3GFTA

Human k-ras (q61h) in complex with a gtp analogue
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
167
structure length
167
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Human K-Ras in complex with a GTP analogue
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 167
sequence length 167
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gftA00
1NVWQ 3SQWA 1TQDA 1QDEA 1VIAA 3BRWD 1LTQA 1QHHA 4P31A 3SS8A 1FX0B 4Q4AB 1ZIPA 2RMKA 3X1XA 4R7ZA 3FHCB 2HV8A 2ZROA 3EX7C 3SI7A 1P5ZB 3U3KA 1Z3IX 2VIIA 4HAZA 1E9SA 3K70C 3ZS9A 2CE2X 4PQRA 4OHXA 2XSZD 1NNEA 1G3IA 721PA 4KCGA 3BERA 3H4MA 3WBJA 5LD2C 1MO6A 1DAEA 3SR0A 1N5IA 2P2LA 4JSYA 4Q4HB 3IO5A 3C5HA 3R9WA 1VCIA 3PEUA 5JCPA 2QG6A 1KO5A 4Q9HA 1BKDR 5H70A 3M4YA 1T3SA 4QXAA 4MDEA 4AYXA 3RS0A 1TQ2A 1XD9A 2CE7A 3OAAA 3ZS8A 3RC3A 4M2LA 5M04A 4GRAA 4JLKA 4PPGA 5JZVA 4MRSA 2ZUDA 2WWHA 1Z0IA 2GRJA 3IILA 3O47A 5FTMA 3KJHA 4AURA 1XXHB 2IUTA 3TE6A 3GLFB 1JR6A 1OPXA 2N42A 2ZI4A 3W8RA 1N6LA 1Y63A 1GVNB 2YWHA 1WBBA 2QE7A 1OXSC 2IL1A 4TQUS 1U9IC 1KAOA 4Q9LA 2NO7A 1S3SA 3UMFA 3X1ZA 4H1UA 2DR3A 3SBEA 2GZAA 3N70A 4D4LA 3SZRA 3B6EA 5JI2E 3AVTA 1MT0A 2IUSA 1GL7A 2G3YA 3CM0A 2NO1A 5FOXA 2CJWB 1NG1A 1X8LA 3PUXA 2ZE6A 1X1RA 4PHTA 1FP6A 3EIHA 3SYLA 2JA1A 1U0JA 1P62B 2WAXA 4HUQA 4C0JA 4YONB 1E1RD 2QPOA 1FOEB 5KDDA 5JFGA 4GP7A 1CJMA 3IIMA 1P2TA 1Z6AA 1UBGA 4AKGA 4CIDA 1BYIA 3AVXA 1ZD1A 1ZC4A 4YDSA 4B71A 4BZPA 3DEFA 3JZAA 4RZ2A 3NIBA 1G3RA 3MGCA 3PEYA 2ATVA 3QKUA 3RC8A 3FPAA 4KFRA 4QFMA 2BKEA 2F1HA 1JAIA 3O8BA 4ASUD 4MRPA 3FOZA 3BB3A 1AKYA 1OV4A 5CM9C 2C98A 1WBDA 2IUUA 1OYYA 3LXXA 2JLVA 3ADKA 2ZI6A 1HQCA 5F2EA 3NC0C 4IXNA 2XSZA 2EYUA 1KTVA 3EIQA 4IOKA 5IT5A 1N0UA 1TQ4A 1MO5A 5JECA 1KI6A 5EXXA 4UXHA 5FTJA 1JJ7A 4G5GA 5CJPA 3TAUA 2WWWA 4OI1A 4WBSA 3CIOA 1G16A 2ZJBA 1C9KA 1HYQA 4HAYA 4M1WA 3K53A 1T8UA 4KHZA 3C5CA 2PZEA 4LJ7A 2QTFA 4ILEA 4JLBA 1UM8A 4B3FX 4YMTA 1GIAA 2ZJOA 5TMPA 4TQ9A 1SVKA 2IA5A 3AGPA 3NBYC 4TLAA 4TMTA 2BOVA 2O0HA 3HYRA 4DDWA 4Q18A 2EW1A 1G19A 2IYYA 1QHHB 4HLUA 1IN4A 4KJZA 1W49A 2VP5A 3VR6A 1NBME 4Z1MD 2P67A 2R6AA 3Q5DA 4E22A 4AYWA 2RGCA 3DO6A 2J0VA 1VECA 4LJ4A 3T5DA 4BLQA 3L43A 4X8HA 2ZRKA 2VSFA 3ZZTA 2JCSA 1O3YA 4BLSA 4C0KA 4PHHA 4DUGA 4QHTA 4CGZA 4Y0VA 5IK2A 2YVUA 4CYMA 2GBLC 2B8WA 2OCPA 4M22A 5FL7A 4W5WA 3RWMB 5EUQB 3CNOA 3KFVA 2W6IA 4M1YA 2IC5A 3BB1A 5EP2A 1YZTA 5B58C 2V6JA 3GCGA 2HJVA 1L7VC 2XJ9A 1DARA 3BH7A 2QY9A 4IFEA 4A6PA 1G3QA 1S3GA 1W4CA 3O8DA 5F9FA 3W6OA 1K6MA 1E6CA 4UNQA 1E1RA 2BC9A 1CR0A 1JEEA 5KDLA 4QJ4A 4F91B 3K09C 4S2EA 3QKTA 4ZKEA 2QM8A 4TMVA 4FMDF 3AKDA 3MMPA 3PUYA 1NIPA 2ZRNA 2QP9X 1XXHE 4IDQA 1NSTA 1DELA 3DM5A 4FCWA 3GLFE 3BFXA 4M1OA 1G5PA 2G6BA 5G40A 2L0XA 4GZMA 2DFKB 1LS1A 2WJHA 1Z0JA 3ASZA 3KTAA 3B1WA 4DJTA 1LVGA 3OEED 2JJ1D 3L0IB 4ACBA 2AHOA 5CJ2A 3UPUA 2P3SA 2HF8A 1NLYA 1AS3A 2HT1A 3UKDA 3AF2A 3P4XA 4YC7A 1QHIA 2FSFA 3CX6A 5C4MA 2QAGA 1VPLA 1PLKA 2Q9CA 1YQTA 1G4AE 3Q3JB 4URVR 2R6DA 5SZIA 1Q44A 4DSNA 4B34A 5EXPA 3LXRA 4FMBB 5CLLA 4CZ2A 3FB4A 1NMYA 4XTRA 3U7FB 2YKGA 1T0HB 3CBQA 1QHXA 3PVSA 1R8QA 2JDID 5EE1A 5KSZA 5AUOB 5TY0A 4HDCA 1UEJA 3M6AA 2MSEB 4G0NA 2FA9A 2QENA 3LWNA 5AK0A 3UATA 4F92B 2NMVA 5J4KA 4M53A 3OESA 1NY5A 1KSFX 1NMZA 2AD1A 1PV4A 1G3MA 1G8GA 1ZRHA 1R0ZA 1HH4A 4AK9A 5JI3E 2QM7A 5IRCD 5A5GA 1DBSA 3PENA 3U3OA 1E9BA 1NKTA 4NCNA 1UBEA 4MGIR 4NE2A 1GL6A 1N5KA 1W44A 5CYPA 3TNFA 1RRCA 1ZU5A 3IBGA 2KSQA 4LV8B 1G7RA 1HV8A 2PMKA 1KKLA 5AJWA 3D3QA 2QUZA 3WMEA 1OB5A 3PFIA 1R5NA 3GLGA 1W0KD 1IY0A 2ORWA 3ONWA 2A3RA 2O5VA 5DN6D 3AVOA 5CDFE 2EFCB 1Q12A 1GSIA 3SYKA 1A2BA 2EWWA 2XX3A 1XPUA 1EGAA 2WJJA 3KXLA 2QMHA 1Z29A 3LX5A 4B33A 4NU0A 3Q8XB 4XIGS 4M9XA 1YJ5A 2ERXA 4RD4A 5LPNA 4LV6A 1Z83A 2R65A 5HE8A 3QJYA 1FTNA 1OYWA 2NO9A 2A7QA 3D31A 4LYJA 1AN0A 5K8TA 2Y8EA 3GMTA 3S1AB 2OLKA 4OQFA 2ORVA 3LV8A 4Q9IA 4EPRA 2MMGA 5SZKB 1KI7A 4DDTA 2OESA 3KDSE 4QOSA 2HXYA 3BH0A 3MD0A 5H8WA 4FCTA 1WRBA 1X6VA 4F4CA 3OIWA 3OEEA 1KDTA 4MA4A 2BBTA 3T61A 2Q0HA 2QBYB 4AKHA 4TSFA 1ODFA 2GXUA 1NSFA 1XMJA 2ZYUX 3G5UA 3L0OA 4UXIA 3CWZA 2F3RA 3NEYA 3SBDA 4L4UA 2QPTA 4H9GA 4LK2A 2F43B 3ZQ6A 2QROA 4CW7A 3RDPA 1JR3A 2OBMA 1Z22A 4MYTA 1YVDA 4Q1DA 3K9NA 2BWJA 1FMLA 3VU9A 2YWGA 3K9LA 3K0AB 1HQYE 1IN7A 4ITRC 2XEXA 4DHEA 4JBYA 2AXNA 3Q9LA 4KFSA 1KZGB 2WSSD 2ZRLA 4UNPA 3KTAB 4HAVA 3IIKA 1JEDA 4PZLA 5DISB 1T4GA 1K5DA 1B0UA 1R2QA 1Z2CA 2RGEA 5DI3A 5HKKD 3G0HA 1BH2A 1FTSA 3DL0A 5L3QA 5FFMA 2OHFA 2QAGB 1S96A 2D2EA 2PCLA 4TYYA 1E9DA 4OHYA 4PSKA 1G20E 1DO0A 5A4JA 4HEJA 2ASEA 4BWYA 1G6HA 4WXPA 4ERNA 4PPQA 2EU8A 3KX2A 1A2KC 4YDHB 1GKIA 1OE0A 3OE7D 3KXKA 3NDPA 3GJ0A 4PSVA 1II8A 2QI9C 2P6RA 3R9XA 4QKQA 2Q9AA 2RGDA 1VYUA 3A4NA 1ZW6A 1GRNA 3ZQJA 1FUUA 1W0KA 4QHSA 1KK2A 2YOGA 3TVDA 2LWIA 4IOLA 4N0EA 3KKQA 1W4RA 1OXUA 2EQBA 4P0TA 4ON9A 2HYDA 1OLOA 2R8RA 1CF4A 3QENA 1NBMD 2YV5A 2D7DA 1FL9A 1Z5ZA 2B7BA 1H8HD 2CEAA 4ARZA 4Q7LA 3F0TA 4Y0AA 4BFXA 4TLCA 3EPLA 1ETUA 1RYFA 2R9VA 1U0LA 3IHLA 4BECA 1D9XA 5KTYA 121PA 2FX3A 1AQUA 1E0KA 1XPOA 2ZS9A 4LYHA 4JLOA 1G7CA 5GJCA 1CR2A 1UDXA 2DYKA 2VO1A 2YWFA 4QC2A 4BPBA 1RIFA 1JAHA 1H8ED 4L15A 4GNKA 2GVZC 1IHUA 1FQKA 3GEEA 2RGXA 4LC1A 5FBVB 2IEYA 5L3SA 1CXZA 3I92A 4OI4A 1G64A 5EJEA 3GLGB 4A92A 2AR7A 5AJXA 1DAHA 1KGDA 4LCBA 3M0EA 4MYHA 1QHGA 2YOHA 4EAQA 2ODWA 1XB2A 2WJIA 3ZVNA 3TVTA 1TEXA 1OIXA 1CRPA 3V4FA 4AC9A 1IONA 1GITA 2RHMA 1OKKA 5J4VA 1NKSA 3FKSD 4C0SA 1GG2A 3SJCA 3I62A 3T1QA 2V1UA 2XZOA 1U8ZA 2ZAOA 3QXSA 1N2CE 5B64A 2GJSA 3L8YA 1COWA 3NEJA 1X8JA 1NVUQ 2IS1A 4JLNA 3TUZC 1UKZA 3VKGA 4DCNA 2Z83A 2D62A 1E2DA 1N0VC 1T5LA 3LVQE 1U8YA 1KI9A 2AK2A 2VHTA 4B3BA 2OBLA 3SFZA 2F1JA 1BS1A 2DY1A 5EP1A 2C78A 5CITA 2WSSA 4FMCB 2OFOA 2R6CA 4ZKDA 4WW0A 3FMIA 3TRFA 4PTLA 2CVHA 4PO9A 3CB4A 1QRAA 2ZRDA 5D3MB 2O8EA 1DAGA 3T12A 1OXXK 3QXXA 2R2AA 2ZE7A 2NGRA 3MWJA 1KY2A 1II9A 1SXJB 4IJMA 2C5LA 1FPMA 1DG3A 5FR2A 4RY2A 1G8HA 4Q1CA 3H1TA 4GOJA 4GSYA 3VR5A 1T9HA 3CR8A 4FI3C 4YMWA 4CVNA 1G8FA 2Q3FA 3HU2A 3FHOA 3LH5A 3EC1A 3IGFA 4BFZA 5KDOA 1FUKA 4LYFA 2OFWA 1SVMA 2GXAA 4I1SA 4LX0A 4TT3A 4B32A 4DSOA 1IJEA 3WYFA 1BMFD 1P2UA 1H8HA 2NPIA 2VYFA 3N2IA 1KO1A 3QXCA 3UANA 3THWA 2IYLD 3CZPA 5DI3B 4QJ5A 1FX0A 2CCGA 4Q4AA 5L3QB 2WMOB 1P7CA 1JQLB 4XJXA 4FCVA 5EUMA 3L82B 4EFNA 4YMUA 2QGZA 5EE3A 3N2EA 4NYJR 2VTKA 2ANCA 2P65A 3IEVA 4LZZA 3KKPA 5B2ZA 1F2UB 2IYTA 3RS4A 5TDHA 5JWRA 2FEOA 5AJVB 1RZ3A 4TL9A 1LNZA 4Q4HA 4KVAA 1C1YA 3C15C 5EXSA 2QSZA 1Q1QA 2J45A 4P4UA 1I4DD 4JVLA 4MRRA 4PO1A 4Q1EA 3EPHA 2UVQA 3SYNA 4A6XA 3IPYA 2KB0A 4HLUC 1S0UA 2QT1A 3EXAA 3UG6A 2OUKA 1R10A 3KB2A 3WHKA 4DCSA 4M1SA 3H84A 5JHHB 5HR5A 2ZQ5A 4ARZB 4JYCA 2W2VA 2J5XA 3EAQA 3F3YA 4RZ3A 4JJZA 2XTMA 4PHGA 3Q5EA 1KO4A 2YHSA 4P33A 4RVCA 3WMFA 3WXMA 2H17A 2ZRHA 4N1AA 5C46F 2HEIA 1X1SA 3Q85A 2E1RA 2OM2A 3CRVA 3LBNA 3FYHA 4U00A 3ZVRA 4RSGA 1OSNA 4DDVA 2GHIA 3U44A 3RHFA 4LBYA 1HA3A 3KQLA 3V9PA 4ZI3A 1SKYE 1YE8A 4GZLA 1J90A 2WAYA 3GLHA 1OXTA 1E4VA 2PBRA 2YWEA 1GDDA 3GQBA 4ZO4A 2CJWA 1DADA 1XRJA 2R6FA 3RRYA 3EZ7A 4YMSA 4QBHA 3GLGE 1NVVR 4D81A 3OAAD 1ZD9A 2Z4SA 2MSDB 1TPZA 2NG1A 1NN3A 4DVGA 3KQNA 1Y3AA 2G0TA 2RGNC 5GVRA 1DPFA 5ANRB 1C4OA 3U3RA 3MRSA 2WPDD 4P4TA 4EPTA 3WP1B 2C8VA 2NO0A 2VEDA 4V0OA 1R4AA 2IYRA 3K0CA 4FINA 4OK3A 2MSCB 1JJVA 3HP1A 4ZCLA 4URYR 2QE7D 4EJSB 5EE5B 1KMQA 4UJ5A 4Q5IA 1E2IA 1AK2A 4JLAA 4DLRA 1ELOA 2NO6A 521PA 1NMXA 1QVAA 2GKSA 2O8EB 4PC1A 1ZC3A 3WNCA 3UWOA 1KO8A 2H1LA 5LB2A 2ATXA 2FGKA 2NOAA 3B78A 4L8GA 4OQLA 4XSGA 2IWHA 4DLWA 1XTJA 2JIZA 2QTHA 3PJRA 3GEIA 4IDNA 1OH6A 2OAP1 3VMFA 1TNDA 1KI1A 3QPUA 4EUNA 4HLDA 3RSLA 1G21E 1CEEA 4GMXA 1SHKA 2VF8A 2ZRJA 1JQJC 1OJLA 3B1VA 5IHPA 2J7PD 2A9KA 4B44A 1JR3E 4IKEA 4NCHA 3CWQA 4NYIQ 1GFIA 1IOZA 5HCIA 3VKWA 2R44A 4QGGA 4EQ6A 1XF9A 2OILA 3QNUA 2IS2A 3JZMA 2CHQA 1KJYA 1GUAA 5IDVA 1Q21A 3AF4A 2FEMA 4MYCA 4WZ6A 3A1UA 3THWB 3CKLA 1IQPA 4DKXA 3TR5A 3AQ4A 1X86B 5C1BA 4A8JA 2ZRGA 1HUQA 3EA0A 1E2QA 2WHXA 2RGBA 3W34A 1M1YE 4D6PA 1GZSA 3VFDA 1KIMA 5JWHA 2BBSA 1AS0A 2P5SA 3DKPA 3MWYW 1NG9A 1KHTA 3CO5A 3DM9B 1ZP6A 4DSTA 1Q1EA 2KJQA 1IN6A 2XB2A 3CH4B 4PC3A 1BYUA 2NZ8A 4TTPA 2ZREA 1XEWY 3GFOA 3PITA 2HCBA 4C9BA 2OXRA 2ZRBA 1AQYA 1KJWA 4HLQB 1KDRA 2G88A 3B9QA 4KFTA 4B3CA 4LBVA 3E1SA 5LBIA 5A0FA 4MGZR 3BD9A 2VBCA 2IHBA 3BC1A 3D8BA 4DLUA 1NN1A 5JRZA 2A30A 5EXTA 3AVUA 1JXMA 3SDZA 2WPDA 4PXAA 1R0XA 1GNRA 1Z0DA 2ZYTX 2JJ8A 3TIFA 4F4IA 3U44B 1E0AA 4DUGD 1W0JD 2OLJA 5IK2D 3EWAA 2O8FB 2I4IA 2YJTD 3MWKA 3AB3A 4K8OA 3TSWA 1B23P 3GLHB 5EE9A 5FL7D 1AGPA 4R98A 5J40A 4MQBA 2RCNA 2W6ID 1S9DA 3L8ZA 2XITA 3PUWA 3F5FA 3CPHA 1CR1A 2XB4A 1IN8A 1ANKA 2J41A 4XVRA 2CXXA 3B7GA 2ODNA 4GT1A 5AUNB 2QRNA 1DVRA 1SVOA 4GL2A 5DHFA 4DWJA 1NI3A 4L9WA 1CRQA 2AKYA 2J0QA 4JKIA 4ABYA 4TLDA 2ZRMA 1G8YA 2QZ4A 4LJ9A 4OJKA 3B85A 2V4ZA 1QG2A 4BFVA 2J7PA 2ZEJA 3MFYA 3LVRE 3BOSA 5E7IA 4OK5A 4DZZA 2CLDX 3ADCA 2ZPTX 1TUEA 1RFLA 2ZSEA 4KU4A 1X3SA 5FOWA 3MCAA 1EG7A 3FFAA 1R8SA 2ZSBA 1S4QA 2V7QA 2O0KA 4MUAA 1XD8A 2XOKA 1KYIA 3RRMA 3QEJA 3QOFA 2IK8A 4NONA 4QBFA 5ELXA 1YR6A 2BCGY 4HYYA 3FKQA 4D82A 1GAJA 4NYMR 1ZNWA 3W9YA 4W9MC 4PPNA 4BGDA 1Q3TA 2F1RA 2JATA 4GOXA 3WYAA 3GLIB 1VG8A 3FHTA 4C7OB 2PX3A 1R5BA 5J5CA 2BKUA 4CEJA 5AR1A 1R7RA 2FNAA 4OYHA 5HZKA 4C0BA 421PA 1Z8FA 3ASYA 3C7KA 1N6RA 1J8YF 3IDQA 5K8UA 5EZ6B 4XWOA 1ESMA 3RWOA 1YZKA 1UJ2A 1XNJA 4DLVA 2OAQ1 2HYIC 1Z07A 4EQ6B 4RZUA 3B8HA 1FFHA 3ZDQA 1AM4D 5JBQA 5DE3A 3VHLB 1TX4B 1PZNA 2VP0A 1Q22A 1U99A 3UMSA 4HUTA 4KAXA 1N3BA 3QG5A 4XWKA 4A8JB 3C14C 4RKEA 3B1XA 4IOJA 5DGXA 2ZJZA 2XZPA 4LHYA 4C3ZA 2OG2A 3TQCA 4IRUB 2YZ2A 1O87A 2FSIA 3W8NA 1ZNYA 4F4JA 2ZJ8A 1AA9A 1D9ZA 1EX6A 1KMHB 1W0JA 2VP9A 4KODA 2VRWA 4IDOA 5DYIA 1X8KA 4P32A 3LLUA 5JEDA 3TLXA 4PSAA 3S1AA 2DHRA 3AV0B 3WNBA 4Q19A 5BYKA 4CEIA 2IHYA 3WY9A 3EARA 3NTUA 4B74A 1KKMA 3X1WA 3U4QB 1Z08A 2QBYA 2UKDA 2V55B 3QF4B 1N6IA 3T5GA 1VIYA 4XVUA 1VCOA 3QIAA 3QUSA 3KZ1E 3CNNA 4AWXA 2W58A 3Q72A 2FF7A 4A15A 3SE0A 1L4UA 1TMKA 2F43A 3AKYA 4NKRA 3QPVA 2ECKA 1CU1A 1IAQA 2WWFA 1D2MA 5FOVA 2ZXUA 3MSXA 1MH1A 4J0QA 3RRZA 2J87A 2I1QA 3K0AA 4BRUA 3BBPA 1JPJA 1U98A 3RRNA 2A5GA 3LD9A 1NP6A 2ZR7A 4V03A 3KJGA 4BEBA 3I61A 4D4MA 3THYA 4DLZA 4A0HA 2VL7A 2NZJA 2OT3B 3DZDA 1RW4A 1VKJA 2X8AA 3EPJA 2V8OA 4RD0A 3DPUA 4D25A 4TSFD 4C0QC 3CX8A 3GLHE 3IKJA 1A4RA 2IYXA 4BZXA 4HATA 4EPXA 2F7SA 4F38A 5L3VA 1Z6YA 4PQYA 4BZQA 5GVSA 2IYWA 1SHZA 2ZYWX 2GJKA 4HB0A 1DAMA 2ZE8A 2JEOA 3VNVA 1JR3D 1UKYA 4Q7JB 3AVQA 1TUIA 3KXIA 1OFUX 5CIQA 1A1VA 2BHRA 1XJCA 4CEHB 1AZSC 1GKYA 1OH8A 3DDCA 3ADBA 1NN0A 1U0HC 5HCNA 1WE2A 3GJXC 1NLFA 3OIVA 1GWNA 2WOOA 4EFLA 2KBFA 3REGA 4B3DA 3U61B 4US0R 5CB8A 1TQ6A 1F2TB 3FMFA 1TL7C 1U2RA 2GESA 4JL5A 2FZ4A 5AUPB 5DYGA 5BN3A 3AF1A 2VPPA 3RANA 3OFNA 5JLJA 4UQOA 3RS3A 3BXZA 4M9SA 4TN1A 4WZAE 4A4DA 2V54A 1KSHA 1XMIA 2D2FA 4DRZA 3NHBA 4QRHA 4V0ME 1XCPA 4PPFA 3THOA 2ZRCA 4XSHA 4ZDIA 3RNLA 3KKOA 4CEJB 4Q9JA 3RABA 3U2QA 4PC6A 2N1BA 1DAFA 4MKFA 5CIWA 3GLIE 4RFSA 2ODEA 5BYJA 4KO8A 4TTQA 3QVUA 2RB4A 4RCZA 4KITB 2GZHA 2GXSA 3GFTA 2ORIA 4UJ3A 2FE4A 1PLJA 2VHJA 1JNYA 2XNDA 2C04A 4I1UA 2X2FA 1VG0B 3TGPA 4M21A 1F60A 2VSXA 5BWMA 8OHMA 3AGQA 3EASA 1IY1A 4JVMA 3SHFA 4DT1A 2RGAA 1E2GA 1KI2A 4G1UC 4L9SA 1EFRD 1WF3A 1P9RA 1YRBA 3GJ3A 4A82A 2IBMA 2OCYC 3A1TA 2IF2A 3HJNA 2D74A 3MAAC 2GNOA 2ZRIA 2ZAMA 2FJUA 2BDTA 3ECCA 3G82C 3EZ2A 3QKSB 3QQ5A 4JYBA 4M4SA 2ZRPA 4CEIB 2AN9A 4BLPA 3A36A 4DC9A 1XJQA 5K8IA 4AKIA 3A6PC 3U5ZB 4IEIA 1N6HA 5D3MA 5E7MA 5FBRB 4LPKA 2JLQA 1IY2A 1IM2A 4JZKA 2HJGA 1Z0AA 4NCKA 3EW9A 2QL6A 1SXJA 3MG9A 1K8RA 1OKKD 1ZINA 4TL6A 4O3MA 2BBOA 3TR0A 4G01B 3A1SA 4MKHA 2P0EA 2IS6A 2QN6A 1COWD 1TF2A 1IBRA 4BEJA 4HAUA 4OQXA 3TJZA 4B3XA 2GAAA 1U9IA 3NWJA 2GDJA 3WHLA 4ESVA 2LCFA 4X8OA 3I1FA 3LW8A 2BMDA 2O8BB 1E94E 2WMNB 5G53C 1IXRC 3THYB 3QG1A 4MH0R 2WV9A 3N5CA 4NCIA 2PEZA 4G5SA 2O8CA 4A0RA 4GPTA 3TK1A 4FN5A 2RKOA 5C18A 3KJEA 3WP0A 4XD7A 1V5WA 5KU1A 3U6BA 3QKRB 4BLTA 2YOFA 1Q20A 4L16A 2H7VA 2ZI3A 4AG5A 1T91A 2JASA 3VHXA 1XMSA 5JHGB 3I8SA 4QNMA 4B76A 4JBWA 2KWIA 4O25A 4PAQA 4PAOA 3F8TA 4DLYA 1E32A 4LHWA 5JJKA 2NTYC 5GJVC 4II7A 2CBZA 1J70A 4MRVA 1R0WA 2WJGA 4B6FA 1F2UA 4KBFA 5E95A 2K5UA 3VQTA 4R9UC 1E9CA 5KNBA 4C2TA 1OH5A 2XJ4A 2D3WA 4HAWA 1XDBA 1W2HA 4O2RA 1VG9B 2WIAA 2FWRA 3UG7A 3BJIC 4E07A 3QPWA 4W7SA 2BM1A 1EFTA 2GK6A 1UPTA 3H0KA 4TT3D 1W36B 1AIPA 4M1MA 5FI0B 3EC2A 2A2ZA 1GTVA 4OL0A 4PZYA 2Q6TA 2YINC 4N3NA 4IHQA 3OHMA 4A36A 1P75A 2I3BA 4B3GA 1ZUIA 4OQNA 4JVSB 1QHNA 1Z2AA 1Z6GA 2GJ8A 3AEZA 1EFRA 4NTZA 5FR1A 3R8CA 1JXOA 3D7MA 1E0SA 4CF7A 4Q7KA 4D2IA 2V6IA 1D8TA 5KYKA 3OF5A 3A4LA 2Q3HA 1KOFA 1SVWA 1Z47A 3RYTC 1M8PA 5C4GB 2QGNA 3IPXA 3DMNA 4K81B 1ZNZA 1UBCA 2X77A 2BMEA 1WMSA 2VH5R 4RFSB 3AUXA 3P1JA 3I3SR 3UXMA 4FWIB 4KXFB 5CK4A 3HR7A 2HCJB 4F7WA 1N25A 1T6NA 2ZR0A 1QBKC 4DCVA 3QBTA 1MO4A 1XTSA 2PJZA 2AK3A 3U7GA 2JLYA 4OI0A 2B6HA 3ZGXA 2VA8A 4C0LA 4DBLC 1NLZA 1M7HA 3K70B 1DOAA 4B75A 2GETA 4W5JA 2J1LA 4DT1B 1MOZA 3VKHA 1FQJA 4FIDA 2DBYA 1WXQA 4JL8A 3T34A 3ZVLA 5LD2B 5FUYA 3LDAA 3Q7QA 2AX4A 4GBMA 4B2LA 3FVQA 4DSUA 1H65A 1RE0A 1Q0UA 2CHGA 3PUVA 1RRGA 4EJSA 1E2FA 1A7JA 2QSYA 1W5TA 4IVQA 5FPTA 4WAUA 4TYWA 1E4YA 1GP2A 1GOTA 3TMKA 1W2GA 1JI0A 2FGJA 3NH9A 5AJZA 1KNQA 5FTNA 4D26A 4GP6A 3THXA 3VR3A 4LUCA 4V02A 2GK7A 1N0WA 3RAPR 3OEHD 4R2HA 3W90A 4QGHA 1DAIA 1E3MA 2HXSA 3K09A 1KJZA 3CONA 1E69A 3VR4A 5E3HA 3P27A 2ZYVX 5GJBA 1ZAKA 2BBWA 2J7KA 4TMKA 2AFIE 2YC4C 3HYTA 5J47A 2NQ2C 2HUPA 5F3WB 4BRWA 4DEYA 1U8AA 2WJYA 4BFYA 3QE0A 2D7CA 2FFQA 3PR1A 1SULA 3LA6A 2GWHA 4OJQA 2DFLA 1KSGA 4TLBA 2G9NA 4CRWB 2O8CB 3I5YA 4I4LA 3CRMA 3CRRA 4D0LB 1UFQA 3LX8A 5BXQC 4HDOB 4AKEA 5HE9A 1YZLA 3TW8B 1LFDB 1RC8A 4KVGA 2HF9A 2JIZD 2RAPA 3M1IA 2IS4A 2HT6A 2LKDA 4QG7A 1KNXA 2N46A 5FL3A 4E03A 3SU8A 2PLRA 4JBXA 4OI2A 3RLFA 1LV7A 1XTIA 1ZNXA 2A78A 1W7AA 2ZETA 5JSZB 4Q00A 4D4KA 3A37A 3EIEA 3PQCA 1XCMA 2QRZA 4L5BA 2FMXA 2RHDA 4B43A 5KPDA 2FFHA 4XTCS 2QAJA 4Q7MB 3BFKA 3PEWA 3E5HA 5FH9A 3QEOA 2W2XA 3ZH9B 2QMUA 3QY0A 3GJ4A 1RJ9A 1CJKC 1F48A 2BMFA 1EXMA 2FOLA 4POAA 5F9HA 1KK3A 4PFSA 3X1DA 3W5JA 1I4TD 1UKEA 2REBA 2IXFA 4BFWA 3CR7A 3J81k 2QMEA 3NHAA 3R20A 4R2IA 4U02A 4XWAA 4RD3A 4Q01A 1MKYA 4WVFA 1WA5A 2C95A 2PT7A 2VP4A 2PL3A 3CNLA 6Q21A 5KHOC 3DHWC 2GXQA 4LPSA 2O8FA 2YYZA 1HURA 3TW4A 2XTNA 3W5IA 3RS5A 3TQFA 3U6KA 1JALA 3TH5A 2ZI9A 2GF9A 2AL7A 1E79A 2W6JA 1II0A 4JLJA 1ZD8A 4TLEA 4JKYA 2DB3A 1QHYA 5AWFC 4FMDB 1NL3A 2ZSFA 3FWYA 4DXAA 3OEHA 4MRNA 3O8CA 4UKDA 5BQ5A 1F6BA 4V0NA 3REFA 3T1TA 3A1VA 4Z8YA 1AJEA 1FNMA 1T0JB 5AJYA 1W47A 1XZPA 4RFVA 2WM9B 1MABB 4R71A 2Q3MA 4AI6A 2ZUCA 4DB2A 4U5XA 3E70C 3NVAA 4YLGA 2QTVB 3ZZ0A 1EFUA 1CJUC 3T35A 3B2EA 4IOMA 3C16C 3GJ8A 5HZHA 2JLZA 1VHLA 1G5TA 3AVVA 5FPHA 1GNQA 3CRQA 4Z54A 2QAGC 4LY6A 3THXB 2DWPA 4V0MA 2PT5A 1OHHA 3O8RA 4IDPA 1E2NA 4NYJQ 3HU1A 3AVWA 3UK6A 1NN5A 3BB4A 2WSMA 1KI8A 1ZM2A 2J9RA 2WZQA 1XEWX 3K9GA 4HI0E 1E9RA 4LJ5A 3TKLA 1YZNA 3P20A 2QA5A 3KQHA 1G1MA 1SXJE 2GCOB 2ODBA 2OBNA 3GLIA 4C7OA 2CNWA 1ZCAA 1M2OB 4I99A 1VYVA 2WJVA 4UXJA 3WBKA 3TUJC 4C2UA 2W00A 4KYUA 4NMMA 5J4HA 5FOTA 1U90A 5L8VA 2EWVA 4PAMA 1Q57A 2WVJA 3JVVA 2QU8A 5IF9A 1ZUHA 1AGRA 3W3AA 1G9XA 3ICQB 3HU3A 2CL0X 2IYUA 1R6BX 2YNMA 4Z8XA 4BQSA 1FW6A 5JS8A 3SOPA 1BO6A 1HE1C 2V7QD 4US2R 3IO3A 1S9HA 2XOKD 1AZTA 3LO5A 2JLUA 4TMZA 4MGYR 3WRYC 3V00A 1S1MA 4EIWA 2OXCA 4GI7A 1M7GA 2UZIR 2ZANA 2ZSAA 4QBIA 3LBIA 2G1KA 1XBTA 3ZLJA 3AP2A 1KMHA 3DVLA 4JSTA 4LBWA 4UNRA 1DAKA 4PC2A 2GEUA 3NKVA 3GJ6A 1SGWA 3K8YA 5EZ5A 5TARA 4CT5A 1NIJA 3U4QA 1W4AA 1NVVQ 2AWNA 4ZPXA 5KUTA 3QF4A 3C8UA 5DO9A 1QF9A 1V43A 1XPRA 1TU3A 1RJ9B 4EPWA 2XXAB 4OKSA 3LLMA 1VCMA 1N6NA 2JJ2A 2QQ0A 1W5SA 4HSEA 2F9LA 5KOYA 3B5JA 1UAAA 1AS2A 2J46A 4FXPA 4IVPA 4M8NE 2VSOA 1WCV1 1FNNA 2B21A 1SQ5A 4JVNA 4LJ6A 1DTSA 1OIWA 1ZMXA 5P21A 2IT1A 5E4FA 4GFDA 1T3HA 5FOSA 3WRXC 1XEXA 2FU5C 3AUYA 2W2TA 5KPJA 3DKVA 1SVLA 4UNNA 1ZVQA 5FPKA 1SXJC 1W46A 3KKNA 4G5RA 2GILA 2Z4RA 1PVOA 1F5NA 1OFHA 3EZ6A 4A0FA 3AM1A 1G8PA 1RRFA 4CDGA 2ZI7A 4TMXA 1TADA 1YR9A 5CLQA 3AF0A 2CHVA 4QJ3A 2PZFA 4N0DA 1G291 3MLEA 4G5QA 4A9AA 4B6EA 2BMJA 1NY6A 4YXWA 1P2VA 3CLVA 2JLWA 5FOUA 1BOFA 3OIYA 4PZZA 1ZJ6A 2OZEA 5C2JB 1YZUA 1US8B 2ZIAA 1EX7A 1YR8A 4CT4B 1G18A 4URXR 4CEHA 1UF9A 5FTKA 5E7JA 2ZVPX 1YZGA 3T1OA 3DOFA 4RCYA 2BCJQ 4DLXA 2IXGA 2NIPA 4FMCF 5TB5A 4MDFA 1D5CA 2ZM5A 1F2TA 3B60A 4V0LA 3T15A 1TEVA 1E2PA 5JS7A 5F98A 2PZGA 2QQEA 3LNCA 4HAXA 1LW7A 3VX4A 3ZYCA 4DCUA 2HLDA 2CL7X 1E1QA 1LS6A 2ANBA 3BK7A 2VHCA 3NH6A 2ZI5A 2CL6X 2GEVA 2QEQA 2ZU6A 3H2YA 4AD8A 4RD6A 3KFXA 3HWSA 1GRRA 2QORA 4OHVA 2QP4A 1DE0A 4OQMA 2VHUA 3A1WA 1HTWA 1WDTA 4LHZA 3BH6A 4P4SB 2C9OA 3PUZA 1CBUA 4I1OA 2IYSA 4LHXA 4Q9KA 4A1FA 4TYQA 1KK1A 2AWOA 3PV0A 3K9HA 2J0UA 2REOA 2Z6VA 2AKAB 1P73A 3TSZA 5KSOA 1ZU4A 2OSBA 4S35A 4AG6A 4BLRA 5JCZA 1G7SA 4MKIA 4B35A 3P4YA 4DB4A 3ND9A 1ZYUA 1GILA 3OFND 2BV3A 4OHZA 1LY1A 5KNCA 1KI4A 1MV5A 3L2OB 2FV8A 1I2DA 4LJAA 5EP3A 3PXGA 3CX7A 3VR1A 2C99A 3HPRA 4O2LA 3RSOA 3C41J 4M1KA 4B2IA 3QKSA 3EWSA 4TZ0A 2CLCX 4ZCMA 4A2QA 3K0SA 2WWXA 5DLQC 1OT3A 3NDBB 3QF7A 1P4SA 1PUJA 3P26A 4DIEA 1TTTA 2ZUBA 4RJLA 2QMOA 2GCPA 2XNDD 3ADDA 4HZUA 1EFHA 5K8LA 3B1YA 1E0JA 1E96A 3EZ9A 4MITA 3U7HB 3ZD6A 1P72A 1U81A 1XFAA 2UZ3A 2IYZA 1QG4A 4HLCA 1XTRA 2GZDA 5DI9A 5DHAA 3K70D 1A82A 1IXZA 4HB3A 2GAOA 4TTRA 2ZRFA 3IUYA 1ZM7A 1P2SA 2KI5A 4PO8A 3UIEA 4EJSC 3R7WA 2PMDA 1P6XA 2JLXA 2RH5A 3RS7A 3GFPA 5DH9A 2O8BA 3GJ5A 1UEIA 4PQFA 4C30A 1XEXB 2DFTA 2QP3A 5DIFA 221PA 3FGNA 3LY5A 4D0GA 3IIJA 4JLPA 2JLSA 5BN5A 2E87A 4NHOA 1XMVA 5D3QA 2J0SA 2A5JA 2PX0A 3QKRA 1NF3A 1P60A 4NYMQ 5GJWC 5KSYA 5KNDA 4TL8A 3LQQA 3SJBA 2BEJA 3AVYA 1XD2A 3MUFA 5JMTA 3DMDA 3X2SA 1OFIA 1CR4A 4X8MA 1SXJD 2CK3D 2RGNA 3V4RA 3ZVMA 1PJRA 4RKFA 2HDNB 2C9YA 4URZR 1OW3B 4ESHA 2V3CC 4BFUA 4QM6A 1KI3A 4ZCIA 3GD7A 5BN4A 2JGNA 5KO2A 4PHFA 3E2IA 4XH9B 4ASUA 2WWGA 1G41A 1SVIA 4NL4H 2FH5B 4EPYA 1G4UR 2F1IA 1EK0A 4IEEA 4URWR 3ND8A 3SNHA 5B57C 1G3UA 4KFUA 1HEIA 2ZTSA 4NCJA 2EVWX 1MR3F 1T5IA 2KE5A 2OCBA 4KV9A 4LSGA 5FBLB 2VP6A 4YQFA 1KZ7B 2MMCA 4HUQB 4BUJA 4OBEA 3B9PA 2GJ9A 2CLSA 1ZCBA 1E2EA 4XD7D 2AFHE 1K5GA 4LI0A 4JL6A 1HY3A 3GPLA 4QBGB 1T8TA 1DO2A 2ZJ5A 4QGFA 3PG5A 3QBVA 4LJ8A 4TL7A 4GDFA 2GTPA 4Q48A 2H16A 1TU4A 1NJGA 4Q4JA 3KQKA 2XAUA 1XTKA 1W48A 3A58B 3SJAA 2GF0A 1P9NA 4KBGA 4LWZA 1U94A 3P32A 1YRAA 3SN6A 2RGGA 3UMRA 4D0NA 1WB9A 1OH7A 3NBFA 1Z6XA 3B13B 4P3YA 4UNSA 4JIMA 3EPKA 1LF0A 4Q21A 2IF0A 2ONKA 3K0FA 3LBHA 2PCJA 4Z1MA 4KLZA 4Q1BA 4DLTA 1MRSA 4PANA 3T1VA 1YU9A 2ZE5A 3T06B 2BM0A 1BIFA 3FMPB 4Q4LA 2BJVA 3FMOB 2X19A 3OIUA 2J0UB 5FI1B 3TBKA 4I1VA 4LBZA 3ZIAD 1KI6B 3L0SA 1WQ1R 2BEKA 2Z5FA 4DCTA 3OZXA 2ZJYA 1N5JA 3SQXA 2CCKA 3AP1A 1W4BA 2AD5A 1E2MA 4ZDKA 2FPLA 5KSPA 1PLLA 4BE7B 1FZQA 3AF3A 2FSHA 4Q66C 3K0EA 4RZXA 4MGKR 2TMKA 5EE0A 4ZDJA 3R9IA 4IVRA 4TZ6A 3PCRB 3W6PA 4G5OA 4MYUA 4H1VA 1NVXQ 3RS2A 2O0JA 2H92A 2JAQA 3X1YA 1ZM4A 2F9MA 3FFBA 1Q1BA 4HZUB 1CJVC 1Q1ZA 2CK3A 1UBFA 2H18A 3FE2A 4GMDA 4RD1A 5G3YA 1JB1A 1P9WA 5FPSA 1LF5A 3NBXX 1RKBA 4KYIB 3ZZUA 3U7EB 4IW3B 5CM8B 3K0CC 1ZBDA 4WOPA 3I5XA 3EG5A 5EQTA 3MJRA 1OXVA 2QPAA 3DZ8A 3R7WB 4IXMA 1FP7A 2REXB 1Z0FA 2BJWA 2JJ1A 3I73A 4LRWA 1ZM3A 4PX9A 4D80A 1DEKA 5TXGA 2WOJA 2BVNA 5HPYB 3KJIA 1XCGB 5FUXA 2C77A 2DWOA 4QHYA 4Q1FA 5UKDA 3CUEF 1CLUA 3WNDA 1CKEA 4G3XA 3GJ7A 3SFVA 4C0HA 2WTUA 2OO7A 4PC7A 1M7BA 3U3MA 2FZLA 2ZVQX 1MRNA 2ZS7A 4KLNA 4Q03A 1XD2B 3UWKA 1GL9B 1VDZA 5J4YA 4HZIA 1XU4A 5LDDC 2GEDA 1XWIA 1NJFA 4NZYA 5G41A 4E09A 2JDIA 2IW3A 2IYQA 4B2PA 4TWZA 4DEXA 3QI2A 3BIFA 2F55A 621PA 2AXPA 3B82A 1F3OA 2LKCA 4U7DA 1VTKA 4TYNA 1CJTC 5JSZA 4AIIA 4RD2A 1J2JA 3VTKA 2V9PA 2WICA 1ZIOA 3CZQA 1D2NA 4WZBE 2IYVA 3NG1A 2PJRA 4X8LA 4BASA 5JEEA 2OE2A 4A8JC 1TF5A 1L4YA 1IN5A 2B7CA 1KO7A 2P6UA 3KKMA 5LB4A 3ZIAA 2DFNA 2PLFA 1KDPA 2X1VA 3A4MA 4NPHA 5H1YA 1VMAA 3AP3A 1E9EA 2G83A 4Q4JB 1M74A 5TVKA 2YC2C 1LB1B 1JPNA 1RVDA 3I72A 2NPFA 4HB4A 5DN6A 2IXEA 2H5EA 4MKGA 3EA5A 4WA7A 1Z63A 1OF1A 1CIPA 2VP2A 4A0GA 4JMPA 2GVDC 5FBQB 2H57A 3QVVA 3IQXA 4BFTA 1CP2A 5HTKA 3K0FB 2G77B 2CMKA 3LAWA 3I32A 5FUVA 2XNSA 1XP8A 2B92A 2C9CA 1EFCA 3LW7A 3CF2A 2BIFA 3IHWA 2ZU0C 5GADl 1S8FA 2WIBA 4TYPA 1GKUB 1XJ0A 3MJHA 4D4JA 1SKYB 1KAGA 5CK5A 2J59A 3K1JA 5BW8A 1EWRA 1VCNA 1L2TA 3LRPA 1EESA 1MABA 4XVQA 1OFTA 2DPXA 1G5RA 1P61B 1QHSA 1VYTA 3JVUA 5CYOA 3TAHA 2VQSA 3VR2A 3W3ZB 3QXHA 3U3JA 2EFHB 1JBKA 2GBLA 3HR8A 2ZS8A 4HDQB 1Z6TA 3CPEA 1YZQA 1E2LA 1M34E 1CTQA 2Z43A 2ZJAA 4LYAA 4QL3A 2IX3A 4BFSA 3GEHA 4FD2A 4JLVA 4Q1AA 2XZLA 1RYHA 2OFXA 1KY3A 1OB2A 5JRJA 4LOAA 1E79D 4EFMA 2W6JD 2KBEA 4KI0A 4ZI2A 3TSOA 3QXJA 3TUIC 1D2EA 1HT1E 2VHQA 2CCJA 4M0LA 1I4LD 3D6TB 2ZITA 1N6PA 2C2HA 1WP9A 1TAGA 2FSGA 2ONJA 3SEAA 3SJZA 2O8DA 4QM7A 4LGMA 1T3LA 1FMJA 3WMGA 3FTQA 2WBLC 2WKPA 3VAAA 2WWYA 5JJIA 3B1ZA 4DIDA 5FPYA 3VNUA 2GCOA 2OV2A 1XTQA 3LFUA 1IXSB 3BGWA 4EKDA 4US1R 1D6JA 3Q7PA 4AYTA 2IWRA 4EPVA 1E2HA 3KL4A 1ESNA 1NRJB 2A5DA 1KK0A 3AH8A 4DDUA 3CRW1 2FG5A 2JLRA 5SZJA 3A8TA 5HKKA 1JECA 1AKEA 1UDWA 1TF7A 2FFBA 4NDZA 2D4HA 2VLIA 4LDJA 3QSYA 3GP8A 4EDHA 3KB1A 1XX6A 5DSZA 1S2MA 1UKVY 2D06A 4JS0A 4O0MA 4BLOA 3OE7A 2FFAA 1XZQA 3VU9B 1OHHD 3BE4A 2B8TA 3L0PA 2FN4A 2WKRA 4QGAA 1E9AA 4QNRA 4Q02A 5H68A 4ZIRA 1S1CA 4PR0A 1J99A 1HT2E 4TQAA 1N6OA 4C0AC 4C4PA 2CNWD 2EFDB 3FDIA 4LHVA 4M1TA 5FTLA 1NBMA 3NBZC 3NXSA 2IEZA 4LC0A 2WWIA 1YR7A 2E9SA 4NP6A 1DS6A 3NC1C 4K46A 1W1WA 4JT4A 3DOEA 1HE8B 4OHWA 1N5LA 4HB2A 1IJFA 2ZRAA 3VX3A 5FUWA 1Z28A 2SHKA 2XXAA 2H8KA 4GOKA 3BFVA 1M6NA 5DNYB 2W0SA 2PEYA 5FBWB 1H8EA 5CB6A 2WKQA 3HPQA 1II8B 1G17A 4F93B 2XTZA 1DG1G 1KDOA 2VF7A 2Z0MA 2CDNA 3AKCA 1E2KA 3MWLA 2ZR9A 3IBYA 3SHWA 2PH1A 2DCUA 3BS4A 3CW2A 1QZXA 4B48A 1SKQA 1J7KA 1RRPA 2A5YB 1CULC 4JT2A 2Q21A 3H86A 4NBSA 1Q3HA 2EYQA 4NYIR 3ICEA 2W0MA 3FKSA 1J8MF 3EZFA 2C03A 3BAFA 3PEVA 3CF6R 3CF0A 4E5UA 3ZJYA 3HDTA 2G0NA 5EP4A 1N6KA 1UADA 4M9ZA 2DWQA 2GJAA 1E9FA 5TV2A 1G7TA 4WIAA 4ZDWA 3AVPA 4IDHA 4Q47A 1XXHA 3C4JA 5B30A 3ZD7A 3ETLA 4A2PA 3GLFA 2GCNA 5G3ZA 2OCAA 4FWTA 3KUDA 3SC3A 1ONBA 3R8FA 2JJ2D 4ZV4A 4URUR 4LV5B 1PUIA 4IFBA 3WYGA 4JLMA 1MO3A 2XGJA 5L3SB 1R5OA 2FPKA 5AUQA 4XOIA 3PIRA 2FDCA 1US8A 5SZHB 1VG1A 4A2WA 3W6NA 2EFGA 4B73A 4Z51A 3BWDD 1GM5A 3LQRA 4JJKA 4B47A 4V0KA 2F6RA 1YHNA 2ZJ2A 3BORA 2G1JA 1VHTA 1E98A 3I4LA 2W83A 2C96A 4FW9A 4NH0A 2O8DB 4TMWA 2ERYA 2R62A 1ZM9A 1RPZA 1XEFA 5JJLA 2A5FA 4KSCA 2I1VB 3IEUA 4KSBA 4WXRA 4YMVA 1Z06A 3KQUA 3IQWA 1BMFA 821PA 4AY2A 5JWOA 3KUCA 1GNPA 2EFEB 4I81A 4YXWD 1SZPA 1W36C 3CPJB 4JLDA 1SVSA 3U60B 2O52A 2OEPA 4P4SA 1GRQA 3AKEA 1R0YA 2CVFA 1E2JA 1Z0KA 2GA8A 1G6OA 2P6NA 4MUBA 4OK6A 1OIVA 1EWQA 3CH5A 3RVBA 1E99A 1A5TA 2X2EA 2F3TA 4LJYA 4ACAA 5J4LA 1I2MA 1P3JA 1QVRA 2QNRA 1ZUNB 5L3RA 2ZSDA 4W5HA 2P5TB 4ZIRB 5CDFA 1L8QA 1CS4C 3I8XA 2HLDD 4DLSA 1E1QD 4M9QA 2J3EA 2Q9BA 1KSJA 2V1XA 2QT0A 2R6GA 2FPMA 1W36D 1YKSA
chains in the Genus database with same CATH superfamily
2R4UA 1DCFA 3L7OA 1NVWQ 2WVAA 2PUHA 1LTQA 1N0IA 1N9GB 2CXUA 1QCZA 3Q7EA 2ZZKA 4JP8A 3C3DA 4UMEA 1P19A 4X20A 5F73A 3SS8A 2CLLB 1FX0B 3MF4A 3U4AA 1UCFA 4CMEC 2P2GA 1XMPA 2GLXA 2XQJA 3FOBA 2ZROA 2YS7A 3RIGA 1ZCZA 4AL4A 1C9MA 2C7PA 4PR3A 4ZZIA 4PQRA 4OHXA 721PA 1JWAB 2P1RA 3THRA 3DWEX 2XZTA 4OHOA 3QEMB 1N7IA 4BX2A 4YUAA 1DEXA 1R8JA 4YALA 5EGSA 4K8RB 3DAPA 4JSYA 4UZSA 3IO5A 5F3RA 2ONCA 1B2RA 2EAUA 5D7NA 3MS2A 2Q1TA 2R4TA 3BZBA 3DAFA 1KO5A 5JCPA 5KNCD 1TZBA 5ALDA 4UDNA 1OWNA 1NE2A 2ETXA 3M4YA 4KOAA 5U1PA 3H11A 5C80A 3OQPA 4AAYA 1XD9A 3ZS8A 4RCVA 2PZAA 3JQDA 3RC3A 2G76A 3QFHA 1T3ZA 3PX7A 4J3NA 4GRAA 4PPGA 3VU3A 2ZUDA 4TOIA 3FGZA 1BNCA 1TVKB 3LQFA 3W5DA 3W6UA 4L27A 2ZWAA 2EDCA 3O1LA 3K9BA 2QL7A 4IKPA 4IIVA 4DIUA 1OPXA 4PGFA 5JXGA 2N42A 4XGRA 1N6LA 2BFBA 2O6HA 3FYTA 3R3JA 1OXSC 3K2QA 2Y6UA 4BNVA 3EGXB 2D2VA 4CM3A 1ADYA 1DWUA 1I7LA 2B1IA 2XCIA 3AM3A 3N70A 3QBJA 3SZRA 2G07A 3AVTA 3E1GA 1ID8A 1V9LA 1GL7A 3CM0A 1K4MA 4U9HS 3F1LA 3LKZA 4S0ZA 4UVGA 4LKRA 4G4JA 3I04M 5IT4A 3AZPA 2OQRA 1NWCA 3KOZA 4RA9A 5GV7A 1U8FO 3EIHA 4UHBA 3SYLA 2LDXA 1U0JA 4RZQA 1FFAA 3ENVA 2FFRA 3K2IA 1CUYA 2F4VB 2PZBA 3HUFA 4KAJA 3J81A 1BWRA 1X7YB 1YJXA 4YONB 4BVHA 4MPPA 3DZIA 1Y1QA 1FOEB 1ZK1A 3PZRA 5I7EA 5TMDA 4GP7A 3KYIB 2HI0A 4YACA 3O1IC 4QASA 3NRCA 4PE5B 5HIMA 4EHIA 2JFUA 1BYIA 1X7WA 2ZP1A 1ZC4A 2GM5A 3OCWA 2VAVA 4BZPA 1UT6A 3DVQX 1H4QA 3KUKA 2ZT6A 2Q6VA 4KQXA 4JXXA 2AVDA 3I9OA 3IRVA 1J1ZA 4FU0A 4O6VA 2G5CA 1P0MA 1Y3CE 1IMOA 3SWWA 4NI5A 3RC8A 1V5EA 4KFRA 4A5OA 3WKEA 1LPSA 2DQZA 2H0RA 5C5EA 3F98A 3WOHA 3HJHA 1V16A 2P2ZA 2X23A 4N65A 1AKYA 3GUVA 3FOZA 2XDAA 2JEZA 3QE3A 2C98A 1UXGA 1I7PA 1KS2A 2GZ3A 4FYIA 4ALKA 1LSOA 4AQYB 1ZONA 1DV1A 1VZ2A 3UB3A 3ZE6A 1XHLA 4I8IA 4DANA 5JAZA 2ZI6A 5JZBA 2R6R1 2ZSKA 1AQNA 5REQB 3OZTA 4AZTA 1HDYA 4BZWA 2EYUA 3EIQA 1E5XA 3AXSA 1N0UA 5LCXA 7REQA 5EMLA 3KPUA 5IBPA 1JFLA 4A2CA 4X1IA 3GD5A 2CZCA 3JD4A 2APJA 4NATA 1KU6A 1PQUA 4WBSA 3V9AA 4OP1A 1RRMA 1RXYA 1T0BA 4JQSA 3B6ZA 2ZJBA 4HAYA 1NZJA 1FQOA 1QKJA 4M8LA 3K53A 4NZNA 5IASA 2C4TA 1SUBA 3L6UA 3VYWA 1X1AA 1Y3IA 3G7NA 4RAOA 4B3FX 2IZZA 3G1WA 4QOEA 3D4BA 2OQVA 3LCRA 5TQ0B 1FX1A 3NBYC 4P4NA 4TLAA 5KTKA 2XR1A 4J4BA 4RLFA 2W37A 5HDQA 2P40A 4QTZA 4KJZA 3SE7A 3C45A 1O0CA 5AXBA 2P67A 2R6AA 1SUFA 4I5FA 4E22A 2IIPA 4AYWA 3K30A 4HYEA 4LJ4A 1UEXC 4TM8A 2G36A 3WNVA 2QTLA 3L43A 2C20A 4J91A 3SQMA 4DV5B 1DXHA 4C0KA 1JI3A 2I9PA 2R11A 4BYMA 2EATA 4JY7A 4S12A 1RRKA 3THSA 5JNVA 2YVUA 3UH0A 3TLAA 4DNOA 2MU1A 2R5WA 1P1FA 5C4IA 1M5TA 1CUSA 1U4NA 2JHPA 3OQ1A 5B4UA 3KFVA 3ESQA 2JVJA 4H77A 1D0SA 2SECE 4S24A 4V2IA 2EHJA 3AJ8A 3OZCA 2WJ4A 1I3LA 2RGUA 4CV0A 2EJVA 3FVTA 3KPWA 3ZY2A 1HE4A 4OHKA 4EYKA 2VNSA 1TTTA 1WSWA 2D2IA 4IFEA 4A6PA 4ZMSA 3W6OA 4AG3A 3HLYA 1XRNA 1RDFA 1ZVMA 2JFXA 1BDBA 2BC9A 2FN8A 4UNQA 5E8JA 4MEJA 2ZOSA 2DSTA 2Z04A 3SLRA 1SO8A 5IAJA 4FYYA 2P2NA 3PICA 3SY8A 4FUTA 1KERA 3T5MA 2DWUA 1IDOA 2DKFA 1Q7TA 2SCUA 1NPTO 2QM8A 3F3KA 1WHSB 3P9XA 4EP1A 4QVGA 1C7IA 3AKDA 2QJTA 3EPPA 2DULA 4GPAA 4M9UA 2QP9X 5LYJB 5E9WA 3JQ6A 1XXHE 3C7AA 3HXLA 3K4PA 2WB4A 3DM5A 1JF8A 1FP2A 2JHCA 3HY4A 4MV6A 4Z9XA 4M1OA 5BMOA 3GLFE 4K03A 5FYDA 3IAUA 3N0TA 4GVLA 4OMUA 2DFKB 5FNVB 2WJHA 3T3EA 4A03A 1I7SB 4BKMA 1OBFO 4DUYB 5BOSA 2QVZX 4JP5A 2CNKA 2QZPA 2J3QA 1N0HA 2XF2A 4MA5A 1DU4A 4H7EA 1PR5A 2XA2A 4EWLA 2P3SA 5DCLA 3UJPA 3HBJA 1VJDA 3UKDA 5GTDA 3I5UA 3P4XA 3V6LA 5FQNA 1CUFA 1YCGA 5C4MA 1ESDA 1VPLA 1PLKA 1ISIA 4B34A 1V3VA 3FJOA 3I23A 3LXRA 4OMDA 1OGYA 2VQFB 1YO6A 3PPIA 5CLLA 5CEFA 3FLBA 2PRIA 3ZHSA 4QNNA 3U7FB 2YKGA 2QLBA 1VFNA 3EY9A 2Q5JA 4IHJF 3CBQA 2PT9A 1KVTA 1EZ4A 2JDID 3F2IA 2V5UA 5EE1A 3SOZA 4OSOA 2H7YA 4HDCA 4MINA 1JEYA 5I9SA 3AOEC 1E18A 1QLWA 1Z2DA 3L05A 2FA9A 1QJ4A 2CXTA 2QENA 3LL4A 3DTVB 5AK0A 2KLBA 1YONA 1KSFX 2AD1A 2PFGA 3DJFA 4YAFA 1E2BA 5EQJB 4Q3NA 4WPGA 5JSYA 5FIUA 1XQXA 1QGUB 1UBSB 4ERXA 1R0ZA 1HH4A 2OY0A 4AK9A 3RADC 4NCNA 3WLHA 3VO1A 1N1DA 5LQDA 4MGIR 1VOTA 1RWXA 3FCYA 3ST7A 1PNRA 1FTQA 5EEGA 5IJZA 1LRJA 1W44A 5D8DA 2JGRA 3ZLBA 3R3SA 3KHTA 4MKXA 1RRCA 3IBGA 3ACBA 4CF4A 1W6UA 1X13A 1JG7A 4E33A 3R0ZA 4C21A 2XRYA 1HV8A 3C1AA 3HM9A 3RRJA 4FDVA 1I6LA 3ZWYA 3WMEA 4X00A 1FRVA 1R66A 1VHJA 1NULA 1DKOA 1R5NA 1TJYA 3EEYA 1IY0A 1I4WA 2J4FA 3AV3A 1PNTA 4BCBA 4C3UA 3QFTA 3ZBTA 4E88A 3MB5A 1O95D 1EK1A 5ALSA 2JEYA 1K4YA 1N2CB 4HWPA 4YPFA 5BW5A 1R6VA 4RPIA 3GP3A 4L8WB 2F8MA 3DLIA 2EWWA 1BDJA 1LC0A 2IE8A 2XX3A 2YIMA 1R5JA 1MOPA 1Z7GA 1OU4A 4PV7A 3HVHA 4PS0A 4B4DA 1GFWA 3Q8XB 1LSSA 3CX4A 4LVNA 4LWPA 1YJ5A 4M9XA 3FNBA 4RD4A 5IBRA 1QK5A 4LV6A 1L4MA 3VBEA 4ZQBA 2R65A 3WGNA 1MB2A 4OY3A 2FVYA 4GQBA 3QU2A 1XZ8A 2EEZA 5KC9A 1JFSA 4KRXA 2NO9A 3OG9A 3NT5A 1IUOA 2XCTB 2F9FA 1JSLA 5ISMA 3VH1A 5CTAA 1C41A 3S1AB 2OLKA 4P9NA 2ORVA 5LQUA 3SM9A 2L19A 4QOSA 4C4YA 1RLOA 4GX0A 1KDTA 2ALJA 3BFJA 4MA4A 3T61A 2Q0HA 3VR2D 4LY0A 3TAXA 4TSFA 2WABA 4AKHA 3UAGA 2C2GA 4TTTS 1LTHR 2F3RA 5CHEA 1ULZA 1I36A 4NG4A 3W79A 2FW6A 4HH1A 2QPTA 2I71A 1SIBE 1U0TA 2F43B 2C58A 3LPCA 5K0NA 4WJLA 1FNSA 1F8UA 2IUFA 4CW7A 1QRTA 4GE3A 1JR3A 5HOEA 4MYTA 1U9JA 1H4TA 3O0TA 3PL1A 3BE8A 4TS4A 3PE6A 3K9LA 1T36B 3K0AB 1HQYE 4LXUA 4W5RA 1MX3A 1UBMS 1HYBA 1WZEA 4JBYA 4B5LA 2IJGX 1Z6QA 3IT0A 2OAEA 5BWNA 1Z7WA 4Y0NA 3DZCA 2WSSD 3C6MA 2OHIA 4AO6A 2F1KA 3NAZA 4ZYUA 3C70A 4K3VA 4LDZA 1R6AA 1X42A 1U28A 2JAWA 3P2IA 4FX2A 1T4GA 4RLQA 5DTJA 1BQEA 1R2QA 4NZZA 2LD4A 2RGEA 3BWCA 4UPEA 2WSLA 2YV4A 3G0HA 1Z5GA 3DL0A 1N2IA 3SC4A 4H18A 4BUZA 1S96A 4PLCA 4B17A 4BMXA 4JI6B 3I4CA 2GWRA 4B4KA 4ARSA 5A4JA 4HEJA 4ARUA 4S0XA 1HM5A 3NBKA 4WXPA 2O3UA 3N2KB 2ATCA 2EU8A 2HGSA 4YDHB 4HVAA 5BORA 1E5QA 3KXKA 1SA0B 3IDOA 3NDPA 5EMHA 2Q5LA 2ZYGA 4QKQA 3O2NA 3O4JA 3BTSA 3OQIA 4J3JA 2OXTA 4B4UA 3ZQJA 1GRNA 1EZZA 2W90A 5FHQA 4N0EA 3WLTA 3RCBA 3AETB 3DHEA 3SICE 2JHAA 1J00A 2GBGA 2WP8J 1QK3A 1E8MA 4Q9DA 4DA4A 2DTXA 1CF4A 2X9GA 1XOIA 3C3BA 2B7BA 2BHTA 1H8HD 1RU3A 1RWMA 3EGCA 3HABA 4FW8A 4N82A 4YGXB 2OWEA 4JJ4A 3WX0A 4BE9A 2HA6A 1VI6A 1N1MA 2X9QA 2WB2A 3RU3A 1YFLA 4C04A 4K9LA 1LLCA 1XPOA 1E0KA 2VPXA 1GPNA 3OJ0A 4LYHA 1N33B 1B15A 4JLOA 5M34A 4ZAVA 2VO1A 1FSFA 2BZSA 1TMGE 2R87A 4ZI7B 5HXAA 1O5TA 3INNA 2I03A 4TYMA 3O91A 4NJOA 4L15A 3QHAA 3DGEC 3E9DA 4GNKA 1M75A 4L51A 1RCTE 3WRWA 2VDVE 5IMBA 3GEEA 2F48A 2RGXA 2IBSA 3FY4A 2DBRA 3HACA 4XIJA 1KFEB 2WDPA 3I92A 3NTRA 4GYWA 5EJEA 4RM2A 1DAHA 4MYHA 1QHGA 4EAQA 1PP4A 1A76A 1XB2A 2AQIA 2FMIA 2WJIA 2BGNA 1CRLA 3MS4A 1R4NA 4KQHA 4ZOLF 2BZ0A 1IONA 3V4FA 3WWOA 4AC9A 3CPSA 4DLAA 2QI9F 1VL8A 4BKRA 1WPGA 3R6WA 2V1UA 1V71A 1M2FA 1U8ZA 1XEAA 5T4EA 1PAUA 4J2OA 5KO2A 1UBJS 1HDCA 1JS1X 5B64A 4ALNA 3ZWKA 3NEJA 4HRYA 1KE1A 5CD9A 1K98A 3QBEA 4FCCA 4MVJM 4U4AA 4Z9FA 3TNDA 1DUVG 1YA8A 2Z83A 4X7BA 4G1CA 3KV1A 4WMLA 1BFKA 4DC0A 2EX0A 1XMOB 3WIDA 4GBJA 1U8YA 3P9YA 4B3BA 1DKRA 2QLJA 1QMPA 2VXYA 1LH0A 2F1JA 3URKA 2C5GA 3KQVA 2DY1A 1AO0A 4NJMA 4EI8A 1T2VA 5CITA 2WSSA 3PXDA 4FMCB 2R6CA 3PGVA 5EWJB 5HMMA 3FMIA 3GX1A 3MHTA 2CVHA 3BSYA 4JA0A 4BL5A 4PO9A 4O2AB 5D3MB 1DAGA 1DZIA 2HMTA 3BE5A 3VKUA 4CLRB 2XMDA 1NYRA 1XCLA 2OD2A 4JR2A 2JKZA 4YJGB 3WLKX 4LWQA 3TQSA 1IPFA 1ISPA 3RKRA 3KIPA 1JFTA 2VUTA 4I55A 1S2OA 1DG3A 1TB4A 2UYQA 4HX5A 1NF9A 1G8HA 2PA3A 3TEFA 2VPTA 1KR5A 3H1TA 1JR4A 3MERA 4X1KA 2Z9CA 3HJRA 1T9ZA 3AEXA 3KE8A 4E2YA 3N76A 1PD1A 4CVNA 5JJBA 1O1YA 1G8FA 2GERA 1Y3HA 4AQDA 2QTAA 3QJGA 2RAUA 5I45A 4BFZA 5B6PA 4MWBA 5KDOA 1PQPA 2QUAA 2ZAGA 4LYFA 5C8YA 5THQA 1GV0A 3WK4A 1OAOC 2D1QA 1YZFA 2G9UA 4JJFA 1TM3E 3RBXA 3ZCPA 3ETHA 1JT9A 3OCCA 5JBIA 1BC5A 1WPXA 4RKRA 2CJXA 1H8HA 2CLFB 1E77A 2HPZA 3LM8A 1DMRA 1B0PA 1KO1A 3V1NA 5HZGA 5FRDA 5FNVF 2DUJA 2RGWA 5DI3B 3FR8A 5TEWA 3VHXB 1FX0A 4TKLA 1EFVA 2PRJA 2VDOB 2WMOB 3NTXA 4B1FA 4IX9A 5KOIA 5L3QB 1FU7A 4IH1A 1IQ0A 3LPAA 3BPSA 4YMUA 1HFEL 4N0QA 4NBTA 1IB6A 3GFSA 4LRSB 3R7BA 2DU8A 2WF8A 3WKAA 4EKNB 4QEDA 2VTKA 3IEVA 3UT5B 3H04A 2H1FA 5B5SA 4UUPA 2O2HA 3A2KA 2Z3ZA 4NMLA 3QEMA 5ED4A 3KXDA 1RZ3A 4L8LA 1LNZA 4MJLA 4PFKA 4YP5A 5DGIA 4GPEA 4AF8A 4HF7A 2NSDA 2QSZA 2K2WA 4TWBA 5BV7A 4Y2YA 1SU4A 2NUTA 1CSEE 3SJUA 2UVQA 5K3FA 2GPNA 4PXSA 3Q12A 3W5UA 4A6XA 5DCWA 5F2OA 5KAMA 1S0UA 3EXAA 2H4JA 2P90A 3ETCA 5J2TA 1SU6A 3D8TA 3EVDA 4M1SA 4K9SA 3H3XA 1QQBA 1J07A 1OYVA 2RHHA 1Z2EA 1APBA 1TA0A 3IOBA 1NXXA 3L0BA 2FP4A 4FOTA 5K4HA 2ACEA 4UHJA 4EGJA 4RZ3A 2OYCA 3H7AA 1SKUA 3TD6A 4O02B 1GFZA 4UHDA 4UDXX 1PL8A 4R3WA 5JE8A 4HNAB 3STVA 5LVAA 3Q85A 1BX0A 1NJ1A 1T6BY 2E1RA 1V1RB 2OM2A 2W71A 3ESDA 3FHLA 3UJ9A 3LKBA 3A6KA 4RSGA 2I67A 3ZR4B 3NYWA 3LSYA 1GKLA 1M0WA 3U44A 3PWSA 4DV2B 5IMSA 1CB0A 3PC8A 4XWKA 1HA3A 2X1LA 3RRFA 4AJJA 4E5YA 2Y0CA 1TYZA 3GNLA 1SKYE 4Y6OA 4CL8A 5FOQA 1HRKA 1RI3A 3SPXA 3IMCA 4DZTA 1Y1TA 2IHUA 1SCBA 1F4VA 2H65A 2YWEA 3CF4G 4I9NA 4ZO4A 1HG0A 2QTMA 1BZYA 4ARCA 4KZPA 1NUSA 2L18A 1QX4A 3ND5A 4KPGA 3PX2A 5EKXA 3WJ2A 5JQGF 3JR7A 2DLCX 3KBOA 4NNOA 3EZ7A 4K1XA 1IYZA 2AGVA 1NVVR 3GLGE 1NUHA 4D81A 2Z4SA 1QP4A 1ZEMA 1RJGA 4L0QA 3V8VA 3G2QA 2XUPA 2PR2A 3LZ6A 4Z7JA 1Q6ZA 2FW7A 5ALUA 1R9NA 4DVGA 4NBUA 2ZTVA 4PX3A 3ZCRA 2E7ZA 2LBPA 3FDFA 4ZCTA 2HKIA 2I66A 4ZRDA 1OLUB 2I5PO 4P4TA 4CETA 1JZQA 5CAEA 1YDWA 3B6IA 4V0OA 4H35A 3K0CA 4FINA 4OK3A 3K5HA 1VI5A 1ND5A 2RI6A 3HP1A 2Y1XA 3N0VA 4M99A 4ZCLA 3ZDEA 3IOYA 4URFA 1KMQA 1XAHA 1A7AA 1EXDA 2GJ4A 4Q5IA 4BNLA 1E2IA 4MS3A 1JXQA 5SY6A 2VNHA 5JANA 1NXVA 3ANNA 4IHAA 5CLIA 4I9FA 4WZAA 2O8EB 2PDAA 2AUTA 1ZC3A 3WNCA 3GPIA 5DHTA 1EMDA 1EEXB 1KO8A 2B4RO 3R2JA 1U3WA 4J49A 4KG7A 5AVQA 2D8MA 1XTJA 2JIZA 4XPIB 2VDJA 3ZD8A 2C4KA 2WA2A 3PJRA 2DSNA 3COYA 3H5AA 3DQZA 5REQA 2UZ0A 5IBCA 4OEHA 5JALA 2YVKA 5CH8A 4EUNA 4YRTA 5LZ2A 1N2SA 1CEEA 2WILA 1UC8A 4LZNA 1DRJA 2ZRJA 4XEHA 1TIKA 1C0LA 1KAQA 2YBDA 3WO0A 2AUNA 4TKUA 4P08A 4NYIQ 3ZHBA 2R96A 3ZX4A 1GFIA 1VRCA 2Z2IA 5MGBA 2I7XA 5DLPA 1NW5A 3A32A 2OILA 1N7HA 3QNUA 3UOWA 4ISCA 2IZOA 3GRFA 5K51A 5TQ0A 5J2UA 1MFPA 1H2EA 3DTVD 1KFKB 2ECFA 4MYCA 3CZ4A 1Y7LA 4MV9A 5A4IS 4MUFA 3CKLA 8ADHA 3TR5A 4PBRA 1K8YB 1BVYF 1ORVA 3I6QA 3I6MA 3DHVA 3QVLA 4MNTA 4KC0A 4BN4A 4J0HA 3ANTA 3QA3E 4JK3A 2GKGA 4AS3A 1RJWA 1GPAA 2IDMA 1KIMA 1VKHA 2JFPA 4B87A 3DTYA 4UEWA 2BBSA 2OKGA 1AS0A 2P5SA 1RPJA 3DKPA 2VYVD 3PI7A 2IYAA 3LK7A 4TXJA 1LX7A 1KHTA 5JD6A 3R23A 1U9YA 2Q4RA 1Q1EA 3E7FA 3EGIA 2GGSA 5DNWA 4B5KA 5I7VA 1IN6A 3PFFA 2GKOA 4FHEA 3CH4B 4WGGA 2ZREA 1C4WA 5CB4F 1UBNA 2XGSA 3GFOA 1XROA 4AJ9A 1ZMRA 4X5OA 2ZRBA 1AQYA 2XNJA 3Q2OA 5TT0A 1ETHA 1KDRA 2G88A 4M0UA 3ECSA 4R2KA 1SZDA 2QYSA 5DLDA 3TO5A 4GE0A 4RVDA 1RABA 3FRHA 1KMMA 3E5RA 3DKKA 3LUKA 5DYNA 5KMGA 3VR4H 1JA0A 1N75A 4IYJA 1Z88A 3HZOA 3QNWA 2I6SA 4DLUA 1UJ6A 3EJ6A 5CNKA 2UVPA 1T24A 1Z6ZA 3DD1A 3QTLA 5JRZA 5EXTA 4WDRA 5F1YA 3AVUA 3JALB 3MAGA 3NM5A 3NRJA 5EJAA 1YC2A 4G8BA 5TNXA 2B83A 2P9GA 2C4HA 1RKQA 4DTCA 1Z0DA 2CFCA 2JJ8A 2ZYTX 3TIFA 2O50A 4F4IA 1E0AA 4EHBA 2OLJA 3EQ6A 2VSYA 3D6AA 4IQ8A 3LP8A 1UDBA 3EWAA 5IK2D 3GCWA 2B4QA 2I4IA 3IAEA 4RXUA 3SQLA 5I4IA 3D8UA 5M5BA 3LQ4A 5EE9A 1I51A 1VDMA 2KS6A 4G81A 4QDZA 1AO3A 2HWXA 3FZNA 4G1BA 4R98A 5FL7D 3DL4A 3AINA 5J40A 4U2DA 5CDSA 1N1GA 1T26A 3PUWA 2XA1A 1UFRA 1GGHA 5CBPB 3UK0A 3FRJA 5L4SA 3O6VA 3S55A 3VPAA 4XVRA 5A1TA 1DJMA 2A67A 2E4ZA 3NYIA 3S29A 1DVRA 3RT1A 2CLIB 4INOA 5DHFA 4GL2A 4Z2YA 1SPBS 1TQHA 2H48A 4DV7B 4NCXA 1CRQA 4FC6A 4KDCA 1RTKA 3B2QA 1MAAA 1P2DA 3OO1A 4TLDA 1O2DA 2QZ4A 3L92A 3PVZA 4CHTA 2R5FA 2ILTA 2V4ZA 2VATA 5KYYB 3BOSA 2R48A 2VRCD 5LIPA 2QUIA 2DETA 1NA5A 4DZZA 1SUEA 2CLDX 4EY4A 1MDBA 3MN1A 5AOAA 5CLFA 2X86A 1U28C 2Q1SA 3V8BA 3CRNA 4QLOA 5FPQA 4CDNA 2VAPA 4YUVA 2O0KA 3UHPA 5DNCA 3QELA 1HDRA 5K0CA 4KBYA 3KZVA 1KYIA 3FNIA 3REQB 3RRMA 3QOFA 3T4UA 3Q2IA 5HWSA 5C32A 5ELXA 1WEHA 4M7WA 4BJ5A 3RG8A 5A3VA 1D2CA 1J5PA 3FVVA 3WGTA 3VNQA 4P2BA 4ZHQF 2GEBA 1A97A 3P97A 4MP8A 1JE1A 3CNQS 3IUMA 5T3UA 4JJ7A 1NZDA 3CLRD 3FHTA 1U3VA 1YRLA 2QV7A 5DGDA 2OV8A 4JNCA 3LT5A 2GRUA 4GLFA 1HC7A 1O9GA 1MH9A 4C0BA 421PA 2GZ2A 2VI5A 4NQRA 2A9FA 4DRXA 4J6EA 5AVZA 5K8UA 5EZ6B 3GYGA 1ESMA 1YZKA 1UJ2A 1Y5IA 1FMCA 4P98A 4DLVA 2XYPA 3ORYA 1PX0A 3HCAA 4RZUA 3GJRA 1FFHA 1P45A 1B7GO 1ZGGA 1VJRA 4BAUA 2E5WA 4G9EA 1FS5A 1JHVA 1FRNA 5DE3A 3VHLB 1PZNA 1N2CA 2VP0A 4YV7A 3C39A 4FIZA 1U99A 1YRWA 5CGQB 2C2KA 4KAXA 1SELA 3DOUA 2PH5A 4JT8A 3ZEIA 3B51X 3C14C 4RKEA 3MTAA 1CB7A 1NE7A 3B1XA 1GQ2A 3QX9A 4A8JB 1PZEA 2OG2A 3TQCA 1Y7TA 2J33A 4OFXA 5BQOA 1LVHA 3L7NA 3W8DA 3L4KA 3CN9A 4C2BA 4WESB 2FSIA 1XCBA 2FMFA 2G5GX 4GAEA 3ZW9A 5GGXA 2UZ1B 4F4JA 1EX6A 5A9SB 1AN9A 4V1CB 1V9CA 2VRWA 4F1JA 5DYIA 1X8KA 4XDZA 3LLUA 4EW1A 3S1AA 3RODA 4A10A 2DHRA 2ID4A 3HEBA 5E9JA 4Q19A 5IC5A 1U2PA 5FJJA 2IHYA 1I14A 1EBFA 4C2AA 3NTUA 4CEIA 3DC2A 4CMAA 3X1WA 2P9EA 4D3DA 2C82A 1RZRD 4MVJF 5DT9A 3QUSA 3F9RA 2QW8A 2RH9B 3CNNA 3QBDA 2W58A 4AWXA 4MWGA 1O08A 3I58A 3Q72A 1PDWA 1RHKA 2FF7A 3BXXA 3UV3A 4CTKA 4CMJA 2XIQA 1RWVA 2ZR8A 3SE0A 3TXAA 1TMKA 2F43A 1U2ZA 2PLWA 3K1TA 4OG2A 4TXMA 5DVZA 1V3UA 2YW2A 3MTBA 4ARAA 2Z08A 3MSXA 3JWJA 3ZBPA 3SC6A 2VRCA 3EAGA 5CFQA 1U2GC 3K0AA 3BBPA 4P8RA 2EL9A 2GSDA 5IN4A 2A5GA 3J7AC 1J5XA 1NP6A 3OTQA 4QQFA 1PEYA 3MAJA 1GN9A 3DG9A 3H8WA 3ZG6A 5HX7A 2R25B 3WQRA 2BSQA 3OHSX 4PYOA 1RW4A 4TLLB 5J59A 2ZBQA 3EPJA 3GJQA 3DPUA 2Q41A 4D25A 2I2WA 3SIXA 3NHZA 4PYKA 3CX8A 1J2YA 1UODA 2C4NA 3EA4A 3FVWA 3FWPA 1A4RA 2HHJA 3GLHE 2XHZA 3EMBA 4BHTA 4BZXA 4F1WA 1J8QA 3GVPA 2CLKB 4X41A 1AUQA 1KQ3A 1MOSA 1AMUA 1KAHA 3CUTA 1FJGB 3DONA 5CH5A 4F7DA 4BXOA 2NVWA 4H1HA 1T3GA 1O77A 4HUJA 2GJKA 4IGAA 1IUNA 1PG0A 4PZ9A 1X2BA 1YMQA 3WBBA 1A5SB 3C8HA 3LC7O 3UT0A 2FPXA 4E13A 2UXBB 4FHDA 3KCQA 5CP8A 1K7XB 2NXCA 3HA2A 2BHRA 3NYRA 4PYMA 1NQ5A 1H1LA 3ZI0A 3EF0A 4O59O 2IV2X 4BQIA 4E15A 5I8PA 4CEHB 5L45A 2PT6A 2Z8XA 3WA6A 4Z4EA 4EK9A 4F12A 3NHUA 1VKZA 1IK4A 4PLHA 3ZE2B 4OBBA 5CDYA 2XVYA 1JTVA 1WE2A 3OICA 4MV3A 3S8EA 3W2HA 2YCLA 4LISA 1UM9B 4PZPA 3Q8MA 3T3DA 2KBFA 4L5AA 4AWAA 4EFLA 3KNZA 4RMJA 1Z5PA 4US0R 4BE4A 3VPFA 3FMFA 1F2TB 1TM2A 1TL7C 1KC1A 2A9VA 4C78A 1DKUA 2ZQZA 3JVIA 4J94A 2VPPA 3ZGYA 3OFNA 4EF5A 4UQOA 3RS3A 1ZXLA 1WB6A 3BXZA 4TN1A 2V54A 4DRZA 1YJ8A 3NHBA 3DEHA 3G2LA 1CZKA 4QRHA 4JP1A 4UBMA 3THOA 1HL7A 5L7WA 4IIEA 3WRYA 3TIIA 2IRWA 3UN1A 2SBTA 2ZRQA 2BR3A 1YDGA 2ZIWB 3GN2A 4ND1A 4PZUA 3GOQA 2W5UA 4ZI7A 4CEJB 3K6RA 3FNFA 3FJYA 3HWRA 1ZOIA 1VKRA 1DRUA 3ITEA 3M3HA 1URPA 5BYJA 3WIUA 1CQIA 3DZBA 4TTQA 1L7QA 2RB4A 4RCZA 1XU7A 4EY6A 7MDHA 4KGVA 4ALIA 4F2GA 3IR7A 3PR3A 2FE4A 3C48A 1NBHA 3Q3IA 3ZIUA 1GYQA 2QDXA 3LX6A 3QOXA 2GZMA 2POQX 5JO9A 3RIXA 5BRAA 1LBIA 3GZNB 1T5TA 1F60A 5EMKA 5ALVA 2PO5A 5E4JA 2VSXA 1G5FA 5H4GA 3OUTA 2CF5A 2NWQA 4CQMB 3K15A 4TRMA 1KI2A 4L9SA 5LU9A 1P81A 4OQYA 5IN5A 3GJ3A 1ZAYA 2IBMA 1M6YA 2JH8A 2GB4A 3F74A 1M76A 3VDXA 2HWYA 4U3JB 2JK1A 1GKKA 1Z4KA 5K09A 2D74A 2HA2A 1GPJA 2ZRIA 4PGGA 2FJUA 3ZHQA 2DLNA 2G28A 3EZ2A 2VTEA 2ZRPA 3BMCA 1KPHA 3LHSA 4NIMA 7ADHA 2AN9A 2V5AA 4DC9A 1XJQA 5K8IA 2PZMA 3A6PC 1B0AA 2I80A 2P2DA 4O2AA 5D3MA 3PQ7A 5DLYA 5FBRB 3F6EX 3WRXA 2ERCA 1IBLB 4CLRA 1IM2A 4JZKA 2ZTHA 4X84A 2D3TA 4YJGA 2NYUA 3VZSA 1V4VA 1H6AA 1XLTA 4GRIA 3MG9A 2AFIB 1ZINA 4HEA6 3G2NA 4F06A 4U7FA 1YS4A 1C29B 3SZMA 4AIRA 4O3MA 4UTOA 2E6KA 3RH0A 2C2YA 3A1SA 3ULKA 4FB5A 1UJ4A 1YULA 2IS6A 2V03A 3BGOS 3PNBA 2ID8A 1OZFA 1COWD 2GAFA 1TF2A 1IBRA 2J85A 2QN6A 4D4GA 1EK6A 2WU4A 4YJDA 1U1GA 3I1FA 3LW8A 3AEQB 3IDSA 5G53C 5ITSA 4CKEA 1YB2A 4MH0R 2HQBA 2AN3A 1C9YA 4A0RA 4D9MA 1YFKA 2PUJA 3TIGA 3JX9A 4FN5A 4MIKA 2F3UA 3ILYA 3WP0A 1USGA 4FDUA 3U6BA 4X62B 3WKDA 4ER0A 3QVXA 4WH0A 3V8MA 5BSEA 3DEZA 1ORIA 4AG5A 3CKKA 3OX1A 3VHXA 5JNWA 3GT3A 4BMPB 1LZKA 4PN3A 4HDKA 3BSFA 1TLLA 3AW8A 1RQNA 3UGTA 4O8CA 5HQ3B 4NV3A 4G0VA 2QTTA 4II7A 1QO0D 1KEWA 1UDAA 4MRVA 1MX9A 1A5ZA 2O1SA 3TYXA 2AG8A 4B6FA 1N4AA 3EPRA 3R3VA 3U9TA 5CEJA 1EAMA 1P1KA 4KBFA 3HB0A 5BNTA 4EI9A 4C7VA 3VQTA 3PXUA 5KNBA 2XJ4A 2VZ9A 2O3QA 3H6KA 1JAYA 1VZ3A 2H1WA 2JB9A 1XL0A 5K4GA 1KFCB 5DCUA 3QWAA 3ASUA 1KORA 3S1LA 2O06A 2BM1A 2VJNA 3COZA 1EFTA 3DW3X 4QATA 2AZ4A 4EO4A 2GD6A 1BN6A 3T9EA 4GL4A 1F4PA 3ORQA 2QQGA 4OL0A 4C07A 3C3WA 2GCIA 4BO0A 2G17A 1HDGO 3OHMA 1EFDN 3SAJA 1Y5NA 2PUAA 3SC2B 5FR1A 1QHNA 1MPTA 1Z2AA 1Z6GA 2GJ8A 2HLNA 3BXOA 1K8ZB 5CVCA 3D7MA 3OTGA 1YZVA 2JBAA 5LNK1 4L78A 2O7NA 4D2IA 1XP5A 2C94A 1ATZA 1V1RA 4HL6A 1JSRA 3D02A 1ABEA 1KIAA 2HN9A 1YUBA 3A4LA 1J33A 1KOFA 2BE7A 2M6KA 2PHZA 4PG4A 2E21A 1Z47A 3RYTC 3TBFA 5DM1A 5I7OA 5IJ0A 2GD1O 4YAWA 3E4DA 4DA0A 1SZCA 3WL6A 3AUXA 3P1JA 3ELBA 2VRNA 3RVNA 3UXMA 4XVCA 3OLCX 4FWIB 4AF7A 3G3EA 4RULA 5CK4A 2COKA 2QUKA 4IINA 4F7WA 1QBKC 5AKEA 1PHPA 3QBTA 4QUKA 1W0CA 5BWOA 1L3CA 3BTVA 2I8AA 1U31A 4QVIA 1USWA 3HE3A 4MV5A 2VA8A 1PWXA 3D2BA 1NLZA 4PYRA 3K70B 4B75A 2EBUA 3KLPX 2J1LA 1RPTA 3KJXA 1GL3A 4DT1B 1MOZA 3R41A 4FIDA 1W4LA 1O57A 1OLUA 1P0FA 2DLDA 4TV9F 3SD7A 1SN7A 5AW8A 2AZXA 2JIBA 5FUYA 3Q7QA 2Z09A 4YDQA 1UC9A 1Z33A 3FVQA 2VXBA 3TF5A 5AICA 1U2TA 1ZD2P 3C5WP 1E2FA 2PRYA 5JOQA 4E31A 3Q98A 4OXKA 3AI1A 4IVQA 1VMDA 4UUAA 3OU2A 1FLNA 5CW2A 3DOCA 4TWRA 2QT9A 4MPRA 5EIOA 4OXXA 4M38A 3G8BA 1S02A 2F62A 4EO7A 3CVJA 2QD3A 1M8GA 3NH9A 5AJZA 4AJLA 4EELA 4WN9B 3UFXB 3RGWS 2E49A 3THXA 2VR1A 5ALGA 5A5DA 3RRBA 4IG4A 4H3HB 4LUCA 2HK8A 2OZKA 1QQ5A 4BTEA 5KOHB 4OJNA 4NXMB 4OLHA 4M49A 3OEHD 3D54D 4JQOA 1TEZA 1T2FA 4XPIA 5GIPE 4INZA 1IBSA 2HY7A 1VHWA 4BBZA 4EZIA 1YRHA 1E69A 2I65A 4L4RA 5EEHA 1WOMA 2B2CA 2PIAA 3V1UA 3RIYA 3KVYA 3HYTA 1WV1A 4L57A 4TWJA 1PVVA 3K7EA 2HUPA 1MQ9A 3U56A 5TPWA 2BTOA 1U8AA 2G1PA 4K6OA 4XPZA 4BFYA 3SHVA 3WLFA 2IV3A 2AOUB 4BVGA 3QYPA 2D7CA 4UVHA 2Y92A 4TLBA 2C5BA 3I5YA 1Z82A 3ROTA 3RUFA 1JEAA 3A6LA 5DU2A 4PG8A 2KX7A 4GD3Q 3SZUA 5HE9A 3GMDA 3WBFA 3KT8A 4MB6A 5I6DA 1Q83A 1K9SA 4CU5A 3G1UA 1Y7HA 3I6IA 4N8DA 1C7QA 4S1TA 1LPBB 3MUOA 1D2RA 1T4DA 1RC8A 1Z5VA 4EJFA 2Q4EA 5BV0A 5B1DA 4X65B 2C2WA 1V8OA 3M1IA 1IRIA 1HWYA 1E3WA 3AG5A 2JCGA 3H8SA 3CW8X 3HRKA 3QX8A 1AKRA 4PO3X 4RJIA 3QUQA 2LKDA 4QG3A 1QF6A 2I3DA 4MWOA 4TMYA 3BIWA 3PD1A 3M6XA 2D4AA 1T1RA 5FL3A 4B8YA 5L53A 2XCRB 4N48A 3O3OB