3WJ1A

Crystal structure of sshesti
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
PLDPRIKKLLESGFVVPIGKASVDEVRKIFRQLASAAPKAEVRKVEDIKIPGSETSINARVYFPKAKGPYGVLVYLHGGGFVIGDVESYDPLCRAITNACNCVVVSVDYRLAPEYKFPSAVIDSFDATNWIYNNLDKFDGEMGIAIAGDSAGGNLAAVVALLSKGKLDLKYQILIYPAVGFDSVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRFSPIIAQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIDQGKDAIGLIGSVLRRTFYDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Low-pH Adaptation of a Unique Carboxylesterase from Ferroplasma: Altering the pH Optima of Two Carboxylesterases
doi rcsb
source organism Sulfolobus shibatae
molecule tags Hydrolase
molecule keywords Carboxylesterase
total genus 104
structure length 304
sequence length 304
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wj1A00
3R3VA 3YASA 5CT9A 5LZ8A 1QFMA 1LPAB 2YH2A 2WJ3A 5JARA 1P0QA 4X00A 2D0DA 3AIKA 1R50A 3BF7A 4N8EA 3QZUA 1AKNA 3AJAA 5E4TA 5ALSA 1XLVA 4OCZA 4GECA 2DQYA 2JGKA 5ALQA 4X95A 3QPAA 2HU8A 1CUHA 2J4CA 3FAKA 1D07A 4ARBA 4F60A 2HA7A 4CCYA 5AICA 3HEAA 4OPMA 4F0JA 1WB4A 4JUIA 4INZA 2JGMA 2OG1A 2PKYX 1XZGA 3FNBA 2XB6A 5HK9A 5AK3A 2OAEA 4G1FA 3I6MA 1EA5A 3VKFA 3PF8A 1UKBA 4JEIA 2QXTA 1ACLA 2ONCA 1CUBA 4W1RA 1BEEA 4ZV9A 3LLCA 5ALIA 2H7YA 1ODTC 2PPLA 5AI9A 3B5EA 1R4ZA 3TEJA 3QM1A 1DQYA 4UHCA 2FJ0A 4KRXA 2CB9A 4J0KA 4FNGA 5AJHA 2JGFA 4OYYA 4LIPD 3F9CA 1FFEA 2BUBA 4WDRA 4MQMA 1H2YA 2C5FA 4FLEA 2O7VA 3D7RA 5ALTA 3CCBA 1W6RA 3ANSA 2X76A 1NU6A 3E4DA 5HQ3A 5K3BA 3OC0A 4HTAA 5ALDA 2HADA 4Q3KA 3EQ9A 3BXPA 2K2QB 1TCBA 1TRHA 1EK1A 4BVKA 4G8CA 3WMRA 1E8DA 1A8QA 1VKHA 2CJPA 2ZYSA 1FFBA 4Y2JA 3CXUA 3FCXA 2PSEA 4OUKX 2RAUA 5ALOA 1QIDA 1W52X 4BYMA 2OQVA 5JD6A 5EHXA 2H7CA 5E4YA 1DTEA 3FYUC 4C4ZA 1VZ3A 1ISPA 2C7BA 4K2AA 1FFCA 5LZ2A 2VJAA 1UFOA 2WJ6A 1E89A 5AP9A 1X70A 2XLBA 2QR5A 3D4LA 2JF0A 1BCRA 1EDDA 1YB7A 3DD5A 1DT5A 4G9EA 4CCWA 2OGSA 2V9ZA 2RHWA 3DYIA 1ZIYA 2XMRA 2I3DA 2QJRA 3EF3A 4B83A 2XUJA 3KWJA 5EIEA 2JGJA 4MYDA 4BDSA 4MJ3A 2XI4A 3ANTA 4U2CA 2AJBA 1JJIA 2QJWA 1QLWA 4BC0A 5LLSA 5LYYA 1UK9A 5AOCA 2FUKA 5CT4A 1P0PA 5AIAA 5AKEA 2QT9A 5AKGA 5AKKA 4C87A 4XX1A 1ZI9A 4RE5A 5AO9A 1IVYA 3A2NA 4B82A 3C6XA 4NS4A 4M0EA 3H2HA 5AM3A 3HLKA 3BJRA 2B4KA 1C4XA 3L1HA 4QDOA 1H2ZA 1H2WA 3G9UA 4KAAA 3G9ZA 3F8SA 1J1IA 3IUMA 1DX6A 3F96A 1DQZA 1CUWA 2HU5A 5ALEA 1ETHA 5A71A 3B12A 4EA6A 3V1MA 2NW6A 4JNCA 3ZLUA 1F8UA 1UOPA 2QM0A 4X90A 3R3ZA 1X2BA 3ED1A 1ZICA 3H0CA 4U2BA 2XLCA 1JJFA 1QIEA 2DFPA 2WTNA 4DGQA 3RARA 3WK5A 2Z8XA 2CMFA 4BB0A 3GELA 2GZRA 5CT8A 3QITA 4BCBA 2VJDA 3V48A 1IZ8A 4KE6A 1GZ7A 1BROA 4E14A 2HIHA 1Y7HA 1WB5A 5YASA 3G7NA 1ZD2P 3C5VA 2DHDA 3WK7A 1JT2A 3LCRA 1MPXA 4Q82A 1GPLA 4HAIA 2YASA 4W1QA 5D6OA 2XUFA 1S8OA 4E11A 3G0CA 5JANA 4X3CA 3G9XA 2FJPA 4BVJA 3N0TA 3STXA 4UFPA 2JIDA 1CUDA 3VJMA 4GEGA 1HPLA 2C58A 4IH4A 5ISMA 4W1PA 4X6YA 1QE3A 4FTWA 5CT6A 4BBZA 2QOEA 2HA5A 2VTVA 1WCYA 5JD5A 2PBLA 2RIPA 4H7FA 2ZJ7A 5C8VA 1ZGCA 5AKXA 2H7XA 3ESAA 2XQIA 4FNMA 4BATA 3BDIA 3W04A 4KYVA 4IO0A 4AZ0A 5ALMA 4BP9A 3Q0TA 1U2EA 5K3DA 1BEZA 2HA0A 4C89A 2HRQA 5LZ4A 4QE3A 4KAJA 4Y9SA 4X6UA 5FRDA 5T4EA 4C88A 3O4GA 2XUIA 1IUOA 2ECFA 4HXGA 1CFJA 4BTVA 1HBJA 3QMVA 2WM2A 1W76A 3WKDA 2DHCA 4N8SA 1XKLA 2GYWA 3C6BA 2O2IA 5HZGA 2BUAA 1J07A 1GT6A 3G0GA 2OCGA 4J7AA 1PFQA 1F0NA 3FWHA 2WFZA 3OPMA 4ZWNA 1ZI6A 2VATA 2WSLA 1MNAA 1QOZA 3C87A 2XT0A 4Y2TA 1F0PA 5HKBA 5FPQA 4UFOA 3IDAA 3I2IA 1XZFA 4Z49A 4E46A 5H3HA 1L7QA 4WJLA 2XMQA 1OCEA 4PSCA 4Y2YA 1VZ2A 1PJAA 3OM8A 1LZLA 4Y2SA 3FYUA 3M3DA 3STWA 4W63A 1F6WA 3D5EA 3QVMA 1P0IA 4GLBA 1YCDA 1QFSA 1FFDA 3F67A 1NX9A 3GBSA 3D0KA 1YASA 3C5WP 2C0QA 3HRHA 4G9GA 1CUYA 3B3QA 2VAXA 2WJ4A 3IA2A 1TIBA 2XQJA 4GWLA 5AKIA 5IVDA 2BCEA 4A23A 4EY8A 3BIXA 3D2AA 1J2EA 2HHAA 1TAHA 5AM4A 2XUQA 3PFCA 5DTIA 4PNZA 1LLFA 3E3AA 4GDMA 4TPKA 3BJMA 5LZ5A 5HF9A 3STVA 1O6FA 1GQSA 3PDCA 3H2KA 1MT3A 2PSFA 1A8UA 2Z3WA 4ZGBA 3DJYA 5BWBA 1AQLA 5EHNA 3WK6A 1XZIA 4HVTA 4PSDA 2Y2UA 2Z8ZA 1HKHA 5HFNA 5I7UA 3DEAA 2B20A 3DOIA 2ZSHA 2PU7A 4FLMA 3WL5A 4B0PA 4O08A 3VJLA 4LXIA 3PFBA 4WY8A 2CBGA 2AJCA 3WI7A 4LXHA 3QBJA 3QMWA 1IUPA 4G5XA 3H2GA 4CFSA 2QMQA 2WIJA 4AQDA 2C5GA 4KE9A 4QA9A 2DR0A 2JGEA 5EI5A 3G0DA 4AN0A 1N5MA 2OGTA 2VJCA 3AIOA 4U2DA 3WL6A 3FVTA 1CUSA 5JATA 1UZAA 2WTMA 4B81A 3C70A 4J03A 2HA2A 2B9VA 3ZLVA 4FFVA 2WHRA 2AJ8A 3WWPA 3W2TA 4OYLA 1VJ5A 5K3CA 1XRRA 4WFIA 1XRMA 1EB9A 2LIPA 4KACA 1MAHA 1ZD4A 1VXOA 4Y2XA 4LYEA 4B85A 5KBYA 4EB0A 4CIAA 3QPDA 2ZJFA 4BRZA 2QKYA 4HXFB 4C6HA 1EH5A 1SCKA 1JMYA 5ALWA 3ESCA 4LKOA 2GBGA 3WKBA 2V97A 1QIIA 3IULA 1QTIA 1JI3A 4HZGA 3QH4A 5A7GA 5JAPA 4Y2UA 5KREA 3WKEA 4UHBA 1DWOA 1CUXA 5JIBA 3EBLA 3UUEA 2XQFA 2VJBA 3SWWA 2WUGA 3HYSA 2DSNA 4BP8A 4Q34A 4U2EA 5LKAA 1ODSA 3L1JA 4KJXA 3PICA 4W1SA 2PM8A 1NU8A 3WA6A 1K6EA 5E2IA 3WWEA 1XZLA 2HFKA 3I2HA 4DNQA 1VA4A 3X3HA 4H7KA 3TJMA 4X91A 5CH5A 4FOLA 5HK8A 1XLWA 3KSRA 2O2HA 1DWQA 5CTAA 4PV7A 4FHZA 1XFDA 2ES4A 5EGNA 2GZSA 2BAGA 4K5QA 5FLKA 4P08A 3E1GA 3ESBA 2I03A 3M83A 2GBFA 4H0CA 4J0GA 3FSGD 3M82A 5HQ3B 1ZJ4A 1ZD5A 1JMKC 3H2JA 5CXUA 1ACJA 4QDTA 5AOAA 5IKXA 5ALUA 4F5ZA 5JAOA 4MQLA 1P0MA 4CI9A 4UHEA 1OILA 1AURA 3RM3A 5LKRA 1E3QA 1W75A 4OB8A 5FXMA 1ODCA 3SX4A 5AKLA 4DMKA 5EHQA 4X7BA 3UUFA 4UPDA 2Z3ZA 4AO8A 2WHPB 2YYSA 1QGED 5JAUA 2HA3A 5T4FA 5EHZA 2PX6A 1EXWA 3NGMA 4PO3X 3IB3A 3WL8A 2HFJA 3C43A 5AKJA 3JW8A 3K6KA 4BTLA 2GYVA 5ALNA 2PSHA 2J3QA 1UK6A 4A16A 3NUZA 1ZGBA 2WUFA 1SC9A 4C4XA 4N8DA 4ZV7A 2WILA 3FYUB 3AUKA 3WZMA 2RONA 1R9NA 1TQHA 1RWQA 3CCCA 1VE6A 3T52A 2WIFA 5AH0A 1GKKA 1EVEA 2FX5A 3N2ZB 1CUZA 2HL6A 1CRLA 5CURA 1HQDA 4KAFA 1JKMA 3DNMA 3MUNA 4P92A 5A2GA 6YASA 3C8DA 4HRXA 1YR2A 2G5PA 1MAAA 3EQ7A 3BF8A 4B0OA 2WKWA 4OU5A 4J3JA 1U65A 5I9IA 4FWBA 3V1KA 3TGLA 5IH7A 5DLPA 2QRUA 2OPHA 1THGA 1A8SA 3ZPXA 5A6VA 1TKRA 2EDAA 2VT6A 1UKAA 3O4HA 4H18A 4WCVA 2XUAA 3I1YA 2OQIA 2XMCA 3AIMA 2WHPA 5IVHA 4NVRA 5K3AA 5A7HA 4QZVA 1QIMA 1QIHA 3WLAA 2PUHA 2AJDA 3UMJA 1YAHA 1CUFA 5AI4A 1GKLA 4B84A 3FSGA 1QIJA 4KRYA 1VE7A 3DLTA 5DTJA 1LBSA 1TK3A 4LXGA 3WQHA 5AM0A 3R3XA 2O7RA 3GUUA 4UBNA 1K4YA 2QVBA 1VOTA 5K3EA 4BE9A 3FOBA 1G42A 3EQ8A 4FFWA 1EDEA 3I28A 5CH3A 1YA4A 5DYYA 1T4MA 5K3FB 1UOQA 3WA7A 4YX9A 5DWDA 4AZ3A 4ROTA 1LPSA 4AMYA 2ZJ6A 5F4ZA 1WPRA 3VXKA 4HS9A 3STTA 2H9YA 4DTCA 5E4JA 1GQRA 1XRLA 2IIVA 1XZCA 3R41A 1E66A 5AI6A 3EIOA 4HRYA 1PV1A 5AKZA 5BWCA 1CVLA 5ALJA 1Q83A 5JALA 4AXBA 1IMJA 2I3ZA 3RLIA 1YA8A 4BCDA 3PE6A 2JEZA 5J3JA 1LPNA 3OURA 4UUQA 1GPNA 3ICWA 3V9AA 2QUBA 4X92A 3WL7A 1JU4A 2Y1KA 4F21A 3E0XA 1H22A 5A62A 4U2GA 1WOMA 3WWOA 4BAUA 1ORWA 4I19A 4GW3A 2WG0A 1BN6A 4EY4A 3FLAA 2XUHA 2Y6VA 1XZAA 5AKHA 2GBCA 4I4CA 1KEZA 4M0FA 3WK9A 3DCNA 3F97A 4MWTA 5ESRA 3AFIA 1R88A 3MGAA 2PVSA 3DKRA 5BV7A 4FBMA 4ITVA 1YS1X 3DDUA 3GFFA 4UFNA 5DNUA 4QNNA 5K3FA 4L3WA 5EIAA 4UHHA 1YS2X 2QUAA 4H35A 5ALGA 4LHEA 1SOMA 4UBKA 4H77A 1AC5A 4J0IA 4FKBA 1XQYA 1CQZA 4B6GA 3MVEA 4D9JA 3MUOA 2PL5A 1RYYA 3KDAA 4KEAA 3WKAA 1XZHA 2VSQA 3WZLA 5I8PA 1BRTA 3H04A 1C7IA 4FLFA 1UKCA 5AI5A 1CQWA 1GXSA 4ZXFA 2WIKA 4ZREA 1SCQA 3PF9A 5T4HA 2WG1A 3VVMA 2CEKA 3H17A 5HF6A 4YASA 1GGVA 1XZBA 2ZYHA 4N5IX 4V2IA 2BKLA 5FV4A 2IITA 2PU5A 5D7BA 5HF5A 4QDZA 4BDTA 3R40A 2G63A 3A70A 3IUQA 2OGZA 3NWOA 1G5FA 1XQXA 4XVCA 3C6YA 4AMZA 3G02A 1EX9A 1OXMA 2OCIA 2XMSA 1CUGA 1JJBA 1LPMA 1IUNA 4DMCA 3WKCA 3W05A 4UHFA 2AXEA 4MWSA 3LP5A 3SK0A 3I2FA 4X6XA 2WFLB 4LYDA 4EUSA 4AN1A 1H23A 3O0DA 2HA4A 5EFZA 4MXDA 5ALVA 4XJVA 3ZV7A 5K5EA 1XZDA 2WIGA 4KE8A 1XRNA 1QZ3A 2H1IA 5LZ7A 3ZLTA 4UBIA 2G4LA 1DWPA 5FUMA 5KWJA 3I6ZA 5DYTA 4B80A 3H2IA 3OTQA 1QO9A 1XZEA 1A7UA 4BAZA 1LPOA 3IVMA 3Q8WA 5LP1A 1A88A 1CUVA 5DNVA 4L72A 3R3WA 2D5LA 1H2XA 4H7IA 3I6YA 3FYTA 3LIIA 4UBLA 3KWFA 4GI1A 3V1LA 4UHDA 3JWEA 3FVRA 5SYNA 3H19A 2XMDA 1UOOA 4G4IA 4H7JA 4DM7A 1K5PA 3G0BA 3BL8A 4MYSA 3I2JA 4QWMA 1XKTA 3FBWA 4CCYB 5CW2A 2OXEA 2WG2A 4ARAA 2RHTA 2YXPX 3RKSA 3BWXA 2EDCA 4BC1A 1Q0RA 4UBOA 2OCKA 5AM5A 1CLEA 2I78A 4UBJA 1FJ2A 2WFLA 5JASA 3PI6A 3IUJA 5ALXA 4L0CA 1EVQA 5A7FA 2WU3A 3O9VA 3W06A 3IUNA 4RE6A 4Y2QA 3QPCA 4WFKA 1W4LA 3QMMA 3FLBA 2P8SA 1FSSA 3G9TA 4PSUA 1UWCA 2XQGA 3C6ZA 3R3YA 4ETWA 2CZQA 2VF2A 3ZI7A 4UBMA 4J0HA 4Q05A 1UK8A 5AI8A 1EK2A 2V98A 1U4NA 1WB6A 2ZYRA 5SYMA 1LPPA 3PUHA 4BAGA 2OCLA 3S2ZA 2XMBA 3VVLA 5DYWA 1DX4A 2HM7A 2JGLA 2QS9A 2XUGA 4GXNA 3DOHA 2G5TA 4PQEA 5C81A 3QYJA 5ALHA 1HDEA 4XIIA 1AX9A 4BZZA 5ALKA 5DJ5A 2V96A 4EY7A 1QTRA 3WWCA 5FOQA 5ALLA 4Y2PA 1MNQA 3AILA 4X71A 1AUOA 1XZMA 1QONA 1C7JA 4P9NA 1CV2A 4B9AA 4J0CA 1J06A 3D2CA 4QDXA 1G4HA 2ZYIA 3HC7A 3NOXA 3DYVA 3H1BA 3C45A 2R11A 2XUDA 1XRQA 3HACA 1ZJ5A 5LIPA 4GHWA 5AK5A 4L9AA 3A2MA 1XQWA 2OAGA 4KR0A 4FMPA 1XQVA 3BE8A 1BCSA 4DLNA 1HLGA 1XROA 3LIPA 3DL7A 1VXRA 2J3DA 1G66A 2BFNA 5FPPA 3VISA 5C8ZA 4S0XA 1DT3A 2DCMA 2GBIA 5HF8A 5IVIA 3TRDA 3O9MA 3AZOA 3DQZA 4K6GA 1RP1A 1WM1A 4OB7A 2RI6A 1LZKA 1BN7A 2BJHA 3WJ2A 3CN9A 1KU0A 1MX5A 5C7YA 2UZ0A 5AK4A 5CT5A 2WUEA 2ORYA 1KU6A 2DHEA 4P93A 4BE4A 3FLEA 5IVKA 1N5RA 3D59A 2XE4A 4QLOA 4WDQA 1BE0A 4DNPA 4MEBA 3IURA 1R3DA 2PUJA 2BUCA 3F98A 3ESDA 4X97A 2VEOA 3G0IA 2O2GA 5AHXA 5D3ZA 3GA7A 1SCIA 1CUCA 2HA6A 3O95A 3VJKA 1UK7A 4IQ4A 1VLQA 5FDFA 1XLUA 4E15A 1TCAA 3HABA 1B6GA 1CUIA 3AINA 3OG9A 2WHQA 3HSSA 5HKAA 4XWGA 4Y7DA 1R9MA 4C01A 1QIGA 4H7EA 2Q0XA 1CUJA 4NZZA 5CMLA 4M0MA 1CR6A 2X5XA 2VT7A 1GPKA 2ZVDA 5JADA 2VAVA 3BDVA 4AO6A 3DL4A 5ALFA 4PF1A 3HJUA 3GROA 1JU3A 3D2BA 5C8XA 1AZWA 1VA5A 4RPCA 1O6GA 4GBGA 3WK8A 4RGYA 5AI0A 2HRRA 1Y7IA 3VDXA 7YASA 2QTBA 4QDUA 1JFRA 5ALPA 4EBBA 2JGIA 4DIUA 1ORVA 5ALRA 1BU8A 4BCCA 2VA9A 2WUDA 1MX9A 2JEYA 4Y2RA 4AO7A 4CG2A 2Z5GA 2GYUA 1L7AA 1AMNA 1QO7A 4C4YA 4DYHA 5FKJA 1QIFA 3P2MA 3H1AA 5AIBA 5ALYA 4OB6A 5CRIA 1QIKA 2ACEA 3K2IA 4X93A 4OSEA 1EINA 5BOVA 2HDWA 4DMFA 3I2GA 3WJ1A 4BVLA 3K9BA 3STYA 1MJ5A 4EHBA 5AM1A 5FP0A 4OU4A 2JBWA 3WIOA 4DNOA 2W6CX 4Q1VA 1Y37A 3OOSA 1CIJA 5EIHA 3AZPA 2WLSA 3LS2A 4H7HA 3HZOA 4IH1A 5JZBA 3C8HA 1E8MA 2WU4A 4HXEB 4Q3LA 1WPXA 1ZI8A 2AJLI 3WK4A 2C4HA 1XRPA 4PW0A 2X8BA 3IBTA 5JD4A 4I3FA 1XZJA 2XMZA 4FDMA 3WYNA 2EEPA 4N5HX 2VQ6A 2HU7A 2XQKA 3GZJA 1X2EA 2R8BA 4JYPA 2XUOA 2ACKA 3A2LA 3R0VA 4Y2VA 4J0JA 1AGYA 4CG3A 2IX9A 5LZ9A 5AK6A 4DMHA 4Q3OA 1LGYA 1QJ4A 1E5TA 2E3JA 2C0PA 3BIWA 4TGLA 1DU4A 1EI9A 1CEXA 3WWDA 4EY6A 2WIDA 2OLEA 1MU0A 1T2NA 1WHSA 1CUAA 3W9UA 4X85A 3JYHA 5DNWA 1E8NA 1MTZA 1U8EA 4NMWA 4A5SA 1IZ7A 1HL7A 3PUIA 3O4JA 1Q0ZA 4G8BA 2B61A 4TVKA 2ROQA 3R3UA 4MEAA 3HXKA 3U0VA 4B7ZA 1LPBB 4H7DA 3I1IA 1EHYA 1N8SA 3S8YA 1UXOA 3KXPA 3T4UA 4JH0A 4AB1A 3W9BA 2XUPA 1N1MA 1LNSA 3G8YA 4BZWA 3AZQA 3D3NA 3STUA 1YSCA 3WIBA 2CKMA 2WFMA 2PSJA 5HFAA 2Y6UA 4G4GA 4OD0A 4B9EA 1CUEA 1USWA 4CIBA 3KD2A 3L1IA 2J4FA 1M33A 1ZIXA 1L7RA 2BGRA 4QEKA 2PSDA 5T4BA 2DQZA 4EY5A 1MO2A 2QZPA 1B41A 1FFAA 4WY5A 3O4IA 4G8DA 2QXUA 4AX4A 1DINA 2XUKA 1EDBA 4IHAA 3SC2A 4CG1A 3ILSA 4BRSA 1XZKA 1K63A 1I6WA 2W22A 5JYCA 5AM2A 4K6HA 4WFJA 5JZSA 4QWWA 1YB6A 2RGUA 5AOBA 4IH9A 4K6KA 4QLAA 1EB8A 4G4JA 5KWIA 3V1NA 3RK4A 3ICVA 3DKKA 5CXXA 1UT6A 4DSZA 4RNCA 4W9RA 5JAHA 2ZSIA 2XDWA 3KOOA 1W1IA 1TCCA 1CPYA 4ZI5A 1YAJA 3DS8A 3HI4A 4FBLA 3WYDA 3H18A 3U1TA 5CBKA 2CUTA 5JZ9A 1LBTA 2BGNA 1K8QA 4EZIA 3ZWQA 4JYMA 3FCYA 4J0DA 5CH8A 1SFRA 4U2FA 1MX1A 2XMGA 3IIIA 1ZD3A 1R1DA 1Z68A 4DNFA 3M81A 3A6ZA 1MN6A 1WHTA 4DSAA 1CUUA 5HCUA 4KE7A 3I2KA 4X94A 1ZOIA 5ALZA 2WQZA 1THTA 2Y2VA 3CN7A 5D3KA 1Q84A 1BS9A 4YK7A 5AKYA 4ZRDA 4YPVA
chains in the Genus database with same CATH superfamily
1C1HA 1RI2A 4GEKA 3AERB 3JVDA 5AFSA 2EKPA 4YMSA 2FYTA 1KPHA 4QIHA 3MQFA 4WACA 5H59A 3U3RA 1PL8A 2OO5A 3T35A 4A8HA 3N53A 5G1PA 3HO8A 4OX9B 4QUGA 4E12A 1GFWA 2YJZA 3JTMA 2YHIB 4PFJA 3C7DB 3VH1A 1Y8RB 1E2PA 4P4SB 4NMXB 4WUTA 1HEUA 1R50A 4ZYLA 2CY0A 2FN8A 1UAAA 1FTQA 3W6ZA 2C4WA 1XTQA 1E0AA 3SS7X 3LKVA 4CM9D 3DC2A 5LP6A 1XTIA 1AZSC 3CLUC 5ALSA 3ZE0B 5DIZA 4XIJA 3KG2A 3LYAA 3EVCA 1PR6A 3KUDA 1P39A 4KI0A 4NQZA 4NZMA 1T6NA 5CFPA 8ADHA 5KHOC 4FEYA 5KTPA 2DQYA 1WSDA 3G13A 4HH3C 2C5EA 4DXHA 2YJTD 3CGWA 1YBAA 2QP4A 2W0SA 3VKGA 5CFLA 1V5WA 1U8YA 4R8VA 4MWDA 4X95A 1AA9A 5G0TA 2A14A 1DUVG 4GZ5A 1AKWA 2QX8A 4ALNA 4KSYA 3FAKA 3X2EA 1D07A 1E4EB 4DUGD 1XKXA 1GVNB 4ALMA 3DLHA 5M04A 1PYGA 4CCYA 3KQLA 5CB6A 1UQUA 3GJ3A 1E64A 3PVZA 4F0JA 3OEHA 2HWXA 2OCAA 2V5AA 3OFVA 4JUIA 3VYVA 3CNQS 4J49A 3WGZA 2RC5A 4P58A 4G0ZA 2QI9C 1F5SA 1T6YA 1M9NA 2VP4A 4INZA 3BWEA 2ZRCA 4DARA 2JGMA 1CJUC 2NU7B 4MKRA 2FPWA 5J2TA 4IS3A 4J4HA 3M33A 3FNBA 5IUNC 4F56A 3LDHA 3COVA 3IUEA 1NE2A 5AK3A 1K89A 4KQIA 1ZM7A 2CBZA 4DDWA 1E9EA 3V6MA 2P90A 3WHKA 4DV0B 1QOQB 3EEQA 2EFDB 4XZ3A 5M5BA 1AV7A 1V7CA 1Q15A 1AGRA 3EXFB 2C42A 4ZGGA 1RAGA 4CW7A 4RK4A 3RVDA 4WE3A 5I7HA 1K06A 2FWRA 3BFXA 3PJGA 1C9EA 4OH7A 2WWWA 1L5LA 4LBWA 4JLOA 3BH7A 3GV0A 1RWPA 2KBFA 3LUHA 3U6KA 1N8KA 1C30A 2F6RA 2ONCA 2DF8A 3A4VA 4I1RA 2OFPA 1WZIA 2EAUA 4M37A 5BYBA 4C43A 2PY6A 2RKBA 3R23A 4IHJA 1HK7A 5NULA 1U0HC 4CMGA 3GGOA 5ALIA 2FGJA 3NBXX 4OHBA 1Z26A 3RODA 5LOVA 3GYBA 3ZU5A 5F5LA 4XGIA 3EG9B 1ZMOA 3TNFA 3L7DA 1VCNA 3MN1A 4GKKB 1R5BA 3KTDA 5HOQA 3T6KA 2VS1A 2Q9UA 3DNPA 1B23P 4LOLA 2VHCA 3B3AA 1L5WA 4GBED 1ZH4A 3T7DA 4LIPD 3A9SA 3QVWA 5BYKA 3THOA 1XMJA 3NIDB 2MTBA 1KGSA 1A9YA 4U63A 1UANA 2CF5A 1S9DA 3KLMX 4YDHB 5JDIA 5FOWA 3OHSX 1OYVA 3WIEA 1G98A 4Z4HA 5FA6A 1GZUA 2C2OA 1VM6A 1NOIA 2HMVA 2O7VA 4ZODA 3ANSA 4MO2A 3COYA 4XOUA 1SPBS 3BJIC 3WDKA 3IX7A 5DHTA 4BLVA 3DZBA 5K3BA 1VLJA 4R6XA 1KVRA 3OC0A 1SXJE 3EFEA 5IULC 3B70A 4Q4LA 1BFDA 2JGAA 4EKYA 1SXGA 4EPVA 2CYCA 2ZSFA 1X1EA 3P2YA 1ZD8A 3OTOB 5EJGA 1TRHA 5LNK1 5L4NA 2R60A 4MB6A 1T34A 1H6AA 3ISTA 1ZPDA 1NTOA 1JBQA 5EIWA 5I8ZA 5JWOA 2VCHA 1ECGA 1I0LA 5BUSA 1MA0A 2C31A 2L18A 2YY5A 5EQFA 3CNHA 4Q02A 4CKCA 3WBJA 4EH1A 4MO9A 4ZOEA 4H3SA 1G60A 1VKHA 3ACDA 3MS2A 3VKUA 1QKKA 1YS6A 4J07A 4CFZA 2BSAA 2Z5VA 3U4QB 4TUYB 1HT3A 1FFBA 2VHQA 2YWDA 3LX6A 1L4FA 1RC8A 3DFZA 2CDRA 3FCXA 3L82B 5TGTA 2PSEA 4NJEA 5KYGA 1TEZA 2CL5A 3HJTA 2ZREA 1JGTA 1ZMRA 2ZWOA 3UG6A 1MZPA 3ZZNA 3I4CA 1QC5B 2XH8A 4GO1A 3TB4A 4BYMA 4LJ9A 3UAOA 3JRXA 5GAJA 3TKYA 4EA8A 4OHKA 4YJKA 2YXEA 4ZKEA 2P9TA 1H6CA 3FNQA 1DTEA 1FRVA 3E5MA 3M5WA 1M73E 2C7BA 3G5LA 4K2AA 1FFCA 1BS1A 1GGJA 1NW3A 1W44A 3DUWA 3PHIA 1KMNA 1YJ5A 4QO7A 3RADC 3AGQA 3TEFA 2G9QA 4A8JB 4C7KA 5F9FA 5KSOA 3JQAB 1UFOA 5IJ0B 3I9V6 1CU1A 4YP6A 3EB9A 1NP6A 1KY3A 1VIAA 1WCIA 3DT6A 1TOAA 4C22A 3AESA 3DAPA 1ZR4A 4IQGA 4UAGA 3CZQA 2DY0A 4BV9A 3PITA 2FMFA 4AL4A 1GGEA 5JI2E 1BW9B 5JQWA 1GDTA 1U28C 2A9JA 3NHAA 1KI1A 1H5UA 1YB7A 3IP8A 3RBZA 3DAOA 5FQNA 1II0A 4XKJA 1ESEA 3UTCA 3FCEA 1QXSA 4WINA 1SUAA 4CCWA 2VQ3A 3I45A 2V9ZA 3TECE 5C5EA 2FEWB 1KZ9A 4AG3A 4CBVA 4UNRA 4F1WA 2CW5A 1VFPA 2W6QA 3EAQA 2IV2X 1W73A 3P5BA 4GD3Q 1UBLS 3Q3EA 1CY7A 2XECA 2XMRA 4AULA 4AUNA 2I3DA 1UBFA 2O5EA 1K6IA 4MDYA 5EZQA 3RFFA 3CV3A 1LFDB 3EIEA 4DA4A 4MR9B 2FLKA 3EF3A 3DT8A 4R84A 1QB7A 5JJIA 2VJOA 2QA5A 1UZLA 4MRPA 3F4LA 3SX2A 3UW1A 3GAFA 4CDGA 5A4MS 3BQ9A 3E8MA 5LIRA 4TVSA 2WD7A 3C4JA 1X94A 5EIEA 2IVZA 2JGJA 1YV9A 4EI7A 4RVFA 1BDMA 1Y9AA 4MJ3A 3QNWA 5EHGA 2XI4A 1WNTA 1E1RA 2GJ4A 2B3TA 4GUDA 4HDCA 4X8OA 5EWJB 1TM1E 1DKPA 5BN5B 5LLSA 4BC0A 4QUHA 3N70A 3EX7C 3H0EA 1EEHA 1G6KA 3OLQA 4IJQA 3GEBA 3HKCA 2H9AA 2QV7A 2RHRA 4W4TA 4Q9LA 1MFZA 2CXQA 2YW9A 1Q91A 4MIOA 3H13A 4B3FX 4DMLA 3KZXA 2P65A 4CODB 3AUJB 5AK0A 2Z4TA 3KZCA 4M1EA 4XX1A 1ZI9A 3BZUA 3T8YA 2BTQB 2DM6A 3K1TA 4X0EA 4OHRA 2GQ0A 1TIKA 3LXRA 3TQTA 3CKMA 3TCNA 3I73A 3BE5A 1IAVA 3S2YA 1W2HA 2DFVA 5E6RA 1M2GA 3OFKA 2HH9A 4HL6A 4B82A 3S5JA 1H3NA 5I9SA 3C6XA 2B1JA 2VSOA 3SVZA 3UY4A 3K5IA 4QGBA 5J5CA 3V7YA 1PQ4A 3W8NA 1YU6A 4L74A 5AM3A 2JRLA 4FU0A 4GMXA 1LQ2A 3CH6A 1HI9A 4R5MA 2B4KA 1NN3A 1NL3A 3Q7IA 4IXWA 3R7LA 1C4XA 4GYWA 2YYAA 4JT9A 1VIVA 2OCDA 2Y1GA 2F1IA 4QT4A 1TLLA 3G7SA 3DKIA 1JEOA 2QRQA 2G70A 4WBSA 1H2WA 5BOSB 3G9UA 2Q28A 5I45A 4IX9A 1HYGA 5D3MA 4LC9A 1CR1A 2Q9AA 4QXQA 1XU9A 3L4BA 1K4KA 2D3TA 1KI6A 1H5QA 2ZR7A 3F96A 3Q3IA 2QR3A 1YBHA 3NBMA 4TQGA 4ZAFA 1CP2A 5IBPA 4YUZA 3K6SB 4GRIA 2X9LA 3LOUA 1VLMA 4PHHA 3LQQA 4RH1A 3X44A 4LXXA 4TL7A 5K8LA 2XIJA 3H9UA 2QI9F 3U6BA 1Z13A 2ZE6A 5A71A 3B12A 1XAGA 3IQGX 1MX3A 3JASB 3PJDA 3ZCVA 2CK3A 4Y9TA 1R10A 3MW8A 4ZXPA 5J1SB 2P2NA 1WBJB 1L7EA 3JQ9A 4AP9A 4HJXA 1UOPA 1CDOA 5HTKA 4F1KA 2Q1SA 2RJNA 2PRIA 3I37X 3VR4A 1XVLA 3U61B 1X2BA 1I4OA 2AK2A 2GCPA 3C3BA 3REQA 3H0CA 3IDSA 2EBWA 3LVRE 1I7NA 2I6XA 4RIFA 1JJFA 4RGVA 4PAOA 4GOLD 1XXLA 3NM4A 2WJJA 2RGNA 1U0GA 2J3HA 3A4LA 2FSSA 4CQMB 2VJLA 3PNVA 4U3JB 1GN8A 1V71A 3ZVNA 2C4NA 3RARA 2UU9B 1KEEB 2Q6TA 3DV9A 4RXUA 4URUR 4DIDA 3K70C 4XASA 1YIDA 2IXDA 4ZVSA 1TZJA 5BO5A 3QITA 4QBHA 4EKGA 5BORA 4L78A 1A7KA 5KJFA 2ZT8A 3E7DA 4BCBA 4P81A 5SICE 3BRCA 1W96A 2DBVO 3SIPA 1L4NA 4EVSA 1GZ7A 2JGDB 3UWMA 1LLUA 2IL1A 5HIIA 3ZCXA 1H66A 5JC8A 4C7OB 4PQGA 4EG5A 3BMXA 2CUZA 2Y1EA 3DDOA 1SG0A 1Y7HA 1FPQA 3DOUA 1DJNA 1V11B 1WB5A 2BBOA 1EJ6A 3ILHA 3LCCA 4YWHA 1ZD2P 4DCNA 2DHDA 2HWUA 4ZVKA 3H65A 3EGXA 3M70A 3ZU3A 1JT2A 1ORTA 1T3TA 5LU9A 5JECA 5DKFA 1FYEA 1NRJB 2VNKA 4YA6A 2DTEA 1D4OA 3LK7A 2UZ3A 1H4VB 3G2NA 3WFJA 1LEHA 1LDGA 4HAIA 5ECGC 1ZHFA 1A2QA 1IN5A 2YASA 3QHPA 4G5RA 4S0ZA 3UV3A 4BVHA 2VQFB 1Z2OX 2VPWA 4E1VA 3BOSA 1U0EA 4ZA2A 1AQ6A 1WTCA 1YHYA 1XNJA 3M3PA 3DMTA 1JQ3A 3G0CA 4EWLA 5JTUA 5EE3A 4MYTA 2PH7A 2D2VA 3AT1A 1ZK0A 4JUBA 1IBSA 3ZKWB 3ZWMA 2JI8A 3IBYA 5CHEA 4M53A 2FX2A 5KTTA 4HBZA 2QLTA 4UUPA 4F92B 1YQEA 3JQ6A 1M2HA 4E7PA 3F7MA 5ER9A 2P67A 2QMYA 4MGHA 2WF6A 2NPFA 2F55A 2C9ZA 4DJJA 3CG0A 1IEQA 1RYDA 4NABA 4DW8A 3Q15C 2C58A 3FY4A 1I3CA 2YJNA 1AK1A 1U8ZA 5F7XA 5AW2A 2VUHB 1RWVA 3KEGA 2L69A 1OXXK 1UKZA 3FYDA 5BN4A 1MAWA 3MJCA 3T7SA 1HDXA 1QH0A 4X1KA 4BBZA 1PZXA 5ITSA 1JEQB 2ZWAA 3IEUA 4YRSA 3UMBA 4KGXA 1Q0QA 3D8SA 1G3UA 5BMOA 3UHAA 3RS5A 1JDBB 4MKZA 2IY8A 1GRRA 2E4UA 2FQWA 2W2PA 5KKNB 2P4QA 1ZGCA 1SBQA 4PC7A 2XOKD 4KCGA 4PGMA 4ETNA 2AF4C 1U6JA 3PNLA 4CM5A 4LCBA 2GJKA 3ORHA 3DAFA 2OCBA 4TN5A 3DBVO 4IO0A 2HLNA 5I9MA 5JSFA 4WCDA 1JDJA 1FP6A 1MB3A 3Q0TA 4EB6B 2HA0A 1HYEA 3EH1A 4C89A 4UXHA 4R40A 5EJ2A 4IX1A 2XJ4A 4FGLA 2OBLA 2WWVD 1G3MA 2EIXA 4QRDA 4NCAA 4JXJA 1GCGA 5T4EA 2J09A 5B3JA 1G4AE 3MTEA 5H8WA 3K7EA 3FWKA 1J49A 1Z0IA 3SC3A 1QUFA 2AYYA 3ORYA 1RYFA 3O4GA 3BCUA 5JS2A 1VRVA 1IUOA 3EULA 4NWIA 4ZU1X 5F21A 4D4IA 5M29A 3DMDA 5KOJB 3L7BA 3SQNA 2DUNA 4BTVA 1TDJA 1SG9A 3RC7A 2RK6A 3UMYA 3RUIA 2MR5A 4E1BA 1VG8A 3DMHA 5EVJA 4FYPA 1PWZA 3PI7A 1WU7A 5A9SA 3SVTA 2DHCA 1U1CA 5EMNA 4N8SA 2VK8A 1W5TA 3RVBA 3ZE6A 1BVHA 5L6MB 3SM9A 1XKLA 3K0EA 3X1DA 4EHAA 4E5DA 5DCWA 1YOBA 3OZ7A 5HZGA 3KDPA 3UUWA 4IUBS 1LDNA 4QLBA 3EZ9A 4HH4A 3HB7A 3JAMA 1F0NA 2X19A 3NT5A 3QX3A 5IZ4A 2W2XA 4S1WA 2ZE5A 4D6XA 1ZI6A 621PA 1J9ZA 1KYQA 2GAAA 1Y7PA 3B6ZA 3LUJA 4Q4HA 4E2WA 1FVXA 3CMMA 3JZMA 2OVFA 4JU9A 5AYVA 5FEUA 2D7CA 2FW1A 3RVKA 3HUUA 4UCXA 2BY4A 2HCBA 5BY2A 2IVFA 3HI6A 3QENA 4Y2TA 4IYRA 4CMJA 5JD3A 1LVHA 3B3JA 3KFXA 2CLOB 5DRTA 2BCJQ 5H16A 1L1FA 5B6IA 1MW8X 5FPQA 1ID1A 2YTZA 4OIMA 4NF2A 4UFOA 2FVXA 5GV8A 4AY4A 2WUVA 1P81A 3LU1A 3L4BC 4DDKA 3VVBA 5TY0A 3RYCB 5G0SA 4ENQA 3B1XA 2CXNA 5JXJA 1OLUA 1IOLA 1V41E 3M5CA 2W98A 4JROA 4KVZA 3C5HA 4NK4A 2X3FA 4WJLA 2G04A 2XMQA 1N6PA 3WJAA 1RC0A 3P20A 4GSLA 3VR1A 1SQ0A 3L0PA 3UWSA 4PSCA 1IBCA 1PWXA 2JAQA 4R1QA 2JBAB 1VZ2A 1PJAA 2Z56A 2ZI7A 2X1MA 4TT8A 4GLFA 3E9EA 2TMGA 4N7JA 5AVQA 2IOYA 3KU4A 3RR2A 4D9HA 4F5WA 3MJRA 1DC5A 3C15C 4Q4JB 5L3SA 3M89A 3ON5A 4Z3DA 4MJ7A 5KDLA 2I65A 1QYXA 3K73O 3EPJA 2CUKA 1W4ZA 2PX0A 3TUZC 1UCFA 2RE8A 5BVHB 4H1TA 1F8FA 3F67A 1FFDA 3QF4A 1THZA 1K08A 2MOKA 3CNBA 3HRKA 4RV9A 2PMFA 3ZN2A 5KTKA 3HNRA 3NORA 2HGZA 4FI3F 4OFZA 5JNRA 3REGA 4EECA 4YMHA 1AXEA 3BXHA 4KXFB 3HRHA 4L9RA 3FDJA 1XP8A 2EFHB 4YR9A 3W1EA 1UBKS 1D2GA 3QJYA 2NU6A 1XD9A 1CUYA 2AG6A 2QYOA 1CYDA 3QEBZ 2LD4A 3U62A 4Q4AA 5E8JA 4BCDA 1BMDA 2OOKA 3HCOA 2CJXA 2FPKA 3BHIA 1X9GA 5BR7A 1LBHA 2XQJA 3CTPA 5AKIA 1KHTA 5E6SA 4ENTA 5AXBA 3OFSA 4A23A 4BMZA 5KJCA 1U8FO 1USIA 2AOTB 4W8OA 3D2AA 2HR1A 2HHAA 5JI3E 4CT5A 1TAHA 3FPBA 4ZO8A 1FP4B 3PVCA 5HBRA 4B6JA 1LY1A 4GI3A 2W5UA 3K20A 4RPKA 3I12A 4GDMA 1RPNA 3CEHA 1JIIA 4OMDA 4TWIA 4WZBA 5FTJA 4CEJB 1DIHA 3OE7A 1QGZA 2P9BA 2XGOA 3MC1A 5LZ5A 1P3JA 3HNOA 5F2OA 3WP0A 5KS2A 2N0SA 5GONA 3D2LA 4GMFA 3V7UA 1HTBA 1Z6YA 2ZRIA 4WEQA 5FR2A 3MMZA 4M60A 2LP4Y 3KE9A 2Q2QA 5U9CA 4M8LA 1DAKA 1K2VN 4ID3A 2W2TA 1EDOA 3QEOA 4OBXA 2VDLB 4KSCA 5DGHA 3OT1B 3TR0A 3PC4A 4HSGA 1QVVA 1M2VA 1T9DA 2GCOB 2R1ZA 4BV8A 2Q4EA 3ES9A 2CL0X 2BE7A 3ZEIA 3PCTA 4CLXA 1C1DB 1HFJA 1RZ3A 5FBLB 1N6OA 1M76A 2A33A 2C78A 2OFOA 4MA4A 3ZVLA 2R6FA 4EL0A 3LOQA 1JU9A 2GHIA 3KHTA 3TVYA 2Y2UA 4EVRA 5IT0A 4E21A 1K27A 1U3GA 2GPWA 5HFNA 1XEFA 5I7UA 1M3SA 5AWFC 4MGKR 3HPRA 3OX2A 3P19A 5TMDA 3AHCA 1UBHS 4DLLA 1GIAA 4M76B 3IUPA 2B4RO 1PCXA 2H1HA 1NXQA 4UDOA 2PA3A 4B0PA 1VLLA 4O08A 1AVTA 1PYOA 1N34B 2ZDGA 3GMDA 3OCYA 4JX8A 4LEIA 1JNYA 3LKDA 1F4PA 4X6LA 3VOTA 4EI8A 3ZU6A 5TF4A 2AJCA 4QBIA 3WI7A 2V58A 1ISHA 3CJRA 4FHCA 4XDYA 1X3LA 4G5XA 3QYPA 4C03A 4JYZA 3F2IA 1FDUA 4RZ2A 1EWTA 5E8RA 3L7JA 3R1IA 4ZVTA 1NRIA 4OXKA 3T7RA 4GPIB 4KPEC 1RI5A 5DASA 5JPCA 5KJ6A 3GFBA 1PKXA 2GJ8A 2NU9B 5JFTA 5JH7A 3AEKB 4R9RA 5KCMA 3KSBC 1T1SA 4YCSA 4QO8A 3B9RA 1XMXA 1V8ZA 3DEZA 2ZR9A 3A6LA 3FNRA 2FDXA 1GL6A 1HUQA 2O1EA 1DRKA 3PX3A 1Z28A 1RABA 4AN0A 2NUBA 2O48X 3QVUA 3NTQA 5GPBA 2ZXUA 2BH2A 2WE8A 3RT1A 3Q3CA 3UHOA 4WMLA 1PFYA 2BFFB 4C3OB 2J6IA 4G0XA 3HVUA 3FVTA 1BMFD 1JG2A 1CUSA 1KMMA 1L7OA 1W5AA 1EE2A 3DWEX 1N6NA 3JPYA 3GC6A 5FTLA 3L6OO 5EKXA 1N2SA 4UOZA 1IBRA 2I8CA 3C70A 2FW9A 3PZRA 2IC5A 3W90A 1Z5GA 2CYAA 2JJMA 2HA2A 2QLNA 5FI1B 5BRAA 4R68A 2YR0A 2C03A 1GSAA 4AKSA 2B1RA 3PQCA 4W5QA 3LA6A 3ABZA 2J3IA 4OI2A 3AVYA 2V54A 3I9JA 3MWKA 3Q9SA 5DCLA 4FFMA 4FOOA 1VJ5A 3ZY2A 3KB8A 3R0IA 3E22B 5D1HA 5K3CA 3COSA 4DC9A 2BGWA 1J9GA 4TRRA 3TZLA 1PW7A 2P4HX 4FHDA 3A4MA 2G1PA 2ZIFA 1E77A 3HP1A 4L57A 1ZNWA 1EB9A 2FPMA 2LIPA 2ZT5A 5J2TF 4CLRB 1RWNA 3AVTA 1MAHA 1WQ1R 4RCZA 5I9LA 4INAA 1TEHA 3A06A 3N6VA 4WBNB 3QI7A 3QA3E 5B55A 5BWNA 4B71A 2ZKIA 1OJLA 5KINB 1RBQA 2BEKA 4EFNA 3C24A 1JLLA 1PK8A 4RC9A 2PFGA 4WKNA 3I5MA 5KBYA 3VH4A 3EEIA 4LHWA 4HVAA 2PGIA 2WK1A 4FZ5A 4H1UA 4Y1GA 4EB0A 1GGFA 3VPSA 3X2SA 3W1WA 2PYIA 3F3YA 3O94A 4H9GA 3QYAA 1JA9A 3NIWA 4II2A 2BR4A 3QQ5A 4GMKA 3KSZO 4LOKA 5T67A 3PU6A 5KNCA 2PL3A 1BMTA 1SCKA 2NXWA 1LNZA 1RLMA 3N58A 4F3NA 1M5TA 2B7CA 2R6ZA 2JIMA 1C7ZA 2QLFA 1EUQA 1OX6A 4RDIA 2C1ZA 3WKBA 2V97A 2QORA 3UH0A 2XAAA 1YUNA 3BT7A 4H3VA 2IIQA 1CEYA 1J42A 4DMRA 5JAPA 3FOFC 4ZI7F 3DZJA 3UG7A 4RL6A 2FFBA 3HWSA 4H4EA 5IDQA 1E1DA 3WKEA 1P1JA 2WA2A 3FF4A 5AVYA 5DMXA 1FY2A 1QGDA 1P60A 2JLQA 1CUXA 3J81k 2V7WA 4TL9A 5AMXA 2YWCA 2MYPA 2QDKA 1NSTA 1YDEA 3EBLA 1ZLXA 4EW2A 5JSHA 4RMHA 4P22A 3E9RA 4OJQA 1W88B 5FD8A 3ZJ5A 4DBZA 2WUGA 3SXJA 3AEZA 2V59A 2PV0A 5IDVA 5BMVF 3AGPA 5LKAA 1I3LA 4YFYA 3KM0A 1YOVA 4G5QA 2R751 4JI6B 1LVGA 4NBLA 3DUFB 1V1RA 1QG2A 1CHDA 4TX1A 3L1JA 3LZCA 3N76A 4WXHA 3KQYA 4OJYA 1H05A 2V7QA 3EZGA 4IDNA 3Q8LA 3ER8A 3ENVA 3V5NA 1L7BA 4GDFA 2GLTA 4PLVA 4NX2A 5IC4A 1AF7A 3VDNB 4ZI7A 2O3SA 2X40A 5DYIA 5MFPA 2IU3A 4FMCF 4FVTA 4JVNA 5CGQB 5E2IA 1ZSYA 2VXOA 4LDJA 3N3BC 5HE9A 1UMCA 1U9ZA 4MUEA 1KNQA 1NR7A 1Y3CE 3GUVA 3H7AA 4RTJA 4DR5B 4AMVA 2J0QA 2QQ5A 4XARA 3K71B 4HUQB 4Q7KA 1GOTA 3DWFA 1EFLA 3OZCA 3UMFA 2G83A 3ZE2B 2GEKA 2AMYA 3Q8MA 1EVJA 4TLAA 1G8MA 2FJUA 4QUEA 4CIWA 1FSZA 2W8ZA 4IGAA 4WL0A 1ZW1A 3PKIA 1JX6A 4IHKA 2DH5A 5HK8A 1XLWA 1WOYA 3T9BA 4BN0A 1M1XB 1K66A 2PGJA 3A1TA 4BKPA 5JT1A 4DSUA 5KVVA 1SCAA 3MJHA 4E5SA 5B4UA 1AJEA 3MWGA 4KBYA 5FLKA 3TLJA 1BXGA 4MAMA 5CLJA 1JFFB 4W9NA 1FRQA 3CRW1 1ANKA 2O8CA 4MHOA 3UVEA 3CVWA 1ENOA 1JALA 2VNIA 3ESBA 2XEDA 4BB9A 3G3EA 2I03A 1W0JA 2HUPA 3HKBA 3PHGA 4LF9B 3N8KA 4C0WA 3IODA 3NV7A 5IKMA 3OLZA 4Z9XA 4H0CA 5A03A 2VSFA 1XMIA 1QO0D 3FSGD 2R87A 4KO1S 2CNDA 1L7XA 4EZBA 5DP1A 1MH9A 2ZCUA 3DOEA 5HQ3B 2FU5C 2Z04A 2R2GA 1ZJ4A 4XXHA 1ONBA 4K9QA 3EOAI 1JMKC 3QNUA 5KYXA 4ZYXA 5JBQA 4KPGA 1FTSA 1QH1B 1ACJA 1YE5A 2FRDC 2EZ4A 2G4VA 2OE2A 1W0KD 4HYYA 2V7XA 2NX2A 3S2SA 1SBYA 5JSUA 5IKXA 2PT7A 3C5EA 4ASUA 2FOXA 3GYGA 1FFGA 4IJKA 4MQ5A 3DTVB 2R47A 4URWR 3USES 5BSHA 1DIGA 2FKNA 1AURA 4RDXA 1NJ2A 3DLBA 2UZAA 2N1MA 3M6FA 4B35A 3SZUA 1IXYA 1ISMA 2I55A 3L18A 4R81A 3LUPA 3AVPA 3T5AA 3SX4A 3NZEA 3F4KA 3D8RA 2ZM6B 4IWNA 2IS6A 2HIAA 4J9VA 2NZ2A 5KWEA 3SC4A 5KX5F 4I6JA 3G8DA 4E5PA 3N8HA 1GO2A 4JJFA 1SUBA 4PG7A 4U5QA 3T5GA 4A6DA 4YYZA 5E9QA 1OBFO 2SNIE 4JUDX 3QFCA 4LRWA 3P9KA 1NJ6A 3I62A 4P4TA 2YYSA 1GD1O 1WMDA 4HYEA 2EGUA 2R0QC 1WP4A 1XALA 1DAOA 2OBYA 4YDQA 2HA3A 5T4FA 1HZZA 2PX6A 3V4SA 1IU9A 4KK4A 3WL8A 4IMPA 1NJ1A 5ICEA 2V4MA 3MGBA 4RV4A 2WSMA 3K6KA 1NRWA 1QQTA 4OJNA 4DCUA 1ZKMA 3G0OA 1JR6A 1K7EB 2AUTA 3QBEA 3GT3A 3H4TA 2X6RA 3IO3A 4TV8B 1F0KA 2J3QA 2PSHA 3TRKA 3V2HA 3BICA 4A16A 9GPBA 1Z0DA 2G36A 4WOCA 2AZ4A 1ZGBA 2QB5A 3LC0A 2CXHA 5JCJD 1Z6PA 2G9UA 2WUFA 4C4PA 2J5XA 4C4XA 5L3RA 4JD5A 2X4LA 3C1UA 3N2KA 4MP3A 2H29A 3FYUB 2K5UA 4Y98A 4KAXA 1L4KA 1GVHA 1C7QA 1HEIA 1G2IA 5CGZA 5DCUA 3OUTA 2AK3A 4ND7A 4ARCA 4K1XA 3I76A 5FI0B 2ZJ0A 2EFYA 2NNLD 1FCJA 1US8A 1T4GA 1VPTA 3CW2A 1GKKA 2R1UA 3HUTA 5AH0A 5GY7A 1FDRA 1H8EA 2JD1A 3L04A 2C99A 3N2ZB 2IKSA 3TOZA 1FE8A 5H02A 1G9TA 1GT91 3LQFA 4KAFA 3M1LA 1N25A 4LNHA 1T13A 1AG9A 2P4SA 3C98A 4F3RA 1O95D 1HH4A 1JKMA 1E0DA 1EFHA 3MUNA 4P92A 3W5SA 4R2WA 1XA4A 2G0AA 3MGCA 5FFNA 5A2GA 5JDCA 5DM0A 1N1EA 1BG6A 1RYNA 1YR2A 3FNGA 3KSDO 2G5PA 1I14A 3BTOA 4YRAA 3BD7A 1ICIA 5LDGA 4U39A 4M1TA 1P80A 3X43A 1JIQA 4EG4A 2OFWA 4G0YA 4I55F 4DEXA 1QX3A 1DRJA 4JELA 5C7IO 1QGUA 4HF7A 4F2PA 1D03A 1L5MA 3GPLA 1T5BA 4N0EA 4CLDA 4B4WA 4B0OA 4HAYA 2WKWA 2X8LA 4IIXA 3GAMA 4NCJA 2NSDA 1EE1A 2C95A 4FWBA 5I9IA 4N82A 3PNKA 1E60A 2JJQA 5ULLA 4MS1A 3EPRA 3R76A 3SZGA 3WX0A 4LMBA 1X74A 2P1ZA 3BZBA 1EZ1A 3ZHUA 4CMEA 4PWYA 2HQOA 1G7SA 3ZGZA 2D3WA 1A8SA 1CBUA 2AN1A 2ECPA 3Q87B 3M6AA 1EP1B 4J6EA 1A9XB 3WRVA 3ZQUA 5TPWA 5A6VA 1CZHA 2D4AA 3KB6A 3O4HA 4KJZA 3IRVA 4R7TA 1MOSA 4PGGA 1HZJA 3CTMA 2ZK7A 3TLYA 1Y3FE 3R5SA 2VXYA 2AEEA 1MB9A 4RJLA 1R6TA 2OQIA 3HM2A 4NK5A 4HEJA 1DCMA 7ADHA 1ZBDA 2G67A 2REQB 3TR5A 4P6VF 2XMCA 2IYVA 2GDZA 1LLDA 1IQRA 2XJ9A 3DHWC 3IR5A 5IVHA 5MHTA 4QUIA 4MVJF 3PHCA 4RFSA 5K3AA 1K86A 5A7HA 4BFYA 1Z15A 4PC6A 1G3QA 1RQLA 3LCUA 3KLOA 4CIVA 1II8A 3FH0A 1RXSA 4UHKA 1I13A 1KJZA 3NXSA 1B2LA 4XX0B 4C06A 4R9NA 2AJDA 3T9EA 2F1KA 4L1KA 3T7IA 3U56A 2OK8A 1U7OA 3L2OB 4J16C 4LYFA 4B84A 2H4YA 4KN5A 3FSGA 2Q1UA 3FVQA 3PFNA 3RIEA 1PT5A 2PXHA 3MMNA 5F1PA 3T3IA 4D8UA 1WDKA 2CEAA 4TWAA 3OQMA 1L1QA 2AS0A 2H4HA 5DTJA 1NRXA 2NZJA 3Q9UA 5CYOA 3KQMA 3RJMA 3TVDA 2OBXA 1TK3A 4Z4GA 1VYVA 1J90A 2BHTA 4GKBA 1SU8A 1XCJA 1P3Y1 5AM0A 1T9KA 2O7RA 3JD4A 5M3BA 4MV9A 3RC2A 2CXSA 2C5LA 4JDPA 4MICA 3PL1A 1TF7A 2VOEA 3AP3A 2PA0A 1N57A 2B8NA 2HWKA 3OLVA 4I5IA 5CPBA 5I47A 1LD3A 2HOQA 3FMFA 4JYAB 1H3EA 4ZDKA 4I4NA 5FQOA 4CLOA 3CEJA 5BQPA 2PQ6A 2PZMA 4YYEA 1X92A 3EQ8A 4MV8A 3TNJA 1KIFA 2BOVA 2DVMA 4KN9S 4DQ0A 1SUIA 1R4MA 1FX0B 2R25B 3L8CA 3BHNA 4MS3A 3AMVA 1BKSB 1S4QA 3R9XA 1T4MA 1V37A 2GRJA 4L07A 1RRKA 5K3FB 5DEOA 3TQSA 4LF5B 1T0JB 5CPFA 2A9QA 1UBOS 1POWA 1T24A 1VL0A 5DSTA 3CF4G 2NO5A 4AZ3A 1LPSA 4KQHA 1YUMA 5NLLA 4MPPA 2XE7A 3PA6A 3H1TA 3M2PA 4TTQA 3VXKA 3G82C 3EMDA 4O4IF 2H9YA 5L4LA 1AKMA 3GFOA 1T1GA 4Y1RA 4C05A 5L95A 1W85B 2FSFA 4NICA 2E4ZA 4WLVA 4XQ0A 3SOPA 1MHTA 4NFHA 1GQRA 2GVZC 3G2KA 1XRLA 2VDWA 5G0VA 2IIVA 1XZCA 3N0VA 1XPJA 3R41A 3E5RA 4UZFA 2H3EA 5AI6A 5IAEA 4JVSB 2WVHA 3EIOA 1VDZA 2D2FA 4H6PA 1BMQA 1PV1A 5AKZA 4FYYA 1NJGA 1LDBA 1ZOSA 4Q9IA 4UUOA 1C8KA 1ONNA 1PWEA 2XE6A 3D5QA 3SHQA 3LF1A 3R5HA 4FYMA 4EHKA 5MDHA 3GRZA 3CE6A 1ECJA 4OQPA 3ZKAA 4AXBA 2I3ZA 4YV0A 1G21B 3LC7O 1QFJA 1F2TB 1YUBA 1FXSA 4WADA 3EGOA 4FMDF 1HNXB 4XGQA 5LQCA 5TS3A 1HMPA 2JEZA 2QZJA 2VIIA 4MGEA 4WW0A 1E32A 4A2CA 3A9CA 5J3JA 1R6UA 4PX5A 1LPNA 2MDTA 2QJOA 2ZBQA 3I5UA 3L02A 3PNYA 5D1NA 5HRAA 4UUQA 4X1IA 1QQ5A 2YWBA 3ICWA 1N8TA 3BA1A 3GUHA 1OIVA 1P17A 3V9AA 2JI4A 4FW8A 2J9ZB 3DE3X 4KHZA 2AVNA 4PLWA 3EGVA 3TPZA 1PG0A 2NLOA 5E1OA 4ZC1A 3B82A 3WL7A 1R0KA 2QLJA 4D8YA 2VA8A 4KBFA 4F21A 4NZOA 1H22A 2I62A 4S2UA 3EVFA 4GWGA 1T8WA 1EFDN 1C0IA 2DPYA 1K7SN 5KHAA 2YJ5A 2JFNA 3E7PA 2R4TA 2VTKA 4ZVVA 2WG0A 2DECA 2YYZA 1H94A 4R3UC 5A4DA 3ZV5A 4EW6A 3DJFA 1OHHA 2QTZA 3NTOA 2JVIA 2GS9A 3JWIA 5FUYA 2CHQA 2G9VA 4M1WA 5BSMA 3PPWA 3OETA 3I8SA 5BP7A 4MUNA 3WK9A 2UXCB 2YFKA 1P6XA 4Q66C 2BEUA 3GJ6A 4ZN6A 3ZCQA 1FFWA 1V3TA 3L0ZA 4QUDA 2IF2A 4FMDB 1IM2A 5IXJA 3G2LA 2YBEA 5E7IA 4HG2A 2VPYA 4CUZA 1AU9A 4QFDA 4DDTA 4LRSB 5BV7A 3AF6A 2FEMA 1G21E 4H4CA 1KMCA 2ET6A 1Z5NA 1APBA 2PUAA 1W8IA 221PA 2O23A 1XPUA 1GR0A 3N2EA 1L4EA 2IPOA 5FWXB 1HZZC 1OI4A 2GA9A 4QG7A 4JBLA 1NDUA 4YVFA 4C1NA 2QRHA 3ISVA 3QOFA 5EIAA 4LFAB 4ZOCA 4IIVA 5ICFA 1Z6ZA 4KW7A 2R7LA 3CRMA 5EIFA 5FNVB 4B3DA 3OE4A 4H35A 5HMLA 2Q3EA 2DSTA 5CVJA 3UTDA 1SOMA 2NUPA 2JG3A 4UBKA 2J7PA 2EZTA 4HFJA 4OKIA 2I2FA 4X63A 5EN4A 3V6LA 4DG8A 3HKEA 4FKBA 1RPZA 5LR6A 3IELA 1L8OA 5K4AA 3KXKA 2PV7A 5KYKA 3MVEA 1XD2A 2P3QA 2HUNA 4BO0A 2ZRHA 3F5QA 4CLEA 5KHLB 1L4BA 4WN9A 1K6JA 1TVCA 3SHTA 1Z5WA 2A5JA 3PQ4A 2VC2B 3W2HA 1FC0A 3T4PA 3HM9A 2QM8A 4QDJA 1FUIA 3G8BA 3L7OA 3ENWA 2H48A 5E1BA 1JFTA 3T3OA 2FSUA 4PZEA 3GLHB 4FFOA 5HBGA 5I8PA 1BRTA 2YV5A 4D7AA 3O8BA 1MC8A 5CX4A 5CDGA 1A2KC 1NI3A 2Q6VA 2Z0MA 3MT7A 4G0OA 3HU1A 4L4RA 2ORVA 3ZVRA 1YT5A 3USZA 1UKCA 3O1HB 4JR1A 4Q47A 2DC1A 1CQWA 4U5XA 1OVGA 1PJ8A 4WI1A 3L7MA 2W43A 3REOA 2NTNA 4NYJR 1Z45A 3CKKA 3EVZA 3Q8XB 3QEKA 3RYFB 1GZ6A 1KMHA 3ZK9A 5L45A 3LP8A 1WR8A 3PF9A 4YCAA 4BO4A 4D6PA 1QH8B 1OFUX 2WG1A 2V5UA 3C6KA 2HF7A 1M2EA 1L5HB 1P2VA 3N28A 4GMGA 4FM9A 4QM6A 2NSYA 2OD9A 2ZBGA 3W3AA 3T0FA 3FW1A 3TG8A 4B5KA 1GGVA 1FJXA 3P2KA 4IEEA 4PXYA 1SUFA 4CMKA 4NYMQ 2NWQA 3ZIUA 5KNBH 1NW7A 2BKLA 2CLIB 3IT3A 4M38A 5KNDA 3CVVA 2AZDA 2PKQO 7REQA 2O2XA 2C8LA 2FEAA 4ES6A 5JCOC 2QN3A 2G9NA 2N47A 4LDNA 5HWSA 3DWIA 1GTRA 2JDIA 1KZ4A 1KY5A 3EDYA 4QDZA 4WK4B 5AQEA 3RFVA 3OF3A 3WBKA 2QE7D 4YJ3A 1BOOA 4KDFA 2HQRA 4PBTA 4POOA 3A70A 4DWOA 4MR8A 3KYCB 4F6LA 2EZUA 2WPDA 3OU6A 2BFEA 1NFFA 2X9GA 4I9UA 3RRFA 5FL7A 1TKCA 1OBCA 1KEWA 2HNAA 3OY7A 4TLBA 1H6DA 3C6YA 4AMZA 1GRVA 3IT2A 3JD0A 4EJMA 2GFQA 2O1XA 1DUSA 3H11B 1YS9A 4EL5A 3DXZA 4DE5A 4UTNA 1C5KA 1DIRA 4H4DA 5K0SA 1BE8A 2GXUA 4TTVA 2FPLA 2HCRA 3KV1A 4HB4A 5FBRB 3K9GA 2DPMA 2JFUA 3V2GA 3LCVB 3WGTA 3VKVA 5CYGA 3W4JA 3NBAA 5LMCA 1T2FA 3CRNA 4HPXB 3MTGA 3NEAA 4L4UA 1M0WA 3NT2A 4MA5A 3QNMA 4DMCA 3WKCA 3ZQKA 2P4UA 3W05A 4BFUA 4TKZA 3UIEA 4EF6A 1SVSA 1U7UA 3IBCA 3SK0A 4E07A 3I2FA 4HQFA 1Q2XA 2BISA 4X6XA 3OOYA 4JX9A 3VZPA 2WFLB 2Z2KA 3PLAE 1NQTA 2FPIA 4AN1A 5DBIA 3D3WB 2IEZA 4PQRA 2YNMA 2HA4A 3I72A 1JQEA 1N2JA 2HJWA 1R0LA 2X8JB 4KLCA 2FSHA 1UJ4A 4HNVA 1GADO 1TTQB 4UPEA 3TAUA 1XZDA 4A92A 1E3SA 2I4LA 1XRNA 4QQFA 3KR2A 3SCZA 2JAXA 4NFYA 4B5LA 1A4XA 2H1IA 5DEIA 2DFLA 5IKEA 4LOAA 2P2GA 4MR7A 4NYIR 4UBIA 5FWYA 5LL6P 1GQQA 4W5TA 4FNOA 1GPYA 5FUMA 1NQVA 4H7PA 1UJ2A 5E3IA 3MFQA 4FKMA 1VG9B 3B6EA 2QW0X 4L4SA 4LW8A 3AU9A 4EFKA 3AC0A 4PTLA 3F7TA 1I0IA 1D2CA 1NMSA 3LRTA 4KVGA 2YRWA 1O89A 4YJDA 3EWNA 1IWOA 5FWAA 1MABB 4ZIRB 2A1TR 4RHTA 3QFSA 1T6XA 4UEOA 2V8OA 3IVXA 4GR4A 3OY2A 4IRMA 1GPH1 1MCZA 1JFVA 3JYOA 1SB8A 1X1DA 2EOAA 3RLFA 1YB5A 2GPJA 2JAHA 1XZEA 5D5QA 2QGFA 4J1SA 2R6GA 3I32A 1XCGB 3PGJA 4D3DA 1DP4A 4TV8F 1P1IA 3A6HA 1BHQ1 1LQUA 2F4NA 2BWJA 4DLVA 2AN4A 2IT1A 2X41A 1LPOA 2CLSA 2Y71A 3LLUA 2E55A 3MT9A 1QQ7A 1WVIA 4TYYA 2WTUA 2M6RA 3FDFA 1CUVA 1Y1QA 2G5GX 3LPNA 3MBOA 4JUCA 4N9WA 5DNVA 5FEMA 1Z0UA 5KNCD 3RVSA 2D5LA 4QYXA 5JYBA 2W6PA 1CZOA 1WXQA 3K05A 2D0PB 3FSRA 4FFRA 4YCNA 2B5WA 4JQSA 1SN7A 4UHDA 5FL7D 3TLZA 2YQZA 3LG2A 3HRIA 4B47A 3R8FA 4NECA 1L1EA 2XMDA 1UOOA 4RVNA 4H7JA 3VO2A 2FZVA 4D44A 1I30A 5KTYA 1ULBA 4YMIA 1FRZA 1E2QA 1PEDA 1O4WA 1IN4A 2BP7A 2HIMA 1SO8A 4MYSA 4MZDA 1IM5A 1PJRA 3WL3A 2ZW9A 1YK1A 3D8NA 1GRQA 1XKTA 3B5IA 3DBOB 4K03A 3GWZA 4GXRA 3FBWA 4ER3A 3BQMB 5K03A 1RRPA 5DPMA 3EIUA 2IZ5A 1L7NA 2VWGA 3TNYA 3WRXA 3H9EO 3QX8A 5IUKC 2WG2A 2MINA 3WNCA 2HV8A 3LBNA 2R84A 1H2BA 4CV1A 4BIIA 1AQYA 4PZAA 3IAM1 3EIFA 5JS7A 3K72B 3VR6D 4YREA 5FYDA 4QREA 3RKSA 3BWXA 4REQA 1G1AA 4MRNA 5F1OA 5KPDA 2X23A 2B21A 2KLHA 3ESXA 2ISQA 2VYVD 1QO0A 1RHMA 1TCUA 2IEYA 4BN4A 3ROTA 5CEJA 1AB5A 1CLEA 1DLIA 1LW7A 3TSZA 1F2UA 2WJIA 3HZRA 1K8YB 4L75A 4ZCLA 3RJTA 4M22A 3RYTC 4D81A 3NU1A 2XB9A 4ESHA 1NBIA 3CKYA 5JASA 4B7AA 2VP9A 3PI6A 4C4SA 4L0CA 2ZIXB 1E6UA 1Y9EA 3WP1B 5LA6B 5DT2A 4PPNA 2GJSA 2V65A 2WSBA 5HFAA 1TC2A 2YUIA 5CAEB 4LGYA 4TYWA 3QMMA 1G2PA 3TPCA 1EBUA 3TI7A 2B34A 3RV3A 5J2UF 1OH7A 1WPGA 2HGSA 1PZFA 2G40A 3JR7A 4PRLA 2CCJA 4IOKA 5B37A 5TF0A 1XT6A 1YGYA 2G28A 1R6XA 4FYWA 2XQGA 4OO3A 5HS4A 4ITRC 4F06A 2YJ4A 3MWEB 4LC0A 4RSGA 2C1XA 5BYAA 4XYBA 2R6CA 1B0PA 2VF2A 1GQ2A 3QUQA 4CM6A 2E6UX 2O54A 3CM0A 4RQAA 2O0MA 4UBMA 1XN4A 1ESNA 2A88A 2R1VA 5GJWC 4PGHA 5AI8A 3B2NA 1OE0A 1H5NA 4U9UA 3R7WA 3BK7A 2V7VA 2BFBA 3VPBA 1QPBA 1HA3A 3RF6A 1R8SA 3TTVA 5IWAB 1WB6A 4RTPA 2IYYA 1ZVKA 4W7HA 2Y1CA 2XIQA 4DLAA 1NUHA 3TO5A 2GRUA 2O06A 4WLUA 1PR2A 5CB4A 3GD5A 1LPPA 2EX4A 1C3VA 4OF4A 3LUKA 4BY9E 4K81B 3U09A 3RT9A 4LDAA 1INLA 4D4KA 2K4MA 4H3HB 3S2ZA 1MG0A 3VM6A 2ICAA 3AVWA 4RHXA 3EMBA 1F6DA 1PL6A 3IQWA 3NP9A 1EESA 4IIBA 1ZXXA 1N2CB 5G02A 5A3QA 2B3DA 3TGWA 4C1BA 1RAAA 3EISA 4LMRA 4RUKA 3SEAA 4OYRA 3V8PA 4GXNA 4LMPA 1BZYA 2ON6A 3DOHA 1EXVA 1Z36A 2LCIA 2OILA 2IGBA 5JFGA 1AKYA 3B78A 4PPFA 5ALHA 2L19A 5JMPA 5GVRA 2BFMA 4XIIA 4XE5A 3V7FA 5GWXA 3UV6A 4EMSA 4QTZA 3HUEA 1OX4B 4P7FA 4RLHA 5JAOA 2RH9B 3E2IA 3MJDA 1MDFA 3HKDB 4Q7LA 3U60B 1A8PA 2QWXA 1XHEA 5ALLA 3R3SA 2AQHA 3GLHE 1MNQA 5DHQA 3AUAA 2W2KB 3JWGA 1E6LA 5J5AA 4F4CA 2UUBB 1AUOA 4ZQFA 1XZMA 1ZEMA 2Q9CA 1Y1TA 1PLKA 4RZ3A 1PV4A 1WXIA 3K0CA 3PXEA 3ZDEA 1CV2A 3V55A 3KLNA 4B9AA 1UDXA 3VAAA 1ZAKA 3MNFA 3JARB 1XWWA 2DPXA 1J2RA 4MUGA 3RSHA 1FW6A 1GPUA 1P0FA 3FFAA 1VSVA 3JQBA 4RESA 4PSKA 4ED9A 3EXG1 2WTAA 2WJYA 1V96A 3T12A 1KKUA 2B6NA 4TYMA 1G4HA 1PGNA 5FTMA 4UU8A 3FWYA 2NUTB 3HC7A 1V8OA 1QQAA 2B4YA 2IEGA 3C45A 2R11A 2WP0A 2XUDA 1QMGA 2QX6A 1IG3A 1XRQA 3IQFA 5DTEA 3IILA 4Y9UA 4F38A 1XEWX 3D3JA 2QJTA 4MUYA 1PJBA 2A0FA 4L9AA 1XQWA 4XCQA 4PO8A 1E0KA 4BNDA 3VOBA 5EAIA 3HCRA 1SC1A 4DOMA 2DWCA 3C1TA 4CI0B 2OAGA 5LSAA 1CK4A 5EP3A 1QF7A 3A6DA 4FMPA 1XQVA 3ZHYA 1K0UA 3H4IA 1Q7RA 3LW7A 3PFHA 4W7SA 1BCSA 4N5MA 3QKRA 1E69A 4S24A 1A4IA 4DLNA 3GLIB 1XROA 1Z8NA 1DBQA 2H5JA 3DL7A 3LYHA 4FEGA 2D6FA 4R2KA 3DGEC 1USUA 1YMQA 1VXRA 4DA8A 4DRXA 4IKOA 5AVRA 3NETA 4PIVA 4S0XA 1V3QE 1SKAA 1HORA 3ERCA 1Z06A 4AI6A 4UCQA 5HF8A 5I4KA 1FDVA 2XTAA 1YQQA 2NYUA 2IZ6A 4IIYA 1PT9A 3P2JA 5EKTA 1QDLB 3AZOA 3O9MA 3R6DA 5JNSA 3S7TA 5BUZA 4YQYA 2IPLA 1ZONA 3AI7A 4BZPA 3DLPX 4BMXA 5K6RA 4KH0A 4MAFA 1B1CA 4OB7A 5EWLB 2RI6A 1WULS 3E7FA 2BZ1A 2WU0A 1C0KA 2JFOA 1C1XA 3C74A 3U3DA 3DNFA 1D9ZA 3V8EA 3WJ2A 5KEIA 1YJAA 4DR6B 3WGVA 1MX5A 4ZYTA 4YT2A 1KAMA 5C7YA 4HDMA 1CZKA 1KJ8A 2QRZA 1D6SA 4KL8S 5B1EA 1QFXA 5AJVB 3G5AA 1GTJ1 1ML3A 1Z7WA 2E2WA 2Q2WA 3DOJA 1JE0A 1KU6A 2EWVA 4K9LA 3AEUB 2VJPA 2ZS7A 721PA 2VO1A 3U19A 2JJ2A 1IOWA 2I99A 1LWOA 1K68A 5IBQA 1C3JA 3U7EB 1BHJA 5AW1A 3HYNA 4YBZA 4FS3A 3H3XA 3PGXA 3D59A 2IYZA 4G67A 2H3HA 4CKEA 4A8TA 2ODPA 2CXPA 1SVUA 5H3CA 4ZTBA 1JL3A 3WLLA 1BE0A 4L76A 1FLVA 1PFVA 4KQXA 2OPBA 3KQOA 1YACA 5JJLA 1KBOA 1MEJA 1R3DA 1XXHB 2PUJA 3H5IA 3T1VA 4ZGBA 1CQJA 3BRWA 5LLTA 2Y93A 2JW5A 4YHBA 3MQ2A 4MVWA 4WH0A 3FZEA 4GGMX 1YE3A 1UPUA 3RVLA 4F9TA 3M49A 4E5NA 1SCIA 4CETA 4PVCA 2EF0A 5DI9A 4XJTA 5JSYA 2IYFA 3WLSA 1VLQA 2Y0CA 5FDFA 3DMGA 3DDHA 4L3VA 5BVGB 2UYCA 2QBYB 3OC6A 5CDTA 4XRGA 3KT0A 2O2YA 2PX8A 2Q0QA 2VSYA 5GZ3A 2WZQA 3OG9A 3AINA 3BVPA 3TLXA 3TSOA 1NV9A 2JPDA 2NXNA 5ER6A 3RQIA 1G20B 3Q3JB 4Z0NA 4EZEA 5EJ6A 5IU6A 3QWFA 4Y7DA 3RS9A 5KDDA 3MA0A 1R9MA 2G06A 3R5XA 4C01A 4Z6KA 3RJZA 3UNXA 1UC4B 1U6IA 2IXAA 3LX4A 3CZRA 3WRYA 1NQ5A 3KJZA 2Y99A 4IQ8A 5IEBA 4JJ4A 4NZZA 4KFUA 4OLJA 1FMJA 4E5UA 2X5XA 4O1MA 3L92A 1GPKA 4AF6A 2ZVDA 1E3TA 4ZYVA 4GPBA 3KYJB 3DL4A 1HM5A 1H9CA 2ZRMA 4WZAA 4PF1A 3QW2A 4YTEA 3NDPA 4LZNA 2JLWA 1P8AA 4LJ5A 4Z0TA 3HV2A 3TMKA 3F74A 1YFZA 1KFCB 1JU3A 1JV2B 3EEYA 1N2OA 3RTGA 2NN3C 2P1DA 4DM4A 3BMCA 4YJ2A 1X1TA 3UENA 3NBKA 1R8XA 1O6GA 2HV9A 2N46A 2ZVPX 2ZXFA 5DHFA 4MKHA 4BP1A 2P1RA 2W6JA 5JNTA 3AKZA 1VB3A 1RQPA 2H57A 2C88A 3GRPA 2OGWA 1XXHE 2HRRA 1Y1KE 3DE0X 4IWYA 4AURA 7YASA 3D31A 1MEOA 2ZUWA 2DKOA 2QTBA 2A5LA 2J9YB 1IXZA 2P8JA 5F5XA 4JYCA 4QDUA 2QY6A 1SULA 2DWPA 4HRVA 3TQFA 3CVXA 1ESZA 3AJ8A 3GLGE 3IH5A 2QE6A 2QG4A 4RNDB 1JDPA 1NP3A 1RPJA 2EARA 1FFXB 2BMJA 3LBAA 3X1JA 4EBBA 2REXB 4UVIA 1RXCA 3DR5A 1D7AA 3FJYA 3HP4A 2OMEA 4U6SA 5DHRA 2J67A 3H8SA 4HDSB 4Q4CA 1LDMA 1MC1A 1XTVA 4I9GA 1P2FA 3ONNA 2EWWA 3QU9A 4Y2RA 2IS4A 1XGKA 3QFTA 1CG6A 4QQRA 2R8PA 3R7DA 5JBNA 2Q5FA 1KO8A 2J87A 3LLMA 4TSFD 3NM5A 1QO7A 2C9CA 1AMNA 4TZ6A 2VJMA 2DBZA 3KELA 2QRMA 3QVSA 1YRBA 3OLYA 2ZI9A 3UCFA 5DWVA 3MELA 1BRMA 4WA7A 1BDJA 3CPSA 4D74A 5HRCA 4Q6WA 4PYJA 2QZ4A 3D6VA 4FHFA 4TVOA 3MOSA 4RJTA 5JROA 4IIUA 4UQOA 3U2QA 4LZJA 1B3RA 5CRIA 1X80B 4R0NA 5JSZB 4MGZR 5A9RA 2ACEA 3K2IA 4HQLA 3ZX5A 1WMEA 1P7WA 3JQ7B 4HK4A 1PVVA 1FDWA 5REQB 4DCGA 3I39X 3SX0A 3EF1A 3KCNA 3VHLB 1JW9B 2GUGA 5FPYA 3HE3A 3TEMA 2DUMA 2WPDD 4HN2A 1MKYA 2CLDX 4M9CA 3WJ1A 1Q7EA 3B20A 2P69A 2X9NA 4NBKA 2FPUA 4NIMA 4J94A 5ECWA 3AVUA 1XA0A 2GEFA 2QE7A 3K31A 3GCDA 4GP6A 4RKQA 4RWEA 3ST7A 3U4HA 3SZOA 4F7WA 1DIOB 2SCUB 4M8KA 4OU4A 3ZDBA 2P5YA 3NV9A 4IVNA 4QGHA 2FDCA 1MO4A 2IDMA 4TMWA 2Y1FA 2W6CX 4QUAA 4F91B 4A0QA 1NDHA 2QNRA 4Q1VA 4CMAA 3ZVKA 2F64A 1SUEA 1U0BB 3VC7A 1U0LA 2B82A 3ZI0A 4YQEA 3ICQB 5FX2A 1H6BA 2OV2A 5J59A 4DY6A 1XTUA 4IV8A 2VYND 2R6JA 5JCZA 4ZZ0A 3PE4A 4OAQA 1AOXA 5DNAA 1X1RA 2JFZA 5CM8B 2Y4OA 5CFQA 2W8BB 2X2EA 3HNPA 5I51A 1ZNQO 3D64A 4D56A 2UZ1B 1TJYA 3MJSA 5JYDA 3U7GA 3C8HA 3CWCA 4TZ0A 3TRHA 1JDBC 3IHLA 2WU4A 2XDQA 1KVQA 4Q3LA 5CEEA 1WPXA 1ZI8A 4OQ4A 3K2QA 5MN4A 5K0FA 1GCAA 3HJFA 1UMKA 4O2BA 2WAMA 3A11A 4U8GA 4B45A 2AFVA 3CX4A 2CFCA 5TGZA 3E15A 3OPQA 5HP4A 4V0SA 4DQKA 2XCOA 3ODPA 4DC1A 1UDBA 3QFHA 4I3FA 3RSLA 3ZY5A 1S7GA 3RIHA 1XZJA 5DU2A 4BNFA 1B93A 2EEPA 2ZSUA 3HYRA 5AXAA 4B4VA 5C52B 3W5VA 4TYPA 4HQ0A 4QU9A 2B4QA 4HDAA 4CG3A 5BQXA 2ZTHA 3WV4A 2IX9A 4M7WA 1RCTE 5KTMA 1ONPA 4V1CI 3UGJA 2YVQA 3ADOA 2H4JA 1V2GA 1QE5A 3FCOA 2FPOA 2VSXA 1U1FA 4FOTA 1Y6ZA 4TGLA 5GONF 1DU4A 1RWMA 2ZUDA 1U0NA 1L4GA 2F8SA 4UD6A 4KR6A 1RFLA 3DOCA 1D0IA 3RFTA 3WLKX 3NAMA 1YQXA 4KWEA 1MIOB 4BMOB 3JYHA 1MH1A 3LT2A 5DNWA 1JJAA 1U0SY 3I83A 4AC9A 4DLKA 3PG5A 3E5NA 2HWYA 2NYRA 1WZEA 3PRKE 1SJ9A 1RE0A 1E1RD 2NXJA 1NFRA 3DO5A 1JYEA 4LHXA 4PZUA 3R4CA 1ZRNA 3PUIA 1ZNYA 1IZYA 4A03A 2YHUA 5K9ZA 1NSYA 1Q0ZA 1XTJA 3GNTA 4CM8A 5ERGB 1E7RA 1FF9A 1YDFA 3EY9A 3LDAA 4DBVO 4TVKA 5IZCC 3DZIA 3ORSA 2ROQA 1IXRC 5DNEA 1KTIA 3KE8A 3U7FB 2OBMA 1ZAYA 3FFXA 2VR1A 2DKNA 3ZH2A 5K2OA 3BMNB 4MEAA 1RKXA 1T0PA 5LP6C 2EEZA 4R2JA 2LR0A 2VN8A 2Y27A 4WOJA 4B7ZA 3ETDA 1KJNA 2COKA 2X86A 4DDMA 3T0IA 3DL2A 1RXWA 4N5NA 4EEXA 2XYGA 3L4JA 1JHXA 1TQ6A 1JVSA 4W7IA 3PPYA 3S8YA 4KFCA 3T3EA 2HTEA 3THYB 2CFOA 3A4IA 3GUCA 2QUJA 3KXPA 4N3GA 1Z8FA 5F9HA 2NZVG 4KNYA 3OTWA 2NACA 4RVCA 3V4PB 3SYKA 1TKBA 4O3FA 4WA8A 2ZJAA 4FOPA 1A7JA 4BMVA 3VO9A 5BQOA 2F43B 4YS6A 3W9BA 4UEQA 5FV7A 5SZIA 5JZMA 2XNDD 2JIZA 1EHIA 1YONA 2ZJOA 3UAVA 3AZQA 1UP7A 1II9A 3ICOA 3NOOA 5U4XA 1SC3A 1FMLA 1UUFA 3D3NA 1FXWA 1YSCA 1WCWA 2ODQA 3DZDA 3LQ4A 3VQTA 3S81A 1R5JA 2P75A 2WFMA 2PSJA 3DM5A 4YV1A 4LK3A 1IN6A 2Y6UA 5A5GA 1OZHA 3N86A 3TSYA 1D4FA 4Q4DA 4XWTA 2Q3BA 2Z6AA 5LDHA 4B9EA 1U6KA 3TL2A 4PZZA 2Y9PB 1USWA 3MRTA 4CIBA 1KPIA 3PSHA 4M98A 4RTLA 2J4FA 4YJGA 5J2TB 3LK6A 1DMRA 4NOMA 1ZIXA 3AUTA 3N9IA 2IXTA 1Z4MA 3C6QA 1G8GA 5LFAA 1VLZA 2PSDA 5DOVA 5IKOA 4DQLA 3F73A 5JYEA 5T4BA 2IU4A 2ZAMA 1TD9A 5G0WA 4PYOA 1YL6A 5AW4A 1LI4A 2I6FA 4DZZA 4ZJZA 2BFAA 4K9OA 3TS1A 4QOJA 5C1BA 1JAZA 2YICA 4WY5A 2J5QA 4ZQGA 2P9EA 3KPVA 3IV6A 2QLMA 4L2IA 3O4IA 5D5PA 5B36A 5F1YA 2XGSA 1JIKA 4B4UA 3ACCA 4G8DA 4DCVA 1IJKA 3ZI4A 2XD9A 5ENZA 1S8FA 5FJJA 1GL3A 2PLNA 4LSGA 3RAFC 5K99A 2QF7A 4AX4A 4KQGA 2XUKA 4RQTA 4IHJB 5JJ5A 4DY4A 1ZH6A 4RPJA 1XHLA 3MB8A 3T9CA 4CTKA 2WQ7A 5JQGF 2GXQA 1KYVA 2OHHA 1ZGJA 4GPD1 2I2XB 4NYJQ 5AM2A 2I3GA 5CITA 1N2HA 3RVQA 2DETA 4QWWA 2JHPA 2MSEB 2RGUA 3IP7A 1K97A 1LF0A 4E09A 5TVKA 1F8YA 4LWOA 4DT1A 4QLAA 1EB8A 1WMSA 1J0DA 4G4JA 3UOGA 3A6GA 2QY9A 3SKYA 1W7AA 1VE3A 4OUDA 3KTAA 2ZRKA 2TYSB 5TMEA 4TMVA 4ETMA 5CG1A 3RE1A 1BXKA 1FBTA 1Q3KA 1I32A 4GQIA 4KQJA 2QRJA 5I9TA 5FUQA 1RLOA 1PG2A 2ZB4A 2J1LA 1GPWB 4UARA 1X7ZA 3WRXC 1F7VA 3V9PA 2Q2VA 4ZHQF 1UMDA 4DSZA 4HEQA 5BPHA 5KYWB 2GVNA 2C1EA 3SI7A 1MAUA 1QSGA 5FOXA 1JH8A 1VSQA 5T8KC 4N54A 2GHRA 2ZSIA 3TI9A 5IBRA 1QYRA 4Y1FA 2I1WA 3I34X 1DTWA 4GG1A 4HGZA 4NCXA 2B2NA 1AK9A 1YGPA 1UIRA 3LVQE 4ALKA 1UJCA 3LTEA 1S89A 2Z08A 2CFSA 1CPYA 2B1QA 2TMKA 5BW8A 5K0EA 4DV2B 2JIZD 1NQWA 1HDGO 2O5VA 3S3TA 3W2FA 4CM3A 3DS8A 1ISSA 3NT4A 2ZWPA 3UPTA 3HI4A 4KX5A 3IBFA 1ICEA 3RAPR 4A6EA 3Q40A 4FBLA 1T2AA 3HG7A 3OESA 2OQRA 3ENQA 4LY3A 4UU7A 3VNSA 1QE0A 2OZVA 3OZWA 1IN8A 1L4LA 2XZTA 3OFJA 1TA0A 4JA0A 2FWJA 4JT4A 4REMA 3SFVA 4ASUD 5LBIA 3V8BA 1DLJA 5DOZA 3W79A 4MPJA 1CCWA 3IP3A 4IUDS 1A9ZA 2A3NA 4EZIA 1GRCA 2WU8A 3G9QA 2ANCA 3HV0A 4W8HA 2P0AA 3LPMA 4JYMA 3LNTA 4J0DA 1V26A