3WJ1A

Crystal structure of sshesti
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
PLDPRIKKLLESGFVVPIGKASVDEVRKIFRQLASAAPKAEVRKVEDIKIPGSETSINARVYFPKAKGPYGVLVYLHGGGFVIGDVESYDPLCRAITNACNCVVVSVDYRLAPEYKFPSAVIDSFDATNWIYNNLDKFDGEMGIAIAGDSAGGNLAAVVALLSKGKLDLKYQILIYPAVGFDSVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRFSPIIAQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIDQGKDAIGLIGSVLRRTFYDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterase
publication title Structural Insights into the Low-pH Adaptation of a Unique Carboxylesterase from Ferroplasma: Altering the pH Optima of Two Carboxylesterases
doi rcsb
source organism Sulfolobus shibatae
molecule tags Hydrolase
total genus 104
structure length 304
sequence length 304
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wj1A00
1LPBB 2ZVDA 4CIAA 3A2MA 2ZSIA 4XX1A 2QM0A 1WPRA 1E8DA 2BUBA 2YXPX 4AXBA 1FSSA 1U65A 1R3DA 3KD2A 1JFRA 4ARBA 1IUNA 3F9CA 4UHEA 1MPXA 2PSFA 4U2BA 1CUBA 4G4JA 3IVMA 2HA7A 2HADA 3NUZA 3ANTA 3IUJA 1XRNA 2DSNA 2XMBA 5FXMA 4UBMA 5AI8A 1LNSA 4Y2TA 3WWDA 3S8YA 4LKOA 3FLAA 2PSEA 4BZWA 5JADA 2OQIA 3JW8A 1YS2X 5CRIA 3MVEA 3YASA 2WIDA 3VISA 5KBYA 1HDEA 1TCAA 4AN1A 5AIBA 5E4YA 4NMWA 4IH9A 4BBZA 3I6YA 3D4LA 2QXTA 5AH0A 1IUOA 1UFOA 5ALMA 4PSDA 5ISMA 5HF9A 1VJ5A 2HA2A 3G0BA 4MWSA 4KAJA 1UKCA 1N5MA 1MNAA 3F96A 1LPMA 3H04A 1WHSA 5CMLA 4LYDA 4KAAA 4OPMA 2E3JA 2GBCA 1P0PA 2D5LA 5K3FB 3OG9A 2OXEA 3B5EA 4AZ0A 5IVDA 5ALKA 4K6GA 1EB8A 5JD4A 1USWA 1CUVA 1F0PA 5FDFA 3WWOA 3C43A 2B9VA 4WY5A 5D3ZA 2QT9A 3PICA 3B3QA 4UHFA 4W63A 5AM1A 3WL5A 5ALOA 2CZQA 2BAGA 1UZAA 2XQJA 1H22A 2RHWA 3FWHA 1UOQA 3UMJA 1H2ZA 4Y2YA 4XVCA 2AJBA 3H18A 5AP9A 4GBGA 2V97A 5ESRA 1GPNA 2FJ0A 4BCCA 4G4GA 1XKTA 3IURA 1P0QA 4DMHA 4UUQA 1E8MA 4LXGA 5HK8A 3QYJA 3TRDA 1K63A 4H77A 5D3KA 1J2EA 2WFLB 3KWJA 1LPNA 2GYVA 3I1IA 4EY7A 3I2GA 2FJPA 3AFIA 2DHEA 3L1IA 1VZ3A 1QO7A 2GYUA 5LZ5A 2G4LA 2I3DA 3I1YA 4L72A 2UZ0A 3IUMA 4CG2A 3WYNA 1LGYA 2HA5A 4L3WA 1AQLA 4JYMA 1O6FA 3WIOA 5DJ5A 3ESCA 1W1IA 5ALFA 3PDCA 1VXRA 5T4HA 2XUIA 4Y2UA 3BF7A 2NW6A 2WUDA 4CCYB 1HLGA 2QRUA 4P93A 3W06A 6YASA 2PSJA 4FNMA 3EF3A 1JJBA 4EBBA 4GHWA 2GYWA 3FYUA 1ZD4A 1VOTA 2WLSA 2XMDA 1QIKA 4JH0A 2W22A 4ZWNA 4B82A 2OQVA 3VKFA 4A16A 4MJ3A 3WJ2A 3EQ8A 3LLCA 4BB0A 2J4CA 3VVLA 4B0OA 5ALHA 4FLEA 5DNVA 3WK4A 4GI1A 1HKHA 4ZV9A 2WTNA 3STYA 2ZYSA 1CUWA 1UK6A 5IH7A 4EY4A 1XZBA 2WU3A 2XMRA 4LXIA 4B9AA 3OURA 3WK5A 1IZ8A 5E2IA 4E46A 4G9EA 4J7AA 3S2ZA 3WA7A 1B6GA 3DKRA 1JKMA 4QDZA 4CIBA 2XMSA 4MEAA 5JIBA 1CUAA 3DYVA 2ZSHA 4G8CA 3D59A 4N5HX 2CEKA 4BC0A 1XZGA 2G63A 1EB9A 3LS2A 1W6RA 4XIIA 1JMKC 4X91A 3AIKA 4X6UA 4BVKA 2HU5A 4E15A 3Q8WA 1E3QA 3WL8A 3G9UA 2B20A 3HSSA 2VJBA 2HU7A 1XZIA 3PF9A 5ALZA 1KEZA 4JUIA 5JZBA 3G8YA 5IKXA 2BGNA 5JAOA 4BAZA 5EHNA 5ALUA 2CB9A 1QLWA 1XQYA 4J03A 2RI6A 1ZIXA 3FVTA 5C7YA 1BE0A 4Y9SA 3UUEA 1OILA 1EVEA 4TPKA 2XMCA 3DOIA 3K9BA 2ACKA 5C81A 5AOCA 1XZJA 2Z5GA 3G9ZA 5AIAA 1D07A 3O4HA 1CV2A 3EIOA 1QFMA 4BP8A 4A23A 5AK3A 3O9VA 4W1QA 1QE3A 4LHEA 3WMRA 1VKHA 1YR2A 2XI4A 2HFJA 3OOSA 3FYTA 1CUIA 3ZLTA 5K3EA 3W9UA 2VJCA 3V1LA 3STXA 5ALXA 4UBJA 1C7IA 2QVBA 2Y2UA 1UWCA 3QPCA 3ED1A 2XLBA 1UT6A 2XLCA 2QUBA 4W1PA 2Y6UA 4DTCA 3NWOA 1AMNA 5LIPA 4KRXA 1N8SA 4DMCA 1QGED 2QXUA 1FJ2A 5EHZA 1IVYA 4OYYA 2VJDA 3M83A 5LZ2A 2OGSA 2ECFA 4FFVA 5K3DA 3BDIA 3WK6A 3CXUA 3OM8A 4J0KA 5AKEA 1QIJA 4UHBA 5D6OA 3I2HA 4BE9A 4C6HA 3R3YA 5AM3A 4OSEA 1XZDA 2WHPB 1UKAA 1LPAB 2XB6A 2G5PA 5ALSA 1DX6A 2PSDA 4B85A 4KR0A 3QPDA 2WILA 3X3HA 3SWWA 3QMMA 5FV4A 4Q3LA 4X3CA 3QITA 1BS9A 2VATA 4G8DA 2VAVA 5AM5A 2PX6A 3ESBA 5I8PA 1EDEA 1FFEA 2XQFA 4F21A 3NGMA 1MNQA 1CR6A 4ZRDA 1Z68A 5AO9A 4X97A 4UBKA 5LKRA 5JAHA 1U8EA 3W05A 4B81A 5ALNA 5LZ9A 2OLEA 1L7AA 4QWMA 4YK7A 4F5ZA 2JF0A 3BIWA 3G0CA 1BN6A 2J4FA 2HFKA 4FLFA 1JMYA 5HKAA 2OCGA 3R3ZA 4INZA 4DGQA 5ALIA 3FLEA 2VJAA 3RK4A 3M82A 2WQZA 2EDCA 2HRQA 2WUFA 5HF8A 1ODTC 4MXDA 4U2GA 1H2XA 1WHTA 4KE7A 3WWEA 4S0XA 3WA6A 4PW0A 4QDXA 3A70A 4W9RA 4G4IA 4PV7A 4FNGA 1EX9A 4EUSA 4OB8A 3FOBA 5IVHA 3ICVA 1DWOA 4QDUA 3EQ7A 3H2GA 4WJLA 4TVKA 2YASA 2C4HA 5DYTA 2OAEA 3P2MA 2H1IA 3OPMA 2CKMA 2WJ6A 5E4TA 5J3JA 1XQWA 1MTZA 5AI5A 4KRYA 4X7BA 2XUFA 3STVA 1LBSA 5DYWA 1SFRA 2HA3A 1Y37A 5ALPA 5T4EA 4W1RA 3DS8A 4KE9A 3I2JA 4J0IA 1E8NA 1EDBA 2VT6A 4HAIA 4O08A 5EGNA 2B61A 1CUSA 2JGFA 5JASA 3SC2A 2I3ZA 2ZYIA 2W6CX 3WL6A 2XT0A 4IHAA 5AK6A 4IQ4A 1W4LA 3VJLA 4DNPA 3I6MA 3O9MA 3R0VA 3E0XA 5LYYA 3RARA 1K5PA 2PVSA 5JALA 4RNCA 4RPCA 3R3VA 2OG1A 3H2HA 1G4HA 1ODCA 2XMZA 1Y7IA 4DM7A 5SYNA 2XE4A 1A8QA 5HQ3A 1SOMA 1BN7A 5CT6A 1QIGA 4U2DA 2XQIA 3DDUA 1ZJ4A 4I3FA 1ORVA 2XDWA 4KEAA 3F98A 1NU6A 4X6XA 3WWCA 1VLQA 2C5FA 4H18A 1QIFA 2HIHA 5EI5A 4M0MA 2B4KA 3GROA 5A62A 1EHYA 4WDRA 5AKZA 3UUFA 1X2EA 1ZGBA 3FAKA 5C8ZA 3C8DA 2RGUA 2WJ4A 3C6ZA 4J0DA 2WG2A 1EDDA 4J0GA 5ALTA 4C01A 2X5XA 3AIMA 4ROTA 1HPLA 3IIIA 1G5FA 2IIVA 1M33A 4RE5A 4C88A 2WKWA 4H7DA 3HJUA 5T4BA 2YYSA 1K6EA 4PSUA 1GPLA 4BDSA 1XLUA 4K2AA 3V1NA 5ALVA 2LIPA 3GZJA 1XKLA 1TIBA 2VAXA 1JI3A 3CCBA 1DT3A 1RP1A 4PF1A 3VXKA 4IO0A 5ALWA 3V1KA 2VT7A 3U0VA 3JWEA 1A7UA 3OTQA 3ZLUA 5ALJA 1AUOA 3D0KA 4BRZA 1C7JA 3G0IA 4E14A 4H7KA 3U1TA 1VZ2A 4GEGA 4MYDA 5CT9A 2I03A 2X76A 4GLBA 2IX9A 1XZCA 3HC7A 1BROA 5BOVA 4BZZA 1PJAA 2RHTA 1EINA 3HACA 4EY5A 1O6GA 2QOEA 2PUHA 5CT8A 3AZPA 1NX9A 5ALQA 1AKNA 1FFAA 4ARAA 3D3NA 2ORYA 4BAGA 1CUFA 4N5IX 4Q34A 4H35A 1W52X 4DSZA 3O95A 4PO3X 5A7HA 1JU3A 3R40A 4B84A 3DCNA 3G9TA 4JNCA 4DNFA 2GZRA 4BVLA 2HA4A 1UOOA 2QMQA 4HXFB 1ZOIA 4Q05A 5AK5A 3T52A 1Q84A 1TKRA 4Y2XA 1QIHA 5CBKA 1F8UA 1IUPA 3N0TA 4UHDA 5AKJA 3D2BA 5CH3A 2HU8A 3FVRA 4JYPA 4XWGA 2H7YA 1WB6A 3WK9A 1BU8A 1R88A 2G5TA 5CW2A 1KU0A 4WY8A 3C6BA 3F67A 4WCVA 3I6ZA 5EIAA 3GA7A 1BEZA 2V96A 3DJYA 1MX1A 4BRSA 2WG1A 5CT4A 4N8EA 3RM3A 2BJHA 5JYCA 2XUKA 2DFPA 4OU4A 1TRHA 4Q3OA 2K2QB 1A8SA 2PBLA 4GECA 2VEOA 3O4IA 2CJPA 3WKAA 3JYHA 1X70A 4JEIA 1ACLA 1FFCA 4KJXA 4BTVA 5ALEA 4D9JA 2V98A 4J0CA 2X8BA 1XRPA 2VF2A 4AO6A 5JAPA 3DKKA 4QDOA 1EXWA 5AK4A 3DL7A 3A6ZA 4HTAA 2CMFA 5ALDA 2ROQA 4YX9A 4Y2QA 1YSCA 3V1MA 3CCCA 3I2IA 4DIUA 1L7RA 3HABA 2WUEA 4F60A 2GBFA 2BGRA 5AKIA 4BCDA 4WFIA 1CUJA 1MAHA 1R50A 5A6VA 2JBWA 2BFNA 3LP5A 4Y7DA 2XUAA 3L1HA 4B80A 3EQ9A 5HF6A 2HHAA 1MX5A 1QFSA 1H2YA 3FYUB 3G0DA 3WL7A 3TGLA 1YASA 2XUDA 1LPOA 4AB1A 1Q0RA 1EA5A 4P08A 3H0CA 3WI7A 4FTWA 1X2BA 2QUAA 4DYHA 1UK8A 2JGKA 1YAHA 2WG0A 2Y2VA 4FBLA 4PNZA 5AOAA 3AUKA 3G9XA 1GQRA 5FOQA 1XRMA 1W75A 3HZOA 3WQHA 2AJCA 4Y2SA 1T2NA 5AOBA 4E11A 4BATA 5HCUA 4UBLA 1QO9A 1CFJA 2R11A 4QWWA 3HYSA 3WKDA 1WB5A 4BTLA 1XFDA 3KWFA 2QR5A 1QJ4A 1BEEA 4OU5A 4QA9A 3ICWA 1GXSA 2AJLI 1JJIA 3VJMA 5CXXA 5JARA 1MAAA 3D5EA 1SCIA 1XLVA 3BJRA 2OGZA 4C89A 4FLMA 1FFDA 2JGLA 2HA0A 2O2IA 1EVQA 1H2WA 1PFQA 4KAFA 4OD0A 3FYUC 4DNOA 2ONCA 4U2EA 2WIFA 2V9ZA 1C4XA 3ESAA 2ZYRA 2XUPA 1CEXA 2XUHA 4XJVA 5KREA 3VJKA 5EIEA 3O4JA 5HZGA 2H7XA 4J0JA 1F6WA 4GDMA 4EZIA 3W9BA 1GZ7A 3F97A 4DLNA 4UPDA 1K8QA 3C5WP 4H7HA 3DQZA 4H7IA 4WFKA 3PI6A 3GFFA 3ILSA 3WKEA 2OGTA 3AZQA 5JD5A 2GBGA 5FPQA 1RYYA 2C58A 1GQSA 1ZICA 2OPHA 3CN7A 4G9GA 2Y6VA 2XMQA 2JGMA 4UBNA 3IB3A 5AKGA 5EHXA 2O2GA 4OB7A 3I2KA 4KYVA 2OCIA 1WCYA 1LZKA 1P0MA 4LIPD 3V48A 5CTAA 3WYDA 1KU6A 2WIJA 3H2IA 4CG1A 1TK3A 4P9NA 3PFCA 3WWPA 4Y2VA 1LZLA 1R9NA 1QIMA 1CUHA 3WZMA 5K3AA 4L0CA 5AI9A 5AKYA 3PFBA 1GKLA 4DMFA 3PUHA 4MEBA 3ZLVA 1UK9A 4QNNA 4W1SA 1ACJA 1RWQA 4AO8A 5HKBA 3ZV7A 2PKYX 4QE3A 3H2JA 2DQZA 1GKKA 1WM1A 1G66A 4TGLA 5CXUA 3LCRA 2ZYHA 5IVKA 5AM2A 4OCZA 1OCEA 5BWBA 2XUGA 1ZIYA 3LIPA 4H7EA 2PU5A 4BE4A 3W04A 4UBOA 4CCWA 3PE6A 2H9YA 4N8DA 1CUGA 4L9AA 2ZJ6A 3AILA 3AIOA 4BVJA 2ZJ7A 2C5GA 4EY6A 3IA2A 1TAHA 2WM2A 2DR0A 3PF8A 4EHBA 1QIIA 4IH4A 1IZ7A 2I78A 4P92A 1N1MA 4NVRA 2WSLA 2DHDA 4N8SA 3BXPA 4RE6A 2AXEA 1F0NA 4GW3A 3E1GA 1H23A 3C45A 2J3QA 3SK0A 3H1BA 1QZ3A 3C8HA 3A2NA 2PM8A 3BDVA 1VE6A 4U2CA 1U2EA 4K5QA 1J06A 3STTA 4DSAA 1EK2A 4LXHA 1LBTA 4H7FA 5T4FA 3R3WA 4B6GA 4HS9A 3BJMA 4X94A 5YASA 4ETWA 1XZAA 5CURA 3TJMA 3DNMA 1CUCA 4GWLA 1MX9A 1J07A 5H3HA 5SYMA 2JGEA 1G42A 1PV1A 4YASA 3B12A 3IBTA 3DL4A 2EEPA 1XQXA 2WU4A 4BCBA 2FX5A 2JGJA 3IDAA 2Q0XA 4ZGBA 1HBJA 1QIDA 3MUNA 5K3FA 3HXKA 3WLAA 3BWXA 4KE6A 1R9MA 2Z8ZA 4H7JA 5FP0A 4AO7A 1E66A 3IUNA 1K4YA 3BIXA 2JGIA 2RIPA 1CUEA 2VQ6A 3STWA 1NU8A 2DQYA 5KWIA 3WK7A 4Y2JA 2H7CA 4HRXA 4QLAA 1XRQA 1WB4A 2CBGA 2ACEA 3AINA 2J3DA 5C8XA 1ZJ5A 1WOMA 2PUJA 4J3JA 3PUIA 5HK9A 1AC5A 2PL5A 1GPKA 5HFAA 1AGYA 3ZPXA 4G8BA 4CI9A 2VSQA 1SCQA 2O7RA 2ES4A 4QDTA 4EY8A 1DTEA 3E4DA 3WZLA 5DWDA 5KWJA 1GGVA 4U2FA 4M0EA 3C6YA 4QZVA 3QPAA 4AMYA 3SX4A 3H17A 1DX4A 1ZGCA 2YH2A 2GZSA 3N2ZB 4BC1A 5LZ7A 1EI9A 1JU4A 3RKSA 4BYMA 3H19A 1THTA 4KE8A 4GXNA 5ALLA 2WFLA 5JD6A 5HQ3B 1EK1A 5K5EA 1A88A 1L7QA 1HQDA 5AI6A 1S8OA 5DTIA 3DYIA 4FOLA 1P0IA 4ZXFA 1XZFA 3FSGD 1QIEA 1U4NA 3W2TA 5LZ4A 1WPXA 5FLKA 2HA6A 3WKCA 5A2GA 2OCLA 4ZI5A 5JZ9A 4C4YA 2R8BA 4NZZA 5AKLA 1YB7A 3QZUA 4G1FA 4EA6A 3HRHA 2WFMA 3C87A 3TEJA 2VA9A 3IUQA 2HDWA 4FHZA 4CCYA 3HLKA 3H2KA 4M0FA 1ORWA 1XZMA 1YAJA 4UFOA 1UK7A 1XZKA 2GBIA 4C87A 4FMPA 3C6XA 2QS9A 1YA8A 4K6KA 3ZWQA 3HI4A 1E5TA 5BWCA 1XRLA 1ISPA 5EHQA 3DEAA 1VA4A 5FKJA 1T4MA 2WUGA 3AZOA 2O2HA 5AKHA 1MN6A 2P8SA 4UHHA 2DCMA 5ALGA 1SCKA 4ITVA 3BE8A 5FRDA 1LLFA 3WKBA 1ZI9A 3Q0TA 4Y2PA 3R41A 3QM1A 2JEYA 3BL8A 3D2CA 1AURA 3G0GA 2C0QA 2Z8XA 1LPSA 1A8UA 3FNBA 3DOHA 3LIIA 2Y1KA 4AN0A 1BCRA 1DU4A 4LYEA 2O7VA 3QBJA 5AI0A 2HRRA 2QJWA 4UFPA 4WFJA 4PSCA 5I9IA 2QJRA 1DINA 4PQEA 1XZEA 4K6HA 4MYSA 1E89A 1AX9A 3F8SA 1UXOA 3CN9A 4DMKA 3WK8A 3STUA 2VTVA 3D7RA 3I2FA 4ZREA 4CG3A 1CUUA 3H1AA 5LLSA 4X90A 4B83A 3QMWA 5AHXA 4OUKX 4HRYA 2PSHA 2EDAA 4BAUA 4X71A 1CUXA 2OAGA 5HF5A 4X93A 4AQDA 4B9EA 4RGYA 4Z49A 1Q0ZA 1ZD2P 3KXPA 5LZ8A 1BRTA 1YS1X 1R1DA 1CUDA 2D0DA 2RAUA 5E4JA 4MQLA 5HFNA 4X85A 3MUOA 4X95A 2WIGA 1GT6A 4AZ3A 1TCBA 3VDXA 1CPYA 3O0DA 1XZLA 2QKYA 4B7ZA 5JZSA 4BP9A 4HXEB 4UBIA 1FFBA 2Z3WA 1R4ZA 4FKBA 4X6YA 4OYLA 3GUUA 3VVMA 1Y7HA 3E3AA 3K2IA 3C70A 1DWQA 1YCDA 1DT5A 4X00A 3M81A 3KOOA 3HEAA 5F4ZA 2PPLA 4HVTA 1ZD3A 4V2IA 4FDMA 2Z3ZA 1IMJA 3G02A 1ZI6A 3FSGA 4QEKA 3QH4A 4Y2RA 2XUJA 3M3DA 1CIJA 2QZPA 1DQYA 4DNQA 4FBMA 4UFNA 4OB6A 1VE7A 2C7BA 5AKXA 5EIHA 1CLEA 1Q83A 3WIBA 1AZWA 4B0PA 1DQZA 3V9AA 1XQVA 1HL7A 2BUAA 3EBLA 2XQGA 4ZV7A 4AX4A 1THGA 5LP1A 2WHPA 5JAUA 2AJ8A 1OXMA 3ESDA 1ZD5A 1QTIA 5DLPA 4A5SA 4F0JA 1BCSA 5EFZA 4FWBA 3O4GA 3FCYA 1UOPA 3WJ1A 2WTMA 1XZHA 2WHQA 1CUYA 2RONA 5ALYA 5CH8A 5AKKA 3D2AA 3DLTA 5DTJA 1MT3A 2XMGA 4CFSA 3R3XA 1TQHA 4Q82A 1JJFA 1LPPA 1YB6A 2PU7A 1UKBA 3K6KA 4I19A 1N5RA 1VA5A 1QOZA 4HZGA 4I4CA 4FFWA 4IH1A 4J0HA 5CH5A 7YASA 4UHCA 4C4ZA 5ALRA 2ZJFA 3T4UA 4WDQA 4YPVA 1XRRA 4BDTA 5CT5A 2WHRA 3AJAA 5FPPA 1MJ5A 4QLOA 1B41A 2WFZA 5DNWA 3MGAA 5A7GA 4MQMA 5I7UA 1JT2A 3G7NA 2JIDA 4H0CA 3QMVA 1DWPA 3ZI7A 3R3UA 5C8VA 1ODSA 5A7FA 2AJDA 1CQZA 5IVIA 3KDAA 3KSRA 3FLBA 4NS4A 1CQWA 3GELA 5BV7A 2CUTA 3C5VA 4KACA 3ANSA 2FUKA 4X92A 1MU0A 3I28A 2BCEA 1XLWA 3GBSA 3DD5A 1CVLA 2HM7A 1TCCA 4HXGA 1ETHA 5LKAA 4Q3KA 3L1JA 2OCKA 5DYYA 2DHCA 5D7BA 5AI4A 2QTBA 3BF8A 3A2LA 2WJ3A 1W76A 5FUMA 4EB0A 1SC9A 5AJHA 4G5XA 2HL6A 4MWTA 1QONA 2C0PA 1YA4A 5K3BA 3RLIA 3NOXA 2XUQA 1J1IA 1CUZA 1EH5A 2BKLA 3FBWA 5K3CA 3IULA 5AM0A 4C4XA 3FCXA 2BUCA 2XUOA 2XQKA 1QTRA 5A71A 3OC0A 1CRLA 2WIKA 5AM4A 2IITA 1ZI8A 2JEZA 1I6WA 5JATA 1MO2A 1VXOA 5JANA 4AMZA 1XROA 5DNUA 3QVMA 4Q1VA 5AICA
chains in the Genus database with same CATH superfamily
2ZAGA 3LP8A 1RKXA 3F5SA 1Z29A 2BFBA 1BYUA 2R8OA 3GARA 2ZVDA 3I0ZA 2BHNA 5FO0A 1T5SA 2ZSIA 2XDYA 2QM0A 5C18A 1FCJA 1ZM4A 4XSVA 5HSGA 2I4MA 1E8DA 2BUBA 4LBWA 2XYGA 1QAQA 3ZCSA 2WVHA 2YXPX 5M34A 4Z8YA 5BMVA 4Q39A 5DI3B 3EFOA 4PY2A 4ZAFA 1WZUA 1U65A 3OZUA 2D62A 2II6A 1R3DA 3KD2A 3OC6A 1Z4LA 1VHLA 1IUNA 2CXOA 4HX9A 4YRQA 1ODLA 3ZOKA 4MW2A 2NTEA 4PBRA 4R0MA 1PJQA 1MPXA 1HNZB 3CLTC 3F9IA 4PG7A 4Z1MA 3IP5A 4U2BA 3D3WB 4R8RA 1QVAA 4HBGA 5IDWA 1L8XA 1QPGA 4HZUB 1BD3A 2VQEB 2VCYA 2DSNA 4V02A 5J43A 3LHIA 1JQJC 1IXZA 1KVUA 1Z13A 1T5LA 2GVZC 2YWGA 3EUWA 4KGZA 1BX3A 4N5MA 1OHHD 5EN4A 2V7TA 3C85A 3ZZMA 1LNSA 5L9AA 1LV8A 4LV5B 3WWDA 2EHJA 2ZUBA 4M9ZA 1UBRS 1UBUS 1A5TA 2R1UA 1TMGE 1RNLA 2AN4A 1XBTA 2PSEA 3FLAA 4RY2A 1Y48E 2IDKA 1MENA 2WSYB 1JSZA 3JQQA 2X4LA 1KAHA 4N6NA 2H11A 2ZDQA 4I0WB 4JR0A 4D97A 1JLKA 4YS6A 2FPWA 2R7MA 3R9IA 1FXWF 3NFYA 3P4YA 1QHGA 3K31A 4FR0A 4ML3A 3TW0A 1CYEA 1JLLB 3RCBA 4GLJA 5KBYA 1HDEA 4REMA 4URUR 3UJDA 4AN1A 1JG3A 1U3VA 3CWCA 1K68A 5AIBA 1I7DA 5K0SA 2X5JO 1HYBA 1KAOA 1DBIA 3I6YA 5C0OE 1RZRD 1KRHA 4DIOA 2QJTA 1FRZA 2FQWA 2XHZA 2V0CA 4GQIA 1KQFA 5IXSA 3NHKA 1JPUA 3HYLA 3IODA 2XCLA 4H4DA 4K2HA 4MR7A 3PHLA 3BXOA 1WB9A 2X42A 5LU9A 1KI2A 1Z62A 2MYPA 2QN3A 4KGXA 2O8BB 4K9MA 2W6OA 2G7MC 3FWKA 2V3WA 3NKVA 4KW7A 2JNWA 4JT4A 1OAKA 4D8WA 3H6HA 2AVNA 4KAJA 4R9UC 2GKGA 4XVUA 2IOFK 1Z5ZA 3Q7TA 1N5MA 3VC1A 1D6JA 1MNAA 1UKYA 3F96A 2DUWA 2PKXA 2ZYDA 5MDHA 4NARA 3H04A 4EW2A 2QTMA 4LVNA 1F2TB 3AV3A 3DGEC 3K2EA 4LYDA 4V0QA 4URXR 3BHMA 1OXUA 4OPMA 1HDXA 1G5QA 3MC1A 2WABA 4NNPA 1GJRA 2FW0A 1A1VA 2CUKA 2FUEA 1BRMA 2I4LA 3RIMA 4MLPA 3LPNA 1QF6A 3NONA 1PJ3A 3A1UA 4CV1A 2O1SA 4V24A 5IVDA 3KQWA 2D59A 2OENG 1QKJA 1T2EA 3BMCA 3WIEA 2IOFA 3ZJYA 4ZOLA 5DHRA 5JD4A 1R8YA 4WX2B 3L0OA 4O63O 1GEGA 3SF0A 4YCSA 2AC7A 3FDZB 4F06A 1U5AA 4MO9A 2IYRA 1TGYA 2VRWA 2XXJA 4AF6A 1KK2A 4PSVA 4CRWB 2D6FA 3B89A 2FWNA 1O2DA 3C43A 4F7WA 2QIPA 5D3ZA 2B4QA 3OM1A 1Z75A 4IZOA 2HRCA 4UEJA 3K4QA 3B3QA 3RTDA 4FHDA 2PQMA 3CNHA 1VBMA 2OP1A 3LOQA 1A0OA 1H0KA 2QAGB 4H7PA 4Q47A 4W63A 2ADMA 4ZCQA 1J8YF 3U49A 3WL5A 1R3UA 4TRMA 1HFEL 1YBMA 3OM0A 2QD2A 4KIFA 3CLHA 2HJVA 1NLUA 2NZ8A 2ZR8A 3IOYA 4QFCA 2LDBA 4RMGA 2QP4A 2ZQYA 3L4EA 2ZYWX 3LC1O 1UZAA 3O94A 2CWWA 1NATA 3HL0A 4EW3A 1GDTA 1U9YA 1YJAA 1TJYA 4IS3A 3IP7A 5EZYB 3UJAA 4UQLA 1KP2A 1ZGHA 3PYLA 3C6KA 1KSJA 1RC1A 2BH9A 4IY1A 3F6YA 1UOQA 3PRJA 4CLHA 1EHCA 1CIPA 1F2VA 3GLIA 2QF7A 5K6TA 3WGVA 4Y6RA 5F4BA 3ZX5A 3QUBA 1C9MA 2AZDA 1CJVC 1G21E 3GVCA 2FWBA 3AUXA 1JB1A 1EFRD 5ESRA 1GVHA 1N2SA 1SPBS 2PT5A 5DMXA 3WLSA 3W5AA 3ZW7A 4QKQA 1HRDA 4UU0A 3VPCA 4G24A 3KFVA 3U3XA 2AK3A 5KYYA 1YZHA 4NS1A 5F2NA 4YMIA 1P1HA 4O3FA 1KBZA 1X77A 4DSNA 3IURA 1ZOSA 2H1FA 2R87A 5DNEA 3K5IA 3ZHVA 2DHRA 1P0QA 1JS1X 5CYPA 5IKOA 5JXJA 4X3OA 3PNOA 1T0PA 5ED4A 4DMHA 4UUQA 1PO7A 1OR8A 3QYJA 4KVAA 4RKQA 4BWFB 1XL0A 3QXCA 3GFBA 2WFLB 3UJ3X 3KWJA 5IZ4A 2BH2A 1B2LA 3GGCA 3LVFO 4OATA 4Y6PA 4B6RA 2H2HA 3K9QO 2W11A 3OO1A 3RJ9A 3EB9A 3SSMA 2IYYA 1CDDA 3M7IA 4N1AA 5L3ZA 4ISCA 1HSOA 3TQTA 5I7SA 1N7IA 1BVHA 2LE0A 2BE7A 4NF2A 1H9AA 3GVPA 4R54A 2O3JA 5AHWA 2FF7A 1P1RA 1H93A 4BRWA 2Y27A 5JZVA 2IS4A 1NUAA 3PPYA 5JBNA 4INAA 1SVLA 1BKYA 2PX5A 3KSZO 4FT2A 2E21A 1QG4A 2HBZA 2JAPA 1QO7A 3Q0IA 5HWSA 2ZDHA 3AI2A 2E2WA 1PX2A 1Z18A 2GYUA 4W99A 4O8ZA 4Q18A 1GPMA 1HMPA 3W6NA 3KQLA 2XODA 1SK9A 1G63A 2CXNA 1FYWA 1PR5A 1V35A 2G1UA 3FYSA 4OFZA 2PUEA 3MSCA 3QKWA 2NWQA 3DR5A 4LK3A 4OAQA 4O4IF 3AERA 1LGYA 2HA5A 5EKTA 2N1BA 4MDEA 1OFUX 4M1MA 3ZV6A 3WIOA 1X80B 3KKPA 1XDBA 2BHTA 4BJ6A 1W1IA 1K6XA 3BGIA 4QQNA 2E48A 2FPRA 1VXRA 1E7WA 5K8VA 4KX5A 1JQ5A 1ZUNA 2JAWA 2JFVA 4X8LA 4PIPA 4JUDX 3C98A 5T4HA 1E2FA 2EJBA 4RORA 2QVLA 2G1KA 1A04A 4ZAZA 4Y2UA 1YTLA 4WLEA 2EV9A 1ECJA 4G5SA 2WUDA 1JWLA 2HYDA 2BM8A 1W2HA 3BE5A 4XLLA 3QNUA 1D7AA 1O96B 4BV2A 2R1VA 3UJNA 1C3LA 1N2OA 2PYIA 4P22A 2REXB 1YL7A 2JLRA 1ZBQA 2YL2A 3KSDO 2VUTA 4FE4A 2YQ4A 4NU5A 2AKEA 2MMGA 3N53A 3FFBA 4JNKA 4F85A 1EMDA 2PSJA 1ZIDA 2WHEA 3G2OA 4D9NA 2HPAA 2HT6A 4O2AB 5CA0B 5IJ0B 4B34A 3L01A 3ZXYA 4PHCA 3M89A 2XCIA 3K72B 2QRZA 3ACCA 1PZGA 3H9GA 3TBKA 1DKMA 1O77A 5EA2A 1W4RA 2FWJA 3EVEA 2ZJZA 3G6WA 3IELA 4H1TA 5REQA 3LVBA 1IRIA 4OQDA 1XNJA 1QIKA 4JH0A 3FZEA 1YK0A 4B82A 3CONA 1L5HB 4B7UA 1PJRA 1Y6JA 4A16A 4Z4CA 5ITZA 2X5KO 3Q3JB 5DCLA 1II9A 5KHOC 3OZSA 2J7PA 4DBLC 1AXEA 3DMRA 3WJ2A 2P79A 1WIWA 3ET5A 3G5LA 3F73A 1DGQA 1XTSA 1VC2A 3EGXA 3EQ8A 3LLCA 4BNTA 1JIVA 1J7KA 2AW3A 3Q9SA 1QGUA 2IS1A 1WABA 4N5DA 2CLDX 1JDJA 2J4CA 2BGIA 5DTQA 3TNYA 3T7AA 5LLTA 2I55A 4Q9DA 4DCVA 1Y5LA 5A03A 4L85A 3VR5D 5KSYA 2BC9A 3H5NA 4CQMA 2ZXFA 1ADBA 1TECE 3MTAA 3ID6C 1MO4A 1A9ZA 3NPAA 4GX5A 4TL9A 4WA7A 3GN2A 2GSWA 2D1TA 3KQVA 1Z2AA 1HKHA 2FJUA 4GI1A 4JBYA 4JP5A 1FS6A 4LCBA 3LHDA 4P3KA 3CUSA 1NGSA 1P6XA 2AMYA 3JTEA 3K3PA 4OIMA 2O20A 5KOJB 1AKQA 4OQEA 3AYZB 5IH7A 1EP1B 3GG2A 2X9QA 2WU3A 2GJSA 1TC2A 2NUPA 2JGDA 1J2YA 1E1CA 1IJKA 3OZIA 3PFFA 3SZMA 4B9AA 5KVAA 4C08A 4E46A 2UZ3A 1MJNA 2OXIA 1CF4A 4G9EA 2EFJA 5AOVA 4DA7A 1Z5NA 1NVTA 3EEYA 3OOEA 4JLSA 4DLXA 3RV4A 1E2GA 1IXYA 4KHZA 5JIBA 3BS4A 1QBGA 1PR9A 1CUAA 2N75A 1ZK0A 1YBAA 3DC7A 3GP3A 4YLYA 5E2BA 3I3SR 4ASUA 5ADHA 5I6DA 3TR6A 1G7SA 1EFPA 3PC6A 3GFSA 2CEKA 1TNDA 3CR8A 3A25A 5T57A 4R8KA 2BR4A 1JHOA 3BMNB 3QUQA 4Y3UA 1YZFA 4OJNA 1P60A 2PMEA 4CM4B 1W6RA 1V6CA 4ZC8A 4LE1A 3M33A 5KNDH 5EEHA 3N2NA 4X91A 1WUTA 1NLFA 3AIKA 4S1PA 3I9JA 1EE9A 3WFIA 3WLKX 3WK7A 1AGPA 1RBMA 5KNCH 1IN7A 4NU6A 1SU8A 4QOFA 1M6VB 2H7VA 4HEA1 5ENDA 3SQOA 5BR7A 4F91B 2X7XA 3AJRA 4FW9A 3CRMA 1E9SA 3CVYA 4FFBB 3TDNA 3F2VA 1ZM3A 1UAGA 3RSCA 1E3QA 2J46A 3HCRA 2CHQA 5CU7A 3I5MA 4FQ7A 2RHLA 1QSGA 2RBGA 3P0RA 3PSHA 3DM9B 5BR8B 3DCJA 2JEOA 3RO7A 2VJBA 2OV3A 2WRZA 1XZIA 4EMUA 2WVJA 1Z28A 1UZNA 3MTQA 4MCJA 1C4KA 1WXQA 4KN9S 4UMVA 5ALZA 5INTA 1GAXA 2OV8A 1ZUHA 2QA5A 4I46A 1JEDA 3BMXA 3U62A 5JZBA 2H5LA 1TW2A 5KQLA 3UB2A 1OXSC 1S3GA 4NFLA 1R18A 5DCUA 4BUZA 1QOPB 1SN7A 3CWQA 1G21A 4CIYA 2DLCX 3FCOA 3L79A 1I6LA 2X8AA 5FYDA 2PGJA 1NW9B 3A1WA 2I2AA 2J9YB 3FOFC 3GWZA 2HJRA 4J03A 2RI6A 1ZIXA 3TVYA 4AJKA 4NOJA 1MJGM 4LBZA 1BE0A 2J6IA 4IV8A 2AZMA 3JQPA 1YZYA 2C0CA 4EYSA 4E3WA 3MQ2A 2AR9A 3QBTA 3PQEA 4HUQA 3LQ1A 3UUEA 3KAKA 4LNUB 4TPKA 2PGNA 2RHRA 1I9CA 4PFJA 3DVAA 1T15A 1N2GA 4PYRA 3KYIB 1FQJA 1C3OB 3IPRA 5FBKA 2PNFA 1QBKC 1P1KA 2FOLA 2M98A 4UEQA 4AZ3B 5C81A 1W93A 4EJSB 3WSWA 4V0LA 4EFDA 1P2FA 2HGSA 4QUKA 1D07A 1VLMA 1LY1A 3O4HA 4YQZA 3GRCA 4U9HS 4J7XA 1N2BA 2MSWA 4DV6B 4MVXA 4NBRA 3VSBA 4A23A 3IBGA 2AYXA 1KYYA 4MDYA 1HRKA 3EQ2A 1SUDA 4NJEA 3A7EA 1YR2A 2XI4A 2DFLA 2HFJA 5COBA 2P1RA 3DE3X 4K81B 3VR2D 4DJJA 3GLHB 4NY1A 4MGEA 5EUQB 3L40A 3QE4A 2VJCA 2R8PA 3G5TA 3U1VA 5JBIA 4KOAA 3SHWA 1PNQA 3CEAA 3RIHA 2RHCA 5I4IA 1Z4QA 1QFYA 2Q2NA 4UBJA 3KOXA 2I6FA 1XMPA 4BN4A 3R20A 5G0WA 4CDNA 1UWCA 2VHQA 2Z57A 3B48A 2WOJA 2I7VA 3KQYA 1U9CA 1B16A 1UT6A 2FMIA 1GLNA 3LK7A 4QOEA 5EVJA 2YYYA 5LA6F 2WICA 3SS7X 1CE8B 4EPYA 4K9OA 3WP1B 4M9RA 5DN6A 4BKUA 4DTCA 1Z5GA 2C4VA 1E0JA 2GJKA 2ISQA 5LIPA 1L4NA 2G04A 2PA0A 3CLUD 2D54A 3UJHA 5EUMA 1YHYA 4RELA 1BWRA 1FX1A 1PZMA 3VH2A 3ZWVA 1WZNA 3DD1A 2VNSA 1MVOA 3TI7A 4LGYA 2MYUA 4IV0A 2VJDA 1O1YA 1Y8CA 2OGSA 4JI4B 2VJNA 4K1LA 4J0FA 5KKAA 1SXJD 2FR0A 2GCGA 2J0EA 3CKYA 4WD3A 5K3DA 3ZQ6A 1HT1E 5EQTA 4C0KA 4IXTA 1NP3A 3WYCA 3R09A 5I9MA 3U4QB 1FDTA 1P19A 1Q2UA 4QQRA 5KWSA 1EZZA 2NTYC 2E6KA 5COAA 4PR0A 4KREA 3L7MA 1TF7A 4R2MA 2FP4A 3GJSA 1M1YB 1TADA 4ZVPA 2JS7A 3ST7A 5CNMA 4Q21A 1TXGA 3IPLA 2Q2WA 3FF1A 1JVBA 3NORA 3PEEA 4L78A 1OWMA 3TJZA 1V4VA 2NXJA 1LPAB 2F1KA 2G83A 2HEIA 1HA3A 1V1MA 4HUJA 4M36A 5CPFA 5JSZA 1LDBA 2NPOA 2A9KA 3B9QA 5TIIA 3AL0C 4TKVB 1DX6A 3PQDA 1M67A 2NXCA 4YMWA 2LNDA 4S2UA 4K8RB 4C0JA 3DL0A 1Y4UA 5C4MA 3GY0A 5K0FA 2W4QA 4BNJA 1SUAA 3HCEA 4FN4A 4YGYA 2B1JA 2QVYX 4C4PA 3SYKA 2QVXX 4X3CA 5JI3E 2BGKA 3ME5A 3SVLA 1KFEB 3DEHA 5ICMA 4Z99A 2VATA 4C1NA 4F9EA 3QIVA 1NMZA 3GH1A 3VAZA 3ESBA 3JALA 1U3UA 1JAXA 1EDEA 2JZNA 3L7OA 4ZPXA 4XZ3A 1DQPA 5JS1A 1FFEA 5TE9A 5I3ZA 1G3IA 3NVKI 1NMEA 2Y92A 5EWLA 3R7NA 2J5RA 3OAAD 3RRXA 1AJEA 4L07A 4UBKA 5LKRA 3QW2A 3ZJ5A 1OFIA 1U8EA 1LWNA 3GFOA 4B32A 3QKIA 3W1VA 4KLNA 2X5NA 2REQA 4BBPA 3E03A 4QD3A 1WVIA 4D6XA 1L6RA 1D6MA 3K9CA 3JR3A 5LZ9A 2WOOA 4F5YA 1YR8A 1FNNA 3K9LA 4XIFA 4RD2A 1Y3HA 1V2HE 2OYSA 2OLEA 3CINA 4YCNA 3DW1X 3VSAA 1L7AA 3L8ZA 2ZXEA 1H5QA 2C98A 3MEQA 4INJA 4QWMA 2HRBA 4KR6A 3MRTA 4WVLA 3QOXA 3VU0A 4H59A 1XAHA 3A6JA 1EYZA 1KO8A 2OXCA 3L8CA 421PA 4DR2B 5LQAA 1MHTA 1JEQB 3LO8A 4RK0A 4D02A 4YQYA 1GFZA 1JMYA 1PAUA 1Z7EA 3JS5A 2OCGA 3R3ZA 3ITEA 1I2AA 1KDPA 1K7YA 1UDCA 5F64A 5TDHA 4CN9A 4JLJA 3C6MA 5JHGB 1CLUA 2J3JA 3PC4A 3BA6A 3H13A 1SQGA 3AB8A 1NJSA 2EZ4A 4HGZA 4PCLA 1JPVA 1KI6B 3GZNA 4YAOA 2CHVA 3L6RA 3OQHA 4HAZA 4OUDA 4P1ZA 4RK7A 4KO4S 1Z83A 2EDCA 2XE6A 2CDRA 2WUFA 4GI7A 4Q0MA 5KYUA 1SEPA 2Y4NA 3W8EA 1SHLA 4MUKA 3DYBA 4NBTA 1ODTC 1H2XA 1WHTA 3CF4G 1R0CA 3BHJA 2Q5HA 3EYWA 1RYHA 5AXCA 5JI2E 1SHZA 2GYYA 4X8MA 3W6OA 3WA6A 3HCPA 2WAOA 1RXIA 4CM9D 1K92A 4LMRA 4MJ7A 4KXMA 4LF7B 3SOPA 3QU9A 4Q1BA 4KQEA 4JUFA 4ZAVA 3C3YA 4HEJA 2Z3VA 1N92A 1SQ0A 1L4FA 2PFKA 2ZREA 4PANA 2OZKA 3LVRE 3V1TC 2C2WA 4HDMA 1RKQA 2SKDA 3GAMA 4DLPA 1SIBE 1VPDA 2D2XA 1N2XA 2JD1A 4XWAA 2W71A 2G3YA 3N2IA 3VI3B 2D5CA 4H2DA 2F7SA 3EYAA 1OBHA 4TSKA 5TNXA 5IVHA 4MMXB 3GP5A 1OC4A 1MQ9A 1UDWA 4FINA 4YJ2F 1JUDA 1ZIPA 2C9BA 2BHLA 2FR8C 3H2GA 3T0IA 1U7ZA 4WJLA 1P9RA 4Q9NA 5K4HA 1KJIA 4XCVA 3DHNA 3V3TA 2C07A 2NV2B 3HHEA 4LQLA 4C0HA 3RS4A 5BP7A 5EMJA 2C92A 2CKMA 1G1AA 3ETNA 2DETA 5IM4A 2G40A 2IP1A 1QQBA 3BEOA 3K5HA 4Y9RA 1O03A 4YJHB 4EAAA 1JXMA 3ZCTA 3GJ8A 5AI5A 4L5JA 3E2MA 1XMQB 3E84A 1Q1EA 2P9JA 8AT1A 2EGUA 4U7GA 3P9RA 1ZIOA 1I2MA 3U13A 5LP1A 5DYWA 2WJZB 2ABWA 1Y37A 4R1PA 5ALPA 1GNSA 4D9BA 1X19A 2JLAA 3GV0A 4B4VA 1CETA 1F4VA 4NMLA 5KTPA 3BWVA 3DS8A 4LOKA 5FADA 4ZU3A 4LY6A 1WJGA 3JAWB 2QM3A 1M0SA 4J0IA 4QPNA 5J4KA 3FY4A 4O29A 4CM3A 2A30A 2CLHB 4O08A 4RLHA 1GTZA 4WCVA 3Q2KA 3DKIA 5K2MA 1JKFA 1GGMA 2Z58A 3AG6A 3TTYA 3Q3IA 5EVCA 1Y5IA 1ZXBA 2J5QA 4BRUA 5EJAA 3KXLA 2HR1A 3AUUA 3CUWA 5FR1A 3WL6A 1IPEA 1QPZA 2B7LA 3EVAA 3ETDA 3EZXA 9GPBA 4PO8A 4MA5A 1ADJA 1W4LA 1M83A 2ZRLA 3VJLA 4IWYA 4PBSA 1A95A 2EZ8A 2Y8EA 3O9MA 4MQFA 3C7DB 3P20A 3PUKA 5LYYA 1QTQA 3J7TA 1MLDA 4JAVC 4QJ5A 1G5IA 4WKBA 4QNRA 5LDGA 2PVSA 4JP1A 4DLRA 3ZLBA 7ADHA 1G8FA 2BTQB 4RNCA 5JALA 5KTNA 1YONA 5A1JA 1FFYA 3KAJA 2OG1A 4XQ0A 3H2HA 5DE3A 3BWMA 4KITB 3NTXA 4OV6B 1T5BA 2BZSA 3SLGA 2J5BA 1W7AA 2XMZA 2XUZA 4J75A 2IZ0A 4DVJA 3V46A 3VA7A 2C03A 2N9UA 2XD9A 4RTMA 2X0NA 1PR0A 3QELB 1A8QA 1KBOA 4S1WA 2H2IA 4RLSA 3QEKA 4OQXA 5JZMA 3BD7A 2DFDA 1JR3E 2CXSA 4CL3A 4PVCA 2XQIA 1JB9A 3GCGA 3ZIAA 4QJIA 1VSVA 1Y7LA 2QT0A 1PGQA 4J76A 9LDBA 5A6SB 3SX0A 2HIAA 2FRDA 3U6BA 2WTUA 1KE1A 4FPXA 5GV7A 3C7TA 1CK4A 3P26A 3L6OO 3D81A 1RZVA 1FA9A 2Y0DA 1ID1A 3F98A 1FUYB 1PGJA 2A3RA 4UE3S 4X6XA 5HEKA 3V8PA 5JMOA 1VLQA 4RCVA 3F7NA 2ZRHA 4ES6A 3CXRA 3ZQUA 2ZIVB 2B8WA 1RC0A 2IXDA 3GT3A 4N3GA 1S3SA 2YIJA 3KQMA 5HVNA 4QU0A 4O5OA 2GASA 3FG9A 4IDNA 2BKVA 4GMHA 5EI5A 2C88A 2ODTX 4ER6A 4TZ0A 4L75A 1Q91A 3EEOA 4P83A 1HQCA 2BPOA 4HYTA 5IZCA 4N76A 1MVNA 1PLKA 2GK3A 4OQ4A 4DT1B 3PBKA 3W3AA 1GRVA 4WDRA 1DC5A 1HDYA 3E9DA 4PLTA 4V3CA 1UFVA 5AKZA 4YTEA 3UUFA 1I1QB 1ZGBA 2CFOA 1GA6A 2CBZA 5L3RA 2GCOB 3WLQA 3HR4A 3WLMA 2WJ4A 2QTCA 4HTFA 1U3FA 2NO5A 1GL3A 4EMTA 1TTTA 4YJ2A 3PEFA 3ESXA 2WG2A 2YY5A 1SKYE 3CRQA 5AHRA 4Y1RB 4BNIA 1KZ4A 3WWZA 3EFBA 3JQ7B 3L7JA 4MNTA 5ALTA 4C01A 3AIMA 2V5AA 3GRKA 3ZYCA 1YNOA 4ROTA 4BLPA 4HYQA 1A76A 3A1EA 5HZHA 2E4UA 2OB1A 3MJHA 3FFXA 1Z8DA 5J59A 5JC8A 1P9WA 2Z9CA 2EFCB 4NENB 3AONB 3GAFA 3H11A 2YS7A 2V6IA 1RE0A 4OHCA 1AA6A 1KZ7B 2JK1A 1EBFA 1QYVA 3X1MA 4V1CB 4Q4JA 1MX3A 4KUGA 2QBYA 4QARA 1DQSA 4NCKA 2NQTA 2FEAA 3COJA 3ODGA 4O4HB 1NXPA 1E62A 1XD2B 5IAGA 4EB6B 1FP4A 2AG0A 4DCOA 4GKVA 3RYCA 4WCFC 1DIOB 3UMVA 4B3JA 4EG5A 1A71A 5BV2P 2IPXA 3SEQA 4K2AA 1XXLA 2X4IA 3JPYA 3VOTA 1D4OA 1IRXA 2PTGA 4AG3A 4RTRA 3LL7A 3CNEA 1T3SA 2PH5A 1JI0A 4U4AA 2ASVA 1XKLA 1TIBA 2Y93A 1F7VA 4G0QA 1XYYA 4YMGA 2VXCA 4UCXA 5TMEA 1VLZA 1Y4DE 1A5SB 3AHCA 3OQ6A 2G67A 1KTVA 4S1TA 1LLDA 1YJQA 1MOZA 3COVA 1Z34A 4V0ME 5ALWA 2DT5A 3T94A 1DAGA 4JLBA 5HX7A 2AK2A 4OLFA 5CJ2A 4A92A 3LT2A 1VIVA 1MAWA 2J6CA 3JWEA 3LY9A 3ZS8A 5BV1A 3N7UA 1A7UA 2YJNA 4G0PA 1CY8A 5ALJA 4HH1A 4DEVA 4AWBA 3K8ZA 3WAJA 4JJEA 3ELUA 4YXFA 1M1XB 1A4XA 4HQRA 4EHIA 3G0IA 1E9VA 3OEYA 1NVDA 2A9FA 1I9GA 2IIBA 5DX1A 5AQ1A 5ADWA 1AA9A 3DPIA 3B1VA 3FB4A 1HZZC 2VBFA 4GXTA 1MRSA 4FMCB 2HRZA 4GEGA 3GRPA 1ZBDA 4GAEA 4MYDA 5CT9A 2X76A 4MSUA 2VF7A 5J1SB 1XELA 1AZLA 2APJA 2ZSBA 3P9XA 4B3FX 1M75A 4EATA 1T3TA 4OOEA 1T9GS 5IG2A 2C4TA 2IU4A 2P5YA 2YRWA 4GVXA 1BROA 3IV9A 2VHZA 4IWXA 1WMAA 2GEKA 4RCYA 5CJJA 4Z86A 3TNLA 4BZZA 3AKDA 3IBYA 3VR3D 2XVAA 4WOPA 2XCQA 2C3MA 2YS6A 4ZOBA 5CT8A 5DBFA 2NPFA 1SPXA 1C0PA 4UE2A 1US8B 3DHWC 1HYGA 3CJQA 4ARAA 2Q28A 4NZ9A 2ORYA 3EA5A 4DQXA 2V55B 3E7XA 3RSHA 2OCYC 3T15A 4JC5A 4V0NA 1BH2A 1CUFA 4BUCA 3EE6A 2ZCVA 1WDMA 2O2JA 4FSDA 1TLTA 4KLZA 4N5IX 1DZ3A 1UT8A 3OTWA 4MB2A 4RA6A 5LP6C 3P0IA 4CCSA 3I05A 3OZCA 3P9NA 4H35A 3TQQA 3LGSA 2Q0QA 2FZGA 1SVOA 3EASA 2ZANA 4GSLA 3T7KA 1KEEB 2C1XA 5FOVA 4KPUA 4E70A 4UTRA 4YUAA 3EW9A 1X87A 4DSZA 3QGMA 5A3RA 1DPFA 5IYZF 1VPTA 3JATA 1G0NA 3CKLA 2HYIC 2X1VA 4RA9B 5A7HA 1BDJA 1FTGA 4DCMA 1ZITA 5D87A 1H94A 2CLLB 3R40A 4UW9A 3ZUGA 1CQJA 1WDLA 2BN4A 2GDJA 2JIQA 3G9TA 4G0MA 4B84A 2P62A 4JNCA 2GJAA 1FMFA 1J8MF 2PZMA 2VUSA 4S04A 3HVKA 4LZAA 2DFNA 1XMVA 3LCJA 5ECGC 4ROSA 4EEZA 4EARA 3CLUC 3F49S 3OJWA 4QNMA 3DEJA 4ESHA 4JS0A 1VFNA 3HBMA 2IYEA 2H4ZA 2QMQA 3AHEA 3L0PA 4MVJE 1ZOIA 3I39X 3GK3A 4MUBA 4Q05A 3TLAA 3U09A 1E1QD 1WXFA 2PBZA 1HI9A 4YAWA 2FG5A 1A77A 3G59A 3AUFA 4IXWA 2PNJA 2GZDA 3U4GA 4M0UA 4HR7A 4C5AA 1YULA 4K88A 4RKWA 1TKRA 2GN9A 2R60A 5FNZA 3ZX4A 1P5JA 4FWIB 2JH3A 3GHYA 2QTAA 4L16A 1SXJC 2P4HX 3IC5A 1V71A 4RZ2A 5CBKA 1SVUA 1F8UA 1RHKA 1ZHHA 1HL3A 3DAHA 2GM5A 4XR9A 5AKJA 2NZYA 4X61A 4UMEA 4JIGA 2XKKA 4OH1A 2HU8A 5JXIA 3SBXA 3SKXA 3AFNA 2RGRA 2Z6AA 1T1GA 4JYPA 4L6AA 1FRFS 4RWZA 3PE4A 2GETA 3K1AB 3RTCA 1BU8A 2YDYA 2C9MA 3H4VA 1KU0A 4TXHA 5AVWA 4TKUB 1EESA 2HJSA 1JR3A 1OBFO 1U1GA 2Q8PA 1QMGA 3C1TA 2P40A 3FHCB 3HUEA 3I6ZA 4NCIA 1CZHA 4JT2A 2F1JA 2N47A 2V96A 3UC5A 2HJ9A 2IUFA 4K86A 3AEQA 2A92A 3GHHA 1I3OA 2VWQA 4BRSA 3FKSA 1P39A 3RBZA 1F8XA 2XSZD 1MDFA 3U9TA 3E9EA 2A84A 4Q7KA 1NPTO 2BJHA 1EIZA 5JYCA 1U6JA 1C3XA 1FL9A 3U5ZB 2WWRA 3C97A 2C29D 1TVKA 3EIUA 1LUAA 5THKA 1DRKA 3DLIA 3LOPA 3TSAA 5CAEA 2FW7A 2Q3MA 4I81A 5CUQA 5DM60 1ZK3A 4OLAA 4Q9HA 2PBLA 1DARA 3IQZA 4YDRA 2FZCA 2ZJOA 2VEOA 4Q7LA 5C31A 1Y4AE 1PJ2A 3WIDA 1KR5A 1KY4A 4WN9B 1T34A 5D6NA 2NADA 4DGSA 4EUNA 4HWGA 4GZ6A 1I6KA 4FGWA 4ND2A 3WKAA 5IVKA 4JEIA 2JFOA 5F2EA 3WMXA 4EAQA 4EMBA 1D7OA 2BEKA 3VPHA 2OV1A 3DBLA 2V58A 2BM9A 5JRDS 1R12A 5F12A 2HSJA 2IXBA 4B6QA 4CT4B 4MVJF 3UHJA 1CCWA 3E53A 1KARA 2NZWA 3E6AA 5CDHA 4OMUA 1EXWA 3V8MA 1NQWA 4OL0A 4YJKA 1ZYUA 4D92A 4FI3F 4CMGA 3BJIC 3Q7RA 2QNIA 4GM1A 4F84A 3U4MA 2CMFA 3FZQA 1VJCA 2OWDA 4YX9A 2CJWB 4GBMA 4Y2QA 1SXPA 1HDIA 1O6ZA 1H3EA 1LDYA 2A2ZA 1BU5A 1QC5B 1R6UA 2FQ1A 5JPIA 3V1MA 3CCCA 4GQAA 1EM8A 2FDCA 1YVDA 2WD8A 3VKUA 4ESEA 2UAGA 1U2QA 1FW6A 3OOYA 3KSMA 1C0IA 2XRYA 4F60A 5TQJA 5LXTB 1GNRA 2OCAA 3TG8A 1U7TA 4KFTA 5ALIA 3QUCA 4PYLA 3L3BA 4WFIA 1GPDG 1MXFA 4QOJA 5GONF 3VPDA 3WLLA 1CUJA 1R00A 1YQUA 3SMVA 3TPFA 4AD8A 2HK6A 5IYZA 3B60A 4UXJA 3BGWA 2BFNA 2QM7A 1CHNA 2NM0A 3ABOB 3LP5A 4PFSA 5TF4A 2F1IA 3EOBI 1YDGA 3LT4A 5J4HA 2ZVJA 3KE8A 1X7HA 4B80A 3EQ9A 4J94A 3ZHUA 2HHAA 1MX5A 1H2YA 1K66A 2Q4EA 1X7ZA 3G0DA 2PAFA 1L5GB 5CFZA 3BULA 3EXHA 2BZGA 2XUDA 2QN7A 3CH5A 1T0UA 2JLQA 3G82C 4KDFA 2NP6A 1Q0RA 1EA5A 2ZWAA 4P08A 1EEHA 4V0MA 1ZP6A 2DOKA 2YOHA 1ZN7A 3TLBA 2E7ZA 1YQGA 2ZG6A 1UBTS 4KQKA 4CMEA 4DZTA 1QQ5A 1PT6A 3RYHB 4D1YA 5JQGB 3MGCA 2GS9A 1SIWA 4KWIA 3QP9A 4HQLA 2WQ7A 1XCOA 2RGXA 1J24A 2B2XA 2WP8J 3BQMB 1YU9A 2C4WA 4WN3A 4MLCA 5JW6A 4WNAA 1E6UA 3ZCRA 5KKNB 2HMWA 5BPFA 1A5ZA 1E3LA 1C9JA 2YJ4A 1GGJA 3FWZA 3KYDA 1AO3A 2P41A 4UDNA 1JVNA 3FIJA 1T4GA 1MGPA 2IEIA 1JEAA 3MJSA 4PNZA 2O8EA 3FNEA 2QB5A 2EHDA 1SZJG 2JIBA 4BS9A 2FQYA 5C1PA 2YV4A 2O7NA 2EW8A 3KBBA 3CO5A 3G9XA 3FSRA 5TGDA 4YLGA 4ERXA 5ER6A 3WRXA 4Z3DA 2RKWA 1TO2E 4JB3A 4KAXA 2J85A 1UBHS 2OHHA 1U98A 2YWCA 1Z2DA 3HSYA 2CHGA 4YI3A 2DM6A 1FFXB 3TTWA 1KJWA 1QHYA 2FSFA 4CIVA 1PZEA 4RMHA 1A9XB 5DHAA 3S5UA 3WDKA 2JATA 3T4EA 1RAFA 4E11A 5KYVA 2D0IA 1K9VF 1OIXA 2XEXA 2JIRA 2PSSA 5TQ0B 4UBLA 1XG5A 4BU0A 5JVDA 1NUSA 1FYVA 5EYPB 4HX5A 1PQYA 1YMUA 3OFNA 4CMKA 5AUPB 3AGPA 1WVMA 1X9HA 1XD9A 1NBMA 3JPWA 1AQUA 1ODKA 4YBZA 3VYVA 5AXAA 4B6FA 3JYNA 2J3IA 1C8VB 2ZSFA 4BTLA 4IIDA 1XFDA 3AEZA 4F4UA 1QO0D 4QC2A 2V59A 1DJNA 3G17A 5G1PA 3QPBA 1VI6A 1ZR2A 3JRNA 3DO6A 4OU5A 2JBHA 1EZ1A 4BFLA 2ESRA 3O3NB 3D3KA 1JHRA 5J47A 3G68A 3FCEA 3Q41A 5DU2A 1GXSA 5AK0A 4RVDA 4Z9AA 3DZIA 3VJMA 3K71B 4M76B 5CXXA 3SNKA 5LFAA 1BO6A 1NJGA 3C3BA 3HSKA 5H70A 1QS0B 5GAJA 1O5TA 1L5VA 1MAAA 2FEMA 4MW9A 4TVBA 3WV5A 3D5EA 1EFUA 3UPUA 1T91A 1F8GA 1W25A 3PEUA 2QP3A 3BJEA 1XLVA 4I3GA 1E0AA 4MVJA 5IDVA 1JZQA 1M66A 2B8JA 5HP4A 2X40A 3INGA 3Q15C 1IQUA 1E3DA 1WF3A 1SWVA 4GI2A 4GZMA 5DIFA 1PZXA 4F1JA 2GPJA 2UVDA 4CKZA 2PWPA 1DJMA 1RQLA 1NSTA 3GLFB 3KVYA 4FM9A 2ODBA 5IAJA 5F9HA 1IWOA 4DNOA 4G0XA 4TS9A 4CKBA 4LI0A 5A0FA 2OV6A 3DE4X 2QRQA 1I0IA 1VL6A 1C4XA 1YK1A 3U3DA 4F5EA 4G86A 5HPYB 4YAEA 4R0VA 2FV8A 4YPOA 3IXQA 3CEMA 3RK0A 3OZDA 1F2UB 2XUPA 3JAKA 4JR1A 4CETA 5I01A 2B98A 3UWDA 3R7DA 1FRVA 2DC1A 5EIEA 3O4JA 3ECAA 2Q9BA 3HN2A 4GLFA 1X7YA 5HZGA 2OM2A 1H0RA 1RP7A 1TTHA 4EZIA 1HUQA 1QAOA 4KIGA 3VYTB 4AKTA 4DMUB 3K70D 1BSVA 2JLSA 4C5BA 4R9NA 3N70A 5F7XA 5LMUB 1THMA 2RG7A 1K8QA 4R2LA 4UPDA 2KPOA 4HH3C 5CFPA 1QKKA 3QTBA 4WFKA 4GRDA 3IP9A 5BVHA 1FP1D 3I6QA 2H2GA 3CB2A 1QK5A 3WHIA 5FI3A 3WKEA 4WOCA 1CB7A 2OGTA 3AHIA 3FF4A 2VTBB 2ODNA 1I36A 3QV1A 2IHUA 5KYNA 1JEYB 1G8SA 2AX3A 4OXXA 1WDKA 1B1AA 1HDZA 3BXFA 4HWSA 3TEMA 5CVTA 1BFDA 2EJWA 3LOUA 3THXA 4F97A 5FPQA 5B64A 2WKPA 2LCQA 4YRPA 5FI5A 4DWVA 3I04A 4X8HA 1GQSA 3HPQA 1ZEMA 1FVHA 2G5CA 2OPHA 3GD5A 2VJOA 2HK9A 3DBIA 3WXMA 1NFQA 3ZYZA 4YYZA 1N36B 3E8SA 4OYHA 1GCUA 2WKQA 4IOLA 4AIRA 1U99A 4R3UC 1SOVA 3IB3A 4UBNA 1U2DC 4YH1A 4B6OA 4EL5A 3G2LA 1JT9A 4ID3A 2PGOA 1U1EA 3A3KA 4WWHA 1K8ZB 4P58A 1E79A 4GP7A 1LZKA 1BE1A 1DG1G 2OVBA 1YDHA 3G1UA 4JWTA 4MLZA 4MR8A 1S7CA 4CV0A 5CTAA 2CFIA 1IL0A 2HHHB 2FX2A 1OKKD 4IICA 1FTSA 4F46A 2IBSA 4MWCA 1KZHA 3L1VA 3KS9A 3ZKWB 5KVVA 1YQQA 2H5EA 3NC0C 5FBHA 3LA8A 4JFAA 4YR9A 2GCPA 3HKEA 4KLAA 3PFCA 5JNUA 1CQPA 1WXIA 2XRMA 1GO2A 1VMDA 4R69A 1K5DA 4Y2VA 4CKCB 4BVFA 3EUAA 3M3PA 1FK8A 4HAUA 4PZPA 4FQ5A 3DMFA 5K3AA 3PWTA 2P4SA 2A9OA 1RWWA 2H08A 1GZDA 1U9JA 4M3NA 2KE5A 4MI6A 1FS5A 4R0NA 3GLSA 1BDHA 3HQ4O 1OY1A 2B78A 3AV0B 4R1QA 1DX9A 2DPXA 5HS4A 4MEBA 3DO8A 4KR7A 3HU2A 2HQRA 3RFTA 5KS2A 5LPNA 4O4JA 3LA6A 4U7JA 4KP7A 2V65A 3LT5A 4M0CA 3S27A 1UBJS 2VF4X 1C14A 2WPNA 2YICA 3RUCA 1GZSA 1TM1E 5HKBA 1DBPA 2GBLA 2CNLA 1SM4A 2IYNA 2PKYX 4QE3A 2DQZA 3GJ4A 2X19A 4XGNA 3TZKA 4EA9A 5JFTA 2IS6A 1XA0A 2N3ZA 2BFDA 2TRSB 3R7WB 4UQOA 2ZIZA 4EY3A 4L0MA 4BNXA 9LDTA 2VZ9A 4MV4A 1TFRA 1PK8A 2AXQA 2JB9A 4Y1GA 2CDNA 2VPPA 2Q6KA 1ZGZA 2BKEA 2O8FB 1A97A 2BBTA 3LIPA 3AP3A 2GBPA 4FEAA 4Q93A 1W47A 1P5HA 4GOXA 4TYMA 3T9DA 1IOWA 3B5JA 2ZRIA 3O1HB 5LB2A 3JQ9C 3OBBA 2OECA 4FB5A 1GU1A 5GOTA 5A05A 4DLBA 5E1MA 1T2AA 3IRVA 3N1UA 2H65A 2FSSA 4YUZA 4DJTA 1M6HA 5DI3A 1IMOA 3NB0A 4FOSA 4DA0A 5G0UA 2G28A 4PR3A 4TMXA 1OYWA 2GTPA 4MAFA 5GOZA 4AJ2A 4PPYA 1RHQA 3NIDB 1KGDA 1PTJA 1RQGA 3IEKA 1D2NA 1TZKA 2ZRGA 1ECBA 5SZHB 1ODJA 1HE1C 3EIHA 4HDKB 4NMXB 4AJNA 3PGKA 4CF5A 2DUNA 1HFJA 3OMWA 4QFDA 1G17A 1LC0A 3D3WA 3IIMA 4RFSB 3VNAA 4BX8A 4NFYA 1MZPA 3ELYA 4HZUA 1KIMA 3L8HA 1BTOA 1Y3AA 4CDGA 2EG9A 3VPSA 1BDIA 3UPDA 4WXYB 1AOXA 2PMFA 3V33A 4C3OB 2CD9A 2XA2A 4FU0A 1GR0A 1VL8A 3QQPA 4RIFA 1T4CB 3JSAA 1H23A 1OPRA 1P5FA 1FY2A 5CW1A 3QG5A 3QQ5A 1LDGA 4KDEA 3MUEA 5HCIA 4IFIA 1TVEA 2PKQP 2D8AA 1M2VA 3RJTA 2FN8A 3GDHA 1H0HA 3IH5A 4KR2A 3A6EA 5L4LA 2ZM6B 3CG4A 3H1BA 3DZ8A 1ABEA 2ZPAA 3AMVA 3MYRA 2I4RA 2QN6A 2PM8A 1L4BA 3JQEA 4XWTA 3PC8C 3GVIA 5C7IO 1U2EA 1WPQA 3HK2A 3K0AB 1WKBA 1EJ6A 5LNK6 1AD2A 1CR4A 4YY3B 4A2WA 3MW8A 1H65A 2C20A 2E87A 3CJRA 4PM4A 5CB6A 1XMOB 1PT7A 5I8ZA 4ZEXA 3V2GA 1CFZA 2PH7A 5BV0A 3DBRB 4UAVA 4B6GA 3K0SA 1IXRC 4JSTA 1KI8A 4LWQA 3SZLA 5ICGA 2J9XB 2KQUA 1V16B 2WNIA 4WINA 1C30B 3I5YA 1QQAA 2L82A 1I3NA 1JL3A 1XZAA 3L9WA 3PD0A 1PEYA 3TJMA 3WXBA 3ROXA 1Y6RA 5IT5A 3EUFA 5LYJB 4NXMB 4JKIA 1ZMOA 2O1WA 4R1UA 1XNHA 2HQSA 5SYMA 3TQHA 1QUEA 1N8KA 3QOYA 4UTXA 4AIIA 5A2QA 4NH4A 2IK8A 3I9OA 2CN1A 2ASEA 2YWRA 3QEMB 3N8IA 3IBTA 1DV2A 3T7CA 1DAFA 4RSHA 1L4YA 1IBMB 1B2RA 2G80A 4WXRA 3SBDA 5JU6A 3EOZA 5FTLA 3WNBA 3ER6A 3QU5A 10MHA 1F2TA 4YB8A 1MTOA 3RYIB 3TCNA 3U61B 2JFQA 4TMKA 3TRHA 1YTUA 3CLKA 1W46A 2GKSA 3DDZX 4LRYA 1PDWA 2YWXA 5COQA 2Q3EA 5DKFA 5LCXA 3HCFA 1IOLA 2O0JA 1W8IA 1JHVA 2J7PD 3EDRA 3ZI4A 1T8YA 3OIUA 1TCUA 4TWAA 2H85A 2A94A 3RVDA 4EVIA 4M21A 3PXBA 3HB5X 5JCOC 2EBHX 3WLAA 5BRAA 1U0HC 1T13A 3HA3A 1R9MA 4WW0A 2CF6A 3VU9B 2IOQA 1J33A 1M34B 4FFSA 4G63A 4I50F 5T5QA 2NO4A 2BT4A 3SX2A 2NN3C 1UQUA 2ZE6A 2BEJA 3QVUA 3W77A 1WUKS 2QW8A 3DW3X 1ZN9A 4CQMD 1K4YA 1LWOA 4PS0A 4DADA 2CSXA 3BIXA 3N2GB 3V2UA 1HMYA 2A0KA 1N0WA 1FMJA 3DE1X 3R5HA 3FBTA 1DC6A 4BQRA 1WMSA 3STWA 3MLBA 2HUNA 2QAGA 3U7IA 1NU8A 2QTTA 5B3JC 2DQYA 3MUFA 3KX2A 3WL4A 4NZPA 4QOHA 4Y2JA 3EH2A 1KSHA 3JYPA 3DVLA 3FCUB 4JHLA 4QLAA 4EO4A 4NQZA 1YZ3A 4R5HA 1Z6XA 2HNKA 2QMYA 5EZYA 4C0XA 1TUEA 3L0YA 1UR5A 4ZJUA 2W2KB 4UTZA 3QEOA 4K0RA 1YVUA 1OXVA 4HZIA 5CITA 3M6UA 2J6HA 1WOMA 2G0TA 2RHJA 4H1WA 4UTPA 1C0LA 1LTQA 2FFBA 1GPKA 1E60A 1YBFA 3MCAA 3OPXA 3OWHA 3RVRA 3PHJA 821PA 3UCFA 4DANA 4ZJYA 2G4CA 5B7PA 2WWWA 3OZAA 2WY2D 2ZJ8A 1VGRA 2JPDA 4D8UA 1EP2B 1GTMA 1ZNXA 3FPGA 2NU6B 2IHJA 5KQPA 1MPTA 2KHZA 2PZAA 3WZLA 2XMPA 5P8WA 4FYXA 3T7RA 5H9WA 1MV5A 1WEKA 4LDAA 1EK0A 3C6YA 4IUYA 4RK6A 4FHFA 4GE3A 1GKUB 1TMYA 3JQGB 2YH2A 3VGJA 1WDTA 1I94B 4LYFA 2WTEA 1IJEA 3N75A 4QGGA 1QQTA 5FI1B 4BC1A 4E30A 4ZK2A 1P17A 3RKSA 5AW8A 1R4NB 2VG8A 4GXNA 2ZJ3A 4D9EA 3OE1A 2WFLA 4B3XA 1E61A 5K09A 1EK1A 5JS7A 3DTVB 1WD5A 3OQIB 3RSFA 3EVTA 1WXHA 4RD3A 5K5EA 2DPHA 4MPJA 4ZAYA 1S8OA 3PJGA 5DTIA 2JJ8A 3HDJA 4WBNB 5FWXB 1FRQA 1S0UA 1XCLA 3OHMA 1GYRA 4BFTA 3GGSA 2V5VA 1XZFA 3ANNA 3H5OA 3VPFA 2RK6A 1L3IA 2F2TA 2FN4A 4NZNA 4RJIA 3ZWBA 3N6RA 2DBZA 2Q3JA 3R0XA 3SJZA 1Y5RA 3W2TA 1NR1A 5LZ4A 3AGQA 1PT9A 4OBEA 5ILGA 1QK4A 3AF4A 3ORQA 3T9FA 2JFZA 1QPBA 4ACAA 4RDHA 3GLHE 3BXZA 1P33A 2QU8A 1PS0A 4JIMA 1G2QA 5BQFA 1NVVQ 1V96A 2R8XA 3HCBA 1VG0B 3MCZA 1LEHA 3OX4A 3H5VA 1MOPA 1I5RA 5JZ9A 3WQQA 5BSKA 2JFGA 3H5TA 3OT5A 1EUCA 3N3BC 5MN4A 3C1AA 4XYLA 4A15A 3BZUA 3VI4B 1X80A 5AKLA 2RI0A 3ZK7A 3OFJA 5BVGB 1E2MA 5TXGA 1CR2A 3QZUA 4G1FA 3UWOA 3HRHA 2B3TA 2WFMA 2DFKB 4OL9A 3ND9A 1SOWA 4Q7QA 2JD2A 2P0EA 4HFJA 2AVDA 2XW6A 4DG9A 1E1MA 2JLXA 2VA9A 4WRRA 4F5DA 3MT0A 4DQDA 4FHZA 1ZCAA 2V7UA 1RJ9B 3AVXA 4ENWA 1GNTA 1JU9A 1O96A 2ET6A 2FE1A 3CUTA 1P7PA 3I1FA 1WX1A 2W6JD 1XDSA 5EJ7A 1P0FA 3F0TA 2P0YA 3ZJ4A 4AURA 3C6XA 4UM5A 4B2PA 1U6IA 2H4HA 4ZXPA 5C2JB 5H82A 4UAGA 5ESWA 4EELA 1CS0B 3ENZA 4FVTA 3RYFB 4EUEA 3GFTA 1YUMA 1G41A 3OTGA 3O8LA 2OOSA 1D9XA 3PVZA 4HAXA 4MWOA 1DFHA 2A1UB 2HWXA 4IZ6A 4O2AA 5IJ0A 3RODA 3WGMA 1ISPA 1FE8A 2IW3A 5HKOA 1F9EA 4WI1A 5BQ3A 1UDRA 1VHTA 3PB3A 1T4MA 2WUGA 4OXKA 4LFBB 2I2WA 1WULS 1NI5A 1Z22A 4HDCA 1STOA 2OD2A 2OHGA 4QSMA 1RHUA 2NNWB 4RCZA 2H57A 3UAGA 4C7MA 3W9YA 4F4HA 3KBOA 4YCMA 5K2OA 4XFJA 3WFZA 1AZSC 3QKRB 3N6VA 4GQBA 4M8NE 1X7XB 2QENA 2E4ZA 2G36A 1M1YE 1YFZA 1L5HA 1MN6A 4L50A 3IMKA 4JQZA 5BNIA 5DN6D 2P2LA 3LUAA 4C04A 4C2UA 3MB8A 3U19A 1NI3A 3BT7A 1KAEA 1V45E 2QMHA 2YUTA 3RD5A 2I6GA 2WV9A 1VE1A 5EE0A 3MNFA 4HDNB 1EX1A 3RS7A 2ZJYA 1N5JA 1OZ0A 1HURA 5ALGA 1IM8A 4TKZA 3IAXA 3LXMA 4HNGA 1PGNA 3WRVA 3GL9A 4KQ2A 1TYDE 5FTMA 1U7UA 1JDVA 2GK4A 2QRLA 4M55A 1VJTA 4A26A 1W30A 3FUXA 4DUZB 3GJ5A 5DHQA 3HKDB 4ALKA 4CEIB 4PX3A 1T8UA 1XXHB 3IMFA 1VYUA 4YRBA 3B1KA 2QQ0A 1PFKA 1T8SA 2W2OA 3L7LA 2PUVA 4ZQIA 2Z8XA 2XWSA 5H81A 4ILEA 1LPSA 4EB3A 3AETB 3SZ3A 3K0FB 3MJRA 1A8UA 4P7GA 3SQXA 3K70C 3OO0A 3SSOA 3K9GA 4MCAA 1JBQA 2VHUA 1NV9A 1KQ3A 2PJDA 5LVAA 4H1HA 2JHGA 1W2GA 4TV9F 5T7BA 2YBEA 1WLSA 4CN8A 3WLHA 3EY9A 4UUBA 2IYSA 2X2FA 3NH9A 3W6PA 1GVNB 3EW7A 1PFGA 3PGMA 1PV2A 3AOEC 4PQEA 3SYTA 3IE2A 1XZEA 4K6HA 5JYEA 5JISA 2D0PB 3FMVA 1E89A 3BMNA 4KPFC 4CM4A 4C7JA 4ND7A 1BFKA 3PG5A 2WIAA 2BGGA 3CN9A 1VHJA 2IHTA 3JTMA 4OHBA 3AI3A 3DZGA 4DMKA 1NXXA 4PQRA 3BHNA 1UBLS 1MC1A 1AMOA 3P2OA 4AP9A 3C4VA 3I2FA 3O47A 3Q98A 1M6VA 4CG3A 1X0VA 4EUFA 4A8JB 2OYCA 1C1DB 1GTG1 4FYYA 5ERYA 3FNIA 3HU3A 4FFBA 3QMWA 1HH4A 1VMIA 3A27A 4QBHA 4QBGB 5BW6B 5JJIA 4YCLA 1LCIA 4OP1A 4Q7MB 1Q1BA 4A0HA 3AG5A 1SD2A 4FGJA 3VM6A 2ZRCA 3A9UA 3PNVA 1WVGA 3HA7A 3KOWA 1H85A 1G2IA 1RWVA 2OFFA 1QZTA 5HF5A 3ZWAA 2GMWA 1Z39A 2PMKA 5KC8A 1WO8A 4JP3A 1O4VA 4B3RB 3ILHA 4B9EA 1IPFA 2EQBA 1N6OA 2PL9A 3PNMA 4IGEA 4JUAA 4QHYA 4RIGA 1U2TA 2IZ1A 5A9SB 3B6KA 4Z49A 2HOQA 2Y0EA 3TJRA 1S4QA 1BGWA 1PUXA 1E5LA 4IJWA 1OYOA 4L5IA 4MWDA 2GF2A 3IR6A 5LZ8A 2PUWA 3H2ZA 2YFKA 4RJ2A 3ZIDA 3NZEA 1R1DA 2FN7A 1MRNA 4U0JA 4GYKA 1H2FA 1A5AB 2C5BA 1LBQA 2XWBF 3P4XA 1OLSB 3JZAA 4S1VA 1R6TA 3ZQKA 1IHXA 1KI1A 2YNMD 3JWHA 1J2UA 3K8QA 1FUIA 4C43A 2K7FA 2V6JA 4M87A 1ID8A 1H2EA 2Z2JA 4RHXA 2MCFA 4A0FA 5IARA 2ERXA 2NO7A 1HTTA 4KGDA 1TUGA 3WX0A 2CBXA 3KXDA 1ECGA 1PX0A 4BNLA 2G82A 3DMDA 2JK0A 4FZ5A 1V9CA 3ONNA 4BNMA 4EG1A 1C3OA 1LKZA 2OG2A 1E7SA 2WIGA 2WF5A 4Z4IA 1GT6A 2X0IA 1KC3A 2RE8A 5HRAA 4AZ3A 3VDXA 2CWDA 5JOQA 4EJSA 4C07A 4J2TA 1ZJWA 1XZLA 3NC4A 5FPHA 4TKLA 4RY8A 3UXEA 3WL3A 4B7ZA 2Y1XA 3AL2A 4BP9A 3ZZUA 1IN1A 4IZIA 4U00A 4XDZA 2JIOA 3AOGA 3C8MA 4TTTS 3OFKA 1ULZA 4UBIA 2I87A 2Z3WA 2H0AA 3GD7A 4ENUA 1Q7TA 4FKBA 1PG0A 4OYLA 4NL4H 4JUCA 4NJMB 1FVFA 4Q48A 1YR7A 4HQNA 1RAEA 3VVMA 3EIXA 3C70A 3FCCA 2GXQA 2H4YA 1OC2A 3KPWA 3GLHA 1CZRA 2PKCA 2QJFA 1G2PA 1GZ6A 3NBYC 3PUVA 1GILA 1YZNA 1UPAA 4TLBA 2CL5A 5DGHA 4ZC1A 3OIYA 1HE5A 3ZWPA 4CF4A 3FWPA 2CXUA 3Q88A 1L7DA 4YT2A 3KOOA 2QN2A 5T3YA 4EGFA 4YJ3B 1E6CA 3EGOA 4BL5A 4DR5B 2Q7OE 1DOHA 2XGOA 3H9BA 1IDN1 2EARA 1OFUA 1QYWA 1ATZA 3C3MA 1Q0LA 1V11B 2EF0A 4V2IA 1CE8A 3MJDA 1T9BA 4D79A 1HWYA 1N8TA 4G5OA 4QQFA 4EB8A 1KJ8A 4RFVA 2V7XA 4JJKA 4AF7A 5KQRA 1BQ4A 3LDAA 1V47A 2IPOA 2Q5FA 4B2LA 3R7SA 1IMJA 2IJGX 2QU7A 1Z63A 1ZI6A 1Q6ZA 3TOXA 4M9XA 3CZRA 3FSGA 4IQGA 4NU8X 5BNTA 3K4PA 2ZAYA 5AMXA 2VDLB 3BRQA 5LQRA 3RVKA 1G59A 2GA8A 1DAOA 3HCAA 2B1GA 3NCTA 1VKZA 2PT9A 3CT4A 4BASA 2VSOA 4EH1A 3NRBA 2XUJA 4L0DA 2QZPA 4RBNA 1UCFA 1DQYA 2RB5A 2WZDA 4OHOA 1KERA 2WKSA 1XALA 1E18A 2WJYA 4FBMA 4OB6A 2PFGA 1VE7A 4RVSA 3V7YA 4GRIA 4PC6A 3CRZA 4J49A 1L7OA 1NVFA 5KYKA 1T3LA 2P6PA 4AM8A 1XDDA 1G9XA 2FVXA 3ELWA 3EGWA 1DEKA 5TT0A 3Q8XB 3U4QA 3WIBA 1LS6A 3KO8A 4TM7A 1UF9A 4YO8A 2OT3B 3EAQA 4Q4AB 1CY1A 1M1YA 2YXNA 2P77A 1E9BA 1L3BA 2CKDA 1PG2A 1Z5WA 4LVCA 2QD3A 1YR3A 3EVZA 4ZV7A 2IGBA 5TPWB 3UJCA 3HKBB 5G1NA 4PRLA 5JAUA 5FLYA 4GSYA 1LSOA 1V26A 3WHLA 3R9XB 3SMQA 2VZ0A 3GFPA 3H8WA 2AJ8A 2GN6A 3B1ZA 3VRHA 4TKVA 2PRJA 2PR7A 1TJNA 2ZIFA 3RVSA 5UKDA 3NHFA 3LXXA 3DXZA 3RRJA 1Y3CE 2O23A 3KEMA 1EFKA 4TRJA 3T1YB 4QXMA 4WASA 4C4RA 1JHQA 4XX0B 3TRJA 3LRXA 1TT5B 2WFAA 4LJ7A 1SZDA 4D26A 3ZE8A 3OPYI 3TUIC 1E94E 4K46A 3GT7A 4IIUA 1OVGA 2R1ZA 3WJ1A 2EZTA 1JAYA 3EIEA 6AT1A 4IEEA 4K28A 3N3AC 4HKTA 5IM4F 1B8VA 1P75A 4CFZA 1E9FA 1T1SA 3R7LA 2RONA 1F9AA 5AVYA 2YFHA 4PLGA 3MTJA 3OP4A 4RXTA 4PRYA 5DP2A 1RQ2A 3ZIAD 2P69A 2P6OA 3A14A 1PVVA 2WBLC 3DLTA 1J2JA 3N2KB 4W82A 1QMPA 3GNQA 4QGBA 4RPLA 4YO7A 1ISHA 3TN7A 2QLMA 2OMEA 3C7AA 3OVMA 3R3XA 2ZVQX 2BOVA 3EVCA 1KAGA 1O57A 1U7PA 2FUNB 3WLPA 5KHAA 2IF0A 3OIGA 3OETA 4LZWA 5FUWA 1VA5A 3ZBQA 7ABPA 1GEEA 1Z2OX 2R7NA 2V7EA 4IKOA 2E18A 2PEZA 5HQJA 1XLTC 2ZYAA 1ORTA 1RXSA 4G1EB 4PHGA 4BLTA 1JEQA 4W5OA 2C4KA 4FFWA 3Q72A 4IH1A 1SR8A 4J0HA 3ZHYA 4J6FA 5CB4B 7YASA 4UHCA 3I09A 1UKEA 1XTRA 4G85A 4H15A 1U8ZA 2HT1A 2Q2QA 3CGWA 4HS4A 1P77A 2IYTA 1QRDA 4U1RA 5FAXA 4TXLA 4EHJA 5KNCA 5PNTA 3ZHBA 1RS0A 4LNAA 4P81A 4TRNA 3USCS 3CEHA 5JSQA 1KI6A 5K0NA 3F3YA 2HLPA 2ORVA 1GLGA 1KHHA 3K6RA 1ZJ6A 4TOIA 5DLQC 1ZSYA 2W4IA 4MCIA 4XDGA 3J80A 4NBKA 1DAIA 2QN9A 3QYPA 4QLOA 2KSQA 4OXNA 2XKJE 1HDRA 4JA2A 1ATIA 3LCCA 4BB6A 3CMMA 1Z0UA 1EP3B 2C7RA 2QE6A 2C95A 3DUWA 3KTOA 3DXXA 1BG6A 1W88B 3NDIA 3G5AA 2W6IA 1XQ1A 4M0DA 1U28A 4QOIA 4PG5A 3V4SA 5BRJA 5AW4A 5FX2A 3KFXA 3Q3VA 4KG7A 2F3SA 5L45A 4DDVA 3W5CA 4YBRA 3Q8LA 2C4MA 2PUGA 4BMPB 4YUXA 2WJIA 3PX3A 3TQIA 1E6WA 1GA4A 1H2BA 4ND8B 1TTPB 1CR1A 1OSNA 1YQ9A 2DH6A 2IPMA 4QECA 3SC3A 4DDWA 1C4OA 4AKIA 3L41A 2FGJA 3Q9UA 3EDMA 5AW5A 1M8PA 3ZBPA 1V8DA 3LW8A 4PPQA 5A6VA 1UAAA 1OA0A 3L0SA 2XTMA 1Y7TA 1D2EA 3FLBA 1CQWA 4PLYA 1WKCA 2BHSA 3RAEC 3VR4H 2C82A 4KACA 2RC5A 3MTBA 3PNQA 3UC9A 1AKTA 3LWDA 2Y76A 3TIIA 1E4EB 1G60A 1C29B 2ZBPA 5H16A 3WLFA 2X3YA 1OXKB 2PEYA 4KSCA 5FQOA 5AVUA 1YF3A 1RACA 2VAWA 4YJHA 4FUQA 5AXDA 3VO9A 1O5IA 4EGCB 3GBSA 2ZKIA 1H5NA 4O4HF 3IIEA 5TPZA 2IYWA 1LV7A 2FZVA 3DD5A 4ZCMA 3DONA 3G7UA 2VDRB 3H3JA 2GNAA 4C29A 4NAVA 5B58T 3NHSA 1P5RA 5CFNA 1GNVA 1SUIA 4RXUA 4WV3A 3RFVA 3TLYA 4ER5A 1P29A 1IZ0A 3ZK8A 2EYUA 3SVZA 1ETHA 3U7RA 3IL2A 1NR5A 1YB5A 1AGXA 3JAWA 1ZKDA 3M70A 1U2GA 3U4IA 1ZUWA 4Q3KA 2GEBA 4AY6A 4XM2A 1VJRA 5EUCA 3JYOA 3U81A 4XAQA 1UL1X 4V3BA 4Y8VA 1M74A 2JLCA 1QRAA 2H8KA 3DE2X 3FN4A 3Q2OA 3AEUB 3VR1A 2VJLA 3H4IA 2GNPA 3OWXA 2X0FA 4TT3A 3H0KA 5C7OO 3BF8A 3ZY6A 1UIRA 5I7RA 4NK4A 1R7RA 1G64A 3PXUA 4E5NA 5JFGA 1ZPDA 1RQRA 2QD1A 3TLCA 1G8GA 4MV7A 1PF7E 4LCEA 2AS0A 1IY1A 4QAQA 3TAUA 2JI6A 1QGYA