3FPJA

Crystal structure of e81q mutant of mtnas in complex with s-adenosylmethionine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
264
structure length
257
Chain Sequence
SCYIYWDKIKRIASRLEGMDTSGVMPLLDEIEEIAHDSTIDFESAKHILDDAEMNHALSLIRKFYVNLGMKLQMEKAQEVIESDSPWETLRSFYFYPRYLELLKNEAALGRFRRGERAVFIGGGPLPLTGILLSHVYGMRVNVVEIEPDIAELSRKVIEGLGVDGVNVITGDETVIDGLEFDVLMVAALAEPKRRVFRNIHRYVDTETRIIYRTYTGMRAILYAPVSDDDITGFRRAGVVLPSGKVNNTSVLVFKCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein, transferase
molecule keywords Putative uncharacterized protein
publication title Crystallographic snapshots of iterative substrate translocations during nicotianamine synthesis in Archaea
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 89
structure length 257
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03059 NAS Nicotianamine synthase protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fpjA00
1VPTA 1EAMA 2YR0A 3FPEA 4IV0A 3T7TA 5KQSA 3PB3A 2IP2A 3AWIA 5DPMA 3BUSA 3UBTA 3FTEA 1VP9A 5EZQA 5C1IA 2O06A 4Y2HA 1SVUA 3AJDA 4C04A 3OFJA 3I64A 5EEGA 3UJ7A 1ORHA 1RJGA 3G5TA 3KQWA 1FPQA 3SR4A 5FA5A 2H1RA 3GRZA 1X1DA 2FHPA 2VDWA 2XYRA 3UJ9A 1Y8CA 4LWPA 2ZWVA 2PV0A 3HVJA 1YFLA 3HVIA 2JH8A 3I53A 4RX1A 2Y1XA 4E2XA 3HA5A 3O4FA 3I9FA 4RVFA 3NVMB 3HCFA 2QM3A 4RYLA 2P40A 2OYRA 1RJDA 3EVEA 5EHGA 2PJDA 4AZWA 5E1DA 1NV9A 4XCXA 5DM1A 5EMLA 1AV6A 3JWJA 3LPMA 5EMJA 4PYKA 2AS0A 5FADA 1X1BA 4E2ZA 4P58A 1RJFA 3KHKA 4RTPA 1PRYA 3MQ2A 4EKGA 2DULA 3KR1A 5DXAA 2A14A 1JG2A 3B3GA 4DA4A 5FHRA 3G8BA 4PYMA 5EMMA 2ZZKA 3CJRA 10MHA 2K4MA 3EVAA 4GF5A 4LECA 5DT2A 3S68A 3AY0A 1ZQ9A 2PT6A 2O0LA 3G7UA 3NW9A 4GOOD 3TM4A 2NP6A 2O57A 2QY6A 3VC1A 1ZGJA 2PY6A 1EG2A 3G89A 3QV2A 2PWPA 4ZTBA 4PYJA 3BWBA 5DWQA 2HR1A 2JHCA 3LSTA 3OZTA 4OA8A 5CVVA 3KPJA 1YZ3A 1ZKDA 2ONZA 3GRVA 3LCVB 4HH4A 4LWOA 5HFJA 5BW4A 2ZBQA 3EVBA 4QDJA 3G2OA 1KXZA 4KIGA 5LSAA 4Y30A 1G8SA 3SSOA 4ER7A 3LGAA 4BP1A 4KW7A 3MCZA 3Q7EA 1XDZA 1G60A 1JQEA 1XTPA 4MWZA 5DTMA 5FWDA 4YMGA 3P9CA 4XUDA 1L1EA 1P91A 3DLIA 1TW2A 1JG3A 5F2NA 1EIZA 2B3TA 3AXTA 3BWCA 1KPIA 3OPNA 5GM2A 4OX9Y 3O31A 5FQNA 2JHPA 1D2CA 4OA5A 4HGYA 5GOZA 3P9KA 2AN5A 4ISCA 3G5LA 5FTWA 3LKDA 2AOTA 2B25A 3M6VA 4K6MA 3TR6A 4QQNA 5CCBA 4B17A 4RTMA 5HIIA 4KWCA 3FTCA 1NBIA 4P7FA 1YFJA 2VZ9A 1VQ1A 1O9HA 3M4XA 5K0BA 2ZZMA 3F4KA 5CVJA 4R6WA 3GCZA 3LDGA 4OBWA 4KVZA 1RI5A 3B7PA 2VS1A 1U2ZA 1MHTA 2IH4A 4BY9E 1KPGA 2ERCA 5EVJA 2ZIGA 3PTAA 3DMHA 1RI2A 3M6UA 2CMHA 2NXJA 5K0FA 3E8SA 2HNKA 1G55A 4GUAA 5B1SA 5GIOE 3B5IA 2JJQA 4IKPA 2BR3A 3UWPA 1D2HA 2OPBA 4FSDA 3CJQA 5CM2Z 4C08A 1FP1D 3NWEA 3BWMA 5EG5A 2F8LA 4HTFA 2YVLA 5K0GA 2G8NA 3FTFA 2P8JA 2QRVA 4RTOA 1G38A 3GIWA 3VYWA 4HRAA 1KYWA 5EGSA 2N47A 3EVGA 3B89A 3MTEA 3FUVA 5T67A 3HNRA 5EKUA 5LQCA 3C6MA 1I4WA 3KQVA 5G02A 1QYRA 5FCDA 5DLYA 5KS2A 3P2EA 3DP7A 3V97A 2AZTA 2UZ4A 4AZTA 4IWNA 3SXJA 4FS8A 5H02A 4PYLA 1PJZA 5HIJA 1FP2A 1DCTA 2YX1A 2VDUE 2KW5A 3LCUA 3LCCA 4M37A 4UOEA 4YUXA 3FTDA 3OU6A 5HEKA 4CKBA 5GP1A 3DR5A 5U4XA 2PX2A 1N7IA 3HP7A 2AOTB 4PONA 3SSMA 4QVKA 2EX4A 2IPXA 2WA1A 5EKXA 1T43A 3KQYA 1OR8A 5EQJB 2GA9A 3CC8A 1BOOA 1N2XA 2P3LA 1ZG3A 2OO3A 4C4AA 5K01A 2HWKA 5F2KA 3OU2A 5HIKA 3FRIA 3KQOA 1YUBA 3LBYA 2ZULA 5CVUA 5EIFA 4QDKA 1XDUA 4QTUB 3G2QA 2AR0A 5E8RA 3NWBA 4PGHA 4RTLA 5KVAA 4RTNA 4RTSA 5EOVA 1NW7A 3EVCA 4PYOA 3P9NA 1O54A 2H11A 5E2BA 3U81A 3WSTA 4C05A 4RTKA 3MB5A 5LQUA 1RJEA 2PKWA 4FT2A 4ER6A 3B3FA 3HVKA 5FA8A 4R05A 3DTNA 5EC8A 4A6EA 3T7SA 5E9QA 5K03A 4KIFA 5KQRA 5BW5A 5BXYA 1SQFA 2P7IA 3TKAA 5K0NA 4DF3A 2IBSA 2PX8A 3HA7A 5FHQA 3HCAA 5T64A 3NDIA 2CMGA 3G88A 3TKYA 2PXAA 4HTFB 2UYOA 3A7EA 3GNLA 1NW3A 1NW8A 2QRVB 4RVGA 1JQDA 1WXWA 2NYUA 4U7PB 1WXXA 3CVOA 1JSZA 1R74A 3HM2A 1H1DA 5FUBA 4M38A 4PCAA 2AOWA 3DLCA 3M6XA 3ER9A 5ICGA 3UJ6A 1M6YA 3KQSA 1BHJA 1HMYA 4AUKA 1DUSA 2FPOA 3DOUA 3KPWA 5IH3A 4YUYA 1KYZA 4GC5A 5CIYA 3C3YA 3DUWA 1G8AA 3UJCA 4ER0A 1ZHFA 4XUCA 1KIAA 3X0DA 1WZNA 4E33A 3C0KA 5JR3A 3UJ8A 4CKCA 2JHAA 3BGIA 1XCJA 4V0QA 3ELUA 3R6TA 4FZVA 4E30A 3PS9A 4R6XA 5E1BA 5LR6A 1TW3A 1AQIA 1JR4A 4PWYA 2H00A 2DPMA 4YUWA 5GM1A 1X1CA 4PNEA 5T6BA 5K05A 1VBFA 5IKMA 2IBTA 3FYCA 3BKWA 3KQPA 2IIPA 1X19A 4AX8A 4GOLD 3OCJA 4HGZA 1JTFA 3T7RA 2ZVJA 3FUWA 3PX3A 1YZHA 2I62A 1JQ3A 2WA2A 4RVDA 3P8ZA 4GQBA 5HILA 1N7JA 1D2GA 2IGTA 2BM8A 2OB1A 3O7WA 4JXJA 4POOA 5K8VA 2PWYA 3TPZA 4QTTB 2ONYA 3R3HA 2OY0A 2NNWB 5P8WA 1SKMA 3GXOA 4KDRA 4F85A 3BXOA 4CTKA 1XXLA 2FYTA 2R3SA 1JG1A 3P97A 3NMUF 1NE2A 4YV0A 5ICCA 1VLMA 1BC5A 2O07A 4QQKA 1IXKA 4V0RA 4RTQA 3BT7A 3E7PA 3ELDA 4G56A 4E32A 3CKKA 2EFJA 1KPHA 2P41A 3PVCA 1JG4A 1NW6A 1VIDA 4PIPA 1FBNA 4DMGA 2AN4A 2O05A 3FPHA 1L3CA 2G71A 3HCDA 3ANXA 4QPNA 2B2CA 1M6EX 2G72A 2Y1WA 3SSNA 2ZW9A 3B3JA 1YF3A 2BZGA 5GINE 5K0EA 5EZSA 2C7PA 3ERCA 3DMGA 4RV9A 4H0NA 1EQAA 4X63A 2XYQA 4YUVA 2ZBPA 3K6RA 1V39A 2HMYB 4DZRA 5D1HA 4E2YA 3SVZA 2Z6QA 3I58A 4PINA 1XDSA 4HC4A 3KR2A 5HZMA 3BGVA 3BGDA 3LHDA 3DMFA 2JG3A 3MCTA 1EJ6A 3EGVA 4WVLA 3NDJA 4CTJA 2Q41A 2FK7A 5E8JA 3ELWA 5DRTA 2GLUA 5ICEA 3KQTA 1DL5A 3FUTA 2ZFUA 3VSEA 2ZIEA 2UYHA 2NXCA 2OB2A 3DULA 5FWAA 3QOWA 4AZSA 3GGDA 4MQ4A 1M0EA 3OE4A 1QAQA 4NECA 2LD4A 4FSXA 5E1OA 3E05A 4P7KA 4X60A 4EMSA 5EHIA 4U7TB 3DH0A 3MTIA 2IFTA 3DXYA 5LQAA 2GH1A 2XVAA 3FZGA 2YXLA 3A26A 3RODA 4E70A 3OFKA 5ERGB 2ZZNA 3DXXA 1UIRA 2ZIFA 5DRYA 2ZTHA 3OZRA 4ATNA 1XCLA 4HG2A 4DCMA 3FPFA 3PLAE 1F3LA 4QVGA 2I7CA 2XVMA 3BZBA 2ZCJA 2PBFA 3TFWA 1G6Q1 5CVEA 4C06A 5MHTA 5KYGA 2BR4A 5DTQA 1KP9A 1L3BA 2BM9A 3UFBA 4DM3A 2PT9A 3FPGA 4PIMA 4EK9A 1IY9A 1P1CA 3MERA 3PX2A 5JUWA 4CXMA 4PYQA 3GRYA 4YUZA 5GIPE 4GEKA 3SMQA 2B78A 2OKCA 3DXZA 3M6WA 2GPYA 3LX6A 3M33A 4C07A 3FYDA 2QYOA 1NT2A 2B9EA 9MHTA 5DM0A 1Q0SA 3L8DA 3GWZA 5EMKA 5EIWA 3VC2A 5HIMA 2ADMA 5CD1A 3BWYA 4GBED 4OQEA 2NXEA 2AOVA 3A7DA 4M7RA 4RTJA 5LQRA 4PCLA 4HSGA 3IEIA 3KR0A 1KR5A 1VL5A 4BP3A 2HV9A 2BH2A 3EPPA 5EEHA 2Z6UA 1SQGA 2OXTA 5FQOA 1R00A 3EVFA 4EKIA 2PX5A 3LDUA 5ICFA 2UYQA 1R8YA 3LBFA 4DKJA 3EMDA 1JSXA 3OZSA 2BR5A 1P39A 2YTZA 3R24A 4L7VA 4BLUA 2P35A 3KQQA 3G2MA 2NXNA 4X41A 4C03A 2PGXA 3JWGA 3HEMA 1YB2A 4EQZA 3TOSA 1MJFA 1WS6A 4M36A 5HOQA 1NBHA 3NTVA 5CCXA 2IH2A 8MHTA 1WG8A 4IV8A 3Q87B 4FGZA 3UA3A 2PLWA 5DM4A 2CL5A 5DSTA 3LKZA 2WK1A 2CKDA 2JH9A 3IV6A 1L9KA 3BKXA 4MIKA 3UJAA 2FCAA 1R8XA 1RI3A 4RSRA 3QOXA 5E9JA 1Z3CA 2AVDA 1NW5A 2AOXA 3CJTA 3EGEA 3NJRA 4OQDA 4QPPA 4WXHA 4XUEA 1L3IA 1ORIA 1RI4A 3V8VA 3ELYA 5C9ZA 3PT9A 2VDVE 2P3QA 3A27A 5E9WA 1R6AA 3RIEA 3GDHA 5K0JA 3FPJA 3KPUA 4O29A 3FUUA 4P7JA 1JTEA 1SUIA 1XVAA 3KPYA 1EJ0A 1WY7A 2AN3A 5LQKA 1Q0TA 4GOMD 2AOUA 3PFGA 1B42A 1I1NA 3M70A 4X61A 2I6GA 1VE3A 5DTRA 1INLA 2P7HA 5C0OE 2ZBRA 2V74B 4X1OA 3K0BA 4FT4A 7MHTA 2OZVA 3A25A 1O9GA 1UWVA 1ZGAA 3A4TA 3GRUA 3P2KA 4R8SA 3UJDA 4BLWA 2EJTA 3GJYA 4RVHA 4MTLA 5DX8A 3TRKA 2EG5A 1RI1A 2CWWA 5D1NA 5EPEA 1FJXA 3LL7A 3EVZA 5BP7A 4KDCA 4YV2A 3REOA 4EVIA 3EEOA 2UYCA 5FULA 3RW9A 3FUXA 3TMAA 5LQNA 3MHTA 3T0IA 2VP3A 4BLVA 3KKZA 1F38A 4CWAA 4F84A 2PX4A 3JWHA 3KR9A 2OBFA 3KPVA 4AZVA 3EMBA 2YUIA 5K0CA 4E2WA 3HCCA 1QAOA 5DX0A 2PXCA 3EGIA 2AVNA 4OBXA 5GWXA 3THRA 3ER8A 3AXSA 4RTRA 3E23A 4PGGA 4RWZA 3UZUA 3KU1A 2Z6AA 1AF7A 2ORED 2ZLBA 3IHTA 3GU3A 1NV8A 3KQMA 3TLJA 2ZWAA 3LDFA 2C7QA 2EJUA 2GS9A 3CBGA 5CUQA 3C3PA 5K0LA 3TM5A 2C7OA 1X1AA 2NP7A 3OE5A 1BKYA 3EEYA 1VP3A 3HCEA 5E1MA 4R8RA 5K09A 3R0QA 1UFKA 2QE6A 5M5BA 1NKVA 3PFHA 1I9GA 5DX1A 3ORHA 2IH5A 4YV1A 2I9KA 3G8AA 2E5WA 3GRRA 4FR0A 2G1PA 3H2BA 2PVCA 4A6DA 2PXXA 4Z2YA 5LQJA 1XJ5A 2AOUB 4F86A 3ME5A 4MHTA 2R6ZA 3UJBA 2XYVA 3EVDA 2YXDA 3NVKI 2GAFA 2FRXA 3THSA 4DCGA 3I5UA 4PYNA 2ESRA 5F2OA 4E31A 3SX0A 4KRGA 4PYIA 3P9IA 4ER5A 3CCFA 2G70A 3G2PA 4FP9A 1IM8A 2PSSA 2ZSUA 3IYLW 5DM2A 2P1DA 1HNNA 5DSXA 3MGGA 3SM3A 2XBMA 1R18A 3HTXA 1QANA 3R9XB 1KHHA 4ER3A 4DQ0A 1SUSA 1QZZA 3LECA 3HA3A 4YMHA 3HCBA 3MAGA 4LG1A 4P7GA 1TPYA 1AQJA 2YXEA 2HTEA 3C6KA 3D2LA 1SG9A 4GOND 3P71T 5DXJA 2V7EA 4CKEA 3HVHA 2FK8A 2GB4A 2P3OA 2YQZA 5E2AA 5CVDA 3UA4A 2IDJA 4GC9A 3ID6C 1QAMA 3P2IA 2IDKA 3CGGA 3GO4A 3OU7A 2C7RA 3TQSA 3JWIA 3SGLA 1P1BA 3FRHA
chains in the Genus database with same CATH superfamily
1FX0B 2P5SA 1UXOA 4GP7A 1TLTA 3A37A 2Q5FA 4ITUA 5A6SA 3LT0A 3G6WA 1ZJZA 2CT8A 2RK3A 1OC2A 3JVEA 3EOZA 5FOQA 1BDHA 2PG3A 4BO5A 2F3SA 1DG1G 4JC4A 2ODQA 4OUKX 5EEGA 5B1HA 5AOVA 1JXAA 1VYVA 1X77A 1QYDA 1Q15A 1VGRA 1M76A 2HPAA 4BLSA 2OGTA 4MQLA 4QLOA 4ICIA 2C29D 2FUEA 3O84A 2H31A 3JARB 5L3SA 4UDOA 4AKSA 2NW6A 1DKRA 3AM1A 4L3VA 4KQ9A 2P90A 4JI1B 1NMQA 3WL3A 1JFFA 3IDSA 3CEMA 1QQ5A 4EVRA 1N6KA 3NIFB 1IOWA 4JJKA 2QUBA 3GA5A 4HDQB 4QWWA 4LZOA 5G3ZA 5I7AA 2I2WA 1LLDA 1NLUA 1IBLB 3ZHYA 3L01A 1ABEA 3ZV4A 4AS2A 2ICAA 5JH7A 2A1UA 5DZSA 4XCXA 3S1LA 1KSHA 4JT2A 1R88A 5K4AA 1DBPA 1NBMD 3LOUA 2G0NA 1ONOA 2P9CA 4E2ZA 1PX2A 1XV5A 2ZETA 2QTHA 2FPUA 1KVUA 5CDTA 4MARA 1UDXA 3GAFA 1U7ZA 2DUNA 2PS0A 4GKJB 4YA6A 2Q4OA 3ZD8A 3ANYB 4TN5A 5DXAA 5IJ0A 2BT4A 3QUSA 4X1IB 3GROA 4R0MA 5CLJA 3N39C 4I4TB 4OBEA 3AFMA 1IN5A 3B12A 1O4WA 3EVAA 3IRVA 4LECA 3S68A 1Q84A 2REBA 4CCAA 4PICA 3I45A 5T8KC 1E2QA 1BGXT 4K87A 3C4QA 4PYRA 4W6ZA 2UUPA 1RM4A 1NASA 4X93A 3STXA 4R1UA 1GQFA 3UMVA 5JJIA 1NF9A 3G8YA 3R0VA 4GR9A 1TUBA 2JEYA 3KHUA 5DWQA 4FHFA 5HKOA 5DBGA 1ZIYA 3ZE1B 2NGRA 1I2MA 5CB6A 3GRVA 2FV8A 1N6LA 1KO7A 4YRKA 4LBVA 4KZKA 5FR1A 4D3SA 2MU1A 1NRJB 3ANLA 2C5SA 2NU9A 3TNLA 5C5IA 3NAZA 4LXHA 3SZMA 4AB1A 3G8DA 1QPBA 1NF2A 4RABA 1MZPA 2M32A 1KAEA 3BTVA 5TMDA 3RVQA 1JEOA 2P2GA 4WTOA 3NDRA 1IEXA 1V7CA 4I9NA 3H1EA 2HJ9A 1T9HA 1G0OA 5HRAA 2BKAA 1PL7A 4TKLA 3K94A 1PJ3A 3KV1A 4DWJA 2XTAA 2Z6AA 4Q18A 2XKJE 2HT6A 2ZAMA 5MN6A 1A77A 1GQOA 4BB5A 3U3MA 3TLBA 2Q8NA 3B48A 2X0JA 2WZBA 2GAJA 3PYMA 4GI2A 3UOWA 2CXQA 2X4DA 1H9AA 3QVMA 3H5NA 3WAJA 4DLWA 3U7FB 5DHUA 3PRHA 2PKEA 4JJ7A 1D0IA 4UEQA 3N3AC 2VAXA 4OQ4A 4QQ8A 4WOPA 3HO1A 2ZDHA 3HDYA 3GAZA 3LT2A 5LC1A 1G9TA 3FDXA 3AEUB 3B51X 3IB6A 1HZZA 1LC3A 1PNTA 3EY4A 1TM1E 3R5KA 4Q4JB 1JQJC 1FK8A 2C8LA 2HHLA 1NLMA 3UUWA 1L6IA 1CY1A 1PR3A 1ZP6A 3F5SA 4MS3A 2G6TA 3O3MB 2L2QA 4BDTA 4CV3A 2AUNA 3KEGA 2OHOA 4YJGB 2PUFA 5AO9A 1ZSVA 3D8HA 1VSTA 3MJTA 3PWKA 2B1GA 1RYFA 2OESA 3HN7A 2WR8A 3OBIA 3CW2A 4MW0A 3C41J 1CUWA 2P8JA 2JAUA 3IBTA 1U94A 5EWJB 2FA9A 3HJBA 1IN6A 3RS0A 4UQOA 2Z9CA 3DHVA 1LDNA 3NBAA 4HB2A 4CFYA 2YQ4A 1NQXA 3TXYA 7YASA 1GA6A 2ZYIA 3IUSA 4H4DA 3V1KA 4YP0A 2EGUA 3OA0A 4RXUA 4HUJA 1OBFO 3JPYA 4R8VA 4AZTA 4E5UA 3BRWA 1HEYA 3QP9A 4B4KA 3EXIB 1PJZA 4LYYA 3NALA 2VDUE 1GSIA 1AHPA 1FX1A 3FR7A 2MR6A 4RANA 2KLBA 3LFUA 1TUIA 3ON5A 3H04A 3U4AA 2WHEA 3VR3D 1K7FB 2COUA 1SKYE 2XCUA 3IILA 4JLDA 1KKUA 1YDMA 2FTKE 3NHWA 1N3LA 3AP2A 1KQOA 3D1VA 3DKPA 3IQDB 2D2IA 4D56A 3HSKA 3X1JA 4CM3A 4CQLA 1JXQA 2GPBA 4BVGA 2GBFA 4Y6SA 2VP5A 1EKXA 1Y4SA 2QGZA 3KSBC 2XX3A 1Z6GA 2WE8A 3R9WA 2GZ2A 3GG9A 2ASEA 2MYUA 3TFOA 4MUNA 4TYMA 3ZUGA 1H8HA 2A5JA 4XUGB 2LVBA 3LBIA 4QHYA 5JVDF 2B35A 1FVFA 4DMUB 1S2GA 1U3FA 3LUPA 5CLLA 3AP1A 4G0PA 3T9DA 2R1TA 2IL1A 2KWIA 5EZ5A 1UPFA 2B1QA 2UVDA 2DQZA 2JBAA 4FHEA 2YVUA 3O92A 4LCEA 4DM4A 4F2PA 3NORA 2DH6A 3IQXA 1U3GA 4JP8A 1QKIA 5HJ2A 5I8ZA 1Z7EA 3ZCQA 4UBNA 5FL7D 3SP1A 3NQ41 1J2JA 1T35A 4GSLA 3FDZA 4FMCB 4L2IA 5K03A 4EY5A 4DC1A 2HLDA 2VAMA 4PBSA 2DY0A 3W6PA 3ZI0A 1AS2A 3H4MA 1XF1A 1D5WA 4FD2A 1RYMA 4KYTA 2W8BA 2ZRJA 3TKYA 3EFHA 1U0NA 3FKSA 2D06A 2QRVB 4EM6A 3VNRA 1QRSA 3AQ4A 2NYUA 4BNZA 4B4DA 1JSZA 1PSDA 3AETA 3H2JA 4UCXA 2IQ5A 4BXOA 5B53A 1HL7A 5DXFA 2D5IA 3FWZA 3MJFA 3GJ4A 3PHJA 1J42A 2VYCA 5D00A 1YT5A 4YBZA 4HH3C 5KYVA 2P68A 3ZNQA 3FNGA 1UDCA 1U6JA 3TSAA 1MOZA 1PJ2A 3N2EA 4LFAB 1QMPA 4GAEA 3GNQA 1NUTA 2FFQA 3A6EA 4C3UA 2QXYA 3RANA 3VZSA 4B47A 1UKYA 2WUVA 1ZONA 1NFQA 1P1HA 1IVSA 2OK7A 3W4IA 1O87A 1C80A 2JCBA 2J9GA 3UWMA 5CLQA 3GLTA 3WP1B 2A9VA 2WFLA 4LDQA 1Z28A 3QW2A 2JIBA 4HXGA 3KTAB 1C7FA 1TF5A 2YV3A 3A9SA 5EUCA 4EY8A 1EGQA 1G8PA 1Y1PA 4GQBA 1E32A 1J00A 1PG0A 4O4JB 1A97A 2CHVA 1CE8B 3KJEA 5HF6A 3WDKA 3G6KA 4Y67A 1GPDG 2W6MA 4FKBA 1NI4A 1WL8A 1Z0DA 3BXOA 4FFOA 4ZHQF 4KO1S 2IZ1A 4PPGA 3ZJTA 4ZQCB 1W8IA 1BVRA 5B30A 3P2YA 4RM3A 1AGPA 2Q6KA 4V0RA 2CNNA 1O95A 3LX8A 2ZANA 4E32A 1FQKA 2NTVA 4UASA 3IHWA 2V96A 2B7BA 3CLSC 3FLBA 4JUDX 5T6MA 1FBNA 2AV6A 2CVPA 2O9JA 3AERA 5CDSA 4MUBA 3O8CA 3A8TA 4YREA 3HCDA 5J2TF 4X97A 4B75A 3LQ4A 3EG9A 1SWWA 1YZVA 3I0NA 3SSNA 4DEVA 2BIFA 4ARVA 5BY2A 3Q8MA 3ROGA 2ZRLA 1UMKA 4D9GA 2HMVA 2NOAA 5FV4A 5I7VA 1OI3A 1EQAA 4RD2A 4X63A 4R7ZA 4RLQA 4W8GA 1JPUA 5CHEA 3K32A 5EI5A 2RKOA 1KMQA 2QLBA 2QZ9A 1A5BB 2B0CA 4KBGA 3SVZA 5A4KA 5BVHA 5HTOA 3E9EA 4A0FA 5I8PA 2YV2A 5EJFA 3IURA 2F55A 4DR5B 3MCTA 3MOIA 3PRYA 2Y0PA 2GQ0A 4YR9A 4K6CA 4KZPA 4G65A 4KXXA 3P45A 5IDVA 4MINA 1NURA 4RLSA 1ECLA 4JASB 4QUEA 4L0MA 1CZUA 4XR9A 3DBVO 4QU8A 3VH4A 5LJLA 4JI3B 4QJIA 4AF7A 2H0RA 4Y2SA 3FB1A 3ISTA 4ITVA 3T3DA 3BC1A 3TLGB 2H4ZA 5J58A 1JLSA 2UYGA 4EEXA 2CDBA 4M98A 3UT6A 1F4VA 1KDOA 2G0AA 2CL6X 2JB9A 3WGYA 2WIJA 4BPRA 5IANA 2BHSA 5LQAA 3I5XA 3NATA 1E2EA 1NW4A 3E84A 4U9IS 3JQ7A 3GLIE 2ZZNA 1LW6E 4FPXA 4B3HA 1JIQA 2NV6A 3VVMA 1CR2A 2C3UA 4QYXA 1M6VA 2I7CA 4DY4A 5E3IA 1JIJA 4JB2A 1Q6YA 1G6Q1 1UEIA 3LUAA 4IOMA 5KTRA 5AK6A 4DRZA 5L95A 1L3BA 2LE0A 1ZCAA 3VHXB 3PHIA 4DT1B 4XSVA 4LDJA 3DD1A 1OJ7A 4AP9A 1QH8A 3A05A 3Q0EA 2MMCA 2I2XB 2OCIA 4RMHA 4LQ4A 4U3JB 2R8EA 4RE5A 3ZCPA 4BNXA 5DLEA 3RS8A 4NARA 1HXHA 1A9SA 3LX6A 2AIRA 2W6CX 1FZTA 1GZUA 4M99A 1XRLA 4JGIA 5CCEA 3JAMA 4IIYA 2JCSA 1SVSA 1UKBA 2AL7A 2QMUA 1OXVA 1TC1A 3G3EA 3OOJA 3V7UA 2X5JO 3VZDA 2HU7A 4GBED 1FTWA 4OCZA 4CQMA 5LNK1 3JALA 5LQRA 3IUJA 4P4LA 2VQ6A 4MKGA 1AGRA 3C3DA 1K27A 3M89A 2ACWA 2ZRCA 3LH5A 3W8FA 3BCSA 4G01B 1F2UB 5HF8A 2QJTA 4N5DA 1KEZA 4AJEA 4EKIA 4DQKA 1HK7A 2NSJA 5C2JB 4EO9A 5L6MB 4DKJA 3LPCA 5KNDD 4CEIB 1PDVA 1BXRA 3FDIA 3Q15C 4LYEA 1LF0A 1T5LA 1CJVC 2FPIA 3OBBA 1ZUWA 3MF4A 4L7VA 3WLLA 4BLUA 1RC1A 4FFMA 5HHTA 1N0VC 1UDAA 3KLOA 3LRXA 2DWOA 3TRIA 3F73A 2XV1A 3I0MA 4CLDA 3T5DA 1KMHA 4OQQA 2C2WA 1SH7A 1WUJS 2CXHA 2FPRA 5ENDA 3FYUA 2R11A 4P2BA 1H94A 3DO5A 4A73A 5JG7A 1Y6RA 3HKCA 3ETJA 2Y1EA 3SJAA 4M9UA 1UEJA 3WGVA 1XJWA 2IOYA 3NJRA 3G2KA 1P72A 2Z95A 5TQVA 2Z1NA 1P5RA 4X20B 4R7GA 5C9ZA 3HRKA 4W5QA 1FLNA 1OLXB 5KWSA 1ZCZA 3KPUA 2IYLD 5GVRA 1M2GA 3GGSA 3T15A 3I4CA 3KUKA 5AKKA 4F6RB 1C3OB 1HFEL 4FE3A 4PZCA 4KG7A 2IEAA 2P9QA 2VF2A 3NT4A 3UHOA 3BMQB 5H70A 3L6DA 2I6GA 5FUWA 2ODTX 4WXMA 1TA4A 4KO3S 2UDPA 1UPCA 2GPTA 2OZVA 3NOVA 5ARDA 1ZJWA 4DA6A 3WRYA 1PSWA 2JIQA 3H83A 2RHCA 3UAWA 3UK6A 1KTIA 3LL7A 1WXFA 1OROA 1PF7E 4KUHA 4XQ9A 3VNVA 3VPBA 4CE6A 5C1BA 4IKOA 2HY7A 3H8JA 4LUCA 3SG0A 4KWIA 4OSEA 5EJ9A 4F4IA 3WGMA 2PQ2A 1AK9A 1EIWA 2VP3A 1M34E 2VXCA 5CNMA 2GAAA 3U40A 4K05A 3MUFA 5SICE 1N92A 4KMOA 5DGXA 5ADWA 1KH1A 1UP4A 3H2YA 5B58T 1VJCA 4BO4A 2V7GA 2QN1A 3HCCA 1UDBA 3KC2A 2WQ6A 3L7IA 4OBXA 3WGIA 1NMXA 1FQJA 1U7PA 1BU8A 3M2PA 1G20E 4G26A 4ETWA 1RKXA 3HUTA 3A2MA 3UZUA 3E4DA 3HRHA 3I8OA 5IYZB 2FMFA 2G9ZA 4M1ZA 4BFCA 3IFSA 3IESA 3M9XA 3L7CA 4PANA 3C1UA 4W1SA 1KAMA 2HD4A 1ZU5A 5F12A 3DMTA 5KC9A 2QD3A 1H4SA 3HCEA 1VP3A 4KUEA 2DECA 4L5CA 3NEPX 1IZZA 3ZYZA 4O08A 1BG6A 1QOQB 5KSOA 2AN9A 3MZ0A 5DNDA 1IY0A 4TMFA 3AHDA 3ORHA 4NNJA 2DBRA 1U1EA 4WUTA 5CCDA 2FPGB 4FR0A 3EJWA 4ML3A 4B3BA 2G1PA 2HK8A 3IJEB 3BJZA 3O73A 3M3DA 3AR5A 1V1RA 4NFSA 3ZDQA 5CFOA 1HZJA 1AQNA 2Y1LA 2NZUG 2VTBB 1NL3A 3IKMB 3PL1A 1SOAA 3E7XA 5EIHA 1QPZA 4GPIB 1V6CA 3F5DA 4OJKA 1SCJA 1C9EA 3WIBA 1NU6A 3UJ3X 3MA0A 2HF8A 3ZS9A 2ID7A 1RYHA 2Z3ZA 1GITA 1FRZA 3PHGA 4Z3KA 4YQEA 1RCFA 5LA6B 1WPGA 4L5AA 1UBFA 2HREA 2E85A 4LG1A 4E5PA 3T12A 3D2LA 1H5QA 1BJTA 4GOND 5ALOA 1WJGA 3PDJA 4RGBA 3RUHA 4QRDA 5AHKA 1UMDB 4ZXFA 4X6UA 4Y7DA 4B0PA 2JZOA 2SNIE 3GVHA 1AZSC 5K2OA 3WAGA 2B37A 3TS1A 1ZK4A 5BUCA 1W5TA 1XA4A 2JBHA 3ACCA 1ZWKA 1XXHE 1Z8DA 2Q2WA 3A14A 4HDNA 1O0CA 3NC0C 4WGFA 4NCIA 1QDLB 3TQSA 1OH7A 1VKJA 1USWA 1L2TA 3EISA 4P36A 2GWRA 4G9BA 3DVLA 3IELA 4LOJA 4XDZA 4ZVLA 1JJAA 1XROA 4B4VA 2DWCA 2AMVA 3GAAA 1GFIA 1EXNA 2YMQA 3AJDA 3EXHA 3EHDA 3O2NA 4Y6OA 4P8RA 5FT9A 4BFWA 3ZWWA 1W48A 4ECEA 3IEVA 1JKXA 3T3PB 2VQEB 1NJ8A 3ACBA 3DZ8A 2Q29A 1DAPA 3BMCA 3OT1B 1ORRA 4II2A 3C7CB 3AR8A 3PZBA 2G4CA 3L0ZA 4KPYA 1O77A 3ICOA 3O1JC 2IPAB 3BK2A 4IMJB 5EXTA 2FUCA 3MWKA 4C7OB 1K0UA 2ZPAA 1RAAA 4XLTA 3EW7A 2DHRA 2D59A 3KSUA 3VKHA 5DEIA 4MW1A 4DJAA 2HW8A 4OI4A 1JECA 4L57A 1IN7A 2INGX 4G07A 4ZOLB 4D9BA 5MGBA 2AS0A 5I7EA 1ZXXA 1J20A 4XARA 2DU8A 2XB4A 4X94A 4PZUA 3VHRA 4N3NA 3TD6A 1ZW1A 2JGNA 2JI6A 4PAMA 3QXGA 2AJBA 2XADA 1G5HA 5FOVA 3M83A 2D1FA 4MPDA 1OLOA 2XMPA 3E5MA 5LKRA 3G1UA 1T4BA 5JMPA 1VSVA 3FRJA 2Q0XA 4DC9A 2WHPB 3GH3A 3CX4A 2ZYTX 3BMOA 5DT2A 3OZDA 3HHEA 3TM4A 3U80A 2GHIA 3UW1A 3ZVLA 4HAIA 1EG2A 3L6BA 1UBCA 2J31A 3G89A 4YVFA 1A8UA 4OHYA 3HDHA 1RCUA 2HMWA 4HS9A 4M4SA 1QCZA 3LS2A 3N2GB 3WB1A 3ZE6A 1A5TA 5LSAA 3F6RA 1MLDA 1X2EA 721PA 3D59A 1H05A 3OCWA 1SCUA 4GX1A 3N7TA 1SOMA 3OP1A 2AFIA 3FNQA 4MWZA 3BRWD 4K2HA 4MLDA 4X8HA 1U04A 2RHJA 2I2CA 3IOMA 1YR2A 2HA6A 5F2EA 1RYEA 3DPSA 1E61A 2J0SA 2EJBA 4KPFC 2GBLC 4C7BA 4WL0A 1NR1A 3IBYA 3OPNA 3R9IA 3RHFA 4C4OA 5KNCH 4OHMA 1Y37A 2FLKA 1K5HA 3OSZA 5TLSA 3NYWA 4DTCA 2JAOA 5CD9A 4NCAA 5JCXA 2VKTA 2I3GA 5CYGA 1GTRA 1V47A 1IXYA 1RWVA 1QYXA 2H4WA 2QE7A 3EJ6A 3II6X 1RQRA 3DL0A 3HI6A 2XSZA 1SCAA 4NJEB 3RTGA 3U7QB 3GMTA 1Y8RA 5HKKD 3NWPA 2FN7A 2HDOA 5H3HA 4AL4A 5BV7A 1A9YA 2X3YA 1WPXA 2CNLA 1H8HD 2IUYA 3FYHA 1VG0B 1DJNA 1GARA 2YV5A 2Q21A 1X7XB 4KVZA 4PXAA 3T5AA 2FWRA 3HJTA 1PYGA 1PR9A 3OY7A 2JCYA 3RG8A 1QRUA 5ALWA 2HCRA 4II3A 4LPSA 4Q1BA 5E7MA 1ADYA 4AXBA 1XMJA 4ZCLA 2JGJA 4URFA 1RI2A 1TOAA 3UPUA 4CG1A 1FUYB 5JJLA 5ECYA 1C8BA 4AC9A 1T5BA 1O6GA 4RFVA 4GWGA 5BPHA 2RGNC 3L92A 2VEDA 3ZQJA 1TKBA 2VO1A 4C2UA 2PKRA 2Z8ZA 1S3SA 3KZOA 4ZYLA 4EF4A 2NTEA 2QUAA 3DJFA 3ITDA 3PC8C 5G53C 3VZPA 1N5JA 1Z2PX 3FKSD 4FQ8A 5CAEB 4LCBA 5F9MA 3V1TC 1BA3A 2W48A 2WKSA 2WU4A 1J8DA 4LX8A 1YKSA 2QZSA 2R68A 4C6TA 4CLEA 3KJNA 4PC7A 4EZBA 4R5HA 3IGFA 3F46A 4E4RA 2ONCA 4QTYA 1II8B 4EGFA 4ZVTA 2RD2A 2F8TA 3DCYA 1XZBA 4LCJA 4LNUB 1G7TA 5ESDA 5DI3B 3RC7A 2W6PA 4F9TA 1R6DA 2VQFB 2KI5A 4OLFA 4OUDA 5AR1A 2XUAA 4JQYA 4ZT2A 1AO3A 2WPDA 3LCCA 3LCUA 4NESA 1N4AA 1F1JA 4YUXA 4GKBA 5JDCA 3TEJA 2VT7A 3ZXXA 1KU0A 4O2AF 2PS9A 3GJ8A 3WNQA 4PG4A 4EUNA 3W3AA 4ND6A 3DBIA 2GD0A 2IPXA 3SIPA 1XK6A 1YB4A 5AVYA 4D8YA 1OFUA 2CDCA 4N39A 4E7OA 4LN1A 3TB4A 1XMIA 5AM4A 4FX5A 4OQXA 5CG1A 4PSVA 3CT4A 4RYDA 4IQ0A 1P7VA 5AOBA 1J7KA 2QR3A 5JY6A 1PV4A 3HNPA 2XT9A 4HNVA 4PLPA 1UT6A 2BCGY 4OAQA 3PENA 3F78A 3FOFC 1T2CA 3WX0A 4ENPA 3Q9NA 3SKYA 5CXXA 5KJEA 1SKBA 1TX4B 1YQTA 1PEKE 4RZIA 3EC7A 4D3ZA 4CKXA 2HHJA 2WKQA 2IY9A 3L1HA 1KE1A 1O95D 5CFQA 2QTLA 4I1UA 4NU5A 5LLSA 3RLIA 2P0AA 1P6UA 3I73A 1DHTA 5HUHA 1JDZA 1GPBA 2IV7A 4DCVA 3IAS1 1YIAA 3IQZA 2I87A 2CUKA 1U0SY 1Y6ZA 3IUMA 1WXHA 1G5TA 4PWZA 3SU8A 3Q4GA 4WECA 4AWBA 4I14A 3E5HA 1OBHA 4Q12A 3TL3A 4RKWA 2VL7A 3NT2A 5FUBA 1XKLA 5JWHA 3TYXA 4L4RA 4RQAA 1FJGB 2CK3A 1QZXA 4BLOA 3PEVA 3VBCA 4IIEA 4FTWA 3RYHB 1YL5A 3C3YA 4RNDB 3THYB 1I2AA 5A0FA 1Q3TA 3NR2A 4U2BA 4JKIA 4F3CA 3WO0A 5JR3A 4RZXA 4A03A 3WA7A 3QTBA 4F7DA 1RWXA 1A4UA 3BH0A 4FZVA 5K3OA 1NMEA 3WFJA 4G1VA 2H51A 1J8MF 3UT5B 5CA0B 4HN4B 1DG3A 3KNZA 2C92A 3W34A 3FYCA 3TXAA 2DX7A 2DPXA 2WILA 4RH3A 4Z86A 1AQUA 2C4TA 4UE2A 4PRZA 3STWA 4RH1A 4ZVQA 4G4JA 1CUUA 3N2YA 3ZOZA 5FAKA 2R7KA 1T3LA 1VFNA 4EHLA 4FDVA 4JU8A 3LW8A 2ZCUA 2Q9BA 3AVPA 4GQAA 2OXEA 1BXGA 2YFHA 4PAWA 3TPZA 1HLDA 2OY0A 2X9VA 2RE8A 3H6GA 4IIBA 4NPCA 2Q5JA 1HYQA 3AHGA 4I66A 4KYUA 3T5GA 2ZI6A 2ON6A 3OF2A 4LS3A 2NZWA 3E22B 3NHJA 3O4RA 2QM7A 4KLRA 2ZIWB 4MVJM 5D01A 2EFJA 4EELA 1JR2A 4HTAA 4ETNA 3PNVA 3PVCA 1JG4A 1IBRA 1QIJA 1RJ9A 3UV6A 1ZGHA 2IYSA 2VQSA 4XM1A 1E5TA 1RFGE 1ZM4A 2HDNB 5BN3B 3IV7A 1M6EX 2Y1WA 4DFDA 5JS6A 3FOCA 2ZKIA 3KUUA 2OZLA 2AEFA 1E7QA 5EZSA 2JJ2D 4AN1A 4QDTA 1ZUHA 1G8JA 4K5QA 1GU7A 4CQMD 1E94E 1SBCA 2IOFA 4YALA 2I80A 2PO5A 2D7CA 2GN0A 3BA6A 1C1XB 2Q1TA 4C3ZA 3MD0A 5D5PA 1TCBA 3BGVA 1CDDA 1E2PA 1GZ5A 3S2UA 3V1UA 2DFVA 3EMKA 4TWRA 5BW8A 4L51A 4U2FA 2O3SA 4PC2A 3O8OA 3CNNA 3W90A 1GVHA 3MMNA 4E0BA 3OCCA 1XI2A 2AFHB 1EFDN 3BL8A 5SY6A 3PD7A 1VXRA 3F98A 2GLUA 3MUNA 4HUQB 3G79A 3QELA 4WLVA 3U17A 3FPLA 1K8YB 2YZNA 1ABBA 2D74A 3SNHA 4H1UA 5J1SB 3WB2A 1E6LA 2FY8A 4MQ4A 1IJEA 3AF0A 1MV5A 4NOKA 5J5VA 1DT5A 1DEHA 1G5PA 3MTAA 4ACAA 1EFRA 1OAAA 3L7KA 5E6UA 3LUDA 3R3SA 5AW6A 3V33A 4HWTA 1OGYA 3OESA 1QPGA 2BVNA 2IZ5A 2ZVQX 2FOLA 3A26A 3M82A 3BMNA 3GJ6A 3IDAA 1UIRA 3NTLA 4ATNA 3E3LA 3FLMA 4KR7A 1XU9A 2Q3BA 3K8OE 1IQ0A 2XVMA 4L02A 2HDWA 1LS6A 4JY7A 4FOOA 5CVEA 5GONA 1CZRA 3NH9A 3ADKA 4KFTA 4QOSA 4WXYB 1NHGA 5CT9A 5AFSA 4NCBA 1FC0A 2FWBA 2J1LA 4PLCA 2BEUA 2CJWA 1JJFA 3CM0A 1U3TA 3GJ5A 3PX2A 3VU9A 3B6MA 1K8ZB 1PW7A 2I6FA 2GGSA 5IVHA 2B78A 1L4MA 5JLAA 1YQQA 4HSEA 1OWOA 3DXZA 3HKBB 4MV0A 4U63A 3UMFA 1ONNA 4C07A 3KEQA 2B9EA 3DCNA 3L8DA 4WQMA 2B8TA 3C85A 4L07A 3HDJA 3PEFA 4XYMA 4FEYA 5CD1A 2PL1A 3KIPA 3PSAA 3U4QA 3SHTA 2YMLA 3BDIA 3A7DA 3JVUA 4DMKA 3ZU6A 4DZTA 5AESA 3QZUA 1JFVA 1KR5A 3AH8A 5D5HA 2VYNA 3GJRA 3GJQA 4OIMA 5B3JC 2EC5A 3WTCA 4FBGA 2H0AA 2QMYA 2R66A 4EO7A 5FUQA 3OOSA 5ELXA 3EGDA 4KV7A 2BR5A 5TQ0A 2I6UA 2OLEA 2FLVA 2WSYB 3CBQA 3KRTA 2E7ZA 4IDOA 2O8CB 4Z53A 3CO0S 1L7PA 3O4IA 3OURA 3Q9SA 4DCJA 4FJ2A 1XDWA 1HYBA 2GWHA 1LPSA 4DV1B 1UL1X 2XZLA 2BPOA 1LPBB 4HQFA 4M9RA 3NTVA 3NTRA 2Z9DA 2G17A 1E3WB 2GZSA 5AKLA 2ZT6A 1N1EA 4FGZA 4I1YA 4MR8B 4IQGA 2VDMB 1CRQA 2G04A 2YIDA 3D8RA 2AI2A 4B87A 2ECOA 1W85A 1RR6A 1C1HA 2IBMA 1EYZA 1ZUD1 4HJXA 1TJYA 1NDUA 4I6GA 4I1VA 4XUEA 5EP4A 4I08A 5JSKA 2IU6A 2YCBA 1P7ZA 1PBTA 5TQJA 1R5BA 4U4AA 1PO7A 1N9GB 1E2JA 2SCUA 3QLUA 4BVFA 5LP6B 4G0ZA 3CVYA 2PD6A 1O0SA 3DZJA 1HT3A 1W52X 1CHDA 1U2SA 1VZ2A 1BCSA 1DBIA 2D5BA 1ZNXA 2Q5IA 5F5XA 4HYEA 3TAXA 3KKMA 1IZ7A 4UD2A 1XJ0A 4YO7A 3LYUA 1QX4A 3F7OA 1WY7A 5HJEA 4RADA 3TLYA 3UAVA 3J80A 2CMKA 1LTKA 1MEJA 3Q7QA 1Q7RA 3NC1C 2HCTA 1INLA 4NOMA 1P5JA 5FR2A 4JVMA 3K0BA 1E3IA 2Q3CA 1C7RA 3ESYA 5FUXA 4HDAA 5JE8A 3UJPA 1JQLB 5FTNA 1A1SA 2B21A 3TI9A 4DIOA 3FR8A 5KJCA 4X1YA 4HPXB 3HLYA 3OCVA 2DUMA 2ZJ2A 4YCMA 1BRTA 4ZHSA 3H99A 4DV3B 4UPEA 4MWSA 1N25A 5J5CA 2HHAA 3RSQA 3VQTA 5BQOA 1QHHB 2IE0A 1XZMA 4FEAA 2HPHA 4DM7A 4P54A 1QRTA 1YR8A 2P9ZA 1GNSA 1TGYA 4H3KB 4Y8VA 3O1LA 2QGNA 3L0DA 3R0XA 3ZBPA 4LJKA 5M7EA 2IX3A 3TGLA 4GX0A 3TH5A 1ZS9A 2L69A 5I9NA 3IKJA 4LGCA 1I4EB 5KHOC 1DIRA 3A3YA 4RAOA 3KR9A 1E0DA 2O1XA 3CVUA 3OQMA 5K0CA 5DX0A 5CA1B 2CVQA 2JGMA 5LP6C 1VPLA 2A4KA 4RWZA 4XPIA 4PHTA 4YT5A 4YJ3B 3QQ5A 1FX0A 3EF0A 5AM5A 3PLRA 5DH9A 4NCHA 1YL7A 2ZTMA 3NUGA 4ZCRA 1H6CA 1SZPA 2QYTA 3E5RA 4WA7A 1B16A 3ZHXA 4KE7A 1A5SB 3O95A 2HYDA 5T8KA 4JJ4A 5HMLA 3ZWAA 4PO8A 5B57C 1Z25A 4OI0A 2R6R1 2YXNA 1HDGO 3LLUA 4DANA 2OCBA 3HN2A 4FVTA 2KHZA 1TKRA 1NUHA 4J0HA 4LRXA 3HKEB 4TLMB 5DN6A 1ULUA 3C3EA 4N0PA 4WNCA 4F5WA 1U2GC 1FMLA 1KK0A 1T26A 1AXRA 1U2DC 2NO7A 4FHDA 4IIVA 1S9DA 3HBFA 3CONA 3JARA 2IUSA 3LC0A 2Q4TA 2VSNA 3G8AA 4JIMA 3H2BA 4A6DA 2VJNA 1SU8A 4JKOA 4CM8B 2GK4A 1ECPA 2NT3A 2FZWA 4JR0A 4F86A 4KXVA 5JAPA 3EVDA 5F23A 1N2JA 3ADDA 3THSA 4LDNA 3EF1A 4M22A 3JU3A 4DQVA 5JFOA 1WW8A 3PXDA 1SIBE 3OF3A 3SQWA 3DAFA 4MJLA 4FP9A 4MQBA 1GNVA 5CIWA 5D86A 1CPYA 2WOJA 1PEYA 3CUUA 5DT9A 4D4JA 1AUXA 3AKDA 4DBLE 1IL0A 1BO6A 2VCEA 1BCRB 4YMHA 5B7QA 4F71A 2NG1A 3KK0A 3FCUB 5LYYA 4XWKA 5DXJA 4X1IA 4K81B 2CDRA 3GQBB 4WOKA 2FK8A 2NO9A 5H81A 5DCLA 4I4TA 1O5IA 1WNTA 4QJ5A 1KZ4A 2O48X 4LRSB 1ISHA 3ID6C 4M9SA 2OVBA 2VI5A 3A1SA 5EQDA 4HUTA 5ALQA 2VHVA 3GO4A 2C4NA 2IWHA 1VYTA 1K75A 4PLWA 6REQB 5KYYB 4E03A 1SMKA 4XYLA 1DX9A 4FDAA 3AYXB 2ABWA 1VP9A 2NN3C 3FHTA 5EHXA 3R40A 1XAIA 3IAAA 2QRZA 3W9UA 3B20A 4BFZA 4LHXA 2P6PA 1WQ3A 4ZWNA 4C4XA 3HBAA 3R3VA 4TXMA 3TX6A 3G0BA 4IOKA 1PIWA 3JX9A 4CUZA 4EKYA 5JBQA 3COSA 4P3OA 4S1VA 1CNEA 1XQ9A 5ESRA 5JXWA 4EI2A 2GSDA 2LR0A 2QLLA 1NVTA 1MQ9A 1MFPA 4ZU3A 3IA2A 1ZL2A 3BTSA 1JX6A 3IL2A 1HQYE 1WA5A 4ND2A 3ZZMA 5BR1A 4MW4A 1XYVA 3K05A 2A9FA 2B69A 2AH5A 3MW8A 1Q74A 2QHXA 2C8JA 3CKLA 5IFKA 5IPFA 5F4BA 2J9RA 4XASA 2VJQA 2IZOA 2OAEA 4IRMA 4P58A 1WZ2A 3IEPA 1DEOA 1VE7A 3IJRA 4C0XA 3H3JA 1GNTA 4P0TA 4UQLA 4EEKA 1NXQA 3AEUA 4MTCA 4O5OA 4TZKA 4CZ2A 4P4SB 2IEBA 3JY6A 1VLQA 3JZFA 4Q4JA 3OJWA 5EIBC 5HPYB 3HM9A 1ZBDA 5EMMA 4B9EA 5I45A 3MXOA 4MYDA 3MXTA 3A6DA 2EYUA 4B2LA 2A1IA 4YJGA 5AJXA 3EGWA 4MRSA 3ECSA 4YRLA 2WJ6A 3P32A 2AYXA 2Z5GA 2LWIA 4RKYA 4GWKA 4TLDA 2PIDA 1FL9A 2BOVA 4PYJA 1SUEA 1BJKA 3BH6A 5EWJA 4CIVA 2K6GA 2ZITA 1VLZA 2FCRA 1ZK1A 2ZBQA 2LV8A 2Q5EA 2VSXA 3NPMA 3R2JA 1TEZA 2X41A 1GGEA 4Q3OA 5JAOA 2ZK7A 4MKRA 4GLFA 4D97A 1L7RA 2G9UA 5HZKA 5I9LA 2H8GA 4D8TA 1ZQ1A 2WV7A 4A0RA 4E09A 3RVPA 3ICVA 3QKSB 3KQLA 3QLJA 4A9AA 3P9CA 4XUDA 1Q3KA 4RZ3A 1K89A 3DOEA 3VYUB 1NFRA 2R8BA 3EXIA 3IIJA 2BP7B 2WTUA 1PNVA 4M0DA 2E9SA 1LA2A 3ZW7A 3GVCA 4DJJA 3UJNA 3KBBA 2ZAOA 5GZ6A 1A4XA 3OCYA 3G17A 4X7MA 1AV7A 2W2VA 3W3AD 4HNRA 3GBVA 4C78A 3M6VA 2D1QA 3LHIA 3ZX5A 4UM7A 5LDGA 3IQIX 2CNWA 4Q34A 4RZQA 1CVRA 3DFIA 4P7FA 3S2GA 4GZ6A 3FBGA 3RUPA 3R3ZA 4F4CA 1TF7A 1ZRNA 1DV2A 4EB0A 5DP2A 4HFRA 2QS9A 3T5PA 4L6AA 4RL6A 5I4CA 2Y6VA 4FCVA 4IY1A 1FRFS 2OGUA 1U2ZA 1DDIA 2CMDA 2L82A 4MRMB 1ADBA 4DB4A 2VSQA 2FW7A 4G2TA 4QUAA 4B45A 2E21A 3ASVA 4EJ6A 4IMRA 3GEIA 1JKFA 3D3WB 3GDFA 3R77A 3S0JA 3WIDA 3U37A 4DV6B 1T1JA 1Z88A 4R3NA 4NBTA 2WLTA 1Q0QA 5J4HA 5JZSA 2VTVA 5H1YA 3CISA 3RIGA 2CFIA 4C08A 1RBQA 2P9GA 4OFZA 1NDQA 2H1VA 1AGYA 3NWEA 4KQXA 4BCBA 3WLQA 4EPVA 4ALMA 3PQFA 4LKOA 3FTFA 3FOBA 1SFRA 2G8NA 2CVOA 2QRVA 1YJ5A 3EARA 2WF7A 3ADCA 3DUFB 1U7TA 2N47A 2ZIXB 2QVCA 3B89A 3H97A 4R16A 5HA5A 4HI0E 4XYBA 3HNRA 2CK3D 2EL7A 1L7EA 5EY5B 1CRZA 4IWXA 4NAHA 5H5JA 3G23A 4D9HA 4N5LA 4POAA 3SLGA 4EG1A 3ES9A 3WIUA 4A8JC 1IZ9A 2VPXA 1NYQA 4KFSA 5HF9A 4EY6A 3RRMA 4PYLA 4ARBA 4BBPA 2F8SA 1FP2A 1LW7A 1QX3A 3O94A 2DUJA 5ADHA 5GPBA 4JDUA 1FP6A 1L7OA 3IALA 3INYA 5IU6A 2O2CA 4QUBA 3PHLA 3OO1A 3LRTA 3LPLA 5U4XA 2EF1A 3QBTA 2M9MA 1Q14A 1ST3A 2W43A 3PCXA 4UQPA 3D8BA 1F0PA 3KWMA 1U6KA 2C97A 3BYZA 5EKXA 1JYSA 3RTAA 1JWBB 2C04A 4MVJP 3KTAA 2HWKA 2ZJ1A 5F2KA 1E58A 5JJKA 1JHXA 3VTFA 4O4JA 1HC7A 5EOVA 1CE8A 1Y63A 3V1NA 3V80A 2CE2X 3PDCA 1DFHA 1NG1A 1O54A 1RLUA 2BM0A 2PX3A 2YHSA 4JR2A 4KDFA 4TS9A 3C97A 1VXOA 1WDLA 1SUWA 1RPJA 4FT2A 4BRWA 3QXHA 3I6MA 3TJRA 2PUBA 3VPSA 4PRKA 3O21A 1YACA 4TX1A 1JEYB 3KT6A 3ZY5A 4J43A 4RPLA 3BCHA 4PQEA 4R51A 4RMNA 2WC1A 2HQOA 4QREA 4W99A 2QYHA 2HUNA 4WRRA 1B6RA 1IXSB 2GCOB 4RSHA 2PX8A 3S2ZA 2H9AA 3M4NA 3K0FB 1EDBA 4JBLA 1GZDA 3HFJA 2BONA 1YJ8A 2W6NA 4RVGA 4ZYXA 2OE2A 3Q6NA 4G36A 2CW5A 3D2BA 1EAYA 4C0LA 3DE6X 2PVPA 2YBDA 1RRKA 3ER9A 2XVXA 3KQSA 4FCCA 4WFQA 3V7NA 4AUKA 4B33A 3DOUA 5FEMA 4BVEA 1YDFA 3PI6A 1KYZA 3VNUA 4FFBB 4OB6A 4EG8A 4RD3A 3TL6A 1PQYA 4KWTA 1X39A 1TK9A 1P4JA 3PFIA 3S55A 1JE0A 3BQMB 3AF2A 4RD1A 1C1DB 5A1TA 2FE1A 1T8PA 1AQIA 3H4TA 3LZ6A 4PWYA 5CJPA 5CNKA 3WYDA 4CFSA 3R8XA 3ZV6A 1SJ9A 4L8YA 121PA 5ESXA 3OLXA 5AVVA 4R2MA 4LOLA 3TLGA 5LBTA 3ZDDA 3L84A 4FNMA 3IOYA 1EFRD 1VDMA 3D6HA 1I32A 4N3BA 1JTFA 1CUFA 1XTKA 1ODIA 1T1EA 3QBEA 4PHHA 3TW8B 1X7YB 3FOWA 3WZ2A 4JT8A 4L0DA 5BWCA 4NBKA 1R3DA 1DJLA 2O5CA 5GY7A 2PWYA 1AX9A 3HP4A 3INRA 4FHGA 1BKSB 1TO6A 1X7ZB 5K3AA 4L6CA 5LBIA 3WL5A 3P97A 4EDHA 1SHJA 2YQ5A 3NI2A 3TZQA 3VPHA 1W36B 4UBIA 3W4KA 1H4VB 1RWMA 5EMNA 1CUSA 3E7PA 3PYLA 2DUUA 3VHXA 3DDNA 3H8WA 3WZMA 3UAOA 4DT1A 4P4NA 3RE1A 3TUJC 1VIDA 1WUIS 2W2NA 4A8TA 5ICSA 1ZUIA 2AUTA 1K7EB 1Z4NA 1KNQA 2VRWA 4QPZA 3IBFA 3OTOB 3C3AA 3ZTWA 2HJVA 1NWHA 1PVOA 2H7CA 4O2BB 5DVZA 3TE7A 2VHQA 3HYLA 2G1KA 1W94A 2XNSA 4Y98A 1YHNA 3W6UA 1QFSA 5DLPA 1X6VA 2L18A 3ZQUA 5EERA 5GAJA 2R7LA 2V7TA 2ZBPA 2P5YA 3R0IA 3RC1A 1D4AA 1FOEB 2HMYB 4AIIA 4AS3A 1KFEB 2VYND 1XDSA 1MC8A 3A4NA 3CT6A 5TVGA 4LDAA 3RSOA 2JG3A 3GLFB 1NX6A 1F2UA 1X1RA 1UPTA 4I81A 4PW0A 3JQGB 1AURA 4RFLA 4ZU6X 4CEIA 1HKUA 1U5AA 3PWSA 2F8MA 3DKKA 1R64A 4A10A 1NJSA 1KJQA 2VOEA 3OQVA 3FUTA 4DEYA 3X2FA 1CF9A 1VECA 3GBPA 2NXCA 4W1RA 4M9CA 3EVNA 1W36C 4LA4A 1QAQA 1Y33E 1E5VA 4HGQA 4R8KA 3IVCA 3TLEA 3KAQA 2CY0A 2CZQA 2DTEA 1C0IA 2BI7A 2XDQB 2ZS8A 3AG5A 3ISVA 4EG4A 2Q28A 2A0UA 3FZQA 2E0IA 5KX5B 4PEVA 1JFTA 4OXXA 1Y6GA 1CF2O 4G84A 1H9BA 2H1WA 2AT1A 2V5AA 3NHPA 1P6QA 1ZI9A 3IP1A 3FCAA 3JSXA 5B3AA 3FPFA 5IUNC 3A31A 4X20A 2HU2A 2ZCJA 1W4BA 1LRKA 2DWUA 2QR2A 3TDNA 3I9LA 3QJ5A 4TSFA 1OLXA 5JD4A 1PS9A 2WFMA 1WAMA 4MWGA 3E7WA 2OBLA 5GIPE 4B3MB 2HF9A 2H1CA 4F6RA 1C3OA 4D1YA 4GSKA 3DLAA 4K6KA 1KOLA 3OPMA 1D03A 2NT4A 3EGXB 3W9YA 4D8WA 4R81A 2C9DA 2RH5A 3BMQA 3N6RA 3DC7A 1ZZGA 2FEWB 4JU9A 4MWTA 4N8DA 4BS9A 4DSAA 4YQFA 4HVAA 1KI2A 3JVVA 1TZCA 4ZA2A 3W1WA 3H2ZA 5A06A 2RGBA 4K6HA 2XTZA 2YHIB 2FNAA 2QN6A 4L16A 2B30A 4MWCA 5AIAA 1YZKA 3UBMA 1KOFA 3WLOA 1ELOA 5CDFE 1IBMB 4XQ0A 2HF7A 3GRCA 3OVMA 1P9RA 3KB8A 3OQ1A 5KYNA 3AVWA 3C8MA 4CL0A 2QNRA 1P1RA 3S29A 2OAQ1 2ZYHA 1AM4D 4HVTA 4US1R 2QD5A 4U8HA 5CK4A 3JQ9A 2ZE7A 5DGHA 4F60A 5FBHA 2R48A 4X95A 3HCOA 4M1SA 1O6FA 3U31A 3MWYW 1D0SA 2ATIA 2Y1DA 3JWGA 1I2CA 5DNEA 3RREA 3DL4A 1GTZA 3D43A 421PA 1BDIA 2EX1A 5E4YA 8MHTA 3GN1A 1H2AS 3Q87B 4XGRA 1ESNA 4Z3DA 5IYZA 2ZQZA 4MA0A 2PN1A 3GFTA 2WK1A 4N0MA 4HV4A 2VRCA 2BMDA 1ORDA 3QMWA 1UFQA 1XKTA 1O89A 5BSUA 4JNKA 3KXIA 4NMWA 3LUFA 2UVQA 1XRQA 2PAFA 2WE7A 3DHEA 1S2MA 1ORIA 1T2UA 4B3RB 5DN6D 1ZINA 3GK3A 5TSDA 5DO9A 4C22A 2VDVE 3A27A 4DKXA 1R6AA 4J0JA 4PFJA 1A8PA 1G4AE 2ODNA 3D0RA 3HJUA 3PC7A 4GKKB 3NNDA 1SUIA 1A71A 4BYMA 4KHZA 2FPGA 3GFPA 4QG7A 3MLEA 3K72B 3IVGA 1ADFA 2CVHA 1WXGA 1YS2X 4CLRB 2VTBA 3QMMA 1NOKA 2YVKA 3O82A 4LJRA 3FD8A 4LNHA 1E9RA 4EPTA 4BNFA 3GRUA 4H59A 2H2IA 3ASYA 3GJYA 3GC6A 5IAAA 4MTLA 2GYWA 2C3PA 4BQPA 2I6SA 2GKSA 4IDDA 1FJXA 1VC2A 2JHFA 1BHQ1 1Q19A 1VL1A 3BD7A 3ZDBA 1T1RA 5L6LB 3EWSA 4Y2GA 4Y2RA 4QQRA 1FP7A 5LA6A 3JQDA 3SK0A 1T5IA 4X0EA 4YRIA 5B6PA 3TX2A 3O3NB 5CM9C 2IY7A 3TMAA 2YIVX 1G21E 3NBUA 5FO0A 1HEIA 5AKIA 4NOLA 1UMDA 1TKAA 5HQJA 1P7CA 3CGWA 2JGLA 5IMBA 2WVAA 4Q4CA 3H11B 2YUIA 2Q5QA 4GUDA 1GAEO 3ZLUA 3EUAA 1G0NA 5GWXA 1T9AA 2ZUWA 3ETDA 1IZ8A 4KN9S 2XB2A 1BXZA 2F1KA 1NX9A 1RAHA 2JK0A 3EDRA 4QBKA 3L07A 3TLJA 4M1YA 5NULA 1E6UA 2W2LA 3LT1A 1L0BA 3L40A 3OZXA 1NQVA 4XQGA 5FBWB 2IV3A 4EUEA 3KZMA 3CBGA 1GV0A 1PJCA 3KT3A 3KVOA 4YWHA 1D6JA 5LVAA 1RRGA 2QSYA 4FFRA 2B4YA 2O23A 4O6VA 3NT5A 5CYOA 1A5ZA 4PU0A 3DZDA 1OWPA 1TL7C 3C14C 3OT1A 3W2TA 2ZTVA 3KP1A 4IDHA 3PFHA 1O3YA 2WIBA 1HYHA 2O3UA 5DGCA 4HFNA 4YV1A 4RXMA 5LQSA 2NTJA 1DAMA 2NZ2A 3QYFA 1AO0A 3AVUA 5LQJA 3ORQA 1JE1A 5ER6A 3A2LA 1SOUA 4C7OA 2B3DA 3A3KA 1FRVA 3VZBA 1PWZA 3EIQA 1D9XA 3VZCA 3UOGA 5F2OA 2PT7A 1LJUA 2GBLA 3L1UA 1NMSA 3KU4A 1XUOA 1L4NA 3PU6A 4E31A 1PJTA 4KX5A 3P9IA 4ZOLA 2WWXA 1WY5A 1Q50A 2ASVA 3MRTA 4OXYA 5COBA 3PUYA 2W2XA 1RXVA 3CLTC 2D0IA 2QUZA 3AEZA 3CSSA 3DO6A 5DBEX 4QHSA 2ZRFA 3K70B 2G1JA 1Y7TA 1KAGA 1X0VA 4QUKA 4NU6A 4MW6A 5EP2A 1NQWA 3BTUA 3HJCA 2WHPA 2C9CA 1YS6A 2HM7A 3B6KA 4FLFA 2PKXA 4TZTA 2EWVA 4A0QA 2ACEA 2O2EA 5LWQA 2ZDQA 1TTQB 3CGGA 1MRSA 2JASA 3H1TA 5AKYA 3MGAA 3HABA 2YNMC 4AVYA 1K6JA 3OX4A 4IO1A 2W0MA 4D98A 3UPTA 1LPMA 1ZZEA 5A5FA 3ESRA 4HYTA 3N2GA 5D3ZA 3PB3A 4J0EA 4ZZ2A 1FNNA 1Q0UA 3OPVA 4Q6BA 1R0XA 2V9PA 3OZAA 2H3EA 5BR4A 2PMBA 3RC9A 1AUVA 2BCEA 4TUYF 1NP6A 3VPGA 2I3BA 1NQUA 5I7RA 3OZGA 4YRAA 4G09A 2JI8A 1AKVA 4NYJR 4M2LA 4PE5B 1VSBA 1G3MA 1PAUA 2XE4A 2WTNA 2H1FA 2H1RA 2FHPA 2Y0DA 1CR6A 1IE3A 2A8YA 2LDBA 2QDKA 3IAFA 4R9VA 4S1TA 4EG7A 2YOHA 4YLYA 1KEKA 3I53A 4NH4A 1H2RS 1EWKA 2Q3JA 5MN4A 3ANMA 1KDYA 2WTEA 4Q4AB 4WK4B 3AOGA 1L6RA 5ULLA 1LBIA 2CNWD 2XNKA 1MENA 3S2SA 3K70C 4NJEA 2P40A 5AXBA 4MR7B 3U7QA 4F8YA 4UDNA 2JLRA 3O0TA 3RPEA 2ID8A 2NWQA 4NVRA 3ZDAA 3TR5A 5JVDB 1KO4A 4CM7A 4ROTA 3CVVA 4L27A 1X7XA 2GJSA 4QXPA 3BX1A 3OH8A 1M6HA 3D6NB 4ZTZB 2HA4A 3AJEA 3FETA 2EW1A 2HRQA 6GPBA 1Q1BA 4NE2A 4RK0A 3U7RA 4EB3A 3G7NA 4Y9UA 4DIDA 4DA4A 3SYLA 5LXTF 2OG2A 4LBWA 4J49A 5H0IA 3OHSX 1VA5A 3T4XA 3QFFA 2P6RA 3O2QB 4UPVA 2O0LA 1QVZA 1OXXK 1X1TA 1P7YA 3Q7IA 4TXHA 1AZLA 2H29A 5L3VA 4GOJA 5K3FB 3GVPA 4IDBA 5CAEA 4G41A 5SYNA 4G5YA 2OV2A 4A0SA 1NOJA 3OLZA 1NVKA 4JR1A 4EAAA 3K1TA 2X4IA 3FNHA 1U7DA 3LCVB 2VXYA 2AQHA 4CI0B 4FXOA 4ME6A 1NVVQ 1DDGA 1II8A 2WWGA 3PNQA 4KIGA 5G40A 2OA0A 3SSOA 4CF3A 1W4ZA 2RHLA 3JD1A 4LNUA 1C7JA 5GTDA 3VI3B 4WZBB 3NDBB 5DI3A 4M6WB 5AJYA 2Z0MA 4ODIA 4ESOA 5JFTA 1WMAA 2Q62A 2Q99A 3H5IA 3P2JA 5JZVA 1WB9A 1UFVA 1UQTA 1CV2A 4RQTA 3QX7A 3WMXA 4M0FA 1YQ9A 3UWOA 4BQSA 3AF5A 1F51E 4F2WA 2JLQA 3OHMA 5C8XA 3Q8WA 3RHTA 3AUXA 4CIWA 2JJ1A 2ZYAA 4MMYB 3NHRA 5IXSA 4PXYA 1UOQA 1Z06A 4NK4A 1JPVA 2RBEA 3N9IA 3ET4A 3GEEA 3ICPA 4HVCA 4ZZ3A 2H08A 4FWBA 1W581 1F2DA 2GM3A 4DLRA 3E2PA 4JQOA 5K0BA 1XJCA 4NP6A 1G9XA 5D6NA 1NMZA 1C9YA 2PZLA 2Q2OA 2ZU6A 4M9QA 3O8BA 1PLJA 1RMYA 3BD8A 3MK31 3G0OA 1FDIA 4FZ5A 5FBRB 4ZHQB 4YCSA 3GMDA 1UOPA 4IKEA 5EVJA 3PTAA 4BMZA 1NIPA 1RCTE 2MINB 2PU7A 2WU1A 3DMHA 3FPSA 4JGBA 2QMQA 3RROA 3RRYA 1SOWA 3W6ZA 1GP2A 3AY3A 1CYDA 5K0FA 4COKA 3BIJA 3HY3A 1CZNA 3VSCA 4F93B 2LIPA 4URXR 1PJRA 1QGED 1RHKA 1Z2EA 1JMVA 2JFBA 2WD8A 1D2HA 1II9A 2GPWA 2OHXA 2OPBA 2QROA 1SUFA 4F38A 3HYTA 5AM3A 5J2TB 1F6WA 4RL4A 1MB3A 2GRUA 4GKAA 2OK8A 4QJ4A 1LZKA 4A1FA 2GT1A 1NXTA 2YVLA 5DISB 5K0ZA 1BAPA 1A9OA 5JWOA 6AT1A 1EXWA 3FTNA 3PFCA 3VDQA 3EVGA 3OZFA 2QRNA 3N87A 3IHLA 1CR1A 1P9WA 1A96A 2Z8YA 3DEAA 2AMJA 2AWNA 2G80A 2TMDA 3MMXA 1E3LA 3Q3GE 5DKFA 5KNBH 4MI3A 2GXAA 3IJ5A 4J2OA 2XCQA 1N4DA 3A6HA 4P4GA 5K3EA 3RYHA 3THYA 3H18A 3MGBA 1NF3A 2XZDA 2O1EA 4BGVA 2QT1A 4CQNA 1L5KA 3GHYA 4DR4B 2F2TA 2HMUA 2KW5A 3DTYA 1JDTA 1JQAA 1SKAA 5C34B 1R5NA 3L4BC 3O6VA 1PFKA 4EY7A 5B4UA 2LPMA 1TLLA 2C61A 2MSDB 1RC0A 2SICE 5ECGC 3DF9A 3QKRB 4MI6A 4NNOA 5AD1A 1JIUA 3UT5A 1SXPA 4TVOA 3E58A 4PM4A 5GVSA 4LYHA 2J6IA 3WWOA 3IEUA 4N5IX 1IPEA 4Z4GA 2HIAA 4H4CA 4GH5A 3TSCA 2BLNA 2P3LA 3INGA 5HIKA 3WYCA 5KCZA 3N0WA 3VPAA 4D4MA 4Z1MA 1YCDA 2FP3A 1HX7A 1ZGCA 2OHIA 3E9CA 3NWBA 3CE9A 1CIVA 1WABA 2QVYX 2J8ZA 3ZDCA 3LQRA 2BF4A 1T2FA 4PYOA 4V0ME 1HL3A 3BE8A 4KH0A 1U9IA 3VOBA 5IBQA 3URMA 3GRFA 5K8JB 3G0CA 3LWDA 4FE7A 3HVKA 4OHUA 4ZYWA 2CXUA 1MX9A 2BZ1A 1JT9A 1PKXA 1Y5MA 3NRCA 4NFYA 1T8UA 4R05A 1WLSA 1V6SA 2OCKA 1CSEE 2ORVA 4XM2A 1ZOLA 1AIPA 2DFTA 4IJQA 4XYGA 5KCMA 5I3CA 3F8TA 1C81A 2ONKA 1NONA 3BD6A 3T1VA 3UWKA 3X43A 2FSPA 5BNIA 5DM70 1VGQA 3SJUA 5BN3A 4FYJA 2D2EA 3A9UA 3HWRA 3SAJA 1JQDA 2QQEA 1XVLA 2GA8A 2I76A 4KVAA 1YZLA 1TC2A 2CCKA 3WIEA 3KJHA 3PKJA 3DGEC 3PHCA 2P9TA 1C1XA 4LY9A 3ENKA 3LQ1A 4FMPA 4RJLA 1KDPA 3QIAA 1ISFA 4MWEA 5U4QA 1RM5A 5ERYA 1OPRA 5J63A 4DIBA 4QLAA 1EFCA 3DEJA 3ONNA 4G8CA 1KK2A 3C0KA 1QK5A 3MWFA 3QJYA 4ZZIA 4E30A 2AFHA 2BBSA 4ZO6A 1E8DA 4DJFC 1QB8A 5C1OA 3ITKA 3NHSA 4HUQA 2FAXA 3EZ6A 2YICA 5KNLA 2E89A 2BDUA 4KXNA 2QPOA 1RWKA 1C4OA 5L8VA 3V2HA 1CQIB 2R47A 4EGAA 1X19A 1YJCA 3IC5A 2JDIA 4NATA 2J9FB 3U5ZB 2FW0A 3T7AA 4NBLA 2EKQA 2QGFA 4JI8B 4J4TA 2WA2A 1ZM3A 4A6PA 4PBRA 2NZJA 1SUDA 1TO1E 2J0VA 1M1ZA 4BNUA 4BO2A 1IU9A 3UM9A 4IJMA 1NVGA 2FP4B 3SEQA 1QP0A 1Z6QA 2FYTA 1YGYA 1II0A 1ORVA 2ATXA 3LGXA 4TSFD 2QIOA 1IZYA 1MO4A 3GLQA 3SHVA 3VHLB 3ZWOA 2F3QA 1RZRA 2I99A 3SC2B 3O9MA 3QH4A 1KPHA 1QFMA 2R85A 3K4HA 2RHBA 4C4ZA 3VKFA 1WD7A 4G89A 4AKGA 5KKCA 5ALJA 2AN4A 1PD0A 1GN9A 4E2FA 3R5SA 4UNRA 2ZJ4A 3HKBA 5CT6A 2O7QA 2KQUA 2QRMA 1BN6A 1LI5A 4ZYUA 1KAQA 3TTUA 1WX1A 4ZTUB 1BMFA 3KHSA 4H0NA 2OD7A 4IGAA 2ZR0A 2JGKA 3BIFA 3OLQA 3WDMA 1ENYA 1K8RA 1W0KA 3L3BA 3UB2A 2ZB8A 2Z4TA 3SEFA 4H3VA 3VNAA 1HDYA 3WLNA 3X1MA 2BSXA 1YDGA 2JGIA 4UNIA 1F06A 3PUIA 4FW9A 4GLLA 4C6RA 3VR4A 5BPFA 3I1YA 4YBRA 4KNYA 1JH9A 2E2WA 1EJ6A 4EFMA 1W29A 1XZKA 1ECBA 1G5IA 1QK4A 1UK9A 5L7YA 5DRTA 1RWBA 2CXSA 1Y48E 1WBDA 4XTCS 3Q8KA 5KQGA 2J48A 3VSEA 1Z0KA 2XTJA 1W5FA 5DIZA 3QOWA 4LJSA 1AMUA 3H16A 1T8YA 4WERA 1CEQA 1E3WA 2IHUA 1NQTA 4MR8A 4TWBA 3CMCO 3I32A 2FWJA 3L1VA 3ROPA 3W5UA 2VRCD 1WZCA 2NTNA 3MTIA 1GQ2A 5AWFC 3M6FA 2IFTA 2HX1A 2QEQA 4P98A 3L4KA 2YXLA 3GZJA 3QHPA 2C94A 1PJQA 2NNLD 3UH0A 1G21B 1B2RA 2CLOB 2W4QA 2D54A 1OBVA 4OO3A 2ZQYA 4JA0A 4FDMA 1JQ5A 5F98A 1N9GA 1GADO 3TFWA 4B6PA 3QXJA 1F5SA 2X5OA 5ITWA 5LP6A 3Q8LA 1P2UA 4DDTA 2OUKA 3COPA 5K6RA 3SDSA 1PI3A 2BM9A 4KR2A 1CR4A 4EK9A 2VZLA 1HE5A 3OQIB 1CDEA 5C8DA 2IYOA 4R8MA 4QEZA 2J4CA 3FHOA 3EPHA 3GPIA 3PUWA 4N76A 1LQTA 4J1SA 4XD2A 3G02A 1BQ4A 2R6JA 3IB3A 5IC4A 2EVWX 2WB4A 4JSTA 3M4YA 3EC1A 2BMJA 1YRLA 2JKVA 5CPFA 2AG1A 2XCTB 3DZFA 1WUKS 1RHUA 3A3PA 3AF3A 2JVKA 3NAMA 4QEKA 4RTJA 2YYYA 3CRVA 3VU3A 1WRBA 1P44A 2ERYA 1YKGA 2QQ0A 5TS3A 4B31A 5LMNB 3ZGZA 1QHHA 1XTRA 2H9YA 2OXTA 4U00A 3LDUA 1A04A 2FZGA 2GARA 2PFKA 2NUAB 1N0WA 4M1KA 3T7DA 2VQ3A 2O52A 3SXUB 5JNUA 1XB2A 2WSMA 4PTZA 4BMNA 1YHYA 2ODEA 2ZTSA 5CCXA 1LVGA 2GVZC 4AURA 3WK6A 3N0RA 4FB4A 1TVEA 2XGOA 1EP2B 1CJMA 2WINI 2EGHA 4YJ3A 3SJ7A 4DY6A 3OE7A 4TKMA 4L5BA 4UTVA 1UC8A 1OFIA 4FLEA 1WWKA 2D0DA 3PNYA 4IYJA 4MJ3A 4EJFA 5KC8A 4NFHA 1N6OA 4NZ9A 1ULAA 3P9YA 2I2AA 4BMVA 1NW5A 2PANA 4YCCA 1WKCA 3O8QB 1QZUA 1SXHA 2REQB 2CZCA 3K5PA 4GRIA 1XLVA 2CCGA 3LFHA 3PT9A 5KYXB 3W78A 3HKEA 2VP4A 5JFGA 3VJMA 3WRVA 1L9XA 3A9WA 2C9OA 2MYNA 3H9UA 4DDWA 1DELA 3LE8A 4ZVNA 2BTEA 3V46A 4IRXA 1E7RA 4RVCA 2I9PA 2HRDA 3TBHA 3ZNOA 4CM8A 1I6MA 3PFGA 1KI8A 1I1NA 3UAZA 2QRUA 5AW8A 3A4VA 3EIFA 2IYYA 4LRYA 4OFBA 3KEMA 2X7XA 3A25A 2YWCA 3G9TA 3RKSA 4O02B 5HE8A 1ES9A 1Z2DA 2WNIA 1XO1A 1EZZA 3DLPX 1QV6A 1YCFA 4IVRA 5D1NA 5FLYA 2Q4BA 1KERA 4JS0A 3W06A 3WISA 2GZHA 2ZBUA 3L0PA 3ZNNA 3PHBE 2H4YA 4UVEA 1QMGA 3QE3A 4P4UA 5DK4A 1BCRA 2WAXA 1GIAA 2Z2KA 1NUQA 3K3PA 1HKHA 2GTIA 2I4NA 2Z2ZA 5CR9A 3GQBA 1V8FA 2B2NA 3EDMA 5JIBA 1DMSA 5THKA 2WT8A 4HR7A 2O2ZA 3ETHA 4QATA 1TK2A 4DG9A 4E2WA 1SBYA 1ZI8A 2PWZA 3AB7A 4QGAA 2AVNA 5HKBA 5AK4A 4AIRA 2BFAA 4ZQFA 4IAOA 6REQA 1I4TD 3E23A 4H7PA 5KYYA 2YWGA 2JLAA 4H60A 4IUYA 3VBEA 1B74A 1JHYA 3O03A 3RNOA 1CP3A 2X9QA 3GFFA 2F90A 5AUPB 4X8MA 2DHEA 1QK3A 4G5FA 3ISJA 4MIYA 5B1IA 4AYTA 3HVRA 4OX9B 3AW8A 3CNLA 1FVHA 4XWOA 1UKEA 2OMKA 5AM1A 3HXTA 5E1MA 2HSGA 3RV3A 1SR8A 3Q3HA 5H9VA 4C29A 4TT3A 1T36B 3OIWA 1HFWA 4QPCA 3ENZA 2QRQA 3MINB 3NKFA 3TEMA 2ISQA 3GR6A 3QF4B 4RVSA 3LBNA 4KYVA 3UEOA 1V1JA 2A1TR 1U9JA 4LJ4A 2PXXA 4UARA 1WDTA 2GEFA 2R86A 4MHTA 4XKJA 3S7ZA 3DNFA 2IUEA 2V54A 2YRWA 3N07A 4YP1A 4PZEA 1XZJA 5JEDA 3PX7A 3BWVA 3RFXA 2W0SA 4PYIA 4ZGWA 5MGNA 2HWXA 4IMIB 4BTVA 1IM8A 4QSHA 4BEVA 4I2NA 1J9EA 2XPCA 1ZMTA 1REQB 4CHGA 4Q3DA 5K20A 1E3DA 1TU0A 3U44A 3SIWA 3S2YA 4GNKA 2KYRA 3LECA 5FYDA 1PFVA 5TMBA 2BUAA 2F7SA 3C48A 4UXHA 2IS2A 2R4UA 4JJIA 4P4SA 1SG9A 1UXGA 2A5LA 3IS3A 2G8LA 3N3BC 4MHOA 4KGVA 3LNCA 3RVOA 4BU1A 3DOIA 3UA4A 3L8HA 4L5YA 2NV0A 2C78A 2QW0X 1BS1A 2ZE5A 2D4HA 3TPCA 3BB4A 1UCFA 2OHHA 4KBFA 4Z4CA 3IAM6 4H1HA 3QPVA 4AUMA 3RSZA 3SHQA 2VFAA 2VDQB 3OT4A 4Z4HA 1EAMA 1P73A 3IPCA 4BCCA 4X5OA 1K7SN 2GO1A 5JMWA 2HJGA 3QBVA 3Q40A 3RIHA 1GZ3A 3NM4A 5C1IA 2O06A 4TV9F 1PTJC 2BKEA 4G5QA 2JI4A 4JXZA 3OFJA 3MPUA 2DWPA 1YB7A 3LM8A 3NVKI 4J0DA 1Z0IA 3J7AC 3G2IA 2EBHX 3UMSA 1FPQA 3KE9A 3KELA 1ZJJA 2BP7A 1FBTA 1KI1A 3WKBA 4O2AB 2P3SA 1ZGBA 4FHCA 3UV3A 1DWUA 4WN3A 1YQUA 5FUMA 3DEKA 3SS7X 2JH8A 3X1KA 4CI9A 2R2AA 3EY9A 3N05A 4HGRA 4J94A 3RF7A 1CRWG 2GUWA 4C0JA 2I33A 2XQGA 2CUZA 3JCZA 3KKNA 3T3EA 1NTRA 3HB1A 3AI2A 1JHDA 3W9BA 1U0TA 5K4GA 3PC2A 4JP3A 4PLVA 3LLCA 2VF8A 4JLBA 4IIDA 2YMMA 3UAGA 4AZWA 3ZD6A 4LXQA 3D5EA 2YCLA 3BFJA 2I8AA 2XA9A 2PMKA 2GD6A 1SC4A 2W5UA 3LI2A 3PV0A 4Q47A 3TSZA 1JVSA 2V45A 3LVFO 1YS4A 2R8OA 3HFRA 4URYR 1OAOC 3EQ9A 3SOZA 2Z4RA 1I14A 4BVAA 4B44A 2D8AA 2P2SA 1NLFA 4DQXA 1A9TA 3D3WA 4PYMA 2A9JA 3BE4A 3WQQA 1IJBA 1Z12A 2VDPB 4FMDF 1Q7BA 1XFAA 2LP4Y 1ISSA 1E0KA 2PT6A 5KAPA 4AP5A 2O57A 3DVRX 1NIJA 1T6ZA 3PNKA 1M0SA 4P6VF 4IGKA 4MROA 1N2CB 3QKTA 4ZQEA 5FPQA 3U5TA 2EG9A 2HR1A 5A62A 5J3JA 4YR7A 3HG7A 4OA8A 1KXJA 5ANRB 2I5PO 3N86A 2E1PA 4XXHA 3DUFA 1YASA 2ZIXA 1NBAA 4M1TA 4NJOA 2QTBA 2ZROA 3DTVD 1I0LA 3BA1A 1DHRA 4TT8A 5F51A 2IS6A 4OJQA 1I3OA 4V0OA 4Q1AA 5AQ1A 2X2FA 4URUR 5EZYF 2V6FA 2PWBA 1YAJA 5EJMA 4IX9A 1L1EA 4G67A 1MORA 5JOQA 2IX9A 4TTTS 4K9RA 1JHRA 4JI2B 3S5JA 2CJYA 3GJTA 1RLIA 5IT4A 3VNQA 4GL2A 5BR7A 4WY8A 5EN4A 4B81A 2ZM5A 3CZMA 1JG6A 4OA5A 1U5BB 2WIAA 3JYLA 4RQBA 3DKIA 5BSMA 3ZK8A 3KB6A 3L7AA 4BO7A 1WPRA 4C43A 3TR6A 1JJ7A 3CZPA 2ZSJA 3VKGA 2JIPA 1MVOA 1R5OA 3R7NA 1CUYA 1VQ1A 4B43A 3AV0B 2ZRHA 4QPDA 3SYNA 2EIXA 4E1AA 4JLKA 4RHUA 1KE2A 4QFCA 1K9VF 1JA1A 5EJIA 1EM8B 1B23P 5CURA 2F3RA 4IJWA 2H1HA 4KK3A 1NSFA 2ERCA 4HDSB 4YDHB 4WAUA 1X1SA 5IK2A 1PZEA 5A7FA 1GU0A 1UODA 2B8WA 4FX2A 5DASA 1N8NA 1B8OA 2I8CA 4OGGA 3RVDA 3IVMA 3V3KA 5IZ4A 4MV5A 5EJGA 2IEDA 1T34A 4GNRA 1KZGB 2ZTUA 2OV4A 2XI4A 3K20A 2IF0A 5EP3A 3BSYA 3CUTA 1DAHA 4FSDA 1ZNWA 1QYVA 4Q9LA 4GPAA 4KPUB 2GCOA 1QH1B 1Q83A 3DAGA 3B6EA 3K0FA 3NJ8A 2ZBGA 2DGDA 2I71A 4WBNF 5CB8A 3R41A 4IICA 2H6EA 2PV7A 4BO3A 3GIWA 3OQHA 4R54A 5EJ7A 4NBNA 1WLYA 1BYIA 3MBOA 1YSCA 4NEHB 3AQIA 3FUVA 3GXBA 4LXXA 4RQUA 4CM5A 2ZP1A 4PGAA 2XWBF 1Y3FE 1A7AA 3ER6A 4KX3A 2YHAA 5I3ZA 2CF5A 1PHPA 3UMYA 4DUYB 1QQAA 2AZTA 2QU7A 4FFBA 5NLLA 2IITA 5AI9A 5KNDH 4CIXA 2IDZA 4Q37A 4GM0A 1V3QE 2J33A 1XF9A 3NOQA 3R75A 1HNZB 4Z8XA 4ZI2A 2C58A 2EBWA 4X66B 1C3JA 1C1DA 2HIHA 1OGIA 1CUCA 1SCIA 1JDUA 3PKIA 4P0PB 3D3NA 4Q3CA 1NN0A 5E38A 3DOFA 2DPHA 2C83A 3N0VA 1V7ZA 2EFYA 2JDID 2LGJA 2WJJA 3O3CA 3H05A 3RUAA 1BOOA 4B0OA 4BP9A 4CR8A 1SVMA 4HNSA 1TM3E 4C4AA 3A2NA 3OZBA 2F17A 3CNHA 3C1OA 5K8UA 1Z74A 1AQYA 3LJKA 1X7YA 1N57A 3TW8A 3RJMA 4E14A 5IDQA 4PGHA 4KIJA 4RTSA 3X3HA 3LDHA 3EVCA 3BXEA 4PAQA <