4KRYA

Structure of aes from e. coli in covalent complex with pms
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
317
Chain Sequence
KPENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYTLERRFWNAGAPEMATRAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational analyses of Aes, an inhibitor of MalT in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Acetyl esterase
total genus 115
structure length 317
sequence length 318
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.-:
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kryA00
5IVIA 4DMFA 4H7HA 5IH7A 1QLWA 5ALSA 3E3AA 2J3QA 1CUWA 2OQVA 1JJIA 1TRHA 2VJAA 5AK6A 3I28A 2VSQA 2WTMA 2X76A 2C0PA 4LKOA 1YA8A 1MT3A 4Q3LA 1YS2X 1CEXA 4DLNA 4UBIA 4N5IX 1JFRA 1F0NA 4F5ZA 3FOBA 2B20A 6YASA 2WHPB 1MPXA 4H0CA 4J0GA 5AI9A 1ORWA 2XUJA 2HU8A 5ALUA 3FNBA 5DNVA 3OURA 3H17A 3DKKA 3D2CA 2WUFA 4TPKA 3V1KA 3HC7A 1WHSA 5C81A 3K6KA 4FLFA 2ACKA 1Z68A 4Y2RA 4ROTA 1XROA 3GBSA 1SFRA 3I2FA 3WYNA 1BN7A 1EA5A 1EDBA 3CN9A 3I6MA 4ZGBA 2J3DA 4WFIA 4Y2PA 4TGLA 3WJ2A 3WWOA 4Y2TA 1U8EA 2OGTA 2ROQA 3WYDA 5C8VA 3G0GA 4GECA 2VAXA 1Q0RA 2WUEA 5AI0A 1ISPA 2XDWA 3IA2A 1UZAA 2GBFA 5AM2A 1WB6A 4UBLA 4QLAA 3AJAA 1EX9A 1MX5A 4CCYB 1AQLA 4Q1VA 3D3NA 3OPMA 2G5TA 2Z5GA 2G63A 2WJ3A 3ZPXA 2HDWA 1MJ5A 5AKGA 1E8DA 4X6YA 4AMZA 1RP1A 1XZLA 5CURA 2GZRA 4M0EA 4PNZA 4WY5A 3W2TA 3M83A 1SCQA 5JALA 2DHCA 2RI6A 5AKEA 1MO2A 3H1AA 4H7JA 1YCDA 3OM8A 3T4UA 3ZLUA 3WWPA 2XUAA 3WLAA 2JGLA 3EF3A 1XZBA 2AJCA 2PU7A 2HL6A 5CMLA 1E3QA 2GYUA 2ECFA 4B80A 3KWFA 2DSNA 1A8QA 4QLOA 3G0DA 2VF2A 1FFBA 3I2KA 3DLTA 4KACA 2XMCA 1GXSA 1BCSA 3WK9A 1T2NA 2PUHA 5JZSA 1OCEA 2BGNA 3W9UA 3ZI7A 1SCIA 5I8PA 2O7RA 4E46A 2XUIA 1KU6A 4LHEA 4UBJA 3G9XA 1WCYA 3BIXA 4DM7A 1XKLA 4BVKA 1U2EA 2QS9A 4JYPA 1NU8A 4OSEA 3WKEA 4W63A 3V1LA 3R0VA 5FLKA 4JYMA 4AB1A 5AHXA 3H04A 5LZ2A 3KSRA 3B12A 1GQRA 2ZSIA 2YYSA 1YB7A 1GGVA 2P8SA 4L9AA 2JEYA 1ACLA 1I6WA 2WJ4A 4EUSA 4X95A 1R50A 1XKTA 5HFNA 3GA7A 2WJ6A 5EHQA 3WI7A 2V96A 5D6OA 5EHXA 3EQ7A 2BKLA 2PSJA 4Y2JA 5DYWA 3F98A 3BJRA 4FWBA 2XI4A 4XWGA 3DNMA 4QDTA 1WM1A 5I9IA 5HF8A 4B84A 4MWSA 3S2ZA 5JD6A 1BCRA 4J03A 4B7ZA 3WA7A 4WFJA 4G8CA 4BC1A 1N5MA 1ZIYA 1VJ5A 1HBJA 4BTVA 5E4TA 1FFCA 1CUSA 4EY5A 1CUVA 4AX4A 2JEZA 1CLEA 4HXFB 1JKMA 3WKDA 3O4JA 4ZV9A 2D5LA 2V9ZA 1MAAA 4LXIA 3O9VA 4OU5A 3H1BA 2ORYA 4AN1A 3NWOA 1RYYA 4BAGA 3W9BA 1ZI9A 3IULA 4FBMA 1ZJ5A 5DJ5A 5HF9A 2X8BA 4DNPA 1XZAA 1EHYA 2H7XA 5K3AA 2QT9A 1UK8A 1BE0A 2XUDA 2XUPA 2K2QB 5AH0A 5EIHA 5ESRA 1BROA 3LIIA 2W22A 3RK4A 2I03A 2VATA 3EQ9A 3R3XA 5HCUA 5JZ9A 5ALMA 4XJVA 3F97A 1DINA 2XE4A 4GBGA 4UHEA 4CG2A 2PSDA 1FFAA 3STWA 4CG1A 3STTA 3I1YA 3FLBA 1SOMA 2WLSA 4IHAA 3D2BA 4AMYA 3C5WP 1Y7HA 3WIBA 3S8YA 1P0IA 4PV7A 3MUNA 5AKIA 4J7AA 5A7GA 3IBTA 1XLWA 1VXOA 1L7QA 3UMJA 2QXUA 4G1FA 2HU5A 3BWXA 5AOBA 4ZV7A 1ZD5A 1SCKA 4H77A 2XUKA 3WZLA 1ZICA 4AO8A 4W1PA 3SWWA 5ALQA 2OGSA 2QZPA 2BCEA 5K3BA 3QPDA 2VT6A 5CBKA 4QZVA 2XQGA 1QFSA 2JGEA 1F6WA 4LYEA 4JEIA 5A7HA 3FSGA 5HKBA 3ZLVA 1MAHA 3PF8A 5EHNA 4HXGA 2BFNA 1GT6A 1QIJA 3I6YA 3HLKA 4PW0A 5AM5A 5H3HA 1YAHA 3GZJA 5CT4A 3RKSA 5FPQA 1ZI6A 2VQ6A 4OU4A 4EHBA 4MYDA 3IB3A 4HZGA 5CT8A 3NUZA 5ALHA 2OGZA 4H18A 2HADA 2PU5A 4KEAA 3NGMA 3I2GA 1LPOA 2CBGA 1YR2A 1PJAA 5AIBA 1XQXA 3LS2A 2QJWA 1QIMA 2QMQA 3OOSA 1Y7IA 2JGIA 2YXPX 2I3DA 4FDMA 5AM0A 4PSDA 5LKRA 5JAPA 1D07A 4JUIA 3IUJA 4OPMA 5CT5A 2OQIA 3I1IA 2VJCA 2Y6VA 3CCBA 4Q05A 1UK7A 3IVMA 2FJPA 3SK0A 1FFDA 2JGJA 1YA4A 3FYUB 3E4DA 2V98A 3RARA 2UZ0A 2Y2VA 3ZV7A 2CKMA 3VJKA 5AK3A 3D0KA 1DWOA 3DYVA 4MXDA 4X94A 5AKHA 1Q84A 1E8NA 3T52A 5BV7A 5D3ZA 1AC5A 1XZHA 4P93A 3WL6A 2WG1A 3A2MA 1AGYA 5AKYA 3BXPA 1EB9A 1N8SA 1CUJA 1MN6A 4CCWA 4UHHA 3D59A 2OPHA 1JMKC 1NU6A 2RONA 5JAHA 4F60A 5CXUA 3C6BA 4DSAA 5CTAA 3LP5A 3WWEA 3R3YA 1W52X 2CJPA 2X5XA 4CIBA 4OB8A 5ALGA 3PICA 3ZLTA 4EBBA 3MGAA 2GBCA 1QO9A 3FYUA 4BAZA 1FJ2A 2WUDA 1T4MA 4MYSA 2ZVDA 3HI4A 5JARA 4EY7A 1XZIA 4MWTA 5DLPA 5EGNA 2QJRA 2G5PA 5AKZA 1A8SA 4DNOA 2IIVA 2ZYSA 4JH0A 1P0MA 3D5EA 3O4GA 3KD2A 4W1RA 2PPLA 1H2XA 1CUYA 4B6GA 1BS9A 5CH3A 2RHWA 3H2HA 2H1IA 2OLEA 3C8HA 4IH1A 4UHCA 4H7EA 1MTZA 3ICWA 4GLBA 5LZ4A 2QVBA 5HF5A 4FLEA 4C4XA 5LZ5A 4Y2YA 5E4JA 1YASA 3O95A 3ESBA 4BTLA 1FSSA 2WHQA 4A5SA 5AICA 1EVEA 2ZYRA 3IUMA 1WHTA 1ETHA 1WPXA 1M33A 3AILA 3R3VA 4HVTA 4OD0A 4K2AA 3H0CA 1QIDA 2CMFA 4MJ3A 1XZDA 4WDRA 1GPKA 5T4FA 1DWQA 4B9AA 3PUHA 1XRQA 1HL7A 5ALDA 3H19A 2RAUA 1YAJA 2WQZA 4PSCA 2WUGA 4ZREA 4X00A 2GBIA 1OILA 1CUXA 1H22A 2C5GA 2WFZA 4B85A 2HFJA 4WJLA 5CT6A 4I4CA 4J0HA 4AXBA 1Q0ZA 4PF1A 5T4EA 5FXMA 2J4CA 2OAGA 4X90A 3WK7A 5DYTA 3SC2A 1YS1X 2CZQA 3QITA 5ALOA 4F21A 4BVJA 2HHAA 4QDXA 1B41A 5FV4A 5IVHA 2VEOA 5JD4A 1AZWA 5HK8A 3I2IA 4OCZA 1EK1A 2XUOA 5LP1A 1C7JA 3CXUA 3A2LA 5HF6A 4ETWA 5EFZA 1J1IA 3RLIA 2XMQA 1XRMA 4B0PA 1Q83A 3PFBA 1VA5A 3PI6A 1JMYA 1JI3A 4J0DA 4BATA 4BRZA 2PSEA 5CXXA 2QUBA 4W1SA 1UOQA 4BP8A 4AO6A 4HS9A 4YX9A 5AI4A 1BEZA 4QWWA 2AJDA 1DT5A 4UFPA 1K8QA 3Q0TA 1GPLA 2FUKA 3D2AA 2QKYA 2XUGA 2XQFA 3WQHA 1XQWA 1TK3A 1WOMA 3G7NA 1LGYA 5I7UA 1CUEA 1UKCA 3G9ZA 1G4HA 4TVKA 5A62A 2WM2A 3B5EA 4J0IA 5BWCA 4U2CA 2DR0A 4U2GA 3HRHA 3SX4A 2QRUA 2AJBA 2B4KA 2DQZA 3FYUC 3H2JA 4RGYA 1W4LA 1MNQA 1XQVA 3O9MA 5CH8A 1YB6A 1EH5A 5E2IA 3A70A 1VE7A 1ZJ4A 3M3DA 4X91A 1W76A 3FLAA 3ESDA 5CT9A 4P08A 1ODTC 1CUZA 1W75A 2WIDA 3KXPA 3GUUA 5DYYA 5ALEA 2BJHA 2WIFA 3O0DA 3STYA 3WL5A 4CIAA 1ZD4A 2GBGA 5AKJA 5LIPA 4FTWA 5D7BA 1QO7A 5FOQA 3IUNA 5DTJA 1G42A 2W6CX 3HEAA 3FVTA 3DDUA 3FBWA 1ZOIA 4FNMA 4GEGA 4IO0A 1CUDA 3WWDA 2BUCA 1VKHA 3C87A 5FP0A 5JZBA 5JATA 1YSCA 2FJ0A 4G8DA 3AIKA 5LYYA 1EB8A 5ALKA 3O4HA 2O2HA 2XQIA 2B9VA 3DL4A 5AK5A 4AZ3A 1XRNA 5JIBA 4KR0A 4DYHA 2XUFA 1EK2A 1CFJA 4CCYA 3QZUA 1LBSA 1H23A 5SYMA 2AXEA 5IKXA 5A2GA 1CUGA 1TAHA 5ALLA 3VKFA 1L7RA 1R3DA 4NS4A 3DD5A 1IUOA 3EBLA 1WB4A 1XFDA 5AKXA 2OAEA 1X70A 1QONA 5CRIA 4UBNA 2PSHA 5AP9A 5ALFA 2PM8A 2DFPA 2CEKA 5BWBA 4X6UA 2ZJ6A 4I3FA 1VXRA 3FWHA 3WIOA 2QM0A 4HRYA 1UK9A 4HXEB 5DWDA 3VVLA 4KYVA 4IH9A 1GZ7A 1QTRA 4N5HX 1CUHA 4KAAA 1X2EA 1ODSA 3EQ8A 3BIWA 2C4HA 2XMDA 3ED1A 1AX9A 4U2BA 3QPAA 3X3HA 1VA4A 1AMNA 2DHDA 1E89A 2R8BA 3V9AA 2WKWA 2HU7A 3W04A 3GELA 2R11A 2VA9A 1JT2A 1H2WA 3V1MA 2QR5A 4K6HA 5JAOA 1QFMA 4DMKA 3F96A 1AURA 1IUNA 1GKLA 3R3ZA 1UWCA 5ALIA 3BE8A 5E4YA 4V2IA 1LPBB 1MX1A 2E3JA 2WSLA 3C6YA 3R41A 1DU4A 2B61A 1ZGCA 4GW3A 3AINA 1QIHA 2HA5A 5ALVA 4UBKA 4C87A 1DTEA 5ISMA 3NOXA 2WG2A 1C7IA 2Z3WA 5LZ8A 5AOCA 4S0XA 3V48A 1BRTA 4N8SA 1CUFA 3QMWA 2VJBA 1W6RA 3QMVA 3I2JA 2ZSHA 2HA0A 4XVCA 1ZI8A 3C8DA 2CUTA 1XLVA 3AZQA 3WK6A 1K63A 3U0VA 4B0OA 1XRLA 1IVYA 4Y7DA 5KREA 2LIPA 2GZSA 1HKHA 3G0IA 4E15A 4LIPD 2G4LA 4E11A 1JU4A 5FDFA 3U1TA 2XLBA 4X3CA 2XT0A 3LIPA 4H7DA 3IDAA 2JGMA 2ONCA 4W9RA 1NX9A 2BUBA 1VLQA 4OB7A 2CB9A 2RHTA 3C6ZA 2OCGA 1F8UA 3QPCA 1DQZA 1LPSA 1MU0A 3BDIA 4FMPA 4Y9SA 2XMBA 3FVRA 5ALPA 1E66A 1QZ3A 4Y2UA 1QGED 4X92A 3ZWQA 4J0JA 3AZPA 1B6GA 1PV1A 4KE6A 4H7FA 5DTIA 5KBYA 4C01A 2J4FA 2PVSA 4Q3KA 5T4HA 4K5QA 3VDXA 4X71A 1E8MA 4G8BA 1W1IA 1LLFA 5AOAA 4ZWNA 1QJ4A 3K2IA 3AFIA 4FFWA 3ESCA 1EDEA 2JIDA 4ARAA 1G5FA 1WPRA 5A6VA 1THTA 4W1QA 4G4IA 4NMWA 3A2NA 4INZA 4KJXA 2HM7A 5AM1A 4AZ0A 4HRXA 3IIIA 5ALWA 4D9JA 3L1IA 1IZ7A 3WKBA 4MEBA 1SC9A 2ZYHA 2FX5A 5AI6A 1O6GA 1KU0A 5K3FA 3WK4A 3PE6A 2EDAA 1QIGA 3HSSA 1BU8A 5ALJA 3M81A 1WB5A 4BDSA 2PX6A 1LPNA 1UXOA 4EA6A 4EY8A 5HK9A 2WHPA 4Q82A 3G8YA 4X85A 1R4ZA 2QXTA 4AO7A 3HABA 1EDDA 2D0DA 4MQMA 1TCCA 5HKAA 5YASA 2GYWA 4X97A 4C6HA 1MX9A 4QE3A 4DMCA 1LZKA 1TQHA 1LNSA 4L0CA 4BP9A 5ALNA 3DOIA 5AM3A 2WIGA 2OXEA 4J0KA 3B3QA 3DL7A 1DQYA 1J06A 2HA6A 2YH2A 5AK4A 3BDVA 4AQDA 3ANSA 3AZOA 3FSGD 1QIIA 5AO9A 5F4ZA 4GDMA 1CUBA 1TIBA 4UHDA 4WY8A 2XUHA 2ZJ7A 4CFSA 2EDCA 4JNCA 2BUAA 1DX4A 3C6XA 2O2GA 1EI9A 3C43A 4C4YA 4GI1A 1GKKA 4BDTA 1CQWA 1USWA 2Q0XA 4WFKA 4G5XA 4CG3A 3CN7A 5LZ7A 2HIHA 4P92A 1QIFA 4BB0A 3WA6A 3ILSA 4KRYA 3PFCA 2IX9A 3G0BA 1XLUA 5JASA 5K3FB 4DTCA 4EY4A 3STVA 4UFNA 1XZGA 5J3JA 3HZOA 3F9CA 3ICVA 4OUKX 4LXHA 3KOOA 2AJ8A 1N5RA 4KRXA 1R9MA 4YK7A 3HJUA 4QDOA 4BRSA 2JGFA 4ZI5A 1XZJA 2Z8XA 2VT7A 2XLCA 1RWQA 3DQZA 4WCVA 1HPLA 2DQYA 2XMGA 3G9UA 4RE5A 4FFVA 1MNAA 5EI5A 5ALTA 1XZMA 4I19A 4PSUA 3H18A 3N0TA 4UHBA 4QNNA 2NW6A 3BF7A 3KDAA 5HFAA 2WFLB 1LBTA 5EIAA 5LKAA 1UT6A 5K3EA 1U4NA 5A7FA 4WDQA 4FKBA 4PO3X 4CI9A 4RE6A 2Z3ZA 3R3WA 4U2FA 4L72A 1K4YA 4DIUA 1K5PA 3PUIA 1S8OA 4Z49A 2DHEA 4ZRDA 4UPDA 4BZZA 1ZIXA 3GFFA 4BE9A 4KE8A 5C8ZA 4H7IA 1EXWA 3WK8A 5EHZA 2WFMA 3FAKA 4ARBA 2WIJA 3Q8WA 5D3KA 5T4BA 1BN6A 4BBZA 2QTBA 1CIJA 4BCDA 4G4JA 5AI8A 7YASA 1VOTA 3N2ZB 1TCAA 2PKYX 4IH4A 4FBLA 3L1JA 2ZJFA 3H2IA 4X7BA 3VJMA 4M0MA 1CPYA 2WFLA 1P0PA 4DSZA 3F67A 3MVEA 2WILA 1CUIA 4EB0A 1EVQA 4GWLA 1JJFA 1F0PA 2OG1A 1TKRA 5C8XA 4DMHA 1FFEA 5FPPA 3HXKA 2PL5A 2BGRA 1LZLA 3M82A 3K9BA 3RM3A 5JADA 2I3ZA 3OG9A 4UBOA 2XUQA 2O2IA 2OCLA 3WKCA 1JJBA 1N1MA 2AJLI 5AIAA 3CCCA 1R9NA 4U2EA 2VAVA 4HAIA 1THGA 2HRQA 3UUEA 3VXKA 2C5FA 4C4ZA 3WL8A 3HACA 5A71A 4H35A 5K5EA 4UBMA 4AN0A 2ZYIA 2ES4A 3OC0A 4C89A 4BCBA 4NVRA 2PSFA 4QDUA 1ORVA 4DGQA 2VJDA 1QIEA 5AJHA 4N8EA 4EY6A 1HDEA 2HA4A 4QEKA 3I2HA 5LZ9A 1HQDA 3G9TA 1PFQA 4BZWA 3H2KA 3WKAA 2H9YA 4RPCA 4A23A 2PBLA 3WZMA 3TJMA 1U65A 1ZD3A 4BCCA 4QWMA 2Y2UA 3MUOA 3IUQA 3STXA 3QYJA 3TEJA 2C58A 4FLMA 4G4GA 3QBJA 4B83A 2I78A 1AKNA 1XZFA 4M0FA 4BAUA 5ALRA 2XQJA 3W05A 3BL8A 3C45A 2JBWA 1ZGBA 3WL7A 3VVMA 2XQKA 4U2DA 4GXNA 4GHWA 3HYSA 4XX1A 1ZD2P 4OYYA 2QOEA 4OYLA 5DNWA 3WWCA 3G02A 2DCMA 3L1HA 4G9GA 4MQLA 3DJYA 3QH4A 1UK6A 4UUQA 4XIIA 5FKJA 5SYNA 1XQYA 1CV2A 2HRRA 5K3DA 3DCNA 3TRDA 3D4LA 1L7AA 3FLEA 1UOOA 5ALZA 3UUFA 4BVLA 5ALYA 2JF0A 4MEAA 5JAUA 4ITVA 4Y2QA 4FOLA 1IZ8A 3E1GA 3IURA 3JWEA 1CUAA 5FRDA 1QOZA 5JD5A 2O7VA 4Y2SA 1KEZA 4DNQA 1HLGA 5AKKA 1A88A 4FNGA 5HQ3A 2JGKA 2WU3A 5JYCA 3TGLA 1XZEA 5HQ3B 3VJLA 4B81A 1R88A 4KAJA 3H2GA 4KE7A 2QUAA 2WG0A 3WMRA 1BEEA 1R1DA 4LYDA 2VTVA 5AM4A 3O4IA 1JU3A 3W06A 2ACEA 1H2YA 1UOPA 3R40A 1XRRA 1QE3A 4BC0A 3EIOA 3ESAA 1CR6A 2Z8ZA 1VZ3A 1DT3A 5FUMA 5CW2A 3YASA 4B9EA 2XMZA 4FHZA 4IQ4A 3AUKA 5C7YA 4G9EA 2HA7A 3PF9A 2RIPA 5LLSA 2Y6UA 1CUUA 1XZKA 2XMSA 3GROA 3VISA 1O6FA 5EIEA 4L3WA 3LCRA 4P9NA 4EZIA 3E0XA 3KWJA 3PDCA 1J07A 5HZGA 4KAFA 4X6XA 5JANA 3F8SA 4Q34A 2V97A 1DWPA 3DEAA 1VZ2A 2EEPA 2C0QA 5AKLA 4BYMA 3FCXA 4LXGA 2XMRA 4O08A 2HFKA 3P2MA 3R3UA 3V1NA 3WJ1A 3JYHA 4QA9A 4DNFA 1G66A 2C7BA 5K3CA 3QMMA 2RGUA 1TCBA 2H7YA 5BOVA 2WTNA 4OB6A 1CRLA 2OCIA 3STUA 3FYTA 2IITA 2WHRA 3QVMA 1AUOA 3G0CA 4E14A 4NZZA 5ALXA 3C70A 2GYVA 4UFOA 4ZXFA 1QTIA 5KWJA 1VE6A 4K6GA 4PQEA 2OCKA 1EINA 3DKRA 2WU4A 2YASA 1C4XA 3FCYA 4YASA 2XB6A 5CH5A 1IUPA 1DX6A 1UKBA 4H7KA 1E5TA 4KE9A 2HA2A 3OTQA 1LPAB 2HA3A 5DNUA 3DOHA 3I6ZA 3ANTA 1CQZA 1LPPA 3DS8A 1Y37A 4N8DA 1GPNA 3A6ZA 1XRPA 1J2EA 1OXMA 3AIMA 3JW8A 1H2ZA 2Y1KA 4B82A 1P0QA 4F0JA 1UFOA 3LLCA 1GQSA 3DYIA 4X93A 4QDZA 1A8UA 3D7RA 2BAGA 4Y2XA 3QM1A 4Q3OA 4K6KA 1CUCA 3BF8A 4HTAA 4BE4A 3WK5A 4YPVA 4C88A 1ACJA 1QIKA 3BJMA 5IVDA 4RNCA 1ODCA 2WIKA 1IMJA 4UHFA 1XZCA 1CVLA 1A7UA 3C5VA 3AIOA 1X2BA 1LPMA 1UKAA 5IVKA 4Y2VA 4J0CA 2PUJA 4A16A 1K6EA 5AI5A 5KWIA 4J3JA 2H7CA
chains in the Genus database with same CATH superfamily
5IVIA 3QLTA 1WUJS 1ULZA 1G2QA 3HA5A 4H7HA 3O38A 2J3MA 3UCEA 3D4IA 2BYTA 1QLWA 1AGPA 5B37A 1DKNA 3W6PA 2DTEA 1MC1A 2COEA 1UBGA 3I6IA 4P22A 4BO5A 1XTPA 1G5PA 3JVVA 2XOEA 3BWVA 2CHVA 4TKUB 3VVBA 1P9NA 1QBGA 4P3KA 2P7IA 4AFNA 4K7JA 5E2BA 3RNLA 2QYSA 1XCPA 1TRHA 2QT0A 4GQAA 4EQ6B 5KVAA 4YI5A 1LV8A 4QSHA 5E6SB 3BZUA 4PNHA 5CR9A 3RC3A 1KP9A 1V43A 4TLDA 3P9XA 2X76A 2ARKA 4IGFA 5CW1A 1Q7CA 4LZJA 5FYDA 1XXHE 4QGGA 1OMOA 1J8QA 4HLCA 4ZXPA 2RGNA 2TMYA 4ZEXA 1ZVJA 4S2EA 2RIRA 5KOHB 1X74A 2H1FA 1Y48E 3AOEA 3GJ7A 3NHKA 4CKWB 1SXJB 3JXEA 5LMZA 4HL6A 5C80A 3CLHA 3CW8X 4Q3LA 3V4OA 1CEXA 1YXMA 5GM1A 2W4QA 4DSTA 5K4GA 2JLSA 7MHTA 1EFRA 3ZHXA 3FMIA 2GN2A 4CKCA 2K7ZA 3GLUA 5JH7B 2B20A 2Q2VA 4ZZ1A 1JHYA 2Q3EA 3NT5A 4N0DA 4H0CA 3NIBA 2H5EA 5AI9A 5EMKA 3LKZA 2NSHA 1ORWA 3HB9A 4HEA6 4LE0A 4O4HA 3R76A 1Z2EA 5J2UB 2HDHA 2IYEA 1NZFA 4WZAA 2CLFB 3H6KA 4M99A 5K6TA 3D6JA 4JP2A 4GMXA 4HZUB 2ISSD 4UNPA 4YIHA 1KNXA 1K89A 4H31A 5TIIA 4TYMA 2C2WA 1BMFD 1D8AA 5E1OA 2V6BA 5EOVA 5CVCA 2WUFA 4MARA 2QV0A 4YY3B 3HC7A 1VECA 3T41A 3AKEA 4WHMA 1E3JA 4NJOA 3K6KA 3PA8A 4PS0A 1OREA 4Y9RA 4XPIB 1KQ3A 5B30A 5C81A 1N4AA 3H1EA 4FLFA 2ACKA 2XRFA 3LHFA 4H4CA 4YRMA 4PO1A 2Q3BA 3KPYA 4YGXB 5C4MA 4F5YA 1YUBA 4DQUA 4OLFA 3AFMA 3URKA 5KPDA 4LGYA 1BN7A 1BFKA 2E4WA 1EDBA 1JHOA 3LG2A 4YCNA 1JN0A 3BH0A 2YJTD 2XVAA 3GRAA 4R8MA 3EX7C 1RRCA 1DBPA 1E6LA 4FYXA 3GO4A 4M3NA 3HN6A 2GK7A 1KDZA 3TZLA 1U11A 5C8VA 4LDRA 1BQ4A 4FHGA 1I3OA 1ZJWA 1C3JA 4NE7A 1HNWB 1Q0RA 1KAOA 2WUEA 5K8UA 3WZ2A 3J7TA 1DAOA 1XU7A 1EWTA 2YIMA 3PKIA 2I8AA 3O4VA 1AKYA 1UZAA 3U61B 2C31A 4QARA 3HVJA 3TZQA 1IRIA 4M8KA 1EX9A 1XJ0A 3R8FA 2DFNA 4GH5A 3FNRA 1P1IA 4PLHA 1JPVA 2B7CA 1AQLA 1F51E 2BFWA 3RABA 4WGGA 2AZTA 3UJ9A 4MPPA 1KPIA 1PVDA 1Y9DA 3JPYA 3N0RA 4TT3D 4YRSA 5KJEA 1VMDA 4YFYA 3UJNA 4OHBA 3IQEA 5AUQA 1U8FO 4BO2A 5KWVA 4ZANA 1DTSA 1T8RA 4PZ9A 3MAGA 1RI3A 1MOQA 1ABEA 2IVZA 2IXFA 1OXSC 1RP1A 2QVCA 3F7OA 5HTOA 1C7EA 2RHGB 2Y1LA 3KVVA 2GXSA 1JBKA 2HCBA 3W6ZA 3WB1A 1T5BA 3TNLA 5CXSA 4IRXA 1P2VA 4YRCA 4CQMA 3WGVA 1E2KA 5DHRA 2DG2A 2GO1A 3A7EA 1KI8A 2AE2A 2VNJA 3M83A 2OCPA 4GR4A 2DHCA 4R01A 1LY1A 4R1OA 1D2AA 2RI6A 3PRKE 2N9UA 2R7MA 2C97A 1W5AA 5A05A 2ZYWX 3QXXA 4H7JA 2JI8A 1M1UA 3ZEIA 1SCUA 5IFKA 1GTL1 3T4UA 2WMNB 3BMXA 1YULA 2AOTA 2WT8A 3OAAA 1T3HA 3QPUA 3EY9A 3E3LA 1X77A 3GR6A 3WLAA 1WABA 2QROA 4INJA 1I5OA 1FX0B 3KLMX 3OM0A 3FR7A 3UTDA 3KQLA 1W2WB 1FUKA 2NV6A 1JT9A 4E09A 5CMLA 5JI2E 1BZYA 5IDXA 5TGZA 4RPJA 1YB5A 4KXUA 2YV3A 4LJ4A 1E3QA 4S1VA 2MCFA 1H9AA 2FSUA 3BE4A 1C9DB 1SOWA 1U3TA 3G5MA 3BWEA 3EXFA 4B46A 2EFYA 4RJTA 1EP3B 3RWBA 4N54A 5IYZF 2DSNA 4AN4A 4ZMSA 4HGPA 2YXNA 5C8YF 1OI7A 2F8LA 3MMNA 3I2KA 1JWLA 4NATA 1YMQA 1KO7A 1JEYB 1E2JA 1ZAYA 4ND2A 3W2EA 2JJ2D 4RDCA 2Q4TA 4YCJA 4E2FA 5ICMA 2HRZA 3EIEA 3AESA 3L7DA 4O4IB 4GL4A 5JMPA 3WTBA 1OXUA 1T3SA 3T7EA 4DTIA 4OP3A 1B8UA 4PYLA 1T2NA 3CGGA 1QCZA 2VJYA 2C7PA 1OCEA 1Z3IX 4IMIB 4NEHB 4CM7A 2W6PA 4AKHA 1IHUA 2R79A 3CO0S 1MABB 2WMYA 3ENQA 4ODIA 1TGVA 4LX0A 4GGOA 2CDAA 5AVOA 1RWBA 1JIJA 3QV1A 4JUCA 5D2CA 4LQCA 4E46A 2PD4A 3R8XA 1R9GA 4NCXA 2QU7A 3SYLA 3Q5GA 1DOZA 3V9PA 2AFHE 2UV8A 1Z6XA 4LHEA 1ESZA 4BXOB 1KY3A 3AWDA 4PIVA 4G0NA 1FLAA 3PQDA 2OP0A 2X7XA 1IPEA 5IVPA 2HBYA 4B6EA 1YF3A 4KQIA 3ZLJA 1YR9A 3BIXA 1ZVKA 4RD2A 1L8AA 4BVKA 1U2EA 4OBWA 4R83A 5PGMA 5F21A 1ZDMA 4JK3A 4HFMA 3ROEA 4OSEA 2KI5A 3VPSA 1W2GA 4RF2A 5FLKA 4DIKA 3L43A 1VIVA 4IRUB 2CYCA 3CHYA 2A5GA 4IILA 4MQEA 2IX3A 3NDBB 1OZFA 1GFIA 3LC2O 1LNZA 2OFPA 2PLFA 5DMHA 4JA2A 1LI4A 3H6GA 4NCKA 1GPBA 4WLVA 3G49A 3BD7A 4P1ZA 4Z4IA 3J81A 1GQRA 1RQXA 2QX9A 3UV6A 3SDBA 3VDQA 3SFZA 2HB6A 3KV3O 1JFVA 1SXJA 1NNI1 2VP3A 2SKCA 4WJKB 1S1CA 3R8CA 1VJDA 5FNZA 4LE2A 1TKCA 2JEYA 1I6WA 2QRMA 3KBBA 2UVQA 3F1LA 4CKCB 1X1CA 3QI7A 4Q5IA 2EHDA 2ZYDA 1RWXA 4FUTA 4X95A 3V2GA 4EBFA 2EZ8A 3FFWA 3GYBA 5C35A 5JQGA 3QX8A 3EFOB 4WACA 2VDQB 4F3TA 1TLFA 4K9OA 2D06A 3N7UA 4LXXA 2V96A 3P8ZA 1JDZA 2NUPA 2W6IA 3QF7A 4GLFA 4Q7JB 4GZ3A 4RQBA 5EQFA 4YMUA 3EQ7A 1WZ2A 2J59A 2QI9C 1PDWA 4US1R 4F97A 3QLVC 4EKGA 1RBYA 1PJ4A 1P8JA 3H6HA 1C3LA 4MQFB 4UNIA 4W7IA 2PSJA 4YLEA 1BS1A 2VDWA 2WT4A 1N6NA 3RS5A 3JSXA 3S40A 3ZBUA 1AKMA 1B73A 3V42A 3F98A 3N75A 4E94A 4EYKA 4DREA 5JXWA 3RVKA 1ZRMA 1SQGA 3VYTB 3G85A 5E2AA 1W0KD 4G5OA 2FSVA 4IO1A 3E70C 5I9IA 3PT5A 1HT2E 1B7GO 5JCOA 4QTTB 5L40A 2BKEA 3AK4A 1GYPA 4B84A 4MWSA 3S2ZA 1ODIA 3PYXA 1QH0A 1J39A 1F06A 1SVLA 2IU4A 3MCTA 3Q85A 4X63A 3WDLA 3OFJA 3OQVA 1X1EA 1EK0A 1YCHA 4URXR 4I55A 4PLPA 1QGYA 5JCXA 2X6TA 1ZXXA 2FEMA 4L8GA 1BSVA 1N0HA 1E18A 1Q22A 1FFCA 4OFBA 3GLGB 1PGOA 5HJ2A 3HVRA 3C41J 2JEZA 1G3QA 1CLEA 4PC3A 4CT4B 4URUR 4HXFB 1QHIA 4TSKA 1QZZA 5FQOA 3FPSA 1GPUA 3EUAA 4NS1A 4KQ1A 3WKDA 2ZPUA 3KFXA 4ENPA 3GDWA 2UYOA 1FYWA 1PG2A 3W0LB 1E2GA 1Y4AE 1U2QA 4N9QA 2VDPB 3JQBC 4BNFA 4J1NA 1DEKA 2V9ZA 3D31A 4ERNA 2MU1A 1UWKA 4Q66C 4Q9DA 1NYQA 5AWFC 3W5VA 1GRNA 3F0TA 1SRQA 3ENWA 3M8KA 3ZHUA 4RJJA 3R77A 5DWVA 1RYEA 2XTMA 1P7ZA 2JZNA 3NWOA 5J2TF 2ZIVB 4QFBA 3P0RA 3G17A 4EYEA 3OUUA 3N05A 1ZI9A 3LUKA 3W9BA 1W88A 3OOYA 2WWGA 4PO8A 2J33A 3GD7A 5ES3A 3H83A 5DN9A 4ARZA 3BHIA 2D13A 4YTEA 4RKWA 3RRYA 1E9CA 1SWVA 1BHQ1 4RLHA 3SICE 3VR2A 3VU0A 3ZW9A 4BASA 2IOYA 3K0KA 3REQA 1KZYC 1KR2A 1E5XA 2UYHA 1BD4A 4OKNA 1NP6A 2G9UA 3ACBA 3B6EA 4B3HA 5K3AA 4CMHA 2HPVA 3EZLA 4G5FA 1L5VA 3NXSA 2VAWA 5CPFA 3IOMA 3QSYA 4MH0R 5CJPA 2DVMA 2XUDA 2ZI4A 2R4UA 5AH0A 4PFKA 1YC2A 4QUAA 3FNEA 2JFWA 1K2VN 3HY6A 1AUPA 5EXSA 1ESEA 3JATB 5EMNA 3Q1LA 1CZHA 1C9YA 3EQ9A 4INAA 2JBAA 3OZ7A 4Q7MB 1BGXT 1WZNA 3E23A 3TGWA 2XZLA 1W4ZA 5A9TA 3OEYA 1ZU5A 4MWZA 4N12A 3LHIA 3N7TA 1V1JA 4RD4A 5HCUA 1WCIA 3PUKA 4ZKEA 2XAAA 1MV8A 3LXUX 4BZPA 2BI4A 1FDOA 1FE8A 3UXMA 4ZVVA 3TIXB 3ZD6A 2HEGA 3IAUA 1JA1A 3F97A 1PD1A 3IL2A 2XE4A 2B69A 4GBGA 1I0LA 4TTJA 1TT5B 3IR6A 3NBFA 5DM2A 2ZUVA 2FN8A 2ZAMA 3K9NA 2PSDA 1FFAA 4CG2A 2C9CA 2PS0A 3W34A 4DLRA 4GUAA 4CG1A 1AG9A 4F7DA 4F4DA 3NATA 2I76A 1HYBA 1JHRA 2QD3A 2YS6A 5DHPA 4TZ0A 1TZMA 2CNKA 3F6CA 3K6JA 3STTA 2YQ4A 3R5JA 5TPWB 5LP6C 1SOMA 4LZPA 4AMYA 1GRRA 3C5WP 4NONA 1U9CA 2X8JB 4MIKA 1M5UA 3D7MA 1GQYA 4FGZA 3WIBA 2FG7C 5IBQA 3S8YA 1HORA 1P0IA 1T0IA 1LLDA 2CLDX 3L6DA 5CLQA 1AGNA 4GWGA 1JFSA 1JRLA 1N9GB 1ZXBA 3FPGA 2DJIA 2W6ZA 3IDOA 4PV7A 1ARZA 2ZEJA 4CDGA 4J7AA 1FRFS 4AIRA 5DM60 4Y0NA 2W70A 5EQDA 4C0WA 4J7UA 1WVIA 3EC7A 3FRJA 5FTJA 3ABRB 3SE0A 2GH1A 1U9IA 4ZMBA 2H9IA 5AJXA 4DV1B 1KARA 2EKDA 3C7KA 4DCCA 1U5AA 4G1FA 3QWBA 2H17A 1VB5A 5KYKA 3BGSA 1PT7A 4MW0A 1KMCA 1QRAA 4OHOA 4U9IS 3U26A 2ZR0A 5J2UA 1MR3F 3JALA 3AHJA 4DM4A 3HWRA 1ZD5A 2X1MA 1SCKA 4FFOA 3X1ZA 2GKSA 3H5NA 4H0NA 2NUTA 1O96A 3SZUA 2YVAA 1NN1A 1QMGA 1O54A 5HZHA 4LTDA 2H52A 1O8CA 1PI3A 2OGSA 3OO0A 4KITB 5JROA 1RLMA 1C3OA 1LU9A 2VT6A 4AQYB 5AW7A 2QYOA 2XQGA 4WK2B 1VLJA 3PC6A 1XAGA 1WLSA 3O8QA 2CGEA 3EVEA 5HKBA 4P36A 1N25A 3LP6A 3QE0A 1AB5A 2YHSA 5CLFA 1QR6A 1PZHA 4I55F 4RK6A 5KX5A 4C0QC 2Q9CA 4DCPA 4GKKB 4CF6A 2EGHA 3Q1KA 4WOPA 1OIVA 4ZJYA 1VP9A 3RRXA 1IVNA 5IF3A 1DADA 1RQRA 1FIUA 4WOCA 5GWXA 5EXPA 3U40A 4UHKA 5JWRA 2PMKA 3I53A 3IBCA 1UZNA 2NU9A 4I1YA 3ETLA 3I3OA 3WGNA 5BVHA 5C1DA 1UR5A 5JZVA 1M66A 2HTEA 5CT4A 3IUPA 3RKSA 5IXJA 2HD4A 5KVSA 5FPQA 3GFQA 1K2WA 1KWGA 1Q20A 2I7XA 8ABPA 1M0SA 4MYDA 1RBQA 5T3YA 2G3YA 2XCIA 1ZSYA 4HZGA 2N46A 1Z62A 5L9AA 5DI3A 2M32A 3DFUA 2D1FA 3M5CA 2AC7A 1JX6A 1P3JA 2ECPA 3NUZA 5ALHA 3ZU6A 5DX0A 4X20B 2VF4X 4C2AA 2HADA 1LTHR 3OCUA 2RKOA 3SNKA 3MJ4A 4MUHA 1H2EA 2GX6A 2PU5A 1GUBA 5E3JA 4WKOA 2FPMA 1H8HA 4MVYA 4CU5A 1RYDA 5BPHA 1B2RA 1LPOA 1NF9A 2GM9A 3NTLA 1F1JA 3R9XA 2CBGA 3OPYI 4XYMA 4C08A 2R6FA 3AEKA 1PLLA 1WKBA 3NHSA 2E7ZA 3DNFA 3NNNA 4KSBA 2RGWA 1H6CA 3LS2A 2QPLA 2B1RA 2QJWA 3I92A 3ZXSA 3MJSA 4OFZA 4AKIA 3RQSA 3H9UA 3LYUA 4LXUA 5KDDA 4FI3F 5DWQA 5AM0A 1DIHA 2I3DA 1KC1A 1J2YA 1DE0A 1Q50A 2NVUA 3GJ3A 3SQWA 4LWQA 1KEUA 4C7MA 4EPXA 1KNQA 4TWJA 2GEVA 4NHOA 1O58A 5B4UA 4UXHA 4CLRB 5SYAA 4J0QA 4FMCF 4I14A 3AGQA 1STOA 3EVZA 4X7RA 3VYSB 2ZRNA 3SFTA 3OLXA 2FZVA 1K0UA 2DUWA 4W4TA 1B0ZA 3V34A 2VJCA 2Y6VA 4EO7A 4E2ZA 5D85A 3EMKA 4HDQB 1Z0KA 4PHHA 1FEZA 3QYAA 1NN5A 5CJJA 4GUDA 1RWVA 1IJKA 2FLWA 2OZKA 3GC6A 2I6SA 3IVMA 4TKUA 5EWMA 1K7EB 4R8KA 1VMEA 1H6BA 3BSYA 4MUJA 4MB2A 2CJYA 5T8KC 1W35A 2A3RA 2YXDA 4G41A 4Y1EA 1VRVA 3WOVA 4CMIA 5A9SB 1NX6A 1BA3A 3FPAA 1HK7A 1RVDA 1RYHA 1UP7A 2QGZA 4MLCA 1ELOA 4RHFA 4CZ2A 4FXOA 2PKXA 4QRIA 3VJKA 3I9OA 5JCPA 2ZBEA 3GGJA 3I30X 2OVFA 3FRIA 4V0MA 4X94A 5C52B 3T3MB 1ZEMA 3S44A 4JLMA 1Q84A 1ZONA 4WCFB 3JRNA 2X0EA 4HX2A 3T52A 3EG9B 3USCS 4YUXA 1XL0A 4YB8A 1AC5A 1CJUC 1UPAA 3HTXA 1NAIA 4DC1A 1KVUA 1E9AA 4PYQA 3WADA 5LD2C 1ODFA 2VYNA 5COAA 2I6UA 2QF7A 4LHWA 4XCVA 5IYZA 1T25A 3BJIC 3IQXA 3PR1A 5I7OA 3LL4A 4ZCSA 4US2R 4XWWA 3L0YA 2QTAA 4MRMA 5B1EA 3OT1B 4CT0A 3AETB 3IR5A 4HGZA 2X40A 3CRNA 1TPZA 1EZ1A 1MN6A 1VFNA 3N53A 3V2IA 1H5QA 2GXAA 1KFBB 1TU0A 3H2BA 3LHSA 4UHHA 1GZ5A 2EATA 2IHTA 1F20A 4K6FA 3L0IB 4ZCTA 4YP0A 1GDDA 2VQ3A 4P0TA 2QT1A 3R9XB 3GDOA 1P4RA 4KBFA 4AY3A 1S8AA 2YBDA 4B8WA 3GDFA 2V7EA 1XEXB 3QXSA 3AEQA 4EEZA 3C6BA 3ASZA 3DB1A 1RHRA 5CTAA 1BQ3A 4JX8A 4JJ6A 4EF5A 3WWEA 3ILVA 4X9XA 1W52X 1ZGJA 2CJPA 2W2MA 2X5XA 2CLKB 1Q57A 1YZQA 2EWVA 2VDLB 2FSIA 2WAXA 3ISJA 2I2WA 3IHKA 1DXOA 3U16A 2VUUA 5JS7A 1D04A 5A0TA 4MX8A 4EX6A 1QH8A 1VGQA 3AF5A 3C3MA 3OE4A 2OMKA 1LTQA 3PICA 4RZ3A 1MLDA 2Q4DA 3ZLTA 3VR4D 3B3GA 3ORYA 5HE9A 2X7HA 4I0WB 3MGAA 1XCOA 3LI2A 3SCZA 4DLXA 4EH1A 1EFVB 3DLHA 3U4QB 4D92A 4BQSA 4BAZA 4RVGA 1GQOA 2JAPA 1KI9A 2E4ZA 2QTCA 2WUDA 3AJ9A 1X1RA 2F00A 2ZVDA 3V7WA 4B74A 5KYWB 1A2OA 2FEWB 3N39C 5DKFA 5JC1A 2BGKA 4EY7A 3QXCA 5JSFA 5DLPA 3F71A 2V7VA 3N2LA 1W1WA 3B1KA 4I9HA 3A6JA 1IQRA 3CGWA 3JZIA 1A8SA 4JR2A 3LQ4A 4N6NA 4YAGA 5K01A 3E18A 7REQA 1M34A 4YDRA 4DR3B 4I6GA 1FS6A 4XFDA 2Q9AA 4XYLA 3CLRC 3KYCB 4KQHA 1TCUA 1W36D 2IXGA 2OZEA 3HZHA 5LQCA 3U49A 1LRLA 2OBYA 2A4KA 5DK6A 1P8AA 3DTTA 3RVJA 4R40A 3VKUA 4EEKA 2GF0A 1H5UA 3NONA 2B8JA 2GD1O 3IT0A 3KD2A 3LBHA 3O4GA 5TY0A 3EIXA 4HNGA 5IJAA 2AZMA 5FFFA 4YMWA 3JQPA 1JQEA 1UZMA 2I0FA 4MP6A 4NYIR 2X7JA 1BYIA 4WKPA 3X1WA 4BGEA 5FPYA 1QHEA 5ADUS 1P7VA 1O94D 2F1OA 2HGSA 4RPLA 5CVJA 1DC4A 1TEVA 2Q49A 3KWLA 1FP4A 3H2HA 4JJEA 4Q9KA 2QE6A 5CJ2A 1DQNA 3BJEA 5KZMB 2YTZA 3C8HA 5E7IA 1BVHA 3CRVA 1RTKA 1RPAA 4RXTA 3RAJA 1SHKA 5I47A 4YACA 1WXQA 4QYWA 5IAJA 1UP4A 5GVRA 3ZWCA 5K6AA 1EHIA 2BI8A 2PYZA 4H3KB 1G8KA 3H5WA 3U0BA 3QK7A 2B7BA 1EDZA 4A82A 4DEYA 2WYOA 3MTQA 2A8YA 2XHEA 3COWA 1M76A 1XV5A 2QVBA 3E2PA 4DLUA 4Z2YA 2LPMA 1F2UA 2H4WA 3PNQA 4N1AA 5H80A 4HR7A 3GRKA 3I05A 5HF5A 4C4XA 2PO5A 3BH7A 4Q4DA 5IC4A 1C0PA 1TIPA 1L9XA 3OZSA 4ZYYA 1YASA 1MH1A 3DLAA 1O0BA 1QBKC 4GM4A 3QKUA 4JKOA 2PQMA 3WO0A 1JHQA 3RRBA 2DWPA 4N7MA 5C5IA 4BTLA 4QELA 4JVOA 3W1WA 4EPYA 4LZZA 1C1XA 5AXDA 5I9NA 5JQGF 1FSSA 2WHQA 4Y9UA 3IMEA 2J87A 5DGCA 1N6RA 3KEGA 2ASEA 5BT9A 5BNIA 3D6AA 3EXHA 4C05A 4CFZA 2VCHA 3EC1A 2A7XA 1XRJA 4IV8A 2DMRA 3I6BA 4IWXA 3KWMA 5DMXA 5JO9A 2UZ1A 1VPVA 2PXCA 4I9GA 3EXIB 3I5XA 1W2HA 2RGEA 2DYKA 1RNLA 1XZDA 3AHIA 3HJAA 3UQYS 3LSTA 4WDRA 4MWEA 1O4VA 4DLSA 4LXTA 2MYPA 4OGWA 5C46F 3C3KA 3O8RA 2ZB3A 3G2LA 4B9AA 1PSWA 2DWCA 5CNJA 4I50B 3SM3A 4Z5XA 3PUHA 1MABA 4F2HA 2QQ5A 1DXHA 1ZBQA 1RACA 1L4UA 4M86A 1B3RA 3WRVA 4MKRA 3QOXA 3DF7A 3BZWA 2FEPA 1H0SA 2BEWB 4OMFG 3FW1A 2Q2WA 3LH5A 4D5EA 3PWTA 4FGJA 2R6GA 2W98A 4WBSA 4NMMA 4UE6A 5LQUA 2NO4A 2AUNA 2BE9A 1OILA 2P0AA 4G89A 1H22A 2C9OA 3OKPA 4TLCA 1U4OA 3OZRA 3SSMA 2HFJA 1MH9A 3FUXA 2UVDA 4MVCA 5CT6A 3C6KA 3FNIA 4RL4A 3UWMA 2QSYA 1OI3A 4HTFA 4PF1A 1K1EA 3V33A 2QRKA 2PUEA 3A1NA 3C7TA 2BKVA 3F90A 2OAGA 1JEAA 2FXVA 4QBTA 1D2NA 1Z5ZA 3EGXA 2FMHA 3N86A 1UF9A 4F3RA 3IX7A 5MFZA 2NPFA 1B26A 3NDRA 4J9UE 3LD9A 2HHAA 4C0XA 4CMAA 1B1CA 3TW0A 3G13A 4BFYA 4EF4A 1A9XA 3UK6A 1KYTA 1MAUA 2VEOA 1K7SN 2Z1DA 1AZWA 1TZCA 5KSYA 4MV9A 3REFA 2F3RA 5BRJA 1KTVA 2OO3A 4OCZA 4KRFA 1SA0A 3WLJA 2AQIA 1XDGA 1DDOA 3Q7PA 4P2GA 4YJDA 1GNTA 2QRLA 4WNIA 3IE0A 5DH9A 4ACAA 5A4FS 1S02A 4RZIA 2O59A 5LP1A 3VO9A 1LUAA 1AMOA 5SZJA 4R54A 3UXEA 4ESHA 2PMWB 3KT8A 1Z45A 1Z17A 4L07A 4V3CA 5BNTA 5HF6A 4WPGA 1J1IA 3Q9LA 2O06A 1XAHA 5MHTA 2DF8A 2VPXA 3CKYA 2XXJA 1Q83A 3PFBA 1NLMA 5EXEA 2QVYX 3P4YA 5DO9A 1JMYA 1R6DA 4KXYA 5G4KB 4BATA 5ITVA 2VHVA 1Y5IA 3G7SA 4XFJA 3EZFA 2R4QA 1BCRB 1Q92A 2PV0A 2ZK7A 4GPEA 4AO6A 3ROZA 4HS9A 4S05A 3QENA 4DCGA 4DVJA 1ND6A 3VHXA 2A86A 3KYJB 2ZUCA 1WO8A 3NTXA 1BEZA 5AI4A 1V3TA 3PRHA 1FLNA 4KFRA 1YV9A 3NEJA 4FYIA 3W8RA 3PEEA 3A6KA 3LYHA 2Z9CA 1K8QA 2DSTA 4NULA 1XEXA 5HGXA 3SMVA 2B0CA 3OMLA 3Q0TA 1QYCA 5KX5F 5LXTF 3OQMA 1GPLA 1IU9A 3NWEA 3G1UA 1V1MB 3TKYA 4N6GA 4NQZA 3W3AH 3MEQA 4QGAA 2XQFA 2QUJA 4A4DA 3TOZA 4PZDA 1BKSB 3DTVB 4UW9A 3IO3A 2XB4A 4BN5A 2FRVA 3OPVA 2BGUA 5BSGA 4OEHA 5I7UA 2MDTA 2PWPA 4JUFA 1W87A 2ST1A 1S01A 3OPNA 3S27A 1G4HA 4TVKA 4KO8A 3GJRA 3JTEA 3KALA 4KQEA 2OHIA 1UM9B 2G40A 5JXJA 1NG1A 5BWCA 1EWKA 3E3OA 4U2CA 2LCFA 4P84A 1X8KA 1T6BY 5CP8A 5ELMA 4EQ6A 2K4MA 3SX4A 5HXAA 5JQGB 5AUOB 1PR9A 3BZBA 5AMXA 4YT5A 3TCXB 3WMEA 3CIFA 4V0LA 1K06A 1HQYE 4U7PB 1E1RA 1KSFX 2QLJA 2ZLBA 1M1XB 1TYEB 2MIIA 3JYNA 5JCOC 3LOPA 1LI5A 3UJPA 1XQVA 1YQTA 2DWQA 4REOA 3ROFA 1TAGA 4RZ2A 1T0JB 3UW1A 5CH8A 4GOND 3VGJA 4BMNA 1LKZA 1EH5A 1WUIS 1XTRA 3IPXA 2DBVO 3JCZA 4M54A 2BKUA 4UE3S 3VA7A 1M1YA 1O95A 1QVAA 4E5YA 1TJPB 1RZRA 3FETA 4LSWA 1M0WA 1FJHA 3ZQUA 4G9BA 4PHGA 4R9SA 5DBIA 1UMCB 1JJAA 3P4UA 1X1TA 4EVSA 1GGFA 2XD4A 1EESA 4MR7B 4F4HA 1M6WA 1SUWA 4L6AA 1UKVY 4X1KB 5JTUA 1BNCA 3GUUA 2V54A 2C61A 2Z4TA 1E1RD 3GVHA 3DVRX 3LDFA 4LVCA 2QX4A 4PBRA 4L5JA 1Z07A 5ALEA 1H05A 1PKXA 5HOQA 1T1IA 2BJHA 1F9AA 1SBNE 1ZCAA 2WIFA 4JVNA 4Q9HA 2IEZA 3Q12A 1B8PA 1M54A 1QKIA 3CR3C 2BP7A 3U7FB 1KIFA 3K09C 1ZD4A 4NBRA 3AEQB 3AT1A 5FB3A 2GETA 2OQ2A 5FUBA 4O8CA 4DJEC 3WGJA 3IKTA 1ZJYA 1NXXA 3QOFA 4UU7A 1FMTA 3BFJA 4I6JA 1DBSA 3HU2A 4UJ5A 1G20A 1W85A 2B0JA 3RB8A 3J7AC 4B3RB 1ZBDA 3GP8A 5HW0A 3Q2KA 2CXUA 3PUJA 1BEUB 3B82A 4ZO9A 1PR2A 1G42A 3I39X 4O0LA 1JS1X 4HYQA 1V6CA 1LTKA 3QUSA 2GEUA 5IBCA 4LNHA 4K40A 2C2HA 4B3IA 4GEGA 4CMCA 2WKPA 3VU9A 2GF2A 3JAMA 2QRQA 3GBVA 3SYTA 3BXGA 4K03A 3AKDA 4XOUA 5LJIA 4PSVA 5TNXA 1CHNA 2QENA 4TV8B 4HV4A 1N6HA 1UM9A 1PGNA 1US8A 3C87A 3K1AA 1PHRA 5JATA 1NJSA 1YZ3A 1PN3A 1I30A 4NU8X 4G8DA 1G4AE 4C3ZA 4YRAA 2CXNA 2UYQA 5DBOA 5BSMA 4BLTA 5FL7A 1N78A 4PQYA 1TVKB 1BXKA 4J16A 1RI1A 3M1IA 4MWDA 1A5ZA 1Z4QA 3T35A 4Z7QB 1AKUA 2B9VA 1EFUA 3OP1A 2ZBGA 3NTVA 1XEWX 4BNJA 1MRZA 1XRNA 4G5GA 3IT3A 3OOHA 4AYTA 1TD1A 2FPUA 4KR0A 1K08A 4M1KA 2XUFA 2QBYA 3OVMA 1C50A 4YCLA 3G2KA 2IWHA 2JHCA 1EVKA 4L50A 2OV2A 5DYGA 4A0GA 5A2GA 4PLVA 4OK5A 3BGDA 4YYEA 1TAHA 5K0GA 2YIDA 3VKFA 4O1HA 3TQQA 2EXXA 2G9NA 3ETJA 3IXQA 4O2AB 2OB1A 3EBLA 1U2GA 1E4OA 3LUHA 2ZTLA 3E61A 1UQUA 1T29A 4GPBA 2P62A 3QKTA 4KI7A 4L02A 4XM2A 3KB6A 4N48A 3O92A 3TRKA 2QR2A 4EA9A 3ASYA 4HDRA 2IRWA 3BN3A 3O93A 4J7CA 2BM8A 5CRIA 1VHDA 3CZ5A 1YIOA 1L7MA 4KDFA 1PR1A 1OV6A 4XA8A 5AP9A 4UTZA 2P9HA 3NS7A 4DY6A 2PM8A 1UC5B 1DC3A 3A4YA 2IQ5A 4MVWA 3AERB 5DSZA 3QJGA 3WL3A 3JYOA 3LLSA 4QYTA 1FFXB 3HDYA 1XXHB 5JPDA 1GDHA 4LYGA 2FA9A 1W8DA 5L3RA 2FMXA 3AX6A 5DWDA 4HWGA 3VVLA 5HMLA 1UDBA 4ON9A 4PIPA 2YHAA 3G5UA 2X4DA 4O4JB 5H82A 2WV9A 5DGHA 4KYVA 4IH9A 2R25B 4N5HX 4RDXA 1CUHA 1X2EA 4CMIB 1A2BA 1ODSA 2WNIA 2ZAOA 3CUWA 3BIWA 3DXXA 3ED1A 4JP5A 3RUPA 3EDOA 3R0ZA 4HPJB 2TMKA 4OJKA 5DT2A 1C2TA 3NVKI 3VX4A 1PUIA 3PC8A 1FFWA 1HRKA 1BXGB 2AMLA 3GZ4A 1DEOA 1HTWA 3EN0A 4IOLA 1MC4A 3X3HA 1KY2A 2G88A 2NU7B 2E49A 2XYHA 3HYCA 3OE7D 1UPBA 2F90A 4K8OA 2FW9A 3K1JA 3INRA 1SXQA 1DMRA 4GAEA 4EYQA 2ZIGA 3BK7A 2JH8A 3OCYA 2R11A 1I14A 1OFGA 4COOA 2EJTA 4D9MA 5A1JA 3OQ1A 1GNLA 3V1MA 3QFSA 1MENA 1V0JA 3QQPA 3AVUA 3PHIA 2QR5A 3Q6MA 5IHPA 4AECA 5JAOA 4V0SA 2WJYA 1Y8QB 3FMVA 3H8WA 4UEKA 2VQEB 1IB6A 2FLKA 1V4VA 4WXRA 1QFZA 4KU4A 3B6ZA 4Z4QA 3QX7A 1GKLA 3WBFA 1QPZA 2F8SA 1UWCA 5ALIA 3UKDA 3WQRA 5HKLA 2PUDA 2UXBB 1DEXA 3H13A 5ANRB 3U9LA 5KC9A 3HSYA 2VHEA 4M8SA 2V7BA 1ICEA 3FDIA 1W5TA 5ULLA 3C6YA 5DIFA 4YV1A 1ENZA 3L7KA 3FYHA 1DU4A 1NC1A 3KYDB 3NHYA 4IWNA 2WY2D 3U7JA 4D98A 4TMVA 1PWHA 3MCAA 4XPIA 4V1CA 3ADBA 5FBHA 1JKFA 3CWCA 1LDYA 1JIIA 1ML4A 2PJZA 3HR8A 4UULA 3U3OA 2OO5A 2GEJA 1XVTA 5G4LA 4IDNA 1FXWF 2BEVB 2PGLA 3HZRA 3KR1A 4Q01A 1VJTA 4WUVA 3F7TA 3X1MA 1C7IA 2GZ2A 5AQEA 5LZ8A 2H7VA 5AOCA 3O4FA 5ADVA 3IE1A 1ISSA 2A67A 3BBLA 5CB4F 1AN9A 2OWDA 3DDOA 4BTEA 4DDMA 5DM0A 3SQLA 1BRTA 1FDRA 1PJ3A 4ZQGA 5E9WA 1PX2A 5EEHA 4I9FA 1ZGZA 5CB8A 1WXGA 1R6TA 1CUFA 2OZVA 3OT5A 5B36A 1UADA 2VJBA 3CCFA 3Q98A 3SEQA 3EA4A 4CNQA 3AF0A 4PXAA 3ZHZA 3B5IA 3DR3A 4FR0A 4EUFA 3SKXA 1PVVA 2WBLC 5IK2A 4DUYB 3TIVA 3IC5A 1C0EA 4PRLA 4RORA 4KVFA 3K20A 4B75A 1VQ1A 1LF5A 3HYLA 4S35A 4C07A 5I8WA 4L7QA 1N5DA 1X7WA 2G7MC 4NFYA 2P2DA 4EI8A 5BN4A 5CFZA 2ZJOA 3GEHA 4H15A 4N6OA 4Y18A 2ZT7A 1ZI8A 3C8DA 1XZ8A 5CLGA 4ER3A 3LE8A 2Q27A 3QU7A 4ENWA 1XLVA 1RLJA 3GIWA 2WJVA 2NV2B 4TS1A 3CH5A 4W8OA 4ZVMA 5H7XA 1ILWA 4B0OA 4IBOA 1XRLA 4Z9BA 3MAAC 1FYEA 4RD0A 2WEKA 3HK2A 1M72A 3K96A 1O8BA 5KYTA 1U02A 4IKPA 3OSZA 4LJSA 2RGXA 4JBGA 5EIBD 3MSXA 4GG1A 1UBSB 1J0EA 2O50A 3MMSA 4D4HA 3BQ9A 3U1TA 4KXFB 1Z0FA 1UBNA 4Z0NA 4X3CA 5C8YA 1XVVA 1T0PA 2XT0A 2CK3D 2NZUG 4RIEA 1P1JA 1K66A 3MGCA 4H7DA 4AY4A 2ID4A 2ZIXB 4D0GA 4EX7A 3PLAE 3MJCA 1W59A 3NO4A 4IIXA 4WUTA 1FXSA 3NAMA 1IONA 3RSSA 5K0JA 1DAIA 2NZYA 1RXYA 5J59A 3JQFC 3O75A 2VRBA 3GG9A 5IEJA 3BGIA 2H2WA 2G08A 4HEHA 1EVYA 4MLZA 4MW5A 2MINA 4E22A 1KZHA 1ORIA 2OB2A 2BEKA 3TFOA 1X80A 2Y0BA 1K6XA 1XJ5A 4J7XA 5LYJB 1RRPA 4OXRA 1F8UA 1HTTA 2XYRA 1LPSA 1WIWA 2XSZA 3TUIC 1MU0A 3BDIA 3T3IA 3O5AA 1SCDA 4M1YA 4NNOA 1SUAA 1KYXA 1U1EA 3BXEA 4EA8A 1J5PA 5BY2A 5JMTA 3SVLA 3ZY4A 1F7VA 3GAAA 2DH6A 4J4BA 2WM8A 3AVYA 1F2VA 2GESA 4P4SA 2NV0A 4HQ0A 3K9FC 1QGED 4OHPA 1PJBA 2OHVA 1NWHA 3QEKA 2B4TO 2ADOA 4IXTA 4OBEA 3AZPA 3SS8A 4UAVA 3KE8A 1E3WB 5IKMA 5DTIA 2VBCA 2H00A 2C5BA 4HNSA 1T3ZA 5IC6A 4W5WA 4WA7A 5CB4A 2X2FA 5AVJA 1QVZA 3BTOA 2PD3A 2DECA 4R2JA 2WINI 2ECOA 4NCIA 4YHHB 4RV5A 3D1JA 3GGPA 2HMUA 4K5QA 5K3OA 1R3UA 1AKRA 2F6RA 2JDID 3TLJA 2I4TA 4J49A 4ES6A 3ADPA 1W1IA 4W5RA 5AOAA 5FI5A 3U5TA 1QV7A 1S2LA 2BFOA 4FX2A 5IT5A 2IHVA 5JNLA 3ZNQA 3TZ6A 3AJEA 5C4GB 2AZXA 1EDEA 4A0QA 2C3PA 1N75A 4Q1CA 4A1OA 4DQXA 4LPKA 4UD6A 2CY0A 3D8HA 4ARIA 3TX6A 2OHJA 1DJPA 3DKVA 4GI5A 5AW5A 2VHQA 2ZIEA 1Z4LA 3GLGE 3TDKA 1G5FA 3LW8A 1XWWA 1JFTA 5BYAA 3FA2A 3OQIB 1Y1TA 3KEOA 2JFFA 4QL3A 1N2OA 1NUUA 2ZRCA 3CW9A 4KJXA 1ZRSA 3AUYA 3DO5A 3IUEA 3SC6A 5BOSB 3TFQA 2OK8A 1USGA 2ZSEA 3CZMA 3VR3A 1XN1A 1BFUA 2YS7A 1XPUA 1U0FA 2AF3C 3HO8A 3PTZA 1X7DA 2P0YA 1WZIA 2P4SA 2YV1A 4UARA 3A06A 5LBTA 2C95A 3PL1A 4RKQA 1SUIA 1E2QA 1OZ0A 1IZ7A 1YTLA 3FI0A 4BNXA 2CUZA 2BTQB 4H08A 2PANA 1SBTA 3ZY5A 5KJCA 1NVBA 2PTGA 4H16A 3OAAD 1NV9A 5AI6A 3HG7A 1JLRA 1GZUA 3AYZB 4TRRA 2CF5A 1OA0A 1KU0A 3EDQA 1LSSA 1UM8A 3N2KA 3F7MA 4UXIA 4KVGA 2EGGA 3U3DA 1PJ2A 2G1JA 3ESXA 4P4GA 4EHDA 1VI5A 3N70A 2OUIA 4FBGA 3GCWA 4I4LA 4GKJB 4KXVA 3PE6A 5H3LA 5T64A 4HEJA 4EGAA 3THYB 4E51A 4IHQA 1UBHS 4DCOA 2HHLA 4KYUA 2M6SA 2Q8QA 5KTYA 4FSHA 1LX7A 2JAUA 1UC8A 4IP0A 1ZR2A 5HS6A 1MJNA 5G40A 4NP6A 2JATA 1LWOA 2JIMA 4G0MA 5FPSA 1O89A 3OUTA 2FSHA 3QVSA 1NVMB 1HT1E 1UXOA 2JAQA 2PCLA 2Y27A 2Z6QA 4EY8A 2BGGA 2Q1WA 5HK9A 1JH8A 1KRHA 2BHNA 2WHPA 4QBIA 1TECE 2BFCA 1E3WA 1KK1A 1R4ZA 3AESB 4X85A 4LVUA 2Q7OE 1H8EA 1QR2A 3FMFA 3NHFA 4AO7A 2H0QA 3VR1A 4C21A 3LT1A 4MQMA 1ZMOA 1OTYA 2TSYB 5HKAA 1L7BA 1MEEA 2GYWA 3UENA 4R84A 1MX9A 3HO1A 2VSFA 2DPHA 3OJWA 4WXPA 3JVIA 2AKAB 2FZGA 5JAQA 4L0CA 3L7BA 1QAOA 4BP9A 5AT1A 4GLLA 2H1OA 3TZCA 5A3RA 4F9TA 5I01A 1V8DA 2W83A 1XCJA 3DOIA 5AM3A 1T9AA 1AS0A 1B6TA 2YXEA 4MLDA 5EZSA 3SBEA 1C7QA 4Q02A 2YYAA 1PL8A 1INLA 1FRVA 3S2FA 3L9XA 5DTQA 4URZR 2OCBA 1Y98A 3EHDA 3DMPA 1E2UA 3B3QA 3KT0A 4NF2A 2GEBA 2HJRA 5AR1A 1GSIA 4RV9A 3JASB 3HLTA 5KJFA 2HA6A 3GVXA 4AUEA 1KEPA 1BWSA 4WLFA 1IQUA 2IY9A 2VDKB 2CN1A 3R9KA 1ZH2A 3OSUA 2Y67A 2X0NA 2G0NA 1B4DA 4FN5A 4M0PA 1TMOA 3SQDA 1RTTA 1M67A 1XVLA 2F43A 2EJUA 1E2MA 4O33A 5F4ZA 4B3GA 4Q37A 3ESZA 1A1SA 1SVKA 2B8TA 3JQ9A 4W7SA 1CUBA 4DG8A 3CVOA 1EA7A 1NUTA 4XTCS 2I6QA 1XD2A 2JH9A 1CR4A 2XUHA 1EE1A 2CFSA 1OH5A 1L5WA 1Z7WA 2NNLD 2VP4A 4KZKA 4WN9A 4MW6A 2ENWA 1XTSA 1PYDA 2ACWA 2ILTA 4MKFA 2GCOA 4NRDA 1AB6A 4JASB 2A88A 3MW8A 1KYWA 5A3VA 1D9ZA 1IQPA 2O0LA 3GP5A 4JB8A 2AX4A 2N1MA 5H1YA 1PWEA 3T54A 2MT9A 3TPFA 4MUIA 1JLLA 2COKA 1QDUA 1E5DA 2I34A 2SCUB 4HQKA 4JLUA 3TTVA 3UWKA 2D1YA 3T7TA 3FWKA 3K30A 3VPAA 4G1MB 1Q7TA 3IMKA 4FZ3A 2HCRA 2IF2A 3EAFA 5TT0A 4EENA 3I9KA 2BONA 3EXFB 1DG1G 2ODPA 2OUKA 1QCYA 3F74A 1JR3E 4YROA 1QO0D 3ZZ1A 4QXAA 1BGWA 3T3EA 3K0BA 4OATA 4CG3A 1ZK3A 5GMOA 5J5CA 1ONPA 2J3KA 4YJ2A 3FTPA 1VBFA 4RJKA 2LVBA 1J0AA 2HIHA 5K9ZA 2GK4A 1FLDA 3JV7A 1E0DA 2ZU0C 4ASUA 1Q6ZA 3SSOA 2EG5A 3TSWA 3ILSA 4Z9FA 4CM8B 3PFCA 5CIQA 5HILA 2XWQA 2BELA 2B4AA 1MRSA 3LRTA 5ED0A 2FE4A 2GAFA 1XLUA 3O9ZA 3GN2A 3WR5A 2R7KA 3QRWA 1T5HX 2G1UA 2H6EA 1JR6A 1D8TA 1I2MA 4RK7A 1DELA 1SKBA 2GN6A 2O23A 5CHEA 5F12A 3AHGA 3N0WA 3OC6A 4NU0A 3UAOA 4EY4A 1YONA 4UFNA 1RBZA 1SCUB 1WVMA 3HZOA 2GPYA 1GLVA 4DAEA 4FGLA 2HZ7A 1YMUA 4B3XA 3MTGA 3ICVA 1CDEA 4YIKA 2XGOA 4ZAFA 5GINE 4FFBA 4L8YA 1IMOA 2B92A 1H2AS 1N5RA 2XYGA 1WMBA 3ZGLA 1NT4A 1W6UA 5J23A 4NABA 1NSTA 1B42A 1K7YA 1YJCA 1ZLXA 2QTRA 3COYA 3BD9A 3HJUA 3EGEA 4BKQA 4E12A 2N47A 1W29A 3E6AA 1LCIA 1XZJA 1E9FA 2ZYVX 3D6UA 1KMQA 2QPAA 1C1YA 2Z8XA 3DVQX 2VT7A 4Z4HA 2XNDD 3CZQA 4ML3A 2C03A 1D2EA 1Z4KA 2XTJA 3G3EA 4KN5A 3SYMA 5LLDA 3O3CA 4FZVA 1I1NA 3OZFA 1D2RA 2B37A 1Z28A 1ZM3A 3PFHA 1OR8A 2JG3A 5FORA 3NCHA 3GAMA 3OTHA 3VKHA 2C84A 1PTJA 3H4IA 4IY1A 3HO6A 2IEIA 1G8YA 5BSEA 1CIPA 2XIQA 3PHHA 1VYUA 5HKKD 1OGYA 5HJ7A 3KCQA 1G2IA 2E82A 1C0LA 4FP9A 4MDEA 2HK7A 4RFSB 3T4EA 1MNAA 4N0MA 4B79A 5I7VA 4FEAA 3K4HA 4PGHA 2IPAB 3P2OA 3MWKA 1L5NA 4KXQA 4BB5A 3LX6A 1FFSA 1VBMA 2QTZA 4BQPA 3H18A 4Q3BA 4IIUA 3AP3A 1KJYA 3FHOA 1YL6A 3FWYA 2NW6A 3MQ2A 3X0DA 1GD1O 2ZRBA 1NVAA 1NZJA 1RKUA 4DE5A 1Z35A 4GD3Q 3LPNA 4LDQA 1Z2DA 1ZW1A 5LKAA 1EP9A 1Q0PA 4NYJQ 3K70C 3THRA 1KR5A 2PZJA 3LWNA 5EUBA 3TLKA 4GP7A 4MRMB 1PLJA 1U4NA 1YRAA 3KO8A 3WLHA 4PLCA 2BP7B 3FUUA 1FRNA 1YQWA 2Q5IA 4BRWA 3I62A 4C7VA 4JC4A 5I7SA 3N6XA 4PO3X 2DM6A 3VNVA 1V2HE 3T6KA 2HHCA 5HUJA 2GCIA 3NC1C 1T5IA 1FDWA 2GJSA 3A3YA 3S2EA 4ABTA 4DIUA 1P29A 3RK1A 1XSEA 2C9YA 3PUIA 4DEXA 3D64A 4JBWA 4OQLA 4X3PA 1PX0A 1ADFA 2FJUA 2MYTA 3V4FA 2KB0A 3OY2A 3B3AA 3LXRA 4R1TA 1VLZA 4RMIA 5IC5A 4ZGGA 1Y3IA 13PKA 1ND5A 1KFJB 3LQYA 3Q10A 5KS2A 1UT5A 2GHIA 2GM4A 1Y5MA 1DOHA 4H1WA 4PANA 1E98A 3PQ2A 2HK9A 5E6UA 2YINC 4DJ5X 1X42A 4X8HA 1D4AA 3BWMA 3SBDA 3LY5A 1HLPA 3STHA 2R7NA 1S7GA 3FWPA 4TV8A 4CQNA 2I4OA 4NBSA 2AXNA 2WIJA 3SF8A 2O2JA 2P40A 3CLSC 1IZ9A 4L57A 1E79D 1DHTA 2WVJA 1Z7EA 4MTCA 1AXEA 4PCAA 4PQFA 3DLIA 5T4BA 1I4OA 4A8JC 1Z0AA 3EQ2A 2ZYTX 4KXNA 5L6MB 1O97C 1DRVA 2GM3A 2G71A 3G2MA 2QTBA 5JNSA 3WRWA 2V55B 4H0FA 1XEWY 2FDRA 5CDGA 4B44A 2OV3A 4BCDA 1F8FA 4FDLA 4L3VA 3ZE9A 4G4JA 5AI8A 3HFGA 2JC3A 2Q3HA 1E2BA 1BE6A 1TYAE 3NTOA 1XF1A 2C3UA 3H9BA 3RVMA 1TCAA 3VR5H 4ZK2A 3AR8A 3PR2B 4WX2B 1XN4A 4TN5A 2DKFA 1RYBA 3T99A 3DFIA 3L1JA 4RDIA 4I1VA 1E7QA 4X7BA 1VL5A 4OM8A 4EEXA 4L9WA 3VU3A 3O8DA 3BD8A 5IN4A 2ZT5A 1JFLA 1ATIA 3MVEA 4DRYA 4MV0A 3VC2A 2WILA 1UFKA 4RHTA 1RQLA 5AVUA 4PC6A 2V65A 5LWHA 1FP6A 1EYZA 1Q3TA 1ZA2A 3RV3A 1R4MB 4KKVA 3B9BA 2PT6A 1NUSA 2ZULA 2OG1A 4M1WA 4PZYA 3RROA 4IGIA 3C8MA 5A4JA 221PA 1YA6A 4E6EA 1XDDA 3F9IA 2Z6UA 3DJFA 3G59A 3LDHA 3HXKA 2WYHA 4TTVA 1X8LA 4R1SA 5EL0A 1AO0A 5ARDA 3NXKA 4R8VA 1LZLA 1K6JA 1QU3A 5J2TA 3THXA 3PWZA 3HN7A 4UBOA 1J9GA 1EXMA 1RHQA 4N82A 3TTYA 1DNPA 4WL0A 5K0LA 1KHHA 4JHXA 1HOTA 3ANLA 1KZ9A 3USES 1NP3A 4WI1A 1N6OA 2JZOA 4F06A 2HH9A 1SULA 3N3AC 4IDPA 421PA 1N5OX 1A7KA 1V5IA 3I09A 3JWPA 4G0QA 2AOVA 1X1BA 1C7FA 4KFUA 4U2EA 3TF5A 1IJFA 1NI4A 2VXBA 3GJ0A 3RYTC 4AJJA 3LCMA 1HC7A 5E3HA 4L08A 2QLNA 1FPMA 2D2XA 1Q1QA 1THGA 3IEIA 3DMTA 3SX2A 3GBPA 3VXKA 4B4OA 4Q4AA 3G7UA 2FG5A 4DQLA 3FGZA 4IGEA 5K05A 5LIRA 3UB2A 4C4ZA 1DZIA 4RW0A 2POQX 3RTDA 1NXSA 5EJIA 1ESDA 3HCEA 2FP4B 1A3CA 3EAGA 4ARVA 3FH0A 2FPRA 1Z0UA 3OJLA 4ER7A 1T0HB 1G19A 3L8GA 3MS7A 5LLTA 3UB4A 4MGYR 4C4PA 4DLYA 4FDAA 4DR4B 4TKVB 1IDN1 1P1KA 1C3OB 4GE3A 2VDUE 4NCJA 1E58A 2PSFA 3UFBA 3H2ZA 2IY8A 1TZKA 2FPKA 1U7XA 2VJDA 2VOEA 1MG5A 3GVPA 2PBFA 3IV9A 5AJHA 5EUMA 4QEKA 4KPUA 4D3DA 3JVEA 3SZ3A 2RH9B 3CZRA 4QT0A 1DJMA 3WGGA 1HT0A 1HQDA 3IOEA 4DN6A 4NH4A 1XTQA 5A02A 1AV7A 3TR0A 5JUWA 4NFLA 1OBFO 1PSZA 4WKNA 5K8VA 2L82A 3ELUA 4HQLA 4IX1A 3H2KA 2QI9F 2W2KB 1IATA 3DEKA 2PGIA 3I72A 3LVRE 3QKIA 1QUEA 3T5PA 3IESA 1EFLA 2JLQA 1HYQA 4RPCA 1P61B 2QX8A 2XSZD 5AVXA 2ZXUA 4OOEA 1E1QA 5KYVA 1THZA 3KM0A 1L4HA 5JSUA 2OMEA 3K05A 2NUAB 5CK4A 4XIYA 4URWR 4E5MA 3PPIA 1M2EA 1JMVA 2NADA 3LPAA 4GL2A 4N3NA 4FDVA 1I3KA 4KNWA 4H1TA 3M49A 5DGDA 4WT7A 2ZTVA 2P2NA 4NCBA 1ENOA 1A9RA 4B4UA 3EDYA 3ZCTA 1WZEA 1QYXA 3P32A 2QX6A 1TEHA 2VHWA 1GNPA 2VRCD 2QZSA 3DTYA 3M2TA 4FSXA 4KPGA 2WU8A 3F3YA 2HJHA 3GEIA 4BPRA 1S9DA 5EKDA 4EKNB 5I4KA 5LXTB 3QVOA 3QHAA 4QPCA 1RFLA 4YMLA 4ZT4A 2OM6A 5F3WB 2MWMA 4YJ2B 1DI0A 3L8HA 1I3CA 1T4CA 1SG6A 5F73A 1X9GA 3QKWA 3P19A 1ZP6A 3W1VA 1N7JA 1OWLA 3P1JA 5FWDA 1T34A 2XCLA 1Q91A 4W9NA 3DZHA 1C8KA 1UPFA 4CL0A 4PFJA 4D02A 3MCWA 3EFEA 2FW8A 5CAEA 5CIYA 3ZY3A 2HBZA 2J3IA 1O6BA 1NMEA 3HRKA 3HVHA 3ZCRA 3ZDCA 2C8JA 4TMYA 4LMPA 2GBLC 4LFBB 1NE2A 4LOAA 4G0YA 2QD1A 4P7JA 2ATIA 1CZLA 4WKBA 5BXYA 2H1VA 3MPOA 4BQQA 3QUAA 4UASA 5L4LA 4HAOA 3PNSA 3P9PA 2F8TA 4JELA 3KAQA 1MO3A 1ZGBA 3W2IA 4LRYA 3VVMA 2HYDA 2O5EA 1U1IA 2D1SA 2JW5A 4OK3A 2O3JA 5I4BA 1L1QA 4HCJA 3RS4A 3K5PA 4GHWA 1R6UA 3E2IA 2B4RO 2PR7A 4XCXA 3FTEA 5DDIP 3VZCA 4KLRA 4OYYA 5K0CA 1H4SA 4RFLA 4RY0A 1RD4A 4YCBA 3WWCA 1XJWA 2WA1A 1YACA 4LRWA 4MKGA 4M7WA 1IXKA 4WECA 5CCXA 1XO1A 4GM1A 2MSLA 3QH4A 3TQFA 2YMQA 3IQDB 4P38A 2J3HA 3WFJA 4OQPA 2JAXA 4P7GA 2CYAA 4KODA 4RTLA 1I1OA 1N5IA 3MOSA 1XQYA 3BXFA 1VHLA 5H3CA 4JJKA 4Z4GA 3W8DA 2LWIA 2G1KA 5G3YA 4EO4A 4M1QA 2MTBA 5ADHA 2IEAA 2IHJA 2D74A 3DCNA 2A1UA 2CMGA 2R62A 3EIHA 4ND1A 5K4AA 4EJMA 1D1SA 1GNVA 3VNSA 4BFZA 3PHGA 5B3KA 1JHPA 3OX3A 3RJMA 4JT9A 3VKVA 2IYRA 1CD5A 2JHPA 1YZGA 1HNXB 4L15A 2IS2A 3PHBE 3PCTA 4HWSA 4I9UA 4WK6A 1NN3A 2HJVA 5ALZA 3UUFA 2VYCA 3WMXA 2EFGA 2MYNA 4WZBA 3VH3A 1GARA 3SC4A 1M9NA 3UMRA 1ZKMA 1NBOA 4ZHQF 3L9WA 4WLEA 5ALYA 1SHTX 3GGOA 1IN4A 3VPCA 4QULA 2EQ5A 3IVAA 4WD3A 4F91B 5J47A 1RXUA 1E63A 2CFIA 4Y2QA 1VCMA 3INGA 3ZGVA 4FEEA 1UDCA 1YHNA 4LGMA 5LA6B 4N7BA 4QNMA 3DOCA 5FRDA 4KCGA 2I66A 3IOCA 2FX2A 3Q3IA 3N6VA 4G3XA 2ZE5A 1KEZA 1RI5A 2G6TA 1HLGA 1JIUA 1WV0A 1Y3DE 4TSFA 5F1OA 1ZM7A 3Q2IA 4GPZA 4PYJA 2Z56A 1WW2A 1U9IC 5IP5A 1NVVQ 1OWNA 1JP7A 1KEKA 3MQ4A 1YZHA 1O95C 1Z83A 1FLVA 4U7WA 1Z5UA 4NENB 5H70A 1RMYA 2JGKA 5GY7A 2DC1A 1JV2B 1II8A 2YZ7A 1NOKA 3MERA 4L76A 2JFPA 2B21A 3EY4A 3FDZB 1H2HA 2FOLA 4TSRA 2LKDA 4D4GA 3W5BA 3HWX1 3OMWA 4B7XA 3NDPA 1X94A 2F7SA 3U37A 4R5HA 4OH7A 5IAEA 1A77A 4K81B 2BGTA 2ZB2A 5TQVA 3ICOA 4WBXC 2AVDA 3U6KA 5BMVF 3AL0C 3PXUA 1XPJA 5BR4A 1IXYA 1G8SA 1NOJA 1VYTA 3R24A 4YONB 4C20A 4EKDA 1JAHA 1KVRA 1P77A 1RRVA 4IVPA 4HBGA 1N0VC 3Q6IA 4IZOA 4KQGA 4Q21A 5GAJA 4BV3A 1E3SA 3H3FA 2DP4E 4KO3S 3CZCA 4KN6A 1BVYF 2P2ZA 4IX9A 4FYMA 4J2HA 4K6MA 3A11A 4CIDA 5THXA 1JSXA 4ZVTA 3SF0A 4XOIA 4A0HA 4LJ7A 1H4VB 4UXJA 4PY2A 1CR1A 2WR8A 1W44A 2NSJA 2BMFA 1X0VA 4KIUA 4LZAA 4QOFA 1GSOA 2KMLA 3ECAA 3V8EA 5EZYB 4XX0A 2RG7A 4ZYZA 4V0ME 5BSKA 3ZXUB 1M5RA 5JBNA 4ZJUA 1AUQA 1JLSA 2E2WA 1MC8A 3R5SA 2GCOB 1U8TA 1ES9A 1F2TA 5THKA 5EIOA 4CN9A 1XTZA 4PYMA 2QIPA 2P27A 3KYIB 1YI8A 3LK6A 1XRRA 5CU7A 2FG6C 4CMKA 3ET5A 3ESAA 1W88B 2CB0A 3U4HA 1W46A 3EF0A 3MC1A 1M0TA 4ZK6A 3PKJA 4MR9B 1UFQA 3TNFA 5KQPA 3PIIA 4UUBA 5F4BA 4O4JF 1N2GA 2XB9A 2X22A 2YV2A 2FPIB 3P27A 3TW8A 1TUBA 1V5GA 4B3CA 3YASA 3L7YA 3HV0A 1K27A 3F8WA 3SZRA 1QORA 1EJ6A 4QFCA 3ZWBA 3I58A 4MVJF 1X86B 5LDDC 2EV9A 1TEZA 3K94A 4RA9B 3GUVA 2PZEA 3T1VA 2FSFA 2PUCA 4LV6A 4G9EA 2B6HA 4FZJA 1L5HA 1RWPA 5BR7A 5CDHA 1N4DA 2HLDD 3QXGA 4TWRA 2Y6UA 3QVKA 4AU1A 1Z4IA 5I9LA 3NR2A 3AOEC 3VISA 1O6FA 1P6QA 2IYZA 2JVJA 3KE9A 1QRSA 1BJRE 2GASA 3OKAA 2IXDA 1SU8A 2JFHA 3PUZA 3UMFA 2MSNA 3QFRA 2LDBA 4K8RB 2VDOB 2HOQA 3QXHA 1V1MA 2H0RA 3RTBA 2V0NA 4PQRA 1U90A 3FPKA 2QM8A 1K7FB 4JCOA 4RL6A 4BMDA 1TJ4A 2EWWA 2IH4A 2I2CA 5IT4A 3TXAA 2HIMA 3AKYA 4U8HA 2QSZA 1J07A 4I1PA 2AW5A 3G2IA 5DNDA 2BFDB 2F62A 1AHNA 3QYPA 4DPMA 4DL9A 2AA3A 4HX5A 2BMEA 4ECEA 4F4UA 1PZNA 1Q14A 5HM6A 3ADCA 5FNVF 3MTAA 4DLTA 5J2UF 3H1GA 2WPDD 2PBRA 2VH5R 1IWOA 2IU6A 1PJ8A 3A1DA 3PVCA 4UZEA 5ESDA 3SJAA 4AJ2A 1OH6A 3CVVA 2CVFA 4XM1A 1WTCA 1ZK2A 1H8HD 4X65B 1T1GA 2P6MA 1TW2A 3FCXA 1DFHA 4BNGA 4HSEA 2XMRA 3GPCA 5J4KA 1M6YA 4BKRA 3P2MA 1NMQA 5IU6A 5DLEA 3RVSA 3ODPA 3C4QA 5TJ9A 3L7JA 4X24A 3WJ1A 5CEJA 3JYHA 1DKPA 2HXSA 2HSZA 3TK1A 4D79A 2E4XA 2IYUA 5L3VA 3TVTA 1KEWA 1YZNA 3JWGA 4GYWA 2EX1A 2ZR7A 2JLCA 2FRDC 2H7YA 2XTAA 2A92A 1XCGB 5BOVA 2VOJA 3HZZA 1A4IA 4OB6A 1Y1PA 5FUWA 3QSGA 4EVRA 3EA5A 1FTWA 3EUWA 4M6WA 2P2GA 4O6VA 3EPKA 3CF4A 4RNDB 4Q16A 1GZDA 4IV5A 4OL9A 2P9GA 4NBVA 3GLFA 4BZXA 4CQMB 2IGBA 2J31A 2ZANA 1RAHA 2HWYA 3P4XA 5F2OA 5ALXA 4UTRA 4CEJB 3WNZA 1OH7A 2MHCA 3C70A 4UFOA 4LMAA 2ZI6A 4A8HA 1MJGM 3DFFA 3RD5A 4ED9A 1E77A 4ZVKA 3NP7A 4EFKA 4K6GA 4FB5A 2FR8C 1DUIA 1NN0A 2JHAA 2X2OA 3PGJA 5K51A 2OCKA 4BKPA 2QRVB 1UFVA 1D1TA 1EINA 2JCVA 3BRWA 4M1EA 2YASA 1E4EB 1C4XA 4BO1A 3D8NA 3HR4A 5HRAA 4YASA 1MBZA 1I3LA 4C78A 1UKBA 1R6AA 1E5TA 3FKQA 3LC7O 1IIBA 3DE6X 2DBYA 5SICE 3WRXC 2GPJA 3DOHA 2AVNA 5KOYA 1VP3A 2A9VA 5M29A 3R7SA 3URMA 3VOSA 1E6UA 2ZAYA 3NHWA 5FL7D 3W4IA 2G4CA 2UVPB 3HJTA 1YZYA 1GPNA 5CM2Z 3AIMA 4KL8S 2OGWA 4DIOA 3DMRA 1A50B 1UBCA 2O0MA 1NW8A 2HEIA 2P0EA 2Z5LA 4AZWA