3V4RA

Crystal structure of a uvrb dimer-dna complex
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
588
structure length
586
Chain Sequence
DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/dna
molecule keywords UvrABC system protein B
publication title Crystal structure of the UvrB dimer: insights into the nature and functioning of the UvrAB damage engagement and UvrB-DNA complexes.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 189
structure length 586
sequence length 588
chains with identical sequence B
ec nomenclature ec 3.1.21.5: Type III site-specific deoxyribonuclease.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 3v4rA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v4rA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v4rA01
4IVRA 2W6IA 2IS4A 2IYSA 2YKGA 1JJVA 4KYIB 3QENA 1K8RA 2B8TA 3AKDA 1ZUHA 2H16A 2QQ0A 4EJSB 3HJHA 4Q7JB 3QEOA 1VIYA 3HU1A 3K0SA 1AS2A 5DLQC 2ECKA 4DWJA 3M4YA 1ZJ6A 3OEHD 3LVRE 1M2OB 1FTNA 5BYKA 1YQTA 4LI0A 5CYOA 1W36B 4CIDA 2QSZA 1W0KD 1TF7A 3OIVA 4V0OA 2J5XA 2EW1A 4TYYA 3AVUA 1E0JA 3MWJA 3VTKA 1ZNXA 3W8RA 1KZ7B 2IYYA 3LLMA 3QE0A 1KK1A 4RD0A 3LXXA 4CEJB 1W4AA 1U8YA 1D5CA 3EZ6A 5KTYA 1BH2A 1IXSB 3AP3A 3LX8A 2IYTA 5CLLA 1S96A 1GSIA 1N6KA 3P32A 1JPJA 1XD8A 4ON9A 3RVBA 4A8JC 1C1YA 1E2PA 3BBPA 2O8FA 1G7SA 4ESVA 1TNDA 1KMHA 4A15A 1G5PA 2JATA 4I4LA 3FPAA 4BZXA 2TMKA 4XTCS 3I5XA 1OFUX 4H9GA 4KBFA 3X2SA 4EJSC 2AHOA 2ONKA 1C9KA 1Q20A 1W2GA 5F9FA 2GVDC 4II7A 2CE7A 2V7QA 4I1SA 2ODBA 5LB4A 1FMLA 3KKQA 4DKXA 2GAAA 1PJRA 1U8ZA 1I4TD 1F60A 3O8BA 1U8AA 1R5OA 4D2IA 1W36C 1P2VA 1E1QD 2CCGA 5M04A 2C99A 3UG6A 2NO0A 1YZUA 4JBXA 1TUEA 1Z47A 4K81B 3U7HB 4ITRC 1JXMA 4ZV4A 1S8FA 4KV9A 4Z54A 1VG8A 3KB2A 2BHRA 1F48A 1TF2A 2O8FB 4QJ4A 3KJIA 4XWKA 1ZP6A 1ZC4A 1VPLA 2OXCA 4JSTA 3KQKA 2Y8EA 3LFUA 1KMHB 1Z29A 1T3HA 3TH5A 4Q1DA 1HT1E 2FSHA 4KI0A 2ZJZA 3TJZA 3EX7C 4F93B 2VEDA 2GJ8A 2QAGA 4X8LA 1XCGB 2DFTA 1IN8A 2Q6TA 2ZR7A 2QP4A 4D4MA 1E2NA 1FOEB 1E2JA 3LX5A 4M1KA 3A36A 3NEYA 3TR5A 4I1VA 3CF0A 3ADCA 3CH4B 1YZNA 1TF5A 4Q9HA 3WMFA 3HYRA 1WP9A 3SYLA 2ZSAA 1J8YF 4PHHA 4YMSA 4B76A 3LA6A 4NONA 4MDFA 3HWSA 4K46A 4URXR 3LBIA 1TEVA 2BJVA 2OHFA 3VR5A 5JRZA 5ELXA 2ZI4A 1ZAKA 1KDRA 3D8BA 1GZSA 2GESA 4JLVA 4ZCLA 2IHYA 3SN6A 3W9YA 2O0JA 1BMFD 1RFLA 2WJYA 4GRAA 2PX3A 4KFSA 4U5XA 3DOFA 4I1UA 1NBMD 1E3MA 1MO4A 4MGYR 1EK0A 2QAGB 3SS8A 2OBLA 4QC2A 4M9SA 4WZ6A 5J4LA 4IXNA 1CR0A 4RSGA 4JVMA 1QDEA 4HAVA 3TLXA 3OZXA 3KFXA 1E9DA 4U7DA 1O87A 3FMIA 3RLFA 721PA 1C4OA 2ODNA 2IK8A 1QHHA 2P5TB 2R6DA 4Q1CA 4TTQA 1SKYE 5KYKA 1OFIA 3QG1A 3WNCA 1DADA 1XD9A 5D3QA 1LS1A 1RE0A 1VCNA 1GNQA 2IC5A 2J46A 1H8HA 5FUVA 1UFQA 2QBYA 1QG4A 1YZQA 3LRPA 1KK3A 2MSCB 4NCJA 1OFHA 2FEOA 1DPFA 4C4PA 1OHHD 1WA5A 4QKQA 5HPYB 2P2LA 4QHYA 3FKSA 4CDGA 4YC7A 1W7AA 1GIAA 1NN3A 2DBYA 3WRXC 4CZ2A 1EESA 2IXFA 4ASUA 2QTHA 3EZFA 3IBYA 3B1VA 4R9UC 3U3OA 1SVIA 2FA9A 1QHGA 2XNDA 4ZCMA 4MGZR 1SULA 3UANA 4F7WA 4GT1A 3PEWA 2ZJYA 1QHHB 2QAGC 1WE2A 1A2BA 4FMBB 1SKYB 3J81k 1KJZA 2XZPA 2PZGA 3AVWA 2AKYA 3ZZUA 3K0FA 5HKKA 1YVDA 1Q1BA 4L16A 2VHTA 2P6RA 1W5TA 3OFNA 4GNKA 2QBYB 2R6FA 2CLDX 3W5JA 3DPUA 2XZOA 2QQEA 2EFCB 3REFA 1KKMA 1JPNA 1YR6A 1UM8A 4RY2A 1R10A 1YE8A 1HQYE 1N6PA 2BIFA 2VP0A 3C14C 3PITA 1MH1A 5IK2D 3WMEA 1Z2CA 1OXTA 3R8FA 1YHNA 4PQRA 2AL7A 4MKIA 2ZRPA 1SXJE 2YWFA 4LJ7A 1SXJA 2J0VA 3PVSA 4DVGA 4F38A 5FPTA 1EX7A 1KTVA 3DZDA 4RD2A 3QKRA 1AKEA 4DHEA 1E2DA 2AK2A 3EPHA 4IJMA 1H8EA 4AURA 1PUJA 5JZVA 4LX0A 4UNPA 3L2OB 4PO8A 3QG5A 1Q21A 4DSOA 1Z6XA 2CL0X 3FB4A 3EPJA 1IJFA 3K0FB 4IKEA 1YRAA 4W5HA 4U02A 4RD4A 3QBVA 4WZBE 1YZTA 2UVQA 1E96A 1KGDA 4L8GA 3V4FA 4Q9KA 3RABA 1FFHA 1T0HB 2WM9B 4E09A 3ZZTA 5DHAA 4KCGA 2LCFA 2QA5A 1D2NA 1XJQA 3GCGA 2QORA 3L0IB 2C96A 1GILA 3CPHA 2ZJ5A 4Q7KA 2YOHA 2GRJA 1ZRHA 2GF9A 3SC3A 5KDDA 5FI0B 5EZ6B 4JL6A 1SXJB 5CM8B 4EPWA 2WSSD 2X2EA 2ZPTX 2QAJA 3QKRB 3CPEA 1AGRA 2EFGA 1ZM9A 1YZLA 3BERA 4G3XA 1L2TA 4HB4A 1DO0A 5AJWA 4RKEA 2A3RA 5LD2B 2V1UA 1GKIA 2XXAA 4LCBA 2HYDA 1AGPA 2XGJA 2XAUA 4DCSA 4QM7A 4B74A 3LQQA 3B8HA 5IT5A 5B58C 2C9YA 3VMFA 1RRGA 2DYKA 3MWYW 3QPWA 2QSYA 5TY0A 1ZUIA 3TW8B 3NHBA 4Q21A 2IWHA 4X8OA 2R65A 2GXQA 3CONA 3UKDA 4DLYA 1KK2A 2XZLA 5E4FA 3BFVA 4KAXA 5KSPA 1NVWQ 3CO5A 5JSZA 3CWZA 1BYIA 1MO3A 3FHTA 4D4LA 2W0MA 2FN4A 4LHZA 4US1R 4ZDIA 2GA8A 4C30A 4URZR 3K0CA 2KI5A 4QL3A 2CBZA 1KSGA 4YXWD 1YRBA 3NKVA 3K0EA 4QGHA 1P2TA 1Z3IX 1SXJC 1SQ5A 1SHKA 2D06A 3AP1A 2XXAB 3T15A 1G4UR 1P2UA 1O3YA 1P62B 1WRBA 1N5IA 1GFIA 4WOPA 3KXLA 3X1WA 3ZQJA 2Q21A 2JDID 1JECA 5LD2C 1E9EA 2GEUA 4L4UA 2NO1A 4D4KA 1G64A 5FL7A 3UMRA 1E1RD 3HPRA 4XVUA 2FWRA 1RVDA 1OLOA 3GJXC 5A5GA 4LYHA 1TADA 3TRFA 4LZZA 3I3SR 2PT5A 2PEYA 1W46A 3DKPA 4QBFA 1T3SA 2C95A 4E22A 1OH8A 2Q9BA 1S1MA 2W00A 2ZRLA 2F43A 2AKAB 2I1QA 5JSZB 4DRZA 1OT3A 2G83A 1UDXA 1ZM4A 2VYFA 4XWAA 4B33A 1R5BA 4EPVA 2JJ8A 3TUJC 1KO1A 1JQLB 2MSEB 4LJ4A 1VHLA 4TSFA 1GNPA 5FTMA 2CJWA 1V5WA 3THXA 4GOKA 4UKDA 4JLDA 3ONWA 1T5IA 4BQSA 2ZJ2A 2X8AA 2IYWA 2ZR0A 4BFWA 4E03A 3TVDA 2FMXA 2FF7A 4TYQA 3U2QA 5EXXA 1LS6A 4CF7A 5FFMA 4MA4A 1WQ1R 2VP2A 2QPTA 1OF1A 4DSNA 3EA0A 3Q3JB 3SFVA 2J45A 2PL3A 1XDBA 1FP7A 2LKDA 3MJRA 3GJ5A 3Q5DA 2VP6A 1VCIA 3A1SA 4YONB 1DO2A 4YMWA 4C0AC 3RSOA 2YZ2A 2F43B 4F4IA 1TQ2A 2BVNA 3OE7D 3AP2A 1N6NA 1HV8A 3RS2A 3SNHA 3GLIA 1ZD1A 4OK5A 1NY6A 3OAAA 4B6FA 2J7PA 3IPYA 3AV0B 2P5SA 2MMGA 2C77A 4TQAA 1SZPA 4HI0E 3NDPA 4NTZA 2CJWB 2HDNB 4AYXA 3B82A 3THXB 1Z0IA 3K0CC 1KI6A 4HZIA 1KI9A 1OYWA 2IX3A 5TV2A 3LDAA 5JFGA 1GVNB 4TLEA 5GJBA 4WW0A 4Q9LA 1GG2A 2BBWA 4IEEA 1D2MA 4D0LB 3IO5A 4EAQA 5EZ5A 5TXGA 1T8UA 1VMAA 1QBKC 3ZS9A 3SHFA 4B3GA 3B1XA 1T91A 2AWOA 2HCBA 3GLGE 1T0JB 1E2LA 3GLGA 5G40A 3GD7A 4Z1MD 5K8TA 3LH5A 1IHUA 2ZUDA 1IY0A 4M1OA 2WICA 5EQTA 4ZO4A 5KPJA 2VIIA 3GLIB 4MUBA 4FCTA 1PLKA 1BO6A 3H1TA 4JMPA 2IXEA 4B6EA 3KQLA 1W49A 4Q7MB 2OM2A 3P20A 1DG3A 3C15C 4DZZA 1XP8A 1DAEA 2JLRA 1KI6B 3NC1C 4RJLA 2IYUA 1OIWA 2CHVA 5JRJA 2H92A 2VHUA 3ZYCA 4ZKEA 4OHWA 4JYCA 3A1UA 3Q8XB 2NMVA 2IYXA 4C0HA 1G8YA 1ZCAA 1RJ9A 1LNZA 4PPQA 3FVQA 2HJGA 2OG2A 2PEZA 1CR1A 3A4NA 3DO6A 4HLQB 1FL9A 2OCPA 3BOSA 3HYTA 4Z51A 3I5YA 3H0KA 3CX7A 3AGQA 1J70A 3EZ9A 1XFAA 4N3NA 5C4GB 3GLGB 4Q18A 4C0JA 1F2TA 1G9XA 2GJAA 1J99A 3PENA 5C18A 4OHYA 2D7DA 4IW3B 1KSJA 3KUCA 5JEDA 2J0SA 4B2LA 1XPOA 4HLDA 2CNWA 3B5JA 2ZI3A 4O3MA 4AYTA 3GMTA 4FMCB 5FUWA 4TZ0A 1XTSA 4HSEA 1W0JD 5LDDC 4NU0A 4J0QA 5HZKA 4HAUA 4FMCF 3SFZA 3SJZA 2AFIE 2FG5A 3B2EA 4Z8XA 1IXZA 5EP1A 3R9XA 1G7TA 1SVWA 4A2QA 3FYHA 4A0RA 2FU5C 1YU9A 1G6OA 2QP9X 3E2IA 2QL6A 4KLNA 4P33A 3U3RA 4HAYA 2XOKD 1NLZA 1RJ9B 2FH5B 4HDCA 4ZDWA 1KSHA 4NHOA 4TTPA 1FQKA 2A9KA 1N0WA 3M6AA 2HUPA 5LPNA 1QVAA 4GSYA 4A1FA 4P4TA 3VKGA 3BH7A 4LK2A 5K8IA 1BIFA 1XRJA 5FR2A 3GEHA 2FPMA 5CB6A 1J7KA 1Z0FA 3IGFA 1G3QA 3FWYA 4Q4LA 1F2TB 2OCAA 3QKUA 4HUTA 1NN1A 4Q19A 4LJYA 5BN5A 3NTUA 1QHSA 5AK0A 421PA 4MYCA 5EJEA 2BEKA 4A0FA 2QENA 1GRQA 2ZYWX 2XEXA 4JLNA 5CK4A 2ZI5A 2WSMA 2Q9AA 3KKNA 4PAMA 4Q5IA 4KXFB 4PX9A 3EZ2A 2VLIA 3I73A 4LRWA 1Q1ZA 3AKYA 4DFCA 3B13B 1XJCA 4KSCA 4YDHB 2C04A 4GZLA 4US2R 2EFHB 3V4RA 4M0LA 5KNBA 2NG1A 3K9HA 1Z63A 1T4GA 5KNDA 4Q1FA 2Z43A 2FPLA 4G5OA 4X8HA 5EP4A 1D6JA 4S35A 5E3HA 4JLJA 3U3MA 4HAZA 1R6BX 3LQRA 3QIAA 3DMDA 1LFDB 1GNRA 2Q3HA 3CR8A 3FE2A 4RCZA 1UADA 3VX3A 4TYNA 3ND9A 4UNSA 1EX6A 2I3BA 4LC1A 5GJWC 2C5LA 3ADBA 2VP9A 4LJ8A 3P27A 4HZUA 4MITA 3CRVA 3VKHA 3VX4A 4Y0AA 1PVOA 1DAIA 1J90A 2BKUA 3DHWC 2FDCA 2IEZA 2IBMA 4G1UC 3ZZ0A 4AIIA 2A5YB 2I4IA 2J41A 2Z83A 4P31A 4KBGA 4WZAE 3CF6R 3KX2A 5L3VA 3T1TA 1TQ6A 1A5TA 2JAQA 2OBNA 3CNOA 4KFUA 4URUR 1EGAA 4LHXA 3UWOA 2FEMA 2KE5A 3KXIA 5E95A 4LBZA 5BYJA 4XIGS 2VF8A 3B1WA 4KFRA 4TLCA 4D82A 2AX4A 2ZI6A 4Q7LA 2R9VA 1MR3F 3AH8A 2DCUA 1DOAA 5GADl 1ELOA 2G1JA 1Z6AA 3NVAA 2AK3A 2G6BA 3GJ4A 3IEVA 2RKOA 3GLHE 2FPKA 2JASA 3GLHA 4U00A 4QNRA 1DBSA 4NCHA 4S2EA 1A82A 3WNDA 4GBMA 3ZIAD 1KNXA 4HZUB 4CEIA 1P9NA 5JI3E 3UPUA 4HEJA 2BEJA 1CEEA 3E1SA 4C7OA 4AD8A 3QXHA 2FFHA 5SZIA 1ZIOA 2YOGA 1A7JA 2WJGA 1NRJB 2J3EA 3P4YA 1IN6A 4V0NA 2ZROA 1S3GA 1N0VC 4TL8A 2ZQ5A 4NP6A 2OE2A 3IBGA 4BGDA 3OIWA 1JJ7A 4K8OA 1XWIA 3HR7A 4NCKA 1QHNA 1NNEA 2D2EA 4C0SA 1F2UA 2ZI7A 4PQYA 2IL1A 3TUZC 2D62A 5GVSA 1XNJA 3DM5A 1AQYA 5KPDA 4C2UA 2ZS8A 3N70A 1CS4C 3QKTA 2O8BA 1G8GA 3VFDA 4EFNA 2JJ2A 1ESNA 3THYA 5G41A 3GLHB 4AG6A 3QSYA 1FZQA 3K8YA 3QBTA 5JCPA 3W3ZB 3AQ4A 3CRMA 1ZCBA 3I8SA 4EUNA 2CE2X 3CUEF 1ODFA 4V03A 1D9XA 4CEIB 4BFVA 3ICQB 1IXRC 4DXAA 4AWXA 4AI6A 1EFRA 1G16A 4PQFA 3QY0A 2P67A 1M1YE 4C7OB 1E9AA 5H70A 2PJZA 1CJVC 2B21A 2ANCA 3LW8A 4N0DA 3EARA 4ZPXA 3GP8A 2BC9A 2XTMA 2G0NA 3RS5A 1NIJA 2VO1A 2OFWA 4MKFA 4JLPA 1F2UB 3K0AB 1R0XA 4W9MC 2W2VA 3EZ7A 2AN9A 4TLAA 2O8BB 4QBGB 3L8ZA 2RGNA 3PG5A 3THYB 1GRRA 3THOA 2GXSA 3NDBB 1YKSA 4IDQA 1YJ5A 1QVRA 1A2KC 3UG7A 1G17A 3SR0A 3K1JA 2F3TA 3FKQA 4G5GA 5ANRB 2QM8A 3CM0A 2RAPA 2GZHA 2N46A 1NSTA 1E2QA 4A0GA 3NH9A 5JECA 1KDOA 2BCGY 1Q1QA 3Q9LA 4LJAA 4Y0VA 3ZS8A 3F5FA 6Q21A 2CHGA 5FI1B 3KKMA 4JLMA 2G88A 4BZPA 1AIPA 1VHTA 2ZYTX 4BLRA 3X1YA 3ASYA 3HDTA 2UZ3A 4KYUA 1XTIA 2WPDD 1HY3A 4R98A 1COWD 2JLXA 3DZ8A 2DFKB 2QE7A 4FIDA 1PZNA 3EC2A 4MQBA 3OEEA 3PCRB 1P2SA 2CCJA 3CZQA 4RD1A 1R0WA 4R7ZA 2FV8A 1XTJA 4N1AA 4XTRA 3TGPA 1Z0KA 3ECCA 4NBSA 4B71A 1GM5A 2ONJA 3W6OA 3G0HA 2HXSA 1ZINA 2ZR9A 2YC4C 3MCAA 5TMPA 4YQFA 3SHWA 3SQWA 2OFXA 2YNMA 4TYWA 1G1MA 1X3SA 2DR3A 4RZXA 3A4LA 3U7EB 2GZAA 4DJTA 3HU2A 4DIEA 4DUGD 3LBHA 1OXXK 3ZVLA 1XTKA 2VH5R 4AKHA 1Q0UA 2BMEA 4KVGA 2A5FA 2MSDB 2EYQA 2D3WA 2RGBA 4PZYA 5G3ZA 4Q9JA 3Q85A 1ZM7A 2FOLA 2OLKA 1KAOA 1L4YA 1KMQA 5UKDA 3RWOA 3SEAA 4ERNA 5AUOB 5DNYB 3RS7A 5HCNA 2YHSA 2ZVQX 2CVFA 3HJNA 1UBFA 3OIUA 1ZNYA 2B2NA 2C03A 2CXXA 4KJZA 4PC1A 3K9GA 1RRFA 4A0HA 5JWOA 3X1ZA 4BFTA 2RGNC 4FW9A 5JEEA 1OFTA 2GXUA 4MYUA 2CEAA 2CLCX 3QQ5A 3S1AA 4HATA 1NMXA 2X1VA 4M1WA 4P4UA 2AWNA 2JLSA 2YJTD 4JJKA 4QNMA 2WMNB 2JIZD 2QRNA 4PC3A 3LLUA 2HLDA 2L0XA 2JEOA 2OT3B 3AVOA 1DAKA 4BLQA 3GEEA 4DLSA 3W8NA 1X86B 5JS7A 5JCZA 1KO7A 3K9NA 2EQBA 3UK6A 4BPBA 4F92B 3BAFA 1RYHA 3A1TA 2PMKA 3NHAA 5FOWA 1JQJC 4NMMA 4BRUA 2OLJA 3AF0A 4ZKDA 2YWHA 1PLLA 2KSQA 1P73A 1E2GA 2QI9C 4RD3A 5GVRA 3ASZA 1ZC3A 2WOJA 2ODEA 4WVFA 3MLEA 5FOVA 2J0QA 1UEIA 2GEVA 3S1AB 5B2ZA 1R0YA 1E2KA 2OEPA 2P6UA 3AB3A 4OQFA 4Q1EA 1KO4A 2ASEA 3W6NA 2GK6A 3UMFA 4DLWA 2JLWA 5EXTA 1VKJA 4GOXA 3OHMA 1XMVA 4CRWB 2HXYA 3PIRA 1CF4A 5DYIA 1AA9A 2ZJOA 3U6KA 2WIAA 1G19A 3KB1A 2GWHA 4GZMA 4WIAA 4WXPA 3GJ8A 3CRW1 1JR3D 2W0SA 2G9NA 4RVCA 4YLGA 1E79D 1D9ZA 4OI4A 1SGWA 2BM1A 2C8VA 5IHPA 1FPMA 2LWIA 2VSOA 3B1YA 3QXXA 1Z28A 1KDTA 1YR7A 2O0KA 1S2MA 1E2FA 1GKYA 3AVQA 3C5CA 2YWGA 2PLRA 3AM1A 2AR7A 2QNRA 4XD7A 2KWIA 3GQBA 4KITB 3NBZC 4EFLA 2BJWA 2JGNA 3O8DA 1XEFA 1S4QA 1SVSA 2RHDA 2W6JD 2V4ZA 2PLFA 1YR8A 2VP4A 3MG9A 3MGCA 4GDFA 1Z22A 1U90A 3AF3A 5SZKB 3R7WA 5J4VA 3QNUA 2YVUA 4HB2A 1F5NA 3BORA 3L82B 2E1RA 1FMJA 3EXAA 2LKCA 2ZRBA 2AXNA 4TT3D 5DH9A 3W6PA 4EFMA 4ARZA 1W36D 4GMDA 4TMVA 3RRMA 4UXIA 2CVHA 4R71A 4R2HA 1OH6A 2BCJQ 2R6CA 4W7SA 1CRQA 1Q22A 1UBGA 1ZVQA 4IOJA 4B3DA 3L8YA 2WJIA 4EPYA 4TL9A 1KI4A 3TAUA 1X1RA 2FGJA 1E9SA 3Q5EA 1L4UA 2IYZA 2V6JA 1GL9B 2H57A 4DIDA 5C2JB 2DWPA 2W6ID 4DB2A 4O0MA 1KO5A 1KZGB 1S9HA 1VG1A 1VYVA 4P32A 2VRWA 2R6AA 3FMPB 1XU4A 2JLZA 2NO6A 4LV6A 1IOZA 1PV4A 2PBRA 4I99A 1N3BA 2KB0A 3R7WB 2VF7A 1M7HA 1II9A 2BMDA 1GUAA 1TU3A 2V8OA 1OPXA 2WWWA 3CW2A 3LV8A 3RWMB 4ZCIA 1T8TA 2OILA 3MJHA 4A2WA 1W4BA 1N5JA 4BFUA 3K53A 1E2IA 4ARZB 5B57C 1GP2A 1KJWA 1AS0A 2ZTSA 1DELA 3FFBA 2OXRA 4MRPA 4RZUA 2REOA 3MWLA 4ZI3A 3FPNB 3IUYA 4BLOA 1DEKA 3ADDA 4M1MA 2ZITA 1QF9A 3EIQA 3O47A 4DLZA 5AR1A 4CEHA 4WA7A 1G5RA 2KBEA 1NY5A 4IFBA 4LJ5A 2XSZA 4YMUA 2DWQA 3K9LA 4MKGA 3R20A 1Z6TA 2BMFA 2NGRA 1UKZA 3T06B 1HE8B 2X19A 4G5QA 4OI2A 3Q72A 4XH9B 3IILA 4BFXA 3CNNA 3QPUA 1J2JA 1DG1G 5JBQA 2YC2C 1SVOA 2WMOB 1P75A 2ZU6A 3E70C 3G5UA 2DFLA 4LWZA 5CM9C 3VR2A 1RYFA 3QOFA 3ZJYA 2JLVA 3ZH9B 2V7QD 1IN5A 2R8RA 4LPSA 4H1UA 1MO5A 2HCJB 3BRWD 3GJ3A 3B7GA 3NG1A 4EPXA 3EAQA 1Z2AA 2HJVA 4QGAA 3CZPA 3NH6A 3SJBA 4B3CA 5JMTA 4BEBA 5J40A 2CK3A 1TX4B 1NMYA 4A36A 5L3SA 2B7BA 4CEHB 3RRYA 5B30A 4KODA 1GOTA 1L8QA 2WV9A 4TTRA 1QG2A 3MRSA 4PXAA 1QHYA 3MAAC 1OXUA 4PPFA 3PEVA 5JJKA 1CJMA 1PLJA 2FGKA 3SZRA 2A7QA 1G3IA 4IRUB 2V6IA 4TLBA 5BW8A 1MOZA 2Q9CA 1AJEA 4PSAA 1VDZA 2J87A 2OCBA 1U2RA 4PSKA 4V0KA 1CJUC 4D0NA 1WXQA 2YYZA 3SOPA 4QG7A 2ZREA 1R8SA 2IYLD 2N1BA 5FPKA 4HB0A 5GJCA 2B8WA 2F1HA 2G3YA 3IIJA 2RB4A 4B2IA 2ZRMA 2QT0A 2RGXA 3GLIE 2A5GA 1P7CA 3DL0A 4JYBA 4EQ6A 2I1VB 1A1VA 3RC3A 2G1KA 4ACBA 5JS8A 1E2EA 2F7SA 3KDSE 1VYUA 3TSOA 5L3SB 3VNVA 3QI2A 3T12A 1R8QA 4NKRA 4Q9IA 3EPLA 3OEHA 1Z6YA 1UF9A 2OUKA 4KSBA 1NVUQ 2PX0A 1OJLA 1U81A 1GRNA 3U5ZB 1GAJA 1UEJA 1W0KA 1I2MA 4G5SA 4QBIA 2AFHE 1CKEA 3BIFA 2R2AA 4OYHA 3IHWA 2B6HA 3AUXA 3U7GA 4V02A 1M7BA 1E32A 1XX6A 2NPFA 4QJ3A 2WKQA 1U0LA 5JWHA 2P0EA 1UKVY 121PA 4DSTA 1GL7A 1LVGA 3KKPA 4PZLA 4QXAA 5JWRA 1XCPA 2PZEA 3ZDQA 1HA3A 1F3OA 5J4YA 1CJKC 3A6PC 3AVTA 2HLDD 4NYMR 1XZPA 1KOFA 1H8HD 1RW4A 2ZRGA 2WJJA 4EQ6B 4NL4H 2F3RA 2RGGA 2C98A 5JLJA 2GTPA 2OZEA 1ZYUA 5KSOA 1OE0A 5J47A 1UBCA 2Z4RA 3ICEA 4O2RA 1FW6A 4CT5A 1MT0A 3FKSD 1ZM2A 5FBWB 3P1JA 1NJGA 2ZS7A 1DS6A 1NN5A 3TQCA 2XJ4A 4ASUD 4C0QC 1E1QA 1KI1A 1W1WA 2XNDD 4I1OA 4KVAA 3TIFA 2XJ9A 2RMKA 5BN3A 2F1RA 2IYRA 3FMFA 3LXRA 4BLSA 1KHTA 4XWOA 2V1XA 2ZRFA 3RS4A 2PCJA 4OKSA 2VP5A 2G0TA 3T35A 4B44A 3AVXA 3EG5A 4MYHA 1BS1A 1WB9A 1E9CA 3IPXA 4A9AA 1EWRA 5HKKD 4UXHA 5DGXA 2GXAA 2C9CA 3KKOA 3OFND 2J59A 3NC0C 2OO7A 2GK7A 4DLUA 5EUMA 4BEJA 5FTNA 1P5ZB 4B73A 4M4SA 1T5LA 1E0KA 2O0HA 1IONA 1TUIA 4OQNA 3U61B 1U9IA 4TZ6A 1XTRA 1CRPA 4Q1AA 4ABYA 4F4CA 4FXPA 3QVUA 2IW3A 1D8TA 4MH0R 1KY2A 2H8KA 3TQFA 5CB8A 1QZXA 4US0R 1SXJD 3MWKA 4LPKA 2IS1A 1KAGA 2NQ2C 3EWAA 3W5IA 4HLUA 2F1IA 4PFSA 2DY1A 3NXSA 1H8ED 4NYMQ 4L5BA 1CULC 2NZJA 4A6PA 2ZRHA 4HAXA 2YOFA 5KDLA 2REXB 5AJVB 1IJEA 5B64A 1BMFA 3GFPA 4ZDJA 5JJIA 1EFUA 4EKDA 1BOFA 1IN7A 2GAOA 3C7KA 1NBME 3VR3A 2D4HA 1NBMA 4DDTA 2YV5A 4Q4HA 4DCNA 1WBDA 3R9IA 2EWWA 5G3YA 3KZ1E 3QPVA 2HF9A 3A8TA 1TU4A 3CWQA 4HUQA 3VQTA 3I32A 4V0LA 3U6BA 2F9MA 3QUSA 4ILEA 2ZRDA 1TTTA 3N2EA 4DDUA 3JVUA 4JBYA 1RPZA 4FINA 3V9PA 1VTKA 3BH0A 4LBVA 4YMVA 5CJPA 1G3RA 1W44A 2WHXA 3ZVRA 1JAIA 1ZBDA 1Z08A 5JHHB 2IUUA 3P26A 1OKKA 2H1LA 1ZU5A 1XEWY 2VSFA 4EPRA 1DAHA 1US8A 1ZIPA 4HDOB 1G20E 4EPTA 1VCMA 3DMNA 2GBLA 3NBXX 4M1TA 1KDPA 5AUNB 4Q03A 1HH4A 2JA1A 2YINC 3G82C 4LV8B 4AY2A 2C2HA 3BB1A 5CYPA 4FD2A 1OHHA 3AF4A 1T3LA 3WYFA 5FTKA 1R2QA 1RKBA 1N6OA 2QEQA 3C8UA 4KU4A 2QP3A 4DEYA 1Q12A 3X1XA 2Q3MA 2ZAOA 3QKSA 1DAGA 1UDWA 3VKWA 1W4RA 1LW7A 3FTQA 4UNRA 4Q4HB 3KJHA 2GZDA 3IQWA 4HUQB 5H1YA 1W2HA 4AC9A 2MMCA 4FI3C 1YZGA 1NVVQ 1XJ0A 2X2FA 4HAWA 2CDNA 1XTQA 1JEDA 2J7KA 5KO2A 2VHJA 3WHLA 2PMDA 3AEZA 3T61A 2GF0A 5TARA 2XITA 2WTUA 1PUIA 1U9IC 3EC1A 1FNMA 2ZE5A 4MRSA 1NKSA 4LY6A 1US8B 1M74A 1OIVA 2AXPA 2ZRAA 4UXJA 2CHQA 4PAOA 4IOKA 2BM0A 4XSHA 3DDCA 5FOUA 4LJ6A 4QM6A 1BKDR 3GJ0A 1P6XA 3UXMA 1NJFA 1N2CE 3TMKA 2OAP1 3FFAA 5EXPA 2IXGA 3QVVA 4JBWA 1QHIA 4JLBA 2ORVA 3R8CA 3SYNA 3QKSB 4JLKA 1GTVA 1VG0B 5FUXA 5IK2A 4ZIRA 5G53C 2HT6A 3H86A 4IDPA 3BGWA 4JLOA 1I2DA 5DI9A 5EE1A 5FL7D 1JXOA 1T6NA 4EIWA 1TQ4A 5LBIA 3VMAA 2ZRCA 1W47A 3I92A 1FUKA 2N42A 4Q01A 4QGFA 3DKVA 4JJZA 2ZUBA 4PC7A 3QXJA 2ZI9A 1M34E 4QFMA 2RGEA 3RSLA 1H65A 4TSFD 3T5GA 1WF3A 3K0AA 3ZQ6A 4B48A 821PA 4OL0A 1Y63A 3SU8A 5FOXA 2JLUA 1R5NA 2IWRA 5EE0A 4C9BA 2X77A 4QBHA 4TLDA 1KNQA 4H1VA 1E94E 3UIEA 2ZIAA 2WOOA 3F3YA 2ZUCA 2GBLC 5DN6A 1Q1EA 2WIBA 5AJXA 4ZIRB 1CR2A 1EFCA 1NG1A 2WWXA 2VPPA 2ZRKA 4D81A 2FSFA 5IRCD 1Z8FA 1RIFA 2WSSA 1JR6A 2ZETA 1LF0A 1HUQA 5KSZA 3AF1A 3GJ6A 5DISB 5H8WA 5AJYA 2RH5A 1AZSC 4TL6A 1MO6A 1KK0A 4QOSA 2JLQA 5KNCA 4LBYA 1M8PA 4C0LA 1J8MF 5CITA 1LB1B 2NO9A 1ZW6A 3OAAD 2J7PD 1MRSA 1WDTA 5KU1A 4POAA 1XMJA 2GDJA 1Z0AA 4JVSB 1N6LA 1OXSC 2C9OA 3PUWA 3B85A 4BFYA 1EWQA 1ZNWA 1IN4A 1DARA 3CRQA 1XEWX 1Q57A 2JLYA 3SQXA 3BFKA 3GFTA 4CW7A 4JIMA 1W5SA 2HEIA 1OH5A 3KUDA 4P3YA 2R44A 3FMOB 1FUUA 3H84A 1B23P 2Q0HA 2ZSBA 4FCVA 1WMSA 3GPLA 2WWHA 1OW3B 3IIMA 3ND8A 3QXCA 3REGA 3KJEA 3NIBA 5E7JA 4OQLA 4IEIA 4YXWA 3WBJA 1JAHA 4DCVA 4TWZA 5EP3A 2REBA 4AKIA 3BD9A 2GCOA 3BS4A 3EA5A 3SE0A 4NCNA 1LV7A 3EIHA 3PEUA 1Z07A 2E87A 1NN0A 1OXVA 5A0FA 2F1JA 3PQCA 2JDIA 2A78A 3AKCA 4BZQA 4MUAA 5EP2A 1E1RA 4I81A 1KY3A 3B1ZA 4PO9A 4ESHA 2XTNA 2GKSA 2VHQA 2A5DA 4OHXA 2DWOA 3V00A 2ERYA 3LO5A 4RFSA 1GWNA 1UJ2A 4JT4A 5DIFA 5EE3A 3M0EA 1KI7A 1XMIA 3T34A 5SZJA 4D4JA 2H7VA 4NPHA 4DCUA 4OQMA 1ETUA 1KSFX 2GEDA 4O25A 1MABA 1U0HC 3IQXA 4FWIB 4L9WA 4M53A 1NF3A 3SBDA 1A4RA 4OHVA 1X6VA 5FPSA 5HR5A 1TAGA 1G41A 2VTKA 2QTVB 3WYAA 2R62A 4FMDB 2GCOB 1K5DA 1QHXA 2IF0A 3VR1A 1P72A 2QMHA 5C46F 4FMDF 1E69A 1JALA 3WP0A 3PFIA 4LYAA 2RGAA 4HDQB 5EXSA 3I72A 4GMXA 1G8PA 4W5JA 5FUYA 1RZ3A 3K70B 4C3ZA 1HE1C 2ODWA 4JT2A 2ZE7A 4DLTA 1IY1A 3E5HA 4MDEA 1NKTA 2CNWD 4M2LA 3IHLA 2KBFA 4RFSB 4Q4JA 1XF9A 4ZI2A 1KJYA 4TMTA 2QMOA 2FSIA 3LY5A 3QF4A 1R7RA 5CIQA 4URYR 3JZMA 1I4LD 1X8LA 3VAAA 1ZD8A 3OE7A 1MABB 2QUZA 1AN0A 4LHVA 3RAPR 3T1VA 1G8FA 3CIOA 3UATA 1XXHE 3U44A 1XXHA 3C16C 3HU3A 1N5LA 1DVRA 3ZVMA 4GL2A 1UKYA 1U98A 1EFHA 3FGNA 4IOLA 4BFZA 1Z5ZA 1YZKA 1P9WA 2O8CA 5FBQB 1OB2A 1I4DD 1ZUNB 3L0OA 221PA 2P6NA 1B0UA 4PO1A 1TEXA 4ACAA 2RGDA 3AF2A 1GKUB 1NLYA 4NYJR 5FTLA 4E07A 1CJTC 1U0JA 1HYQA 2O52A 4A4DA 4B34A 4GP6A 3GFOA 3WYGA 1AQUA 1VYTA 2W83A 3I1FA 4PPNA 4CYMA 4M21A 2FFQA 4Q4JB 2GETA 3K70C 2XNSA 5J5CA 2RGCA 3QF4B 4OI1A 3F8TA 2OCYC 5F9HA 2AD1A 3CRRA 1ANKA 4Z1MA 4LSGA 4P0TA 1JNYA 1OKKD 3KJGA 3FHOA 2CCKA 4CVNA 1R4AA 3RS0A 3B9QA 5C1BA 1AKYA 3U44B 3RC8A 1OYYA 1XXHB 4D0GA 4IHQA 4DLXA 4LHWA 2CLSA 3GJ7A 4UQOA 2GNOA 5SZHB 1VIAA 3BWDD 2A5JA 4Q47A 1R0ZA 4Q4AA 2Z5FA 4G5RA 4D80A 1G4AE 4PC6A 1E2HA 2ZVPX 5BQ5A 1RRPA 2O8CB 3Q7PA 1FX0A 1W48A 2ATXA 4IDNA 2FNAA 4V0ME 3AVYA 4V0MA 1CXZA 5HE9A 2DPXA 1TPZA 3DM9B 2ZJAA 4LUCA 2QT1A 5E7IA 3CNLA 4NYIR 1S0UA 3ZD6A 1CBUA 2BBOA 2QMEA 2VL7A 3P4XA 2GJSA 3K09A 1FP6A 2KJQA 4URVR 3PR1A 3ZLJA 1CR4A 4PHTA 1OV4A 3THWA 3X1DA 2WVJA 3RHFA 3A58B 2A2ZA 2WJHA 3D3QA 2ZANA 3B6EA 4AKEA 4DEXA 4D25A 2VBCA 4BECA 1G3MA 4CT4B 4FWTA 1P3JA 4IFEA 3ZGXA 4BLTA 4PHFA 4M9ZA 3B60A 3BJIC 4WAUA 3LWNA 4O2LA 2NO7A 3BB3A 3TW4A 4A82A 4Q4AB 5AWFC 2G77B 2BBSA 1G8HA 1N6HA 5AUQA 2ZE8A 4NYJQ 1FX0B 1W0JA 1XZQA 3CPJB 3OIYA 3SI7A 1U94A 3PXGA 1T9HA 2OSBA 2HT1A 1XPUA 4RZ3A 1E6CA 2XOKA 4RFVA 5J4HA 2OESA 3FDIA 3A1VA 4D6PA 4FN5A 4M1YA 1IM2A 2PT7A 3MUFA 3O8RA 3TSZA 3AVPA 3THWB 2EU8A 2QN6A 1N6RA 3NBFA 2V3CC 2JJ1A 2ORWA 4XSGA 4KFTA 4RCYA 3F0TA 4OHZA 4F4JA 2F55A 3EW9A 2A30A 5C4MA 2QZ4A 4C2TA 1E2MA 4HB3A 1IAQA 1X8JA 4GI7A 4TMKA 2H18A 3NWJA 3IDQA 3D7MA 3D31A 3TR0A 1KI3A 3B9PA 3IIKA 5IDVA 5KUTA 2EWVA 2HF8A 3BK7A 2JJ2D 4BWYA 3FOZA 4NYIQ 4XVQA 1L7VC 5DN6D 2FZLA 2FFAA 5FH9A 1QRAA 1CIPA 5A4JA 4TMXA 4DLRA 4UNQA 2HYIC 2W58A 1W4CA 4UNNA 2ZXUA 3ZVNA 5FOSA 4NZYA 3A4MA 3PUVA 2IT1A 4EDHA 5DO9A 1E0SA 1EFRD 2ZYUX 4FCWA 3T5DA 5KDOA 5DHFA 5KOYA 1GITA 3KQNA 3HP1A 4QRHA 4MRNA 4RZ2A 4LOAA 3K09C 4PZZA 3BE4A 4B35A 2PJRA 3TKLA 1K5GA 5D3MA 3TAHA 2V54A 2D7CA 4TMWA 2IHBA 4JLAA 4LYJA 4BE7B 2GHIA 1ZU4A 1DTSA 1KI8A 2EVWX 2WJVA 1MKYA 2BDTA 3PUZA 2CL6X 3U4QA 3IKJA 1WCV1 3LAWA 1XMSA 4B32A 1G3UA 1NI3A 3WNBA 3DEFA 4M8NE 1IQPA 5BWMA 2FSGA 4N0EA 4GPTA 1NIPA 2BWJA 2IS2A 3KL4A 1G6HA 5FBVB 3CR7A 3WY9A 2XTZA 2UKDA 2ZRIA 2XX3A 4B3XA 3L43A 1NP6A 1P4SA 2BOVA 4OJQA 1JBKA 4BLPA 1ESMA 2OBMA 4Z8YA 1XCMA 3BXZA 4ZDKA 1Z83A 1Z0DA 2QY9A 3LVQE 3U3JA 4MRVA 1OSNA 4B3BA 3AUYA 2CMKA 4JL8A 3SJAA 521PA 3BC1A 1Q3HA 5TDHA 5D3MB 2J1LA 4KHZA 4WBSA 1P61B 2IEYA 3ZIAA 4DDVA 1U99A 3MMPA 3U60B 3GLFE 3K70D 3GLFA 4RKFA 1MV5A 1KI2A 2ZJBA 3U4QB 1OB5A 1AM4D 1XBTA 5P21A 3WXMA 3EPKA 2H17A 2K5UA 3IEUA 2DHRA 2UZIR 2QE7D 2WBLC 3OEED 4IDOA 1X8KA 1GL6A 4PC2A 1VCOA 2D74A 5HE8A 1DAFA 1S1CA 2H5EA 4OQXA 4B2PA 4BASA 2GCNA 2O8DA 1ZNZA 5GJVC 4AK9A 3KXKA 2GCPA 2ANBA 1EXMA 4UJ3A 3U3KA 2NOAA 4YMTA 2PCLA 1S9DA 3WRYC 2QM7A 2WWGA 1OIXA 5H68A 3L0PA 3TK1A 3VNUA 2O5VA 2QG6A 3A37A 4MGIR 3TVTA 3WMGA 1FNNA 3N5CA 2BV3A 2RCNA 1X1SA 2IYVA 2NPIA 8OHMA 1M6NA 4B47A 1II0A 2QTFA 5CK5A 1NL3A 2OFOA 3GLFB 4PPGA 1DAMA 1CLUA 2V9PA 2FFBA 2ZSFA 3AGPA 3ETLA 3LW7A 5AUPB 4DC9A 4L9SA 5K8LA 1HURA 1N5KA 4PSVA 4IXMA 4PTLA 2P65A 5F98A 4OK3A 4RD6A 4GOJA 5JHGB 5E7MA 3I61A 1E99A 3QXSA 1KIMA 4DT1A 2O8DB 2WKPA 4AYWA 1N6IA 5FL3A 2IS6A 4MYTA 1XEXA 3VU9A 4HLCA 4CGZA 1CTQA 2W2TA 2Z4SA 4TQUS 5BXQC 2BBTA 2J0UA 2W2XA 3RRZA 3TUIC 4LGMA 3HPQA 4TYPA 5FPYA 3EWSA 3WBKA 3PJRA 2J9RA 3MSXA 4PAQA 4LV5B 2V55B 1KKLA 4JS0A 3CB4A 1N0UA 2E9SA 1G5TA 4Q02A 4GP7A 1RRCA 1E4YA 1XB2A 1UPTA 2GVZC 4JZKA 1KO8A 1FTSA 4LC0A 4M22A 1V43A 1NMZA 4L15A 2QGNA 2QPOA 4Q66C 2VSXA 1P60A 2IYQA 1UBEA 2NZ8A 2OAQ1 1P9RA 3R9WA 2WAYA 3Q7QA 3RNLA 3CX8A 1SHZA 3OESA 5DE3A 2ZJ8A 3SJCA 1KYIA 1YR9A 3NEJA 1K6MA 3L0SA 4DT1B 2R6GA 3TE6A 3PUYA 1N25A 2NTYC 2FE4A 3C5HA 1XEXB 3VU9B 5J4KA 1SVMA 4OBEA 5DSZA 4OI0A 2HV8A 2WPDA 4UJ5A 1EFTA 2J0UB 1G7RA 1COWA 1AZTA 2IUTA 1Z0JA 4LYFA 1IBRA 4BUJA 4PANA 4TL7A 4XOIA 5F3WB 4Q1BA 3LD9A 1E98A 2QMUA 3VR4A 2ZRJA 5HZHA 1JEEA 4KO8A 3BH6A 5HTKA 2EFDB 1XD2A 3DVLA 2PH1A 1NSFA 4MKHA 4C0KA 4LDJA 1Q44A 5FOTA 1G21E 4JKIA 2YWEA 4M9QA 1EG7A 5FR1A 1AS3A 2F9LA 4DDWA 1SVKA 3EASA 2ZU0C 4B3FX 3T1QA 2P3SA 2FJUA 1HT2E 4LHYA 1NVVR 4DUGA 2SHKA 3VHXA 1TL7C 3SBEA 3NBYC 3CBQA 3JZAA 4G01B 2VA8A 4M1SA 5DI3A 1NVXQ 2WWYA 2QPAA 4XD7D 4LBWA 1E0AA 3OF5A 2QU8A 3IO3A 3ADKA 5HCIA 3W90A 1E9BA 3JVVA 1ONBA 4LJ9A 4A2PA 2ZEJA 4XVRA 4F91B 1LTQA 5AJZA 1Q3TA 1RC8A 3ZD7A 2AD5A 4BFSA 1XD2B 1ZMXA 4JVLA 4B75A 1ZM3A 4C0BA 4PR0A 1F6BA 3QEJA 3C41J 4JKYA 3TNFA 5EE5B 5JI2E 3FHCB 2BMJA 1Z6GA 5KHOC 3TSWA 2VQSA 2O8EA 5TB5A 5DYGA 4A6XA 2ZS9A 5BN4A 3VHLB 2JIZA 4PHGA 2JJ1D 1DE0A 3T1OA 3QJYA 1SKQA 3CLVA 1XPRA 4HYYA 5L8VA 1FQJA 5L3RA 1TMKA 5FTJA 1BYUA 3TBKA 5DI3B 4A92A 2DB3A 3RRNA 1II8A 2ZE6A 3B78A 4YDSA 1JB1A 1VG9B 4DSUA 3I62A 2Q3FA 5L3QA 3O8CA 2ATVA 2JCSA 3QF7A 2VHCA 1JI0A 3RANA 1G7CA 3I4LA 4OJKA 3MD0A 5KSYA 3GEIA 4QGGA 4DLVA 1Y3AA 4TQ9A 2DFNA 1D2EA 1IY2A 1HEIA 1VECA 3A1WA 2ZSDA 4TN1A 4E5UA 2ZSEA 3C4JA 3CX6A 1SVLA 1Z06A 3DOEA 4IVQA 2PZFA 4NH0A 3VR6A 4Q00A 4AG5A 1GDDA 1HTWA 3D6TB 3CKLA 1OH7A 2O8EB 2Z0MA 3KTAA 2QRZA 1UAAA 5TVKA 2D2FA 5FBLB 2NIPA 2WWIA 1HQCA 3WP1B 1WBBA 1NG9A 2B92A 3N2IA 4AKGA 2QROA 2F6RA 3RS3A 4QHSA 4NDZA 2FX3A 3HR8A 3SYKA 4IDHA 1E4VA 4M9XA 2WKRA 1II8B 4OK6A 4XJXA 3EIEA 3LBNA 4IVPA 4GFDA 3UMSA 5FPHA 2XSZD 3WHKA 2ZM5A 2BKEA 5L3QB 1JR3E 1JR3A 2IF2A 2XB2A 3PEYA 1E79A 2XB4A 4HLUC 4URWR 2CL7X 4MGKR 3H2YA 5EE9A 3RDPA 3W34A 2C78A 4W5WA 3CF2A 3KFVA 3MFYA 4JSYA 4P4SA 3PUXA 2FZ4A 4BRWA 4A8JA 3KQHA 3KTAB 3KQUA 4QHTA 1G18A 2ORIA 2WAXA 3BB4A 1ZD9A 2W6JA 1TQDA 2WWFA 4NE2A 3LNCA 4R2IA 4MRRA 4G0NA 3I8XA 3M1IA 3PV0A 3SDZA 4X8MA 4EJSA 2GJKA 2EYUA 3AKEA 2OV2A 3RYTC 1AK2A 1MRNA 2CK3D 3FWLA 2WZQA 1CP2A 1G291 2GJ9A 4B43A 4JL5A 2ZAMA 5CDFE 3H4MA 5CDFA 5JJLA 4TT3A 1CU1A 2QGZA 5EUQB 3CH5A 5CLQA 2GILA 2IA5A 2ZYVX 3UWKA 4KLZA 5CJ2A 1E9FA 2ZRNA 5F2EA 4NCIA 1UKEA 1M7GA 4DBLC 1LF5A 2IUSA 2Z6VA 3AVVA 4DCTA 3W3AA 4TMZA 4P4SB 4Q48A 2B7CA 621PA 3BFXA 4DB4A 3U7FB 2EFEB 5CIWA 4WXRA 1NLFA 1S3SA 4QJ5A 4A8JB 4JVNA 2RHMA 1LY1A 4IOMA 5K8UA 5LB2A 5FBRB 2ERXA 5IF9A 4CEJA 4D26A 1E9RA
chains in the Genus database with same CATH superfamily
3RT1A 1IK6A 1DKPA 1OWNA 2XB6A 3IUMA 4MV9A 5I47A 4H7IA 3N2KB 4KQ2A 1KBOA 2Y6UA 4KYIB 3NKFA 1V0JA 3JQ7A 4LE2A 3LRXA 3BL5A 3OLVA 5AI5A 2NZVG 2VAXA 5AHKA 2OK8A 1TVKA 1UKCA 3QLEA 4ZOLA 2Q4TA 4JI7B 3OEYA 3HU1A 4FQ8A 4NICA 2FWMX 5DLQC 4ZQEA 1BHJA 2FSVA 3DJFA 5DLYA 3TLGB 2QJTA 1BKSB 4BVFA 4PW0A 4DBZA 5HTOA 3LVRE 4C4AA 1DIGA 1S2NA 3S5JA 4JVOA 4E7OA 1P6UA 1DUSA 5CYOA 1D1TA 4C5CA 1BOOA 1PNRA 1W0KD 2BELA 4O0LA 3EBOA 1F9AA 3I37X 3KV1A 3ODPA 4MICA 4ZARA 5JS2A 2Q4DA 1AO3A 1KS2A 5AICA 2EW1A 1I7SB 3CMCO 4HFJA 1B26A 2QXUA 1E0JA 2C9BA 3PQ5A 3DF9A 4P1ZA 3VTKA 4FS8A 2Q1UA 4ENRA 2XNCA 2EZ4A 2H1SA 3H1BA 3SX2A 1W87A 4MIYA 4GX2A 3MEQA 1C1XA 1MEOA 4QUJA 3RUIA 1WQ4A 4F96A 4G4JA 3Q2OA 3VYVA 4CEJB 3EZ6A 3ITKA 1D5CA 1IXSB 3AP3A 4YRTA 5CLLA 1OFVA 3BF8A 4GR4A 4MAMA 4E4TA 3V7FA 3FNEA 3PGJA 1WY5A 1K6JA 2CXOA 2X5JO 3JQ7B 3S4YA 4GOMD 2QDXA 3DLIA 4B6RA 2J8ZA 5CFQA 2EZUA 2PKQO 1TVKB 2VDKB 2WFZA 4ZOLB 3DZHA 4R1TA 4BZXA 4CU5A 1HYGA 1OI3A 2ADMA 2TMKA 1E60A 2CXRA 3I5XA 1OFUX 2GYYA 4G56A 4JQOA 4OHUA 5DVZA 1P5HA 5BYBA 2JC3A 3VPDA 3X2SA 2BFOA 4EJSC 2AHOA 3UH1A 2OKGA 3FROA 1C9KA 1N75A 1XTPA 1GCOA 3SF0A 3FVWA 1BMQA 4PN7A 5LB4A 2ODBA 3VUEA 1FMLA 1QF6A 4OM8A 3FETA 1NX9A 2GAAA 1IMOA 2A84A 3TD9A 3AESA 1I4TD 3O3MB 3QWAA 3GEDA 1QZUA 3O8BA 4D2IA 3D1JA 4WJLA 1W36C 1P2VA 2NU8A 1MNQA 1E1QD 1L7PA 4DIKA 1YV9A 4Q7EA 4X41A 1C1XB 4F9FA 3Q0EA 4XW2A 1M0WA 1UBOS 4YWHA 4Z54A 1ZGJA 3BZBA 4RK0A 4W82A 4GAEA 1CHDA 4JN6B 2EBFX 5CVEA 3BGVA 4N12A 4EYKA 2W2KA 3H5RA 4QUGA 5KHAA 2I3GA 4JSTA 4NR0A 4AJPA 3T3NA 2X3UA 2B5WA 2RG1A 3KKZA 3F71A 2PSSA 1Z29A 4ZYVA 3EGIA 5AI6A 3FYTA 3QFHA 4A7PA 4BMZA 4XCQA 1D0IA 1Y1QA 4E30A 4Z7OB 2GJ8A 1VMEA 4UNIA 1XCGB 3L6UA 8AT1A 4WACA 2IIPA 4LXYA 3SSNA 3L1IA 1P1CA 1XWFA 4GUDA 1E2NA 2D4AA 2FPGA 1Z15A 4I2NA 1UIMA 2ZB4A 2R25B 5HBGA 5BPHA 1I1QB 3R3UA 3ADCA 4QREA 3AESB 3G6WA 3L01A 4RHYA 1S5PA 4Q9HA 2IQIA 2B8EA 2NU8B 3ETNA 2AN4A 3S7ZA 1Y3CE 5DNEA 1WP9A 3GCWA 3CZRA 4I6JA 3USCS 2R8PA 3PFFA 5J1TB 1VJRA 1L5FA 3ABQB 2R751 2OHFA 4RH0A 1YGYA 3NFRA 3V1LA 3AF6A 3KTFA 1IPEA 2W2KB 4R6WA 3W9YA 5EEHA 3QA3E 2LPMA 1IJBA 4CV0A 1NBMD 1ISSA 1AXEA 1UKBA 2JAUA 2PS9A 1Y9ZA 4BO4A 3IDFA 2WSBA 2J09A 3SS8A 3MXTA 5J4LA 1MHTA 2QX7A 3AI7A 4IXNA 1BEZA 4RSGA 4JVMA 3D7RA 3UAVA 2WV7A 4DPMA 2K87A 7MDHA 4K9SA 1FFWA 2FPGB 3V7UA 3JQDA 3RLFA 1C4OA 4DS3A 2PWAA 2IK8A 1G8MA 2R6DA 4NABA 4G1FA 4TTQA 4F46A 5KYKA 2ENWA 4PLFA 2M6LA 2E0IA 2O2XA 3D6AA 3HWX1 1DFIA 3OOHA 1UOQA 4JJ7A 1LS1A 3RRJA 2EJBA 3KJFA 1JLHA 2XA1A 3I9V1 1ZD5A 4G4IA 5ALXA 5DT2A 3KIPA 4BVKA 4MS4A 5FUVA 4BVBA 4JQZA 4J1SA 4AJ9A 1KKUA 5BNIA 3LRPA 1C4XA 2F1OA 1KK3A 5CT6A 3ZXIA 4MHTA 4HJXA 1TDJA 2NV2B 5AI9A 1DPFA 1H6CA 1OHHD 3F5QA 3UMYA 3F3SA 3GT0A 2JPDA 5HPYB 4LEIA 4BCDA 3W2EA 1CV2A 1GLVA 4QHYA 4BP8A 4CDGA 3EGDA 5B12A 2O54A 3LOPA 3D0OA 2R68A 3LUJA 3TDMA 3AR9A 1QGOA 3PQ8A 2GRAA 1NQUA 4FP9A 2C8KA 3PCTA 1EESA 4H7FA 1TUBA 4GF5A 4ZREA 4JV5B 2H1IA 1OOEA 2QTHA 4ASUA 2P90A 2C9DA 3IAFA 3IBYA 1SOAA 3DT9A 4D3XA 2V98A 5JE8A 4OQEA 3ICPA 4LZNA 4J1QA 5EIWA 3M4JA 1HRKA 1IC6A 2A5LA 3HNPA 1FK8A 4OIMA 4HQRA 4TWBA 4FE3A 3RJ5A 4J94A 3UANA 3M6XA 1DDGA 1ZICA 3K4HA 4K9DA 3WLHA 1UDCA 3LP5A 5K20A 5AXCA 3KAQA 1WE2A 2G07A 4LHSA 2ZT5A 3JRXA 1L5QA 1KR2A 3VO8A 2E4YA 3ZU4A 4F3TA 1I8TA 2AKYA 3CINA 2CDAA 4J1TA 3IELA 4MS4B 2B4AA 1WVIA 3CXRA 4GNKA 4I9NA 4KLAA 2R6FA 2CLDX 3SCZA 1MAHA 1P77A 4UHJA 3W5JA 2GK4A 3H2ZA 3TDNA 2XZOA 4LF6B 3HVJA 4ABTA 1O6GA 1O2DA 3REFA 1QQ6A 1JPNA 3CVWA 4YUXA 1P7WA 4JASB 1CLEA 1R10A 3E81A 3BTUA 3EGDB 3HCRA 1HQYE 1WPRA 3SLRA 1Z2CA 3I2FA 4FSXA 1OXTA 3R8FA 5FLEX 1YHNA 4PQRA 1ZLYA 1TUBB 3CSSA 1WS6A 2IXBA 1JHQA 2YWFA 5TC4A 3RFUA 3AEYA 3WWZA 2BEVA 4D9CA 3OE1A 4ALKA 3QKRA 4RV9A 2NUBA 4IJMA 2DQKA 3ANTA 1SWVA 4X6YA 1XDGA 1U9ZA 2IPMA 3IVGA 4LX0A 3AG5A 1NW7A 5E4JA 4LQ4A 4EBBA 4ALLA 2PT9A 1RBMA 1VFNA 2CMFA 3FB4A 3EPJA 2AC2A 4JYAB 2FI1A 1W59A 2H08A 2X4IA 3HBMA 4K26A 2XB8A 1HBJA 2RK6A 3KC2A 4ND3A 4LFBB 1WO8A 3P0EA 1E4OA 2G80A 2NPOA 1E96A 1KGDA 1Y7PA 2Q1SA 3CE9A 4XGNA 4D92A 2WRZA 4Q9KA 1FU8A 2J6CA 1SC1A 4MQ5A 1YC5A 5IC5A 1VP3A 3UN1A 1T0HB 5I7OA 4RQAA 3AILA 1GFWA 4X44A 3ZZTA 2J3JA 1QB7A 5F12A 2Q49A 2QA5A 4FDAA 3VR0A 2QQGA 4FOPA 2C96A 2N47A 1KZ4A 1TJ3A 5EPOA 1J09A 2YOHA 1MJ5A 2VZEA 5A9SA 1ZRHA 2WAAA 1WR8A 3KBBA 1RQLA 2COKA 1XALA 3AXTA 3DA8A 4PQGA 4TXNA 4CQMD 5FI0B 2W8BA 2JGEA 3QPBA 3OQPA 3KSUA 5K99A 3BIWA 3WE7A 4EPWA 2WSSD 2BEVB 2EZTA 9LDBA 4AECA 1U28C 4HZGA 4YHBA 3QKRB 3D8UA 2B61A 1SQSA 2WB4A 5ED4A 1PEAA 4OB8A 1YZLA 2VZ8A 4G3XA 4M0EA 1IL0A 3LI2A 5AJWA 3T4PA 1DT3A 5DPMA 2A3RA 4QVGA 4HLNA 5LD2B 1GKIA 2EARA 4LCBA 2XGJA 5KNCD 2XAUA 2YZ7A 4OMCA 3R5SA 3LQQA 5JSKA 3B8HA 3OM1A 5IT5A 3MMSA 4MCHA 5CNMA 3CG0A 5IKXA 2D54A 4IDBA 1RRGA 1S01A 3N0XA 1G8AA 3MWYW 1T36A 3QPWA 4YY3B 3HQ4O 5FV7A 2VR1A 4C1NA 4BQNA 5L6LB 5D8DA 1FS4A 1EFAA 1DC5A 2HSDA 4MLPA 3AUSA 1GNLA 1NX6A 3AUTA 4XQEA 2GB4A 3VSAA 5E4FA 1E2UA 2P9FA 3GP3A 1Y7LA 4KAXA 3VRHA 1DV2A 4F7DA 5A9SB 5JSZA 5E9QA 1MO3A 2Z98A 4DREA 5L4NA 1DQRA 3FHTA 4FGWA 2FN4A 3JWPA 4ARIA 2W8BB 3RFFA 4DLPA 4GLBA 3VV2A 4IH9A 3NXKA 1F3LA 2CBZA 4GM4A 1E3IA 1KSGA 3RSHA 4YXWD 3CZ4A 4AB1A 4CF5A 4YO8A 4WXEA 3IALA 1YRBA 3NKVA 5AVOA 3VGPA 1NMSA 2XMPA 3DCYA 1CFZA 1SXJC 3A4VA 3N0TA 3N7UA 5DCLA 5ECDA 1SHKA 5BSRA 3T15A 1PYDA 1UBTS 2YHAA 3C8DA 4PZPA 1N5IA 3RSSA 4TVSA 1QVZA 5DEOA 2JDID 1JECA 2H9IA 1H5NA 2WIKA 2Y1WA 1E9EA 2GEUA 3QKIA 3ZNOA 4ZTUB 1G64A 5FL7A 4LGYA 3IEMA 1NYTA 3GO4A 3TX6A 3VZSA 1RVDA 5LU9A 4CMJA 4OL9A 4FD3A 4D9FA 1BXKA 1QGZA 3A28A 3B7WA 4LZZA 4YN3A 3RK1A 3VAZA 1GU1A 2PEYA 3DKPA 4YACA 1A9TA 1JHDA 3KSZO 2HA2A 2CLHB 3SX0A 4E22A 1HX7A 4XDGA 1IK4A 2ZRLA 2AKAB 2FQYA 2Y1LA 2I03A 4Q39A 5JSZB 1ZM4A 2W6OA 2JS7A 4IGIA 2O2EA 5B4UA 4L5IA 2EEZA 3EVAA 3ZQUA 1T13A 4AUNA 3HKBB 1QP8A 1VJ1A 3PPWA 1R9JA 1TLFA 3A3PA 3LDUA 5JJBA 2QF7A 2FPIA 1EFVA 1N4DA 2G40A 5LBTA 1EVIA 2C84A 3STHA 1V5WA 3THXA 3OPQA 5KZMB 3LZ6A 2V6FA 4IDEA 2ZJ2A 1S2GA 1ZH4A 2GUGA 2Z3VA 4MTLA 1U11A 3K32A 4DA8A 4E03A 1YBVA 4TYQA 1LS6A 1IEXA 3ZJUA 1BA2A 3E9QA 3DXYA 3AI3A 1C2YA 4DSNA 3UUGA 3DMFA 3GH1A 3GNLA 1XDBA 3OKAA 1FP7A 1JMVA 3MJRA 3Q5DA 4JAVC 4ITUA 4XSVA 2PZMA 2P7IA 2C31A 3QVSA 5ALIA 6REQB 3GPBA 4FYWA 4DN6A 3A1SA 3VVBA 2Q46A 2R4TA 3IP8A 4YONB 5I9NA 1V6CA 2FWNA 3UOWA 3QPDA 1XT6A 1BWSA 1TQ2A 4EY7A 4HEQA 4BB9A 3AP2A 4G67A 2EP5A 2HNKA 5LLDA 5L3ZA 3HFSA 4E5KA 2Q4EA 3SNHA 5ALYA 1ZD1A 3I2KA 5EIBC 4ZZIA 4EY3A 3QOXA 3DOIA 2FPIB 1EFVB 4I3FA 4NTZA 2EKQA 2HMYB 2P9YA 5CBPA 1QAOA 3THXB 3K0CC 1KI6A 3G68A 1EDBA 3EN0A 5BXYA 2TMDA 1KI9A 1EP3B 1I7LA 3PJGA 2IX3A 2WDPA 3N05A 3ZHQA 1ITZA 2VJMA 5JFGA 1NVMB 4E1VA 5IBCA 2K4MA 4WW0A 3CMMA 2BBWA 3KPUA 4IEEA 2VNJA 1XDZA 1KU6A 2WF7A 3BGDA 1OBHA 4HAOA 2PR2A 4R8LA 5HIIA 1HG0A 4LNHA 3ZS9A 3V6MA 4B3GA 3L49A 3MJDA 3B1XA 4N18A 3ZJ5A 1BFUA 1ADGA 1K92A 3DHYA 5IVDA 2V6BA 2WJPA 4HDMA 3L7JA 4RHUA 4JP3A 2PRKA 2ZB3A 5CLHA 5K8TA 3FYDA 3TTSA 4C01A 2ZUDA 1TQHA 1NT4A 1ZJJA 2UZ0A 2E49A 2WICA 4ZO4A 5KPJA 2YIVX 3LCCA 3KU1A 1BO6A 1EBUA 1TTQB 2IXEA 3H1TA 1H0SA 1RWBA 3L3BA 4JFRA 4YHHB 3KQLA 1XRRA 2X14A 1X39A 3V4PB 3ETJA 3C15C 4OP1A 4QXQA 4ENVA 2ODAA 5CBPB 1DAEA 2IY9A 2JLRA 2Y3IA 5CTJA 1KI6B 1P0MA 1ZHHA 1ZQ9A 3MJ4A 3HMKA 3OSUA 4G09A 4EABA 3U4MA 2E6KA 4ZCRA 2F3UA 5BMVF 2H92A 2YWXA 1ZJYA 2WHPA 4OJNA 5C9ZA 2VJMB 2UUBB 4YCNA 1HFJA 4ZVSA 1UPAA 3W3AH 5BNTA 3D4NA 4RL4A 5ILGA 4H4CA 1G8YA 1VJ0A 1ZCAA 2WM8A 3PJFA 3WA6A 1RJ9A 1KTIA 4PPQA 3AY3A 1C30A 2PLWA 4P3PA 9GPBA 4S05A 4W99A 3UVEA 3TIVA 1CR1A 3A4NA 1USUA 2DT8A 3DO6A 3IAXA 3OZGA 2OCPA 3FDZA 4OB7A 5I01A 3I5YA 2F17A 1VLZA 3CX7A 4KWHA 1IZZA 2Z6UA 5ALVA 3B48A 5C4GB 4HDMB 2I7DA 3KHUA 2E82A 2I66A 5ESRA 4YASA 1OFUA 2VPYA 2VH2A 3S70A 1G9XA 1YU6A 2JJYA 1J99A 4FC6A 3PENA 5G0VA 4DG8A 2D7DA 4FYMA 4IW3B 4ZVMA 4BVHA 4OHYA 4HTAA 4NMWA 4PX3A 2IP2A 2J0SA 4HLDA 4RIEA 4Z3OA 3NYWA 2EIXA 3B5JA 4EHKA 3B3JA 2JG3A 2IYEA 4TZ0A 4FMCB 4XA8A 1XTSA 1OTYA 3G2KA 3JQ8A 5FJIA 1YFKA 4P22A 4CMAA 4D3FA 1Y6GA 1P29A 2B20A 2CNLA 2WHPB 3E84A 5BW4A 1VSQA 4LQLA 1IXZA 1J2UA 2ZR8A 5GAJA 3WFJA 1C9MA 4BKQA 5LZ4A 2AT1A 6REQA 1GADO 5I51A 5B3LA 2QP9X 4P33A 3R8XA 2QL6A 2WWVD 1YFLA 3ENNA 1RJ9B 4HDCA 4ZDWA 1C30B 4FDTA 4INAA 4NHOA 5BWOA 4A2CA 5LPNA 3DFIA 1THGA 3FDZB 2E5FA 4GSYA 1AUVA 2H4JA 1PK7A 3OJOA 1PNTA 3KTDA 3TRIA 1DQNA 3OQMA 3CYFA 1L7QA 2HCTA 5FX2A 2GJ4A 2QTBA 1UJ5A 1NASA 5CB6A 1XO1A 2CLOB 3IGFA 4O4HA 3TXXA 4EUSA 3AL0C 1AV7A 5LQRA 2JGKA 1NN1A 4U1RA 5TEVA 4TZTA 1NE2A 3CLRD 1QHSA 3FSRA 1LSOA 4MYCA 1KDVA 2V7PA 4LVCA 4HHEA 1GRQA 1R0CA 4AZWA 1LNSA 1Y5MA 2Q3JA 5JFOA 3JQ8B 3N87A 5KQPA 2Q9AA 3KKNA 4CM6A 4PAMA 3ZWNA 4M86A 1CEXA 1EAYA 3PWSA 1JDBB 4H7KA 5F78A 4BVEA 4PX9A 1JIJA 3G5LA 3I9LA 4M49A 3I73A 4LRWA 3SBXA 1Q1ZA 3AKYA 4B6QA 6PFKA 2P6MA 4KSCA 2C04A 3D8SA 2BEWA 5T3UA 4OMDA 5KNBA 2PWYA 4L8VA 1T4GA 4Q1FA 2FPLA 2GHQA 1PNVA 3PRHA 1U6KA 4G5OA 4X8HA 3BWCA 5EP4A 5E3HA 1MQ8B 2JVJA 3HBLA 4HDRA 1R6BX 4HN9A 2I2BA 3DTTA 4F5WA 1TT7A 3R6DA 4ZQIA 1GNRA 5EGSA 4DDHA 5K0CA 4K9PA 2HW8A 4RCZA 2XWBF 2DBQA 1RU3A 2EKBA 1DIAA 3AU9A 4O4HB 4BYGA 2Y1DA 2DFVA 3N39C 2AW3A 3ADBA 2JH8A 4XYEA 5DNAA 1AN9A 3AFMA 2VJPA 3MBIA 4L50A 3A3NA 3VX4A 2V7UA 3CVXA 1PVOA 1AUPA 1DMSA 4U2DA 5EIXA 2D3TA 3E58A 2B36A 4PYQA 4HAIA 2IBMA 5C8ZA 1W8DA 3L8DA 3G0BA 2A5YB 3T1TA 4P31A 3ZHYA 4KBGA 4YAIA 3CF6R 3KX2A 4X61A 1TQ6A 1KEPA 2JAQA 3CNOA 2C2MA 4KFUA 4N7BA 4IH4A 3A4TA 3CPSA 5EIBD 1EGAA 3ZWBA 2VBFA 4KQGA 5K4AA 1EPUA 2FEMA 4V0RA 4GX0A 4YIHA 2O2CA 5JYCA 4FGUA 2OG1A 2BEWB 1U8TA 4TLCA 3NHUA 4YCAA 4MI9A 3OHSX 4MMXB 4BL5A 3FPSA 3MQFA 1SQFA 4HDRB 4MP6A 4UATA 2GCEA 1DOAA 5DNUA 5GADl 1ELOA 4OAPA 4WESA 2C42A 4NATA 3L40A 4REOA 1W88A 4B80A 2I2DA 3T7CA 2AK3A 2G6BA 2JRLA 3GJ4A 3T3DA 2RKOA 3DVSX 3TYXA 1TD9A 1M2EA 1NBAA 3TLMA 1L4LA 2HPVA 1Q3KA 2QYOA 4KTVE 4UBJA 1KFBB 3WNDA 4GBMA 2V97A 1KNXA 1YQ9A 2CUKA 4JA0A 5DBFA 4G9GA 3O2JA 1P9NA 4MVJG 1RMQA 4QUDA 3UPUA 1A97A 1V37A 2BEJA 3QLTA 2V7BA 2I5PO 3OHPA 1DV1A 2FFHA 1ZIOA 2XA9A 2HK6A 3WAKA 4Y6SA 3WL7A 4JIGA 3AR8A 1NRJB 2BISA 3TOXA 3H0EA 5HKBA 2GM9A 4J2OA 1W19A 3ZU3A 2ZROA 1QO9A 1JH9A 2DSTA 4DWOA 5PGMA 3WKBA 3S68A 3K4QA 2D2EA 1UP7A 2YRXA 1ABEA 3K16A 2FE1A 1R5JA 4RKWA 2IL1A 3TLYA 3K2IA 1DL5A 1D1PA 4K6KA 4KLRA 1VL5A 3BA1A 4RS3A 1R4NA 1I6LA 1UZLA 4WESB 4YV7A 3N70A 4LNAA 1LSUA 3H13A 2WZBA 1W88B 3C85A 3ICWA 2BUBA 4JOBA 4QTTB 4GKKB 1F5SA 3TAXA 2H4ZA 3THYA 4ZC1A 1N1MA 1KP9A 3FF4A 1X8XA 4AG6A 4BTLA 4EI2A 3ABSB 4DJJA 3QUCA 4G25A 7AT1A 3AQ4A 5DX1A 2POCA 3I8SA 4C4ZA 5JCPA 3INGA 2P3QA 3KT8A 4XDYA 1DLIA 3KZNA 4JQSA 5COAA 1OGYA 1SA0A 2I87A 1EDZA 4W9NC 5HFNA 1HLFA 4XAQA 5K0BA 2NADA 2P4QA 2WU1A 4PQFA 1E3JA 4OHBA 1X1EA 2P67A 3QV1A 4WV3A 5H70A 3IMFA 1BDJA 2PSJA 4MWEA 5LLSA 4ZFNA 3GXOA 2AI3A 3J7TA 4AFNA 1FSFA 1EHYA 2X22A 4WBXC 4K3VA 4LXUA 3LQYA 4ZAXA 3C8ZA 5DTJA 4D4HA 1PS9A 1I4EB 3IOEA 4S1TA 1U0SY 1R0RE 3K0AB 5CYFA 4V1CI 2W2VA 3EZ7A 1LQTA 3A26A 3H8SA 3QYJA 5LDGA 4JUCA 3T3IA 4B3JA 4QJIA 1R4NB 4JJ6A 1Z26A 1I7NA 3MK31 3TZKA 1E18A 3EIUA 3WB1A 1LPNA 3OP4A 3HMQA 3C97A 2VCEA 3THYB 1GRRA 5LBUA 2GXSA 4BNXA 4CF6A 3ZHVA 2ODPA 4YCCA 1A9ZA 1A2KC 5BOVA 3K1JA 1S8NA 5FI3A 1SA0B 3ROPA 3GYBA 3IVCA 4BDTA 2QM8A 3CM0A 1WM1A 5CDTA 1ZGAA 4B5KA 1NSTA 1VKRA 5CA1A 3VNAA 3NH9A 3TRKA 4FILA 1LU9A 2R4UA 2G7ZA 4EITA 1DUIA 4LJAA 2PX4A 2Z8YA 4LXTA 4TS4A 3ZS8A 6Q21A 3MPOA 5FI1B 3DMRA 3JRNA 3PR3A 4LRSB 2EV9A 3UK1A 1BWQA 1KJNA 2YH2A 5LQNA 3S2SA 4BZPA 4UREA 1VHTA 2E4UA 2ACVA 2AXEA 2ZYTX 3HLTA 1U3TA 2ZM6B 2Z5GA 3TSYA 4XWGA 3ASYA 2I29A 2UYGA 3QTBA 5F73A 3LC7O 4AJEA 5FI5A 1IAVA 4E3WA 1TKAA 2WPDD 4CTMA 3FUTA 3JD4A 4L51A 4P7BA 3T8YA 5FOQA 3DZ8A 2X40A 3VOAA 2BKVA 2I6GA 1LTHR 4PY2A 2WT8A 2NYVA 2C4VA 4MUHA 4EI8A 1P18A 4MW2A 1IVSA 4I5EA 4KNVA 1P2SA 4M7PA 3C6ZA 1JG6A 3S55A 2CCJA 4R83A 2M32A 3QLJA 1EUDA 4L6AA 2V8BA 3ZD9A 1XU9A 1H0HA 3BL8A 2PGJA 5ITVA 1RM3A 5AVWA 2QRKA 3EOBI 1O96A 2C5SA 5LZ5A 3UV7A 4B71A 5A4MS 1MF7A 1YWGO 2GN4A 2IHVA 2L69A 1ODLA 1VHWA 2XUIA 3DTVA 4L75A 1QJCA 3V3TA 5CA1B 4DNPA 2LZ0A 3CN7A 3SHWA 3SQWA 2WM3A 2HBYA 3PC4A 1G1MA 5CVJA 5T57A 1FLVA 1LA2A 2IY8A 5JCJD 3B12A 2QD1A 3ZWWA 4MRAA 4OLJA 1XZHA 2G76A 3ZVLA 4NENA 2JGRA 2WAMA 4RULA 4AKHA 5CNIA 3T0IA 1Q0UA 5EOVA 5ALDA 4FJ2A 4KVGA 5IAOA 2HHCA 2D3WA 2RGBA 4PZYA 5FWXA 1UZUA 4DNOA 1BCRA 3FYUC 3VZPA 3H9UA 3N59A 1C8KA 1OJ7A 5D5QA 1DB3A 2OLKA 4W9RA 1L4YA 1FFCA 2H3HA 2HPAA 3JQQA 4WN3A 5UKDA 3SEAA 4C78A 3W05A 4ZQFA 1KQNA 2J4CA 1DIBA 3RS7A 5HCNA 2ZVQX 3DEJA 1WMAA 2VDWA 1LFAA 3ZGZA 3G8BA 1EUDB 1GXSA 1RRFA 1WXHA 2JVIA 3K9GA 1C0PA 4ZXFA 3V6LA 2IH2A 2BKAA 1O96B 3QPAA 4LSZA 5D7NA 4YAWA 2GERA 4PF1A 3IKLA 4MYUA 1YHZA 2CEAA 3DTVB 5L53A 5IVKA 2IP4A 4P4UA 1ZSNA 2AWNA 4GDMA 2YJTD 3SKXA 3I3OA 1YE5A 3FWPA 1ZA2A 4RZQA 1FQOA 4AUKA 2WMNB 4CIBA 4DR5B 3HJBA 4LA4A 3UK0A 4YP1A 4UDOA 1CY7A 1WHTA 2OT3B 4NENB 1SKUA 1N9KA 3L4BC 4QARA 2DR2A 5DTEA 4LF9B 3WAJA 3GEEA 4IIXA 5FWXB 3ZXYA 2R48A 2RI6A 3BE6A 1KO7A 5KS2A 3KAJA 4FZ5A 1BCRB 2H65A 2P30A 3E3AA 5ERXA 1TI7A 2NQTA 4JJAA 4GBGA 4B3IA 3JPYA 1JVBA 4KO4S 1XUOA 1RYHA 2OXEA 1BU5A 3WZMA 2ON6A 1PGPA 2XQKA 2XQJA 3BXXA 4C21A 2H1OA 5FOWA 1JQJC 2RGUA 1KYZA 2PZKA 1MTOA 3OTHA 4PCUA 3ZI4A 4GBED 1VZ3A 4KE8A 2VDWB 4WCFC 1STOA 1ZD3A 1GXSB 1NQOA 4KYVA 2BSAA 3RTBA 3GX1A 4BUZA 2R85A 1HF3A 4FBLA 2BRUA 5IP5A 3WGOA 3ZGVA 5GVRA 4RPIA 1I3MA 5FOVA 4ZALA 5K3DA 3VR6D 5HKAA 1AHPA 1I5RA 5KCMA 3T3MB 2RHLA 3SDBA 2FOXA 5BORA 4EY4A 4WLUA 5CAEA 3V1YA 3WKCA 2JKYA 2YX1A 1AHNA 3AINA 3NPMA 2PX8A 1DOHA 2PUCA 1LPSA 1BMDA 1YASA 4J0KA 4M89A 4ME6A 3W6NA 4GPD1 3VDRA 3ZDFA 1RZUA 2GK6A 1P4GA 1NP3A 1Z17A 1WHTB 2W2QA 2JLWA 1JN0A 2BT4A 1ZLXA 1VKJA 2XLCA 3H2KA 2BW0A 2XCLA 2PVPA 3OHMA 3PIRA 2A92A 4QASA 5L4LA 1FYVA 3QFSA 2XYPA 2ZOSA 1G19A 2Z2JA 3KB1A 4HRXA 2GWHA 3F6CA 4MV0A 4K9MA 3GJ8A 3THSA 5ER9A 3OWOA 5IH3A 3U7JA 2TYSB 2G9NA 1LSJA 4DZTA 1E79D 4MYRA 3FPCA 2C8VA 1MHPA 3QE2A 1FPMA 4O08A 4BO5A 4V0SA 2AVNA 1Z28A 2J5KA 1YR7A 2ZUSA 1FMTA 3Q4GA 3IXLA 2O0KA 4GKBA 3W6ZA 4L7VA 1Q0PA 3GN1A 2YDYA 3WWOA 4GRIA 1BC5A 2YWGA 4R1NA 3AM1A 4LI3X 2KWIA 6LDHA 1Q7BA 2JIOA 4JJGA 5CAEB 2JK0A 1NUPA 4KITB 1TYDE 3IUNA 4EFLA 2PL1A 3N6VA 1XEFA 1SVSA 3RKSA 3D7LA 5A3JA 5EJ2A 2W6JD 1G9TA 2PLFA 1Q0RA 2RHJA 1PR5A 1RWXA 4M83A 3A14A 2AR0A 1ONNA 1U90A 3R7WA 5J4VA 3FSGA 1TFRA 1F5NA 4XCVA 3ULKA 1IY9A 1VDMA 3EXAA 2O6HA 2LKCA 4L78A 4ARUA 4IKPA 2IPAB 2M6SA 5C52B 3W6PA 3MBKA 4PRLA 4WGFA 1XQ6A 3HJAA 5LQKA 4TMVA 1PQWA 2BFNA 2P41A 3SD7A 1G59A 5K3EA 4JBNA 5GTDA 1ZKDA 3KR0A 2UZAA 1ZVQA 3C7CB 3HYCA 4MOWA 1GO2A 3F1LA 4IOJA 5ECWA 3OOSA 1CFJA 4B7ZA 2WJIA 1ZJWA 1L5GB 4R0VA 5HKLA 4FQ7A 3MN1A 4M38A 4B9AA 3HXMA 2FN8A 3DEAA 1N7GA 4RFLA 3X1JA 5B36A 3Q5EA 3IMGA 2DTEA 1VE6A 1ZGCA 2V6JA 3ZLBA 3HXPA 3SFTA 1URPA 2WABA 5ESDA 1P1KA 3BQNB 2JI9A 4O0MA 4P32A 2BCEA 4X00A 5G2OA 2AOTA 2ZJ0A 3P19A 5I9SA 3UKOA 2J32A 2NO6A 3ET4A 2VPZA 3GAZA 4WXYB 3R7WB 2VF7A 3WLFA 1YZ3A 5DP2A 1TU3A 1VE7A 3JD2A 3LV8A 4BNFA 4ZCIA 3M1AA 2OILA 2W4MA 4A2WA 3CEJA 4EUFA 4LZPA 5BV2P 1N5JA 1TYAE 4L3VA 1L4FA 1E2IA 3RU2A 1QZZA 4E14A 4M9UA 5B57C 3RV3A 1M6EX 4Y2PA 3S2EA 2ZTSA 5LXTF 4I9HA 5IS2A 2D59A 4BNZA 2G8LA 4RBNA 3WDMA 4Z4CA 3OY7A 3IUYA 3VPXA 1Z5OA 1DEKA 3HVKA 5CR9A 3ADDA 3O75A 2W48A 4LZOA 2GCGA 1NBHA 1RI5A 4I3GA 5LP1A 3VSCA 3NRBA 3VMMA 2GM4A 1G5RA 2R5NA 1USWA 2PD6A 1ZZEA 5TMEA 3HADA 3K9LA 1ID8A 3TNDA 3R20A 3F97A 1LDMA 3ILHA 1UKZA 4Z0NA 2AYYA 2XYHA 1UMBA 4UUAA 3HB4X 5H02A 2AOTB 1K86A 2IOYA 4DQLA 2BE7A 3FMVA 4MCJA 1I0ZA 4WCDA 3E7PA 4J16C 1SJ9A 1XZEA 4K0RA 4KH0A 4WY2A 1DG1G 1LDGA 3UENA 1GPLA 4BHTA 2TECE 2FLWA 2VYVA 4L1KA 2YWJA 2FMTA 3IDAA 3SEFA 3DYIA 3G5UA 2DFLA 4LWZA 5CM9C 4CKBA 2PRZA 4RLQA 2JLVA 2R8RA 2D5BA 3CEPB 3VVLA 1ULSA 3U4CA 2HMSA 2PMBA 4E5SA 1V3UA 1WSBA 3TL6A 3DMTA 1SHLA 4EPXA 3D4PA 4NZ9A 1QIEA 3NOQA 1DRVA 3EAQA 1Z2AA 3QI7A 4JNCA 2NAFA 4IHJF 2PMCA 5CDYA 5LYJF 2I22A 3AY0A 2WVGA 1P5FA 3QNMA 2WT4A 4PGAA 4WECA 2O48X 2J31A 4GYWA 1WVMA 4KODA 1Q7EA 3NOOA 5BSFA 3AB8A 5F64A 2FMFA 2IKQA 3D6UA 4PPFA 2YMPA 1UMBB 3E9DA 5DGTA 2WIJA 1A0OA 1D0SA 5CX1A 3QVGA 5EAIA 2G9RA 3PXBA 2I33A 1AGXA 1K5HA 3NVDA 2JARA 3CVUA 2A7QA 2XCQA 2BLNA 4IRUB 1T34A 2PLAA 4P5EA 2QG9A 1NQAO 4UEKA 3UJ6A 1JSLA 4PSAA 4DPLA 2J87A 4V0KA 2PZLA 3DG9A 4E94A 1ESDA 5DHUA 5LNK1 4CKBB 3SVZA 1HXHA 5IC4A 1QV6A 1WXXA 1R8SA 4HMOA 5FUBA 1XVLA 4J2HA 5GJCA 3ZCSA 1EFPA 1D6NA 2B8WA 2QUIA 1L4EA 3IIJA 4FE7A 1JU4A 3RHZA 3SM3A 3U9LA 2QT0A 2RGXA 1ZJZA 3DE1X 3IDOA 4BC1A 5AO9A 4H0NA 1P7CA 3KM0A 5ALOA 5DXFA 1FUYB 2G1KA 4JUIA 3W3AD 1E2EA 1UBRS 2DLNA 1FYDA 1VYUA 2EDCA 2F7SA 4NJMA 3QI2A 3VNVA 1JEQA 1R8QA 2OMKA 3H5TA 3T12A 5JY6A 1UF9A 1G5HA 2PX0A 3ZCXA 1U81A 5IKEA 4ZVKA 1GAJA 1W0KA 2PRYA 4G5SA 1F06A 5CX1B 3QVGB 1P7YA 2B6HA 3CBGA 3AUXA 3FCEA 4XXHA 4FS3A 1XL0A 1M7BA 1IWPB 1XX6A 5AW1A 4Q9AA 1JTFA 4DSTA 1GL7A 2RARA 2XADA 3EZXA 2WF9A 3KKPA 4H08A 3X0DA 1XCPA 2PZEA 5JOQA 3ZDQA 1KH2A 2FAXA 1EFPB 1TCAA 3MJSA 1KIFA 3N53A 3GG9A 3NALA 5HDQA 4JI5B 2NVOA 3GC6A 2VAPA 4OYLA 4E2FA 1H8HD 1WZCA 3ESXA 3PNMA 4NL4H 5F23A 2MYUA 2GTPA 4NJMB 1V48A 2OZEA 3O2NA 3MTGA 1JEQB 5KSOA 4DQDA 5HJ2A 1YRWA 4BS9A 1M1NA 1QGDA 4RK6A 3O6VA 5C1OA 3PTZA 3C3PA 5D1NA 3FKSD 3H2JA 3GN2A 5FBWB 3BDVA 3GOHA 4MPDA 1Z4NA 3U16A 4MI6A 1IXYA 5HWSA 3OM0A 2CLEB 3TQCA 2XBMA 5K0EA 2ZFUA 3C7AA 4D8YA 1AZWA 1E1QA 4G9EA 1F4LA 3FKJA 3IAM6 4DJ5X 5JC8A 3H0CA 4BYMA 1W1WA 3TIFA 3IJPA 4RVFA 1D4OA 2XJ9A 3JZIA 3PC2A 2RMKA 1FZTA 2IYRA 1EJ0A 2G6TA 1KHTA 3C4QA 2CNNA 2GFHA 2PU7A 2Q6LA 2G0TA 2G28A 4NBLA 4QVKA 2XYQA 3M7IA 3AVXA 1SKMA 1SC4A 3RUAA 2ZSUA 4ER3A 1BS1A 1NYRA 1E9CA 1M73E 2EQ5A 4G41A 4I1RA 4JEHA 2G1AA 4WKPA 1T24A 5DHPA 3SK0A 5HXAA 1N33B 3HJCA 4EARA 3K1TA 2CKMA 5CYGA 2J59A 3LNTA 2OO7A 3W4KA 3JD0A 5CEEA 5FTNA 5KYYA 4ENPA 3MB5A 4B73A 4DPKA 3LC1O 1DQZA 1JG2A 1PFVA 1M1NB 2Y6VA 3PXAA 4OQNA 1TUIA 1U9IA 3AR4A 1K7XB 2C00A 4CI0B 2PUGA 2BUCA 2BSQA 1SBQA 2HMAA 5FA6A 3ZXUB 3IP5A 1PL7A 1A95A 5LZ8A 3U9SA 4UU8A 1M8KA 3UFBA 4EATA 2V0CA 3UT5A 5TGZA 5ILQA 5IANA 2CMHA 3MWKA 2GM3A