2XZDA

Caspase-3 in complex with an inhibitory darpin-3.4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
141
structure length
140
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQARGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords CASPASE-3
total genus 51
structure length 140
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xzdA00
4QULA 3R7SA 1RHUA 4DCJA 4ZVRA 1PYOA 3IBFA 1NMSA 1ICEA 2XYPA 4FDLA 3OD5A 2CJXA 4LSZA 4M9RA 2QL7A 1NMEA 4FGUA 4JR0A 4QU9A 5I9TA 3RJMA 4JR2A 2H51A 4D3ZA 4EHDA 5IANA 3NS7A 5LUBA 4JJ7A 4DCPA 5LU8A 4JJ8A 4JB8A 1K88A 4QU8A 3E4CA 5IBPA 1SC3A 5IBCA 2C2ZA 3SIPA 2H5JA 3P4UA 2NN3C 4JR1A 5IBRA 3D6MA 3EDQA 4NBNA 3H13A 2J32A 1F1JA 4N6GA 4EHKA 3H0EA 4AW9A 2FP3A 4JQZA 4NBKA 2H65A 4QUBA 4ZVPA 1RWPA 1SHJA 4NOMA 4EHAA 1RHRA 5K20A 4JJEA 3K7EA 3R5JA 3R6LA 5LU9A 3H11B 2CNLA 2H4WA 4NOKA 4EHFA 3V3KA 2HBZA 3V6LA 2AR9A 3GJRA 2K7ZA 3PD1A 4PRZA 2CJYA 3V6MA 5H0IA 4DCOA 3S8EA 1CVRA 1QDUA 2H54A 3NKFA 1SC1A 3GJSA 1RWOA 3GJQA 4FEAA 4D3YA 2HBYA 2XYGA 4JQYA 2J33A 3BIJA 3DEIA 4EHHA 2CNOA 3R5KA 3KJQA 5IAJA 3PD0A 3SIRA 1RHQA 4ZVOA 1NW9B 3DEHA 4NOLA 5IASA 4QUDA 4EHLA 2P2CA 2J31A 1RWMA 4QU5A 1QX3A 3D6HA 2C2MA 1JXQA 3V4LA 1GQFA 1SC4A 1K86A 4ZVTA 3DEJA 4QUGA 3KJFA 4QU0A 4FXOA 3V4OA 2WDPA 4N7JA 4PRYA 5IAGA 2CDRA 2C2OA 2XYHA 4N5DA 2Y0BA 2FQQA 2J30A 3H1PA 4PS0A 4ZVSA 1I51A 1M72A 4AWAA 5IABA 4AWBA 3QNWA 2C1EA 1RWWA 3H11A 4I1RA 4I1PA 1RHMA 4N6NA 4NBLA 5IC4A 3V55A 4N6OA 1I4OA 4HQRA 4N7MA 2FUNB 3NR2A 1F9EA 4PS1A 4QUHA 3PCXA 4IYRA 3R6GA 3UO8B 1RWNA 2QLBA 1IBCA 3ITNA 4IEFB 4D3XA 4EJFA 2DKOA 4EHNA 2QLJA 3R7BA 3R7NA 1KMCA 4HQ0A 1RHKA 2HBRA 3DEKA 2CNNA 1RE1A 4QUEA 2QL9A 1I4EB 3EDRA 3S70A 5I9BA 1SHLA 1BMQA 2H4YA 3IBCA 4HVAA 3D6FA 4ZVQA 3UOAB 5IC6A 4QUIA 1PAUA 2H48A 3P45A 1QTNA 2C2KA 3KJNA 1RHJA 4QUAA 4QUJA 1RWVA 2XZTA 2QLFA 4QTXA 5IAEA 1RWKA 2XZDA 1RWXA 2HBQA 1NMQA 4QTYA 5LUAA 5IAKA 2CNKA 2H5IA 1GFWA 2QL5A 4ZVUA 4NOJA 5JFTA 1CP3A 3GJTA 2Y1LA 5IARA 1I3OA
chains in the Genus database with same CATH superfamily
1ZIPA 4B2IA 5JPCA 1N2BA 2RJOA 2JFNA 2MDTA 3QHAA 4DM4A 2XZOA 1ZWKA 2OV1A 2HNBA 3L0PA 4GO1A 4M1EA 4L8YA 1MT3A 1G3UA 4ID3A 1G63A 4EMTA 1UZUA 3NH9A 1IWPB 1OFTA 2CVFA 2P4UA 2QNRA 4JR0A 3N6XA 4CETA 3LXXA 4QXQA 3K70B 2WZQA 1UAYA 3UUGA 2Z2KA 3O38A 1GGEA 4I3GA 4LAFA 2YNMA 4PTLA 3QUBA 1I3CA 4LDRA 1DS6A 3KSUA 4PR0A 4C7OA 3MLBA 4R2XA 2VATA 4RM2A 4H0NA 5TB5A 2P90A 5CM2Z 1CBUA 1JZQA 1JKFA 2BP7B 3CUSA 1O0BA 2O3QA 5BN3B 4JQZA 3KELA 3WTCA 3G1UA 1S2IA 5IULC 3QUCA 1FYWA 1AGNA 2WZBA 5A3JA 3EULA 1SHUX 2FPRA 3AB7A 4RO0A 5FBLB 4RY2A 4PNPA 2VG8A 1QWSA 5AK3A 1Q95A 4D9MA 2LRHA 2VFAA 3Q7SA 4ITVA 4FGZA 3DYIA 4YLEA 2BGKA 1J2RA 2ZWVA 1RPZA 4HV4A 2XLCA 1TJ5A 4Q4HB 3BRQA 4R8LA 5C53B 1SG0A 4BQSA 1F7UA 5TVGA 3PHIA 4P7JA 3RTAA 8ADHA 4TM7A 4TLDA 3PGKA 4B2PA 3NPMA 3MWDA 4TYWA 3F8TA 3I9MA 4XGRA 2KJQA 5I7RA 1KSFX 3OAAD 3PD0A 4HYEA 2FQYA 1L3CA 3UT5A 2ZRLA 4WZAE 1J21A 4LNAA 1UQUA 2OBXA 4RU1A 1VJTA 2PA0A 5DBEX 1ZN9A 5FQOA 1QQBA 1I6WA 3VJMA 1WG8A 2R751 4OBWA 4XDYA 2C5FA 3F6YA 2C5EA 1JBQA 1I1QB 5EIWA 4MUFA 3AT1A 2F1JA 5EXTA 1GQFA 3JD3A 5EMLA 1FS6A 2P9BA 2Q27A 3DAHA 5JPIA 2OGZA 4TROA 4CL3A 3WRWA 2AIRA 1XXLA 5A9RA 4BQIA 4ZVNA 1W0JA 3HDHA 4WZAB 2BEVB 2DSTA 3NANA 3TR5A 3UT0A 2V0CA 4EI2A 3DF7A 2OQRA 2V8OA 1XKTA 5EE0A 1S2NA 4Q3OA 1KERA 2FE4A 1UDAA 1QH8B 3QWFA 4MWCA 1C7JA 4AMZA 1BROA 1ECGA 1YZYA 2R8XA 3NR2A 5DPMA 4MROA 4WK6A 1QUEA 5K8TA 2NYAA 1E2IA 3CV3A 3KKNA 4DPMA 5C8YF 3D43A 1V7QA 4WPGA 1OBFO 3MIZA 3OSZA 1R0ZA 3NMUF 1OLXA 2BDUA 2RGBA 3B70A 3N2NA 3SBEA 1DHTA 1U98A 1XPUA 1NUTA 5I8ZA 5CFRA 1Z5PA 2YYSA 2V3VA 3GY0A 2GTPA 1HYGA 3S1AA 2WJWA 5F1OA 2C9DA 1WZNA 2D4HA 3U1BA 1JFSA 3W5SA 2JAUA 2H0AA 2LTAA 2OUIA 3DXYA 3E9MA 3NHYA 4EGAA 2W6IA 4RTRA 4RD2A 2IX9A 4RH0A 1KU6A 1T0BA 5J5AA 3STWA 2JFQA 2OZPA 2VHQA 3EQ6A 3PXDA 4KI0A 4RQAA 5SZKB 5JEDA 1PU2A 1CF9A 1LBHA 2C98A 1TCBA 4FN4A 3P9RA 2FK7A 4GMKA 4I4TA 3RVMA 4ZDKA 3CO5A 2G7ZA 4UW9A 2XDYA 1N0HA 5C37A 4WUTA 3P2IA 3C4QA 4OXYA 4X3CA 5CHEA 4RA9A 1O96B 3K1TA 4Y1GA 5H8WA 1L5MA 3HDTA 5B6JA 4CKWB 4O8ZA 5DRYA 2Q4OA 1DT3A 3LUFA 4M9CA 4P32A 1PYOA 4XWGA 5I7AA 2Y9PB 5U4XA 2HRCA 4AO8A 4M83A 4QRDA 1Z6PA 4BGUA 4D44A 1PEYA 3VPSA 3NBXX 1Y1QA 2VK1A 2YXDA 3PFGA 4PC2A 3GFVA 3KOXA 4TXJA 4WKCA 1AMNA 2FSGA 3IEXA 4B5LA 1FX0A 3VHXB 3TO5A 1R5NA 1M6HA 3KXPA 1CY4A 3I4CA 1Q50A 4C4TA 4F5EA 1G4UR 4MQ6A 5KJEA 5CDYA 1SC3A 2R2AA 1G8HA 3LECA 4E31A 4KNVA 1QXSA 2I7TA 2M6SA 1YC5A 2ZANA 3E82A 5E7MA 2WJ6A 3K4HA 4RCVA 3RASA 3WGMA 4ZYYA 2ZRPA 2PRSA 5ARDA 3CXUA 3LQRA 1YL6A 5AJVB 5KEIA 1QC5A 3II6X 4BATA 5TT0A 1LZLA 2AOVA 3VKGA 4JBYA 1IPEA 2ODPA 2RHWA 5AVSA 3G0DA 3R5JA 3WBFA 1PUXA 5HCNA 1L2TA 4F8JA 2VOEA 3IO5A 1HNNA 4XE5A 1I8TA 2PZLA 3PUIA 3HXOA 4PR3A 2PUGA 4E88A 1F0PA 1T9ZA 3HM2A 4XEHA 4LXIA 2IBSA 3CBGA 1DBRA 1DKOA 4R7GA 2MT9A 5MGBA 4KR2A 4HXEB 1B6GA 2R5WA 1AT1A 2N1BA 3JQ8A 1LF0A 2VTDA 1NE7A 4ND2A 5DTEA 2D62A 4A9AA 2O8FB 2E7ZA 4W7HA 1ZXXA 4XX0A 3T1VA 1MX3A 1YCDA 2CEKA 2YMPA 4Q3EA 3KB8A 3T7RA 3O8CA 5F4BA 4ZV9A 1N6IA 1CDZA 2PKEA 2C4WA 1UKEA 4KQWA 5KC9A 1NMXA 3BIOA 4LTNA 2UZ1A 4D25A 1FRFS 2X4IA 3CF2A 1EFPB 4NY1A 5KTKA 2XSZD 3UMYA 4BLPA 1EFCA 2AI2A 3HRKA 3FIUA 2ZSHA 5DSXA 2FQWA 3I32A 2J3QA 4KMRA 4IJ6A 1LLDA 3K92A 3UK6A 3TNFA 2P7IA 5K6RA 4ZMRA 2GM3A 1RLIA 1YZFA 4OQYA 3KG2A 3L1IA 4FDTA 4WA7A 2FSHA 4Y18A 5CA1A 4I1PA 4LWPA 1COWA 1D09A 2GEJA 2GJ8A 2HRQA 2PUVA 1ADCA 2Z5FA 2ZXUA 3JYOA 3NHMA 2D3TA 2XZPA 1M33A 3IIEA 4HDOB 4LYEA 3M70A 3I2JA 4PZEA 2PVPA 3VR5H 1THMA 4XVHA 1NW6A 1MQ8B 1NVAA 2QDKA 4ZCMA 2ESRA 3WWPA 3ZXIA 3QPAA 4LV6A 1XT6A 2UYHA 4R2IA 5CCDA 3TW8B 5HR5A 1YFJA 3EQ7A 1ZGCA 3I45A 4H6XA 3A1TA 4KXUA 2HHHB 2ZJOA 2OCGA 1E59A 1S5PA 3E9DA 1JHXA 1SO8A 1PBNA 3H04A 3E3LA 3H5AA 5AI4A 3U7IA 4MHTA 1DC8A 1UZMA 1ZESA 5L51A 5L9AA 2Y1CA 3JV7A 4LYFA 1ISJA 2XODA 2NAFA 4C7OB 4FSHA 3HJFA 4GKJB 5JXGA 4YJGA 3A3YA 2R6JA 5E3JA 2R60A 1M2NA 4L0DA 1OT5A 2VUTA 5EPOA 1NJSA 2Q5HA 3DD5A 3E53A 3G2QA 4O63O 1IDOA 3AY3A 4B74A 2HTEA 2ATVA 3K8YA 4OUDB 5ALJA 4BFWA 2WTEA 1O77A 3M4NA 4M76B 1WB6A 2L2QA 3IEKA 2BGIA 4MMZB 5L7WA 5DM70 4JFRA 2JGAA 3PEWA 4XWYA 3IQEA 3RBXA 5JJBA 2W93A 4DTIA 4BJ5A 2PUFA 3ZDDA 5A7GA 4RH1A 1ZM3A 4ZQBA 4MHSA 3B78A 1JEEA 4HRAA 4BFUA 4XWKA 3QFTA 1NSYA 4JT2A 4M4SA 3NJRA 2CHFA 4K9KA 4D9JA 2PE5A 1P0FA 2K7FA 1FMCA 5IP5A 3VNVA 1L7PA 2PGAA 3OKPA 1PL6A 5IJAA 3WK6A 1MOPA 2CZQA 5JTUA 1AG9A 3RRZA 5KINB 2J0SA 4MB2A 1FSPA 1ECPA 2CC2A 2I99A 1IZZA 4K9OA 3TR6A 1NW4A 1DWOA 3O4FA 3HKCB 4JX8A 3LC0A 4K6HA 4NI5A 3N70A 1W2GA 5C4MA 4AJKA 4C9BA 5I4IA 1RXYA 2FJUA 5EJFA 1N1MA 2Q5IA 4C4ZA 4RMJA 5BT8A 1ODTC 2O8BA 3A26A 1A4XA 3D0QA 3DJYA 3VHRA 2D59A 1A8SA 5BQFA 4HEA1 4DCVA 3W06A 2H2GA 3SDBA 2O5RA 4BZWA 1JQEA 1Q91A 1R6BX 2O5VA 3AKCA 5CEJA 2I80A 3PPWA 1ESDA 1CJCA 1XOIA 4WHMA 4Z6KA 4BQRA 2JI8A 3GJYA 3LFUA 4PRZA 3FMPB 2YY6A 4KN6A 4ZVVA 2AC2A 2Z1DA 5I7VA 3BCHA 3IMCA 1Y9DA 4GH5A 1FYXA 4LHWA 2PM8A 4YQFA 1FZTA 1ZMBA 3L9XA 4QNRA 4QDUA 1F4VA 3FMIA 2GK6A 1FYFA 4M54A 1MV8A 2ZYSA 5THQA 3ZV3A 4D74A 4JK3A 2VK2A 4YROA 3JSAA 2GO7A 3CNOA 3DZKA 5GIPE 4H17A 1TKBA 4ASUA 1H2FA 3K1AA 5THKA 4IHQA 3T4EA 1W93A 5IJ9B 2C92A 3DLCA 3R7WA 3ZDXB 3CLSC 2AI3A 3QYPA 4BO5A 2RE8A 3NIGB 4TRRA 4J0IA 2VDVE 1AS2A 1KETA 2Y4NA 3WLIA 4H7DA 4Q7MB 1FP7A 5IKOA 4ZC1A 1TYBE 2B7LA 2E55A 2JVJA 2XA2A 4IF4A 5C5DA 2H2HA 3BB1A 3KX2A 4M37A 4XIGS 3ZR4B 4BFXA 5IXSA 1M6EX 5IVKA 2B8JA 3ITDA 5BVGA 2XMSA 5H16A 1DL5A 4AB1A 4I1RA 3VSEA 4WOJA 4CUZA 2MHCA 5C5IA 4CE6A 1NJFA 1H8HA 4S12A 4EY4A 4RA9B 5KYKA 4Q16A 3I5XA 2WT8A 4Q01A 4RIFA 2O1SA 2PX3A 3TUJC 4KGVA 4UMVA 1UWKA 2H31A 4PCVA 3DAOA 1DBIA 1NIPA 2CLOB 2Q1SA 2V5AA 3AHEA 5D5HA 1YA4A 4QATA 4XWOA 2O2XA 4GOXA 1R9GA 4WADA 4BMCA 3PDIA 3RRJA 1JQ3A 3QEKA 3HKEA 1CIJA 1IXRC 1KOJA 4O1IA 5AR1A 5C8ZA 1ODCA 3LZCA 2EQ5A 1PJRA 3KWLA 4HQNA 4IIGA 1MXHA 4C3VA 1OIVA 4H6VA 2ZB2A 3LE8A 3RG2A 4L57A 1XFDA 5ALHA 4IVNA 4Y9RA 3O9ZA 1ADBA 5CK5A 3IILA 1C3EA 4G5QA 4UQLA 4KFCA 1IRXA 1XZBA 4NONA 5IAKA 1K8ZB 2WUFA 4G37A 3LPAA 1OU0A 4FFWA 3CJTA 2YMQA 4FBMA 3D2AA 5AHOA 4ZI5A 3DUWA 4MRSA 2TMYA 3RS0A 1R5BA 5C7YA 4MYTA 2IU4A 1NYQA 4Z86A 1DGQA 1VLZA 2COEA 2NU7A 3E8XA 2OV6A 5GQSA 2AEEA 4B35A 2W2PA 4PM4A 3U7HB 3NRJA 1QQTA 3PQDA 4JQOA 3A2LA 3H2ZA 1D1QA 3DVAB 1QIMA 3RSFA 2A0UA 3IYLW 2PXXA 4HSGA 1HDRA 4K6CA 1K66A 4M1QA 4Q4DA 4NCXA 1VJ5A 1KJWA 1U28A 3FETA 4LOJA 1KQFA 1PQYA 3JASA 2O8FA 4UVHA 3OESA 1V9SA 1SBYA 3TTWA 1I13A 3CPEA 4MDEA 3AEUB 5EJEA 1K88A 4TM8A 1F3LA 5CLHA 2C20A 3KSMA 5CH8A 1B3BA 3GNQA 3COPA 1ST3A 1WO8A 2C4TA 3L0IB 1OI7A 2QN8A 5IJXA 5JBIA 3L4BC 1SCDA 5CURA 4HAWA 4OHXA 3IOYA 4QUBA 3W6PA 1RWPA 2VEDA 3K2QA 4DMLA 4B3MB 1BXRA 5MHTA 2WF8A 3T5GA 3CN7A 1YR9A 2Z9DA 1LTQA 3TOCA 5E1MA 3RRNA 1EQUA 2V9PA 1GAJA 1E1RA 3R3WA 4BV9A 5B3JA 1QFMA 3ZNPA 2CL6X 5CA1B 2IH4A 4YMVA 5BRJA 2OV4A 1O54A 1W0KA 5ALGA 1O4WA 1KJ8A 3V80A 3WICA 4LYHA 5ER6A 3ER6A 3PIRA 5AH0A 1ZNZA 5AJZA 2C8JA 3E0XA 4DIFA 1RWOA 2YJ6A 3BULA 3DKIA 4YP1A 2W4MA 3ANLA 4OFWA 3V1UA 3BGVA 2OOKA 1YU9A 2QV0A 4KO2S 1H2EA 4ND4A 4YJFB 3SIRA 4XTCS 4ZOLA 3LQYA 1OC4A 3AR2A 2QBYB 1BKDR 3CZMA 3BM5A 2D0DA 4YJKA 3I0MA 2NTNA 2QX8A 4FYIA 4WIAA 5JCXA 2QZPA 3E9QA 1AUOA 3FW1A 2NUTB 4KAJA 4BKPA 5EHQA 1IM5A 2H1SA 3BEDA 4S3MA 5JNTA 1BEEA 3TG2A 1W49A 3DFIA 3E35A 2J4FA 3LLCA 1R74A 4O8CA 3IQXA 1QH0A 3ZYZA 3UOWA 5FBWB 2C7OA 4CQMA 4FYXA 4MPRA 4L8FA 2D7DA 4H3SA 1P9LA 2YXEA 3W7AA 4OUDA 2P8JA 1P8AA 5ICEA 1PJAA 2QVZX 3GRCA 1QQ7A 3WSWA 2W2TA 2DHRA 3PTZA 3WGNA 4XVRA 3L6RA 4AECA 3UQYS 3ZWAA 3GRRA 3RT9A 3ND9A 4TN1A 4FOPA 4WESB 2X14A 5F5XA 4YRRA 1HQCA 2PUEA 2IPMA 2VJOA 1SCNE 1L5LA 2ONYA 1RHKA 1MB9A 2W2XA 4L7VA 2QTBA 3FPEA 4QWWA 1HE5A 5DOZA 3TFWA 3L1JA 1W4CA 4YH1A 3I1FA 4YV0A 1RKBA 3ICPA 1T9AA 2VYVA 2WSMA 4UZFA 4UTVA 4U9HS 5KWSA 2B35A 2WHXA 3JAMA 3FPLA 4QGGA 4AJNA 3LBHA 2OFPA 3PV0A 3ILHA 2B1GA 1QFSA 2A5GA 3QKRA 5BOSA 4EJMA 3P1JA 4DBVO 1GT91 4BFYA 2CUKA 2BFEB 4WJKB 3CTMA 4ZO7A 2C3YA 4RCZA 3D7MA 3RNOA 1U1CA 2JFOA 5A0FA 4IXDA 2ZR8A 2BL4A 1V1RA 4O25A 4OJTA 2OORC 2YV4A 3AHIA 4FUQA 3SR3A 1CB0A 3VOSA 1XELA 4YRQA 3U31A 2EHDA 4P33A 5LOVA 4IIFA 4XJTA 1AK9A 1B16A 3NVMB 1FU8A 3SBXA 3VKFA 3AG5A 3HUDA 4XPZA 3VPXA 2RGNC 4ALLA 2M6RA 3O47A 1MDBA 4L07A 1SK8A 2XITA 3ROXA 4EY5A 2OAP1 3O03A 3JR3A 4QYIB 2PSFA 4JC0A 4P4TA 3QJGA 2YRFA 3FZNA 2GT1A 3T9EA 3GWGA 2ZYGA 1BN7A 1UDCA 5JMOA 1AHPA 1PQPA 1F20A 3F46A 2ID9A 4X6XA 4MW1A 4ZEWA 2Q3JA 5LN1A 1W35A 5H4GA 3NATA 1EPUA 2AXQA 2CXNA 4CMAA 4W8OA 5C46F 2F67A 1YOBA 3ZJTA 2RC5A 4O2AB 5B53A 1I7QB 1P75A 1GGNA 3KZMA 3LT1A 4EHAA 3ZJUA 2JJ8A 1XD8A 4YMWA 1TEVA 2BAGA 4FEYA 1LC0A 1QYVA 1F2DA 1QCZA 4PZCA 3VPDA 4NOKA 1E1CA 1ODLA 4BCCA 1UBLS 2R5FA 2HI0A 3CF6R 1LZKA 1YBVA 2RI6A 3DZHA 4RHFA 4EY3A 4BNUA 4ZI3A 3W9SA 5FL7D 5BWLA 3AI7A 4OAQA 4ZT6A 1JG3A 1U8CB 2E89A 3CGWA 3SD7A 1MUUA 5LKAA 1GTSA 5EXXA 3NW9A 2D0IA 5E6SB 1P81A 4JCOA 5EFOA 1UM9B 2J1LA 3VZRA 3RK0A 2FG6C 2JAPA 2NACA 4Q9DA 1SXJB 4Z9BA 3RBZA 1VCOA 2G82A 1W46A 3JQGB 4MI9A 5JAUA 2B8TA 4ZREA 4DILA 4PIVA 3AV0B 4A1OA 4D82A 4OHYA 4IDCA 3TZ6A 5C1PA 3AVPA 3H97A 4F7DA 1XPRA 3E8MA 4MA0A 2JFWA 2WILA 4INAA 1VHQA 3B1FA 2C03A 1EHIA 2F59A 4MK4A 1X8XA 4RSMA 1ZUHA 3OC6A 1YOVA 3L4BA 4QYMA 4FHFA 2JFFA 1EHCA 4KOEC 1R4AA 4R16A 1MCZA 1TM5E 1Z5ZA 1RWNA 2ERYA 3GF4A 3PVSA 3UJ9A 3BEOA 1ZP6A 3WFZA 3ZX5A 2MYNA 1PV2A 1Y1TA 1CEYA 1U4NA 5EHGA 2CVPA 1XZJA 3KC2A 4OD0A 1U7WA 2JCXA 3AY0A 3QTBA 1J99A 4XQ0A 5HQ3B 1BDIA 4MAFA 4A03A 2H4YA 3QVVA 1BRTA 4NBTA 3L8YA 1RDFA 3CX7A 5HS4A 1JDZA 2QNBA 3HWSA 2C4KA 2CMGA 4TMYA 2HRZA 5CT6A 5T7BA 1VE3A 5BV7A 1X80A 2DHEA 2FFQA 2I4LA 4G4SP 3SMVA 1M34E 4KR0A 2NV0A 3VKVA 3ZOZA 4EKIA 4F72A 2V7TA 1QX4A 1NFQA 5JO0A 3KTOA 4U7GA 4V0NA 3SC2A 4UATA 2KLHA 2YWDA 3CUWA 3INNA 3HKBA 1RWVA 5FV4A 4R1QA 3WYEA 4B6EA 2G9RA 3X1JA 4ANFA 2QPTA 2GN2A 3O8DA 1KQ3A 2V7UA 3FOBA 3RIMA 4YMUA 2GN9A 5BR8B 2FJ0A 3KYDA 5J2UF 1GG8A 2G06A 3DOUA 3C1UA 1O95C 1T3LA 5FUBA 2JKVA 3HA3A 5TIIA 1UL1X 1V3TA 1JHQA 1NC3A 2GD1O 1SQSA 2L82A 3HB7A 3O2QB 4JB2A 1PQ4A 3D8HA 5REQA 4BU1A 3PNOA 2CLEB 2C97A 3IKVA 1QKJA 2IEGA 4WY2A 4H1VA 5AJWA 3ZI7A 3PFFA 2QUBA 4PQGA 4FTWA 4CDRA 2XOKD 1PRYA 3ZE2B 3LCMA 4OQFA 1RI2A 3PYMA 1WMAA 1FP2A 3A2KA 1RLMA 3CEPB 4M9RA 4ZYWA 3BF8A 4O4IF 5IVPA 1GTRA 3SSAA 1Z12A 5I45A 1FRNA 1YUBA 4OLFA 2JL1A 3GA5A 3GIWA 1YACA 4NEGA 1KH1A 4DLWA 2H2AA 2I7CA 2WUWE 4MGIR 4I6EA 4CDNA 2A2ZA 1JDVA 2DFLA 1AKUA 5AKYA 1PKXA 8MHTA 5BNTA 1GV0A 1K92A 3TIXB 3W0LB 1VKJA 2QPAA 3A1CA 4N6GA 5D3ZA 3SIXA 4OGWA 3W8EA 2H65A 1KTIA 2QMYA 1C9NA 2D5BA 2OZKA 4TKLA 5ITZB 1X2EA 1U9YA 1YB2A 2Q3LA 3IKMB 2IBTA 2NSYA 3AQ4A 8LDHA 3N8IA 4HNAB 3KR0A 1USGA 5AWFC 5C3MA 2VQFB 4WD3A 3NHLA 4ZO4A 3IOEA 3V34A 1RKUA 2FZEA 1KC3A 3P20A 3VC1A 4IIJF 2QIOA 4N18A 1BKYA 3EPLA 1M2VB 4I5IA 4CCWA 1LPAB 1G60A 5JDCA 4B32A 1HDYA 2FQXA 3STHA 4EL5A 3OX4A 2ZSAA 3Q8XB 4M9SA 5BWMA 4ZTZB 1P4RA 3U4AA 1XDWA 1N2ZA 3P9IA 3GGSA 3P5SA 1QK5A 1NG9A 1TMOA 2GN1A 3CX3A 3EXEB 5EC8A 2D2FA 4EF5A 3OPMA 2BM0A 3G7NA 4QL3A 4ZPJA 4TMXA 2WE8A 2QMEA 1V8DA 3AFNA 2FZWA 4FCVA 4BKMA 2A7QA 3D3KA 1V11A 1WMDA 3FUTA 3QHPA 1FLNA 2EOAA 3E03A 4PHFA 2E1PA 4C2TA 2D0OB 3WS7A 2WICA 2BVNA 1LD3A 3T8YA 1D2AA 4TXHA 5AUNB 3R8FA 1K4KA 2BFEA 2I6FA 3CLUC 1M1XB 4FGKA 1D7OA 2B69A 2OD7A 4W5HA 4B3RB 2ALJA 2YWGA 2P78A 2EBUA 1XP8A 1EJ6A 2NADA 4ZIRA 3IT0A 4OG2A 3NHKA 1Z29A 4LC0A 1H5QA 1QIKA 2G0TA 3NTRA 4YRTA 1TQ2A 1ZG3A 3NT5A 4O0MA 4YGXB 4ESVA 2LCFA 3F8SA 3GLFB 2FMHA 2FQ1A 3WIEA 4Y0NA 2ZT7A 5DLPA 5A4DA 1I9CA 3C4JA 2CVQA 3EDRA 3PPYA 3WJ2A 2AH5A 2NU6B 2AA3A 1TZCA 1YS4A 3GFSA 3INTA 4EAAA 3ZWVA 2FN7A 2W5UA 3SLKA 1FE8A 2AD5A 4BAGA 1D4ZA 4D0GA 4YDQA 2EQBA 3BIXA 3MJSA 3Q7QA 3DKVA 5EKSA 1NTOA 1YK1A 3DMTC 4TYMA 3KUDA 4DSTA 3MINB 2ONKA 4PX9A 1T8RA 2EX0A 1IUKA 4FINA 3BQNB 4I1YA 2G76A 4H2DA 4UZSA 1ZSYA 2VUUA 4LWZA 4UOQA 3DFMA 2P5SA 4TUYF 1TM7E 1O7JA 1DAMA 2IVFA 2XGSA 1C3JA 2JRCA 1PV4A 2FUCA 1IG3A 3EISA 1L4KA 3MTEA 2AQ8A 1SCIA 1U8XX 4RHUA 2VNSA 4RETA 1E1CB 3V7FA 2BWJA 4URUR 3E84A 4DJAA 2ZYIA 4FU0A 3W2EA 3ZQJA 4AY6A 1EFAA 2X7HA 2GEKA 1WD5A 2HQ1A 5DX8A 1KEEA 4GZ5A 1ZINA 4J29A 4PPGA 2QW1A 4YUWA 121PA 1VIMA 4PZ0A 1ULSA 1UPAA 2LZ0A 1V6CA 3G49A 3WWOA 5DXFA 3MJHA 1WY7A 3TGLA 2ZRQA 1ZJYA 3F4KA 2FG5A 3DL0A 3TIIA 2ZYUX 2GA8A 2O3RA 2PK3A 2YUTA 3H0EA 3ILSA 3KJZA 4BEVA 2XOEA 1XG5A 1OLOA 5K45A 2JJMA 2YC2C 3GZJA 5BW6B 2J9FA 1XB2A 1EVZA 4GE0A 2I22A 3ZY5A 3B53X 3AKYA 3AZOA 1PZGA 4ZOQI 2C82A 1DLIA 3W6ZA 1PR0A 4NZYA 4RV4A 5BMOA 3VJLA 3Q8LA 1OJLA 2J6IA 4KZKA 1BQ4A 4OVKA 4QGSA 5CFQA 2B78A 2FEOA 2J0UB 4FZ3A 4BWGA 3LO8A 2D8AA 4PSCA 3HC7A 2C84A 1Z68A 2DFKB 2VF5X 4HK4A 4H1HA 4EUHA 4BB6A 4Z1OA 4NENA 3F96A 4E6PA 1IZYA 3DCYA 4PZYA 5G1PA 3DEZA 1IAQA 3SVLA 1ZR4A 2RG1A 3UHFA 1EEHA 1NW9B 1S96A 2ZVJA 3MTJA 4E1VA 2ADOA 1DTEA 3FI0A 1LPOA 2Q4TA 3QBEA 1YUNA 4N76A 2UZAA 3CZ9A 3OTWA 1B15A 1NYTA 1XMPA 4I0WB 4IXTA 1S8OA 3SPXA 2Y92A 2ONJA 1OXBB 3OUTA 3VC7A 2IGTA 3BWXA 2DCUA 3B1YA 3ZXYA 5DK6A 4ERNA 2PAAA 2I6XA 3EGXA 2OAEA 3ASZA 1CQIA 4AJHA 5CXXA 1GSIA 3WYNA 1YXMA 1C2YA 2XRMA 2PD4A 4YEDA 4O08A 1MEEA 1KHHA 1W5BA 4XUCA 4YMIA 5FFMA 3B6MA 1CX9B 3J7AC 1LSJA 3LT2A 4C7JA 1JT2A 2QUAA 5JXWA 3GA7A 4BNNA 2C2HA 3AIMA 1UXOA 3COYA 1DX6A 4Q9AA 5DXAA 5K3FA 1RJ9A 3ELDA 4EF4A 1PNTA 2H52A 3P97A 1X74A 1EH5A 1Y8QB 4E2FA 4H27A 4HXFB 2P69A 5DHRA 4A0FA 4LXXA 3PHHA 4MUJA 4FFMA 4M8IA 5HILA 3ROPA 1OX5A 3QMMA 2COKA 5EL0A 1SVWA 2ZSDA 3CS3A 1OU4A 5C81A 1LW7A 3CW8X 4QARA 1PGJA 1K0UA 1KF0A 3IT1A 2AL7A 4L8WB 2WNHA 1A69A 2AMFA 1KS9A 1L7DA 1QP8A 2MSEB 3Q12A 1IULA 2FPSA 4UBLA 3VU0A 4WRRA 3WK4A 4DS3A 1J2UA 1L8AA 2UZ4A 4EOGA 1DRWA 2IHKA 1M0TA 1FS4A 2DETA 5AVRA 3TZKA 1NY6A 1KMHB 5BQPA 4IRXA 1WZCA 1RJFA 4KSCA 1CUVA 3MTGA 4HNRA 3ZWWA 2J8ZA 1E63A 1ZD9A 2I91A 1XMOB 3H9JA 3KDSE 3V8RA 2F55A 1QR6A 4LDAA 1D07A 4H6PA 3QVSA 4JP5A 4A91A 3LSTA 2VDLB 2NO6A 1LV7A 3EN0A 4UASA 2YOHA 1LXCA 3OTHA 1BD3A 2JAWA 3GZ4A 4KLNA 3UYKA 4GX2A 3X1ZA 4AZTA 4P3XA 5JEEA 1P74A 2PFKA 1XEWY 3OECA 2JEOA 2WD8A 3HJGA 2OZLB 3SVZA 2JD0A 3VR6D 2N47A 4UFPA 4MKGA 2G04A 3A4IA 5FOSA 4MGZR 3CNNA 1IOLA 4EITA 2YRWA 2FPOA 3MJVA 3OZXA 1BS2A 3HS3A 1PNOA 4I4TB 2IH5A 2ANBA 2XD4A 4W1SA 4EG4A 3MQFA 8ATCA 4J7XA 4A2PA 4K9RA 1P1KA 2X3UA 3FPGA 1VSQA 3NYWA 4WGGA 2QD1A 4Q19A 3KVRA 2OBBA 3HJHA 3M9XA 4BN4A 4CKCA 4F5DA 4ZIRB 1FLAA 5CUQA 5LNK6 2G5TA 2WF7A 2PGXA 1X19A 5CXUA 2XLBA 5CNKA 5DCUA 2XE4A 5JCPA 1ULHA 1GCOA 4TX1A 1B6RA 2WM8A 2DR2A 1NAIA 5P21A 5C1OA 1PZNA 2XCOA 3OLVA 3B60A 1KYXA 1Y3AA 2JIRA 4QOJA 4B2YA 2X13A 4KLRA 1SCBA 4EW6A 2GPAA 4HMQA 1ADGA 5KYYA 2W22A 4R98A 2PWAA 2R86A 2GKOA 4BWYA 1BWPA 4EATA 1IN8A 2OO7A 4C76A 1LJLA 2WSLA 3GROA 2JLRA 3D8UA 4LNHA 4F71A 3NU1A 4GEGA 3GR6A 4W9NC 1E77A 4WOBA 1EVQA 2BRUA 2WWVD 1MW8X 4L8GA 1U0EA 5JC8A 4UAJA 2JKYA 1AQNA 1G16A 3W5UA 4TL6A 3VNSA 1EWTA 4G0PA 4BVHA 3GO4A 3UH0A 1L7VC 1QZTA 1UC4B 1NVTA 4GWGA 2RHGB 3B2NA 2G88A 3DT8A 4JX9A 4F3KA 3O4IA 2IYVA 5HE9A 1Y1RA 3Q5EA 5BSMA 3IEIA 4MKZA 3RSOA 1F0NA 4PVDA 4YRZA 4UOEA 2IFTA 1U8AA 3V4FA 5KTSA 1KEEB 3A36A 3UMRA 3OZWA 5JW6A 5DIZA 1WL8A 5CX1A 5DT9A 3QSYA 1Z7BA 1U0SY 4MWTA 1YIOA 2O5CA 2D1QA 1EXMA 3NHSA 1YQWA 2X9LA 4MW0A 4M2LA 3SN6A 3GFFA 1Z17A 4DARA 2QTHA 5FWXB 1A4UA 3TSCA 1XJQA 3VNBA 4RTNA 5KNCD 4J9UE 2J9FB 1RPAA 2AN4A 2MSWA 1QGAA 2PZMA 1N8TA 2JGNA 3S29A 5U9CA 1GKLA 5F2NA 3U56A 1CY6A 2GETA 3FROA 1VKZA 3MCUA 3L7CA 2VF7A 1YJBA 3LVRE 4HNQA 5GONA 3WYFA 1FTNA 4JIGA 1H94A 3L02A 4YONB 1M3SA 3QWHA 2HMTA 4RNCA 1P62B 3FFTA 5NLLA 3M89A 2NWQA 1FFBA 4ND5A 2AWNA 4GIBA 4XX1A 3ZY2A 5DTJA 5FJIA 2HHLA 4DZTA 1KYZA 2IBMA 1Y81A 3JQ7B 1XMXA 2BV3A 4XLTA 3T9AA 3WGHA 3EIOA 2QMQA 1R37A 1UF9A 1X3SA 2BM1A 1GPAA 3R74A 4IXWA 1KEPA 2XUJA 2Z58A 2Y05A 4I9NA 4P83A 5CU7A 2Q5LA 2Z2XA 3H9EO 1SVOA 2J09A 4JAVC 1RC8A 2I2AA 2WFLB 4J91A 1WP9A 5K2MA 5M29A 1FF9A 3CNEA 2XJ9A 4I5DA 5F3RA 1Q6ZA 1G6KA 1IPHA 1XE3A 3OM0A 4FEGA 4LHSA 3ADBA 2VKTA 4YMLA 2DWCA 4IKOA 3LCRA 4AKIA 2QPOA 2OMEA 5F2EA 4BKQA 2HYDA 3DOIA 5BSTA 4X61A 5F3DA 1P1RA 4MHOA 4WH0A 3DDOA 2QI9C 5EIXA 1YCGA 4QDOA 1NXWA 3EVDA 4IHJA 2E5FA 3L7KA 2GN0A 1KJYA 1JG1A 1OKKD 2RGCA 2UYCA 2F3SA 1E0JA 2C07A 1V25A 3KJQA 5F1KA 3TM5A 3SM3A 2XNHA 4OQLA 1EWKA 1TYZA 2J3KA 1L6IA 2RAFA 1KJIA 1T2DA 1U3UA 2XQFA 3D4OA 3DZDA 1R64A 5ALOA 5TGZA 5KOHB 1YTUA 1R5OA 2V7WA 3T7IA 4UUNA 3WDSA 4R01A 5EYPA 5B2EA 2FRXA 4KV7A 3U16A 1IBKB 1KY3A 1RRGA 2A8YA 1SIBE 2V0NA 3CE6A 4TSFA 1FPMA 1SHKA 1C7EA 1Z4JA 1FU7A 3B52X 2EKLA 3GL9A 3NNSA 3SEQA 2CJWB 3BMNB 3DOJA 5TV2A 2VTBB 5IAGA 1IZ9A 2JG3A 5L53A 3M5PA 4OMDA 3IVAA 4GMHA 2O2IA 3D4PA 1G5FA 4URHA 4YASA 3TEFA 3K53A 3TQTA 5IABA 1YU6A 1SD5A 2UXCB 1XKLA 3BXGA 3F6PA 1EP1B 4P35A 4PZUA 3QPDA 3NGLA 4XDZA 1I4OA 3FRHA 2P6NA 3CF4A 5EJIA 3Q3JB 4RYLA 4ZQIA 3TVYA 1P5JA 1IXKA 3AW9A 2GUGA 4ER7A 1GA1A 3CINA 4KE9A 2I3ZA 5AVQA 1WQ1R 4HI0E 5CRIA 1NSFA 2VS1A 4Z4CA 5I51A 2IODA 4GYYA 2JBWA 3VR2D 4ZDWA 3H4IA 4HVLA 2CNNA 2EFHB 5CFMA 5D7BA 2WHRA 1FSSA 1XCMA 2JKZA 3TS1A 2FU5C 1N4DA 4EG7A 3NDIA 3HO1A 3T5PA 3OMLA 4IMRA 1LLCA 4CXMA 2CXQA 1GLGA 2GB4A 2Z8YM 3KUKA 2VDUE 3H2GA 3N5CA 5EPEA 3QFHA 3VH4A 1EUDA 2WJVA 2N1MA 3N3BC 1P2BA 1IHXA 1J49A 3HJRA 1B1AA 3UFBA 4PSDA 5BVGB 3PA6A 4O5AA 3KEOA 1A0OA 1T8YA 4R1MA 3T4XA 4US1R 4LZPA 1S6YA 1W4RA 1USVA 2FOXA 5K3DA 4I36A 1X0VA 1AF7A 3BQMB 1CDOA 1U0TA 1VYTA 1OI3A 3G3EA 3LC1O 3O7MA 4DRYA 3EGDA 3G9XA 1PQUA 3SYLA 5B7PA 3RU2A 1E0AA 1NMSA 4UXIA 1HTBA 1ESNA 2WIFA 1TDJA 1KRHA 1WW2A 4FEEA 2Q3DA 1JECA 2PGJA 2VCYA 2JS7A 3IDQA 3EVZA 4XGQA 1TFRA 4IUYA 3TMAA 4C7BA 2GXQA 1XZAA 1IVSA 1N6RA 3L8MA 1V16B 4J7UA 3TLGA 5K09A 2C2YA 4L4SA 4UEOA 2OPBA 1FFEA 3OE4A 3LWDA 3N2EA 1OYWA 4PG4A 3WIDA 2Q3CA 2Q9UA 3ZBUA 1PT8A 3DA8A 4N3NA 4XB6B 3RYHA 1LDEA 1JEDA 1XALA 4IP0A 4EMUA 4I55F 3T41A 1CUAA 3AB3A 5TC4A 1XYVA 2QHXA 1OFIA 5D87A 4NE7A 4UREA 4H1TA 4M9UA 3GV0A 3RWBA 1H0RA 5ILQA 3DOEA 4ETNA 3GPCA 1RM3A 2EFDB 9GPBA 5CDUA 3M5WA 3JQDA 3GEHA 2PEYA 2FSUA 4DVGA 4H1UA 2C77A 1UQTA 1ZXBA 1OLSA 2JC3A 2P5UA 3HZZA 1T1SA 4G1FA 4M8LA 4NRDA 1Z6TA 1Y5MA 4QYWA 5YASA 4AAYA 2X4GA 4QG7A 2UZ3A 3B9BA 1UFQA 2IDZA 5AD1A 1OI4A 4GUDA 4K0KB 2IEBA 4RA6B 2UXBB 1C5KA 2W43A 1J2TA 1FNNA 1RHQA 1TZBA 4MH0R 3STTA 5ITWA 1VQ1A 1AU9A 3C7TA 3LVQE 1A95A 1E3DA 1W59A 3IAFA 4ZT7A 4MR7B 3QVMA 1CJKC 1HE2A 3NHFA 4PHHA 4U2DA 3V4LA 1PQWA 3VNUA 2JGKA 3BK7A 3CMCO 4HUQB 3QEBZ 2JDIA 4DMKA 1GR0A 2DT8A 2LIPA 1GUBA 2XNCA 2OORA 4L5AA 4RTQA 2A92A 4Q7EA 1KAOA 4E30A 1BXRB 1BX1A 4GMDA 3MPOA 2HU5A 2IEZA 4K3VA 2DT5A 3PDWA 5JC1A 1EJBA 3QBJA 1K97A 4KXLA 3LVBA 3D8SA 3A3PA 2F3QA 5E0KB 2Q0SA 2WT9A 1J5EB 4LF5B 1DKLA 1NLUA 2H2IA 3WDLA 4HQRA 1M1UA 3MCAA 5JNSA 3HDVA 1Q1ZA 1J1UA 2C2WA 4F3TA 2OAGA 1GT6A 1RVV1 1KI9A 2IZOA 1RXCA 1Z73A 3ROMA 1XEXA 4JP3A 1YKGA 4EPVA 2QN2A 1GQRA 1NF3A 3ZE0B 2BE9A 1PTJA 3NUQA 2DJ5A 3OU6A 2BUBA 1O6GA 1EVJA 1MDFA 3BMCA 3WMRA 5K0GA 3N07A 4GI7A 5EKXA 3IERA 4HS9A 4M0FA 5LP6C 4ZI2A 1MC4A 3WNBA 4MDYA 4L2IB 5GPBA 1Z56C 2IUUA 3IHKA 3PJEA 3KALA 1C50A 4L9RA 4M1YA 3I8OA 4EJ2A 3FYSA 3RTGA 5D84A 5FIUA 2F17A 4WKPA 4ZDIA 2WFLA 4AFNA 2VK8A 2FW0A 3EDOA 4TS1A 5AI6A 5J4VA 1H85A 2P2ZA 3E5HA 1N1DA 2HXGA 4F9EA 4JXZA 2L18A 3JD1A 2B4AA 1KDTA 2E4WA 3H99A 3TCNA 1RS0A 1T36B 5EIBD 5LC1A 3CBQA 2AMYA 4MQEA 3CZ4A 2QTAA 3V4RA 2HV8A 1XDUA 1JPJA 1YR2A 2BHRA 2C0CA 2XUOA 3A58B 3F78A 2OECA 1YB5A 2X9VA 4PFQA 4BVBA 5BSEA 5JQGF 2ZT6A 4FUTA 4IHJB 3I34X 1CTQA 3AL3A 1D2CA 2VPZA 2R4UA 3CISA 3OBIA 3FPHA 4IIVA 4ZTBA 2EERA 3SXPA 2DWOA 2WAXA 3AHCA 1HT1E 1QOPB 1T2AA 3VVCA 1JTVA 2GZ1A 5E2IA 3P71T 1XO1A 4JJ8A 2I2WA 3RFCA 4K03A 4XYMA 1RZVA 4K5QA 4L15A 2IVZA 3MVEA 5B3JC 2NN3C 4KE6A 1G19A 2FSPA 1NQ5A 4L28A 5A71A 1APBA 1TGVA 4N3BA 3OP1A 3OUUA 2KM1A 3T3IA 2VKQA 1C7ZA 4ALMA 3NBQA 1N5DA 4WXYB 1IOVA 3L41A 2NYUA 3W4IA 4ZARA 1U0GA 2RK3A 1PWHA 4C6HA 4L4YA 4B75A 3E1GA 3AUTA 5JU6A 5JXJA 5EMHA 4GPAA 1WEHA 5EKDA 1CZHA 2FW9A 1QG4A 1TLTA 1BCSB 4DQUA 2VUSA 2FFAA 4NXNB 3MSXA 3NEYA 1U04A 4D3YA 2HWXA 4I3HA 2JI4A 5DNYB 2XQJA 2VCEA 1KI6A 1VRWA 3AHGA 4I5FA 1JAHA 4G01B 5CDSA 4DV5B 3ND6A 3A1EA 1NJGA 2PMEA 2ZWIA 4A0RA 1PR2A 3AV3A 5B1HA 3OKCA 1UCFA 4MI6A 2R8ZA 1ECCA 3LXRA 2OM2A 2Q8PA 3LWZA 2C2MA 4HH4A 4QUGA 1EZ1A 3CXRA 5TF0A 1KE2A 1E3IA 4JBIA 2MR6A 3HYRA 4O2AA 2CDRA 2C2OA 4GI1A 3FHJA 3O21A 2EKPA 3RVQA 3F3SA 1Z9BA 3NBKA 2YWFA 3AO0B 3QW2A 2H07A 4YS6A 3A70A 1AHNA 3V8PA 3VQTA 1BYIA 4LPKA 1XA0A 4W5RA 1KZGB 2AW3A 2VRCA 3GUUA 1M1YE 3HRIA 3L1UA 4Q24A 5EWLA 2CYAA 4MV9A 1I32A 4O0LA 1YB1A 4QPZA 3S7TA 1RCUA 4CKBA 4DMGA 4LYAA 1TEHA 1QIFA 3RTEA 1VTKA 1AO3A 3EPRA 1SHTX 3CB2A 2QB5A 3UMSA 4YRMA 4LXYA 3LZDA 2HX1A 1EUZA 4FOLA 2J6HA 3G2KA 4NMWA 1LS6A 3VO2A 4TVSA 3ONEA 4K26A 4UE2A 2PQ0A 2OXTA 4O4LB 4MVCA 1M1YB 4TKVA 4PPFA 5BRAA 5I3ZA 2PKXA 4FZJA 4AUNA 2MU1A 4DAOA 4UHDA 2A0XA 4M1KA 3AILA 4MS3A 1IOWA 1ZW1A 1CFZA 1CY1A 1NUQA 2A14A 2MIIA 2GZ2A 2CLMB 3DKRA 3H9CA 5FAXA 4N41A 3TM4A 3K20A 2QE7D 1VB5A 3KT0A 4R2WA 5FX2A 4UXHA 5D6NA 2WNIA 4NYIR 4PXYA 1KKMA 5JSZA 1H3EA 4CF6A 3ZE1B 5LDGA 2FEKA 3TDKA 1MB2A 3CKKA 1GU7A 1II8A 4RK0A 5EIBC 3ZW7A 4EBFA 3U7EB 1U2DA 3QKSA 3OFVA 5LP6A 3FUUA 1OBCA 2WHPB 5FUWA 3OX2A 1WOYA 1P3Y1 3BHJA 3M2TA 2QRVB 4AYXA 1SAYA 1ILWA 4ARIA 3ZWBA 1N6PA 5LBTA 4V1CA 3OI7A 1RHUA 3GUCA 5JHGB 3T4PA 3FWNA 3KQSA 4I6GA 4O4IB 3VJRA 1ESEA 3R0JA 1KJZA 1P19A 2JGIA 3A6LA 3ABSB 4K87A 3OFJA 4GOLD 1PR6A 2VHYA 3U19A 1U2QA 4I50F 3EDMA 4TRJA 3MM4A 5KWVA 4I4CA 2W6JA 5IBCA 2DB3A 4IS2A 4P4LA 4QDXA 5KX5F 5TARA 4NFHA 3HB0A 5IKXA 4HNUA 1BS9A 2NW6A 3Q7PA 5T41A 4DLAA 4XM0A 3HKBB 4EUNA 3EA0A 5IM4A 2Q4RA 1BJRE 2C8KA 4IUCS 2IGBA 2WR8A 5KAMA 5IDVA 1NULA 5F9FA 3O3CA 10MHA 4MR9B 3USES 3IE1A 3M5CA 3D8BA 2XT0A 3G8YA 4D6YA 3SS8A 4KNWA 9LDBA 1OCEA 5DB4A 5F7ZA 4OSOA 4KAFA 3CUEF 3DO8A 2NYRA 1FDVA 3KOOA 6REQB 4JSYA 2OCLA 5IUNC 4MW4A 2VPPA 3FJYA 2C4HA 4ECAA 2OSBA 2FFJA 4CM3A 1FYDA 3ESRA 4XGIA 1Y9AA 3TX6A 3RVDA 4EO7A 1UXIA 5DK4A 2A9OA 2FPIA 3QVGB 3O7WA 1Q92A 3JVDA 2N42A 2A5LA 2PYDA 3L92A 2WPNA 2IU0A 2CD7A 3K9LA 4LOHA 2QORA 4LZLA 2CE2X 5L3SA 4C7XA 4FYJA 1X14A 4DXHA 1ZCBA 4JEUA 5LBUA 5K3OA 1Z7EA 4RVNA 2P2YA 4OP3A 3GOHA 1L1FA 4NR0A 1G3MA 1XTVA 2WMYA 2ZJ6A 1XTPA 4QTUB 4UKDA 2FW7A 1JLSA 1GTJ1 3F5MA 2IYRA 3ZLUA 4FIZA 1RMTA 4LYDA 3TYXA 3F4LA 4AMYA 3QXXA 5H80A 1C1HA 4AJ1A 3ZHUA 3VR4A 4E3ZA 2X41A 3DT9A 1BG6A 1V4VA 1V8FA 3AERB 2QYHA 4Y2TA 3WYAA 4ALKA 1NW3A 1SIOA 5EKTA 2PMCA 3K15A 4N6NA 2O23A 2O2SA 3FSRA 4L76A 1FRZA 4GNKA 3I4FA 3WHLA 2OLEA 3Q85A 1QTIA 2BW0A 1R4ZA 4I1VA 1DJMA 4UEKA 3UWPA 4XD7A 1F7VA 1M2VA 3MFQA 4ZK6A 4CEIA 5FWDA 4TYYA 1LGYA 1BW9B 3JQFC 2HBRA 5A05A 2AG1A 1EUYA 2C7GA 1FFHA 3RBAA 4DLKA 1RZUA 3D7LA 1A7UA 2QM8A 3UOAB 3MMSA 3SCZA 1IK6A 1IEWA 4UBNA 1JDJA 3B3FA 3EF0A 3K16A 5C1BA 3RHTA 3AFMA 3VZCA 3FI9A 4XR9A 1F6DA 1DQRA 2GYUA 3CRRA 1SBZA 3TOVA 3TQIA 2FPWA 1G2QA 2RMKA 4IGEA 5DTIA 3UNXA 3WGKA 4D4MA 4YXWD 4TLLB 3M3HA 4R1SA 4U6QA 1LB1B 2I66A 3HCPA 1RMQA 1TTHA 5KAPA 1X7XA 1N5LA 2DR0A 3A10A 4QTYA 5TPWB 1Q21A 2HA0A 2PSEA 2C83A 1EBUA 4YI3A 3I04M 2HJHA 1FL9A 1OV4A 4GC9A 5DCWA 4N3AA 4AUEA 1SN7A 3NHAA 1PWZA 2ZU0C 4C0BA 3GLFA 1KC1A 2YYAA 1UFOA 3QEMA 3PYLA 2Y77A 1YR3A 7ADHA 3GBSA 3K71B 4MSUA 2V5VA 3KU1A 3RIEA 1ECFA 3OCVA 3QMVA 1P0QA 2NU6A 3HFRA 5CJPA 2QP9X 2J59A 1MJNA 1U8EA 2XWJI 2FRDC 3PYXA 3P2JA 3WKDA 5MN6A 4UUPA 2PT5A 5KNBD 4BEWA 3TINA 5FADA 1TYEB 1V5WA 4OQXA 4K40A 1VL6A 4RZXA 3ABIA 4XVCA 4MI1A 2HA2A 3H6GA 4DQDA 1PVOA 2D4AA 2UZ0A 1DBSA 1M54A 2Y93A 2XNKA 3EE6A 1KVUA 1EWRA 2B21A 3OOWA 3VDMA 1OH8A 1N32B 1G3QA 3PR3A 4IS3A 4KL8S 1YZKA 4HB2A 4MCHA 1G98A 3V9PA 4CODB 2C58A 2ABWA 1NRJB 3FCEA 2O8DB 4Q9IA 5B64A 4B6RA 3WLKX 1GRVA 3RKUA 5CG1A 1M2JA 1O4VA 3C87A 3K8QA 3T3HA 1KXZA 1EDOA 1FW8A 1VE7A 5F5LA 5CCEA 1UKBA 3MJFA 4CKBB 3RIHA 2K7ZA 2O4UX 2GMWA 1WSAA 5TS3A 1OB2A 1K63A 2QXYA 4OHOA 4IQGA 4ALNA 4CPDA 3K0FA 2KSQA 1S4MA 4QLOA 5SYMA 3X2SA 5BURA 1MG0A 4KB5A 4C20A 4B45A 2HIGA 4QPPA 4YDSA 1FUEA 1JJAA 1NPTO 2DHDA 2IITA 2W2MA 4P7FA 2O6HA 3K70C 3LBYA 1DO2A 2GF0A 4FMDB 5LQSA 1SZPA 2UZIR 3ISJA 3KXKA 1GLNA 4I1OA 1TMGE 1XUOA 2H85A 1EE2A 4L8LA 4MIKA 4QODA 3LA8A 5JSZB 1DFIA 3P27A 3T38A 4O2BB 6LDHA 4Y8VA 3RVBA 3EFBA 3GRPA 4YR9A 4PYQA 4LUCA 1GPNA 1Q15A 1CY7A 3K0CA 2AOTA 4LGCA 1OVGA 5J63A 3THSA 4Z1MD 3QKSB 3R9XB 2IRWA 1WB9A 4FYYA 1QP0A 1DFGA 3IVCA 3ITKA 4NBLA 3WLAA 4C2BA 2FEAA 4BYGA 1Y9ZA 2XTNA 4PYIA 2J0UA 3ZNOA 3LHIA 2WJ3A 4QBIA 3NIFB 3T1OA 2FZ5A 4DYHA 1FJXA 2XGOA 1GADO 1QH1B 3HR7A 4M7OA 4I50A 1P44A 1V37A 3T12A 2WM2A 3D6JA 3Q9LA 1QANA 4PAOA 4E13A 4GPIB 1AQJA 2G25A 3QF4A 3FRIA 4FZVA 4JROA 2BCEA 4YCBA 4KR9A 2QE7A 1QRRA 3RAEC 4D98A 2J9YB 1GIAA 3UA4A 3RH0A 1DEAA 2WHEA 4X7RA 3CWCA 5BN5A 3T35A 2IH2A 4RQTA 1FTWA 2NQ2C 5AW3A 2FEWB 4WLOA 4ARVA 2IP2A 3N6VA 2HH9A 2DCMA 1JXAA 4ZA2A 4DNQA 5DYIA 5DASA 1FFSA 5B1DA 2FMTA 4F11A 5BQOA 4MPJA 4ZEOA 1F2UB 1AURA 3KWMA 4RV9A 2WIKA 1GUYA 2H5IA 1ZLXA 4JHLA 4NYMR 1J09A 3H5NA 4WZBA 3WLMA 2IXFA 2GVDC 4OATA 1E2DA 2QX6A 1ABBA 1GDTA 4ZOBA 1F4LA 1JPNA 2B94A 4GYKA 2HIAA 3OJXA 5AJHA 3Q7RA 1U6IA 1VP3A 4HP8A 4EENA 1RQXA 3A3NA 7ABPA 5JS6A 2ERCA 3AZPA 2WA1A 4FS3A 1UK6A 2PD6A 1IY8A 2QRLA 5ADVA 3L79A 3NONA 2D0PB 1DWQA 2BR3A 1T35A 1Y8QA 1Q2UA 3NASA 4AS2A 3QV1A 5DNAA 2HTFA 2VWGA 4TTAA 2GK4A 4C7KA 1OD6A 4QDKA 2VDKB 4UJ3A 3WRYC 3CSSA 2OQVA 2I54A 1DAIA 4MUYA 4JEHA 4QOIA 3SSNA 1WDMA 2AK3A 5DP2A 2AJCA 2I8CA 5LOVF 2V6FA 3UKOA 4FWBA 5LJIA 5GGXA 4DPLA 4EWLA 4JUIA 2OBFA 4PAWA 1RBZA 3AU8A 1EUQA 1EVEA 3BJRA 4I46A 3VISA 2ZJ4A 1ZJWA 1YS7A 4B34A 4UUQA 3WIUA 2GEUA 3WRVA 1M8KA 3AX6A 3D2LA 1ZN2A 4G56A 1LI5A 4RD6A 2FW6A 3Q5DA 4F38A 1SU4A 5L3VA 3PNQA 4WBNF 4R6WA 4CMIB 5K20A 2E87A 2BKLA 3UUFA 2J46A 5FLYA 4L95C 1YQGA 5LMCA 3W5BA 3VUEA 3VDQA 4CEIB 3EF1A 2JLYA 2FUG6 1BW9A 5AHXA 4M46A 1WLSA 1GEEA 2WYIA 3U4IA 4ERXA 4TV9A 2GNOA 2ZRKA 4WN9A 1CUWA 2BTEA 5IC5A 1PZHA 1XZCA 2WJJA 3H87A 3EOBI 2CUZA 2DG2A 1DEXA 1ZNWA 1K86A 4LYGA 1Y5LA 3OC0A 1ISIA 4G6ZA 3OOEA 3PXGA 2G4VA 2L0XA 1NYRA 3COJA 2YS6A 1ZD8A 3P8ZA 4UNSA 2J30A 5F78A 1VKRA 1TKAA 4XIJA 3S2UA 1UJ2A 1ZIYA 3L04A 3OPVA 1GAWA 1CD5A 4IJQA 4A0GA 2OBNA 2VQ6A 1AKRA 3IESA 1TLLA 4BO4A 2ZJ5A 3PJGA 5CXSA 5AM4A 4IOMA 1R6AA 1HMYA 3E3MA 1EX9A 4G0WA 1EK5A 2PN1A 1QGYA 1XNRB 1SKYE 1U2SA 1AE1A 2VQ3A 3GT7A 4LZNA 4ZHQF 2DLNA 4YV7A 2R7MA 1QUFA 2Y1WA 2DVMA 4KK4A 1P61B 4Q3CA 4XIIA 4AJ9A 1CXZA 3FG9A 4E7PA 1JFFA 3L6OO 1VCHA 5JROA 3ACCA 3NBFA 1T4MA 1YS6A 1KWGA 2VDNB 4MARA 2XCUA 2J0QA 1DHRA 1KSJA 1EE1A 4OK3A 1A7KA 3KEMA 3PQFA 4B8YA 1LWNA 4FDAA 5K0CA 2FHSA 3TKYA 3H2KA 3DMGA 3OWHA 4JJGA 1XAHA 3RPEA 3JQQA 3I8SA 4JWTA 1MW9X 1P9WA 3DFFA 1BD4A 3H6HA 3GG9A 1CR1A 2EBFX 4PX5A 4X5OA 4NH4A 1XRNA 1Y3FE 1ML4A 3BYZA 4FCCA 4J0CA 4N0DA 5THXA 4CGZA 2X8BA 1FJHA 2MCFA 4GT1A 1ZR2A 3PQ5A 1M7BA 2O8DA 1L4HA 3HO6A 1OFUX 1T8TA 1G21A 4NATA 4PYLA 2RJ3A 1UZAA 3ZUGA 2C9BA 2IUEA 4OLAA 3NC0C 4M9ZA 1ZL2A 3PWSA 3AJ9A 4QULA 5DCLA 1BNCA 3VNRA 2E4VA 2KE5A 3C97A 5DV9A 4DV4B 3RRFA 3GQVA 3PGXA 1QHYA 1WZ2A 1Q19A 1I6LA 3P2EA 1I24A 1SVSA 3K0FB 3ZS9A 1ZH2A 2VAVA 3ENKA 3F47A 3KOZA 1NLYA 4PTZA 4LFCB 4L3OA 2G0NA 2WIBA 4EA6A 5A0TA 5E8JA 2O0JA 3U9LA 4GPEA 5FPSA 2PYIA 1EGVB 4YYEA 1U1GA 3O8NA 2X5OA 2DFPA 5DT2A 4MLDA 1PFUA 2XYRA 1IBRA 1Y6JA 1WPGA 4JZKA 2ZJ1A 4UHEA 2TS1A 3RARA 4PCLA 4Z4EA 3C3JA 2FH5B 1E3WA 1EIZA 1ETHA 1L7AA 2UVQA 4S1VA 3U61B 3WGGA 2EFEB 3ZD6A 1TM3E 4HYYA 2I4IA 3OHMA 1P1BA 2Y0CA 2QTNA 3AUSA 3U49A 3K6SA 3PTLA 2GEDA 5HDQA 4CUJA 2R8EA 5LDDC 3R9XA 5BQ5A 2PU5A 1EK6A 2GJAA 4ACBA 2NXWA 1JI3A 4RK7A 3C7DB 2A3RA 2AR9A 3UAWA 2I6QA 1V5FA 3EAFA 3H8JA 5AICA 1SEPA 4LJ9A 1JDBC 4WA8A 3SYTA 3BA1A 5CA0B 3SC3A 4BNFA 3M34A 2BFCA 3DMTA 3REQA 3RS4A 1IIRA 3DDUA 4Y2YA 5HPYB 3E2IA 2H1HA 1NY5A 4DLPA 5COAA 2WOJA 1GKIA 1D7AA 1FTGA 1JAIA 1MVNA 4X45A 3V7WA 5A7FA 2QIPA 4IMIB 3WYBA 2CHUA 3AW8A 1DJQA 1Q84A 2RB4A 2KYRA 4OM7A 1RJDA 5CPFA 4CM6A 5CFNA 4OI0A 2PUJA 1CYDA 4NG5A 1TMKA 4RXTA 4F85A 5AJUA 5FNVF 2V3CC 1XZNA 2WNSA 1Y7PA 1NJ6A 2I2CA 4UDYX 1BH2A 2C5SA 2FWAA 2VHZA 4RMGA 4TYPA 2HO5A 1INLA 3SBDA 2AEFA 2C8VA 1MQ9A 1ACJA 1SXJE 1QORA 2YR0A 4E5DA 4FGSA 1GU0A 4FKMA 2P5YA 5AHWA 3O2SB 1DXQA 2PWZA 4JYBA 2CGEA 5T4BA 5CCBA 5CEFA 4RXMA 2QRUA 3X43A 5K6TA 2OKGA 4BNTA 4RZIA 1XQXA 1A76A 4CLRB 1Z5UA 2IHNA 4KMSA 1OWOA 2PKYX 3VU3A 3KJXA 1PI3A 5JI3E 1IZ8A 1H65A 4YCNA 3OD1A 1ZD3A 4F6RA 3MZ0A 1JNXX 5I9BA 5T4EA 4EA7A 1CERA 5FL3A 4HJRA 1GA6A 1UXKA 4INOA 2SCUA 1EZZA 4AKTA 1SB9A 4DC9A 4F8EA 2V65A 2CJWA 3BMNA 3QH4A 4Q3AA 2QWXA 5C34B 1DKMA 1UODA 1D5WA 4ZCPA 4BLWA 1PZXA 3GUYA 1L4BA 1S01A 2BJWA 3GC6A 4KTVE 1QTQA 1HK7A 2IY7A 4KVGA 1N33B 1GP2A 4UDOA 2FZLA 3K6KA 2X0DA 3VTZA 3KAPA 3T5MA 3ICVA 1K5HA 3JZAA 2CWWA 3R20A 2AQIA 1DKUA 3BUSA 3I5UA 3NDPA 4MGYR 1RRCA 1U5BA 2BGMA 4BEBA 1TZMA 1U1IA 3LPLA 4ZVLA 3GLHA 3OIGA 4G4GA 4BJ6A 4DIUA 1US8A 2VA8A 2NTEA 4D2IA 2D1YA 1T5IA 1M7HA 1EK0A 2AK2A 2X9GA 3OETA 1HE1C 4JJFA 5DZSA 4DMHA 2OBYA 4E5NA 2GBGA 2OCAA 4MTCA 2ZBDA 2V6BA 1T2VA 4M7PA 4YJ3F 5ESDA 3NM4A 3LQ4A 2AB0A 1EP2B 2AFIA 2JD2A 3ZLTA 1VCMA 3H5RA 1TVKA 5COBA 5LZ2A 1Y4UA 1RABA 5EAIA 2B3DA 5TJHA 4RF5A 4DLZA 2O2ZA 1M2FA 5DFAA 1E9AA 4DMUB 2DPXA 3MRTA 1Q7RA 2PLRA 3ORFA 4UCFA 1PL7A 1VYVA 1SOMA 4MRMB 5H1YA 3W8RA 5DN6D 4L08A 5GVSA 1HLFA 4UQPA 1DWPA 2XYVA 1NUUA 3GDHA 3HCFA 4KV9A 3R3JA 3QE2A 1E2PA 2BONA 3A6DA 1NZFA 4DG5A 4ZRMA 1O95A 1NRIA 5D3QA 3EMKA 5SYNA 5DGCA 1O8BA 3V3KA 4E2XA 2Z6QA 2ENUA 1AMUA 2GHTA 1J06A 1JG4A 3FSGD 1QVRA 3F97A 3ONWA 4B6OA 3VDXA 1QZUA 2IL1A 2YW2A 4KJZA 2GDZA 2GPYA 3IHTA 3ZQ6A 4AG6A 2IEIA 4BRZA 2QG6A 4GVLA 2JASA 3FXAA 4RJLA 4GXTA 3C8UA 1BA2A 4NV0A 1IN4A 3NDBB 4LGMA 2QVCA 3HXQA 1J0BA 3IULA 1ES9A 2WKRA 1NOKA 4QECA 4QZVA 1N78A 3TMKA 5FTNA 4EK9A 3S6JA 1WXQA 3Q41A 3RYHB 2MSKA 4I1SA 1T6YA 5FO0A 2Y6UA 2FW1A 3KJFA 3VZBA 1L5HB 3IXQA 1Y4SA 3C3KA 3JAWA 1WNTA 2WU8A 4GXNA 4GPBA 4CU5A 5KB3A 4EDFA 3IJEB 3MJRA 4HNGA 5AVKA 1IJBA 4H35A 3TLAA 3ZLJA 4MWOA 3D0RA 1O57A 1Y1SA 2CNDA 2DU8A 1QQAA 4XLLA 4OHZA 2J5BA 3RFUA 3PHBE 3TKAA 1XQWA 1L9XA 1XRRA 3CRW1 4NL4H 1BE0A 2FDRA 3KUXA 4HRVA 1DJNA 2IQIA 5LLDA 2L69A 5LMUB 1MVLA 4DC1A 4FKBA 1N2SA 1KNQA 2BLNA 3ZNQA 4RA6A 1SUCA 1S3FA 3ACDA 3NM6B 4QFMA 5FOWA 2ZTVA 2AOWA 3W34A 4ZT4A 3FDJA 4BGVA 4R2KA 4D9NA 1C0PA 1RYMA 1GVHA 2XRFA 3B2EA 3NRCA 4JVMA 4PG7A 2O52A 4NMHA 5A5DA 3KLPX 4ON9A 2YWXA 3LX5A 3PGLA 1NZDA 2PKWA 3ELUA 3L7BA 5EPUA 2MYPA 1G0OA 3S2ZA 2GS9A 5IM4F 4LFAB 2GRAA 2PS0A 1E7YA 3SHTA 5HQJA 1CC1S 2CCKA 1W94A 1ZLYA 3ZCUA 3BCUA 1XF9A 1EK2A 3IAEA 4QQRA 1Q5PA 1SBIA 2DJIA 4QXRA 3ZDQA 1UR5A 4OMUA 5HIKA 5JECA 4U8GA 1X6VA 1O0CA 2B1QA 4BLQA 5GM2A 3EXAA 3KVVA 4Y6SA 3OZGA 3M1YA 4QDJA 5K8UA 2FCAA 1WXHA 2R3SA 4QAQA 1XVLA 2QMUA 4I4TF 3WIOA 4H1WA 5CFPA 5DXJA 2C7BA 5ECYA 1UBCA 4IWXA 4WCVA 1JVNA 3K6SB 4MV3A 1JJVA 2GJ4A 4XFJA 1SUSA 1RT9A 4D4KA 2DE0X 1GAEO 3Q15C 2X2FA 3E70C 1S7GA 2QT9A 4LV8B 4WV3A 3EUWA 5ANRB 2Z08A 1XEXB 3DXZA 4RHEA 3WRXA 2GRUA 5TNXA 3HMKA 3WFJA 3G2OA 4JT8A 4GYWA 4RGQA 2EZ8A 5FA5A 1W29A 1EGHA 1ZBDA 3I72A 4LKOA 4MUXA 2O2JA 4NCIA 4OLJA 4BPRA 1AO0A 4J16A 4DKJA 4BV8A 3U5ZB 1RM5A 4LDZA 3LAWA 4FHGA 4TN5A 3REQB 4CHTA 2OCKA 3V33A 4RHXA 4LYYA 3LY7A 3KUUA 3MC1A 1WKVA 2DHCA 1AGPA 2FX2A 4S04A 3D7KA 3ZVRA 4FHDA 1I14A 1FUUA 3P0IA 1N5JA 3HN7A 3HVJA 3K9CA 1XD9A 3OWXA 3Q7TA 1I30A 1MB0A 3BZUA 4NBKA 3HYCA 5TPZA 3TI7A 3TSAA 4F9GA 2QR2A 2W2LA 3QBDA 5TY0A 5KTMA 3LCVB 1F4PA 3BTVA 1EESA 4MVWA 1FDRA 4DGQA 4MQEB 1VMIA 5EXPA 4Q6WA 4F4UA 4BDTA 4LXGA 2C42A 3OH8A 4YP6A 2POQX 3N87A 2IPLA 5J5CA 4NCBA 1QIJA 3RC8A 1R6DA 5B7GA 1A27A 2NNWB 3HM9A 4HQFA 2R6R1 5IVIA 5TMBA 3EAGA 3DE3X 4HADA 5CITA 2PVCA 2F64A 3IAS1 1YCFA 4B7ZA 3JX9A 4YO7A 1D2EA 1OAOA 3DV9A 4IBOA 1N0UA 1XRQA 3ZU3A 2WLTA 3FGNA 4TV9F 4PNEA 2C4MA 3E23A 1NPYA 2HU8A 5AK0A 1S4QA 4NHOA 2XEXA 1DRKA 1BC5A 1PHPA 1M2WA 3T7EA 4QU0A 4DUZB 4E5PA 5BSFA 5KNDH 1GGHA 5LZ4A 3S55A 4F9TA 2PRYA 1UAGA 3JATB 4HAZA 4XUGB 5FFNA 3RFXA 3FSJX 3RGWS 5I47A 1XRPA 3AFIA 3ZC3A 1YQUA 2HA6A 3FB1A 2DLCX 2WJ4A 4B0OA 1OA1A 3V4ZA 1QO0D 2J7PA 2BGGA 3A14A 2GERA 1GY8A 1FNCA 1A2OA 1TPYA 4RBNA 4YVFA 2TSYB 3GRKA 3K9GA 1XU9A 2VA9A 2ZYTX 1U5BB 5LLTA 4BKUA 1MD9A 5KYXA 2YFHA 2OWDA 5CIQA 3DLBA 3QVKA 2P11A 2QQEA 3Q3IA 2A30A 1PNVA 2W4IA 3CRZA 1FDWA 4KVAA 5CAEA 1KI3A 3WIBA 1U8TA 2HPZA 5C2JB 1T2UA 3NWJA 3WMFA 5KTOA 3C16C 4A10A 1MO6A 1NJ1A 2CL0X 4G8JA 1AGYA 2ZI7A 4OYRA 3K09A 1CUHA 2BMFA 4EELA 3M6FA 4C3UA 1UMKA 4OYHA 1RTKA 3EXHB 5CGQB 3ZV6A 1P0CA 1RBYA 2A35A 2WAYA 2WQ7A 4M8NE 4R1PA 2PCLA 2YWHA 2TECE 1V5IA 4GX1A 1OWPA 4Y0AA 4I14A 3VPFA 4MRMA 3Q3EA 4QASA 4BQEA 5ENZA 1Q3KA 2V9ZA 3KZXA 1MJGA 1TKRA 4HC4A 4JYPA 3M1LA 4XCVA 5F2KA 3U81A 1PZEA 1FBNA 3GG2A 4RFVA 4ZEMA 4IYJA 1UMCB 4QSHA 1VE1A 5HF6A 5HNKA 3GFRA 2XYPA 3B1JA 4O4LA 1M1YA 1LDYA 1AXEA 1PWYE 4OFZA 2JJ1D 3NDRA 3DBRB 2EG5A 2DEUA 1FMLA 1QK3A 5I3CA 2XRYA 5BUZA 4DA0A 4C06A 2IZ1A 1WUKS 1ZRNA 3P4YA 1E18A 2CDBA 3M9LA 1N2XA 2A1TS 2IXTA 1QSGA 2J9RA 5HKAA 2HF8A 2C2ZA 2O2CA 5FTWA 5IKEA 5SZJA 4E6EA 4ENPA 4F1WA 3LYHA 4DA4A 3CW9A 2ISSD 3QF7A 1U2GA 5KX5B 3WLPA 1VL2A 1W2WB 3CLRD 3VYTB 5KSOA 1W85A 3DDHA 1SUIA 4FYHA 4RENA 4MXDA 4XSVA 2QENA 3CYFA 3GFQA 4F8YA 1ZM9A 3BXOA 3X1YA 1JFVA 1FYVA 3U2QA 4FYWA 2A59A 4O4IA 4NU0A 4AY5A 4X24A 4MLZA 4B2LA 3M4JA 1HX7A 1DAEA 2X8AA 3KV1A 4ZRDA 4CTOA 2WAMA 3L8CA 1JEQB 2OHJA 2PV0A 3AY6A 3KD2A 4KU4A 4NLLA 4DM7A 3A11A 1E96A 1BWSA 3DTVB 3I1YA 2AXPA 4H4CA 4A1FA 1N25A 5CVDA 5LYYA 5AHKA 2XTMA 4LG1A 4WW0A 5EQTA 4C08A 1JL3A 2F8MA 4IW3B 4KRYA 4G2TA 5T57A 1UP6A 1VHDA 2R62A 2V45A 5CB6A 3TGPA 4P7GA 1VLMA 4GZLA 4GXRA 4AKSA 2YN0A 1R66A 4DLYA 2YV1A 5LXTA 4L0MA 3KZCA 1M9NA 2J0VA 4AJOA 2Y1GA 4AMBA 3F1KA 4JYZA 2RJNA 1YVEI 2BD0A 5KOIA 1XJCA 2B4QA 4EABA 4I3FA 1G8AA 1Y63A 3DHVA 3FA2A 3P9QA 4HZUB 4TXNA 4DA8A 3QBVA 4DDWA 5BO5A 3A2NA 1WR8A 3EHDA 3SHWA 1Q14A 1Y8CA 1LDBA 4IF6A 3R0IA 3TRHA 3D4NA 3Q3VA 3OEEA 4CW7A 2D1RA 3QLJA 5G2OA 4Y3UA 3DNFA 3QW4B 4PC1A 5IC4A 3BWDD 1JTFA 1YA8A 4AKGA 2ZSFA 1CFJA 2Q4BA 1E4OA 4L73A 4J2TA 5TQJA 2GYWA 1GZVA 2QLBA 4HXYA 3QVGA 5KU1A 4EB6A 3UATA 1OXTA 3RIGA 4BVGA 5BWBA 3N59A 4LW8A 1FP1D 4HAIA 4LIPD 2R8PA 1W0JD 2R7KA 4UVEA 1BMQA 2ETXA 4ZVQA 3B8EA 3PT5A 2B7CA 4YQEA 3HDJA 3LM8A 4AY2A 1GL7A 4PGMA 3KPWA 2FR8C 3FCYA 2IKQA 3TQOA 5KQLA 2OYSA 4G0OA 3WMGA 4D43A 3C2QA 5K0BA 3FWPA 3KKQA 1AB5A 2EJVA 3RVNA 2AFVA 3PXAA 4KPYA 1T29A 4RVHA 4FFVA 5B30A 4E5UA 1XNQB 2PX8A 4R0VA 5E4FA 2P2GA 3AUJB 4CVNA 1R12A 3LF2A 5IBQA 1NKTA 3FMVA 2P2DA 4CN9A 3NQ41 4IRUB 2B37A 4J90A 4H7KA 2Q3FA 4TWRA 2ZXEA 1PP4A 3WQQA 4X1YA 1LBSA 4KQFA 2PRIA 3N8NA 4NAHA 1UXJA 2XADA 1YBAA 4HN2A 4PSUA 1QO9A 5MN5A 1Y98A 4CKEA 2VXYA 1L5RA 1QHEA 1VG0B 3GDOA 2NO7A 1OI2A 1VSBA 3UWKA 3WP0A 2VSQA 1GWNA 4G0QA 4RORA 4K9PA 1YJCA 4WXHA 2ZIAA 5SV2A 4XKJA 3HR4A 5JLAA 1K08A 2CFTA 2GLXA 2PNJA 3LNTA 4W8HA 3GVXA 4JGIA 3D6AA 1KYTA 4O1HA 3PJDA 4FW9A 5KOJA 2BGWA 2WMNB 3QFRA 4KLCA 2O54A 2IV7A 1CG6A 2JVKA 4U2GA 2J32A 4MGHA 3T3GA 3EZGA 4IAOA 1G55A 3ZY4A 2PZGA 1Y9JA 1D0IA 3VZQA 2QRNA 5HTKA 5LBIA 1JHZA 3KQUA 3HUTA 2RGUA 3CIFA 3FFAA 3CZPA 4R8VA 4Q3DA 4HDMB 3JATA 3RAFC 4JJEA 3SI7A 3DF9A 1U4OA 1VI6A 1XWWA 1UEXC 2YZ2A 3GIDA 3UXMA 4E14A 4BMOB 4CZ2A 2ZUVA 1J1IA 1PEDA 1CZNA 5E3HA 3IVMA 4J6EA 1DP4A 3SQOA 4PPNA 1SKMA 4XYEA 1OY1A 1UT6A 1HZJA 3BIJA 1ND5A 3D3WB 3P2YA 5C8XA 4DYVA 1BGXT 3ZPXA 1ZGHA 1ZDMA 2ZG6A 3H4VA 3QTTA 4KGDA 3DZCA 3GDWA 4LDPA 2RH4A 3DYBA 4D3DA 3N75A 3ZTYA 1ZMTA 4CF4A 1ISSA 3VMMA 4BVEA 3JSXA 3CEMA 1Q44A 2CHQA 2H9IA 3HCNA 1OIXA 2BI7A 3CH7A 1JWLA 2R9VA 2F62A 3MWJA 5LQCA 3SHVA 5JFOA 2ZCJA 3QITA 2JBAA 3EJ6A 4RVDA 1XBTA 2JIQA 4HWOA 1P1IA 1OIWA 2YIDA 2PFSA 1MEJA 3UCEA 2NZYA 3ENWA 4AWAA 2ZQYA 4MVYA 2VPTA 3C6KA 1NQTA 1H1TA 4BO2A 2BJVA 2GAIA 5TPZD 1ZA2A 3B5JA 3K2IA 2P7HA 2YHIB 3C48A 3JYQA 3IXMA 5DMXA 4PICA 1CJMA 1F06A 1UMCA 4FT4A 1KZHA 1JHUA 1S8NA 2HDWA 1SBHA 3QPVA 4Q1CA 4WI1A 3AJ8A 4U3JA 4GL4A 3U7QA 3LW7A 5F73A 3ABZA 4AJIA 1HY3A 1OUMA 2JJYA 2QM0A 3DOHA 4JN6B 1E92A 2YQ4A 5C8YB 2DUNA 2IYTA 5JAZA 4G5HA 3WZ2A 2GKSA 3MMNA 3LFHA 2OL4A 4A8HA 5ENDA 1E2BA 3HPRA 3WB0A 1K7CA 2XQGA 3IAAA 4B87A 2FSIA 4Y1EA 3W90A 4I1IA 4OU5A 5I9NA 4R69A 5JCOC 1GZ5A 4P4NA 5JZBA 4IG4A 3JARB 4A5OA 1E5LA 2ECFA 8ABPA 2D1SA 3K30A 2VDWB 3VDRA 3HYLA 4GL2A 5KX5A 3I5YA 4YO8A 3E7PA 2JFBA 1RWBA 3N0TA 4Y6RA 4LRYA 3RJTA 2HJRA 1FX1A 1TC2A 2GFHA 3N2YA 3R3VA 3U62A 1G4HA 4RKQA 4Q7JB 1DCTA 5CNMA 5EA2A 4X62B 4AUKA 1P2SA 1VI5A 4OGKA 1S2GA 2B99A 1PVDA 2XKBA 2ZULA 1O9GA 1LBQA 2C9OA 3OF3A 4JL5A 4X1KA 1OPRA 3E15A 3E22A 1H6DA 4NYJR 4EMBA 1DNPA 2I62A 3PUKA 4JODA 3ASVA 4LEIA 4P0TA 1FQWA 1JEYA 1XXHB 2PANA 1W48A 1JBEA 5JWOA 1MA0A 3LUAA 3FPCA 1PJ2A 4LMPA 3PTAA 3FYUC 1R7RA 2EYQA 3IIMA 4QC2A 4FX2A 3RF7A 1JR6A 1KDRA 2HLDD 3JYNA 4FDVA 2ODAA 3OLCX 2OO5C 3ZZTA 3EFOB 2M2IA 1DQYA 3HU3A 3NCHA 1SQ5A 1K6IA 3OCXA 3U4HA 3ORRA 2C78A 3DE7X 3LX6A 4G26A 4C22A 2ST1A 3AU9A 2GK7A 4RGYA 3UHPA 2JGLA 2WJAA 2C61A 1U0LA 1DTWA 1JR3D 5B3KA 1EP3B 2QPLA 2WSSA 4PWZA 5KYWA 3BRSA 1NAHA 3AXTA 2DUMA 3C8ZA 4WXRA 3GJRA 1E6LA 2VVTA 5HZHA 4C88A 4GD3Q 3PD7A 3R0XA 4BX2A 5A02A 3ZCXA 4MJ7A 4D9BA 1YVRA 1L4GA 4KG7A 1OAKA 3D6NB 4AJEA 5DW3A 3IAUA 3N6RA 3PXEA 2RBGA 3QLTA 4RZHA 4TQUS 1AH2A 2VF4X 4F93B 1YVPA 2ETVA 1OOEA 1W0CA 3DMHA 5AM2A 5EVCA 5K8CA 4Q15A 1L7XA 4OXRA 2IYWA 2EGUA 5CR9A 3G13A 1D0VA 5ITSA 3BVPA 3E2MA 5G0TA 3CEJA 5FOTA 1JR3A 3HABA 4ZEXA 2WDPA 1T0PA 3FNEA 4YP5A 1E6WA 2DY0A 4K9SA 3VC3A 3WNVA 2GF2A 4PCAA 4QSMA 4UC0A 4B79A 4TYNA 5KQMA 3PSHA 4EHJA 3O1LA 1C1DB 5B57C 2FDXA 1ZJZA 2AD1A 2JAHA 5DLQC 2P3LA 3VR1A 4LISA 2C1EA 2WM3A 3GAZA 4O2RA 4PFKA 4Z1MA 4CIBA 3ZZ1A 1LPPA 4YXWA 4PCUA 3TL2A 2G5CA 4Y9UA 3QG5A 4JJAA 1U2RA 3CM0A 2Q0HA 2P4HX 2ZBUA 4MV8A 4QGHA 3CH5A 2NUAB 4KX5A 3I6YA 3VSCA 5K6AA 1ZGZA 1P8JA 7REQA 3W2GA 1N8KA 4WCDA 5BWCA 3NTVA 2RGRA 4JT4A 1E2MA 4GP9A 5DX1A 4B71A 4ZHQB 3L5OA 3N2LA 1J4AA 3RIXA 4CMHA 1HDXA 2XUPA 3PKZA 4HKTA 3ZV7A 2HK9A 3S2SA 3MD0A 2WWHA 3LYLA 5HYVA 1HF3A 1PX2A 5AKHA 1PLLA 2H7YA 3ETDA 2NSHA 1GXSB 5MFPA 1I80A 2DC1A 2Z6UA 3JAKA 4L78A 5GV7A 5BPFA 3EGWA 4V1CI 4BLVA 3OTGA 4LJ7A 1KO7A 1CQZA 1J25A 1N2CE 1VJ1A 3AUKA 5DJ5A 2NUTA 4BVKA 5IYZA 3HWX1 2H4XA 3CLUD 3D3QA 1EMDA 1KIFA 1NUSA 1VHLA 3BAFA 3H8SA 3MOGA 4DCUA 2CV2A 3W9YA 5EMKA 4LRQA 4RTMA 4NJEB 3ONFA 5BUSA 3TNLA 3NVKI 1YI8A 2X5NA 3ZHVA 1AK2A 2PS9A 3CU5A 3LP5A 4JCCA 4M0EA 5CVTA 5E6RA 1ZVVA 3X1KA 4MV0A 4H6WA 3HQ4O 2JEYA 2PUDA 1G0NA 1ZD2P 2PG3A 1XDBA 1JLMA 2VH5R 3EZ6A 4LVNA 5EJGA 4LGYA 4ID9A 4B9AA 4WUVA 4QT4A 4NCHA 1HDCA 1Y3IA 3DBOB 3IQFA 3NLLA 1G291 5EQJB 3Q98A 3D3WA 4KO4S 3NOQA 4DT1A 2AWOA 4EYSA 2CF5A 4UU7A 5A4JA 3E9RA 3H9GA 5DBOA 4YWHA 1EVIA 1VXOA 4J0JA 1MO4A 4QU8A 4RHTA 2FSSA 4KMMA 4GLLA 4RACA 3PQ8A 2G1AA 4WDRA 2FN3A 1UOOA 3F9RA 4MV6A 1Z5NA 3NHRA 5BXQC 3IELA 3MJTA 4DREA 1RJGA 3F2IA 2JBAB 3W9UA 2ZIXA 4R51A 1GGJA 1OSNA 5SICE 3X2FA 1PW5A 3MCVA 1NBOA 2C3OA 5EJ8A 5L6MB 1GNSA 1J5PA 2F3TA 2I71A 4IH1A 2IU3A 2JRLA 5A0VA 4I4IA 1C3OA 3KCNA 4A27A 4EPTA 3WAJA 3BSWA 3V6LA 4POAA 5LA6B 2WWIA 3ZWYA 4EP1A 2J48A 4FNAA 3IEUA 3G23A 1YI0A 4P58A 1FFXA 1G6HA 1RSZA 3ECAA 5I4CA 1ZFNA 2B5WA 1EFHA 3GDFA 1FDSA 1T4BA 1YE3A 1E69A 1GM5A 4G67A 4GQAA 4II3A 4NZ9A 1T5OA 1ECJA 5C8YA 1WXIA 1Y8ZA 3WJ1A 3IOCA 1T5BA 5CJ2A 2ACKA 2EDAA 3TD9A 4AMUA 2WQZA 2M32A 2X8WA 5LXTF 4J1NA 3T0GA 2G17A 1EP9A 3FYCA 1PJBA 1XC7A 3ZVNA 4Q9KA