4KRYA

Structure of aes from e. coli in covalent complex with pms
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
317
Chain Sequence
KPENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYTLERRFWNAGAPEMATRAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational analyses of Aes, an inhibitor of MalT in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Acetyl esterase
total genus 115
structure length 317
sequence length 318
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.-:
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kryA00
4M0MA 1LLFA 2W6CX 3V1LA 2EDAA 4B82A 1XRPA 2WIKA 4QNNA 4UBJA 1T4MA 4FDMA 4QDZA 1LGYA 1WB6A 5AM4A 4LXIA 5CT6A 5CT8A 3U0VA 2XI4A 4K6KA 4FKBA 1CQWA 3D59A 5CBKA 3EBLA 2IITA 3S2ZA 1QIIA 5DYTA 3ZWQA 3QPCA 3VJKA 1UT6A 2HDWA 1E89A 1A7UA 3FNBA 3MUOA 3N0TA 4AZ0A 1XQVA 2EDCA 1ZI6A 4X6UA 4M0FA 3WWDA 2XMGA 2XMDA 2FX5A 5HF6A 1ZGBA 4Q3KA 4KAJA 4KE8A 4HRYA 5AKYA 3G7NA 3PF9A 3WA7A 4WDRA 2OGZA 2Z3ZA 1UFOA 2QXUA 4GW3A 4OYYA 5D7BA 3GUUA 5A6VA 1YB6A 3M82A 5DNVA 1QIHA 4S0XA 1QO7A 2V97A 3H18A 3W05A 4GWLA 3W2TA 4YX9A 2QS9A 3DOHA 3H2IA 2VT6A 2Y2VA 1EA5A 5ALSA 1UKBA 2JEZA 3QVMA 2B61A 2O7RA 1EHYA 2HU8A 5LZ8A 3LP5A 4GLBA 3I2HA 1CR6A 5I9IA 1TQHA 3O95A 5D3ZA 3E0XA 5FOQA 3QBJA 1S8OA 5JZBA 4J03A 3R3WA 3IULA 1QGED 4UFPA 2WFLA 4N8DA 2XLCA 2QJRA 5AK3A 2ZYRA 1WHTA 3ZI7A 4ZREA 1TRHA 3B5EA 4J0CA 3M81A 1YA8A 4ARBA 2K2QB 2XUFA 1ORWA 4BC1A 3D2CA 4C01A 1Q0RA 1GZ7A 3G0CA 2WUFA 4JYPA 3FYTA 4MJ3A 3STVA 1DQYA 4U2FA 3OM8A 3LCRA 4XX1A 2DR0A 1VKHA 3BJMA 2XUHA 1UOQA 1O6FA 3CCBA 2I03A 1J07A 2ACKA 3I2KA 3DKRA 4WFKA 1VOTA 1HKHA 3MVEA 5KWJA 3QM1A 4DNQA 1X70A 1MU0A 3QH4A 2DQZA 2ZYHA 1GQSA 1B6GA 3IIIA 1E5TA 1F0NA 4J0KA 4DM7A 3BDVA 5IH7A 3DCNA 3A2MA 3I2FA 1Y7IA 4D9JA 2GZSA 4WFJA 1GXSA 1A88A 3HJUA 4EY4A 5C8XA 2XDWA 3QYJA 5BV7A 3O9VA 1AQLA 1VE6A 5DJ5A 1R4ZA 1IUPA 4J0DA 1DWQA 1FFDA 5AO9A 1MAAA 1Y7HA 2VF2A 2XMQA 4DSZA 2HU7A 5ALZA 1F0PA 3FCYA 2XUPA 2CMFA 2DHDA 5ALFA 4FLMA 3R3ZA 2VTVA 5HFAA 1SCQA 5ALTA 4FFWA 2DCMA 1C7JA 1GGVA 3WL7A 1CRLA 4WDQA 2NW6A 4XJVA 4FNMA 1JMKC 4I3FA 5ALUA 4IH1A 4J0GA 4AXBA 1WCYA 1LPNA 5AI6A 2JGEA 4LXHA 2HIHA 3OOSA 3C6XA 1E8DA 1P0QA 1YS1X 3F9CA 2VJDA 3LLCA 1QIMA 4F0JA 2OQIA 2BFNA 4B9AA 4QLAA 2BUBA 5AP9A 2WFMA 1R9NA 3B12A 1QIGA 4G4IA 4WY5A 4BDSA 3NWOA 4TGLA 2CB9A 1JJIA 1Z68A 1FFAA 3ILSA 5ALQA 2BCEA 1K63A 3H04A 4ITVA 3FLEA 1UK6A 1TAHA 3JWEA 2XMBA 1AGYA 1W75A 3IDAA 1EXWA 1Y37A 4B80A 3HYSA 3W9UA 1CUIA 1XZAA 4GDMA 3D5EA 4DMKA 5AI0A 1GPLA 1UOPA 4X91A 3TEJA 4UFNA 3UUFA 1G4HA 4MYSA 1SFRA 4AO6A 1ZD5A 3OC0A 5AM2A 2QJWA 1EVQA 5AI9A 2Y2UA 3F98A 3LIPA 5ALNA 4BTLA 5EIHA 3PDCA 2C0QA 2RHTA 5IVKA 3OURA 1Q0ZA 5AIAA 2C4HA 4AN0A 3O4JA 4NS4A 5D3KA 2XQJA 2WSLA 1MAHA 5AHXA 1D07A 4HRXA 3V9AA 2H7XA 1R1DA 2LIPA 3E3AA 2WU4A 4AB1A 1E3QA 1AUOA 4C4YA 2Z8ZA 3IB3A 1CEXA 5EHNA 2BJHA 5IVIA 3BIWA 1ACJA 3D2AA 2XUIA 1Q83A 3C87A 4B9EA 2Y6UA 5K3FB 1CUYA 2FJ0A 1WB5A 2C5GA 1VXRA 4Y2SA 1LZKA 4A23A 5HK9A 1FJ2A 3ANSA 4OB6A 2AXEA 5T4HA 1CLEA 3WKDA 1ZJ5A 2PVSA 1QO9A 4F60A 3EQ7A 1U4NA 4CIAA 4Y2QA 4GBGA 1VLQA 4G4GA 2B20A 5DYYA 3C45A 3ICWA 4B0PA 1NX9A 4DGQA 4GXNA 2ONCA 5DTJA 1PV1A 4U2EA 2PL5A 4KR0A 4Y2XA 5CT5A 4V2IA 1LPOA 3NUZA 2ECFA 1ZI8A 1XLUA 1MNAA 1TIBA 3CCCA 4DTCA 3EQ8A 5YASA 2JF0A 3C5VA 5ALOA 5AOAA 1XZMA 4G4JA 4U2CA 4BATA 5C81A 3KWJA 4H7JA 4KE9A 1CIJA 5HK8A 4C6HA 5LP1A 1XZDA 1UZAA 3WWOA 2WIJA 5K3DA 4KJXA 1FFCA 2FJPA 4C88A 4BAGA 5FPQA 2WTMA 2O2GA 4MWTA 2HM7A 3DOIA 4FOLA 1H23A 3B3QA 5BOVA 1EDEA 4X85A 2DSNA 5LZ2A 2DQYA 5I8PA 3KWFA 2WM2A 4HXEB 1VA4A 2ZJFA 5LYYA 5E4JA 5ISMA 3ED1A 1EDBA 2XUAA 4E15A 2HA6A 1TKRA 4H0CA 1ZIXA 2CJPA 4K5QA 4LIPD 1XZKA 3C43A 1DT3A 5LKAA 3KD2A 1VE7A 4UBOA 1CUAA 4PNZA 2WG0A 5ALRA 4IH9A 5LLSA 3R3VA 4H7DA 5K3EA 5FPPA 4FTWA 3I28A 4W1QA 5AM5A 1IUNA 4J0JA 2WTNA 3C70A 4UHHA 3NOXA 4B81A 4A16A 3I2IA 4E11A 2I3DA 3R3XA 4E14A 3T4UA 3L1HA 3BE8A 4A5SA 2ZJ7A 2QRUA 4C89A 5T4EA 1NU8A 3WZMA 1JT2A 4W1PA 5A71A 2PSFA 2HA5A 3RLIA 3BDIA 1CUHA 1MNQA 2GBCA 5EIEA 3EF3A 3ZV7A 2XB6A 2YASA 1SC9A 3GA7A 4L0CA 2JGJA 3I6MA 2C0PA 1RP1A 2PPLA 1P0MA 3A2NA 4KEAA 3DNMA 4BCBA 3OTQA 5JATA 1CUVA 2XMCA 2PUJA 1QIFA 2ZVDA 2XQKA 3FSGA 3BF7A 1O6GA 1OXMA 5AICA 4WJLA 5LZ9A 3H2JA 3CXUA 1XZFA 1EB9A 3TRDA 5HFNA 4BZWA 3VXKA 4IQ4A 4PV7A 1XZLA 2HADA 1W6RA 4J7AA 1ZIYA 1DWPA 1EH5A 3QMMA 5AKIA 1SCKA 3D3NA 2IX9A 1DINA 1JFRA 2JGFA 4Y2RA 1W4LA 3WWPA 4NZZA 3BWXA 1CUBA 3H1AA 1RWQA 1TCCA 4QA9A 1J2EA 1XQYA 4J0IA 4PW0A 4X90A 3GZJA 3H17A 2PBLA 1R9MA 4ZI5A 5FDFA 1HL7A 1JU3A 4DNOA 4W63A 3X3HA 1OILA 4H7IA 5KREA 4BB0A 3JYHA 1MT3A 4BAUA 1YCDA 1DWOA 4MEAA 2WJ3A 2WUDA 1A8QA 4ROTA 5FXMA 4FLFA 2BGNA 4X71A 2OCKA 1CUZA 4X6YA 2WG1A 1LZLA 1VXOA 1ZOIA 4PQEA 1K5PA 3D7RA 2HL6A 4AX4A 4FFVA 1N5RA 1ZI9A 1LPBB 5HF5A 4BCDA 1LPSA 2QT9A 3TGLA 5CH8A 3H19A 4G9GA 3MUNA 2WJ4A 4EA6A 4BVJA 4DSAA 5JD6A 4H7KA 3WK4A 1XZJA 1USWA 4G8BA 6YASA 2B4KA 3VISA 4MEBA 5AK4A 4BP8A 4U2BA 1DTEA 4LYDA 3BL8A 4GI1A 3DL7A 5E4TA 1EK1A 4KAFA 2DFPA 2HRQA 4EY6A 3SK0A 5E2IA 5AKZA 3ZLUA 3H2GA 3I2JA 3ESDA 2VQ6A 1TK3A 1YS2X 4Y9SA 3QPAA 2OGSA 2AJ8A 1L7AA 2ZSIA 3H0CA 3PI6A 2RIPA 2WG2A 1BEZA 2WIDA 3QMVA 4PF1A 3M83A 4LYEA 2ACEA 2HA2A 4FWBA 3CN9A 4I4CA 1VA5A 2CBGA 1GKLA 2Y6VA 2WUGA 3WKEA 5K5EA 2PX6A 1HBJA 4H7EA 4XIIA 3WQHA 4MXDA 1QLWA 5ESRA 4MYDA 3KDAA 4CFSA 1JMYA 3HLKA 3GFFA 3FSGD 4B84A 5LZ4A 2QOEA 1DQZA 3FWHA 1QFMA 1U8EA 1E8MA 1GKKA 2V9ZA 4UHCA 1MX9A 2W22A 3FCXA 2HRRA 3HEAA 2E3JA 1QTIA 2VJBA 5CW2A 4H7HA 1P0PA 1BU8A 4EHBA 2OGTA 1FFBA 2XUDA 4I19A 4KRXA 5DLPA 3RKSA 1AKNA 4FMPA 2OCGA 1ODTC 1XLVA 1E66A 2RAUA 3I1YA 2PSHA 3H2HA 1ZD4A 5IKXA 3LS2A 4AO8A 4X6XA 3WMRA 5JALA 2Y1KA 5ALJA 2Z5GA 2RONA 3DYVA 2V98A 3WWEA 2C5FA 2BUCA 2XUJA 2VSQA 2GBIA 3DYIA 5JASA 1AX9A 4MQMA 3PFCA 2VEOA 2AJCA 4E46A 3G0IA 3VJLA 1SCIA 3D4LA 3D2BA 1HQDA 4FHZA 3DLTA 4W9RA 3YASA 5AKJA 4ETWA 3NGMA 2HFKA 4G1FA 4OU4A 2AJDA 2X76A 4H7FA 2XUOA 4X3CA 4EB0A 2XMSA 1QZ3A 2ZYIA 4XWGA 1VZ3A 4AN1A 3AIKA 2DHCA 2HA4A 2HA3A 2V96A 4QDUA 3FAKA 5DWDA 1R88A 2OXEA 4Q34A 5C8VA 5HF8A 3WL8A 3AIOA 4KE6A 3K6KA 4PSCA 2WIGA 3RK4A 3WIBA 3L1JA 3STWA 4BRSA 4QDXA 4RPCA 1UK8A 1XQWA 3H1BA 2WU3A 3GROA 5AKEA 1JJBA 2VAVA 1WM1A 1JI3A 4QDOA 2WFLB 3PUIA 4Q1VA 1QJ4A 3O9MA 3VVLA 1FSSA 4HXFB 4UUQA 3G9TA 1BCSA 5A62A 4TVKA 4UHEA 5EHXA 3IUMA 4X94A 2WIFA 1JKMA 5FV4A 4Q82A 1QOZA 2J4CA 5JZ9A 4QE3A 3K2IA 1GT6A 2JGIA 4OCZA 4IHAA 2G5PA 4CIBA 1QIEA 1MO2A 5AKKA 1YAHA 4H18A 2JGKA 2XQGA 5CXXA 5D6OA 2JBWA 4PSDA 1BRTA 5F4ZA 3WK8A 5ALLA 4DNFA 5AJHA 2WHPB 2OPHA 1U2EA 4CG3A 1KU0A 1QIJA 3E1GA 3G9XA 5JD4A 1UWCA 5AI8A 3KOOA 1JJFA 1NU6A 2XE4A 2WQZA 2GYUA 5ALYA 5LZ5A 1W52X 3O4GA 1C4XA 1L7RA 4H77A 4BC0A 1N1MA 4BP9A 2WFZA 2XUQA 5CRIA 1ZD3A 2QMQA 4YPVA 5FUMA 4ARAA 3WK7A 1YAJA 1R3DA 2YYSA 3T52A 2XMRA 4JYMA 5HQ3A 1H2WA 5CXUA 1CUGA 3WL6A 3DKKA 1LPPA 4OPMA 3G8YA 1CUXA 1CUWA 4F5ZA 5DNUA 1K6EA 3BF8A 5CT4A 1QE3A 5IVHA 4RE6A 5SYNA 4EY5A 1CUJA 1ODSA 1YSCA 3WLAA 2YH2A 3U1TA 4XVCA 4Y2JA 3P2MA 1MJ5A 1GPKA 5CT9A 4X95A 2XQIA 4KAAA 3O4IA 3C8DA 2WKWA 5EI5A 5AI5A 5AKGA 4UBIA 1CUEA 4F21A 3AIMA 1XKTA 1WPXA 5T4FA 4MQLA 3AJAA 3C6YA 3EQ9A 4HZGA 5FP0A 2CKMA 4LKOA 1GPNA 4NVRA 3WK5A 3WJ1A 5K3CA 1MTZA 4UHFA 3Q0TA 1HLGA 4GEGA 5C7YA 2PKYX 3UUEA 4MWSA 3DS8A 3R0VA 4HS9A 1EVEA 1XFDA 1KU6A 3C5WP 5HKAA 3DL4A 4OU5A 3M3DA 4PO3X 1IZ7A 1AC5A 4W1SA 1X2EA 4M0EA 5AM0A 1ZGCA 3DJYA 5EIAA 2ZYSA 3IUQA 1QIKA 2O2HA 1LBSA 2WHQA 2QUAA 4UFOA 1CVLA 2H9YA 2QKYA 5EGNA 1CV2A 1FFEA 2BAGA 2Q0XA 2GBGA 3HC7A 1N5MA 5JYCA 2ORYA 1VJ5A 5ALMA 4K6HA 3PF8A 4Z49A 3AFIA 2WHPA 4EY8A 4X00A 3KXPA 3A70A 3ICVA 4P93A 1YASA 1LPAB 4U2DA 3ZPXA 3VVMA 3V1NA 4BVLA 1UK7A 1XLWA 5A7HA 1EINA 3IURA 5ALWA 2DHEA 3AZOA 1XRRA 4EUSA 5LIPA 2J4FA 5ALHA 2PSJA 4BZZA 2OG1A 1BN6A 2XLBA 2H7CA 4UBKA 3FYUB 4UPDA 4X7BA 3OPMA 4B7ZA 3ESCA 5AM3A 4QWWA 4B85A 1XZCA 3VKFA 5AK6A 3GELA 4L72A 3QPDA 1BCRA 1LBTA 1CUCA 2IIVA 5KWIA 4Y2PA 4N5HX 3BJRA 3QMWA 4OB7A 5JD5A 3STYA 1EX9A 1HPLA 3VJMA 3FVRA 1Q84A 4JUIA 4J3JA 5CTAA 3AILA 4PSUA 4G8DA 1PFQA 1YB7A 1XZIA 1H22A 5ALVA 3F96A 5K3BA 4H35A 4J0HA 3STUA 3KSRA 4N5IX 3HI4A 5EFZA 2PM8A 2UZ0A 2R11A 4YK7A 3V1MA 2J3DA 1XKLA 2D0DA 4AMZA 4CCWA 3TJMA 1K4YA 1H2YA 2PU5A 4C4XA 3FBWA 3L1IA 4BTVA 2PU7A 4BAZA 3ZLVA 5LZ7A 1XRQA 3DD5A 4FLEA 3WIOA 1P0IA 4OUKX 3UMJA 1WHSA 2WHRA 4JH0A 3WWCA 3HSSA 2XQFA 4EBBA 3AZQA 2CZQA 3V48A 4DMHA 4BE9A 3AUKA 4HTAA 3HXKA 4OSEA 2OAGA 1A8SA 4BRZA 4DMCA 4N8EA 2XT0A 4IH4A 4KYVA 1UOOA 1I6WA 2C7BA 3BIXA 1QFSA 4GECA 2QTBA 1XQXA 5A7FA 4UBMA 1B41A 3EIOA 1F6WA 1TCBA 3WL5A 4OD0A 5ALXA 4WY8A 3C6BA 5CURA 1LPMA 2JGMA 2B9VA 3F97A 1J1IA 3WKCA 2JGLA 2GYWA 4B6GA 1IVYA 5BWCA 3LIIA 1OCEA 3HZOA 2AJBA 2Z3WA 1F8UA 3G0BA 3FLAA 1BE0A 4LXGA 1G5FA 4CCYA 2QXTA 5ALEA 4ZGBA 3WA6A 3A6ZA 1EI9A 1T2NA 5JAHA 3G0GA 2RGUA 1EDDA 2J3QA 3SC2A 1MX1A 1U65A 4KE7A 4UHBA 3WJ2A 2X8BA 3RARA 4WCVA 1G42A 5K3AA 5JAUA 1IUOA 2G4LA 3WI7A 4Y2TA 2HHAA 3G02A 4Q3OA 1VZ2A 3F67A 5A2GA 3IA2A 1IZ8A 2YXPX 1XROA 1N8SA 3FVTA 1THGA 5AKLA 3ESBA 4AQDA 4BDTA 2G63A 1CUUA 3SX4A 3PICA 3G0DA 1XZBA 2FUKA 4NMWA 4DIUA 3WYNA 2CEKA 5H3HA 4L9AA 4P08A 1ZD2P 5AH0A 4Q05A 4OB8A 2ZSHA 1BEEA 1C7IA 4YASA 5K3FA 2G5TA 2BGRA 4DYHA 2XMZA 2BKLA 5DYWA 1WB4A 4UHDA 2QR5A 4K2AA 4BCCA 5J3JA 3OG9A 1J06A 2CUTA 4P92A 4DMFA 2ZJ6A 5I7UA 2QVBA 2PUHA 1H2ZA 5AIBA 1ETHA 3STTA 1MN6A 2ROQA 1ZJ4A 2OQVA 1YR2A 3GBSA 5ALKA 3R3YA 1CUDA 4Y2VA 4BVKA 4X93A 4BE4A 5KBYA 1UKCA 1XZHA 1G66A 3I6YA 1L7QA 5ALPA 1TCAA 1YA4A 3CN7A 3VDXA 4ZV9A 2JIDA 4GHWA 3ZLTA 3I1IA 3JW8A 5HQ3B 3IVMA 3SWWA 5HCUA 1QTRA 4RE5A 3A2LA 3G9UA 1ZICA 4HAIA 7YASA 2HA0A 4C4ZA 4JNCA 1CFJA 3FLBA 5HF9A 2Z8XA 4KRYA 3D0KA 3R3UA 4INZA 1XZEA 4DNPA 4HXGA 1AZWA 4RNCA 3PE6A 2H7YA 2WJ6A 5JIBA 2GZRA 5IVDA 5CMLA 3W9BA 2OAEA 5AKHA 3I2GA 3WKAA 5AI4A 1W1IA 1KEZA 4ZV7A 2QZPA 3O0DA 3RM3A 1E8NA 5EHZA 2H1IA 4IO0A 3DEAA 4Y2UA 2VA9A 4LHEA 1X2BA 2RI6A 5JADA 3W06A 1DX4A 3E4DA 4N8SA 2I3ZA 4O08A 2I78A 3DDUA 3WZLA 4G5XA 4UBNA 3AZPA 4UBLA 5ALIA 2OCLA 1CUSA 4ZXFA 5EHQA 1QONA 4ZWNA 1QIDA 1XZGA 5JARA 2WILA 2VATA 1UXOA 1ODCA 4CCYB 5E4YA 5T4BA 3WK9A 3FYUC 1DT5A 1EB8A 3QITA 2EEPA 5CH5A 1THTA 4CI9A 1AURA 3IUNA 3R41A 2RHWA 4EZIA 4QZVA 4U2GA 4P9NA 2GBFA 4HVTA 4X97A 1M33A 3PFBA 3WYDA 4AMYA 2R8BA 3V1KA 2GYVA 1WPRA 3S8YA 5LKRA 1RYYA 1CUFA 4FBMA 4BBZA 3AINA 2OLEA 1DX6A 1XRNA 4CG1A 4OYLA 3W04A 5AM1A 1H2XA 5JZSA 3O4HA 1GQRA 3PUHA 3IUJA 5C8ZA 2VJAA 5BWBA 1MX5A 2P8SA 1EK2A 5JAOA 1XRMA 4EY7A 4AO7A 3WKBA 2BUAA 3Q8WA 4G9EA 3IBTA 4ZRDA 1BN7A 4RGYA 5JANA 2ES4A 2QM0A 3N2ZB 4X92A 4B0OA 4AZ3A 2X5XA 5FRDA 3C8HA 1LNSA 2PSEA 4JEIA 4L3WA 2JEYA 1CPYA 1HDEA 5HKBA 3ANTA 1UKAA 5AKXA 1JU4A 5DNWA 5HZGA 2D5LA 4Q3LA 3K9BA 1ORVA 5ALGA 4BYMA 3HACA 2VJCA 2C58A 3BXPA 4K6GA 4W1RA 1W76A 3HRHA 4Y2YA 4B83A 1SOMA 1IMJA 5DTIA 1BS9A 1AMNA 2OCIA 5AOBA 4DLNA 5A7GA 3MGAA 5CH3A 1ISPA 2O2IA 2O7VA 2HU5A 2PSDA 3G9ZA 1WOMA 1DU4A 5JAPA 4Y7DA 5FLKA 3WK6A 2AJLI 2VT7A 2XUGA 1UK9A 4G8CA 1K8QA 4TPKA 1A8UA 3DQZA 3R40A 1BROA 4KACA 2QUBA 2XUKA 4QEKA 4QWMA 4WFIA 1CQZA 4C87A 3QZUA 2WLSA 4FBLA 5ALDA 5AOCA 3HABA 2WUEA 1XRLA 3FOBA 2HA7A 4QDTA 3STXA 3C6ZA 3F8SA 3ESAA 3I6ZA 5SYMA 3FYUA 1PJAA 3H2KA 4QLOA 4FNGA 2HFJA 1R50A 2VAXA 5AK5A 1ACLA 5FKJA 1MPXA 4CG2A
chains in the Genus database with same CATH superfamily
1XU4A 3MS4A 4PZYA 5EZ6B 2YVKA 2H2IA 4ZANA 1DE0A 2WY2D 5JSZB 2XOXA 3IRVA 2RBEA 4MVYA 2BFEB 3V1LA 3TH5A 2V7PA 4NMMA 3IBSA 2QMEA 5H4HA 4PFJA 1RYHA 2WIKA 4QNNA 1A76A 2H31A 1IPEA 3IQFA 4CM8B 3BS4A 4V2UA 4G56A 5KTYA 1MG0A 4JFAA 1LGYA 3PQFA 3H5LA 5CT6A 4F5DA 5CU7A 4L5JA 4NJOA 3HR8A 1BE1A 4K6KA 2HLNA 3MXOA 1O4VA 1NP7A 2PUGA 4I9NA 3QEKA 1FSFA 1U6KA 2D1QA 3QI7A 4UOZA 2DWPA 1ECLA 3TGWA 4POOA 4ZVOA 2CLOB 2IITA 3S2ZA 1DAKA 2WF9A 3OLCX 1FFWA 3HGTA 3RK0A 3QPCA 2P6UA 1RXIA 3QUSA 3LPMA 4M8IA 1UT6A 1FE8A 4F9GA 3TNYA 1NMXA 1QC5B 2QGFA 4I55F 1E89A 4QGBA 5COBA 1HEYA 1RAHA 1B14A 1MJNA 1YL7A 5E9AA 5DB4A 3FNBA 1GUZA 1VLLA 2NZWA 3AY7A 3N0TA 4LXXA 2EFHB 3P7MA 4O63O 3AOEA 4IGAA 2EDCA 1ZI6A 1KS2A 1HOXA 3I42A 4PLTA 2OLJA 4M0FA 1VJ0A 4CMJA 1IOVA 2XE8A 4DR4B 2GEBA 4FFPA 2X15A 3HKEA 4M1WA 4CMEA 3QEBZ 3PHHA 1D9XA 1JJVA 3DB1A 4C0LA 3FY4A 1WUHS 1Z0IA 4Y8VA 5DYNA 2Y27A 4EF6A 1MA0A 2X6RA 3GDFA 4S1NA 4LVCA 1QGUA 3ZV4A 2YX1A 4B8WA 4CUKA 1DAEA 1YE5A 1ZM9A 4KE8A 2FG5A 4YACA 3VI3B 2Y68A 1FYXA 2A0UA 3G7NA 4IDGA 1YFJA 3BWYA 1E3TA 4MUIA 2FFJA 1NPTO 2MSEB 1X8LA 4MQFB 5DHQA 1XMQB 2IA5A 1IM5A 3TLMA 3FZYA 3MS2A 2P3SA 4OX9B 1PAUA 1IBRA 4UVDA 1RE1A 4JLNA 5ABPA 3T1QA 5CLFA 3I39X 3ZGYA 4ZPJA 4ZEWA 3ZGZA 3JV7A 2NU6B 1TIPA 3L0IB 4OYYA 1BDJA 5F64A 5A6VA 3TO5A 5IANA 5BWNA 4JUDX 5EERA 2SKEA 2PKQP 3ORSA 3H5RA 4DXHA 1EJ0A 1V95A 4L07A 1YB6A 3M82A 4NJEB 5DNVA 5LC1A 3H18A 3UMVA 1R0XA 2BMFA 1HORA 2I7XA 2PQ0A 1D0IA 1E94E 1YBHA 2XCLA 1OZFA 4JJFA 1W8IA 4YX9A 1NATA 1NAIA 3DOHA 4Y6LA 1XL1A 1SULA 2LVBA 4EG5A 1U0HC 5ADUS 3DONA 3GLGB 2Y2VA 1ZONA 5BYJA 1JR4A 1ORTA 1ZH0A 4E1AA 5JCXA 2QBYB 2B61A 2O7RA 3F1KA 4EUNA 1PF7E 1EHYA 1RPNA 2A78A 1E1YA 3TB6A 1WDWB 3UH0A 2QYOA 1T1SA 4XIYA 4PYJA 1J56A 2CK3A 4GLBA 3EYWA 4BNUA 4D4HA 1LUAA 4HAVA 3RAEC 4F86A 1SBYA 1TQHA 1YNOA 4GG1A 1A8HA 4DSUA 1Z5OA 4R8SA 3ZW7A 3SZOA 4BLQA 1YZKA 5I6DA 3FOFC 1UXGA 1BCRB 1GPAA 1W5BA 3FGZA 3RYFA 2P78A 4B43A 4M9ZA 1Z2CA 2W2VA 1B76A 3GA0A 4NX2A 1WDLA 3KSDO 3ZVRA 2AC2A 1OAKA 2BMDA 2Y9MB 1F8YA 1U3GA 2ILVA 1X15A 1Y1RA 2IJGX 3V1YA 2WF5A 1RP7A 2FPSA 3NCHA 4GS5A 4NH0A 5BNWA 3D5QA 4YAUA 2WFLA 4N8DA 5AK3A 1ZNWA 3MTAA 4L4XA 4KXLA 5CIQA 5D8DA 4I5IA 3LQYA 2WVJA 1JQDA 1QU3A 3RUAA 1YZGA 1JPUA 1F4LA 5AXCA 2UUCB 2EKZA 3O94A 4YAFA 1EAMA 3DHVA 4ILKA 5CAEB 3EIHA 4Z7OB 1C14A 1AH2A 3E5RA 1JG7A 4ARBA 5JAQA 5K3SA 4EAQA 1UFRA 1OZ0A 3ENVA 1WUYA 3G5AA 4BC1A 3UFXA 4C01A 1JKJA 2VXBA 4YJ3F 4CV2A 1ADGA 1GZ7A 5DHSA 3DT9A 4D96A 2H4FA 3RU9A 4JVMA 2D8AA 2WUFA 1TK9A 1X7HA 2EQBA 3CF4A 3D5TA 5CPFA 5HOQA 3EXHC 3MNFA 1ZK1A 1GR1A 4NBKA 3HTXA 2X4GA 2OKGA 2DKOA 2GFIA 2GKSA 3OM8A 4FDTA 2DR0A 2PZAA 4KFSA 1Y5NA 3DPIA 3T3EA 1I7SB 6REQA 2GQ0A 5IDXA 1IBLB 1HQKA 1NMSA 4N40A 2RHBA 1N6PA 2POQX 3DLAA 1WU8A 1R12A 2DECA 2KPOA 4WFKA 3SC6A 4G0UA 3D6TB 4K7JA 1W73A 1Z5VA 2VDLB 4MVJH 2VKTA 4DNQA 1E9BA 2O2XA 2N0SA 3KCQA 1X70A 1JHYA 4P33A 4UUNA 1M75A 3UAXA 3W3AD 2PUDA 2BBSA 2H1CA 2DQZA 5A3VA 3LXXA 1GQSA 3E27A 3M8KA 4JI3B 3QJ5A 4I1PA 5GJBA 1E5TA 3U7QB 1Y5RA 1FNBA 2QWXA 1F0NA 1ORDA 2NLOA 3GBPA 4J0KA 1QH0A 4LZZA 1Z35A 3HBNA 3GIWA 3JAKB 1SVKA 3V7FA 1NWHA 3UGQA 4C7OB 1A98A 1A95A 1F4VA 2BM8A 3A2MA 3UPTA 2YDYA 1EUCB 1QH1A 2WT8A 1QYIA 1X1AA 3M89A 3RSOA 4I8XA 1FNCA 2GLTA 3COVA 2WB2A 3I0MA 2WZDA 3FTNA 4EY4A 1RPAA 4UTOA 2XDWA 4G5HA 1PD1A 2BSAA 5BV7A 1QPZA 1AQLA 2BSQA 3JQGB 5I47A 3P96A 3J81k 2GDZA 3PLNA 4I0WB 4KZKA 4UEJA 5FTJA 1TA0A 5IKMA 1A5AB 1Q91A 4G1UC 4J0DA 4AYTA 4NBTA 2O8CB 3TQQA 4KWHA 5JZOA 2C2GA 1O1YA 1GKYA 3DAPA 4I5DA 5JSFA 2VF2A 1KFEB 2PWAA 3OI7A 2OPBA 4UNQA 1LSUA 2E2WA 3IVRA 4K6FA 4DGSA 1ABBA 3QP9A 3UXHA 3SZMA 4QT4A 3X44A 2J9FA 2XWBF 4MUNA 5CVTA 1OLUB 4UARA 3MBIA 3FCYA 1Y4UA 4RVFA 3PPYA 2B1IA 1X7ZB 5ALFA 5IHXA 3I9NA 1E98A 4FLMA 2QLJA 2O07A 3CTPA 4RCVA 5HFAA 4IRUB 4C3VA 2NNLD 1K86A 5ALTA 5DCWA 2BTEA 1GNSA 1SU4A 3WL7A 2EOAA 4JP8A 4YCBA 1NC3A 1ONNA 2JRLA 3DMRA 1E2NA 5F5LA 2XVYA 1EE1A 3DTVA 1YZ3A 3PIRA 3V7YA 1ML4A 1EDOA 3OZFA 1QKJA 1CD5A 2OE2A 4O59O 1PTJC 1Y5MA 2WI8A 4R9NA 3K0HA 1G7TA 3G79A 4JSTA 3KK0A 2IS2A 2P2GA 3WTBA 8ABPA 2WSSA 4ITUA 3L18A 3GLFB 5BT9A 2JGEA 2BGUA 3EASA 3HL0A 3IBYA 4Q39A 4BE7B 3FNQA 3OOSA 1X86B 5FOXA 4K8OA 3RTDA 2FN7A 1TKBA 2XT6A 4MR9A 5FO1A 3JWPA 1G6Q1 4MJ7A 2Q0QA 3F9CA 4KTVE 1VPLA 2C77A 3LLCA 4R1PA 4C29A 1EWYA 2J9YB 4F0JA 1T26A 4N9WA 5FYDA 2HPHA 2GPWA 4CIVA 1PEYA 1I1NA 2QRHA 1FY2A 1NLFA 1NDQA 2Y1CA 4OATA 1UBRS 2CSUA 2ZU6A 4JQCA 4WY5A 1JYEA 2WM8A 1JWBB 1W36B 3KB2A 2DFVA 3CJRA 3G7UA 1U0EA 2CV1A 3IDFA 1DARA 1MXFA 1J2TA 1OE0A 3MMPA 3EOBI 4FZ5A 4OHWA 2JJMA 4QLBA 3WAGA 1FFAA 2X77A 3D8NA 4LDAA 3ZDAA 4KN9S 4PLVA 4U63A 3H5TA 1BKYA 2F59A 2IP2A 3UT5B 2BCEA 4M36A 1K63A 3K73O 4WNYA 5HJEA 4KI7A 2AFVA 4RSGA 3ILVA 1PGQA 1WBDA 3MJFA 3MGGA 5I9MA 1M2OB 3JYNA 3ZDBA 4WCFC 3JWEA 3NDPA 1U9IA 5DLYA 4EKIA 1AGYA 3O73A 4X44A 1XQ9A 1W75A 2OTCA 3EDCA 2JK0A 1UZMA 3ZE0B 4D57A 5AHOA 2D3TA 5F1PA 5IZCC 2XITA 2RHLA 4ZT7A 4BVBA 1IXYA 1TJ3A 3BTVA 4KUGA 4L3OA 3LX5A 2IUSA 3KTAA 3EA0A 5B7NA 2VDJA 3UANA 3W9UA 2QV7A 1V5IA 1C1XB 2HK9A 3OICA 2JFGA 4YR7A 1SWWA 1RPJA 1KP9A 1T0BA 4D8UA 4I4TB 4BO7A 2XWQA 1KI6A 1N7GA 3HPRA 3TEJA 2L42A 1ABFA 1QWOA 2C1XA 3M4NA 1BEUB 5JMPA 2A9RA 5JYDA 3HVKA 2MMCA 2BL4A 4YMIA 4HNAA 1LTKA 4C6RA 3OMLA 5AM2A 4QM6A 2AFIB 4KQWA 1EVQA 2WVGA 4KQ9A 4DQKA 4G89A 2FGJA 1JDZA 2Y2UA 3T3OA 1YS9A 3FPCA 3OQNA 1XIVA 1XL0A 1L7EA 3EAQA 1DFGA 1ORIA 2W6MA 3B48A 3IT0A 2QLNA 3FPHA 4NJMA 4JVSB 1ZEJA 3CT6A 1T29A 5EIHA 2UXCB 2Q1UA 2FPGA 4R4JA 4UAGA 2O8EA 3ISTA 2AOVA 1WZEA 1ZUHA 2XOKD 1Y1LA 3R5FA 2RHTA 1WDKA 5I9TA 1C1HA 1VHTA 4AN0A 1G6OA 2IXAA 3OHMA 2YBEA 1A82A 3ENWA 4OP2A 4WLOA 4TMZA 1G2QA 2UZAA 4GXRA 4NATA 4YRKA 5IM4F 5AHXA 4MV1A 5T57A 5BWLA 1D07A 4Q24A 2NT4A 4E13A 3L43A 2IYTA 1NHGA 1Z6TA 3AM3A 3EBOA 1R1DA 4NNJA 1QP4A 5EJ4A 1W96A 1NBME 3L8EA 4AB1A 5BURA 1E3QA 4TWZA 1VECA 4DDUA 1BQ4A 1I9GA 2Q8PA 2W00A 3COJA 1DEAA 3CX8A 1JLLB 3Q3IA 2Z8ZA 1CEXA 3M5CA 2JRCA 4U5XA 5AJZA 2BJHA 3VTKA 3CVOA 3GR6A 5IVIA 2PJUA 1IBMB 3TD9A 4JYZA 1PKXA 2BRUC 2VTEA 3QUBA 3U13A 1F7VA 2PGJA 1SG9A 2XV1A 3C87A 2RAFA 3O47A 5IMSA 1MW8X 3W8NA 2RMKA 5K3FB 4IKEA 2GCEA 1C3VA 1U7XA 3KHUA 4JGGA 4NV3A 4X1KB 5DGXA 5TDHA 1ONPA 4X20B 4MLDA 1NQAO 1Q15A 5K03A 2XRFA 1JXAA 1H6BA 2IYXA 3DV2A 4OO3A 5TVGA 3RYCB 1P1HA 1VIVA 4A23A 5HK9A 1YZQA 2JI9A 4KFUA 3QBDA 4GDFA 1U3VA 2PWZA 5T4HA 5AUPB 3PNVA 1CZNA 4A10A 1PQUA 1BH2A 2VP4A 4TXJA 5L51A 3A6PC 1RSZA 2XF8A 3JRXA 5CVDA 3QHPA 4O4JA 1XJ5A 4M87A 9LDTA 1ZJ5A 2PVSA 4YR9A 5EQFA 3AGPA 3NHSA 2V7QA 1ZWLA 3K16A 4F60A 3U7FB 3EQ7A 3L1UA 1Y1KE 4Q12A 1U4NA 2VBFA 4MKXA 2AN1A 4Y2QA 1Y4DE 4KVGA 5ECDA 1YHYA 5T64A 2Z6AA 4U7WA 2B25A 2HXSA 1FZQA 1NUSA 2B20A 2OHXA 3GCZA 5TX7A 1F2VA 1OHHA 4UNSA 3ICWA 4OIMA 3B6JA 4OXXA 2QHXA 5DF1A 4LJ9A 2Z95A 2NO7A 3GFVA 4GXNA 2BEJA 2O06A 3IE2A 1KOLA 5DTJA 2PGAA 3U3KA 5CCDA 3R9XB 3MPUA 4ZQGA 2FK7A 2PL5A 4Y2XA 4V2IA 1MEOA 4DRXA 1BE6A 3OEHA 4XYGA 2ZZNA 1Z0AA 2ZDHA 4JU8A 1W5AA 5ILQA 4G2NA 3RT9A 3X1WA 1KWGA 1FSGA 1T2UA 2DC1A 2NSLA 4LRQA 1X94A 1Q44A 1UPUA 2PL9A 4Q48A 1KE2A 5JDIC 4EY3A 3BREA 1B73A 2F1KA 1XLUA 2ZCVA 3WL4A 5FOUA 1FP1D 1RMYA 1UT8A 2LKDA 3CCCA 5EYPB 1IC6A 4QQNA 5EMHA 3AB8A 2X4DA 3CF2A 2XADA 2EXXA 2WZCA 5L6MB 1KMHB 3GAZA 2B5OA 2JFPA 4HN4B 5BR1A 3ZX4A 2IBTA 3E18A 3NHZA 621PA 3VZPA 1M6YA 2EBFX 4NV0A 1IE3A 2VF7A 5FR1A 4ZT4A 3SHWA 1H1LA 1F3LA 4PHTA 3T1VA 4BATA 2VF8A 4RVGA 4DPKA 3A1TA 4CMAA 4H7JA 3OQVA 3CVYA 2AI1A 4KE9A 4E12A 2BFFB 2FUG1 3RABA 1K8YB 4O4HF 4C6HA 2ZAOA 5DDIP 1LK0A 2RKWA 4NCBA 3SOPA 2I2DA 3ZJUA 2V7UA 1R0LA 1KI1A 1ORRA 1FFCA 4JROA 4DV7B 4DCJA 4BAGA 1XKXA 3TW4A 1KY5A 1XTSA 4K9NA 1UKVY 1D2MA 2ZATA 3LYLA 4IZOA 4MGZR 1VPDA 4JJEA 4RPLA 3PA8A 1OU4A 2GCGA 3F4BA 3W3AH 1M2OA 5L53A 4CDGA 3UGKA 2HPZA 4N0DA 1JA1A 4Q21A 1NF9A 1NR5A 1WVIA 3B3QA 3IILA 4E31A 5BOVA 2VSYA 3AKEA 2BJVA 1N1GA 2PJDA 4MV4A 5LZ2A 1BRMA 4ON9A 3QWIA 2BH9A 1GFWA 1JDVA 1IHDA 4JL5A 5F7ZA 4F2DA 5I8PA 1I94B 3WSTA 1TYCA 2WM2A 2H4HA 4N7MA 4MR7A 4R0NA 3A37A 5LYYA 1DO2A 1PR9A 1QG0A 2ID4A 3LY5A 1YU6A 3I23A 4RXTA 2O6HA 3V5NA 2B4RO 4M7WA 3DMTC 4B7CA 5ARBA 1P1RA 4DA9A 5IYZB 4YUWA 1ZIXA 2C83A 4YREA 2IY7A 4GKVA 5EJEA 4YCLA 1RRVA 1HI9A 3FSJX 3NAGA 2GXUA 3OE5A 3VHQA 4L8FA 4S04A 3A6HA 4TS4A 4FE4A 4JJZA 4BZQA 2IPLA 4Z9AA 3OZTA 1CUAA 3VTZA 1H8HD 1RHKA 1P6XA 3FDFA 4RD0A 1JEDA 2Q3BA 5D51S 1QE0A 1NVWQ 4KN8A 2FSGA 2R1VA 3TTTA 3D7NA 1PRYA 3DDCA 3MYRA 3R3VA 2NUAA 2Q07A 4FMBB 4N3BA 4PCVA 1TM3E 4H7DA 4WXHA 4ZOBA 4ZT5A 5H0IA 5IJ9B 1NXTA 4UXJA 3FJ1A 3KYCA 3C5EA 4J0JA 4UM8B 1Z38A 3SIWA 5BMVB 3GBVA 1UBNA 1AG9A 1TUGA 4ZCRA 1NRWA 4OXNA 3UWKA 2JGAA 4CM4A 3EJ6A 1XCMA 2UZ3A 3ONWA 3TOSA 2I3DA 4X9XA 3AHCA 1R4AA 3WLTA 1GU7A 1UMKA 1UJBA 1REQB 3BE8A 3GLQA 3JSXA 3OPYA 1JQJC 4HMPA 4KC0A 4GICA 2ZJ7A 4ZFNA 1F2UA 4PN7A 5T4EA 2EW2A 1Q1BA 1VI6A 5FEMA 1KYTA 2FOXA 2NZUG 4DA0A 4F2WA 2FW1A 2VP2A 2H2HA 1JT2A 2WJGA 4Z1OA 1L4YA 1ZUNA 2HA5A 2EZUA 4CYMA 5GINE 2RD2A 2Z09A 1JDPA 3FNGA 1A27A 4YO7A 1T5IA 1P9OA 2VDUE 5GP1A 2J0EA 1Q17A 3GN1A 3GRFA 4KGVA 1K2WA 1KF0A 3PCTA 3IPRA 5A9SA 4EJSB 1EWQA 3QHAA 1IXZA 3QVGB 4L85A 4FI3F 1D0SA 1QRDA 5GJVC 4WNIA 1T9ZA 3AYXB 1SC9A 2FFHA 4DA4A 2PKWA 4CT4B 3H8JA 2ONKA 2VF5X 4EGAA 3H2SA 4K9KA 3KHKA 4OHRA 4CQMD 1IK6A 3I6MA 3ZY4A 4F9FA 3D3KA 2MYNA 4XQGA 1U2GC 3H6HA 4EELA 3FKJA 4Q7EA 4OH7A 3WFJA 2F62A 3BXGA 2X6TA 4AVYA 3MSXA 1ZNZA 2DBQA 2FF7A 3B6IA 2FFQA 2JDID 2JS7A 5EJAA 4FHEA 3CE9A 4ND2A 5EJMA 1QK4A 1B8UA 3WR5A 2DT5A 2ZRBA 4KO8A 3P5SA 1A5ZA 1PJZA 3QLJA 4KEAA 4QRHA 5G3ZA 3QELA 4BCBA 4YLYA 3HXQA 1VMIA 1T5TA 4X3PA 5ELMA 2CHQA 1ETUA 5EVCA 4XUEA 5FADA 1ECJA 4LSGA 4KNWA 1K7XB 1ZLXA 1BX3A 3FNIA 1BKSB 5EXSA 1FZTA 1Z45A 4FBGA 4OGWA 2EV9A 2XQKA 5DI3A 3U6BA 2QRJA 1N25A 3BSWA 1R6DA 2QRKA 2IEYA 1V3QE 2JFWA 3CNBA 1IXKA 3G89A 2Q41A 2JIZD 3GLHE 3KSAC 4PC3A 4N1AA 5C1BA 3BWMA 4G0OA 1PT8A 4WVFA 1U0LA 3SC2B 4BZWA 1OXBB 2R1TB 5EIXA 2OXCA 3ROXA 2GJ4A 1C9EA 4L95C 1YBFA 4JLKA 2HADA 2Q7XA 1CJBA 2VPPA 4HLNA 3SMQA 3PQ3A 5KIAA 3JYOA 2Q2OA 1ZIYA 3IESA 4LYYA 4WNAB 2IXEA 1UBHS 4AROA 4PE5B 3C3EA 4KO4S 4OMFG 3TLZA 2B0JA 3CQ9A 4WL0A 4OGGA 4TLAA 2ONYA 1UL1X 1K7CA 3DFIA 3VR6D 4NOJA 3HM2A 4I55B 5E95A 4PANA 1W19A 3VPCA 4Y2RA 4EJFA 3FHTA 4U3JB 1M54A 1P61B 2HBZA 3RTAA 2I1QA 3RTBA 3D6MA 4D42A 5KYWA 5HUHA 5TE9A 2QAGA 5JVDA 5IX8A 3B52X 3GHYA 4R7TA 4RXUA 2DY1A 3Q2IA 3S1LA 2DY0A 2XUZA 1T91A 1D6NA 4YBZA 2EP8A 4L08A 1N33B 1EFCA 3BIJA 4A6XA 2EWVA 3ZGLA 2H5JA 1LLUA 2H51A 2Z04A 1OXTA 4L8GA 3UJDA 5CFMA 3DM9B 1TF5A 5LNK6 5EZYF 4BLPA 3ILXA 3PNLA 1KDZA 2Y9PB 3A9TA 5LL6P 4F93B 4J0IA 2GMWA 2QE6A 3MWJA 2G4CA 2RH9B 2WEKA 2OSBA 4JB0A 9LDBA 3ZBTA 2E4ZA 2QN8A 4NYIQ 3ZHZA 3ER9A 1R9MA 1FFXA 3QVJA 4DIEA 5CFRA 1U8XX 4XGQA 4DCSA 3SC3A 5BSRA 4LWZA 1VJ1A 3QKRA 5EAIA 4CNBA 1R8XA 3QRWA 3PEYA 4CLHA 1Z37A 4LXYA 5GM2A 4XVRA 1O58A 3G23A 1IY8A 4CF3A 4BB0A 3I9FA 3RK1A 3ZHOA 1W0JA 4AUEA 5GIPE 2B4AA 1XTIA 1L5WA 1Z13A 4IZ6A 1WW3A 1FP7A 1YCDA 2GLXA 4EQZA 1B8PA 1PNRA 2WJ3A 3WMWA 3G59A 1A8QA 4Q9AA 3J7TA 5AVWA 2WRZA 4FB5A 4CLXA 1KZYC 2ZITA 1II0A 3CR3C 4EGSA 2Q9UA 3MJCA 2D7CA 1I2BA 4X71A 4F3KA 1CUZA 3IQXA 1AZLA 4INJA 5FUYA 2WG1A 5HEKA 3PFNA 3EVBA 1VXOA 1VHDA 2C5SA 2QX7A 4J3FA 4PQEA 5EIBD 4BMXA 4HX5A 1K5PA 3REFA 3EXHA 2HL6A 3A9RA 3DO5A 4FOSA 1NZJA 4FFVA 3E7WA 3U3JA 4BYGA 2QP4A 1ZR2A 1PZMA 1AQIA 1V48A 2JAXA 5FOTA 4BCDA 1WHTB 5AK0A 3PNMA 1LPSA 1REQA 3OPYB 3TGLA 2Y1DA 3K30A 2QMZA 4JUBA 4TKUB 5CH8A 3K5IA 1YIAA 1D04A 1G55A 4KLNA 1V7PC 2XX3A 5DW3A 1IWBB 1T0UA 1U2DA 4TMFA 3TE6A 3WB0A 4B7XA 2ZJYA 4KIUA 3OE7A 3M5WA 4DSAA 4MEJA 5BN1A 1RVDA 3QF4B 3BCRA 5DW0A 1M1ZA 4X66B 1USWA 3HUFA 4EEKA 3C1UA 4GOMD 4HI0E 4PLYA 6YASA 1UJ6A 2H1OA 4LTNA 5SZKB 4EFNA 3B5IA 2CHFA 3RG2A 4PC2A 1XAGA 1HDCA 1YRBA 1YI8A 1CWUA 4MEBA 4FCCA 4U2BA 4XPIB 1M1NA 1YJ8A 4FCWA 1XD2B 3E22B 5DNDA 1YQWA 4C03A 4DY4A 1T6ZA 4Q0MA 1AGXA 3TIXB 4GI1A 3U44B 4NHOA 5JBIA 1TL7C 1T3TA 2ZZKA 1NUAA 3QW2A 5E4TA 5EIFA 3DZBA 2HQ1A 1KI3A 3LWZA 4E3ZA 3BBPA 3A6JA 5J4HA 4YRJA 3ZY3A 4EY6A 4CMHA 4RVHA 4I99A 1XDBA 2ZIAA 3ER8A 1FS4A 4MHOA 5E2IA 2WSIA 4YP9A 4TL9A 2CC2A 3TCXB 3QJYA 3I2JA 4RVUA 3SIPA 3MQ4A 5SZJA 3ZZUA 1DG1G 4OLAA 2MSDB 4V39A 2HXYA 4Q00A 4DJJA 5F5XA 3RAJA 2ZSJA 3R0XA 3KALA 1OBHA 5LD2C 4Y9SA 4DM3A 1A5TA 3IPAA 4AWXA 2OGSA 2AJ8A 2R7AA 1DTWB 5F52A 2E0IA 3D4OA 1YGYA 3VNAA 4N7BA 4MK4A 3PI6A 3AR5A 1UBUS 2RIPA 4RIIA 4YV1A 1G18A 3O7MA 2NV2B 3L6RA 4BMOB 1Y42X 3EG9A 4WKCA 2HA2A 3CN9A 3R7LA 1OPXA 1C1YA 3L7KA 3COSA 2CD7A 1MKYA 2CBGA 2QUKA 3VR4A 4NK4A 4OLBA 3IVCA 2SBTA 1NUUA 2WUGA 2ZWIA 5HS4A 1N2CE 4R2HA 3P9YA 3E84A 1SMKA 2N9UA 3PXUA 1TD9A 3OTOB 4OQNA 4R0VA 1PQWA 2PDAA 3WLJA 2Y1OA 2NYAA 1W87A 3K70C 4H7EA 4P7FA 2D00A 4XB6B 1T9CA 3JQAA 3WQHA 1QLWA 2FETA 3GY0A 4MKFA 4MYDA 4QG7A 4WMLA 5ESRA 1THZA 3RU3A 5C8DA 2P3LA 3UOWA 5BRJA 4CFSA 2C92A 2XTAA 4WLVA 2A7XA 1F6DA 1WWKA 3GT3A 2AN3A 4BL5A 1RXVA 3MUEA 1XZ8A 1E0AA 1LNQA 3U80A 3V7WA 3ZV3A 4PVDA 1CULC 3MRTA 4RUKA 4CMIB 2DBZA 4FYKA 1GKKA 4Y0AA 2Q6OA 2GUWA 5TS2A 4BNTA 3OZUA 2W22A 3WYBA 1RDFA 2HRRA 2YMQA 1NR7A 4IX9A 4DIMA 5M7EA 1SC6A 4FMCF 2YJ6A 1IN8A 3VKUA 1XZNA 2PZKA 1MVOA 4C7JA 1YA6A 2ATVA 4MVXA 5JU6A 4J4BA 2R2AA 3RD5A 1T8TA 1DPFA 4E5KA 1AO0A 3BG5A 1JILA 4CIDA 4ZEMA 1SQGA 1P0PA 1H8EA 2AUNA 1P62B 3ZWMA 1X80A 2W8BA 3MWLA 1GFIA 1TPYA 1NRIA 1XPUA 2KLHA 4EHBA 4QBFA 5DLEA 1VRVA 3OWXA 3S27A 1V1JA 2XSZA 3L7YA 1UAGA 3NGXA 3QLUA 3KE9A 4FD2A 3K05A 4LV8B 5LB4A 1SXQA 2OCGA 2VHEA 3NTOA 4KR3A 1ZW6A 1LY1A 4GO1A 3K0SA 3TM4A 1E66A 3T7RA 4RTNA 2PSHA 1JIIA 2HEGA 3H2HA 4RPIA 3WDSA 3PXBA 5CDYA 3GLIE 3K9WA 3VSAA 2D0OB 2GD1O 4QBGB 1SUWA 1UCFA 4EHAA 1CR2A 3BEOA 1Z29A 3RS9A 1M2JA 4X6XA 1NW3A 4FB4A 5ALJA 1DIBA 2RONA 3E8XA 2V98A 3OOWA 1S3SA 2QXYA 5KDLA 3MGBA 5L4NA 4X6LA 1RI1A 2O8EB 1R5BA 1XTQA 2C5FA 5FUVA 1H69A 1QHHA 5KO2A 5J23A 2O05A 1QQAA 2I2BA 3JVUA 4I4LA 3W77A 1OASA 3EEBA 1GAQA 2B21A 4FN5A 1E69A 1QZZA 3DYIA 1U9YA 2BEUB 2VLIA 2WV9A 2B8TA 4LF5B 4XWOA 3PFCA 3RC2A 1JNXX 2AJCA 4RCZA 5JG7A 2P6MA 2JCGA 4FOTA 4Z3OA 3VJLA 3HXOA 1YB4A 1QANA 4G0QA 1EUCA 1QH1B 1HQDA 2FJUA 1YE3A 3D2BA 3DLTA 4TXNA 5IDYA 5IDVA 5C7LO 2F3RA 1S4MA 4AKGA 1JDSA 1MVLA 1P81A 1ZITA 3KZCA 5AKJA 3NGMA 4JC0A 4ETWA 2FZ5A 2XYHA 4RADA 1YQEA 4ZIRB 1JSLA 2CWWA 5TQ2B 4EHJA 1E0JA 4OM8A 1ULSA 3B36A 3R0QA 2KHZA 2V3VA 4NYMQ 4EB0A 1P18A 1YFZA 4K9LA 1SB8A 2TMGA 3T9BA 2YXLA 1EHIA 1VZ3A 4QATA 5JSUA 1GTG1 1T9GS 3BMCB 3AIKA 1D8TA 5E0KB 4P7BA 2HA4A 2HA3A 2NZ8A 3N1UA 2JLRA 4ETNA 5KVQA 3LH5A 1RZUA 4QEZA 3TTXA 3VHRA 5AW1A 1NGSA 2X5OA 1R88A 2BGKA 1DX9A 4EAAA 3NUQA 3WIEA 4ZOEA 1G21A 2FWAA 4OFBA 5EC8A 1D4AA 1TZKA 1KYYA 3ZW8A 3M6FA 5CA0A 4HB2A 3THXB 1L5LA 2O4UX 5HF8A 4FC6A 4F97A 2WNHA 4MQ4A 1V7ZA 5EGSA 1HE4A 4KE6A 5GZ6A 1QVVA 2NXJA 3GH3A 1Q1GA 1P5FA 3AI3A 2Z9DA 1ESNA 2PZ8A 1EGAA 1Q20A 2NG1A 3C7KA 2IYWA 3O1JC 4GE3A 4GQBA 1CDZA 3FHCB 4KXUA 3WHKA 5B7QA 4MZDA 4ZJUA 2C88A 2X2OA 2YFHA 2QN3A 3IDZA 1TUIA 1JG2A 1Z73A 1T4GA 3FMVA 4G09A 1SWVA 3WLFA 2O8BB 2ZTHA 1PT5A 1QVRA 1EP3B 5K4GA 5I7VA 3LRXA 4U8GA 4ER7A 2ZIXA 3WOVA 3A28A 1Z9BA 1VCIA 4DMUB 2FP3A 2NVUA 3RADC 1E92A 1WM1A 3OEYA 1ZQ9A 1OWLA 1S2IA 2O1SA 5IZ4A 1BXGA 1TYAE 3BA1A 4YXFA 1BH6A 2W37A 3PUIA 4FR0A 3QFRA 3VU3A 1VBKA 4Q1VA 4BTEA 2IV7A 1Z7BA 1KQ3A 1TTQB 3BH7A 4GI3A 5DHPA 1AF4A 1LDBA 1U1GA 1ST3A 1ECBA 2H57A 2VK1A 3BD7A 2HNAA 2WKSA 3DE6X 3JASB 3O9MA 2Q6TA 2ZTVA 4KH0A 3VVLA 5ANRB 4V1CB 4HZUB 4LGCA 4YAJA 1E1NA 3GRAA 4IRMA 4U7HA 5FV7A 3HUUA 3LL7A 3DFKA 4PPFA 4UHEA 3IUMA 4PYKA 1U5BA 2B92A 4OHUA 3URMA 3WNDA 4KCGA 5ITZA 2JIRA 5FV4A 4D0NA 2ZB7A 1XALA 3D8TA 3B6KA 1EK6A 2G40A 2IZ6A 1COWD 2QW1A 1KEKA 3DKPA 2JFOA 1F8XA 2H9AA 1KKUA 1N6HA 3CKMA 3GEPA 4U1RA 4DPMA 3K2IA 4G1BA 4DPLA 2JG3A 2KB0A 4KIGA 4G41A 1Y7TA 3DCIA 3MB8A 4OCZA 5FBLB 1BHQ1 3ND9A 3VBEA 2B4TO 2CJXA 2VAPA 3JWGA 4FJ1A 3VNQA 1VKOA 4LMPA 5JDIA 3FYDA 3QFHA 1MO2A 4V0KA 3IKTA 3BZUA 4Q9DA 1ZMRA 1G7SA 4R1SA 3MC1A 1AKTA 1E4VA 1KOJA 2W93A 2CJFA 2Q5CA 4H18A 2XZLA 2OEPA 4A91A 3LECA 1DQNA 5TARA 1N2JA 5D6OA 1R0SA 4R3UC 4ZO9A 1JHQA 2JFQA 4JQSA 4G5OA 2KSQA 1U2DC 4KDCA 1Q0QA 5CPBA 4ZEVA 1DAGA 1JHRA 2CE2X 2QYSA 3WK8A 1CIVA 2XDAA 3A3NA 1XEXB 3DMYA 3HJRA 1TQ2A 4XDHA 4N5DA 5E9JA 4ZPXA 5J4VA 1EQUA 1QHEA 3DZDA 3WLLA 4DNFA 1EZZA 1NX6A 1UPAA 5AJHA 4DDTA 1KBOA 4TL6A 2OPHA 4A7PA 1U2EA 2BEKA 3DAOA 3E1GA 1DAPA 3A6LA 5AI8A 4NAUA 3NNSA 2RJ3A 5F4BA 2GN2A 1AS3A 3E5NA 3ETNA 1ZQ1A 1WOYA 1CY4A 1JJFA 3WLPA 2PKCA 3FXAA 3KCNA 4LV6A 1CX9B 3JD0A 3NJ8A 2XE4A 1RFGE 3V8BA 4GP9A 4CGYA 4OTZA 5HKKD 3LA6A 1MABA 3E9QA 3T54A 5BN3A 3B9RA 3BE4A 1L7RA 2IVFA 4H77A 1IEXA 1C1DB 2DQSA 3K7EA 3L7CA 2QMQA 5JFGA 4DJFC 1JHXA 1GL3A 5ICMA 4QM7A 4N0MA 4EARA 4NOMA 3L7OA 4XJTA 4ARAA 1GN9A 1LDGA 3HB0A 3WG9A 2W2QA 1EE9A 3ABQB 1WKCA 3JTMA 3UJHA 3WK7A 5BVGB 1T3HA 1UPBA 3G8DA 3KRTA 5TQ2A 5DBGA 1R3DA 1XXLA 5BUSA 1M0WA 5GGXA 1G20B 2YYSA 1MR3F 4R54A 2FSSA 4DT1A 1KFBB 1H2WA 1KNXA 2B1GA 4GYWA 5CXUA 1V8PA 1UZNA 1T1IA 3KZNA 3ZY6A 1CSEE 3DKKA 4REQA 3TRIA 1Z0FA 3DLBA 2VP0A 3HCNA 3DGEC 4HAXA 2PX5A 3BRCA 1VJRA 3A6EA 1E6LA 1Q7BA 1T9GR 2XDYA 2JBAB 4ZZIA 4F6RB 4IJUA 4Q4AB 3W2GA 2QZZA 3KD3A 2AVDA 4WADA 3GRVA 1DRJA 3PENA 3ITKA 2R0QC 1CUWA 4F5ZA 3HVJA 4LX8A 3ZIDA 4ZIRA 2G0TA 3AUTA 1J2YA 3BF8A 5CT4A 1JR3A 1GTL1 1QE3A 2P1RA 4YROA 3RSLA 1FRNA 1O97D 4RD4A 1OW3B 4W5NA 4W9NA 4F1WA 1QO0D 3T94A 4BMCA 4I81A 5GPBA 1FLAA 3II6X 3W90A 1ITZA 1RZ3A 2PXXA 3W8DA 1VMAA 2R8XA 1RBYA 2VYVA 3CUEF 1TXGA 1PUJA 1V5EA 1WCIB 3GZTB 3CLUC 3MWDA 5KOHB 3P9RA 5FULA 3K9QO 3LL4A 3IEVA 2L18A 3TFQA 4CQLB 1ODSA 1YRHA 2PZBA 4PFKA 3LQRA 1FRFS 1E1LA 2YH2A 5EVJA 3UG6A 2G9NA 2VDVE 4ZCMA 1ECCA 5J4LA 2ZRNA 3P2MA 3RRXA 4ECAA 2IGTA 4Z7NB 2CJYA 3QVOA 1K08A 4KAAA 5HUJA 4RL4A 2IE8A 1DDOA 3KQTA 4O5OA 3HKEB 3Q8KA 4IXNA 3IEXA 4ILEA 3TPCA 4Y9TA 1BFKA 4F96A 5FEUA 4WLFA 3ZWWA 1XKTA 1IJKA 1WPXA 2JHAA 2JJ2A 2OXFA 2ZBUA 4CKBA 1RC0A 1QDLB 3JQ7B 5IKPA 3O4VA 2R4UA 1IDN1 2YHUA 4B3RB 4JXXA 3N2EA 3V55A 3KJEA 4MIYA 1EGHA 2D62A 2FMIA 1GPNA 3AGQA 4ND6A 1ENYA 2SICE 1WULS 2FN4A 3F7NA 5K3CA 2GERA 4NLLA 5CFPA 4FZRA 3QG1A 2YUIA 2G0NA 5EE9A 3W8FA 4UHFA 3Q0TA 2VPZA 4ZOLB 1FUEA 4KPEC 4GEGA 1GAEO 3N8KA 1ZSYA 1D7OA 1U8CB 3RVPA 1RXSA 2WT9A 2YNMA 1AF7A 1NE7A 3G2HA 3GJ4A 5DHUA 4HFRA 5DTMA 2IYSA 4BFTA 2PYZA 1JPNA 1U2GA 3AJEA 3WYGA 2Z4SA 4CF5A 4C20A 4DQLA 4RA6A 2CVPA 3SF0A 1AV7A 5KKAA 3DL2A 3CUVA 5HKAA 2VXCA 1UBOS 1II9A 2X2PA 2PH3A 3A9VA 1H1DA 2ODAA 4NG4A 3T0IA 2RDMA 3SJZA 3B1KA 2CV0A 1IZ7A 3A36A 3VR5H 1IJFA 3AFOA 1XF1A 1Z6GA 3F47A 4XW2A 3NM6B 3UM9A 2H5EA 4KQ2A 3FYSA 1AC5A 1U3UA 2A9FA 2GX6A 1J23A 4TVSA 1IIRA 2BM1A 1X2EA 3JYLA 4IZHA 3V8PA 5AM0A 3ZE2B 2XEDA 4OP3A 1ZGCA 5TNXA 3VR3A 4YDQA 5L3VA 3HO1A 2CXUA 5KYWB 1FOEB 1AUVA 4GGPA 1XPOA 1JVBA 4KSCA 2IKQA 2EF1A 1QIKA 5KINB 3N3AC 5EE0A 2WHQA 2YFKA 3FOZA 2J3KA 2BFFA 2R8ZA 4EA7A 3GP5A 3TRKA 2AW3A 3CEAA 4DIBA 2HO5A 5AVQA 3M6IA 1KQFA 5EGNA 5F1YA 2CHUA 2AD5A 1CT9A 2BAGA 5LLTA 2I4LA 1SA0A 1CDEA 3B1ZA 1I2MA 3VPDA 1FJXA 3MFYA 4OHZA 2Q4RA 5JYCA 3O8NA 2ZJOA 2H4XA 2ZYDA 4U4AA 3C7TA 4WK4B 1G8JA 2PEZA 1PR2A 2MWMA 1B16A 3Q7TA 4QU8A 2PGOA 2CHEA 1YNSA 3C8UA 4IEIA 4Y67A 2A35A 4RK0A 5AUNB 4NONA 4Z49A 2FUEA 2AF3C 3SOZA 3H4MA 1ADFA 2V9PA 2YWFA 1OVMA 1Z4NA 4YJGB 4J91A 3LX4A 5HG0A 2V1XA 1BXRA 4NCKA 3DVLA 3F5DA 2WPNA 2ZJ5A 4FU0A 4HDSA 4TZTA 1O77A 5HS6A 4E7PA 4X8HA 4HF7A 1BU5A 1OY1A 4A2WA 2N47A 2BHLA 2QJTA 1LPAB 1ZA1A 1V16A 3CIFA 4JOBA 1SU8A 4U2DA 1LRKA 3ZPXA 3MJEA 5DWQA 4BVLA 2P2DA 1I7NA 5MFPA 4YAOA 3OPXA 5D87A 4LF4B 2HWYA 3IURA 1XLTA 4MB6A 4C0AC 3FUUA 1YB1A 3DT6A 1H66A 3BB1A 4WZAB 3AZOA 4IJKA 2J4FA 3L8MA 3I12A 2EFDB 3EDMA 3SPXA 2OKCA 2ZS7A 4M1OA 3AR7A 4WXMA 1FCJA 3SE7A 3ZQJA 4JR2A 2ZIVB 3TBFA 4B31A 4CKYA 1XV5A 1T9KA 3PRHA 1IBCA 2OHVA 4ZMBA 1UPCA 1JFFA 3C24A 4FNAA 3GW8A 2B4YA 2BR5A 3ROZA 2P9QA 4B71A 5A4DA 4N39A 1NWCA 2XZDA 3PS9A 4I8IA 4FFSA 4X7BA 3HCOA 3SEFA 1Y6QA 3KSZO 4R2IA 5B2FA 4C5AA 5KTPA 1T6BY 3U61B 5T67A 3KZMA 5J5AA 4B7ZA 1E62A 3N7AA 1QOPB 2G0AA 2ZAMA 4E2ZA 4LZNA 4UTRA 5BORA 4R1NA 1XZCA 1E9SA 4RTMA 1MG5A 3O03A 4L5AA 4L72A 4G86A 5TT0A 4QKQA 3HM9A 2XKAA 5CIYA 5J47A 4PN3A 1ZHOA 2FP4A 3U39A 3PRYA 4YAIA 1C30A 4JK3A 2NQTA 4LWPA 3L0YA 4JEHA 2O8CA 3DE2X 4AYXA 1BCRA 4DDHA 2H07A 2H1LA 4B32A 4KXYA 3LUAA 4WZZA 5I5GA 1CUCA 4B3XA 4YAWA 5KWIA 2H54A 2E18A 2VTBB 4KI0A 1YJCA 1ANKA 3IQZA 2IYAA 5BWOA 2ZQYA 3IAHA 5JD5A 4TOIA 3T7TA 4D3ZA 2REQA 3STYA 3TR5A 4ADSG 1Q11A 2H65A 2V6MA 2GARA 3A3OA 4LXQA 4RJ2A 3S2EA 4ALMA 2HUNA 3BERA 4ALJA 4LDRA 1O8BA 3PFKA 3KP1A 5LFAA 4G37A 5AHKA 3S40A 3ETLA 2FR1A 4C0KA 2BPOA 3KKOA 1JMVA 4J3JA 2FPIB 2NOAA 3BD8A 4DYDA 5BXQC 5CTAA 1XCJA 3JQBA 3QELB 4F3RA 4FR5A 3UB4A 1UEIA 1DAIA 2HQOA 2I99A 4G8DA 2J32A 4RTRA 1D1QA 2RCYA 1PFQA 3HY3A 4FGSA 1R4MB 5JISA 4A82A 4XWWA 3F6PA 5DGCA 2WTUA 2YZNA 4UDOA 3IXLA 2VNKA 5DYIA 1FQOA 1VIAA 1IDOA 1U3TA 2Z58A 4Q03A 4BO4A 2ZVQX 2CNDA 4J0HA 2PG3A 1JTEA 4IJWA 4LVOA 3U1VA 4JT2A 1Y6JA 3WE7A 2DU8A 3ETEA 2NU8A 4GI2A 1P4SA 1J0EA 2UZ0A 4RCYA 1WQ1R 3VR5D 4JP3A 2YOHA 1USUA 4BNWA 2JBHA 5G0WA 3NTXA 1JAIA 1H5QA 2G9VA 3LUBA 3K4QA 4ENSA 4XUGB 1Y7LA 1YR8A 2D0DA 3O91A 1EA7A 3OPVA 4KTTE 3TJMA 4AMZA 1ADYA 4I1VA 1K4YA 1UKZA 4WNAA 1NUHA 4AJ9A 2JA2A 2V6BA 4M0CA 1K3UB 5BN5B 2FR8A 1G2PA 3GARA 3TFWA 4PZZA 2PU5A 4EPVA 5JXWA 2HLDA 3JYQA 2JFUA 3DZIA 3VU0A 2RH8A 3VV2A 4C3ZA 4F4DA 4YRZA 1NDHA 4LY3A 4GLLA 4R9RA 4I55A 1MO6A 1ZXLA 2I33A 3OCVA 4KSYA 2OHJA 3ZLVA 4MAFA 3V4SA 5CB4F 3N5CA 1NG9A 2B34A 1OA1A 2E4XA 1COZA 1JR3E 3BILA 1GGKA 3OKPA 4Z4IA 3MMZA 3O8DA 1KAEA 2KYRA 1L5SA 4LHXA 4MUBA 2GEJA 1WG8A 4LRWA 4O2BB 4Y9RA 1TU0A 3K09A 5I9BA 3TXXA 1P0IA 3WO0A 4EITA 5I48A 5L4SA 3UMJA 3ZWKA 1WHSA 2VUUA 5HFJA 3ROTA 1R10A 4JH0A 3WWCA 1RHQA 4C6TA 1G9TA 4NPCA 1CS0A 3DVSX 4DWVA 2XHEA 1R0CA 5FWDA 5CNKA 1MZPA 1ZN7A 1U0JA 2PX8A 3ZHQA 3KQSA 4WFQA 1NVMB 1JAXA 1O4WA 2AEFA 2D1YA 3P9KA 2CMDA 2GD6A 4J0EA 4M60A 2N46A 4IGFA 4COOA 4OSEA 4RD3A 1PJBA 2RHRA 4LA4A 3UBTA 4MV5A 3NXSA 3I5MA 1Y3HA 2MYPA 4BRZA 2F43A 4TKVB 2YNMD 5D3QA 2PX2A 2QRMA 1D4ZA 1FFXB 1FTQA 1J0AA 1I6WA 1MOSA 2C7BA 3ZWNA 3BD6A 1DQRA 2OBFA 1IN7A 3EFOA 1Y89A 1SPBS 1G3UA 3CLUD 1XQXA 1L6RA 4URUR 1V5GA 1HETA 2C78A 5H3LA 1Z2DA 4RV5A 5JCJA 7REQB 4UBMA 4NR0A 4O2LA 3O26A 4ND8A 1EUDB 4RK5A 2R00C 5HWSA 5DE3A 3Q85A 4YP6A 1W46A 3EIOA 3UNXA 2QNRA 2ZJ4A 3MSCA 5KTMA 1LJUA 1AQNA 3ZKWA 4TWIA 4OD0A 3H3JA 4RIEA 2PVCA 1VRWA 2D06A 4WY8A 4WJZA 1KERA 3CZAA 1JRLA 3X2SA 2F2TA 2NUTB 2PLAA 2Y93A 3DZGA 5JUWA 2B9VA 3AUSA 4HLQB 5G02A 3QU4A 3AY6A 3N59A 3NH6A 1HGXA 4MVJG 1KRHA 1PR5A 4DIOA 1XN1A 2JGLA 2QQGA 3EFEA 5DHAA 3ZCTA 2FLWA 3AJDA 3H5NA 4I6JA 2F8MA 3UHPA 4N6OA 5F2NA 1OV4A 2R62A 4OG2A 3TZCA 1DCTA 1OCEA 3HZOA 2PAAA 4RZXA 2Z3WA 1WLYA 3CNQS 3IELA 4Z9FA 4R9VA 1J2RA 1F3OA 3WX0A 1A50B 1SUEA 3R5HA 1RS0A 1RYZA 4LXGA 5BY2A 5FX2A 1E64A 2PX3A 3MCWA 3SS7X 3PFIA 1OH8A 4D79A 2II6A 2P35A 4IIXA 4DN6A 4FFLA 3M5PA 4ZGBA 1G1MA 3DFUA 4R8KA 5JZMA 1EIWA 1ISHA 4FQ7A 4B6QA 2Q4OA 1T2NA 1TK2A 3GRYA 4BZPA 1MFZA 1MRNA 4NECA 5JAHA 3ADCA 4Q9JA 3T5MA 4C4PA 4D82A 1KMMA 3K20A 1EDDA 3KJNA 4UXIA 4UC0A 5E0OA 4ZT3A 2WAOA 4JBHA 2AE2A 5IEJA 1M67A 3BHNA 4U9UA 4RA9A 4FGLA 1SK8A 3WJ2A 2JAWA 2QYHA 3K9NA 4GZ3A 1ID1A 1D9ZA 1FPMA 2QM8A 4WCVA 4XGIA 2I80A 4WINA 4F45A 1UDAA 3EULA 1VTKA 2AA3A 3OT1B 2I4OA 2P9CA 2UXBB 1CQIB 4KRGA 4QPZA 2WWWA 1OFHA 1F12A 3BMCA 4R1OA 4TRNA 1XPRA 4MPTA 1QP7A 1LTHR 3C1OA 2AHRA 2C4KA 1SO8A 1KMQA 3ESXA 3I73A 1WF6A 3G02A 4ATNA 2AC4A 3KT3A 2C9ZA 3P2KA 1E1DA 1EP9A 3P9QA 5G0TA 1ZOPA 3E81A 3D8HA 5I7OA 5KNLA 1ZCJA 1N9ZA 2O3UA 2ON6A 5AR1A 3IA2A 1ZP6A 1A9PA 1YBAA 4NMHA 3UWMA 5AOVA 2CNWA 3PNKA 3FVTA 3EEOA 2FI1A 3P9NA 5AKLA 3ESBA 3ONEA 3OWOA 4XLTA 1R4NB 3HHPA 3UOGA 3AEZA 1AJEA 4ZT6A 5LQSA 3WGGA 1G9XA 4BDTA 4CTMA 2FSPA 1VPTA 1L4KA 3EEYA 2WKPA 3R23A 4HDRA 4RL6A 1CUUA 3TR0A 1B93A 5L8VA 3A3PA 1OJ7A 1K66A 4GZLA 4LMRA 1LK5A 3H1FA 1Y8RA 1SAYA 1NVAA 3D31A 4WSOA 2IELA 5B1IA 2NVWA 5MFZA 5FBVB 4X1YB 3MK31 4XYLA 5AI9A 4RYDA 1LB1B 2O7QA 5I7RA 5FCDA 3U7IA 2VL7A 2ZWOA 3CG0A 3CEHA 3OQMA 3CW9A 3CXRA 1SCNE 3BWDD 5CGQB 1DBWA 3MINA 2CEKA 4URYR 4LOLA 2EYQA 3OHPA 3OIDA 2O8VA 5AH0A 3VYRB 4DCPA 1OWNA 3KYJB 2HSGA 2QVLA 2WUVA 2GRAA 1NPYA 4WLNA 3EPPA 1X42A 3I04M 1C7IA 1S96A 5IUJC 2ID9A 3BWCA 2APJA 1HDZA 4DBZA 3HP7A 5EMLA 1FVOA 4DG9A 4NBUA 4L4RA 3UK2A 1HC7A 4C0SA 1GARA 1Q14A 3N2LA 4HR7A 3TEFA 3RASA 1P2GA 5HM8A 4AY5A 4KQHA 2OXRA 1JTFA 3THRA 3SR3A 2HLPA 1Z4JA 1SKMA 1JR2A 2QR5A 3IP1A 3PGLA 4OREX 5FUWA 4JUFA 4DLPA 3RGGA 2NN3C 5GVRA 3OF5A 2OB2A 3W5VA 5FF9A 4BCCA 1E3MA 1IHYA 2J08A 3FH0A 1OX4B 1J25A 4JASB 1RWKA 3V2IA 3KLPX 1J06A 1V26A 5LQDA 3QQPA 4DMFA 2ZJ6A 3HU3A 4Z2AA 5CB8A 1F9AA 1Q7GA 4ZQHA 3UT5A 5I4IA 2JZNA 4LQDA 2RFLA 5AIBA 3GUZA 5KJFA 2DQ4A 4PYRA 4C14A 1G19A 1C80A 3MQFA 1AXGA 4PIPA 3GNLA 4LE1A 4R81A 1XEAA 1E5XA 1YDEA 2VEDA 3DLCA 2NUTA 2OCYC 3NGLA 5EPOA 3GH1A 4Z3DA 3DKIA 1PS9A 1DZIA 2LCQA 1CIPA 1NURA 3M6LA 1C0PA 3KQHA 3GFSA 1FDWA 3G2QA 1UDCA 3NYIA 3UMFA 5T3UA 5C8YA 3TVTA 3D6FA 2EZ8A 1UPTA 1D2EA 3BGWA 2ZIZA 3DV0B 4GOLD 4UCQA 1IQPA 3DUFA 2YOFA 5EZYA 1RW4A 3ESZA 3VQTA 1W9HA 3PA6A 3KVYA 5ILOA 4LVNA 3KJZA 1K92A 3LK6A 4FFNA 4FSDA 4WTOA 1CUDA 1G5PA 2E37A 4YECA 1NBEA 4Y6OA 5H8WA 2QQ0A 2PMKA 3TX2A 3NVKI 1UKCA 1XZHA 4G65A 4ZYWA 3CX7A 3D2LA 4AMGA 1H65A 4QC2A 3I6YA 2ZBFA 2RGWA 3BFPA 1NN0A 2OYSA 3OEEA 4H9GA 5ALPA 1J8MF 1P17A 3NVDA 1TM1E 2OV3A 1TCAA 3PNBA 1UPXA 4FOPA 4TM8A 2EHDA 4B34A 4L9WA 2FW8A 2PKRA 4MWZA 2IS6A 3CN7A 3VDXA 3SICE 2C3YA 4ZV9A 2D2EA 3U4GA 3DVAB 1EZ1A 3E0QA 5K20A 4XWTA 3JW8A 4YRDA 2C5HA 3QY0A 4PLHA 1YQTA 1MLDA 1Y34E 1GL6A 1E99A 3N2NA 2EKDA 4ED9A 4XOUA 4L2IB 2HT1A 4YTEA 4OFWA 2WOOA 5BWMA 1EMDA 4GBJA 2YWHA 4V1CI 3CSUA 4YUAA 5J58A 3SXUB 1BMQA 3DF9A 4C4ZA 4KB5A 3CBQA 3IIEA 1BDHA 1QPBA 2GZMA 4JUAA 4CEHB 3IE0A 1KQPA 3CW2A 5DU2A 2IQIA 3D0KA 5BO5A 3VSDA 3R3UA 3WAJA 2VNSA 3RVRA 1PJCA 5BPHA 4NCXA 4GKBA 3U3DA 2B98A 2ZXFA 1II8B 3AVQA 1V5FA 4WECA 2QGNA 4Z1MA 3PKIA 4YRGA 3FKQA 2Q1YA 2CNNA 1U6IA 4DA6A 5IJWA 3EMVA 5LA6A 2NQ2C 4RNCA 4AJLA 3NWJA 3V80A 5EPUA 4E5SA 1RRGA 5E9QA 4DNXA 2FX3A 3ANMA 3ET5A 4MPPA 2XF2A 3LFHA 3HBJA 1VG0B 1CHDA 1F2UB 4J90A 1FMLA 5JIBA 2C61A 5IVDA 4MUKA 3HV2A 3DOOA 2J3MA 1C9YA 5CMLA 3W9BA 4XD7D 2O8BA 5E7JA 2EJTA 2CMHA 3TD2A 3HBMA 1NTRA 3WKAA 2A9KA 4DLTA 1OMOA 1RD4A 2B5VA 3GDOA 1Z39A 2R7KA 3A4NA 3ACCA 4JP2A 3ZDZB 1W1IA 2FH5B 5JZVA 1E8NA 3OWHA 5C53B 4JYCA 1X7YB 2HF9A 4PSVA 5K09A 1R9JA 3RSGA 5BPFA 1CZRA 1M34A 3ICPA 4YJFB 3TR6A 1VMKA 1S2DA 3D02A 3I6QA 4KODA 1U9JA 1VE3A 2CXPA 3QYPA 3PYMA 5KYYA 4N4AA 1EFPB 3KPWA 5K8VA 3LDHA 4X1IB 3PGMA 3MW8A 2TS1A 1G0NA 2V7VA 4JL6A 1W2WB 2O2JA 2VHXA 4QXQA 1X2BA 3NORA 2H0AA 3OA0A 1BD4A 1W0KA 3E03A 3W06A 4KLZA 2HJGA 3D9QX 2VZLA 1K8ZB 1WNFA 3GC6A 4EW1A 2Q6LA 3E4DA 5K01A 2UYHA 4BFUA 4BNZA 3LC1O 3CRMA 4MDHA 3AF0A 5HDBB 4B4OA 1CF2O 3DDUA 4Q6WA 2Q3EA 2B3DA 2Q0HA 3LSTA 3PSAA 1WTCA 2GD2A 2Y1LA 2JJ1A 2AOTB 2R6CA 2UYYA 2YV4A 4MW7A 4UBLA 3RF6A 2ZBVA 1TA9A 2D4HA 4MR8B 5FUBA 4B8YA 3CNHA 4QELA 4GH5A 3WQRA 1FUKA 3JD2A 5EHQA 4V1CA 3M3PA 4DUPA 1HTWA 2E55A 4JL8A 3T1NA 3PJFA 1BGWA 1MVNA 3SJUA 1UOEA 4XB1A 1XZGA 3VPFA 2R1ZA 4FFBA 2V8BA 4G5YA 4U3JA 2PJRA 4CCYB 1P7ZA 4M1SA 5E4YA 5CA1B 4UTZA 2BHRA 1UDRA 1GPUA 2LPMA 4MSUA 3AI7A 3RUIA 2YZKA 1EB8A 1XCOA 3QITA 2EEPA 2C5AA 4QARA 2OR3A 1YVUA 1EJ6A 1NDUA 4NBSA 3TQHA 1Z5PA 3HYTA 3NYWA 3AEKB 3GOQA 3IUNA 1L8AA 2MU1A 3F90A 5GONF 3VSCA 4LYAA 4AIRA 4EZIA 1M72A 2RHWA 4QU9A 1GG5A 1DC7A 1TCUA 4QPNA 3J81A 1ZJWA 3MB5A 2JFZA 3OZEA 3QV2A 1XMPA 3RSFA 3SYLA 3LTNC 4HVTA 2PV0A 3RRBA 1Z12A 1OOEA 3PFBA 5AVSA 3A8TA 3HO6A 5DM0A 4J6FA 1IHOA 2RHHA 1QJCA 1UP4A 4AMYA 4QQ8A 3FMIA 3PC7A 4KQFA 2VDKB 1GDDA 3SEZA 3USCS 2CLLB 2FWNA 3V1KA 1QB7A 2AKAB 2QZJA 3EEFA 2D7DA 4XCXA 5FPYA 1E5LA 1EBUA 2I4NA 4OVKA 1O6CA 1PHRA 1GZSA 2W7TA 2Y0CA 4G4SP 2PFGA 5JSHA 5LKRA 2IHZA 3HJNA 1RTKA 1HEUA 1OAOC 4J1NA 3A6FA 3AINA 2OLEA 2EATA 2OO7A 4KXXA 1KC3A 1LBEA 4TV9A 3QLVC 3LCMA 3W04A 4H7PA 4ISBA 2NUBA 3ROGA 5KQGA 4BQRA 2DKFA 5JEEA 2E6KA 2RH5A 3VI4B 1YZNA 4TTAA 4DR7B 2MINA 1S1MA 3IX7A 3WFIA 4BEJA 4MQ5A 3ZU6A 3KV1A 3DV9A 3O0TA 3QYAA 4FXOA 5D5HA 2GM9A 1GKIA 2CB0A 2NACA 2PZJA 1F51E 3T8YA 3A7DA 4PFQA 1YONA 4YJ3A 4YCJA 1PO7A 2IBMA 1BKDR 4L73A 3DPUA 1DUIA 1XXHB 3EH2A 4A6DA 1XP5A 1HLPA 2YWGA 4JBYA 4ZVKA 4IJ6A 4QJ5A 1IQUA 4MH0R 4EHDA 4A03A 1PZFA 3ZZTA 4K1LA 5HILA 4C1BA 1IULA 3P71T 3RG8A 2NZ2A 3GUVA 4G9EA 2E85A 3DP7A 3HB5X 4PC6A 3ACBA 4AMVA 5B58T 3F6CA 4WN3A 5JANA 2ES4A 2RAPA 5D3MB 4AP6A 8MHTA 2ESRA 3T99A 1RM4A 5DSZA 1BS2A 4B0OA 3K8ZA 4ZYTA 3GYGA 3ZDDA 1D4OA 3OESA 1PWHA 2X5XA 3GFRA 4D3DA 2VQSA 5K8LA 3L1VA 3N2KB 5AXAA 2QTVA 4TZ0A 3W6NA 1QLJA 4J8PA 4AAYA 1K89A 1P2DA 3OZRA 3VTFA 1Z0ZA 3RHSA 1ZCBA 4OJYA 2PXCA 2YV3A 4BNVA 1LS6A 1BDIA 5EUBA 4B73A 2ZR9A 3HFGA 3KKMA 4RM2A 3ZEAA 4OK3A 3VR4D 1W1UA 3K6SA 2R7NA 5T8KC 3W2EA 1RJ9B 2Q4TA 1KFJB 3AYZB 1IH8A 3HZHA 1MCZA 3DXYA 2BFEA 4G24A 2G9ZA 1P31A 4UUPA 2AS0A 3I6BA 3ICOA 4Q3LA 1W25A 5IT9A 1ORVA 3DEHA 4UQLA 1DJPA 3S2UA 3SJCA 2VHZA 3RUFA 2EG5A 2C9OA 2ECPA 2GAOA 2C5EA 3HGQA 5TPWB 1UM9B 4K6GA 3V1TC 3EWSA 2GVDC 2Q3HA 1CQJB 2ZXEA 2NTVA 2OGWA 1R6UA 3HRHA 2ZCUA 3VR5A 4EBFA 1Z2OX 3ENKA 3FA2A 3K8OE 4IOKA 3AJRA 4I4NA 1QLHA 3W5IA 2FPIA 2H0QA 4YJ2A 4C21A 3EUEA 4BBJA 3GG9A 2IXDA 3KWLA 3S4YA 2EWMA 1QRSA 1E3EA 1Q0HA 3DUWA 4CLEA 2DERA 2DLCX 4IDHA 1YVEI 1ISPA 5CH3A 3W34A 1N5IA 1JBKA 2FMHA 1X7ZA 1QYDA 4RORA 2WA2A 1JUDA 2O7VA 3X2FA 3L6BA 5BW8A 5JFOA 2NM0A 1DTSA 3M6VA 3JQ9C 1A7AA 1RRMA 4NOLA 3BGIA 3V7NA 2F4VB 1GQ2A 2B5WA 3ELDA 3ROKA 5I4KA 2H2DA 1VI5A 2ZU0C 1P1FA 1W29A 3LUDA 2F55A 3WK6A 5EZQA 4OY3A 5FLKA 4AI6A 2W6IA 1S9HA 3T1TA 1J7KA 2ZM6B 1SURA 1NASA 2QD5A 3R09A 1YDWA 2O48X 2PA0A 2WAXA 4I1UA 1UK9A 2FMKA 5CM2Z 3UAZA 4C87A 4COKA 1K75A 5FI1B 3NWEA 4KR9A 1HZZA 1K1EA 3H7AA 3GCXA 4XSGA 4N48A 1A8UA 4MR8A 4QXRA 4EUFA 2ZBEA 1MZVA 4OQMA 3ENZA 4L9RA 4Q3EA 1D5CA 4W82A 4RY0A 1BROA 1OUMA 3F3SA 3G13A 4N76A 5F7OA 2JLCA 4QWMA 3A32A 3PT9A 3WB9A 5C4GB 3TK1A 2OHHA 2J3HA 2QN7A 3OMXA 1Z63A 2BGLA 1W59A 4L0MA 1CQZA 4EF4A 2XKKA