3WJ1A

Crystal structure of sshesti
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
PLDPRIKKLLESGFVVPIGKASVDEVRKIFRQLASAAPKAEVRKVEDIKIPGSETSINARVYFPKAKGPYGVLVYLHGGGFVIGDVESYDPLCRAITNACNCVVVSVDYRLAPEYKFPSAVIDSFDATNWIYNNLDKFDGEMGIAIAGDSAGGNLAAVVALLSKGKLDLKYQILIYPAVGFDSVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRFSPIIAQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIDQGKDAIGLIGSVLRRTFYDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Low-pH Adaptation of a Unique Carboxylesterase from Ferroplasma: Altering the pH Optima of Two Carboxylesterases
doi rcsb
source organism Sulfolobus shibatae
molecule tags Hydrolase
molecule keywords Carboxylesterase
total genus 104
structure length 304
sequence length 304
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wj1A00
5AM1A 5AHXA 1N1MA 5IVIA 2B61A 1DU4A 2XQIA 1DT5A 1UK9A 1CV2A 1L7QA 1XLUA 5AP9A 2RONA 3PICA 3H04A 2BFNA 5ALFA 1AURA 3VVMA 5DWDA 2WJ6A 3V1LA 3WQHA 4G4GA 4D9JA 3G9XA 4UFPA 1D07A 2BGNA 3B12A 1TIBA 2FJPA 1CUBA 5ALPA 4N8DA 5C8XA 5AKXA 3OOSA 3X3HA 2ZJ6A 1WB5A 1XZBA 3M81A 4FLMA 1CUXA 1XKTA 4X71A 2IX9A 4N5IX 5EI5A 4UFOA 3WK8A 1YA4A 2OCLA 1NU6A 1VZ3A 5HQ3B 3BXPA 4X6XA 3ESBA 1MX1A 2GZSA 2CJPA 2XMSA 3G7NA 2WQZA 1TQHA 3O9MA 2ZYIA 3FWHA 2WHPB 4BAZA 3IVMA 4B0OA 4MEAA 2G63A 4CCWA 1TRHA 4Q3OA 3PFCA 4C6HA 1F6WA 4UBLA 1YASA 3ZLUA 3FBWA 3PUHA 1ZI6A 2H7YA 4UFNA 3RARA 3BF7A 2FJ0A 4K6HA 2YASA 5FOQA 1CUGA 3FCXA 3ICWA 1XRQA 4KR0A 3AILA 5I8PA 4N5HX 4HXEB 1CR6A 1P0MA 1FFDA 3HRHA 3QH4A 3R3VA 2B20A 1FJ2A 5ALDA 4JYPA 4F21A 3BWXA 5KWIA 4U2CA 1H2XA 1CUYA 1G42A 5ESRA 1A88A 3FLAA 4Q82A 2Z3ZA 3WL7A 1TCBA 1E5TA 3W2TA 5EIAA 3FYUC 2G5PA 3O4GA 2PUHA 3I2GA 3ESCA 3I6MA 5BWCA 4M0FA 3JYHA 2DCMA 2BJHA 3M83A 1UT6A 3WK9A 3LP5A 1L7AA 3C70A 1VXOA 4EA6A 5AKJA 1QTIA 1XZHA 2GBFA 2DR0A 4LHEA 2VTVA 1WOMA 4ETWA 5EIEA 1C7JA 2QXUA 4QDOA 4I19A 4BZWA 4DTCA 3EIOA 3R3UA 5ALLA 4EY7A 2WFLA 5HK8A 3PI6A 1DWPA 3I2HA 1VE7A 5A71A 3S2ZA 1ISPA 5HF5A 2EDCA 5A7GA 3ILSA 4GLBA 3V1MA 1U2EA 2NW6A 5ALXA 2QJRA 3YASA 1CIJA 4NMWA 2WG0A 4H7HA 1QIKA 4UBNA 2ZJFA 1SFRA 1HKHA 2WFLB 1SCQA 2ACEA 1QIMA 2AJBA 2VA9A 1CVLA 1OCEA 3O0DA 1T2NA 1XLWA 3I2JA 3PUIA 4QDUA 4B0PA 1XRRA 4FFWA 1G66A 4HZGA 1VOTA 1ZICA 3ZLTA 2Y1KA 5LKRA 3OTQA 2ZVDA 3PDCA 1AUOA 1ODCA 5CH3A 4CFSA 3D5EA 3F96A 1UOQA 1G4HA 7YASA 1M33A 2XUJA 5ALEA 2HA4A 1Q84A 1FFBA 3MVEA 1SCIA 4BBZA 1UWCA 4YK7A 3WZMA 1H22A 1UKAA 1CUHA 1QIHA 1XRLA 1JI3A 3IUMA 3C5WP 1DWOA 4J0IA 1EK1A 4G4IA 3Q8WA 5AKGA 5EHXA 2CKMA 1ZIYA 2WHRA 2WU4A 1EDDA 2XUQA 4BP8A 2Y2VA 1QGED 5DYYA 3G0CA 5ALZA 3GUUA 3KD2A 4N8SA 1FFAA 4DNPA 2HA0A 3F8SA 1E66A 3DL7A 2X8BA 1ODSA 4QLOA 4UBIA 3FVRA 1ZI9A 4DNQA 4CIAA 3D4LA 4AN0A 2W6CX 3U0VA 2OG1A 1K63A 4QLAA 3FCYA 3QM1A 1Q0RA 4HRYA 1U65A 4WY5A 1VJ5A 4OSEA 1WM1A 2XUGA 2XI4A 3O9VA 4OYLA 4I4CA 1JU4A 3HABA 1XRNA 3VJLA 2HU5A 1CQZA 2GYUA 1ZJ4A 5FDFA 4H7DA 4GEGA 4X7BA 5AKZA 5AIAA 3HLKA 1VZ2A 4OB6A 1LZLA 3FSGA 5T4EA 1RP1A 2HM7A 3NOXA 4UHEA 3G0IA 1LNSA 6YASA 5HK9A 2J3QA 2I3ZA 4BCCA 1XQVA 4EHBA 2J4FA 3DYIA 2VJCA 4AO8A 3FYUB 4PF1A 5ALOA 4PSDA 2AXEA 2PKYX 5C7YA 4QZVA 4XJVA 3AZPA 2HU7A 2OGTA 4LYEA 5HCUA 4OUKX 5AIBA 1U8EA 5AI8A 3UUFA 4PW0A 1NX9A 4X6UA 2WIFA 3AFIA 5CH8A 5AICA 5HF8A 4EB0A 2H7CA 4J0CA 1XZGA 2C4HA 2QKYA 4I3FA 5DJ5A 1EVEA 3G9ZA 2WFMA 4Q1VA 3F67A 1F0PA 4U2EA 1ZGBA 1CPYA 3KSRA 1LBSA 1ACJA 3G8YA 1UKBA 2HA6A 4QDTA 1JJFA 4LXHA 4F5ZA 1ETHA 4MWSA 3H2KA 5ALHA 2Z8ZA 5AI5A 4UBMA 3QPDA 4YX9A 3DNMA 1WHTA 2VEOA 4XIIA 3WA6A 1QO9A 4G1FA 3CXUA 2AJLI 2HFJA 4DMHA 2XLBA 4MWTA 1QE3A 3V1KA 2H9YA 4IH9A 4C4YA 3DL4A 4KRYA 3IUNA 4CIBA 1EK2A 4U2BA 4Y7DA 4PV7A 4DYHA 3FAKA 1KEZA 4AO6A 3STUA 4H77A 1ZD5A 5FLKA 4BB0A 3O4IA 4G9GA 4ZI5A 5AI0A 2OAGA 2PSJA 2V97A 2VQ6A 1R9NA 1QIFA 4DIUA 4W9RA 1GQRA 4UBJA 1J2EA 2QT9A 2GBCA 2OQIA 2WM2A 3H19A 4KAAA 1Z68A 4OU4A 4KYVA 4J0DA 5I9IA 5HZGA 2G4LA 1XZFA 4G8CA 3OPMA 3BDIA 4B9EA 4DNOA 4BDSA 4UBOA 5D7BA 2PM8A 1JKMA 2ONCA 3PFBA 2R11A 2BUBA 3C8HA 4GW3A 1LBTA 5EIHA 2H7XA 5JANA 4GWLA 2G5TA 1O6FA 2GYVA 3A6ZA 1LPMA 3JW8A 1W52X 1C4XA 5IH7A 4UHDA 4UUQA 4CCYB 1LPOA 4HS9A 3HXKA 1QOZA 1BE0A 1LZKA 2I03A 5C8VA 1FSSA 3GELA 5CURA 3F97A 2C58A 3DQZA 1BU8A 2HIHA 2OLEA 3E1GA 3F98A 4Q3LA 3TGLA 4CG2A 5LZ4A 3B3QA 1GPNA 1A8QA 1ZIXA 5AM3A 5YASA 2WG2A 5CH5A 5E4JA 4GBGA 3G9UA 2WU3A 1UKCA 2W22A 4PO3X 2WJ4A 2OCKA 1XZJA 5JAUA 2OXEA 3A70A 3VJKA 4UHFA 2OGZA 2ACKA 5A62A 5JAPA 1GPLA 2RAUA 2C5FA 4F60A 4DMKA 4H7JA 3VISA 1TK3A 1THGA 2AJDA 4HAIA 1P0QA 3CN9A 1DWQA 1HL7A 1QIGA 2O2HA 2ZYSA 5K3BA 1N8SA 3DJYA 2CUTA 3M82A 1JFRA 5ALSA 5LP1A 2WFZA 1WPXA 5HFAA 1EINA 2OCIA 1IVYA 3EF3A 2DSNA 4B85A 2DHEA 2JIDA 5ALRA 2XQKA 1WB4A 1UZAA 2GYWA 1P0PA 2WLSA 5AM4A 1JMYA 2XUKA 1JMKC 2QZPA 2WKWA 1YS2X 3FYTA 3WJ1A 2VJDA 5LIPA 5SYMA 3D7RA 1IZ7A 4FDMA 2YXPX 2X5XA 4H18A 4WY8A 3RKSA 1R4ZA 1SC9A 3E4DA 3V9AA 3HI4A 2VAVA 1QIEA 1QIDA 5KBYA 4IO0A 1ACLA 2I78A 4JUIA 4Y2JA 4BE9A 1QTRA 1BS9A 3C6BA 5F4ZA 3LS2A 1J06A 3WKEA 1MAAA 1MPXA 1Q83A 4GECA 5AOBA 3IB3A 4OPMA 3IBTA 4LXIA 1DT3A 4MYSA 3ANTA 3QMMA 5HFNA 2CB9A 1XFDA 4X97A 4OU5A 2CBGA 4BVKA 2V98A 3OG9A 2C0QA 2OQVA 5DNWA 5CBKA 2R8BA 2HADA 2FX5A 3L1HA 4M0MA 4BATA 2VATA 3DCNA 1UOPA 4W63A 1BRTA 2HL6A 2PU5A 1CEXA 4MQMA 1GQSA 1VA4A 5AOCA 4W1QA 4EBBA 1ZOIA 3BIWA 1BCRA 4FMPA 3ED1A 4GXNA 1WB6A 4Y2SA 2QR5A 1J1IA 5A7FA 5JIBA 1XQYA 1S8OA 5AI4A 1AZWA 5FV4A 5AM5A 1UK7A 3KOOA 2PL5A 4C4ZA 4U2GA 2QTBA 3QMWA 4A23A 4BAUA 5IVKA 3O95A 5CRIA 4INZA 1E89A 1Y7HA 2Z3WA 3WK5A 2XUPA 3BIXA 1AGYA 1PJAA 1EH5A 3G0GA 1CUEA 4BTVA 4WDQA 4BC1A 3C5VA 1IUPA 1IMJA 1FFEA 2VAXA 1C7IA 3S8YA 3L1IA 2HA3A 3NUZA 2PPLA 4EY4A 1YSCA 3IDAA 5JARA 2WIGA 1MNAA 4FHZA 2C0PA 4GI1A 5ALJA 3E3AA 3SC2A 4TPKA 5KWJA 3H2HA 2XMBA 2C5GA 4AB1A 5EFZA 1XZDA 4M0EA 2ZSIA 2HA5A 2K2QB 1VKHA 2XMGA 4C89A 2XDWA 2XMZA 3LLCA 1QJ4A 2FUKA 4UBKA 2VF2A 1R88A 1N5MA 5AM2A 1CUVA 2J3DA 5FXMA 2WHQA 3FYUA 5K3AA 4WDRA 1O6GA 4AXBA 3PF9A 2DFPA 1WHSA 4QNNA 1ZD2P 4UHHA 3I6ZA 4B81A 2HA2A 1H23A 2JEYA 5DTJA 3VKFA 2AJCA 5CXUA 4Y2TA 1LPPA 3AJAA 2DQZA 1ZJ5A 4ITVA 2IITA 1DQYA 4H7KA 5FKJA 2JGJA 4EY6A 4Y2QA 4HVTA 2RIPA 3LCRA 1CUCA 3TRDA 2JGKA 1W75A 5AI9A 1HBJA 1RYYA 1LGYA 3I6YA 1DX6A 4UHBA 2UZ0A 1KU6A 3A2LA 3DEAA 4FTWA 4AMZA 4MQLA 4BP9A 3GBSA 4ZGBA 1HLGA 3M3DA 3DYVA 2BCEA 3CCCA 3KWFA 5E4TA 3VXKA 4QDZA 2YYSA 1JJIA 4K2AA 1GPKA 1H2YA 2ZJ7A 1NU8A 5JZSA 1SCKA 4WCVA 3BE8A 2WG1A 3C45A 4W1SA 3W04A 3QYJA 1ODTC 5HKAA 4BVLA 1W4LA 2CZQA 4B84A 3EBLA 3R41A 3BDVA 4WFIA 3C43A 4BDTA 1CUZA 3WJ2A 2ZYHA 4O08A 5DNUA 2JGIA 3H1AA 3I2KA 1XQXA 2ZYRA 2XQGA 4G9EA 3R3ZA 2QVBA 4TVKA 4X6YA 1MO2A 1EDBA 4FKBA 1CUWA 3AINA 4EY8A 2WJ3A 4BRZA 4ROTA 4NZZA 4MEBA 4MJ3A 1MAHA 1USWA 3I1IA 5BV7A 3BJRA 2XQFA 3QBJA 2XUAA 2Z5GA 4BCDA 1EX9A 2XMRA 3WK6A 4FBLA 4K6GA 2D5LA 4X91A 3D59A 2PUJA 4AX4A 1X2EA 3QZUA 4Y2RA 1VE6A 4J7AA 1YB7A 3N0TA 3R3XA 5K3DA 2HRQA 4KACA 3WL6A 3WMRA 2PSEA 4Y2YA 3H2IA 2QUAA 5CT8A 5AKLA 3DS8A 5BOVA 5LZ2A 2QOEA 2WTMA 4H0CA 2XLCA 3H2GA 4HXFB 4C4XA 3C87A 2I3DA 2RHTA 3HSSA 3WA7A 4G4JA 3WYNA 2HDWA 3W9UA 1XZIA 2AJ8A 4EY5A 1PV1A 1U4NA 1HPLA 4EUSA 4PSCA 1E8DA 1X70A 3EQ9A 3RK4A 2WIJA 1MN6A 4X90A 4ZXFA 1B6GA 3DOHA 4J03A 4AZ0A 1EB9A 5ALVA 5JAHA 4IH4A 3W06A 5DLPA 5T4BA 3WKAA 5K3EA 4DSAA 2QJWA 4J0JA 4A16A 1EI9A 5T4FA 2D0DA 4LIPD 4DM7A 4IQ4A 2XUHA 4X95A 3FOBA 4KE8A 4ZV7A 1CUIA 2XMDA 3ANSA 3BL8A 2QXTA 1TCCA 2B9VA 2Y6VA 1ORWA 3DKRA 2VT7A 5AKIA 1JT2A 3TJMA 1MJ5A 3C6ZA 1R50A 1XZMA 4K5QA 3ZLVA 3R40A 5LZ8A 2BUCA 4AZ3A 5LZ5A 4OCZA 3GROA 1W1IA 4CCYA 5AKHA 4J0KA 2ECFA 4X00A 5ALYA 4B7ZA 3MUOA 1AC5A 1OXMA 4QWWA 3D0KA 2LIPA 4BE4A 4OD0A 2O7VA 4LYDA 3WWCA 1DX4A 5H3HA 3R3YA 3RM3A 3WWPA 4ARAA 1GT6A 3O4HA 4RPCA 5DYWA 4FBMA 4BTLA 2C7BA 1TCAA 2YH2A 4KE7A 4B80A 1TKRA 3V1NA 4AO7A 2CMFA 4U2FA 5K5EA 1ZD4A 1L7RA 3EQ8A 4DMCA 1IUOA 3WK4A 5LZ7A 3KDAA 4H7EA 4BYMA 2DHCA 4KE9A 2HA7A 5LYYA 1LLFA 5CT6A 3OC0A 4ARBA 4WFKA 5J3JA 4DNFA 4JEIA 4A5SA 1CQWA 4WFJA 1AX9A 2OPHA 5AK4A 5I7UA 2XE4A 3B5EA 3NGMA 3G0BA 4X92A 3C6YA 1I6WA 1R9MA 2EDAA 5JYCA 4JNCA 3KXPA 3IA2A 3WKDA 5FPQA 5AK5A 1CLEA 4BVJA 4CG1A 3G0DA 1MX9A 4GDMA 2Q0XA 1WPRA 4DLNA 3F9CA 1YAJA 5SYNA 1GGVA 4BC0A 2X76A 4QA9A 2JF0A 4P93A 4Q3KA 4P92A 3V48A 1EVQA 1KU0A 1N5RA 3D2CA 1E8NA 3G02A 3WIBA 1HQDA 4FLEA 2JGMA 4QDXA 2WIKA 5C81A 4PQEA 1Y37A 3IURA 3ICVA 3K9BA 3QMVA 4Q05A 3STWA 2JGFA 4L9AA 4G8BA 1XZAA 4PSUA 2BUAA 2PVSA 1XZEA 1Q0ZA 4H35A 3EQ7A 1XROA 3H0CA 3I2FA 1K4YA 4Y9SA 1T4MA 1E3QA 2P8SA 5FPPA 5JATA 5C8ZA 2XUDA 5FUMA 1R3DA 1J07A 5CXXA 1W76A 4IHAA 4IH1A 4RNCA 1AMNA 3IULA 4U2DA 4B9AA 3GA7A 4AN1A 5JD5A 2WSLA 3GZJA 4KAFA 2B4KA 2ES4A 2XMCA 5FRDA 3WL8A 5JADA 2O2IA 1ORVA 1R1DA 4E14A 4H7IA 4W1RA 1DINA 3ESDA 5CT5A 1VLQA 2PSFA 5ALQA 1ZD3A 3AZQA 1VXRA 3DDUA 2VJBA 2V9ZA 1QO7A 4CG3A 5AH0A 1K6EA 2PSDA 2XQJA 1XZKA 5KREA 4P9NA 3K6KA 3VVLA 4XX1A 3C8DA 5T4HA 5CTAA 3D3NA 3QPCA 3HJUA 2Y2UA 2WUDA 1THTA 2DHDA 3C6XA 3DOIA 5ISMA 4MYDA 1CFJA 2PU7A 3WWOA 3MGAA 3H2JA 3L1JA 3D2AA 5JZ9A 5LZ9A 1QFSA 1Y7IA 5FP0A 1MT3A 5AI6A 3A2NA 4UHCA 1LPAB 2GBIA 2WILA 5JZBA 2WHPA 4NS4A 1GKKA 4J0GA 2JEZA 5ALIA 1QFMA 3VJMA 4K6KA 1W6RA 3JWEA 4NVRA 3RLIA 1BEZA 3AIOA 2DQYA 4HXGA 4X93A 2WIDA 2QUBA 2XT0A 3AZOA 5IVHA 3IIIA 4E15A 4X85A 3W05A 1X2BA 4B6GA 1RWQA 4KAJA 1CRLA 4AQDA 5A7HA 1SOMA 2OGSA 3O4JA 2OAEA 3BJMA 2QM0A 1YB6A 3IUQA 5D3KA 5HF6A 3WI7A 1QONA 1QZ3A 1YAHA 2PX6A 1IZ8A 3QITA 1CUUA 4JH0A 3WZLA 2RI6A 3SX4A 1PFQA 4X3CA 3VDXA 3A2MA 4XVCA 5JAOA 4L72A 4DMFA 4DGQA 4Y2UA 4H7FA 2XMQA 2HRRA 3ZPXA 5IKXA 2BKLA 4QWMA 4X94A 3FNBA 1MNQA 1EA5A 1A7UA 5E2IA 1MX5A 1JU3A 4FNGA 1DTEA 4CI9A 5IVDA 4C01A 4PNZA 2OCGA 4GHWA 4E46A 2IIVA 3HC7A 5HQ3A 3STVA 3ESAA 1MTZA 2Z8XA 1CUSA 2O2GA 3CN7A 1TAHA 1E8MA 1XZCA 3ZWQA 1GKLA 5DYTA 5EHZA 2VJAA 1ZI8A 3IUJA 5JASA 3SK0A 3NWOA 5K3CA 2Y6UA 1F0NA 3OM8A 3ZV7A 2CEKA 4TGLA 2WUFA 3AIMA 5ALNA 5CT4A 2BGRA 2E3JA 5AO9A 3UUEA 5K3FA 5AKYA 1OILA 4YPVA 1EB8A 5D6OA 2JGLA 5HKBA 3W9BA 4QE3A 4LXGA 5BWBA 4HRXA 5ALTA 2PBLA 4Y2PA 1BCSA 4F0JA 3FVTA 4RGYA 5JALA 1CUFA 1EHYA 3GFFA 4LKOA 3DD5A 4N8EA 5AKKA 3FLBA 3T4UA 3WL5A 1YA8A 1DQZA 4BRSA 3G9TA 4Y2XA 5LLSA 4C87A 2QRUA 1IUNA 1XQWA 3TEJA 4BAGA 4KRXA 1BEEA 4OB8A 1A8SA 4OYYA 2EEPA 2JBWA 2GBGA 4ZV9A 2XUOA 5CW2A 4FNMA 5HF9A 5AK3A 3K2IA 1QLWA 1BROA 4Y2VA 4Z49A 2HHAA 4DSZA 1UFOA 1BN6A 4S0XA 2WUEA 4ZREA 3WKBA 5AKEA 3AIKA 5DTIA 3WK7A 3LIIA 1WCYA 1H2WA 1EXWA 3ZI7A 3R0VA 2VT6A 2J4CA 3WYDA 3AUKA 5E4YA 1FFCA 4KJXA 3SWWA 1G5FA 1BN7A 4G8DA 5JD4A 2ZSHA 1XRMA 3E0XA 4FFVA 3HYSA 5DNVA 2HFKA 1UXOA 2JGEA 3WWDA 4YASA 4ZRDA 3KWJA 4C88A 3MUNA 4V2IA 4MXDA 5A2GA 3I2IA 3I28A 1A8UA 2RGUA 1CUDA 1LPBB 1P0IA 1XZLA 3H17A 4P08A 4FOLA 4JYMA 1LPNA 4KEAA 4Q34A 1XRPA 2HU8A 5CT9A 4RE5A 2XB6A 2QS9A 5ALKA 2QMQA 3HACA 3WWEA 4J3JA 4FWBA 3QVMA 3R3WA 4KE6A 3HZOA 2GZRA 3STYA 4BCBA 1H2ZA 2BAGA 2VSQA 1YCDA 4E11A 4ZWNA 3WIOA 1GZ7A 2XUFA 4B82A 4UPDA 1EDEA 4L3WA 5D3ZA 3PE6A 4OB7A 5EHNA 1XKLA 5EHQA 1CUAA 4RE6A 3D2BA 4G5XA 4EZIA 3UMJA 4AMYA 1LPSA 2ORYA 1HDEA 2ROQA 4WJLA 5AM0A 1MU0A 2WTNA 2RHWA 1CUJA 3DKKA 4J0HA 4B83A 1JJBA 1YR2A 4L0CA 1UOOA 1K5PA 2PSHA 2O7RA 1GXSA 3STXA 2XUIA 3DLTA 3STTA 3HEAA 1VA5A 3OURA 1QIJA 3LIPA 4HTAA 3T52A 3N2ZB 3H1BA 3P2MA 4FLFA 5ALGA 2V96A 1K8QA 3CCBA 5AOAA 4QEKA 3Q0TA 3H18A 3PF8A 4W1PA 2WUGA 5ALMA 5AK6A 5CMLA 3WLAA 1B41A 3WKCA 5ALUA 1ZGCA 5AJHA 1UK6A 1F8UA 1YS1X 1AKNA 2H1IA 3BF8A 3FSGD 5JD6A 1AQLA 5ALWA 5EGNA 3FLEA 1UK8A 5LKAA 1XLVA 4XWGA 4BZZA 5A6VA 3QPAA 1QIIA 3U1TA 3I1YA 5K3FB
chains in the Genus database with same CATH superfamily
2W2MA 4F4JA 2Q6LA 1X15A 1WTAA 5AHXA 5H80A 5JQGB 4C3UA 2GRJA 3SYMA 5BSUA 5A2QA 2B61A 2NO9A 3IDZA 3ND5A 4RXUA 2YY6A 3UOWA 4TV9A 4EVSA 1TVKA 3CPEA 1GU7A 4G85A 5JVDB 3LLVA 2EW8A 1SVMA 3NC4A 5GZ6A 2NADA 1TM3E 5KNLA 4LE1A 2RONA 5EQJB 1IPHA 3H04A 1Z4LA 4BLTA 3DE3X 3GYGA 1SBCA 4D8YA 1ZH4A 1HI9A 1OXXK 1NTRA 4EO9A 1UP4A 1Z83A 4WOBA 3SDZA 3ZJVA 1NN0A 5ALFA 1AURA 2XQVA 1W4BA 3GEPA 4R8LA 5D1HA 3IJ5A 3ROEA 1JFLA 1NVWQ 1TQ2A 4PG8A 1TQDA 2CHVA 3PQ7A 2WJ6A 4UZFA 3ROGA 3V1LA 1DQSA 4G4GA 1V1JA 4IJMA 3BGOS 4FDUA 4IDCA 3RRXA 2H51A 4B6PA 5EEGA 5HTOA 1AHNA 3L07A 4JODA 1NRIA 2OUKA 2I55A 2FJPA 2O4UX 5ELXA 1YB2A 1CUBA 3E8MA 3H05A 4RL4A 3SICE 2P8JA 3ET5A 3FM9A 4CKWB 3H5RA 4UUAA 5C8XA 3OOSA 3W9SA 2V6IA 3DXXA 1XZBA 3FHLA 3R0XA 1N0VC 3DWGA 4PPFA 4PS0A 3DVQX 5AD1A 1ZRMA 1PR4A 4BN0A 4EX7A 3ZOKA 1U2DA 2IHYA 1IONA 2ZBGA 1HNZB 3S28A 3HY4A 3BIJA 4A82A 3ZZ0A 1C0LA 2QB5A 3PIRA 4RJTA 1NQUA 2VC2B 4B7UA 2PTHA 4Y1RA 4AIIA 5EESA 1PUXA 3RJ9A 2QHXA 2YZ7A 4F6RA 1Q3KA 1QHIA 1I3CA 4Q3DA 1N3LA 1E6CA 3OD5A 4XE5A 5BQOA 4CN9A 2OV8A 1HTWA 5IKPA 3VOBA 3WK8A 1L1EA 5G0UA 2FWAA 3PC8A 4IL5A 1DWUA 4Y8VA 5JSQA 5E3JA 1PNQA 2H65A 3SVLA 1Q17A 3FWNA 4LJ8A 4ZQEA 5HQ3B 4PRKA 1N2XA 2IU3A 3QSYA 2OORA 2BH2A 2PS9A 4DLAA 4MDEA 5JTUA 3T0FA 5FNZA 3ZTTA 4EMTA 2YDXA 3K4QA 1VE3A 2QW0X 2RH8A 3UKJA 2IHNA 2R47A 3HN6A 3LT0A 4LOIA 3VR6A 4B47A 2CLIB 5CVVA 3PPVA 3DZDA 1TQHA 2FLVA 4HYQA 1HWYA 1CHNA 2ICAA 4PNEA 3S2EA 3U3ZA 5ED4A 3LW8A 3E9NA 3LHIA 2PUFA 3JVIA 1YZHA 2FY8A 2I54A 3G2PA 4QNMA 5DBIA 4K1XA 1UEXC 2IYNA 3M4XA 3P32A 4Q7KA 4UMEA 4BO3A 3FWHA 3JD1A 2WHPB 2QX6A 1YUNA 4BAZA 2R0QC 4R81A 2CV2A 5CEJA 2WR8A 1VMDA 3DWFA 2FETA 1PYGA 1G17A 1ZG3A 3S2UA 1DE0A 3CM0A 5DGXA 1KDVA 4C6HA 3TECE 3LBHA 2Q29A 3KVYA 3VMMA 5JZMA 2QQ5A 3KHSA 1DLIA 1IDOA 1EVJA 1QF9A 1R0XA 1TU3A 2ORVA 2YNMC 3A3NA 3LY8A 1U1GA 1ZI6A 2H7YA 2ZJOA 3OVMA 2D4AA 4NMLA 5KOJA 4BPBA 2KBEA 2Q5IA 2X0JA 5AXCA 2H1OA 4M88A 2JI6A 2Z1DA 3BF7A 2FJ0A 5TT1A 2EP5A 1VKJA 3ESRA 2M2IA 3NZEA 5COQA 1PL8A 2ZYDA 1JDPA 5FWDA 4WE3A 5A9RA 5EIXA 4ARCA 3CB2A 3K96A 3T1OA 1FYXA 4X63A 5FQOA 5BUZA 4GYWA 4WZBA 3UFXA 3OZRA 3RC8A 2WZBA 3HCAA 2BEUA 1N77A 2QRJA 1NVEA 2BFDB 5EQTA 1K6XA 3TX6A 4YP5A 2TS1A 3AILA 4YT5A 5I8PA 4HXEB 3OJ0A 1CR6A 5IASA 1RAEA 4HQFA 2PX4A 3EXHC 1OFUX 2E6UX 2HNKA 2OK8A 1ULHA 2YFQA 4ZEWA 1KOLA 1NLUA 4WV3A 1FJ2A 5TMBA 4Q16A 3T12A 3HPRA 2GO7A 3PWKA 3B38A 1GTMA 3BWXA 3F7NA 3EIEA 3QXCA 4BQEA 3RAGA 4AO6A 4CKWA 4PZAA 1CUYA 1I0IA 3SS7X 1RNLA 5HDBB 2IDJA 2ZAOA 3KFXA 5TARA 5JXIA 3L41A 4RSHA 3GFGA 3T54A 2UDPA 1HT1E 1Y80A 4D8TA 3DEHA 3SBDA 1TUIA 4HC4A 4JC4A 3W2TA 4ZYLA 1G6Q1 2YC4C 3H9CA 2CYAA 2PKEA 1JH9A 1T5SA 2G7ZA 3QUSA 4LJKA 4BQSA 3QA9A 1U7XA 2PUHA 5GZ1A 3IEVA 1JBEA 1SBTA 3I6MA 1TZCA 1P62B 4UTNA 2PD4A 5F9HA 5TF4A 1U7ZA 5TMDA 4ACAA 4KHZA 1Z7EA 1EYZA 3FPGA 1NUTA 1UT6A 3WK9A 1VXOA 3A26A 2GM9A 4YCBA 1YJ5A 3GBVA 3DAPA 1GPBA 3Q72A 4RTSA 2P6NA 1S96A 3TQHA 2ZR0A 1OXKB 3CVJA 3KKQA 1K3UB 1QTIA 2CNWA 3M34A 4TXHA 4DCTA 1JEDA 3RPEA 3MWGA 3WSVA 3QJGA 2HK8A 4OXYA 4GC5A 1THZA 2GBFA 2NAFA 2VG8A 4CKCB 1NYQA 2X9NA 3FPAA 3C39A 3DF7A 3WGQA 3JR3A 4ENRA 1JIUA 3VR3D 3B9QA 3LX8A 1DHRA 1C7JA 1GU1A 1Y5MA 4KN8A 1CW2B 1K92A 2EC5A 1H2EA 3AW9A 3A3PA 3JSXA 4H1WA 2G5GX 1Y1LA 2J45A 3EIOA 2IBMA 1IZ0A 1YU9A 1J5EB 1ISMA 1GR1A 5GJBA 5A02A 3TSAA 4Z54A 1CY0A 3D3EA 5BSVA 1Z13A 3FNGA 4K86A 3FMFA 2H06A 3I2HA 1VE7A 1Z73A 3JQFA 3KYCA 4QULA 4RDHA 5JEDA 1VHWA 2AFRA 2WEKA 2BE7A 4ZVSA 1I24A 4OYRA 1FYVA 4HP8A 1ELOA 5HF5A 2ACWA 2V6FA 4H6VA 1YJCA 3OBIA 5CDFE 2J0SA 3JSAA 4IHJF 3TIFA 2IPNA 3CS3A 1KK2A 3PHCA 2HNBA 4XDYA 4IZ6A 1Q7RA 2B94A 3IMFA 4JKOA 1VHQA 1KZ1A 4NKRA 1U2EA 4HQ6A 3O2QB 3V1MA 2ERXA 4OLJA 4UM7A 1BX3A 3IIKA 3KPVA 3QSGA 4HNQA 1KTIA 2QJRA 2FZKA 2OC4A 1L0BA 3IALA 3BGSA 4NMWA 1M6YA 5EFOA 1K0UA 2WG0A 5HUQA 3PVZA 4HS4A 1TF7A 1HKUA 3GLHB 1QIKA 2C59A 2MSLA 3CWZA 3OQPA 1B2RA 3UK7A 5AW4A 4UJ3A 4WKPA 3VQTA 3K70D 1NVAA 4QYIB 4S1NA 5A05A 2HQRA 5K7SA 4ZOAA 2OESA 3GGJA 1ZONA 3RRNA 4MQFB 3QPWA 4L4YA 1QIMA 2XNCA 2VA9A 1XDBA 3WO1A 3WGVA 3W1EA 2ZLBA 1N0WA 4UMFA 3K8YA 1KNXA 2FPIB 1H93A 1GGMA 2J8ZA 3KR9A 4MQUA 4RHEA 4HD8A 1XPRA 3NWEA 3IHLA 5C5EA 5AVUA 1U0RA 2VXYA 1WXEA 1RYZA 3KU4A 1IM2A 4KIFA 3NV9A 1WWKA 4M0DA 1RSZA 4QFDA 4CMEC 2R97A 4EJMA 2JCVA 5HW0A 1DX9A 3JQ8B 2A35A 1GSOA 2ZRNA 3OCVA 1FY2A 4LJ9A 3M5CA 4KQ1A 4MV4A 3SYNA 4CVNA 1X1AA 1O58A 1BFUA 1DIGA 2OY0A 3VYVA 1G66A 2BHSA 1PWHA 2F9LA 3N86A 4P5EA 5CDTA 4H4CA 4YDQA 3EZXA 3NFRA 3ODGA 3C8ZA 4X1IB 5AR1A 4N47A 4BFTA 1Y6JA 2C2KA 2OXTA 3RRZA 1ZK2A 2CE2X 3NO4A 4YJ2B 1OYVA 2AQHA 1BIFA 3ABOB 2CY0A 2BR5A 4WUVA 4LWQA 5EIOA 1HE2A 1W5TA 2BTEA 1AUOA 4DBVO 4NG4A 5CH3A 5K8IA 2NTJA 5AW8A 1SUAA 3VPCA 3VR4H 3X1ZA 1FDOA 3D5EA 3F96A 2O05A 3WLSA 1WZUA 5EJ8A 1G4HA 4QNRA 5J5VA 4C4OA 2RGRA 2IS4A 2PCLA 2L0XA 3CUTA 1O97D 3NEAA 5HA5A 3TD9A 2EXXA 1DBWA 1CY1A 2C95A 1Q84A 2NTYC 3S40A 4YVFA 4YYEA 1Q1AA 4FKMA 2QN7A 3DZIA 1UWCA 1CVIA 1P1JA 1JU9A 3WZMA 4HDSB 1JT9A 3Q3JB 1E64A 3UYLA 1H22A 4HYTA 1J25A 4DKJA 2P30A 5K0EA 1SN7A 2WWYA 3OESA 3N07A 3IEPA 5ILGA 1JI3A 1Q92A 2RJOA 1YHYA 3CPJB 3E7DA 1QM5A 3ROZA 3SHQA 3ZDAA 1XDUA 1TIPA 4J0IA 1KP3A 2PV7A 4IR7A 4I3HA 3ZHCA 3E3OA 3H16A 3B82A 3NHFA 1JHOA 4YJKA 3DR3A 2H4XA 5AKGA 3EF0A 3RUDA 1IULA 4K40A 2RJNA 1ZIYA 4MRMB 1KY2A 4O8CA 4ETNA 3R9WA 2VK1A 2IYYA 1EDDA 3PHBE 1NC3A 2BVNA 2Y2VA 3A4YA 3OE4A 3I05A 3LC1O 4ZI2A 1SZJG 2FK8A 2Y1EA 4IIDA 3J81k 1QGED 3NS7A 2DHQA 3C3KA 4FONA 3HL4A 1PZHA 5GWXA 3GUUA 3KD2A 2WAXA 1CJMA 1FFAA 2C2YA 4N5DA 4TQ9A 2QYHA 3JAMA 3CRQA 3F8SA 4Z4HA 3Q1LA 4GMFA 1RJEA 5F2KA 4EF5A 3TKYA 2X8BA 4G89A 2PL3A 2BBSA 3ESXA 1LJLA 1LLQA 2Z9CA 5A5DA 3FVRA 5JSHA 4MDFA 3UMCA 1CZNA 2W2XA 1ULSA 3T3DA 4BOYA 5LOVB 1ITZA 2R1VA 1SHTX 3RSZA 4AN0A 3UC5A 3L7AA 1ZH2A 3SX0A 16PKA 5LP6C 2KHZA 1K63A 1XN1A 2ZIUB 3PTLA 2ATXA 5TLSA 6NULA 3RNOA 1II0A 2O06A 4XIJA 4DEYA 1EIWA 3FCYA 3NDBB 4GG1A 1TMYA 3GNQA 3UHJA 3QM1A 1JECA 3IVCA 1T9AA 2ISCA 2IYLD 2XVXA 3A1DA 3C5EA 3HRKA 3ORSA 4DILA 1BMFD 4YPOA 1V5WA 1VJ5A 1MPTA 3FUCA 3R6WA 4TRMA 5KTMA 4KQ2A 2QR2A 2XUGA 3A27A 4L5YA 3N2GA 4GYYA 4RH1A 1SCUB 3V34A 1Y8RB 4I4IA 4GIBA 1Y5RA 1NVKA 4JITA 4EB8A 3Q6MA 3COYA 2XNDD 2NX2A 3O03A 2QMYA 4RZXA 3N3AC 1XJQA 1GUBA 2F3RA 1WVMA 3HABA 1S6YA 4JNKA 4ZAFA 3TRIA 4AJKA 3VJLA 1JFFB 3LMKA 4NJEA 1CQZA 1RYDA 3T0IA 1DJOA 3HBAA 3L1UA 4UE6A 2I8CA 2Z5VA 5EMJA 3B6IA 4PHFA 1NI4A 2Z95A 3VU8A 2HR1A 3NRCA 1UBFA 4GEGA 4INJA 4QPCA 4IIHA 3TZ6A 1JHUA 1W59A 2PS1A 2AEEA 4RM2A 4Z4QA 4GP6A 1MO4A 3W5JA 1OFIA 2XKAA 5EJ5A 1KQFA 2JZNA 1OIXA 5TPZD 3IVAA 3CGWA 3F3YA 3L8DA 4ZZ3A 1RP1A 1BKYA 1CD5A 1E79D 1SD2A 2HM7A 4OGLA 4O3MA 1LI4A 4B3GA 1TAGA 2E85A 2PD6A 3H1TA 2H17A 4POAA 3CZ5A 1CP3A 5BQPA 3U49A 4W5TA 1T9GS 1Z0FA 4R8KA 1QG2A 2KSQA 4PLPA 1AIPA 5ESDA 2VF4X 3UB4A 5HK9A 1SUFA 5IZCA 5CGQB 4BCCA 2PX8A 2XEXA 3PEYA 2VJCA 1L5SA 5BUQA 3FYUB 4B3DA 5H7XA 4DLPA 1DPGA 3U7EB 4O4LB 2CLSA 4MW5A 3ZN2A 5IK2A 2JFVA 4NFLA 3M1IA 1GXSB 2DH5A 1QAQA 1ACMA 3K1YA 4EB6B 3MCZA 1X0VA 1YZYA 4QZVA 1GO2A 1KH1A 1Z88A 1TLFA 5CM9C 1B43A 4KFCA 3PQ3A 2LCFA 3NBKA 3AHGA 4FOTA 2RGCA 1UBUS 2VDPB 3OHPA 3SYLA 4EELA 1R6UA 3GVIA 1IU9A 2ZSAA 3FPSA 3HZRA 1PKEA 1ZNYA 4XJTA 3M6MD 4BGVA 4HB0A 2O1XA 4JEUA 4KO8A 5DM0A 3RU2A 3JWJA 1U8EA 2YWHA 4FI3F 2VDJA 2VT3A 4TWAA 4XAQA 3AFOA 2FGKA 4QU8A 5IT4A 2J32A 4GWGA 2FN9A 3HCFA 1U7DA 4OFWA 5A1JA 4Q15A 5B3JA 3AGPA 2O3RA 1N9GA 3AVWA 3FZQA 3CF4G 3M49A 3V00A 3TWOA 5CH8A 5HF8A 3JTMA 1EG2A 1DCFA 4TTPA 2CLCX 5GOTA 3OU6A 2BI7A 4Z9BA 1XZGA 5AVXA 1AD2A 3PR2B 3QFTA 1CJUC 4IUYA 4WXRA 5I9MA 5LPNA 4QUIA 3WLJA 2QKYA 5DJ5A 1RM3A 5HGXA 1OR8A 3SIXA 2Z6UA 4ALMA 1A95A 3WRVA 4D81A 4U7HA 1NKTA 3AHDA 6GPBA 1DNPA 3D9QX 4Q1VA 2H54A 2WSYB 2Y9MB 3GJ8A 2XYQA 3F67A 3I8SA 3NATA 2VEDA 4P4UA 1RQ7A 2QLNA 1WRBA 1ONOA 2X40A 3K09C 3KDSE 3S70A 4YACA 3WIDA 1ZKMA 3TO5A 1WD5A 4BJ5A 4A0HA 4TL9A 3RVNA 4Q9KA 3UJAA 3EGWA 1F7VA 5EC8A 1XEXA 1ZZGA 2PMBA 4TZTA 2HYDA 3G89A 1Z0AA 3I3OA 1TGVA 5AK0A 1H0KA 5KX5A 5KPJA 2MSKA 3ZK9A 2MJLA 3JASA 2BEUB 1KHHA 1RI2A 3N05A 2PO7A 5A6SB 2BSXA 4K7JA 1P0FA 3LUHA 4L0DA 4N9WA 5KOHB 3G8YA 2XNSA 5EIBC 2PBFA 1JJFA 4BVGA 4BV8A 2LUOA 5B4TA 2FZLA 4LXHA 4F5ZA 3PXUA 2IPAB 3GG2A 4MWSA 4R0NA 5KUTA 3FJOA 4MR8B 3FI0A 3OT4A 2PZKA 3F6PA 4HNHA 2AQIA 5AI5A 3BERA 4CDNA 1GOTA 2PMWB 4QUBA 4XDZA 3S44A 2XR1A 5AJUA 2GKOA 3E53A 5E1DA 2PD3A 2WJHA 2QPOA 1JAXA 1VYVA 1W94A 2Q1XA 3BAFA 5C5CA 2ZBVA 1DEKA 1B0ZA 1YKFA 3I3SR 4QU0A 1GL7A 2G36A 1KAMA 2YQZA 2W98A 5EYPB 2HCTA 3VSBA 1AV7A 4UKDA 3WGMA 1KMCA 4ARIA 2OFPA 1D1QA 1W5SA 1ZEJA 3GEDA 1VIYA 5FBLB 3V5NA 5C7OO 3LOUA 3VUEA 3Q7IA 1JDJA 3RU9A 1ZXBA 3D6FA 4HX2A 1SQ0A 1I3KA 2HFJA 4H4DA 2C04A 2IK8A 3F71A 4WASA 2RH4A 2XLBA 1KC3A 5L3RA 4GPEA 4OQXA 1X77A 3UAXA 4IH9A 2NZ8A 4N7RA 4KRFA 3BGWA 3KFLA 1JG7A 1YBHA 4M21A 1ZM4A 1EK2A 1ST2A 3BMNB 4U2BA 3U7HB 2VRCA 3BMQB 4H1HA 5JH7A 5REQB 5C32A 1EE1A 3L8GA 4DYHA 5J58A 3FAKA 4QDKA 4QOEA 1GM5A 3C15C 2ZDGA 1KEZA 1E3MA 1DAMA 2XZPA 3MELA 1PWYE 3NHUA 2Q49A 5EYPA 1ZD5A 4MVJM 5FLKA 4ZVQA 1EA7A 2XSZA 1DRVA 4G9GA 4IGFA 3BH7A 1B6SA 3E7XA 1JR2A 1V5FA 4NZNA 1U0TA 5AI0A 2XKBA 3TDNA 4E6PA 1AUPA 1TVEA 5T6BA 1WEHA 3FWYA 3OZXA 4HWPA 5FUQA 4DLLA 2GBCA 3K8OE 3N0VA 4BB5A 2GI4A 1MAWA 4LS3A 4RKEA 1SU6A 3MINB 4OU4A 2GGSA 2J41A 1MT0A 2CHQA 3CUEF 1F6DA 3TW6A 1T3ZA 1VIAA 2DC1A 1Y1QA 2AWNA 4V3BA 4B3JA 2CMKA 3OTGA 1JFFA 2B1JA 1Y33E 1QCDA 2W0SA 2PLWA 2W43A 2Z1NA 5D7BA 1JKMA 2Q62A 4DDVA 2GXAA 1F0KA 1ZXLA 4BIIA 1OXTA 1VJRA 3HKCA 2P90A 3KKMA 1RHQA 1LBTA 2ZRHA 3IP8A 4GW3A 3NIWA 4KWIA 1Z08A 4D99A 1B8VA 2D2XA 2REOA 4US2R 5JANA 3EZ6A 1VKOA 5G4KB 5GADl 1O6FA 3OQJA 1RW4A 2IDMA 3PRJA 4KIWA 1CJKC 1R4NB 1RMTA 4W8OA 3HJRA 2P2ZA 1C4XA 2HZ7A 3C3YA 4RF2A 4CL2A 5IDQA 3B36A 2ZI3A 3FZYA 4GI5A 4QARA 3NRJA 3FOFC 2XCUA 1JXMA 2YXDA 3OIUA 1M6NA 4MRPA 4K9NA 2CYCA 2NSLA 4KDRA 2IUFA 3JATB 4EGAA 4HX9A 5HMMA 1JG2A 3IQXA 3RHTA 1L4NA 4L5IA 5H16A 3UKDA 4DV5B 1K27A 1A76A 2OKGA 3MRVA 3GLGA 4WNYA 4JI8B 4XCVA 1KEPA 1Y6QA 2I7TA 4H1VA 4JI3B 2YDYA 3VZPA 1NRXA 3K4PA 2O20A 1UPFA 2P27A 2QUZA 1FSSA 4P7KA 3H0EA 2E0IA 4BLUA 3P19A 4ZOBA 2O0LA 5CURA 3U26A 1KZYC 3F97A 2A94A 2FOLA 1QVVA 4ND2A 4HATA 4NDNE 3HBMA 4EGJA 1D1PA 3E1GA 1V8BA 3BZUA 1M6VA 2G08A 2QR3A 1U9IC 3CH4B 3L7LA 2FDXA 5CB6A 3QU9A 5GONA 3ZXSA 5F78A 5LZ4A 4NARA 1GPNA 4Q9AA 4KIJA 1MRNA 3KAKA 4YRNA 5HIJA 1P19A 1UPAA 2QVXX 1GPJA 2CC2A 3L6RA 4QQ8A 4RF3A 3U37A 5FLXA 1LEHA 1U3WA 1ZIXA 4B4VA 1HUQA 5HVNA 2UVDA 2OHFA 3C6MA 1NN1A 2OV2A 1ZK3A 3ADOA 2IIPA 5E4JA 3OTHA 5I01A 2O3JA 1RI5A 4HR7A 1UKCA 4I8DA 1XVVA 3FTPA 1UEIA 5DNDA 4JROA 4QJIA 3VYUB 3U3DA 5DN6A 3KR0A 3OLCX 3G5UA 3OP4A 2E2WA 3ESQA 4P54A 1PV4A 2WJ4A 3AHCA 2XVZA 3OQNA 1XZJA 3IQFA 1EP2B 2GTIA 1P5JA 3QY9A 4XJSA 4R69A 2K2WA 4XGIA 2R2GA 1KO7A 3FNIA 3I76A 3VJKA 2GKGA 2VTBA 4J1SA 4HQRA 2ACKA 2FW9A 3F5QA 5A62A 4ZVVA 3E84A 4WECA 1EMDA 2B98A 1Z4PX 2L2QA 2YVLA 4EENA 1ZM2A 4OSOA 8ATCA 2FOXA 5F33A 1BCSB 2KYRA 2Z56A 3PFFA 4PPYA 4XTCS 3VISA 3LM8A 4ZAWA 4KR6A 4L95C 3RVDA 2O2YA 1UP7A 1XTUA 3GJXC 3HSKA 4FVTA 4KSBA 4AUNA 2CGEA 2EJBA 4XARA 5FBHA 3AESB 2BZ0A 4RFVA 1FTYA 4HKTA 3X1DA 1NDUA 4TN1A 3CVWA 4IXMA 3MT8A 1C30B 2ZYSA 3T7EA 3BRCA 4H6XA 5A6SA 2EX1A 2BFWA 1HEYA 3L8ZA 2K5UA 4EG7A 5AJVB 2EVWX 3BFKA 2HMUA 2ZUVA 2CUTA 3GFRA 4D41A 4AP9A 1JFRA 2QMOA 1QHFA 3DCYA 4PLWA 5TEWA 1DZ3A 2WJZB 4LPSA 4UNSA 1P1FA 4C30A 4CETA 1KRXA 1NMQA 1RCUA 2CXSA 4M0PA 4NZYA 4UTXA 1RWBA 2WFZA 5HFAA 3TTWA 3WGLA 4CQMA 5CXQA 1GJRA 1QH0A 1OKKD 1KZ4A 2EBUA 4U4AA 3RU3A 3TUJC 3SG0A 4DPMA 5KTOA 2ID9A 3DEYX 5EXTA 2X9GA 4GO1A 4DWVA 1Y1TA 3KCNA 1NSFA 4M36A 1ZUIA 2XQKA 1T6BY 1JLRA 3B3AA 1WB4A 2P1ZA 4YMTA 2OPBA 3MTJA 2ZI6A 2B3DA 4OGFA 3L8HA 1UZAA 1WSBA 4LY3A 4MKFA 4NEQA 4RZ2A 4TL6A 2VHCA 2XMPA 4E3WA 1VLZA 5AESA 3DLBA 3GOHA 2OXCA 3EPJA 2WUVA 3PQ8A 2LBPA 3EZ9A 3IUYA 2G1JA 4KBYA 4MW7A 4TN5A 4BMNA 2XUKA 1XO1A 1JDSA 1M2HA 1FQWA 1OV6A 3DTVB 4CU5A 3N8KA 4L9WA 4DABA 3K9LA 3TR6A 3GIDA 2Y0EA 3L1VA 3R7SA 4QGHA 1RQXA 4R5MA 1V6SA 1IZ7A 5IT9A 4WY8A 2H59A 3OF3A 4HLCA 4LXYA 1OH8A 1ZY2A 1O4VA 3RV3A 3O4RA 1J8QA 1H9AA 3E4DA 3OECA 2D1YA 2VSOA 5LVAA 1JYSA 1EE9A 3GUVA 5E9JA 1HX7A 3AEXA 3EJWA 3MFQA 3HI4A 4TV9F 4S1TA 1EP9A 3LV8A 1C2TA 2ORIA 4DQKA 1SUEA 2ZZKA 3OFJA 5JDCA 2D5AA 2PMFA 5A4JA 5JV5A 2ECOA 1DRKA 3USES 5CFQA 2IELA 5KBYA 4JUIA 4Y2JA 5FA5A 4BE9A 1NDHA 2H0QA 4G1MB 4RVCA 3R7DA 1ONPA 1G38A 4MJXA 2WINI 2R48A 1V45E 1YRLA 1QZZA 4ER5A 2IS6A 1V41E 2W6ZA 1P1KA 3WC4A 4Y6RA 3SYTA 3OEYA 3REOA 3RGWS 1YVUA 4KVAA 4AYTA 4MRSA 3PRKE 1U1CA 5TJHA 3TXYA 3TLGA 3LRPA 1WZCA 4TYQA 4GECA 5IUKC 4E2WA 2CJWB 2E5LB 2E55A 3NW9A 4OPMA 5AOBA 3PJFA 1QQTA 3IBTA 5DU2A 2AV6A 2VLIA 4LJ4A 2EP8A 2CL6X 1U1EA 4B32A 1J0CA 4MUNA 4HVLA 3O8NA 1AF4A 2CB9A 3RT7A 2JGAA 2RGNA 4M4SA 3IESA 1HFJA 2EZUA 2VNSA 1NE2A 2CBGA 3OCYA 2OXRA 2V98A 3SLKA 3HCDA 2C0QA 5DEIA 2OQVA 5FIUA 2NTVA 1BW9B 5CGZA 2CXOA 1KJZA 4MHTA 2FQWA 4P86A 3ZGLA 1RYBA 4DJJA 4LGVA 2FRXA 1DI0A 3WIUA 1O94A 1XPJA 4RHFA 1C1XB 1NR1A 3KLBA 4DW8A 5L51A 1QU2A 3L1HA 2ZIGA 5EZQA 1XU7A 2DECA 2NAPA 2VATA 3DCNA 3QWIA 4BATA 3ZY3A 4EW6A 3NKFA 2ZYUX 1J49A 3KYBA 2GUWA 1MGPA 4IXWA 2DFKB 4Q01A 4RZSA 4TLDA 2EBWA 3PJGA 1E6KA 2MT9A 1ULAA 4G8JA 4D92A 1DGQA 1FSGA 1D7OA 4PZPA 3VV2A 1GQSA 5JCZA 3F49S 3AW8A 2XGSA 4QHSA 4B3CA 1PL7A 4XYGA 5JQGF 5AOCA 4W1QA 5D5HA 4EATA 1V7CA 2CT8A 4I46A 1L7DA 4X3OA 2W8ZA 5TPZA 4OJMX 4RMNA 4F1KA 5DNYB 4H7PA 2XOKD 1IN7A 2HKIA 3ED1A 4DDKA 1UM8A 4GXNA 1XK6A 2R6HA 3E9RA 3E3LA 3PKZA 2IY7A 1Y4DE 4G2NA 1XELA 2PG3A 3ZGYA 4YRGA 4FMCB 5CFZA 1J8FA 1PG0A 4QPNA 2HMWA 2VWPA 2P69A 1N5DA 4Q9LA 5JIBA 5BXYA 4LMBA 4OLBA 4IGAA 2V65A 4QKQA 5IT0A 3QW4B 4EAAA 1RYFA 4RO0A 2DJIA 1KDRA 2X8JB 3BH0A 1TZJA 4U2GA 4YMVA 1L4EA 2RH5A 3NOOA 4CG0A 1N2EA 1T43A 2QTBA 1EFKA 2XB9A 1FDUA 4ZVTA 4FHGA 4Q24A 1EX1A 4BHTA 1UBCA 4F56A 2BKUA 4MPJA 2CUZA 2Z30A 5HHTA 5BYBA 1NW6A 3O95A 3GHYA 4IHJA 4INZA 2IV2X 3E8SA 1OH5A 1XDWA 4XOIA 2P7HA 3OZBA 3GIWA 4DDMA 1Z0KA 1Y5LA 5GM1A 4D9BA 5I9BA 3DMTA 3Q9UA 4Q1DA 1PJZA 2C99A 1G6OA 2HHJA 5JQGA 2P75A 1CZUA 4FB5A 1T4GA 3JRXA 3B2QA 3BIXA 3DDHA 1MRSA 4L8YA 1B7GO 5IC6A 4D97A 2UZ4A 5E2BA 3H5AA 2IUUA 5BR1A 4E2XA 5EMLA 3ROKA 1SHKA 1Z8NA 1E3LA 3C5VA 3W9YA 4WRRA 3AFHA 1QFXA 2IZ7A 2QW1A 4FNOA 4OF4A 2FF5A 3L1IA 5G41A 1V8DA 2ETXA 5LR6A 4AX8A 2VJMB 4B4OA 2PKCA 3IAS6 4L8LA 5DTMA 2PPLA 1YJQA 2OCPA 1N6NA 1UC8A 1Z39A 2FFHA 2GNOA 3NBAA 5COAA 3MWJA 4DC9A 2WMYA 1IOVA 1Z6QA 2OCAA 2CCKA 2F4NA 1SBHA 1MNAA 2E4AA 2NWQA 2QZJA 3ADKA 3ADCA 5IHPA 3O74A 3DE6X 1YJBA 3JD0A 3CVYA 3E3AA 2AX4A 3GPIA 4BJHB 1EZ4A 3HN7A 2EGGA 1RWNA 2Q9UA 2ZKLA 4PFQA 5KYVA 3D4PA 4JI6B 1PJTA 2C5GA 1SHZA 3ELDA 3HJGA 4HDRA 4TUYF 5EFZA 4B31A 2H52A 4QIHA 4DR4B 3BHIA 4M0EA 1U4SA 2C82A 3P2JA 5C8YF 2HA5A 5IEJA 2Q28A 2X5NA 3IEXA 3ACCA 4MI1A 3WLMA 4EMUA 5J4HA 2K2QB 5DX8A 3WFZA 3C7TA 3OEEA 3SVZA 4TLBA 2C00A 1JW9B 4ZHQB 2J07A 3DPIA 1WKBA 3L4JA 1CU1A 1OY1A 1OQAA 5IAEA 4C76A 3MB8A 4PAMA 3UN1A 5A0TA 2HHHB 5CFPA 2PUEA 1XALA 4RVGA 1NQWA 3HDVA 1QJ4A 2BGWA 4UZSA 3GU3A 1J0BA 1P7WA 2NUBA 2C3UA 4BLSA 1KARA 4HDNA 3VDQA 4RPIA 3GRVA 3R4CA 1GL3A 2HO4A 3I6BA 5AM2A 3H97A 3K15A 3PHLA 2J3DA 2VHZA 3HKBB 1Z4OA 5TX7A 3NXSA 2AUTA 4RIHA 1SCJA 1IZYA 4TZ6A 1AKUA 1C4OA 2DFPA 4JB8A 4Q3CA 3RVJA 1QDLB 2W2LD 2KQUA 2D8MA 3EUAA 4JKIA 4MW0A 3I6ZA 2JL1A 4KXWA 1KP2A 5FBKA 3BXHA 4PYMA 4RM3A 2BGTA 1Q77A 5G40A 3VKFA 3R9KA 4EYKA 3EY9A 5CXUA 3GHHA 4CM9D 2I6UA 5KDDA 3GX1A 3K8QA 2MSWA 3DE7X 3E5HA 4LHZA 4YJFB 3WNVA 1TIKA 1W1UA 3IDQA 1U1FA 3O1IC 4N82A 3DHNA 1ZJ5A 1U99A 4MWZA 5DW3A 2JIPA 4P82A 1GU0A 2B3TA 3M33A 3T7AA 5EUMA 3B48A 2H2AA 2Q8PA 5BN4B 4EKGA 4M22A 4BO9A 2X9VA 4G1CA 5DBGA 3UENA 2OKCA 3UJCA 5C7IO 2M32A 1ENYA 2NUAA 4E2ZA 1Z47A 1C8KA 1HBJA 2QLLA 2X0NA 4UHBA 2XRZA 2WWIA 4HHEA 2XA2A 3UAGA 2CLHB 1XUOA 2VDQB 4JASB 3ANYB 1KU6A 3T9AA 4M9XA 1ANKA 1C14A 2MIIA 2QIPA 4CKBB 3ANNA 2W90A 4FTWA 3UFBA 2O8CB 5JJLA 3E70C 2QM7A 4BP9A 4EO4A 3CRRA 3KPYA 3F4KA 4G24A 4OJYA 4QYTA 3SEZA 3SQMA 5BV8A 1HLGA 4FQ5A 2FUG1 3DYVA 3PUVA 4NP6A 3TRKA 3KWFA 2DQSA 3IBCA 3KKLA 5JI2E 1E96A 1FJGB 2A2ZA 1OGJA 2BEVA 1Z07A 2C9CA 2Q3LA 3AU8A 3E6AA 2MYTA 3EVNA 1EHIA 4NFHA 1GGNA 2FG7C 1F8YA 1Y1PA 5CLLA 4MCHA 1PZMA 4K2AA 121PA 1SO8A 3LKBA 4UUOA 3TH5A 4MHSA 1Z5UA 1R5NA 2OBNA 5JZSA 4BLOA 5FNVA 4WBNF 2PGOA 1XN4A 1E1NA 2G06A 3JWHA 5CW1A 3UJ3X 1JA9A 2BFDA 3KPUA 1D8AA 3ZNNA 2WG1A 2F1IA 4CMBA 2FWBA 1FRQA 5ITVA 4OJKA 5HUHA 3C45A 4LOLA 3RVRA 1KI4A 1U02A 2VNIA 3EGDB 4C4TA 4EW2A 4C0QC 1B42A 3CKLA 4AFNA 4BVLA 2VXOA 3U7FB 2OWEA 5KYWB 3R41A 2R62A 3PC6A 3RTEA 3SF0A 4WFIA 4G5OA 3OFKA 2JLBA 1FFWA 4PAWA 4WSOA 1MR3F 4GNRA 1BG6A 3DW1X 1O6BA 5ED0A 3SSMA 5JCXA 1MW8X 1QLJA 2C7PA 2WC1A 5KINB 2DB3A 3WGYA 4PAOA 1Z28A 4I8XA 2OHVA 4I3GA 3LQFA 4YRRA 4B75A 2C4TA 4G3XA 3RSQA 5JBIA 2Q27A 4A8JB 3UK2A 3KJIA 4KXMA 4N7JA 2IP1A 4YMHA 5H1YA 4D3ZA 1G8SA 3SJCA 3O1JC 1M8FA 9ABPA 4JYZA 4OK6A 2I80A 3KTOA 3RRFA 4PZUA 5BQXA 1C3OB 1N9GB 4HZIA 5F2EA 4TTVA 4AS3A 1FS6A 2I99A 3OHSX 3PR1A 4M37A 1JVSA 1GZ3A 4X6YA 1Y6FA 4EPVA 4E4RA 1EDBA 3PHIA 4FKBA 1CUWA 4AJ4A 4MB0A 1BXRB 5DYNA 2XXAB 2JH8A 4EY8A 1QPZA 1LWNA 2WJ3A 2XGOA 3ZEAA 4UTVA 1EUDA 4BRZA 5P8WA 5J4VA 5T8KC 2HPAA 4KXVA 1DUSA 1XBTA 4PANA 4G01B 4WX2B 4HT3B 4WZAB 2GARA 2PK3A 2G76A 3SXUB 3DWIA 4Q1AA 3TQQA 4X64B 5BV7A 4RULA 4NX2A 3UHOA 3RAFC 2R44A 3KZVA 4FKZA 4PHHA 4E5VA 3ADBA 3RLFA 4BCDA 5IUJC 3AM5A 4KN6A 1EX9A 2G83A 2XMRA 5I7FA 3GLGE 4FBLA 5IKEA 1NHWA 2FPPB 4YCCA 4IZIA 4P22A 2E5WA 3IRUA 1ESMA 3K1AB 3PVCA 1KH2A 3EZGA 1X2EA 3QZUA 4HFJA 4AX4A 4ZIRB 3AL0C 4K0KB 4FYYA 1SM4A 3KZMA 3OPQA 4H2DA 1M7GA 1N0UA 1QBKC 5LFAA 4F4FA 3T9CA 4U63A 1QWSA 2GPNA 1A5TA 1FP2A 2EYQA 2BP7B 3WMRA 4EEZA 2ZYTX 3KPJA 3OQBA 1N25A 1V6AA 1Z0DA 2EGHA 2OCXA 1JWBB 1VG8A 2QP9X 1O9HA 1YDFA 3EWIA 3IP3A 4FHEA 4RWZA 1ZD1A 4LJ6A 4MGEA 4IWXA 3KVRA 3P20A 5JR3A 4HUJA 2XTMA 2WM8A 3N3BC 4HPJB 2WTMA 1FSZA 1PJ2A 2Q45A 2JCBA 4FYJA 1F8GA 1YQUA 2DWPA 3C87A 4JB0A 4ZALA 2HBYA 3ZHTA 3LK6A 4F6CA 4ZPXA 1NW8A 2RHTA 4WESA 2J48A 1IJFA 3H8JA 1S4QA 4MJ7A 1KAHA 2HDWA 3WYNA 1JVNA 5HNKA 4AULA 4EHHA 5FTMA 2VPPA 3KEMA 4R9RA 2Q2QA 1XJ0A 3I9NA 4EY5A 5IWCA 3TNYA 1S2DA 1DTWA 5HS6A 1T6NA 1YMUA 5AJWA 2NVWA 1PV1A 5DBEX 5C4IA 5JCJD 4EUSA 1YL7A 4D9HA 1ZN7A 2A1IA 1KEEB 1MABA 3JARB 4WGFA 5ESXA 1MJGM 4WCFB 4J1TC 2YZGA 4QOFA 1CEYA 1XD9A 2PWAA 5AMXA 4L2IB 3U17A 2I66A 1SUCA 3VV3A 2EYUA 2F59A 4OHZA 3OCJA 3RREA 3R0IA 4BNDA 2C84A 4NAHA 3U4GA 2A0FA 3UHAA 1Z7YA 2GDZA 4KQ6A 4AZ0A 1BD4A 4JJFA 4B8YA 1G8KA 5JAHA 4XR9A 3LRXA 4FM9A 1XNGA 4UM8B 2Q4TA 3E61A 2RB4A 3A2KA 3WBJA 1YE8A 3GB9A 2JZOA 3FR7A 3QX9A 4DUGD 1HMPA 2GJSA 1RM5A 2C3OA 2IXTA 2ZJAA 3AUYA 2AFHE 5T4BA 2VH1A 4MI3A 3SM9A 3BSSA 3VR5H 1YRBA 3WKAA 4K3UA 2HWWA 4B5KA 2QG6A 4RSRA 4F4HA 4D98A 4A16A 5FI3A 4IFBA 4Q47A 4ZGGA 1K98A 2P62A 2FPRA 1KI3A 2OZPA 3BYZA 1OC2A 1RCFA 1JDBB 2G28A 2NM0A 2P9CA 4IXNA 5ITZA 4KPYA 4WCFA 2CLFB 2QRMA 5GOZA 4OM8A 3ZE2B 3ZV6A 3ANSA 4ZV7A 2QNRA 3MT0A 2PXAA 4JLPA 4DANA 5ILOA 4OUDB 1OXSC 4KNWA 3SQLA 1Z5VA 2Q5HA 4PRZA 1IJBA 2H48A 4YT4A 4ZYVA 2IOQA 3GLFA 1OIVA 3DKRA 2JJMA 4W5WA 1EK0A 4EFDA 4NBWA 1EDOA 1RCTE 3OLVA 5DM60 4F7DA 3UVEA 5I4IA 4CF6A 4JDPA 2Z08A 1TPZA 3S99A 3TJMA 4L8VA 1GILA 1UT8A 4OFXA 3V8NA 1M2VB 3TOVA 3WLEA 5K0JA 4ENVA 1BTOA 1YUBA 5K1ZA 4A0QA 1N1DA 1ZSVA 3R40A 4YMSA 1OIWA 1WKVA 1KHTA 4MWBA 4IDPA 1MB3A 1BKSB 4PX3A 1T3LA 4TXJA 4AZ3A 4OCZA 1QO0A 2LE0A 3MCTA 3IEMA 2JCGA 4YLEA 1P6XA 4J0KA 5KOJB 4X00A 5FPYA 1B0PA 4CM3A 5LIRA 3U1VA 3L40A 1AC5A 2NXCA 3O7WA 4MW9A 1OXMA 1HURA 4QWWA 2G72A 4EPRA 3D0KA 1T6YA 2N1MA 3WNZA 4A26A 1VHTA 2CLEB 2GXQA 4MV8A 4G41A 4OD0A 5LB2A 1QB7A 4LDAA 2XX3A 2M98A 2J33A 1NJ6A 2O7VA 1LTHR 3TTYA 3WWCA 3ROPA 5HMLA 4EUFA 2BELA 3MQFA 5K4AA 2HLDA 3FGPA 3TW8B 4YV1A 3EVFA 1Q20A 3NRBA 4JUBA 3LY9A 3R3YA 2J9GA 4RANA 5KVCA 4G5QA 1C5KA 2GN8A 3RFVA 2DYKA 4HUQA 1U3FA 2CZGA 1Y7TA 4J4HA 4Q12A 4GE3A 1SRQA 5G02A 3ZZNA 1L7XA 2V45A 1O1YA 4C7XA 2BDEA 3VR5D 3RHZA 2ZUDA 3I04A 3INGA 3O73A 1MQAA 3O4HA 3QX7A 5KYUB 2W7TA 2WICA 3OY7A 5DYWA 1I7PA 3VR6H 1C7FA 1VB3A 2B4TO 3PUZA 5JC1A 5SYAA 2G71A 4F1JA 3DAHA 3EGVA 3MHTA 4NYIQ 4LXUA 2J3KA 2F8MA 3EBPA 4FBMA 4PZLA 4BTLA 3QPUA 4NQZA 4EG0A 2WJWA 3BT7A 1EXNA 3QMPA 3SBXA 2JLUA 1E3JA 2QF7A 2JBAB 4M1KA 4TS4A 2IYSA 1JLLB 2W6JD 2YH2A 3IELA 4KE7A 1IHPA 1TKRA 5BRAA 3JYOA 2Y27A 3EY4A 1UM9A 3DW3X 2CMFA 4Y1EA 1P2TA 4FWIB 1ZD4A 3BD8A 1DZIA 3I9MA 1G55A 3X0DA 4ZCTA 3A31A 1A7JA 4NG5A 4KPFC 1QHXA 4DLTA 4RTNA 4O4JB 1QGUA 3UHPA 3KDAA 4MMXB 1Z5NA 1I1HA 2QTMA 1PG5A 4NATA 4ONEA 2I87A 5DXJA 3VHQA 2A4KA 3SJZA 4BYMA 1RVV1 5LYYA 2GCIA 1WCV1 2IC5A 3OZGA 4MWGA 1HZZA 3RVPA 4C2UA 3BILA 3TQSA 1GDDA 5JECA 1SXHA 3LPDA 2XCRB 4C7MA 5J3JA 3BTUA 4EA7A 3T9BA 1G21E 3M6FA 2YV3A 4OQ4A 2GDJA 3D81A 3GT0A 4EX6A 4N5MA 5B7GA 1CQWA 2GAIA 2VHVA 2YC2C 3BKWA 3HA5A 4WFJA 4GXTA 2QZZA 2XJ4A 3U4AA 4P38A 3VC2A 4ZFNA 4UUBA 5AUOB 4OFBA 1DL5A 4QHTA 1GSHA 2W4IA 2O8DA 3L7DA 1JTVA 1MVNA 3AI3A 1GN9A 2H57A 3D3QA 3LXXA 3RYFA 1T6XA 1ZCJA 1ZOSA 5DYIA 2QRVB 2P2CA 4E12A 2KB0A 1OYYA 4EJSC 2C2GA 3UJ9A 3MA0A 3CJTA 3QI7A 2CLLB 1J9EA 2CZCA 3HKDB 4G0OA 4JEHA 2CSUA 1M2GA 1FYFA 1JG1A 4CLRB 1DKRA 1I6WA 3CVUA 1UKVY 2EDAA 2YTZA 4MOWA 1VI5A 2ADFA 1VHJA 2I33A 1GGEA 1ZP6A 2VUSA 1BDMA 2C29D 3OI7A 3P0HA 3KXPA 3H4VA 4HGOA 3IXQA 2YW2A 3ENVA 5GV7A 1N2ZA 1I6MA 5DTEA 3L8MA 3DMHA 4LY6A 2WY2D 2GVZC 5BYJA 2XEDA 4EQZA 1LK0A 1MG5A 1Z56C 2NU7B 1P1HA 2ZUCA 3LT1A 3DBHA 2JLYA 2NU9B 4N7MA 3OSUA 4QUHA 3M1LA 3QWBA 4GDMA 4PSVA 3LTEA 1WPRA 1ZVQA 3T6KA 3RYFB 3QJYA 2XGGA 4EABA 1X7XA 3A32A 5HIAA 2JI8A 2OL4A 4BC0A 1R5OA 1EGQA 2H2IA 1YZNA 2NSJA 5BN4A 5BSGA 3OBBA 4QA9A 1Z12A 2VRBA 3TOCA 3WB0A 1NP3A 3ILXA 3ZHZA 1GZ5A 2ALJA 2XA1A 4QUDA 2JF0A 3B3JA 2HRBA 3FNEA 2LR0A 5CBPB 4R71A 4M46A 1UF9A 2PJZA 4RW0A 3K92A 5BVHB 4BMCA 3L0IB 4H31A 3FPFA 1EVQA 5JXHA 3CC8A 4TLMB 4KGZA 5DGHA 3ANXA 4ZANA 1M7BA 3DBIA 3WQBA 3KSUA 1E8NA 2X86A 1GGFA 5JRZA 5J47A 3HNOA 2ZJBA 1P4AA 3N87A 3ST7A 4COOA 4ZTUB 1A2KC 3QFSA 4GSYA 3AOEA 3GCDA 2EZ4A 2PLNA 4IDEA 1U2GC 4YO8A 5DN6D 2DWCA 4FEYA 2RHGB 2JGMA 4IV0A 1UXJA 1T1RA 2P9GA 2J7PA 4BECA 1D2NA 3MMSA 5C81A 3KDPA 3VNUA 1H94A 3VO2A 1J5XA 1IHOA 1K2VN 2P2SA 3H83A 4OGWA 3VPHA 4CNBA 1RJ9B 1RI1A 1E32A 1SXJE 3KT6A 1OI3A 2G0TA 1VLHA 1AKMA 1G16A 2JLAA 2W58A 3F4LA 3FH0A 4JY7A 4ME6A 2IZ6A 4O1IA 4IIXA 4X6LA 1D6JA 1EK6A 3HR7A 1E58A 2W2LA 4GZ6A 4J91A 4XASA 2VVTA 2E18A 5CIYA 2FNAA 4KXFB 4RZUA 1T2AA 4DDUA 4IF4A 4OJTA 1LQUA 1SU8A 5L4NA 1SZDA 3M70A 2Q6IA 4DWWA 4PSUA 2BSQA 2BUAA 1SY7A 3EVGA 2PNFA 3E9DA 3Q2KA 4JVOA 2JFQA 3RD5A 3RK1A 3TMAA 3MGBA 2JDID 3U19A 1Q0ZA 2BCJQ 4PG5A 4UDYX 2WP0A 2UZAA 2GCNA 4LVOA 1U9YA 2IYOA 4DAEA 3AKYA 3S8EA 2Y67A 5B64A 1R5BA 3H2YA 1SOUA 4EG8A 4C0WA 4Z1MD 2PUGA 1YZVA 3GD5A 1MC1A 3COVA 4FFDA 3MS2A 4BMDA 5KNDH 4Q7MB 2WJYA 2IHTA 2QRLA 3WLIA 2B5VA 4B7XA 2P8SA 3JQCA 3EBOA 2FV8A 1VPEA 3VZRA 4IMIB 3UV7A 5C8ZA 1H2RS 5KTSA 4B7CA 1U3TA 5IF3A 1PJ8A 2IHZA 1AN0A 3LZDA 5G0SA 3LUDA 2AHOA 3DP7A 1C9YA 4RTQA 1K7FB 3QU2A 4CLOA 2Z2KA 4XPZA 1XVIA 4BVHA 2PRYA 3EE6A 3RBAA 4AJOA 3ZDDA 1RWPA 4B9AA 3TL3A 2H92A 3THSA 5DNAA 2C07A 3BRWD 5HQTA 5JD5A 1GKIA 2JAWA 4IQ0A 1G7SA 5LWHA 2VQSA 3AY0A 1CERA 3IE0A 3HRIA 3QWAA 3EGOA 4TMXA 3GZJA 4KAFA 3TDMA 5AUNB 3Q3EA 1WUKS 3N53A 4ECEA 1ECCA 1K97A 4JR1A 5JADA 5KKCA 2UKDA 4I1PA 3RS0A 1JQDA 4EVRA 1ORVA 4F93B 2X8LA 4A36A 5JJIA 2JFFA 3RIXA 3SY8A 3RSGA 3QG5A 4HLDA 4DPLA 2UZIR 2GEVA 4HMOA 2QQEA 4GKVA 1G21A 1RJFA 1KAGA 3CEMA 2B30A 4RHYA 2FXVA 3PXEA 4PQYA 4W99A 1YB4A 1Z2AA 5EMHA 4W1RA 3JQEA 4BMSA 3PJRA 3CSUA 1UWKA 2AB0A 5CT5A 3B8HA 1MLDA 2YIJA 3QWFA 2CCJA 5B57C 4AWBA 3BRWA 4PIPA 1Y7PA 3A6HA 2LRHA 1ZD3A 3AZQA 1UDCA 3WMEA 2A4MA 2X0FA 3DDUA 2Q3EA 2HDNB 4HNGA 1VPWA 2FWIA 4FCTA 1BGVA 2Q5OA 1Y3BE 1WA5A 3OLWA 1OBFO 2PSDA 1L5RA 3QKIA 5AH0A 5CB4B 1YTUA 2V4UA 2WWWA 2AOUB 2XQJA 1Z8DA 1USIA 5LQNA 1KR5A 5H4GA 1Y9ZA 1LRJA 2G67A 4DV3B 4X8MA 1TYCA 4C20A 4V1CB 4C7OB 2O8EA 3UAYA 1H8HD 2P5SA 4TVBA 3TZHA 1GRNA 5CLFA 3Q7QA 5LWQA 4G0UA 3V4SA 3LYHA 1B73A 1KDOA 2VDWB 5AJYA 3V8BA 3VVLA 2OAQ1 1HE8B 3W5DA 3QFRA 7REQA 2QTLA 3E7WA 1B93A 3FDXA 3BORA 1YVPA 2DP4E 2WUDA 3P2YA 4KO2S 2O0HA 1NOJA 2C9DA 5B4VA 1Z0IA 1NBMA 3JZFA 4JGIA 1E1MA 3G2IA 4E07A 3NAGA 1KY4A 4E3ZA 5KSWB 5I8WA 1IQRA 3DOUA 1A72A 4MGKR 4U8HA 5ISMA 1UPBA 1W8IA 3DDCA 3OF2A 2DBRA 3MJ4A 3MTQA 3U39A 4YCLA 3IPXA 2PU7A 3CF0A 4IHQA 3MGAA 1OBCA 1UPCA 1E5XA 4K9PA 2VTEA 4Q1EA 2P0EA 3H2JA 3R6LA 3T5CA 3VPBA 5J2UA 1PAUA 1E2HA 1ZNZA 2Q5JA 4FGJA 4ZQFA 4BO6A 4C7KA 1K6IA 3VYWA 5HZKA 1IOLA 4Y2GA 2EIHA 4V0RA 3PEVA 5FP0A 5IW8A 3RJ5A 5EE1A 1GLVA 1ADJA 2GBIA 5B58C 5JZBA 3X43A 3MCVA 4C43A 1G8GA 3NHYA 3C8MA 3JYNA 1QG0A 2IPLA 2NU9A 4FD2A 5ALIA 1J23A 2Z58A 3AR8A 4KKXB 3VJMA 4CT0A 4NL4H 2VWQA 2HV9A 1JHZA 1A04A 3AKCA 3JWEA 3TZEA 5ITZB 2JGDA 5DSXA 1KDYA 4RQAA 2I4IA 4JL8A 1GR0A 3AIOA 1C3OA 3ER6A 3PQ2A 4OGKA 4IJWA 5GP1A 4QXRA 2ZUUA 1V7ZA 2DQYA 3RAPR 1UH5A 1N6PA 2O7NA 2WIDA 3EZ2A 1JX6A 2ZI4A 3AUTA 2QUBA 2I2XB 4MV6A 2O3SA 1E2JA 3KQSA 4IUDS 4CKYA 1YBAA 4LX0A 2ZBQA 5ARCA 5CB4A 3N2NA 4X85A 4QPDA 1HTTA 2EFJA 2Q3CA 4ND4A 1OF1A 5IDXA 3PDHA 5SZJA 1ZRHA 1QRSA 2C2OA 4B6GA 1RWQA 4JJEA 1SXPA 1FP6A 3BXGA 3W5AA 1ISRA 3T61A 1GA1A 1E2LA 1SOMA 1Z0UA 4B4KA 3AJ8A 1JS1X 1LQ2A 4C0HA 1P60A 4CMJA 2LGJA 3IUQA 3PE4A 5CEFA 1G20E 5C8YB 5D3KA 4YA6A 5H9VA 1MEJA 3HU1A 2QTCA 1TO2E 4B6RA 2CJFA 3F7TA 4EW3A 1YAHA 1JAYA 2QMZA 2ZIFA 1OAOC 2ID4A 4GF5A 4KFRA 3O3NB 1KGDA 3GAAA 4JH0A 2ZS7A 1QHYA 2XVAA 4KMMA 3TIGA 2RGXA 1G8AA 3EEBA 3QVWA 3GVPA 1OE0A 4OHPA 4QATA 2A9JA 3AERB 3HVJA 1PFQA 5GINE 1C8VB 2G9NA 4LCEA 3RS7A 1NP7A 1JP7A 5BRJA 3FPCA 4WOKA 4L8GA 3VDXA 3P26A 3RAEC 1Y9AA 5JAOA 5FUWA 1U0OC 4KMRA 3NJRA 4L72A 3N8DA 1Z45A 2Y1CA 2VH5R 2EQBA 4FC7A 5CNKA 3PFNA 3OE5A 4ZDJA 4RTOA 1ZLYA 1Y34E 3ET4A 3IBYA 2IEIA 1JHRA 1H66A 2DFTA 4P4NA 4B7AA 2QG4A 4OHRA 5B5SA 5E9WA 4QWMA 2Z43A 3PYXA 3FNBA 3KUCA 1SC3A 1C7EA 4MW1A 5CJ2A 1ZNWA 3WNCA 4XGQA 3TI7A 4KDFA 2YJGA 2D0OB 2WJGA 3CVXA 1U8ZA 2NYRA 1A7UA 5DCYA 1J42A 1N75A 1GYPA 3AUFA 4QUEA 1DTEA 3SVTA 4UCFA 2J5KA 4C4RA 3RIMA 4UXIA 4J49A 2P4UA 3QKRB 2DQ4A 2WWGA 5IVDA 2J6CA 3LP8A 1J2YA 1UKZA 3GDGA 2GX6A 4FSDA 4LDJA 2PRSA 1K3FA 3B89A 3RFCA 4D9KA 3CLVA 2CNOA 1FDTA 1KPIA 2PAAA 2Z8XA 1ZGJA 4OM7A 2BW0A 3E9QA 2CDAA 4I6GA 3CZCA 1E8MA 1QGUB 1N3BA 3ZWQA 1GKLA 4DXAA 5DYTA 1ONSA 4JLUA 3RT1A 1GAQA 1XF1A 2IU6A 3VPDA 2OOKA 4DL9A 5JASA 4R1MA 1XMSA 1PO7A 4YBRA 2H2WA 5K3CA 1YU6A 4HI0E 5TS2A 3SBOA 1COWD 2JLVA 3G0HA 2CEKA 3J7AC 1KZGB 1OZHA 1NN5A 4C08A 2X42A 4FMCF 1A3CA 4LWZA 2IPMA 2IYQA 5ALNA 3DXFA 1NNLA 2NMVA 5FAKA 3VR2D 1Q7GA 2E3JA 3PPYA 4JYCA 4Q19A 4ZA2A 4YRFA 2GTHA 2KS6A 3NDRA 2QN3A 4TV8B 1C9MA 5E6SB 1YOBA 1PDVA 4KWHA 4RJKA 5BN3A 3HCPA 4C7BA 2V6JA 1EB8A 4BLRA 2GF2A 1WF6A 5LMNB 2WJVA 4FFLA 3SN6A 4ESVA 3KE9A 3FDZB 4CKXA 5HKBA 4JLAA 2Y9PB 5FOWA 3W9BA 1TVKB 2AS0A 3FPHA 1NURA 2W6OA 3V8MA 4QJ4A 4A03A 2APJA 3BWBA 5ALTA 1PYOA 1M34B 3LF2A 1IOWA 4KSYA 3OSZA 4F8EA 4FR5A 1W88B 4P81A 1OA1A 2HT1A 1TUBA 3IHKA 4C1NA 1RZRA 1AS3A 3GJ6A 5LQJA 3NALA 3OOHA 2LCQA 3LVQE 1DO8A 3PEFA 4Y98A 2C3MA 4AKHA 1PVOA 3T4UA 3FJ1A 1G2IA 1QG4A 4GDFA 4PHGA 4TYWA 2EP7A 4A91A 4MR9B 1Z5OA 2H6EA 5EIBD 3SPXA 1DQZA 1QMPA 5EL0A 2JIZA 2X3UA 4LSMA 4BLVA 4BRSA 3G9TA 4Y2XA 2REBA 3OX2A 5AWFC 4C87A 2BP7A 3DE0X 1UR5A 3B78A 4INAA 2OA0A 1UL1X 1K86A 2F90A 1V6CA 5H68A 4BAGA 3N2KA 2JATA 3OZIA 1U2GA 5DKFA 5BPHA 1NA5A 2J3IA 4EGCB 5DN9A 2VBIA 3QEMB 1P4SA 4MO9A 1ZUNA 4G86A 4GQIA 5KNCA 2ZB2A 1FTWA 3LLSA 3RJTA 2EEPA 5FWXA 3SZRA 2JBWA 3VGJA 1P9WA 2IOYA 4EL5A 4C3ZA 4DBLE 1EKXA 1NUHA 3JQ7A 2CNBA 3QLVA 1F48A 4PE5B 1CB7A 2ZIAA 5AK3A 1TJ5A 2ZE7A 1E92A 2MR5A 3DOCA 1RLJA 1ES9A 1G9TA 4YFVA 3ZI4A 4LE0A 3VNQA 4YRPA 2R8RA 4UQPA 3SDSA 3CGGA 3CLRC 4N49A 2B1QA 2YRWA 2NN3C 4DPKA 4RK6A 3BB1A 4S0XA 2VQ3A 3QEKA 2QLTA 1F2DA 2X3YA 3QELA 3SKYA 2WUEA 1GG5A 1H3EA 4I1VA 4TWRA 8MHTA 1VMKA 3WKBA 2XSZD 4YAIA 5JNVA 1U8YA 3AIKA 1ARZA 3VNSA 5FBZA 5DTIA 1N6IA 3FBGA 2RK6A 1PS0A 3WLPA 7ABPA 3I5XA 1BQ3A 2D1SA 2A9QA 3FOAA 3ND9A 5JW6A 1Z6ZA 3OQVA 3U7IA 3TPFA 4C0AC 4YY3B 2IEDA 3GLIB 1GKUB 1X0XA 1A9OA 3D1JA 4DIKA 1G9XA 1FU7A 4QQKA 4LSGA 3LAWA 5DOVA 3T5PA 2B99A 1T1SA 2RGYA 4HDSA 5L7TA 4EJSA 1XMXA 1EWTA 4X44A 4DXHA 1EXWA 2ZBPA 2ZAIA 3R0VA 2VT6A 3N8NA 1J56A 3D64A 3DJFA 5F3DA 5AW7A 1TEXA 3O94A 4FGKA 1Z82A 1TXGA 4NCHA 4Z1OA 1VLVA 2Q1YA 3AUKA 3DHVA 3K1ZA 3AH8A 2YCBA 2XD9A 4X7RA 2QGNA 3DVRX 2YHIA 2YZNA 1N2OA 5F7ZA 1DO0A 4JCOA 3TS1A 4DCGA 3CX4A 4JFAA 3WDMA 4DNFA 5LDGA 1AF7A 3M6LA 3H13A 3PEUA 2XRYA 1G5FA 3NKVA 3R0ZA 4YJGB 1DIAA 5IULC 2AYXA 1RHJA 5JD4A 3RBXA 2ZSHA 1Y82A 3NPMA 1XRMA 4QTUB 2DLNA 4RK4A 9LDBA 1RPNA 3E0XA 3GVCA 4JIGA 3EEQA 1N5LA 2VCEA 3C24A 1UAGA 4GSKA 5NLLA 3OU2A 4X7PA 3T3EA 3OFND 1BDHA 3W5BA 2QTAA 2GT1A 3WWDA 1K0FA 2QX8A 5CYPA 5WRFA 3KWJA 3U9LA 2QE7A 4C88A 1FXWF 1MEEA 1NJ1A 4FEGA 1W36B 4LHYA 2FUNB 4V2IA 3SOZA 1JPJA 3F6BX 3GAZA 4O3FA 1JH8A 1CUDA 1YVDA 4BNVA 2YWRA 1LPBB 1A2BA 3AXTA 3NTOA 2HXSA 5H83A 4XKJA 2WIBA 1AHHA 2Y93A 4FIDA 3H17A 4P08A 3LDHA 3R3JA 4RS4A 4Q93A 3DQPA 2Z2JA 3DOOA 3DTTA 4DC0A 1ISSA 3VX3A 2WVJA 1U9JA 1R12A 1I2BA 3E7FA 3M9XA 2X1MA 3CBGA 3DEZA 3KPWA 1XRPA 4RQBA 1Z0ZA 2HU8A 2WSSA 4RE5A 5E2AA 3VKUA 5KNDA 1TQ4A 1Q6ZA 3ZQ4A 4J16C 4OHWA 2PRKA 1U0SY 2NU8B 4BKOA 1S2LA 3WBKA 2NYAA 2QMQA 2IH4A 4WK4B 1CF4A 3NQ41 2OYCA 1U2PA 1YMVA 3OICA 3PIDA 4J3JA 4WI1A 5C3UA 3TW8A 5J23A 2WB2A 4X45A 1G5IA 2QM3A 2FWNA 1U0LA 4K8OA 4BO4A 1AUVA 4DSUA 2W2PA 3STYA 5KSZA 2Y71A 2VP5A 1QSGA 2CXQA 3F5FA 3QEOA 1CZRA 2BAGA 4LWPA 2QL6A 3RSHA 4YQEA 2MTBA 2ZWIA 3FPEA 2ZBRA 5K0NA 4UARA 5CX4A 4HZUB 3UPDA 1GZ7A 3V7YA 1SUPA 2NGRA 3OX3A 2BFMA 1OROA 1QC5B 4B82A 1U98A 4QAQA 3TB6A 2W9XA 1WCXA 5F9MA 5THQA 1VCOA 2VDWA 3HADA 1IXKA 1JR3E 5JPCA 5D3ZA 1P4HA 4HB2A 3GLIE 3MRSA 2W83A 3INNA 4KMSA 5SY6A 4G5XA 3SHWA 3UB3A 3UJ6A 1TDJA 2XTJA 4EZIA 4LSWA 3EFHA 1IWOA 4TLEA 1F5NA 3JQ8A 2OC9A 2YJ5A 2IYTA 1T3SA 1PWZA 1UP6A 2HX1A 4LXTA 3MLAA 4BEWA 3ACBA 2ORYA 5I3ZA 1V48A 5BW5A 2XWPA 1DCKA 1HDEA 2ROQA 5IPFA 3WQRA 1G19A 2FH5B