3WJ1A

Crystal structure of sshesti
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
PLDPRIKKLLESGFVVPIGKASVDEVRKIFRQLASAAPKAEVRKVEDIKIPGSETSINARVYFPKAKGPYGVLVYLHGGGFVIGDVESYDPLCRAITNACNCVVVSVDYRLAPEYKFPSAVIDSFDATNWIYNNLDKFDGEMGIAIAGDSAGGNLAAVVALLSKGKLDLKYQILIYPAVGFDSVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRFSPIIAQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIDQGKDAIGLIGSVLRRTFYDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxylesterase
publication title Structural Insights into the Low-pH Adaptation of a Unique Carboxylesterase from Ferroplasma: Altering the pH Optima of Two Carboxylesterases
doi rcsb
source organism Sulfolobus shibatae
total genus 104
structure length 304
sequence length 304
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wj1A00
1DQZA 3GZJA 4PF1A 3FYUA 1H23A 4J0IA 3R3UA 1UK6A 1BEZA 5AO9A 2D0DA 3STXA 3NUZA 4DMKA 4X7BA 4X94A 1XZHA 4BATA 5A62A 2W22A 1NU8A 3O4JA 4W1RA 4FOLA 4BCCA 4LXIA 3C70A 1XRLA 4KAJA 4KE8A 4G4JA 3GA7A 3O9MA 1A7UA 2J3DA 5DYYA 5K3AA 5C81A 2GYVA 3F96A 4B9AA 4DLNA 3A2LA 1H22A 4CG2A 3R3VA 3MUOA 3ESBA 5CTAA 5I7UA 4BC1A 4UBMA 4GEGA 1Z68A 4UHEA 3I6MA 1VE6A 3RARA 2C58A 4HS9A 1ETHA 2CEKA 1XRPA 2HA6A 3G0IA 1FFBA 5BWBA 1DX4A 1CUWA 1QTRA 3C6ZA 3VISA 3DOIA 4AQDA 2JEYA 3G0GA 3VVLA 5BOVA 5DYTA 2CMFA 1ACJA 5FPPA 3ZV7A 1U8EA 1GPLA 5DNVA 5AKXA 3KXPA 3ANTA 1PFQA 4B6GA 5K5EA 2Q0XA 1ISPA 5SYNA 2CB9A 5CMLA 2XUGA 2WJ6A 1RP1A 3IUMA 4B0PA 2UZ0A 4F21A 1XZEA 2WUFA 5CH8A 5AK3A 5LIPA 1AX9A 1XZBA 4RPCA 2VF2A 1QOZA 4G9EA 1UT6A 3I6ZA 4NVRA 4OYLA 1BN7A 2B20A 1QJ4A 1ZI6A 3S2ZA 3R3ZA 2XMQA 2XUJA 1Y7HA 3FLBA 3WK5A 1SOMA 4BDSA 3KD2A 3E4DA 2HA5A 5KWJA 4M0MA 3C6XA 4AMZA 2VJDA 2HU5A 1JFRA 2IX9A 2RAUA 2VTVA 1ZICA 2OXEA 2HRQA 3PE6A 5FDFA 3HABA 5LZ2A 3OPMA 1XZMA 4Q3LA 2VJCA 4X95A 1J06A 3ANSA 1XKTA 5JAUA 2OGSA 2HA4A 1MNAA 2H7YA 3L1IA 2HA3A 1MN6A 4DYHA 4K6KA 1YS2X 5LZ8A 3I2IA 4J0JA 4HXEB 4H7IA 3H04A 3ESDA 5ALEA 3DLTA 1R4ZA 3H2IA 3WWDA 4CCYA 3I6YA 3GELA 1VXOA 1CPYA 3C87A 4BCBA 5AIBA 5JAOA 2HA0A 1VJ5A 2RHWA 3C5VA 4ARAA 4N8DA 4Y9SA 4G1FA 4XIIA 3BE8A 2BCEA 5ALJA 4C6HA 1CUXA 2WFLA 3RK4A 4GECA 4DMHA 4EZIA 2VT7A 1K6EA 3G0CA 1ORVA 2QOEA 4G5XA 1R88A 3K2IA 4K5QA 3YASA 2WHPA 1HL7A 1SCIA 3I2GA 5CT8A 4QEKA 2GYWA 2HL6A 3FLEA 2PPLA 5EIHA 1Q83A 3R40A 4UBKA 1WM1A 5LZ5A 3DEAA 4BC0A 2AJ8A 4U2BA 2VJAA 3WWCA 1XQVA 4Q3KA 5ALHA 4JEIA 2Z8ZA 5ALFA 3NOXA 4BRSA 3QMMA 1P0MA 5J3JA 4KACA 2O2HA 5FRDA 4N5IX 5ALLA 2DQZA 4OUKX 5AKLA 4KRYA 1SCQA 4K6HA 1DWOA 2Z3WA 3DYIA 4BCDA 4A23A 5EIEA 4QDTA 3FCXA 4FBLA 4Q82A 3GFFA 1LNSA 5JATA 1CVLA 4BAGA 4KYVA 2OGZA 2PL5A 4U2EA 4EY4A 4X90A 2G63A 4GI1A 2OGTA 3PUIA 2JGMA 2WFMA 5E4JA 1UKCA 2XLBA 4WDQA 1IZ8A 1LBTA 4E46A 4QWMA 1H2YA 1P0PA 3HYSA 1N1MA 1W4LA 1WB5A 6YASA 2VAVA 3GROA 5DNWA 4LIPD 3QITA 3HRHA 4I3FA 2XUFA 3KOOA 5AM5A 4DNPA 3FBWA 4H7EA 1E89A 1EK1A 3TRDA 3ICVA 4B84A 5AKIA 1QZ3A 1KU6A 4QDUA 3STVA 5ALXA 1G5FA 2BGNA 3WKDA 5FP0A 1K63A 3I2KA 5A7HA 2VT6A 2RHTA 2Y2UA 3IBTA 1R9NA 1ODTC 4LHEA 3QMWA 2WJ3A 3STYA 1CUIA 4LXHA 4AX4A 4G8BA 4PQEA 2ZYHA 5A6VA 3VXKA 1ZD2P 1FFDA 3WYNA 5IVKA 4PV7A 3JW8A 2RONA 2C5FA 1LPMA 4J7AA 4B85A 3DNMA 3NWOA 2XQFA 2ONCA 4DNQA 3FSGA 1W75A 1XRMA 5JYCA 2Z3ZA 1TRHA 1G4HA 4UBIA 1LZKA 2W6CX 3WKBA 2DFPA 3MUNA 4H7JA 3H2JA 5EIAA 2QUBA 4FDMA 3WJ2A 1BROA 4QDOA 4Y2PA 2JF0A 1CUHA 3A2MA 5EHNA 2H7XA 1F0NA 4KAFA 1AQLA 3AZOA 3I2FA 5H3HA 3QMVA 3WI7A 2YH2A 1BN6A 2EDCA 4FFVA 3C8HA 1QIFA 2GBFA 4H35A 3D3NA 3SK0A 5HF6A 4W1PA 4QZVA 1KEZA 1EDEA 4G8CA 3QBJA 1QONA 3H2HA 4B0OA 2G4LA 3K9BA 3DDUA 1X70A 2PSHA 3DKRA 2AJLI 4M0EA 1ZGCA 4DGQA 4U2FA 2XUHA 5D3KA 5ALSA 5A71A 2XUDA 3KWFA 3FYTA 4FKBA 3GUUA 2PX6A 1NU6A 2V96A 3R41A 3TEJA 2XMGA 4JUIA 4W1QA 1N5MA 1SCKA 3ILSA 5HQ3B 4Y2XA 1SFRA 3FVTA 1XQWA 1FFCA 1ZD5A 4KJXA 4MWSA 2PSDA 4HRXA 2C0PA 4U2CA 3SX4A 1CQWA 3WK9A 3WKCA 5ALPA 4ZREA 1M33A 3MGAA 3C5WP 3QZUA 4DNOA 4PO3X 4FWBA 5HF5A 1XRQA 3WKAA 3W9UA 3RM3A 4G8DA 2CUTA 1MX1A 1A88A 4IHAA 1QO7A 4M0FA 1QGED 1HDEA 5AM1A 4BDTA 2R8BA 1XQXA 4LYDA 1EB9A 2FUKA 5CT9A 1CUVA 5AI4A 2PU5A 5HF9A 5D7BA 2GZSA 1CUAA 2XI4A 1DU4A 3ZI7A 3LIPA 4MWTA 2ZJ7A 5K3FA 2ES4A 4F0JA 2HDWA 3FYUB 2NW6A 1CQZA 1UOOA 3WL5A 3WK4A 3BL8A 4Y2SA 2CBGA 1QLWA 4UHDA 5ALKA 1QTIA 4YK7A 3FSGD 5KWIA 1EXWA 3BDIA 4H7KA 1JJIA 4JYMA 1TCCA 2ZVDA 3FCYA 1QFMA 3IUJA 1R50A 4Y2TA 4BAZA 4MEBA 5JALA 4GLBA 2JGKA 2PU7A 2HFKA 2XMZA 1FJ2A 4Q1VA 4CFSA 2IITA 5FV4A 4INZA 5AOBA 1Q0ZA 3IUQA 1ZIYA 1TQHA 4EY8A 1VZ2A 2JGIA 4D9JA 1E8MA 3AINA 2JGFA 5K3DA 5HFAA 3E3AA 3D59A 3BWXA 1T4MA 1ZJ4A 1YSCA 2XUAA 4X97A 3LCRA 3SWWA 1THTA 1JU4A 4HRYA 1IVYA 1A8UA 2ZJ6A 4C4YA 3WWPA 4H0CA 2DQYA 4EY6A 4KAAA 3HI4A 4X91A 1XLWA 4UBLA 2EDAA 4DSZA 4RE6A 1JJFA 4EY7A 2V98A 4FLEA 4UUQA 5AJHA 4B9EA 2BJHA 2BGRA 4QE3A 4AMYA 4AZ3A 5LZ4A 1QIGA 4OCZA 5AKGA 2RIPA 1QIKA 4Q3OA 3U0VA 1ORWA 4GBGA 3RKSA 4TVKA 1ZGBA 5AKZA 2HRRA 1TCAA 5HF8A 3Q0TA 1GXSA 5LZ9A 3RLIA 5JZSA 1G66A 4J0GA 3WKEA 1LPPA 2AXEA 4A5SA 2ZYIA 5CXUA 3B3QA 3QPDA 2ACKA 4X85A 5LP1A 4H18A 1GKLA 3VJLA 3G9TA 3WWEA 1YAJA 2HU8A 4ROTA 5D6OA 5E2IA 5EI5A 5ALIA 3AFIA 4AN1A 3AILA 1ZI8A 2VEOA 3IUNA 4CI9A 4DTCA 3KWJA 2PSEA 2XUPA 2JBWA 4PW0A 5YASA 4I4CA 2OG1A 2WG2A 5FLKA 2Y2VA 1IMJA 3CCCA 1QIJA 2O7VA 2DR0A 1GKKA 4UBJA 1AUOA 2WHRA 1EINA 5HK8A 4K6GA 1K4YA 5K3CA 3BDVA 3WA6A 1XZIA 2FJPA 1G42A 4FNMA 4TGLA 1FSSA 3W2TA 3WLAA 2XQIA 4GDMA 2BKLA 3W04A 3A6ZA 3DOHA 5ALUA 4FNGA 5EHZA 5CT4A 4X92A 5AP9A 1TCBA 3R0VA 5CURA 1W76A 3G02A 3K6KA 4BAUA 3FLAA 3WL8A 3DS8A 2WHPB 3PFCA 3WQHA 1UK7A 4AN0A 5DYWA 1TKRA 3WIBA 3QPAA 1UOQA 1BU8A 1EHYA 3FWHA 5CBKA 5EHQA 1HQDA 3IULA 4QDXA 4OB7A 1IUNA 2QTBA 1IUPA 5HKAA 1Q0RA 1W1IA 2XDWA 3UMJA 3LIIA 4UHHA 1CIJA 4X71A 2XMBA 2HA7A 2H7CA 4GHWA 3N0TA 3H1BA 2V9ZA 5ALDA 1C7JA 3OM8A 1XROA 2XLCA 2XMSA 4BZZA 2WU3A 2OCIA 1DT5A 2ZJFA 4A16A 2DHEA 5HFNA 5JD6A 1GPKA 1JMYA 1QIIA 4NZZA 4OB8A 4YASA 3WK6A 2QXUA 2J4CA 1XZAA 5C8ZA 3W05A 2CKMA 3PUHA 5KREA 4OSEA 3EQ9A 4WFKA 4F5ZA 2VQ6A 1X2EA 3LP5A 2P8SA 1WHTA 4FLFA 4GXNA 2XQKA 2YYSA 3V9AA 3C6BA 2WU4A 5D3ZA 3CN7A 2VATA 3NGMA 2WSLA 4H7HA 5ALRA 5HK9A 4HAIA 1K8QA 4CG1A 1ODCA 3IDAA 4C89A 1DT3A 2H1IA 1K5PA 1QO9A 2PSFA 3BF7A 4GW3A 4Z49A 4W1SA 4QDZA 1WOMA 1B41A 3OG9A 5C8XA 4NMWA 3W06A 4C4XA 1UKAA 1XRRA 4AO6A 5HKBA 4IH4A 1EK2A 4V2IA 4CG3A 1YR2A 1XZLA 3G0BA 4U2GA 1HKHA 4W9RA 2O2GA 4P9NA 2VJBA 3V1KA 5EGNA 2WKWA 3V48A 3B5EA 2WTNA 3G7NA 3PF8A 2QR5A 2WUEA 3DL4A 1MT3A 1LGYA 2YXPX 2XUQA 3HZOA 2WIKA 1CFJA 1LPNA 2PUJA 1ZOIA 2G5PA 3DQZA 4B83A 5AKKA 4HTAA 4MQLA 2PUHA 4OU5A 5AOCA 1THGA 1JI3A 3F9CA 3G8YA 3FVRA 1CUBA 1VZ3A 3BXPA 3H19A 4P93A 4MEAA 3UUFA 4MJ3A 5A7GA 1XZCA 4LYEA 7YASA 4ZRDA 4J03A 4X6YA 1AMNA 1VXRA 1R9MA 5IVIA 4H7FA 2XQGA 3O9VA 1GPNA 5KBYA 3P2MA 4HXGA 1CUGA 3AIMA 4B82A 3F98A 3DKKA 1CR6A 5T4EA 4L9AA 2QZPA 1L7RA 1XZJA 4Y2QA 1MAAA 1C4XA 1CUCA 5ALTA 5CT6A 5T4HA 5ALMA 4X93A 4C88A 3WK8A 1BEEA 5FOQA 2Y1KA 3AZQA 3JWEA 4KE6A 3QM1A 4Y2RA 3C45A 3FNBA 3VKFA 3WL6A 4I19A 4O08A 3FOBA 3C43A 4EY5A 2XUIA 2DHDA 4AB1A 3BIWA 4LKOA 1XZFA 1AGYA 5AI8A 2PBLA 1QE3A 2JIDA 1XZGA 3H18A 5E4TA 5AI9A 1CV2A 2GYUA 5AM0A 1UXOA 1XLVA 4X6XA 2PM8A 3BJRA 5DWDA 2G5TA 4E11A 3G9UA 1EH5A 1XFDA 2JGLA 1MX9A 4WY5A 5JANA 3AUKA 1EA5A 3CCBA 5DTIA 3KSRA 5JADA 3I2JA 4AO7A 4KE7A 4DSAA 4BE9A 2QM0A 1AKNA 1XQYA 3D4LA 4EB0A 1OCEA 4E15A 3O0DA 1ZJ5A 3HACA 4G4GA 1VE7A 1R1DA 3AIKA 3WK7A 1HBJA 1R3DA 1DX6A 3IURA 3IVMA 4MQMA 2WIFA 5JIBA 1EDDA 4CIBA 1JKMA 5I8PA 4ZXFA 4WJLA 4KEAA 2GBCA 2OCKA 3STTA 1QIMA 3O4IA 5JZ9A 2BUAA 1F0PA 3SC2A 5A2GA 1LPOA 1WB4A 4BRZA 4ITVA 3WYDA 2AJDA 4YX9A 3F67A 4BYMA 1LPBB 4DM7A 5JD4A 5K3FB 1KU0A 4KE9A 4X00A 2ZSIA 3STWA 1LBSA 4X6UA 5LKAA 5IVHA 2J3QA 2X5XA 1MAHA 5AI0A 2C5GA 5K3EA 2JGJA 3IIIA 4FBMA 5ESRA 4PSDA 1CUJA 1U65A 3WZMA 2X8BA 5AKEA 3G9XA 2WG0A 3D2CA 4HZGA 3OC0A 2PKYX 1MJ5A 4L72A 5AICA 1L7AA 1OILA 4B80A 2PSJA 1RWQA 3F8SA 5EHXA 1XZKA 5AK4A 1GGVA 3WA7A 4P92A 4QWWA 4QNNA 2QVBA 1E8DA 4AXBA 5T4BA 5AK5A 1JMKC 3DCNA 4J3JA 1H2XA 1P0QA 4BBZA 1VOTA 4HVTA 3D0KA 2WIJA 4J0HA 2PVSA 4E14A 1ODSA 4J0CA 4OPMA 4OD0A 3EQ7A 2BAGA 4X3CA 1O6FA 3D2BA 4L3WA 4P08A 3EBLA 1B6GA 1GZ7A 1AURA 5EFZA 5C8VA 4PSCA 4L0CA 2Y6UA 1S8OA 2Z8XA 4C87A 3R3WA 2DCMA 5AM2A 5CT5A 1WHSA 1MNQA 1JJBA 1IUOA 5LYYA 2OAEA 5HCUA 4WDRA 1X2BA 5ALYA 1BS9A 1WPXA 2RI6A 3FYUC 3L1JA 4Y2JA 2XMCA 4QLAA 3U1TA 4N5HX 5SYMA 4ZV9A 2IIVA 3PI6A 3R3XA 5I9IA 1UOPA 1LLFA 4YPVA 3GBSA 3OTQA 5AM4A 4C01A 1E3QA 1H2ZA 4K2AA 4FHZA 1A8SA 4WY8A 5LZ7A 3VVMA 2C7BA 3PDCA 2XMDA 2VAXA 3BJMA 1CLEA 2WIGA 3VJMA 1N8SA 2O2IA 4IH9A 2JEZA 1MX5A 1E66A 2XE4A 3S8YA 1J1IA 4BTVA 4AZ0A 3H2KA 4XWGA 5IVDA 1PV1A 3L1HA 4ZWNA 2QT9A 2OLEA 4WCVA 4CIAA 2Z5GA 2CZQA 5AOAA 1E8NA 2K2QB 2QJWA 2ZYRA 3WIOA 1ZI9A 4OB6A 1JU3A 5DTJA 3HEAA 1EX9A 5CH5A 1TAHA 1CRLA 2ORYA 2J4FA 2HFJA 3W9BA 5K3BA 2XMRA 4BVJA 1W6RA 1GQSA 1UK9A 1RYYA 4ZV7A 3TGLA 2XT0A 3M83A 4ZI5A 2WM2A 3EQ8A 3X3HA 3G9ZA 4UPDA 4Y2VA 3HLKA 1EDBA 1WPRA 4CCYB 1MO2A 3QYJA 1YB6A 2HM7A 3HC7A 5C7YA 3QH4A 4BP8A 4AO8A 4S0XA 1ZD3A 2WFLB 5DLPA 1GT6A 4B81A 2OAGA 1LZLA 2ECFA 5FXMA 3WMRA 2OQIA 5ALWA 2ACEA 5DJ5A 1UK8A 2GBIA 2QMQA 1OXMA 4BZWA 5BWCA 4IO0A 4EA6A 5BV7A 2C0QA 1E5TA 1U2EA 3ZPXA 2B61A 3ESCA 4FTWA 1Q84A 3PFBA 3A2NA 2QRUA 3TJMA 5T4FA 5CW2A 4JNCA 3MVEA 3AZPA 1VA5A 3KDAA 2E3JA 2DSNA 5AH0A 1FFEA 4BE4A 1C7IA 1CUZA 2V97A 4PSUA 1EVQA 2HHAA 3DJYA 4ZGBA 5JASA 2QJRA 5JD5A 1DWPA 1BRTA 3ICWA 2VSQA 1VKHA 5CXXA 5AKYA 2X76A 2BFNA 4C4ZA 5AKHA 2Y6VA 4ARBA 3QVMA 1T2NA 2I03A 4Y7DA 4XJVA 4UHFA 2R11A 1Y7IA 3FAKA 2C4HA 5E4YA 3N2ZB 2ZSHA 5F4ZA 1YA8A 1UKBA 1QIEA 4H77A 1U4NA 1YASA 3OOSA 4UFPA 4B7ZA 3CN9A 1CUSA 3WL7A 3OURA 4BVKA 4XX1A 3ZLTA 2QKYA 3I28A 3O95A 3B12A 4N8SA 2OPHA 1SC9A 1CUFA 3I1YA 1QIHA 2WLSA 4N8EA 1CUYA 3ZLVA 1LPAB 1XKLA 1AC5A 1I6WA 4JYPA 1LPSA 4RE5A 2ROQA 4MYDA 1UWCA 2OQVA 3T4UA 4DMFA 2WFZA 3O4HA 5A7FA 1CEXA 3AIOA 1EB8A 2QS9A 1ZD4A 3JYHA 3H17A 4J0DA 3V1MA 2XQJA 4LXGA 5CRIA 2OCGA 3DL7A 5AI5A 4UFOA 3ED1A 2GBGA 4EHBA 4JH0A 4WFJA 1USWA 1VA4A 5JAHA 5DNUA 4XVCA 4MXDA 4EUSA 1P0IA 1F8UA 1EVEA 1XLUA 1DINA 3UUEA 1A8QA 2O7RA 1MPXA 4HXFB 4U2DA 2AJBA 5IH7A 3HXKA 2I3DA 1AZWA 2WJ4A 3H2GA 3VDXA 2FJ0A 4KR0A 5ALOA 1UFOA 1O6GA 4PNZA 3ZLUA 2I78A 4IH1A 1TK3A 4QA9A 1PJAA 2H9YA 4Q05A 5FKJA 1XZDA 4DIUA 5ALVA 5ALZA 4BVLA 1L7QA 4QLOA 4GWLA 5AK6A 1WCYA 1D07A 5JARA 3V1LA 3E0XA 2XUKA 5IKXA 3C8DA 1Y37A 1J07A 1YS1X 1JT2A 4UBNA 1EI9A 5ALNA 3HSSA 3WWOA 2WQZA 3EF3A 2WTMA 5FUMA 4FFWA 5AM3A 3G0DA 5JZBA 3Q8WA 4W63A 5AIAA 1IZ7A 1ACLA 3D2AA 3CXUA 2CJPA 4Y2YA 4CCWA 3M3DA 1DQYA 4RNCA 4MYSA 3ZWQA 1YB7A 5ALGA 4OU4A 2XUOA 2WILA 3D5EA 1GQRA 2YASA 4G4IA 2AJCA 4DNFA 4ETWA 3WJ1A 1BE0A 1HPLA 1QFSA 3LS2A 2LIPA 2HA2A 3H0CA 4UHCA 1MU0A 1WB6A 2BUCA 1XRNA 2HADA 3STUA 4G9GA 3I1IA 2WG1A 4IQ4A 2D5LA 1QIDA 4F60A 4FLMA 4J0KA 1BCRA 3PF9A 1UZAA 1FFAA 4Y2UA 4BB0A 1DWQA 5FPQA 1CUDA 3H1AA 5AKJA 2DHCA 3R3YA 3IB3A 3A70A 2VA9A 1HLGA 1NX9A 1YA4A 2QUAA 1ZIXA 4BTLA 2HU7A 1DTEA 3AJAA 2I3ZA 1H2WA 3M81A 3DYVA 2WUDA 4TPKA 3HJUA 2FX5A 3DD5A 3C6YA 3O4GA 5ISMA 1TIBA 3LLCA 4KRXA 4OYYA 5HQ3A 2GZRA 4Q34A 1F6WA 4UFNA 2OCLA 3IA2A 3BF8A 4BP9A 4WFIA 2WHQA 2JGEA 5LLSA 5JAPA 2XB6A 2B4KA 1VLQA 4UHBA 3V1NA 1BCSA 4UBOA 5AHXA 1YAHA 3EIOA 4FMPA 5CH3A 3ESAA 3E1GA 1N5RA 5HZGA 1CUUA 3D7RA 3QPCA 1MTZA 2QXTA 5AI6A 4EBBA 3I2HA 3T52A 2ZYSA 1CUEA 2RGUA 2WUGA 2HIHA 1W52X 3F97A 3M82A 5ALQA 2BUBA 3WZLA 5LKRA 4NS4A 3BIXA 2EEPA 2WIDA 1YCDA 4DMCA 4H7DA 1J2EA 3VJKA 2B9VA 3PICA 4RGYA
chains in the Genus database with same CATH superfamily
4L22A 2PL3A 4EJSC 3F47A 3O93A 3SYLA 7MDHA 2CT8A 4DR7B 2R0QC 2YDYA 5DM60 1KJNA 3KV1A 4WKPA 3FYUA 1ENPA 1VSTA 5LMCA 1RJ9B 3KQYA 2ZLBA 4J0IA 3A4YA 1KQGA 3TTWA 4O2RA 4KUEA 4IP0A 4NX2A 3ROEA 1R6VA 4X61A 3ZWAA 5AO9A 1FXUA 1NUPA 1Z45A 1ESZA 1TLTA 3QOFA 4CKWA 5T7BA 3DDHA 1XZHA 5M3BA 3AEKB 4WY2A 3GPBA 1CG6A 3RVKA 3L4JA 1X80A 4RK4A 3QPVA 1MIOB 4OLFA 3RB8A 3JQAA 3SXJA 2GS9A 4MGEA 2PZLA 1MV5A 3O4JA 4LJRA 1JYEA 1WW3A 2HSGA 4R8RA 1AK2A 1X8JA 2B6HA 3HN7A 3SZ3A 2HV9A 3HP4A 5BN3B 1SVIA 1O9HA 3ASYA 1L5GB 5F12A 2D1FA 3C70A 2JC3A 5CFRA 1XMJA 3E7DA 1Q11A 3IUEA 4WA7A 4KE8A 3W8DA 4F5YA 4YRNA 2M98A 5GP1A 1NFRA 1XTUA 1CDOA 1T9GS 2AZ4A 1RLIA 2CLDX 2IY7A 2MSCB 3O9MA 3SFZA 4EEXA 4EG7A 5I47A 2J3DA 3FD8A 4B3GA 1IXRC 4RJKA 5DYYA 1VL0A 3LVBA 5C81A 3F96A 3NEYA 4QU9A 1VLVA 5IANA 3FMVA 3SZGA 4B9AA 4MRMB 2AEMA 2GI4A 2REQA 2WA2A 3QKWA 3RUHA 4F3KA 1K9SA 1A9XA 3GPIA 5GONF 3R3VA 4QG3A 1PV4A 5IJAA 5LLTA 4RV4A 1B16A 2DX7A 3DUFA 5CDTA 2E4YA 1CJUC 3N2KB 4YCDA 2Q9AA 1IHXA 3DE2X 5JSYA 5H3LA 5D5PA 3KHSA 3D8UA 1JQBA 1KSFX 3IMGA 4B34A 3FYSA 3IE1A 3ICEA 1RABA 4ZOAA 3SC6A 1NAIA 5HWSA 4K3UA 1GG2A 5KNCH 1S8AA 4Y1RA 5A4DA 1GWNA 1Z68A 5FWYA 2QBYB 4HGZA 2RARA 3ZJ4A 4NJOA 3K16A 3KTAA 5A03A 5CK5A 2CSUA 1GAQA 1X3LA 2H4WA 3A1CA 3E05A 3HDGA 3PNVA 3O5AA 2GN4A 3ZHXA 1VKOA 1ZUNB 3ZYCA 5HIKA 2JIOA 2C58A 4LI0A 1GCUA 1RLOA 2VO1A 1E4OA 2JHFA 3R3JA 4MGYR 1AN0A 1NXQA 5BWBA 2SCUB 4HH0A 1YZTA 3MSXA 4WX2B 5DRYA 4JIGA 3PUVA 3UGJA 3TI7A 3TSOA 3BILA 4AZ3B 2AQKA 4P4TA 3H5OA 4QM7A 4EGSA 1EJ2A 4UUBA 4JD5A 5CYFA 2QT0A 4OQFA 3V9PA 2CDBA 1VBMA 3N0RA 4R1OA 2X58A 2PLWA 3RT1A 1TA4A 2P9EA 4PLWA 4FHEA 4OSOA 1WABA 1K5GA 5FPSA 3ZV7A 1NQAO 4YMIA 2R62A 2YXEA 4EKGA 1XNRB 4PZ9A 3QRWA 3WYAA 1HK7A 4HN2A 2J9FB 3LT2A 2UZ1A 3QVJA 3TQIA 3L8FA 4AZ0B 3ANTA 3NGLA 1OC4A 3WLKX 4AIIA 5K5EA 5LMUB 5I6DA 3HO8A 1LDGA 2QTGA 4P35A 4URWR 2Y1GA 4A8PA 3TECE 4P38A 1XU9A 1FP6A 3EA5A 1LDMA 3F78A 1IZ9A 4L51A 2YHIA 3THRA 2BT4A 4BJHB 2EG5A 5TT1A 2AN3A 4P8RA 4PSVA 1RP1A 2H1HA 1HFWA 1RC0A 2B8TA 2IHYA 2PN1A 1J0XO 1HYHA 4B0PA 3TG2A 1F38A 2P68A 4AM8A 1QNLA 1Y8QB 3GVHA 3JQDA 5CU7A 4DLRA 4EG4A 3QHQA 4EI8A 2WUFA 3KS9A 5EE1A 4F91B 1NBIA 1XZBA 3PGKA 2H31A 1XPRA 1UBHS 3EXHC 1CJCA 4IL5A 3T9BA 4ENRA 5EKSA 3I6ZA 1PQUA 1VHDA 2QE7A 1B7GO 2DTDA 2WP0A 2ZRKA 4NVRA 1Y9DA 3SS8A 4BGEA 4DA8A 5JY1A 1RMQA 5H82A 1SA0B 1QR2A 2L42A 4ND6A 1EFDN 2DTXA 1ONOA 2XUJA 1Y7HA 2OLKA 4LDNA 2PUEA 1CKEA 1EWQA 1TM1E 2AZMA 3FLBA 3WK5A 3BCHA 1AB6A 3KK0A 4IHJF 1SOMA 1U0OC 2VAWA 5KMGA 2FN4A 4LS3A 1ZWKA 4BNLA 1Y1QA 5AVOA 2PT7A 5GONB 3RR2A 2HW8A 4P0PB 3EULA 3WLFA 3G79A 2F9LA 4KOAA 2HA5A 4DDTA 3IPRA 3TOVA 3BDAA 3BCSA 4KXWA 4AMZA 4BYGA 5CDFE 1ZICA 1Q7GA 3MPUA 4JP8A 2OXEA 2WMNB 2OFFA 3FROA 2ARKA 3T5TA 4GWGA 3V4OA 2V7TA 3PXCX 4E3WA 3NAZA 3RNLA 3TDMA 5HKKD 3UFXA 5DGTA 1T36A 3SHOA 3UMGA 5LWQA 4QUDA 5LXTA 2RB5A 3I39X 3I73A 4PYNA 5E9WA 3BICA 5L7YA 2VKTA 1XZMA 5JNLA 1L7OA 4RWEA 2QQEA 4X95A 4M1QA 2IYOA 5EXDA 2Y0CA 3WGLA 1J06A 2ZUFA 3U3ZA 1UC8A 4Y30A 1Z2DA 3WLNA 5M29A 3ZCRA 2PPVA 3EC1A 5JAUA 2HA4A 3NYRA 3TRFA 2E5LB 1W8DA 5IH3A 2G76A 3GY0A 2PG3A 3HYCA 1MN6A 4DYHA 4JQSA 5E8JA 4BZPA 5ES3A 3A3KA 1CZUA 3PXDA 4QEZA 4DIBA 1NSTA 3ZGNA 4ZMSA 3K6JA 1U6IA 4EHKA 4MI1A 5C31A 1ZH4A 1T26A 5LZ8A 3I2IA 4UOEA 3HCRA 4U7FA 1X94A 2OFOA 3RH0A 3ANYB 3ELWA 4YECA 1ZRSA 2A4MA 3RUDA 1E9CA 1DAHA 1RWBA 2QYOA 3FPHA 1B3RA 4YTEA 3DVRX 3KKQA 4UARA 5AYVA 2QAGB 1LLUA 2G77B 1OYYA 3OHMA 2O2JA 5THXA 3B2NA 4O2BF 5HSGA 3I9OA 1S8NA 4OBXA 1RVV1 2W2MA 4JX9A 5FB3A 4C0LA 2O0KA 1L5OA 2GEBA 4NU5A 3GCWA 4OQLA 1V9CA 4WNCA 1JEJA 1HRKA 2HLDA 3EWSA 3H2IA 4IVQA 1E6WA 4XIYA 4F71A 3BCUA 3OT1A 3COWA 3COZA 1L5NA 2EYQA 3WG9A 3ZU3A 2Z83A 1E9SA 4N0PA 2MJLA 4R6WA 2NUAB 1U9ZA 3RG8A 1TQ4A 2VRCD 3FX2A 1KJZA 1N7IA 4ZICA 1NDHA 4P58A 5I9NA 4B2IA 2HLNA 3BH7A 3AR8A 1EUQA 1RQRA 3HP1A 3PR3A 3DZGA 1I30A 1FDVA 5T6BA 4B6SA 4DSAA 4EIWA 4RDCA 2VYVA 3UB2A 3C3YA 4JBLA 2VBGA 4Y9SA 4TTTS 2BR3A 2FWAA 3M4NA 4JEMA 4YP1A 1MIHA 1P5RA 3C3EA 4ANFA 4E5UA 1YZKA 3FHOA 4Q1CA 3BE8A 3LBIA 4BMVA 2BR4A 5TLSA 2GWRA 1NHWA 3H1TA 2HBYA 3QXHA 2GZMA 4L95C 2BFCB 1SHUX 3RK4A 1B0PA 2XB4A 4OBBA 1WCWA 2NSDA 2Q5FA 2ZI6A 3OF3A 2D00A 1HC7A 4BECA 3NH6A 3MQ2A 1JH9A 1NNLA 4G56A 4GECA 4DMHA 4Z4CA 3RADC 5SYAA 1HF3A 2DKOA 3SJUA 4R41A 4V0QA 4GQBA 5IDVA 5AFSA 1PT7A 1H9BA 1JPUA 1V45E 1K6EA 2DFLA 3G0CA 3L6CA 2FCAA 3Q1LA 2QOEA 2NAPA 2XXBA 4G5XA 4M8SA 2QVYX 4NULA 4PC7A 4GR4A 5HVNA 5JW6A 1H1DA 4IHJB 2IRWA 2X2EA 3IVXA 1VKZA 4B6JA 4EM6A 1E94E 1SQ5A 3E9MA 3NBUA 4ARZA 1AO0A 2ZBGA 3ICOA 4K5QA 3U16A 3OVMA 2BH2A 2IZOA 1GQ2A 5CT8A 5EXTA 1V1JA 3QEJA 1A5ZA 1D04A 1Q6YA 1UANA 4M7RA 3K9LA 3KAKA 3VX4A 1ZKDA 3F6SA 4HWGA 4JT4A 1YB2A 1ZH8A 3FLEA 4TTQA 4XYEA 5EYPA 2RGRA 3L7OA 1Z0DA 1RQNA 4ZYZA 1J39A 2UUAB 1E62A 3DEAA 4O3FA 1E3SA 2P9TA 2D1RA 4X7MA 1GNTA 4BN5A 3B7GA 3H3FA 2G7MC 3KUCA 2AJ8A 4FE3A 2C2XA 4CLRA 5LMZA 5B37A 2NACA 4W5NA 4CODB 1P17A 3BRSA 3O38A 4A7PA 1DLJA 5KTPA 3BFJA 3GDHA 3BAZA 4P2GA 1UAGA 2XNJA 4XM2A 3KJNA 3NPAA 1NNEA 2X1MA 3PUYA 1DZIA 4FT4A 3I61A 1Z6ZA 3T7RA 3UUWA 4LBWA 4F1JA 3NOXA 3Q3VA 2GD1O 3QMMA 5JIBA 5C7LO 4HJRA 4A8TA 2NUBA 4QVKA 3VMMA 5J3JA 2FZVA 2ZRMA 4B3RB 3IPCA 3DMNA 1DQSA 2OFPA 2MSKA 2DQZA 2OO5A 4YRPA 3VR2A 4K40A 3WGGA 1WXFA 4RJJA 5DB4A 3OZDA 3G5MA 8LDHA 3TLGA 5B58T 1DWOA 1NA5A 2Z43A 4A23A 5KTRA 3Q7EA 4FBLA 4Q82A 1HFKA 2JFOA 1FP4A 1LNSA 2PXXA 1TYDE 2BLLA 4O2BB 3AFGA 1LLQA 4BAGA 3G13A 3IHLA 3WICA 1ZM7A 1KDPA 4NK5A 1CIPA 1M8GA 2QLBA 2IYUA 1N33B 1CWUA 1P62B 2YVKA 4GI1A 1YZLA 1JHUA 4KQMA 3UJBA 1ZRHA 1ABFA 4X3PA 1U9YA 3EIXA 1J2RA 2EJVA 1MD9A 1UJNA 2JLQA 5IT0A 2QQ5A 1H2EA 2E1PA 4Z9BA 4RIFA 1GZDA 3V7FA 3S44A 2MDTA 2CVQA 4PAWA 3KQKA 4KFUA 4RH3A 1P0PA 3K31A 3O8BA 4Q24A 1SD5A 3QOYA 1OE0A 3SHWA 2SBTA 4QREA 1CRWG 3HYSA 2J09A 2R85A 2UZAA 1W4LA 1ZK0A 1WB5A 2OSVA 3PQ8A 1CFZA 3UV3A 5CEEA 2CLEB 4AKEA 4IQ0A 1PT5A 3GZTB 4EVRA 1SIOA 4ZVMA 3UMVA 4PLPA 1GNQA 3U6KA 1Q44A 1OXTA 4Q9LA 3REGA 4A9AA 4F9TA 5JFGA 3QLVC 1ECLA 5BQPA 1ZCFA 3J7TA 3Q0EA 5TQJA 4EPRA 4M6WA 1E2IA 3HCPA 3UWDA 1KR5A 5HKOA 3ZN2A 4MRAA 4RTNA 3QLTA 4ZKEA 4QYTA 1VM6A 3NRBA 1DEOA 1S6YA 3OLVA 4REQB 3KKOA 5HBGA 3WISA 4OREX 2R1ZA 5KX5F 2FZWA 5JXJA 4QUJA 4LIPD 4XE5A 3E22A 5JE8A 3GW8A 1O1YA 4I3FA 4RHUA 5AM5A 3FBWA 4H7EA 1FB5A 4G2TA 4PC1A 5AXAA 4BQQA 1TJ5A 2GBPA 3E61A 1CHDA 4JBNA 1WXGA 1DE0A 4MUGA 2FSVC 4L4YA 4NE2A 4CKBA 4A0SA 3U7JA 1E63A 4KIWA 4L85A 4B84A 2AW5A 1QCYA 3MPOA 1PX2A 4OQMA 1ORRA 1VLHA 1K1EA 4NV0A 4BX0A 2WIAA 3STVA 1OROA 1Z5NA 3FGOA 2XYHA 4MGHA 3N75A 2JFUA 1SQ0A 3CNBA 4KGXA 2XTMA 4YAUA 5JJKA 3AUUA 3WKDA 3FAZA 3H8JA 1F20A 2C3MA 3AP2A 3O75A 1FXWA 3BX1A 4YUVA 3TBFA 3FMIA 3VZRA 4EO9A 5FTWA 4GAEA 4HQFA 5AVQA 2Y2UA 2PGNA 1UQRA 2YJZA 4TSRA 1YS9A 1EVZA 2GCEA 4WZBA 5T57A 2HRZA 4OLJA 4BFSA 2PUFA 3N6XA 1R66A 3MS7A 5EPUA 4C05A 1GPUA 3FBTA 1G20A 3RAFC 1N0WA 2B4YA 3KL2A 2JHPA 1RJFA 2IY9A 4PAGA 2HQ1A 5EQTA 5G53C 5CCXA 3RRMA 5TB5A 2WF5A 1ODTC 3B6KA 3N2YA 4LHEA 3SCZA 3QMWA 5FEUA 3IR7A 5LD2C 1YNSA 1LDBA 4RUKA 1O0SA 5KYXB 2WB4A 4LXHA 1I2MA 4U8GA 1T0BA 2FFJA 3P0EA 4J29A 4IIYA 5DNCA 4ZTUB 4G8BA 5F2NA 3QU5A 4EPWA 4Y1FA 5BW8A 4CMCA 1ZD2P 2C04A 3CTMA 1VP9A 3LE8A 3LZDA 2UVPB 1O54A 4NH4A 4YXWA 2IGBA 3WYNA 5IVKA 2F1JA 2C29D 4LNAA 2P62A 2Z3VA 1HGXA 2RGNC 3RVQA 2HIAA 5F9MA 1KH1A 3CLVA 4PG4A 2PYIA 3OJFA 4QOEA 1JDTA 4D2IA 2Q5QA 1FFGA 3VDQA 1AMOA 2FK7A 4N7RA 1QRDA 2AG0A 1E7QA 1TMYA 4ZI2A 4QTZA 4O4IF 3PX3A 4RDXA 5JYCA 2AZXA 4G26A 4GKJB 3T1NA 3O21A 3PLRA 4BKPA 3F4KA 4MTCA 2N75A 6PFKA 2WF8A 2Z6VA 1LZKA 3WKBA 1GGHA 1OBFO 1P1IA 2EZ8A 3LWDA 2E5FA 1NY6A 3DFMA 4P5PA 3ZTYA 6Q21A 4DEYA 3TVYA 2QRJA 4F12A 5KX5B 1CJKC 1ZK4A 1GGFA 1UBCA 3CEPB 4FDMA 4O4HF 5J9FA 3WJ2A 4BEVA 2JJ2D 5BW4A 2CDNA 3ER6A 1AXEA 4FWIB 3PC3A 5BWOA 1XL0A 3ZG6A 4TUYF 3BQ9A 5LUAA 1W88A 3HA7A 5ILQA 4YRZA 4KVAA 5KDDA 3K71B 3PUZA 4YB8A 1HYEA 3GCZA 4D5GA 1PJ4A 2W90A 3A3YA 1CS4C 2R2AA 1AQLA 3AZOA 1KEVA 3I2FA 5GVSA 4UNQA 3WSWA 2FMXA 2IEAA 1MO4A 4XPIB 5E6SB 1OX4B 3AL2A 5AW9A 1L2TA 1N25A 4I5DA 1MVNA 3WBBA 5ITZB 1L4UA 4PSAA 4BKUA 1PG2A 1AH2A 4YGXB 3G9QA 1SR8A 3UK0A 4Q18A 4ER6A 5CD9A 4AULA 1OLUB 2C4TA 1KC1A 3GDOA 3QBTA 3P9PA 3IKLA 2CDAA 2GF0A 4ZVNA 2IOYA 2XDAA 3IUYA 4CR8A 5IZCC 1VHLA 4A8JA 1LTKA 4MVJH 4W1PA 1E60A 3MCZA 4QZVA 1KEZA 3C7CB 3DWIA 5JS7A 1Z5UA 5H9VA 5LQAA 3JX9A 4HGOA 4TL8A 1G63A 5H9WA 1VDZA 2FPKA 4MO9A 3Q9LA 5FBKA 5HW0A 1YS7A 2GTHA 3K8OE 4YCNA 4FZRA 1O0CA 3PCTA 4GMKA 4DPKA 1X70A 2PSHA 3E2IA 5EKUA 4YCBA 1SHLA 3ETJA 4E4TA 1KI8A 4GYJA 1SH7A 2MU1A 4I7EA 3K8ZA 2RBKA 2OT3B 2BHNA 4IG9A 3H3XA 4M0EA 1PRYA 3JSAA 3DE4X 3X1YA 4HDMB 3LUHA 3X43A 4BV3A 5D3KA 4RF2A 2ZRAA 3H6KA 4HJXA 5DH9A 5JNVA 2AKEA 1J49A 1LVHA 1RCFA 1BXZA 4PGHA 1SHJA 5ALSA 2OENG 5A71A 4AZVA 4HB2A 3TMKA 3RAGA 2X23A 4A6DA 1P1RA 1H65A 2BMAA 3SLGA 1IL0A 5IWCA 1XXHB 3RUAA 4IUCS 1PFKA 3L8HA 4IZ6A 1ECCA 2CNWA 1WPGA 3CX8A 3PVSA 5GQSA 1R0ZA 1TF2A 3MYYA 2DR2A 4GQIA 2AX4A 1EXDA 4EYGA 1DDIA 1AKUA 1PJBA 3K32A 3PRJA 4JUIA 5F5XA 1OI2A 2XCSB 1M5TA 3IQHX 2ERCA 4O4IB 1QTQA 3G2JA 1U3GA 3ILSA 4YYEA 1C30A 2I1LA 3C7DB 3EYAA 4CDRA 3AB3A 5KIAA 1SK8A 2RAPA 2LD4A 4MDYA 3E9RA 4LJ7A 3OWHA 5D2CA 1Q95A 1V4VA 4QTTB 5BN5B 1OW3B 4EPXA 3P2EA 1E2LA 2G40A 4RTQA 4DR1B 1SCBA 5GOTA 1PZFA 1IIRA 1YK0A 1P5ZB 3KKPA 3ZY2A 2AFRA 1FBNA 4A8JC 4EK9A 4O4HB 1X1CA 1NJFA 3CINA 1X9IA 3B3AA 3KELA 3PDUA 2XZOA 2YCBA 5FPKA 5BVGA 1MBZA 4TUYB 3AI1A 4H3VA 4I9UA 5ALPA 3AXTA 4G89A 2FUG1 5E1DA 1BAPA 1WJGA 4FSDA 4JL6A 3QZUA 4INPA 3R6TA 1ECFA 3SHFA 4MUNA 4DNOA 3V4SA 4L5BA 1MJFA 5TY0A 1QP8A 4IF4A 1H1LB 4IDBA 4FWBA 2DFKB 4MA4A 3IOCA 2X4GA 2YJTD 4XH9B 3W9SA 1LJUA 1A7AA 1DARA 1QAMA 2OV2A 1N4AA 4Z4HA 4PTYA 5GY7A 1M2GA 2FW0A 3NHFA 1QO7A 1XZ8A 4GSKA 3MT9A 4M0FA 2XTAA 4EARA 1TI7A 3MT0A 5C53B 3CE9A 4JI2B 3PJGA 1RAAA 2UAGA 2HGZA 4DR4B 1JKJA 3ZDFA 1U9IA 4YREA 4KX3A 3NIBA 3L3BA 3ZU5A 1QK5A 2R8BA 2NPIA 1A8IA 2OV8A 1IK4A 2W37A 2BF4A 3N8KA 5T3YA 4M1EA 3EC7A 3WTCA 4RQAA 3SQMA 2FUKA 1QQTA 2ZB3A 4KQHA 4JBXA 3LXRA 2WDZA 1DHTA 4I14A 2GZSA 2FTKE 2N3ZA 4XTCS 4A2CA 2Q21A 3LIPA 4MWTA 4ODIA 4LXTA 5DNEA 3D0QA 3PPVA 1QAOA 1G6HA 5E3HA 2IIQA 2IEYA 5K3FA 4WKCA 4EAQA 4O4LF 3SBEA 4A26A 3FYUB 2YZMA 1Q0QA 1I51A 3WAJA 3OZSA 2ZRQA 4KV9A 2VQEB 1UOOA 3AETA 4DRXA 1GCGA 2ZYUX 4Q3EA 3WL5A 2A9KA 3DJFA 1QXSA 1E18A 4LYYA 3WK4A 1EIWA 1Z0KA 1CZHA 1K0FA 3PQ7A 1PYOA 1ZDMA 1RAEA 3PGLA 4CKWB 3QEBZ 2JK1A 4ZOEA 1RT9A 2A9JA 1X80B 1QTIA 2MSWA 4RJLA 1NG1A 3JQAB 4G0OA 1JR3A 3UAWA 2WAAA 5FIUA 1ND6A 5JRDS 4EGJA 2NNLD 1EXWA 3B82A 4ZFNA 4H7KA 4JYMA 1DKQA 1TCCA 1YACA 3G2IA 4Q4DA 5LJLA 2Y1CA 2J30A 1Y0BA 4DXHA 1HE5A 1KMNA 1M10A 3QFTA 3WGHA 4F1KA 1DC8A 4M37A 1CIVA 3RC2A 2XOEA 1L4NA 1BHSA 1SOWA 4XWOA 3QIVA 4EJ0A 4DABA 4G9BA 1YFJA 2QD4A 4BAZA 3E9NA 1RBQA 4UM9B 1UBKS 1P2SA 2B25A 2REQB 2IQIA 4GLBA 4RORA 4MUFA 4XQCA 1ADYA 3GLTA 5K6TA 2HFKA 3V8RA 4ABYA 1A9XB 1PCXA 2XMZA 1BTOA 1THMA 4HSGA 4Q1VA 4EG3A 4ZVTA 3DUFB 2VNAA 3O2QB 3D0OA 4EI2A 1EFHA 3ESQA 2DFDA 5JEEA 3H6HA 3QQPA 4INZA 4YACA 4MITA 1JEEA 5H0IA 3R5FA 2APJA 3ZWVA 3RYCA 3C15C 4F9EA 2P2ZA 1DAEA 4NP6A 3SX0A 1KVRA 2IBSA 1LFDB 1O94D 2H16A 3IUQA 5BUZA 2J9GA 4W9NC 5AVRA 2WPDA 3EVTA 3LPLA 4IW3B 4Y1RB 4EY8A 3EB9A 3SZUA 5KNCA 3OOWA 3TAHA 2WINI 3KTAB 3GGGA 5CG1A 1E8MA 2CYAA 4HAWA 5CFPA 4JLNA 3W5IA 1SHKA 2HSZA 2CVPA 1HZZC 1E0AA 2ZEJA 1GFZA 4IOMA 3U3JA 4L4RA 4GH5A 2GPJA 4EITA 5JNTA 1JECA 1I7QB 2BHTA 4AJJA 4KQ6A 4IQGA 4LHXA 1AM4D 2EU8A 3F9IA 2H2AA 1IPHA 1N5KA 2QMZA 1MB0A 1YSCA 3MJCA 4EP1A 3SWWA 3D6VA 4TSFA 4Y1EA 5EZSA 4JBYA 4GMFA 3CRZA 5ELLA 3AM1A 1JFFB 1XN4A 2PTHA 1KYTA 2GPWA 3O8CA 3SIXA 4D96A 3TRJA 1DQPA 1VDMA 1M3SA 5AVSA 3OKAA 4YCMA 4JLMA 1YBVA 4O4LB 4N18A 1VG0B 2JCVA 2XCUA 3QA9A 1M6HA 3R0ZA 2DC1A 2X1VA 1B1CA 1R0KA 4HLCA 4RK5A 1U5BA 4H0CA 2NO6A 3O8DA 2Q5LA 2PE5A 2OBXA 1DRKA 4YIKA 1NVMB 4BNDA 2WIBA 3WNZA 5EP1A 1J5EB 3IEMA 5E0OA 4HF7A 1HNXB 4BZQA 4DSZA 2YHIB 2BEWA 3ZGZA 2YKGA 1AQNA 2DBYA 3OLZA 1UR5A 3BTVA 4Q39A 1JJFA 4RE6A 3IX7A 4ACAA 4CQMD 2QPOA 2E82A 5K05A 2BJHA 2R8EA 1V4BA 1B2RA 3AV0B 5HNKA 4C1BA 3I76A 4BNIA 1T1RA 5IAJA 1A96A 4UVIA 4BWFB 5LZ4A 1NVTA 1OJLA 4CBVA 1W44A 4P32A 1R4MB 4DLTA 1GQOA 3DEIA 3R9IA 1GUBA 3KQLA 3B13B 3EOZA 3NT4A 4XRRA 5L3RA 2OHIA 4Q3OA 2FQ1A 4O3MA 4PHTA 2NZWA 3BRWD 4X1IA 5AD1A 2JIBA 2P6PA 2BJVA 4MR9A 3GMSA 4TKVA 3I5UA 4GL4A 2Q1UA 2WHYA 5LQMA 3A2KA 2NYVA 2QUHA 3JAWA 3V00A 3EPKA 2BSQA 1KOGA 3W3AA 4TVKA 5FO0A 2YIJA 3HBLA 1W581 1YMUA 1PR1A 4WK0B 3OM9A 4HNAA 4EF5A 3M3PA 2D74A 4E03A 4QEDA 3ITEA 3RLFA 2C4NA 4OXKA 4V24A 5HTKA 2Y1OA 4NHOA 5LZ9A 4NEHB 3D1JA 1ZHHA 1UBGA 4HDAA 3E23A 4ALNA 4ZDKA 3TR5A 1KZ1A 2B1GA 2R9VA 1ZL2A 4UAUA 1GYRA 4ARUA 4WEQA 3GARA 1YC2A 2ZYIA 3SDSA 4D9KA 1OZGA 5TMEA 3UFXB 4EGQA 1T36B 5CXUA 3B3QA 1QGUA 2P2CA 3ROZA 1FSZA 4LRWA 7MHTA 1JG2A 1GL7A 2JLSA 4LE0A 3K53A 1NE2A 5LP1A 4GEKA 4OY3A 3A04A 4ZCTA 5HQJA 4PEVA 1DI0A 1GKLA 4N5DA 2XKBA 3VJLA 1SG9A 1RI2A 1L7BA 3WWEA 1YAJA 4CMEA 1QV6A 2CV1A 3DL0A 1O4WA 3MWEA 2FXVA 3CO0S 2IJGX 1JSZA 4JNKA 5D6OA 5ALIA 5EI5A 5LN1A 3WJ7A 1IN5A 4OHXA 1IRIA 3SKVA 3I8OA 4LJSA 4PTZA 3W78A 2XUPA 4RVHA 1MFZA 3U09A 1EVLA 2H1WA 2I8LA 1M8FA 1QKKA 4JYZA 1KOJA 1TPZA 4G5HA 4KTVE 4RZSA 2O8EA 1L4EA 4RVUA 1N9GB 3TEMA 1RBZA 1UFRA 2GM3A 5SY9A 1QQ7A 2X14A 3JYPA 4FGWA 2OG1A 2JIRA 1SZPA 3HZHA 3KWLA 4MR8A 5IP5A 1EP1B 1KO5A 1KPGA 1WP9A 3ND9A 4BJ5A 4EF4A 1J0CA 2DXIA 1KIMA 3H1EA 1Q7EA 3C41J 3TTVA 4UBJA 4YBRA 3ND7A 2RHOA 4Z4QA 1AUVA 5HK8A 3OT1B 2WICA 1KAEA 1K4YA 1BWRA 4K9LA 2SICE 1XNQB 1GZSA 1MCZA 5G0TA 1GM5A 3TW8B 3BDVA 1I0LA 3WA6A 5H7XA 2XVXA 1N6RA 1PJLA 1MOSA 4YNBA 1JBKA 1G42A 2VRWA 3WMFA 2XB8A 4NBSA 3WLAA 4E3ZA 2RGDA 3DBVO 5KQGA 2XQIA 2BHLA 1KFKB 3RBVA 3AHFA 4ZCMA 1Y4UA 5EIXA 3TQTA 3DZKA 3EASA 2KMLA 3FZQA 4HX2A 3R5HA 3L8EA 1ESCA 3RGWS 1A5BB 2IUTA 1NMEA 1YTLA 3IPXA 1Q21A 4FNGA 1BGVA 2KBFA 4MWCA 4TWJA 4UAGA 3PNSA 3T5PA 1JVSA 4X92A 5FTMA 3RIMA 1C50A 3SD7A 5AP9A 4HHEA 4PZLA 1M9NA 1RADA 4PQYA 4MH0R 3RS4A 1U63A 4QAQA 2XSZA 4QKQA 3IMKA 3V8VA 3WY9A 3B53X 3LQRA 4PX5A 3FLAA 1MOQA 1Q16A 3DOUA 1KQNA 3N2EA 5IABA 4YI3A 4FK8A 5IF9A 4ZU1X 5DM2A 1BMDA 4XQ0A 4QATA 4FYMA 1LBQA 4TLEA 5T5QA 3X2EA 5DI3A 4NI5A 1KAGA 2HBQA 5EJ5A 1JSLA 5LP6C 3VA7A 1IPFA 1UK7A 3R77A 1U2DA 4AN0A 1W25A 3WIBA 2WSSA 3OTWA 1UOQA 3QPAA 4Q5IA 4UHJA 5EYPB 3ZU4A 5K9ZA 1ZR2A 3N28A 1OWPA 1R0RE 1MH9A 2NZYA 2VSXA 3O4FA 1RJGA 1ST3A 2Q27A 2NZJA 1VMKA 4TMXA 4FIDA 4B75A 4UM9D 5FH9A 3PLAE 3UJPA 2H4XA 1OKKD 4B6FA 1RI1A 4ZVLA 1N2EA 3ISJA 1YF3A 3WGVA 1PNTA 5IMSA 3MAGA 4RTJA 1YB4A 3KQMA 2R1TA 5JMOA 4NPAA 4R31A 4PGFA 4MV3A 4PLZA 5AW8A 3QXCA 1MC8A 2J6CA 3GLHE 1FXWF 1KQFA 2LKDA 1Y5NA 2DY1A 1F6DA 3LIIA 2IK8A 3LGAA 4UHHA 2ZIEA 5EZYA 4IWNA 4DA4A 1PSWA 3REQA 3W4KA 5FHRA 5FWDA 5EE9A 2H7CA 4GHWA 3T4EA 1RMYA 2I4MA 1L7MA 1S2LA 4RKFA 1M2FA 2IPLA 1XVLA 4XGRA 5ALDA 3WLJA 4N41A 1C7JA 2H3EA 3OM8A 3UA3A 1DJMA 2XLCA 2JIZA 1FP4B 3FFTA 1J42A 3MM4A 1J97A 1JZQA 1TDJA 4N7BA 3W7AA 3R0XA 1M5UA 1KEUA 3DFKA 3UHJA 3TGPA 1M2HA 2TRSB 2XMSA 4BZZA 1Z3CA 4B7UA 1Q22A 1DT5A 2AL7A 2BZ1A 5HE9A 3F6BX 4OHUA 1ZW1A 5HFNA 1GGJA 2VDVE 1X7XA 3ICPA 1GPKA 4FHCA 4H0NA 4TROA 4BE7B 4YASA 3WK6A 4CMAA 2AH5A 3CVVA 3EPPA 4KG7A 3GEPA 3GJ0A 1IOZA 1BMTA 4DSTA 5LR6A 1M2JA 3W05A 1P29A 3ISVA 5FOSA 1FF9A 5DI9A 3S29A 3LGSA 3PUHA 4WLOA 1L5WA 3AT1A 3SQWA 4RK0A 4K8OA 3FZNA 4GM4A 3CU5A 1NJ2A 1L6RA 4PS0A 4LYFA 4WK6A 1P2FA 4RFSA 4F5ZA 1RYFA 2HQSA 3WQBA 2P5YA 3ZEAA 4DC9A 5HG0A 2VQ6A 3C5HA 1RACA 4GLLA 4FFNA 4DCTA 4MNTA 1F2UB 3IO3A 1FYEA 4M6WB 2X41A 4Z9FA 3TL2A 2WHXA 2YYSA 4EYKA 2BIFA 2IOFA 4I36A 1ZM2A 3H4VA 4BO3A 4H0FA 4LRXA 4PVCA 1BD4A 4JLVA 4BNNA 1ONPA 3IMFA 3E6AA 2R3SA 4GPEA 1UJ5A 5D3ZA 4KGVA 1X7ZA 4KK4A 4B32A 3NHSA 5KTTA 1K06A 2C92A 3QHPA 3LUPA 1XR3A 4V0RA 5F7XA 4AUEA 2GN6A 3ORYA 4FS3A 5D84A 4CKCB 4DCGA 4EYEA 4PR0A 2LBPA 4CKBB 1LF5A 1T15A 1X7WA 1JEAA 1AHHA 3LKZA 4BX8A 4M1MA 1I5RA 3FNGA 3DDSA 3G5UA 2JFPA 3I5XA 1CX9B 2IFTA 3DR3A 2XZDA 3SG0A 4IIEA 2E55A 2H1IA 2PSFA 2A9OA 3PR1A 3AP1A 3QYFA 4GW3A 4CL2A 2IHZA 2K7ZA 2UZ3A 1C3EA 4QDZA 1A77A 1C0KA 4RXMA 4NTZA 4XI9A 3N0XA 1B41A 1XFAA 2CJYA 3OG9A 5A0VA 2GUWA 1XI2A 2Z57A 3LECA 2XOKD 3ZHOA 2XNCA 5K8LA 1DSSG 3AVVA 1H0SA 1B0UA 5HUHA 1G98A 3MINA 1LBHA 1T2FA 2F1RA 2ZG6A 1R8JA 4WZBB 3BZUA 2EHJA 4Z54A 1ECPA 4Z53A 1E69A 1CZRA 4PC3A 4W99A 1Y3HA 4ND1A 3ZV4A 1XPOA 1G20B 1E1DA 1GQFA 3DMTC 2QNBA 3ZUPA 2EHDA 4IH4A 5J2TA 4CG3A 2ZBEA 1IJKA 1LA2A 1YR2A 4IM7A 2GERA 1EE9A 1T0HB 2NZ8A 2H0AA 5A4IS 1WRBA 2INGX 3UBTA 1BHO1 2XNDD 3OF5A 1QZUA 3RI3A 1UDXA 5EE0A 2GAAA 5FBQB 2VJBA 1VECA 4G07A 5J4YA 5G02A 1PL8A 4JOQA 4RZIA 3FPCA 4B73A 4YMLA 4OSPA 1JE0A 4KWTA 4WWHA 5BVHA 3T1TA 3UN1A 2CNOA 1JDVA 3G7NA 3L0CA 3PF8A 4B3HA 5BPHA 2WUEA 4NBKA 4K88A 2IE8A 2YXPX 4CLXA 2XUQA 3HZOA 4DNXA 3U7IA 4MS3B 1NRIA 2WIKA 3EGDA 2EKDA 4FHDA 5K2OA 1I94B 4CN9A 4FEYA 5AOVA 2PUJA 2FQWA 5LB4A 1GV0A 1Z6TA 2ZI4A 3CS3A 1GSHA 4RAOA 4A91A 4CMIA 1OFGA 5DMHA 5BRAA 3UHFA 3CLTD 1PGQA 3JVVA 2IQ5A 2O48X 3ZE1B 5AOCA 1ATZA 1U8AA 5BY2A 2J5KA 4ADSG 1FDSA 2FMIA 4F8YA 3BULA 3ZI4A 4IQ8A 3AKYA 3FVRA 3BXPA 3GLFE 2E4UA 2FWRA 1SUDA 3CW9A 1QX4A 2B4RO 4WLFA 1DIAA 3OX2A 4L76A 5IBQA 1XZCA 4M1WA 2XWQA 3KQUA 1WCXA 4KZKA 4ZRDA 4D46A 4V0KA 1R9MA 1MW9X 4JL5A 1YQEA 4UM8B 2PVPA 4XB6B 3N53A 3LDUA 3FW1A 1NR1A 1N6KA 4L4SA 1GPNA 4RIEA 1U9JA 4C43A 3H99A 4II3A 1W88B 3EQ6A 3P2MA 1ZZGA 4G63A 4G1VA 3RTDA 3AIMA 1SKUA 3UJDA 2FF7A 2ZTMA 2ZT6A 3F98A 4B82A 4DZRA 1E61A 1G18A 1Z83A 4M54A 2HREA 1IWPB 2QMHA 4GSYA 1AHNA 2BMJA 2QZPA 3W2EA 1G60A 2C99A 2DULA 3EMVA 2GCIA 4IMIB 1CUCA 3AI2A 4IS2A 1OAAA 1T0UA 4KXVA 1XEXB 5CT6A 3TPCA 2F4VB 3SHVA 3WBKA 3WSVA 3D6FA 3KZXA 3WK8A 2H1OA 1UXJA 1BEEA 1XD9A 2Q5IA 3K4HA 3PIIA 3TW8A 3TMAA 3FDZB 1GAEO 4BO9A 3JWEA 3E9ZA 3Q7TA 3QM1A 1WV1A 3FNBA 1JSRA 2VYFA 3WL6A 5MN5A 3GZNA 4KXXA 3NNNA 3RJMA 3SKYA 1C7RA 1DO2A 4CCAA 3BYZA 2ZE7A 3C43A 3FOBA 1W36D 5F23A 4R0MA 1JMVA 3KE9A 4M36A 3EDYA 2G83A 4ZYLA 4Y0AA 5DP1A 1N8KA 4LKOA 3LKBA 2P78A 4KRGA 4UULA 4WQMA 5D85A 4BO8A 4ESHA 5AI8A 8OHMA 3AEUA 2H4HA 4JDPA 4H6XA 2X4LA 3CNLA 3L9XA 3GNTA 1H8HA 2QUIA 4MMXB 5CVDA 5ARBA 1SUEA 3MOIA 1DS6A 3DP7A 4JKIA 2I1QA 2XYQA 3QXXA 4OXQA 1UIMA 1KZ6A 4EGFA 1SGWA 3K15A 4DKJA 1P9OA 2I2BA 4JK3A 3LPAA 5LA6F 3DCIA 4Z9YA 1UWVA 5JZMA 3LWBA 4IZOA 3UOAB 3K9HA 1J7KA 1PJZA 5HEKA 3OQOA 1OHHD 2QLNA 3JYNA 2BM0A 3SEQA 1R00A 5B4TA 4IFEA 2H06A 1BDMA 2DG2A 2NSJA 1VMDA 4W8GA 1XLTC 2WKRA 1EH5A 3GFPA 3Q6NA 5K0SA 4Q4AA 1XFDA 2QB5A 4YONB 4JJ8A 3ZC3A 4WY5A 1NOKA 3CCBA 1EA5A 5JADA 1COWD 5C3UA 5JECA 4RM3A 1IY8A 2ZB4A 4LOIA 5H80A 1VYUA 4EKIA 5DYIA 4RTRA 3DT8A 2JCXA 4KFCA 5CYOA 2IH5A 1C30B 2B7BA 4IHQA 4QBHA 1AKNA 2BEJA 3U7HB 2QD3A 3AF5A 1PGPA 3UAYA 2JDIA 1BQ3A 3HMQA 1Q17A 1N1EA 3OOJA 1R1DA 3WTBA 4KIJA 1ML4A 4KQGA 3KUDA 3KOWA 1O7JA 4QPJC 1UH5A 2P6OA 3FVWA 1HBJA 1KKMA 3RUIA 1GRRA 1IEWA 3QVGA 1XEWX 5DV9A 3EGOA 3L41A 3J80A 4EQ6A 2FPPA 5K6AA 4QL3A 4R8KA 3ZGVA 1IRXA 1HI9A 1Y9ZA 2YHAA 2WIFA 4TRJA 2WUWE 1EDDA 3IEPA 2DWPA 3RYHA 5A5DA 2G17A 4CIBA 3HJGA 1J8MF 4HQLA 3UMBA 3R9XA 3H0KA 2IXFA 1K8XB 2SKDA 1GL9B 2M6KA 4TM7A 4KEAA 4NLLA 1PR6A 3A3OA 3NMUF 2HRCA 3T61A 2P69A 4OK5A 1UM9A 1EG2A 1E1QD 2BONA 3NXSA 2DLDA 3QUQA 2F4NA 4UCQA 5DX1A 1PEAA 2FQXA 5JCJD 1W4BA 1QIMA 3HY3A 2GB4A 2C2WA 4XWYA 1WBJB 2ZIAA 1EWKA 3I0ZA 4L15A 2A84A 1IU9A 1E99A 3V33A 3C6MA 2PGXA 3VKWA 3W8RA 4BU0A 2JLCA 1MHPA 4R0VA 5K2MA 1JKJB 4C6TA 4YR9A 3ZVKA 2EP5A 2TMGA 3D6NB 3CRVA 3ZXIA 5A2GA 4BX9A 1LPOA 2FCRA 1DJQA 4GPAA 2V55B 2EQAA 2IBMA 1AZTA 3QUTA 1AD2A 4OP1A 4UVDA 1GP2A 1URPA 4E1AA 1EE2A 1ZRNA 3T95A 2Q3HA 3F67A 3ZBQA 3D8BA 1E7RA 4GKVA 3UB4A 2CFCA 1JB9A 5EAIA 4BYMA 4MQEA 3LV8A 1LPBB 3SC3A 2JKZA 4ITRC 2W2OA 2OK7A 5B2EA 2IH2A 1OU0A 3MOGA 1HMPA 4P4LA 4PYMA 1NTOA 5K3FB 2VP0A 3UGTA 3DMGA 4HDSA 1QC5B 2WNSA 5CJJA 4GI5A 4HBZA 4PAOA 3TLMA 4X6UA 2C2BA 3TIXB 2J3QA 3AETB 4DRXB 5LA6B 1JEDA 4MWDA 2J3KA 2W2PA 2SKCA 1RM5A 2UUOA 5K3EA 2JGJA 2QGZA 4GBED 1T9HA 4NY1A 1P2BA 4O1HA 5ESRA 4YN3A 1C3OA 4MVWA 3MCVA 2NVUA 1DCTA 4BV8A 4IRMA 4D97A 1F1BA 4EKDA 4AKIA 1D5CA 2HUPA 4WL0A 3V4ZA 2WG0A 2XIJA 4O33A 1YQGA 2FOIA 2G9QA 1DAPA 3K3PA 3VYVA 2NYRA 4BKOA 1E9DA 1ML3A 4FUTA 2PKYX 3DM9B 3I05A 4LSGA 2CSXA 2WYOA 2YRWA 4X9XA 5AICA 1IXYA 4KW7A 4B80A 1RQLA 4EYSA 4KQEA 3A1WA 5A4JA 2D5AA 2HEGA 1GGVA 3ASUA 5KKNB 4P92A 2CLSA 1E1LA 2GILA 2Z0MA 1M6VB 2FAXA 3BREA 1WXEA 2WAXA 3DTYA 4DY4A 2FA9A 4N3GA 1EM8B 2QVBA 5HUJA 5AK5A 3CZ4A 2MSNA 1ZINA 2PXCA 1O96B 4GRIA 1CY4A 2WD7B 3NZEA 2FRDA 4RL4A 3AUJB 2AFIB 3UCEA 1XVIA 2J59A 1AOXA 1E5QA 4AKHA 5A9SB 1R16A 4J0HA 3N8GA 3SQLA 4PCUA 3UV6A 2PVSA 4JJEA 5DLEA 2WOOA 2FZ4A 3EA4A 4J0CA 4KDRA 4P4SA 4AP6A 4X64B 3HCOA 2N9UA 1OB2A 2ZATA 2OHXA 2P67A 2WMOB 4OPMA 4S1OA 4BNKA 2J3EA 4HWRA 2J45A 3MMPA 3W6UA 4R68A 4AKSA 2WB2A 2BAGA 2H07A 2Q8PA 3PCXA 4P08A 2ASVA 3D5QA 1GZ7A 3ZWCA 5BWMA 1Q1QA 1RRCA 2JFHA 1JFLA 4BQSA 3GC6A 4RO0A 3S5UA 1OLXB 4TKLA 3TJZA 3TRKA 4P7GA 5A3JA 4C87A 2X7JA 3HV2A 4NICA 4MKRA 4S0ZA 3VOSA 3H1GA 3R3WA 5AM2A 2GSDA 1FU4A 4N54A 4BASA 1JJBA 2BVNA 2XD4A 3LCUA 5ENDA 3BKXA 1B42A 4RD4A 4JKOA 4K6OA 5FORA 1X42A 3DYBA 1U28A 4REMA 4B3SB 1Y6ZA 3ILYA 3PT5A 4OFWA 4JP1A 4OHBA 4G0NA 3E7PA 5GTDA 4YJGB 5HCUA 4WDRA 2QGFA 2FSIA 5CG2A 1KYQA 4OHWA 5JS1A 4BNUA 3M1IA 3P9YA 2GJ9A 4B6PA 3A6JA 2ZTSA 2BFEA 1JA0A 3E8MA 2QEQA 1SBIA 3CWQA 1U5BB 3VPDA 3DTVA 3L1JA 4Y2JA 5KYKA 3QKRA 2O4UX 2IHBA 2P1DA 3H4MA 3C4JA 4NCKA 3E7WA 3U1TA 3LHKA 4BNDB 1WKCA 4U39A 2EFYA 4B3DA 2B4TO 2BEWB 1FMTA 4DADA 4ZO4A 5KVVA 2GZHA 1NXPA 1ZCAA 4KQXA 3VU3A 1UOPA 3FHCB 3HLTA 3INRA 1MEOA 1H3NA 4RY8A 3GBSA 4RZ3A 4FOPA 3PEYA 2PFGA 3OEED 4BXOA 1T8UA 4JN6B 2DB3A 2EX1A 4F3NA 2H54A 3W5DA 5ECWA 1ZH2A 2WI8A 3FWKA 4BVHA 3TLBA 1N36B 2JI8A 4WY8A 1FFSA 1TYAE 5LZ7A 1RRMA 2C7BA 2R96A 1INLA 2OZVA 3FFAA 3URMA 2G8NA 2VP4A 2BFFA 3TRIA 1L7VC 3KVOA 3OECA 2XMDA 1BE1A 1FW8A 1MJNA 4RHEA 3VZQA 4DLLA 4X1IB 4ZYWA 4MV1A 2BFBA 1E1CA 2BV3A 4N4AA 4MR9B 4TKVB 4NBRA 3AOEA 3HDVA 4EFLA 1QU3A 3IO5A 3JAWB 3O2JA 3THSA 3UK1A 2TECE 2O2IA 4IH9A 4ER7A 1A1SA 3UAZA 2WF6A 5CX4A 3RAPR 1QFZA 2HN9A 1P2UA 4HNAB 1N2HA 3W2HA 2WJYA 3S8YA 2RAFA 4UOZA 1BW9A 1LRKA 3G6WA 5FTKA 4E09A 1XJ0A 2XCTB 1L5QA 1EHIA 1TJNA 3WE7A 5IUJC 3AVTA 4OQYA 2JJ1D 2H9IA 3A8TA 1JHDA 5G41A 3U48A 2CXOA 3G5TA 3TI9A 5J47A 5TPWA 3RNOA 3URKA 2V74B 2GASA 3O3OB 4MIEA 1G1MA 3K2EA 4WUTA 4UQLA 2XGJA 1CF9A 3EODA 4DA6A 8AT1A 1QGUB 2OZLA 1KY4A 1P9LA 4AX8A 4J3NA 4V0MA 4K87A 4FN4A 4XWTA 1A9OA 4UMEA 2Z5GA 1L4LA 3CZAA 3H2SA 4IEIA 3V2IA 1ZN2A 4Y98A 5AOAA 2L17A 2P1ZA 2WU1A 3CH6A 2GDJA 2F55A 4GSLA 2QP3A 3H5NA 3MJFA 3EQ2A 3GB9A 1N2ZA 1LQ2A 2ZYRA 1ZI9A 3MWEB 1HEIA 3LLVA 2NXWA 4AIRA 3Q6IA 3VX3A 3WO1A 1Z4IA 3HKDA 4O1IA 1U80A 2HHLA 1Z88A 1IY0A 4G5FA 1KHTA 1KMMA 1F4VA 1JLLA 2C5SA 3A4TA 1QANA 1TECE 3MQ4A 3NHWA 4KPFC 1XU4A 3MJRA 2HFJA 1KJYA 4LOHA 4PR3A 1BEUB 3DZFA 3W9BA 1SCJA 4OM8A 4C7OA 4BVJA 4MR8B 3NBAA 1GQSA 3GQBA 4CM8A 3NVDA 1VSQA 4OK3A 3RG2A 1R27A 2XGGA 4B09A 4MW6A 3PEWA 1Z0FA 1F51E 5CB6A 2A92A 3FTFA 5IHXA 1M0SA 2XT0A 3EY4A 3ZJTA 1W4CA 2IYLD 2WM2A 3GWGA 3CV3A 3X3HA 3QJ5A 1E0KA 5BQOA 3PD0A 3SQNA 1E6KA 3PX7A 4RLSA 4DV3B 3RDPA 3HLKA 1DIRA 4BQPA 2AG5A 1DXQA 1GTG1 1UUFA 4ZCSA 5COAA 1YBHA 2AMFA 3GJSA 1JTEA 2ZIGA 2ETVA 3OAAD 4G5QA 3WIUA 2BF7A 1C80A 2WTXA 2BM9A 3BXZA 3VNAA 2AXPA 2IYNA 4D45A 4HS4A 4XJSA 5DE3A 4TS4A 1HWYA 2F17A 3GRZA 2Z1NA 4RMGA 1Y1RA 4E2WA 2OXTA 3QKTA 5KVQA 2Q3FA 2GEKA 3WBJA 1AV6A 1G291 4NMXB 3GZ4A 1QVVA 2XZTA 4Y9UA 1T4BA 4WXHA 2LCQA 1UBRS 1R3UA 1HSZA 4AD8A 1I2ZA 3HZZA 2VR1A 2J8ZA 4G24A 3JARA 2P6NA 1Y34E 3FUTA 1GT6A 2VJKA 2BP7B 5AVJA 4DCSA 4PYQA 4CMJA 4IJWA 2ECFA 2OFWA 5FXMA 5DI3B 2YQZA 3ZTTA 3DFFA 3FG9A 1Q74A 1JFTA 2ACEA 3WB0A 4HZUA 1V9SA 5JQWA 3HK2A 3HSKA 4GQAA 5DYNA 1YQTA 1EGHA 2GBIA 4BQOA 2Z95A 5AUNB 3ELDA 5ADUS 1QHXA 1HY3A 3LCJA 4FI3C 3HADA 4OGKA 4NOMA 4TTJA 2EOAA 3MQFA 2CLCX 5KSWB 2Q3EA 4DQ0A 3CFYA 3CNEA 3AEZA 4G0ZA 1V3VA 2EBFX 3PE4A 3HEMA 4M9ZA 1LWOA 2GNOA 5ECGC 3OQMA 3CRMA 4QFMA 4A73A 2FFHA 2AC4A 3LQKA 4WD3A 4WW0A 1WNTA 2EGHA 4FTWA 3RVNA 1WZCA 2Q5HA 5DGHA 4MR7B 3WX0A 1F06A 5KQSA 4UJ3A 2X9LA 1OFHA 1R5OA 2G9ZA 1PR3A 3KTOA 1DQRA 2R1TB 2QRUA 1NQOA 2OD9A 2W6MA 4JVSB 5T4FA 3R8CA 2I7DA 3TJMA 4QPDA 2O5VA 3KV3O 1WUJS 3K09A 3OFKA 3THYB 1S1MA 1Z47A 2O0JA 1XXHE 2IYWA 1EUCB 1C7EA 2QL7A 1ISJA 2P9FA 1YQXA 3IQZA 3VI4B 5CFZA 5A05A 3EZLA 3HU1A 3REQB 3F5FA 1XMOB 4AI6A 4XD7A 4MV7A 2B3TA 4YV0A 3JD3A 1BA2A 2TMDA 4FYJA 1CUZA 3CX6A 1AB5A 4HWOA 4N12A 4RSRA 4R2KA 3ZOZA 5J2TF 4DCCA 1C0PA 1M1NA 2F8MA 1LY1A 2W0SA 5A3RA 4KHZA 4KQ9A 4BFCA 1RLJA 1J23A 3B9QA 4W6QA 5JASA 1EZ4A 2QJRA 1P80A 1QHEA 4WHMA 3TNYA 4UMDA 3DE7X 1CZNA 4XSHA 3S2GA 4S2UA 3ZE6A 3OTHA 1NKTA 2A0UA 4PYOA 5KS2A 2WDPA 4JDUA 1RWXA 3ZR4B 4M98A 1X7XB 4ASUA 1E1MA 1YCHA 2GRJA 2WSIA 3MTEA 2X76A 4JLBA 2FPLA 1KSJA 1I6LA 3VZDA 4CV3A 1X1AA 4NE9A 1V6AA 2Y6VA 3U9SA 3ABRB 1QVWA 4Y6OA 2IYXA 4ARBA 1SEPA 4V0LA 1FYWA 1P7YA 2I03A 2XDQB 3RVRA 1GRVA 4EECA 2FPIA 3OQVA 4PE5B 4D0NA 3E18A 1ARZA 1ZK2A 3IOMA 4FU0A 2GA9A 3AR2A 4P3YA 3X44A 2R11A 2HQRA 3P2KA 3GHYA 1STOA 3LC0A 3RVOA 3S2UA 2PH1A 3RVJA 2XVYA 4RFSB 3FTEA 2O1SA 1LD3A 1X92A 2BTQA 2YOHA 1GNPA 2DP4E 2ZSHA 3PQCA 2PD3A 3HVRA 3IAFA 4LJ6A 1NXTA 4TX1A 3RIGA 2CHQA 4OQEA 3AHCA 4JENA 3LSYA 1NJGA 2ZTHA 1G2IA 4JP2A 3UOGA 2X15A 4H77A 3GJYA 3IFSA 3F2IA 4H9GA 4ZOBA 3X1XA 1FL9A 2PMEA 3HR8A 3M6IA 4FONA 3RHFA 5UKDA 2C78A 1YASA 4XKJA 4CLEA 1X7ZB 2ATIA 2RGCA 3MJVA 4UFPA 3WLPA 3FOCA 1KH2A 3ONNA 4FDTA 3RC8A 1TC1A 5LBTA 1GVNB 4DLVA 4FEAA 1U7ZA 2WYIA 4JITA 3RJ5A 3L1KA 3L04A 4IR7A 1DJPA 4BVKA 1RBYA 5JDCA 4MUHA 3TE7A 4DG8A 5L40A 5JRJA 3LQFA 3KYCA 1QK3A 1SXJC 1X7WB 3R1IA 4XX1A 3I37X 4RH1A 2GN8A 1JSXA 3I23A 4OO3A 4AS2A 4G23A 5EE5B 1WCV1 3HH8A 5C8YA 4FEEA 3HXTA 1CUFA 2QTTA 4R1MA 4S2EA 4KLNA 2ZFUA 2FWNA 3BRQA 3L6BA 3MF4A 1QIHA 4MQUA 4TS9A 3HUUA 5AJUA 2WLSA 4E22A 3AUFA 4CMGA 3ZQJA 1LPAB 1Z4QA 1T6BY 2YZ7A 4JOCA 1UMDA 4C7MA 1XKLA 1AKMA 3LPNA 4M87A 2HJ9A 4FFLA 2AOTA 4LBZA 1GZ3A 2PHZA 5FNZA 1LPSA 4ZO7A 1EJ6A 2FUG6 1ZITA 3EPRA 1ULHA 3K9FC 3MINB 1UWCA 2D0PB 2QNIA 4Z1MD 3PTZA 4RKRA 4X7RA 3EW7A 3E9EA 4PQGA 3CA8A 3VUFA 1CEYA 3MFQA 5J2TB 3QWAA 2LP4Y 4JIMA 1HDXA 3B9PA 3LLSA 1HTBA 1UXKA 2KI5A 1S2NA 4I1OA 2RHLA 1UAYA 3H17A 3O74A 4LQCA 4US1R 3EUAA 2AG6A 3KKKA 4XCVA 3LOUA 5E3JA 3ZGYA 2AQ8A 2PT6A 4Z8XA 1O3YA 1QH9A 1WP4A 4JVLA 2E4VA 1CP2A 2BZ0A 3AFHA 3L0PA 4AG5A 3ZUGA 1SBQA 4LCBA 2GKSA 4R3UC 1WEHA 4OEHA 5BSGA 3JAMA 2PZGA 3PRKE 1W5EA 1B8PA 4U1RA 4BN0A 2BFOA 4KMSA 4NE7A 2ECPA 4UFOA 3PFHA 1HLFA 4CQJA 2YJGA 1PG0A 1JE1A 4WFJA 1S96A 1ZRMA 1F0YA 4Y67A 4D8WA 1VA4A 4EHBA 1NPTO 5HOQA 1K86A 2Z58A 4BGDA 5JAHA 5DNUA 3EGDB 1I5EA 2QMOA 3EARA 4MKGA 4WV3A 2QY6A 5I7OA 4UHKA 2HK6A 1JG6A 1IH8A 1XMXA 4CMIB 1AZLA 1RP7A 1F8UA 1EVEA 1XLUA 1I1HA 2QYSA 3ZVNA 2EJTA 1L3CA 3KB6A 3PBKA 3CYFA 2YXNA 2VNKA 3KZMA 1MVLA 3P0HA 4FDVA 4J49A 3EVGA 5DOVA 5FTNA 4XM0A 3VU1A 1QLJA 2RD2A 3T3NA 4Z4EA 3TQOA 4F4HA 1G0OA 2V45A 4LBVA 4HXFB 4WXMA 1YUNA 3S55A 4GXQA 6ABPA 2A8YA 5DW0A 1WU8A 1SBHA 2NU7A 1SVOA 1XYGA 3DBHA 3N2NA 3O8NA 4GPTA 1FRFS 1I4WA 3IAXA 2WJ4A 1YU6A 3RBXA 3AH8A 3HR7A 3V7YA 2YQ5A 4E21A 2FN7A 2VJLA 3L4EA 2FMHA 1WDWB 1ZO8A 2BI8A 2CNKA 2FJ0A 2Q6IA 3VDXA 3FPSA 3QVOA 2MR6A 2VPQA 3T4XA 4UEWA 4HAYA 1ZU5A 3DDNA 3W5AA 5JQGA 3UWOA 4GRDA 1C7FA 4HMPA 1AKRA 1JPJA 3JD2A 4NQRA 1BGWA 3TQRA 4OJTA 3VAAA 4AYTA 5H68A 3OE7D 3D3WA 2D1YA 4PNZA 3R7AA 2H7VA 3E84A 1C1HA 4ZHQF 3FA2A 4E2ZA 2XYGA 1B6SA 1ZVQA 1XALA 2EYUA 4IH1A 3ZLUA 1NVBA 5L4NA 4HMOA 4DLXA 1PJAA 2DJIA 2GX6A 2N1MA 4P3OA 3IT0A 4PXYA 4EYQA 2OORA 4GOOD 5PNTA 3P1JA 4AURA 4R8MA 5JLAA 1TYEB 4CM5A 3W5CA 1KO1A 2Z6AA 1ZMXA 5ALZA 1ZMOA 4EHHA 5KQLA 2PXHA 5C1PA 1VPEA 4QLOA 3L6DA 1R74A 1K8ZB 2GTIA 4GWLA 4EUFA 4Q3AA 5HP4A 1YVDA 1D07A 1PZNA 3HS3A 2PX3A 3BHIA 1CNMA 1E9BA 3GZNB 1QE5A 4JODA 1NMYA 2XUKA 4KSBA 4P3PA 3L92A 5CDFA 3VC7A 3ER9A 5DLQC 5KO2A 3C8DA 4LYJA 3U4QA 1S3SA 4I5FA 2J4DA 1JT2A 3L79A 3W1EA 4UBNA 1QUEA 3JAKA 2UUBB 3UYLA 2I6XA 4R5HA 3V1YA 3KPUA 2AI2A 3HMKA 1WETA 1CRPA 3QV1A 4EJFA 3HSSA 2Z2JA 1KDVA 1CJMA 1QRTA 3WWOA 1VPDA 2XRMA 5FUMA 5DO9A 5DM4A 5SZHB 1RCTE 2GZAA 3JWJA 4GVLA 2OHFA 4LHVA 5AM3A 4BS9A 1JXQA 2PZKA 4ZVOA 5AVVA 4W63A 1ZQ1A 1VL6A 4E2YA 1IZ7A 4A0FA 2QPTA 1PGJA 2OGWA 1TF5A 4CL8A 3UAXA 3L6EA 1Z6GA 4N3CA 3BGDA 4AXXA 4YT4A 5I7SA 1EUYA 2ZWOA 2MYTA 1KO4A 4HLUA 3V8EA 3LSTA 1GUDA 1HDYA 2V9CA 4DZZA 4ZKDA 4YDQA 3R9KA 2A1IA 1MHTA 3BG5A 2V6FA 2WNIA 3NAQA 2F00A 3N5KA 2H9AA 1YB7A 4M22A 2D2FA 5ALGA 1JKIA 5ARDA 2JLYA 5CAEA 1GQRA 4PIPA 4I1IA 1RC8A 5F76A 3JQ7A 3KQTA 2J0EA 5H1YA 3CKMA 4ID9A 4Q12A 5EP3A 3AW8A 3I9JA 3RUFA 4R1SA 5ELXA 5E7JA 5BR7A 5KWVA 4DNFA 4Q4AB 1J2YA 3AL0C 1HFEL 2CFIA 4FZ5A 4IVNA 3HNOA 3WJ1A 1BE0A 5BMOA 2ONKA 3H9UA 1GU7A 4EUHA 4ZDWA 3P19A 5HA5A 3RC7A 1QFSA 1CSEE 3KKZA 1L5LA 3CPEA 5DTRA 3RV3A 2OBFA 1GHTA 1E2KA 1E9AA 1NR7A 2XTNA 3LQ4A 1XZNA 2H51A 4N65A 4YRBA 5JR3A 4QO8A 2F48A 3OZXA 3WO0A 2OESA 5BXQC 4YP6A 3H0CA 2V4ZA 3B6JA 4F5EA 1RAFA 4NCBA 2B2XA 2W8ZA 4GZ5A 3L40A 2ZJ5A 3KEOA 3STUA 3ON5A 4J1SA 1I4LD 2I2WA 3PGMA 4U8HA 3WLEA 2WW8A 1U0EA 1VGRA 4F60A 1W0KA 4PLYA 1GFIA 1IZ0A 1ZA2A 1A2OA 3T3HA 3NIDB 5KYWA 4IAOA 4L5YA 2FPPB 1YFZA 4PO1A 4YUWA 1QCZA 1IZZA 1I4OA 1CEEA 2JLZA 3RU9A 1RZRD 3RYHB 1CF4A 3H1AA 2H2IA 4LK3A 1PT9A 1JGTA 2DHCA 2IU3A 4ZHQB 3R9XB 1BDJA 3UQZA 3PJDA 3R7SA 4B17A 1Q0TA 3V1LA 1GT91 1YL7A 3IB3A 3NWPA 2BBOA 1Z0IA 3DFUA 1UM9B 1WUIS 3ECCA 2BD0A 1HLGA 2A58A 2J6HA 2KJQA 2MT9A 4I1VA 4M0DA 2QV0A 2BLNA 4TSKA 3W8FA 4NDNE 1H2HA 2VSYA 3FPBA 4IKOA 2I9PA 1DTEA 2J5RA 4BP3A 2I3ZA 3M9WA 1SKMA 5IK2A 1FVFA 3ZEIA 3AHEA 4EHLA 2JAUA 3HYLA 4C6TB 3N1UA 5DLYA 3OBIA 1MQ8B 4IXMA 2LDBA 2VNHA 5JSZB 2X9NA 3BOSA 4O0MA 4JUCA 1GSIA 4KQIA 3IH5A 4MUMA 5BYKA 3T3DA 5HQ3A 5HZKA 1E5DA 1PWHA 1MPTA 3NALA 4LOKA 1F6WA 1YS4A 2ZJBA 3ABSB 2OCLA 5HFJA 3WNQA 4ERXA 3VZPA 2MINA 4BP9A 1Z33A 1YJCA 1MV8A 1LBEA 3HFJA 2VNIA 4TMTA 2DUUA 1DG9A 5AQEA 2E4AA 4A0QA 4ETIA 1SQFA 2IZ6A 2Q2OA 3CSDA 4MQEB 4UHBA 5NLLA 1OC2A 2ZS9A 3VR0A 2ZBPA 3KETA 1BCSA 4Z7QB 1NXWA