3GFTA

Human k-ras (q61h) in complex with a gtp analogue
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
167
structure length
167
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Human K-Ras in complex with a GTP analogue
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 167
sequence length 167
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gftA00
1ZMXA 3EPHA 2EW1A 3K0AA 2NPFA 1OFUX 4NBSA 3FMFA 3Q72A 3WNCA 1EK0A 1NP6A 4A1FA 1KDRA 2DWPA 5B58C 3MGCA 1GTVA 5FL3A 1E32A 2F9LA 3FTQA 3QNUA 2F7SA 5CM9C 4OJQA 4KFTA 2XTMA 4PZYA 4D82A 1IJFA 4D26A 2R62A 2CNWA 3DL0A 4JLPA 4FMDB 4Q00A 1XEWY 2C8VA 2DYKA 4LK2A 4U00A 1G7RA 4ASUD 4AKIA 2WMOB 2BJVA 3LFUA 3NXSA 2ZJYA 1UJ2A 1KHTA 3IQWA 4OQFA 4PSVA 3SQXA 2JLRA 1U8AA 1XWIA 1P4SA 1GUAA 1KIMA 2VF8A 3LDAA 4LJ7A 2GAAA 1A7JA 2FSHA 1II0A 1MRSA 2P3SA 5JECA 2ZR7A 5JZVA 4DEXA 1IBRA 2IC5A 3QVUA 2C77A 2IK8A 3CPEA 4PSKA 1IN5A 3HYTA 3QF4A 2IYRA 2ZSFA 1XJQA 4C0QC 3MAAC 3QEOA 2AL7A 4D4LA 1K6MA 4TT3A 4BFSA 2ODWA 3BORA 4M0LA 4PHFA 5TY0A 2CL6X 4JVNA 3R8FA 2IX3A 3W3ZB 4WXPA 1OH5A 3QKRA 2WJHA 3BOSA 3AUXA 1G6OA 4LBVA 1CBUA 3M0EA 3DEFA 2Y8EA 1TF5A 5JWOA 3V9PA 2QP3A 1FX0A 4HAWA 4UXHA 3KJEA 2B8TA 1J90A 4LC0A 3U44A 1YZUA 5DYGA 2KJQA 3EW9A 1X3SA 3AP1A 4LHZA 5FPYA 1OFHA 2QM7A 4URUR 5E7IA 3VR6A 2J3EA 1J70A 4BFTA 3JZMA 5FBWB 3UK6A 3KFVA 3KL4A 3WHKA 2IYXA 1Y63A 1LS1A 4M1TA 3THWB 2MMGA 5E95A 4YMTA 4HAZA 2JJ8A 1TQ6A 3CZPA 3CF0A 3OZXA 2AD5A 2BHRA 4YLGA 1UKZA 5KUTA 1UF9A 4RD0A 5CM8B 4BRWA 4CEHB 2OBLA 5CB8A 1W4AA 5JHHB 1XTQA 3W8RA 1G4UR 1V5WA 3B9QA 4D0NA 1AQYA 2DWQA 4X8OA 1J8MF 1AKYA 5CK5A 2IUSA 4E09A 3I5YA 3EPLA 5JJLA 2XX3A 2CNWD 3SNHA 1XEXB 1BO6A 2G1KA 2ZYUX 1KI8A 3EARA 4B3CA 4IVPA 5JHGB 2ODNA 1T9HA 4B48A 1JI0A 1T4GA 3DHWC 2QT0A 3CR7A 2BBTA 1Z6YA 4F38A 2JDIA 4IXMA 1L7VC 3D7MA 4HAUA 1M34E 3K70B 4CW7A 1WE2A 4Q9LA 5CJ2A 1P2TA 4B3BA 1VMAA 4A2QA 3PR1A 1HE1C 4FWTA 4EFMA 2OXCA 4K8OA 1OLOA 4PAOA 4JLBA 5K8TA 2EU8A 1UBFA 3NEJA 3D3QA 4V03A 1Q1BA 4D25A 3LBNA 1NBME 3UKDA 4C0LA 1P62B 3A1TA 4OHYA 3FMPB 3DZ8A 4BGDA 2AR7A 4TT3D 2DFKB 1E79D 3A6PC 3C5CA 1AKEA 3VQTA 3ZQJA 1YR8A 2RMKA 2XTNA 2H7VA 4C2TA 4XIGS 2GF0A 2Q9CA 3TH5A 1T0HB 4KYUA 2JLSA 5D3QA 1RW4A 1CULC 2CVFA 2CHQA 2XSZA 3KDSE 5EP3A 1BMFA 4DWJA 1G3MA 3O8BA 1NL3A 4BEBA 2Z4SA 3FFAA 3RSOA 1LFDB 3BD9A 5J4VA 2JJ2A 4X8LA 4Q4AB 4B3GA 2FSIA 3ECCA 4HUQA 4ZDWA 4PC6A 4PQFA 1XCMA 4TYWA 1XNJA 2CE2X 1DO0A 5K8IA 2IYWA 5GVRA 3LX8A 1JALA 4RVCA 5ANRB 3UG7A 5E3HA 3TQCA 2CCGA 2C9YA 2R9VA 3MSXA 4DDVA 4OI2A 4LY6A 1VYVA 1E9AA 4AD8A 1KSHA 2R6DA 4DSTA 2F3TA 3K09A 1G5RA 2ZANA 1ESMA 1VIAA 3WP0A 2ZJ5A 4JIMA 4C0JA 2G83A 2WWFA 3BE4A 2QAGB 1ZC4A 2XEXA 5CDFA 1KK0A 2PLRA 4V0MA 4WA7A 4ZCIA 5H8WA 4IOLA 1WF3A 1W36B 3GLGE 1WBDA 1G18A 2G3YA 2OILA 5AUPB 1NY6A 2W0MA 3L82B 5AUNB 3QEJA 3J81k 421PA 3IHLA 5IDVA 4B35A 4PC7A 4O25A 1SXJA 2IXFA 4JVLA 1IAQA 2NMVA 3K0SA 1T8UA 3B5JA 2EYQA 3X2SA 5CLLA 4TL6A 3THYA 3HU2A 1RPZA 5J40A 2FA9A 1NIJA 1VG1A 2N42A 3VNUA 1G16A 4KITB 2D74A 4KSCA 2O8FA 5EP4A 4IDQA 5JS7A 3NC0C 4Q9JA 5P21A 4JT2A 3SEAA 3AVQA 3OAAD 4EIWA 1QHNA 4A6PA 1NG9A 1YKSA 1OH6A 5L8VA 2BMEA 3AKEA 3LVRE 2FNAA 4IDOA 4RCZA 2RB4A 2JJ1A 5KO2A 1IONA 2Q9BA 1J7KA 1BMFD 4HAVA 5KDOA 5KPJA 2CLCX 1XRJA 2NO1A 3WYGA 3KX2A 3BB3A 2JJ2D 1GILA 2QBYA 2PEYA 4BLSA 3T5DA 1T5LA 2BBSA 1YZGA 4P3YA 4WZ6A 4Q4HB 4Q18A 1U8ZA 3SI7A 4Q1CA 2ODBA 2GCPA 1E2PA 2RGNA 1U9IA 4FMCB 3PCRB 3CF6R 4RD3A 1OF1A 4DC9A 3N2EA 3T61A 2C04A 3GFPA 2AXPA 4GP6A 3GLFA 3RC3A 4G5GA 1FP7A 3S1AB 3TLXA 1I4TD 1N5JA 2FWRA 4Q03A 4WXRA 4JL8A 1RIFA 3FOZA 5B64A 4Q66C 1MABA 3IHWA 3GLIB 1XZQA 3T1TA 2ZE6A 3GLHE 1KTVA 1ZM4A 4HAXA 2HYIC 1H8HA 3ZGXA 4U02A 1G5TA 3UMFA 3WY9A 4NZYA 4MDEA 3GFOA 3FHCB 4I1OA 1Q1ZA 5FBVB 2QT1A 2WWYA 2W83A 2ZRJA 1SXJD 2WJJA 4R2HA 1T3HA 1PZNA 2C9OA 4K46A 4POAA 3QG5A 2QPAA 1Q0UA 2X19A 5J5CA 2WTUA 1ZINA 5EXSA 3ADBA 1ZD1A 1IY2A 2QN6A 1QBKC 1OIVA 1VCMA 3WRYC 3W5IA 4ZIRA 2QMEA 2EYUA 5CK4A 3KQNA 1S1CA 3CR8A 2KB0A 2R2AA 4PHTA 1N6PA 4A8JB 2D06A 2OCAA 3NIBA 4DT1B 4BWYA 2MSEB 1Z3IX 4FD2A 5L3VA 1E9CA 4HZUB 2HF8A 3OHMA 2D7DA 1A82A 3WXMA 3SN6A 3A4MA 5KDDA 2JJ1D 3RHFA 1NSTA 3FMOB 4NL4H 3OEHD 4CEJA 1YHNA 5BN3A 2ATXA 2VA8A 1P5ZB 3LW8A 2NIPA 1KI6A 4URXR 3NHBA 1GL6A 1GVNB 2EFCB 4Y0VA 1F2TB 2ERYA 2J0VA 4MRSA 2AKAB 5DI3A 4GSYA 4XWOA 2KWIA 3BB4A 4JBYA 4JVSB 5AR1A 4XOIA 4EKDA 4DB2A 4LDJA 3ZVRA 1EESA 2W2TA 4OK6A 1PLLA 2IBMA 2OAP1 3PV0A 3BH6A 2RAPA 2WKRA 5B57C 1NF3A 2X1VA 1GL7A 2BBOA 3H84A 2AFIE 4URWR 2C03A 2RGAA 4DIDA 2FU5C 4G5OA 5FI0B 4QGAA 4B34A 4HB3A 2ZXUA 3HYRA 1XXHB 2DPXA 1DAMA 2O8CB 2JIZD 4TQ9A 4QKQA 5HKKD 4LJ6A 2GTPA 4R9UC 5AWFC 3FWYA 4BFYA 2EFDB 5KDLA 3P26A 3T1OA 3AP2A 3HPQA 2ONJA 3OIVA 2W6JD 4FCVA 2ZR0A 4OK3A 1W7AA 3EZ6A 4M1OA 1Z6GA 1BYIA 2RCNA 5H70A 5HCIA 2QTHA 1RJ9A 1ANKA 4YQFA 1S3SA 4GI7A 4JLKA 4URVR 2WHXA 3LY5A 3W6PA 3QKUA 2P6RA 3CX6A 2ZSBA 5EE3A 4NCJA 2FN4A 1I2MA 5M04A 1W0JA 3QKSB 5HPYB 5LPNA 2HDNB 3CWZA 4M22A 3H86A 3U61B 3LLUA 1CJKC 1TUIA 6Q21A 2FZLA 4M9XA 2YJTD 3PEWA 3IKJA 3LLMA 2ZI6A 2CLDX 2CBZA 4D4KA 2FEOA 5F3WB 3HP1A 4LV5B 2BKUA 3QI2A 3CM0A 4AKHA 1HA3A 3UG6A 1X6VA 3NH6A 5DH9A 5DGXA 3WMEA 3RS7A 1JNYA 2FFQA 4L15A 4BPBA 4EPTA 3QENA 4LX0A 1VKJA 4YDHB 3QE0A 4A2PA 1EWQA 2WAYA 3LXRA 5H1YA 4Z51A 3NHAA 3PITA 3KTAB 4RZ2A 4C7OA 4MUAA 3U3OA 4A4DA 2J5XA 1GRNA 4QGHA 1N6KA 3FFBA 1U0HC 5DO9A 1DBSA 1LF0A 2H1LA 3RS3A 4BLOA 2FJUA 1VDZA 3OIYA 1E1RD 3BERA 4NTZA 1VPLA 5FOWA 4PPFA 1N5LA 2DFTA 2RGGA 1TU4A 3SS8A 2JLQA 3L0IB 3LBHA 2V1XA 3EIEA 4NMMA 2OO7A 2WWXA 1P61B 4PR0A 2HUPA 3QJYA 2ZM5A 2VQSA 4TQUS 1SVLA 5HTKA 3R9XA 1UDXA 3VKWA 3BBPA 4V0NA 2XOKA 3UWOA 4MKIA 1E96A 1LV7A 1S9DA 2VP4A 5BN4A 3G82C 4BFXA 2V55B 4KAXA 4U7DA 3WBKA 2P2LA 2O8EB 2BDTA 2CDNA 1UBCA 2F1HA 1KSJA 4YMSA 1ODFA 2OFWA 5SZKB 1M6NA 4AYXA 1W0JD 4IOJA 3LV8A 4GL2A 4TMWA 2B7BA 1IN4A 3U4QB 1NG1A 1VIYA 5G41A 3HU1A 1D2NA 3NC1C 5AJWA 4D6PA 1KI2A 3L8YA 3T34A 4EPYA 2C5LA 2CVHA 4Z8YA 3RS0A 4W9MC 1II8A 2AKYA 4ESVA 2FSGA 1HURA 4W5HA 3TK1A 2HJGA 2VP9A 2C95A 4IEEA 2J46A 3ZIAA 1N25A 1GIAA 2FGKA 1GDDA 1G21E 4OHXA 4AWXA 1NN1A 1II9A 2N1BA 4RJLA 5FI1B 5EZ6B 3L0SA 1RRGA 1JAIA 1Z8FA 1Q1EA 3W6OA 4BRUA 4UNRA 1S96A 4DIEA 4FI3C 4FIDA 3SJZA 3HDTA 1ZUNB 2GBLA 4EPVA 1RFLA 4NH0A 4US0R 3LA6A 2ZE5A 2MMCA 4F92B 3U7GA 3U2QA 4MITA 4BLTA 4KVGA 3SBEA 3ZS8A 2FFHA 2V3CC 1Z6TA 2HV8A 3ETLA 2QTVB 3SOPA 3I3SR 3BFXA 3B6EA 4TL8A 5J4LA 4TMTA 5GVSA 2A5DA 1IXZA 2ZRNA 2UVQA 5AUQA 4JBWA 1S0UA 3CBQA 2DHRA 1AM4D 2QPOA 1K5GA 3I73A 3CIOA 4QG7A 4DSNA 4ARZA 1ZM7A 4WIAA 3OFNA 4A82A 2RGEA 1EG7A 4JLOA 2V54A 2J0UA 1TEXA 4DHEA 3AVWA 1SULA 1FZQA 3EWAA 5EE0A 3PEUA 4MH0R 2ZSAA 4XSHA 5C18A 5K8LA 4XJXA 3GEEA 1E9DA 3TE6A 4EQ6B 3IIJA 4CT5A 1FQKA 3EIQA 4YONB 4M1WA 1V43A 1W44A 4RSGA 3TGPA 2QL6A 2WWHA 2F9MA 1DAIA 1A1VA 2J0SA 3UMSA 2Q3HA 1W2HA 1H8EA 2VHUA 2ZQ5A 1VECA 5HR5A 1D9XA 3QIAA 5UKDA 1RC8A 1KKMA 1SKYE 3W8NA 4EFNA 3HPRA 3A1UA 4LHYA 1AS3A 2GBLC 3EPJA 1KO8A 4L4UA 1S8FA 2UKDA 1JR3D 1UEIA 2NOAA 3KQUA 4Q9IA 4MYCA 2PMKA 4KLZA 2QROA 1Z0DA 2WOOA 1XTKA 4AURA 1E9SA 5FTMA 3QY0A 3X1DA 4RZUA 1SGWA 3NDBB 2VEDA 1UADA 1S4QA 3MMPA 1QRAA 1JR3E 1N5IA 2ZVQX 4M4SA 4ASUA 4HDCA 4W5WA 1ETUA 2ZRPA 2IXEA 4IXNA 1EGAA 5G3YA 5F9FA 2IF2A 2PH1A 3RRMA 3B13B 1OE0A 1LW7A 2F1IA 1E2DA 4DLRA 5AJVB 4LJ8A 5CB6A 2BOVA 1GG2A 1CJVC 3F3YA 3FGNA 3PEVA 3REGA 1XJ0A 4R71A 1CIPA 4CGZA 1VG9B 1AGRA 2F55A 4QBIA 1CR1A 2ORVA 2XNSA 3EG5A 3K9LA 4C2UA 3E2IA 2ONKA 4XTCS 3K70C 2ZYTX 4KJZA 5G40A 2FV8A 2C98A 3LVQE 4TLDA 4B73A 3Q5DA 2GILA 3C4JA 3OFND 4A0FA 1W4RA 2Q6TA 4TL9A 4CEIB 3ND9A 1QZXA 4LC1A 3ZDQA 2WJIA 1KJYA 5FPHA 2VHQA 4RFSB 3UWKA 3ZVLA 4LHWA 4AG5A 3EPKA 1R8SA 1EFUA 2Q0HA 1P9WA 1JJVA 1NMZA 4G3XA 1PLKA 3K70D 3CPJB 4EUNA 4HZIA 3K1JA 2ORIA 2WPDD 4TN1A 1H8ED 4GRAA 3T1VA 4BUJA 4DXAA 1G3RA 5JBQA 1XB2A 1N6OA 1Q22A 4DBLC 1XEWX 5LD2B 3T35A 2NO0A 3NDPA 4YMVA 1OH8A 1TF7A 2DB3A 4Y0AA 2GJAA 4NHOA 3SYLA 4DJTA 3WMGA 2IS4A 1E99A 3NBFA 2KSQA 3IPXA 2WJYA 4F4CA 4PX9A 3R9WA 4EPRA 4IHQA 2OE2A 1D9ZA 4RD1A 3K0CC 3U60B 2IHBA 3UMRA 4V0LA 3GP8A 2OBNA 2FEMA 3CONA 3NBZC 4LHXA 5A0FA 2VRWA 4PC3A 2IYVA 1XD8A 3GMTA 3NKVA 4PO8A 4XVQA 5IF9A 3QSYA 2H8KA 4JLNA 4FMCF 2YWHA 1FPMA 3ZZUA 1L8QA 1VYTA 3X1WA 1NBMA 3AB3A 1SKYB 1N2CE 2BM1A 2QAGC 3DOEA 4KO8A 2ANCA 5DLQC 1GSIA 1GOTA 3LRPA 2OXRA 2QZ4A 3A36A 4HYYA 4C4PA 1W36C 2HF9A 4JVMA 4PO9A 3KXKA 2G0TA 4JL5A 3S1AA 1M74A 4GP7A 4OQMA 3KQLA 3RNLA 1QG4A 2CLSA 3EA5A 4OK5A 4P4SA 5D3MB 1HT1E 2QGNA 3CNNA 5F98A 2OESA 2GK7A 1P73A 1G8HA 1E79A 1UDWA 4P0TA 3ZD7A 1E2EA 1VHLA 1G3IA 1E0SA 2VP2A 2EFGA 3KKOA 3CNOA 3TAUA 3BH0A 2CK3A 3DM9B 1Z29A 2YNMA 3OE7D 1DAKA 1W36D 5J4YA 2QG6A 1CJMA 2QAJA 3RRYA 1NVWQ 4XD7A 5FOSA 1IHUA 1NLFA 1T5IA 1FMJA 2YWFA 2HJVA 3CRVA 2JA1A 1YZLA 1W2GA 2DY1A 721PA 4HDQB 4OBEA 1SVOA 2WVJA 3QKTA 1E6CA 2GWHA 3LNCA 2HXSA 3RS5A 2Z4RA 4ACBA 1S1MA 3ICEA 1KZGB 4OQNA 2YOFA 2OFOA 2JLZA 3B82A 2ORWA 4AYWA 1DPFA 1N6IA 1PLJA 1RRPA 4OYHA 2PX0A 5C4GB 2ODEA 1MOZA 4ZCLA 4H1UA 2LKDA 3MRSA 2ZRIA 1HY3A 4NCNA 3PENA 4KBGA 5C46F 3GLGA 1XMJA 1VTKA 4A9AA 3WNDA 1G8GA 3EC1A 2PZGA 1KAOA 2AXNA 3OIWA 3H4MA 4DLWA 1OJLA 5DHAA 3TQFA 4Q4JB 3QPWA 3UATA 3W3AA 3MLEA 1GNQA 4LOAA 3I61A 1NBMD 2P5TB 1HTWA 1AIPA 1DARA 1G6HA 1YR7A 2F43A 2IT1A 4OI1A 3O8DA 4B44A 2ZJZA 4C0SA 3SR0A 1F2UA 1XU4A 1YQTA 3C5HA 3DM5A 1G7TA 4G5SA 5EJEA 2KE5A 4LGMA 5DE3A 5EXXA 1AGPA 4B3XA 3VNVA 2O8CA 1XPRA 2YYZA 2R44A 5CITA 2BJWA 2PCJA 1NIPA 1SHKA 1CJUC 4DCUA 3OAAA 2XXAB 3VR4A 3HJNA 3RDPA 3W90A 3IBGA 1G7CA 3KJGA 3F5FA 4PSAA 2CK3D 1N0WA 1UAAA 3ZLJA 3VAAA 2P67A 2GAOA 2IUTA 1P9RA 4M1YA 4PXAA 2X2EA 4A8JC 1I4LD 1T0JB 5FUWA 4I1VA 4A0RA 1MO4A 3GLIE 2R6GA 4XD7D 4BFWA 4L8GA 2GVZC 3G5UA 4YDSA 3TVDA 4A2WA 4A0HA 2ERXA 2X8AA 1TF2A 2FSFA 5F2EA 1YZQA 1GFIA 3AF4A 2ZI7A 4A92A 2QMOA 2REBA 3VHXA 1NNEA 5TDHA 5FL7A 2CXXA 3GLHA 2IYTA 1CTQA 5GJBA 2GETA 4II7A 1EFRA 3O47A 1IY1A 4RY2A 1LB1B 4MQBA 4X8MA 3B9PA 1U94A 2UZIR 3U7FB 1OYYA 2BV3A 2PBRA 4QNRA 1G8PA 1GM5A 1VG8A 3T06B 3PJRA 2IL1A 2JLVA 2GZDA 3L0OA 4BFUA 1E1QD 4G5RA 1Z0JA 5L3QB 4CRWB 1CXZA 2IYYA 2CHVA 5L3SB 2F1JA 4EJSB 2EWWA 2Z5FA 1W5SA 1SZPA 4LHVA 4AI6A 3CX8A 1QDEA 2W58A 2PJRA 4TYYA 2O0KA 2CJWB 3Q3JB 5BYJA 1WCV1 1VYUA 2YINC 2W00A 2FDCA 1P2SA 3V4FA 2GJKA 4GBMA 3B85A 5JWRA 3K0FB 4EAQA 4NU0A 1CF4A 4I4LA 4N0EA 4FINA 5DISB 3ADKA 4IVQA 1KI4A 3TVTA 2WMNB 2JLYA 1KDOA 4PQRA 3RANA 4S35A 2E9SA 4HLQB 5FUVA 5KTYA 3MG9A 1FNMA 1SVMA 5BWMA 3AKCA 1G17A 2C96A 2XITA 3BK7A 3A1WA 2J7PA 2GESA 2PT7A 3CRW1 3ASZA 2F3RA 1NJGA 1WRBA 1XXHE 4D0GA 3RAPR 3OEHA 4PAQA 1CKEA 1WXQA 3VU9B 1AS2A 4M9SA 2EFEB 2OUKA 4IKEA 3KUCA 2ZUDA 3K0AB 1PV4A 4PAMA 1W47A 4GFDA 3RS4A 4B71A 3LXXA 4KXFB 1AZTA 1F6BA 1F5NA 1RRCA 5G3ZA 1AS0A 1OFIA 3C8UA 4US1R 3LWNA 1DAFA 1WA5A 4JYCA 3TW4A 4BASA 3I62A 5FL7D 3TUIC 2XJ4A 5FPKA 1KI9A 1L4YA 2XNDD 3ZVMA 4QBHA 3PUXA 2JLWA 3WBJA 1EFRD 2ECKA 821PA 1XPUA 2JIZA 5JSZA 1J99A 4L16A 5HKKA 4I81A 5KSOA 2H57A 2ZU6A 4BZPA 4IJMA 4F7WA 2ZREA 4CDGA 1KMHB 2OFXA 4NYMQ 2H18A 3CO5A 1SVKA 2QMUA 3BAFA 5E7MA 2W6JA 4FXPA 4NCHA 2GZAA 4B2LA 3NG1A 5GJCA 1GNPA 4PANA 2HXYA 2QUZA 3NTUA 4BE7B 4V0OA 2J9RA 4CIDA 3JVVA 3QXSA 4W5JA 3C7KA 3THXA 1CRQA 1L4UA 1DOAA 4KSBA 4G5QA 5EXPA 2DCUA 3QG1A 3QF4B 4DDWA 1KY2A 1Z08A 4DUGA 1ZW6A 1NN5A 1ZP6A 2ZYVX 4IRUB 2PZEA 1KGDA 2IYZA 1QHHA 1OB2A 5AJXA 5JCZA 1DTSA 1E0AA 3QKRB 5FFMA 1G1MA 4B32A 2FG5A 2ZITA 1UKYA 3GCGA 4PC2A 2GXUA 3B1XA 5A5GA 3L43A 1XD2A 1KJZA 5AUOB 3O8RA 4B3DA 4D4JA 2GXQA 2J7PD 4P33A 1C9KA 2O5VA 3BFVA 2W2VA 3B78A 1TQ2A 2WIAA 1FX0B 2ZS8A 1NVUQ 2VL7A 3TUZC 2R6AA 3U44B 3U7HB 1J8YF 2KI5A 2ZR9A 2KBFA 4TWZA 1Q44A 4OHZA 4MRRA 2DWOA 3EZ9A 1YRAA 2QSZA 1YJ5A 2YVUA 3RABA 2WSMA 3MD0A 1N0VC 1W5TA 2C99A 2VYFA 4IOMA 1KNXA 4DLTA 3V4RA 3BJIC 1EFTA 1T6NA 1G4AE 4LPSA 5JFGA 5G53C 1Z28A 5JJIA 4BZQA 5FH9A 3B8HA 4GZLA 2AX4A 3KKMA 5EXTA 1E1RA 2QNRA 2PX3A 2DBYA 3IBYA 2IUUA 1BIFA 1O3YA 1M7BA 1XMIA 1QHGA 1XZPA 1BH2A 2ZAMA 1AA9A 1EX7A 1CR4A 2MSDB 3B1ZA 2A5YB 2G6BA 3I8SA 1JAHA 3B2EA 1JPNA 4KVAA 1HH4A 5JWHA 4GT1A 3OEED 4Q1AA 2ZVPX 2R65A 4JS0A 4BQSA 2OCBA 4DKXA 521PA 2GCOB 3FYHA 4DZZA 3K9HA 1R0XA 3AM1A 2GA8A 4IDNA 3WMFA 2C9CA 3GPLA 4QRHA 1YR9A 2IS6A 3D31A 4M53A 1E2JA 5LBIA 4Z1MD 3RLFA 1UEJA 2AWNA 3N2IA 5KSYA 2DFLA 5JMTA 1JB1A 1JQJC 2W6IA 1TAGA 2WZQA 4B47A 4CYMA 2PEZA 4L9SA 1EFHA 3AGPA 3IIKA 1SVIA 4DUGD 1XCGB 3UANA 4KI0A 1KKLA 4YXWD 3TSZA 3CKLA 2NPIA 5IT5A 3NEYA 1ZNYA 3WYAA 2K5UA 4DDUA 3SJAA 2ZJOA 1E3MA 1JXOA 4ZI3A 3P4XA 1US8A 1FNNA 1N6RA 1S2MA 3JVUA 4I1UA 3P20A 4JBXA 4N1AA 2QI9C 2Z6VA 1ZD8A 1CR0A 3PUVA 4JKIA 4LV6A 2O8BA 3A8TA 3LH5A 3ZD6A 1R6BX 2H92A 4F93B 4LSGA 4HUQB 2JASA 5BW8A 1DE0A 1R7RA 2HT1A 1IM2A 2H16A 4M1MA 2QQ0A 4DRZA 2WAXA 3T15A 3AVVA 3TSOA 2CHGA 4Q1EA 1JR6A 1U8YA 3KUDA 1RZ3A 4OHWA 3FKSD 2YWEA 2E1RA 4HATA 1HQYE 1R0ZA 4ITRC 2QP9X 4NKRA 1ELOA 2CL7X 5IK2D 3FHOA 4C9BA 3UXMA 2ZPTX 5EE5B 3EWSA 1GZSA 3EX7C 4HLUC 4QBFA 1R0YA 2CCKA 2L0XA 3QF7A 2F1RA 5EP1A 1C4OA 1W0KA 1W4BA 4I99A 4CVNA 3IGFA 1ZYUA 2YOGA 5KOYA 5JRZA 1YU9A 1EXMA 1FQJA 2OAQ1 2BKEA 2GNOA 5EE1A 2ANBA 2ZRFA 1IN8A 4IDHA 3RVBA 3MWKA 1E2IA 3FHTA 1KJWA 2H5EA 2IYLD 3AVTA 1KO4A 1SXJB 1E4VA 3THYB 2TMKA 4JKYA 2VP0A 3OIUA 3NBYC 3KB2A 4QGFA 2OSBA 1MR3F 2XAUA 5AJZA 2GF9A 121PA 3DMDA 3QXJA 5FTNA 3QPVA 2W6ID 1RKBA 4N0DA 4RFVA 3SZRA 1ZAKA 621PA 1T8TA 3M6AA 2RHDA 4MUBA 1KK3A 5CJPA 1YVDA 3SFZA 4QM7A 1CS4C 1X8JA 2RKOA 4UNSA 5D3MA 2GZHA 3W9YA 4QBGB 1R10A 4M21A 5DYIA 3AP3A 4DCSA 2IYSA 2ZRHA 2PMDA 4Q7KA 5ELXA 1JR3A 2Z43A 2VHTA 3IQXA 3ZS9A 4C0AC 5FTLA 2QBYB 3QUSA 5LD2C 4P4TA 3SHWA 3U6BA 4IVRA 2X77A 4JMPA 2FPKA 3BC1A 3WHLA 1KI3A 1RYFA 4L9WA 2ZRGA 5DI9A 4LJYA 3SBDA 1GRQA 4F4IA 3U6KA 3GLFB 1OXTA 4IFBA 1OH7A 1Z6AA 4HLCA 2OCPA 3CW2A 2VO1A 4JLDA 3LX5A 1KI1A 5EZ5A 3ZYCA 2FOLA 3DKVA 3T5GA 1CR2A 3THWA 5L3RA 1R4AA 4NPHA 2BCJQ 1Z0IA 2HCBA 4NONA 5FBQB 3SQWA 3BXZA 4RD2A 1KO5A 1VCOA 1E2QA 1W0KD 4RKEA 3VX3A 4KHZA 1OKKA 4CEHA 3ADDA 4MYTA 3SU8A 1P2VA 4NYJQ 1VG0B 3TUJC 2ZJ2A 4MYUA 1XEXA 3AQ4A 1N0UA 4HDOB 5KSPA 1Z07A 3H2YA 3TBKA 3E70C 4LYAA 4EPXA 2PLFA 3EZ2A 3AF1A 2WV9A 1FFHA 1QF9A 4DEYA 4CF7A 4LJ5A 1MKYA 3F8TA 4UNNA 5FPTA 1G7SA 4ZIRB 4QXAA 1IOZA 2WPDA 4NYIQ 1YZTA 3EASA 4D2IA 5KPDA 4XWAA 2GJ8A 2QU8A 4JSTA 2DR3A 1Z06A 3M1IA 4B76A 1UBEA 4UNQA 3OF5A 1G41A 2V7QD 1NVXQ 2ZS9A 4O2LA 1BKDR 1D8TA 2O52A 4HB2A 5CYOA 3T1QA 4Q7MB 1KI6B 1KNQA 3LD9A 4XVUA 1XBTA 1F3OA 2ZS7A 2Q9AA 1ZUHA 1X1SA 5DI3B 4QJ3A 2LWIA 2BM0A 3DZDA 1BYUA 3EZ7A 4QJ5A 1R2QA 4ZI2A 1OHHD 3IO3A 2XZOA 2JLXA 1TTTA 4MGKR 1D2EA 1XTIA 2JAQA 1X1RA 2YHSA 2PT5A 1RRFA 1ZCAA 2C2HA 4ZDIA 2LCFA 4Q4AA 4DCVA 4BLPA 2CEAA 2AFHE 1XX6A 1W4CA 4TYPA 3KKPA 1XP8A 2FPMA 2D2EA 3WNBA 4ZDJA 1D5CA 2IYUA 3LQQA 3AUYA 3I32A 3K0CA 3L2OB 4JT4A 1U98A 1CU1A 4V0KA 2JATA 2A7QA 2N46A 3EA0A 5J47A 3EAQA 3SJCA 1ZVQA 5E4FA 1U81A 2V1UA 4M8NE 3RWMB 4GNKA 1PJRA 3I5XA 4FN5A 1NVVQ 3FDIA 2NG1A 4YMWA 4DVGA 3MWLA 4G0NA 1OKKD 2V4ZA 4AG6A 4KU4A 3AVYA 1RJ9B 2PL3A 1FP6A 2QAGA 4NDZA 5H68A 2QA5A 1CLUA 1WBBA 3OE7A 4A0GA 4EJSA 1E9BA 4DLSA 3AVUA 3R20A 1XCPA 1NRJB 4ZPXA 3MJHA 4Q01A 4BLQA 3EIHA 3LW7A 2J41A 1JQLB 3PQCA 3L0PA 4AY2A 4Q21A 4PZLA 4E03A 4ZKDA 3P4YA 2OV2A 4H1VA 4B74A 4TZ6A 1M7GA 4TQAA 1DG1G 1ZIPA 2X2FA 2FPLA 3LQRA 5C1BA 3GEIA 3AF0A 1KMQA 1T3LA 1NVVR 1HUQA 3K9GA 1GAJA 1KAGA 4K81B 3A58B 2GRJA 2WIBA 3MJRA 3T12A 2YV5A 3QBTA 3BWDD 1FTSA 4MDFA 4XSGA 221PA 1Q21A 1Z83A 1NN3A 1ZRHA 2B92A 4JYBA 4C7OB 3P1JA 3CB4A 4KV9A 1XTRA 4PZZA 5EUMA 3VU9A 5B30A 2CL0X 2AK2A 3WP1B 4B6EA 2CCJA 4LJAA 5TARA 3EC2A 4ERNA 1YZNA 5K8UA 2GKSA 3ONWA 4WZAE 3Q9LA 1MO3A 4Q4HA 4TTRA 2I1QA 3IIMA 1PVOA 2QORA 2OHFA 2ATVA 3FPAA 2NZJA 2OBMA 3QVVA 1NI3A 3LBIA 3KQHA 4TYNA 2ZAOA 3A1SA 2ZYWX 3WYFA 4EJSC 1YZKA 2A9KA 4HAYA 4U5XA 2ZRMA 2IYQA 3KJHA 3PUWA 5GADl 1W48A 2YOHA 3CZQA 2V9PA 4HB4A 2IWRA 3GLIA 3VTKA 2P6UA 2OZEA 3R7WB 1KMHA 1Q57A 1U0LA 4QHSA 3V00A 2DFNA 5IRCD 1XD9A 2D2FA 1N5KA 2R6FA 1E94E 2BC9A 2WWGA 3PFIA 1ESNA 2EFHB 2RGDA 2J1LA 1IQPA 5KU1A 1OT3A 4P31A 1M1YE 2OM2A 1ZNXA 3DVLA 1D6JA 1QG2A 4C30A 1P9NA 3IILA 1JPJA 3CF2A 1KY3A 3CPHA 1AN0A 1KO1A 4TMZA 4PPGA 4KFUA 3QQ5A 1OIWA 1II8B 4WW0A 1VHTA 3RC8A 4RCYA 3BS4A 4P4UA 4HLDA 5JI2E 3GJ0A 3FB4A 5LDDC 3SE0A 4E22A 3QOFA 4A8JA 4GPTA 1COWD 2ZJBA 4QOSA 4HI0E 1M8PA 4DT1A 2O8DB 4X8HA 2BMDA 4HZUA 2G77B 2O0JA 4NP6A 2Z83A 2JCSA 1DELA 3SJBA 3FE2A 5AK0A 1A2BA 2G0NA 1EFCA 4FWIB 3K8YA 4Z8XA 4KCGA 3FKQA 4EFLA 3PG5A 3KKNA 1Z22A 2AHOA 1E1QA 1F2TA 3NVAA 3TNFA 3KFXA 3NH9A 1IXRC 2ZRKA 4DLYA 2WSSA 4AC9A 2QRNA 3QBVA 3D6TB 3CH4B 2IS1A 4TLAA 3AVPA 1R5NA 4HUTA 4PC1A 2FF7A 2BVNA 3DOFA 5HE8A 1TL7C 2GDJA 3HR8A 4ILEA 2BBWA 3DMNA 4LPKA 4CT4B 3TJZA 3A1VA 4O2RA 4Q48A 1B23P 4ARZB 2P65A 1XXHA 5KYKA 2NO9A 5BXQC 3VMFA 1VCNA 1R5BA 2NZ8A 5IHPA 2JLUA 4Q1BA 2J0UB 2IS2A 3U3KA 3HU3A 2IF0A 2J59A 3WRXC 4M9ZA 1G64A 1TU3A 1LF5A 2GCOA 2GXSA 5HCNA 1GKUB 4QNMA 2OLJA 3GJ7A 1ZCBA 4JLJA 2ZUBA 1R0WA 2JEOA 1N6LA 5CYPA 5FPSA 1SKQA 2A5FA 1WMSA 2I3BA 4M2LA 3R9IA 1HE8B 1GITA 4B6FA 4AKGA 4ACAA 3B1WA 4EPWA 1OXXK 5DIFA 4ABYA 2UZ3A 2GHIA 3H1TA 3QKSA 1ZM3A 5BYKA 3DPUA 4EDHA 1GKYA 1G3UA 5FOVA 2WWWA 1DG3A 1JEDA 2ZJAA 2RGCA 2P5SA 1IJEA 3GFTA 4TMXA 2VPPA 3GJ5A 4TL7A 2QENA 1OIXA 2ASEA 2OLKA 4ZDKA 2HYDA 2XNDA 4KFRA 1R8QA 4J0QA 3SFVA 2QEQA 1ONBA 2GEVA 4PO1A 2XZLA 3MFYA 3MWYW 1XJCA 3VR3A 1KDTA 1KO7A 1K5DA 2QPTA 3KJIA 3NWJA 3KKQA 1NMYA 5J4KA 5JEEA 4Q47A 2BMJA 2XGJA 2WOJA 1NKSA 1Z2CA 4MRNA 4E07A 3W34A 2ZI4A 3TR5A 1TQDA 3ZQ6A 1FOEB 2ZE8A 4JJKA 1KDPA 3VX4A 1OXSC 1XTJA 4B3FX 3G0HA 5SZHB 3AF2A 1WB9A 1DS6A 2WSSD 4FMBB 1E2FA 2QP4A 3KXIA 2QQEA 3KTAA 4BECA 3X1ZA 1X8KA 1RVDA 2WBLC 2B8WA 2VP6A 4NCIA 2ZSEA 2QM8A 2A78A 4AKEA 4UXJA 1A5TA 4HEJA 1ZJ6A 1MV5A 1AK2A 5TXGA 4Z54A 1MO5A 3CRMA 2VSFA 1LNZA 3ADCA 2EWVA 1PUJA 3P27A 4LYFA 1M7HA 2WKPA 4BFVA 4IDPA 1KK1A 4GMXA 4Q1FA 2VHCA 1FMLA 2J45A 2CMKA 2WICA 4F91B 4YC7A 3VR5A 1XPOA 2I4IA 3CX7A 3VR1A 1JXMA 1UFQA 2IEYA 2NGRA 1W46A 5KNCA 2JDID 2NO6A 2OG2A 4B2IA 3AF3A 4Q7LA 3U3JA 1DEKA 3AEZA 1FUKA 3VHLB 3RYTC 3GJ4A 3K53A 4N3NA 4QHYA 4WOPA 4A36A 5LB2A 1ZBDA 2XJ9A 2IA5A 2VTKA 2FX3A 1Q3TA 2ZRLA 3AGQA 2EVWX 2D7CA 2G88A 1TADA 2O8EA 1DAGA 2CE7A 4UJ5A 2HLDA 4QGGA 2V8OA 2WWIA 4QL3A 3L8ZA 3THOA 1MRNA 3TSWA 4G01B 1Z63A 2ZRCA 4UXIA 3U4QA 1P7CA 4MRPA 1SVWA 1SQ5A 3MCAA 1E2GA 2D4HA 4B33A 4C0HA 4TTPA 3RWOA 3BRWD 2XSZD 1X86B 2D3WA 1O87A 5A4JA 1N6NA 4B43A 3ZVNA 2VSXA 1XTSA 3RS2A 1E2LA 1MH1A 3N70A 3AVOA 1KK2A 1HEIA 3K09C 4DLZA 3OEEA 5DHFA 3DDCA 4MKFA 4GOXA 2ZROA 3IDQA 4JLAA 2YKGA 1CJTC 4YMUA 1UKEA 4DSOA 1E0JA 3EXAA 4DCTA 4FW9A 3REFA 3FMIA 3M4YA 2ZEJA 3C15C 4Z1MA 5DSZA 4TSFA 2GK6A 4IFEA 4Q5IA 1AJEA 1WDTA 2H17A 4M1SA 2REXB 1NLZA 1E9FA 4KBFA 1S9HA 1H65A 1X8LA 3JZAA 3B60A 2ZJ8A 1NJFA 2BWJA 4P4SB 4AYTA 4WAUA 1Z5ZA 1Z6XA 1SXJC 1QHSA 2PCLA 4FCWA 4RD4A 4YXWA 3SC3A 1QVRA 3Q5EA 4R7ZA 3I1FA 2BEJA 4LCBA 3PXGA 3U3RA 1BS1A 3EZFA 5FR2A 1P60A 1W49A 2IEZA 2ZI3A 4DLXA 1LTQA 1GRRA 2YC4C 1ZM2A 1G3QA 1G8FA 3AV0B 2A5GA 1ZD9A 3Q8XB 4HSEA 4KYIB 5AJYA 4ZKEA 3R8CA 1Q20A 3B1VA 4BFZA 4NYMR 2OT3B 5JJKA 1FUUA 5CDFE 4LBZA 1BOFA 4Q7JB 4GOKA 4V0ME 3IPYA 2D62A 1JECA 3U3MA 3SYNA 3ASYA 3IO5A 4LRWA 2W2XA 4R98A 3SDZA 4EQ6A 2C78A 5FOXA 2QE7A 1XFAA 5F9HA 3TKLA 2A2ZA 2HLDD 5FUYA 1FW6A 2VH5R 4KLNA 1DO2A 1TEVA 1Z47A 2A3RA 5TV2A 1SXJE 3FKSA 4DSUA 1U99A 3BGWA 2QMHA 1WQ1R 4DCNA 5CLQA 5KNBA 2A5JA 2GJSA 2BCGY 2QSYA 3I92A 3GLGB 5IK2A 3BFKA 4LWZA 3HR7A 3TMKA 2RGNC 1U9IC 2VLIA 1MT0A 3SHFA 3O8CA 1QHYA 2ZI9A 3AH8A 4JL6A 4US2R 5CIWA 2YWGA 5B2ZA 1NY5A 2AD1A 2FZ4A 5JCPA 1E4YA 1J2JA 1EWRA 1ZNWA 2B21A 2OEPA 2P0EA 2AK3A 3QXXA 4LI0A 4ESHA 3F0TA 4IW3B 2R8RA 4M9QA 1JBKA 4GDFA 3N5CA 2F43B 2Z0MA 4Q02A 3E5HA 3LO5A 4D4MA 4HLUA 4Q19A 1F2UB 4MRVA 1E2KA 2V6IA 4RZ3A 5SZJA 3SYKA 4TSFD 4BLRA 1P2UA 1CEEA 1R5OA 3MUFA 4I1SA 4D81A 3DKPA 2Q21A 5EP2A 1OFTA 3GEHA 4S2EA 5FUXA 2FE4A 4TZ0A 3RSLA 1E2NA 1H8HD 1XMSA 2G9NA 3A37A 1XDBA 5DN6A 3GLFE 2GXAA 1CRPA 3GJ6A 2GVDC 2VBCA 2GEUA 3K0EA 1DAHA 1Z2AA 4LBWA 1DAEA 1G20E 4IEIA 1G291 3AKYA 3MWJA 1L2TA 3A4LA 4CEIA 2A30A 4O0MA 3IUYA 3QXHA 4RFSA 4HB0A 1ZU4A 5KNDA 1QHIA 1ZUIA 4UQOA 2HCJB 1P6XA 3A4NA 3IEUA 3K9NA 1RE0A 3GJ3A 4URYR 1LS6A 4QM6A 2QE7D 1Q3HA 1KSFX 3GLHB 3ZJYA 4A6XA 5HZKA 4OQLA 1OW3B 1I2DA 2VHJA 3B7GA 4QHTA 3KXLA 4PFSA 2ZIAA 4CZ2A 4KODA 1KZ7B 1C1YA 3KB1A 3C41J 2AWOA 3B1YA 3ND8A 4DDTA 5TB5A 5J4HA 1YRBA 1E0KA 2O0HA 4P32A 1HYQA 4RD6A 1QHXA 3HWSA 4LV8B 4FCTA 4C3ZA 3QXCA 4TMKA 2ZRAA 2JGNA 2XTZA 4MKHA 1VCIA 1T3SA 4QFMA 1A2KC 4JSYA 3I72A 5BQ5A 2VSOA 3AVXA 1KYIA 5LB4A 3CLVA 1TX4B 1DADA 4RKFA 4JJZA 1TMKA 2WJGA 2ZRBA 1Q1QA 4E5UA 3TW8B 1ZNZA 3CUEF 5FBLB 2F6RA 4OL0A 4PHHA 2O8FB 2ZTSA 4R2IA 1XEFA 4UNPA 3TIFA 1G9XA 5DNYB 3CRRA 4FMDF 2BEKA 4UJ3A 1YR6A 1KI7A 5EQTA 3BIFA 5FOUA 2V7QA 4Q4LA 5DN6D 4OI0A 4QJ4A 4WZBE 2QGZA 1B0UA 1AQUA 1UPTA 5HE9A 3VR2A 1NLYA 2E87A 3R7WA 2IWHA 3TAHA 1LY1A 1TQ4A 1A4RA 1KSGA 4TLCA 2HEIA 3C14C 1U2RA 4OJKA 2ZRDA 1OHHA 1TNDA 1OXVA 1IXSB 2OCYC 4ZV4A 5JRJA 1P3JA 3ZZTA 2Q3FA 2ZE7A 4B2PA 2ZUCA 3VFDA 3KQKA 3D8BA 5FTKA 4PQYA 1ZC3A 2J87A 5TVKA 4WVFA 1Z0KA 2LKCA 1MO6A 5EE9A 5FR1A 4D80A 4LYHA 5E7JA 4BZXA 2WJVA 4L5BA 4MGZR 1NSFA 3PIRA 1IN6A 4AIIA 5JSZB 3Q7PA 5C2JB 4ZCMA 1KOFA 1MABB 2AN9A 4NE2A 4LUCA 2NO7A 1JJ7A 1GP2A 3NBXX 2O8DA 5JI3E 2QRZA 3ZH9B 5GJWC 4V02A 2XB4A 5KHOC 1Q12A 1G5PA 4DLVA 4MGYR 2GEDA 2WKQA 5KSZA 4URZR 4LBYA 2RGXA 4ZO4A 1EX6A 2B6HA 2FGJA 2YC2C 1ZU5A 1N6HA 1Z0AA 1DVRA 3THXB 4JZKA 1E2HA 2FH5B 4H9GA 5JS8A 1IY0A 3KZ1E 4Q9KA 5SZIA 1HV8A 4LJ4A 4Q4JA 5FOTA 3GQBA 4M1KA 2QY9A 1U90A 3QPUA 4OI4A 2J7KA 3ZZ0A 1UBGA 2PJZA 3BB1A 1AZSC 4GOJA 2YZ2A 1NN0A 1QHHB 1OXUA 3Q7QA 4D0LB 1F60A 4LJ9A 5JEDA 1N3BA 3AKDA 4TTQA 1IN7A 4AK9A 1TPZA 1XD2B 4XVRA 1XMVA 3PUYA 3X1YA 3DO6A 3I8XA 4PHGA 4UKDA 2QTFA 4GMDA 2XOKD 1E98A 4XTRA 2XXAA 3IEVA 3ICQB 3VKHA 5C4MA 4CEJB 4NYJR 3Q85A 1OB5A 3TR0A 1SHZA 4XH9B 2SHKA 3X1XA 4OKSA 2RHMA 4DB4A 1E69A 4PTLA 2IHYA 4DLUA 1OSNA 2IXGA 3I4LA 1ZIOA 4WBSA 4MGIR 3PUZA 1HQCA 3UPUA 2ZI5A 1OPXA 1LVGA 2VP5A 2ZU0C 2ZETA 3P32A 4LYJA 3CH5A 5CIQA 2GCNA 2KBEA 2NTYC 4C0KA 1RYHA 3FVQA 5FBRB 2FMXA 4NYIR 4OHVA 1GL9B 3ZIAD 4TYQA 1Y3AA 1WP9A 2VIIA 2P6NA 5GJVC 1NKTA 4BEJA 4IOKA 4OQXA 3VKGA 4B75A 4MYHA 5FTJA 3OESA 1P72A 3GJ8A 4LZZA 4MKGA 3W6NA 3RRNA 2NQ2C 1F48A 3CNLA 2FFBA 1GKIA 1M2OB 2J0QA 4PPNA 1SVSA 2G1JA 2IW3A 2HT6A 3CRQA 2EQBA 4MA4A 4PPQA 1GNRA 1FTNA 1TUEA 1CP2A 5L3QA 4A15A 1NMXA 1JEEA 1D2MA 1Z0FA 2GJ9A 3CWQA 1YE8A 4TLEA 5L3SA 3BH7A 2REOA 4QC2A 1U0JA 3H0KA 1UKVY 3W5JA 2BIFA 4W7SA 1UM8A 2V6JA 3LAWA 3RRZA 4TMVA 2R6CA 1ZM9A 3GD7A 2I1VB 1G19A 1G8YA 4TLBA 4C0BA 2RGBA 1FL9A 2CJWA 3U7EB 1PUIA 3TRFA 5BN5A 2MSCB 1US8B 5HZHA 4Q1DA 3K0FA 2O8BB 2XZPA 5EUQB 3C16C 1E9EA 1S3GA 2PZFA 3U5ZB 2XB2A 2B7CA 2FFAA 5TMPA 1OV4A 2VF7A 4F4JA 1E9RA 1COWA 1HT2E 2BMFA 8OHMA 3PVSA 2RH5A 3PEYA 1GWNA 3GJXC 4GZMA 4O3MA 1OYWA 3UIEA 2WM9B 4KFSA 5JLJA 4Q9HA 1XF9A 4NCKA 1K8RA 4JLVA 1QVAA 4ON9A 1T91A 1P75A 4XWKA 1I4DD 2ZSDA 3E1SA 4RZXA 1W1WA 4G1UC 2W0SA 1E2MA 4JLMA 2Q3MA
chains in the Genus database with same CATH superfamily
5KYXB 4MUEA 1SBYA 3CF4A 2EW1A 1LVUA 4D9CA 4EL0A 4YQEA 4QUJA 4P98A 3AYZB 2PMWB 1ZNQO 2FEKA 2B0CA 1D7AA 1G55A 1K9VF 3KKEA 5J9FA 4GOOD 4O2BF 5CFNA 2IU0A 1A71A 4Y30A 2F9LA 3NV9A 3LHFA 5JYEA 5H7XA 2BGWA 1T1JA 2F7SA 5KHLB 1Y6RA 2G4CA 2Q1WA 2VRCA 5HSGA 2CDBA 3QYAA 3KE9A 5KX5B 2VLBA 3FVTA 1USUA 1U2ZA 1Y9EA 3NJRA 3O2SB 2AMFA 3PNLA 2ZWMA 1OI7A 2CXQA 1JAXA 4HBGA 4U00A 4JQOA 1ONPA 4D99A 4ZXFA 2HMYB 4YACA 4AKIA 5JAZA 4PSVA 5JS2A 4U2DA 4IDDA 4ARUA 1VE7A 5H9VA 2JLRA 1ZOSA 1XWIA 1P4SA 4LJ7A 3NTQA 4GIBA 4DBLE 4DR6B 1AD2A 2MHCA 1J2TA 2FZKA 1IWPB 2P3SA 3DVSX 3UJCA 4DEXA 4E51A 1QH1A 1VL0A 3W4KA 1ZFNA 4U7FA 3N2GA 4S0XA 4OG2A 2C77A 1N1EA 1B6RA 2DE0X 2JI7A 4G2NA 1EXNA 4LN1A 3VHRA 2IYRA 3WRXA 4BJ5A 1XJQA 4ZYLA 5HQTA 3OA2A 3ZE7A 1QXSA 4TT3A 3DKIA 2B9EA 2G40A 3BORA 5A3JA 4PHFA 4Y2PA 3R8FA 4JVNA 3RVDA 3AHJA 2IX3A 3VTZA 3H3XA 4TXMA 1GZHB 1OA0A 3W3ZB 5KWSA 1HE2A 2WKWA 3QKRA 4G0YA 4CDRA 1SVNA 2CDCA 1YO6A 3S2GA 3N8IA 1G6OA 4RBNA 5KTSA 4LBVA 4AMYA 1MC5A 3AC0A 5HNKA 1UC8A 2JEZA 4O4HF 1TF5A 4JT9A 5CHYA 2EC5A 2QP3A 1UMDB 4ZQFA 4DR2B 3U44A 1YZUA 4NV3A 2ZUTA 3W8EA 1NW9B 4L85A 4KDRA 4RKQA 1X3SA 5FPYA 1TJ3A 2EXXA 1OFHA 1RQNA 1SD5A 2QM7A 1T2FA 3V2HA 3WAKA 3ITDA 2VAPA 3KM0A 4BFTA 3U19A 4XYMA 1VC2A 9LDBA 1QS0A 3KFVA 3WHKA 1OBCA 5KBYA 1Y63A 4Y6QA 1LS1A 3C43A 3THWB 2MMGA 1UDBA 2OUIA 5E95A 3CF0A 2CSXA 2FPSA 4YLGA 1UKZA 1DQRA 1UF9A 4BRWA 1ZISA 2ID8A 2DRIA 2OBLA 2WLTA 1JH9A 2WVGA 5CB8A 2H2IA 1KU0A 3TKYA 3W8RA 5KOJB 1P77A 4X8OA 1DBWA 2PX2A 4PG5A 4M0CA 2IUSA 4UVDA 5DTJA 4QOJA 2XX3A 1D5WA 3EARA 5FWDA 2RAVA 3RPEA 5KIAA 4G0QA 1ENYA 2BAGA 3MGAA 4W9NA 3UJNA 1K3UB 1T4GA 3E1KA 1N1MA 2QT0A 3UH0A 5C8YF 1Z6YA 3SC6A 4OMFG 4D8TA 3CKMA 2SCUA 5DU2A 1X0XA 2WNHA 3BSWA 3D7MA 5CBPB 1NVEA 3QH4A 1YKGA 3CJRA 1RADA 1PZXA 3Q9UA 4OL9A 4RY9A 3L5OA 1ST3A 2YNMC 3GRUA 1WR8A 2VOJA 3DOUA 3OMLA 3ZWBA 4K8OA 1KY4A 3G9ZA 1BKSB 4P84A 4PAOA 5JZSA 3M4JA 4PTZA 3OLQA 4FGZA 3EDOA 3NEJA 5D85A 3DULA 3RBVA 4OM7A 3T1NA 5AFSA 3UKDA 1GU7A 4A0SA 3DZ8A 4BGDA 2QRLA 2AXQA 3HXLA 1PGOA 3R09A 4NXNB 1ARZA 3ZWCA 1AKEA 4U2GA 2H7VA 2J5KA 4Z9YA 3OQJA 3TH5A 5D3QA 4KYUA 5EWMB 3LYLA 1RW4A 5H16A 3C6XA 4WXMA 1CULC 2CVFA 2XSZA 5EP3A 3WRVA 2IGTA 2AR0A 2Y77A 2FWNA 3BCSA 3DXYA 4OAQA 1G3MA 1N2CB 2HPVA 4N3CA 4P53A 4QPPA 1NL3A 4RJIA 3TL6A 4BEBA 2ESRA 2Z08A 3FFAA 4IQ0A 5LMCA 3NB0A 3KSBC 1LFDB 1EAMA 3BD9A 2NVBA 4OUDA 4YX9A 3ID6C 3C3YA 4Z4CA 2H5LA 4YRQA 5G4KA 4KUHA 3ANYB 2WF9A 4HUQA 4RPHA 5BMVB 3BDIA 4DFDA 5BSMA 4TVBA 4DANA 1M2HA 2PFGA 1LBHA 4QAQA 1OGYA 3CISA 3DC2A 1RAEA 1VIVA 4CFSA 2PX8A 2IXTA 4WN3A 3PFHA 5KYWB 5CAEB 3PJFA 4RVCA 1JALA 5F7ZA 4QQKA 4DA8A 3V42A 3AI7A 4GG1A 1J09A 2C9YA 2H9YA 4W9NC 3WB1A 4JELA 1TCCA 1L7EA 2HY7A 4MLDA 4JK3A 1GPKA 4NR0A 1E9AA 2YYAA 3R4VA 4A5OA 3VC1A 4RTOA 5JZBA 2ZXEA 3VH4A 1XZHA 3C3PA 2VZEA 3S68A 1VIAA 2D5CA 2XYVA 5I9IA 5J2TB 3IAS1 1OTXA 4JIMA 4HNSA 3PGVA 3MMNA 2WWFA 1SOAA 4CLHA 1O0BA 5CDFA 1DEAA 1Q92A 2XEXA 1ABBA 3PGXA 4MJ7A 5JO0A 4ZCIA 5TC4A 1E3IA 1UXIA 3DBRB 1AKQA 3GLGE 1SY7A 3G0BA 1I9GA 2OILA 2R4TA 3RS9A 4EVQA 4E3WA 5AM2A 1ISSA 2IDJA 5AUPB 3OU6A 5C8XA 3QEJA 4BVBA 2I2DA 4ED9A 2X5XA 2GKOA 2QMYA 4K5QA 4R2XA 4UAVA 5IDVA 3RSQA 4NECA 1XTTA 2HK6A 3SGLA 1IAQA 1HM5A 1UINA 2HQBA 3K0SA 3X2SA 4QJBA 5CLLA 4DIKA 4J90A 2QTBA 1FSFA 4OHPA 5BW5A 2FA9A 3FHJA 2I55A 3H65A 4LUCA 4R69A 2JS7A 3GGDA 2AN3A 1UFRA 2YRWA 3ONFA 3PTLA 2ZDHA 4GMGA 2A6PA 2VDJA 4GQAA 4IDQA 3KV1A 5A2GA 4QPDA 5P21A 1YASA 5BOSB 1C7FA 2BHLA 4X90A 3SEAA 1G8AA 3E7DA 1UOQA 3FA2A 3OAAD 2VJAA 3ZGLA 4WGGA 1U0RA 2XDQA 3B3GA 4MUKA 4X1IA 5DMHA 3BXXA 3HNPA 1OH6A 2ZLBA 4EHAA 1FJGB 2H06A 4AJ2A 3AKEA 2FNAA 4G25A 1ESDA 3KEMA 4J1QA 5CXSA 4O5AA 5KO2A 3RJZA 1GUDA 4B4VA 4INOA 2Q9BA 4ZT5A 3UF0A 2PWPA 1J7KA 1K4KA 4HAVA 1GNVA 4NIMA 4KPUA 3AZQA 1XRJA 2CF6A 3MGBA 3KSRA 3WV5A 3F46A 2OV4A 3HKDA 3LPMA 4G1MB 3USZA 1GRVA 1Z15A 2OCLA 2Q9UA 1KMCA 1Y8RB 4P3YA 4PZCA 8GPBA 5B7GA 4NEQA 1QLJA 3UXEA 4XARA 2RGNA 4EI7A 1I13A 4FMCB 4TWIA 4X66B 3VC7A 1PX2A 5ARDA 2NUAB 1NP3A 4N5HX 1JKJA 3ZY4A 3GLFA 1LRJA 4N76A 2QRGA 4WXRA 3U31A 2H11A 3ONNA 3N0XA 4LXTA 2QZPA 1Q2UA 2ZJ0A 4ZK6A 3WGTA 4Q66C 4E1BA 3GLIB 1UT8A 3EB9A 1XZQA 2IODA 1G20A 1UKCA 1KTVA 3L1IA 3QLUC 4GEKA 5AI9A 2X4DA 4CE6A 2G0AA 1VB5A 1FP4A 1H8HA 1X1AA 2I6GA 4HAXA 4U02A 1ZJ4A 3QA9A 1Y98A 1H3FA 4NZYA 4ZZ0A 2HTFA 3HSKA 4BOYA 3A25A 3IX7A 3U56A 5EI5A 3FHCB 3F2IA 3OZVA 5HIMA 3VI4B 3AOGA 2XECA 3SLGA 5BR1A 5FBVB 4GZ5A 2I62A 2W6PA 3ICOA 3B36A 3DG9A 2WJPA 3FM9A 4YXFA 5B7NA 2WJJA 2JANA 1XK7A 1T3HA 2C9OA 1SHTX 4POAA 3WLEA 5LQDA 2X19A 5J5CA 4OFXA 5L9AA 5EXSA 2V5UA 3JQEA 4A5SA 1I0ZA 3M9XA 5BUQA 3IXLA 2HU8A 1GYPA 1VCMA 2H07A 3A2NA 1NM5A 2EYUA 4IIJB 5CK4A 4XLZA 3KQNA 1UPFA 4ZOAA 3CR8A 4PHTA 2R2AA 4JWKA 2MSEB 4FD2A 1ZGBA 2I6QA 1W29A 1E9CA 2PD6A 2QVBA 3OHMA 3ZWDA 5B3JA 2D7DA 1JV2B 3WXMA 4LW8A 3A4MA 4A3SA 3FCUB 1MW9X 4XWWA 3AIOA 1NXWA 4RF3A 2HA2A 1KZ6A 3FMOB 4RV4A 3OEHD 3VDNB 3NIWA 3NANA 2CB0A 3VJKA 4CEJA 1ZIXA 3LIPA 1KI6A 1N32B 3NHBA 1GL6A 2QN8A 3PYXA 1KYWA 3R9KA 3THSA 1YMQA 3DAHA 2J0VA 2AZMA 1K3FA 2NNLD 1VBKA 3E4CA 3OCUA 4MRSA 4RKRA 5DI3A 4RA9B 1YAHA 2IKSA 1FA9A 2OYSA 1A5ZA 4Z5XA 2FP4B 1Z8HA 4LTNA 3J80A 2FHPA 4DB2A 1K63A 2TECE 1PLLA 3R3ZA 3BH6A 2V7PA 4BHTA 4A73A 5CVUA 4DVJA 1CIJA 3HDVA 5NLLA 5TX7A 1C3EA 1IK4A 2Y0EA 4QGAA 1P7YA 2AIRA 2GPJA 3C0KA 4LGCA 4WZBA 4ODIA 2DPXA 2R1VA 1N4AA 2IELA 1S8NA 2JIZD 2P2CA 2NYUA 3JASB 4PG6A 3WB9A 1NI4A 4QKQA 2PV7A 5HKKD 4GKKB 3OLVA 1V6AA 1GFSA 4R9UC 2H63A 3Q7SA 4UUAA 2GM9A 5EQJB 3BJZA 3AP2A 1PT6A 2XWQA 3HPQA 2CZCA 4KK3A 3S8MA 3BHNA 3OURA 1G0NA 3DDOA 3D81A 1W7AA 2NZWA 3FOFC 2NSYA 1P8JA 3KALA 5U1PA 5ALSA 3V4LA 1QZTA 1UC4B 2PH3A 2QTHA 1RJ9A 2YIMA 3F4KA 1LFAA 1S3SA 3NOVA 4N6GA 5DZSA 4YQFA 4JP5A 4JLKA 4BKUA 2WHEA 1VP3A 5H02A 2MYNA 4URVR 4CQNA 2OR3A 5HZGA 1DEXA 3W6PA 2EATA 3RI3A 2P6RA 1YB1A 2VOEA 4OCZA 3HMQA 3CUKA 5M04A 3QKSB 5A0TA 1N2GA 1RP7A 1Z82A 3VGPA 3F1KA 2HDNB 3CWZA 1U2QA 3P5BA 3ZHBA 4GKVA 2VCEA 3PHGA 6AT1A 4BYGA 4IXWA 1AE1A 3LLUA 1WDKA 1BWQA 4E4RA 4LF5B 1JA1A 3VYVA 5LMNB 5HFAA 2CNKA 2UUAB 3PQ4A 5H4HA 3C7CB 2O6LA 2FZLA 1GQFA 4RDIA 1JTFA 1R6XA 3GGPA 1FJXA 3IKJA 3LQKA 2ZI6A 4ZAFA 1LPPA 4MIEA 2MU1A 1WCWA 4MUHA 4W5OA 2VH1A 2QN2A 3LUGA 1RXWA 3QI2A 2OPHA 1L5WA 4AKHA 1HA3A 3FRJA 3OEYA 3AEKA 1W6UA 1QIMA 2R60A 1QO0D 5DH9A 1UKAA 2NTNA 2B37A 1L5SA 3WMEA 4FB4A 4BPBA 1L0BA 1EPUA 3PQFA 1N8NA 3QENA 2ZKLA 2QW0X 4M49A 1JSZA 5LQRA 2YV4A 1J9ZA 4YO7A 2Q50A 3UENA 1EWQA 5H1YA 5H9WA 1JVSA 4MUAA 5EJ6A 1S8OA 1GRNA 3NI2A 1N6KA 4QGBA 2C9DA 2NT3A 3FFBA 3KQPA 1U0HC 2RH9B 3TZCA 3PHLA 1ODTC 1ZVVA 4W1PA 4BEVA 3RUHA 4EO7A 4BLOA 4DV1B 2QV7A 2CZQA 3EW7A 2W2KA 4I1IA 4D46A 1ADJA 2ABWA 5E6UA 5BSFA 3HI4A 1C41A 2JIDA 4H27A 2A0XA 1PTKA 1JDBC 2IVZA 1ODKA 2V3VA 1V26A 3GQVA 2I76A 4K87A 2WTEA 4F3RA 5KX5F 3A4VA 3NR2A 2JLQA 3SEQA 1BCRB 1C30B 4D74A 2CBGA 2O2SA 1SG0A 4PR0A 1KZ1A 1ICIA 1O6GA 1AO3A 2COUA 2ZGVA 5DHRA 2M1ZA 3PUJA 3RE1A 1CZOA 2P2ZA 3V5NA 2CFOA 3RS8A 2YDXA 4V0NA 1JDZA 2Q2WA 5KTNA 3R9XA 5ALHA 1RS0A 5LYYA 2Y2VA 3B51X 2FRVA 2NTJA 3GHHA 5BSRA 3VNQA 1A95A 5HX7A 4F12A 1X39A 4FP9A 4XPIB 2E89A 1CF9A 1RKXA 1I5EA 3D8RA 3K94A 4MS3B 4KAXA 4Q0MA 4ER5A 3EIXA 5HGXA 1JYFA 2P2LA 4JUBA 4U7DA 1A4XA 3OFKA 1GTL1 1BQ4A 4IZOA 3V4PB 1WSAA 2F1HA 3NM5A 3ZBQA 1KSJA 3N53A 1AQNA 3DBLB 3FPSA 2VHZA 4TMWA 5DOZA 1AF7A 2AXEA 3DLCA 1IN4A 4X1YB 1NG1A 5ELLA 3RM3A 2JHAA 5AJWA 1KI2A 1V5GA 3T34A 2CC2A 4EFKA 2PGJA 2TS1A 4NQRA 2C5LA 2CVHA 3OWOA 3ZE6A 1II8A 1L5HB 1M2FA 2FHSA 2HF2A 3SK0A 4IDCA 2HJWA 2HJGA 3H17A 2AG8A 2C95A 2C2OA 2XCQA 4HZUB 1TFUA 1N25A 3EZLA 3QV1A 4QUIA 3LX4A 4BBPA 4KZKA 3QKWA 1GN8A 4GEGA 1G21E 4ROSA 3YASA 3SVTA 4H7KA 5EZYA 1QP8A 1OROA 2OL4A 5D1HA 1YRLA 2C7VA 2JKVA 2H9AA 3G1TA 3H2IA 1H6CA 1Z38A 3N6RA 5EZ6B 3U4IA 1U6IA 2XYGA 5FI1B 4H7JA 5TJ9A 2JZOA 1SWVA 2I1LA 4BRUA 3U0VA 3CVYA 2NM0A 3V7FA 1O97C 4KDFA 4UNRA 4FI3C 3SJZA 4LJSA 1NF8A 2ACKA 1ZUNB 2XNHA 2CGEA 5I9BA 5KB3A 4NH0A 2BFPA 1FRVA 2R8PA 4RXTA 3U2QA 4ZGWA 4GXNA 1KJQA 4MITA 4TM7A 4F92B 1T9GR 4BLTA 4ZYYA 3RQSA 3HA5A 3ACCA 2I6TA 3R1IA 4NG5A 1Z6TA 2V3CC 3HLYA 3ETLA 1C81A 2EJTA 4NENB 3SOPA 1U04A 3F7OA 3R76A 4KB5A 3KCQA 4FWBA 4QPJC 3IOBA 3OZTA 4L8LA 4TL8A 1IXZA 2DQYA 3CUSA 4UTNA 2UVQA 3KHSA 5AUQA 2Z6UA 4RPKA 3F8SA 2H29A 1BFKA 4IQ4A 1AM4D 4DR4B 2B4RO 1KAHA 2RK4A 3V2IA 2HC9A 2ZDGA 4ZAWA 4GMHA 3I73A 1SEPA 4RS3A 4E70A 5JCOC 4ARZA 2XUIA 2J3HA 1ZM7A 2KX7A 2QJWA 1MCZA 1RAGA 3B6JA 3DJYA 2J0UA 1GLNA 3C48A 3OH8A 3RJTA 2HA7A 2I4RA 3DHNA 5ENDA 2IUYA 1S5PA 4XSHA 4RIEA 1BA2A 4JU8A 3GEEA 5C81A 3GMIA 3TE6A 5BWCA 4JC0A 4EQ6B 3EIQA 5CU7A 4YONB 5D3ZA 3T0GA 4X95A 1NQXA 2QL6A 3Q3HA 5KNBH 1FQWA 1FVFA 3V34A 4YUVA 1FFSA 1H8EA 5DF1A 5HRUA 1YMUA 3JTMA 1YQUA 2WT9A 4JI5B 2VHUA 1P80A 4D8YA 4G1CA 3NAGA 4RORA 4EG0A 1VL8A 5HR5A 1YQEA 4TXHA 4CM3A 1SKYE 3IULA 3PZRA 3W8NA 3PPVA 4EFNA 1QIIA 1YKFA 5GM1A 1AS3A 3ETNA 5H3HA 5KMGB 1NVAA 4HRXA 4LKRA 2YZMA 3UOGA 1UEIA 2XOEA 1SCJA 2Q5OA 4OXXA 2WTAA 2WY2D 4BX9A 1V3TA 3BZUA 4K6FA 4U39A 1C0IA 4H15A 4D96A 4Q9IA 1BZYA 2AI2A 2PMKA 5I9SA 4ZCTA 2H5JA 2XIJA 4L95C 1WETA 1WNTA 1T29A 2JA2A 4YWHA 2YXPX 4YRRA 5BMVF 1YQQA 2BUAA 3SF8B 3P2JA 3JQ7B 1X1BA 5HJEA 4MS4A 4XGNA 4JX8A 5D5QA 5J2UA 1DDIA 5DNAA 2ZVQX 4M4SA 1PNQA 2W6CX 3FLMA 1EGAA 3K15A 4G4SO 3STTA 1XWFA 2BFBA 2KQUA 3WHIA 1LLFA 1P6QA 2K7FA 1W1UA 3TBHA 1C1XA 4FX5A 3EXFB 1GG2A 3F3YA 3FGNA 5ICSA 1J42A 4N5NA 5BNIA 3KJZA 2EAUA 3IPCA 1CIPA 1N9GA 2C2WA 2O4UX 5J2TF 4CGZA 3CQ9A 1FNCA 3CLKA 3CSDA 3K9LA 4ZEOA 1V3UA 2ONKA 4XTCS 3HUUA 2C98A 3LVQE 3GXOA 3T9EA 1TA0A 1GKLA 3CMCO 3D6MA 3EUFA 3VU1A 1JBEA 2OGWA 3C4JA 3RYFA 4DA6A 5KEIA 3W7VA 5AHOA 2Q6TA 2FWPA 1ULBA 2JH9A 2WJIA 4REQB 5K09A 5C8VA 2Z6QA 1AA6A 2DP4E 3EQZA 1YZFA 2FUCA 2IQIA 3KC2A 4RIHA 4J07A 1JN0A 1Y3FE 4WJZA 4ZV7A 4PRKA 3CPJB 2ZUSA 4HZIA 1CX9B 3WGZA 3DEAA 1WKBA 2I8LA 2W37A 2WPDD 4GRAA 4TN1A 5DWDA 3SAJA 1SOVA 3T1VA 5B55A 2VDUE 1ISHA 3NT4A 4XDHA 4DXAA 2I4MA 2OK8A 5AXBA 1XB2A 1QYXA 2BGMA 1P7VA 1C1DA 1VMDA 5C9ZA 5LD2B 2J48A 3DZGA 4YMVA 5JAHA 1RPTA 5L95A 2IYAA 3SYLA 4QT4A 4O4LA 3WDLA 2HCTA 5CBKA 1RM0A 5CDHA 4YCAA 4D79A 1ATIA 1Q0SA 2GHTA 4AECA 1VLJA 5GZ3A 3NBFA 4RGBA 3ZJ4A 1SKUA 4PX9A 4EPRA 4BLQA 3R9WA 5AJUA 4YEDA 1CDDA 2OE2A 1D9ZA 2GFIA 2AYYA 3BQ9A 4RD1A 1PL0A 1R4NA 3H2SA 3V9AA 4V0LA 4BTEA 4CIAA 4BFLA 2COKA 3W1EA 2OBNA 2X1LA 3WWPA 3MJEA 4G23A 2QX4A 4P4GA 3STVA 4M8KA 4IJWA 1D7OA 1TD1A 2QTZA 3RR2A 2I3DA 3VH2A 1XZMA 1DDOA 2O2DA 3ILHA 4XVQA 3QSYA 4I1PA 2R1UA 2H8KA 4C3VA 4FMCF 4B80A 3UMYA 1IAVA 4UUMA 5BSHA 1TC2A 1OU4A 5DRYA 1YMVA 1EK5A 1ZS9A 2QAGC 1IRIA 3A9RA 1Z2NX 5DLQC 1GSIA 5L4SA 3TPCA 1JLSA 4MV5A 5FKJA 2QZ4A 5K20A 1Y1PA 3QWFA 3PLRA 1WPXA 2VPIA 2ZYGA 1H1TA 2DH6A 5BUCA 2O7RA 2IGBA 2FZEA 4MYSA 3KQLA 1L5MA 2X6TA 3EA5A 5T8KA 1NA5A 1C80A 1RZUA 1TZ2A 2YVQA 3CLSC 3CNNA 4UC0A 4YCSA 5DGHA 4RVSA 1QLWA 1E2EA 3TAUA 3JSXA 3KLMX 4C4ZA 2IZOA 1SVUA 3M7IA 1SUEA 2PBFA 2O19A 3OF2A 3AI3A 4TVSA 3DM9B 4C1BA 1Z29A 3WLNA 3OE7D 3PA6A 4IEFB 3NDJA 2P91A 2QG6A 2NU7A 2QAJA 3GG9A 4J49A 1FMJA 2YWFA 1PK8A 4DYVA 4WCFA 1LDMA 1MB4A 1YZLA 1W2GA 4F3KA 1JSCA 1Q0RA 2X14A 3FNQA 4IIJF 3QKTA 2GWHA 3CMMA 3TZKA 1MV8A 2VT6A 2HXSA 4PBSA 2LNDA 3OZAA 2ON6A 4RLQA 2VF5X 4UBOA 3DE5X 1BXGB 2YMMA 4ACBA 1S1MA 1OAOA 3F6RA 2I34A 3CEMA 1GSHA 4MR8B 2ORWA 5LQUA 1DPFA 1HLGA 1N6IA 1PLJA 2GEBA 2J6HA 1MA0A 3S6JA 5BR8B 4Z9BA 2ZB2A 1G98A 2ZIWB 1KVUA 2PS0A 3K31A 3QWAA 3CVWA 2LKDA 5CA1A 3PENA 4KBGA 4HVAA 1G8GA 1PR9A 1V7ZA 2ZR8A 3HRIA 4HEQA 3ONDA 3K6SB 3GJRA 2FQWA 4DUPA 1BMQA 1CZUA 3UM9A 2GKGA 2ECFA 2H2AA 1SU4A 1OH8A 4EY6A 4J7UA 2FSSA 2Q3BA 3QPWA 1JLHA 1XU9A 1K6JA 4H3VA 3GV0A 1H4QA 5ALGA 4ZAYA 4RK0A 1OLSA 3S5UA 3TEJA 5EWJA 4KVFA 5IT4A 4AZ3A 1Y0BA 1H2AS 1GNQA 1V11B 1WY5A 4LOAA 3AI1A 2HX1A 3I61A 2NAPA 2P5TB 1U2DC 4XLLA 1G6HA 1YR7A 2F43A 3ELWA 2O59A 4RZQA 1YQTA 5BP7A 1JQDA 4R01A 2AG1A 3ZOZA 1UUFA 4ZOQI 2C4VA 2XUFA 2NU9B 3VNVA 3HGQA 1MG0A 2YYZA 3PKJA 1YIDA 2JHGA 2X2PA 3CF4G 4ZT6A 2BJWA 5LDHA 2PCJA 4D6YA 5IYZB 2M1XA 3OAAA 3RYCB 3HJNA 3RDPA 2I7DA 4JEHA 3IBGA 1XZGA 2HQSA 3E9NA 4QIHA 4QYTA 1FPQA 5TGTA 5IUJC 1JQ5A 3C7AA 2VK1A 4L4XA 3RFTA 4C6HA 2QT9A 1DXOA 3ESAA 1UAAA 2FG7C 5KQMA 3ZLJA 3VAAA 2BHNA 2YNMD 3L7LA 1KE2A 1RQRA 4HDSB 2K4MA 2PX5A 4YS6A 3UHOA 1VSUA 4NJOA 3UV6A 4A8JC 4KQJA 5FUWA 4F8EA 4B40A 3Q40A 5AIBA 2CXHA 4RVFA 3X1KA 4FFVA 5C32A 2BDUA 2BW0A 2V0CA 2ERXA 3QX8A 3UUFA 3RSFA 4EYKA 2X8AA 4W9RA 1IPHA 1ODIA 1YZQA 4MV7A 4GWLA 3JYQA 2REBA 3MTDA 1R6DA 4FGSA 1XIVA 3RASA 1E7YA 3ED5A 4BPRA 5TDHA 4AMZA 4IV5A 3TB6A 1SR8A 2HFKA 3HB5X 4LWOA 2L69A 1FW8A 2P7IA 1QBGA 4O4JA 2PVSA 1T2EA 3LF2A 1MDFA 2GETA 3FCSB 4ZAZA 5GJBA 1MHPA 3A9TA 5GV8A 3FBWA 1B2RA 5AQ1A 1LB1B 2ZJ1A 4HRAA 4DTCA 5CDTA 3EHEA 3IVRA 1AU9A 3LUPA 1JDPA 3OMWA 1PAUA 4R51A 3TXXA 2LPMA 4QJIA 3KQOA 1GKKA 3TGWA 2IL1A 1A5SB 2I3ZA 3OPMA 2GZDA 3D4LA 1IC6A 4QOGA 5DX1A 5F4ZA 4C0XA 5BSGA 2ZIVB 4L57A 4OSOA 5L3QB 3G5AA 2Q1XA 1C7IA 4F0JA 2CHVA 3O4FA 4J0CA 4RHUA 4EJSB 2Z5FA 1W5EA 4GW3A 4LHVA 1NMQA 1Y6GA 1GCAA 1IXKA 5GV7A 3NHMA 1YUBA 3WLIA 4C2AA 4XRRA 1CB0A 3W3AD 3BQNB 3DOJA 4LDRA 1NMEA 4EYQA 3CW9A 3CX8A 1PDWA 2W58A 3GRAA 3IOCA 3PQ2A 2WNIA 3R24A 4JBGA 4TYYA 1WW8A 3FWNA 1WCV1 1VYUA 2WE8A 2ZJ3A 2W00A 2FDCA 1VSVA 4S24A 5JCXA 2GJKA 4L9RA 4GBMA 2PZBA 1RXEA 2R79A 3V32A 1C7RA 5EVJA 4PE5B 4I4LA 1KEWA 1PFGA 1GV1A 4FINA 5DISB 2DHEA 2JBAB 4OXIA 1ZH0A 4IHJB 2JLYA 1FTYA 4IS3A 4KOEC 1P1IA 2HW8A 4S35A 2SBTA 5AKLA 5FUVA 4BP9A 4CTNA 5K99A 3VR4D 3EPPA 5BWMA 3AKCA 5LP6A 3MQFA 1YT5A 1RU3A 2Q3DA 3BK7A 4TTAA 3KU1A 2J7PA 3ZK9A 1ZMOA 3EK2A 2XV1A 4MEJA 1AQIA 1M54A 1MX3A 1NJGA 1ZLYA 3EWNA 4U5QA 2MYPA 3OEHA 4N03A 4HQ0A 5DW3A 4R0NA 3SXUB 4PAQA 3VU9B 1NPTO 1NX9A 1PDOA 4UOQA 4P36A 4DV2B 3F8WA 5FTWA 1TLFA 2C54A 2XMZA 3DV0A 3K0AB 1RWWA 1E3QA 3UAGA 1HORA 1W47A 2OZVA 4JYPA 4L02A 4GFDA 4MQLA 4P58A 4KXFB 3IQHX 4EHDA 2P27A 4Z49A 1MLDA 4ALIA 2VJPA 4RY8A 4US1R 1OFIA 3C8UA 5C1DA 2J5QA 1A9ZA 1Z36A 4BASA 1KFJB 3TUIC 2B4QA 1KI9A 1QGYA 1WJGA 4AX8A 4YP5A 1E1LA 3ZCUA 5JMPA 2DFPA 4L8VA 4HGNA 4QBHA 1DP4A 2AZ4A 4D7AA 1LLQA 1UBLS 2JIZA 4EATA 4CQLB 1T35A 4L16A 4CM9A 3EJWA 1C8LA 3EYWA 4I81A 5HKKA 3BG5A 3EXHB 3BMOB 1H2BA 4F7WA 3OJ0A 5SYAA 2EP8A 3C3MA 5C80A 1SVKA 2QMUA 2GS9A 5E7MA 2XVYA 5LZ8A 3CJTA 3NG1A 3VPGA 4PANA 4WXHA 5F2OA 4DVGA 4ENWA 2EG9A 4V0OA 1TM5E 5I8ZA 1NWCA 4GUAA 1ZL2A 2OCGA 3JVVA 3QXSA 5B53A 4G0ZA 3KR1A 3W5CA 1T43A 5LP6C 1NJ2A 4I9NA 4KSBA 5DSXA 2WJ4A 1A97A 1VJCA 2QTVA 3K1YA 2AA3A 3L7BA 3QF4B 1XVAA 4FEEA 4E88A 2PJUA 5FEUA 3R5HA 4D9KA 2AMVA 2X4LA 4GSKA 2QJFA 4Z3DA 2JCBA 3NCTA 4JY7A 1QHHA 4LOJA 1PWEA 1SQFA 2JL1A 3D2LA 4MUYA 4B8ZA 3BBLA 3SJUA 5FFMA 1E0AA 1G1MA 2ZITA 4JIGA 2HKIA 3AT1A 5G0UA 4AP9A 5MN5A 4PC2A 3KK0A 3VR5D 3D4PA 3PDJA 3O8RA 5AUOB 4EELA 1UOOA 2GXQA 4K3UA 4NBVA 4P33A 1C9KA 1JP7A 3H5WA 2W2VA 2WIDA 4NHEA 1FX0B 3EISA 3L04A 3GRCA 4ZZ3A 2I9KA 3DHEA 4FFMA 1RCTE 2BDEA 1YJAA 1UXOA 4ALNA 4RF5A 2Q62A 3HU5A 3K9WA 4MRRA 5KTTA 3DOCA 3M33A 2QSZA 4B6JA 1T8WA 3QU9A 3RABA 3M9LA 1N0VC 1DX4A 1Y4UA 1UBRS 4JUFA 5JZ9A 2ZCJA 1ZI6A 1KNXA 2OVFA 2Q6OA 4NJEA 3DT6A 2R5FA 3IR7A 1EFTA 4C6SA 1TUBB 1QKKA 3LWBA 1G4AE 4LPSA 3DZCA 3KSDO 3OC0A 3M70A 3HRKA 3MT9A 3PRJA 2B30A 3TPZA 5FH9A 5ITVA 2QR3A 5JJIA 4TUYB 4HPWA 2AX4A 3IUEA 4F9FA 4DBVO 1NXXA 2DBYA 2QD1A 5FQOA 5BWLA 1OA1A 3TLGB 3B48A 1XZPA 3K8QA 3P5SA 1CR4A 2OCDA 5TGZA 2A5YB 3SKVA 5KTKA 3KSMA 3KOUA 3M2TA 4QDZA 1MB9A 1JPNA 4HX2A 3TLZA 1HH4A 4GT1A 3RSCA 3OEED 5L4LA 4ZZIA 2H59A 2R65A 1GGMA 3E18A 2QRHA 3LSTA 1T4CB 3L0BA 3M5DA 4PFJA 4DKXA 521PA 2GCOB 3LUAA 4BNTA 5CXXA 4DZZA 3G6WA 1WTCA 1R0XA 4M9UA 4OB8A 3I6YA 4UARA 3GPLA 1CUHA 1L4MA 1Y7IA 4LMRA 4QRHA 5TT0A 2Q0XA 2IS6A 2QF7A 3D8UA 4I5GA 1CUGA 1SAYA 2JAWA 5C0OE 5TJHA 3DBIA 2PZKA 4C29A 4J0GA 1UEJA 2AWNA 4U4AA 4F6LA 3ECSA 2OHVA 2RCYA 2FWMX 2W6IA 4B47A 4CYMA 4P6VF 2PEZA 1QQ5A 5LQKA 1L4KA 4ONEA 3AGPA 3LHDA 3DEKA 4X20A 3GVXA 1RHKA 1XCGB 1PBNA 3ZKWA 1KKLA 1MT3A 4IWXA 2C31A 5IAGA 5LP1A 5IEBA 1O0SA 3OE1A 1ZNYA 2PGDA 3QVOA 4DDUA 1ZOIA 2ZBEA 3FZNA 5AQEA 4CHGA 5B36A 5E6SB 3ENQA 3G2KA 3OEWA 1US8A 1FNNA 4ZI3A 2QUJA 5LQMA 2Z6VA 3KT8A 3NALA 1CR0A 1FLAA 4H1TA 1EFPB 3WFZA 1ZKMA 1H4VB 3GYGA 5CTJA 5CVTA 1ZMBA 3LT1A 5EIBC 4WH0A 3F6EX 5B1EA 2PQ0A 2DT8A 2C00A 3O2JA 1EIWA 2P9HA 3EIOA 2EF0A 4R2JA 4LSGA 4CLRA 3BWXA 4OIFA 3FOWA 5BW8A 4S3MA 2H16A 2D1SA 3MGGA 3UKOA 5CFQA 1JHOA 1XNGA 1XKTA 3NTRA 3WKAA 3AVVA 3TSOA 2CHGA 1LTKA 4Q1EA 4TV9B 1JR6A 4UEJA 4YJDA 4JA2A 4RIGA 5D87A 2W5UA 5IW8A 4YRMA 1FS6A 1TPYA 4ZREA 1HWYA 3RTEA 1HQYE 3D3WB 1VBNA 2QP9X 4BU1A 3HADA 4NKRA 1VIMA 4L51A 2ZM6B 2VVTA 2WDPA 3GUCA 1FSGA 1PO7A 4D5EA 5ITWA 2PQMA 3UXMA 3HY4A 5D2CA 2G9UA 3AR4A 3KXDA 1GZSA 5DCUA 4HO1X 3SC4A 1R0YA 3TX6A 2VNHA 4I66A 2IPMA 2L0XA 1W0KA 4PINA 1W4BA 4I99A 4AP6A 2WUDA 2YXEA 2Y1WA 3W2EA 2YOGA 5KOYA 3NWEA 1UP7A 1PJTA 2GWRA 1EXMA 4ZC1A 2WINI 2QX6A 3IXQA 4WBXC 3ZTYA 1R9GA 4INAA 4J8PA 5EE1A 4K86A 1G9TA 2ANBA 2CLOB 2X4GA 4DHWA 5CD1A 4K6MA 3WLSA 1FIUA 5EERA 1U7ZA 2EW8A 3RVBA 3U40A 4D8XA 4Y2VA 2OO5A 1Q15A 1HE3A 1KJWA 3ZBUA 4ITUA 4DQUA 1WPRA 1DGQA 2ID4A 3N8DA 3THYB 3H0CA 3R2JA 2E4YA 1V5IA 3U49A 3IE1A 4JVOA 1P4HA 1U80A 3T7AA 121PA 3DMDA 4FONA 3GFGA 3QPVA 4N0MA 5KSWB 2PYZA 1NXOA 3TJMA 1GN9A 1XO1A 2OY0A 4HF7A 4UQLA 3ZU3A 4K1XA 3RRBA 3TQRA 3WLPA 4AY3A 1ADFA 621PA 1Z6PA 2IOFK 1HFKA 2NU8A 1KXJA 1KK3A 3EF3A 5ALPA 5J5AA 5BWOA 2HI0A 5DNCA 4O1MA 4PYKA 5AT1A 1YDGA 4E30A 3JAKA 3FBGA 4IGFA 5F23A 4QBGB 1R10A 4QYIA 1AY0A 1JRLA 1UPUA 5DYIA 1V7PC 4AJHA 4EVRA 5K6TA 4DCSA 4KH0A 4LXQA 2ZRHA 4CDNA 1GG8A 1RAIA 4PYOA 1P2BA 1OXKB 5ADVA 4MQMA 4DC1A 2VHTA 1QV9A 4B6GA 1KQFA 4R8MA 2H1SA 3ZKAA 2QBYB 2IITA 2KLBA 1NLMA 3I6ZA 1YE5A 5A2QA 4IVRA 1VB3A 3OICA 2X77A 4PHCA 5EJMA 1ZGGA 3E9DA 1L8AA 2I4OA 2N9UA 1HL7A 4D3ZA 3BC1A 4I1YA 1C9NA 2C84A 1F38A 3L7JA 1KI3A 4L9WA 3WRWA 4RO0A 5HS4A 5DM4A 5E7QA 1EFAA 3C1UA 2ZUEA 3K9BA 1OXTA 1WU7A 1X92A 4CM4A 7ABPA 1Z6AA 1OH7A 1KEZA 2ZWAA 4OUKX 4YYEA 3FDXA 4BNJA 5I47A 2WUGA 2JHPA 2OO5C 2FOLA 3WZMA 1LTHR 3G8DA 2QSJA 1TDJA 3NBQA 3ASVA 3KJQA 3OX2A 4NPHA 5DTIA