2PRKA

Synchrotron x-ray data collection and restrained least-squares refinement of the crystal structure of proteinase k at 1.5 angstroms resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine proteinase
molecule keywords PROTEINASE K
publication title Synchrotron X-ray data collection and restrained least-squares refinement of the crystal structure of proteinase K at 1.5 A resolution.
pubmed doi rcsb
source organism Engyodontium album
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1987-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2prkA00
2SICE 4NE7A 1KDVA 1AVTA 4H6XA 4RYDA 1GA6A 1GNVA 3Q5GA 4LVNA 4DWWA 2ID8A 1BE6A 1ST3A 3GT4A 2X8JA 2SBTA 2GKOA 1AH2A 1SUPA 3VV3A 1DUIA 2W2NA 3VSBA 5ARBA 3SICE 4KB5A 2PYZA 3LPCA 4ZOQI 1WMDA 1UBNA 3DW1X 4CFYA 3D43A 3TI9A 5JMOA 3UNXA 1Y3BE 1NDQA 4H6WA 4C3UA 1SUAA 2W2OA 1CNMA 3DVRX 2HD4A 2DQKA 2DUJA 1SCBA 1THMA 5JXIA 4H6VA 3I34X 1R0RE 1SIOA 1C3LA 1CSEE 2Z30A 3DE5X 3DW3X 3WQBA 2ZWOA 4LVOA 3WIVA 1ZVJA 1BH6A 3VTAA 5FFNA 2X8JB 5K7SA 4AKTA 2Z2YA 2Z58A 3F7OA 5AVKA 4CFZA 1SBCA 3PRKE 1WMEA 1SH7A 2IXTA 1S02A 1GTG1 3H42B 1TM5E 2PKCA 2XTJA 1P8JA 1SUBA 1SUCA 5FAXA 2IY9A 5B1DA 5ARDA 1BE8A 1AF4A 5AQEA 3LPDA 3BPSA 1WVMA 1Y33E 1C9MA 1YJCA 4DZTA 4OMCA 3T41A 1A2QA 4HX2A 1Y3FE 1PTKA 1Y48E 3I30X 1Y3DE 4GI3A 2WUWE 4YN3A 1WSDA 4KG7A 1R6VA 4FONA 3DVSX 1AU9A 3WHIA 3EDYA 1TO1E 2E1PA 4NE9A 1SCNE 5JXHA 2SNIE 3AJ8A 1MPTA 2W2QA 3GCWA 1AK9A 1OT5A 3TECE 1Y9ZA 3ZXXA 5AVJA 4NMXB 1LW6E 1T1IA 1KDYA 2P4EA 1P7VA 3DE1X 4ZARA 3VV2A 1JEAA 5JXJA 4K8RB 4WOCA 1KDZA 3BGOS 1V6CA 3HJRA 1EGQA 3DYBA 3EE6A 5ARCA 3EIFA 1TECE 2Z2ZA 3QFHA 1C9NA 1TM3E 3PTLA 3DE0X 4OV6B 3F7MA 1SBNE 1TK2A 1Y4AE 2QTWB 1SCJA 3DE7X 4HVLA 4I0WB 1TM7E 3I2YX 2ZWPA 1Y3CE 2B6NA 1AQNA 3CNQS 1SCDA 1XF1A 4WOBA 3DE3X 5JXGA 1V5IA 2ID4A 3DDZX 2PQ2A 1EA7A 1GT91 3WIUA 3GT3A 1PJ8A 3L1KA 3AJ9A 4M1ZA 1AV7A 2Z2XA 5B1EA 1HT3A 4KPGA 1MEEA 1BFKA 1SIBE 1SUEA 3LPAA 4B5LA 4CG0A 1GTL1 2PWBA 3CO0S 1IAVA 2ST1A 2WV7A 1Q5PA 2TECE 4JP8A 3OSZA 3QTLA 1NDUA 2G4VA 2V8BA 1T1GA 3VHQA 1S2NA 3SQOA 1TM4E 4MZDA 1Y1KE 1ZVKA 1TMGE 2W2MA 1YJAA 2PWAA 1SVNA 1OYOA 4AKSA 1TM1E 1SN7A 1PEKE 2W2PA 1SBHA 1ST2A 1IC6A 3D9QX 1Y34E 3I37X 1GTJ1 1BJRE 1YJBA 5FBZA 5CW1A 3DE6X 1YU6A 5SICE 1TO2E 1SBIA 3TI7A 1WMFA 1Y4DE 2WWTA 4J94A 3DE4X 3A3NA 1KE2A 3P5BA 3VYVA 4C3VA 2Z56A 3Q40A 1R64A 4DJ5X 3F49S 3DVQX 4OMDA 1GCIA 2WUVA 2DP4E 3ZXYA 2ZRQA 1OYVA 1GNSA 1GA1A 2PMWB 3QMPA 3GCXA 2SECE 5AMXA 3DE2X 3LXUX 1C9JA 3A3PA 5I9SA 1SIUA 3DWEX 1P7WA 1KE1A 1GA4A 3A3OA 2PRKA 1SPBS 1BFUA 1VSBA 1S01A 1T1EA 1DBIA 1NLUA 2Z57A 3BX1A 1SBTA 4Z2AA 3AFGA 2XRMA 4BWGA 1SELA 1SCAA 2HPZA 1SUDA 1PFGA
chains in the Genus database with same CATH superfamily
4MUFA 2GHRA 3Q1KA 3WXMA 3P2IA 1X1DA 3O4GA 3RS4A 2RAVA 4RE6A 4BNDB 3UUGA 2DLDA 4PV7A 1RI2A 4D5EA 4MVJI 3S29A 5C1DA 2VHEA 4C7KA 3H0EA 4GZ3A 2QL7A 3SJZA 3KP1A 5CYOA 3VYSB 1UDBA 1OU4A 4UNRA 4P0PB 4DSOA 1FX0B 4N54A 1SHTX 3B60A 4W8HA 2LZ0A 4M1EA 1AG9A 4O1HA 3M83A 3IUBA 4UEQA 1MOQA 4DA6A 4LRTB 4QGSA 3PXUA 2QTMA 1C0LA 5CD1A 2AJBA 3TSYA 1RZ3A 1RAAA 2H7VA 4NTZA 2EJTA 4XQGA 5ERYA 3WDMA 4UAGA 2ZR0A 1E5VA 1Q17A 1XVUA 3GFTA 4ZTUB 3MSXA 1HXHA 4KDRA 1U8CB 3E2PA 1RQXA 2QTNA 4ZANA 2G71A 4UOEA 1K8YB 2R6ZA 1VLZA 1VG0B 1Q3TA 4NHOA 1CJCA 1HDGO 4NMLA 5K3FA 1B23P 4DQUA 1Z37A 2OHJA 2WM8A 3DKIA 1FLNA 3P9XA 5HF9A 4MUYA 2VG8A 1VA4A 1K08A 1IEXA 1XZFA 3Q3GE 5CEEA 4EVRA 4IIVA 4NEHB 1FYFA 1UCFA 1UBNA 2PKEA 3BM5A 4HGRA 4Q34A 3TEJA 3W2GA 4BQFA 5AVVA 3HGQA 3D43A 5HTOA 3FHTA 1N1GA 1S3GA 2X9GA 4YIKA 3ZQ4A 5CB4B 3NOVA 3QWFA 4FFVA 3K8OE 3A6JA 2WHXA 3G0GA 4QQRA 1GPBA 1WLYA 4PBTA 2P4UA 1SJ9A 2YVKA 2PV0A 2AXNA 1JG1A 3ZCSA 2IWHA 4D9MA 1N2BA 1PIWA 3R5XA 3UOGA 4FGZA 4FS3A 2JFGA 1HTTA 2VDPB 3D8BA 5BN3A 3CZ4A 3P32A 3X43A 3EDOA 5CX1A 4CIVA 3NS7A 3U26A 1VXOA 4W99A 4G0YA 5HIMA 4EJ2A 1ETUA 2OGUA 1DT5A 2ON6A 4UBLA 3BMOB 3E05A 2Y4OA 2CJPA 3LCVB 1A9OA 1JPJA 3ZY3A 4MHOA 4IJWA 1GQ2A 5BWLA 3IUQA 2GNAA 4DTCA 1KP3A 2ZSIA 3H9QA 4PSAA 1C3EA 5A3SA 1Y9JA 4C6SA 1D2MA 4CTMA 5B2EA 3ZDBA 1TYAE 3T9BA 4HJXA 4B8YA 1W1WA 2A7QA 4R98A 3G2HA 1YL5A 1CETA 2IOYA 1SRQA 4XB2A 1EVYA 3L6BA 1SOVA 3A7DA 3GA7A 2ZRJA 3LQYA 3W8NA 4AO7A 5COAA 2MYTA 3OCJA 1YS4A 1AQIA 1XVAA 3ABQB 3R7AA 2PUEA 2VSOA 1X77A 1EM6A 3M2TA 3KWMA 3ZCUA 4DLTA 4DLSA 4ZQIA 3V7UA 1CUFA 3N2NA 3FDIA 1K06A 3B7WA 4LVOA 3U4HA 4ND2A 2VC2B 1QGDA 1T6NA 1XZJA 1XCOA 3JYLA 3C87A 3KHSA 1PJRA 3P2EA 4TMXA 1U3CA 5AKZA 5EE3A 5K0FA 5E4FA 2ACVA 4E07A 3OFKA 2CV1A 5H59A 2XNCA 1GV1A 4BX8A 3M70A 1PUXA 4GL4A 1CJUC 4LOIA 4WXMA 4IOMA 3CWCA 3Q6MA 2Q5JA 4M8LA 1H1LA 1O2DA 4JLMA 1UOQA 5JFOA 2FVXA 1PR4A 2CDCA 2JDID 4GZ5A 3DC7A 2O3UA 2HDOA 5K3FB 4CMBA 4YRIA 1W5SA 4LDJA 3O8OA 1QG4A 1LSSA 3RSSA 2HW8A 2Y0PA 4W63A 3VR4D 4JJ6A 4MIKA 1HYHA 2YTZA 1SHLA 1U3UA 4A91A 1AD2A 2JANA 4MR7A 1MG5A 2BHRA 4L4XA 2BCEA 3LK6A 4BIIA 1J00A 2GN8A 2IXAA 3JTMA 1LRLA 3ZDQA 1IXKA 2D3TA 2JIZA 3IQHX 2B9VA 1JH8A 1T2FA 1TYDE 2O23A 2BISA 2P41A 2JH8A 3QKUA 4CMIA 4MITA 3BGDA 2YWHA 4K03A 4NBSA 5FLYA 3IAM1 1HC7A 4QJ4A 4BMVA 4TMKA 3AF4A 2M6LA 1EBFA 5CNJA 5C5IA 1YJXA 3E3NA 1IBRA 3OEEA 4MTCA 2YV3A 3P8ZA 3CR8A 4P82A 1G1MA 1Z0AA 3PLRA 4G8DA 1Y0BA 5BN3B 3L4BA 3PNMA 5KREA 1AA6A 5CT8A 5CX1B 5LZ9A 4NULA 4M1TA 4M0MA 1NM5A 2XWSA 2WD7A 4HZIA 4NV1A 4YRBA 3GJXC 3ND7A 2QVGA 4WDQA 2J8ZA 2KYRA 3CIFA 1I0ZA 2ZB8A 1UFOA 5FJIA 4BYMA 1FDWA 4ND1A 3S68A 2YZKA 3VZQA 3FCSB 1QNFA 3I8XA 2JH3A 5T5QA 1DT3A 1XG5A 2FPWA 1QE0A 4ZEOA 3H2BA 1WXWA 2HQOA 2CBZA 4Q93A 5KYYB 1VE7A 5AR1A 1JWLA 5I7OA 2H2AA 2CBXA 1ZWKA 2X14A 3GP3A 3G0CA 3EISA 3LW7A 4WESA 5FPSA 1EFVB 3KBOA 3T3MB 2ACEA 4JI5B 3ZIAD 2FNAA 5GJWC 1M6HA 4N4AA 4OK3A 1A95A 4UU0A 2JJ8A 1GKKA 1XCGB 2F3UA 3IV9A 1DV1A 1X38A 2Z2KA 3CG0A 5F7ZA 3NTVA 3TLGA 4PGGA 1X7XA 2FV8A 4BIMA 5C1BA 3O2JA 1JR3E 1ZG3A 1Z74A 1PV4A 4NABA 4FR0A 2OSBA 2PXAA 2WF9A 4GUDA 5T3YA 3HVRA 3FLAA 1KRHA 2GARA 4GDMA 1DP4A 2NU7B 1USGA 2Q9CA 1DC6A 1JMKC 2F2TA 2GN4A 3AU8A 3QHPA 2NZJA 1RZRA 3GYGA 3D6HA 5DBHX 4HN9A 5JCOC 3VNRA 5KB3A 1N5DA 5L9AA 1H1LB 2HFJA 4LI0A 3U48A 3OOJA 2O8CA 5CYPA 1OT5A 3GR6A 1XPRA 5FI3A 1I3MA 5GJVC 3ZXXA 4CMJA 3EEOA 3TW0A 5LYJA 5IYZA 1PGNA 1IK6A 3O8OB 1O54A 4ZJPA 4G0XA 3PWTA 1PT5A 4GWLA 5JUWA 2E4VA 3H13A 3K5HA 4F9TA 4DLXA 4DIOA 5KSYA 1LLDA 4Q6WA 3UWOA 2AZDA 3DE1X 2PSSA 2ZWMA 3HBNA 4MR7B 2RONA 3D3WA 4GM1A 2G7ZA 1M9NA 1GZ7A 4LX0A 5A3QA 4PCUA 3ST7A 3KOOA 2H3HA 4YA6A 5KVAA 3N53A 4JI8B 1KOGA 2I4MA 2RGWA 1IZZA 4DJDC 2OTCA 3GBSA 4PIMA 3NM5A 1K89A 4N3CA 4CG2A 4ZVOA 3UWSA 1LZLA 4P2BA 1XD2A 2YRWA 3JYNA 3OPQA 3KK0A 5C52B 5K8VA 4QQ8A 3LDGA 3KWLA 2IVFA 2IXBA 3FMVA 3JQQA 2C78A 4WBNF 2WD7B 3CT6A 1TE2A 1LSJA 2W6PA 1JT2A 1QF7A 3U49A 1VRWA 1L4LA 3NIFB 1NXVA 4C4ZA 1L1QA 2QV7A 4BNZA 2ABWA 2P3LA 4J7CA 4OJMX 2RGEA 3UWKA 5HKAA 1QGZA 1NZFA 3F7MA 3GJZA 3LQKA 2H0QA 1ISGA 1Z28A 3MJDA 5FBVB 4DLUA 3OZ7A 3G02A 4XRGA 2C4MA 3ZGOA 2QRLA 4LHEA 3BZWA 3OCZA 4JGIA 3A27A 1IL0A 1DFIA 5EJGA 1NMYA 1CS4C 4WESB 4N03A 4P33A 3B9PA 1EDZA 3MWLA 4BATA 2GJKA 2JLVA 1Z0DA 2D3WA 4GVXA 4A2WA 1I4DD 4HQKA 5FUYA 1GGFA 3UT5A 1GRQA 2OOSA 4JP3A 4B80A 3QJGA 4K9LA 3LY7A 1TF2A 1Q57A 3QQ5A 5H3HA 2DERA 3T5AA 1PN3A 3WGNA 4RX1A 1DKPA 1SCDA 3H2YA 2X58A 3LCRA 2Q4TA 3DPIA 5AO9A 3RTDA 3HKCA 1HDZA 3TMKA 1CZHA 3EFEA 5IT9A 3K0FB 2ZULA 2BGKA 3GYBA 3LY9A 4MO9A 4RENA 1IM2A 3SSNA 1QPZA 3KD2A 3ZQJA 2G1KA 3PUKA 4KOAA 1WKCA 1VZ2A 1KQGA 4U9IS 5JXWA 4YP6A 4NCAA 1AUOA 3O84A 4LXQA 5CT6A 1TF5A 2O06A 1YDFA 2QP9X 5DBFA 5BSRA 3W6OA 3WIUA 4CMGA 4E14A 1OH7A 1Z4OA 4LTMA 2C9DA 1HMYA 1YVRA 3PT9A 4PRLA 4NV0A 5LYJB 1ADGA 1QVRA 3FKSA 4QTZA 4CF5A 2X3UA 4UKDA 2D0PB 4M55A 4PIPA 1F5SA 2ZSUA 1U2GC 3ROGA 1VLHA 4D80A 1BDJA 1FTWA 1M74A 3QKTA 3ZHVA 3VYRB 3UB4A 4RH0A 2XUOA 4YQFA 1B8OA 3HDYA 1LC0A 2OBYA 3A1FA 3D3WB 3IXLA 2PL9A 2PS9A 1NN3A 2V65A 2Q99A 1OZGA 2RGNC 4IINA 3K6SA 1A7KA 2CVHA 1XC7A 2WWIA 5EHQA 3VH4A 1IAVA 1IEWA 1J0DA 3HVHA 4BGDA 2FW7A 2ST1A 2V7WA 2X9VA 3DA8A 1G66A 5E9AA 5FTJA 3TOXA 3ABRB 2XCRB 3HJNA 4AVYA 3TL6A 1ZHFA 2Q4DA 3JQAD 1R0XA 1XD2B 5JALA 4GOMD 4JENA 5I9MA 4EHKA 1YH3A 5KI6A 4BGVA 3IUJA 3BSFA 4KSCA 4L74A 2DQZA 1DPFA 1MOSA 1QZ3A 4E2FA 4CKWA 1L5FA 1HFWA 2HADA 2FDRA 3PJRA 1Q3HA 2Z6QA 4DSNA 1D9XA 2ARKA 2R1ZA 3EMKA 2ZCUA 3KETA 2IIQA 3I5AA 2VHTA 1JIQA 3BHMA 4H0NA 4JIMA 4EKDA 1J21A 4A92A 4O4HB 5TJHA 3WGQA 1EB9A 1MKYA 4KQXA 1IULA 2HZBA 4IBOA 4KR6A 1MN6A 1DQNA 5DM0A 3MS2A 5D3QA 4FEAA 5L6MB 5KNCD 3AM4A 1TDJA 3DTVA 1ZC4A 3D2AA 3F6PA 1TMGE 3FA2A 5IWCA 3ZYCA 3IUNA 3T52A 4JI4B 4KDEA 3A6FA 4FGWA 4ZQGA 5U4XA 2VPZA 1IOWA 4AKSA 1FTQA 2R8OA 2G5PA 4CIXA 2EJWA 1Z34A 3R4CA 1UODA 2W2PA 3HKCB 2X19A 3ZZ1A 1IJBA 3TL3A 4E03A 4RNDB 4MCAA 1TU4A 4KE8A 3E3LA 4R84A 4Z8YA 4QYWA 5WRFA 4H08A 3WWOA 5HILA 5LLSA 1CJBA 4EP1A 3BXPA 5D7BA 4U9UA 1IC6A 4NH0A 1ISPA 2QN3A 4Q1AA 4B9EA 2J32A 1C8KA 2V03A 2V4MA 3IAFA 4CQMD 3OZFA 5DLQC 5LLTA 1ENYA 3AXSA 1XDDA 3ODPA 1J97A 1MXFA 2CXHA 2IHJA 3DHVA 1BRMA 4WY8A 5DHSA 4PPFA 2VPWA 1Z29A 5DYNA 3UV3A 4DC1A 1L4EA 2OZEA 2QRMA 3FM9A 1A8PA 4CR8A 2HV8A 2CK3A 2QOEA 2VNJA 1YIOA 5KTMA 1HRDA 2M1ZA 3ECCA 3M89A 4OHBA 3QVSA 4D4HA 1FTYA 2MMGA 4HLQB 5TX7A 2VNAA 4WLEA 4M0PA 3UMGA 5SICE 3ESYA 4YVFA 4YR7A 3ITDA 4WJZA 3JQRA 3A1SA 3FNGA 3U7QA 3K6SB 4EI2A 4YP0A 2N1BA 1C4OA 3CF0A 3L7DA 2EWVA 4MR8A 4RSHA 1G21E 1Y1QA 2Y1EA 1DAHA 4MVXA 3KOXA 4DR6B 3GLFE 3LVFO 1XN4A 5LNK1 1UQTA 2WBLC 3WKBA 1YSCA 1W5AA 3AXTA 4HHEA 4HYQA 1T3LA 2JFHA 3GPCA 3VR6A 3WK7A 2F3SA 3G0DA 1X14A 1U2EA 2PMDA 3TIIA 1OHHA 1UP7A 1I4TD 3OKCA 2AN4A 2OORA 4NQZA 4P7FA 4EY8A 2J09A 4DCSA 2ICAA 3I4LA 5LZ2A 1RPAA 4ACAA 1SHZA 3EZ7A 1PDVA 5H9VA 1GCIA 1NPDA 2H51A 3HSKA 1NMEA 2WDPA 5BURA 7ADHA 3HXOA 1JNYA 1E69A 4DRXB 2VVTA 2W42A 4J16A 1MC1A 2CVFA 2PMCA 4O08A 4WY5A 1M33A 2IUFA 4DIEA 3HZRA 5HUHA 4YNBA 4QDOA 3UJ6A 1KQ3A 2HB6A 3DTVB 3H97A 2IOFK 5PGMA 4EG0A 4ZCIA 3EGWA 3WZLA 1PYDA 1PGOA 1PEYA 3AINA 4WMLA 4M22A 2Y1GA 2I6XA 5K3DA 1FS6A 4YRRA 4DMCA 2IYVA 3NJ8A 3B3AA 3DLBA 5DN9A 4LXYA 4Q9DA 4GOND 1FDOA 4RAOA 4WACA 5FOWA 4YEDA 2A1TS 3ICPA 4FYXA 4KW7A 3VMMA 4EGJA 2OB1A 5AFSA 4IPTA 1SM4A 4I2NA 5JNSA 4RS3A 4KAAA 1Y42X 4EJSA 6LDHA 3OQHA 4OJQA 3ZWVA 4TVSA 1DQSA 4QU9A 1Z82A 3U40A 2X0IA 5HCNA 4NQRA 2DBVO 3BBPA 3ZW9A 5EJ8A 4YCSA 2C8VA 5EL0A 1XZNA 2XTNA 4GI1A 1S8OA 2AFIE 4J4BA 5CVVA 3TPZA 4OFZA 4ZYLA 1BCRA 3GP5A 3BIXA 3AI2A 1KR2A 3OM9A 4IO1A 1H85A 4NF2A 4RAQA 1SPBS 2DY0A 3HZOA 3EIUA 5E2AA 3V1YA 4BN5A 1EHYA 2VK4A 3KAKA 1DBIA 1GAWA 2BD0A 3G2KA 4DLZA 4DZRA 3KZ1E 3LYHA 4ZJZA 4MGEA 3IKLA 3KKZA 3HXKA 4WXYB 3WMGA 1H0KA 5BXQC 1YQXA 2AMJA 4UOZA 3O1JC 4EI9A 4YMLA 5DH9A 1BEEA 2AG0A 3G17A 2AYXA 4XJXA 1VFPA 1RJEA 1E9BA 2ZRFA 3ZZMA 2V3WA 2RIPA 2Z2IA 3D7RA 4MR8B 1HLFA 4FQ8A 2QR5A 3QTBA 3QUQA 5C1IA 1MRZA 3ANTA 3KJGA 4E11A 2L17A 1Z8HA 3DMDA 1NYTA 2V0GA 1Z0FA 1ZA2A 3COWA 1NIPA 1BCSA 3NCHA 1C1YA 4CF7A 4C0SA 2X3YA 1Z88A 3NEYA 4JY7A 1XTQA 3IAS1 1HV8A 1R4NA 1N8NA 4LDNA 1YE8A 4X90A 1GA6A 1UKZA 1HWYA 1RYHA 3HDTA 4TRJA 5BYJA 5FTMA 1Z2NX 2J1LA 1K5PA 5ER6A 5F1YA 3V1TC 3UHJA 2CCGA 4R1UA 1CB7A 3WIBA 3BD8A 1RFLA 3AUXA 3G0IA 4DE5A 2XVYA 4BNHA 1SULA 1W44A 4E5UA 1DC3A 1NUTA 2V7QA 2ZIZA 5AHRA 3KFLA 2Q3HA 3QBTA 5AI0A 5AJHA 4DREA 4DDUA 5GTDA 4C21A 3VZPA 1RDFA 3LX8A 4HX5A 4X94A 2GFHA 4L5AA 5G2OA 1WXDA 4IH1A 2GX6A 1DEHA 2C4VA 3FFAA 1V39A 3LLVA 1NUAA 4ZMBA 1Z0KA 4FCVA 1OXXK 3CUYA 4FX5A 4C88A 4CHTA 3IJ5A 1S2GA 3CZ5A 5ECYA 3T38A 4FZJA 4TTQA 1JMVA 3LHFA 1IBSA 1U8EA 2CYBA 2EJCA 3KKEA 2CYCA 4MUXA 1FJGB 1R8QA 1USUA 3E5HA 4V0OA 1AURA 2VP2A 3U13A 4EJSB 5CRIA 2WFLB 2XIJA 1GNTA 1JV2B 1F60A 2BMFA 2GD2A 2V7VA 3JPYA 4H3VA 4DIFA 4AAYA 3AVQA 3L1UA 5IN5A 3EWAA 3VH1A 3C14C 5KUTA 3EUFA 2ECFA 3OF2A 4EQZA 3CVXA 2OAGA 3F3KA 3MT0A 5FLEX 3TLJA 3FJYA 3C7CB 1XJCA 1ZZGA 1BCRB 4OXKA 4ENVA 1JHOA 4R2LA 4MUEA 2C5LA 3EXG1 2ZQ5A 1KFCB 1LNSA 4WAUA 5CHEA 2PX8A 1OX5A 2Q4EA 1BU8A 3WLKX 4HDRB 3SP1A 1ZUNA 3CCFA 3UGQA 4CTOA 2JNWA 5EJ7A 4N9WA 5F3DA 2P2SA 1UKCA 2DKFA 3H1EA 1PUIA 5D5HA 1ZHOA 1A8QA 3LGAA 3ZH2A 3Q7QA 4QASA 1YZGA 3TD6A 3W4KA 4TTPA 4QOIA 3VU8A 5EVJA 1ZM9A 1F48A 1BCSB 5HIAA 3U7EB 1IPFA 2GEJA 5IC5A 3WSVA 4M7OA 5BRNA 3GN2A 2GEKA 3ZV6A 1PL7A 3F67A 4H3SA 1T8SA 5CXQA 4IZIA 1XRMA 5AOAA 1WDLA 3BXFA 4N0QA 2XNDD 3SEQA 5LKRA 5EXSA 3U4MA 3F74A 4KWIA 2GVNA 3U1VA 5J9FA 16PKA 2SKDA 4RQAA 4NL4H 4XDHA 3V8NA 3U6BA 1HLDA 2IPNA 4Z9FA 1EXMA 5I8PA 5EPEA 2YYSA 3NIBA 3RLIA 2G0TA 3LHDA 4RH1A 5BSTA 2KW5A 3VU1A 2P75A 4XQ9A 4ECEA 2ZM5A 5CIWA 3AW9A 3AZPA 2A88A 3I0NA 3CVWA 5JSKA 3G9QA 4PTZA 1TMOA 4LRWA 4UQOA 1UEJA 1WZCA 2P11A 4EL0A 3AONB 2VHQA 1QR6A 4KJXA 1YCDA 2J9ZB 3O1IC 2QMEA 3CEAA 3IQDB 3LL7A 3DEAA 1K9VF 2KMLA 3OIFA 1Z13A 2WYIA 4FEEA 5FAXA 1Z6QA 3OLCX 4HN4B 1PW7A 4JL8A 3OE4A 4Y9TA 3V33A 1KH2A 5AJTA 5FO0A 4RPGA 1R8SA 1ECPA 1U6KA 3AWDA 4J0JA 4CG3A 4TV9F 4BO7A 4NFHA 3ACDA 4PLGA 5AJZA 5LR6A 1JQ5A 4B4OA 1U5BA 3KLOA 4D4MA 2J0VA 2XB9A 1QHIA 2HO5A 5CFZA 1VE3A 3F98A 3OJOA 4MGKR 5IM5A 4BUCA 4IIXA 1BXRB 5IKOA 4H7HA 4B48A 2A4MA 3LWDA 4G01B 5A7GA 4D8YA 3GFSA 3IQIX 1JU4A 2H7YA 2GM9A 3ONFA 4WK6A 4YYZA 5LP6A 3BYZA 3T41A 1HTBA 2O3QA 2NXCA 1PGPA 2WJVA 5CTJA 1BVHA 4LZNA 2WOOA 3P94A 1ZUNB 3EEBA 4AO6A 2YV5A 3OBBA 1KVRA 1BA3A 2VUIB 3AUAA 4M9ZA 3NPAA 4V0RA 1LPOA 3IRVA 1MOZA 2WHYA 1O8CA 3QUSA 2NYRA 1I1NA 3QVMA 4NZYA 3REQB 3GLGE 1EUCA 2ZIGA 3O7WA 5D86A 5I7FA 2IHNA 3FPEA 3ADPA 3OZBA 4FB5A 1XXLA 4JKIA 4L5IA 5GPBA 4AQDA 1DX9A 2POQX 3C5WP 3MQ2A 3E82A 4ZO7A 1JLHA 2QAIA 1YMUA 1IZ0A 4B73A 1PJTA 4KV9A 4RY2A 2EFYA 3BT7A 3FPJA 1SA0A 1TADA 5LFAA 2Q9BA 4EFMA 3G8DA 4JWKA 4D6YA 1ULZA 1JG7A 2H54A 4HNAA 2HK9A 3EXHA 3QI7A 5JXHA 4K9OA 4D56A 2JI9A 5K8JB 5FL7D 2LNDA 1Y5IA 4ISBA 2GDZA 1LJ8A 3CF6R 3AW8A 3IQWA 3K15A 4RIFA 5EWLA 5B4VA 1T1RA 5FB3A 2Q0XA 4FSHA 1AHHA 3QKRB 2FA9A 2RHLA 1KJIA 3AK4A 4W9NC 1U6JA 1DTEA 1RPTA 4ARAA 4JA2A 4ZT2A 2CB9A 2XADA 2VSNA 1XQ1A 3USES 3GPLA 4TZTA 1PV1A 3F9RA 1THZA 5KHLB 4N5MA 5DLEA 1TMYA 5BR1A 2V3VA 4DJFC 4REMA 4M2LA 4YQYA 3P0FA 4A8JC 3DAFA 4MW4A 3ZVMA 4MLDA 2EZ4A 1YRYE 2JIRA 1DTWB 1P33A 3EY4A 4JLOA 2D7DA 3VZCA 3P96A 4WLUA 4R1MA 1QYRA 1E7RA 4I7EA 1LI7A 1JJBA 4OA5A 4Y1FA 3WC4A 5I7UA 2HMTA 1J1ZA 2CUTA 2CXTA 3UJ7A 1NUSA 3UK1A 3HADA 1VSTA 2W90A 4D3FA 1U5BB 2JGKA 1ZONA 3ZLVA 5IS2A 1KDZA 3DB2A 3QIVA 3QMVA 5AI8A 3VSCA 3V8RA 2IS6A 2YOGA 5L3QB 1P6UA 2FQQA 1V6CA 3D3JA 3IP5A 5KTSA 4X65B 2B1JA 1LWOA 3EDCA 3I9MA 2ZJFA 2IV3A 5AI4A 3L0IB 3OP1A 1RRCA 1JEDA 5ARCA 4AIRA 1DKNA 3O4RA 4F06A 5DNDA 5KYXA 5IAGA 4MVJE 3QFHA 2HQBA 4HKTA 1YDWA 4P81A 2VPQA 4X8MA 1GSHA 2C5HA 3IGFA 1G5HA 4D0RA 1UAAA 2NPOA 1CIVA 4G8BA 1TKBA 5IBPA 3W5BA 1F0KA 3A9TA 2P6OA 2BJHA 3UK0A 1GZHB 2AFHE 1OILA 1XRSB 1F4VA 1V3VA 1K98A 2CJFA 2WU1A 5GGYA 3SHTA 2G9VA 4R2HA 3TLAA 1PLKA 4HS9A 1EX9A 5THXA 1EUCB 2PL5A 1GPMA 1YB7A 1FXUA 4QUKA 3RTBA 3W6UA 2BMJA 5BT8A 4O59O 3NTQA 5H3LA 721PA 2BT4A 3VYWA 3BRSA 2XI4A 1JIIA 3NHRA 1SA0B 3JQDA 1Y3CE 2CD7A 3AHGA 3I6ZA 1YI8A 3TPCA 3CNQS 3Q8XB 4TUYA 3UF0A 4HNAB 2GOYA 3EXHB 4ZT3A 9ATCA 2GD0A 3K0BA 1Q0UA 1QGED 1J0BA 2FFQA 2GNPA 2WKSA 3C0KA 3VKFA 5C1OA 5HWSA 4F5DA 3ITKA 4RHFA 3K3PA 3ZY2A 4IQFA 1P4SA 2IZ1A 2ZPAA 3GARA 2PU7A 3H1AA 3QUCA 2Y67A 4MCHA 4PC1A 1DELA 4RA6A 1M7HA 1YK0A 3FOEC 4QUDA 3M6XA 3ZTYA 1KBQA 1PWHA 1L5KA 5CG2A 1IY1A 1CBUA 2UVQA 5AUNB 2ZJ1A 4LDAA 3OFNA 2I80A 4L75A 1DRUA 3VR6H 2R68A 4GS5A 2WF8A 4ZYZA 5DWQA 1E99A 4EHAA 4EZBA 3HHEA 1VE1A 3OFVA 2C7VA 1P77A 1QRSA 4ZZ2A 3FDXA 5F2NA 5DYTA 3M33A 5EQTA 1VBKA 3IHWA 3T54A 1W8IA 1I3OA 3PFKA 1A4IA 4DMLA 1XNHA 4DV5B 4PYOA 2BKEA 4RLHA 4Q7LA 5F78A 5EJIA 1H66A 3CQ9A 2B0JA 4DR3B 4QXMA 4QVGA 4EF6A 2V7GA 4RGBA 4UDYX 1H5UA 2HJSA 2E48A 4WUTA 1C41A 3NT2A 2Q7XA 4M8SA 3O8CA 1WPRA 1WU7A 2CW5A 3ILSA 2JK0A 2W6OA 3NO4A 4PG7A 4YJ3F 2FZGA 4UW9A 1R74A 2HRDA 3KFVA 2YHIA 3G2JA 3JD4A 1SGWA 3L6RA 3MCAA 4D3ZA 5KYXB 4DSTA 3DOIA 1MEJA 2ZJ4A 3EIXA 2X76A 3H0KA 4RL6A 3WMRA 1U0BB 2P69A 3M8KA 1J90A 4DCPA 3DL7A 1G8GA 2V8BA 4DVJA 2PE5A 2XWPA 2XSZD 3PVCA 1ZFNA 4JNKA 2WT4A 4KLAA 3AFIA 4HTAA 5DHQA 2RGRA 3DEKA 2ATXA 2WI8A 2EG5A 3QVGA 4K9NA 1SKUA 2OO5C 1VJRA 1X92A 4RQUA 3FI9A 4TV8A 4H4DA 4TQ9A 2XV1A 3AKEA 1M7BA 3PQFA 3VNUA 4ENPA 2BDUA 2I66A 1J4AA 4OXYA 4OK5A 4C1NA 3FYCA 4EGFA 3GA5A 4UCQA 3DYIA 1TQ8A 4N01A 3UJCA 1NBMA 3VHLB 4Y6SA 2PUTA 2XYPA 4FJ1A 1ECBA 1N0HA 3ESAA 2Y1FA 3FZNA 1A7UA 2A6PA 1ODCA 3HM2A 1IJFA 3MN1A 2IKSA 2H08A 4JR0A 1T3TA 4TUYB 1GTZA 5DGCA 3WGVA 1VIVA 1TO6A 2XHZA 3H05A 4CM8A 3CCBA 1B8VA 2QRJA 3GN1A 2EZ9A 2BHSA 1T5IA 4LXXA 1I2BA 4E5MA 1Z6GA 5CH8A 4BMXA 4YJDA 4RA6B 5LWHA 1HLGA 5JYBA 4Z4FA 3BJIC 2JFUA 5HBRA 4RIIA 5GVRA 1TCAA 4DUGD 2ISQA 1TKAA 3KV3O 2Q0HA 1BJRE 1UT6A 4OOFA 5BPFA 3OX3A 4PO8A 4INAA 3QSGA 4K9KA 1WXQA 3NDPA 4HFJA 4L6CA 2WJYA 4CL8A 3GB9A 1KK2A 2EQAA 3MGGA 4X3OA 4BNWA 1PT8A 3QMWA 3QH4A 1E0JA 3RAPR 2VQEB 1RCUA 3TRIA 1ZX1A 1F2TA 2VDMB 3GAAA 3K8ZA 3RC1A 2PGAA 4Z6KA 4CEIB 3ZVLA 5LIRA 1Z35A 2WJZB 3KTAA 1Z3IX 4X24A 1INLA 1YU6A 2PIDA 1H8EA 2AVDA 3E61A 3FSGD 4X20A 1BSVA 3GLFB 1C7IA 1TIPA 3LE8A 4P3OA 4AJLA 4DY6A 5MN5A 3K31A 3RYFA 1GY8A 1W4ZA 2J33A 1COWD 2RGYA 2ZS9A 4HYTA 3B7PA 2IEZA 4YDRA 4ZKEA 1VJDA 1Y6ZA 2ILTA 3B1FA 1H8HD 4WI1A 5EWMB 1FB5A 4D1YA 1KZ4A 2HDNB 1JEOA 2O2GA 3BK1A 3OPXA 1FNSA 1ZOPA 3AJAA 2YHIB 3SG0A 4EKGA 1TYZA 1FDUA 4RQBA 1ZK0A 1BQ4A 4M0UA 5HFJA 1YZTA 3TR6A 2LW7A 3NC0C 3LSYA 5IVPA 3J7TA 5CLFA 3VC3A 5MN6A 5LB4A 3CX6A 2PWPA 4X7PA 4S2UA 1IPEA 1FOEB 4RFSA 3DVQX 1KMCA 2XOXA 4XIJA 2AZ4A 4OMDA 2ZAOA 4HB0A 3HR8A 1NATA 3DLPX 4TV8B 3W79A 4OAOA 5BYBA 2BFFA 3OH8A 2YWXA 4K3UA 4BMCA 4G5QA 1Q2UA 1S9DA 3MYYA 4GOXA 4L72A 3ZBTA 3ZWBA 1F2DA 3KEFA 2PA3A 2HWYA 1Q14A 5BO5A 4BGEA 5GIOE 4D25A 4N5NA 1ULSA 3PK0A 2WOJA 1N5KA 4V38A 3VR0A 4DBVO 1RKQA 5IVIA 3N2LA 3JCZA 3B1XA 3HU2A 2P79A 4HYYA 3P9QA 2EWWA 1MAWA 2CE2X 1ZJZA 2J0QA 1MR3F 2EHJA 1ZUWA 4CM8B 5JD6A 2O20A 3VTFA 2SECE 4DMMA 2XF8A 1ORDA 1Y6JA 2GILA 2IYSA 3TS1A 1OV4A 1W88A 4G25A 5ADVA 3KTDA 1EWVA 1IG3A 1KAGA 4K6OA 4X54A 1TQ4A 2NQTA 1Z5VA 4J1TC 4GR4A 4D98A 3JY6A 4Y3UA 5C4MA 2OQIA 1KYTA 1EVJA 2NQ8A 1KE1A 4DV0B 1RCTE 4JYBA 4P93A 1KKLA 4PZPA 5P21A 1M34E 3YASA 2AS0A 2OXCA 4EFLA 1LVUA 2OHFA 2XMZA 2M6KA 4E6PA 1F7VA 2IHZA 4YI5A 1QH1B 1F2TB 3CM0A 4UJ5A 3QZUA 5LQJA 3K5WA 1N3LA 4W5JA 4PXSA 1PZHA 4M0DA 1IHPA 1NT4A 1M6VA 1YKGA 2JLBA 4BNVA 3EN0A 4X20B 2ZRNA 4A5OA 2DH5A 1UMDA 2DU8A 1C3VA 2JJQA 1B74A 2ZBEA 3BFKA 4YBZA 3RYFB 1OREA 4ZCLA 5DASA 3TZKA 3TR5A 4B8WA 3NNSA 9LDBA 3CCCA 4RKFA 4EPTA 4OX9B 3QVVA 3RARA 1AHIA 3AESB 1UFVA 5KHAA 3GBPA 1YB4A 4URUR 5BYKA 5LZ8A 4Q7QA 3G23A 3G2QA 1Q0HA 3AVPA 4V1CA 3FWYA 4CODB 3BJEA 1Y9DA 3LT0A 3K6RA 1YI1A 4HPWA 1GNVA 4RK4A 1KARA 4FFRA 2VKQA 3NUGA 5DTQA 3AJEA 3IP9A 4RFSB 1T5SA 4IVPA 4ONEA 4TWRA 5ECWA 4DABA 3T3IA 4IRXA 3SR4A 4IG4A 5JAZA 1IXRC 1I1QB 5NULA 2BFFB 5ED4A 4G0UA 3NWOA 3W1EA 3NBQA 1Z5NA 2W2LA 3TQQA 2NVUA 1K6MA 2H00A 1A3CA 1EE2A 3F3SA 1UZLA 2NO0A 2FOLA 2UV8A 5CDSA 2IXGA 2Z9CA 4H77A 5B1YA 4AMZA 3WMEA 3T5MA 3ZKAA 4CCYA 3NXSA 4I55A 1JJFA 1Z4LA 2HK6A 2IZ6A 5UKDA 1W4AA 1N4DA 1NBWB 3ZDZB 2DHEA 2CNKA 3DR5A 4MKIA 3JSXA 3U44A 1DBPA 2ECOA 4KH0A 4R4JA 2VS1A 2J3QA 1UM8A 2BKLA 3SYRA 2J3MA 3E1GA 2QG9A 4NARA 4DCUA 5ALDA 5B4TA 3GDOA 4TYYA 2WZQA 3GFRA 4PNHA 4HF7A 4RMGA 2PT9A 2AB0A 2I91A 4JNCA 1W88B 4ZXPA 1IQUA 4RACA 3C5VA 3MM4A 3FPKA 4HYEA 4LUCA 4WZBE 5G1NA 3T5DA 3V8PA 4DJJA 1NDQA 5LJIA 1VJ5A 5LZ4A 4JKYA 4UHDA 1BZYA 1O77A 3HEAA 2DQKA 4R1QA 2XEXA 5CFRA 5AK0A 3CUEF 4YXWA 3AM1A 2G1JA 2RK6A 1DAPA 4LZLA 1J25A 2W83A 4K28A 3NETA 5A4DA 2CNWD 2ZTLA 3KTFA 3L6CA 4KQHA 3PRJA 2DHDA 2OFFA 3CG4A 4JYAB 4URYR 1ZNYA 3TQFA 1KMNA 4OHOA 1R0WA 4RSMA 1UMDB 1W47A 3EJWA 3KT3A 2ENUA 3I34X 3KWFA 4YJ2A 3L8EA 2XW6A 2G40A 3HP7A 3OQ6A 1TT7A 2OGTA 4LSWA 1ZGCA 4G23A 2QAJA 1LF0A 1P2BA 1G5RA 3PU6A 1KI9A 1NYLA 4LCEA 3GPIA 3HJHA 4DYVA 3DBHA 1YT5A 4R69A 3R77A 1GQQA 5BY2A 3I5XA 4EA7A 1RXWA 3D2BA 2GJ4A 5CH3A 1DIAA 2PX4A 1C8BA 4BKOA 1M0WA 4E09A 4DMRA 1AHPA 4V1CB 4RCYA 5KOYA 4L02A 4YUXA 4EOGA 1O6CA 4ZDKA 1AZTA 4U7FA 2DUNA 1FTGA 4U7HA 3C3YA 1FW6A 1H6CA 2IYXA 2Q5QA 1NXSA 1KMHA 2BFEA 4Z0HO 1LX6A 1KJWA 2DJIA 2GTIA 3ZCRA 2HM7A 1WTCA 1CPYA 2OC4A 4RK1A 3X2SA 3GXBA 1RLTA 3VC7A 4G5XA 2CFIA 4CM6A 2H1OA 5CA0A 2NVUB 4JL5A 1MEOA 2Q3JA 2NU6A 4D26A 1M0SA 2QX9A 4WV3A 1X86B 5MFZA 2A0UA 2H7CA 2QMHA 1W4LA 1Z12A 5ES3A 4TTVA 3D8TA 4I55B 3RU3A 2P8SA 1D1QA 3QXJA 1F8YA 4H1VA 2FCRA 1E3JA 5K2MA 3IA7A 3ASZA 4R0VA 2FPIA 5MF6A 2E49A 4JLVA 1QR2A 2NVBA 4LOJA 1GFZA 4OKNA 5DK4A 4ZC1A 4BJ3A 4DJAA 3A6PC 3L4KA 2UYQA 3C7DB 1PR6A 3EULA 3ROFA 1QZZA 1IXYA 3RWOA 1SXGA 1BE8A 1IUPA 1J9ZA 4X6UA 3MBIA 5GIPE 4MWDA 3WZ2A 1N6PA 3LPDA 2EHDA 2XA9A 1WQ4A 4MQBA 3HLKA 2K6GA 4J03A 2GK4A 4U6SA 5LUBA 1V37A 3IOMA 1KYWA 4RK5A 4AG6A 1LK7A 4KRFA 3H04A 2GZHA 3FTCA 4IIFA 4L8LA 5TNXA 3FD8A 4LE0A 2ZAIA 2AE2A 2X4IA 4B6OA 1C0PA 1HE4A 4TTRA 2P7IA 5LYJF 2FPSA 2JDIA 5G40A 4F5ZA 2F90A 2AQIA 3IXMA 2PUJA 4QHTA 2R9VA 1OFTA 1Z73A 2V6GA 2ZIWB 4JP2A 3O9MA 3FWHA 3PQ7A 4RK0A 2IEBA 4X7RA 3VR4A 1NMQA 1YMQA 4QTXA 1Z4MA 4YJ2B 4IQ0A 2VYND 1F8GA 3FCCA 1QP4A 2HMVA 2ZWIA 1T1SA 4IMRA 1AT1A 2ORYA 4HUJA 2EJBA 1IZYA 3UV7A 1N9GA 5FAKA 5C1PA 5HKBA 5FDFA 1QP8A 1PP4A 3I04M 4NCHA 4D41A 2VTVA 2AX4A 2XH8A 3P0IA 4KSYA 3EIQA 3QVUA 1NXPA 4K6HA 1VG8A 4GQIA 4FZRA 1MW8X 4DV4B 2WWGA 5CXUA 4D81A 3LDHA 2Q3LA 1NU6A 4TWIA 3GDGA 5ELMA 1XTUA 2QVYX 4D5GA 3L0YA 1KMHB 1N2GA 2BFEB 2XGGA 3AWIA 1RPNA 1HEIA 3TQHA 2WU3A 2O2YA 3DOEA 3EG9A 3ZGZA 2BE9A 4RGYA 5FV7A 2FRDC 4OGWA 3SBOA 1HUQA 1SBQA 2OYCA 5F23A 1BG6A 3KSMA 4MNTA 1H1TA 1UDWA 2C03A 2BKXA 2QTCA 2DTXA 1C9KA 5D6OA 1OTHA 4BWFB 2NU6B 1BDHA 1XAIA 1L9KA 3BEDA 2XUKA 2LDXA 4FIZA 3TDKA 3E6AA 3EGXA 4PLTA 4RHUA 2F67A 1M72A 1YD7A 1QB7A 3MMPA 4RBNA 4DSZA 3U5ZB 3IEVA 1SOWA 1XVIA 1Q22A 1BWPA 4C89A 3IHLA 4O63O 3ZIAA 5KDDA 4C0BA 5AYVA 3S8EA 1LK5A 4E22A 3H5OA 5CIQA 1PVOA 4F6LA 3VKUA 1RJGA 2JA2A 3ORRA 3RC2A 3WADA 5BMVB 8ABPA 5JYCA 5MDHA 3FPFA 3IEMA 1RJWA 1DQPA 1U9JA 1WXHA 2RDMA 1WIWA 1GPKA 2IPOA 1OR8A 2D6FA 1FSZA 4MQUA 4QBIA 4OA8A 2OC9A 3EIWA 4TZKA 3R40A 1FRQA 1L4HA 5F2EA 5TMPA 2C31A 3FYDA 2D1QA 1FF9A 4PZCA 3VAAA 3ZJTA 1O08A 3D6FA 1T4MA 3QQPA 3T5GA 4JEMA 5B7QA 3QWHA 2R8YA 5F1KA 3STVA 4C2UA 2R5NA 4F71A 1FQWA 3OFSA 3IE2A 1TEHA 4HP8A 2OFWA 1U2DC 4XWYA 5TPZD 1D6MA 4JN6B 1GAXA 4EI7A 1F0PA 3WWYA 3C8UA 1ZCBA 2QG6A 2O7QA 3O3OB 4P7BA 4GPEA 1CUUA 1GL6A 3K35A 1UBFA 3WLTA 4XH9B 1P4HA 3N28A 4YRMA 5GZ1A 4B3TB 2VDVE 3L4EA 4J49A 1XMVA 1ML4A 1Z39A 4WFIA 3ULKA 2JFPA 5KC8A 1TA9A 5EXEA 3MC1A 1JHYA 2YH2A 4GX5A 2LCQA 1EGMB 1UKEA 1N9GB 1AXGA 4TLBA 4EY7A 2JCYA 5EYPA 4NIMA 5CM8B 1OWLA 2XGOA 1VPVA 1YDGA 2G3YA 4JYZA 2LRHA 3LT1A 1JDBC 2VKTA 2QLNA 3GCZA 3I2YX 3U37A 4E3WA 2I67A 5KYTA 1DTSA 1KF0A 1N6NA 1C1XA 4G36A 2XCOA 2VJBA 4RY9A 3Q2OA 2ZYUX 4OBEA 5D84A 1KEPA 4RPCA 3W2IA 3NVDA 2H1LA 5KKAA 5LOVF 3EG9B 3T1NA 5CBKA 2COEA 2QZPA 2YIVX 1HDXA 2GZ2A 3UAXA 4CNBA 5G0WA 5JJ5A 1IZ7A 3MINA 4B3SB 2AWNA 1ECFA 3LDAA 4WN9A 2CSUA 4LYYA 3EGXB 3WLRA 4TYNA 1TXGA 3RIEA 3KVYA 1W2WB 4E2YA 4KWHA 1QRDA 2Z2XA 3GELA 1XMQB 5L45A 1BMTA 4GLOA 4QG7A 3SLKA 3LNCA 4DIUA 2H5JA 4UTRA 3EGCA 5EXTA 3KQKA 1YIAA 2Z4TA 4IIDA 5FOUA 4ARZA 2B1IA 4XD2A 4D0NA 3I9FA 3QU2A 2GCOA 3VH3A 3WAGA 4JZYA 4ISCA 1WAMA 5AUOB 4QWWA 3W8RA 2EERA 3EGOA 4B6QA 5AIAA 1Z9BA 3KC2A 3PGA1 4L95C 5LYYA 3ZCPA 1CU1A 1DO2A 1B8UA 2IYYA 2X0RA 3CR3C 5AK5A 4EB8A 1EFCA 3QMMA 1K5GA 3T06B 3OSZA 3OY7A 3CO5A 4KAJA 3DAOA 3RH0A 2RGXA 3DWFA 4AZTA 2V3CC 4PNPA 1OH8A 3Q15C 1POXA 1P7PA 1NDUA 1QHYA 4W5RA 4ZFNA 3SMQA 1GV0A 1RKVA 3P9IA 1N0VC 4J7XA 4YAOA 1B0AA 3AIOA 3QLJA 2P0AA 3SZLA 2FGJA 1N7HA 1P2DA 1R6UA 4JLAA 1PJLA 3U3ZA 3DEZA 4OI4A 1FK8A 1NSYA 4F3KA 5AW7A 1JQEA 3C7AA 4IDDA 1JE1A 4FB4A 1A9YA 3ROMA 2D1SA 5IJAA 1MVLA 3T7CA 2CFSA 3FZYA 3EQZA 4E30A 4YAEA 5EYPB 2BSXA 2FFRA 3HY4A 3I45A 5FRDA 3CPSA 4LZPA 3KDPA 1YJAA 1T0IA 4PX5A 4R2WA 4BVBA 3JQAA 1PAUA 1X9IA 2B4TO 2PWAA 3PXXA 2XYHA 4OEHA 1LRKA 1MUUA 3G1UA 1C1XB 2PUHA 3LUBA 4ZEWA 1UBHS 1O97C 2QTBA 4MR9A 1M1XB 1RAHA 1J5PA 2C2GA 5JIBA 4M0CA 3SSMA 1BKYA 1ZJJA 2D4HA 2FWNA 2HHAA 3KLPX 3T9FA 5B3JC 4WKOA 3MINB 1T3ZA 4KTVE 3RNLA 4FMCF 1P0PA 1UZNA 1NW8A 2VHXA 1NQTA 4WN9B 2JLSA 1L5GB 1RHKA 4O3FA 4RYLA 3WBFA 4UD6A 1OMOA 5LMNB 3I42A 3SC2A 2MOKA 1ESNA 1XA4A 4O4IA 1U2SA 2PLNA 4HAUA 1NYRA 4JOQA 5K1ZA 4E70A 5CVEA 2PA0A 5KNCA 3GLUA 3OMLA 1RWXA 4YLEA 4KQCA 3MJCA 3FGNA 4UUAA 3KQMA 2PBRA 3FB4A 3ZUPA 2H06A 2QYTA 1VHJA 2G7MC 3ODGA 4ARZB 5A4IS 2GCOB 4F46A 4GC9A 4LF7B 3E84A 1H2EA 1CFJA 3MWGA 1OWOA 2EFJA 3C1OA 3GIWA 2NU8A 1E0DA 3RVDA 3C4VA 3U1TA 3MLAA 5HRCA 1DAIA 2J7KA 4EYKA 3EVGA 3MELA 4YJFA 4KSBA 4E5YA 3DE4X 2B7CA 3GZTB 4DV6B 5EA2A 3WSTA 4FXPA 1EU1A 3HI6A 5KEIA 3WDKA 1O94C 4YGYA 4CQMA 1QDEA 1AO3A 3T5BA 3S2FA 4H3HB 3SFZA 4U3JA 2O5RA 2WINI 3H84A 2DX7A 1UJBA 2XA2A 4YCCA 5BYAA 3G9ZA 1ZNQO 5ALFA 4BLVA 5ICGA 2VJYA 3RVKA 1T5DX 3ERCA 2PRSA 1YZQA 2H4WA 5DM70 1ADFA 3NB0A 2BIFA 3DJFA 4HB4A 5DHPA 1E3DA 1OGIA 2VA8A 3JQFC 4O4HF 3SNKA 1EDBA 2RHWA 4M98A 4MGHA 5ITSA 3EYAA 5H70A 4YV7A 1VPWA 2IRWA 4C2TA 4JBHA 4MIOA 1S8FA 4F3NA 3FUCA 1R6DA 2EL7A 2ZRIA 4FZVA 4A8TA 3PE4A 5F7OA 3TXYA 4YPVA 2CKMA 5A3VA 1X7HA 4X1YA 1BHQ1 3CUSA 3TLCA 3DNMA 1HPLA 4CMEC 5JARA 1EP3B 3JQAB 3MPOA 4C9BA 1CE8A 1E0AA 3IBYA 4UAUA 2PKYX 3CRMA 3MCUA 3IR6A 2OLKA 1NXTA 4RDHA 3MTEA 1K86A 1KEZA 4ODIA 4UBOA 1VZ3A 2CNOA 2HDHA 3Q3VA 1IQPA 3N1UA 3UB3A 3I53A 4XIGS 5AVYA 3AJRA 1PHRA 2Y0CA 4Z4EA 1DAEA 2WAYA 2F3QA 2Q3MA 2NYUA 4RJJA 2PBLA 4IFIA 3GJTA 3NVAA 1BD3A 4M83A 5C3UA 3TOVA 7YASA 1IY8A 4YV0A 5JHGB 2A3NA 2LIVA 2FMTA 4XFJA 1NVFA 2DWOA 4UDOA 3ENZA 5KVSA 2KB0A 4FDUA 4LVCA 1VL2A 5AK4A 3V8MA 3SC2B 4O4IB 1YF3A 3CH7A 2B1QA 2XYRA 1RRGA 3FTPA 2JFFA 5DBEX 4B9AA 3G79A 1NVGA 4UTPA 4O5AA 2QTVA 3FNFA 2NM0A 3C8ZA 4PYRA 3ZWQA 2YJ4A 4DDMA 1T43A 4JLBA 4LOHA 2JI6A 3NDRA 3TKLA 4Z2AA 1Q77A 3ILXA 2G25A 2QM7A 4I4TA 1TW2A 4EENA 4JQZA 5DTEA 3M3DA 4QO8A 4XTRA 4TT8A 1M2WA 1D4ZA 1XLTA 1AKWA 2NU8B 3SXUA 4AJHA 2EBWA 5CTAA 2ZKIA 5ALUA 5FIUA 1JIKA 3N9IA 5A05A 2UXCB 3SQDA 2VRNA 1FMTA 4WOJA 5ALXA 1NBEA 1TVKA 1V9CA 5CCXA 2XKJE 1UWCA 2PEYA 2F00A 3OQIA 5K3SA 4HQLA 1GDTA 1CLUA 1HNXB 1NLYA 4O2BA 4PLFA 4YI3A 3R0VA 3LKVA 1C7FA 1YGPA 4AX4A 3W5SA 4OBWA 2O57A 1SY7A 2A0KA 3ELDA 1ONSA 2IQ5A 3WKDA 1KDOA 4GDFA 3P9CA 1NWHA 1WW8A 1Y7IA 4UFNA 2EZ8A 3Q41A 3BQNB 1FW8A 4WFQA 1X42A 2OHHA 1VFNA 1WSBA 2JHFA 4QEZA 2AIRA 1QC5B 4RZUA 5KU7A 3P9ZA 3PICA 5BP7A 3DEIA 5F76A 5KVQA 4C6TA 2X8JA 4B3FX 2SBTA 3NGMA 3LRTA 5C3MA 1KERA 1NVAA 3WIEA 1V8BA 4OQMA 4HGNA 3VX4A 2Q1TA 3BL6A 3VSBA 4PFQA 2QENA 4IMJB 4TVKA 5E8RA 4X1YB 1QGOA 4MRPA 4Y9DA 1U8UA 1ZCFA 2F48A 2IOHA 5H83A 3RANA 1XZLA 3W9YA 4CIWA 5AVZA 4DUZB 3S99A 4BZZA 4KFTA 2YYAA 3H65A 2OD2A 3IT3A 3VR4H 4BN0A 4GMHA 4UEJA 2G09A 5E1OA 1LS1A 1J24A 1XWFA 5IF9A 4X9XA 2EF1A 3FHJA 1QLJA 2ZJBA 1HQDA 4B5KA 3ONVA 1IN6A 5ALTA 1X1EA 3TI9A 4LDRA 2OV8A 3RBVA 4WL0A 1HT1E 3OPYI 2X6RA 2XNKA 4NJOA 4C5CA 2HGZA 5TQVA 4AUNA 4GPZA 5JSZA 5FKJA 1Y3BE 2J59A 3LUFA 5SY4A 4QOFA 1JL3A 4FW8A 1JR3A 1E6CA 1H2YA 3UJDA 4HZGA 4TL9A 1PL8A 4JIGA 4URXR 3W3AA 1SUAA 4RSRA 5K8IA 3F4BA 4GI2A 5IMBA 3GJYA 1GJRA 4OXQA 4WKBA 2QTVB 1Y8CA 1E7SA 1H2HA 2BHLA 3E1KA 4A36A 2D5CA 1UK7A 1R5OA 1CQZA 1G2QA 3E81A 3KE9A 2FUG1 4BNIA 2XUQA 1XYVA 1KBOA 4I4TB 3DZ8A 3N86A 4H6VA 4OQPA 3L8DA 4JU9A 4OYRA 3SLRA 3SXUB 2QSUA 4L7VA 4ZYTA 3D4BA 3IMEA 4ZI2A 3E7FA 1RI5A 3FYHA 2OV3A 1YASA 3OZRA 4Z3KA 5EJAA 5F73A 2HBYA 4EF4A 3UVEA 1TVKB 1CWUA 1WV1A 2A5JA 2YJ3A 3C3DA 3CEJA 5DBIA 5F98A 2I55A 3N75A 1ZN2A 2ZVDA 4B3CA 3OQIB 5KCMA 1WW2A 4XW2A 4Q4LA 5AW4A 1PT9A 2WAAA 2PFGA 5A7HA 1NI4A 4OXNA 2BHTA 1TLTA 2FQYA 3NAMA 3NBXX 3WO1A 3OZGA 4OHYA 4Z2YA 3AEKA 4M1SA 4TRMA 3ZBUA 3OAAD 2NZ8A 2FX5A 2YWBA 1U28A 1R0CA 5CFQA 2MSLA 5CFPA 5K0TA 1L4KA 3L43A 5IABA 3T61A 3UZUA 5C7YA 4QBTA 1LDYA 4Y2TA 4WWHA 2I87A 2IHKA 2VP5A 1UINA 1Z0JA 2X8JB 1NULA 2CVOA 4QOGA 5GONA 5E6RA 5BWNA 2IPLA 3SGLA 2CJXA 1O7JA 1UBLS 2QMQA 1MCZA 4BO3A 1GKUB 1A72A 4LIPD 1FMFA 3C3PA 4ZODA 4E2XA 2Q2VA 3JWGA 2JJYA 1J33A 2VRCD 4ID9A 1WQ1R 2PKCA 3EZYA 4K81B 4UATA 3IEUA 1MNAA 3BXGA 5AI5A 1FA9A 4H18A 3BE5A 4K1XA 1E1NA 2QP4A 1O9HA 3LOUA 4M8NE 1CQWA 2OV1A 2PFSA 1F8FA 4W9RA 1RLIA 3EPHA 4MAFA 4HAVA 1OC4A 2B5VA 3PNBA 3W6NA 4K9SA 3BMNA 5K3OA 1KS9A 1SB8A 2P27A 4PFJA 2XNDA 3HR4A 3ZPXA 1CR6A 3HCWA 1ZEJA 2LXNA 5HF6A 1L4NA 3KXLA 3KYBA 2C20A 3EWIA 4L57A 5JPCA 1C50A 3X0DA 3NI2A 4CM5A 4XM0A 5KJEA 1YO6A 1P9OA 4FR5A 2F3RA 3KLNA 4DZTA 5B6IA 2AVNA 1ONBA 2C9MA 2WICA 3KYCA 5ADHA 1PTKA 4TKUA 4EFKA 2PO7A 4ERNA 3NDIA 5L3SA 2ZYAA 4QLOA 5HGJA 3CX4A 4KK4A 4DXDA 1QHNA 3AEYA 4AP9A 2R96A 2JFVA 1FTSA 3HDQA 2A1TR 2B4RO 3DZFA 2BM0A 2IBMA 3AHHA 3K2QA 4XZ3A 3O8DA 1QRTA 3LP5A 1YFJA 4ABTA 2BKUA 3BMCB 4ZDJA 2UUCB 1FL9A 1VGVA 2JIMA 4RH3A 3UFBA 5M2QA 4BVAA 1W5BA 2BSQA 2DQ4A 2NAFA 1V1JA 5CK4A 3RUEA 4AW9A 2J31A 5EJ2A 4KG7A 3OU7A 3C6BA 2OZLA 2NO6A 2IL1A 1XMXA 5BNWA 1ECCA 1P9LA 3WHIA 4BNFA 3A6DA 3OTGA 3AEKB 4AWAA 4HH0A 2DR2A 2OZKA 3U4QA 3MCTA 1PO7A 5DW0A 4WLNA 2ZUWA 4KC0A 4ZI7F 4IXNA 1CNEA 1XZDA 4MLZA 2PD4A 3THSA 2L2QA 1RM5A 2YZMA 5BNIA 2R7KA 1H6AA 3WLQA 5GONB 2ATEA 2ZUBA 4JLNA 5E6RB 2GK6A 4HDKA 2ISSD 3RD5A 5KTYA 1BKDR 3EZLA 1RPJA 3FUWA 4ZO6A 5H4HA 3WNCA 4Z7JA 2FKAA 2FP3A 3DF9A 4GKVA 3I4CA 3FJOA 2JHGA 4IMPA 2NNWB 1KI3A 2HH9A 4ZHQA 3QEJA 4C04A 2HLNA 4WVLA 4LJYA 4TM7A 2ZQYA 3UJ9A 4RD4A 4W5NA 1F9EA 3CKYA 2O2EA 3UJHA 5E3HA 1SURA 2XRZA 3IDZA 2OGSA 4O8CA 2GEUA 2BVNA 4MRMA 2R6CA 5JS6A 5KOJA 3ZWPA 4KMRA 1ZN9A 2REBA 4K8RB 2HV9A 2FPRA 4M9QA 5I4IA 3JQ9C 3BMNB 2OMEA 1QP7A 4BB6A 5IVDA 1XRRA 4IRUB 4WOCA 4LMBA 5K0SA 4DLBA 1Z7EA 5FL7A 4F21A 2B25A 2FRVA 3CNHA 3T3PB 3VZRA 2GUGA 3E9CA 2EFDB 2OQVA 1V47A 1C4KA 2FLKA 3G0BA 4KE7A 1P8AA 4P53A 2HUPA 3O2NA 3WJ1A 3ICQB 3ELBA 1U2QA 3E53A 3QVLA 4CV1A 4TMTA 1YBAA 5D3KA 4IDFA 5KYUA 2NP7A 2QNRA 1G6HA 5IH3A 3TLEA 4TKZA 4B46A 2NPIA 3KYCB 3JS5A 1NYQA 2E4XA 1C9NA 1W0KA 2C9CA 2JA1A 3JD1A 4UHKA 1FSPA 4UASA 4BOYA 2GRAA 1GGNA 1Q0SA 2QN7A 4RVOA 1NNUA 1PJSA 4XSGA 5L3SB 5JR3A 3B8EA 2BEUA 1IG0A 2O19A 7MHTA 3ZQUA 3KM0A 1F3OA 2Q3FA 4LDQA 4QSHA 4LZOA 1V11A 3PNKA 3B6MA 1J5EB 1F14A 1XXHE 2C7BA 2PZMA 2CSXA 2Q2QA 2EDAA 2QW1A 3VGPA 2IEYA 4D3YA 1N5JA 2UU9B 2R66A 5AJUA 3C3XA 4OU5A 1WD7A 4YWJA 1KSGA 3L40A 2HLPA 5FFFA 1QIEA 5KNCH 3Q8LA 3RUDA 4GLJA 4LNHA 4O0MA 2R6JA 3SZ3A 2CUNA 3HRKA 4QEKA 1S4QA 3A2KA 5JZ9A 2ZAYA 3UT0A 5ETJA 4NOKA 2HF8A 4EJ0A 2IYQA 1T2NA 3DO5A 2AR7A 4PLHA 5L40A 3U4QB 1N2CA 5EXXA 3SM9A 3ZTTA 4BFYA 3DFMA 3DV0B 4HSGA 1BHO1 1N34B 6Q21A 2HF2A 3ZE6A 5HHTA 2IYWA 1LLQA 3V8VA 4ZCMA 5DNCA 1K4MA 1RRFA 1KSJA 1FVFA 1GT91 5JAQA 2XUPA 5I5GA 4HDKB 2QSJA 3F9IA 2BY4A 4YFYA 5IN4A 3GT3A 1MAVA 4HCJA 1MZVA 5EMHA 2V5UA 4JGGA 3O4HA 4ITRC 5IHXA 5DZSA 5HTKA 3SF8A 1YVDA 4KDFA 2KBEA 2WB4A 4G0ZA 4ZHQB 3Q72A 4L07A 4QWMA 2XUGA 2WKWA 4C5BA 1KETA 3F2IA 4CN9A 5HA5A 4ZAXA 1NF3A 4BKQA 1KEWA 1QZUA 2VH2A 3IIJA 5K0CA 4KJZA 4MRMB 1T2EA 4B2LA 1NY5A 5AVRA 2G1UA 2I78A 3IPRA 3L2OB 3QU5A 5JDCC 4Q9AA 4BZXA 2FYTA 4ROSA 2PGIA 3NBMA 4LW8A 3C15C 3F8WA 4KZPA 4H1WA 1KI6A 3A9VA 2JS7A 4KR0A 2GTHA 1J8MF 4RPIA 1EX1A 4WDRA 4XSHA 3UYLA 3A0UA 4WUVA 4ZVLA 1JEEA 1E79D 1MQ8B 4TQAA 3WAKA 3LGSA 1HDEA 3OM1A 1NSFA 2E3JA 2KI5A 1U0HC 3BULA 3IXQA 4HAYA 1M2FA 3KQOA 3LUPA 4UHHA 5LCXA 3AY3A 2QL9A 3DZJA 4AK9A 3OJLA 5BPHA 3WB2A 3HPRA 2HT6A 2VBFA 3EC7A 1OPXA 1TZBA 4OIFA 4ZVRA 1RABA 3KUKA 5K3AA 3WJAA 1HZZC 2AFIA 1R1DA 1BJTA 3H6HA 2BEUB 2BONA 2XJ9A 3NBFA 4L15A 5GAJA 2WPNA 4ZCQA 4E51A 1JEYA 5E3JA 2PDAA 5JS8A 4QNMA 2FJUA 1V11B 3OZXA 2HQRA 1CR1A 4PEVA 5AT1A 1N8SA 4MKZA 3TO5A 3COJA 4B2PA 1T9GR 3I28A 2R62A 4WCFC 2AEEA 2G36A 3KJFA 5DIFA 5G4KA 2BDEA 2JGFA 4HG2A 5FV4A 2H1SA 1UBEA 2R79A 2M9MA 4OQ4A 1Y1KE 3KR1A 3AVVA 2WAOA 5HZKA 3SDBA 4FMDF 4BFUA 4LXIA 1YHYA 2R5FA 2X0KA 3A04A 3F97A 4OVKA 2WUGA 4IW3B 3WLAA 5K6AC 1XMOB 3ANSA 2QTFA 4DHWA 4KV7A 1UT5A 2FHSA 4ZAYA 3U17A 1ZMXA 3GFOA 3KJQA 1I1HA 1K2WA 2AJTA 3DWIA 3TR0A 4C0AC 5IBQA 2GSWA 4WZAA 5E4JA 1KVTA 1Z25A 3DT9A 1O6GA 4CKYA 2ZZMA 4M6WA 1TCCA 1GFIA 1V5WA 2IV2X 4FTWA 3E15A 2XSZA 3MAAC 4KQGA 1KAMA 3F73A 5LUAA 1FYXA 1XT6A 1N2EA 3EUAA 4IV5A 4U6QA 4YBRA 1P5RA 4H7PA 5D3MB 3IA2A 3JYOA 2VSFA 3HLTA 5JJIA 3U4CA 1Z83A 1HR0B 4YT2A 3BERA 5TVGA 1QIFA 2L19A 2NU9A 2ZI4A 4JT9A 2Z43A 4I50A 3SE7A 2XZLA 2GZSA 1YAJA 2FUNB 3M6WA 4MW5A 2VQ6A 2YZNA 2YNMC 3G2NA 3MXTA 3PFCA 2F1HA 2FSFA 2OUIA 3PGXA 4S1OA 5YASA 4ZN6A 3ZD7A 5B5SA 1E77A 5DCYA 3TSOA 4DY4A 1ZNWA 2X5XA 3X44A 5JPDA 1I4EB 1QLHA 4KQEA 3O3CA 5LMUB 1SBIA 3KPUA 4EG5A 2ZJAA 4LQCA 5AKYA 3OPNA 3PF9A 1XI2A 2X4LA 4X97A 4PBRA 2HWXA 3KR2A 3DCNA 1N7IA 3E8MA 4EPWA 4TT3D 2QPTA 4HNHA 1CQJA 4Q9KA 1KE2A 2A9KA 3C3WA 5TY0A 3AHJA 1QOQB 1KWGA 1ABBA 2VJAA 4X45A 3RFUA 4FSDA 2DBQA 1R64A 2HNAA 1KYQA 2BFDA 4OLBA 1QFYA 2I9PA 1TKCA 3WGKA 1C5KA 4HQNA 5F5NA 3L41A 5J5AA 2AFIB 4IIJB 1GYPA 1I3NA 1UOOA 5I4BA 3KHKA 1JEYB 5E9QA 3KALA 3GD7A 4DQDA 5AI9A 5LDDC 1YS2X 2AC2A 3CS3A 1ICIA 2DETA 1H9AA 4HH3C 3W3AH 3FVRA 4EB0A 2I6FA 3FSGA 4EHDA 1VJGA 3GNLA 5G4KB 2JLXA 3VR5D 1EVLA 4UAJA 5EQFA 1COWA 3DONA 1EWYA 3T1HB 2AW3A 4GGPA 3I2KA 2Q3CA 4MVWA 3K0CC 1H8HA 3WR5A 4RKWA 3HDVA 3IX7A 1QYWA 5G1OA 3S44A 4DT1A 3B51X 3D5TA 1MXHA 1QTNA 3KZNA 1AJEA 4PVCA 2PZKA 3EXIA 4FLEA 4J76A 3W4IA 4DTIA 3OM8A 4G65A 5JTTA 1JDZA 4RGQA 1HFKA 3OSUA 2D8MA 4Q15A 3SFVA 3TQCA 2Q41A 4QDKA 5A0VA 1ZIYA 4IIYA 5J2TA 3OI7A 1E9CA 3H16A 4AJ4A 3FNQA 3AQ4A 4CG1A 3GJ0A 2XITA 2J08A 4EAAA 5A0TA 1Z45A 2AZMA 3T1TA 5BV7A 1I7PA 2NU9B 4IS2A 1K6IA 4Q4HA 4I50B 2ZZKA 1E62A 1T1EA 4I55F 3KPVA 4KIFA 3NASA 4I5FA 4KODA 4GWKA 3G68A 2XJ4A 4K6MA 2XCQA 1EGAA 3FCAA 3SZOA 3OC6A 2Q5IA 4J3FA 4KLZA 1KXJA 2AJCA 5B57C 4NU5A 4YDQA 3PCTA 3O73A 4MS1A 1X19A 4Y2PA 2W7TA 1G20E 2REQA 4ZCSA 5KWEA 1NGSA 4ZVQA 5ALGA 1WZ2A 3WIDA 5G3YA 4KVZA 2WVJA 2Y1XA 2EFHB 3FB1A 3WXBA 2HPZA 1CP2A 1KY3A 1D2RA 1M8PA 1EKXA 2YICA 3IMFA 1E2LA 2ZYDA 4KQIA 4P98A 4BGIA 5U9CA 3ZKWB 1Q1GA 4WBSA 3WSWA 3PXAA 1CQJB 2H48A 4DUPA 3O4VA 4G5SA 3T1VA 3N2GA 3ZK7A 1Q7RA 4DLNA 2C2ZA 1PZEA 4MMYB 5LWQA 4ZRNA 2O7NA 2BUAA 5CDFA 1KDTA 1QFZA 4J4HA 3KQQA 2Y1WA 1TQHA 3ZS9A 4TS1A 1PEDA 2OBMA 2DC1A 4DWWA 5C18A 3BSYA 1AX9A 2I7XA 3CW2A 4MQ6A 1ORRA 1JX6A 2QUJA 1T2AA 4JDPA 2IK8A 3P0EA 4ZOEA 3S7TA 1IWOA 1CZRA 4AZWA 4A16A 1DUIA 5FHQA 1I7LA 3IMKA 2AUMA 4OU4A 4D8TA 2ZB4A 1GRVA 1K6JA 1D04A 2ZRMA 3A1CA 1XK7A 1VB3A 3DBLA 4LJ7A 3U3DA 1P5JA 1U7WA 3NORA 3QUAA 3E4CA 2CMKA 3GLGA 3KV1A 2J5QA 3IT1A 3LPCA 1EFLA 1G60A 4FFBA 4GQBA 3W5HA 4OYLA 4BEVA 1EZ1A 1WMDA 4DT1B 1YR7A 4Q1BA 1UFRA 2CXRA 1NIJA 5BQOA 3PWKA 3VO2A 4E5KA 4EYGA 5JD5A 4LS3A 3EPJA 1CY0A 1RAGA 3PLAE 4UBNA 4BXOA 4XJSA 4QOSA 2BTQB 1IWPB 1I9GA 1UJ4A 2IE0A 4HDMA 4E3ZA 1MB0A 1UWKA 5J2TB 5DGXA 1ISRA 4JBWA 1DCKA 2OENG 1T8PA 2Z1MA 2GHTA 4L08A 1U6IA 4ASUD 1F5NA 1WPGA 2Q6LA 2C92A 1MIOA 4MYDA 4RLQA 1ZKMA 5B3AA 5L7WA 3VKVA 4LF5B 2J3LA 4F8JA 2HRCA 3SE0A 3GLIA 2MDTA 5ICCA 2I8CA 2O52A 3LXXA 3BF8A 1GT6A 3UMYA 3KX2A 2EC5A 5K4AA 3RFXA 4R1SA 3TTXA 2WE8A 5EJ5A 1IM8A 1GR0A 2REQB 2XE6A 3RSFA 3OUUA 3T12A 3ZX4A 1K63A 1RS0A 2C97A 5ICFA 5K0ZA 2ZUCA 1JJAA 1UPXA 1DKMA 2NP6A 1SVLA 3Q7PA 1X94A 2XYVA 4Q00A 4QTUB 3DFUA 4LF8B 1QF6A 4BRZA 3WQRA 5CA1A 2CVQA 1YDEA 4BLRA 2ZRHA 5KYNA 1SK9A 2PRYA 3B85A 3TAHA 4P3XA 3AFOA 1C30A 2VSXA 4UD2A 3UY4A 3FR7A 2IUYA 4NP6A 3T7KA 3BD6A 3N2GB 4NSNA 4PC6A 1FRFS 3KOYA 4LJ8A 2OCKA 1E7MA 5ILOA 3HB7A 1SZJG 2G06A 4YMUA 1HL3A 3OO1A 4PXAA 2JFOA 3OE7D 2Q3EA 4FPXA 1BN6A 3BVPA 3NU1A 3VFDA 3KOZA 2TMYA 2LD4A 2M1XA 2EU8A 4LC0A 4UCWA 2ODPA 3Q0IA 4JBGA 2K5UA 3EPRA 3R3VA 3DOCA 1V8FA 5AVKA 4MVJP 3ZE1B 2GB4A 4XIYA 3ZXIA 4J6FA 4X1KA 4B71A 1DS6A 1JA0A 4EGCB 4F3CA 3OO0A 6PFKA 3DBLB 1OLUA 2AUTA 2JGAA 2X3FA 5BQ5A 2PYIA 4EABA 1TJ3A 1DOZA 5ALOA 3TLZA 3DBRA 1XMJA 3GLGB 2XTJA 3HU3A 3HK2A 4FFBB 1OVGA 3K1ZA 2O2CA 4R2KA 4RWZA 5B6JA 1BEUB 1RYYA 4AJ9A 2C0CA 4TVBA 2O5EA 1FPMA 4GO1A 1B16A 1EHIA 2AWOA 4V0KA 2FSVC 2ZKLA 1OAKA 1VCHA 5AQ1A 2QQ5A 1I0LA 3D6AA 4HDMB 1SR8A 5DNVA 1DRKA 4WNCA 4URFA 5B36A 2HI0A 4BL5A 1Z0IA 4FYPA 2CN1A 5HIJA 5HUQA 4AQ7A 1UBTS 3AF2A 1TUIA 2ZSDA 1O96B 3B89A 2QLMA 4IRMA 3JXEA 2P90A 4DNPA 5L7TA 1LA2A 1MIOB 1HORA 1P1RA 1B7GO 1SEPA 2APJA 2EAUA 3B5EA 3IQZA 2OSVA 4RHEA 2C54A 4ZT6A 3DXFA 1GTRA 1Z4PX 4KH1A 3KQUA 4NESA 2DLCX 1FE8A 2N75A 1Z7GA 2LUOA 1S7GA 2YY5A 3SHVA 2ZIXB 3V4ZA 2WTEA 2CGEA 1NOKA 4P7JA 2ZCJA 3GT7A 3D7SA 1ONPA 3EIEA 4ZJUA 1ORVA 3ZQ6A 1EP9A 4A0FA 2VFAA 1NUHA 2WTBA 3E9MA 5THKA 1ZJWA 1V8DA 2VZEA 1UMBA 5IAKA 5CA1B 1V3TA 2W58A 2Y6UA 3AR4A 2P9QA 3U9LA 1R0SA 2RBGA 1MH1A 3EVFA 4LGCA 4EDHA 2WWXA 3PITA 4OMUA 2UKDA 1C30B 1CUIA 1MW9X 3GY0A 3OE5A 1DZ3A 4IXMA 4NBLA 4PC2A 2MJLA 3IKVA 5CURA 3JZFA 4HH1A 1EESA 3TCKA 1E3QA 2DTEA 1AXRA 3ZZTA 4OATA 3MTBA 4BBPA 5ABPA 2ZIVB 5G3ZA 4C4OA 9LDTA 2GCIA 3ESCA 3WRXC 5BV1A 3AU9A 3K09C 1Z18A 4GKJB 3IIEA 2SNIE 4JCCA 4MVCA 4Y6OA 3U0BA 1HNWB 3QX3A 3KAJA 2JI8A 3GJ3A 3RC3A 1P1FA 3VPBA 1VIDA 3CW8X 4BQPA 6AT1A 2WIFA 5IC6A 4JJZA 4PTYA 2YXDA 4QM7A 1O4WA 2E21A 3PEUA 1TK3A 2C9YA 4N3GA 4F1JA 4X1KB 1R4MA 2VYNA 3EC1A 1UPTA 2GEBA 3NT4A 4LCBA 5KSPA 1OLUB 4S12A 5EFOA 1T3GA 2W0MA 4I3FA 4MYSA 5A71A 5BOSB 4NYIQ 3DBRB 3CLHA 2DE0X 1U1IA 4DNXA 3P27A 1GPAA 4YV2A 4C7JA 1KR5A 3F6CA 4NAVA 2O2DA 3UMJA 4ZARA 5TGZA 5C7OO 1D4FA 3VV2A 1H5QA 1YQUA 1RZUA 5JXJA 4BKPA 1K5HA 3R3XA 2ADOA 4LTDA 1FMCA 1N8TA 3OECA 2Q6OA 4O4JA 5BUQA 3CFYA 1WKVA 3TWOA 3BGOS 3F8SA 5AM0A 1E59A 3C3BA 3IPYA 3IS3A 1WR8A 3NWPA 3R4VA 3CW9A 3TUJC 3SJUA 3DEJA 2ZDQA 1QYDA 1DZIA 2D13A 1QKJA 5EPUA 3K70C 5A02A 4X85A 1ZVVA 4JB3A 4MVJM 3LWNA 4EPXA 4GG1A 1AUXA 3BE6A 1GLNA 2G80A 4KNWA 2UZIR 2WJWA 5JH7A 2CFTA 2HIMA 4LMPA 4CT0A 4C5AA 2LGJA 1NQXA 3BWCA 3EF0A 3L0PA 3IHTA 2VCYA 3PTLA 3D4LA 3LJKA 1OAOC 1MMFB 3ESRA 3CSUA 2D5IA 3RRBA 2Y2VA 4X93A 1S89A 4TYWA 3IQEA 1NBOA 2PTHA 3R0JA 1PDWA 4D4LA 1E20A 2H31A 3PWSA 4I08A 1NKVA 4LI3X 1U0FA 1UMBB 1KJYA 5NLLA 2B4QA 1D0VA 4S24A 3HLYA 4ZO4A 5LDGA 3E48A 3UAYA 3ROKA 4GXTA 3RADC 2QTZA 3HHPA 4I3GA 1FPQA 1MU0A 1XZBA 5JCOA 1JTFA 3C5EA 3GFPA 2H2DA 4MB2A 1K7CA 3FWKA 1EB8A 1X15A 2JIPA 5KNDD 4CMAA 2B6NA 1HOXA 1W75A 2INGX 5DTIA 1OI3A 4P2GA 2UDPA 2J4DA 3CLSC 3DDSA 3BZUA 2GS9A 1HY3A 2PX6A 1J20A 4QEDA 4LHZA 4ZVTA 5TPZA 1C7QA 2I54A 1JDUA 2ID4A 3HI4A 2DH6A 1G63A 4YUVA 4HV4A 2XB8A 1UBMS 1EA7A 4BFVA 1ZKDA 3O5AA 4WNYA 1V5EA 4ZK6A 4QULA 2BMAA 5A5DA 3G5MA 3V32A 5F52A 4ZVSA 1UDRA 3CMMA 4CETA 2XLCA 5IU6A 1R4MB 4BRWA 3FDZB 3T4PA 1JU9A 4RD0A 3IQXA 4I99A 1T13A 4M1ZA 3IOBA 3RU2A 3HCOA 3HA5A 1TIBA 3JYHA 4KQ9A 3D0QA 5LIPA 4H0CA 1AQUA 3QK7A 4R2IA 1UPUA 2PUFA 1H0SA 3H1TA 5ITZA 2X5OA 4ZKDA 1UAGA 3AM5A 2FEMA 1P62B 2V55B 1SIBE 1Z7YA 4DUYB 5HP4A 1SUEA 3D7MA 1XZHA 4D9CA 4DM7A 2C4KA 4P5PA 2AK3A 4BO1A 4PANA 1JSLA 4CUJA 1YHZA 4CDNA 5FWXA 3M0EA 3FUTA 3S5JA 2G0NA 3O95A 5FWDA 4CGYA 5JFTA 2FG5A 5DP2A 1J42A 2FPMA 3V4PB 3GVHA 5TS2A 2PGNA 4DWJA 5A4JA 2LP4Y 1NBAA 2DG2A 2C3PA 3CUKA 1CR2A 3MWEA 4KYIB 3UPTA 3N8HA 1UH5A 1H23A 7REQA 2QXUA 1PFKA 1VHTA 4MROA 5A5VA 5JH7B 2C3YA 1W30A 2O3SA 4KIUA 4DCVA 5JECA 3TZ6A 4NCJA 1ATIA 4JUCA 3BSSA 4KU4A 1P3DA 3ELWA 2ZXFA 3CZCA 4HWOA 1KEUA 4L4YA 2W6ID 3R9KA 1YTUA 1CCWA 2CLCX 1RWVA 4D3DA 1RWPA 3UWMA 1H22A 1UXIA 4G89A 4FFOA 3D8HA 4Z9AA 2PAAA 5FL3A 3VHQA 2BGMA 2KE5A 2BBOA 4JT2A 3HDJA 1LPNA 4GXNA 4WOKA 3ORHA 3ILYA 3RREA 3ZJVA 1E2GA 3ZHXA 1PWYE 2LCIA 3THRA 2JL1A 2XMCA 1B41A 5EE0A 3ZW8A 2Q1UA 1K7XB 1P0MA 4JEHA 3G13A 3MTGA 4HDAA 4XE5A 5ERGB 1NI5A 3DD5A 2AN1A 3QOWA 4TWJA 4B3JA 1FVOA 1WSWA 4WE3A 5JQWA 2YVLA 4X63A 3ECAA 2QW8A 5DT2A 2GPTA 4IOKA 2P0YA 3WDSA 4TLDA 4YAWA 1I24A 4RTJA 1QSGA 5H7XA 4F8YA 3JAWA 4M1QA 4MHSA 3G49A 4UUQA 3ZHBA 4EAQA 2AOUA 1GYRA 4CI9A 5A4FS 1Y4SA 3MHTA 1PE0A 4CM3A 2CMDA 3CH4B 2G9NA 3OQ1A 3W34A 5IANA 1TGYA 1X9HA 2XTAA 4KAXA 4DLPA 5HQTA 3DFFA 4RETA 1JI0A 2PGOA 2RGNA 4CBVA 3KXIA 3TGLA 4ZPXA 2RK4A 4IJVA 5CW1A 3T94A 1OXTA 1SVIA 3FPSA 1VLQA 3COVA 4CQJA 2ZVJA 3BIJA 3QKWA 5LQAA 2BE7A 1VSVA 5EMMA 3VVMA 2FWIA 3HU5A 5J59A 4ARCA 5E0KB 4B4DA 2IZOA 1UR5A 3TRFA 5ITZB 3L7CA 4QLBA 4JXXA 3W6PA 4N6OA 2ZQZA 2XKBA 1YZLA 1O97D 3NEPX 4ERXA 1YJ5A 2NYAA 1QB8A 2AHRA 1Y98A 5JDIC 3GFGA 2G4CA 1A4XA 3I9KA 5HE8A 3L7MA 1II0A 4G07A 4COKA 5FWXB 4I66A 5DYGA 3VHRA 4RU1A 2QJFA 3M6LA 4YAUA 3J81k 2JG3A 1A50B 1JDTA 1EFTA 3ORFA 2RFLA 2B1GA 2COKA 1W5EA 2N46A 2V6MA 2ZR8A 3F7TA 3HZZA 2PM8A 4RUKA 3MWEB 2H3EA 5ILGA 3TH5A 1F0YA 1ODJA 4GGOA 7REQB 1RW4A 2H17A 3OQBA 3I9NA 3M9LA 3THYA 2VSQA 3FROA 4BEWA 5ALZA 3H2IA 1LQ2A 1XZMA 4QUEA 4QPDA 2Q9AA 5JE8A 4UFPA 1OD6A 2DPYA 2BN4A 2CL0X 2Z98A 2VAPA 3EWNA 3F49S 4GOJA 4OHCA 3KYJB 3A10A 1DXQA 4XDZA 5EGNA 2MYUA 4QBKA 5KPJA 4Q3KA 1UWVA 3VRHA 1KC1A 2WSYB 2Z3VA 3A9SA 4QTYA 3JU3A 3HJGA 3IVRA 5GWXA 3K94A 3QW2A 2X8AA 2R85A 2D1FA 3K96A 3N2KA 4P4GA 5F4ZA 3ZI7A 3BDAA 3ND8A 5T8KC 4BLWA 5D85A 4K05A 1RZVA 1O94D 3RT9A 1JPNA 3RT7A 4R8RA 5EESA 5HFAA 3WLJA 3QWAA 4OHKA 1VYUA 1FXWA 1R3UA 4LKRA 3GXOA 5FUMA 1TU0A 3NYQA 2GCEA 1EQAA 2JHPA 4ZYVA 3EZ6A 2DGDA 1BE1A 2A7XA 2HA2A 1FDRA 2GRUA 1WX1A 3N2IA 3PHJA 4LXTA 4ZQHA 5IXJA 4YP5A 2DWUA 3CNEA 4JBNA 2QMOA 2ZAGA 3JAWB 4BAZA 4C7MA 2JC3A 2IY8A 2AOUB 1WKBA 3TQTA 3V4OA 2DEUA 2XDAA 1SEVA 2NUBA 4P4NA 3F7NA 3WS7A 3Q88A 5BVHB 4AQYB 3U60B 1BGWA 4F4UA 1SG6A 1A82A 3BZBA 4MDEA 2VF2A 3LQRA 1KZGB 4MI3A 2IELA 3K9LA 1UPAA 3H8WA 2BHNA 2QQEA 3KE8A 1LBEA 1SU6A 1ML3A 4MWTA 2DWQA 4N5LA 3EUWA 1NLUA 2GEFA 3IAM6 4K2HA 3FFTA 2ZAMA 3V34A 1BROA 5CEFA 5I4CA 4MVJH 4EFDA 3T7DA 3AFGA 2GBPA 2WSIA 4FD2A