3GFTA

Human k-ras (q61h) in complex with a gtp analogue
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
167
structure length
167
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase KRas
publication title Human K-Ras in complex with a GTP analogue
rcsb
source organism Homo sapiens
total genus 62
structure length 167
sequence length 167
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gftA00
1YHNA 1NY6A 3BAFA 4B2LA 5FBLB 1CF4A 1F48A 5AUOB 4JKYA 3L8ZA 2QZ4A 3C7KA 5CIQA 4TZ6A 2ONJA 1VG1A 1Q20A 3NTUA 5L3VA 1NG9A 4N0EA 1E2IA 1DO2A 2XJ4A 3DOEA 2F1IA 4U5XA 2XAUA 1UM8A 4URWR 3LA6A 4CEHB 5HTKA 1OKKD 1QZXA 2F9MA 2Q21A 2QA5A 3QEJA 1HA3A 2VLIA 1X8KA 4FI3C 4Q7JB 4A0RA 1DE0A 3V4FA 1N0UA 4PR0A 2P2LA 1BYUA 1E1RA 4CVNA 1KSFX 2OT3B 1FNNA 1DO0A 4TL8A 3CZQA 1EX7A 1DEKA 5DYGA 1NG1A 2RHMA 4LHXA 3R9IA 3RS0A 3FKSA 4UNRA 3H4MA 2ZUDA 1D2NA 4QRHA 2B6HA 1YR9A 1G3UA 1JJ7A 4QKQA 5AJZA 4PSKA 3KQHA 5HCIA 1U98A 3IIJA 3RLFA 4X8MA 4JSTA 2GVDC 1M6NA 2PL3A 2JJ2D 4TLEA 2CVFA 1W1WA 3B1ZA 4QXAA 3C15C 4OHVA 4Q1BA 4TTQA 2JLWA 3GLFA 1J8MF 2ZJZA 1F6BA 1ZINA 1LTQA 4Q1FA 4FMCB 1E9BA 4OJKA 2ZU6A 4Q5IA 4UNQA 4KVAA 2ZETA 4W5JA 1U94A 5BYKA 4L8GA 1UAAA 4FWTA 3DVLA 3QG1A 4TQUS 5J5CA 3AKCA 3V9PA 1R7RA 1VYVA 3AGPA 3GPLA 3KQLA 3K70C 1IHUA 4O2LA 3E70C 1HV8A 1MRSA 3GD7A 2O8DB 3QVVA 2WSSD 4E5UA 2FZ4A 1T8TA 2IK8A 4Q1DA 1ZNXA 4P3YA 4ZI3A 3WNDA 4UJ5A 3TLXA 3DPUA 2FA9A 2F1RA 2W6JA 1GTVA 5H68A 1DPFA 1S8FA 1WE2A 4RCZA 1H8HA 2QE7D 5FTKA 3MWLA 3K0FA 5TXGA 1NL3A 4Q03A 2O8CA 2DWQA 3U3JA 4A0GA 3GJ5A 2DR3A 1J7KA 4LBWA 1JXMA 1BYIA 3I4LA 2H17A 4WOPA 5GJBA 4P4UA 1P2SA 2A5FA 1G8GA 1XD2A 4ON9A 3QEOA 1KAOA 1N5JA 3QENA 4X8HA 2BWJA 2YNMA 3FWYA 3D7MA 2D7DA 1YR8A 2FV8A 2ONKA 3SYLA 2FN4A 4XSGA 3CRRA 1W36C 2GZHA 1F2TB 4I4LA 4EFMA 5SZIA 3EIHA 1SHKA 3GFPA 4R98A 5EUQB 4A8JA 1W4CA 3NEYA 4DLSA 3D31A 1D5CA 2GCPA 2H16A 3QBTA 4M1YA 3THWA 4LYFA 4M22A 3LXRA 1G6HA 5FTNA 3LQQA 2V8OA 4RFSA 1GSIA 1HQCA 2IWRA 3LX5A 1UKZA 5K8TA 4CDGA 3EPKA 3NHBA 2ZSBA 1NLYA 2C5LA 3KXLA 3HU3A 2Z4SA 4V0KA 4PXAA 4ESHA 1NMZA 1TEXA 3VTKA 1RKBA 3IPXA 5KTYA 1NVXQ 1KO4A 1J90A 1T91A 2FNAA 3AH8A 1M7HA 2W0SA 4C0AC 1WMSA 4V0OA 2UVQA 1DAMA 1NLZA 1HH4A 4B32A 1UKYA 3RABA 2CJWB 4TL9A 2BDTA 3SBDA 3U6KA 2GVZC 2D62A 3PFIA 1P62B 4V0MA 4PANA 4XWOA 1KZGB 2EWWA 2REOA 3FOZA 1E2PA 4B3FX 4Q4HA 3OAAD 1D2MA 4H1VA 3I3SR 4PPFA 1RRFA 2Z83A 3BS4A 4DLRA 1XEXB 5L3SB 4R71A 1HTWA 5EE5B 5HKKA 3TUZC 3PUZA 1TF2A 2AHOA 4EQ6B 521PA 1X86B 2NZ8A 5FPSA 5EE3A 3BGWA 1JEDA 1AZSC 4AY2A 4EPRA 2AFHE 621PA 1KO1A 3UG7A 1XJ0A 4LBZA 1GIAA 2GDJA 1SXJB 3W3AA 3WYAA 1DVRA 1P9WA 2J7PD 1FW6A 4BEJA 5FUVA 2XGJA 3I5YA 2E87A 2KBFA 3EASA 3QVUA 1E9DA 1ZD1A 1A4RA 4U7DA 3NBFA 4URXR 1K5DA 1NVUQ 4IKEA 4LC1A 4YC7A 3ZZTA 4JYBA 4NCIA 4BLPA 4AYWA 5ELXA 1IXRC 3QG5A 2BBSA 3DZDA 4A9AA 1U90A 2WSMA 1NSTA 4KV9A 6Q21A 1EWRA 4XWKA 4F92B 4IDOA 1ZM9A 2V7QA 4CT5A 2CVHA 4HEJA 4UNNA 5EP3A 3RS7A 1P2VA 1FP7A 1KI2A 1M8PA 3C16C 1LNZA 2VP4A 2E9SA 2CHQA 1AQUA 4YDSA 4S2EA 2VO1A 1XU4A 2YOHA 4NBSA 5HZKA 1ZRHA 1K5GA 1P4SA 3NBZC 1E4VA 2REBA 4IVPA 4TLBA 3VKHA 5FOWA 4XH9B 1VKJA 5EP2A 4M1TA 4LYJA 4TZ0A 3K0AA 3T1TA 3CR8A 1E4YA 4MDFA 2IYQA 4OYHA 1AKEA 3RAPR 4URVR 4A36A 3LV8A 4PC2A 5TDHA 1CP2A 1VIAA 1E1RD 2WJVA 1G3RA 2WKQA 4PPGA 4TMWA 3EG5A 3U60B 1OH8A 1AM4D 1A1VA 4TMXA 2JA1A 2ZRPA 1ZYUA 2F3TA 4KFSA 1CRPA 4IDQA 1UJ2A 1MO5A 2GBLC 1KI7A 2XSZD 2OFOA 1NF3A 1P60A 4NONA 1E0AA 3SEAA 2IL1A 4HATA 2OFWA 1MABA 2CL6X 4Q7MB 4US2R 2DCUA 2VHUA 1E2GA 2FPKA 3GJXC 2X8AA 1Z29A 3RS4A 3MUFA 1YZLA 3O8DA 2AX4A 3BFKA 2GNOA 4EFLA 1RYFA 1YRBA 1DG3A 1OYWA 4V0NA 3WMGA 5J47A 5CITA 1ZM3A 1Z28A 4TL7A 3W8RA 2H18A 4TL6A 4XVRA 1KAGA 2P5TB 3NH6A 4Q1CA 1GZSA 4PHGA 2OFXA 4TMTA 2GAAA 4HUTA 4B76A 4B43A 1GWNA 4BLOA 4GNKA 3THYB 2AWNA 4Q4LA 2DFTA 4PAOA 3T5DA 2JLZA 4M9ZA 3EPLA 1YZTA 2B8WA 4OK6A 4Q4JA 3CLVA 2IYRA 2ZRCA 1QDEA 2PJZA 4BRWA 1G64A 2WWFA 3DM5A 4O0MA 4A82A 3K1JA 4ASUA 1NBME 3ZVMA 1QHNA 2FU5C 4U02A 5EXXA 4BECA 4IOJA 5FL3A 3VQTA 2OHFA 3RSLA 2CNWA 2PZEA 1CJUC 1HT2E 1KK3A 4DDUA 2GJ9A 3A8TA 1N0WA 1C1YA 3IBYA 3I1FA 3TSWA 4HLUC 1Z6GA 2IXEA 1NBMA 2WOJA 5D3MB 2YWEA 4Z1MD 1AKYA 5J4KA 2Z0MA 3LAWA 4C2UA 3V00A 3MCAA 1EWQA 4P33A 5IK2A 4YMUA 3C41J 2Q3MA 2QPOA 4D81A 4DKXA 2CHVA 1LF5A 3SJCA 3MAAC 3THOA 4EDHA 3LWNA 5E7MA 3X1ZA 2R9VA 4NCHA 4B74A 4C0QC 4DEXA 4Q19A 2OZEA 4V02A 4LJ4A 3WRXC 5E7JA 4CEHA 3LRPA 1AGRA 2JEOA 3ND8A 4QBHA 3Q5DA 4JBXA 4Z51A 4JJZA 4MITA 1E99A 4DDVA 3CRVA 3IO5A 3EPHA 2PLRA 1KNXA 4V0LA 1TQ4A 2GF0A 3HP1A 4R7ZA 5GJWC 4OHWA 5DLQC 3SZRA 4ACBA 1G18A 2VQSA 5BN4A 2JGNA 2LCFA 2ZVQX 4GP7A 1SXJC 5SZHB 4NH0A 4PFSA 1U8AA 1CR0A 2GKSA 2ORWA 1NIJA 1T5LA 3ONWA 4I1SA 2ANCA 3K0SA 1CEEA 2BCJQ 1N6LA 2IYYA 2W6ID 3OZXA 5CYOA 4BZPA 1Z0AA 2J1LA 1SZPA 2OAP1 2OXCA 2R2AA 1MR3F 4IW3B 4LY6A 2R6AA 2J59A 4B35A 1VYTA 4IRUB 4HUQB 2GK6A 1GOTA 2HT6A 3UATA 3AKDA 5IHPA 2ZJ5A 1E94E 2FG5A 4Z54A 1GVNB 4MRPA 4TQAA 1DARA 1HURA 1ZIOA 3SQXA 1NN3A 2ODWA 1QHGA 3C5CA 5CJPA 4JLNA 1TQ6A 4XIGS 2O8DA 1XWIA 4Q18A 5HKKD 3BB4A 3LVQE 1IXZA 1XRJA 4XVQA 2WPDD 5FOUA 3AF0A 5G3ZA 2R6FA 3A1UA 3B9QA 2ZE5A 2ZYUX 4IXNA 4C9BA 4DSNA 4B47A 1QVAA 5FL7A 3VR3A 4YMWA 2FMXA 3QPVA 2GBLA 4QNMA 4URUR 4A2QA 2C96A 5IT5A 3TRFA 5AWFC 2V3CC 1IXSB 5JWOA 2QSZA 3U61B 4XVUA 3BERA 3NKVA 4M53A 1Z22A 1RC8A 5FH9A 5F9HA 5UKDA 1Z6XA 1W49A 1SULA 2X19A 1AZTA 4RJLA 3ZS9A 2ZRHA 1VG9B 3ZQ6A 2BBWA 1BOFA 3CZPA 3OHMA 4NDZA 1ZU4A 2D06A 2ZRAA 4B2IA 4B34A 2B92A 3FMFA 4QBGB 2EU8A 1QHIA 5DN6A 2ZM5A 1M7GA 1F2TA 3GJ7A 2V7QD 3FMIA 4JYCA 4P4TA 1XMIA 2BEKA 5LDDC 3K70D 3WRYC 2FGKA 3W90A 2BMDA 5KO2A 2OUKA 1Z07A 3BH7A 4EIWA 1VMAA 1E2DA 2CK3D 3AVXA 5AJXA 3AVWA 3WHKA 2UZIR 1UBFA 1KDPA 4MKFA 3M1IA 1Z6AA 2AD5A 4B3DA 4OKSA 3B78A 3QI2A 2L0XA 4ESVA 4Q1AA 1CLUA 3IKJA 1WP9A 2JLRA 1VCNA 4HLUA 4DUGA 2KJQA 3A58B 1XD8A 4WBSA 4WXRA 4ZDJA 2W83A 2NPIA 3FB4A 4MRRA 4MDEA 3CR7A 2VHCA 2IYZA 1MO4A 4RZ2A 2CJWA 2OE2A 4B75A 2ECKA 3ZIAA 4LI0A 1N5LA 3KFVA 1JR3A 2ORIA 2HV8A 1HYQA 4QBIA 4C0JA 1NMXA 2J46A 4HAVA 4EPWA 3X1XA 2FSGA 4HAWA 1SVKA 3WP0A 1DADA 1ZC4A 5AJYA 2RB4A 1WXQA 3O8BA 2RCNA 4I99A 2A5JA 2YHSA 1XEXA 4IXMA 5L3SA 3K9NA 1T5IA 2WJIA 3SNHA 2VEDA 4F7WA 4CZ2A 1E2EA 1XEFA 3PITA 1SXJE 2ZAMA 2OCYC 1IOZA 5EQTA 3K9LA 3SYKA 1I4DD 3RS5A 4EQ6A 5DI3B 1A2BA 1YRAA 1KIMA 2ODBA 3Q5EA 2QTFA 3Q85A 4DVGA 4EPYA 5FBQB 1FL9A 3DEFA 4M4SA 1FFHA 2W0MA 2XB4A 1SKQA 2QQ0A 3TGPA 2Y8EA 2BEJA 2EFCB 1OJLA 1TNDA 5TMPA 3TBKA 4QM6A 1ETUA 1SXJA 2OV2A 1QHYA 2R6DA 2ZUCA 3WNCA 1SVMA 3EX7C 2X1VA 4MRSA 1N5IA 4QGGA 4G5RA 1FPMA 5JI2E 4ZDIA 3ZZUA 4ASUD 4RZ3A 1M1YE 4O25A 3HDTA 3VR6A 2HCBA 2CL7X 2WAXA 4GSYA 3WNBA 4IDNA 4TYPA 2WKPA 3BC1A 5KDOA 3ADBA 3G5UA 2C99A 2QEQA 4C0BA 4JLVA 4Q9KA 2C2HA 1E2MA 3TH5A 3PJRA 4GRAA 4D4KA 4GBMA 2XOKA 2RMKA 3KX2A 5IK2D 2QPAA 5JSZB 3W6PA 2JLVA 4NCKA 4PC1A 5HE9A 5EXPA 3IDQA 1G19A 1ZCAA 4C4PA 4D2IA 5JCPA 2AWOA 3T34A 2A5DA 2IBMA 4YXWA 4F4JA 1IN4A 4HAYA 1KTVA 3P4YA 1GNQA 4QG7A 5JLJA 3L82B 3T12A 2QM8A 2XEXA 4GP6A 4GOJA 2FSHA 2R8RA 3EC2A 3CIOA 3NIBA 4BLSA 4JBWA 1ESMA 5CLQA 5HE8A 3AF2A 3K0CC 4BLTA 1O3YA 1SHZA 4B3GA 5AJWA 2ZU0C 1E2HA 4FW9A 3EIQA 4LWZA 3AGQA 1FTSA 4MGYR 4KSBA 3AF1A 4AIIA 1G7SA 4LV6A 1L8QA 4DB2A 2VL7A 1OXTA 2BCGY 2YV5A 3KUDA 3VX4A 1LS6A 2BJWA 4QL3A 5AJVB 5LD2B 2JLQA 1XTIA 3IQXA 4BFUA 4LYHA 3MWJA 3THYA 2PMDA 4LUCA 3VHLB 3W5JA 5G3YA 3I73A 3X1DA 2I1VB 2ZRIA 4BFTA 1ZD9A 4LHYA 4M8NE 1IY1A 2VA8A 1YZQA 4Q9IA 4HAZA 1MOZA 4KBFA 5DI9A 1H8EA 2CBZA 1LF0A 1RRCA 2ZRDA 3Q9LA 2IS4A 4LV8B 2PX3A 2V1UA 3ADKA 2IT1A 3FFAA 3QY0A 4P31A 3MWYW 4WZ6A 2ATXA 5KSOA 3OEHD 1W5SA 2QUZA 3KXKA 2Z6VA 1W7AA 3NBXX 2PMKA 5D3MA 4DT1B 3NDBB 1W48A 4M9XA 1ESNA 2GAOA 5CM9C 3TVDA 3OEED 3H84A 3KZ1E 3U4QB 4XTCS 2OCAA 4AK9A 3AP2A 2IXFA 4I1UA 3T5GA 2RGBA 3A1VA 1G5PA 2ZXUA 1NKSA 2JJ1A 2FFAA 1E2FA 1O87A 4EPTA 3VHXA 4ZKDA 3KJIA 3SE0A 1DAHA 5FBVB 1KYIA 5ANRB 2O8FB 4PQFA 2OCPA 2V55B 4QJ5A 3T1QA 2NO7A 1ZUIA 4LJ6A 2ZIAA 1GITA 4TT3A 2FSFA 1NI3A 2HF9A 3ZLJA 2ZI9A 5JS7A 4N1AA 5JJKA 2WMOB 1L7VC 1XPOA 1XNJA 2HXYA 3TSZA 3C8UA 2DHRA 2X77A 4C7OB 4DCVA 1OFUX 3M4YA 4IDHA 1FNMA 2OSBA 2CE2X 4C0LA 4DUGD 2EFEB 4M2LA 4A6XA 4JBYA 4RFVA 1PLKA 1OPXA 2GJ8A 3W6OA 2IEYA 1KSGA 2G77B 4Q7KA 5FUWA 2YZ2A 4CEJB 1E9AA 1E3MA 5EZ6B 3ZIAD 1GRQA 4JLAA 4PC3A 1R5OA 1JR3D 1N2CE 1D9XA 3FDIA 3TAUA 1YE8A 4HUQA 1XMVA 5CIWA 2RGCA 2IHYA 2OXRA 4OI4A 5FTJA 2ZSFA 1XPUA 2YVUA 5F98A 3TW4A 2IYVA 3CNNA 4II7A 1W47A 1YJ5A 2YOGA 4KYIB 2JLUA 3RWOA 4PC7A 5C46F 1NRJB 3C5HA 3L0OA 3CWZA 2LKDA 4LOAA 4LJAA 1J8YF 2HUPA 1P72A 2HYDA 3RVBA 2C78A 3AUYA 3CRQA 1YZGA 3OIUA 2QP9X 1DAEA 4FMDF 3K0CA 3B1VA 2Q9BA 1M74A 4PPQA 3PEYA 2W2XA 3EZFA 1KK2A 3TR5A 3HPRA 1YZUA 4JVMA 4URYR 2A9KA 1IJEA 1Q0UA 3CRW1 3BFVA 1ELOA 2DFLA 1WCV1 1IBRA 1OLOA 2QMUA 3AVOA 3LX8A 1UBGA 1BO6A 4HSEA 421PA 5J4HA 4CRWB 2IYLD 3HYRA 4OQXA 4F38A 4BFWA 5L3QB 2PZGA 2CE7A 5LB4A 3K8YA 3IBGA 1XXHE 3QXHA 2O0JA 4LV5B 1D6JA 2DWOA 1M2OB 2V54A 4MYHA 4OQFA 4EJSB 1E79A 3DL0A 2VSOA 4MUAA 221PA 2JASA 3B6EA 1UKEA 2Z43A 1XB2A 1C9KA 4A1FA 4A6PA 2IXGA 1C4OA 4TMKA 1G291 4DZZA 2C9OA 4TYNA 2GEVA 5LD2C 3AVPA 2WBLC 4Q21A 2FJUA 2IYXA 4MYTA 2A5GA 2YC2C 4MQBA 1OH5A 1W0KD 4YXWD 1RPZA 3OFNA 2VP9A 3X1YA 2BJVA 3C14C 3T35A 3B1YA 5JFGA 3OE7D 4HDQB 2QENA 1X6VA 3ASZA 3BH0A 1COWA 3BK7A 4BWYA 4DLTA 3IHWA 5FI1B 3U3RA 1PVOA 5IRCD 4ZCIA 1NY5A 3HJNA 3KKMA 3TUJC 4KODA 4NU0A 3A37A 4IDPA 1N5KA 2FF7A 2OG2A 3QPUA 5E95A 4GOXA 3UWKA 1PJRA 4JLMA 2QBYB 1E98A 4P0TA 5FPKA 5LPNA 2HYIC 1ODFA 1BH2A 1RFLA 1R5NA 2IYWA 1R5BA 3AVQA 5G41A 4ZIRB 4G5OA 2F1JA 5DI3A 1VYUA 3DMDA 2D2FA 3RRMA 4D0LB 3Q7PA 4ACAA 1N25A 3LBIA 4ZV4A 3RWMB 4KSCA 3TJZA 2RHDA 4F4IA 4E09A 3AB3A 1BMFA 3LO5A 4TQ9A 2WKRA 4XTRA 4GL2A 1LFDB 2GETA 4BFSA 2P65A 2I3BA 4MUBA 2BMEA 1UKVY 2ZROA 2WWGA 3ZS8A 3NBYC 2C77A 3A4NA 5C2JB 5KSZA 2ZRFA 4XWAA 3BOSA 4QJ3A 4CF7A 3B13B 2GCOA 2P6RA 2X2FA 1Z0KA 2D74A 1XCPA 3NEJA 4QHTA 5H8WA 5HR5A 3UIEA 3BWDD 3O8RA 4NCNA 1CRQA 1OT3A 5FPYA 3R7WB 2C98A 2HT1A 2ZRJA 2ZS9A 2XNDD 5KSPA 1HE8B 1QG4A 3PG5A 1E69A 4M1WA 1IM2A 2JLSA 3IEUA 3VR4A 1GNPA 2P67A 5JSZA 3E5HA 2GESA 1IN6A 2XXAA 2UZ3A 1N3BA 1HE1C 2GHIA 1R2QA 2P0EA 3TR0A 2PT7A 3DO6A 2QMHA 2AD1A 3QKUA 2R44A 2ZRKA 3E1SA 2N46A 4KHZA 4ZI2A 2V6IA 2QPTA 3VAAA 3OESA 4FCWA 2RGXA 1ZD8A 1OFHA 2WWWA 2YJTD 4AURA 1QVRA 4TYQA 3ICQB 1TTTA 2DBYA 3P32A 4QJ4A 3UXMA 5JRJA 4LHZA 1KNQA 1IONA 1N6RA 2FGJA 2GZAA 4HB0A 4P4SB 5F3WB 3BJIC 5E7IA 3QIAA 4PPNA 1OFIA 3Q7QA 1KI3A 2WV9A 3PIRA 1II0A 1G5RA 4M0LA 2NO1A 2IYSA 1TAGA 1Q1BA 3CF0A 3TE6A 5GADl 1TL7C 5FOTA 4A0HA 4TLAA 4ZDWA 4HZUB 2ZE8A 3K0EA 4TLDA 3T1OA 3UMRA 4YLGA 1VTKA 1TF5A 2IHBA 2RH5A 3ND9A 1OE0A 3FGNA 2FWRA 1OV4A 4PAQA 5J4LA 2NZJA 4TYWA 1G3QA 3FKSD 2F1HA 1DELA 3HU2A 4V03A 4B71A 2B21A 1ZW6A 3LLUA 3QQ5A 4GI7A 3B9PA 1M34E 4C2TA 1G8HA 4I1OA 2G3YA 1CR4A 1G17A 1E2JA 1ZP6A 4BZQA 1VHLA 5FPTA 4EJSC 5K8UA 2J0VA 2NGRA 4WAUA 1GNRA 4IOLA 2IUUA 3DOFA 1TMKA 4JSYA 1Y3AA 4BUJA 1DS6A 4GMXA 4C30A 4GDFA 3PEWA 2ZR9A 2XX3A 4G5QA 2Q6TA 4PSVA 1E1QA 1YKSA 2Q3HA 1EG7A 1T6NA 3KB2A 3MFYA 4NKRA 2QRNA 3LXXA 1L4YA 1GM5A 4DSOA 3ZGXA 1UEIA 1L4UA 1KMHB 4RD1A 2GXQA 3A1TA 3SBEA 4DT1A 1U81A 1S4QA 1KHTA 2GXUA 2W2TA 4M1KA 1VG8A 4HZIA 1EFHA 1F2UB 4UXIA 4BGDA 3CF6R 3EZ7A 2GTPA 3U4QA 2W6JD 3NVAA 3TMKA 2F43A 2JATA 2ZSDA 4A0FA 3J81k 2ZPTX 4DCSA 1H8HD 1XDBA 3KFXA 2IF0A 4PO1A 2CL0X 2J0QA 3ETLA 3IIMA 4OBEA 4LK2A 5A0FA 1ZJ6A 3A4LA 3TSOA 3SFVA 2WWYA 4PQRA 1JQJC 8OHMA 1KMQA 1P2TA 1IY2A 1XJCA 1NP6A 2O8FA 1CU1A 4DC9A 1E79D 2ODEA 2J41A 1PUJA 4IVRA 3DMNA 3Q8XB 4DIEA 1WF3A 4LSGA 3P26A 2ZJAA 3AP3A 4DSTA 2ZSEA 1G16A 2QP3A 4MYUA 1Q22A 1JAIA 3FHCB 1G8FA 2ZRBA 3KL4A 3QJYA 4RZXA 3S1AB 1G8YA 4NE2A 4HDOB 1RYHA 2IS6A 1N6PA 4LJYA 5FTMA 2ASEA 3EARA 4C7OA 3FPAA 1US8B 2HF8A 4POAA 4ILEA 1XZPA 1G7TA 4JLBA 3OFND 3MJHA 2NPFA 1KSHA 2EYQA 3H0KA 3H2YA 3MGCA 2HCJB 1E6CA 5JRZA 2R65A 4CEJA 1VDZA 3GEHA 1U0LA 1Q21A 1TADA 1VECA 3A1WA 2KI5A 3I8XA 3JVVA 3TK1A 2R62A 5EXTA 3IQWA 4GOKA 2IWHA 2IUSA 3AF4A 1E9FA 3X1WA 2AK2A 2C9YA 2JJ8A 1Z63A 4B3XA 1NN5A 4UQOA 3TQFA 2YWHA 1P75A 4DLXA 3EAQA 4LZZA 1D9ZA 1U0JA 3GP8A 1TEVA 1R4AA 4M9QA 3EXAA 1I2DA 2Q9AA 2ERYA 3A1SA 3U3OA 1XJQA 3BH6A 2E1RA 4RD4A 3A36A 1L2TA 3K9HA 2IS1A 4OL0A 4AKIA 1KDTA 4DLVA 3ZZ0A 4FMBB 3RANA 2BBTA 1BMFD 1OYYA 2CHGA 2ZJBA 2CMKA 3CO5A 2AXPA 1JALA 1F60A 5DGXA 3V4RA 5AUNB 2VP2A 4QFMA 3UMSA 2JLYA 1JNYA 4IEEA 3SS8A 5HCNA 2XJ9A 4RD3A 1WBDA 4B73A 1W2HA 2QSYA 3IHLA 3H86A 4MGZR 3QUSA 3U7FB 3SQWA 5DH9A 4JLPA 1J70A 3AVUA 2ZJOA 2OLJA 4B2PA 4OQNA 4CT4B 5JEDA 1RRPA 1VIYA 2BBOA 2EVWX 4WZBE 4UXJA 5L3QA 3MWKA 3GMTA 3U2QA 4AG5A 3EPJA 2MSDB 4NTZA 3KQKA 4G3XA 4DDTA 4EJSA 1KK0A 2ZEJA 4G0NA 1ZC3A 5KPJA 3ZD7A 3GLFB 3KQUA 5JECA 4BE7B 4MKIA 3QKRB 1FQKA 3ZVRA 4DDWA 4CEIB 2PH1A 2QMEA 5TVKA 1XTKA 2NO0A 3L2OB 2OLKA 3Q3JB 4L15A 4KU4A 3ZQJA 1FX0B 1MT0A 2OO7A 4JT4A 3FKQA 5G40A 2QAGB 2MSEB 4BFXA 4WZAE 2PCLA 1WQ1R 1ZU5A 4KBGA 2QG6A 5JJIA 1E9SA 2C03A 1II9A 2QP4A 5CB6A 3KKQA 1Z0FA 2ZYVX 4LPSA 1XXHB 3CF2A 1ZIPA 2A78A 2GXSA 3GJ6A 3N2IA 2H1LA 1MKYA 4GPTA 5B58C 4IEIA 1P5ZB 4DLWA 4R2HA 4TTPA 4ZCMA 4FIDA 2XB2A 1W4BA 4JVNA 2O0HA 3F8TA 4Y0VA 4US0R 1VCMA 2RGGA 3BD9A 2EFGA 3BFXA 3F0TA 4DEYA 1XMSA 2DY1A 2IEZA 2QBYA 4C0KA 2HXSA 5KNCA 2YWGA 4TN1A 2XZOA 3ICEA 2FEMA 3RRYA 1NJFA 1ZNYA 2WJHA 1EX6A 4PHHA 4G5SA 4ZIRA 1DBSA 3SI7A 3TAHA 4F91B 1EFTA 4HB3A 1Y63A 2VF7A 1E2NA 2BC9A 1W36D 4NYJQ 3D6TB 4D0NA 2QT1A 2BMJA 1AS3A 1OKKA 4QNRA 4RD2A 1LVGA 4HLDA 3UMFA 3I8SA 4D0GA 4I1VA 1MO3A 2ZREA 1X8LA 1II8B 5HZHA 2W00A 4IVQA 1P9RA 1UBCA 1E1QD 3AVTA 1DOAA 3SJAA 4ERNA 3CH4B 1WB9A 1NMYA 4XJXA 5E3HA 1KOFA 5CK5A 1NN0A 3AUXA 2DFNA 4A4DA 2PLFA 3R7WA 4M9SA 3A4MA 4E03A 1N0VC 5DHAA 1A5TA 5KU1A 1T0JB 1SVOA 1X1RA 4JL8A 2VHJA 1G41A 4HB4A 4YDHB 4D4JA 3MLEA 1GKIA 2C04A 2C95A 3MJRA 4F4CA 5KYKA 3B7GA 2FDCA 2RGEA 3UANA 5K8IA 4EKDA 3GJ8A 2D7CA 2J45A 5TB5A 1Q57A 2CNWD 1P7CA 4N0DA 3W6NA 1IJFA 3PCRB 5KDLA 4Q00A 2ODNA 4RKFA 4YQFA 3IPYA 3U7GA 3U7EB 2ZI7A 2ZE6A 1WRBA 1Z8FA 3GJ4A 1XBTA 4ABYA 1NBMD 3GFTA 1N6IA 2GJKA 2Q9CA 1LY1A 2J9RA 2RKOA 4OQLA 2JLXA 4BPBA 1PLJA 1CIPA 3NDPA 4Q9JA 3EC1A 5EE0A 1CKEA 4C0SA 3QE0A 4NP6A 4P4SA 2JCSA 2QE7A 1OIWA 4P32A 5J40A 4KXFB 3I92A 5KHOC 5CDFE 1Q1QA 4LJ8A 1KO8A 4RY2A 1CJTC 1KZ7B 1U8YA 2J5XA 2O8EB 4Q9HA 1S1MA 3CNOA 4HZUA 3RHFA 4JLOA 1OXSC 3RRZA 1PUIA 1YR7A 2G1KA 2H7VA 1EFCA 1VHTA 3VNUA 1QHXA 1EESA 4FCVA 3EA5A 3QF4B 4LHWA 3CNLA 4PX9A 2ZYWX 2P6NA 2ZJ8A 4LJ7A 4OK5A 4D80A 3GQBA 5CDFA 4IHQA 4LPKA 3RC8A 4NZYA 2EWVA 1IQPA 1JXOA 3EW9A 1OH6A 2F7SA 3K70B 2VSFA 2ZRMA 4LRWA 2D3WA 4DCTA 1S9DA 1EK0A 1GFIA 4H9GA 4PC6A 3O47A 3UK6A 1RW4A 5AK0A 1AQYA 4L5BA 1YR6A 1W0JA 4Q4AB 3JZAA 3LH5A 5H70A 2ZUBA 1Z2CA 3HYTA 4ZDKA 1OHHA 1X3SA 3EZ9A 1GAJA 1A2KC 4M1MA 1J99A 4XOIA 3HWSA 2AXNA 3GJ3A 3K0AB 2WOOA 1G7RA 4LYAA 2KWIA 4UJ3A 3W34A 2QAGC 4NYJR 4PZYA 1KMHA 4IOMA 1J2JA 1R8QA 4B44A 2AN9A 3KQNA 3N2EA 2WZQA 1F2UA 1ZM4A 2WIBA 5J4YA 1QHHB 3T1VA 1N6HA 1JB1A 1Z6YA 2ZTSA 3P1JA 5FBRB 2G0NA 4D6PA 5FL7D 2ZAOA 1AN0A 3AP1A 3L8YA 4JMPA 4KO8A 1GL7A 4UNPA 3OAAA 3KTAB 5GVRA 2OBNA 3FMOB 4AYXA 1KI9A 1AJEA 1A7JA 4UNSA 2YOFA 4US1R 1KI1A 2PEYA 5KDDA 4BEBA 3RS3A 5JWHA 3U7HB 2NG1A 3TW8B 3SOPA 4EPVA 3BIFA 3MD0A 2QGZA 4B6EA 1NJGA 3VR5A 1QHSA 1QG2A 3CKLA 3EZ2A 5D3QA 4AI6A 5DN6D 2AFIE 3S1AA 3NXSA 2WJYA 3RRNA 1ZNWA 3RYTC 1ZNZA 1US8A 2ZVPX 1FQJA 1E9EA 4KFUA 4PZLA 2XNSA 1E0JA 3EIEA 4B3CA 2HJVA 2ZJYA 1UPTA 1UBEA 2ZYTX 3PUVA 3QPWA 1G3IA 3UG6A 3UPUA 2A7QA 2DWPA 1LS1A 3WMFA 3CPHA 2VIIA 3CX8A 1RZ3A 1T3HA 4BFVA 5GVSA 4PO9A 3KKNA 1RRGA 4WW0A 1G1MA 3QBVA 4D82A 2G6BA 4G1UC 2A30A 1YZKA 4PO8A 5L3RA 2ZI3A 2PT5A 3MSXA 3KJGA 2ZJ2A 2SHKA 4OHZA 2VYFA 1S9HA 1E0KA 1GKYA 3SN6A 2YKGA 3QOFA 1ZMXA 2WJGA 4C0HA 3SR0A 4TYYA 2BHRA 1NVVQ 3EA0A 2FSIA 4LCBA 5L8VA 1BKDR 3MMPA 4BRUA 1E2LA 4RKEA 3RDPA 4GMDA 2RGNC 1S2MA 3TQCA 1OF1A 3SJZA 1TU4A 2IW3A 2VBCA 4EUNA 1UDWA 1XMJA 5BXQC 2WVJA 3M6AA 2O8BB 1U9IC 4G01B 3G0HA 1R0XA 2ORVA 1SKYB 3L43A 4WA7A 4D25A 1U99A 2QMOA 3AV0B 3ADDA 2LKCA 2DFKB 4L9SA 4OI2A 4TMVA 3FHTA 3GEIA 1U2RA 3K9GA 3WP1B 4Y0AA 4CYMA 5JHGB 1P2UA 5FTLA 3PEVA 1CR2A 2XSZA 1NN1A 3GLFE 2DB3A 4WIAA 3FYHA 5CYPA 1SXJD 1JAHA 1YU9A 2K5UA 1KDOA 4WVFA 2D4HA 2ZI6A 3ZVLA 2N1BA 4BQSA 5C4MA 3Q72A 4FD2A 3EWAA 2EFHB 4QGAA 4WXPA 1Q3TA 1I4TD 2VF8A 4IJMA 2AL7A 1G8PA 4OJQA 3WBKA 2B7BA 1CJVC 1T9HA 5JWRA 4K46A 4CEIA 2ZR0A 3QKRA 1G7CA 1Q44A 2CLCX 3JVUA 4ITRC 5DIFA 4LDJA 3PV0A 2ERXA 3CPJB 2OM2A 3BRWD 3QXSA 4A2PA 3VU9B 1FX0A 1G5TA 2PBRA 4A15A 5CLLA 1TPZA 4LJ9A 1XD9A 2QAGA 1S1CA 1PLLA 2Q0HA 4FWIB 4Q47A 5FUYA 1MRNA 2HLDA 4RCYA 2XOKD 5JCZA 5BW8A 1ZUNB 5AUQA 4L16A 4DJTA 5JS8A 5IF9A 3WXMA 1F3OA 2ANBA 3DM9B 3AM1A 4EAQA 2NO6A 4PAMA 3CRMA 2IF2A 3KJEA 1XXHA 2OILA 5CJ2A 2VP5A 4BLRA 2CDNA 3N5CA 2GJSA 2C9CA 5FBWB 1G9XA 1AIPA 2WMNB 3I72A 4M1OA 1KJYA 1Q1ZA 2BKUA 2PEZA 2F6RA 2QNRA 2J7KA 1MV5A 4Z1MA 4AC9A 4PSAA 2QRZA 2H5EA 1QF9A 1ZBDA 2GEDA 3GEEA 3E2IA 2BKEA 3SYNA 3B1XA 2VH5R 1CULC 1K8RA 1YZNA 5BWMA 1HEIA 3LFUA 2KE5A 2OBLA 2O0KA 2GEUA 4TMZA 4KAXA 3PUYA 1Z0DA 1DAGA 4MA4A 5GJCA 4NHOA 3IIKA 4LBVA 4TSFA 5A4JA 4OI0A 1P6XA 2EQBA 4QGHA 3EZ6A 3CX6A 1W0JD 3L0IB 2X2EA 4ZO4A 3QKSB 3I62A 2WWXA 4KFRA 3I5XA 3U5ZB 5FOVA 3VR1A 1NVVR 1II8A 1OHHD 1S96A 3QSYA 1FUKA 4MGIR 4RVCA 5G53C 2YC4C 1VG0B 1GL9B 2VP0A 3GLHB 4GZMA 1IN5A 2QL6A 1Q1EA 3W5IA 3PUXA 4V0ME 3NC0C 4L4UA 2OCBA 2V9PA 1PZNA 2W6IA 3AEZA 1H8ED 2NTYC 3R9XA 3OIWA 5EE1A 1B0UA 4DSUA 2QTHA 2F9LA 2G83A 3ZYCA 4JT2A 1T3SA 1W4AA 2RGNA 1QRAA 4DLZA 5JJLA 3NHAA 4DB4A 1JJVA 1R0ZA 2RGAA 2HEIA 3ZVNA 4W7SA 2GILA 4HLCA 2CXXA 4W5WA 3DZ8A 3WYFA 2EYUA 1U9IA 4JS0A 2PZFA 2VPPA 1OIXA 4OK3A 2WPDA 3HR8A 1NSFA 2GF9A 2IYTA 4Q9LA 2QY9A 4DLUA 4AKHA 1OIVA 1TU3A 1FOEB 1P73A 1W44A 2GWHA 2JJ1D 2OESA 3CONA 1WBBA 1KKLA 1DAIA 1SVSA 1X8JA 2FOLA 3BORA 4LBYA 1RE0A 4MYCA 3LW7A 2A2ZA 5C1BA 2WJJA 1VCIA 1SVLA 2P6UA 1PV4A 2O8EA 4TT3D 4PHTA 2J87A 1Z6TA 2CCGA 4AD8A 3NC1C 2GXAA 3WHLA 1GL6A 3HR7A 2WAYA 3BBPA 3AF3A 2J0SA 1BIFA 3QF4A 4Z8XA 4EPXA 3CB4A 2FX3A 3ASYA 4XD7A 4CIDA 2ZI5A 4HB2A 1G20E 1WDTA 4NYMQ 5TV2A 1KKMA 1E9CA 1DAKA 4A92A 3PENA 5H1YA 4D26A 2ZE7A 1A82A 4JL6A 4G5GA 2CK3A 1RJ9B 1E32A 1GILA 4JLJA 2G1JA 3IEVA 1TUIA 4MRNA 1U8ZA 3H1TA 3LD9A 4Q4AA 1FUUA 1KGDA 1NVWQ 2QAJA 3P20A 5DISB 3R20A 1G6OA 2QQEA 2VSXA 4KCGA 4OHYA 4EFNA 2WM9B 4DXAA 1W4RA 3QXJA 2PX0A 3LW8A 3R9WA 3FHOA 1Z3IX 5JMTA 1GP2A 4HAXA 2ZQ5A 5FR1A 2CLDX 2MMCA 3LBHA 3WY9A 1XTQA 2FPMA 4W9MC 1IN8A 2KSQA 1GKUB 1NKTA 2FFBA 1HY3A 3THXB 3TVTA 2H92A 2EW1A 1QHHA 5C4GB 3ADCA 4DCUA 4URZR 5CB8A 2RGDA 2H57A 3LDAA 4ZCLA 2W2VA 3P27A 5LBIA 2WTUA 5KNBA 1KDRA 2GA8A 3KTAA 1FZQA 2GJAA 2G9NA 1R10A 2A3RA 4M21A 4UKDA 3B2EA 1T8UA 1E9RA 4AG6A 4Q48A 2JIZA 2V1XA 5BYJA 4I81A 1I4LD 4C3ZA 2I4IA 5JHHB 3UKDA 3GLIB 5B64A 1KI6B 2REXB 3GLGB 4GZLA 1Z83A 5TARA 4HI0E 3R8FA 2OAQ1 4LC0A 2HJGA 3KJHA 1W2GA 2R6CA 3CUEF 3MRSA 1XF9A 3QXCA 3ZDQA 4BLQA 4OHXA 2HLDD 2ZI4A 1FMJA 5CK4A 3REGA 1ZM2A 2BM0A 1XZQA 2YINC 4ARZB 3CW2A 2Z4RA 3WBJA 2ZS7A 2BMFA 2FPLA 3HU1A 4W5HA 1CR1A 1DTSA 4XSHA 1KSJA 5F9FA 2TMKA 3W9YA 1OXUA 3EWSA 4DRZA 1FP6A 1MO6A 1I2MA 4FMCF 3KUCA 5P21A 1AS2A 3VFDA 2BIFA 3NG1A 4FN5A 5KOYA 4N3NA 1TUEA 3VMFA 5BN5A 4QBFA 1U0HC 5CM8B 2WIAA 4BASA 5HPYB 1B23P 3UWOA 1EFRA 4Q1EA 1LB1B 2BM1A 3LVRE 4GFDA 2QT0A 4PZZA 5A5GA 1COWD 2IX3A 3ZD6A 4QGFA 4U00A 2IA5A 2CEAA 1SKYE 3NH9A 1G4AE 4CW7A 4KFTA 3OF5A 4R2IA 1CTQA 1JPJA 4MKHA 4ZKEA 4BZXA 3T15A 2J0UB 4TTRA 3AVYA 5TY0A 1UFQA 2VRWA 3U44B 1UADA 1XCMA 1DAFA 3FTQA 3LNCA 3WYGA 1P61B 2O8BA 4TSFD 4NYMR 3GJ0A 3REFA 3KKPA 2N42A 3P4XA 1ZUHA 1N6KA 4DIDA 4KLZA 1N6NA 1CJMA 5DE3A 4KJZA 1TF7A 1RVDA 1EXMA 2FE4A 2JDIA 5JZVA 2YYZA 1N6OA 2QTVB 4B3BA 3IGFA 3MG9A 2O5VA 2NMVA 3AKEA 1FTNA 3PXGA 2ZRLA 1JPNA 1QBKC 4E07A 2Z5FA 1S0UA 4CGZA 2CLSA 4NYIQ 3SHFA 3B8HA 1KI8A 1AGPA 4RD0A 1OXXK 2FFQA 3D3QA 3PVSA 4LHVA 4QM7A 1IY0A 4IFEA 3CPEA 3B85A 5AUPB 3KKOA 3OIVA 1HQYE 4ZPXA 1NIPA 3I61A 4KYUA 2FH5B 4AKGA 3SC3A 1ANKA 2AK3A 3VU9A 2BVNA 3NWJA 121PA 2WWHA 3N70A 721PA 1E96A 1P3JA 1LV7A 2PCJA 4BFYA 1XEWY 1NNEA 3T06B 4BFZA 1NLFA 3U6BA 4PHFA 3B1WA 4R9UC 2ZSAA 3BE4A 4MKGA 3G82C 1YVDA 1OW3B 1R0WA 2XZLA 5F2EA 1K6MA 5KPDA 2G88A 3OEHA 3A6PC 1T4GA 1KO7A 4KITB 4E22A 2FEOA 4OI1A 4JKIA 1Z0IA 1YQTA 2H8KA 4UXHA 2MSCB 4DBLC 4JZKA 4DHEA 2B8TA 2O52A 3OEEA 5FOXA 1TQDA 2DYKA 2NIPA 4Q01A 5JEEA 2F55A 4HLQB 2XTMA 3KXIA 5JBQA 3SHWA 1E2KA 1UDXA 3B5JA 1RIFA 1R0YA 3K0FB 3RSOA 4XD7D 3VKGA 1IN7A 2NO9A 2O8CB 3W8NA 4A2WA 3DHWC 2DPXA 1BS1A 1KY3A 5EUMA 2ATVA 1V43A 5AR1A 5DNYB 3PUWA 4QC2A 4Q7LA 1XD2B 3GLHE 3RS2A 3SU8A 1VCOA 1XTSA 2BV3A 1HUQA 1G3MA 2WWIA 1OB5A 3VKWA 3BB1A 1SVWA 3SFZA 5LB2A 4KLNA 3K09C 5EE9A 3QKSA 4MRVA 4OQMA 1W46A 2GK7A 4JL5A 1ZVQA 3OIYA 1F5NA 4FMDB 5FOSA 2AKAB 3F3YA 4RSGA 4A8JB 3GLHA 3RC3A 1KK1A 5M04A 3THWB 2XTZA 1D2EA 1JR3E 3WMEA 1XTRA 5EZ5A 5FPHA 4DLYA 4Z8YA 4RFSB 3FE2A 3ZH9B 5KUTA 3U3KA 1ONBA 1CS4C 2QM7A 3CX7A 4Q66C 3LLMA 4X8LA 4J0QA 1CXZA 3X2SA 4QOSA 4JJKA 2CCJA 3AVVA 4YMSA 3QF7A 3K53A 4JLDA 4Q02A 3PR1A 4X8OA 2G0TA 4FXPA 4LGMA 4L9WA 3I32A 1LW7A 3LBNA 2C8VA 5J4VA 2QROA 2JJ2A 5EP1A 1OFTA 2JIZD 1XPRA 1JECA 3F5FA 2HDNB 2VHTA 4NYIR 1Z47A 2IYUA 1KO5A 2A5YB 2WHXA 2VHQA 2AR7A 3DKVA 3IILA 4K81B 3TKLA 5K8LA 2PJRA 1KJWA 3GFOA 3QKTA 1WA5A 4GT1A 4KVGA 2CCKA 3QNUA 3TIFA 1CBUA 4S35A 3D8BA 4MGKR 4KI0A 4Q4HB 3KB1A 4YMVA 3DKPA 2Q3FA 5DSZA 3CH5A 1GRRA 4IOKA 2WSSA 2ZR7A 1Q3HA 1R8SA 1KI4A 3AQ4A 1S3GA 5FR2A 1T0HB 2XTNA 1Z5ZA 2B7CA 3AKYA 1CJKC 1E0SA 1Z06A 3CBQA 2GCOB 3U3MA 4QHSA 5EP4A 3ECCA 1UEJA 1XTJA 4YONB 3FMPB 2VTKA 1Z08A 3JZMA 5EXSA 1M7BA 3GCGA 4AKEA 1OXVA 3L0SA 1ZAKA 2IUTA 1SVIA 4AYTA 4RZUA 1EGAA 2KB0A 4YMTA 2BOVA 3PEUA 3IO3A 3LQRA 1EFRD 1IAQA 4B48A 2V6JA 1RJ9A 2QN6A 3SJBA 1JEEA 1S3SA 2FZLA 1SGWA 3FVQA 3VNVA 4D4MA 5GJVC 2XXAB 3T61A 5FUXA 5B2ZA 1R6BX 1SQ5A 4HAUA 2GZDA 5FI0B 5SZKB 1OH7A 1VPLA 1DG1G 3RNLA 4MH0R 1X1SA 1Z0JA 5B57C 5EJEA 2XITA 4NPHA 3TUIC 1W0KA 3QXXA 2EFDB 2VP6A 5IDVA 4B33A 2GRJA 2ZITA 1JBKA 4TWZA 2WICA 4TLCA 3OE7A 3THXA 1JR6A 1XFAA 2RAPA 5BN3A 4D4LA 5SZJA 5E4FA 5C18A 1TQ2A 3CWQA 5DYIA 1AS0A 1AK2A 2JDID 4NCJA 2QORA 4H1UA 2IS2A 5DO9A 3CM0A 4M1SA 4NL4H 2IC5A 2KBEA 2ZRNA 3GLIE 1T3LA 1G21E 1GG2A 3B82A 4LJ5A 3R8CA 5B30A 1XCGB 1HT1E 2ZS8A 3GLGE 2I1QA 1XX6A 4F93B 4JIMA 2UKDA 2OEPA 4PQYA 4RD6A 1ZCBA 1Q12A 1KY2A 3K09A 2MMGA 3W3ZB 1GDDA 2D2EA 3GLIA 1KI6A 1V5WA 3O8CA 1AA9A 2ZANA 2R6GA 1W36B 2P3SA 3GLGA 3B60A 3LY5A 2QI9C 3L0PA 2YWFA 2J3EA 1MABB 2QGNA 3HPQA 5KSYA 4JVLA 3PQCA 1G4UR 1Z2AA 4JLKA 4O3MA 4IFBA 1H65A 1OSNA 4FINA 5JI3E 4HDCA 3VR2A 2F3RA 4JVSB 2GCNA 1D8TA 4ARZA 1TX4B 1MH1A 3DDCA 4PTLA 1P9NA 3TNFA 2P5SA 1FMLA 4HYYA 3BB3A 4A8JC 3KDSE 1XEWX 2V4ZA 2LWIA 4Q4JB 1W5TA 2J7PA 4FCTA 1E2QA 1JI0A 2XNDA 1KJZA 1JQLB 821PA 3VX3A 5BQ5A 3ZJYA 2AKYA 1ZM7A 4QHYA 2FFHA 5DHFA 4B6FA 3BXZA 1EFUA 2F43B 3FFBA 4O2RA 1XP8A 2W58A 1GUAA 3C4JA 3IUYA 2NOAA 2OBMA 4LX0A 5FFMA 4DWJA 2XZPA 4K8OA 5KNDA 4DCNA 1UF9A 3M0EA 4NMMA 1OB2A 3SDZA 1GRNA 2J0UA 2NQ2C 4AWXA 3U44A 2ZRGA 2JAQA 2QU8A
chains in the Genus database with same CATH superfamily
4YACA 2FPXA 4X7RA 5I4BA 3MRVA 4WXMA 3CZ5A 5J59A 1YB6A 3FZYA 1CF4A 2OGTA 1SM4A 2OECA 2Q8QA 4WKOA 2Q2NA 4JKYA 4KWHA 2D0IA 4MVJI 5KAPA 3HY6A 3WWPA 3RYCB 5JAUA 2C20A 1JIKA 4EABA 2B5OA 1VG1A 5EC8A 2ONJA 1SKMA 1Z16A 2QDXA 3FYSA 2L19A 2XH8A 2IV3A 5L3VA 1DO2A 4BNVA 2QTVA 3FFTA 5EKXA 2XAUA 1UM8A 3DBHA 3LA6A 3IFSA 3NDIA 1J7JA 4CEHB 2HLPA 1J5PA 2VTBA 1ORRA 4I9HA 2B4RO 5HTKA 4D8YA 3S81A 5BMVA 3ES9A 1GCOA 4Q7JB 5BW4A 3V4FA 1N0UA 2EW2A 1TZCA 2VG8A 1E1RA 4CVNA 1KSFX 1DO8A 5IKEA 4IMPA 4TL8A 4F9TA 1YNSA 1JSRA 2HPAA 4CNQA 4D8VA 3FXAA 1CUCA 1V26A 3EUEA 3RS0A 3RHSA 4UNRA 1GN9A 1T3TA 2JHAA 4C3VA 3W2FA 4UHDA 1G3UA 1JJ7A 1IIBA 1EE2A 2YWJA 3ORFA 1P81A 3KQHA 1MVLA 1VL6A 4PLFA 1WM1A 1U98A 3OT1A 3FAZA 3V7WA 4X8MA 1EM6A 4JSTA 4NFHA 1XNRB 3UWSA 3PZRA 4ZVTA 2LP4Y 3Q88A 2OD7A 1ML4A 1J8MF 3ST7A 1LTQA 1Z3CA 1J1ZA 4ZAFA 4XDZA 4OJKA 2C1ZA 4G0WA 1ISRA 5K1ZA 1YJBA 1U94A 3KQSA 3EF3A 4W5JA 1DLJA 4JOBA 3DVLA 5J5CA 5L7YA 3UHFA 3V9PA 3GPLA 1P45A 5DFAA 2BGKA 2LE0A 3E70C 3DGFC 2NU6A 3QVVA 3QPBA 1ZMBA 2D1RA 3RVQA 1YL7A 3K4PA 1M8KA 4WASA 3D3WB 3VPBA 4B83A 1EU1A 4DABA 4FFOA 1JR2A 5HIJA 5LQAA 4JIGA 1D1PA 1S8FA 5IH7A 4M60A 5HVNA 4XPIB 4RA6B 3MWLA 5AO9A 4DIOA 4E2YA 4OKNA 1MAUA 3PDCA 4PYLA 2ZJ0A 2XWBF 2JAWA 3Q3EA 2D7JA 2DWQA 4MARA 1J7KA 1JFRA 3RQSA 1QTQA 1TZBA 1Z88A 4IIYA 3DC7A 4P4UA 2A5FA 1G8GA 1XD2A 4ON9A 4RVSA 2HX1A 2UYQA 3QEOA 1KAOA 5GZ3A 1Y3CE 4X8HA 3WQHA 4NNJA 3R5JA 4IDAA 5ECDA 2F62A 3DL7A 4N7MA 1C1XA 1ZLXA 1V71A 1XCLA 5F7ZA 4UTVA 3D7MA 2DFVA 2FV8A 1Z4OA 2ONKA 3PDWA 5TQ0A 3ZKAA 4MW1A 4XSGA 5KTNA 2BMVA 2GZHA 3N5KA 5F1YA 4L72A 1RPAA 4HXGA 3GP3A 5SZIA 4A8JA 1I36A 4DLSA 3U4HA 5K8JB 2NUTA 1DBQA 4WN3A 3T4PA 3C7TA 4TTIA 3GWZA 3RUCA 5FWYA 5JR3A 1WEKA 1O9BA 3O5AA 3LXRA 5EA2A 4UVGA 3SK0A 4CTMA 1UXJA 2J48A 2V8OA 3WLFA 1JIVA 5M2QA 2GN0A 2YHUA 4P3OA 1YHYA 5K6TA 4FUTA 2BGJA 5IN5A 5K8TA 3NHBA 1FP2A 4FT4A 1I7NA 2P91A 3H2BA 1SIOA 3CMMA 1YQWA 1NMEA 2VDWB 4PXAA 4ESHA 1NMZA 2EXXA 4H7IA 1FXWA 1MMFB 3K9QO 3VTKA 2C3MA 3G59A 3QBEA 4OHUA 1KO4A 3A2KA 1IATA 1JS1X 1Z7BA 2AN1A 1J90A 1V6CA 2ZIUB 5AKYA 3EODA 1EXDA 5D01A 1DAMA 1NUQA 1HH4A 3BKXA 3G49A 1UKYA 2BEWB 2YVKA 3C2QA 2CJWB 5DOVA 1Y8RA 5ALXA 4A8TA 4WFJA 2CEKA 4HDKB 1XQ1A 4N7BA 4V0MA 4PANA 5GP1A 5C3UA 1T5DX 1AH2A 4YRCA 5JJCA 2B69A 2EWWA 2IVFA 3CSUA 1I9CA 1LK5A 1QOPB 3DAPA 2HJHA 4B3FX 4F6LA 1D2MA 4JP5A 3I3SR 4ND2A 3TDMA 3L1JA 5F2NA 2HK6A 4IS3A 4JJ6A 3ZVKA 1DCKA 4EA8A 4PGAA 4KH0A 4ZJYA 3HA3A 3MMNA 2AHOA 3GUCA 1FTQA 5AP9A 4DJJA 1X86B 2E82A 4EVQA 5FPSA 4EMSA 2PX2A 3KVOA 4OQZA 2C59A 3TL2A 2N9UA 3HB5X 1BWRA 1I5EA 3AHDA 3TIVA 4H4DA 5IT0A 2V3VA 1KEPA 4D9GA 4BBJA 4UZSA 1XJ0A 1HORA 2HPVA 3QW4B 2UXCB 2NP7A 1SXJB 3BWEA 2X42A 2ZUWA 3BCRA 4QO8A 4PLPA 5LP6C 1DVRA 1Z73A 1Y6RA 1IM5A 4R5HA 1FW6A 4MV7A 4WOKA 2RK6A 1WZNA 3NCTA 2XGJA 4GKVA 1WKVA 2AFHA 4GR5A 3WO0A 4U7DA 1A4RA 1NVUQ 4BLPA 4IKEA 5HZMA 3ZQ4A 4CDMA 3GWGA 1A9PA 3QG5A 4ENVA 3FNBA 4TWIA 2WG0A 1V16A 2OAEA 3CZ4A 4G1MB 3P2IA 3SVZA 3USES 4A9AA 5D2CA 3CTMA 1UBSB 2E55A 1LDMA 1U2SA 1P1IA 4FR5A 4N7JA 4ZHQB 4TKUA 1ZM9A 3E3OA 5JYEA 2B3DA 2V7QA 4AZ0A 1ZSNA 2Z04A 3JZDA 4J0JA 5CFLA 1P2VA 5DP1A 2J9GA 2ZBVA 1V9LA 3K5PA 4RZQA 1LNZA 4FDMA 1R0RE 4XIJA 3ENVA 2CHQA 4MUYA 2DU8A 1AQUA 1D1QA 4BLWA 4V0RA 1V95A 4S2EA 5IVHA 3NIWA 2VO1A 4NBSA 5ILOA 3AIOA 2P27A 2XXJA 3BL5A 1K5GA 3VSEA 3JALA 4PLTA 4KRGA 4NOJA 1BKYA 2R48A 1VKOA 3Q3VA 4RPIA 2XB9A 3A6GA 3K8QA 1QQ7A 2TS1A 4JC4A 1GD1O 3LK6A 2OZVA 4R0NA 1W8IA 1VKJA 5EP2A 4M1TA 3ZI4A 5I7SA 4TZ0A 2UUOA 3K0AA 2YQ4A 2ZYGA 3CR8A 4GX1A 4HX5A 3T1TA 1E4YA 1EVJA 4FJ2A 3HVRA 3OY2A 2IYQA 2VWPA 2WKWA 3OCUA 3EFHA 3PXCX 2Z4TA 3M9XA 5IKMA 4M54A 3D81A 3OD1A 5HKAA 3WDMA 4NWIA 3U60B 4TMWA 1RLJA 2WKSA 3E84A 3OM8A 4TMXA 4W5NA 3E22B 1K8ZB 4Y18A 2F3TA 2BFFB 4IDQA 4AB1A 1ZK0A 2XSZD 1KI7A 2OFOA 4HTFB 3TQIA 4GZ5A 4AVYA 3HKCB 2IL1A 2FRVA 1U7XA 2AJLI 4FFVA 4FGZA 4NPCA 2DCUA 2DUMA 3MJCA 1KQOA 3SICE 2I7DA 5EJ2A 2OVBA 4GHWA 3RBVA 2PT6A 3C3BA 4LVOA 4UUOA 1OYWA 1ZHOA 3CLHA 1UK9A 5CITA 3NQ41 4KE7A 1IPHA 2FKNA 2GERA 2JFXA 4G25A 1MX3A 4MW5A 3I9MA 4TL7A 5BSKA 2OHOA 4N01A 5C1IA 3NH6A 1X7XB 1YD7A 4J9VA 4PHGA 4TMTA 1EM8A 1L5FA 4F3KA 2XGSA 4ZVRA 3ZXIA 5T41A 4HUTA 3WGGA 1FFBA 1Z5GA 4M0CA 2I54A 1PL8A 4GNKA 2AWNA 1MJHA 4L2IB 4YCBA 3T5DA 4HO1X 1KYVA 2B8WA 4OK6A 3EPLA 1OREA 2WSLA 4XIFA 4JKOA 1V0JA 4UATA 1T1JA 2O2YA 4UHEA 4O0MA 1XZFA 3K1JA 3KB8A 4KDFA 5CYFA 1QHNA 2FU5C 4U02A 2I5PO 3MCZA 4BECA 1K7FB 2HHLA 1E1CA 2BEVA 2FCAA 3PNYA 4QDOA 1WSAA 4RL4A 3VQTA 3IUMA 5JO9A 1KK3A 1AU9A 1HT2E 2Q5FA 5IW8A 4EB8A 4B81A 1N2JA 1I3LA 1N0WA 4PR3A 3IBYA 1MIOB 3I1FA 3PVZA 2CDCA 4F3YA 1PWHA 4R9SA 3OPQA 2IHNA 1DRJA 3R44A 2YWEA 4E4YA 4F3CA 5K6AC 4LG1A 4RY0A 1AKYA 1A4XA 4IUDS 2Z0MA 3L0YA 3RVRA 5AVWA 5BSHA 1U0RA 3MQ2A 2YNMD 3MCAA 3O7MA 4A27A 4HLNA 1M6VA 3JATA 3OQIB 3A9RA 3HSSA 2QPOA 3CLSD 2FLKA 4D81A 4OP3A 3QE9Y 4OQ4A 1LF5A 3MAAC 3P9CA 1OA0A 1QIIA 4C4SA 2GLUA 1JT9A 3F3MA 4WI1A 5DM4A 5E7MA 1HZZC 1W76A 2X86A 3CLUC 5BWCA 4P92A 4B9AA 3FDZB 4DQLA 5CD9A 5LP6A 3ND8A 2PLNA 3I2IA 3Q5DA 4OQPA 2DE0X 1RHQA 4JJZA 2C8LA 4MITA 4XEUA 3IO5A 3FUCA 3S2SA 1C9YA 3OKAA 5T6BA 3EPHA 1XQ9A 2Z57A 5GJWC 3HP1A 3W05A 3MHPA 1Z7GA 5DLQC 3KBBA 3PUJA 3MPUA 2FP3A 3QTTA 1KHHA 3ZHOA 2JK0A 2VQSA 3DV2A 2ZVQX 1Y4UA 5HDBB 2OYRA 1VKRA 4O4JB 3KOWA 2P9FA 2HRBA 3CZAA 4G9BA 5C8DA 2ORWA 5ITZA 3EQ2A 3AJEA 4EW1A 4RO0A 3ONWA 3TPFA 4BO9A 2ANCA 5LBTA 3K0SA 1CEEA 4L5IA 1N6LA 1ATZA 2GZSA 3N0RA 5CYOA 5I9MA 2X2PA 2OAP1 2OXCA 3DHEA 4ZC8A 5A6VA 3C3KA 3NBAA 3GH3A 4LY6A 4M36A 1XVUA 2R6AA 1Y6FA 2NU8B 2A67A 2W2KB 2J59A 1CE8A 1O6BA 1EVYA 5EKTA 2D0PB 3REQB 4F60A 2GK6A 1VIDA 1QFMA 1R18A 1T6ZA 3AKDA 3CINA 3NOVA 5IHPA 2ZJ5A 3OLWA 2VNIA 2JCXA 1GGMA 4KQKA 2WTXA 1GVNB 2X9NA 4U7WA 2C3UA 3W2TA 3RHTA 3WGHA 1V11A 1AKWA 2OBFA 3VBCA 4CM6A 3T3EA 1QHGA 4CKEA 1S6YA 1TQ6A 1C29B 1HYGA 4XIGS 2O8DA 4GH5A 5HKKD 3L7IA 4D9MA 2PUGA 5B6PA 2X9VA 2R8ZA 4IJ6A 2WPDD 4HWOA 2SKCA 4XVQA 4C3UA 5FOQA 1FNSA 4IO1A 2R6FA 4N8SA 4NU8X 3B9QA 2OHGA 1BE6A 3BYZA 1UWCA 4B47A 5E3IA 4H60A 3WDLA 3TQQA 2XCTB 1YMUA 2XVXA 2VYVD 4YMWA 4QNMA 4FQ7A 1X15A 1WUYA 5HIMA 5L51A 3U09A 1J9EA 5EHNA 1T9BA 2WUEA 4ZMRA 1WDMA 2GZRA 4J0FA 3CCBA 4M53A 4Z0HO 5JXJA 3Q2KA 5KTOA 3ZHBA 5JPCA 2BYTA 5F9HA 4ZVLA 1Z6XA 1GPLA 1R8JA 3LX4A 1AZTA 3VISA 1Z75A 3HJAA 4JT9A 4AXBA 1S8OA 2ZRHA 3UYLA 4HN4B 1RS0A 2N3ZA 1ZU4A 2D06A 2ZRAA 4R8KA 4P7FA 3WVNA 5JS2A 4B34A 3VDMA 3A6LA 3FMFA 3WAGA 1SKAA 3KKKA 4DG9A 2AW3A 4FIZA 2ZM5A 3GC6A 3GJ7A 1RRMA 3FMIA 1OASA 2DBVO 3NDRA 3A4YA 4JYCA 4P4TA 1XMIA 5IYZB 5KHLB 1KZ4A 4EI7A 1K27A 2FGKA 3EWIA 2BMDA 3O4VA 3B6IA 2FWBA 3WRYC 2OUKA 4EHDA 3BH7A 1I24A 1S8NA 2CK3D 3W4JA 2P2NA 3WHKA 5JU6A 4WRRA 2IP4A 3L92A 1R4MB 3LP6A 3M1IA 1H2HA 4MKFA 5D6OA 2Y4OA 5JIBA 1GO2A 2L2QA 3B78A 1MV8A 3QI2A 4IR7A 5E9WA 4LZOA 1E89A 2F9FA 1L4MA 3OTQA 4Q1AA 3U9LA 1ZVVA 1POWA 1LBQA 3NHMA 3QWBA 4XEHA 3H75A 3RHZA 2DTEA 4CDRA 2KJQA 3A58B 4MQ4A 1GL3A 1ENZA 4PZ9A 1VPDA 4B6OA 1FRFS 3EEQA 1P17A 1N4AA 1NJ5A 3UK2A 4ZDJA 5K6AA 2W83A 1T10A 3KJXA 1HDGO 1T4BA 5EI5A 1RKQA 3CR7A 3QE2A 3EIUA 3S68A 4RZ2A 2ECKA 2FK7A 4WKBA 4GDMA 1K1EA 1N5LA 1H94A 1SKUA 3AJ9A 2ORIA 1HYQA 2ONYA 4KXNA 4NFYA 3K1YA 1NMXA 4QBIA 4AJPA 2P1DA 4QFDA 3ZJVA 2FSGA 1XZCA 1GTG1 1W88A 5DX1A 1HZZA 1IEXA 1MB9A 1PV2A 2UZ0A 4FP9A 4GR4A 2RB4A 5KNBD 4L3WA 4BNZA 2A5JA 4E11A 2AG8A 4L75A 3DLCA 2WJIA 1TPYA 3K9NA 3PGKA 3SNHA 4QDTA 3HO1A 1ZITA 3D7NA 1ECGA 3G8YA 1ISJA 3PITA 3P2OA 4HOYA 3WLEA 1IOZA 4ZK2A 4EQ6A 1W5BA 2K2QB 3U39A 3FOAA 5DI3B 4RSMA 3KBOA 4ID3A 2ZBEA 3G1UA 4TTVA 5TGTA 3Q9SA 3JQPA 3O74A 4DVGA 4RTSA 3HHPA 1FL9A 1X9GA 3DEFA 1FFHA 4C5AA 3EB9A 3TGPA 5D7NA 1QCZA 4QM6A 1YHZA 4DADA 3TBKA 1Y1KE 2H07A 1QG6A 2WLSA 2QUKA 3WNCA 3RVMA 1QHYA 2R6DA 3O8OB 2NZYA 4GMGA 1SVMA 1SXGA 4QGGA 3FYUC 1EFAA 5HG0A 4YV0A 5K8VA 4JI6B 3E1KA 1EVZA 1FPMA 3GVXA 4G5RA 4ZDIA 3PNVA 1PS9A 3ZZUA 2PZKA 4RZ3A 1MEOA 2PQMA 4C06A 1EJBA 4QDXA 2JFZA 2VXOA 4DYDA 5FP0A 3DLPX 4GYYA 4PCLA 3ABOB 4RWZA 1TKBA 3TB4A 3NHZA 5AW3A 4I1PA 2JG3A 1C3LA 5F9MA 2ODQA 3WNBA 4TYPA 4BVLA 4XRRA 2PBFA 3AR4A 4FQ8A 4I50A 5C8YF 1ZMTA 1P44A 3BRWA 2OB2A 3ZN2A 3G5UA 3EBPA 4EA6A 4LTDA 4MQUA 4JB2A 3NAQA 3WHIA 4CM4A 2C2HA 2WF5A 3A1EA 4YALA 3V2HA 1E2MA 2QTCA 4DM7A 1AUXA 1EPUA 4GRAA 4GBMA 2XOKA 5H59A 6REQB 1NXSA 1YO6A 3I5AA 5AKJA 3NP9A 1H66A 5IK2D 5JSZB 1ZNQO 1MAWA 2MCFA 1LSJA 2JLVA 2XQKA 1SUBA 4HQOA 1P80A 2WJZB 3QMWA 1JEOA 1TCBA 1TEHA 1PFYA 3LPMA 3MD9A 5EXPA 3RAFC 4G0UA 2PKQP 1ZCAA 4MA5A 5CB0A 1HOXA 5JCPA 3KQWA 4JYPA 1XRNA 4F5EA 3HO8A 1JQKA 2E48A 2DX7A 2IXBA 1JHXA 5B3AA 2AOTB 2P4SA 4HAYA 3F7MA 3IAUA 1HFEL 2D1QA 3RYFB 4U6SA 4FEYA 3IUJA 3NHPA 3UAZA 4GP6A 4IIHA 4BJ6A 3FUUA 4J2OA 3KD2A 3BULA 2DCMA 3RK1A 4Q34A 2NVOA 1DNPA 4E2XA 2O2DA 3NIBA 4YRZA 1LLUA 1U02A 4EL0A 1SEVA 2JI9A 4F06A 3FM9A 2FFJA 3K0CC 1OYOA 1YBVA 5TPWA 3I2YX 1NW6A 4Q1VA 2V65A 3QXGA 4QOGA 1QUEA 1E2HA 2RBGA 2OD9A 3KKZA 1PJLA 1FTSA 5FA5A 3WRYA 2DC1A 4LE0A 5DHRA 4AIIA 4F8JA 1KFKB 5KREA 4LV6A 1QK4A 1L4HA 2XB6A 3NIGB 4C08A 4YAUA 1A5BB 5U4QA 2BCGY 1P2GA 3PRYA 2FW9A 2PZMA 1L7MA 2X7XA 2BJWA 1G21A 3CNQS 4QL3A 4YAEA 3PGVA 5DK4A 5JNVA 3VBEA 2TMDA 4CQMA 2IEBA 1J4AA 2ZWMA 3IQXA 4LYHA 3VYTB 1DQPA 3W5JA 2XNJA 1T2FA 3I73A 3X1DA 3E9EA 2UXBB 3DOCA 3ABZA 4KREA 1P1RA 4NHEA 2OZLB 2VK2A 3LUBA 4X20A 3I09A 3KCNA 4HAZA 1P1FA 4KBFA 5DI9A 1WD7A 3W9BA 3GVPA 2CN1A 3FCSB 1RRCA 1Q92A 2ZRDA 3ITDA 5CFPA 3FCYA 3G0OA 1GARA 3SCZA 3KOOA 1U9JA 4N40A 1YC2A 4PLHA 1Z15A 1BWSA 2O06A 3OA2A 4FR2A 1IAVA 2ATXA 2WJAA 1GUBA 2ZJFA 3OEHD 3Q7IA 5HK8A 2ZUFA 4RSHA 1PX0A 1QZ3A 1S89A 1OAKA 3V2UA 3WGNA 1W7AA 3ZBQA 2XWSA 1NVKA 3TBFA 1VKZA 2OQ2A 5D3MA 1W48A 3OI7A 4WKGA 4JK3A 4XQCA 3H84A 2G67A 2X9LA 3G6WA 2X3FA 3I2KA 4KZKA 3T3NA 2Z8YM 5K0LA 3ISVA 4TRNA 3WYEA 3OU7A 2IHUA 2FEKA 3AP2A 3U4AA 1R16A 5DWDA 4RGYA 1CB7A 2XD9A 3A1VA 2Q62A 4L51A 3MTAA 1E9VA 2JIPA 4DMUB 3KEGA 1O87A 3JASA 4WTOA 2AZMA 2BR4A 2I8LA 1YJXA 1DAHA 3ND7A 4ZYWA 3TMAA 4JD5A 4KOEC 2ATEA 5FBVB 1NW8A 2OCPA 3FYUA 3KLPX 2YWDA 3R5FA 5KOHB 1ZUIA 2X58A 3PR3A 2ZIAA 1GITA 3ILYA 4F1KA 4RTMA 3OPMA 4P5DA 2FSFA 5DRYA 2HF9A 3S27A 3BJZA 2ZI9A 4QUHA 2JGMA 2SNIE 2ADOA 3H2GA 2F00A 4X1KA 1XMPA 4F5DA 3B12A 5CJJA 5DNAA 5JJKA 2BHNA 1IRXA 1JHOA 2WMOB 3ROTA 1XPOA 3TSZA 3WA7A 5G2OA 1T34A 4L5AA 1C8BA 2BR3A 4WLUA 1PK8A 2DHRA 2HGSA 4IUBS 5AHOA 5IXSA 5DLPA 1AHIA 1OTHA 3CF4G 3L8HA 1FNMA 3M4YA 4M37A 2EJVA 4GR9A 3JQ7B 4MO2A 4BWFB 4C87A 4BQEA 4YWJA 3OICA 4RPKA 2YV3A 5FLYA 1KSGA 3TLAA 4ENUA 3RBZA 4Q7KA 1DTEA 4WNAB 2EJBA 5E4TA 3TZBA 9MHTA 1FFSA 4XKJA 4WLEA 4AKTA 4YO8A 2G4CA 4W6QA 1Q84A 1JKMA 3SXJA 1D9XA 2X14A 3TAUA 1YE8A 3V46A 1OTXA 2WFLA 1YA6A 2OXRA 2HMWA 4M0MA 3A9VA 3D8UA 5FTJA 2YVUA 3IOYA 3L6EA 5AVTA 1DIOB 4LVCA 4WY2A 1X1CA 1V6SA 1HDXA 2BDEA 2G82A 2JH8A 2H3EA 4PC7A 1NRJB 3C5HA 3DFZA 2E3JA 5L7WA 3QOWA 4P1ZA 2J9FB 3AUTA 5G1NA 4BAGA 1H2ZA 4BAZA 1UXOA 1ULZA 4DYVA 4E12A 4LOAA 3EZGA 4LJAA 1L3IA 1CRLA 1ZQ9A 2C92A 2A9RA 4FYHA 3V6MA 2HUPA 1K0UA 1YL5A 3UY4A 4CMAA 1QH1B 2DKOA 4QOHA 2C78A 1ORDA 3AUYA 3Q9NA 4LE2A 4YQZA 5FI5A 2QP9X 1DAEA 1F0YA 2QXUA 5JVDA 1OBFO 3ZE0B 3K0CA 2PKQO 4GLFA 1JF8A 2Q9BA 1M74A 1NQOA 3EMKA 3HDHA 3M7IA 4KAAA 1TIKA 1B2LA 3T7TA 4QG3A 1GYQA 1FUEA 5T4EA 1Y4ZA 1Y3IA 4N12A 3E7PA 4RLHA 2O9JA 2XODA 1YZUA 3EQ8A 4JVMA 3R75A 2BMWA 2ETVA 4G1FA 1GG8A 2QMUA 3C98A 1WCV1 1IBRA 3S7TA 1CW2B 2I7CA 3I6ZA 3A1DA 4HSEA 2JD1A 5J4HA 1R6DA 1JQEA 3HYRA 4YDRA 3ANNA 5DGXA 4D8XA 2BFDB 2ZSJA 4BFWA 5L3QB 5ECWA 4OJTA 3KPWA 3K8YA 5FUQA 1BVHA 4P81A 2VUIB 2POCA 1PW5A 3PP8A 1XXHE 2NAPA 2JI8A 1NUUA 2GOYA 4NI5A 4PLWA 4PVDA 3ZV7A 2XAAA 3FDJA 4MV3A 1E79A 1GU0A 3DL0A 3ICCA 5DTEA 3IRUA 3B6EA 4K40A 4EFDA 2OCDA 3GMSA 5SV2A 1NI4A 4DR3B 3C3XA 2PS9A 4TVKA 2VTEA 5DBOA 3H13A 4C04A 2FX5A 1HQDA 5EJ5A 5FPQA 3ANYB 4AP5A 5LYJF 2GEVA 3BE6A 3SJUA 4EVRA 5LD2C 1HDEA 1UFRA 3AVPA 1C1DA 3NWEA 2FJUA 2IYXA 4MYTA 4Y1RA 5F3RA 3UKOA 4HPXB 4M55A 3WS7A 3JWPA 4AY4A 4MEAA 3UAWA 3OFNA 1RPZA 1BE1A 1GZ3A 3LHFA 3A6HA 2VP9A 3F97A 1NA5A 3X1YA 2Y3IA 5EKSA 3C14C 2H1RA 4CT0A 3P9NA 4X41A 3T35A 4HDQB 4X1YA 2VSYA 3WB9A 4RH3A 5TF4A 3LQ4A 3ZWCA 3TFOA 5FI1B 4Z1OA 1L5SA 5IRCD 4PFQA 1OGJA 3TR6A 1JU4A 1XPJA 1NY5A 3TUJC 1ESZA 2GAFA 2QMZA 4KODA 4M9UA 16PKA 3A37A 3BWMA 4D79A 2BDUA 3RSFA 3F1LA 1ISSA 1N5KA 1D2AA 1QH0A 1R74A 2JGEA 3EZYA 2JANA 3BFJA 3KG2A 1PJRA 1BRMA 2C8KA 3H05A 1JEQB 2PG3A 3IB6A 4FJ0A 4JLMA 4CCYB 5FPKA 3TNYA 5K7SA 4L4RA 5HBRA 3DO5A 1ODFA 1BH2A 1T3ZA 4YCDA 1SB9A 4TM8A 1LJLA 3PHIA 3IYLW 3L93A 4NK5A 1UJ5A 4BGIA 4BKPA 5JNWA 2NPOA 4G5OA 5J63A 1ZCFA 1UPXA 3RRMA 3VDRA 3VPCA 3FTFA 3I6IA 4AO6A 1E6MA 4PONA 3FFWA 4Y6SA 1TQ8A 3W8DA 1Y8QB 1B7GO 2B1QA 2RHDA 1PWYE 1U0FA 5AK5A 3LOQA 2CXUA 2PKEA 2NZXA 2OMEA 3LO5A 5T3UA 1R6TA 1LFDB 2GETA 2JGDA 1H2EA 1VB3A 4TUYA 3RH0A 2I3BA 1YTLA 4MUBA 2GEFA 4F4UA 3J80A 4UPVA 5TJ9A 3G7SA 1G5HA 5ABPA 4OLAA 1YQQA 4U63A 1JFVA 3BOSA 1AB5A 2WVGA 3ZBPA 5H02A 1WB5A 2ZUVA 4IIJF 1M2VA 2CZCA 2EKLA 1IJBA 2G1AA 4G5FA 4QHTA 7ADHA 3UIEA 3C3WA 3RSGA 3BWDD 2QMQA 4GOOD 1C7JA 2QYOA 1E6KA 1NVTA 4CMCA 1CRQA 1SC6A 5BV0A 4IJWA 3DYBA 3DL2A 3FCAA 5FPYA 3R7WB 4DIBA 1I7LA 2ZS9A 4WV3A 4O63O 1HE8B 2GCIA 1G9TA 1T5TA 3M5PA 4G8CA 4BV9A 1T8WA 4PCVA 3N87A 4WE3A 4PN3A 4P53A 5KEIA 4M1WA 3WI7A 1P8JA 4ARSA 1IM2A 2JLSA 4YY3B 1G5FA 5CU7A 3TZLA 2CUKA 3ZXUB 4F56A 4WEQA 1EGQA 2L42A 4MQMA 4QPDA 4OHFA 4LYDA 4EG0A 1B26A 1EX9A 1Y8ZA 5KQMA 1VKHA 3M8KA 3P5BA 4CUJA 1N3BA 3QELB 5GONF 3DO6A 4G0PA 1NBEA 3CZRA 5JPIA 3UWPA 2VN8A 1UM9A 4KHZA 4ZI2A 1ZD5A 2FTKE 1EVEA 1DGQA 2YJTD 3D0RA 1NF9A 4AURA 3T0GA 1LZLA 4EDFA 3LKVA 3P32A 2W2MA 3JYNA 4C1BA 3OKPA 4U2BA 4FFRA 3H11A 5M34A 4LVUA 1UJBA 1FP4B 1Y9EA 4LHZA 5F3WB 4HB0A 1Y89A 4OXRA 4DS3A 1AA6A 3UMGA 3ZWQA 1PR6A 2FDRA 1LI4A 3JAKA 1OFIA 3Q7QA 1KI3A 1NF2A 4IGIA 4DZTA 2O3TA 2HHJA 2X9QA 2I4LA 4ZOLB 3T9DA 4K9OA 1TECE 1TAGA 2PU5A 4HQ6A 4HWSA 3CF0A 3TE6A 1RSZA 4BQRA 3S2GA 4E7PA 2W2QA 3MOGA 2HU2A 2O7RA 4FKBA 5BQXA 1P8AA 4Q3EA 4UU7A 4CKWA 3LT1A 4TLDA 3MILA 3T1OA 3UMRA 2FUG6 2JIDA 3Q6NA 4YLGA 1TF5A 4GGOA 4Y0NA 4Z9BA 4A6DA 3C97A 3GARA 1GDHA 1CNFA 4L7VA 1OE0A 4G1BA 4S0XA 3ZNQA 3FGNA 3GAMA 3R6DA 2XNHA 4LQLA 3FKSD 4XE5A 5MGBA 1DELA 1LWNA 4V03A 4B71A 3LLUA 1WQ4A 4QDZA 4C2TA 3AR3A 1G17A 1OLUA 3IUEA 1FMTA 4FDUA 1OR8A 4X7PA 1VHLA 1IUPA 5FPTA 3IJPA 3SNKA 3CKYA 5K8UA 2J0VA 5BT8A 1RI3A 2VQEB 1JXAA 2FDXA 4WAUA 5TF0A 3VXKA 1GZ4A 4MVXA 4BUJA 1DS6A 2MU1A 3R1IA 5BN3B 3SVLA 1Q91A 4GDFA 4D41A 1PFVA 4G5QA 2K7FA 4N6OA 4FOOA 2BM8A 1ENPA 1EG7A 2VRCD 3LPLA 3MFYA 2I65A 3LXXA 1L4YA 4HJXA 1MOPA 5DSXA 3HJFA 5JW6A 3F7OA 2CLMB 3HMKA 5E1MA 3A1TA 4DT1A 5TQVA 1PL6A 1S4QA 2GXUA 5B55A 5JADA 1BXKA 1RDFA 2IP1A 2LCIA 5EL0A 3LQFA 2ZCVA 1BU8A 2DSNA 2GTPA 2QK4A 5TX7A 4BB6A 2W6JD 2ZWAA 3JD4A 4E0BA 2F43A 2ZSDA 4ZQHA 1PR5A 3J81k 2ZPTX 4TKZA 4FVTA 2FN3A 4WNCA 1QP7A 4EVIA 1DC3A 1H8HD 1XDBA 3IHTA 3QVOA 1K3TA 2CL0X 2YUIA 4BB9A 5AT1A 4WPGA 4LK2A 5A0FA 1UOQA 1U0TA 2WWYA 3WLKX 5A5DA 4ZOEA 4EGQA 5AMXA 2I7VA 4PQRA 1A9XB 3I76A 8OHMA 2QR3A 1IY2A 1YBAA 4RV9A 4YIHA 2JFHA 4Y98A 1WUJS 3V3TA 1FJGB 1QYXA 1T2DA 3V33A 4G0QA 4AWBA 3WA6A 1O2DA 3Q8XB 3G6KA 1WF3A 1U7TA 3P26A 4ZVVA 3AP3A 4DSTA 2IYNA 1JAYA 2WD8A 1TT7A 1AGNA 1A9SA 1G16A 4IMRA 5JSYA 4MYUA 3FHCB 2FMFA 2O2GA 2WTNA 5FD8A 3QJYA 2O54A 4U6NA 4LJYA 4PYIA 1CQIB 2ASEA 3EARA 3EQ9A 4KQIA 4O4HB 5C5DA 4C7OA 4ZO7A 4ZVKA 4EBFA 2PHZA 1L4BA 3MJHA 3ZWXA 5LMNB 2PKYX 3PQ8A 4FSHA 3CUWA 3H0KA 2DPHA 3SEZA 3NO4A 5IASA 2IXAA 4JJ7A 3GEHA 1N1MA 1TADA 3PFGA 1X13A 2GWRA 3OMXA 3I8XA 1CUIA 1BN7A 1N5DA 4OQEA 1MRZA 5A4FS 2PL1A 4GOKA 3I53A 2C97A 1OILA 4P2GA 1YSCA 4P2BA 1VLMA 3HCRA 4G63A 4DDKA 3QBDA 4QDKA 2YJGA 1M0EA 3L79A 1S2LA 1I0IA 4LCEA 2J9ZB 3TQFA 3E4DA 2HA5A 4GOLD 1V4VA 3JQ9C 4LZZA 3VHQA 3IH5A 3ZDFA 1TEVA 2VJOA 2HQSA 4H0FA 4YJFB 2G36A 4NBKA 3EXAA 4BNJA 5H9VA 4EP1A 3R3SA 1I2DA 1SUIA 1GFSA 4AT1A 3EQ6A 3HBAA 1YS6A 1T24A 1XI2A 2QLNA 3A1SA 3EEYA 2DOKA 2CFSA 3A0RB 4F86A 4MPPA 2JHCA 1J25A 4OL0A 5K9ZA 3SX2A 1KDTA 1MB3A 1CG6A 1OI3A 3LLVA 3OF2A 1OJ7A 2W8BA 1EDZA 3SC2B 3RANA 1IHXA 1BMFD 1D4FA 2D8MA 2ZJBA 2CMKA 1ADBA 2AXPA 4J4BA 2C0CA 4MQLA 2FPIA 5AUNB 3V4RA 3EVNA 1C7ZA 1SURA 2W2PA 3R6GA 1CQWA 2Q1YA 4QFMA 5BMVB 1UFVA 1SC1A 4EZBA 4HRXA 2XJ9A 1N1GA 2Z09A 1WBDA 4QRIA 3PQ4A 1XDGA 4X90A 5JZBA 4L8YA 1WHTA 1QPBA 4BJ1A 2F1OA 3QUSA 1YS7A 4Y8VA 3DDHA 5DH9A 4JLPA 1NBHA 4L27A 4ME6A 2ZJOA 5CNIA 3RFUA 1RHJA 2ADFA 4D4GA 1G38A 3U26A 4CT4B 1Z6ZA 2WNHA 1WW8A 1HR0B 1JI3A 2NYUA 2YHAA 1JKFA 4QA9A 3GMTA 4AG5A 1CF2O 1RBYA 3D4BA 3KQKA 4G3XA 1QQTA 3F3SA 4M87A 4MDYA 2JHGA 5ES4B 1NR7A 1VLLA 1UJMA 1KK0A 1WAMA 4P4NA 4YBRA 2VWHA 5SY4A 3T99A 5KNLA 3CLRD 3C1AA 4R9VA 2GD2A 2J31A 3B52X 5ICCA 5SYMA 4DMCA 2QTTA 1AQ6A 1O03A 1V41E 3N8KA 10MHA 3W2HA 5A5EA 3UM9A 1FK8A 1PR3A 4BCCA 5BSWA 3ZQJA 4MIEA 1G63A 2G25A 3Q7EA 5G40A 2RH8A 3GDGA 4Q4DA 4AO8A 1WWKA 3SSOA 3UAGA 4WJKB 4BFXA 5H4GA 2XYHA 3KQVA 4ZK6A 4EH1A 5A4AA 2QG6A 1SC9A 3CLTD 2A0FA 3IPLA 4WECA 3E9DA 5CB6A 3W9UA 4O2BA 4JN6B 4CETA 3ICPA 1RP7A 4TXJA 5LA6A 3JAMA 4EOGA 2Q3DA 2XRZA 2XCQA 1RI5A 1IC6A 2VUHB 2YY6A 3KD3A 3AWIA 4R2HA 4XX1A 3GO4A 4X1OA 3TLYA 5HFNA 2XB2A 1P5HA 1UIRA 4B5KA 2TECE 4JVNA 1OV6A 2O0HA 3KQTA 2RGYA 4Y0VA 4DNOA 3SWWA 4UE6A 1S4MA 3D6UA 3PWZA 2DY1A 3X2EA 4R9NA 4C0KA 2PUDA 4YJGA 1DBVO 4Z0TA 5TGZA 3TWOA 4IGAA 4JITA 2XZOA 4K9DA 3RAJA 5C5CA 1PBNA 4MV6A 3NETA 1ZNYA 2M1ZA 2WJHA 3N05A 3L3BA 2JFOA 1MAAA 4G5SA 3SI7A 3WL4A 4C07A 4BQQA 4TVSA 2XVAA 1XNHA 4EGFA 4BLUA 3WGMA 1UJ4A 1CUXA 4DUZB 1YIAA 2NAFA 4NYJQ 4U8GA 4GS5A 2NQ8A 4C6TB 5AOVA 4D0NA 3H5RA 2JCYA 2QT1A 2HIHA 4ZHQF 2QYHA 4C2BA 1A76A 5ICMA 3EVBA 2FW7A 2DQKA 4QNRA 4UUQA 1YONA 3UFBA 3LXMA 4O02B 1DKLA 4WLNA 2BPOA 5KJCA 2Z8YA 3UJBA 5JISA 3HKDA 1L5HB 5IKPA 5LDGA 4D0GA 1UDBA 1X8LA 5AJUA 4JOQA 1KZHA 1Z4NA 4OMUA 2R4TA 3A27A 4Y1EA 5TS3A 3PWKA 4B87A 4BJ3A 5HQ3A 3T5PA 4UOZA 1FFWA 5AKHA 1V8FA 2GHTA 1J09A 3QM1A 4ZO8A 5E3HA 5EUBA 5MFPA 3L7LA 1NN0A 1UMBA 3ER6A 2YMLA 1G2OA 1Z7EA 4DGSA 2DFNA 3QLJA 2PLFA 3JQ9A 1UXKA 1X42A 3OOJA 3SG0A 3ZW7A 5FWXB 2GS9A 3AEXA 3U7QB 3UV7A 5KU1A 5AW1A 1WF6A