2PRKA

Synchrotron x-ray data collection and restrained least-squares refinement of the crystal structure of proteinase k at 1.5 angstroms resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
publication title Synchrotron X-ray data collection and restrained least-squares refinement of the crystal structure of proteinase K at 1.5 A resolution.
pubmed doi rcsb
source organism Engyodontium album
molecule tags Serine proteinase
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1987-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2prkA00
2TECE 3A3OA 2WWTA 1TM1E 1ZVKA 2B6NA 1C9MA 4ZARA 4FONA 2IY9A 1SBTA 1IC6A 1SIUA 1PEKE 3VYVA 1Y3DE 1BFUA 1TECE 2ID4A 2V8BA 4CFYA 3D43A 1V6CA 1BJRE 3L1KA 1S01A 1TMGE 1Y3FE 1P8JA 3WHIA 1S02A 2E1PA 4DZTA 3OSZA 1C9JA 1GNSA 3F7MA 2XTJA 3DE6X 1A2QA 1SIBE 1TM4E 1AU9A 3F49S 1MPTA 1SELA 2W2NA 1SUEA 3I30X 4KPGA 4GI3A 4OV6B 2X8JA 1SCNE 1JEAA 2WUWE 5AQEA 1OT5A 2X8JB 4JP8A 3VV2A 1YJAA 1THMA 2ID8A 1SUPA 3T41A 1GA1A 3GT4A 1TO1E 4YN3A 3BGOS 1SCBA 2QTWB 4CFZA 1MEEA 2ZWOA 1VSBA 3AJ8A 5JXJA 2PMWB 2Z2YA 2P4EA 4H6WA 1AF4A 1SCJA 1SBNE 5AVJA 5B1DA 2XRMA 1T1GA 2Z58A 5B1EA 1WMFA 1AQNA 1PFGA 1Y9ZA 1YU6A 3CNQS 4HVLA 4C3UA 3DW3X 3GT3A 1GTG1 3GCWA 5FBZA 1TK2A 3TECE 1WVMA 1CSEE 2ZRQA 3A3PA 4NE9A 5ARBA 1Y33E 1GT91 3BX1A 1R0RE 1OYVA 3DVRX 2SICE 2WUVA 1GA6A 3Q40A 1YJCA 1XF1A 3CO0S 3HJRA 5SICE 4NMXB 1ST2A 1SUCA 3PRKE 5JXIA 2HD4A 1TM5E 3DDZX 4M1ZA 3WQBA 3EIFA 3SICE 1OYOA 4RYDA 3DYBA 1SIOA 2DQKA 1ST3A 2SBTA 4H6VA 4H6XA 2W2QA 5JXHA 2DP4E 1CNMA 3UNXA 3QFHA 1P7VA 3TI7A 4DJ5X 1NDQA 1KDYA 1UBNA 2G4VA 3BPSA 2Z2ZA 4WOCA 1GCIA 1HT3A 3PTLA 3I34X 2Z57A 1SN7A 1WMDA 5FFNA 4I0WB 2HPZA 3GCXA 1SCAA 1Y4DE 1Y48E 1YJBA 1Q5PA 2WV7A 1SCDA 1NLUA 3VV3A 1PJ8A 1BH6A 1SBIA 3LPAA 4NE7A 2SECE 3VTAA 3LXUX 4WOBA 4KG7A 4HX2A 2Z30A 2DUJA 3EE6A 1ZVJA 2Z56A 3F7OA 1EGQA 2IXTA 1EA7A 2ZWPA 4LVOA 4MZDA 1GNVA 4AKSA 3DVQX 1GTL1 2PRKA 4KB5A 1SH7A 4CG0A 3DE0X 4Z2AA 2PWAA 5AVKA 1GA4A 3VHQA 3ZXYA 3AFGA 1SVNA 1SUDA 4OMDA 3DE1X 3ZXXA 4C3VA 3DWEX 1V5IA 1DUIA 2SNIE 3Q5GA 1SUAA 1IAVA 1Y3BE 2ST1A 1SBCA 1P7WA 5ARDA 1AVTA 1SBHA 4J94A 1DBIA 1TM3E 5AMXA 1R6VA 3TI9A 3A3NA 1LW6E 1BE8A 3WIUA 4ZOQI 4K8RB 1C3LA 2W2PA 1Y4AE 2W2OA 3DE3X 1SPBS 5FAXA 1Y3CE 4AKTA 3DE4X 3DW1X 3LPDA 1T1EA 5I9SA 3SQOA 3P5BA 1AH2A 5JMOA 1BE6A 1KDVA 5ARCA 1NDUA 3VSBA 1T1IA 4OMCA 1WSDA 2PKCA 1S2NA 1AV7A 3I2YX 3DVSX 4BWGA 1C9NA 1AK9A 3QTLA 1WMEA 2PWBA 2Z2XA 4B5LA 5CW1A 3I37X 3WIVA 1R64A 2PQ2A 2GKOA 1GTJ1 5JXGA 1Y34E 3H42B 3D9QX 1TM7E 3EDYA 3DE5X 4DWWA 1PTKA 1Y1KE 3AJ9A 1SUBA 3DE7X 3QMPA 3DE2X 1TO2E 2PYZA 1BFKA 3LPCA 4LVNA 2W2MA 1KE1A 5K7SA 1KDZA 1KE2A
chains in the Genus database with same CATH superfamily
2I7XA 2J3QA 3CGGA 3U61B 2FUKA 3C48A 3FSJX 3R3XA 1E2UA 1GGNA 5ALUA 5K0ZA 3MGKA 4HEQA 2Y4OA 5ALKA 2VUHB 4IJQA 3OAAA 4JS0A 4LDQA 4MYTA 3UWDA 1O95A 3ONDA 2O8CA 1E1LA 4IMJB 3D81A 4FOOA 3OY7A 3QPAA 4M8IA 2DAPA 3ABRB 3Q3VA 1W88B 1L7MA 3S7TA 1QYWA 2PVCA 3ETJA 4XDGA 2AMJA 3P20A 1C7RA 1JR4A 1U3UA 2FZGA 4RHYA 5JUWA 2ZDQA 1N0HA 4ZFNA 3KE9A 1LLFA 5CNJA 2Z98A 4YS6A 2NU7A 2Z2KA 1PJCA 3IAUA 4I9FA 4PU0A 1F48A 2UVQA 3PNOA 1J0CA 4RJLA 3LH5A 3UJHA 4LOJA 1CUHA 3GLIE 5EIEA 4C1NA 1MH1A 3AM3A 3WA6A 5KUTA 1W0JA 5JFGA 4PHCA 4NV0A 1P80A 4KMMA 2V8BA 1REQA 2HRRA 1JI0A 3GY0A 4LBVA 1U8XX 4NC9A 1PJZA 3TTVA 3UWMA 5JQGB 1X2EA 1BGWA 1Q3HA 1GXSA 3OH8A 3ZZ1A 4L9WA 1IWOA 3H16A 4PIPA 3CX4A 2ZW9A 2EEPA 4TSRA 3NBXX 1RM4A 2YWBA 5CB4A 1O03A 4UE3S 4LK2A 2FEMA 1MB4A 3A14A 3OO0A 1IB0A 1MH9A 1THZA 4OJYA 1HG1A 2GI4A 2I03A 1CRZA 1NVVQ 2VSQA 1TPYA 3U3DA 1QHSA 2DWOA 1XWFA 1QIEA 3LY7A 5DP2A 3R4CA 3QELB 3RRBA 1IZ7A 3IR5A 1WHSB 1P3Y1 3NXKA 1SUIA 3HLYA 5SYMA 1F12A 1AKMA 2D62A 2Y93A 2IYZA 1VLJA 2J09A 2WYOA 4YJGA 4AJIA 3O7MA 4QJ4A 3CU5A 3I9KA 4GW3A 5ED0A 3ZU6A 1SIBE 4TLLB 5EE0A 4DPKA 2Q07A 1WIWA 3LL7A 1TF7A 3R7BA 4KQCA 2J67A 4FKZA 4PTLA 3C2QA 2G7ZA 4M0UA 3I04A 1MT0A 2I33A 1E9DA 1KI2A 3N2IA 5F1YA 5K4HA 2CXTA 4RFLA 3QXSA 4JXKA 4PBSA 1DQYA 1PT5A 4RSMA 4XYEA 4FEYA 5CNMA 5KOJB 3MCZA 4HTFA 4U39A 2PPLA 5A7HA 1ES9A 3S8EA 3D6AA 4BNDA 4Y67A 2I2CA 3TWOA 1RAHA 2GK7A 1FYWA 4F3RA 4LVUA 4NOMA 4X62B 1MJFA 1YS9A 4BHTA 3FGPA 1CUCA 4ROSA 4KFTA 4C0JA 1WE2A 1D2MA 4PAWA 4OFWA 2GK4A 5T67A 3GOQA 4G89A 3O8NA 1RHUA 3SR3A 5JNUA 1NR5A 4TV9B 1LLCA 4WQMA 1QFYA 1T5SA 1MVNA 2VOJA 4UU8A 3OTQA 4NH4A 4BX8A 4DE5A 5KI6A 3KXDA 3G0OA 4RW0A 1Z2EA 5HMLA 1R74A 1W4RA 1CS0A 1AKQA 4P81A 2PRJA 1JHVA 3SLKA 1OLSB 2CBXA 3B8EA 1NX6A 2JFGA 5FA8A 5B6JA 2CC2A 2P6RA 5KTRA 2YJGA 3C16C 5EZYF 5HZHA 2AUTA 4EB3A 1NUSA 1LWNA 2JEZA 1ZGZA 1J0AA 3NASA 4E03A 2I55A 3NDBB 4ZT6A 2H06A 1KAGA 4MVWA 4B2LA 4B9EA 3CZRA 3LSYA 4TL6A 4CXMA 3NT4A 3MIIA 3VAYA 2A4MA 2UZ1B 3M5PA 2WWWA 3DEYX 1I4DD 1DLJA 3H5RA 4IXWA 3A1DA 1KZ9A 2ZSIA 3OZSA 4UVDA 1ZK2A 3WMXA 1F38A 2ZYDA 3ODGA 1QH0A 3ZHQA 4O4JA 3SF0A 1ZR4A 2DU8A 1TAGA 5B4TA 1LNQA 5I45A 3TQRA 3JQ8B 4PAGA 5JASA 1ZJWA 1YZNA 1CUDA 1YIDA 2HR1A 4F46A 5AI9A 1SQSA 1Q11A 1LPBB 3QEMA 4IDNA 1EK1A 4ZMRA 4CKZA 1ZH2A 1A8PA 3JQ6A 4LGMA 5LLDA 1E2PA 4P22A 1FS4A 2ZQYA 1J9EA 4O25A 3T7AA 1Y9ZA 1SXJB 1XFAA 1YNOA 4G0NA 3RUDA 3WKCA 3KQWA 3ESDA 4UUBA 4O4HF 3QBJA 2SKEA 4MRRA 1T4CA 3SEAA 1CUXA 3IODA 5BSMA 3KPYA 4OEHA 3E9RA 3UMSA 4XH9B 1CZUA 2E4AA 4U7TB 1POXA 4WTOA 5BUCA 3PDIB 5CA1B 3WQRA 3BILA 1CIPA 1JSXA 2RI1A 3E3AA 4JB0A 1UZUA 1VZ3A 2E82A 3JSAA 4FD2A 4JK3A 4X63A 3DBHA 3MINA 3L6EA 4UE2A 1E0AA 4FD3A 4YQFA 4B75A 4I2NA 4JQSA 5EJ8A 4OGWA 2C5SA 2VJAA 4RMIA 5K6AC 2BFWA 4H1UA 3DDHA 1TMYA 3G2IA 3PPYA 5CLQA 4EG7A 3AF4A 3MWKA 1XVIA 1FJGB 2GNAA 4E5PA 3IE2A 3IEXA 1V39A 4RK1A 1EVZA 1Z2CA 2OC9A 4Z1OA 2R62A 3T38A 3K73O 3HMQA 4MB0A 2C4KA 4IXMA 4QELA 2FEOA 2XBLA 1CY2A 1OZGA 3ZE7A 1XPRA 2PN1A 1A9QA 3T52A 1K98A 3D2AA 3HEMA 4PHFA 4OHMA 4ZV7A 5K6AA 4U0JA 1H85A 2KJQA 5HF9A 4DIDA 5DTRA 4YO8A 1L4HA 3K5HA 1GL7A 2P77A 1T3ZA 3AUUA 3DOUA 4CI9A 1SUCA 3JQCA 1D4AA 4D56A 2C7OA 4WOPA 3L1HA 1RPZA 4C21A 2X2FA 5E6RA 4XLZA 5D5PA 2WLSA 5I5GA 1PEDA 1CR2A 2HMTA 3BM5A 1RKUA 3O3NB 4KR0A 3K8YA 1AD2A 3PLAE 2IJGX 1KWGA 1PD1A 1I7QB 1IQRA 4G9EA 5DBHX 1NVKA 2QTZA 2JLSA 5JDCC 5BXYA 1HL3A 2WIGA 3I01A 5B1YA 3AUAA 3H17A 4TL7A 3DVAB 2V6MA 4BQSA 3BSFA 4D5EA 4P5PA 3LL4A 3C3AA 3DYBA 4KLAA 4AF7A 2Y1OA 4MV0A 4R6XA 5AJVB 3SM9A 3CV3A 3MW8A 5CXQA 3KOYA 4PXAA 3UMCA 1PT9A 2OGWA 1JMKC 4KZKA 4ZJYA 5BR4A 3K92A 4Q37A 5L3ZA 2PCJA 2YY5A 4RTKA 3Q1LA 5TQ0B 4QYXA 4ZU3A 3SEFA 3RRYA 4EA9A 1LDBA 4KO4S 3ZJUA 3BJIC 1C7JA 1OLXA 3FPEA 3RC7A 4BEBA 5HGXA 4AX8A 1CNMA 4AF8A 1EG7A 5FBRB 1R18A 1YDHA 1DKNA 3O4RA 3TLKA 3WGNA 2FW6A 1U3DA 3CZCA 4ZQCB 4BV2A 2BGLA 2QZ4A 4CM7A 3QWAA 1OXTA 2P0YA 4EK9A 3O3OB 2M1XA 3AHDA 4MV1A 5AXCA 1IZYA 1Q1ZA 2QJTA 4B7XA 3MMSA 4JVNA 1OPRA 5FTJA 3DZCA 4RA9B 2G9ZA 1QIDA 2XGOA 4JUBA 4TVOA 2J3JA 3INYA 4QC2A 3WLKX 4EG4A 1RAFA 5DRYA 4DQUA 1SXJD 1FL9A 4BNKA 2B4AA 3QKIA 3MRSA 2B82A 1U4NA 1QFSA 2Z9CA 1OBHA 1DOHA 1X1EA 1PQWA 2X6QA 3DHYA 3FF4A 1ISSA 1Q0QA 2PYDA 3B12A 1EGVB 1N33B 1J5XA 3MMZA 2PL1A 5IUKC 1CY4A 1HETA 3DB1A 3JQGB 4A10A 4DMLA 5JY6A 3U9SA 3UMBA 2OK8A 1TQ6A 1UBLS 2JFPA 5KTYA 1NVFA 1ZWLA 4W1SA 3TDNA 3UGKA 4WBNA 1M73E 4NYJR 4MKGA 4BB5A 4PGGA 1VSUA 4BQRA 2IU4A 3SGLA 1M76A 5HTKA 4D45A 1SBIA 3UMMA 1WETA 4F60A 3WGHA 1UANA 1S9HA 3L92A 5F3WB 3DLPX 4OD0A 3MWYW 3EVCA 3PC4A 1P4HA 1K5HA 1RJ9B 1GSOA 1WUJS 5IC6A 4ER3A 4FB4A 3R0VA 5KYVA 2R97A 5FTMA 1L4LA 1JFLA 4A73A 1I14A 1U9YA 1ZGHA 5AW3A 4LRSB 3FKQA 4DV5B 1YKGA 4KXNA 4QTXA 3ZNOA 3PCTA 2WHYA 1RJDA 1G6OA 4DJFC 3G1TA 5K2OA 3VGPA 4RADA 3UAGA 4R0VA 4X3CA 4FHFA 3PNQA 4UNNA 5HIMA 3VPCA 2KI5A 3HYTA 3GQBB 4LYYA 1P7CA 1RAEA 3BTSA 5HBGA 2DX7A 3P9PA 1SZDA 4RLFA 2ZUWA 3HN7A 1G17A 4A92A 3H87A 1NUHA 4IDOA 2LIVA 1GNVA 1BX3A 3RIEA 3KSAC 3QJGA 4QHYA 2I62A 3CR3C 1TT5B 3WVNA 4TKZA 4E09A 2TMGA 4IS3A 1NVWQ 3BF7A 4IINA 4M8SA 3RVJA 1NDHA 4XQEA 3DLHA 4GX2A 4O5OA 4N6GA 3KAPA 4UVHA 5KINB 1T4BA 3UV3A 3IUJA 3Q12A 4EPWA 2Q5IA 3NH6A 4LF9B 5JYDA 4N3NA 3PHHA 2O19A 4LHEA 5LDHA 2IUEA 1CFJA 3KAKA 4OF4A 3KLNA 4MS4B 1T15A 3DDOA 3L05A 1BXRB 1X8XA 1T8RA 2PR7A 4PVCA 4JI6B 2QT1A 4F2PA 2AFHB 1M2JA 1T91A 3O2QB 4MQFB 4IG9A 2ONJA 4TT8A 4A2WA 3TGLA 1FE8A 4WZBB 1CUAA 4JHXA 4N5DA 1W88A 2OO7A 3NYWA 4LPSA 4B85A 4GOND 1L0BA 1J7KA 1T6YA 3QJ5A 3C8DA 4NHOA 3RT1A 4EATA 1XNJA 1ULAA 3EUWA 4B9AA 4X7RA 1J23A 4Q01A 2ST1A 3LZDA 4L5IA 1PGNA 3LW8A 4HAZA 3S99A 1WVGA 2PZLA 1EP3B 1KAEA 2PUVA 1CUBA 2ALJA 3QY0A 4HB3A 4EHBA 3IA2A 1HLFA 4DUYB 1KI7A 1K88A 1OCEA 1QF9A 2PX2A 2YJTD 3AF1A 4KE8A 4MVJG 3L6BA 3H3JA 2LV8A 1Z06A 5CT6A 1FRFS 2Q8NA 4K28A 4RK5A 4WY2A 4PYOA 3VVLA 2ZUBA 4ZQEA 1PNQA 3OLXA 2XYHA 3WKBA 5I9BA 4EUKA 3EMBA 2O54A 4YCBA 4UU0A 5TV2A 1XN4A 1JQ3A 2QTMA 3EPKA 3ESYA 1EFVB 4IOMA 3R3WA 1JP7A 4TXLA 4GT1A 4I9UA 4XX1A 4CJXA 1K86A 4RDIA 4B3TB 4AQYB 3QPVA 5E2IA 3FAZA 2ONCA 3E8SA 3E7XA 3O4IA 3VO8A 4KWTA 2IYOA 3EPLA 4JSRA 2AN3A 3RTDA 1Y8ZA 1GRQA 1IPEA 3IALA 1YB1A 3ZV6A 4B8ZA 3QELA 2R8BA 1RYDA 2RCYA 1QRAA 4WD3A 3UHAA 5BT8A 4HNTA 1WHSA 1U9ZA 3QPCA 1MXFA 1QAQA 4L08A 3HA2A 3GMTA 4HQOA 3FHTA 1YC2A 1R0CA 4RL4A 4ALLA 2D4HA 4ETIA 4ONEA 1QGAA 2BZGA 2VLIA 4HUTA 1E6KA 1ZN2A 2XV1A 3N2LA 4JKYA 3IQWA 4UUAA 3ZIAD 5CB8A 1AMUA 2HUNA 3MJFA 2ZWVA 1C1XB 1OH8A 1KFEB 3ZR4B 2NZ8A 1T35A 4HFJA 1GVNB 1Q57A 3QW4B 4D98A 5THQA 1E6UA 2WG2A 2FWRA 2LPMA 3MC1A 1ZK0A 3E84A 3OFSA 4PSDA 3TLAA 5B7PA 3ID6C 4HO1X 1BJKA 4OYRA 4PFQA 2GESA 2JGMA 5KOJA 2CV0A 1UZNA 1X1SA 4URFA 1A9XB 3CXRA 3E5HA 3E9CA 3SE7A 2ZUSA 3PFWO 4OK5A 4BNZA 4MP6A 1AKWA 1QZ3A 3KKQA 4G1CA 4E5UA 1B1AA 2J41A 5IDYA 1I36A 5JO0A 3JAWB 1ECJA 5E3JA 1DC8A 3NWJA 5BSEA 4GMFA 3ESQA 1UOPA 5JD6A 4Y6RA 1BHQ1 2A9VA 5IW8A 4QYWA 1J4AA 1N8TA 5BWBA 3ZHRA 2I78A 3TN7A 5JS1A 2GOYA 1E9CA 2H4FA 2ZTUA 4IV0A 1PUXA 4OCZA 2ZIVB 4TV9A 2KWIA 4YCDA 1NYLA 2QU7A 1CEQA 2JCYA 5ES3A 5TF4A 2YJ3A 4M7PA 1M9NA 3DT9A 4O8ZA 3WQQA 1UZLA 4B5LA 4G4IA 2YFQA 5CW1A 1T5OA 1T5LA 4KQ6A 1T9GR 5HCIA 3S28A 2AX3A 1LSUA 1RWBA 1VLVA 3WGYA 8MHTA 1IY8A 3Q4GA 4IIJB 3EQZA 1ANKA 1Q2XA 4AUMA 4ZC1A 2R6AA 1YR9A 3N70A 1KBZA 2GKOA 1OX4B 2MMGA 4MB6A 4OYHA 1ZM4A 4PIVA 5EQTA 4R8MA 3UXMA 1N2JA 5IZCC 1DKOA 1ZRMA 4XWYA 4LYAA 2RAFA 2HNKA 2UZ1A 4BS9A 1EWQA 1U4OA 4JJEA 1HFJA 3DE5X 3FHLA 3IQEA 3K05A 1S2LA 1O6ZA 2WT4A 3NC4A 5EMMA 3R75A 1NL3A 1PTKA 4NF2A 4QNRA 1SUBA 4YRDA 1HNZB 2RJ3A 3R6WA 1OGJA 1SXJC 4KH0A 1RU3A 4RVHA 1FP6A 2E4WA 3JQ8A 2PYZA 1KI6B 1PKEA 3LQKA 2ODPA 3AUKA 2DJIA 3TD9A 5IZCA 2C8LA 4PNZA 3KFVA 4JA2A 4W8HA 4R84A 1RQ7A 5KJ6A 2OORC 2W2MA 2DH6A 2JAQA 2W2TA 4S2EA 5DHFA 5F77A 2VHQA 1SXJA 4NICA 3U3KA 2HA4A 2XF2A 3BXXA 4C20A 2ZSFA 4YRAA 1N2IA 4ALMA 2YFKA 5PNTA 2QYOA 4GR4A 2NXWA 2ATCA 2TS1A 4TMZA 2IPAB 3RVOA 4B3SB 3I52A 5DYNA 4Z3KA 2BTOA 2VLBA 3PDIA 4GC5A 3U16A 1T8YA 1ZVKA 2OORA 3GB9A 4LJ6A 4YRPA 4ACAA 4IDAA 1C9MA 1V9LA 1P73A 2YOGA 3K9GA 4YJ2B 5H70A 4B09A 3KQLA 3ZE8A 7MHTA 1RABA 1G3IA 4WA8A 4IDBA 3PE3A 3DAPA 1DINA 2NO5A 1UFVA 3N8DA 1FYEA 1T4GA 1MENA 1V7PC 2FW0A 1N5IA 3O21A 2O0MA 1W4BA 3RWOA 2XITA 2JH8A 4TXNA 4YDHB 3ENWA 2QSYA 2A84A 4OUDB 4U9IS 2IY8A 621PA 3BIWA 1D5WA 1XZLA 3DEKA 1KGDA 2H16A 1DIHA 5DI9A 3SAJA 3JYHA 3GPLA 3WNQA 3ISTA 3G79A 2ID9A 2I29A 1XVAA 5EP3A 3QZUA 2V7WA 2FETA 2R66A 3BK2A 4ND8B 2GXUA 3DVLA 5AI4A 5D8DA 5FOUA 3DDSA 3VOSA 1A8HA 2XNJA 3WLSA 1NQ5A 5KSZA 1ZYUA 2AMYA 3NDRA 4MPTA 1UWCA 2ZQZA 4A8JB 2DERA 4L8LA 1N6IA 3R3JA 3VR5H 4C4SA 4MHTA 2RK6A 3P9RA 4M8NE 5T4HA 5DB4A 2YDYA 4TRRA 1LCIA 3TO5A 1ACLA 2EIHA 3KQYA 1J7JA 1N1GA 4HDQB 4J43A 1IDN1 4YPOA 5AESA 3PICA 3W34A 1GGEA 5DGIA 3DR5A 3WRXC 5KCZA 6REQB 4EYEA 1Y3IA 1Y3FE 1P4AA 2HU8A 3WLQA 1E9AA 4KR7A 3AEQB 5AICA 3LXRA 3DVAA 1C9JA 1HG0A 1E4YA 3RBVA 2C7RA 3NWBA 1HE4A 4NQZA 4RS4A 2BGGA 2JIQA 3FOFC 3ORYA 3WRXA 1Y5MA 1VGVA 1WQ3A 1KZ1A 3HMKA 3CLSD 1RHMA 3GPCA 5LQJA 1ZM3A 2FDCA 1MABB 3K94A 2G36A 5P21A 2Z5GA 4EMSA 2Q4OA 4ED9A 1M34E 4URYR 1DIRA 2QG4A 4BIIA 2VJOA 1P4GA 5BVHB 3I9MA 2V0GA 2HQBA 1EX6A 4RA9A 1F7UA 4EKGA 2X7HA 4FYKA 4PANA 1AKRA 4Q1VA 3VYUB 5LP1A 4IMRA 2NVUB 2W8BB 1OV4A 2KLHA 2O48X 2QMZA 5CBPB 3LJKA 1E60A 3ENNA 4KWIA 5IX8A 4O33A 3UA3A 5K8CA 4JP8A 1GCUA 1OI3A 4HMOA 3WGUA 2I2BA 2VF5X 3QSYA 2IU6A 1IYZA 3JQGA 5BSFA 5C1PA 4NXMB 4L8GA 4MV3A 4C0KA 1KOGA 3R0QA 5M5BA 2VH1A 2B8JA 3KTOA 3FOCA 5GONF 4BNIA 3K6SB 3X3HA 2IYVA 5C46F 1ZUD1 5LQUA 1ZNWA 4QGGA 2J5QA 3U3XA 4BECA 1P1CA 1GA1A 3GIWA 3D0KA 1EZ1A 3QLUC 3L7NA 2C5BA 5AUOB 1UJMA 4RL6A 4C6HA 1NONA 4CF5A 1SMKA 3HUTA 4C6RA 1R0ZA 5J4HA 3O92A 4WBXC 1TTTA 5EWLB 5JEEA 4LOAA 5AOVA 4OLAA 1KAMA 3OE7D 5FBVB 1TC2A 1JEDA 4HGRA 3RC8A 3OCXA 3JQFC 1L5ZA 4U1RA 3FRJA 5DEOA 2FMXA 1E2JA 1U7ZA 3ZIAA 1U7XA 1YDGA 4AMGA 2DWPA 3KEOA 4E0BA 4HUJA 3QYFA 2YV4A 1I2AA 3GW8A 4EM6A 1AZTA 4NIMA 3PC2A 4HG2A 3S44A 5AK5A 3GQBA 1R6TA 3TCXB 3QNUA 2GVZC 4YP6A 3JQFA 4P0PB 3M49A 1HL7A 5G1NA 2C3MA 2E4ZA 1AHIA 2ECPA 2JAOA 1GUDA 3GAFA 4GBED 3SFZA 3E23A 3VO2A 3C3YA 2PYIA 5ADUS 3OX4A 1TT5A 4WZ6A 1B0AA 1A95A 1WB5A 3FPKA 4JYPA 4Q3BA 3RUHA 5CCEA 4IHAA 1NSYA 1OKKD 1IULA 1B0ZA 2Q3LA 3PFHA 3SIWA 1NXVA 2VBGA 4GD3Q 1UAYA 5JCPA 3C87A 3NI2A 2LKDA 4KI0A 4YB8A 4MB2A 3GYBA 1LJ8A 1BKYA 1JR3D 3GDOA 2QD5A 4GYWA 3T4UA 4F2WA 1QVRA 4MS4A 1CSEE 4CL0A 1BXRA 4JVOA 1EFUA 3IP3A 4L50A 2ZIWB 4PNPA 1I4LD 1MBZA 2AFHA 1OQAA 4NE9A 4MQFA 1GPJA 3EW7A 5KSOA 5CP8A 1V5FA 4FFOA 1ULHA 4WZBA 3PDJA 2H4YA 4H9GA 4XW2A 2YFHA 2Z6UA 5BWLA 2B20A 3SZLA 3I62A 4M9QA 4PG7A 2VHXA 1QQAA 2EOAA 2IUTA 2J5BA 3LECA 2BM9A 2WTXA 3HJRA 1CQZA 1X74A 1IQPA 2WWRA 3R7SA 1SQ0A 3CW8X 3H75A 4MYCA 1V3UA 4NJMA 1LPPA 4EJFA 2A5GA 2JEYA 3DZBA 4XEHA 1LFDB 4EELA 2C96A 3HK2A 1PR2A 3P0JA 1YS7A 2H7VA 3OF3A 4J03A 3P4YA 3E35A 1D2NA 2NPFA 1Z3CA 3OOWA 4DTIA 1RYMA 2CMGA 2X0KA 1MV5A 1XTVA 1EFVA 3K6KA 3PB3A 4MKHA 3T12A 2YMPA 2PKWA 5CIYA 2AKEA 3AW8A 3ZV4A 2WAMA 4HAYA 4TM8A 3UMYA 4WFIA 1GZ7A 4LJ7A 2PV7A 3C24A 1K8ZB 5IKXA 4RNDB 2YIMA 3QTBA 3IB3A 4N54A 5FKJA 3GAAA 3K1ZA 3EF0A 4OHVA 1JDBB 4ZI5A 4D57A 3M2PA 2ZPTX 3CUEF 5DGDA 4D1YA 1N2BA 4HYQA 4BL5A 5A3SA 1U8YA 1RE1A 2R2AA 2OGSA 4OQDA 3HSYA 5ELXA 4ZXFA 4ZYTA 1I6MA 2X6TA 4G84A 3IEUA 5CW2A 1IXKA 4PLWA 3HYSA 5IFKA 4MX8A 5LZ4A 2J32A 1K92A 4KGXA 3HA7A 1Z6YA 1ZXLA 2GZMA 1W94A 1C1XA 1TCUA 2HSDA 2DP4E 3VNRA 4PAMA 1WBDA 1XZFA 3E1SA 3EQ8A 2IZ1A 2GCIA 4KFUA 2YVKA 2BPOA 5G0UA 3L8EA 4FIZA 3RVSA 4J75A 1P7VA 3DLCA 4KAAA 1CCWA 4NBSA 1TLTA 2P8JA 1CUYA 2WA1A 4JLKA 4YCAA 5DXAA 1I2CA 1YHNA 1UKBA 4EBBA 4FQ7A 1EWTA 4ZQHA 3WS7A 4RCZA 1V1RB 3SMVA 3ZJTA 2WE7A 1PG0A 5FWDA 3I34X 4S1TA 2J0QA 4GSLA 1A9XA 1NJ1A 3U13A 4UVEA 1SN7A 1GNRA 1QQ5A 1QQTA 2JGKA 2Q3JA 2XUAA 3MS4A 3RTEA 3X2SA 2G4LA 5FFNA 3LP6A 4ABYA 1BN6A 3QU5A 4RTMA 3LQRA 3JAWA 1IAQA 2ZAYA 3O6VA 4TM7A 4DXAA 4EUSA 2XB6A 2JG3A 1YQWA 1ONPA 1ZESA 3A4LA 2G28A 3RM3A 4QXQA 5I51A 3BGDA 5L6MB 1T0HB 8GPBA 2XUIA 1C0EA 1JUDA 2C8JA 1XKTA 4L85A 4HBGA 4UBKA 3BA1A 4YAFA 1XOIA 2HXSA 2YRXA 1A5SB 1UPUA 5TMDA 3GRAA 5KNDH 1PJQA 3CLSC 2BTQA 4N5HX 1BDMA 1FYVA 3W8RA 4GECA 1UKEA 2Y0PA 2Q3DA 3AB7A 2OBYA 4EB0A 5CJPA 4GZ5A 3OIYA 2P0EA 3RFFA 2JFWA 1ZC4A 2QZZA 2XDWA 4IIJA 3RIMA 5EMNA 3D7MA 3R7FA 4BRWA 1OX4A 3QLJA 2AEEA 2EFJA 3RC2A 1OFUX 3Q7IA 4MHOA 4IVRA 1HM5A 4GMHA 1ZNXA 2DUJA 4NBLA 3B6KA 3DBVO 2QTTA 2PBRA 6Q21A 4UKDA 1XCMA 1O94D 2UUPA 1EFAA 2H85A 1LZKA 2O23A 3VM6A 3ZWQA 1OB2A 1GKUB 2AOXA 2Q5OA 2FB9A 3LF1A 4ZEXA 3ZS9A 1LDNA 3LNTA 1X42A 4I1RA 1PDVA 4NZMA 3V1UA 3HDYA 5B5SA 1TD1A 4O6VA 3K35A 1KI6A 1EJ6A 1UKAA 2JK1A 1P81A 1G5HA 4LXXA 1JU9A 5CPBA 3WIOA 5J3JA 1KI3A 3L77A 2FF5A 4WW0A 4BOYA 4YRJA 4DGSA 4EQZA 5LMZA 3LC7O 5PGMA 1Z07A 3C6MA 3M4YA 1KERA 1NHWA 1V3VA 3GH3A 4XWKA 5JS6A 4RTSA 3MTDA 2JASA 4M9XA 4URHA 3TZLA 1JT2A 3SHVA 3BD8A 3B9BA 3CM0A 1Q1QA 4WVLA 1UPTA 1G7SA 3VKHA 2ZU0C 3PNMA 2DR2A 3P27A 3FYDA 3HCPA 2ECFA 2QXYA 3PE6A 4X94A 1E5DA 1VGQA 1X9HA 2B5VA 3NHFA 3ILHA 6CHYA 1NW5A 3VHQA 3WWDA 2WTUA 4PRYA 1J8YF 4YJ2A 1I2DA 2CJYA 2PL5A 4GLOA 3S81A 2XW6A 1KH3A 4OFBA 3AONB 3DNMA 3QX3A 4O3FA 4IOJA 1E94E 1KEEB 2ET6A 4AECA 2W2KB 1PVDA 1NAIA 5DGHA 3DQQA 3IP9A 3ZCSA 1MKYA 3OIVA 1U8UA 4A8JC 4ZZ1A 4GVLA 3KZMA 3S8MA 3OE7A 4OUDA 3LYLA 5T6BA 3EEQA 4CLEA 4M88A 4D26A 3DAOA 1U2ZA 4OP1A 3ZX5A 2H54A 4FPXA 4KP7A 4ND8A 3NHMA 4Z4HA 4G5FA 1NVMB 4MIKA 1AKNA 4IX1A 5BNFA 1GSHA 1L4YA 4U6NA 2ESRA 4A8JA 2G83A 2PFSA 5JZOA 4R69A 3RHZA 2Q2NA 3VH4A 5JSHA 2KE5A 1NVBA 4QPPA 5IJ0B 2DPXA 1TOAA 2PD3A 2PLFA 2YBEA 4MWDA 4YRBA 2WYWA 3SSAA 3HNOA 5K3AA 3KD3A 3O9ZA 1NN5A 5FUWA 2VJQA 3AV3A 3CH5A 6REQA 4M9ZA 5FI1B 2W2OA 1OKKA 1RWXA 4I3FA 5L3SB 3EZNA 1IVNA 3FWNA 1YFJA 4GOXA 2VQSA 3AEQA 4ZCRA 4NSNA 2EEZA 4F0JA 2XE7A 3X1XA 1QFXA 5KJFA 4W5RA 1O9GA 4ALIA 4KVAA 5FAXA 4EB6B 3COVA 3DDUA 1GN9A 4G85A 4E22A 4P98A 3DW1X 3ELYA 4WJZA 3J80A 2CL6X 2IF0A 4GI1A 1H4SA 2A30A 3L84A 3L7OA 1JIJA 1X1DA 1BEZA 3IAM1 3NPMA 4LJ9A 2XCTB 2P2LA 1JJIA 1MABA 1QHNA 2B5OA 3CS3A 5DNCA 4KIUA 3ZJYA 5I3ZA 2HYIC 4TTVA 4Z7JA 3MMNA 2VDVE 3CTPA 4F1WA 4X54A 2ATXA 2VK1A 1E8NA 1A7UA 1JLMA 2Y9PB 3VAAA 1O0BA 2GM4A 4XA8A 1A7JA 5EIAA 5F5XA 5BVHA 4ZU6X 1Z47A 4JL5A 4JYMA 1KC1A 1JIKA 1FU7A 2IQIA 2I99A 2QHXA 4K0RA 5SZHB 4DLSA 3JRNA 3KK0A 2QRQA 5I6DA 1YL5A 1V2HE 2VT7A 2WSIA 4RCYA 1ZWKA 2AZMA 1PWYE 2PTHA 4L5JA 4BMOB 2NVUA 2FN3A 2W8BA 2ZUTA 5DBIA 4RSRA 5CBPA 1A50B 3TTUA 3WC4A 2GCEA 2QLBA 2ZDHA 3K15A 4AN4A 2ZSUA 4GI7A 1AHPA 3AHCA 2VT2A 1H2XA 2YZMA 4OHKA 1L5RA 2QLMA 2OV4A 3N0VA 1TRHA 3VBEA 1QANA 5J5VA 2BJVA 1SXGA 4HWOA 4AJEA 2FQ1A 4DRZA 1F8YA 4O63O 2ZRNA 3IPLA 3K6SA 4CF7A 1G2QA 4LJ4A 2AXEA 1KSJA 1LBHA 3HWWA 4IYJA 1QMGA 2WMNB 1CJBA 2V7UA 3DJFA 4IZ6A 5K0EA 3ILYA 3OD1A 4GNRA 1FMLA 4EGAA 3GLSA 1U9CA 5C8ZA 2FU5C 3TZKA 3AK4A 3E4CA 4H59A 4ASUD 5IC4A 3GGCA 3GYGA 1F4VA 3TTYA 1E4VA 4YJ3F 4PN3A 4O2AB 4EYSA 2FCRA 3UOGA 4R3NA 5H82A 3VJLA 1YAHA 2E48A 3P4UA 4PCVA 3UY4A 5FULA 4MEJA 3SDSA 4Z53A 1ADCA 3DEAA 1J00A 2H2FA 4BNFA 1MF7A 1TO2E 2BM8A 4E30A 5IF3A 1DHRA 4LDZA 4PSVA 1J0XO 3KXLA 2O5CA 4GOMD 1XU4A 4O0MA 4L6IA 5IAAA 2WUFA 4MW7A 1RHRA 2Q0HA 4JLUA 2OD9A 3WGJA 1A77A 3GI1A 2RG7A 3UA4A 4KUEA 2FNAA 1P0QA 3ZWAA 3B7GA 3DWGA 3HTXA 2K6GA 3W79A 1A8SA 4X44A 2K7ZA 2JLYA 1XCLA 4P2GA 1GADO 2LD4A 1R8QA 3PEUA 4JIMA 1FRNA 5F7JA 5BXQC 4YMLA 4DR5B 5KB3A 3THWB 2FGKA 2JI7A 2VDRB 4PG8A 5BMVF 2XNDD 2ZBFA 4LJRA 2R6ZA 4XUGB 1WEKA 4YAKA 4LUCA 3O2JA 2OCLA 4JN6B 3RIXA 4Q1BA 2E49A 2C59A 3HCAA 4M55A 1N5MA 3A1TA 2F64A 5CT8A 1PL0A 4F38A 3W4IA 2OPHA 3GGOA 5I9IA 1XDGA 3GVCA 1HFKA 1NMEA 2OEPA 4R9RA 3VC3A 3H4MA 2IY9A 9LDBA 3G9UA 3WBFA 1QBGA 3VO9A 1ID1A 2ZE8A 3BHJA 4MVJF 2C77A 2FR8C 5TGDA 1FBTA 3WYNA 2I4OA 3LTEA 1IC6A 3TRIA 1SIUA 4RHFA 1XI2A 1X0VA 4WL0A 1F3OA 4QOEA 4LSMA 1JJAA 1BU5A 3OJEA 4I8XA 4FN4A 2DFDA 3U1VA 4HAIA 2XXBA 1UKVY 3IMKA 2YV5A 1O94A 4QT4A 2NV2B 4CCWA 5FIUA 1VCNA 4I5EA 1PL7A 4TLEA 4RV4A 2N3ZA 3HVHA 2FUG6 1D2AA 2XTAA 3DOEA 4IZOA 5EUMA 2PE5A 1JDBC 2ZIGA 2POCA 2FXIA 5IBQA 1CU1A 1W76A 5I7HA 4BE7B 2D1TA 4FYJA 1JHUA 4W7HA 5CH3A 1M0EA 3AVQA 1VE5A 4MITA 2GD1O 1OXKB 3QYPA 2X8BA 1J8DA 1EU1A 2QSJA 4I46A 5L4SA 3ZGZA 4X8HA 1YHZA 2QROA 3R44A 3WLRA 2A0YA 4RY8A 2IE0A 1USWA 4JEIA 3OQBA 4L0QA 4YAOA 4PW0A 3SQMA 3F7MA 1GN8A 2X19A 3IBSA 3NGLA 1SHZA 1VLZA 3IPYA 1IWBB 1XLWA 4HGYA 3KZXA 2HMWA 1XR3A 4RF4A 4TXHA 4ZRMA 2DR3A 1HFEL 3R7DA 3RC1A 1NLFA 2IKSA 3TNYA 1QE3A 4X95A 3UJDA 4X6XA 1XQWA 4EI9A 1NP7A 4YV2A 3L4SO 1XAJA 3KT3A 4D8YA 2CFOA 3S6JA 1HDGO 5JANA 1TM4E 5GGYA 1T5BA 2JH9A 2G06A 1XK7A 3FB1A 2JIPA 1G5PA 4KSBA 1U1IA 4R83A 1PNTA 2EZ4A 2OM6A 5JATA 4MKIA 4CHTA 1LBTA 4XJSA 3BL8A 1QYDA 3JXEA 1NJGA 3DMTC 4F4UA 2XZPA 3DFIA 3D3WB 3NIGB 2RC6A 5JZSA 4JLPA 2A78A 4AROA 3UM9A 4EKNB 2CXRA 2FPSA 3W77A 4JKOA 2UUOA 5JBIA 3O0DA 5ALOA 2ZVQX 3IUEA 1AJEA 2XUJA 3IHWA 1V71A 1PWXA 1VOTA 2V96A 4KN6A 3IQXA 4ZODA 1PR1A 3EGXB 2RGBA 4O1HA 2PNJA 5FEMA 3DMTA 4B4DA 4LY6A 2BFBB 4ZCTA 5J58A 4C01A 1YBAA 3R3UA 2GBGA 1LX7A 4RV9A 4RPKA 3WWPA 2ZWIA 3TXXA 2ID8A 3FWYA 3F96A 3GFFA 4IDFA 2I6GA 2WTNA 3EQ7A 5DK6A 4PN7A 4ZYZA 2H63A 4MTCA 2WU3A 1TZBA 3WRYC 1MZPA 3NEYA 1XX6A 2C82A 2F2TA 3I9JA 3MGBA 5F4BA 4ZO4A 1QC5B 1TIKA 2REQB 4PSAA 3VI4B 2C4TA 4UDOA 4C0BA 1OLOA 3OM8A 4V24A 1Z6AA 5E8RA 1A97A 2ODNA 1Y7HA 3DYIA 3NOXA 1HE2A 3TH5A 1XFDA 3ZV3A 3WRYA 2I6UA 3CRMA 1XE3A 4M0MA 2MCFA 1O7JA 3UCEA 3A9UA 3GRCA 4AJLA 4RMGA 2DY0A 2PMWB 2Z2YA 1UC9A 2ZB2A 2QGFA 3GCDA 3I9V1 2GEUA 3L4KA 3ZHSA 1C3JA 4YRQA 4JUDX 4D25A 2R6R1 3C6YA 3FYTA 2XCSB 4OPMA 2WM3A 1OGYA 3OKPA 5JEDA 1DMRA 4ZK6A 4BO6A 3FRHA 1T2AA 4HSEA 5KHOC 2F3TA 3Q11A 4PPNA 4FGKA 1QRRA 5DTQA 1O96B 3QYAA 3FZNA 2VDLB 1K6IA 2YYSA 3HZZA 3Q3JB 2RHBA 3LCVB 4D0RA 4RVNA 4RVOA 2EVWX 5LQSA 1YOVB 2QA5A 3FCUB 2GPNA 3QUSA 4GEGA 4HVLA 4HJXA 1M8GA 1U7UA 1VJ5A 3IILA 4H3VA 3OG9A 1OVGA 3STTA 1R9GA 1J22A 1WAMA 3P0RA 5MF6A 1DU4A 1DTSA 1ZU5A 4S1VA 4G4GA 5DBFA 4CMIB 1TA9A 1EK6A 1P2BA 3V9AA 3W5CA 1PJRA 5ELLA 2LVBA 5CFQA 2AJDA 4H3HB 5DW0A 1QK3A 4ZDJA 4YDQA 3FDJA 1Q12A 2FWAA 3VYSB 1XDSA 3A3PA 3NVKI 1KEEA 2W11A 1QB8A 2W2KA 1MJGM 4D74A 3ZNNA 1C3XA 5M04A 2Z1DA 1DEAA 1RBYA 3BX1A 4OI0A 2B7CA 3AXSA 4ASUA 1GPYA 4OHYA 4ZCLA 4RELA 1B73A 2SICE 1NQAO 9MHTA 4TRJA 3K5WA 4DT1A 1Q21A 1RTKA 2ATIA 2QIOA 4E4TA 4L0CA 2WJJA 4RD3A 1XTTA 3P9NA 3VISA 4I81A 3IUBA 5IN5A 4CG2A 3JQPA 2WIAA 1WUTA 1TQHA 4BNHA 4C6SA 1JAXA 4MQ6A 5JAQA 1J0EA 1RLIA 3AGQA 4O2RA 3TVYA 5BW6B 1R10A 3DGFC 1Z38A 3CJTA 5F64A 4HGPA 3RKUA 3EF3A 4RFSB 3ZBUA 4BNMA 2GXAA 5JXIA 4DTCA 4ODIA 4MYHA 1G6KA 1NU6A 4LRWA 2JAWA 5C18A 1DT5A 3BH7A 1VFNA 3WSTA 5IJ0A 1N2ZA 2Y2UA 4QRHA 5E1OA 4B7ZA 2I54A 3FFWA 3GPBA 1GO2A 4XIJA 3GFOA 1TMOA 2A5DA 1LTKA 1VMEA 2UZAA 3CLHA 2V5VA 3Q9SA 1S7CA 4IXDA 4PXYA 1Z2OX 4IFEA 5L3SA 3JX9A 4BNXA 3T95A 1U11A 2XNDA 3KVOA 3AR8A 1LC3A 3B85A 4EB6A 4E46A 4EVIA 2KYRA 2QWXA 4A6DA 4EJ0A 2YIJA 4KO3S 4NYIR 3DUFB 3PYMA 1VE9A 3I58A 5JU6A 1WQ1R 1W4ZA 4BFUA 2GJ4A 4BKRA 1JXMA 2V45A 4YRLA 4B2PA 4BFTA 4EHLA 3EXG1 2NYRA 2V1XA 3FTNA 2I66A 3KT0A 5FUVA 3TL3A 1MGPA 2E9SA 4EI7A 5REQB 3RYIB 4W8OA 2AF3C 2CFTA 3TI7A 3BL5A 3T1HB 4E5DA 2FPKA 2O7RA 3GEEA 4RSGA 2M6KA 4DHWA 5IHPA 3BPSA 4RTOA 1XPUA 1EHIA 2JGFA 4PGAA 1D1TA 5LA6F 3SYRA 3KVVA 4G0YA 4PLCA 1X1RA 3FYCA 4XD7D 2C07A 2NQ8A 4TZ6A 2EKDA 4RSHA 3DOFA 4OH1A 5A9RA 1CZLA 3B6ZA 3CYFA 4B31A 1FP4B 1KZ6A 1TRKA 4N8SA 2YRWA 1ONBA 1V8OA 3LBIA 1TEZA 4OBEA 4BASA 2XMPA 5K0SA 3LD9A 1R3UA 2D13A 2WMYA 5KTMA 1WZ2A 1E32A 3QJYA 4UQOA 1U2GA 4CE6A 5IDVA 3PJGA 4JXXA 2GTIA 4UJ5A 1U0GA 1RDFA 4ER0A 2I4IA 2WV7A 2BGIA 5C1BA 4X1YB 4MYSA 2B78A 3GLRA 4DNPA 3EDMA 1AKEA 3VMFA 1NLUA 3R76A 5LJIA 2C2KA 2OCYC 1DC5A 5DNYB 3COWA 2PU5A 4JJZA 5EJ2A 3D6MA 1Z7WA 1BDIA 3JPWA 1M2GA 3DV0B 2TMDA 5E95A 3K16A 4CT4B 4CVNA 2VC2B 4ZANA 1CEEA 5L4NA 4Q47A 3QITA 1P6XA 4DR1B 2D5LA 3SKVA 4O2AA 4CN9A 4BVFA 1NG9A 4MUGA 3OM9A 2Q0QA 1VHTA 3IT1A 4HN2A 5FFMA 3K2BA 4WKGA 3RI3A 1N5KA 3A31A 4FI3F 4R1LA 4C14A 1YBVA 4BP9A 1R0LA 4XM0A 2OGZA 3RTBA 3KWMA 4M87A 4TYPA 4AN0A 4EYGA 3RS8A 2XDYA 4LG1A 1OXUA 2F3QA 3SHWA 1EA7A 3HR8A 2HWXA 2X4IA 2H5IA 5K45A 5F98A 1CDDA 3MCUA 5JZ9A 1NATA 3EIUA 3GJ0A 3KJZA 3AM1A 2QD3A 2RBGA 4WHMA 4AKSA 4RTQA 4P82A 2PSEA 1VKZA 3DZKA 1K3TA 1L5WA 5TMBA 5L40A 3BWEA 1L3BA 4IRMA 4HYTA 3D2BA 1A9OA 3CRVA 5A5DA 1XRMA 2G80A 1Z62A 4BQQA 2YJNA 3IURA 3ASUA 1EWVA 4JWKA 2EJBA 3K70B 1I4WA 3ET5A 3A10A 3DV9A 1PK9A 2V9CA 5ALPA 1ND6A 2OKGA 4FN5A 4L4YA 3RU3A 4AF6A 1VMAA 3AVYA 1FJHA 2DE0X 2YZ2A 4H7HA 3WK5A 5IJXA 3H3FA 4UATA 4TMVA 2PZGA 4F12A 1ISRA 3A9WA 3BS4A 1QZTA 2VPXA 2XRFA 2YIVX 3ZXYA 4GXQA 4BP3A 4QASA 4D0SA 4G5HA 2D8AA 4UCQA 5DMXA 3GJ7A 4R2IA 3NXSA 4PTZA 3F4KA 4R2MA 3E9MA 1KI1A 3AQ4A 4C0HA 5K05A 3DE1X 2M32A 3ZXXA 3HBFA 2ZS8A 3F4BA 3B13B 3JZMA 4N03A 3P2MA 4DLZA 1DUIA 4CF3A 2QX9A 3OX2A 4QYMA 4BMZA 1KK2A 3O4HA 2YJ5A 4PGHA 4HXGA 4Z5XA 1P7WA 5BYAA 4KH1A 2NUBA 3CUUA 5DI3B 4PC6A 4DBVO 4RV5A 1K1EA 1LXCA 2A35A 5AKYA 4GP6A 2V9PA 1ABEA 1C7ZA 2A1TR 2Z43A 1KU0A 1RKXA 1XRQA 2J3LA 1R6VA 4YV0A 1KQ3A 2VHYA 1CY8A 1QP4A 3QKRB 3WGKA 2SKCA 1JHRA 4F6LA 4TROA 1NMXA 1YZKA 1EX7A 2DUNA 3V7FA 3OJLA 5CHEA 1NVGA 4DCTA 2JRCA 2DKNA 1D6NA 3AHIA 2B34A 2YWJA 5BRAA 4LYHA 2PH5A 1JECA 1E0KA 3O47A 1CX9B 4J1TC 1FMFA 3H4TA 5BRNA 4G8BA 4EA7A 4ZYXA 1CLUA 2JCGA 3OPMA 2C3OA 4H1WA 4HN9A 3KTAB 1GM5A 2HN9A 4RNCA 3TTSA 3WK4A 4E5VA 3ABOB 3EF1A 2F8TA 4IUDS 4DY6A 4LA4A 4ZT7A 3UANA 1OMOA 3JAKB 3ZXUB 4YCNA 1ZO8A 2OM2A 1XZAA 3LBHA 5BNIA 5M2QA 1G2OA 4J1TA 1FDSA 1TTQB 1ZGGA 1UQTA 2Q2QA 2FFRA 4HAWA 1YUNA 2JJQA 4WGGA 3B1XA 4Z7QB 2COUA 1C4XA 2VJNA 2XPCA 1SEVA 3FFXA 3I1IA 3N3AC 4AP5A 3T0GA 2MSEB 4OU5A 4CTNA 2IP1A 4HFMA 5J1SB 1JR2A 4HB2A 1UZMA 1APBA 3D3WA 3N0WA 4H15A 4JSYA 5LWQA 4YECA 4HEJA 1TUEA 2ZSDA 5K8IA 1KSHA 3F67A 4FI3C 3CB4A 1RKVA 3WLFA 3B2NA 3W8DA 5D3ZA 4JP1A 3OY2A 3KR9A 4P4UA 1W47A 2G0AA 2PLNA 2PSDA 4NS4A 3UMJA 3EGXA 1JMYA 4Y6LA 3DLBA 4IFBA 3H6HA 3I32A 2BFBA 2HIMA 3NBZC 3VKUA 1VG8A 1ZITA 4DLWA 1R1DA 2VAVA 1Z25A 1KGSA 1MB0A 1WMEA 2XMDA 4J0JA 1GQSA 4Q3LA 3ZQKA 3HFSA 5EINA 2AS0A 1KVUA 1L7OA 1ML4A 2IPMA 1CUZA 4MI1A 3EUEA 3H9QA 4XYBA 1KH2A 2G6BA 3DKIA 1W44A 4I50F 3AY3A 1W6UA 3DOCA 2G63A 1QC5A 2REQA 1MDFA 2XJ4A 3WYCA 4DJEC 2C5HA 1N6HA 2YRFA 3EARA 3WL3A 3V1KA 5ECWA 4DMUB 1JEYB 4ZVTA 3OCJA 4B6OA 2PJUA 4O2BF 2BLNA 2LRHA 4NFYA 3RBZA 2X41A 3ABSB 2BBOA 2WG0A 4DADA 2ZB7A 3TLJA 1KAQA 1PR0A 3W3AD 4V2IA 4XPZA 4I4LA 5C0OE 2GJAA 3ZW8A 4X65B 4FKMA 2CYBA 5K1ZA 3TW0A 1DXQA 4HH0A 2OHHA 5JSFA 3QPWA 2D5CA 5E9JA 5IJAA 1OOEA 3DMYA 3BICA 3U31A 1UXOA 1WKBA 3B7WA 2CWDA 3M34A 4CNQA 2Y1KA 2X0FA 3I5MA 4Q7QA 3E18A 3JR3A 2FOLA 2M9MA 4BLSA 2HRBA 2Z09A 3KTDA 5LXTF 3AV0B 2GJ9A 5KYKA 1NW6A 1GFWA 2A0KA 3L0IB 2RGAA 3OO1A 3VR0A 5FPHA 5HHTA 3FBTA 1PX2A 1GPAA 3A9VA 3W1WA 4OB6A 3VPFA 3EGOA 2CL7X 3L02A 1JKFA 1DFHA 1HDYA 2ZIXB 2R5NA 4QYTA 3LBYA 3EPRA 1E6EA 1JJBA 4UZEA 3OPVA 1YOVA 5B36A 4OXYA 3ECCA 1JFFA 1HEYA 1NXPA 4RY2A 2I3AA 4PRZA 3NTVA 1DC3A 4MQEB 2CV1A 2OBXA 2B6NA 2PKQP 4MUAA 2P62A 4CMIA 5AXAA 3VKWA 5SV2A 3OM1A 2C5EA 1K2VN 2KPOA 4KKVA 2DKOA 2HHCA 4JU9A 2QE7A 3FMVA 4JXZA 4CKWB 3U44B 4I55F 1SC9A 1XDBA 2LP4Y 3E1GA 1Y37A 2VRNA 1FF9A 4ZCQA 1JKIA 3THYB 1NXWA 4IKEA 1OBFO 1IDOA 4O29A 5TRTA 1B7GO 2IVZA 3EVFA 4FR2A 5CM2Z 3WFJA 1AIPA 1E4EB 3S70A 1BQ3A 1ZMOA 1F17A 5AJHA 4EHDA 4CLXA 2Y71A 2CVFA 1UKYA 3U3JA 3GXBA 3H0EA 4CR8A 5CFLA 1DCKA 4FNAA 5J5AA 1JDZA 1XMQB 3AFIA 5AKEA 4K81B 4O5AA 2IBSA 1PN3A 1Z39A 4I5FA 4YBRA 3WR5A 5BWNA 3LG2A 4Z7OB 2AFHE 2L17A 2O57A 1TL7C 2MIIA 1UZAA 4PX3A 3E22A 4RFSA 1I3KA 1P60A 2OUKA 4MUHA 1ZC3A 4MTLA 5AXDA 2IHYA 1MGOA 3SEZA 1HYHA 5L9AA 4XYMA 1BVHA 1KETA 1QCDA 3L1UA 3UUGA 4NKRA 3R9IA 3HA3A 1S89A 2YH2A 1IQ0A 3MFYA 5H16A 1Z83A 1F8UA 1MIHA 1XCJA 1G8HA 4I3HA 4LRUA 3A6HA 2XVZA 5HZKA 4O3MA 1VJDA 2JFQA 5EKSA 1A9SA 1B0UA 2WA2A 3C7CB 4LW8A 4PCLA 3JSXA 3CUYA 1HXHA 3NV7A 4BU0A 3B1JA 4FFLA 1AKTA 1Z0KA 2RDMA 1VI2A 3DUFA 3G0CA 4ND5A 2C95A 4IIYA 4YI5A 3GLQA 3KOUA 4ZICA 3PEVA 1U0RA 4D80A 3I42A 4GM0A 2PX3A 4B3JA 4IOKA 2N1BA 1OY1A 2CNOA 1PYGA 1AUQA 1FXWA 1VIMA 2P2SA 3J81k 4IIGA 4HPXB 5EAIA 1H3NA 3B1FA 3UK6A 5AM1A 2IOYA 4MYRA 5DYIA 4JAVC 1LI5A 4GLFA 1SELA 1ITZA 2HFJA 2JGAA 1MQSA 2VNHA 1KAHA 2VKQA 3MT0A 1WY7A 3P2KA 3Q87B 3RYIA 4DG9A 2BBSA 2BHLA 2W7TA 2XMBA 3K9NA 5EIHA 3NTOA 3IUSA 4LHSA 5IVDA 3LRPA 3HP7A 5C7LO 2PWYA 3QBVA 3JQEA 4PZAA 5AW9A 4JJ7A 4E1VA 4BEWA 1K9SA 2C8VA 4YCMA 2F1IA 1U8EA 1Y3AA 1QE5A 1FP4A 1JEAA 4IHJB 4PQGA 3KKEA 4ZAYA 1B8NA 2HRCA 3CW9A 3IJEB 2B21A 4OBBA 4KFSA 3G89A 5KC9A 3GEMA 4BB9A 2BL4A 1MO4A 1Z75A 3K0BA 3NRCA 1AQJA 3FNBA 3SBEA 2J6BA 5CDYA 4RVDA 1STOA 1TAUA 1R50A 2EP8A 1QGYA 1QHGA 2EGGA 1KMNA 1YZUA 3FIUA 4X3OA 5F9FA 1DOZA 3FUTA 2XUHA 1YL7A 1DAOA 4ARVA 1XA0A 2A9OA 1JEOA 3Q2IA 2YMQA 3D3NA 3QOWA 4FCWA 1Z08A 4KAFA 4LYJA 1V7CA 4X1YA 3TGPA 3CVVA 4R2KA 4XRRA 4DCMA 4DDUA 3KEMA 2ZITA 4B6GA 4M99A 5EE3A 1OZHA 1Z0IA 3QVXA 3ZZMA 3QX8A 5AXBA 5IN4A 1X13A 4JDPA 1Y5LA 3OLQA 1NOKA 5ALJA 4Z9AA 2NXEA 3AHEA 3QUTA 3QU9A 4HRYA 4IIHA 5H81A 3DV0A 1FJ2A 3USZA 4CFZA 4LNAA 4KQJA 1GLNA 1FQOA 4UEOA 3LE8A 3KPUA 4MCIA 4D9GA 1UM8A 1YHYA 3LKVA 3D8UA 4CPDA 2UXDB 2R7NA 3MTIA 1JG3A 2H4HA 1H3FA 3PP8A 2BUBA 3H11B 3MWEB 2FFJA 4B3BA 4GKKB 1L6IA 2RK4A 1PDOA 3NU1A 1IBLB 2XT6A 3M81A 2Z8XA 1QH8B 4WNCA 3NC1C 5F4ZA 5A4FS 3B6MA 5DNWA 1W2WB 3SDBA 1NW7A 3R5SA 5SY6A 4H0NA 3F6SA 4JYZA 1UWVA 5AOCA 1TIPA 2GK6A 4FMCB 5D86A 4XDHA 1XXHE 2WNHA 4JUFA 3WWZA 3H7IA 2DMRA 3PC6A 4YMSA 5FOVA 4M4SA 2ZIUB 3SJUA 2PUAA 2GO7A 1LVUA 5D7BA 3ADBA 1AQNA 5JI3E 1TFUA 1Q3TA 3WTBA 1E79D 4KHZA 1C9KA 5DHSA 1DRKA 3I1YA 3NEJA 4OB8A 2AQIA 4U9HS 4CUJA 2DLCX 3O90A 2XCIA 2Z6QA 3HY6A 1EFHA 3BRQA 1R9JA 2PR2A 3G13A 4G41A 1W30A 1QRUA 3PHGA 4C3UA 2D4AA 4MUJA 3HUFA 3GEHA 3ZHUA 5EZSA 2ZIAA 4CBVA 2L42A 4ML3A 2Q21A 3MN1A 4MGEA 3FNEA 3K9BA 4RANA 4F71A 1HRDA 4JT9A 3S0JA 2REXB 2HHAA 4E5SA 2WBLC 3ST7A 3NFYA 4DGQA 1HZJA 3IOYA 2WI8A 1DG1G 1G8YA 1X77A 3HHEA 3RT7A 4CGYA 5KOHB 2A67A 4LMPA 2V5AA 5LCXA 3MRVA 1T3HA 2YBDA 3HRIA 3W3AA 3ZTYA 4Z0NA 3RUCA 2ONKA 1YJCA 2Q1WA 4MW5A 5DI3A 3C8MA 2OXEA 4BO0A 4MR9B 2H1SA 4KR9A 1NJFA 2JS7A 3I3SR 1BWQA 3CX6A 3PKZA 3ZX4A 4B3IA 3BFXA 3EIXA 1R88A 2CF6A 2QRHA 1DJQA 3HU2A 1YSCA 3KKZA 4HUQB 3SC4A 3V4SA 4E1BA 1Z37A 2QD4A 1BGXT 2PO5A 5FBLB 3UQYS 2A57A 1V7ZA 3QKRA 4V0RA 1W73A 2PT6A 4IS2A 4CQNA 3CRW1 1IHPA 1CETA 4XM2A 4KITB 1C9DB 2WIKA 3NAZA 1Y7LA 1UC8A 1MAWA 2EKBA 3C39A 2PSJA 5DPMA 4YHHB 1EX1A 1I24A 3HP4A 4KXMA 3TEFA 3EOZA 1FDIA 1HNNA 4FE7A 1OFGA 3OZXA 3UJBA 1DKPA 5IDQA 1OFHA 2AXQA 3KTAA 1O97D 2QP3A 3QMVA 4BB0A 1BW9B 3QQ5A 2ZJOA 3AG6A 4QLBA 3SQNA 1A5ZA 2QU8A 3B53X 7ADHA 1ST3A 4XCVA 3JAKA 1KYIA 2Z0MA 1KYVA 1BXZA 4G23A 4H6XA 2LIPA 2E4UA 2W2QA 4L4SA 1X8KA 1SVWA 4LJ5A 4Q4HB 1NASA 3R7NA 4AJNA 4DQDA 1VBMA 1CUWA 3FOEC 4B3HA 1CKEA 2YTZA 1L5SA 1HQCA 3JWJA 2IYNA 1T8PA 2AZ4A 1WOMA 2HJGA 2YIDA 1ESZA 1KDRA 4C6TA 1KEZA 2X3UA 3EH2A 1D6MA 4HATA 3UB2A 5BQ3A 1AZWA 2G4VA 5BR1A 2O2IA 2VWPA 3NBYC 3TG2A 1GCIA 1F6WA 3AYZB 3LKBA 1IG3A 2JCXA 5LZ7A 1QMPA 3P2IA 1ETUA 4G0UA 2VHJA 1LEHA 1Y89A 1OHHD 2X9VA 2X77A 3TM5A 1J2YA 1EFPB 3DHEA 1N1EA 3ZZNA 4CODB 4DMFA 5H02A 5JNTA 2D3WA 2DBQA 3BXOA 5TGZA 3TRKA 1Q19A 2N9UA 4JVLA 5EL0A 2CLFB 4BWVA 1RC0A 2WF6A 1NTRA 5DTJA 5LP6B 3AUSA 1NWCA 1UBGA 1RVDA 2Z9DA 2FE4A 2OUIA 1XVLA 3K9LA 3EQ9A 2CXNA 2AOTB 3H1FA 3PCXA 4H77A 4TN1A 1P39A 3ILVA 1MOZA 1JI3A 3O8DA 1W75A 4XSGA 2H11A 4PZCA 3RABA 4X24A 3DWFA 2BGMA 3MK31 5G0TA 2PU7A 2OHOA 1E61A 1JEYA 1WMAA 4L72A 3WJ2A 1S8OA 1L7RA 3E8MA 3DCJA 3G8CA 4S12A 1GQOA 1UJ4A 5EKTA 3MTGA 1FFXB 2E89A 3LVRE 1T9BA 4J1SA 2BYTA 4YT5A 2Q5CA 2VK2A 3PUWA 3JQQA 4DA7A 3PSHA 3S1AB 2JZCA 1VIDA 3E9YA 1N6NA 5KC8A 1P2DA 4WDQA 4L4ZA 2NXCA 2PSFA 3AKCA 4U7FA 3CG0A 1JHMA 2QRUA 1BWRA 1PZNA 4CCYB 3CZMA 3K1TA 4ARAA 2HK7A 3BDVA 4L0MA 3Q9NA 2C4NA 5B3JC 5H5JA 1JG1A 821PA 2Z5FA 3DXYA 1OIWA 5LQRA 3RS3A 1JA0A 4IRXA 2BEKA 2QN8A 2WJZB 1G3QA 3E9EA 3RSZA 2OQIA 3V2HA 2ZIXA 3N75A 3PNPA 3P0IA 5DTMA 1KAOA 1LLDA 3F6YA 3MLAA 4ND4A 2ZYVX 3AXTA 4AZTA 3ER9A 2UVDA 4QQFA 1C9EA 4BO4A 1TU3A 2WWFA 3MLEA 1Q0RA 1QVVA 3B1WA 3UWOA 1GPNA 2ZRIA 1RP7A 3AI1A 4HDKB 2QBYB 1H2WA 5IT4A 4MQEA 2AGVA 1GA4A 3BK7A 2EZTA 3ZBPA 4UTPA 1NJ6A 1W4CA 2ZSHA 2P2GA 4N3AA 3PIDA 3U4GA 5EXSA 3O8QA 4CKWA 3UQZA 1XZNA 3ORRA 5LYJB 2FP4B 4MW6A 1QO7A 2V3WA 3B7PA 3BE5A 3TTTA 5GZ1A 3THYA 3O84A 2JBAA 1VSTA 3A6JA 2EV9A 1E4EA 2OHFA 1L4FA 1E1QD 1TPZA 2H1LA 3G23A 4QO7A 4UARA 4QNMA 3PTZA 3KC2A 1NR1A 4FYHA 3LU1A 1EZ4A 1NKSA 3FB4A 4MLZA 4O4IB 4U63A 5CT5A 5FTNA 5J63A 2O0LA 2BGKA 2WWGA 5K8LA 1B3RA 1TM3E 1TA0A 2YCBA 4PGFA 1PFVA 4CEJB 3UXYA 3BVPA 3D4IA 4C0LA 4ZT4A 2PSSA 3ZGNA 4Q16A 3D8RA 1I6KA 3IP6A 3N39C 4P4TA 3OZGA 4UD6A 3R7WA 2WZCA 3AJAA 1SG6A 4MW2A 5BVGB 5KYXB 1LW6E 5BYJA 1CZHA 1OYYA 5HK8A 3W5SA 5B3LA 1H6BA 2Q5HA 1SD1A 3K0FB 4GC9A 1S8NA 4X6YA 5DZSA 4G0WA 4E14A 2CNWA 4LXIA 3JALA 4PRKA 1E79A 5AM0A 3R5TA 3QYJA 4G8DA 4K9SA 1WG8A 3ZV7A 1CY7A 4YK7A 3RO7A 1XROA 4WNAA 1D0SA 1P6UA 5EVCA 4PYKA 5ADVA 5ALEA 3GRUA 4KDFA 1AHNA 1K2WA 3ZDZB 2HA0A 1SPBS 4PFSA 4URUR 2IDKA 4Y9DA 3NTLA 1P45A 2IF2A 3GARA 5NULA 2ZM5A 4ZEWA 1VPWA 4M7RA 5L53A 2NVBA 3OM0A 3BWMA 4MQLA 1N75A 4CG3A 5FBKA 3G2JA 4W63A 4KTVE 2QRGA 1MOQA 4H1VA 5DLYA 1J21A 2HWUA 3GDFA 3RS5A 4BNTA 4BLWA 4KWHA 3L5KA 1A76A 1ZD1A 3BWVA 4GICA 4RACA 3TMKA 1UEJA 3ZBTA 1FZTA 4L9SA 5LQNA 1QVZA 3COZA 3HDJA 4J0GA 3K0SA 2EKPA 3DP9A 1TCAA 3VC1A 1GGMA 3P26A 2YHUA 2DFLA 1L5FA 2FEWB 2IYAA 2CNNA 2PKCA 3TW4A 4G0OA 1H6DA 2H57A 1BWPA 2F17A 3HJTA 3AL3A 3ZCXA 1RE0A 3MCVA 4MICA 4UFOA 4PRLA 4IHJA 1GRVA 1R6BX 1AK1A 2H7CA 3H2HA 4JROA 2ZOSA 4NZZA 1NBHA 1MV8A 4RQTA 5L51A 3BMQB 5A3VA 4FFDA 1P3DA 4YYZA 2ZIZA 3E9ZA 1AK9A 3BB3A 5GV7A 3D2CA 3NLLA 5FI0B 1ODTC 2P9YA 2EWMA 3FUVA 4P5EA 2I6FA 5KPJA 4WK0B 3V7YA 3QWIA 4GPEA 4AK9A 3OKAA 2Z83A 4Z4FA 5M29A 5JPDA 5IYZF 1T4MA 3IAEA 5TS2A 4BC1A 4EF5A 1I7DA 2KB0A 4JQOA 1P75A 4NU0A 2EBHX 2OOKA 5C37A 5F9HA 2OLEA 4Q7JB 1QIHA 3B82A 2DC1A 4XI9A 3TX2A 1GSIA 4DSAA 3Q5EA 1SC3A 1YGYA 1RI2A 5BQFA 3E58A 1XD2B 2A9QA 4C7OB 4NV1A 1BX1A 2GZDA 5AUNB 5K8VA 1G19A 4Q19A 2ACKA 2V98A 4ZYUA 2YUIA 3H11A 3MWEA 2UKDA 1Y1KE 3V8NA 1ZA2A 3DPUA 4WFQA 2DPGA 3F6CA 4KQIA 4FS3A 4KRGA 2EAUA 3WGGA 5LP6F 1QH8A 3ZVNA 5FFFA 1KARA 4AJOA 1BO6A 4FEGA 4NK4A 1L5YA 4QOJA 5DASA 5IUJC 3RUPA 1WCXA 3V33A 5GV8A 2ZXUA 3SDZA 4NX2A 1DO2A 1R0SA 5M7EA 2MYNA 4DQ0A 1CP3A 2GXSA 4OQPA 3NTQA 2AYYA 2WVGA 4U2DA 2OYCA 4LOIA 5H80A 1OHHA 5JIBA 4DLAA 4OHOA 4PC3A 1XL0A 1Z2DA 3P7MA 3GN2A 4QAQA 4HFRA 4QECA 3ZJ5A 4N1AA 3MGGA 3KQPA 1JFSA 1HUQA 2VXBA 3HBAA 1UFOA 3PWTA 3C5HA 2IV2X 4KN8A 4J1QA 4B3FX 3O31A 3PT9A 3C6XA 3W2TA 3G0IA 5M3BA 4ECEA 1H2FA 1SPXA 2X4LA 3BSWA 2UVPB 4KMSA 3KVNA 1U6IA 3L4JA 2JGNA 3JATB 4FONA 1Q6ZA 2H31A 4GE0A 1I4OA 1ZRHA 4FC7A 5GM2A 6ABPA 4DJAA 2CLDX 2CD7A 4HLCA 4HDRB 5KOHA 1QORA 2IYWA 3DONA 2FXVA 4RIEA 4AXBA 4BZXA 4KYTA 3LOPA 4O02B 3V4LA 3O91A 3VHRA 1JXOA 2BISA 3MB8A 3VYVA 1XJ5A 4MR9A 1H9BA 1K5PA 3C3BA 3UAOA 4ZZ0A 2GEVA 1NM5A 4S1WA 2G04A 4HUQA 4V03A 4AO7A 1RT9A 4DLRA 1OZFA 3MT7A 2OYRA 3OBIA 4Y6SA 2Y05A 1DO0A 2XYRA 1G5IA 3JTEA 3TZQA 5KYNA 1DARA 3QLEA 4S2UA 2DYKA 1SZJG 1G3RA 4Y6OA 3C7DB 3DT8A 3MIZA 4OU4A 7YASA 3W5DA 1OAAA 3QHPA 3G7UA 2ZUUA 1MT3A 4ND3A 4FQ8A 4A0HA 3EZ6A 3WHIA 4QIHA 2N0SA 3D0RA 2DPMA 4X00A 1GNSA 3U5TA 5JDIA 2RSLA 5KEIA 4P6VF 1G7TA 3FTQA 3ROGA 3I39X 3PUJA 4YRKA 1ZMTA 1BW9A 3DZJA 1VCHA 2WYHA 3HKBB 5D87A 4BPBA 2ZTLA 4NAUA 1I9GA 1TW3A 4I5DA 4HLUC 1NBMA 4UMEA 4YRCA 5BYKA 1I6WA 4Q4HA 1BGVA 1NF2A 3TLEA 2HSJA 2V4UA 3Q85A 4GZ6A 2VTDA 3BUSA 3DQZA 2CXOA 4N39A 1AQ6A 1U2QA 2V7TA 1NLYA 2XQGA 1E98A 3PXBA 4OQLA 4DQLA 1VI5A 1E2IA 3H5WA 5JVDF 1E1QA 1A4XA 2R25B 4IF6A 3ZZUA 3ZOKA 1H1LB 1NXQA 4HLUA 4ZVRA 2QMOA 4DV7B 5B7QA 4LSGA 5EGNA 5IDWA 3CPEA 1PL8A 3BMCB 4UXIA 3V7WA 4FOLA 3AEKB 1KI4A 5CLJA 7ABPA 1SD5A 5LP6C 2MR5A 1C7QA 3DR3A 4LRTB 4HWPA 5CDSA 3VVCA 1EFPA 4B3XA 3V4OA 1RJEA 1CUUA 2AX4A 1GD1O 3A4TA 4YCLA 2PL9A 4HD8A 3AW9A 4MH0R 1XMJA 1QTNA 1N57A 1Z0SA 4B32A 5IAOA 4F5WA 3THOA 2GZ1A 4HTAA 3X44A 3NATA 3OSUA 3CX7A 5LP6A 1GPUA 4RMNA 1SUWA 3PWKA 4A2QA 4R0MA 4AJHA 2M1ZA 2A7QA 1B76A 5F1OA 2NVWA 2AOTA 2Q7DA 1CRLA 1AURA 3HO6A 3MZ0A 1A5TA 1MTZA 4L3OA 3GRVA 3ICVA 4YN3A 1MQAA 5CVCA 3EG5A 1SCBA 1Z5GA 4F72A 3H2YA 1IY9A 1MEEA 2NZVG 3TZ6A 2H65A 4ZT3A 1FFXA 3D3QA 1MO6A 4I4NA 1C14A 3AJ8A 2CFSA 1CR4A 4NJOA 4TS9A 4OL0A 1J2UA 3S1AA 3U6BA 4HNSA 3K20A 5FQNA 1ZJ6A 1AOXA 1U6KA 4NATA 1BH2A 5LLSA 5WRFA 2EDAA 3UK0A 4CCYA 5B6PA 3EZXA 4N7BA 3NO4A 5HILA 3JD2A 2ETVA 1EH5A 3QE0A 1SZCA 1P2UA 1KBOA 3SYTA 3IMCA 3LIIA 2AT1A 4TZKA 3CKKA 4C43A 3ADCA 3E81A 3A7DA 4TTPA 3P2YA 3R6LA 2J3HA 2VNSA 5JLJA 5IT0A 1RWMA 2A5JA 1TDJA 4RJ2A 1YU6A 3EFOB 3V4ZA 3RUEA 5JCXA 1JQEA 1X19A 1PQUA 2VNKA 3NBMA 2GN0A 2X9GA 3UTDA 3WMWA 4MVXA 4CR7A 1V8ZA 5AJZA 1V5WA 1KH1A 3X1KA 3GROA 1THGA 3GCWA 1W5EA 4HDKA 2QBYA 4Y2RA 4CGZA 2OESA 3ZGOA 4DQKA 4LXQA 1HGXA 4J7UA 3G85A 4XIYA 1F2UB 3ZUPA 4HMPA 1K5DA 1VL5A 3PRHA 4KBFA 3QIAA 5CEJA 1U0HC 2MSDB 4BNYA 1A9ZA 2XH8A 5JARA 2AR9A 3GLIB 1YUMA 3BWCA 2YHIB 2WICA 5TGTA 2F1KA 5LYJA 2FP4A 5AVWA 2I4NA 4MHSA 4R3WA 4EFMA 3GVHA 1KKMA 4NEGA 3NJ8A 4DIEA 2GLTA 1LSJA 2XXJA 3AF0A 3TAXA 3U9TA 4D2IA 2I2XB 2C5FA 1WXDA 5EXPA 1T1SA 3UK1A 3IAS1 1GL9B 4M9SA 4BQFA 2Q8QA 4LF4B 4OHPA 5A6SB 4ZMBA 2C9ZA 1VB5A 3P2EA 3JPYA 1L5OA 2BF4A 2OPBA 4OIMA 3RAJA 3RVNA 5A3QA 4TOIA 4GFDA 4CEJA 4BO8A 2PRZA 1BU8A 1KP3A 3G2QA 2GPTA 4TKLA 1NHGA 4CCAA 3HXQA 4C03A 3BH0A 1A9PA 3KQMA 1VLLA 1ZRSA 3RKRA 3VDQA 1EVLA 1VJGA 1X1TA 2B99A 3HSKA 4FHGA 4FJ0A 5BVGA 5KYXA 5AQ1A 5F2EA 2PRIA 1XZDA 3K0FA 4OGGA 3UG6A 4ZGGA 2HT1A 4JR2A 1RAIA 4NV3A 3W9YA 1XRJA 3SU8A 1Z45A 1K08A 2H0QA 3KOXA 4P8RA 3BN3A 3PUHA 4K9NA 3CPSA 4UUNA 4GPZA 4D44A 5K0TA 2I91A 1V26A 1SY7A 1RCTE 1GGFA 3PQ3A 5KJEA 4RYDA 4OQ4A 3V8QA 3AR7A 1I1OA 2IS2A 1GQQA 1NNI1 2AN1A 3IP7A 3C3WA 4JCOA 1E18A 1AC5A 2D2VA 4OFZA 1LK7A 4W5OA 3F1LA 4NG4A 4OXIA 1SHKA 2SBTA 4OGFA 4U5QA 4EWLA 1AS3A 1B6RA 2OG1A 2ZJBA 3BE8A 3N6XA 3EXFB 3PVCA 3MWLA 5ENDA 3DAFA 2WU4A 3ABQB 3WISA 1EYZA 2XTZA 3JWGA 1ULTA 3ZI0A 4K40A 5JBNA 3AR5A 1L5MA 1VQ1A 1KMQA 3EISA 2Q0XA 1U2DC 1YCDA 4DJ5X 1NDQA 4JHLA 1YC5A 4WH0A 1SXHA 2WWYA 4Z4IA 4H3SA 3FCYA 2G1AA 4EGJA 1Q92A 1NKVA 1E7YA 1PYOA 1OJLA 1T34A 3FMGA 4LQLA 1ZI8A 3F8SA 2P4SA 2QI9F 2ZRKA 4Z3DA 1YB4A 2WF8A 2BP7B 4CEHB 4CKEB 2IITA 4QHTA 4MWOA 5KKCA 1YJQA 3OCYA 1IG0A 3IDAA 4A1OA 3ML1A 3OX1A 1H5NA 1U2DA 2ORWA 2YV1A 1N1DA 2ZG6A 4WXHA 5T6MA 2AXNA 3MD9A 3OIGA 4EEKA 3I5UA 3A2KA 3BMQA 4YXFA 5L95A 1NJSA 3C5VA 4C30A 4RUKA 4CMBA 1SBZA 2VJLA 5JFOA 3B9PA 1HMYA 1WXXA 1A96A 1RM3A 3H9UA 2CHQA 2FPWA 2R5FA 5H1YA 5AVTA 5THXA 1SCDA 3JARB 3KQUA 4HQRA 3DM5A 1O6GA 3WBJA 1IQUA 1ICEA 3PQ8A 4G01B 4LC0A 1MO3A 2PS9A 1LVGA 3E2PA 1LWOA 1KK3A 2HWKA 2ZB8A 3GBSA 2DETA 5HDBB 3T4XA 1X3SA 3PHCA 2SECE 4XXHA 3UAXA 1Y4ZA 3ZWYA 1HT0A 3EDRA 3A9RA 1JIIA 4FK8A 4IKOA 1LV7A 5FOWA 2ZB3A 3GRKA 4Q9IA 5KO2A 4DCPA 4HEA6 4PICA 5JS2A 1XD2A 4LCBA 5SYNA 3T3GA 5JZVA 5KREA 4C7OA 4M60A 2CNLA 4MCJA 3OECA 3T7TA 1YI0A 4DG5A 5FPTA 2PMEA 1VPVA 1M6NA 4TQUS 1NXXA 5IXSA 1CB0A 1N2CB 2XMRA 4ZWNA 5ICFA 4FFSA 4EJ6A 3WB2A 3TUZC 3ZDAA 3PPWA 3IA7A 4CRWB 5CEFA 3BK1A 1XNHA 2FQXA 3N07A 5I9NA 4IFTA 2HM7A 3BORA 3CNOA 4JX9A 1ZKDA 1Q0LA 3HL4A 1UMDA 2ODTX 3VSAA 3TLGB 2XVMA 2QTNA 3FMOB 4CU2A 3A1WA 4B0OA 1HRKA 1GCGA 1AK2A 1GUBA 3BEDA 3I2GA 3JWHA 4Q7EA 5LOVB 1GG9A 2D7JA 4CG0A 4B45A 1XNGA 3UWSA 4NEQA 3FSEA 1F14A 3VZRA 2AA3A 4I3GA 2G1PA 1DPGA 2F3SA 4OSPA 3OTHA 1PD0A 1VDZA 2CMDA 4DCSA 5D5HA 1IMJA 4MVJH 4HWRA 3PX7A 3NETA 1M2KA 4P34A 1EM6A 4X20B 2OP0A 1E3TA 1Y1LA 5JMWA 4B8YA 4W82A 2OL4A 3OLVA 2OMEA 2CDNA 1NY6A 1A4RA 2XEDA 4IXNA 1X1QA 3RARA 1RXIA 1WZIA 4JBLA 1F51E 2UVPA 2PS0A 3FLBA 5ENVA 3WLMA 3JATA 1JLHA 1K68A 2CLSA 1MRSA 3QVMA 4JLMA 2IH4A 4NBRA 5BYBA 1P31A 1QCCA 3ZS8A 2BI4A 3DYVA 4HDRA 5HWSA 1WXIA 3SI7A 2UYGA 1SAYA 2LBPA 4BGIA 5J47A 4PZPA 1FLNA 3PNLA 2GPYA 1E9EA 4JBWA 2G5GX 4MAAA 2DFVA 1HT2E 3H2BA 4NQRA 4P3OA 4QVGA 2BGWA 2X0DA 2AC4A 2RKBA 5FJJA 4KREA 4ZVNA 3T5GA 2NG1A 3AR9A 3TI9A 3AL0C 1NOIA 2Q5JA 2RGUA 4O4LB 3WP1B 1RRMA 1FXSA 2IFTA 4ENWA 2EFHB 2IX3A 3TKYA 5C9ZA 3BIFA 3LOQA 4QFMA 2A0WA 3WSWA 3ROQA 2ONYA 4YRMA 1SC4A 5A0FA 2MYTA 2DT5A 3LO8A 3R8CA 2JBHA 3GJYA 1C41A 5DSTA 4DV3B 2WTBA 1GAEO 3WL5A 1E69A 3F6RA 4CDMA 3GAMA 1DT3A 4RO0A 1IEXA 4OJQA 4TQGA 1SXPA 2DHEA 1U1FA 2IBMA 4FMDF 5C32A 4KQGA 4KOEC 1PZGA 3BWXA 3LUKA 5HXAA 1ZD4A 2QUJA 2UYYA 3FZQA 3ONFA 2ZK7A 2PXCA 3PFGA 3P9QA 3V9PA 3IJPA 3RSFA 1DI0A 3FN4A 4WEQA 3ZD6A 3F73A 4LF6B 5KSPA 2NYUA 1VYTA 5E9WA 4TRMA 3PT5A 2PGIA 1LX6A 4AS2A 3A25A 3HKBA 4WSOA 4JQCA 3LMKA 1NR7A 2FQYA 1DDGA 2QN9A 2W8ZA 4L76A 3EIEA 4MA0A 5SYAA 4BFVA 2IS4A 1QLWA 1JL3A 2IXFA 3HVJA 5ER9A 4NOJA 3TX6A 5LKAA 3ZEIA 3ZYCA 3VR6H 2Q5EA 2H4XA 4JOQA 4LCEA 2F9MA 2R8RA 3LDHA 2I7DA 5KYGA 2A1IA 2NLOA 3P5SA 1FVHA 2RH5A 5C52B 3GLGB 5B55A 2A3RA 1LLQA 2DH5A 3EVGA 4HT3B 1H9CA 3BMCA 2HU2A 1GKKA 4JUCA 3TIXB 3AEKA 3EVBA 4PM4A 3B1YA 1DIAA 4F04A 1PFQA 2Z4RA 3GJXC 1J1ZA 4IGKA 1PK8A 3FNGA 4I4TB 3WLPA 3BRCA 3EDOA 4EMBA 2GRUA 3ELDA 3KYCB 3DEJA 3I2YX 3UCFA 3GLVA 3T8YA 2IZ5A 4RM3A 1T2VA 4YROA 3VSDA 3R1IA 1WRBA 4X8MA 3P19A 2D74A 2D7DA 2Y6UA 3WLLA 4DC9A 2A1UB 3WNZA 4RTLA 2KHZA 2A5FA 4D9IA 1J90A 3PJFA 5C3MA 4F6RB 1NNSA 1FSGA 3HEBA 5KS2A 3AIOA 1N7GA 4GZLA 3R4VA 4I4IA 1LF0A 1Q17A 5LMCA 1PT7A 2DSTA 2J6CA 2O3UA 1B23P 3M5DA 3WLAA 3A9SA 2QTCA 5FBHA 2QDXA 2XGGA 5CA1A 2HLPA 3NOQA 4HRVA 5D3KA 5FHRA 2QJRA 3TMAA 3HJNA 3PNSA 5C4MA 1XZBA 4FZRA 2OBBA 2SHKA 1EE2A 1YB6A 3VR3D 3E70C 3TNJA 3RVRA 5LZ8A 2WIJA 5FNVF 2FZLA 4MWSA 3T34A 1CE8B 1K7FB 4OAOA 3CVUA 1Q7BA 1PLKA 2AJBA 4RENA 3GZTB 4FB5A 2JLUA 3DHWC 5EI5A 5AT1A 3AIKA 4CDRA 4WEOA 1XMVA 1WV0A 2AOWA 4DSNA 3QVUA 3V46A 3GVIA 4MPRA 4K26A 4ZYWA 1ZK1A 2W00A 2W6ID 2YINC 1X80A 4JNKA 4BEJA 5ITWA 2QRKA 5SY9A 2YUTA 3EFOA 3PFNA 1ZX1A 2J9GA 2M98A 5AK3A 4L5YA 5GAJA 4X7BA 4RVUA 3IS3A 4FU0A 4M46A 3FCSB 1HORA 1MR3F 2VTVA 4U4AA 1CF9A 2BGTA 4W5HA 2VPWA 4RK4A 2AH5A 4UHFA 1EDOA 1F3LA 5CXUA 2YQ5A 2JFXA 4IDDA 1U0JA 1DIBA 3HN2A 3IXLA 1B43A 5FPSA 2Z08A 5B58T 5JD4A 3D3KA 1W35A 3N8KA 4MVJM 3TSOA 3L0DA 5BP7A 1ELOA 1F2UA 5HFJA 2WJGA 1U7OA 5CB0A 2AZXA 3OUTA 1G2PA 3ORSA 1CJVC 4KHPB 1IN6A 3C1TA 1PRYA 1FLAA 2QVCA 5A06A 1WR8A 1U4SA 5AVUA 2D59A 5AK0A 4C87A 3JQ9C 4QVIA 3IGFA 3GLIA 2YHIA 2X9NA 1UIRA 3L6CA 5J59A 4PNEA 1PUIA 5ALGA 1QYVA 2H3HA 2HA5A 2LXNA 1U0BB 3R7WB 1YDWA 2TSYB 4EVQA 4IIEA 2EWVA 5FTLA 4EUFA 4CM5A 1P74A 2JANA 1PI3A 4XFDA 4Z86A 4WI1A 4M1QA 3HDQA 3I6ZA 3GFRA 1CWUA 3JQ9A 1SKMA 1CRPA 1X3LA 1UMKA