3GFTA

Human k-ras (q61h) in complex with a gtp analogue
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
167
structure length
167
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Human K-Ras in complex with a GTP analogue
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 167
sequence length 167
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gftA00
1AJEA 1NRJB 4A8JB 4GDFA 2WBLC 3ASZA 5DSZA 4Q4LA 2ZEJA 4NCIA 2RMKA 1AN0A 3PR1A 3GJ4A 5GVSA 1SXJC 1XEWX 2GK7A 2J0QA 3AKYA 2JLZA 3OIYA 3BD9A 2XXAA 1E9EA 2N1BA 1PVOA 1G64A 2O0JA 5LD2C 1J8MF 1NLZA 3LAWA 1G7CA 2Q3HA 4RZ2A 2FN4A 2ZS8A 4A4DA 2VSOA 5IF9A 4C0SA 1E2KA 3N5CA 4ASUD 3R9WA 2Y8EA 3AVWA 2IYUA 3BORA 3NBFA 2CLDX 2I1QA 3BWDD 3BH7A 3NHAA 5AJVB 4JT4A 5DI3B 2PEYA 1Q44A 2GJ8A 2F7SA 4N0DA 1CRPA 2CJWB 5E4FA 4JL5A 1DADA 2XTMA 1V43A 3GLFB 3ZVNA 1QHGA 4M1MA 2I3BA 5EE3A 1AS2A 1TADA 4D6PA 4QHSA 1W46A 1AS0A 1U9IA 2ECKA 3BH0A 5AJWA 4Z8XA 2VL7A 3QKRB 1Z5ZA 3HYRA 3LQRA 1Z0JA 2DFNA 3TKLA 4Q1DA 4LUCA 5JSZA 4QNRA 4ACAA 1OJLA 1MABA 1XTJA 1SXJB 5L8VA 5G40A 4ZV4A 3B2EA 2GXAA 3IIMA 1SVSA 3EG5A 4XVQA 2QTHA 3PV0A 4M22A 5JJIA 4A15A 1EFHA 5LD2B 1KSFX 1CR2A 1ZCBA 4KJZA 2JCSA 3T12A 2O8FA 3QBTA 2ZUCA 1ZNXA 4QBIA 2FEMA 1BMFA 5FH9A 5C2JB 1FW6A 3K0CC 3A1VA 3CBQA 3GEIA 1JBKA 2PZGA 3NDPA 3SJCA 3HU2A 1HTWA 2GF9A 4OQNA 3TVDA 1JR3D 3I1FA 5FR2A 4KSBA 1QZXA 5A4JA 4LHVA 1GTVA 2JJ2A 1IOZA 1TAGA 4LYJA 4Q4JA 1T9HA 3C7KA 1OXUA 1ZVQA 3ZVMA 3TIFA 5JBQA 1T3HA 5LBIA 3TUZC 3X1ZA 3QKSA 1OHHD 4KVAA 3A4LA 3UK6A 2RCNA 5FBWB 4CEHA 1XTIA 4B2IA 1SVWA 2WWYA 1ZBDA 2JLVA 4TT3D 4M1YA 3X1XA 4A2PA 2OFXA 4HDOB 1KSGA 5JRJA 1KI4A 4AKGA 2YHSA 1NP6A 2ZIAA 4B6FA 1TX4B 2FEOA 5JCZA 1B0UA 2OAP1 4EUNA 4RD4A 1KKLA 2K5UA 2RGGA 2ZI7A 2HT1A 1IAQA 3MFYA 2JJ1D 2IYQA 5JI3E 3E70C 1TEXA 1GNQA 1IN5A 1Z3IX 2CVHA 4F4IA 3PCRB 1IN4A 2IA5A 4IVPA 1C4OA 4XWOA 1NN1A 3IBGA 3QE0A 2PCLA 5SZJA 5TY0A 3VR6A 2J7PA 1WB9A 4LK2A 4DEYA 1F5NA 4TZ0A 2O0HA 4V02A 3AB3A 1R5BA 1RRGA 2NG1A 1W5SA 4TTRA 1A1VA 3UATA 4QC2A 2B6HA 2XX3A 2Z5FA 4LI0A 2IYVA 4BFSA 5FUVA 4F91B 1G6OA 2IEYA 5D3MA 2WHXA 3KDSE 1RYHA 4LPSA 5CJ2A 4Q9LA 4UKDA 1L4UA 3ZS8A 1EX7A 1W44A 4U5XA 2C96A 2FG5A 1KO7A 3THXA 2C9YA 3MGCA 1M7GA 1NL3A 2DFTA 1XX6A 3EIEA 2GKSA 4Q66C 1R0WA 1R7RA 1KJYA 1XF9A 1YKSA 4LJYA 4JIMA 2C5LA 1SVMA 1DE0A 4MYTA 4D82A 5CB8A 2RGBA 2ZJYA 4CT5A 2AKYA 2G88A 1M74A 4LC1A 3CRMA 1OYYA 2QTFA 2NOAA 2PEZA 4RZXA 1AGRA 4MGIR 5EXXA 4Q9KA 4EPXA 3DM9B 1UKYA 4B3GA 1RIFA 3GLIE 4M9QA 4R2IA 1GRNA 1YZLA 4DLUA 4UXJA 5IRCD 1BYUA 3CR8A 3K09A 4MRNA 4GI7A 5F9HA 3U4QB 5EP3A 5FBVB 1CJUC 1FFHA 2V55B 1Z08A 4C2UA 3B1YA 5EXTA 3G5UA 2WMOB 1UBEA 3VAAA 1SXJD 1XNJA 8OHMA 2NO1A 2GCOA 2QT0A 2XB4A 1I4LD 4PPGA 3TJZA 1MKYA 3U61B 3B8HA 1VMAA 3RS0A 3OE7A 2G9NA 2HLDD 1H8ED 1K5DA 1A7JA 5TV2A 4BLTA 5B58C 3KZ1E 2WPDA 5HZKA 4BZQA 2IWHA 1SKYB 2WTUA 2DB3A 3NKVA 4LJAA 1G4AE 3K0AA 4JL8A 1T8UA 2J0UB 4HAXA 2HYIC 3W6NA 3BFXA 1KZ7B 3X1WA 3X1YA 3RS3A 4EJSC 3SBEA 2WV9A 2KI5A 2UKDA 3PUVA 4U7DA 2FMXA 2JAQA 2PH1A 2N42A 2ZI3A 3KKQA 2IXFA 2LKDA 4N3NA 1OFUX 2GJAA 3CX6A 4PQRA 4MDEA 4QBGB 2IS2A 2CL6X 3DOFA 421PA 4M1TA 3LO5A 4WVFA 1G18A 1YR6A 1YR9A 2CCGA 2BMFA 2KJQA 2SHKA 2WJIA 3DHWC 4XVRA 4ITRC 4M9SA 1D5CA 3BE4A 3FDIA 4M9ZA 3JZMA 3SI7A 2ZANA 3KUDA 5HZHA 3GLIA 4FMBB 1VHTA 1NVUQ 1MH1A 2O5VA 4XIGS 5CLQA 3EZ9A 5L3RA 1G7RA 2P5SA 3WBKA 2ZSDA 5KNDA 5JJKA 4P31A 1OKKA 4RKFA 4V0LA 2AFHE 2J45A 4D4JA 3KL4A 5K8LA 1EWQA 1E4VA 3PQCA 1Z63A 2OLJA 1DAGA 2F9LA 4Q7KA 3QG1A 3LX5A 4EJSB 3DPUA 3A6PC 4DVGA 2ZR9A 1FQJA 1I4TD 1EFCA 3EARA 2O8DA 3F5FA 2W83A 1XXHB 3VQTA 4GSYA 4V03A 1E2QA 2Q6TA 2D2FA 1OXXK 1JQLB 1ZIPA 3GEEA 2BEKA 3ECCA 4QFMA 1ZD1A 4AYXA 4CEJA 3VMFA 1KDRA 2BBWA 1E1RD 2D2EA 2GCNA 3EPLA 4HATA 4OHWA 4V0NA 3QOFA 1P62B 2W2XA 2QGNA 1GRQA 1XEXA 1KO8A 4TZ6A 2D62A 3BRWD 4FCVA 2VSXA 2REOA 4GOKA 5JWOA 3Q85A 4BZXA 2P65A 3VTKA 1FP6A 2R6FA 1M7BA 1G8GA 2CVFA 1G41A 2E9SA 2ORVA 4PC1A 1YJ5A 3P4XA 3SE0A 2ORWA 2JLRA 5J5CA 3L82B 4M21A 2ZRMA 5GADl 3U6KA 1EFTA 1FZQA 5DYIA 5FTNA 1G3RA 3CH4B 2ZJ8A 2QBYB 2IF2A 2RHMA 3BC1A 2GJSA 2WMNB 3L0PA 1GWNA 5DI9A 1J8YF 1MO3A 1ZW6A 4JL6A 4IW3B 2AK2A 2V6JA 3RC3A 3K9HA 4BGDA 3GPLA 3S1AB 3VU9B 5CYPA 3PUZA 1NLFA 1P3JA 1SGWA 1TNDA 3KJEA 1OXSC 4TL9A 3P20A 3KJIA 5KDLA 2HT6A 1AKYA 4B3FX 4EFNA 3SN6A 1K5GA 4DT1B 4TL6A 3T35A 1RZ3A 5K8UA 2QMEA 2R8RA 5FOVA 2FSHA 1NN0A 4TWZA 2ODEA 1AKEA 2CL7X 3K9LA 3T15A 4BLRA 2XZOA 4D26A 5ELXA 1G4UR 5SZIA 3PJRA 5F9FA 3ZQ6A 1A2BA 1L7VC 1Z29A 4BEJA 1NSFA 3UMRA 3TUJC 2GZHA 3LNCA 3TAHA 4B2PA 5K8TA 3MCAA 1R10A 4EFMA 4QJ3A 1DBSA 2QG6A 3L43A 4C0LA 1E1QA 4X8OA 3IILA 1T0JB 2CBZA 3L8ZA 3CX8A 3OAAA 5FPTA 5FTJA 2I4IA 3CNOA 3QPWA 5G41A 3CX7A 3B5JA 3T1TA 1XCGB 5CLLA 2GF0A 3DMNA 1DG3A 2XOKD 1OLOA 1E2DA 4LYAA 3E5HA 1LF0A 2ZRAA 1SHKA 4KFSA 3THYA 3IQWA 3T1VA 3SC3A 2NO0A 3TR0A 4C7OB 2JIZD 2OUKA 2ZTSA 1E2GA 1IQPA 3KJHA 3ZD7A 3QG5A 4US0R 4XH9B 4JLNA 2WJYA 2PJRA 5AR1A 3TMKA 2ERYA 1QHHB 2ZYWX 1U99A 4J0QA 1FX0A 3FYHA 1X6VA 4RVCA 2A5DA 1E9BA 2VIIA 1ZYUA 1WDTA 1L4YA 4WW0A 4B35A 4DIEA 1Z0AA 4DCTA 1JXMA 3FWYA 2ZQ5A 2IX3A 2ZVPX 4HAZA 3K70C 3WRYC 2X19A 1W7AA 3AVOA 4D2IA 2GESA 2HJVA 3CRVA 4NMMA 4DZZA 5ANRB 5TMPA 4C0KA 4B73A 4FW9A 4TTQA 5FI1B 2ATXA 4HLUA 3SNHA 4HB3A 5AJYA 4OI1A 5FPKA 4AURA 4BLOA 1P7CA 5J4KA 4Q47A 2RH5A 3SJZA 4GZLA 4GOXA 1KI2A 2VP4A 2XSZD 2GNOA 3LRPA 1EFRD 4KYIB 3TBKA 4WXRA 1GVNB 1T5LA 1LF5A 1N6NA 2ZUBA 2YOFA 2DR3A 1UKVY 3FKSA 4Q1CA 4TMXA 3RS5A 1NVXQ 3NBZC 5KSYA 5F2EA 2QI9C 4HDQB 2ZSEA 3HPRA 3TK1A 3ASYA 5FBRB 1ZM4A 5FUWA 4LY6A 4ZPXA 1NMZA 3NVAA 2GAAA 4TSFD 3ZIAD 3WYAA 5KU1A 2GETA 2OBMA 1XU4A 2X77A 1GAJA 1XD9A 2IXGA 1DTSA 3CZPA 4WZAE 4TLDA 2REXB 3K70B 3SOPA 2W00A 1CJVC 1E2IA 4R7ZA 3RSOA 2YWGA 1G7TA 3KFVA 2QENA 4BEBA 2BM1A 3SS8A 4ZI3A 1LFDB 1Q3TA 3IUYA 1OT3A 3T5DA 4AC9A 4MITA 4OQLA 3AGPA 3UIEA 3CH5A 3B1WA 5HCNA 4FIDA 4LBYA 2AD5A 4CEHB 2F55A 2GCPA 4PHTA 1ZU5A 2WJVA 4ILEA 4DEXA 4DSOA 5AUOB 5JI2E 3BK7A 1T4GA 3EA5A 2VO1A 1JEEA 4HUQB 2ODNA 2C2HA 4JJKA 2VPPA 4F4JA 2B92A 2X2FA 1ZP6A 3SQWA 1X8KA 5JEDA 3AVUA 2PLRA 4ZDWA 4GMDA 2OILA 3HR8A 2BMJA 4EKDA 3TSWA 1MOZA 1G3QA 1N6PA 2VYFA 2W2VA 3NG1A 2V3CC 2P67A 1OH8A 2A9KA 3B82A 1PV4A 3ZZTA 4P4UA 2CHQA 3SFVA 2XZPA 1RRFA 4PTLA 1RRCA 4QXAA 4MGZR 3QVVA 2FPLA 1XP8A 3GLHE 3NWJA 1R8QA 2OG2A 1XD2A 1ZU4A 4JS0A 5FUXA 1NJFA 2H5EA 2VHJA 1ZCAA 5JWHA 1TF7A 4Q1AA 4Q03A 4BLQA 4DBLC 4YMSA 4DC9A 1N6KA 4D4LA 3X2SA 3FVQA 2BBSA 3B78A 3GJXC 4DDTA 4LBZA 3SZRA 2OAQ1 1DVRA 1E79D 2AHOA 3PFIA 1VIAA 4NH0A 2Z6VA 4QJ5A 5EZ6B 4G5OA 3ONWA 2WKQA 2O8EB 1ZUNB 3AP3A 1T0HB 3UXMA 3R20A 5FPYA 5BYKA 1J90A 5JRZA 5JS7A 2BIFA 4CIDA 3UPUA 1Q21A 4DLWA 2DWOA 4HZUB 4W5WA 4CRWB 4IEEA 3V4RA 3DZDA 2WWHA 5KNCA 1IHUA 2FGKA 4YC7A 4ON9A 4DLVA 5KPJA 5KSPA 2ANBA 1W4CA 1GKIA 2IS1A 4W5HA 2ZREA 3PEVA 2KBFA 1W2HA 4JVMA 4B44A 3PUXA 4ZKDA 1SVKA 3CF0A 1OFTA 1FUKA 2GJ9A 2W6JA 1XZPA 1Z47A 1RRPA 2A7QA 5H1YA 3U3KA 3HWSA 3L0SA 4NCJA 5HKKA 1G17A 3AUXA 2VEDA 4ZDJA 2ODWA 3E2IA 2H57A 1Q1ZA 1U8AA 2QEQA 4ARZA 1HA3A 2FU5C 3NEJA 4MQBA 2AR7A 3G0HA 1EESA 1DAIA 5FPSA 1VYUA 3OIWA 3FKQA 2W6IA 1VG1A 2AKAB 3GLHA 4AYTA 1KY2A 2CK3D 3CNNA 3OEHA 4K46A 3REGA 3T1OA 1NBME 1N5IA 3K70D 5L3SB 3RC8A 4HZIA 4L4UA 3X1DA 1N25A 4KBGA 4UNNA 4HB0A 4OKSA 1UKEA 3T5GA 4C0AC 5JEEA 3KXLA 5FOWA 5DGXA 1OF1A 3H1TA 4OI2A 3R9IA 2QSZA 2CE7A 1MV5A 1G20E 4BFXA 4DUGA 4IVRA 1TUIA 4OK6A 3W8NA 1IONA 1TU4A 2ZJ2A 4PQFA 3RANA 2GVDC 5KOYA 2WWGA 3U3MA 4UXIA 3Q5DA 2PMDA 3P27A 1CBUA 1EK0A 1M34E 4PC2A 2C03A 2ZE8A 2WWXA 1Q57A 1QVRA 3GEHA 1G1MA 2PT5A 3OEEA 1X3SA 4HLDA 2OXCA 1YRAA 4Q9HA 1NVWQ 3AF2A 3MMPA 2H8KA 1ESNA 3THOA 1RKBA 4IXMA 1US8A 1Z28A 4XWAA 3GLGA 4WZBE 1Z6XA 4LBVA 1A4RA 1Z6TA 2JLQA 2XNDA 1G7SA 1ZNYA 1XCMA 2O0KA 2ZU6A 3NHBA 1NVVR 121PA 2QU8A 1IM2A 3LA6A 1Z0FA 3VNUA 1VYTA 3CZQA 4JMPA 4EQ6A 3QJYA 4URYR 1XMVA 2CE2X 2Z4RA 1PJRA 3BB4A 4GPTA 4LJ9A 1F6BA 1WA5A 2RGEA 4QNMA 4IOMA 3U7HB 3FMOB 1E2EA 3MRSA 2A3RA 1LV7A 3IKJA 1N6OA 3AF4A 1AIPA 2P6RA 3GJ8A 4DRZA 2E1RA 1DG1G 4EIWA 2GBLC 1SVLA 3FGNA 4ZO4A 4JBYA 1N2CE 4MRVA 2WOOA 3B60A 1Q1EA 2HYDA 1KK1A 1Z07A 4AYWA 4KFUA 1Q3HA 4TN1A 4ZCMA 1KDPA 3A1SA 2ZI9A 3A8TA 1TL7C 2D06A 3BFKA 4RFSB 2QP4A 1F2TA 3SYKA 2WJHA 4NYJR 3RAPR 2O52A 3PEYA 1GFIA 4RY2A 3AH8A 1TQ6A 3J81k 3B13B 2H7VA 3SJBA 2FV8A 3CW2A 1F2UB 3MD0A 3MWYW 5DNYB 3ZD6A 2DPXA 1IY0A 1W0KA 2QPOA 2GWHA 2LKCA 4BWYA 3VKGA 2WWIA 3WMGA 4IDPA 1VCNA 5CK4A 2REBA 2GXSA 4B48A 2XAUA 2XITA 2HEIA 2RGCA 2VTKA 1XB2A 2ZR7A 3Q72A 2J0VA 4N1AA 4TYNA 2ZXUA 4CEIB 2GJKA 1LNZA 1RJ9A 4G5RA 4F93B 4EAQA 4D25A 2R6DA 4P4SA 4CYMA 1NN5A 4ZDKA 4FXPA 2GK6A 3QKUA 2IW3A 3NH6A 2F3TA 1Q1BA 2PCJA 4YXWA 4L9SA 1P9WA 4LYHA 4NU0A 3HU1A 3VX4A 2KB0A 2CCKA 4KBFA 5GJBA 3KKPA 1SVOA 1ZC3A 3IEUA 1D8TA 1CTQA 3QPVA 3CRQA 3GJ7A 1W4BA 2QPAA 5IDVA 5TDHA 4AWXA 2ZPTX 4JLPA 4DSNA 2VP5A 4RD1A 1PZNA 4DLXA 2R6GA 1HE8B 2F43A 4MYHA 2ANCA 3H2YA 3NDBB 3L0OA 2Z83A 1C1YA 4R2HA 1ZM7A 3Q7QA 1HEIA 1UADA 3OIVA 3FOZA 3QIAA 4RD6A 1E6CA 1Z6AA 2JEOA 3KKOA 3ADDA 3KJGA 4I1SA 1S96A 5D3QA 2QMHA 4D4KA 1WMSA 2R6CA 1OH7A 1W2GA 1DPFA 4TLBA 3WMFA 3IGFA 1TMKA 2BDTA 2W0SA 2O8CA 1HURA 5HE8A 3TVTA 1D2EA 2BJVA 2ZJBA 5AUNB 3EC1A 5LB2A 1H8HA 5JHHB 3QXJA 2QRNA 4TQ9A 4Q4AA 1GILA 3Q7PA 3W90A 3MWKA 5DE3A 2GDJA 4K81B 1M6NA 3UWKA 4AG5A 3TUIC 2OZEA 2FFAA 3EZFA 2J7KA 2ZRDA 1VG0B 3OF5A 3EX7C 4PO8A 2XJ9A 5C1BA 1G8FA 1BO6A 2GZAA 4W5JA 3M4YA 1KI6B 3QF4B 1NIPA 4Q7JB 3AVYA 3ND9A 2X8AA 4QG7A 3C5HA 2LWIA 2YWEA 2JLSA 5IK2D 4HDCA 4YMVA 1QG2A 1TQ2A 3LX8A 3RS2A 1LS6A 3EC2A 2GEVA 5DH9A 5FOTA 4WXPA 2F1RA 1U81A 5DISB 1YE8A 4JBWA 4V0MA 1COWD 5B2ZA 3SJAA 5JHGB 3TR5A 2CXXA 2PZEA 4TLEA 4C0JA 3SYLA 2OESA 3VR5A 3PIRA 3GCGA 4JYBA 1N0UA 4MKFA 3AVTA 3A1TA 3RRNA 2QT1A 1KMHA 1V5WA 3KTAB 4LHWA 4GP6A 4PPFA 3TNFA 5JFGA 2BV3A 2PZFA 2WKRA 3LDAA 2YWFA 3IEVA 4O25A 2R65A 2OHFA 2PLFA 3CKLA 3I3SR 4G3XA 4IKEA 1DEKA 2QMOA 5FOSA 2GA8A 4PANA 3K8YA 4RD3A 2RGNA 4KITB 3AM1A 3HPQA 4DIDA 1VCOA 1CLUA 4LDJA 3WHKA 3KQNA 1D9XA 1R5NA 3ZVRA 3BFVA 4RFVA 5BQ5A 4Z1MD 2IC5A 2V1XA 3MLEA 4L5BA 3U44A 1RFLA 3ZS9A 1G9XA 4HI0E 2FOLA 5HR5A 1FUUA 5KHOC 2GHIA 3QEJA 1N3BA 3GJ0A 1JXOA 1T3LA 4A9AA 5KDOA 1BKDR 1BH2A 5C18A 4LSGA 1N6RA 2FFBA 2OCAA 3A4NA 3A1UA 3FMFA 1TUEA 1E0AA 5L3VA 2JATA 4ASUA 5E7MA 3RSLA 1AGPA 4KV9A 3ZZ0A 3VR1A 3REFA 4D0GA 4DCNA 1N5KA 1OIXA 2B8TA 3A4MA 3RHFA 4M8NE 3BJIC 4M1KA 4Z8YA 2AWOA 2WAYA 5E7IA 3M1IA 4PPNA 2YOHA 3TE6A 1XEWY 4L8GA 1IBRA 4US1R 1MT0A 3HYTA 4BUJA 3Q5EA 1EGAA 4XTCS 4ZKEA 1II8B 3EW9A 4OJKA 4OHZA 1DO2A 4XD7D 4DLZA 4AY2A 4CW7A 2VF7A 4EPVA 1XJCA 4M1SA 2CLCX 3GJ6A 2Q9BA 4HLCA 3Q8XB 2ODBA 1IY2A 3WYGA 4H9GA 5JS8A 2G1JA 2OCYC 1MRNA 2R2AA 4OBEA 1VCMA 3SDZA 5DHAA 1G8HA 4GT1A 1AZTA 1XWIA 1RE0A 4D0LB 1E2MA 4E5UA 5L3QB 4A2WA 3PG5A 3O8DA 4HAWA 3LXRA 3NC1C 1I4DD 2QAGA 2X1VA 4ZIRA 5BXQC 2VHTA 4QGGA 3QSYA 5DLQC 721PA 3FKSD 3K0FA 3P26A 1RPZA 4JSTA 1E2PA 2ZJ5A 4AI6A 2P5TB 4URVR 2FPKA 3KKNA 3W34A 3KUCA 2ONJA 4I1UA 4OYHA 3D6TB 2F1HA 3FB4A 3KQUA 5GVRA 3AEZA 2JLYA 2BBTA 3WNDA 1JAHA 5J4LA 5BWMA 1NIJA 1G21E 3R7WA 3GLFE 2FNAA 3PITA 1K6MA 3I8XA 2JGNA 2ZAOA 3KB2A 4B47A 3AF3A 1P5ZB 3BH6A 1OPXA 2OFWA 4TT3A 3CUEF 2J46A 2YZ2A 4O3MA 4NE2A 2V1UA 2N46A 2A30A 1YHNA 4XSGA 1MRSA 1NNEA 1IN7A 2QA5A 1E9AA 2WVJA 4Q00A 4HEJA 4PSKA 5HTKA 2F6RA 2ZRLA 1P2UA 2JJ1A 4AK9A 2WSSD 3HP1A 1U98A 2QMUA 4Q4HA 1N6IA 4OK5A 1E9CA 3THWA 1QHNA 1XTKA 1FTSA 4DLSA 2IK8A 3RDPA 3LLUA 4TMKA 4A8JA 2IYZA 5FL3A 4NCNA 4EPYA 4RZ3A 621PA 1J70A 1U0JA 4GNKA 4G5SA 5JLJA 5FTLA 3VKWA 4EDHA 1NKSA 1IN6A 1TU3A 3UG6A 3NH9A 5TXGA 1E9RA 2QE7D 3NBYC 2J5XA 3A37A 2ZRFA 3DZ8A 4HLQB 4PC6A 3DDCA 2CCJA 2D4HA 4JYCA 4URXR 2J3EA 5KTYA 1KZGB 2XEXA 3AVPA 1QVAA 2FF7A 4WIAA 2G1KA 1CR4A 2ZJOA 2ZSFA 4FMDB 4I1VA 5EXSA 2YWHA 2AFIE 5DI3A 1NMYA 3UMFA 2ZI6A 4BFZA 3K9GA 2IHYA 2CJWA 3EPJA 4JT2A 3I62A 3ICQB 2B7BA 3GLFA 1QDEA 5EP1A 5GJWC 4NYMR 3C8UA 4I4LA 3CLVA 1WRBA 2A2ZA 1ONBA 1IY1A 4TMZA 5DN6D 1C9KA 4WBSA 4PC3A 2O8BB 3QKRA 1E2FA 5EP4A 3WNBA 1U9IC 2FGJA 5G3ZA 4AKIA 4CGZA 3QPUA 1G3MA 1XBTA 2HUPA 3EZ7A 1ANKA 2PMKA 1R0XA 1SXJA 4KCGA 1P2SA 1BYIA 1TQDA 2OCPA 3VX3A 2OFOA 1XTRA 1J2JA 5HE9A 3N2IA 2HLDA 2ZE5A 2XXAB 1KDOA 1YZGA 1IJEA 3L0IB 4NKRA 1H8EA 4Q1EA 5AJZA 5TB5A 1OSNA 1OW3B 2DYKA 1TPZA 1E3MA 3R9XA 2ZRJA 1KKMA 1MO5A 1XJ0A 3CPEA 3KQKA 3DKVA 4PFSA 2W6JD 2R9VA 2AK3A 1X8LA 4BPBA 3ZJYA 4A0GA 2VP2A 2QROA 2KBEA 5CM8B 2C95A 1NSTA 1P4SA 3V4FA 3B7GA 2BWJA 2ZE6A 5H68A 2YJTD 4IHQA 3ND8A 4GZMA 2BMDA 1CIPA 1N0WA 3LD9A 2JLXA 5EE0A 3MAAC 3BIFA 1XMIA 2IF0A 3OEHD 1GKUB 2QZ4A 2PL3A 3GFOA 4RJLA 5LB4A 5JSZB 2Q0HA 4C4PA 1MABB 2BM0A 1S3GA 1GIAA 1UJ2A 4URZR 4DB4A 2ZJAA 1Z0IA 5EE5B 3FMPB 2UZ3A 1QHXA 1X1SA 3ZZUA 1OB5A 3QBVA 1GNPA 5AK0A 1AQYA 4AD8A 2MMCA 2O8FB 5G3YA 3ADKA 1EG7A 6Q21A 3K0CA 3WP0A 5KNBA 1FMLA 4HYYA 4DSUA 4UQOA 3W9YA 3DL0A 3D7MA 1IJFA 2QPTA 5EQTA 3DKPA 4MUBA 3U2QA 4O2LA 4BRWA 1W36C 3VR2A 4HB4A 1OXVA 1UKZA 5IT5A 3WHLA 4IJMA 1SKYE 1WQ1R 3WXMA 4Q4JB 4D80A 5EZ5A 3QQ5A 3FHOA 5CIWA 1G3IA 3SEAA 1I2DA 2WWFA 4GP7A 1ZJ6A 2QY9A 3QKSB 4UNSA 4E07A 5KPDA 4KHZA 4IOLA 3KQHA 1SVIA 5HCIA 2XNDD 4F38A 3NTUA 4YMTA 4E09A 5FBLB 5CITA 1SKQA 1ODFA 1YQTA 3K53A 4MA4A 2CHGA 4A0RA 2ZI4A 1OE0A 3OFNA 1OH6A 1HY3A 3I8SA 1W5TA 3RRMA 5CK5A 2WJGA 2V7QD 3WBJA 1XFAA 1DAMA 3B6EA 1JR6A 2RHDA 2ZRKA 1N6HA 2A5YB 2QM8A 4HSEA 4BFYA 4ZDIA 5IHPA 2F9MA 2ZS7A 4GRAA 1W36B 3P4YA 3CRW1 3F8TA 4HUTA 4MGYR 1CP2A 1FL9A 1XCPA 1FQKA 2VP6A 3SFZA 4PC7A 1NBMD 1NI3A 1ZD9A 5FOUA 3WRXC 3U4QA 2OT3B 2GRJA 4TMWA 1UBFA 3I72A 4PHHA 2PX0A 2EFGA 3K09C 4QGFA 1RYFA 5FTKA 3H0KA 1GRRA 1S9HA 1ZAKA 4FMCB 2B7CA 2DBYA 2H18A 3KKMA 5AUQA 3SHFA 1IXSB 3D8BA 3PEUA 5D3MB 3QXHA 4MH0R 1Q20A 1OXTA 4NL4H 4LJ4A 4F7WA 1KK2A 3I5XA 2FDCA 2V6IA 1KAGA 821PA 3UG7A 3ADBA 2AXNA 1KMQA 3THXB 1ZUIA 3WP1B 4HAYA 3ZLJA 4QBFA 5CJPA 3BAFA 2HCBA 1S4QA 4CDGA 2J0UA 3KXIA 1KNXA 2EU8A 1KYIA 1JNYA 4XTRA 2IS4A 1CEEA 4G1UC 1MR3F 5KSOA 3PENA 3O8RA 2WM9B 4QRHA 3RWOA 1FOEB 4O2RA 3GLGE 5FPHA 1WCV1 4JLJA 1E2LA 2OSBA 2XGJA 2WOJA 4QL3A 3W6PA 4JLOA 1T8TA 2OBNA 2AD1A 2FH5B 2NO7A 3ZVLA 2CDNA 2BEJA 2BC9A 1E9DA 1T3SA 4M1OA 4LHZA 1II9A 2VHQA 4YXWD 2GCOB 4ZCIA 1KO5A 2RKOA 1XTQA 4MYCA 2JIZA 1I2MA 4BFVA 2DHRA 2NO6A 1OIWA 4XSHA 2EWWA 2KE5A 3W8RA 2TMKA 1BMFD 2IYSA 4QGHA 2ZAMA 3VFDA 1ELOA 2VP9A 1D2NA 3HJNA 4XOIA 3TLXA 4M53A 5JJLA 2Z0MA 3BBPA 3JZAA 3CPJB 2GXQA 1YR7A 3K0AB 3PUYA 3VHLB 1JECA 4JLAA 3AGQA 1KK0A 4WA7A 3FFBA 4EJSA 4A92A 1Q1QA 1QHYA 2JJ2D 4KYUA 5FOXA 1TF2A 3CB4A 4Q1FA 4US2R 2EFHB 2WICA 1KNQA 4MGKR 4TYYA 1DAHA 3AKDA 1U2RA 1XXHA 1XD8A 3LY5A 3F3YA 4IXNA 3MJHA 3RWMB 1QG4A 2XSZA 1EFRA 3HU3A 1SHZA 3SU8A 1KI9A 2WSMA 4JZKA 4LJ7A 2IHBA 4C0HA 2FWRA 4IDNA 1H8HD 3RRYA 2HF9A 2ZSBA 2ZE7A 4TL7A 2HJGA 4MDFA 1YRBA 3LXXA 1T91A 1HV8A 4B43A 1LY1A 3EIHA 1O3YA 1MO6A 3PXGA 3GLIB 5K8IA 4OL0A 2R6AA 4TSFA 5SZHB 3ZIAA 3CONA 4KAXA 4Q5IA 3KX2A 5A0FA 2NTYC 1W36D 1A2KC 3CIOA 4PAQA 1X1RA 3MWLA 3OHMA 2OEPA 4URWR 4LC0A 2PJZA 2BBOA 2J7PD 4RCYA 4QOSA 2XJ4A 4LWZA 2YYZA 3R8FA 4PR0A 2QBYA 2J1LA 3NIBA 4DDVA 1H65A 2O8DB 2GILA 2P2LA 2QP9X 1ZM3A 4PPQA 1PLLA 4PO1A 4PXAA 3S1AA 3VU9A 2A5FA 1U0LA 1F60A 2ZUDA 4RSGA 3K0EA 2RGAA 5TARA 1WE2A 3LLMA 5HPYB 4UNQA 2FSFA 1E2NA 2X2EA 4DT1A 3A1WA 4CEJB 3LBHA 5J40A 4LV6A 4Q7LA 3O8BA 2V8OA 4H1VA 2C04A 4NP6A 1XDBA 4AG6A 4X8HA 3C4JA 4JVSB 4RKEA 1RW4A 2XZLA 1P9NA 2B8WA 2DWPA 1XEXB 3AVVA 4TQAA 3B1ZA 4C9BA 5FTMA 1N6LA 4DLRA 3GFTA 4NPHA 2J41A 2NQ2C 1W0JA 2WWWA 3NEYA 4GOJA 4QGAA 3UWOA 4PQYA 4ERNA 2D74A 4NCKA 4P0TA 2IS6A 1KOFA 2ORIA 1Q12A 1XPOA 2ZRHA 1VDZA 2J9RA 2ZRGA 1JJ7A 1W1WA 1UPTA 4R71A 4OQXA 1SQ5A 4RD2A 4TYPA 1VG9B 4Q01A 3RRZA 3IPYA 4MYUA 4B76A 2PBRA 2E87A 2VA8A 2OXRA 3B85A 3M0EA 1LB1B 2CNWA 4JKIA 4P32A 4PSVA 3BS4A 2JLWA 2FSGA 4P3YA 4C7OA 3CR7A 1OB2A 3OE7D 1NN3A 1E79A 4FINA 2EFEB 2IYLD 5BYJA 1EFUA 2OLKA 4A0FA 4C3ZA 3KQLA 2YNMA 1B23P 4BECA 1KI8A 2AXPA 4MRRA 1QHHA 4BLPA 2NO9A 3I4LA 3B9QA 1S0UA 2WPDD 2UZIR 1GITA 4KI0A 2ZI5A 5BN4A 3FFAA 3ZYCA 2FSIA 2VQSA 3LBNA 3K0SA 1OV4A 4OI4A 2Z4SA 2G77B 3UMSA 2VH5R 4NHOA 4DCUA 2XTNA 1ZUHA 3L2OB 2BMEA 3FTQA 4IFBA 4V0ME 5KO2A 1A5TA 1E0KA 3OZXA 4HLUC 2H16A 3GJ5A 4CT4B 2A78A 4Y0VA 2AN9A 2MSDB 3N2EA 1W4RA 3EZ2A 1ZIOA 4W9MC 4LHXA 4A0HA 4OI0A 4TLAA 3EIQA 3L8YA 2JLUA 2C77A 1FP7A 2CMKA 3GMTA 1SULA 4B3XA 4LHYA 3THYB 2QRZA 2NZJA 1LVGA 1VECA 3H86A 3JVUA 4FD2A 4E22A 1D2MA 4D0NA 1JALA 1IXZA 5JECA 1UF9A 3MSXA 1E9FA 2VLIA 4IFEA 1WP9A 4QJ4A 4F4CA 3LBIA 4Q9IA 1UAAA 3H84A 1DAKA 2CK3A 4FMDF 3NBXX 4JVLA 1OKKD 1FX0B 2B21A 2CHVA 3VKHA 2P0EA 1T5IA 3NXSA 2F1JA 4Q21A 5GJCA 4KFTA 1CJKC 2MSCB 1JEDA 4Q19A 4PSAA 1KI3A 521PA 1BS1A 4MUAA 1HQYE 3WY9A 3CM0A 4DKXA 2HDNB 5JWRA 3Q3JB 4TLCA 3RABA 3N70A 2IYXA 1QHSA 1KDTA 2F3RA 3P32A 3QXCA 3SQXA 2AL7A 2R62A 1KSJA 4QM7A 1SZPA 4B6EA 3BERA 5CDFE 3E1SA 5FL7A 1G8PA 2ZR0A 1CJMA 2YINC 4IDQA 5C46F 2OM2A 5EP2A 1KIMA 4HUQA 1DOAA 3KFXA 3TSOA 4OHVA 4YQFA 5KYKA 4MKGA 4OJQA 1DS6A 2OCBA 1NVVQ 1YR8A 2JJ8A 1LS1A 3C16C 2XB2A 3C14C 3V00A 1VKJA 3K1JA 1EXMA 3O47A 2ZS9A 2AWNA 1S1CA 2RAPA 1JJVA 1S3SA 4FCWA 4WAUA 2OE2A 5LDDC 1DAEA 1G19A 3IIJA 3QNUA 4RD0A 4M9XA 4MKIA 3TH5A 1K8RA 3WYFA 3ZGXA 1F48A 1R0YA 1UEJA 2R44A 3BB1A 5EUQB 3MWJA 4IEIA 2EYQA 1GZSA 2HV8A 4LJ5A 1E32A 1L2TA 1G5TA 4LGMA 1CKEA 3PUWA 5FR1A 2I1VB 2W0MA 4LZZA 1JI0A 4L16A 2G0NA 3W5JA 4I99A 1OH5A 2VF8A 2FA9A 1Z0DA 4TMVA 1TQ4A 1E96A 1G16A 2JDIA 2WKPA 3IO5A 1XMJA 2W58A 1GM5A 5LPNA 2O8EA 4H1UA 4NYJQ 4F92B 2IYTA 1FMJA 1Z0KA 4A1FA 4Y0AA 3U7FB 3BGWA 2ZETA 3FPAA 1JR3E 1W48A 2EFDB 1DO0A 1XEFA 2P3SA 1VG8A 2Q3FA 4PO9A 2Q21A 4HZUA 2CLSA 1YVDA 3U5ZB 1KI1A 4TYWA 4Q18A 1FTNA 1P73A 3SR0A 1KHTA 5GJVC 4DDUA 4I1OA 4LCBA 3TAUA 1L8QA 1XRJA 2NPIA 3AV0B 3WMEA 1WBDA 4B33A 5CDFA 2GTPA 2VHCA 2ZITA 1E1QD 1FNMA 2FFHA 2QL6A 3I32A 3OAAD 2ZYUX 1XD2B 1ZINA 3LW7A 1CXZA 4S2EA 3I92A 2MMGA 5CYOA 4LX0A 1E2HA 3AKEA 3IO3A 1YZTA 5EUMA 2FPMA 1J7KA 3AF0A 4CF7A 1P6XA 1NF3A 2CL0X 4YDSA 2UVQA 4V0OA 4BRUA 3IQXA 3AVXA 1GL6A 4BLSA 2V4ZA 1VYVA 4QBHA 4YMUA 4U00A 1PLJA 1GUAA 1XPUA 4V0KA 2HXYA 5JMTA 1NG1A 1XTSA 3EA0A 3D3QA 4FWTA 5L3SA 2IYWA 4KLZA 1JQJC 1Q22A 4NTZA 1XZQA 3GJ3A 5CB6A 2ZU0C 4DHEA 1VTKA 1E0SA 1Z6GA 4AKHA 2ZRNA 3CF6R 2AX4A 4FMCF 3QXXA 4GFDA 1BOFA 3B1VA 1CR1A 4WZ6A 2DCUA 1U90A 4NYIR 2OV2A 1JR3A 4B71A 4RZUA 3RS4A 1OYWA 3HDTA 4JLBA 4A6XA 2ZRIA 2QP3A 4A6PA 2ZM5A 1R4AA 1E98A 3QF7A 2J0SA 1CRQA 1PUJA 4ARZB 3TW8B 4II7A 5J4YA 3T34A 1OHHA 3GP8A 2QN6A 2BKUA 1R8SA 2QTVB 1TF5A 2XTZA 3GLHB 2ZVQX 5FFMA 3UKDA 3RS7A 2IXEA 1UEIA 2G6BA 4PZLA 1DARA 1ZNZA 3HR7A 221PA 2KSQA 1QHIA 3EWSA 3EASA 3IBYA 3T06B 4DLTA 2D7DA 2DY1A 1VPLA 3B9PA 4EPTA 4P33A 1SXJE 4Q7MB 2L0XA 2WIBA 3AVQA 2YC2C 2A5GA 3ICEA 1T6NA 1CJTC 4EPWA 3RLFA 2MSEB 3KXKA 3LFUA 1ZRHA 3IIKA 4D81A 1P2TA 4UJ5A 3U7GA 5TVKA 4ESVA 2H17A 4MRSA 2IUUA 4KLNA 1GL7A 1YZUA 1G6HA 5IK2A 3W5IA 2LCFA 4FWIB 4B2LA 4B32A 4XVUA 3IHWA 3PEWA 2WAXA 2BOVA 4D4MA 1U8YA 4O0MA 2A5JA 2C98A 4JLDA 5C4MA 3O8CA 5E95A 3OFND 5BN3A 1COWA 1NY5A 5E7JA 3U3JA 2EQBA 1US8B 1UBGA 2EFCB 5C4GB 1Y3AA 4RFSA 3TQCA 1TEVA 1E99A 4BFTA 3GLGB 3VR4A 1XPRA 2C78A 2FJUA 3G82C 1S8FA 1N0VC 1P72A 4EQ6B 1F2UA 2QM7A 2VRWA 1FNNA 4IOKA 4XJXA 2VBCA 3EXAA 5AWFC 1N5LA 5F98A 5DHFA 2IUSA 4BFUA 2GBLA 3QEOA 4PZYA 4CEIA 3Q9LA 1KAOA 2G0TA 4PHFA 3RYTC 4R9UC 1OFHA 1QF9A 4DCVA 2GAOA 4JKYA 1II0A 3CRRA 4Z1MA 4DSTA 2FX3A 1W4AA 3CO5A 4ZI2A 3TRFA 4U02A 1ETUA 4L15A 1KGDA 5CIQA 3U6BA 1G3UA 2GZDA 1GKYA 1F3OA 1F2TB 3D31A 3CF2A 2WJJA 1P60A 3F0TA 2IBMA 2BCJQ 1FPMA 4ZCLA 1ZNWA 3QUSA 3LVQE 2QUZA 4JBXA 3SHWA 5JZVA 4PAMA 4TQUS 3ETLA 3B1XA 1E2JA 1U8ZA 4KXFB 1HT1E 1LTQA 3FHCB 3W6OA 5HKKD 4WOPA 4DCSA 2YC4C 1M2OB 4B3BA 1ZC4A 4Q48A 3BXZA 2V54A 1QRAA 4W7SA 4EFLA 5BW8A 5DYGA 2W2TA 1AQUA 2H1LA 1RJ9B 3IPXA 3EPHA 4LYFA 2EW1A 2QGZA 4QM6A 4XD7A 4P4SB 1JAIA 3LVRE 4LRWA 2HXSA 2W6ID 2C99A 4FI3C 4URUR 5BN5A 1HE1C 4OHYA 4QKQA 1KJZA 3AKCA 1P2VA 3AUYA 4DLYA 2BJWA 3BB3A 2IYRA 2QQEA 1TTTA 1G291 1YZNA 3LV8A 2VSFA 2RGXA 5E3HA 4NYIQ 2KWIA 1ESMA 4EPRA 1OFIA 1VIYA 1BIFA 2RGDA 1PLKA 1ZD8A 2ZROA 4LJ8A 2RB4A 4CVNA 4Z51A 4RCZA 4DUGD 3OIUA 5FBQB 2F43B 2GXUA 4P4TA 1U94A 3A36A 3FMIA 1GOTA 1KI6A 3QF4A 2DFKB 3BOSA 3EZ6A 5CM9C 3DM5A 4LV5B 1W49A 1NKTA 4IVQA 4IOJA 4YMWA 4PZZA 1N5JA 2FZ4A 4Q02A 5M04A 4NZYA 4KODA 2WZQA 4ESHA 5G53C 1WBBA 3T1QA 2ONKA 2ZRCA 3OEED 3FE2A 1W47A 1Z83A 4C0QC 3KB1A 1GNRA 2QNRA 2BVNA 4DB2A 1KY3A 3CWQA 4OK3A 5AUPB 2O8CB 2G3YA 2ZRBA 1NLYA 4BASA 3IDQA 4QHTA 1HT2E 1A82A 1P75A 1E1RA 4IDHA 2PT7A 3SBDA 3KTAA 4B74A 2PX3A 4Q4AB 2J59A 5JCPA 1OIVA 4POAA 4BE7B 1S1MA 1RVDA 1AK2A 4M1WA 1E9SA 3IHLA 4FN5A 4HAUA 2FFQA 1S9DA 1R0ZA 1D6JA 4N0EA 4CZ2A 2C8VA 2FZLA 2WSSA 1P9RA 3LW8A 1UDWA 3QXSA 3MJRA 4JVNA 5UKDA 2EYUA 4IDOA 2GEDA 2NIPA 2C9CA 5KSZA 2RGNC 5H70A 4UNRA 2HCJB 1R5OA 4YONB 1XMSA 1YZKA 2P6UA 3I61A 2D7CA 4OQFA 1CU1A 3ZH9B 4S35A 5KDDA 1DELA 1PUIA 3CPHA 2QQ0A 3K9NA 4GMXA 4NDZA 3EPKA 1GSIA 2G83A 3LQQA 1R2QA 4LV8B 4B34A 1XXHE 1W0JD 4K8OA 1U0HC 1XJQA 3ZQJA 2QE7A 5EE9A 5FI0B 2FE4A 2F1IA 1KMHB 4LPKA 4NYMQ 3NC0C 3QY0A 2IL1A 4JJZA 3WNCA 1Z2AA 2NMVA 1GP2A 5EXPA 4BZPA 1EX6A 3CNLA 3MG9A 4YDHB 3U3RA 4NCHA 5B57C 1W0KD 3VNVA 1HH4A 1UBCA 1JPNA 2BCGY 2YV5A 4KVGA 3TW4A 4HAVA 2ZJZA 3SYNA 4KFRA 2CNWD 1HQCA 4I81A 1II8A 3AQ4A 5FUYA 3C41J 5A5GA 2ZYTX 4JSYA 1M7HA 5DN6A 1O87A 2ZSAA 3DOEA 4UXHA 5H8WA 2BKEA 4R98A 4LJ6A 4G5QA 4AKEA 1IXRC 3C5CA 3U44B 4TTPA 2XOKA 4G0NA 4M0LA 1ZM9A 3DO6A 5J47A 1KK3A 4B3CA 2GVZC 1R6BX 4JLVA 2Q9AA 1CR0A 1G5PA 3QENA 4GBMA 5DIFA 1GDDA 3RVBA 2P6NA 5KUTA 3QI2A 4MRPA 3AP1A 1GL9B 2ZRPA 2Z43A 5L3QA 1CF4A 2H92A 4L9WA 3ADCA 1GG2A 2V9PA 1E4YA 1KSHA 1NG9A 1Y63A 1ZM2A 4IRUB 2XNSA 3FHTA 2QAGC 4C2TA 1X86B 1JB1A 4TL8A 4FCTA 1UFQA 5B64A 2QSYA 4PHGA 1HUQA 1MO4A 3QVUA 3H4MA 1NMXA 1KJWA 1WXQA 3LH5A 1DAFA 2EWVA 3DVLA 2J87A 1Q0UA 2VP0A 2YVUA 5B30A 1M8PA 3RNLA 2EVWX 4BQSA 3MUFA 1CULC 1D9ZA 2ASEA 1P61B 1UDXA 4ABYA 3TSZA 4DXAA 2IEZA 3W3ZB 4KO8A 1UM8A 3TQFA 4B3DA 2Q3MA 4E03A 2IT1A 4JLMA 4A2QA 1IN8A 4OQMA 4X8MA 3EAQA 4M4SA 1S2MA 3QKTA 4PAOA 4OHXA 5EJEA 4JLKA 3GQBA 2VHUA 1Z06A 1AA9A 1NY6A 2CEAA 2NPFA 4NBSA 3CWZA 1E94E 3I73A 3OESA 1YU9A 1AZSC 4HB2A 4Q1BA 1Z22A 1E0JA 1JPJA 1YZQA 4GL2A 2HF8A 2QAGB 4ZIRB 2IYYA 3R8CA 3DEFA 2GEUA 2NGRA 5FL7D 3VHXA 2C9OA 3K0FB 3U3OA 3U7EB 2DWQA 1Z2CA 3C15C 3GD7A 4M2LA 3V9PA 4B75A 4LOAA 5F3WB 2QAJA 3TGPA 3W3AA 4A8JC 1J99A 1HYQA 3GFPA 4C0BA 5SZKB 3EWAA 1QBKC 1VHLA 4QHYA 1RC8A 3UANA 5J4VA 1X8JA 4A36A 2JASA 3R7WB 3A58B 1Z6YA 1KO4A 2D3WA 3AP2A 1AS3A 5P21A 1M1YE 4PX9A 4G01B 5J4HA 2ZYVX 1Z8FA 4Q9JA 2ATVA 4X8LA 2YOGA 1AM4D 5DO9A 4UNPA 3PVSA 5AJXA 3VR3A 1KTVA 4AIIA 4XWKA 4DDWA 2IWRA 4Z54A 1ZMXA 2YKGA 2DFLA 2OO7A 2QORA 1E69A 3DMDA 4C30A 2WIAA 4ACBA 3AF1A 4BFWA 4KSCA 2V7QA 2IUTA 4TYQA 5EE1A 4A82A 4MKHA 3T61A 4TMTA 4G5GA 4NONA 1CS4C 4UJ3A 1KI7A 2NZ8A 1VCIA 1G8YA 3P1JA 4KU4A 2JA1A 2ERXA 4Q4HB 4DJTA 4LBWA 1G5RA 1NJGA 2JDID 3JVVA 3THWB 4DWJA 1EWRA 3U60B 1NBMA 2OBLA 3LWNA 1LW7A 3M6AA 1WF3A 2Q9CA 3ZDQA 3I5YA 4YLGA 2O8BA 2BHRA 1KO1A
chains in the Genus database with same CATH superfamily
3T3DA 3HB1A 2QN9A 4WGGA 3LY9A 4XDGA 1TXGA 1XV5A 2ZEJA 1M2JA 3NMUF 3RIHA 1AN0A 4AAYA 2P78A 2C2ZA 3GJ4A 4M99A 5GVSA 1O94A 1GGKA 2WYWA 3AKYA 3X44A 1YI8A 1M54A 5H82A 3OIYA 5HZGA 1E9EA 1W8IA 4IM7A 2YHAA 3WMWA 2N1BA 4EW1A 3DHEA 1G64A 2O0JA 3O1HB 3PK0A 2HR1A 1CRLA 1OAOA 3LAWA 4NE7A 4PBRA 2NVUB 1KEEB 4C7BA 2Y1WA 1TVCA 1AQLA 4CMEC 3GDHA 1IRIA 3I2GA 3FOBA 4PS0A 3R9WA 2AG1A 1ZRMA 1FYWA 1U4OA 2M32A 2XXBA 2Y8EA 3M5WA 3KELA 3NBFA 3OLQA 3PQ6A 3AVWA 1LX6A 3NHAA 1RWPA 4XUEA 3RIYA 2F7SA 2FLVA 1ONNA 1DADA 3UAVA 3ABQB 2XTMA 2QYSA 2DQSA 3W5HA 1UK6A 2IOQA 3ZVNA 4GO1A 3ZE0B 1QIFA 1M1YA 1RHQA 1TADA 3CUVA 4ZT3A 3PGLA 3NASA 4G5FA 2JJQA 2ECKA 3BH0A 1PJSA 1QFSA 3P9XA 4NMHA 4NV3A 5GM1A 3WX0A 4EI9A 4C1BA 2QR3A 3LQRA 1L3IA 3TKLA 2HOQA 3G2PA 4Q1DA 1GCIA 4QNRA 4YJ2F 5JSZA 2YDXA 4EEXA 1IWOA 5EJAA 2CLOB 4R83A 4KX3A 4K0RA 5L8VA 5G40A 1XA0A 2NN3C 4C04A 4XVQA 3ZY6A 1HDEA 1YRWA 2QTHA 1IBKB 2HIHA 1DOHA 5CB4F 4CQMA 3FOFC 3GL9A 1EFHA 1E1KA 1KSFX 4B17A 1CR2A 1SKBA 2O2DA 3NUGA 1VXOA 3T9AA 3IAM1 1FTYA 2FEMA 3S2IA 3TQSA 4R3NA 3ZWDA 1Q5PA 1FW6A 3K0CC 4LXYA 1TGVA 1UQUA 3HDYA 1F4LA 3A1VA 3CBQA 2VF5X 3OJEA 4EF4A 3IXLA 2XUAA 3GAAA 3HU2A 2DEUA 2GF9A 1PTJC 3MC1A 2C4HA 3I1FA 3EUEA 5BP7A 4GHWA 4F5ZA 2O23A 1V8DA 2HMAA 3GUUA 1IOZA 2QRJA 3BWBA 4N65A 3W2IA 4LYJA 4C0XA 1O7JA 1T9HA 4F04A 1OXUA 2B2CA 1Z33A 4FD3A 1ZVQA 2A14A 2VNAA 3HN7A 1J06A 4JJ6A 5HJ2A 2O2JA 3X1ZA 3O9ZA 4WNAB 4YA6A 3VZQA 4JITA 4NC9A 4D0SA 5G4KB 2RCNA 5D5HA 2DHCA 3OP1A 4CEHA 4G9BA 4WX2B 5C4IA 3T7CA 4Y2QA 2VDJA 1GQRA 1SVWA 2PKXA 4B2IA 1ZBDA 3K1AB 4A3SA 3LU1A 2Q5EA 1LRLA 2FZCA 5T6MA 4EQZA 1PVDA 3FPJA 4PG8A 4J4HA 4HDOB 3GZNB 5JRJA 1TAQA 1TOAA 3NUQA 2VJBA 4FKMA 3N8NA 1DNPA 4YRGA 1TX4B 3S2YA 5JCZA 3DZKA 2RGGA 3CURA 3MFYA 4ALKA 2RSLA 3OZTA 4MUIA 4HGPA 3LNTA 2CZCA 1O6BA 1GNQA 1Z3IX 5F4ZA 2G80A 3BGIA 4IL5A 2AG6A 4O4LA 5KVCA 4Z4QA 4OU5A 3T4UA 3LLVA 3QE0A 2NVBA 5TY0A 1H2WA 1GEGA 4GYWA 4YT5A 2O50A 2CLFB 1WB9A 3ROMA 1WDKA 4I6EA 1YVRA 4TZ0A 1PFQA 4GMFA 4OMDA 4V02A 1Y7PA 1S8AA 1T0BA 5SV2A 4DNOA 4FVTA 2QPLA 3L93A 1RRGA 4C21A 2QR5A 4QXOA 3RG8A 1Z5VA 1A1VA 3V32A 5CD1A 4L5JA 2B6HA 4LI0A 1ZMRA 3BE6A 2C1XA 5IKEA 1RQLA 3W9SA 4AQ7A 2WVGA 3LE8A 4LPSA 2GNAA 5CJ2A 5DCLA 5BSUA 1NZDA 1W44A 3E7PA 3C6KA 3HI6A 1NW8A 3UTCA 3QKWA 2C96A 1M72A 1KO7A 2FG5A 1D2GA 3U4MA 3MGCA 1M7GA 4BPRA 1UPFA 3CGWA 3CX3A 4KIJA 4DLNA 4Q93A 3H3XA 1YKSA 4JIMA 1C1HA 1SQSA 1LBQA 2ADMA 4D82A 3L1VA 3KWLA 4FDTA 5FHQA 2RGBA 1N2SA 5K3FB 4LC1A 1D1SA 4PX2A 4CLHA 1J49A 2H1FA 2Y9MB 5EXXA 3TWOA 4G63A 5C31A 3ILHA 4XFDA 1J21A 2AYZA 3IA2A 3MGBA 3MMNA 5CR9A 5LDHA 1GRNA 1JKJB 4BTEA 1BYUA 2K2QB 3HZZA 4GUAA 4CIVA 3DW1X 3DGEC 3K09A 3IJRA 2ZB8A 1NW7A 3W5CA 2YIJA 4GDMA 1FFHA 4F6RA 1EXDA 2FWNA 3VVLA 1G42A 4XAQA 3HE3A 3EF0A 2VJLA 3SJUA 1UBEA 3F6EX 3JSAA 4CT0A 4M37A 4IZOA 4I3GA 4MWTA 1VSUA 2V0NA 5I7VA 1RCFA 2PUGA 1DSSG 4WV3A 3U61B 2G9NA 3H5TA 1PJ4A 1CY1A 1K5DA 3EQ2A 4DG5A 3SY8A 5DNUA 3ANYB 3KZ1E 4AZSA 1ZZEA 1NLMA 2UVPA 3LUFA 2Q46A 1HTBA 2GN1A 2IWHA 4TS4A 2B4KA 1XLVA 4FN4A 3GNLA 2IHUA 2YVLA 4LJAA 2OHOA 4E11A 2DB3A 4JL8A 1D6MA 5IJ0A 3ENVA 2VPQA 1T8UA 3P0IA 1PWXA 3EN0A 3G8AA 4PHCA 4PQGA 4X7PA 5C3MA 2V8BA 3IV6A 3GBVA 3OQMA 1KOGA 1KZ7B 1RQXA 2QK4A 3ANTA 1GCAA 4IJWA 1VP9A 3X1WA 3M5CA 3UQZA 4ZI7A 4N5MA 1JBEA 3PUVA 2HLPA 5DHSA 2FUNB 5INTA 3KKQA 2GJAA 4X61A 2WB4A 4MDEA 1U63A 1E6KA 1PU2A 2M1ZA 2VC2B 4I4CA 5K4HA 4ENTA 1BTOA 1DV1A 1K97A 5I7FA 3I28A 4FGWA 5DB4A 1G18A 1MN6A 2NV0A 4KDCA 1CVLA 1TD1A 4CL2A 1XMOB 5JVDA 4MCJA 4R69A 3H5NA 3KHUA 3A3NA 4REQB 3SXUA 1Y5NA 3FDIA 3QTBA 3KUDA 4CCSA 4Y2HA 1VHTA 2WNSA 1MH1A 1YL6A 1D2HA 5CLQA 5WRFA 5KNBD 2P5SA 5JJKA 3BMQB 5C35A 4TOIA 2W42A 3FUTA 1OKKA 1ECLA 1VP3A 4HDRA 4KQXA 4RKFA 4V0LA 4DV5B 2AZ4A 4D4JA 3KL4A 5K8LA 1YVPA 1EWQA 5HF6A 4AROA 2WHPB 2OLJA 1TO1E 1Z4KA 2EXXA 2W8BA 3G17A 4Q7KA 3VR2D 3QG1A 3WXBA 4AN4A 4GKAA 1VL5A 1DC6A 4HCJA 5BQOA 4F56A 4QZVA 3G59A 1ZD5A 2VJYA 3GGDA 5EHGA 1EWTA 5B12A 1N0HA 3L8DA 2ZBFA 3ZDBA 4ARCA 3F5FA 3V7UA 2DRIA 2E4ZA 1BXRB 3OX2A 3DWEX 3IVRA 4NNJA 2AI3A 3LRXA 3VRHA 1E2QA 1IK4A 1VE1A 1QIHA 1UXHA 3VNBA 3Q98A 4D9MA 4DV0B 3PJFA 1C8LA 1C9NA 1EFDN 4G8CA 2JVJA 1F4VA 1ZD1A 3DE0X 5C7LO 4AYXA 1XR3A 4GYYA 3VMFA 3BIXA 1CQZA 3JD1A 2XT9A 5IM5A 5B3KA 3DVAB 1JTEA 1Q0QA 2GCNA 1UBNA 3IE2A 1X14A 4F9EA 4Q4DA 1V1JA 1XVAA 1ABEA 5JYBA 4OHWA 3DCIA 3TECE 1RVV1 4BKMA 3OQVA 1UOEA 3DF7A 3O4JA 5E0KB 3W3AH 4TZ6A 5BUZA 2D62A 1H6DA 1DQPA 4AT1A 3BIOA 2VSXA 3HNPA 1JMVA 2VOJA 2ZIUB 3WGOA 5JWOA 5GOTA 3QPAA 3OVMA 2GX6A 1OBCA 1Y89A 3KUXA 1B41A 2P65A 3OLXA 4X1YB 2FEKA 1U1DA 4FZVA 3SVLA 1HX7A 2CVFA 1G41A 1A8UA 1OZFA 2B1JA 3P4XA 2IBSA 2JLRA 4P8RA 4XIYA 2AR9A 3BHMA 3RVSA 1D4FA 5GADl 1UC9A 4IFIA 2IUEA 2XGMA 3ELDA 5JG7A 5A62A 1RM4A 2B1IA 3EXHC 3C3KA 3WFZA 4BCCA 1YS6A 1QYXA 4JY7A 3RFTA 3NZEA 5ITZB 1EUCA 4YCSA 3LRTA 4MA5A 2WMNB 3L0PA 1RXEA 1J8YF 3HB7A 1MO3A 3BEOA 4MEAA 3OCWA 2RC6A 4H7DA 3S1AB 3PRYA 3VU9B 2ONYA 5CYPA 4WKOA 3D8HA 4TL9A 5JCJD 1OXSC 2Z6AA 1H3EA 1YGPA 3KJIA 5KDLA 1AKYA 4B3FX 4EFNA 1K5GA 2PGOA 5K3BA 3T3PB 4IIBA 1RZ3A 2QMEA 3QU4A 2Q62A 3ASVA 2Z08A 3MWEB 4HTFA 2O7QA 3FNHA 1NN0A 3FB1A 2ODEA 2CL7X 2X40A 3T15A 2WUWE 1DPGA 2XZOA 4A16A 5ELXA 3GJTA 4D9KA 4XRGA 5DDIP 3HN6A 5L6MB 2C82A 5IZCC 5IKPA 4OD0A 4DA7A 2PS3A 3OFVA 1KWGA 1NW3A 4YJFB 3TUJC 5KYXB 1DFGA 1NVKA 3LNCA 4LDQA 3SXPA 1FTGA 5L7TA 5K8TA 1Z25A 3ISTA 3N2KA 3PXUA 3R5KA 4GLOA 1WKCA 1KQPA 4L4SA 1DBSA 2QG6A 4O5AA 4C0LA 1E1QA 2FQWA 3EXHB 2E7ZA 4X8OA 5JSHA 4G0MA 3CN7A 4HKTA 4LF7B 5LM3A 3PIIA 4IG9A 1QP0A 2PGXA 3T1TA 1XCGB 3LDFA 3DMNA 3C3DA 3ICCA 2YJZA 2XOKD 5TSDA 2PAFA 1OLOA 2BL4A 2OCGA 4LYAA 5C1PA 2ET6A 3FJYA 1GUZA 2QVCA 4RH0A 3SVZA 3WK8A 2FW7A 5HRUA 3I4FA 3WLMA 2OUKA 1ABFA 2YW9A 3KJHA 2W6CX 3PPYA 1EAMA 1QRRA 2WJYA 3SOZA 4B6GA 3VDRA 2XTAA 1K8QA 4IXTA 4HL6A 4Q12A 4HX5A 2QG9A 4ARVA 2GN8A 2J32A 5DXJA 2V03A 4UMDA 4Y98A 3WLNA 4DIEA 1N5RA 1WDTA 4MWGA 2BGTA 5AI5A 2YUIA 4YRAA 3RWBA 2ZVPX 1T5SA 3EMKA 3L0CA 4HAZA 2X19A 5MGNA 3EVCA 1B3RA 4NMMA 5TMPA 1ZH0A 2FP4A 4C0KA 2WJ6A 1R0BA 4FW9A 1D1TA 1TUBB 4UASA 2GM4A 4HLUA 1X9IA 4HADA 4OOFA 5AJYA 4XGIA 1H1DA 1NYQA 2H29A 2OBXA 3PJDA 3DHYA 4BLOA 3EC7A 4K88A 4MLDA 4KVZA 1VGVA 1ILEA 4TTTS 4BJHB 2UZ0A 4GXQA 2IP4A 3O74A 1N32B 5IAKA 1EFRD 1QIGA 5IXSA 1K06A 2HSJA 3KSZO 3TBKA 1GVNB 4IIUA 2HA0A 5CT6A 2FSPA 2PFKA 1QKJA 3BCSA 3FKSA 4GI1A 4BLUA 4CJXA 3M6MD 2AFIA 4C4RA 3A1FA 1NVXQ 3TZEA 5EL0A 4EHBA 1YT5A 2FCRA 2HJWA 2GPTA 4KDRA 2IH2A 4HDQB 3PHCA 1WZNA 5FBRB 3K0HA 2C9DA 5FEUA 2DFVA 1HEUA 2Q6IA 2X2OA 4UAVA 1XQWA 1WEKA 5ELLA 4V1CB 3OIGA 3DNFA 3GLRA 4LTNA 4ZPXA 4EO9A 1MUUA 3NVAA 1DC4A 4RZHA 3TW6A 3SC2A 3RREA 3JASB 2X77A 2Z2YA 1DQNA 1DTSA 2IXGA 3TLBA 4JJEA 1ST3A 4WZAE 1GUBA 4BVFA 3O4RA 1WMEA 1DAPA 2FX2A 1F9EA 2F3QA 1SZCA 1X0XA 1Z5WA 3AJDA 1NF9A 3KFVA 1G7TA 4R8SA 2QENA 3DAGA 3R0JA 1KERA 3OC0A 3R5HA 3RGWS 1VMKA 4TLMB 5H81A 4A6EA 4E70A 1Q3TA 5BNZA 1SCBA 1I7SB 4PR3A 1NBOA 2AOVA 1XRPA 1ZWKA 2VWPA 3AUJB 3P0EA 3HZRA 3MS7A 4HFRA 3T5CA 3NYQA 3L41A 3Q88A 1VPTA 6GPBA 3CH5A 1P80A 2I78A 2YXLA 5HCNA 1WHTA 3VVMA 2X4LA 3LUJA 1LC0A 1C4KA 4ILEA 4XI9A 4DSOA 1GPLA 2I80A 4YT8A 1T4GA 1V9CA 5JI2E 4K87A 1JEEA 1I7PA 2C2HA 2IU4A 2ODNA 2WFMA 4F4JA 1DDOA 2EJCA 2B92A 3SQWA 1FS4A 2JZNA 2PLRA 1BE6A 4ZDWA 4D74A 2G76A 3QBJA 1O4VA 2OILA 3WGYA 4PLHA 3MMZA 2EL9A 1E62A 1A4UA 4XPIA 5DLEA 3DPSA 5AKYA 1MZPA 1ZCFA 1REQB 1N6PA 2VYFA 2W2VA 3GN2A 2P67A 3EXEB 4LMPA 3B82A 1YBAA 3RAJA 5BNTA 4F71A 1E7SA 2CHQA 5D1NA 2XZPA 3ZEIA 1DQRA 8AT1A 5LQKA 1RRCA 4MGZR 4PYNA 3N28A 2DERA 3DWGA 4IAOA 1ZU4A 4Q39A 2XGJA 2PQ6A 4J16C 1NJFA 2AJCA 2ZSHA 1U2ZA 3WWPA 1DDIA 3N8HA 5JWHA 5DBGA 1FXSA 1P7ZA 3DUFA 1C8BA 5BSRA 2ZYAA 4BLQA 2HNAA 4DBLC 1A71A 4BB9A 3BXFA 2B4AA 4DC9A 4D4LA 3FVRA 3PQ4A 3X2SA 1NQVA 3VNAA 5EJGA 3SZRA 2OAQ1 4MUEA 1E79D 3SAJA 3TINA 4IINA 4QPNA 3TL6A 1VIAA 4EHKA 3ESXA 3F6YA 5KYTA 3C1UA 3L0ZA 4FZRA 1E1CB 4G5OA 3KZCA 4EYKA 4BMOB 1ZUNB 4YR9A 2B8NA 4B3SB 1T0HB 3R20A 5JRZA 5BYKA 3WWZA 1PEDA 4QT0A 3UPUA 1G8JA 4DLWA 4HZUB 4Y9DA 1JA9A 3AEKB 4WLUA 2EGGA 3EGWA 2QRLA 2WWHA 3HGQA 2FGKA 1I0ZA 4YC7A 4ON9A 3DDHA 5TGDA 4DLVA 1ZZGA 1C30B 5KSPA 4JBLA 1S01A 2GAIA 3ZJTA 4W5HA 2FKAA 1WCWA 3R40A 2XDAA 5CLJA 5E8JA 5TQ2A 2Q41A 3VJKA 3O8NA 4B44A 4L28A 3MJSA 1SVKA 1VIVA 3CF0A 4PQEA 2IPOA 5FO1A 2GJ9A 1D4ZA 3KOXA 2V7BA 3EFEA 3IA7A 3ZHQA 2FMFA 1SUEA 2HPVA 1DTWB 1RRPA 2ARKA 3OD1A 5H1YA 1A8SA 2Q3JA 3HWSA 3WK9A 2IZ1A 4ZDJA 5K0TA 3E2IA 1GUFA 4F3YA 1P0PA 4J1TC 1X1DA 3QVWA 3PSHA 1Y8RA 4XLZA 4NS4A 2WFLA 2XCIA 3DQQA 3G8BA 1FNSA 1OJ7A 2PQMA 5KS2A 4PINA 1TM7E 4MQBA 3P52A 3OWXA 1GAWA 1DAIA 4RS4A 5FPSA 4EYGA 4R1SA 5JSQA 4QLAA 3HHPA 1FTQA 2LGJA 4B8YA 4H1WA 2BFFB 3E8SA 1PFKA 1YJ8A 2NUPA 3OEHA 3REGA 2QTRA 1ZGHA 5IDQA 1YCFA 2XA9A 5CA0B 1RM5A 4HC4A 1WAMA 3AOEA 1N25A 4HB0A 2XCUA 3BILA 4AWBA 5THXA 1T36A 4DQKA 1PS0A 4B3RB 1FLVA 2OWDA 3W04A 2QSZA 4OQZA 3OF3A 1IOVA 4JQOA 4K2HA 1UEXC 4P22A 2A9RA 2I76A 2XYHA 2H4FA 2Y1DA 1P1RA 3TGWA 5CHYA 2HF2A 4EG7A 2CNLA 2B8EA 4M0CA 3PPXA 2Z3ZA 3FNQA 3ZOKA 2VT7A 1IONA 4PQFA 3RS9A 1I3OA 3WHIA 1MHPA 1CUZA 2E0IA 4D3XA 3B5EA 3D6MA 4UXIA 2O2SA 3T4PA 2GHTA 2PMDA 3P27A 1CBUA 4DDMA 4ZEVA 2C03A 1M1UA 3GEHA 2BN4A 4RM3A 3KKZA 2XKBA 3EIUA 1I4EB 2YHIA 3ROGA 5EJ4A 3OEEA 4K8RB 1X3SA 1YRAA 4CCAA 3FA2A 4ND3A 4A5OA 5DP1A 4L22A 2VBFA 4FFDA 1ESNA 4P6VF 1US8A 4TV8F 4RPCA 2IQIA 4F8EA 3VC7A 4P4GA 4MVJH 4J94A 1LPSA 4NOLA 4WZBE 3S2GA 1XO1A 1A4RA 1G7SA 2IEDA 4KXWA 1ZNYA 4HNHA 5DXFA 4HFJA 3WQRA 1YQQA 4WESA 5CB4A 3WA7A 4H59A 4XGNA 1NVVR 1IM2A 2GN0A 1GSAA 2V5AA 3EPRA 4UVHA 3CZQA 3ST7A 1KWKA 1Q84A 3QJYA 4IFTA 1BEZA 5CJJA 1WUKS 4OHRA 2A33A 2CE2X 2HK6A 1PJRA 4Q6BA 2GR9A 4F8JA 1JEAA 1F6BA 1X7ZA 2B20A 2RGEA 3CE9A 3LY8A 3PE6A 4CCYB 4D8VA 1WZ2A 3WLSA 1EE9A 3SBOA 3DOHA 1EK5A 3VR0A 3FDXA 1LSUA 1WX1A 1LV7A 3S44A 2J48A 4H77A 3NWOA 3TD6A 4DRZA 1DG1G 2GBLC 1Z5NA 1H9BA 1QB7A 2XT0A 3CRNA 4GPZA 1MQSA 3T9CA 5AVZA 3TSYA 5CH8A 3HKBB 4YCNA 2PXHA 2HFJA 2P90A 1C9YA 2MINB 1EX9A 3B60A 3G2NA 4COKA 4QYXA 2DG2A 4MKZA 4LFBB 1MXFA 4KFUA 4F1KA 4UTZA 3ND6A 4TKMA 1YMUA 3A1SA 4YYEA 2ZI9A 3DFZA 5I7AA 3DGFC 1VZ2A 4ZVUA 2D06A 2L18A 3BFKA 1C9EA 1QKIA 3JVEA 3SXJA 3BGSA 3IDZA 4R1UA 1KBZA 4EA8A 3L06A 2HDOA 1SCUB 2YWJA 5SICE 5K0EA 3H75A 1JHUA 4XASA 4RY2A 2HDWA 1GLVA 2JGAA 5KMGB 4D5GA 4PSUA 1XDDA 2R4QA 5G02A 6YASA 4KJXA 5AJUA 3CW2A 1X7YA 5K3DA 3IUJA 2Q0QA 5EVJA 4RVDA 3VKGA 3VDXA 4O6VA 3OU6A 3B48A 2JBHA 2P79A 3ZVKA 2BJHA 4O02B 3ZBQA 5BYAA 1NOIA 2O0LA 2XAUA 2XITA 1SBQA 2HEIA 3MWDA 1N57A 4M49A 3R3UA 4J9UE 4N1AA 5C0OE 3TLKA 4M55A 2W6NA 1EP2B 3WGQA 1OWNA 1OTHA 1CX9B 1RJ9A 2HU5A 4GPD1 1KYYA 4F93B 4QQFA 1Z7EA 2AFHB 2WV7A 3ANXA 2QD3A 3TXAA 3D5QA 4BBPA 3W79A 4CYMA 1Z4LA 2R84A 5LZ4A 4HEA6 4U7GA 1OAAA 4M0PA 1NT4A 4YFYA 1OROA 4MB2A 3RAGA 4EYEA 4I9FA 5IBQA 1ZGAA 3CG4A 3N0RA 3QKUA 4H7PA 4YI5A 3W4JA 4DM7A 2QUBA 1WDMA 2VK2A 4P5EA 3Q2OA 5CVJA 5E6RA 3DP9A 4NU0A 4AUKA 4C5AA 3N0VA 5MN6A 1Q3KA 3AJRA 3K4PA 1UMDB 1OI7A 3FPFA 3N7TA 3KKPA 2WD7A 1ZC3A 2QX6A 1OLXA 2JFFA 2YV1A 2GWRA 3GJ7A 2C8LA 3OC6A 2A67A 4KGVA 5IDYA 4KEAA 5TDHA 1GEEA 1UOQA 4RTRA 1RWXA 2OHVA 4NULA 2X9QA 2Q1WA 2R6GA 3FVVA 4RCVA 1XZDA 4UUQA 1RAAA 4ZAXA 4IS3A 3NDBB 1QQAA 3DP7A 3W2EA 1C7QA 2JVKA 2X1MA 4LKRA 4NDNE 3UMBA 1HFEL 4H7FA 2RHRA 3FOZA 5KYGA 3GHHA 3V42A 5BURA 1C7ZA 1RABA 2JEOA 5CCDA 3ADDA 4RV4A 3D7LA 3L84A 5HIIA 1FP2A 1DRVA 1S96A 2VNJA 2QMHA 1RI1A 2J9FA 3GF4A 3NTXA 4G2TA 3AK4A 4HDMA 2C4VA 2RCYA 1KQGA 2F8MA 1BG6A 3WMFA 2LXNA 3V7FA 4AS2A 2X15A 2G5PA 2AOUA 1TIBA 1TMKA 3NCHA 1WV0A 5HE8A 3TVTA 4BB6A 2ZJBA 3GGOA 4ZQFA 3RU2A 4YX9A 5JATA 4TKVB 5LB2A 1WUTA 2BFDA 5ENZA 5A7HA 5CFNA 5GP1A 3QXJA 5JDIC 1QSGA 3B1JA 3VZBA 3AY7A 3UM9A 4EATA 3H97A 1SIUA 4Q4AA 1ZRNA 1IEXA 2QMZA 3W90A 3MWKA 2GDJA 3R3HA 1DU4A 1LJLA 3BJMA 5LCXA 1L5WA 3GGSA 1MAUA 2Z2KA 1ZKMA 3D2CA 1JG2A 5EKSA 4CQLB 2O1WA 1FSPA 4Q3BA 3OF5A 3EX7C 2QUHA 5CTAA 1P7PA 2IOFA 5AM4A 1D1PA 3RT9A 3V1NA 2VJMA 3T4EA 3VU0A 4W5JA 3E3MA 3QMVA 3M4YA 4QEZA 1RYBA 3QF4B 3NYIA 1NIPA 4AJ2A 2J6CA 2OPBA 3I53A 3WVNA 4F5YA 1WHSA 5E4YA 5EHIA 1Y4DE 1W8DA 4QG7A 1RP7A 2OXFA 2YWEA 1W9MA 3BTOA 2JLSA 2PSDA 1BW9B 1WQ3A 2W6OA 1I5RA 2GEVA 5DH9A 3R0VA 4N7MA 4WXPA 2BLLA 1GA1A 5DISB 3UN1A 1KYWA 4MWBA 3AZQA 4P38A 5JHGB 3VKFA 4MHSA 4K9OA 2PZEA 1XRNA 4GMKA 1JSCA 3I42A 5DM2A 2ZTLA 3K0BA 5IABA 2P1ZA 3ABSB 4NAUA 4D8YA 2OESA 1MPXA 2HWUA 3PIRA 4JYBA 2QYHA 4AWAA 1TZ2A 3KTAB 1WMDA 1E3LA 1C8KA 4AS3A 2PZFA 1M75A 1E2BA 1VGQA 2GT1A 1LRKA 2IELA 1ZXBA 2YWFA 3AM3A 3QLTA 1PR4A 1E6EA 2SKDA 1NTRA 1E5XA 1J56A 3I23A 3CKLA 4Z0NA 5G1PA 4MPPA 1J22A 3H5IA 1Y80A 2OKGA 3RUCA 4Y30A 5CDTA 3JQDA 5FOSA 4LMAA 2YZNA 3NCTA 4HQ0A 4KR0A 1NXSA 4RD3A 1PD1A 1NVGA 4FGUA 1RCTE 2HBYA 1SVNA 4JJAA 3H9JA 1C3JA 3BIWA 1QF7A 2H0QA 1TRHA 2OY0A 1X7HA 1ZPDA 2IC5A 3U9TA 3F6BX 1F8GA 5P8WA 2HHAA 1Z4MA 1SH7A 2BGGA 3ZS9A 4TMYA 1QNFA 1XYVA 3A11A 3GPCA 1N9ZA 2AZDA 5DFAA 5GZ3A 1OZGA 3PTAA 1NYLA 3BYZA 3O1JC 1ACLA 1JLLB 2D5CA 3MM4A 4FYYA 1FPQA 2DH6A 4UEJA 2C7RA 3QEJA 1XOIA 3GJ0A 3JQ8A 4WXMA 4YIKA 2DR0A 5K05A 5KDOA 3SIPA 1R9GA 3CTMA 2O2IA 4A1OA 4N5NA 2YJ6A 4WCFA 2OCAA 4QLBA 2CMFA 4IHKA 4MVJE 2JATA 3A2KA 5BV1A 5HVNA 5IMSA 3IDAA 4IQ0A 3PVZA 2WFAA 3CX4A 3IQEA 3O95A 1H4VB 3ICWA 1N5KA 4GQAA 3U5TA 1OIXA 1ST2A 3F9IA 3NRJA 3T0IA 4XWWA 5FWXA 3L4JA 1DCKA 2QSUA 2PSJA 4BMZA 1IC6A 4G8BA 4N18A 7GPBA 1U4SA 2VK1A 4RMNA 3TG8A 2YOHA 4RK7A 3HK2A 4US1R 5BXYA 3HYTA 3DLHA 3Q5EA 4JA2A 1II8B 2HBQA 1WNFA 4E21A 2FW0A 2HPAA 2WNHA 2QTTA 4DLZA 3OTWA 5EWMB 4EPVA 1A5BB 1RBYA 3NI2A 3U19A 3KIPA 4V24A 5E6SA 3ZGYA 1IZ9A 3RVQA 2CLCX 1DB3A 4DW8A 3HJHA 4X0EA 5HUHA 3E7FA 1Y4ZA 5CLHA 3TZHA 3SNKA 5D7NA 4O4HF 3WYGA 1BEUB 4IHJB 4KIUA 5BWBA 2IHNA 1BCRB 2ALJA 5JMPA 4X24A 2OORA 1N8KA 3U4AA 4GT1A 1BU8A 2HPZA 2JZCA 4KN8A 2C1EA 4D0LB 4AZWA 1GNLA 3F5QA 4IJUA 3CS3A 3O8DA 1HI9A 2QUJA 1B74A 5IG2A 5KAPA 1TPYA 4YBRA 1L5OA 2A1TR 2VHTA 1X74A 1WO8A 3FCYA 4AMVA 4BKUA 4X7BA 4K6MA 4RNDB 4PVCA 3ZWKA 5TR9A 5DLQC 3GT0A 4EW6A 3ZY3A 2ZRQA 4H35A 2W2LA 2DETA 5T3YA 2I4NA 4G0UA 3FFWA 3L6BA 3O38A 4LJLA 1JWLA 3S2UA 4AI6A 4URVR 3KKNA 4I1UA 4JN6B 4WSOA 4JD5A 3GLUA 4MMZB 2BBTA 1T4CA 1NFRA 4Z7OB 2D5IA 3A04A 3KQMA 4ZYZA 4EH1A 5LYYA 2GFQA 3I8XA 5HKLA 1A96A 4OXIA 4EGJA 1PSZA 2MWMA 5B5SA 3VBEA 4DUPA 3K16A 5A4IS 3CVUA 2E4XA 2VHXA 1TCAA 3ROTA 2J46A 1ZG3A 1EYZA 1BCSB 4PPYA 1H2BA 4O4IB 2N46A 3VNSA 3U3ZA 3WKCA 5EJ7A 1IM5A 1MORA 1UDAA 3GQBB 3ISVA 3CISA 3QX9A 1B2LA 2C3UA 2WG0A 4HQFA 4ZXPA 4A91A 2TMGA 3I09A 4PSKA 2ZRLA 3LECA 2L2QA 2C9BA 1TD9A 1JE1A 4AK9A 3ZQUA 3OLWA 4H4DA 4HXEB 4WUTA 4Q4HA 1NW5A 3LDHA 1N6IA 1TVKB 4QU8A 1E9CA 2R7KA 2X14A 1QHNA 1OH6A 1W19A 1FTSA 2YV2A 1Y5IA 2XQIA 2IK8A 4Y9RA 4DLSA 5EJ5A 3WHPA 4EZBA 3VHXB 2BTQA 1S89A 2GPSA 4TMKA 4F85A 4ZN6A 5A02A 1SMKA 4S0ZA 3BMOB 1QOQB 2X6RA 2V7XA 4X93A 2H52A 3DCJA 4U7HA 1GNVA 1QQ7A 1PJ8A 3S6JA 5JLJA 4G5SA 3L4SO 3MJ4A 3VKWA 3AY0A 2BH9A 3S5UA 1RD4A 2H31A 3EA4A 5H9VA 1BVYF 1O94C 2DFDA 2NT3A 10MHA 1A8IA 1UZUA 5U4XA 4L85A 5AVWA 1L5RA 4QU9A 1EQUA 4C5CA 5C52B 1ZA1A 3A37A 4RQUA 1OAOC 4QT4A 2YN0A 5KTYA 1KZGB 2BFOA 2XEXA 5BVGA 4ZYLA 4HXFB 3AVPA 5LQMA 1PJQA 1QVAA 2Q1XA 2I3ZA 2ZJ7A 1CR4A 2ZUVA 4LDRA 4D4GA 1GU1A 2AJBA 4DDKA 4JQZA 3W8DA 4EABA 1VRVA 1KFJB 2ECOA 1MFPA 2EP7A 2OOKA 4J3JA 4U2FA 3AEYA 3NNNA 4JUDX 1CUHA 4BQOA 2W4QA 5EP1A 5GJWC 1XROA 4NYMR 4PNEA 3CLVA 4D57A 3THSA 1Y7LA 2PD3A 3H16A 1OPRA 2QHXA 4WBSA 2L42A 1PL6A 4OQDA 2JD0A 3LC7O 3ZI4A 3LPCA 4IJ6A 5JXWA 3STYA 1SOAA 1E2FA 3WNBA 4AKIA 4MA0A 4JJ4A 3L7LA 4NZNA 4NX2A 1UKAA 2PMKA 4C5BA 5IP5A 1ISIA 1L8XA 1K2VN 1R0XA 2XF8A 2EJUA 3GRKA 1P2SA 1TQDA 2EEPA 1AN9A 4EL0A 2V9ZA 3A6ZA 3NDJA 2BDEA 4MW0A 1XTRA 4AO7A 2BR4A 3S40A 2Z5LA 2HLDA 2REQA 2ZE5A 4JH0A 4NPCA 1KDOA 3PCTA 3KT0A 4Q1EA 1QYVA 2HCTA 4S0XA 5AJZA 2ABWA 4ZZ1A 2DYKA 2Q2NA 4NZ9A 3OPYI 3C3EA 5ULLA 5ILOA 1VLJA 3EFBA 2C42A 3AX6A 3X2EA 5EHNA 2J31A 3C5VA 4WESB 1MX9A 3RLIA 2R9VA 2AK3A 5K6AA 1RADA 1U3TA 2BHSA 3CPSA 1XPUA 5IM4F 2DKNA 5CM8B 3FVWA 3YASA 1P4SA 4R51A 1BMDA 1XJ5A 2WM8A 2Q8QA 3AETA 1NW4A 5IAJA 5A5FA 2BWJA 2ZE6A 1YR2A 4H6XA 1M0TA 1ZFNA 5H68A 4ZK2A 1GADO 2Y99A 2VH1A 3FNIA 1M1YB 3AILA 1GT6A 5BSWA 3A4YA 1VSTA 1VKZA 3IUBA 1N0WA 5COBA 5EIAA 1TMGE 3FJOA 1SD2A 4BGUA 5IUKC 4S1WA 3DEJA 5JSZB 2QZ4A 4A8TA 2C2WA 3WGUA 5SYAA 5JAPA 4CMGA 1LBHA 5F1PA 3JQ7A 1H5QA 4URZR 2IH4A 3OFSA 5HM6A 2PMBA 4KQ9A 2MSKA 4RGVA 4TXHA 4CMIA 1Z6QA 4P2GA 5I9BA 1QHXA 3WQQA 3ZZUA 1OB5A 4CQMB 4UDYX 1QGAA 3D8NA 2VT3A 3ZI0A 3C3WA 1AQYA 2O3SA 1UT8A 1VJ0A 6Q21A 2W5UA 1RXYA 3OT4A 3ZTWA 3G9ZA 5DCYA 5EQFA 4HYYA 3DTNA 3MAGA 3P8ZA 4TTSA 2CZQA 2G09A 1IJFA 3IPCA 1USKA 4TVSA 3I9KA 3UTDA 3U2QA 4O2LA 2GPJA 5FBKA 3KQQA 4JUFA 4YPFA 4BRWA 4IUYA 1XQ6A 2P9FA 3M81A 4MQ4A 2YZKA 2FWIA 2VDNB 2ZTUA 5AVJA 3GVIA 3TO5A 1SKYE 4MDYA 4LF5B 1CQIA 2FUEA 2JGDA 3EJWA 2PX4A 2CV2A 5EZ5A 3MJCA 3QQ5A 3G0BA 2XXJA 1UM9A 4X6YA 4CM3A 1G3IA 1I2DA 2BGMA 3I9JA 5T4BA 4DG9A 1ZJ6A 4BV3A 3FMVA 3JPYA 5DK4A 3NBKA 2XRYA 1Z0UA 3RJ9A 1SVIA 1V8PA 3DZFA 1NWCA 2XNDD 3ZNPA 1ARZA 1KAHA 4F38A 3C45A 4F86A 3FKJA 3OBIA 1I3KA 1DJQA 1WXDA 1SKQA 5DJ5A 2XYQA 3BZWA 3CVJA 3NAGA 4MWCA 1FFAA 2QF7A 2Q8NA 1WDWB 2Q9UA 3G2IA 2HWXA 4GWKA 1XNHA 1OE0A 3HB4X 3I2IA 3L07A 3MZ0A 3OFNA 4MUXA 4R1LA 4RX1A 1R37A 5HMMA 3ZIUA 2MOKA 4DEVA 1FXUA 2E89A 5CK5A 5H9WA 4QOEA 1TZBA 2V7QD 2VJDA 4LZPA 2IHZA 1DAMA 3HY3A 1ZOIA 4XB2A 8ABPA 1BN6A 3I6YA 1T2UA 2QM8A 5JXGA 2O2GA 4MCHA 3TG2A 2X0DA 2C94A 1PWHA 4O4LB 2Q29A 3K8QA 3F8TA 3VR5H 3L40A 3RYHA 1CP2A 2P9CA 2VP6A 4LF6B 3WSTA 2IXAA 1ZD9A 3G1TA 1V1MA 3OJCA 4XX0A 5AKLA 1KBOA 2GRJA 3KZKA 4WN9A 1UBFA 3U4QA 1QO0D 2AFRA 2PDAA 2YWCA 3F8WA 2SKCA 3GDFA 3K09C 1RXCA 4QGFA 3OQOA 2V4UA 1ENYA 1D0VA 1Z26A 3MUNA 4M1QA 4LJKA 4ZOLF 1USIA 1YBFA 5FA5A 4X66B 4MHTA 2H4HA 4P4LA 3D8BA 3GRYA 4WKCA 4PF1A 1CIVA 3FZGA 3CNBA 1HLPA 1O94D 3M9XA 4HQLA 1XT6A 3LHFA 4RH3A 4F7WA 3G7SA 3G88A 3ORFA 2V6IA 3OZDA 2VQEB 1KAGA 3A4TA 3G2KA 2XUJA 3LZ6A 3TEJA 4ENUA 3ADBA 1CZUA 3NAZA 4QPZA 3MMXA 3RF7A 2PA0A 3VC3A 1ZUIA 3WP1B 5HWSA 4TV8A 1COZA 1TFUA 3BSFA 3WYEA 4DRYA 1M6WA 4BX0A