3V4RA

Crystal structure of a uvrb dimer-dna complex
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
588
structure length
586
Chain Sequence
b'DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein B
molecule tags Hydrolase/dna
source organism Bacillus subtilis
publication title Crystal structure of the UvrB dimer: insights into the nature and functioning of the UvrAB damage engagement and UvrB-DNA complexes.
pubmed doi rcsb
total genus 189
structure length 586
sequence length 588
chains with identical sequence B
ec nomenclature ec 3.1.21.5: Type III site-specific deoxyribonuclease.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 3v4rA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v4rA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v4rA01
1G9XA 1N5IA 2FJUA 2DHRA 2ZUDA 1GIAA 4Z8YA 4NKRA 1GAJA 4EAQA 5CB6A 2OCBA 2X2FA 3FE2A 1RW4A 3QKTA 3W3ZB 3AVYA 4A0FA 2F43A 1ONBA 4D0GA 3AQ4A 4JVLA 4OQNA 2JIZD 1S96A 1DTSA 4LJ9A 2HYIC 3EZ2A 4B34A 3K53A 5AUPB 3IO3A 1VG1A 1T0JB 4AD8A 3RABA 1F5NA 1EK0A 1FUKA 2J0UA 1MRNA 1HQYE 2WJYA 1KI1A 2QRNA 1GL9B 1VCMA 5GJVC 3SDZA 3Q7QA 5TDHA 3I4LA 1U0JA 2NZJA 3LDAA 1II8A 3K1JA 1AZTA 4IDPA 2CL7X 1Z29A 2GHIA 2HLDA 1UFQA 2KBEA 4URWR 5HE8A 1FW6A 2QSZA 2C8VA 4L16A 2R6GA 1UF9A 2TMKA 4QJ3A 2WJHA 4DJTA 5L3QA 2W2TA 4QBHA 4RFVA 5J4YA 4DCUA 1XTRA 1J2JA 2FPLA 2WMOB 3B85A 3SQXA 3AVVA 4PZZA 3OFND 2ZI9A 2ZRMA 4J0QA 1F6BA 4BWYA 3IBYA 4B76A 4CT5A 3BGWA 1R8QA 2VLIA 2AFIE 4Z51A 5KNDA 1R5OA 3CF2A 2GZHA 3NBZC 2X19A 4BFTA 3W9YA 4KBGA 3VMFA 4RZXA 3OF5A 2PX3A 3AVOA 5AWFC 4WW0A 5DLQC 2A30A 1L4UA 2I1VB 4B75A 2ZRJA 3ZJYA 1QHNA 2XB2A 3TMKA 1KI4A 3CZPA 1P3JA 1CF4A 2YYZA 1W4CA 1GP2A 3DL0A 4P4SB 4BLSA 1IY2A 1KO4A 2WJGA 2FMXA 3B1WA 4YMSA 4ESVA 2DYKA 2WAXA 2GKSA 5EE5B 1LY1A 1WRBA 4P0TA 4POAA 1XEFA 2ZJAA 1JI0A 2BBWA 4MGZR 1G5TA 1TX4B 3A1UA 2ZYTX 1Q12A 3T12A 1F48A 3AF4A 3K0AA 1ZD1A 1JB1A 3RC8A 2EW1A 2GXUA 2HXSA 2OEPA 4UJ5A 3AB3A 3GLFB 1NG9A 2Q0HA 1H65A 2GAOA 2OLKA 2ORWA 4N1AA 4XSHA 3AGPA 3P1JA 4NHOA 5JJKA 5FPSA 1GL6A 4MYUA 4D0NA 2VBCA 2Q3FA 1NSTA 3KUDA 2ZVQX 4TL6A 4EPWA 4ZIRB 5KSYA 1NJFA 4GL2A 1YZTA 1DAIA 2ZAOA 3HYRA 2YOGA 1P75A 1AK2A 3I8SA 3L43A 3WBJA 3QKRA 1KI6A 2OO7A 4LBWA 4LYFA 3CH4B 1KI9A 4CW7A 4B3CA 1SHZA 1OSNA 2FFHA 4TQAA 1P73A 4YC7A 1VTKA 4WVFA 1DBSA 4ZKEA 4OHVA 4P4UA 5JECA 3R9WA 3B1VA 3IIMA 3QI2A 2XTNA 3GLIB 4Q00A 4HI0E 1OYYA 1EFRD 1KDPA 4NYIQ 2W6IA 1N6PA 2WWHA 1JJ7A 3D7MA 4JLOA 2P3SA 2JLSA 2PEYA 4MKFA 4IW3B 1N5LA 2XAUA 4U5XA 1ZU4A 4JYCA 4RZ3A 4P4SA 1CJTC 1SKYB 3GLHB 1VYUA 3PEYA 5DHFA 2PX0A 1CXZA 3GJXC 2XNDA 4YDHB 2RAPA 2WM9B 1GILA 3MWYW 1K8RA 2CNWD 2G88A 5K8TA 4AK9A 4BASA 4URVR 2XGJA 2DCUA 1W7AA 3DHWC 5JSZA 1D8TA 2EVWX 2HYDA 1KO7A 4PO1A 4DSUA 5FL3A 3WHKA 1OH8A 4NYIR 2H18A 3UG7A 4YLGA 1BYIA 1P9WA 1OB5A 1P2TA 1HQCA 2QGZA 4LBYA 1OB2A 1E9RA 3QXCA 1IJFA 2ERYA 1F2UB 4TMKA 1KSHA 2YVUA 1E2HA 4WBSA 4A2WA 4MDFA 2I3BA 4L9SA 4RD1A 5KNCA 1GM5A 1JPNA 4TTPA 4LC0A 1UKZA 4KAXA 3FGNA 3RYTC 2QBYA 1FUUA 4ZDKA 4PAMA 4V0LA 3VU9B 2WZQA 2Q9BA 3CRVA 2WBLC 3QNUA 4HEJA 4MA4A 4O3MA 4QNRA 4KFRA 1XEXA 3N70A 3KZ1E 1TQ4A 4HDCA 1ETUA 1ANKA 4EUNA 1RFLA 1XJCA 1SVWA 1BMFA 1QZXA 3LVRE 4Q03A 2VP5A 1GNQA 3MCAA 4OQMA 3X2SA 2VP6A 2ZI5A 4DT1B 1OT3A 3MJRA 2EFCB 3THXA 2OM2A 1L2TA 3DO6A 2C04A 3GMTA 5F2EA 2Z43A 3O8RA 4HUTA 1LF5A 5B64A 4OKSA 1CR2A 2WSSD 3OAAA 5CJPA 2AKYA 1L8QA 2BOVA 4Q4AA 1A2BA 3ONWA 4JVMA 2NPFA 3RRZA 3GLFA 3PJRA 1KAOA 2F1RA 2OFXA 3L0IB 3LX8A 3B7GA 4H1VA 3SOPA 5AJWA 2X2EA 3R9IA 2X1VA 3CF0A 4KLZA 3DOFA 1RRCA 1U90A 4II7A 2A3RA 2IF2A 2QU8A 4DC9A 2VP2A 5F3WB 2ANCA 2YC4C 4CIDA 1T5IA 2DWQA 2WKRA 3GPLA 1LFDB 1ZMXA 3KXIA 2WWFA 1GNPA 5KU1A 2ZRGA 3QXXA 1IOZA 1TL7C 4V0MA 4LX0A 5L3VA 4TMTA 5CM8B 3RS0A 3W6OA 3A8TA 4QOSA 1KMQA 3U5ZB 2EWVA 3QXSA 3GFPA 2GXSA 2RHMA 4DLSA 4ERNA 3HDTA 2BIFA 2G3YA 3MLEA 2ZANA 3V4FA 4Y0VA 5EP4A 2KB0A 1IXZA 4BFSA 1EFHA 3I8XA 3PR1A 3UK6A 1KK0A 4B48A 1YKSA 4US2R 4WOPA 2NTYC 1IAQA 3R7WA 4IKEA 4HLDA 1E9SA 4M1MA 3VR1A 2XXAA 1RPZA 2QG6A 4URZR 1KDRA 3SC3A 1HE8B 2LCFA 1Z0JA 1Q3TA 4KHZA 3ICQB 3SFZA 2P0EA 4AG6A 1K5DA 3Q9LA 1E0KA 1FTNA 1S9HA 2IYZA 4TSFA 2IYVA 4OI1A 4BLQA 4DSTA 2QL6A 2C9CA 2QM8A 3V9PA 1U8ZA 2WMNB 3C5CA 5KTYA 3OEED 3E5HA 4LCBA 4MRRA 4Q5IA 1UDXA 5EE9A 2O0KA 1BO6A 4MKGA 2AFHE 1P62B 2UVQA 4JLMA 2O8DA 3M0EA 1N6KA 1E9EA 2JJ2A 5KPJA 1MO4A 2GCOA 3IPXA 3QOFA 2ZETA 3SJZA 3ZS8A 3ADCA 1QG2A 1OIXA 4LJ4A 4LJ8A 1R5BA 2SHKA 4L15A 821PA 5ELXA 3VR2A 2ATXA 4IDQA 3TAUA 4EIWA 1E99A 4LJ7A 5CM9C 4LJ6A 2ZRDA 2R65A 3BERA 3BOSA 3PQCA 5JWRA 5DNYB 4PPGA 3WP1B 4A8JA 1MO6A 4Q4HA 3C41J 3PFIA 4PPNA 2FG5A 1AS2A 3D3QA 2G0NA 2EQBA 4OQFA 1H8HA 3CPHA 2RB4A 2UKDA 2C9YA 2ZI7A 3T1QA 3ZLJA 2IYYA 4NU0A 1UBGA 2PLRA 1DAMA 4BLRA 4TYYA 1W0KD 5JS7A 4US1R 3EXAA 2ODWA 3K0AB 4F93B 1T3HA 1JALA 4DCVA 4DHEA 4AC9A 4NCJA 4JL6A 4DLTA 4D0LB 6Q21A 2JLYA 1VCNA 1DAKA 3WMFA 2BVNA 1KIMA 4DDVA 5L3SA 3L0PA 2PH1A 2QGNA 4TYPA 1MKYA 1ZM9A 5LDDC 1NSFA 4FMCB 1OFHA 5HE9A 3P4XA 4G5SA 1X8JA 1ZU5A 2V54A 3X1YA 3S1AB 2R6FA 2O8DB 2JLWA 1E3MA 1E96A 1KI8A 1N5JA 5FR1A 4AY2A 2G9NA 4TMXA 3TSZA 2OUKA 4JL5A 1SKYE 3FHOA 1TNDA 3KDSE 1JQJC 2H8KA 4AYXA 3TJZA 1O87A 2MMGA 2NQ2C 2XX3A 3OE7D 4I1SA 2OFOA 3UMRA 4G01B 1SVSA 3ZQJA 4V0NA 3RWMB 3I5YA 1XX6A 1ESMA 1E1QD 4JLDA 3GLIE 3REFA 1EFTA 4TZ6A 1RRPA 1B23P 1M74A 4BFWA 3MWJA 1T91A 4D25A 2WOJA 2VHJA 4Q1DA 1KKLA 4E5UA 2YWEA 4TMWA 1D9ZA 2IEZA 5J4VA 2UZIR 1MOZA 3OEEA 2GNOA 4RD0A 3BH7A 3K0EA 3Q8XB 2HF8A 1X8KA 4HAXA 4MYHA 1BS1A 3SNHA 2RHDA 2YWGA 1F3OA 2VIIA 4MQBA 2GZAA 1B0UA 3W5IA 2WV9A 4JJKA 2IW3A 4OJKA 1AQYA 2G1JA 4KFUA 5TMPA 1W5TA 1CLUA 4B3BA 3PEUA 2BMFA 1XTSA 3IBGA 4LOAA 3BAFA 3OIUA 5E4FA 2ODNA 1TQ2A 5FOXA 1JEDA 2PZFA 3K9HA 4V0OA 2C9OA 3GJ4A 3TKLA 2VSFA 4Q7LA 4TL7A 5E3HA 1ZM3A 4IFBA 2XOKD 3BB1A 1Z6AA 4B73A 4PXAA 1D9XA 2FFQA 4OK3A 1XF9A 5G40A 3TLXA 3QVUA 4B6EA 1HH4A 1XBTA 3FYHA 2IA5A 3TSWA 4D4LA 3SJCA 1Z83A 4IJMA 3SR0A 1BIFA 1SXJE 4A9AA 3RWOA 3LV8A 3H84A 3K0CA 4FMDB 5JJIA 3KQUA 1QHHA 4BEBA 3SN6A 4A82A 4QBFA 2V1XA 4GP6A 2NO0A 3KKPA 4HB2A 3GCGA 4A92A 2BKUA 5J5CA 1NN3A 1UEIA 5FI1B 4C3ZA 2VF7A 1S1MA 1O3YA 5DHAA 1DARA 1OFTA 3KB2A 2ORIA 5LD2C 3SU8A 1Z0FA 4US0R 3AVWA 4D4KA 3I73A 1OH5A 3IKJA 2JATA 1NBMD 4IRUB 4QFMA 1KMHB 1TF7A 4MKIA 2GAAA 2VHQA 2Q21A 3ETLA 2IXEA 5IDVA 1AS0A 1N6NA 4HDOB 4ARZB 2AK2A 1DEKA 4AKIA 4JYBA 2BC9A 1S4QA 5HCIA 2VHTA 1GRRA 3AKDA 2JDIA 1NVXQ 2J7PA 3EASA 2P2LA 2GXAA 1XEXB 4IVQA 3HWSA 5HZKA 2CHQA 3EARA 4MUAA 3VQTA 1MR3F 1U81A 4GDFA 3LBNA 3P27A 1P9NA 1GKIA 2KI5A 2RGNA 1ZC4A 2VHUA 3AKYA 1Z0KA 3IPYA 5KSPA 3NEYA 3NXSA 1A1VA 2V7QD 4QRHA 1P2VA 2GESA 2EWWA 2NZ8A 3KUCA 3LQRA 1PLLA 4C0KA 4JBWA 4PANA 2ZR9A 4NCNA 1DG3A 4EJSC 3P32A 4GSYA 1ZD8A 4HB4A 4BLPA 2D7DA 5FFMA 1KGDA 1NG1A 1E4VA 3QENA 2GCNA 5KUTA 2BJWA 1IN5A 2AXPA 1JJVA 2ZYWX 4C7OB 4KCGA 3GFTA 5FBLB 4WZAE 2OBLA 2WOOA 3CH5A 4ILEA 1XCMA 2DR3A 4E03A 1HUQA 2JEOA 3TVTA 4JKIA 1RRFA 1KNXA 3I92A 1GUAA 2HJGA 3RSOA 3GQBA 1E2PA 2YC2C 3P26A 2ODEA 4TLBA 2HEIA 1RE0A 1ZINA 2ZSEA 1G7CA 2ZXUA 3A58B 4F4JA 3B8HA 4CGZA 2F1HA 3U7GA 1AJEA 5A5GA 4PHFA 2CEAA 2NO6A 2RGCA 3QSYA 3VNVA 2REOA 3MFYA 4C0LA 4XIGS 4OQLA 3CZQA 4UQOA 2ZUBA 5JWHA 4ZKDA 1E0SA 4Q7JB 5FPKA 3UXMA 1N6RA 2JJ2D 2AKAB 4HSEA 1JBKA 2NG1A 2W58A 1KHTA 3CIOA 4M4SA 4XVRA 1N6OA 2AR7A 2PMKA 1D2NA 1U98A 2FX3A 3SI7A 1SVMA 1GWNA 5KHOC 2WWWA 4D81A 2A5YB 2P6RA 2NPIA 1BH2A 4PC6A 4GFDA 2A5DA 5CDFE 1GNRA 3D8BA 3VNUA 2W6JA 5JI3E 1G17A 3HR8A 1N25A 5DN6A 4DLVA 2AN9A 4D4MA 1N0WA 3NKVA 1MABB 2NGRA 4IEIA 1A82A 2OXCA 3RS5A 5H68A 1IM2A 4FWIB 1XB2A 2HV8A 4R9UC 3EAQA 3EA0A 1TQDA 3K9GA 3L8ZA 2CE7A 3TQFA 4DDTA 2GZDA 3BBPA 2QORA 5BN4A 1G3UA 2H5EA 2O8EA 5FPHA 4EFNA 4A6XA 2GWHA 4Q48A 2W2XA 4DWJA 2J0UB 4TT3A 3U3MA 1GRNA 1XTJA 3EIHA 3HR7A 3P4YA 1OFUX 3FFBA 2V7QA 1U9IA 3EZ6A 4LDJA 1M1YE 1YR9A 4TN1A 4A0RA 2O8CA 1E69A 2ZJ5A 4YMVA 4Q7MB 2L0XA 3A4NA 1E2NA 3HU2A 3MGCA 1RVDA 2XNDD 4A1FA 4DB2A 1OPXA 3N2EA 3NVAA 4BECA 1JAHA 1DADA 3OIWA 3W90A 4RZUA 3U7EB 4KFTA 5CYPA 3I3SR 4TWZA 4C4PA 4DFCA 4C0AC 3CRMA 2R6AA 2YKGA 1QHXA 2AWOA 3RAPR 4Q9KA 4ON9A 3I72A 3MJHA 1NP6A 4LBVA 1RJ9A 1QDEA 3KXLA 2J0VA 3WNBA 3B82A 5FUXA 4PQYA 4Q18A 2RMKA 3DMDA 1Q20A 4Z1MD 2J45A 2V9PA 2V8OA 2Q9CA 3MMPA 2ZRCA 4YDSA 4JKYA 2QEQA 2CL6X 3HJHA 5EZ5A 5EXXA 1UEJA 4TYQA 4JLJA 4LGMA 3WYGA 2Z83A 2F55A 3WXMA 3AEZA 1J70A 3FPAA 3OHMA 3N2IA 4E07A 1W49A 4PPQA 1AIPA 4BRWA 1XNJA 1H8EA 1XD9A 2OV2A 4QM6A 1UM8A 2VPPA 2ZJOA 2V6JA 3NWJA 3MWLA 3A6PC 4QBGB 3G5UA 4KVGA 4HZUB 1IY0A 1II9A 1W1WA 1M7BA 4R98A 4A0GA 3M1IA 2O8CB 2ZS8A 1KY2A 2IYRA 1US8A 2CCKA 3U4QB 1E98A 5BN5A 4JLPA 4I1VA 3AVTA 1UADA 1I4TD 2Q9AA 2VQSA 3KJIA 1NVUQ 1Q0UA 3F8TA 4M1OA 2OCPA 4DLZA 1AKEA 2MSCB 3T35A 1GITA 3EPKA 3RS7A 3SYKA 4A4DA 2R8RA 4I1OA 3AKCA 3X1WA 4GOXA 4CEIA 1ZNXA 3KTAA 4P31A 4O25A 2WJIA 2GBLA 5GADl 4BFXA 2WVJA 4IOMA 1SQ5A 4PSKA 2P65A 3WNCA 3E70C 3L82B 1CJKC 4JLNA 2NO7A 3GLHA 2YWHA 1RIFA 4Q1AA 3PEVA 2ORVA 4L4UA 3BK7A 4DXAA 1P4SA 1RYFA 3GJ3A 4RFSA 1UDWA 4BLOA 2B6HA 3L0OA 1Z3IX 3BIFA 5BWMA 1FNMA 2Z0MA 5DSZA 1NBMA 4MITA 4JMPA 5FI0B 3GLGB 3H4MA 2OE2A 5EP2A 4MRPA 5DYGA 1G4AE 2R2AA 3VR4A 3U60B 3P20A 1E9FA 2F9MA 1NVVR 5CYOA 4PTLA 2H57A 1SZPA 3KJEA 1SKQA 4YXWA 2QT0A 2WPDA 3PITA 3NG1A 4HAVA 2ZRIA 4G1UC 3AP2A 2J46A 1T6NA 3B1XA 1QBKC 4NDZA 4Z8XA 3UWOA 5J4LA 4D2IA 1TF2A 1TUIA 3VAAA 3K09A 2QP3A 1P72A 4C0JA 2IX3A 2QMOA 3PUVA 3QVVA 2XOKA 4GT1A 1IBRA 2IC5A 4KSCA 3U6BA 3GJ8A 1XTIA 3MRSA 1KTVA 2EFEB 2W0SA 1A5TA 2QA5A 3DDCA 3SJAA 4BEJA 1G41A 3ZZTA 4Z54A 1N6IA 5AJYA 5BN3A 4L8GA 1QVAA 1W2HA 4B2PA 1XMIA 1BOFA 3EZ9A 3THWA 1J90A 4BZQA 2DFKB 4LZZA 3Q7PA 5KSZA 2O0HA 5LBIA 1P2SA 2XB4A 3SE0A 2ZM5A 1KYIA 1EXMA 2YZ2A 2MSEB 1ZNWA 2C03A 2F3RA 4LRWA 1WQ1R 2ZI3A 4F38A 4G3XA 3EC2A 1OF1A 4M9XA 4CEHB 2OZEA 5K8IA 1JR3D 4NMMA 3TR5A 3THOA 3A37A 4OHYA 1SVIA 4DDUA 4N0DA 1IJEA 1KK1A 1HEIA 2VP9A 3X1XA 1XXHB 4F4IA 3RNLA 5AUOB 5G53C 1SXJC 1EG7A 4F91B 3KQNA 2ZQ5A 1TEXA 1YHNA 2PEZA 1SHKA 2KE5A 2ZROA 4ASUD 2YHSA 3FPNB 2FH5B 2PZEA 3WMEA 1XD2B 5FUVA 5J40A 2F9LA 1WA5A 2DPXA 2D62A 4QG7A 3W6PA 4HYYA 2GVDC 3UMFA 2IUSA 3ICEA 2JLRA 1VIYA 2AK3A 2PT7A 3QBTA 3I32A 2ZU0C 4H9GA 3BFVA 1QRAA 4PSAA 3LO5A 3H0KA 4QNMA 1LTQA 4AIIA 2BMJA 2VP4A 4FCTA 4C0SA 2C96A 3MAAC 3FMOB 3OE7A 5KYKA 1P2UA 3KB1A 3DKVA 3KTAB 3K0SA 2ZYUX 4QL3A 1COWA 1HURA 2WIBA 4ABYA 1E9DA 4CEJA 1IXRC 3R8CA 2FFBA 4DEYA 2XZOA 2W2VA 3OEHA 4XJXA 1R2QA 1UKYA 2OXRA 5G3ZA 4EPTA 1IXSB 2GDJA 4HZIA 1ZIOA 1NY5A 4NYJQ 1T3SA 1S3GA 3CRQA 5EZ6B 4ZPXA 2O8EB 1KJYA 1IY1A 3BORA 1DAFA 5JFGA 1Z63A 2A5JA 4R2IA 1D2MA 1SVOA 4LY6A 3RS4A 2HT1A 1XWIA 1UJ2A 3B78A 2Q3MA 2IYUA 1X86B 3RSLA 2CXXA 3NEJA 3SJBA 3KX2A 5GVSA 2J0QA 2X8AA 2B92A 1E32A 2BMDA 4JLKA 4TT3D 1YR6A 1T9HA 4K81B 1XD8A 2IBMA 1ELOA 2A2ZA 3L0SA 2LWIA 3QPVA 5FOUA 3T15A 2FSHA 3KFVA 4ACAA 2FEOA 3DEFA 2N42A 4CVNA 2V4ZA 2VSXA 1M8PA 2G77B 3FTQA 4NZYA 4TLDA 2CMKA 4HAUA 1J99A 4K8OA 2OCAA 3PUZA 4TSFD 4TTQA 5GVRA 4AG5A 1Z6YA 3NC0C 1RJ9B 1NL3A 2A78A 2REXB 5DI3A 4B6FA 1SVKA 3T1OA 3IEUA 3FWYA 2LKCA 3PXGA 4M1YA 3TAHA 3VX3A 3AVQA 4W9MC 4WZ6A 1HY3A 4H1UA 4UNNA 3T1TA 4A8JB 1AGPA 5IHPA 5UKDA 5CITA 4QBIA 1ZIPA 1JR3A 5GJBA 2RGEA 2J7PD 2IWHA 4M9QA 1Z6XA 5JZVA 4LPSA 3RHFA 2HCJB 3ZGXA 5JEEA 2JLUA 3OEHD 2BEJA 2REBA 4N0EA 5FR2A 2ZIAA 3QKUA 1Z28A 1KO5A 3QY0A 4JT2A 2OBMA 3QBVA 2CHVA 4RCYA 3UG6A 4W7SA 1ZBDA 3IDQA 1X1SA 1Z2AA 3RDPA 3WBKA 5DE3A 1FTSA 1ZNZA 1VG8A 3BS4A 2CLSA 4JS0A 1G64A 1ODFA 4G5OA 3EPJA 1WF3A 4A6PA 4QKQA 1R7RA 3SHFA 4DLUA 1Y63A 3A1VA 5D3QA 4BUJA 3QEOA 4V03A 4LYJA 3DMNA 1XXHE 3LVQE 2HLDD 3FMFA 4HATA 1AZSC 4M0LA 5LD2B 1TQ6A 2DFNA 2VA8A 3W5JA 2FSGA 5HZHA 4TLCA 4Q4LA 4PC7A 4B2IA 1PV4A 3EW9A 2J59A 1W4RA 4GOKA 2QTHA 3O8CA 1KNQA 1W48A 2C99A 2ZITA 3FVQA 2ZS9A 4QGFA 1TU4A 2ZPTX 3C16C 2JJ1D 2R44A 1E2KA 1JR6A 5BYJA 3Q5DA 3ZVMA 4HZUA 5F9FA 4ZI2A 1XMVA 1G8YA 4YMUA 4UNRA 2WICA 4DCSA 5D3MB 3FFAA 3W8RA 1PZNA 1E2JA 3DZDA 1YZNA 2QTVB 3FOZA 4M9ZA 4PC1A 1OE0A 4PAOA 3A4MA 3CLVA 3EIEA 3MUFA 1W4BA 4NPHA 1XDBA 2ASEA 2GEVA 4E22A 2ZUCA 3WY9A 4D80A 1FMJA 1Z06A 5TY0A 2ZREA 4Q9IA 4Q66C 3IQWA 1E79D 1Q21A 1D6JA 1QVRA 1N0UA 3LXXA 5TVKA 4V02A 1CP2A 4X8HA 4MRVA 3VR6A 1HTWA 2JJ1A 3MSXA 4YXWD 5IRCD 1Z8FA 1W2GA 1OXXK 5AUQA 3CX7A 2O8FA 5HPYB 1E2DA 2IXGA 3EWSA 2I4IA 3R9XA 3QE0A 5EE1A 5L8VA 3LNCA 1G7RA 5CJ2A 1G6OA 4LK2A 2YINC 5HCNA 1XU4A 1GSIA 2A5GA 4LJ5A 3EX7C 4FCVA 2PCLA 1VG9B 4O2RA 5JWOA 1EFUA 1TMKA 3ZS9A 1H8HD 2J87A 4LHVA 5AR1A 3RRNA 3AKEA 2QMHA 4HAWA 1NY6A 4C0HA 3IIKA 4IXMA 1Y3AA 4DVGA 3VHLB 4ZV4A 4FW9A 1G3QA 3LQQA 3SFVA 1X8LA 1YRAA 1DELA 2D2FA 4JSTA 1DPFA 1MO3A 4GP7A 3ZVLA 4BE7B 4DBLC 1GZSA 4O2LA 5EJEA 3C14C 721PA 2ZYVX 1C1YA 3OESA 2D2EA 3PUYA 2GEDA 4DLXA 4ZIRA 4U00A 4BGDA 4C2UA 1CJUC 4G0NA 1AKYA 5JHGB 1UBCA 3CNOA 3TBKA 5FUWA 1U2RA 3SYNA 1R4AA 3MG9A 2V1UA 2HF9A 2XZPA 4PX9A 1MRSA 1XCGB 1XFAA 2ZRBA 1GDDA 1SGWA 3EA5A 1IN4A 3EZ7A 1RYHA 3ADDA 3GLIA 3BB4A 2NMVA 5IT5A 3ZZ0A 2IS4A 4LUCA 1OXVA 3KKOA 2ZSFA 3OIYA 1W46A 3CB4A 4A15A 3E1SA 5EE3A 1OHHA 4DRZA 3DM9B 3V4RA 2EFGA 4IDNA 2A5FA 3LLUA 4QHSA 4KU4A 4Q7KA 3TRFA 4B3XA 1AS3A 1GRQA 3TUIC 4KO8A 1G21E 4ESHA 3ZVRA 3QG1A 4JBYA 2FOLA 1BMFD 4AKHA 4FXPA 5B2ZA 1JAIA 5BW8A 1XMJA 2RGBA 2ZR0A 3B60A 3IQXA 1X3SA 1PVOA 2KBFA 2VSOA 1AA9A 1QHIA 2FN4A 1FP7A 4KBFA 5SZHB 1XXHA 2BV3A 3OZXA 1M7GA 1P9RA 3UWKA 2W83A 4MDEA 1F2UA 4FN5A 4XSGA 1K6MA 4EPXA 4YMTA 3W6NA 1Z0AA 1W47A 2AD5A 2FU5C 4TLAA 5FPYA 5AJVB 1PJRA 2AX4A 1G16A 2EU8A 1G3RA 2HCBA 5C4MA 2OESA 3EIQA 3VU9A 5B58C 5E7IA 3AM1A 3C5HA 2F7SA 3O8BA 3T06B 4JZKA 4PQRA 3RS2A 2ZJYA 4BZPA 2QMEA 2AD1A 2QE7A 2QMUA 4GMXA 4Y0AA 3AH8A 3NHAA 1KY3A 3AP1A 4M1TA 1U94A 2J7KA 2XJ9A 1Q22A 4I4LA 3WRXC 3EWAA 4MYCA 2QP9X 3CWQA 1XRJA 1KOFA 2QROA 3SQWA 3LWNA 1PLJA 3PUXA 4DDWA 2QP4A 3K0FA 2YV5A 1CIPA 4DCTA 3PEWA 2GXQA 1CR0A 1NMZA 5F98A 1NLZA 5DH9A 4C9BA 1AQUA 1E79A 1WP9A 3NIBA 3L8YA 2QENA 4KJZA 2Q6TA 5GJWC 3WRYC 4BFUA 3U6KA 1KO8A 1CR1A 1YZKA 4TTRA 4D82A 4UXIA 3AVPA 2OCYC 3CKLA 3UIEA 2GJAA 1MO5A 4ZCIA 5IK2A 4URUR 2JDID 2O52A 4WZBE 4AWXA 2JAQA 4BFZA 3QPWA 3ADKA 1R0ZA 2R9VA 3KKNA 2JA1A 1CEEA 1VCOA 1AM4D 1TAGA 1NMYA 2D06A 3B6EA 3I1FA 5FL7D 1E0JA 2BBTA 1U8AA 1FMLA 3W3AA 1YU9A 1L4YA 4FD2A 4JLAA 3ZVNA 5A4JA 2ZSBA 1TEVA 4M22A 3N5CA 1UAAA 3DZ8A 3PVSA 4KLNA 2FA9A 1CTQA 4F7WA 4AI6A 1R0XA 3CWZA 1JEEA 3GD7A 3HP1A 1X6VA 4HLUA 3O8DA 1GFIA 4UXHA 3FB4A 3CX6A 1W36D 1DAGA 1QHSA 4PFSA 1FQKA 3ZYCA 1XPUA 4DT1A 4FIDA 1WXQA 3TE6A 4AKGA 5BQ5A 4S2EA 3TH5A 3IIJA 5FTKA 5FOWA 3K0FB 2Q3HA 3UKDA 1W44A 5KNBA 5KO2A 1KI7A 4A8JC 1TUEA 1R0WA 5AJZA 1G3MA 1XCPA 3LW8A 3C8UA 1MT0A 1QG4A 2G0TA 3BH0A 2QQ0A 2E87A 4MKHA 1VKJA 1QHHB 4IOLA 3I5XA 3FKSD 4WIAA 5JHHB 1SVLA 2OAP1 3GEEA 2FF7A 4W5WA 1G4UR 2H17A 2QN6A 2X77A 4Q4AB 4OL0A 3RANA 4EDHA 2IHBA 4GOJA 1PLKA 2UZ3A 1KK3A 3EPHA 1E6CA 2CBZA 1Z08A 2Z4SA 4AKEA 1LVGA 3QIAA 1ZJ6A 5JJLA 3VKGA 3GEHA 1XJQA 1FX0A 4P4TA 4DKXA 2XITA 1TADA 4EPYA 3AF1A 3H86A 3AP3A 1NKSA 4TYWA 1UBEA 1KSJA 1T8TA 1YRBA 3EC1A 3O47A 1FOEB 1OKKD 5L3QB 1R10A 2BBOA 1OJLA 3NTUA 4QXAA 2ZE8A 1ZCBA 1JXOA 2CLDX 4ARZA 1CU1A 2BEKA 1E0AA 2F1IA 5C4GB 1Z5ZA 1S8FA 1G8GA 3IO5A 1E4YA 4LV5B 1KO1A 1YZQA 5KDDA 3WNDA 3SZRA 5C2JB 2PJZA 3U44A 2JLZA 1F2TB 3LAWA 2H92A 2QRZA 2ZSAA 2QM7A 3WYAA 3PV0A 2GRJA 4JT4A 1N0VC 1P7CA 3DOEA 2IL1A 1Z6TA 3K9NA 2JIZA 4DIDA 2GK7A 3R7WB 1AN0A 2WPDD 2IUUA 4MRNA 3BE4A 1FZQA 2JGNA 1WE2A 2LKDA 5DISB 3U3OA 2C2HA 2E1RA 2FGKA 2ZE6A 5CLQA 5FBWB 521PA 3T34A 2XNSA 3SS8A 3UMSA 1OKKA 5TB5A 4ZCMA 5J47A 1Q3HA 1S1CA 4PR0A 4LI0A 4WA7A 5FPTA 2DB3A 5E95A 4C0QC 3JZMA 4LC1A 4BLTA 3LRPA 3TQCA 2Z6VA 4X8OA 4A36A 1DAHA 5FBQB 3VFDA 4DEXA 4UJ3A 2ZJBA 1KSGA 1KJWA 3FMPB 2FDCA 4EKDA 1NRJB 4XD7D 2XJ4A 5FOVA 5AUNB 3H2YA 1ZM7A 4XVQA 1M34E 1NN5A 3GFOA 4C30A 1JNYA 1QF9A 3T5DA 1G291 2OG2A 2WKPA 2O8BA 2J5XA 3FWLA 1VYVA 4TMVA 4TL9A 1Z0DA 3KFXA 1LF0A 2O8FB 2CK3D 4M2LA 2C5LA 2DWOA 2JASA 1RRGA 2ZRLA 1V5WA 2R6DA 4Q4HB 5CIWA 5JCPA 5KOYA 3GLHE 2QAGC 4B32A 3V00A 4KYUA 3RRYA 1XJ0A 3NC1C 1LS1A 2FE4A 2IYTA 3C15C 1GTVA 4A2QA 4PO9A 1E1RD 2CHGA 1XPOA 2ZR7A 2EYQA 1KAGA 2IK8A 4MRSA 5TV2A 4XH9B 4S35A 1YZUA 4PHTA 3HYTA 4A0HA 3FHTA 2QZ4A 4HAZA 4KVAA 1GKUB 4L9WA 4PPFA 1V43A 2BM0A 4XWAA 2ZRPA 2WWIA 4KFSA 4LPKA 3AVXA 5DGXA 2XSZD 3R20A 4UXJA 1T4GA 2P6UA 4CYMA 5BXQC 1TF5A 5FOSA 2NO1A 2DY1A 3CPEA 2ZS7A 2WWXA 3LXRA 5FBVB 2QBYB 3NBYC 2QT1A 4U7DA 1HYQA 4RJLA 3S1AA 2OT3B 3ASYA 3LD9A 4DSNA 1IN7A 1SXJD 2ZRFA 4ZCLA 4NYMQ 2JCSA 4IOJA 2F6RA 2Z4RA 1R5NA 3K8YA 4BFVA 3U44B 3QF4B 1F2TA 4WXRA 2CJWA 4YONB 1IQPA 4EQ6B 2QI9C 4GPTA 2RH5A 5AK0A 3VKWA 3CR8A 5JS8A 3HU1A 4OI4A 3TSOA 5K8UA 1OLOA 2VH5R 3QXJA 2CNWA 3A1TA 2IUTA 4HLUC 4M8NE 1W0KA 3KJHA 3TIFA 1CKEA 5JCZA 3VR3A 4LV8B 2FEMA 5TARA 2O0JA 2C78A 1DE0A 4BFYA 1YE8A 1OIVA 3HPQA 3RS3A 1ZVQA 1ZCAA 4JL8A 1XD2A 5EXSA 4FCWA 5EXPA 2H1LA 4N3NA 1LS6A 3LBHA 3NHBA 4LHWA 3I62A 3TK1A 5EP3A 2CL0X 2VP0A 3AF2A 2IEYA 3ZZUA 3GLGE 3TR0A 1NVVQ 4EJSA 5DI9A 4M21A 5FUYA 2IWRA 2DWPA 2IYXA 3C7KA 2ODBA 2ZRKA 3EZFA 1M2OB 5DN6D 5JRZA 2A9KA 3CM0A 3DPUA 1C9KA 1Q1ZA 3BFXA 1RC8A 2OHFA 1A4RA 1JQLB 4UKDA 2BWJA 2GJ8A 4M53A 3U61B 2CE2X 2RGNC 2WIAA 1YZGA 4AYWA 3MD0A 1G7SA 1CJMA 1J8MF 1N2CE 2QE7D 2QQEA 1ZRHA 2AWNA 2GF0A 3BB3A 3LW7A 3TW8B 1SULA 2W0MA 4LHZA 1IN6A 3HJNA 4GI7A 4RD4A 1G3IA 1MH1A 2O8BB 3U3JA 4DLRA 1HT2E 1EESA 1ESNA 1GVNB 5IF9A 4B3GA 4QGAA 1I2MA 1NJGA 1QHYA 4LV6A 4DLWA 1E1QA 1KK2A 2WWGA 2CJWB 3CRRA 2KWIA 4JVNA 1XPRA 3E2IA 1J7KA 2PJRA 4V0KA 1TU3A 1KDOA 1XEWX 4OHWA 1CULC 2J9RA 5P21A 2QSYA 1Q1EA 2BDTA 3JVVA 1GG2A 5JBQA 4DB4A 2A7QA 2FGJA 1G19A 2WSMA 3QPUA 2N46A 3GJ7A 3FDIA 3KXKA 1VIAA 4M1KA 1JR3E 1OYWA 2AHOA 5FTMA 5B30A 5J4KA 3VMAA 2W00A 4C0BA 1EGAA 1N6LA 5HTKA 2VL7A 1KKMA 2FSFA 1NMXA 2P5SA 2EYUA 4ZDWA 3SBDA 2QUZA 4IXNA 4LBZA 4EJSB 3D31A 4PC3A 3DVLA 421PA 4OHXA 1II0A 1ZP6A 3VX4A 1Q1QA 1Q57A 1HA3A 4GBMA 4DSOA 4C7OA 1KMHA 4DUGA 4NE2A 1Z0IA 2IXFA 4PO8A 4JVSB 2WSSA 3OAAD 4KV9A 1OXSC 2ZE7A 1F60A 2D3WA 4PHGA 1S0UA 2FSIA 1SXJA 2BJVA 3Q5EA 2GJKA 1R8SA 5SZJA 4QJ5A 1KI6B 5G3YA 3B5JA 3CNLA 1E2LA 3Q72A 3SYLA 4URXR 2PZGA 1NKTA 5LB2A 1Z2CA 1CRPA 1NBME 2DFLA 4K46A 3ZD7A 3RVBA 4YMWA 4RSGA 4KYIB 4O0MA 4RD3A 5B57C 1NIJA 5TXGA 4BQSA 4URYR 1S2MA 2DBYA 4HB0A 1XTKA 2ZE5A 2Z5FA 2VO1A 2ZEJA 2XTZA 1KSFX 4Q1EA 1PUIA 4Q19A 3KQHA 3LH5A 4MGIR 3WMGA 1G8HA 2YWFA 4LYAA 2P67A 3EG5A 4B3FX 1I4LD 1E9AA 3K09C 3CW2A 4EFMA 3IHLA 4W5HA 4G5GA 5HKKA 2QAJA 3OIVA 1W36C 1QHGA 1ZD9A 4CF7A 3VKHA 4IEEA 3BH6A 4B74A 2P6NA 3NH6A 1NVWQ 3LX5A 4CEIB 1FX0B 2VF8A 2O5VA 1NF3A 4PHHA 4QHYA 4JLBA 5ANRB 1ZAKA 1DOAA 4B3DA 4RCZA 4XWKA 3K0CC 2R62A 4OJQA 1NNEA 3NBFA 5EE0A 1VCIA 1ZC3A 5SZIA 3VR5A 3Q3JB 2ZJZA 2P5TB 3BC1A 3Q85A 5CK4A 4LHXA 4GMDA 3ASZA 4OBEA 4CT4B 1E2QA 2IYQA 4M1SA 3X1ZA 4JSYA 1P5ZB 1DAEA 3WHLA 3ZH9B 2D7CA 4U02A 2WJVA 3TGPA 1EFRA 2PMDA 1U8YA 4PSVA 3R8FA 1TTTA 1U99A 3BFKA 3K70C 2BCJQ 2XZLA 2QPTA 1C4OA 3BXZA 3REGA 2YOHA 1OH6A 4Q02A 2YOFA 1R6BX 3U7HB 1NI3A 4F4CA 1DVRA 4MGKR 4NYMR 4Q01A 1XZPA 4GZLA 4DIEA 4EFLA 3AUYA 5CB8A 4KXFB 4CRWB 1WDTA 4LWZA 3KJGA 2GEUA 5FTJA 1CS4C 5EUQB 3K70D 3SHWA 4JIMA 3PG5A 3UANA 4BZXA 3CO5A 3U2QA 3LBIA 3QJYA 5H1YA 5M04A 2D74A 2ECKA 4Z1MA 4G5RA 4IVPA 4FMCF 3LY5A 4NTZA 4UNPA 2OAQ1 4ZO4A 1ZW6A 5JI2E 1W0JD 2W6ID 3A1SA 1G8PA 1N6HA 1ZUHA 4B2LA 4W5JA 5JLJA 3BJIC 5HKKD 4B35A 1MABA 1NLYA 5F9HA 2HDNB 4HDQB 1BYUA 2J3EA 2BHRA 2PLFA 1U9IC 1E2GA 1NN1A 2FV8A 2GA8A 1DS6A 2GTPA 1Q1BA 1SXJB 5KSOA 2ONKA 1X1RA 3THWB 1EX7A 1G1MA 1MV5A 2Y8EA 2WAYA 2GK6A 4RD6A 1WMSA 1M7HA 4CEHA 3LLMA 1G18A 2CDNA 3QF4A 3A36A 4NBSA 1ZM4A 4TZ0A 1NIPA 3AVUA 3L2OB 3QXHA 3PIRA 3DM5A 3AGQA 2JLXA 2B7BA 2ZU6A 2RCNA 4HUQB 2BM1A 3OFNA 1YVDA 1OFIA 1UKVY 3X1DA 5DIFA 2V55B 4PQFA 2QTFA 5G41A 2D4HA 3NDPA 5SZKB 3ADBA 4XTCS 5KDLA 4KSBA 1DO0A 1P6XA 1E94E 2E9SA 2B8TA 1T3LA 2K5UA 4IOKA 2GCPA 3WYFA 2CLCX 4R7ZA 1BKDR 5H70A 5IK2D 4P32A 5LPNA 4EPRA 5E7MA 5DI3B 1VHTA 2OSBA 1VMAA 4KI0A 4P33A 2R6CA 1CRQA 5KDOA 2AL7A 3TNFA 1VECA 1N5KA 4WXPA 5E7JA 4I81A 2WTUA 1P60A 4NL4H 4ZI3A 4B33A 5K8LA 1VYTA 4GRAA 2VHCA 4FI3C 3FMIA 1IONA 3FKQA 1YZLA 3WP0A 2B8WA 2IS2A 3LFUA 1OW3B 1N3BA 2ZRAA 8OHMA 3QG5A 2WJJA 1NLFA 2H7VA 3QQ5A 4ACBA 1R0YA 1L7VC 2CCJA 2I1QA 1LNZA 2N1BA 4OI2A 1Z47A 1GL7A 1Z22A 1XZQA 2BBSA 2F3TA 2OBNA 3F0TA 3QKSB 4EQ6A 3BWDD 2HJVA 4IDHA 3KL4A 1FFHA 3CONA 3ND8A 1YQTA 4BPBA 4D4JA 5FBRB 2CK3A 1ZNYA 2GJSA 4ZDJA 3U4QA 3C4JA 2BCGY 4OQXA 4R2HA 4CZ2A 3PENA 1M6NA 1KZ7B 1D5CA 1VDZA 2GF9A 2ZRHA 3NH9A 1S9DA 1ZUNB 5CLLA 1W0JA 3GLFE 1HT1E 3J81k 5C1BA 1KI3A 3GJ0A 4QGGA 1ZUIA 3HPRA 5DYIA 2J1LA 3DKPA 3TW4A 3HU3A 3TUJC 3RLFA 1E2FA 5EXTA 3U7FB 3PUWA 1FQJA 4Q1CA 4TLEA 1LW7A 1OH7A 4OK5A 3GJ5A 2VTKA 5FTLA 3AF3A 4A2PA 1I2DA 2GVZC 4PAQA 1GOTA 1IN8A 2QAGA 2OFWA 1EFCA 3T5GA 4JLVA 1U0LA 5L3SB 2JLQA 1E9BA 3EPLA 221PA 4RZ2A 4OK6A 1VG0B 2XTMA 2FWRA 5FTNA 2WHXA 2WKQA 1EX6A 5FH9A 4RFSB 4ITRC 3G82C 2BKEA 4Q9JA 1G6HA 1Q44A 2FFAA 1OIWA 2CVFA 2ZI6A 2MSDB 2GETA 2GJ9A 2FZLA 2J41A 3VTKA 3BRWD 1E2IA 2NO9A 4HLQB 1COWD 2QPAA 1E9CA 4PZLA 2G83A 3THYA 2VYFA 3KQKA 5AJXA 2QPOA 1UPTA 2ZI4A 5C46F 5D3MA 1S3SA 2C98A 3B1YA 3NBXX 1II8B 4NCHA 4DLYA 4ZDIA 4XVUA 3CPJB 1UBFA 4RD2A 4Q9HA 1H8ED 4HUQA 1EWQA 2G1KA 3IILA 1PUJA 2IYWA 4JBXA 3B13B 4GNKA 2JLVA 1K5GA 2IF0A 3B1ZA 3AF0A 4MYTA 4D6PA 4NYJR 2ZTSA 4R71A 3QKRB 5DO9A 121PA 1HE1C 2NIPA 2VRWA 3QF7A 1XMSA 3U3KA 3IEVA 4X8LA 1T8UA 1XTQA 4F92B 4TQ9A 2BMEA 2RKOA 3RC3A 3UATA 3ZDQA 1G7TA 1P61B 1FPMA 3ZD6A 1XEWY 3W34A 4Q1BA 1AGRA 1UKEA 2ZVPX 5EUMA 1DG1G 3K9LA 2QY9A 4NH0A 3ZIAD 4QM7A 3I61A 4Q9LA 4JJZA 4X8MA 5H8WA 1VHLA 2ZJ8A 3AV0B 4GZMA 4I99A 4WAUA 4YQFA 1JXMA 3K70B 2ZJ2A 1G5PA 1RZ3A 4IDOA 1WB9A 4CEJB 5JRJA 5J4HA 1FNNA 2OLJA 2IYSA 4IVRA 4Q4JB 2ZSDA 4RKEA 3U3RA 2ZRNA 1CBUA 4AURA 4EPVA 2IT1A 3IHWA 1YR7A 3F5FA 5JSZB 5CDFA 5A0FA 2YJTD 3QKSA 3GEIA 3IUYA 3A1WA 1LB1B 2AXNA 3TUZC 1Z07A 5GJCA 4B43A 2GILA 4AYTA 4PZYA 5BYKA 1G8FA 4NCKA 3B9PA 4Q1FA 1US8B 2RGGA 4LJYA 2MMCA 1OXUA 1DO2A 3AUXA 3D6TB 1E1RA 4OYHA 2J0SA 4KITB 1ZM2A 4V0ME 1A2KC 1E2MA 2C95A 1W36B 4CDGA 4L5BA 2EFHB 4ASUA 3B9QA 3RRMA 2FNAA 3H1TA 2HT6A 3M6AA 4Q21A 1WCV1 2XSZA 4NONA 1FL9A 2RGDA 2F1JA 2ANBA 1IHUA 3LA6A 4OHZA 4DZZA 2FZ4A 2QAGB 4D26A 2V3CC 3KKQA 2PCJA 3QUSA 2OILA 4BRUA 1EWRA 4LHYA 1E2EA 1G5RA 1KJZA 4MUBA 5EQTA 1Z6GA 2CCGA 4OI0A 1G20E 1WBBA 3T61A 2F43B 1JECA 2VEDA 3CBQA 1W5SA 3CRW1 4G5QA 4NP6A 3CR7A 1CR4A 2RGAA 2IYLD 2FPKA 2KSQA 1LV7A 4Q4JA 3FKSA 4B44A 4MGYR 4DCNA 3KQLA 2JJ8A 2RGXA 3GLGA 2PT5A 5FL7A 2PBRA 3THYB 4RKFA 4B71A 1JPJA 3QEJA 4QJ4A 5L3RA 5FOTA 4LSGA 2HXYA 3MWKA 2G6BA 2C77A 4UNQA 4QHTA 2XEXA 3KKMA 5LB4A 3B2EA 1KI2A 4TQUS 4M9SA 1FP6A 3CUEF 2WWYA 3T1VA 1VPLA 3BD9A 1I4DD 1HV8A 2IS6A 3NDBB 4HB3A 1J8YF 1XP8A 2EFDB 3JVUA 4MH0R 3TVDA 4QC2A 4TMZA 2QNRA 1D2EA 1GKYA 2KJQA 4DUGD 1A7JA 5JMTA 2B7CA 3SEAA 4E09A 1U0HC 1YR8A 4UNSA 2ZAMA 4P3YA 3JZAA 5CIQA 4FWTA 3ECCA 2HUPA 2PL3A 5C18A 4KODA 5JEDA 3THXB 3F3YA 4XTRA 3IGFA 3CF6R 1KDTA 621PA 2XXAB 4FINA 1NN0A 3A4LA 5HR5A 1W4AA 3W8NA 3SBEA 2FPMA 2NOAA 1T0HB 1OHHD 4IFEA 2H16A 4Q47A 2ERXA 1ZYUA 2ONJA 1T5LA 4M1WA 4LJAA 4PC2A 4QGHA 4RY2A 2IS1A 1RKBA 1WBDA 5EP1A 4C2TA 3ZIAA 1TPZA 3CX8A 4LYHA 3M4YA 4FMDF 4I1UA 5CK5A 4TYNA 2W6JD 2IHYA 2V6IA 3G0HA 2DFTA 3PCRB 3GJ6A 2ATVA 2B21A 3FHCB 3VHXA 4NCIA 1CJVC 1KZGB 1OV4A 4XD7A 2GBLC 4IHQA 4XOIA 3ZQ6A 4TL8A 4HLCA 2YNMA 1YJ5A 1OXTA 4B47A 2B2NA 4RVCA 3GP8A 2GCOB 4XWOA 3CNNA 2CVHA 4HAYA 3ND9A 5KPDA 3UPUA 4FMBB
chains in the Genus database with same CATH superfamily
1LCIA 1M34A 4HFJA 5AQ1A 3IE1A 1HFJA 2R6ZA 1EWYA 4Z8YA 1GAJA 4JR0A 5H9WA 3SQMA 2X2FA 3EISA 3BDIA 4YECA 4R3NA 3SZUA 3HYSA 3V8NA 2AJDA 3B20A 3WOVA 3QU7A 5KJEA 3QKTA 3AVYA 1V6AA 2WQ7A 2F43A 5E1OA 1T36B 5F51A 4KL8S 2QTNA 4CM8B 2GBPA 1GLNA 3ORRA 3EZ2A 5BSFA 1QLJA 1HDCA 2RH4A 2RJ3A 2W90A 1VSTA 1VG1A 1T0JB 2G04A 5LC1A 4AD8A 2FPRA 2BEUB 2NXEA 3CLTD 4G1VA 4YP1A 3FUVA 2AXQA 2J0UA 1U9JA 2JNWA 3NM5A 3DR3A 1VI6A 1OVGA 1DV2A 1U0TA 4MRMB 3SDZA 5TDHA 3D8TA 3IE2A 3HB0A 1I1QB 3H75A 5LDDC 2O23A 2J5BA 2PX6A 4EFKA 1Z29A 1BX1A 2F3UA 2HLDA 4DQKA 3WK9A 3PJRA 4KR3A 1L7QA 3DFUA 1IZ7A 4TV9A 3AEQB 3OEWA 4RFVA 4QBHA 2GBIA 3DD5A 4P2BA 5CAEA 2PUHA 3NT2A 3DQZA 2BF7A 3CLRC 4PZZA 4RA6B 3CZAA 3TL2A 4N76A 5JNTA 4MMXB 4F96A 4L7QA 1BDHA 3ETJA 4NCAA 3PNVA 2C8JA 2VLIA 1MB0A 4ZVVA 3NYWA 1NQTA 1R5OA 1WKCA 2GZHA 1XZHA 2MHCA 2NQ8A 3CA8A 3NVDA 4OVKA 4WNAB 1R6UA 1J4AA 1JA1A 4KBGA 5I7RA 4RZXA 3OF5A 1K0UA 2P9QA 1XK6A 4WW0A 1DC7A 3WZ2A 4RMHA 4BGIA 5BSVA 2ZRJA 3ZJYA 1QHNA 5JU6A 2JCYA 3CZPA 2OXEA 4PGMA 1CF4A 2YYZA 1DINA 1W4CA 2C4TA 4P4SB 4YT5A 1DCMA 1ZA2A 4BLSA 5ADWA 5DCUA 3N87A 3C6QA 3HRHA 2DYKA 1VLLA 4I4TF 4L6AA 4I3HA 4ZCRA 1QP0A 2AW5A 3UFBA 1WRBA 1QTNA 5I4IA 2IUYA 4PIVA 2VI5A 2JFBA 1NNI1 2M1ZA 2ZYTX 4BO3A 3FF1A 4GC9A 1F48A 2B30A 3AF4A 3WLAA 2O6LA 5CB0A 1Y9ZA 4RM2A 4AB1A 1MOPA 4UBIA 1BH6A 2PQ6A 2Q0XA 5DHTA 3S2GA 4UJ5A 5CNIA 2Q99A 3DTNA 3U26A 2Q0HA 3ZXXA 5AW7A 2OBFA 4R5HA 2GARA 4N1AA 1UDCA 2B4QA 4XSHA 3AGPA 2QRGA 1OFUA 5CX1B 4AM8A 1KH3A 3BWBA 4UULA 3S44A 1JDZA 4MDHA 2VBCA 1HLGA 4DVJA 4S1PA 3IRUA 5IT4A 4PVCA 4EHDA 1QX4A 1TE2A 2ZUSA 2ZAOA 3IUEA 3WBJA 1P75A 2GLTA 3I8SA 5ICFA 4AXBA 1K1EA 1IIRA 5ICSA 1R4ZA 3CH4B 3I04A 1W5BA 4WINA 2EAUA 2CY0A 2PR7A 1KMIY 1UMCA 3PRHA 4MWOA 3TR6A 3TQHA 5K7SA 1BEZA 1UIMA 1CQJA 2XH8A 3B1VA 4IYJA 1VPDA 1VMIA 2XTNA 5JATA 4HI0E 1OYYA 4UM7A 2XYHA 3ZK9A 4NYIQ 2W6IA 1KETA 1N6PA 2JFXA 1YC5A 2WWHA 5LQKA 3D7MA 1W9HA 2Z9BA 3L8DA 4GPZA 1SHTX 4MKFA 2GN9A 1EP3B 3PKJA 3GF4A 3VHRA 4E70A 1N5LA 2XAUA 1CJTC 5IKEA 1VYUA 3T3NA 2VK2A 2PX0A 5KJ1A 1CXZA 4B8WA 4BO4A 1WHTB 1UXJA 2DUNA 3VVMA 4R8VA 1EAMA 3JS5A 1AB5A 1AV6A 2G88A 2CNWD 5K8TA 1KFCB 1QLWA 1T5HX 2I65A 4QXQA 4U2DA 1XDDA 4NBRA 2WRZA 4ENSA 1YQEA 4D9FA 2XGJA 2W6OA 2C4KA 3DHWC 2DTDA 3BMXA 5JSZA 3WKBA 2EXXA 2WU1A 3MWDB 2EVWX 2GBFA 4OU4A 4EYSA 1KO7A 5JFTA 1QWSA 4DSUA 5FL3A 4OA8A 3DOJA 3K5PA 4NCXA 3HSSA 1IHOA 4UVHA 2P3LA 1VBKA 4NYIR 4PX2A 1XZGA 1ESZA 5HK9A 3D4NA 5IPFA 1YBFA 4L85A 3DO8A 4A23A 2KX7A 3FUCA 3K0BA 4RF4A 2QYSA 5F35A 1Q17A 1KSHA 2HBZA 4A2WA 1FDTA 4XKJA 4L9SA 3GGJA 3W3AH 3OD1A 5I7EA 1UKZA 1TO6A 2GMWA 4RKWA 4MVJG 3RYTC 3QPDA 1CUFA 2GLUA 4ZDKA 4DJDC 1Y8QB 3UVEA 5JT1A 2WZQA 1TMOA 3EQ6A 3OEYA 4MWBA 2QW8A 4M3NA 1DCTA 2G0AA 1TQHA 5JDCC 2ZSJA 1ZLYA 2UUAB 2FY8A 2R48A 4IIJB 3OQVA 4QNRA 5J5VA 4FYXA 1OAAA 1XEXA 2FWJA 5LZ9A 4J16A 3LPNA 3Q11A 5EEGA 1ETUA 1ZCJA 5K2MA 3UWSA 1JIJA 2XPCA 1DZIA 2XQIA 3IXMA 2A9JA 3MHTA 1XJCA 5K51A 4K9KA 4NMHA 1Q14A 2EGHA 2BKXA 4ISCA 3RYFA 4DMMA 4PX3A 1VB3A 3MCAA 5JTUA 1FDUA 3A28A 3EEIA 1SC9A 1V2HE 3DH0A 2ZI5A 4DT1B 4JLUA 1K7SN 4FYWA 1TC2A 1NQ5A 2FB9A 5L3ZA 2FPWA 5DWQA 5D1HA 3ER8A 3AM3A 3DO6A 3B70A 3BJEA 1B0PA 3UYKA 2GFQA 2Z43A 4GVLA 2B4KA 2HBQA 2HRCA 2WYOA 3O8RA 2CSXA 5IYZA 1DAOA 2WD7B 2FXVA 3RV3A 1JW9B 1YZ3A 1VOTA 4W5RA 1Y7PA 1P4GA 2SKDA 3FTEA 3RRZA 4YJFA 5IANA 2JIMA 1U04A 3DE2X 3ONWA 1YH3A 4K2HA 1NASA 4YQZA 1KAOA 2PZLA 4YT8A 4G56A 3QKIA 3L0IB 3B7GA 3STTA 1NMEA 2CUKA 1F1BA 1GM5A 4RX1A 2A3RA 3JQFA 4XZ3A 3K16A 1N5MA 2PVSA 2P35A 2FQXA 4AUKA 2YC4C 1TUBA 1O5OA 2DWQA 4IINA 1OZAA 4W6QA 3H04A 3MOIA 5D3KA 1ZHOA 1OROA 3L6BA 3Q1LA 5CM2Z 4K9SA 4YJDA 3V4OA 3QBJA 1M2JA 2Y77A 2ZJ6A 3QXXA 5MN5A 1LTHR 1PJZA 4YCLA 4BVFA 5EPEA 3QX9A 1GCUA 3N3BC 3VPBA 3MD9A 4MUJA 5CM8B 1WV1A 3A8TA 3QV1A 4KK4A 3H87A 3U5ZB 2EWVA 3LL4A 3QXSA 1ZESA 2GXSA 2X7JA 2RG1A 1SPXA 3BDAA 3I6QA 4CF5A 1K7XB 2VNJA 3V4FA 1CVIA 5EP4A 5FO1A 2UU9B 2IIVA 3R9XB 1BEUB 1MH9A 3NIFB 1IXZA 3WTBA 1Y9EA 1EFHA 3I8XA 3SNKA 3HJTA 1RJFA 5KQPA 1YKSA 3GVHA 1MDFA 1J07A 4OBWA 2GR9A 3RVRA 1JFFB 4US2R 2NU7B 2NTYC 1JKXA 4IKEA 4DZTA 1L4FA 2XXAA 1R6XA 1I6KA 4F2DA 3D6MA 1ORIA 3UW3A 4P3OA 4BMPB 1RPZA 3EC7A 4Q82A 1CP3A 5IEBA 3SOZA 1VJGA 2LCFA 3A6DA 4DMCA 1Z0JA 2LRHA 3G5LA 4N3AA 1JZSA 1VQ1A 4IDGA 4KHZA 5JPCA 4KXLA 5HRCA 2C7PA 1E5QA 3AR4A 3GD5A 3OCXA 9ATCA 4JBLA 2IH4A 4TSFA 1K88A 2GGSA 1DMRA 2C9CA 1Y6ZA 1UWVA 3RR2A 3U19A 1U8ZA 3RRXA 4HVAA 1LRKA 3EGCA 2RSLA 2Z9DA 3M83A 3TQTA 4YRSA 4QWWA 1X7XA 5C35A 3E5HA 4V2IA 1NFRA 3UK7A 2V7WA 3UOAB 2YJ4A 4AIRA 3VDNB 4UUOA 5HWSA 3H9CA 4MKGA 1M5TA 5J59A 2FWBA 1H2FA 1EAYA 4REOA 4EYEA 3DLHA 3M0EA 4OSEA 4UVGA 4X1KB 3OCUA 1JQAA 4WFIA 1M2FA 2QSJA 1N6KA 2W6NA 3QOXA 2P2NA 4PV7A 4KPYA 5A05A 2OD9A 3OP1A 5EZQA 2RAFA 2VHZA 1H3EA 4KXWA 2X41A 4F45A 2DPGA 2HBRA 1VYHA 1R5BA 2QV0A 2SHKA 2N1MA 1THZA 2DP4E 4E5PA 2W11A 4EIWA 4BVEA 4RV9A 4XEUA 1GGMA 4BLWA 4I8DA 3BERA 2IE0A 3OPXA 5DNYB 4A8JA 4PS1A 4PPNA 3LWBA 3STXA 2G0NA 1P3Y1 2GAJA 2WMDA 4N7BA 4OQFA 1H8HA 3U7RA 5A9RA 5CB4B 2RB4A 5EZSA 5L95A 2C9YA 3QELA 4P22A 3GMSA 4W63A 3T1QA 3ZNNA 5IYZB 2W4MA 3HUEA 5K0JA 4U2BA 6PFKA 1A5AB 3KR0A 4US1R 5B3JA 2O2JA 4DHEA 3T7TA 4AC9A 4JL6A 6Q21A 2YDYA 1JKFA 1L5KA 2H1VA 3UHJA 5KYWB 3WMFA 1P2FA 2PMWB 5BUCA 3N2GB 1KIMA 5CLIA 2FKAA 3L0PA 3P19A 3V4PB 5JNUA 1MKYA 1ZM9A 2ORYA 3GVPA 1Y4AE 2GBGA 2W2KB 3QJ5A 3ID6C 2Z5LA 4RFLA 1OFHA 1VE5A 4M0UA 3DJFA 3P4XA 1VIMA 1X8JA 1Y7IA 3BFPA 4HH3C 3NALA 4AJLA 4O1MA 4P58A 3AJ9A 2VTVA 2O8DB 4G8BA 1N5JA 1VFNA 2EKBA 1L4KA 4DXHA 3LE8A 1NNSA 5IKMA 2XI4A 3FNRA 2G9NA 4GU5A 3WGKA 5HM8A 2PZBA 3K5IA 3O21A 1TNDA 1JQJC 4R69A 3U4CA 1YDFA 2I4LA 1X38A 1LWNA 3HM2A 5HCUA 2IYNA 1JIIA 2YL2A 4HPJB 1QWOA 2H4ZA 1J0AA 1PF7E 4I1SA 4NOJA 2V7EA 2JIPA 4L72A 3UMRA 2LCIA 1U0RA 4R8LA 3RT7A 1BMTA 3ZTTA 4V0NA 4OV6B 3WGYA 1C0EA 1XX6A 2YWCA 4BU1A 2UZ1B 5ARDA 1E1QD 3R7AA 5DPMA 3PJEA 2SBTA 3HJUA 4GXTA 4P7JA 5BW6B 3SC6A 3WWOA 1B23P 3QMMA 1V5FA 3VVLA 2E4ZA 4D25A 1TA4A 3MWJA 4GMFA 1IB0A 2E49A 1JLKA 1ZMRA 1TLFA 2YWEA 2BMAA 1QYCA 2GI4A 2GRUA 2WC1A 3H97A 2VJOA 1D9ZA 3PXXA 4TMWA 3SF8A 1DB3A 1FFWA 2BI7A 3DA8A 1D2GA 2GNOA 1AQNA 2FEXA 4RD0A 3K0EA 4BV3A 5AP9A 3Q12A 1X8KA 4YRRA 4UFOA 2ZUEA 3PL5A 1Z8HA 2AOWA 2VIIA 3IJEB 3KSRA 4XVHA 3H7IA 3SS7X 4E51A 4D99A 1N5DA 2GYUA 2HMTA 4MI6A 5JSFA 2WV9A 3O4JA 3QLJA 4JJKA 4WLOA 1RADA 4ZVPA 1A9QA 2R8ZA 4KFUA 4K6MA 1UK8A 3HJAA 1W5TA 4JLWA 5TMPA 2BMFA 1A76A 1XTSA 3PQ7A 5FNZA 5BUSA 4MQ4A 3LPCA 3OIUA 4UMEA 4G6ZA 5GTDA 1TO2E 1ODLA 1OBFO 1FEZA 3EEFA 3FFWA 3PQ8A 3NDRA 3EUFA 3FTFA 1P77A 2PZFA 5HILA 3REOA 3TKLA 4CUJA 3HADA 1IK4A 4FE3A 2VEOA 3BE8A 4TL7A 3PQ2A 3P4UA 1ZM3A 4IFBA 4IDCA 1OPRA 5IHXA 1CUVA 1JSCA 2FUG6 1JHXA 4I4TA 1U02A 2IA5A 3ACDA 5HIIA 5JS1A 3SR0A 3HO8A 2Q3LA 3M7IA 5CYFA 4BX9A 3G49A 1K66A 3SWWA 1FFDA 2XIJA 3LV8A 2HIHA 1SWWA 4FMDB 3AOGA 4HGNA 1USIA 4XB1A 7REQA 5AW1A 1TXGA 5JNRA 2R7NA 3NAQA 3CMCO 1U11A 2QX8A 1ECJA 1S2LA 4UUAA 4A82A 3OPQA 4O2AA 4PLGA 4A92A 4AZWA 1C7FA 4EW6A 5J5CA 2E21A 3VZRA 4C3ZA 2IS1A 5GWXA 5DNAA 5FRDA 1SIBE 2OPHA 3NKFA 1ZD4A 2HTFA 3W7VA 1D2CA 3FNEA 5BNZA 2D1YA 4DHWA 3L1JA 3NOOA 4KXMA 4M0KA 4YMGA 3ZPXA 1DXOA 2HU8A 3WL8A 2VHQA 3W7AA 2FDRA 3IL2A 4M8KA 2XZDA 2HQRA 2DF8A 1XG5A 1ZONA 3ZTWA 1C7QA 4HDOB 3HCNA 2AK2A 2HNKA 4PTZA 4RTRA 2PXCA 4BV2A 1JG6A 4ZYVA 4N5LA 2J7PA 3DNPA 2JA2A 2Q7DA 4QT0A 3P9YA 1YNOA 1BXGB 5D51S 4BAGA 2PMCA 4L74A 1AUOA 4GICA 3TEMA 1P7PA 1RP7A 5I8ZA 4K3UA 1GHTA 1V48A 3HUTA 4OGFA 3I2YX 1P9NA 3SE7A 4GDFA 2KI5A 2VHUA 5L40A 1NRXA 2JIOA 3A26A 5BR1A 4HNSA 2B35A 2GAIA 1XVVA 2V7QD 3MBOA 1ZHHA 2DFPA 4C0KA 1FNDA 1RAEA 1TLLA 1XSEA 3WX0A 4B7ZA 1H2BA 1U8CB 4L9RA 4CG2A 1ISFA 1XZBA 1QAMA 4NCNA 4EJSC 4RLFA 4ZVSA 1UM9B 3HXKA 4DC1A 1B8NA 3TDMA 4BLPA 3STUA 4Z6KA 4INAA 4JXKA 3Q3IA 1KGDA 1NG1A 3AERA 3DT8A 4G5XA 1IN5A 2AXPA 4BFCA 4GKJB 1NOJA 3NASA 3NBQA 4C7OB 3ZXYA 1CIJA 3FYCA 3OKCA 1UBLS 2P6MA 3GFTA 4MK4A 3NETA 1S2IA 2Y66A 4WLEA 5FBLB 3WOHA 2O3JA 1GG8A 4EUFA 2YHBA 1UPBA 2GTIA 1KMCA 3CH5A 1PI3A 2C2KA 2DR3A 3K1ZA 1J9GA 2JEOA 1H2AS 1QFZA 1P8AA 2CKMA 3I92A 5GV8A 5FOQA 3RHTA 1GUAA 5BURA 1BCRB 1KC1A 1RXEA 2HJGA 4ZZ2A 1N7JA 1MIOA 3GGDA 3P26A 1I3LA 2ODEA 3BGIA 2VRCA 2E4UA 4BBPA 4CJXA 1UJ6A 5KSWB 1JS1X 3ZQ4A 1FXWF 1KMNA 1JU3A 3F74A 1XUOA 3A58B 4F4JA 3B8HA 4CGZA 3R7FA 4PHFA 3S68A 2CEKA 1QDUA 2NO6A 2D0DA 3UJ3X 4ZGWA 3VNVA 4ZEWA 1MPTA 4MWCA 4OQLA 4QTZA 5TE9A 4UQOA 5K6AA 2ZUBA 4G37A 4WQMA 4ZKDA 5JQGA 1E0SA 3FBTA 1JHZA 4Q7JB 4ZD6A 4E6PA 3OLWA 3IAM1 1V9LA 2AKAB 4HSEA 2CJFA 4ZQBA 1Z8DA 1SWVA 1KHTA 1T9AA 4NAVA 1L3CA 3S7TA 3DDZX 5LQCA 4LZPA 2AR7A 4M46A 5J3JA 1KE2A 3CVXA 2PM8A 2H06A 1YQ9A 2P8JA 2FX3A 3SI7A 2Q2WA 4Z2AA 4C88A 2Y4NA 4GX5A 5CGQB 1Q1NA 4RYDA 4X92A 3I5UA 3COSA 4Y2TA 2P6RA 1BH2A 3CJQA 4YPFA 1C5KA 3AZQA 1L5QA 4XX0B 1T4DA 3C1OA 5IC5A 1XAGA 1OTHA 2OV4A 2VWQA 2X0KA 3EK2A 3H4TA 5HKBA 1CYDA 1YDHA 5FJIA 3F7TA 4JX9A 3I05A 3KE9A 2NGRA 4IEIA 4QYIA 3V34A 2OXCA 3TNLA 4D4IA 4UAJA 1BWPA 3LOPA 5H68A 4CM9A 7GPBA 3D0QA 2RAUA 2OL4A 4AZSA 2HV8A 4BZWA 4B4DA 4NAHA 5T8KC 3K2EA 3EAQA 3VPHA 1UXOA 2J6HA 4HTFA 3WBFA 1EFDN 1OZ0A 2BE9A 2XKAA 3F4LA 1MX3A 1Q83A 3RYIB 5P8WA 4EG4A 3GUHA 5D7BA 2DU8A 3HS3A 3LMKA 4L9AA 1A8PA 4YLYA 4HDMB 1LBTA 2H00A 3EGDA 5FPHA 4MEBA 2H8GA 1IOWA 1Q15A 3ETEA 1PHPA 3OCJA 3TLJA 2W2XA 4DWJA 4RPJA 1UMDA 4HQNA 3T4EA 3EIHA 1JHRA 3P4YA 1YFJA 2P41A 5C8YF 1Y1SA 2Q6KA 4B3SB 2EF1A 3T9BA 3K9CA 4LDJA 1YRWA 4YFYA 1XN4A 2V7TA 3E7PA 2VT7A 2V7VA 1E2NA 3A4NA 3RFXA 5I3ZA 2CZCA 2G63A 3JVIA 3R5TA 1OPXA 4WFKA 3M3HA 2I2XB 3MINB 3QW4B 4YI5A 4BECA 2PGOA 2W2OA 2NLOA 3O4IA 4PYMA 1EQAA 4RXTA 5H80A 4HGQA 4RZUA 4DUYB 4KFTA 3IH5A 4K28A 3BTVA 4QDKA 3QVMA 4TWZA 3WA6A 3K8OE 2QLJA 4PBTA 5BVGA 5BPFA 3FSRA 1DBWA 3E7XA 3M70A 4Q9KA 4QQKA 3R6TA 3PQ3A 3MJHA 3IP8A 4PZUA 2SCUB 4CDRA 2NVWA 4UTPA 4NSNA 1NXSA 3AOEA 3ETHA 3BJRA 3B36A 1Q20A 2CDAA 1EUYA 2J45A 2ZKLA 3TNYA 2HWKA 2ZRCA 3EVZA 3COWA 3O5AA 3HFRA 4JKYA 2HMYB 2CL6X 1PTJA 1LX7A 2VXBA 1K3TA 4GLJA 5IZCC 1JMYA 3WTCA 5EXXA 2CNLA 1UEJA 1UOQA 2DBZA 2PSDA 4MW7A 5EY5B 5B4VA 3QX3A 3OHMA 4RVGA 5FAXA 1OBHA 4DR4B 1W49A 3GJSA 2I7DA 3H05A 1NXTA 3SZGA 2C3MA 2XRYA 5FLEX 3RQIA 3O7MA 5I7AA 4BRWA 3EN0A 5AVQA 1UM8A 5LP1A 4Y2XA 3GCWA 3JY6A 3NWJA 4UCXA 1J25A 3GLQA 3EVDA 1NC1A 1YIAA 4YRAA 3I01M 2G9UA 1IY0A 3LUDA 2GEJA 1WUYA 3O84A 3RSZA 5IDWA 1M7BA 3G2IA 3FPLA 4OSPA 2CFTA 5F4BA 3Q7TA 1NAHA 2HMSA 3N6RA 4TZKA 4RWEA 1P4AA 4YEDA 1NF8A 3W8DA 4CXMA 3UZUA 4PYJA 3EH2A 1YXMA 1T9KA 1X3LA 3HDJA 1E98A 1C3XA 3M2TA 4URHA 2BFCB 1L5FA 1H0HA 1ZUNA 1LNSA 3SM9A 2XT6A 2VQSA 2WD9A 2YN4A 1NVUQ 3F8TA 2PXAA 1AKEA 3DTVA 2PN1A 1N8NA 2MSCB 4JB8A 3T35A 2CLIB 5F2NA 1GITA 4I5EA 3SDSA 4EYQA 1LH0A 4RK6A 1U0NA 3SYKA 4EYKA 4LC9A 1MX9A 5BT8A 4I1OA 1LNQA 2Q5JA 1KDVA 3RUAA 1AX9A 2VWHA 3TQOA 1AGNA 1M1YA 4QYIB 2H48A 3CURA 3D5EA 2GBLA 2Y1EA 1GFZA 3AB7A 2RGYA 3GH1A 4IOMA 4Y2SA 3USES 2P65A 4BFXA 5JBIA 3OJ0A 2DBQA 2R6R1 3E70C 3NZEA 2XAAA 3CG4A 4RIGA 3KTFA 3RREA 3W06A 2LBPA 4L4XA 1LDBA 4Q1AA 3PEVA 3BK7A 4YGYA 5E4JA 1O94D 2ALJA 4BYGA 3UJBA 1QVWA 5A5DA 1RRMA 1E77A 3LCVB 1JAZA 1NYQA 1QQBA 2G17A 2W2NA 4EL0A 4LZOA 3EIWA 2OKGA 1CS0B 2XT0A 4HSGA 4QOGA 4YJKA 5DSZA 3Q0EA 4KWCA 4WERA 4C0WA 2CXUA 2CV0A 2C58A 3V42A 1G4AE 2ZUTA 4E88A 2YVAA 1PZEA 2G8NA 4UUPA 1YRYE 3C85A 1GPWB 2IOFK 2ZYIA 5KWSA 1V7QA 1XKLA 4QPCA 2H57A 1E59A 1ID8A 1M8GA 1TCAA 2ECOA 1SKQA 2QT0A 1OGYA 2Z8YM 3PITA 1IVYA 2E85A 2GNAA 2YJZA 2X0EA 4G1UC 4JYAB 3S2FA 4TXHA 2E0IA 5EFOA 5JY1A 4P0PB 1O4VA 3B1XA 1QBKC 1IEXA 2O7SA 3O4FA 4YUYA 5AJTA 2K87A 3OQIB 3PUKA 5J4LA 3RVSA 2C1EA 2BGLA 1HGXA 2SECE 2X3UA 5AK3A 4R51A 1GPJA 4TXLA 1P72A 3LOQA 4MI3A 1L1FA 4CT0A 2PL1A 2QD5A 3DS8A 3PUVA 3OWXA 4G1MB 2QZZA 4EX6A 1NU8A 3PS9A 4JJ8A 4TROA 1IY8A 5D8DA 5F76A 3GJ8A 1NJSA 3MRSA 2O2ZA 1KTVA 2W0SA 2JBAB 4V2UA 4G5FA 1U3VA 3DDCA 4BEJA 1PJSA 4RMIA 3SXPA 2HIAA 5EVCA 3PEFA 1A9ZA 3EZ9A 1SA0A 2D0PB 1DX4A 1W5AA 4WKBA 3Q7PA 5SY9A 4J9UE 2Z2ZA 1RTKA 4GG1A 5C7OO 1KYIA 4JOCA 4L3WA 5IJ9A 4LRWA 1ZNWA 2C03A 2F3RA 3PX2A 1BDBA 2Y93A 4G3XA 3T9AA 4UDOA 1OF1A 2H1OA 3OPYB 2JEZA 3OF3A 4NMMA 3TR5A 4D98A 2LV8A 1IK6A 4OHYA 4DDUA 1XZNA 5JG7A 1ADYA 1HEIA 1QK3A 1NTOA 3UA3A 3X1XA 1F8YA 5CA1B 4XIIA 2LE0A 3R09A 4BU0A 2OY0A 1NF9A 5IBRA 3KQNA 3ZU5A 3ILHA 3BCSA 1SHKA 2PEZA 5CFLA 2WJWA 2YHSA 3O92A 2PZEA 3VMMA 3WMEA 5BP7A 5J40A 2F9LA 2DPXA 4AQYB 1U2GA 3ODGA 3ZWVA 2GVDC 2YN2A 3ICEA 3OKPA 1RHJA 1VIYA 1EFAA 3H2SA 3HR4A 4LF4B 2IPOA 4MPPA 4PSAA 3KJZA 4QNMA 4AS1A 4F3TA 1Z39A 1QFYA 2BMJA 2VP4A 5ECYA 5TQJA 2CFIA 1P2UA 3E7FA 2D13A 1XV5A 1M1YB 3GLTA 1A9OA 1AC5A 1BXKA 4QL3A 3GAMA 5EIEA 1M33A 3NCTA 4C7XA 1HURA 4ENTA 4ABYA 3JQ8B 4NNOA 2FPSA 1PRYA 3RRFA 5F1PA 4GBJA 2D5AA 4EKEA 1IXRC 2FZWA 1Z5GA 4JOBA 2BUCA 3ET5A 1R2QA 1UKYA 1IHXA 2OXRA 1NRIA 1KEEB 4WLUA 3A2NA 5IVIA 4CLDA 4ND6A 1S3GA 2H3HA 1HLDA 3QM1A 5EZ6B 1NWCA 2RE8A 1NUQA 1WNTA 3RGWS 1N8SA 2W2LD 1KJYA 4WGGA 1IY1A 3M81A 2GZMA 1Z63A 2R97A 4PE5B 1CSEE 2WG1A 3HVRA 4L08A 1SVOA 2Z8ZA 3TFWA 2HW8A 2ZTLA 3NHKA 2VZ8A 3UUEA 2XA2A 1PEKE 1UJ2A 2J5KA 4HS4A 4ND4A 1AKMA 2E18A 4B7UA 3T52A 3FOAA 4EGAA 1EVEA 1OCEA 4FB5A 4HYEA 5ALFA 1A8HA 5AM0A 1NYLA 1Z2EA 2G36A 5ICGA 2XWQA 4LDNA 2DSNA 1DJOA 3N7TA 4K81B 4EHAA 3QPVA 2A2ZA 3D54D 3KFVA 3KZMA 3BL8A 1V6CA 1J7JA 4RGQA 5H0IA 2V4ZA 2VSXA 2A58A 2XCLA 1UT8A 2DJ5A 3FTQA 4NZYA 4TLDA 4BQNA 4K8OA 5G2OA 4EKNB 4ZMBA 4AG5A 2XF8A 4C3OB 3HB9A 2REXB 3ZIUA 2P0YA 1R0SA 2B1RA 5ALVA 4FFOA 3TAHA 1E8NA 1P45A 1A27A 4X7MA 5ALEA 4WZ6A 1HY3A 5BNTA 2HN9A 3E3OA 5I9LA 1DWPA 1G2QA 1UPXA 3V8EA 3IQIX 3CZMA 5UKDA 3HM9A 5IVDA 4M9QA 5DTQA 1XNQB 1Z6XA 5JZVA 3OZTA 2H7XA 3A6KA 3RHFA 4EY3A 3EQ8A 2JLUA 3OEHD 2R25B 1QU2A 3LSTA 2EX0A 5FR2A 2ZIAA 3OPYA 4EVQA 1INLA 2Z08A 2V65A 1UJ5A 4FONA 1CR6A 2XVYA 1UQUA 2P2ZA 3QY0A 3R0IA 4JT2A 1RC0A 2I5PO 2CHVA 2WIFA 3T3MB 1KJ9A 1T4CA 3EGWA 2GZ1A 4EP1A 7ADHA 8AT1A 2QDKA 4DW8A 1Z2AA 1GQOA 1K4MA 2FJ0A 1RYEA 2O6HA 3AO0B 5DE3A 2VBIA 1ZNZA 4DRXB 5CFQA 4A36A 3QOYA 1I1OA 1RWQA 3QNMA 2BGWA 2XADA 1T6YA 2BFCA 2ZAGA 3JVDA 4A6PA 3QKWA 1Z7GA 4PLZA 1L7PA 3SHFA 2QR5A 4KFCA 4BUJA 1JHDA 4ZZ3A 2DPLA 2WMYA 4J3JA 1KRXA 2HLDD 1RM0A 3D4BA 4ZEOA 4M0LA 5LD2B 3DFFA 4JUFA 2XUHA 2OV8A 2FSGA 4A16A 5AW2A 1QH8B 2VAPA 4PC7A 4B2IA 1PV4A 1UPCA 1IE3A 1U7ZA 4LK3A 4R0VA 5KKCA 3ZDBA 2OZVA 1I7PA 1XU7A 3FIJA 3O8CA 1W48A 2BGRA 4WOCA 3DW3X 3UJ9A 3HCWA 4PS0A 1F12A 4TSRA 1YO6A 2W2QA 3BMQA 3RU2A 1P1IA 2AJ8A 3VC1A 2OK7A 4QU9A 4DN6A 3H11A 5I7WA 1TECE 1LPMA 1JR6A 1UEXC 2XGSA 2MYTA 1YJAA 3IA2A 1AKNA 1QO0A 2CV1A 1YQUA 1OYVA 1E20A 1P0IA 3F2IA 4QXMA 2AUMA 1FRVA 2A3NA 4KK3A 1Z5PA 3VO8A 1WW8A 3ZDEA 3HJGA 5LMUB 4MLZA 5CP8A 2PMBA 1CWUA 3FFAA 5CDSA 1LSUA 3HSKA 3DZDA 4ARVA 4OO3A 4DM7A 4DWVA 1YZNA 3O95A 2C9ZA 2YVLA 1ZUWA 1GLVA 4AF8A 2GERA 2VJMA 3NC4A 2IV3A 4HFNA 3RWBA 3A4MA 1IM8A 1W6RA 4E22A 1ZMTA 2C59A 2JVKA 3FCAA 4I50F 2OC9A 1FMJA 4MZDA 4DCJA 5BRAA 1SO8A 4F8EA 2V4UA 3B8EA 1MDBA 5IMBA 5YASA 1Z06A 2FG7C 4IV0A 4Q9IA 1N78A 1ZX1A 1YL6A 2XLBA 1E79D 3TIVA 3AUFA 1D6JA 3L1HA 1DJNA 3QLTA 3EB9A 2CJPA 3JAKB 3LCUA 5TVKA 1UC9A 4MRVA 4TM8A 1H9BA 3FN4A 1YAHA 1HTWA 1Y5IA 3L3BA 4GX1A 1ZGBA 4EVSA 3H5NA 1LQTA 3B7WA 3CX7A 4CCSA 3FWPA 3U3DA 5LLTA 4MI9A 1E2DA 2IZ7A 3KYJB 2QJWA 1K6IA 4ZMSA 4BMSA 3EWSA 2DERA 3R9XA 4D3DA 1UZNA 4LHSA 4NG5A 3FCEA 1Q0TA 3PC7A 3KHSA 3TDKA 1TZKA 5HCNA 2A5GA 3F9IA 3VR2D 3DMGA 2DXIA 3PDHA 4O2RA 1VG9B 3E9CA 4QEKA 3ZI4A 5JALA 5CFRA 1TMKA 5K0EA 3N75A 3GARA 1LQ2A 2J87A 2WUFA 5F1KA 5E6RA 1JDVA 2VPYA 3FPKA 5LWHA 3D8SA 3IOBA 2C3OA 3QOWA 1E5TA 4I9GA 4HAWA 5G02A 1PD0A 4Z7OB 2HDWA 1G6KA 3VHLB 3JRNA 1ZJ5A 4KKVA 3BMNB 5IEJA 4KXXA 1EK5A 2WAAA 4ZI7B 3SFVA 5AKXA 1F8GA 1IYZA 4BQPA 4GR9A 5KHLB 1E3LA 1S8AA 2DPMA 4UBNA 1DPFA 4NCBA 1RM4A 4FYYA 3ZVLA 3V8MA 4MEJA 2IQIA 4D3FA 2Q5FA 3L4EA 4O2LA 2CWWA 3C14C 1ADGA 1SURA 2D2EA 3PUYA 1QIMA 2GEDA 1TAUA 2FN8A 3GJYA 1NVTA 4BTLA 4PU0A 4BGDA 2HSDA 4HQLA 1WZIA 4H7FA 1AKYA 4TKLA 5JHGB 1MAWA 3KYBA 1GZ5A 5IJXA 5IT0A 3CNOA 2PGAA 4UHDA 1GZ3A 1QF7A 4YH1A 2X14A 4Y7CA 2IZ5A 1SOMA 3HY6A 1YE3A 2HF9A 3D0RA 4WBNA 2XZPA 4G23A 3EA5A 5DTIA 1B14A 1G8AA 2DPYA 1RYHA 1OLUB 2D00A 1KIAA 3KJNA 1J2YA 1YA4A 4Q24A 4AMUA 3BHNA 2OYCA 1OXVA 2WHEA 1P6QA 3DHVA 3WLFA 5J23A 2QQ5A 3CUSA 5JW6A 4LX8A 4I2VA 4OHKA 1AUPA 2XRZA 4AZ3A 3NXKA 1MJ5A 3EVCA 4RORA 1A8SA 2BM8A 1GU0A 2WSIA 1B43A 4WKOA 1RBYA 3TUIC 2GHRA 1ULZA 5BQOA 2PSFA 3QG1A 2FOLA 2M32A 1UP7A 4FOSA 4IGKA 4IIUA 4FXPA 3OLVA 2YXDA 5B2ZA 3IOMA 2RGBA 1XA0A 3B60A 1DQZA 1MAAA 1X3SA 2GWRA 2NNLD 2KBFA 1BVUA 3PSAA 5K4HA 4YIHA 2V98A 2G6TA 1FP7A 1WAMA 4KBFA 2XMCA 4FGWA 5JPIA 5SZHB 4L75A 1NV9A 5AK5A 4YAIA 3BAZA 3RTDA 3QU2A 5CX1A 3RRJA 4W99A 4CODB 2W37A 3G9QA 2W83A 3RUFA 1BAPA 2GHQA 1F2UA 2C7QA 5B58T 4EPXA 1F17A 3WMWA 3QVJA 5B4TA 5A4FS 3IUPA 3D2BA 1TZCA 2FU5C 4TLAA 3VPFA 4CM6A 1UXKA 1P1KA 1IU9A 2JFVA 2P79A 3GRKA 3OJWA 3QVKA 3QFCA 3EIQA 1N4AA 3VU9A 3C5HA 4AVYA 2Z2YA 1BGVA 3TOSA 4QECA 4QUGA 3ANTA 3BQ9A 4PQRA 10MHA 3FI9A 3LFTA 2MSNA 1JDBC 2QMUA 2AD1A 1T25A 2VHVA 4Y0AA 2HMWA 2BPOA 4NDNE 5E1MA 4QGSA 1K89A 2VHXA 3JTMA 3AP1A 3L7MA 3G5MA 4NPAA 4DGSA 2A57A 1GPH1 3H65A 4KJXA 2I3AA 5HFJA 1KVRA 2Q29A 1WB4A 3REQB 1UJMA 2YBEA 1IQ0A 2FRDA 3PUXA 1OTXA 2Y2UA 1CIPA 3L0DA 3K73O 4QVKA 2GXQA 1WUIS 2ZUUA 3GP5A 1U2TA 2P9TA 4FZJA 4IIHA 4J6FA 4LSWA 3TPZA 3UMBA 2WU0A 4R9RA 1U2QA 5T5QA 3NIBA 3T95A 3L8YA 4KJZA 1XWWA 1M3SA 4U2EA 2ENUA 4Q05A 4P92A 1CT9A 1KO8A 2MJLA 3R3JA 3UB3A 4O8ZA 2QN9A 1R6AA 2YCBA 2NP7A 1VHDA 1VBMA 2V0NA 3KL2A 2PD3A 3M6IA 3PE6A 2HGZA 3UYLA 3WYNA 4KTVE 5TQ0A 2VLBA 1CY2A 2P2YA 1MO5A 4UZEA 5EXEA 4FM9A 1XRNA 4ARSA 4C7BA 1O6FA 2CFCA 1RXCA 3L6DA 4WZBE 3PR2B 2JARA 4DAEA 2OLEA 4XSVA 2IYOA 3ADKA 3QPWA 3KKNA 1X87A 2P9CA 3ZBPA 3SHTA 3I1FA 1TAGA 1K6JA 4YA6A 4GC5A 4Q6WA 3TN7A 5E4TA 1K06A 1ML4A 3HCCA 5JBNA 2BBTA 1U8AA 3AR8A 3QYAA 3O93A 2G9QA 4DGQA 2PG3A 3ELBA 4FD2A 5B53A 4QUBA 3WFZA 2GOYA 2ZSBA 4X3PA 5J2TB 1V5IA 4MVWA 1WXIA 5F64A 1GQFA 3H5OA 4EEXA 2JFQA 2YZNA</