 4KITB 3QMWA 3U1VA 5DEOA 4HUTA 5KOYA 3U6KA 2BGTA 3AIKA 3G13A 4BUZA 4NCAA 1GGNA 3NOVA 3EIWA 2FZEA 4PZPA 2RHCA 3OD5A 3RTBA 5EHNA 1V7PC 3ZE2B 2LBPA 1TMKA 3R41A 4AZ3A 5AW2A 1W19A 1GWNA 5JO9A 1OD6A 2JLVA 3IXQA 4FLMA 1MV5A 3L7BA 4BBPA 4TTQA 1DFHA 3CJRA 3UAYA 3EK2A 1PEKE 3OX3A 4JWTA 4X1YB 1OQAA 5AKEA 5LLTA 1HXHA 4L15A 5AKKA 3MNFA 1GCUA 4BMYA 3DVAA 2AMJA 3T5MA 2V1XA 1P18A 1G8PA 1A95A 3EW9A 4PYLA 3ZD8A 1NBMA 2IXAA 2DFTA 2QPTA 2Z43A 3KWJA 1QX4A 2QMZA 3KTOA 4LA4A 1SCJA 4KXUA 1KJNA 1FNDA 3UHJA 3A2KA 1UFRA 3MS2A 3V42A 1O3YA 1D4AA 3OT1B 4BFWA 2IE8A 1S2DA 3PJFA 4OB6A 3RSQA 2ZUEA 1P2FA 2XUHA 1S8NA 2NVUA 5AUQA 5J2UB 3IDAA 1FRZA 2GBFA 4E2ZA 1ORWA 2DBRA 4PHFA 4Q12A 4GLJA 4FQ8A 4LHYA 1Q1AA 1Z83A 3ENQA 2JJQA 2ZUDA 3RUAA 4QHYA 1YJ5A 4BRSA 1UPCA 2O8BB 5F2KA 1LPNA 1MC4A 1NLUA 2RKBA 1Q7RA 3URMA 2B20A 3GEGA 4NENB 3G79A 1FDTA 2FPGA 2EATA 3GVIA 3S3TA 1U98A 3GYBA 3PTLA 1R74A 4HRVA 2LW7A 1CEXA 1OHHD 3LAWA 3GCXA 1Y7IA 3PC8C 4QDZA 1AA6A 1B76A 2P9CA 4ZHQB 1LK0A 5BUZA 4DKJA 2YWXA 3JYHA 1DJOA 2ZXUA 1C1DA 2PM8A 3CIFA 2FMXA 5K5EA 5ILGA 3FMVA 3EXG1 1N6KA 3PPWA 4JLSA 2H06A 3QF7A 4URXR 1MA0A 2E4ZA 3KNZA 2D1RA 3ZLVA 1ISIA 1XB2A 2PWZA 1GXSA 1AK1A 3A2MA 1GGJA 5C8YA 3CJQA 3JTEA 2G04A 3L6OO 3WLRA 5LDHA 2XZDA 5G3YA 2FF5A 2FRDA 1AZLA 3ESRA 3PHJA 4XM0A 4NP6A 1CEQA 1V35A 2AFHA 3E7DA 3F96A 2QMEA 3C6YA 3C97A 2KQUA 2P41A 1KORA 2I2DA 3BJZA 3MUEA 2QTZA 1SKMA 1AV7A 6NULA 2EWMA 3MWDA 3W79A 5MN5A 1NE2A 3NHKA 3SK0A 4B3TB 4EI7A 1GPAA 3NB0A 3L0DA 3THWA 1AQUA 1NFQA 1VBNA 2RD2A 3ESAA 3HO1A 3K0AB 2JASA 2P90A 2ZRBA 4M0PA 4RZIA 1ZXLA 3S7TA 4US0R 1LPBB 3QX8A 5HMLA 5A5GA 4C2TA 1L9KA 1A2BA 4AQ7A 5JS7A 1YDGA 3ANTA 4AMVA 3PDIB 4ESOA 1XNGA 1E4VA 1ZMOA 3D4BA 3JWHA 2HIGA 4HK4A 3E3MA 4MWCA 3R3VA 4MKHA 4KX3A 5FTLA 1U6IA 3RFUA 1E89A 3C4VA 4GE3A 2XT0A 5ALEA 1E62A 4EY4A 2XNDA 2II6A 4FMPA 5JYDA 2EHDA 1XSEA 4GGPA 3VNQA 4ZVPA 4C01A 1M8KA 2Z9BA 5JNVA 3S27A 1RPAA 3OBBA 1A69A 3FG9A 4LJ4A 4RKQA 3TSYA 1R5NA 2XMGA 3NHJA 3AR5A 1PDOA 4WOCA 3T0GA 3U4CA 1QU2A 2PT5A 2OECA 2F1HA 1EQAA 1RFLA 2ZIGA 1EHIA 3BFXA 4NTZA 3NVKI 1ZUNA 2V5UA 4YRMA 5DGHA 4ZCMA 4MJXA 2QAGC 3DZBA 2H0AA 2UVPB 3EA0A 3ZDRA 1AKMA 5ALOA 4DARA 2J3DA 1F0YA 2XBUA 5AYVA 2AJCA 5I5GA 3VPXA 4PN7A 4AK9A 2NO9A 1C81A 4MRAA 3LI2A 2YC4C 4MUFA 4WECA 4XOUA 4I81A 3EZYA 3R5SA 3U9SA 4LMPA 1G6Q1 4G36A 4WFKA 1E9CA 2DR2A 4TMYA 1K86A 2JJ8A 1HR0B 1T3HA 4PFKA 5JLAA 1TZ2A 1OC4A 2HA4A 1KYXA 2WFZA 4DLRA 1ETHA 4GRIA 1YZYA 3EAQA 4Y6LA 4MDYA 1UKCA 3ZBUA 5AKIA 1XQYA 4LBYA 3ZI0A 2V98A 1WCXA 3GJ7A 1KTIA 3DYBA 4JITA 1E0SA 1H2RS 2GJSA 4JJ4A 1CHDA 1A9SA 1T36B 4F11A 4TSFA 1U1DA 2GESA 3CLUD 4YFVA 5BR1A 2Q2NA 3FPJA 3TF5A 3DW1X 5LMUB 4M46A 5AR1A 1YB6A 2BGRA 2OFXA 4YROA 4ALMA 1U9IC 2Y1LA 4G41A 1GNSA 1LV8A 2W2KA 2ID4A 2X58A 4F6RA 1XZJA 3TLJA 5K3OA 4IGFA 1Z0ZA 2G07A 4LRXA 4MDFA 2CUTA 1N92A 5BVGB 4PNPA 4EW2A 4JX9A 2VJMA 3B6ZA 1DCMA 3EFHA 1PKXA 3V4ZA 1ZP6A 2X7HA 5I9LA 2DFLA 3BXFA 1CTQA 1MEJA 5AOVA 3TTXA 1FSZA 3DLIA 1ZH8A 4MWDA 4KAXA 1EGVB 4Y6QA 2NU8A 4CIBA 1YHNA 5BSRA 4BNJA 1TTPB 2A5LA 2FFBA 2QI9C 2QY6A 2YYSA 4KI0A 3C4QA 1XRPA 2A1IA 4JLJA 4AY5A 2BGJA 1J7JA 2Z58A 3QVOA 5AOCA 1T13A 1H5QA 3DF7A 5BV2P 3C3XA 3FGOA 2HY7A 3BGVA 2XT9A 4OJKA 3ETEA 4ZT5A 3GO4A 3NHUA 3CINA 2O1XA 4D9FA 1Y89A 4YCBA 3MMPA 1YWGO 4IIVA 2F3UA 4J76A 1NXSA 1UBFA 3EHDA 4WZBB 3UWMA 4CMHA 3BQNB 5F9FA 3P94A 1I14A 1QGZA 5FOTA 3EOAI 1C1XB 4TS4A 3QXXA 4RE5A 3G9QA 2JLCA 2SKDA 2ZSUA 4AJOA 1H2ZA 3B3QA 4M0MA 1RCTE 3X1DA 3MQ2A 1VLMA 4FKMA 2W9XA 1X13A 1L3IA 2FW0A 2QTCA 1MJGA 4HNAA 1PR0A 1Z5PA 2ZATA 2QORA 2PUDA 4TQAA 1N2EA 4HR7A 4RLHA 2WA1A 4G1BA 3CEPB 2BMDA 1QE3A 4IXNA 4Y0NA 3LBHA 3W34A 4QTYA 1G8FA 4I5DA 1RZRA 4QO8A 1VL5A 2Q5JA 4R31A 4UD6A 2Q6LA 4HLQB 3AF6A 3NDBB 2C95A 1C4XA 3KUDA 5DTEA 3KQOA 4FUTA 3ZWPA 3L6UA 1CQJA 2ZYDA 2MYUA 1ODJA 2ZIAA 3MTJA 4Q3AA 1JLSA 3HGTA 4RW0A 1R8SA 1ZEJA 1T34A 1FRQA 3GVCA 5KOIA 5DNAA 4QG7A 5KKAA 1MUUA 2ZE5A 4D1YA 2PQMA 5IPFA 1V3TA 1OZGA 1HT2E 1L5QA 1ZAYA 2GCOB 3NUGA 5FFNA 1IBMB 3FYUC 1VCHA 1RE1A 1XZAA 3M70A 2NXEA 2YWHA 3CNHA 3TAUA 1GTVA 4FHCA 3VU9A 4GOLD 1AU9A 2C59A 3BCRA 3KVVA 4MQEA 2PT6A 4J3JA 4RA6A 3TCNA 5ARCA 2AG6A 3JQFC 4FVTA 4C89A 4ZGWA 1JFFB 1JIXA 1H85A 3KPYA 1GEGA 4QOJA 5FTNA 2QN8A 2K2WA 3FNEA 5KNBH 4FFOA 4FEGA 5EPUA 3VYUB 4YPOA 5FUQA 3WDSA 1DRKA 3H2KA 1KA9H 4CLEA 5I51A 2ZUFA 1V3VA 2WYIA 2PX6A 3SIWA 4TXJA 2ORVA 4OHOA 5E4JA 4YCMA 3ZTTA 2RBEA 4LSMA 1GGMA 2GGSA 1DV2A 4MP8A 5CM2Z 2PLFA 1FDSA 2Y99A 1A1SA 4KKVA 4OI0A 2BP7B 1WWKA 1W30A 1GG9A 1SC9A 4L6AA 4DMRA 3UBTA 3HDTA 3UWSA 2QRGA 3LGAA 3ADKA 1X7WA 4PC7A 1O6GA 4JNCA 5EJIA 3PDWA 4B6FA 1UAYA 3P5BA 4RXUA 2ZTSA 3GRPA 3DPUA 2ORED 4RLFA 5FO1A 3SSMA 3JQ7A 1N2CE 3OU6A 2RGYA 1AGYA 2A92A 4QYIA 2FEKA 4IOLA 1HOTA 4YFYA 3E3LA 3RANA 5ESWA 4D9CA 4DSOA 4S1NA 5SYMA 1LVHA 3IPRA 4YP0A 3TBFA 4N3BA 1FJ2A 3RJZA 1KI6A 3KL2A 1EMDA 3HU3A 3WLAA 2UXCB 3OCYA 4IIJB 4L5JA 4Y9UA 4CQMA 4KE8A 3RYTC 2G7MC 3KEQA 2H54A 4MRNA 5HMMA 5C18A 4Y2HA 1KMHB 4E15A 3H5AA 2DUUA 1JAXA 5LYJB 1G3IA 4X1KA 4PR3A 4NPCA 4PTLA 4GL2A 1C2TA 3LC1O 1FVFA 4Z0TA 3A4TA 4I4TA 4YVFA 1OLXA 3AR2A 2JRLA 5AFSA 2XVXA 4YQFA 5FV4A 2F48A 3BQMB 2W90A 1PGOA 2NO4A 1ESNA 1RJEA 3LD9A 5KX5A 4PXAA 3W2FA 1VE3A 5JVDA 2HMWA 4IV8A 2B9VA 5D00A 4NZMA 3RVOA 1IVNA 1P4HA 3IULA 5TVKA 3T7DA 1M1XB 1WW3A 5KDLA 5F3DA 1UJCA 3PL1A 3SWWA 3L8CA 1J33A 4EHJA 2QN3A 4J0CA 1JU3A 2QXUA 1NL3A 3ES9A 3IESA 4YWJA 1G8HA 3RQSA 3VVCA 5E4FA 4YIHA 3L4KA 3GRRA 3GU3A 1E1RD 2QG6A 2YHIA 2ERXA 3LFHA 5DYNA 3S44A 2WB2A 1G20E 4GWKA 2FW7A 4EG5A 2Z04A 4KYVA 3EVZA 3FA2A 5IM5A 4DNOA 1SXIA 4K87A 4MJ7A 1X1EA 2R44A 4N8EA 2JGRA 1BH2A 1GT91 2VK1A 3FKSD 4QPCA 1O95C 4BUCA 4J7UA 3NZEA 5CDFE 2HK8A 4Y9SA 4LGVA 5EMNA 2HBZA 2IYSA 5T41A 2C83A 3MSCA 4GI2A 1KQGA 1RYEA 3I01A 1Z16A 1Z47A 3AMVA 4NI5A 4HWPA 4ZCQA 1XMVA 1KO1A 1JIQA 2AYYA 4BIIA 1CUCA 2EDAA 2RH5A 1KFCB 1XDZA 3FI0A 3GVHA 5C1BA 3K6SB 4I55F 4CQJA 3JVDA 2REQA 5JDCA 1KYVA 3DDOA 2XUIA 3QVLA 3BJEA 4NBLA 2XNKA 1G38A 2WSLA 4K3VA 4XWGA 1LTKA 1XZGA 3ZDBA 2JLSA 2R79A 3I12A 3MJHA 4IQFA 5G4LA 4O63O 5BO5A 4A8JA 2G9UA 3L7CA 3KTFA 2VJPA 1WAMA 4QREA 2NU6A 2TMDA 1RKVA 2W83A 4Y1FA 1A8SA 1MLDA 3CN7A 3HL0A 3RYCB 3KUKA 3VZSA 3T3OA 2VXYA 2CLSA 2CJFA 5G0SA 4O6VA 1P0QA 2AFVA 2VYVA 4R3NA 4DPMA 1DDGA 1XPUA 3LX4A 5FWXA 3QZUA 4RTLA 1W5BA 3QA9A 2Q7DA 1FZQA 1Y6JA 3WGMA 1TGVA 5IEBA 3WSTA 3NIBA 1SPBS 3FVWA 3M33A 3NLLA 2IJGX 4NHEA 4Z9YA 1ADJA 5KDDA 4C7OA 1UAAA 2V7BA 4E32A 4KVAA 2OB2A 2CK3D 2XIJA 3I92A 5EA2A 3EX7C 1D0SA 1G55A 3KT6A 4B3CA 3HRIA 4DIOA 1ESDA 1KDRA 4XLLA 2Z6AA 2C31A 4B5LA 3ASVA 4Q4LA 3TRIA 2BFFB 1N77A 3OPYA 2IOQA 3DUWA 4C5AA 1X9GA 1MAWA 3LQRA 1BKYA 5JSZA 3FMIA 1PLLA 3GCZA 2WG1A 3F78A 3OD1A 1H2EA 3EZ9A 4FEAA 1HE1C 2ISCA 3PKZA 5ICEA 4PQRA 2FPPB 3G0BA 2NP6A 1DAIA 2ZDQA 1FYVA 3U7HB 1XZKA 3KTAB 3C14C 5IVKA 2ECFA 4YJ3A 5CT4A 5EQJB 1Q0HA 3SYRA 2NW6A 4E88A 2JAWA 5JAZA 4O4HB 1WXQA 2ZP1A 5EVCA 4DSAA 1JYEA 1Y8AA 4ABTA 1MB9A 5DWVA 5F9HA 4DA8A 2A1TS 2N46A 4HO1X 1T1EA 1TVKA 5JU6A 1DC4A 3O6VA 5KSPA 1JLRA 2ZCUA 1MA3A 3ZY4A 3WYGA 3RKRA 3D4NA 1Z4LA 3NR2A 3FDJA 4MB2A 3ZHZA 2XMRA 2OV1A 1T3TA 3B52X 2X4GA 1SCKA 2IYFA 1AV6A 1QQBA 1YS4A 3WK4A 5AESA 1Y63A 1IEVA 1EJ6A 5LN1A 2WKWA 4XCQA 2BCGY 3BE6A 3PUZA 3F46A 3LPDA 3LYLA 1NJ5A 5FOSA 5K0ZA 4R5HA 1Y6GA 3V46A 3HRHA 2YNMA 3VC2A 2IYQA 4C30A 4BFSA 3HS3A 1IZ8A 4L4ZA 3KZNA 5SY6A 5J2UF 1IULA 5C32A 3R5FA 1A5SB 2ZJ2A 3EC1A 3O21A 1B23P 2C7QA 1H0SA 4PBRA 4ZI7F 1QYCA 4MEJA 5ELMA 4TN5A 3UJBA 4KQIA 5IAGA 3WLTA 4GECA 4GW3A 1NW9B 1XPOA 4MA4A 4QFCA 5ADUS 1J5XA 2RCYA 5GVSA 3RAGA 3GLGE 1FU7A 4DBLE 3UN1A 4F1WA 3UMFA 2VEDA 2DKOA 1E6UA 3EPKA 5K8VA 3F71A 1WDLA 5EERA 4OUDB 1TM2A 1A77A 3NBAA 4N39A 3RUIA 4AULA 2DFVA 2FHPA 1SXHA 3R8XA 4OXRA 3Q8WA 3G0DA 4Q9HA 5L3SB 2YASA 5LWQA 2PHZA 1GSOA 1BHSA 1WTCA 1OCEA 2H1IA 3K09A 4YMLA 4UEWA 4P4NA 1QZXA 2FETA 5TEVA 1EU1A 3GOQA 4IDGA 4X3OA 4GKJB 3VOSA 1LDEA 3U7FB 3PWSA 3OQOA 2QRMA 1F9EA 5IKOA 4U7DA 2IC5A 4OK3A 2XHZA 3H6GA 2X9NA 3HO6A 3O0TA 1DQYA 2NZWA 3CRNA 4FLEA 5DI3B 3UXEA 3VOAA 1UBOS 5JBQA 3K35A 1HDGO 1I7PA 1M8FA 2V7GA 1BS9A 2ONYA 3HCOA 4CM4A 4QLAA 4HFMA 3DBRA 4GNRA 3UUWA 4I1PA 1JG6A 1T4GA 4HQ0A 2XW6A 5YASA 1QK3A 3ACBA 3KSBC 1RQRA 3AHCA 3RVMA 1IN7A 1KOFA 4C4PA 1FNBA 3D1JA 4O0MA 2CDRA 4K2HA 2JHAA 5THKA 4YY3B 2WWGA 1Q7TA 2XA1A 5JZSA 5E6RB 2O4UX 2H51A 2CN1A 4ACBA 3VR5A 4PNHA 1XF9A 2HFJA 1S3SA 4RADA 4XGRA 1N3BA 3S2IA 1XRJA 3HLYA 4Q37A 3V2HA 1NMZA 1VCMA 2WOJA 2W6ZA 4IF4A 4IIUA 5F5XA 3STUA 5A03A 3PFWO 3AU8A 1OXTA 2WHXA 2ZT8A 4G4JA 4INJA 1S2NA 5BW6B 2VHWA 3ZK9A 4GM0A 3T99A 4MGHA 1C0IA 2ZIFA 2OP0A 2BGIA 1CZKA 2CWWA 4QDJA 1T4BA 2JIMA 3HL4A 2IRWA 4B35A 3Q2OA 3U4AA 4F04A 1FS5A 3NORA 5AICA 3QTTA 4UHEA 2D59A 2JDID 3WLOA 4B76A 4LOJA 1ZMTA 2HLPA 2H48A 4OSPA 3CG4A 3RSOA 5LIRA 3TIGA 4RTRA 3THYB 2FX5A 3GHYA 1EX6A 1U1GA 1OT3A 1SA0B 2VAMA 4F5WA 4QHSA 1E2EA 3F98A 5L4SA 2V3VA 4HB4A 4N40A 5H02A 4X8MA 3ITNA 3AVPA 1Q22A 4QIHA 2O5RA 1EUDA 4LJ9A 5LMNB 1JLMA 1YNSA 1BFKA 2J9YB 4WKPA 4X9XA 2GLTA 5CHEA 4CMGA 1DBSA 2F9FA 2E4XA 3D4PA 1VE6A 5K8IA 4LWZA 4XGIA 3KR0A 5F52A 3P0EA 4F93B 4WOKA 4X3PA 4O02B 1OFGA 2NVOA 1AKEA 3PTZA 4ITUA 3R5KA 3AESA 2XV1A 3VYRB 4F45A 3Q6MA 5JS2A 1AHIA 1PWEA 5LP6A 1ZJYA 1U81A 1FTSA 2Q0SA 4IHAA 4E5KA 3PXAA 1P1CA 2OV8A 4IS3A 3T5PA 5GIPE 2WG0A 2X77A 1XTJA 1VDMA 3DOOA 3ZS8A 1NXVA 1NW4A 4S35A 3O2SB 1CUWA 1IY8A 1CVIA 2GBPA 1ADCA 2IDJA 2FZWA 2GPBA 2R9VA 2OEPA 4IDAA 5DPMA 2FPXA 4HC4A 4CCWA 1C2YA 1L3BA 1M1YB 1XHEA 2R48A 3I5YA 3FLEA 4TKMA 1V26A 2R6FA 3LNCA 4J94A 1P7VA 4W6QA 4Y1RA 2PVPA 3I09A 4G9BA 1PKEA 1QANA 2AV6A 5AXCA 3ADCA 3ZHQA 4Z51A 2ZIWB 1LF0A 3VM6A 4BGUA 1E32A 1NF2A 3H97A 4L0QA 2Q1SA 4N7MA 4BJ1A 2PBRA 1JKFA 5K0TA 1Z2OX 3F7OA 2J45A 3KCNA 3LGXA 2C3YA 4FT4A 3BG5A 4DM4A 5IJ0A 4QGBA 1QHIA 2AVNA 1KI2A 3AG6A 3KJHA 3R0IA 5FOVA 4U63A 3SLGA 3MUFA 3S8MA 4DT1B 3ER9A 1JLLB 5KAMA 3H1BA 3TO5A 1RZVA 5SY9A 3MIIA 2NO6A 1M73E 1S8FA 3LBIA 3RARA 4KUGA 2VK4A 2BBSA 5KNDD 1FU8A 2ODQA 4WZZA 3AW9A 2ENUA 2XCTB 4MW0A 4HLUA 4EYEA 4DMUB 2IHNA 5ELLA 4NU8X 1QX3A 3USZA 1Y1LA 1M6EX 1N25A 4UCFA 3TJMA 1DTEA 1I4DD 1NT4A 3OC6A 4AF7A 4LHXA 4ZVVA 4C4SA 1FJXA 4BY9E 3PLAE 3A9WA 1UMBA 1FA9A 4Q6BA 2D7CA 5F5NA 5LOVA 3I9FA 4IO0A 1S7GA 1UXGA 3K0FA 3N87A 5CH5A 4IL5A 4UDNA 1ZRHA 3IMCA 2ZPUA 3AGPA 1OYYA 3OEYA 1QHXA 4CI0B 3PJEA 5CX1B 1EESA 4XR4A 3KOXA 3AUTA 2ONJA 4D9BA 4JI3B 2Z3VA 1WS6A 4WK4B 4CL3A 2P8SA 4BO9A 2MDTA 2PRSA 5IAKA 3NNNA 4UU0A 2ID8A 4JBYA 3WMWA 1YOVA 2X8WA 4LKRA 4QBTA 4B73A 4CKCA 4PPFA 2D06A 4YWHA 3R1IA 4DIUA 4N5DA 3TLEA 2CWDA 1XELA 1KERA 2Z6VA 3PC7A 1KI7A 2YJ4A 1L5HA 2R6AA 2RH8A 4A5OA 1D09A 4KHZA 1NJ6A 3D59A 3X1XA 5IKEA 2IYAA 3CISA 4H2DA 2FUG1 1Z18A 2CDAA 5J2TB 1DEAA 3BREA 3OP4A 1WSBA 4ETWA 2DECA 2H2HA 2JJMA 1XAJA 3C7KA 1GR1A 1PLKA 2NUBA 2Y92A 1UK8A 2W71A 3RUPA 5HIJA 1Z45A 4RQTA 1B00A 1U5BB 2K4MA 1P0FA 3BMQB 1E6EA 1SOUA 2B0JA 3OEED 2UZ1B 5FL7D 1IB0A 4DILA 3UH1A 2EF1A 1PTJC 2JGAA 3F9CA 3FNQA 4LXQA 5T3UA 5IAAA 2HF8A 3J7AC 1V0JA 1GGVA 1ST2A 1XEWX 2O52A 2XWSA 2G72A 2CKMA 2XX3A 3DD1A 1LUAA 2W2LA 4FX5A 3AVVA 2J87A 1CZRA 4GLLA 1PJQA 1XU9A 1W5EA 3VNSA 3OVMA 3SY8A 1BEZA 3GA7A 4OHUA 5JI3E 3CX7A 4DJFC 2WSIA 4CG0A 5EESA 1J8MF 4BFCA 1R0SA 1ZS9A 3VU3A 3GLIE 1KY4A 1DTWB 2J7PA 4FGSA 2WM9B 4FZRA 3HH8A 3SC6A 5KU7A <