2PRKA

Synchrotron x-ray data collection and restrained least-squares refinement of the crystal structure of proteinase k at 1.5 angstroms resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
publication title Synchrotron X-ray data collection and restrained least-squares refinement of the crystal structure of proteinase K at 1.5 A resolution.
pubmed doi rcsb
source organism Engyodontium album
molecule tags Serine proteinase
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1987-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2prkA00
3SICE 1Y3FE 1VSBA 1KE1A 1Y3BE 2V8BA 1YJCA 3PTLA 4CG0A 1YJAA 1KDZA 1ST3A 3DYBA 1P7VA 4ZARA 5JXGA 1V6CA 1SCJA 3DE7X 1R64A 1BFKA 1TM3E 1GTJ1 1GA4A 1SELA 1IC6A 1SBCA 3A3PA 1Y4DE 5JMOA 2XRMA 3GCWA 3I2YX 1P8JA 4Z2AA 1Y34E 1Y4AE 3WHIA 1TECE 4WOCA 2HD4A 3LPDA 2PQ2A 3OSZA 1GNVA 1SPBS 1SIUA 1SBIA 2G4VA 2Z30A 3CNQS 1SBTA 5JXHA 1V5IA 4C3UA 3A3NA 4C3VA 2TECE 1IAVA 2ZRQA 2PMWB 3I37X 3Q40A 2WUWE 4RYDA 1WMFA 5FBZA 4WOBA 2Z56A 1YJBA 2HPZA 1R0RE 4DJ5X 5B1DA 1PTKA 2Z2YA 3F49S 1TM7E 1Y3DE 1SUBA 1LW6E 1Y48E 1SBHA 3AJ9A 1OYOA 2IXTA 3SQOA 3BX1A 2SNIE 2X8JA 3PRKE 4CFYA 4ZOQI 2W2QA 1BJRE 5ARBA 3D43A 4LVNA 3P5BA 3EDYA 4AKTA 3A3OA 2GKOA 3DW3X 3EE6A 4FONA 2Z2ZA 5I9SA 4DWWA 3DE0X 1Y3CE 1S02A 1EGQA 1S2NA 1BE8A 1PEKE 1GT91 1Y1KE 1C9NA 1GTL1 4LVOA 1SBNE 3LPCA 4KB5A 1SCDA 3AFGA 1SUDA 3L1KA 1KDYA 3HJRA 1TO2E 3AJ8A 4B5LA 1AF4A 1SCAA 1SCNE 1C3LA 4KG7A 2W2PA 4H6XA 5JXIA 1ZVKA 1WSDA 4OV6B 1MEEA 1KE2A 4GI3A 4H6WA 1SCBA 5ARDA 3Q5GA 1UBNA 1TK2A 1OT5A 3D9QX 3VHQA 1SIOA 1S01A 5AMXA 1DBIA 1NDQA 4JP8A 3DE1X 3WIVA 1MPTA 1YU6A 2W2NA 3DE5X 2W2MA 3DE3X 3GT4A 4MZDA 2WV7A 1TMGE 2PWBA 4M1ZA 1AK9A 2SBTA 2DUJA 3DE6X 1T1EA 3DDZX 1PJ8A 3BPSA 1SVNA 4BWGA 1GCIA 1C9MA 3I34X 2SECE 3DE4X 3VV3A 1AQNA 4DZTA 2ZWPA 1BE6A 1SUPA 1TM4E 1SIBE 1T1IA 2PYZA 3DVQX 5B1EA 2QTWB 2Z2XA 2ST1A 1TO1E 3T41A 5AQEA 4K8RB 5CW1A 1GA6A 3F7OA 5JXJA 3DE2X 3QMPA 1GNSA 3VTAA 2SICE 4I0WB 2XTJA 5ARCA 3TECE 2WWTA 5SICE 4CFZA 1NDUA 1BFUA 1AH2A 4NMXB 3GT3A 3H42B 3F7MA 2W2OA 3TI9A 1P7WA 2WUVA 3EIFA 1T1GA 2PWAA 2ZWOA 4H6VA 1THMA 1Y33E 3DW1X 3TI7A 3LXUX 2B6NA 1GA1A 4HX2A 4J94A 1BH6A 3VV2A 3VSBA 3DVSX 1SH7A 1CNMA 1KDVA 1AU9A 4NE9A 1A2QA 1R6VA 3QTLA 3CO0S 3WQBA 1SN7A 2DP4E 3I30X 1AVTA 3ZXYA 1EA7A 4KPGA 2E1PA 3LPAA 3ZXXA 1TM1E 1ZVJA 2X8JB 4YN3A 1HT3A 5AVJA 1SUAA 1GTG1 5FFNA 4OMDA 3QFHA 1Y9ZA 1AV7A 1PFGA 1ST2A 2DQKA 3UNXA 5AVKA 4NE7A 1JEAA 3VYVA 1SUEA 2IY9A 3DVRX 2ID8A 1Q5PA 2PKCA 1SUCA 1TM5E 4HVLA 2Z57A 1C9JA 3WIUA 1WMEA 2P4EA 1DUIA 3BGOS 3GCXA 1NLUA 5K7SA 1WMDA 4OMCA 1CSEE 2Z58A 1XF1A 1WVMA 3DWEX 4AKSA 2ID4A 2PRKA 5FAXA 1OYVA
chains in the Genus database with same CATH superfamily
3LKVA 3PGMA 2Z5LA 4HQ6A 4GFDA 4RLQA 1EBBA 3D4OA 3QJYA 4BNZA 1RXWA 2X2PA 3LDGA 4AZ0A 2BKVA 4CG1A 4JBGA 4DREA 3M8KA 1M2HA 1NV9A 1QHXA 3BAZA 2BH9A 1LSUA 1L3BA 2JFBA 5AHWA 5CA0B 5AM4A 2GPJA 4QPJC 4K88A 2AYZA 2E1RA 5CNKA 1W47A 3DEIA 2M9MA 2GJ8A 3ROXA 2DRIA 4F6CA 2OO5C 3M6UA 5ECGC 4J07A 2FR0A 4NK4A 1KAOA 1ISHA 5EHGA 3RU9A 4AYWA 5LYJA 5JXGA 4ZODA 2O3RA 2UVDA 1TMKA 1TUBA 3BMNA 3F4BA 3RC3A 5JIBA 3KLBA 5KTTA 5SY6A 2JLXA 4QECA 3CF4A 4O29A 2PBFA 4ZAZA 5CB4B 4DCVA 2EIHA 1Y37A 1OYWA 4ZEMA 3HY3A 2NPIA 5EQJB 5AK0A 4GVPA 1GA4A 2FW9A 2QSUA 5K0NA 3F5MA 5IN5A 3NOOA 5HX7A 4RIFA 3VR5A 1HLFA 4KWIA 3GXOA 4BPBA 4FEAA 3RIYA 3VAZA 1ZIOA 4ODIA 2VWGA 3ANSA 3V4ZA 2VQ6A 1DBRA 3W6ZA 3OE1A 1JVSA 4HWTA 4O8ZA 3HEBA 1W19A 3AXTA 1TAGA 2HMWA 5FWDA 1B74A 1NW5A 2WJWA 3CVOA 3IIEA 4LYYA 1DQNA 1PT9A 2JAHA 2PL9A 5I7EA 3KYDB 1FVXA 1U2QA 4DDTA 4B3XA 1GYQA 4BMSA 3U0VA 2OGZA 2BR5A 3ZE6A 4QXAA 1ONOA 1N6OA 2R8XA 3T54A 3W34A 5KQSA 4UD2A 5JLAA 2HRDA 3AT1A 4EFNA 2GNOA 3ISTA 4H3SA 3TTTA 2Q50A 2GPNA 3CU5A 1XB2A 3FWNA 2QPLA 3GFBA 4L2IB 4QU9A 2AOWA 5FXMA 5KWSA 4WKCA 1H2AS 1MORA 4XYGA 2V45A 3SHOA 1GTZA 1KOJA 2P5TB 4QEKA 1SBTA 3VSCA 4UM9B 2D1YA 4YHBA 3SC2B 1N6PA 4Q3NA 3KYIB 1GM5A 5D6OA 1IK6A 2G6BA 2OGTA 3I73A 4ERNA 3LX8A 1Z0KA 5C8XA 1EFUA 2P0EA 4ND6A 2ZRQA 4LJAA 4WN9B 5EP2A 5K99A 1HNZB 1M2EA 3I37X 3N74A 3FR8A 5BN5A 4TXJA 4UMFA 2AXNA 5KNCA 2AJBA 3PC8A 4F12A 1GXSA 2IJGX 2DWPA 4QM7A 2RGUA 1UMBA 1GU1A 2YIMA 2HOQA 3B3FA 4RY9A 4CI0B 4DJ5X 1ZNXA 2AL7A 1JMKC 1QMPA 1AOXA 3BRWD 4UQPA 4LHVA 3NZEA 3WNBA 4AY6A 3OMLA 4ZI3A 2F55A 3FCXA 4U8HA 1QQ6A 1CZLA 4OL0A 1MU0A 4QAQA 4A9AA 3E9YA 3LY9A 3WGLA 1G8AA 5HRUA 4Y0VA 1JEYB 3NT2A 1Q0LA 1LW6E 2R7AA 3CUKA 3RUDA 4DMUB 4L5YA 1I94B 3EXEA 2MYUA 2DYKA 2M98A 1K5PA 3JSXA 3S4YA 1VL0A 3SC3A 3OT1A 4FP9A 3WBFA 4PFKA 3WYCA 3GRYA 2QSYA 4MJ3A 3W79A 1J33A 2FDXA 4J16C 4B34A 2JC3A 1WUIS 2IXTA 3GMSA 3SQOA 1HG1A 2P9BA 5FOVA 5F64A 4EEZA 4JI0B 4I50F 4QO8A 3DEFA 4YMHA 4Y2RA 2ZI7A 3S55A 4DIMA 5LXTA 2OWDA 4FQ7A 4BO1A 1RIIA 2EFCB 1XV5A 1B1CA 3IPYA 1L3CA 2CL6X 2FGKA 2OCLA 3GJ5A 4LTMA 4NEQA 4MI9A 5ESRA 5K2OA 1ISJA 5DXJA 3C2QA 1Z62A 4Q1EA 2AOTB 2RHRA 2JFWA 4HDKA 3OCZA 1FSGA 3C6BA 5IAOA 1RLOA 2XWBF 1P44A 2BI8A 1EYZA 3MCTA 4HTAA 4MR8B 1XDSA 2VK4A 1CVIA 3I4CA 2NWQA 5TY0A 3X1JA 1T2UA 3E22B 5LKAA 3O94A 2Y1OA 4JT8A 1WLSA 1XZMA 1HZJA 3DAGA 3LECA 3P4XA 5LQMA 4M49A 5EXPA 1TJPB 2D5IA 3KHKA 1AXEA 2B5VA 3NIBA 1IQPA 1NXOA 1SBYA 1PUIA 4WN3A 1USGA 3EGOA 3EA4A 2WQ7A 2NTVA 4R1SA 3TKYA 5J4HA 2BEUB 4G9EA 3DT8A 3OT5A 3RWBA 2HRCA 1L1FA 1V1MA 5IK2D 1Y3CE 2O2YA 1W85A 1W4LA 1ETHA 3V32A 3UK7A 4FHCA 1EXDA 2WU3A 3NEJA 4CBVA 4ARBA 4IUCS 3V48A 1VL5A 3TDNA 1ESZA 4RMGA 4RIIA 1R27A 5LDGA 2C92A 4P2GA 5I8PA 3G9QA 4JGBA 2YOHA 1JEQB 4DT1B 1SB8A 2SKCA 1SUSA 1NLYA 3L7JA 1R8SA 1VG8A 4OU4A 3GGOA 4B33A 4KQ9A 2VYNA 4BXOA 5KPJA 4TV8B 2A5YB 1JMYA 2B4KA 3VOBA 1CZKA 1QYVA 4ON9A 3D6JA 2RI0A 1BMTA 1HWYA 3HBJA 3WRWA 1JL3A 4M46A 2IITA 2FZ5A 3PFIA 1CNFA 5BR8B 3N6RA 1GZ3A 2GTPA 4XWTA 2OOKA 4A0SA 5BVHB 3L6OO 3W9YA 2D2IA 3ONFA 3OOJA 4G25A 1R9GA 4AMGA 4K6CA 2OO5A 4MA5A 3DBVO 3ANMA 4J0CA 4N03A 3QE2A 4PW0A 4RHCA 3JQEA 3ONWA 2VK1A 3L0ZA 2RIRA 2HQOA 5ALOA 4B5LA 4OJQA 3KAQA 2JS7A 3V1TC 1DX6A 2OPBA 1BXZA 2JBHA 1ZR2A 3QX3A 2AX3A 1FNDA 2A35A 2PGAA 4QDKA 1UPXA 2RHBA 1TQHA 2FW6A 4WD3A 2W70A 9LDBA 3CEJA 3KQSA 3LUFA 4PZPA 2YVUA 1X7ZA 5C8YF 3UFBA 4Q0MA 4J6FA 1ZAKA 2J3LA 4M3NA 5AIBA 1GQFA 2OD7A 5HM6A 1JR2A 2ZVJA 3EGCA 5HEKA 1XRJA 3G6KA 4KN6A 2GCGA 1K68A 4NRDA 2O8EA 2W6JD 4BRZA 2CL7X 1W94A 2RKOA 1NTOA 3AKEA 3EOZA 1SM4A 4CKBB 1NT4A 1YQGA 3QE3A 2E87A 1U7HA 2OILA 1BDIA 3JZDA 3VKGA 4PEVA 1TDJA 1YE3A 3C1UA 4GHWA 5E1OA 1U9ZA 4YQZA 3HVKA 1FBNA 4JV5B 1ZJWA 3OX2A 3N2EA 3PD7A 4IIHA 4NYIR 4FJ1A 4H59A 3OFND 2NTNA 3X1XA 1DIAA 1C9EA 1CRLA 1NNSA 1RMYA 1WB4A 4NS4A 4QGHA 4CTJA 2Z5GA 1L5NA 3CSUA 3OZXA 1XJ0A 1FX0B 4YCBA 3G2MA 2ZIWB 5FI5A 1ZVMA 3EQ2A 5IFKA 1LTHR 5K3AA 4MZDA 3C7AA 1N7IA 2X0EA 1Z4QA 3N6VA 4K6MA 3EGIA 4MVYA 1DT3A 4J2HA 4WLOA 2XJ4A 4TMZA 4LZNA 1EBUA 1WA5A 1GGHA 2H2IA 4N7BA 4M22A 4LECA 3I0MA 4KHZA 2EL7A 3NCTA 3CH7A 1PJ8A 2D3TA 2PRSA 1TZMA 2VT7A 3UUFA 2JVJA 3IVXA 4HZUB 2I6SA 4YO7A 3BPSA 4AS3A 3EAGA 1P77A 2HXSA 2QV7A 4JX9A 2W83A 3QF4A 5E7IA 4KX5A 2Z95A 3VR0A 4OYYA 4BATA 4DPKA 4J2OA 1P7ZA 1H2XA 1WOYA 4YRPA 3I9KA 3DTVD 3IKJA 4WK0B 3U7JA 3R7DA 4PONA 5FI1B 2CDNA 3GRUA 2HJGA 2PGOA 3O03A 4G07A 4YNBA 2OCPA 3OBIA 4BKOA 1IN1A 4QPPA 4DMCA 1SUPA 2WMOB 2O19A 2IP4A 2HL6A 1IWOA 3PNQA 4PFSA 5EMNA 5EPUA 4N8SA 1T1IA 2IOHA 1C9DB 1ZWKA 2APJA 1VBMA 4B6PA 2XE6A 1WP4A 3HBNA 5BRAA 1VIVA 4PPGA 4INJA 3WBBA 4JASB 4X7MA 5FFMA 3OPMA 4HDNA 2PUCA 1CEEA 2FEMA 4IDDA 3QELA 4FFWA 5MN6A 3S1AB 4G41A 2ECQA 4KR6A 2BKUA 4B7XA 4P4TA 1A2KC 1PAUA 2P4QA 3WBKA 2BGGA 3IR5A 4M8KA 1ISRA 4GXQA 4D3DA 1DUVG 1IVNA 1FBTA 1VOTA 4FNOA 4NC9A 4BB6A 4F5WA 3GEHA 4QJ3A 1E1RA 1Q0PA 1QNFA 3QHAA 3NH6A 4S1VA 4D9IA 2A7XA 2TMYA 1HEIA 2IFTA 3QVWA 3PF9A 2C2KA 1FS6A 1K7XB 1TMOA 1TA9A 5TJHA 1J5PA 2QPTA 4MP3A 1GNSA 4ZPXA 3QFFA 1MV5A 2OYCA 3RVQA 4BFLA 4ZIRB 4I0WB 4EQZA 5ED4A 4CE6A 1GPMA 3CO5A 3L8YA 2FPMA 3QU7A 4IDAA 4KXLA 4DIBA 3FNGA 3F7TA 4OGWA 4D44A 4ND4A 2QUZA 4BNXA 1Q57A 1UZAA 1JI3A 3ESQA 1AKUA 4WOPA 4Y6GB 5GJWC 2FEAA 2BY4A 2PMFA 1VJRA 3HKBA 3NGXA 4H7DA 5CD9A 3GV0A 1QTQA 4F4JA 3MMSA 4EZBA 3DUFA 2NT4A 1P4HA 5DWVA 2HA6A 4JLNA 4CTNA 1XJ5A 2ZBVA 3B6KA 4Q24A 2HIGA 4M7OA 4HB3A 1A8PA 5TT1A 5JTTA 1E2IA 1W1UA 4HSGA 1B4DA 1SC4A 2H2AA 1KF0A 1XA3A 1YHZA 2IXGA 3LW7A 5LU8A 2R3SA 3R8CA 3W9SA 1VGQA 3SD7A 3GFRA 2HT1A 1ISMA 1QORA 2R25B 2WF6A 1KNQA 3OWXA 3BGIA 3HDTA 5DRYA 5FV4A 5AR1A 3FGPA 1K3UB 4BEBA 1QFXA 4ZCLA 5I9TA 2WPNA 3AVPA 3UKJA 1NASA 1H3NA 4NPAA 3DKRA 3T06B 1H05A 2Q5QA 4YMSA 2Z6UA 4HDSA 4CKCB 4H31A 2ZPTX 4DZZA 1HGXA 3JQ8B 5LD2C 4BYGA 5DCYA 4YCDA 2J08A 2ZTLA 2INGX 1A9OA 4PN7A 2X22A 3BRSA 3LCMA 1ORVA 1G21E 4MWEA 3E1KA 4AIRA 4Y2SA 3WOVA 4I46A 2BEVA 4PZ9A 4UASA 5F35A 4EG3A 5JZBA 4IJQA 1SKYE 2P6MA 1W1WA 3KT0A 3AC0A 2I6UA 3DV0B 3L41A 1NLMA 2CXNA 4X20B 5CCXA 4C2AA 1KI6B 2F7SA 3LMKA 1LVHA 2DUWA 2HGSA 3GPIA 3NKVA 2HSWA 1J00A 2W2KB 3IP3A 3UJPA 3WK8A 3GRFA 3RASA 3TR6A 3ND7A 2FPRA 1I3NA 2HU2A 4XGNA 4JELA 2QORA 5DM4A 2YCBA 3MQFA 2C7VA 3BWCA 4QA9A 1C7ZA 4MHOA 1E7MA 4QTYA 4G0OA 1KYQA 2WT8A 3E9ZA 4MVJP 3EVNA 4X91A 3ZJ4A 4R05A 4INOA 2A58A 2JL1A 4M87A 1EINA 4X62B 3W9UA 3SE0A 2OSVA 2I1QA 1E1YA 3ZGNA 2CLFB 4XM0A 4CUZA 2EKPA 4B7CA 4U7JA 5A7FA 3LVQE 4WBSA 3L82B 1U8ZA 1USVA 2XVXA 4GMFA 2OA0A 1TCCA 4JFAA 3TSWA 5EMMA 4ZK6A 4KH0A 1OFUX 2ZBEA 1XVTA 1UWCA 1B0AA 2CK3A 1BC5A 1JAYA 1BKDR 1PCXA 2GRUA 3EMDA 4IVNA 3WNVA 3K94A 3IDQA 2UYCA 3P0EA 3AM4A 1G20A 2XNDA 3PV0A 2ZB2A 2WTAA 4P5EA 3ZQUA 4KW7A 3SZOA 1DGQA 3CPJB 1AKWA 2OYSA 2XDAA 3Q1LA 2I6FA 2RJNA 4JLWA 1CRPA 3WA7A 1ZK0A 2VRCD 2I2CA 5LP1A 5DP1A 3E58A 4GOOD 3B2QA 4S05A 4KUGA 1U1IA 1H1TA 1YAHA 1P75A 2W8BA 3OU6A 4RLHA 5AJUA 1GL3A 3MWFA 3W2HA 1GZ5A 1DS6A 4RF3A 3O4IA 1ZUIA 3ND9A 1WUHS 2FSPA 4NKRA 3H2JA 3ZCVA 1PRYA 3WGGA 5IJ9A 3PNSA 1FMJA 2LXNA 2PKRA 3KV1A 1FDOA 2G0AA 2HB6A 3ELYA 1ZN2A 1DEKA 4URUR 3W06A 2P2NA 2I3GA 4FYJA 4MINA 4XQEA 4BLTA 4TWAA 2NU7A 1PK7A 2ONJA 1WTAA 3DD1A 1S96A 4MARA 1N1MA 2HPAA 4MB0A 4AICA 3UB4A 1NW9B 2IS1A 4OA8A 3USCS 4EY3A 4ZFNA 4JT2A 3BJRA 1JEJA 3JZFA 4MQFA 4DRZA 4ALNA 2ZUEA 2EWWA 3TZBA 5KREA 1BCRB 2D5CA 3NEPX 2JZCA 4IJWA 4KZKA 4CDMA 3CMCO 4IXMA 4O2BF 3I32A 2ZS7A 2NU9B 4TTVA 4I19A 5LMNB 1NMSA 2ISQA 4I4TA 1WULS 5IH3A 4OI2A 4EZIA 3U3KA 4D8WA 1WZIA 3EXIA 4YRGA 2IEYA 1R15A 5L7TA 2A14A 1RYHA 4NENB 2AQHA 2R97A 1L9KA 4MCIA 1G20E 1L5MA 1VIAA 3FDJA 3RJZA 5IUNC 3G0HA 1ZI9A 1W88B 4GLLA 3UY4A 4C7OA 1VXOA 3V9PA 4D7AA 3BAFA 1CR2A 1NSFA 5EC8A 1FNCA 1C8LA 2ERCA 4MO2A 1I0LA 1FX1A 1N8TA 1WVMA 2QB5A 3DWEX 2R79A 4MQEB 4PC7A 1YCGA 4U6SA 2B8EA 2P0AA 3ZDRA 4F04A 2O59A 4C1NA 5G1NA 4I5DA 2O14A 3U40A 5SZKB 4JSTA 1DX4A 1PJ2A 3NWOA 1YRAA 3CNBA 1KP3A 2AWOA 1XG5A 3E82A 4B83A 3JPYA 1FXSA 1KZ6A 3Q3GE 3RJ5A 1QKKA 2A8YA 2XBLA 4JYMA 2VATA 5E9JA 2DHQA 3G8AA 3WGOA 5NULA 4C7MA 1U5AA 3CY6A 3T0IA 3MRVA 3W5UA 3GLGB 1P1CA 3DYBA 1E4VA 3Q12A 5EJAA 1N6IA 3OF3A 4II3A 2HWYA 3UQYS 4A8TA 4OBEA 5K8VA 3IKTA 2V4UA 3ZJYA 4LMRA 4P9NA 3U4MA 1VSUA 2C4HA 2QYHA 4IXTA 2PXAA 5BSUA 2ZSBA 3OM1A 3QP9A 4FBLA 5ETJA 4LUCA 5HFJA 2PKWA 1Y5LA 1X70A 4NSNA 3SIPA 1FSSA 2RH8A 3BK1A 3OUTA 4J0GA 3UAYA 2O2SA 3LG2A 5FIUA 4WNAB 3ZWXA 5CDFE 2FK7A 1E3JA 3O74A 3KKOA 3NASA 2QD1A 4P80A 4E5YA 4YPVA 2O5CA 5AO9A 3UWMA 1IQ0A 1IATA 5F33A 1TM3E 3BZBA 5GJBA 4AZWA 1SELA 5EJGA 5KTNA 1GPH1 4PS0A 3ELBA 1FVFA 2CVPA 4W5WA 4IIJF 4YA6A 4C5AA 1G59A 1EX9A 1II8B 1FLDA 1R8YA 2RG7A 3ESZA 5L3RA 3OJOA 1BMQA 3UAZA 4CM9A 5ICCA 2QEQA 4DA7A 3TCXB 3HS3A 4C30A 3TG8A 1YVRA 5F3DA 3H3XA 4CIXA 3RUEA 1RZRD 4ZICA 3KELA 3LYLA 4R1PA 2Y1XA 2PO5A 2C2HA 3D4PA 5FBQB 1DHRA 4X7RA 1VM6A 2BM8A 2I6TA 1C7JA 3H2YA 3PIIA 4HGZA 4U6NA 3OLVA 3M1AA 1NN0A 4ZT3A 5J63A 3AUTA 2CXRA 3VU9A 1OBHA 5BNWA 4NK5A 2GJ9A 3ZGZA 4ZP1A 1QQAA 4II7A 3LLCA 4R40A 2MWMA 4OSEA 2C9YA 4CW7A 4U39A 1E62A 4JJGA 4UOEA 5EI5A 2CDAA 4DIDA 2Y6UA 3Q7EA 1G19A 3VJRA 1V8PA 4LZPA 2EU8A 3PFFA 1IEQA 5LBUA 2WFLA 4MAAA 5JSYA 1FPQA 5IT4A 5KNLA 2A9RA 1V3VA 2OLKA 2PMWB 2QYOA 4YFVA 1J0AA 1D0IA 2QIOA 2X6RA 1T4CB 2PCLA 3QYFA 4IM7A 4J6EA 4YAOA 3LK6A 3DVAB 4LC0A 3OM0A 1ISSA 1GY8A 2HCRA 1QC5A 1JLLA 2PUTA 2WYUA 3D6HA 3FPFA 3ICWA 3NRJA 4HAUA 5IARA 1W73A 4P7BA 3UHJA 1LKZA 5IT5A 2YYZA 2AQKA 2OGUA 3ZS9A 2VZ0A 4KI0A 2Z2YA 5C4GB 4E13A 4R0MA 4BTLA 1VL2A 1AQLA 2JJ2A 3P9YA 3LKDA 3DQPA 4HRVA 4KIGA 3RO7A 3NBFA 4N82A 2GAOA 4GYJA 1NIJA 4NONA 3BA6A 3S3TA 4ZGGA 4BS9A 3VNAA 3JY6A 2NO5A 1H2BA 1VE7A 1VLMA 3QPWA 2XZTA 4LPKA 2ZR7A 1ZMTA 3BE6A 1IZZA 2AOXA 1OJLA 3BIXA 1B6RA 1RKQA 3F9IA 1JXOA 1N2BA 2MJLA 2ZOSA 4K1XA 3GLIB 4K9OA 1U2SA 4AJIA 2G8LA 5B4VA 4OXKA 5H4HA 3C85A 3EOAI 2QLLA 3A9CA 3HHEA 1G8HA 3QBJA 2BISA 4WWHA 3KXKA 5EL0A 3ZZ1A 4DDMA 2ZRIA 1I2ZA 3IL2A 1N3YA 1JGTA 3D3WB 3IVAA 2D4AA 1E1QD 1Y4ZA 2I66A 4MV5A 3TGWA 3ORRA 1OB2A 2NO0A 3R7AA 4A0GA 2Q8NA 1KO4A 2VHQA 1QF6A 1CNEA 2CYAA 2ZRNA 3EZ2A 3G68A 1L5HA 1ECFA 1Q44A 1VCOA 5ALDA 4UVIA 2IUFA 621PA 1DG3A 5JAIA 3W2IA 2H06A 2VJCA 3KSRA 3Q0TA 5T4HA 2BUAA 5KTRA 1GEGA 4B81A 5HUJA 1R16A 2XW6A 3LSTA 4FSDA 1RE0A 2J3QA 3LXXA 1EH5A 3T7EA 2DFPA 5JJCA 1HFEL 1U80A 1V7QA 2E89A 4FQ8A 1CU1A 3FB1A 4YRQA 2FUNB 3QZUA 2B2NA 2C5LA 4H08A 5JALA 4I3GA 3EIWA 4ZVMA 1PK9A 1WKCA 1ZJ6A 4N3BA 4ALMA 4YT2A 1J8MF 3WK7A 4PHTA 4OLBA 4JI6B 4P92A 3PGKA 3SQLA 3CZQA 2YWRA 3VR3A 1X7XB 2V3VA 5E0KB 4EX7A 3NTOA 1P2GA 2HCFA 4F45A 4ZI7B 1NYQA 5K8JB 1EFVB 3NWBA 5JSHA 3RKRA 2QTVA 1R0WA 1YL6A 3THSA 4NABA 4ANFA 3ZQJA 3GZNA 4YBRA 1IN5A 1TKRA 2X5XA 2O6LA 3ES9A 1QP0A 1L6RA 2GBCA 2OZPA 4KQ1A 2VDWA 1ZN7A 1VZ2A 1WUJS 4XIIA 1F7VA 4O1MA 5C4MA 2GWHA 2BM0A 3ODGA 4J1TC 2PKEA 3RT9A 3PC6A 3JVDA 1C8BA 1R5NA 2VPIA 3ZX4A 1GV1A 2FMIA 2FWIA 4BNWA 5TB5A 4DDUA 1GVHA 3IDSA 5A05A 3H4VA 4G8JA 5C35A 4EZEA 3UJNA 4DR1B 3ED5A 2V54A 5JS7A 3OQIB 3PEEA 2O07A 5CA0A 4IKPA 3ZU3A 4ENPA 1UPBA 3K16A 3E3NA 2B82A 4Q16A 4JI8B 2HA2A 3IIJA 4TS9A 4DQDA 5IEJA 4O4HB 1T10A 1FFEA 1GO2A 3JD4A 5ADHA 1FB5A 4Z4GA 5JS8A 1ENPA 2VPQA 3SJCA 4OX9B 1VP9A 2Y8EA 3WHKA 5B3KA 2A0XA 2FWJA 2XQVA 4UUMA 3T3MB 5CB4A 1C3XA 1MAVA 2A4MA 1FW6A 4HPWA 3M5DA 3ER8A 3BORA 4NMHA 4WZBB 3K1JA 3SWWA 2A9OA 4C5BA 4FWTA 4UCXA 1XJQA 1XA4A 3BTOA 3PNKA 4FYKA 3COWA 4Q1CA 1U0BB 4HO1X 2VH5R 2QROA 2NO6A 4D9EA 4XGKA 4DQ0A 4CODB 4YCAA 1TK2A 2IU3A 3T95A 1ZD1A 4TRJA 1Q74A 1A27A 3RSFA 2HA7A 1XD2B 3R0XA 1DBQA 1U7ZA 4UE6A 1XI2A 1X1RA 4XYEA 4LXQA 2XWSA 1AUQA 4DUGA 1LPNA 5DLQC 2B8JA 4IQGA 4G0WA 3GD5A 3UFXB 1Z73A 1M9NA 3KYDA 4ACBA 3ZVLA 2DERA 2FR8C 4QICA 5CVUA 4LSGA 1W4BA 2J4FA 3DKKA 1XLTA 3FUXA 3PVZA 4DQVA 5F9MA 2Q9CA 2W98A 5A9SB 3HMQA 3OZTA 4P2BA 1XKLA 1F38A 4LY9A 4MV6A 3WXBA 1LS1A 4J4HA 3DEKA 1E7YA 5MN4A 3WMGA 2BI4A 3OTHA 4L2IA 1HE8B 3PCRB 4TKMA 3F5QA 4WNCA 5IC5A 1DP4A 2WV7A 4DOMA 1KVTA 3Q7RA 4P4UA 3H0KA 3IGFA 4BB9A 3SC2A 2VPXA 2ZJBA 2XHEA 4KAXA 3WWCA 5DHTA 2JLRA 3BWBA 4WQMA 5T6MA 2V5VA 3HUTA 2EG5A 4M1ZA 3IDZA 3PFBA 2IZ5A 1J7JA 4GNKA 4K8OA 4LYAA 5TNXA 5B64A 1K88A 1U2DC 4WN9A 5EVJA 5J2TF 3K6JA 1A4XA 1PNVA 3DDZX 2BRUA 4GKBA 4AFNA 4BFZA 3GJ3A 1GJRA 3W5BA 3JQGB 4KPUB 3LE8A 4F72A 4LE2A 4M8SA 4UTOA 3F7NA 4R8MA 1ELOA 1NVEA 1YHNA 2OC9A 5CFLA 4IHKA 1ZGJA 3CPEA 5CCBA 4UE2A 4BNUA 3BXXA 4PYRA 4NZZA 3EZYA 5F3RA 2FEKA 3GDHA 4P0QB 4ENSA 2F1HA 4N54A 1Z0ZA 3DLPX 5IBPA 4DTCA 1CEYA 4FX5A 3NHAA 2Z04A 1K2VN 4N0PA 1H8HA 2YXEA 1QGUB 2MSKA 2V6FA 4PYKA 2PYZA 3B85A 3NBXX 5DPMA 2XVYA 5ES3A 4WCDA 3UG7A 1TL7C 5MGBA 3HA2A 3IBSA 4UHFA 4Y3UA 3HV0A 3SEAA 1CJVC 4HVTA 2B30A 3KOWA 2C2GA 2FMFA 4EYGA 4GRAA 4DNOA 1OC4A 3AILA 1D7AA 2HA4A 2HMTA 1M54A 2GFHA 3E9DA 1S4MA 4KDEA 2ODNA 3LWDA 4ZYVA 1NLZA 4GGOA 1PJZA 1P72A 4P86A 1V26A 4UBLA 4TMVA 1T9KA 4C0BA 5LZ4A 2ICAA 1PNQA 4GVXA 2ZSJA 2H4FA 2JGIA 3ANNA 3OPYI 3FMFA 2KW5A 3P9XA 4EPTA 4D4HA 4N76A 1Z5PA 1XHEA 1RPNA 2I4IA 1YDWA 4E5PA 3G5TA 8LDHA 1NXTA 4NY1A 4E6EA 1CQXA 1M6WA 2GTHA 5EZ5A 2AOTA 1MO5A 1O6CA 3H87A 4HGQA 2F3TA 1UM8A 3D4IA 1DC4A 4KQKA 1XWFA 2SICE 2XI4A 1XTRA 1Q0QA 4MR8A 4YJKA 5ALRA 3E22A 2W0MA 2I8LA 1EP1B 2DVMA 2NOAA 3MJSA 4H18A 2QU7A 1RAFA 1B7GO 4AJLA 3WA6A 5F2EA 3TUZC 3BB3A 1XRNA 2D5BA 1PFUA 3A28A 2DY1A 1M6NA 4NG5A 4C4ZA 2H1RA 2BEUA 4CQNA 1P1JA 1Q91A 3PRJA 1KJQA 4N40A 1L5FA 3PXDA 3Q72A 4N5HX 1SCIA 1RE1A 3AUUA 2OM2A 2GHRA 4OEHA 4WPGA 3SK0A 3SZ3A 3U7QB 3UV7A 2NQ2C 5K0BA 3NORA 2BBSA 3R5HA 5CCDA 4ARSA 1XU4A 4M1WA 5IVKA 3EPRA 5KDOA 2G17A 5LPNA 2W2OA 4QOJA 4LRXA 5LOVF 2A6PA 3Q6MA 4F86A 1P7WA 1GLVA 2FPGB 2VOJA 1UBSB 2FDRA 1MQAA 3IOYA 1F3LA 4YUZA 4QLOA 1JEQA 3OQ6A 4YPFA 1TZJA 3GG9A 3W2FA 4DT1A 2Z9DA 2IYEA 4J1TA 4M54A 1G5HA 2R1VB 2WHPB 1M6EX 1P60A 3KUKA 3P9ZA 4D8UA 4TV8A 2ZWOA 2FSHA 4EL5A 4KNWA 4AMYA 4Q6WA 4Y6RA 1WMBA 5E7MA 3VR6H 1BWPA 1JXAA 1Z68A 2FZVA 2XWPA 2EP5A 4HPJB 5DGHA 1AUVA 1PLLA 3SMVA 2IX3A 3VPAA 3KR9A 5BVHA 1EGHA 4EGAA 4ZQIA 2BLLA 1NQOA 2F43B 1F0PA 3CW9A 4Z1OA 3DMHA 3UAXA 2Z6AA 2KPOA 1F4LA 1T3LA 1O9HA 1E2FA 1S1CA 4RM2A 1KPIA 4KV9A 3SPXA 3NYQA 1WDLA 4IEEA 1JQBA 1BH6A 4BV8A 5BW5A 4PLFA 2CV1A 1I4EB 2IYYA 3P9NA 5D2CA 1EGVB 2X2OA 2X4LA 3L4EA 2NPFA 3GXBA 2PGLA 2J09A 2XUQA 3PLNA 4FGLA 3QVVA 1T0PA 1P74A 1QH8B 2JCSA 2JHFA 1ODFA 1W9MA 2XNHA 2YVQA 1Y6ZA 2Y1LA 3L07A 3KOZA 1Q1AA 4D6YA 1Y7LA 2O52A 5LZ8A 4ILKA 1DXOA 2FPSA 1VMAA 1QG6A 3TQTA 4Q9KA 3C16C 4JD5A 4LQDA 2V3CC 3VH1A 2BFAA 2QD5A 4INZA 2DY0A 4LJ5A 2R6HA 2QVCA 2XT0A 1WRBA 4KPFC 3RTCA 3C8UA 1KERA 1GZVA 1MVNA 4L85A 3MGCA 5AK4A 3SEZA 2VHCA 1EB8A 2EZUA 4CKBA 4ZYXA 1VDMA 3A1UA 3Q8XB 1GAWA 1BXRB 2EP7A 3IQXA 3LYAA 1UINA 3DOOA 4QYIB 1EA7A 5BORA 2VDMB 1DJNA 3DZJA 2O8FB 4IS2A 3KG2A 4C4AA 1HORA 3W4IA 5BOVA 3MBKA 1Z37A 2C1EA 4OD0A 4F60A 2H85A 3ZBQA 2Q6OA 1CZOA 2FGJA 4RAOA 3U3ZA 4A5OA 4NECA 4R54A 4BLQA 1ORWA 2GERA 1II0A 3H5OA 4FEGA 3U0BA 1BMFD 3U4CA 3DZFA 1JE1A 3U39A 2ES4A 3L06A 5DBFA 3WLQA 3DJYA 4PYJA 2VPPA 2VT6A 3BQ9A 3QFHA 3N6XA 2XQGA 4NNJA 2C0CA 1FX0A 2XKAA 2P5SA 4JJ6A 3VFDA 1I5OA 3UNXA 4YQEA 1WPGA 4G67A 5KCZA 2ANCA 2VJAA 4QYMA 5AVTA 1AKMA 1PVDA 1U2DA 2D74A 3DR3A 4UHKA 2GN9A 1IXKA 3JQ6A 5DRTA 1SFRA 2JG3A 1YUNA 1WXEA 1JYFA 1L7BA 3DKIA 4DPLA 4WX2B 3KLPX 2JLZA 3K9CA 2PSHA 3H8VA 5HFNA 3AHIA 3TLXA 3UMYA 3QPBA 1ZCJA 3HEMA 4R7TA 2ZB7A 3RNLA 3OKAA 2WUDA 4D0RA 2GFIA 5K8IA 1FYXA 4HYQA 2GPWA 4DA9A 1P0FA 2V3WA 2QRNA 2XTMA 5GZ6A 4LZJA 4PRLA 1RS0A 4XFKA 1P61B 2PJRA 4FUTA 5F12A 3HWX1 4HV4A 3JD0A 5DLPA 1CERA 1EX1A 4BLVA 3N05A 3BWMA 5FFFA 1TADA 3V42A 1EUZA 4JYCA 3NHBA 3TAUA 3RQIA 2X58A 2YNMD 3CFYA 3PCTA 4G9BA 4KFSA 5IP5A 3R8XA 2C84A 2ZBQA 2CDRA 5E7QA 5A2QA 4JYZA 1DVRA 2V4ZA 3NNSA 2H2HA 2GVDC 2QY9A 3O8OB 4IJKA 4JUDX 2FFHA 4MMXB 5EEHA 3KPUA 3WRYC 3UPUA 4M9ZA 1ZA2A 1JKJB 1SUWA 1VFNA 2NMVA 4CIAA 5JS6A 3CXUA 1E2HA 3O4JA 5KTKA 3CVUA 4NNOA 1JT9A 4M0UA 2P9CA 2BGUA 3PSAA 4CEIB 1CY1A 2Q7OE 4TZ0A 4MVJH 4P5DA 3S1AA 2H1OA 3FD8A 2PA3A 1M7GA 3E5NA 3W1VA 4BQIA 2HWUA 3G0DA 1NW6A 3LQ2A 3ROPA 4FZRA 4J1NA 1WS6A 1SY7A 4KSBA 4RVUA 1JJAA 1KDZA 5GTDA 2NU8B 3S8YA 3OCXA 3PEWA 4Y18A 3FTQA 4W5NA 1BX0A 3NPMA 2R8YA 4DA6A 2PZBA 1MF7A 4NAVA 4X3PA 3UATA 2G1JA 3DBIA 1OU4A 4FN4A 4YDSA 3ZBPA 1SVLA 3LWBA 3FJOA 3WGQA 1UKCA 2XOEA 3TPFA 1SVKA 2A30A 1I2AA 1PR3A 3E4CA 4HL6A 3T9AA 2ZDGA 2W2LA 5AVQA 1SURA 3DOEA 3GJXC 3L7IA 5SYMA 1Q7TA 2IYTA 4MVCA 1LQTA 4ZIRA 1XMSA 2H07A 1XPJA 1EM8B 1ZMXA 3M9LA 1ZO8A 3JWIA 1QFMA 3H3JA 3Q9SA 4LBWA 4XLLA 3LDFA 3VH2A 3X0DA 4URFA 1FDWA 3C3KA 4B4UA 2CLCX 3MWDB 1KOLA 4L5AA 4PWZA 2VS1A 3TR0A 3USZA 2DXIA 2WNIA 3GCWA 1VHLA 4W4TA 4LYGA 2I1LA 1FS4A 3DB1A 1P62B 4JVMA 4I7EA 2J8ZA 1ZUWA 3SE7A 1X1AA 3I9V1 1ZOSA 4JROA 2WU4A 1R0SA 4FXPA 2WPDD 3SXJA 1TPYA 3GBVA 4B1FA 2AG1A 4I5EA 4EO7A 4LK3A 4UHJA 2R11A 4UM5A 4FZ3A 3D3JA 4NPHA 2R4QA 4JLDA 5M3BA 2VLBA 3B60A 1GILA 3GMIA 3IBCA 3LRXA 4HAIA 4MUGA 4C20A 1AQIA 3HO8A 3GEPA 2ZUCA 4Y9SA 1LLCA 4CKCA 2V7QD 3QXJA 3JQ8A 1RRGA 5BV7A 4WKGA 3JZAA 5CFQA 1V37A 5CGQB 3GIDA 2XXAB 3KT6A 2FP4B 4MCAA 4GX1A 1WTCA 2IPXA 2P6PA 1NXPA 3VX4A 1U1FA 5JZMA 4RMHA 1TFRA 4PE5B 1ULBA 1XD9A 2Q41A 3S40A 4C3UA 4C3VA 3DV0A 3IA7A 4X20A 5KB3A 3KQHA 3U1TA 1KI6A 1J23A 1NQXA 1DIBA 1TQDA 2QLJA 4KAJA 2W2KA 1ZM2A 2Z2IA 4PYMA 1WQ3A 4JT4A 4M2LA 4FEYA 4EHLA 3L7BA 4NZNA 1UFRA 2Q3FA 1I1OA 2Y3IA 1G7CA 3KBOA 1ZSVA 3G0BA 3K72B 3O83A 4CV1A 2WOJA 2BHLA 1RWVA 1EJBA 1XCMA 4M0MA 4EPWA 3OF5A 1NVXQ 1YNSA 4UPVA 2GBPA 1TM7E 4FWBA 4TTPA 4ZCRA 5ALVA 2PKXA 1OMOA 1GYPA 2JAPA 3QG1A 4QDXA 4J0IA 3I9MA 4YMIA 1VHQA 4DQUA 4WXPA 4R1UA 2AFRA 4A23A 4LF5B 4QPCA 3MCUA 1T6YA 2GRAA 3T8YA 1Q17A 3X1WA 4DA0A 4AN1A 5JJBA 3W78A 3KDAA 1PYOA 2OBFA 5B30A 1KJWA 2ROQA 3ZWOA 2QMZA 1N8NA 4ZQEA 2G07A 4YAGA 3HI4A 4HX9A 4DC0A 1XEXB 3P32A 3OM9A 4KGZA 3FRIA 4D5GA 3CRVA 5BWOA 3AJDA 4DVGA 3BIWA 4UD6A 4DLAA 3FKJA 2O8BB 4HAYA 4U7HA 3TTVA 3EH2A 1WHTB 4ETMA 4EF4A 3CTPA 1HYQA 3GA5A 3BZUA 3E5RA 3R7BA 2BELA 5AVWA 1ODIA 3KTFA 5L3QB 4E5NA 3G2KA 3S8MA 5HJ5A 2NACA 3C24A 3HI6A 4B6OA 4P22A 3U80A 3Q8LA 5A3VA 2YY5A 1DV2A 1HZZC 1LFAA 5DHRA 3OD5A 1Y1LA 3D43A 3KJNA 4G97A 5FBRB 1UKYA 5A1TA 1RU3A 2ENWA 4DXDA 7YASA 2JFVA 1K6MA 3H1PA 2HFKA 3DFZA 3GDWA 4OSOA 4C2TA 2OZKA 3KU4A 2COEA 2GN6A 3BS4A 4HMOA 4C88A 1Z8DA 5C1OA 4PNHA 2CLLB 1GLGA 2ACKA 3D81A 4YAUA 5HTKA 2W6OA 2J30A 3NDBB 2WJ4A 4LJSA 2DBYA 5I9SA 1FNMA 2HU5A 2H5IA 1A5ZA 1BCRA 3CH6A 2YFKA 5GINE 5TQVA 1HPLA 3P2IA 4ZVNA 1BDJA 2WSLA 3FUWA 2OORC 3MFQA 3NALA 1XZFA 4L76A 1XQYA 1GVNB 1XAIA 2NU9A 2UKDA 3JQAD 4RIHA 5D3KA 4AF8A 3ZWPA 1CYEA 3IP8A 2BGWA 4XD7A 2IRWA 3H75A 3K15A 4RNDB 3ROQA 3ZCPA 4NENA 4L7VA 4E0BA 4IZ6A 4L6CA 1PHRA 4GOXA 4E14A 1YVEI 1PSDA 2Q3BA 3PX2A 1DAFA 4KN5A 1W88A 2LKCA 3O84A 5HKOA 2YN0A 3ZU5A 5CDHA 4CGZA 3LHSA 4MQEA 5AK3A 1R4MB 3HCWA 1MB2A 3IOBA 3X1YA 5EJEA 2FZWA 4N3NA 3LGXA 3AHJA 1SVOA 3U5ZB 2OQ2A 4ZYYA 3M4JA 1KDYA 3CR8A 4S12A 4RHTA 1R2QA 1TO2E 1ID1A 1VE5A 2PYDA 4TVOA 4D2IA 5DN6D 3BH0A 3B9BA 4UARA 1S89A 2B1QA 1JMVA 2EGGA 1XGKA 2E4ZA 2YQ5A 3C43A 3IE0A 3IODA 2Z6QA 3NANA 3H7AA 1S2DA 3TZLA 1NI3A 1RXUA 2D1TA 2W6ID 3HYRA 3R5FA 5K3FB 4B76A 1XZLA 1XZNA 3UICA 4PSCA 3GLGA 4JLAA 4LBYA 4TMFA 2XXJA 4KR2A 1A71A 4Q5IA 2XH8A 5IAKA 2XR1A 4M4SA 1V48A 5EWMB 4DA4A 1N2JA 3B5IA 5AI4A 2IHBA 2OV3A 1M8JA 1ZH4A 1OFIA 3HDQA 1ZKDA 3PYXA 4U6QA 4WNAA 1DIHA 1R50A 3A4VA 2EKQA 1W4CA 4AJEA 1TAQA 2R7LA 1T9BA 4G26A 4OV6B 3B5JA 4QWWA 4UEWA 4DR2B 3GHHA 3GVCA 4KE8A 2H1WA 4FTWA 3H17A 1RQXA 1GCUA 3DOFA 1DDOA 2FLKA 3INGA 4ISCA 3S5UA 3ZNNA 5ITZB 1R4ZA 1FNSA 4TUYB 5JUWA 4TZ6A 1N6RA 4P0TA 1Y4SA 1OTHA 2ZBFA 4URHA 4R2KA 1NXXA 1LDYA 3IV7A 5I7RA 4FM9A 2Y0DA 1OT5A 1ZZEA 1II8A 5FT9A 5LUAA 3GUZA 3VHQA 4ROTA 3CX8A 4YT5A 4TM7A 3O75A 1Y7HA 4KMMA 2YOFA 3GH1A 4L4UA 1YZQA 2J3MA 4Y67A 4QOEA 2OBLA 5K5EA 2A5GA 5TVGA 1WIWA 1AS2A 5FWYB 3EARA 3GGDA 1N33B 2VK2A 2ZYWX 5FBLB 5JVDF 5EZSA 3SR4A 3ME5A 2DWUA 4JYAB 4DCUA 3MA0A 1Z6AA 2C9ZA 3INYA 4BMXA 4M8NE 1U3UA 3VYRB 2R62A 3ZCRA 1YL7A 1T2AA 3HCPA 4LDNA 3GT4A 1UC9A 3A31A 1GGNA 2HUNA 1QJCA 3QMMA 3QSGA 1LBHA 2OE2A 4V1CI 4CF5A 4RF4A 1IJFA 3VNSA 3FSEA 1K75A 3RVMA 2C7PA 1SHUX 2IYQA 3DPSA 5EP4A 2F3UA 4TKVB 1NRIA 1RJFA 2DUJA 2QXTA 4MVJA 1T4CA 2GPBA 1LS6A 1XVVA 3BSSA 3Q2IA 4EBFA 3GBSA 3LX6A 2P1ZA 3DVAA 4ID3A 4Z0HO 4EJ6A 3N7TA 1NMXA 3QHQA 1P18A 2XRFA 1X9GA 1M2GA 4MLCA 1ZM4A 1YA8A 4Q93A 5JZ9A 4ND5A 1NHWA 4O08A 3TRKA 1CUXA 4OBXA 4PPQA 4K1LA 4W5HA 3A6ZA 1IHXA 3PLRA 2FU5C 1N2SA 2K2QB 3IP5A 1C4XA 1Z47A 2HQBA 4OI1A 5BOSB 3IHTA 5HQTA 2HF2A 4YP1A 1IVYA 2H08A 4LJLA 4N01A 4EL0A 1HG0A 4I1YA 4NYIQ 2CNWD 4MYHA 3EMVA 1O8CA 1G2OA 2CZCA 3R09A 1K6IA 2R1UA 1DXQA 5JSFA 2RIPA 4CCWA 4PINA 1YAJA 3CJQA 3QPVA 1U0RA 2EHJA 4ENQA 3GLIA 4EO4A 1WCV1 3PZBA 3IIIA 4OK3A 2N9UA 2EQAA 5A7HA 1VG1A 2ZJZA 4ZQHA 8MHTA 5AVYA 1ND5A 5ERYA 4F3NA 1TO1E 5KCMA 3RUCA 3TGLA 1ZH0A 4K6HA 1X2EA 3FLAA 3D3WA 5I7WA 3QNMA 4G1UC 4M9RA 3H16A 2A1TS 2CMGA 2N1MA 2PZAA 4G8BA 4PFJA 4L8FA 1H2RS 1R0KA 3KZOA 1VJGA 2BKAA 4HGNA 4UJ5A 4P0PB 1OREA 5DZSA 1W4RA 2IYNA 1JTFA 1P2VA 1T8SA 4MQUA 2XOXA 1QIEA 4TLAA 3VOAA 4CGYA 4Z53A 3T4EA 2QVBA 2QX9A 4Z9XA 1Z18A 4F3YA 3C45A 3DP7A 3OA0A 4I9GA 2B5OA 1KIAA 3VNVA 4TQUS 1D03A 2QDKA 2OVFA 1Q14A 2HLDD 2VJKA 5IH7A 2P9GA 4UE3S 3OQMA 1UKBA 5AXDA 3TEMA 4GPD1 3ZQ6A 1HBJA 2C57A 3SXUB 1W29A 3E6AA 4YC7A 1TK3A 1P9NA 2ODBA 2PAAA 3EWNA 5AUOB 2ZLBA 4ESVA 2CY0A 4AG6A 4ENTA 1WY5A 5HBRA 2DFLA 4RTNA 2ZETA 1TK9A 1SQ0A 4G09A 5B1HA 3VH4A 4BFVA 3A36A 3CKKA 1QCYA 3UMJA 3HL0A 3PNLA 1X7XA 1NP7A 3QX9A 4IJ6A 4V2UA 4YBZA 4G5YA 3UB3A 1VCMA 4V0ME 4QQRA 1MT0A 1EFVA 1NVVQ 2B1JA 1U9IC 2HF9A 3AL3A 2QZSA 3O8BA 4IIFA 4R2HA 4R2XA 4WJZA 3VYWA 4N5LA 3ZWWA 3AYZB 3VDXA 4DWVA 4XB1A 2OZVA 2WHXA 4UTPA 4I50B 3WWPA 1T8TA 4QJ4A 1EFHA 2Q2QA 3QE0A 1I3LA 2VHEA 4HN9A 4L8VA 4TSFA 2IIPA 1Y33E 1R88A 2MMGA 3KLNA 5MFPA 2OP1A 3DW1X 1SXGA 1GKIA 2H3HA 2FFRA 3NTLA 4DG9A 1KOGA 1G8GA 3L93A 5FDFA 3FFTA 2GEKA 1NKSA 3F1KA 1NYLA 4AZSA 3OIGA 2J9FB 4HMPA 3IUYA 4OQYA 2C42A 2QE7A 3HKCB 1NC3A 3NC1C 3OQIA 2C7QA 3HYTA 3VV2A 4P33A 1Z5GA 2LCFA 3CH4B 2ABWA 1V3TA 2GCPA 5HF5A 4MS3B 4EYSA 1DUSA 4FFNA 1K7CA 1GGEA 3C3AA 4M9CA 1Q0SA 3OHPA 3RF6A 4O4HA 4HQLA 4BE4A 4LMAA 4MHSA 4WEOA 2IUUA 1QP4A 4JX8A 3HU1A 5K2MA 1K7YA 4DMGA 1DCFA 1SXQA 1NM5C 1SCUB 1EK5A 5I7SA 3KJFA 4OH1A 2ZJ5A 1V41E 3NTUA 4B35A 3P52A 4CL0A 3QKUA 3ZE9A 1UJ4A 4Y2PA 3J80A 4AWBA 3DLHA 3ROKA 3K2EA 1SOVA 4WZBA 5F2KA 2XCIA 5CXSA 1Y7IA 3FA2A 2ONCA 3KETA 3QMVA 1BKYA 4NH0A 4FXOA 4DUZB 2J0EA 3SJUA 2QUAA 2ZR0A 3QKSB 5EUCA 1XD2A 2LP4Y 4R2MA 4E5UA 1ESCA 3LBAA 1F2TB 1KHTA 2XODA 3GYGA 1Z0SA 1NVTA 3ENVA 2BD0A 2VUSA 3H1FA 1BH2A 3LNCA 3PUXA 1F12A 3UFXA 2RKBA 3T7CA 1OKKD 4O0MA 5JD4A 3VKHA 1E77A 1ABBA 4EW6A 2EFGA 4PM4A 3ZDCA 4FSXA 2AS0A 4C6SA 2V7PA 1V3UA 4EHBA 4LVUA 5A9SA 1H8ED 2AJCA 1ZMRA 2ZRDA 4O2RA 4BQPA 1SVSA 1K4YA 3R9XA 1DX9A 1YI1A 1JEAA 1JIJA 1UK7A 4MA0A 5CEFA 1I5EA 2A1TR 3KEOA 1GQSA 2P2SA 3LVRE 3K0SA 4BE7B 2ZJ4A 1HDRA 4X71A 4PC3A 4W1SA 3FOAA 2OEPA 4H3HB 4V3CA 1SUCA 1JBQA 2PSFA 1N1EA 2O2HA 2XB8A 4I6JA 1N3IA 5B7GA 5HS4A 4GVLA 4YJ3F 5ALYA 4PYOA 5A02A 3WIUA 4JQYA 3VXKA 4NIMA 2WZQA 3TZ6A 3NRBA 1MHTA 1Z4JA 5FTKA 1MVOA 1O0CA 2RGXA 3JQGA 4XOUA 1L8OA 4KPUA 5ENZA 4N65A 3FMGA 2IT1A 4RC9A 2HGZA 1WB5A 3BC1A 5C8YB 8AT1A 4I55F 5JBNA 4DBLE 2ZRFA 3WY9A 2XUHA 3G8BA 3TOVA 3LZ6A 4B2PA 6AT1A 4KP7A 2KSQA 2OCAA 4KNYA 2P27A 2OCIA 4NDNE 3IEXA 3KR0A 1JRLA 4OAPA 1S3SA 5TGTA 2VPZA 1F8YA 1KA9H 4WJKB 3ZDFA 5C2JB 3BTVA 1MJGA 2O2EA 2FNAA 2X9VA 1FSFA 2YMMA 1QGUA 2PDAA 4RGYA 1VGRA 2JFUA 4US1R 4U7WA 3V1NA 1B0ZA 3NONA 2NZXA 3BD8A 4R3WA 4DGQA 4FGWA 4TXNA 5TPZD 3FPKA 3LFHA 4HYYA 1SG0A 1XQ6A 1YTUA 2D5LA 1CC1S 1U2ZA 1JT2A 2E82A 2UZAA 3O1LA 3R7FA 3C1OA 3LUKA 1K92A 4NU5A 2HTEA 3T3NA 2RHMA 3ZHCA 1Q2UA 4QXRA 1HDOA 1QM5A 3WSWA 3JXEA 5CJ2A 3RHZA 1Q0ZA 2FEPA 3KZXA 1UC8A 1W5TA 4KQMA 1XTVA 4XEHA 1O9GA 3VC1A 1C50A 2FK8A 2QG4A 1BN6A 1DCKA 4W7SA 4EMTA 3QEAZ 1YRLA 1OILA 3UO8B 2XKJE 1PZEA 4QUDA 1CUWA 3HBLA 5CDYA 1P2TA 1NP6A 3MRXA 4MUKA 1RI4A 5F78A 4XQCA 2VF2A 3D8NA 1IPEA 3Q5EA 2VF8A 4F1JA 5HQ3A 4PPYA 3RFTA 4XWKA 3THWB 2DT5A 4C0LA 4WBNB 1EK2A 1QAMA 3DOUA 1H2WA 4A73A 1KI3A 1L1QA 1SBCA 3M6VA 4FINA 3PUVA 3M1LA 4BNYA 3KB1A 2HREA 4IJMA 4PSAA 1K7SN 4L22A 3E3MA 2ZWAA 1WMSA 1PR5A 2JGRA 4OUKX 4EKEA 3DJFA 4V0SA 4Z7OB 2GD0A 3QU4A 3AQ4A 1EDDA 2X0IA 2XUGA 3D7SA 5E7JA 4PLGA 5IWAB 2DBRA 1V5EA 4ZDWA 5ECYA 1N5DA 1ZSNA 5A71A 3F0TA 4QUKA 1Y4AE 5CLHA 3U7QA 3DWFA 3I2FA 3LUDA 4DB4A 1MA3A 4PGGA 1IHOA 4DNPA 1ZIXA 3DFFA 2EEZA 3HY6A 3QVJA 4HWKA 4IHQA 4L27A 4FI3C 4PIMA 4X41A 2H31A 4P58A 2FPGA 1W5EA 3GBPA 3TB6A 1M1NB 3IXMA 2WAMA 3DMNA 3WOHA 3G2LA 2UZIR 1YE5A 2Z2JA 2R1VA 4BU0A 1ZR4A 2WHPA 1OAAA 1YVDA 1IBSA 3ASZA 4M0FA 2OO7A 2P9HA 3JWPA 4DV7B 3AESB 3OLXA 4MHTA 4MKRA 4QFMA 2WQ6A 1H3FA 1V5IA 2WMYA 5E6RB 3SBXA 1XZ8A 3GUVA 2P3OA 3ZDXB 3F5SA 4ND8A 3ZY5A 4JZYA 2G77B 3JZMA 3P0IA 4ICIA 2F43A 4KMOA 2A78A 5HZGA 5IFLA 2EFDB 4KBFA 3NHRA 4LJ6A 1G2PA 2FPPB 2J59A 3RSOA 4B75A 1ZJYA 2XUZA 3DNMA 3GZJA 4E15A 4TQGA 1CUIA 1NM5A 1CTQA 5CPFA 1WDMA 3PUKA 1A76A 1NNLA 3MTGA 4MX8A 4AVYA 2OUKA 4E88A 2VBIA 2JH9A 4DIEA 1NFRA 2FPUA 3MWJA 3EDOA 2AZMA 3NPAA 5DNDA 2VTEA 1TCAA 1BAPA 4TXLA 4Z8YA 1Y3DE 2GN1A 1IXYA 1QH8A 1PKEA 5EZYF 1EUCB 4GEKA 2CNBA 5CCEA 5DWDA 1GIAA 4CMJA 1M0WA 5B6JA 2XITA 5FTJA 5KOYA 5CD1A 1XTZA 4K6OA 1RCUA 1TJ4A 4AULA 3TLYA 4LRWA 5IAAA 3IHKA 1IDN1 4Y8VA 4MWZA 1SC6A 3FFWA 2YIDA 4A0RA 2PX6A 2P2YA 4YUVA 1IOWA 1XRQA 4R81A 1U98A 5I5GA 1I6KA 1E3TA 1BXRA 3BQNB 4QYIA 2VLIA 3DO8A 3CZRA 2WP8J 2PZLA 3QKWA 4D8VA 5BNIA 4BFSA 2EGUA 3DD5A 2WG2A 2RGCA 3O91A 3ZWKA 1GAXA 1AG9A 1UMCB 5LKRA 4JUAA 1X87A 2P3LA 3TD6A 3BJZA 4KR9A 5CLFA 2CLDX 1OI4A 1QJ4A 1JPVA 1IN8A 2PLNA 1VMDA 3OAAA 1NSYA 3GU3A 3OJFA 4YYZA 3IKMB 5FYQA 1UJCA 2GZ1A 2QRJA 4LVNA 2GCEA 1EVZA 1QR2A 5AJYA 1CP2A 2XCLA 3LY8A 3V4OA 4AKTA 4NESA 4OBWA 3RNOA 3V8PA 2GKSA 3ELWA 2KLHA 4JLVA 2FFBA 2O5EA 1YCFA 2FWPA 3PD1A 2V6BA 3CQ9A 3KQYA 5IG2A 4FGSA 4G5HA 3CEMA 2J41A 4ZO4A 3WTBA 3M6IA 3WWDA 1ODKA 1Z74A 3VR4H 3T5BA 2XCRB 1LRLA 5DYGA 2VL7A 1T3TA 2ZRBA 1G41A 3HKDB 2QVZX 5JS1A 1E2NA 3FPLA 2P30A 4IX9A 4NCNA 2YV1A 5HBGA 1JLRA 3WLRA 4CI9A 2GAFA 4RPKA 4NPCA 5E1MA 4RHXA 2K4MA 4W5JA 3SLGA 4CM8B 3EJ6A 4JY7A 4Q9JA 5KQRA 1SOWA 2AQIA 3WK9A 2IQ5A 3OX3A 4H16A 3UJDA 1AXRA 5HE8A 1P5HA 3TAHA 4ZHSA 3LPCA 4MCHA 4J8PA 3M7IA 5F9FA 4NMLA 3O8OA 2Y92A 4ZVRA 3SHQA 3LC1O 1XMQB 1ZL2A 3ZLJA 3D3NA 1JKJA 3R6TA 4PYQA 4Q1AA 4R9NA 4CPDA 3NQ41 1G9SA 1N5LA 2OTCA 3FWKA 3MBIA 1XMPA 4P31A 1YKGA 4CEIA 2BR4A 3GLSA 5A3SA 4BVKA 2OLJA 1KZ4A 2OBYA 3UBTA 1WL8A 4BPRA 5CYGA 2RGAA 4HS4A 4BQNA 1E66A 1WVGA 3AUJB 5FOSA 3REQB 4CMBA 5LQKA 3B9RA 1U9CA 5CG2A 2CV0A 1Y7TA 2QL7A 2HPHA 4LBVA 3T3PB 4MPTA 3H6HA 1PWYE 3B7GA 1SU8A 4RDCA 1B43A 2NU8A 1USUA 2JLVA 2IYOA 4GI2A 3DLAA 1HDXA 1OX6A 2R66A 3G79A 3MS7A 1L4GA 3RTEA 1A98A 3PE6A 3PL1A 4XLZA 2UVQA 4Z7JA 3IAAA 2DEUA 1GL9B 2H18A 1DWQA 2R1TB 3B3GA 3ETEA 3LA8A 2GLXA 3OKPA 4HS9A 4J49A 2Y99A 2A9JA 2BTEA 4RABA 2Q4RA 4L3VA 3FGZA 3DZDA 2H8KA 1KFBB 2DBQA 3IQWA 2ZI9A 2XIJA 3GFTA 3QBDA 4Q3EA 1P45A 2HJRA 5IWCA 1EM8A 1HL7A 4O2BB 1N2EA 3VOSA 3KJGA 1UC4B 1P7PA 2G8NA 4XI9A 3EWAA 4EKYA 1I7DA 1WDKA 4GF5A 2UXDB 2D06A 1VP3A 3GVXA 3MWDA 4JJFA 1GKKA 1I6LA 4X60A 5E4YA 3UOGA 1H85A 3E8SA 4UU1A 4N5IX 3IULA 1PFWA 2Z5VA 1NR1A 2GCOA 3LCRA 4RPHA 3N07A 3I62A 3VDNB 3HTXA 4MV4A 3IMKA 5CB8A 3V46A 3V4LA 4HLQB 2IOQA 5LVAA 2JRLA 3V7WA 4J1QA 4R1TA 4BOYA 1BHSA 4GMHA 4BO3A 3ZUGA 1NAHA 3A1CA 3ISJA 1PN3A 2J3HA 3CLKA 2NSLA 3DO5A 3N2GB 4JP8A 1E5TA 4YXFA 2PSDA 2XSZD 4PVCA 4LEIA 4WZAE 1FF9A 3TUJC 4D46A 2ZKLA 3N58A 1DI0A 2C0PA 4JOCA 3UXMA 5KHOC 4ABYA 1KGDA 1QHIA 3IFSA 1SKAA 3L0BA 3LHDA 1W5AA 1VCIA 1JU4A 5G53C 5J5VA 3RB8A 2CV2A 3ESDA 4GOJA 2H5JA 4JNCA 1GPUA 1ZDMA 2RHWA 3DE5X 2IYFA 2ZIZA 3DE3X 1JSZA 1OLSB 1UFVA 4XD2A 5DBGA 4AYTA 4EKIA 2XXAA 2FP4A 4BMZA 2WP0A 4M7PA 1KFEB 2QF7A 2IDMA 4ESHA 1TMGE 4PBRA 5A62A 2VVTA 3K5HA 2VUTA 1XVAA 3NI2A 3OEHD 1BXGB 5FUWA 1U65A 4ZN6A 3L7NA 2BGNA 2CCKA 1KK1A 4OJYA 4CDGA 1E59A 3AUAA 3WMFA 1P2BA 4E2WA 4ESOA 2HA3A 3DLBA 2VP0A 3H9JA 1IN6A 4MUFA 1F8XA 1VG9B 3FCOA 2J9RA 4HDOB 4I8XA 1MX3A 121PA 2C8JA 2YRFA 4JKOA 3JYPA 4PX2A 4Z9YA 3FG9A 3JRXA 4UFOA 3IMEA 2CJXA 1QWOA 3D3EA 1C9MA 2QRVB 4M1OA 1NXVA 3Q8KA 4W6ZA 1RM0A 4WY5A 3WS7A 1FLAA 3TLCA 1L4LA 1I2DA 4Q00A 2JK0A 3TLZA 2ZRMA 2JD1A 3HCOA 4G4SO 4IIJB 2GKGA 3TNFA 3ZHBA 2PT6A 4AJ9A 4CF7A 1Z4LA 2WJGA 4ZVUA 4Q03A 3FVRA 3KT3A 4YCLA 1FDIA 5DBIA 2X5KO 1KI9A 4M86A 4MKGA 2JW5A 1E79D 4YI5A 5ALTA 4RJ2A 5FPKA 2JKVA 4XJSA 5JC1A 4YRTA 2D62A 1E7SA 5J58A 2X41A 1EXWA 5HDBB 1YQXA 1JQ5A 3SQMA 4BTVA 1XEXA 2AMLA 3A05A 3RABA 3AF0A 3HRIA 5I7AA 2N1BA 4WK6A 2O8BA 2P4HX 3VBEA 1WHTA 2B1RA 3KRTA 2I99A 3R5KA 1N6KA 4RE6A 1UBMS 3DONA 5IASA 2WTUA 2ORWA 4UVGA 2P9ZA 4LX0A 1YBHA 1Z45A 4IWNA 4PC2A 5L3QA 3F7OA 4YP6A 5J23A 4Q82A 3EBOA 1BZYA 4MH0R 2CE7A 4AO8A 3C3DA 1LDEA 2ZE5A 4MW4A 2HBZA 3UHAA 4XB6B 1Z82A 4DADA 2PG3A 3IJ5A 4KO2S 1ZMBA 3F6EX 1NKVA 2IU4A 5HW0A 1YS9A 1V2HE 3NHPA 3WL6A 4B4WA 1C2YA 1OWPA 3LRPA 2B99A 4I5FA 5BW6B 1LY1A 2WQZA 3WLHA 2H1SA 2I0FA 3I1IA 5HRAA 3K70B 4FCCA 1T13A 1WW2A 3OCUA 4R8KA 2X6QA 3TW0A 4R8SA 2J7PD 2VHVA 1TKAA 4FNMA 2BZGA 3VR6D 2EATA 3GW8A 2I4MA 3HA3A 3L4BA 4MSUA 3OOWA 4PC6A 4M1QA 5DSXA 4I4TF 3VMMA 3IQDB 3MAGA 1DG1G 3E7XA 1YR7A 1QPZA 4EYKA 4H1VA 1GGKA 5CVEA 4L8GA 2CVQA 3GFOA 2LNDA 1ZS9A 2Y1FA 1MKYA 1MG5A 5E8JA 2ADMA 1R1DA 1U3TA 2AR7A 3SYTA 1DAKA 1I24A 2QR2A 5KNBH 3DGEC 4Q7KA 1IZ0A 1CG6A 3CKYA 1TGYA 4ITRC 4F5DA 4DRYA 1Y7PA 3ZUPA 3Q6NA 1R4MA 2BMWA 4BN0A 3EPJA 3I04A 4C29A 4GBED 2ZIAA 4JLBA 4JH0A 4BFTA 3IUMA 2XB4A 2Y93A 1SQGA 1I30A 2PVSA 1UZLA 3L04A 2A84A 3AVVA 4KN9S 5FOUA 4E4RA 3C5VA 7MDHA 5JI2E 3RAEC 3ZIAD 2NV2B 5JADA 2FUG6 1G0OA 3DDWA 1FJXA 5EMLA 5K3FA 2QW0X 3I92A 4IVRA 1I1HA 3GJYA 3PNMA 3BMQB 4EHJA 2JFFA 2XKBA 1HLDA 4QOIA 4DIKA 1AHIA 1DRKA 4B2YA 5EWMA 3B48A 1Q84A 4BNJA 4XOIA 5F5NA 3C5EA 3FKQA 2FX3A 1D1TA 2G82A 3HXKA 3WHLA 1A97A 3OQOA 3F6RA 2NO7A 4P93A 1MRNA 2H5LA 3UUWA 4YCCA 3STWA 3U3MA 4JGGA 4PTZA 4Q1VA 3G9TA 2RGYA 3X2FA 3QTLA 4XVCA 4YVFA 1JG7A 5D3MB 2CXUA 1C0LA 1T2NA 1LK7A 3PHJA 3I39X 2DP4E 5C34B 5ITZA 4TUYA 4XARA 1JFSA 1L7MA 3HU2A 2FLVA 1UIRA 3EIHA 1AVTA 2A9QA 2CNDA 3A9UA 2J4CA 3RANA 1P39A 1E92A 1HQYE 3E70C 3TRFA 5I9LA 2HZBA 4WBXC 3T7RA 4RMJA 2ZYVX 4HDRB 2R6DA 3WBJA 5B5SA 1YE8A 4R8LA 1FFSA 1I80A 1V96A 2RBKA 1DU4A 1L4BA 4KQ2A 1GZ7A 2ZVPX 4RPJA 3B6JA 2BBWA 4FFBB 5D5QA 3NMUF 2R68A 2PUAA 5FWYA 5A6VA 1FJHA 5EHQA 2XT9A 4DG5A 3A9VA 3RGWS 4HDAA 4EABA 1YXMA 3DHWC 5DLDA 1PFGA 2XUJA 1VRVA 4EF6A 4QQFA 4AX4A 2B92A 2P75A 3PXAA 1GNTA 1PT5A 2D5AA 2X3FA 4LJKA 4W5TA 4L0QA 1RT9A 1X0VA 2MDTA 3ZC3A 4XUGB 2J9ZB 4E5MA 4NJMB 4X1KB 4YWJA 1GUFA 2IY9A 4OAOA 4MKIA 4XYBA 5DV9A 1RXEA 5CA1F 4KITB 2PZFA 3D6UA 3EX7C 3K96A 3NIGB 5HNKA 1RI2A 1OI2A 3Q0IA 3IB3A 3JAMA 4FS3A 2ISCA 1DAGA 3IEIA 3H97A 1B0PA 4CZ2A 3ZS8A 5C37A 4TKVA 4ZOCA 4WLNA 3WIDA 4CLHA 4DC1A 2C8LA 3OMXA 4TRMA 2YXLA 3RS8A 5EE3A 3CM0A 4P6VF 2HMYB 1VPVA 1ZNZA 3A7DA 3LQFA 5G3ZA 3I8SA 4YJFB 1Z0IA 4QTXA 1YVPA 4RY0A 5HCIA 1Z2EA 5EIWA 2PT7A 4K9MA 4CLRB 1D4OA 4ND3A 2F8LA 1M72A 1T2DA 2VYCA 2A7QA 2Z58A 5CAEB 3BK2A 2BONA 1PZXA 3ZCQA 5BOSA 3X1ZA 2HF7A 2Z08A 5I45A 1NG1A 3ILXA 3FVVA 1W9HA 4MW7A 4P5PA 5I3ZA 4J7CA 3LS2A 2I1VB 2VIIA 2HDNB 3FHJA 5LZ9A 3JTEA 4RQAA 4J29A 3AKYA 1CIJA 4LGMA 3WL4A 4D99A 5BNZA 2ZDQA 4J3JA 2WINI 2WB2A 2J1LA 4IWYA 5E2IA 3ONVA 1DAEA 2WWXA 1A5SB 1EG2A 5KEIA 2GM3A 4XUEA 1ACMA 4JLOA 4LMPA 3PHCA 2A9PA 1NNEA 1K63A 4C21A 1CUZA 1M76A 2PJZA 3FX2A 5HXAA 4YT4A 1KDOA 4EENA 2JLCA 2X42A 4LDAA 2FZ4A 1F8GA 1NJFA 5BUQA 1SVIA 3DMPA 2ZSEA 2WD7B 5ALFA 4RK7A 4RPIA 5E9QA 1G18A 1IUNA 1Q95A 1LU9A 3OUUA 1E99A 3NBMA 4R1NA 4INPA 2F9FA 4UOQA 2XIQA 4K5QA 3LYHA 3H3FA 2PH5A 4R5HA 1BHQ1 3SJ7A 4F4IA 1KI4A 3EEFA 5A4FS 1AKEA 2HV8A 5J2TB 2JFPA 3A3PA 2K87A 1BHJA 1EE1A 4AF6A 1WY7A 1KTIA 4TT8A 1NN3A 3ZWMA 3CPSA 3KIPA 3Q98A 4RQTA 3JZIA 3GOQA 2CN1A 4MKXA 1VGVA 5K3CA 4URYR 5K8TA 2XTZA 3KFVA 1K7EB 4WXHA 4C3OB 1XTKA 4GYYA 3E7DA 1FZTA 2HLHA 4PZEA 1N25A 2C5FA 2H6EA 5D5HA 3UHPA 5KX5F 4HD8A 3SXUA 1A3CA 1U8FO 3NDIA 3HK2A 3GGSA 1IY0A 3CG0A 3M6LA 2FPLA 3NH9A 4BO8A 4OXYA 2O2JA 2PR2A 4KXYA 4M99A 3H8JA 4BMVA 4RY8A 3TE6A 1UDBA 3ETNA 1AA6A 3LPDA 3ESYA 4YEDA 3U7HB 1CY8A 4AZVA 3P4YA 1PNRA 2RC5A 3KJHA 4NBNA 2ZJYA 1U31A 1WUYA 3K1ZA 3MC1A 2GYWA 3SLRA 4L8LA 1JKFA 2EKBA 2Q5HA 4L8YA 1XZEA 5J3JA 1IN4A 5LQJA 4MRMB 2XUIA 2YN4A 2E4WA 3H13A 3HG7A 3JWHA 5KWVA 4US0R 4I50A 4CM7A 3I6YA 2PD4A 3ESBA 1RWNA 1MZPA 3MILA 4IFIA 1GSIA 4ZI7F 1FYFA 3PJDA 4Q3CA 1U2TA 5EQFA 5P8WA 5K4HA 3ETCA 3FPSA 1GQQA 1VB3A 3WAKA 4XA8A 5G3YA 2J9FA 1JR3A 1Y6QA 1WMFA 2PL5A 1WWKA 4HYTA 3HKCA 3TUIC 2AFHA 3VSAA 5BV8A 5CFNA 3LO8A 4JVLA 1U4NA 1Y8CA 4DLNA 1X39A 2ZFUA 4MS3A 3N1UA 5IVIA 4C05A 3KZNA 5CA0F 1QYCA 4JLMA 3WLOA 4B73A 4KPEC 4BV9A 1L7VC 2X5NA 3B12A 2DFKB 3MJ4A 4V38A 5ER9A 2FWNA 3EGDB 3OECA 5LZ5A 2E85A 4DUPA 1HRKA 5BRJA 2IWHA 1SCUA 3CE6A 4ZXFA 1DRJA 1QRRA 3R4CA 4YXWD 3LIPA 3Q8WA 2YIVX 1CDZA 5FLXA 2Q1TA 5TF0A 1S3IA 2FXIA 2ZJ3A 4N8DA 5GIPE 3EC7A 4J75A 5HF6A 5ILGA 1X86B 1C2TA 3CPHA 5L4LA 5LOVB 4RYLA 1L4NA 5DE3A 1DXYA 4PAGA 4TRNA 4ZVPA 3QKSA 4EI8A 1RI3A 1AKTA 1XK6A 1F2TA 2ZGVA 2Q6KA 3DC2A 3JU3A 3NJRA 1Z0FA 3C0KA 6NULA 4QHTA 1Y9DA 3G8YA 2AFIE 1R3UA 4Q3OA 2HNKA 1R9NA 3BH7A 4GZLA 5EKDA 2P6RA 4AMUA 1KY4A 1OV4A 2CDBA 3RH0A 4IOJA 4DM3A 2DTEA 4HATA 1Z4MA 1K6EA 4K2HA 4NXNB 4U7FA 3I5AA 5DMHA 5K4AA 5DEIA 4NCHA 4PSVA 4DIUA 2Q9BA 1JR3E 1I32A 1ESMA 3WLKX 1V4VA 1BMDA 2AFHE 3PPWA 4JXKA 2P62A 3EVBA 2Q7XA 4DSUA 3FOFC 4MS4B 1KC3A 4MICA 4ARUA 1T9HA 2BL4A 1MD9A 1SXJB 1CKEA 1LEHA 1O03A 5J59A 3CSSA 3NDRA 5CIWA 3F74A 4MV8A 4WK4B 4HUJA 4S1PA 2WF9A 3PEYA 3FPBA 1YH3A 2EJTA 1AO3A 1K66A 1NF2A 2BZSA 2CSXA 1Z22A 1XWIA 3TVYA 1KEKA 2AC2A 2VQFB 4ASUA 4J7XA 4TKUB 2EEPA 2RGWA 3EVTA 1FUIA 1TEXA 4RNCA 5COAA 5C8YA 4DLLA 2GYVA 1C8VB 3VVLA 5JASA 1ECGA 1V6SA 1VPLA 2QX6A 4H7KA 2ECKA 4QQ8A 4COOA 5CX1B 3HJCA 1M33A 1VHDA 1YZYA 3A70A 3PFCA 5EMHA 1WXIA 5TV2A 4AF7A 4CM1A 5BN1A 3GUHA 4X7PA 4YAFA 2AE2A 2XMBA 1KAGA 1C0EA 2J48A 3VZCA 4LRTB 3M33A 1UH5A 3V5NA 1N34B 3NV7A 1XKQA 2YC4C 3M6AA 1PUXA 2OHXA 4M1SA 4LTNA 2CFOA 1FJ2A 1O2DA 2F00A 3B6EA 3LT0A 3PGLA 4B3IA 3A2MA 4ZMRA 5ERGB 4C7BA 5JSUA 2C03A 2C2BA 2FG6C 3CNHA 2F90A 5IKPA 1MOZA 3AJ8A 4KJZA 1WXGA 3QG5A 2PUGA 2Y0CA 1Y6FA 1UBFA 5DX8A 2I55A 1Z63A 3QA9A 4E5KA 4TS3A 2HZ7A 5INTA 5IULC 1MOPA 3ACCA 1BW9B 2GUGA 4I08A 5AK5A 3PX3A 1JJIA 2EFHB 3GLFB 2A5FA 2C3OA 2X8AA 5B2FA 5JYCA 2VJQA 4JEUA 3EZNA 1PK8A 2VDNB 3WDSA 1F8UA 2VHJA 4GXNA 3A4LA 4C0AC 3L8EA 1P1FA 4IUBS 1HK7A 3FM9A 1UAYA 2B9VA 1T15A 1Z75A 2J31A 2AYYA 4GT1A 4RVCA 4XTCS 4AY3A 4WBNA 3FOCA 4FMCF 3C7CB 1HE3A 3RJMA 3NXKA 3WVNA 3KUDA 3MWEB 1MHPA 1SCBA 1TIKA 4CG3A 4CL3A 1YZLA 2BI7A 4LBZA 4M8LA 1CW2B 4TS4A 4S1WA 5E95A 4B6RA 2Q2WA 4IV8A 3BE5A 1TVCA 5C8DA 5JW6A 3U3OA 4N5NA 3FVTA 4BFYA 2HMSA 3F4LA 3DBLB 4N6OA 2RGEA 1AQYA 1A9RA 1Z07A 4B87A 2HHCA 4X6UA 1F9AA 3WNQA 2E2WA 1DQYA 4X6XA 2MSLA 2RHOA 3L05A 4LFAB 1PE0A 4PG6A 1PFYA 4UUQA 3S7TA 5DISB 1I7NA 1OLOA 3SQNA 1Q20A 1QO0A 3F67A 4WAUA 5KU1A 3OQJA 5DTQA 1M1NA 4AQYB 3TBKA 3IP1A 3QFSA 3RS5A 1WV1A 2OHVA 4XZ3A 4LN1A 2VPWA 1D1SA 1XYYA 3WK5A 3AESA 1ZSYA 4PCUA 5BR4A 3IQIX 5E6RA 2CMKA 3WFIA 1OAKA 3Q3CA 3BD7A 1CY2A 1N0VC 2NW6A 3KYJB 3CMMA 3EGEA 3KALA 4LXYA 1NY6A 1PHPA 3SGLA 3ADKA 4DLYA 2C2XA 2REQB 3DE6X 4I4IA 5KHLB 3Q3JB 1I4DD 4GM0A 3SEQA 4GW3A 1XPRA 1TGVA 1YDHA 2C7GA 2G6TA 2VG8A 3DL2A 1M5UA 2WE7A 4N39A 2FPPA 4KFTA 3ET4A 2HV9A 1U5BB 3UWDA 1JZSA 3RAGA 3LDHA 2YFHA 4OVKA 6ADHA 4X66B 3D4LA 3ZDEA 4TQ9A 4D81A 4A0HA 1YQTA 2B7BA 2R2AA 3M4ZA 3O3OB 1NQTA 2XMQA 4JHXA 4UZFA 1U9YA 2XECA 5G0VA 5A5EA 3OPXA 1H4QA 4DMFA 1EXVA 3HNOA 3L8HA 4KRXA 1WXXA 3HCNA 3FKSD 3HL4A 2GHQA 1EUCA 3ZD6A 1V8DA 4DMMA 1HRDA 3EIOA 3Q5DA 4U2CA 2PWYA 5L9AA 2JHPA 1DCTA 1O7JA 5REQB 2CEKA 1KFJB 3FTCA 1EJ6A 1AS3A 2GD2A 4W5RA 3DL0A 5AM2A 2QTWB 2W48A 4Q66C 2X7XA 2PZGA 1LDBA 4HVCA 4DIFA 5EHXA 2Z2XA 3P0RA 1AKYA 3R6LA 2GM5A 2R6JA 3OTIA 3GAZA 4UQLA 3QSYA 4FPXA 1LWOA 3A6PC 1E9EA 3FCYA 2CXQA 4JXXA 3UH0A 1CK4A 4LISA 1GTMA 4I5GA 1TTQB 2QD2A 1GG2A 5DGDA 4EKNB 1UMCA 1E5QA 3UMBA 3LY7A 3O38A 4R2JA 4X9XA 2HQ1A 3RT7A 1G3IA 1TAUA 2HFJA 3NIWA 1BYIA 3QKRB 5CTAA 3WLTA 3L77A 4GDFA 1UXIA 1DDGA 3L43A 4Q12A 1U3WA 3D1LA 1DKLA 2NYAA 1E0JA 1PYDA 4LYHA 3W3AH 3LKBA 1YBFA 5CB0A 5DOVA 2BAGA 3DOHA 1SMKA 1TD1A 4FOLA 5FEMA 5BWLA 1YIOA 2IPMA 2RB4A 4EJFA 1PFQA 3HCRA 4HNSA 5DHSA 4BC1A 4YQFA 3L0YA 4RTOA 5H3HA 1A0OA 4AJOA 4RO0A 3F7MA 4WCVA 3HKDA 2FKNA 1RYDA 2QM3A 4ID9A 2WKSA 3M81A 4CM4A 3BCUA 5F76A 3TLMA 4RA9A 1Z9BA 3THRA 2PMCA 1XELA 5DNAA 5K1ZA 1WEKA 3V00A 4AD8A 5F23A 3OLWA 4XX0B 5C8ZA 5K8CA 2OHJA 4CM8A 5TSDA 1WB6A 3O1HB 3K70C 3CZPA 4MUXA 3K35A 4TT3A 3WYNA 2VQSA 4RU1A 1JSLA 5E3HA 5DCWA 3EODA 1J39A 2I3BA 3LI2A 3H6GA 1RRMA 3RUFA 3K31A 3PXEA 2QRKA 1PU2A 4XQ0A 4LHZA 2M32A 1XYVA 1KKUA 4D3ZA 5MHTA 1IOZA 1QIKA 2ZRHA 3MAJA 4PNEA 3ML1A 3O8CA 2CVZA 4L3OA 1IZ9A 1P1IA 1JF8A 1KRHA 1YTLA 3FJYA 2Z1NA 2PHZA 4JHLA 4JP3A 2C5AA 3BREA 4IOKA 1ZRNA 2PSSA 1IY1A 2IHNA 5D8DA 2IA5A 1WE2A 3REQA 2J46A 2IBSA 1ZHOA 1YR2A 1MQ8B 2EOAA 1S2IA 3QVUA 5BW8A 1MGPA 1PVVA 1LX6A 3RGGA 1L5RA 2QN3A 5DXAA 1E2DA 3WP1B 3N70A 5CH5A 4MZXA 1J0DA 3PFGA 4R1MA 3LHIA 4FLMA 1SKQA 4HFNA 2B4QA 2FVYA 1ZU4A 2CUZA 2HWXA 3CRQA 2R1TA 3ETLA 3F8WA 4K46A 3QVLA 4K05A 3TJMA 3TN7A 1W0JA 5LDDC 1JIXA 3NHWA 4KAFA 5DJ5A 4DJJA 4E2YA 2K5UA 3I01A 3KTAB 3QVTA 1NBMD 1GZ6A 1OQAA 4KTTE 4NE9A 4ZOEA 3VSEA 3WGNA 4OFWA 1Z4IA 3Q4GA 3ZGVA 4O2BA 1L5LA 2D0OB 1SN7A 2I33A 2IVFA 2H17A 5DYWA 1M0EA 3UJ6A 2Q9UA 4XX1A 2BHSA 3RC2A 4CDRA 4PU0A 4Y9RA 1OWNA 4U2BA 4S1OA 1J5XA 1P5FA 3IBYA 3JQ9C 3VNBA 4TWRA 1KSFX 4BNMA 1JDUA 2JBWA 4EB8A 3FZQA 2QS9A 5HF9A 4KPGA 1NQAO 1XC7A 2V9CA 3LPAA 3O8NA 5EN4A 2XE7A 1XP8A 1DJLA 2A0WA 1D2EA 1ISIA 3CLVA 4JSYA 4KQFA 4PO3X 5M34A 3TMKA 4C04A 2P3SA 2QHXA 3K20A 3N2GA 1ZUD1 5J5AA 4AKHA 2Q4OA 4XWWA 6REQA 1GSHA 3FAZA 3WG9A 3DAPA 1V8OA 2I76A 4DLTA 1UIMA 4QT0A 2O2ZA 2XUOA 4Z99A 1GFWA 4YUYA 2YWGA 4B6EA 2HMAA 1UR5A 1X1QA 2QQFA 2VOEA 2YN2A 3E1SA 1ORRA 3LT1A 2H7CA 1GADO 3R6WA 4FNGA 1OLSA 4LRSB 4RH3A 1IHYA 5IJXA 3T3HA 4E30A 3DVRX 1LSJA 1QANA 2F9LA 1OZAA 3IE1A 3T9CA 3WTCA 4JEMA 5KBYA 2OZEA 1BXGA 1AM4D 1A9SA 1KH1A 3RVPA 4UREA 1H4SA 3HUEA 4X44A 3W90A 4HVLA 2LZ0A 2DM6A 1YFJA 4PZLA 1JYSA 1CY7A 1OV6A 4MK4A 4GKJB 4C7KA 4KXVA 1UPAA 3NX4A 4L74A 1HOTA 4NR0A 1E6LA 4PQRA 3DFKA 3PEFA 1MQ9A 3CCCA 2QJWA 2QRVA 1KS2A 1ZD2P 1X0XA 2O2XA 3L8CA 4QQKA 3U9TA 5JAHA 1XTTA 2VCYA 3DDNA 3DZCA 1CSEE 1L1RA 2DTDA 4RZHA 3WO0A 3IOMA