2XZDA

Caspase-3 in complex with an inhibitory darpin-3.4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
141
structure length
140
Chain Sequence
b'DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQARGTELDCGIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 51
structure length 140
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xzdA00
2Y0BA 4QUAA 4ZVOA 5LUAA 1K86A 5H0IA 3D6MA 1NMSA 3DEJA 5IANA 4FXOA 4NOJA 4D3XA 1GFWA 5IASA 1RHUA 4HVAA 5IAKA 2DKOA 5IC4A 3PD1A 3SIPA 2CDRA 3V3KA 1RWVA 1SHLA 2FUNB 5IBCA 1GQFA 3PD0A 4HQ0A 1RWKA 4JR0A 2J32A 3E4CA 3R5JA 1RWPA 4I1PA 4EJFA 3IBCA 1F1JA 3UO8B 4DCJA 4QUEA 1RWMA 4EHAA 4N6GA 3GJSA 2QLBA 4EHFA 3S8EA 2H65A 4NOKA 5IBPA 3H1PA 3R6GA 5IAEA 1BMQA 2QL9A 3P45A 2XZTA 1RHKA 1I4OA 2J30A 4JQZA 4FEAA 4EHKA 4NBNA 4IYRA 5LUBA 3H11B 4QTXA 2H54A 2H48A 1IBCA 4HQRA 2XYHA 4JJEA 1F9EA 3KJNA 1ICEA 1NMQA 1QTNA 3H0EA 1I3OA 1PAUA 1JXQA 3OD5A 4JR1A 1CP3A 4QUBA 4QUDA 1SHJA 2QLJA 2CNKA 3R7SA 1RHQA 2Y1LA 1I4EB 4QUGA 5K20A 4M9RA 4N6OA 2CNLA 2XYPA 3V4OA 1M72A 2AR9A 2H5JA 4QUHA 4ZVTA 4N5DA 4NBKA 2QLFA 2FQQA 2HBZA 4ZVPA 2QL5A 1I51A 4PRYA 3EDRA 4QU8A 4DCOA 4QTYA 4EHLA 2WDPA 3S70A 2FP3A 4N6NA 4JQYA 4QUIA 1RWOA 1RHRA 4IEFB 4QU0A 3R6LA 3KJFA 3NR2A 4N7JA 2C2OA 4QULA 3K7EA 2XZDA 4D3YA 3UOAB 2C2MA 2H4YA 3DEHA 2P2CA 3R7BA 3V55A 2HBRA 3GJRA 3D6HA 1QDUA 2H51A 2J33A 3SIRA 3ITNA 2H5IA 3NKFA 1KMCA 4ZVSA 2CJXA 5IC6A 4FDLA 1RWNA 1NW9B 3IBFA 1RWWA 5IAGA 3V4LA 3R7NA 4JJ7A 4QU5A 4PS1A 1SC3A 2CNNA 3GJTA 4AWBA 1RHJA 1QX3A 4QU9A 3V6MA 2C2ZA 3DEKA 4LSZA 4QUJA 4JJ8A 5IBRA 4ZVUA 4ZVQA 5IABA 2NN3C 4PRZA 2J31A 4AW9A 4EHHA 4D3ZA 4I1RA 4NOMA 1NMEA 2K7ZA 3GJQA 3EDQA 4PS0A 5LU8A 5I9TA 5IARA 2C1EA 2CJYA 1SC4A 4JR2A 4EHNA 2XYGA 3H13A 3NS7A 1SC1A 3QNWA 1RE1A 2CNOA 3KJQA 4JB8A 5IAJA 3P4UA 3V6LA 1RHMA 3H11A 4DCPA 5I9BA 2QL7A 3PCXA 4AWAA 1PYOA 1RWXA 4EHDA 5JFTA 3BIJA 1CVRA 4NBLA 5LU9A 2H4WA 3RJMA 2HBQA 4NOLA 2C2KA 4ZVRA 3R5KA 2HBYA 4FGUA 3D6FA 4N7MA 1K88A 3DEIA
chains in the Genus database with same CATH superfamily
2IYVA 1PCXA 2P2SA 1K4MA 3LDGA 5EZYB 1XRJA 1FW8A 1O87A 3K53A 1FFBA 2CK3D 4WPGA 2XSZA 4D5EA 3A2LA 5IRCD 3U48A 3KJIA 3LP6A 1BN6A 4JI2B 2QRKA 2JJ2A 2CGEA 3I53A 1L7MA 3QY0A 2H5LA 1E0KA 3R9IA 1D2NA 1DPFA 2R0QC 2V74B 1ZNZA 2AV6A 2J45A 4I1VA 4ZXFA 1V5FA 4QUEA 3T94A 3ZGXA 4NZ9A 5F1KA 1JHOA 3R7WB 4NWIA 3IHKA 1GR0A 3OU7A 4O1IA 3AI2A 1I3CA 1YDHA 1OQAA 2FPUA 3VPXA 2XECA 3RWOA 4E7OA 2NXNA 4DL9A 4IR7A 4XIIA 3EZNA 2I80A 1CY0A 5TQ2B 2H2HA 5GGYA 5AKGA 1M73E 1X3SA 3ICPA 1XU7A 3VOTA 1E9EA 2AHOA 4CT5A 2AVNA 1RZVA 3AIKA 3NAMA 1PNQA 3VDMA 2D13A 3KQMA 5BUCA 2I66A 1YR8A 1IWOA 3HRHA 5ED4A 4LHSA 2XXAB 4R2WA 2ZI9A 5E4TA 1V4VA 2C2GA 1KZGB 4KFTA 1AQNA 1MV8A 3FPJA 1AHNA 1WF6A 3LHFA 1JEYA 4K28A 4Q21A 2HRBA 4EUKA 1U2GC 1Z2AA 2DCUA 3EZ7A 2ATCA 3QMPA 4K8RB 5ICCA 1R9MA 3OOYA 4RPIA 4HB2A 2DEUA 5LP6A 4EYOA 5EUCA 3BTOA 3TSCA 1YR1A 5AHKA 1JHZA 1G4AE 2ODTX 3UKOA 4FLEA 2G7MC 2I2DA 2PH1A 1I8TA 3BZUA 3LOQA 4MR7B 3T7AA 3A11A 4YRZA 4PBRA 2GPJA 4FYXA 4ZQFA 1P7PA 3LBIA 3OUTA 4EGQA 2YV3A 5J3JA 3T3OA 2YWJA 4K05A 2B5WA 4A5OA 2ZSEA 3ZGNA 4R5HA 4I8XA 4OM7A 1K06A 3A0UA 3PE6A 2GX6A 1PZXA 4LDZA 5I4CA 2QRNA 4D80A 4KDEA 2K5UA 3LT0A 1ID8A 1NBMA 2CVFA 3SLKA 3I04M 4OQXA 1FDVA 2Z04A 4Q05A 4H0FA 1Z5OA 2F3QA 2ECQA 3IDQA 1CRPA 1AV7A 2BM8A 2QA5A 4A0GA 5F9MA 1L1QA 4IIDA 2UU9B 2VL7A 5ITWA 2CDNA 3QQ5A 3TI7A 2JIZD 3RTCA 4JB2A 4OHXA 2WWYA 3KVYA 1KZHA 1BEEA 1MC8A 4OMCA 3QKRB 4RLQA 3RSFA 4NCNA 4GGOA 1UADA 1HFEL 1YBHA 1VE5A 2YWEA 1QIGA 2SKEA 2AI3A 1Y8QA 3CB2A 2ILTA 2VJYA 3QBVA 4W63A 1MBZA 2QI9F 3ENZA 3S81A 3F98A 4BGDA 2E4VA 4J07A 3DZFA 2I4TA 1N9GA 3KYDA 1RRVA 2YWRA 3MFQA 1R4MB 4R8RA 2YJNA 4C3ZA 2R8BA 4U8HA 3DB1A 4I36A 3FNFA 3P4YA 1XNQB 1FFWA 1RD4A 2B8EA 1JEEA 4H3KB 4O2BB 3RS0A 2ZUBA 2ZWVA 5IAKA 2Q4DA 5EQFA 4AMVA 3VVLA 3WGHA 3ICWA 4E1AA 2A59A 2OR3A 5DLEA 4QJ4A 3AVPA 1N5DA 3HSSA 1AJEA 3KZKA 2JA1A 3D2CA 4M1TA 1ECGA 2IEAA 1D2EA 3HA5A 3LM8A 3OTQA 3GJSA 3KR2A 4LCBA 3HLTA 1KMQA 4OB6A 2NUTA 5K0JA 4UE6A 4UVEA 3EAGA 4JROA 3F46A 3K0AB 3JQ9C 1W36B 4X20A 4AKEA 1K8QA 3PC8A 1JIUA 2JGKA 5CB4F 4LV8B 5JTTA 3H2KA 1X7YB 1ZOSA 4GP9A 3W6PA 4YHBA 2C2HA 1M10A 5F3DA 1JAXA 4YN3A 5A1JA 1EK0A 1L5FA 3NDIA 3NYWA 3S68A 3PUJA 2I3BA 4IDDA 1G8PA 1T8SA 2YYSA 3TNDA 3I9V1 1UXJA 5I9TA 3OO1A 4YYZA 2VPTA 4X6XA 4YUWA 3LFHA 2PWPA 3B48A 1NU6A 1YQUA 3IPXA 5BURA 2FDCA 2HIGA 2LXNA 4FJ2A 4TRJA 2WV9A 1UFOA 2ONZA 4AIIA 1DO2A 1WKCA 1Z56C 1FRVA 3SSNA 4DMMA 5K20A 1XTUA 3CNEA 4NZNA 3IMFA 1K3UB 3QBDA 4KUEA 4TTJA 3C3XA 3OPNA 2VOJA 1WM1A 2CY0A 2Z5GA 3NUQA 4FC7A 4JLOA 3B8HA 1Y33E 1DE0A 1O54A 4YLGA 1EFAA 2XZDA 1ZDMA 1RYMA 4KWEA 1AN9A 2ZT8A 4R9VA 5DCWA 4DYDA 5JCPA 3U61B 3TAUA 3X1YA 3C4JA 2QL6A 3BQMB 3WNVA 4QGAA 4YFVA 3PTZA 1NHWA 3OSZA 4GZLA 3TLBA 1RYNA 2JBWA 1FDRA 1V0JA 4ARCA 2HZBA 3NALA 1X7DA 5EHIA 4UTPA 1PSDA 1F5NA 2ZUWA 3WYFA 4CVNA 2NXCA 5H02A 4YV2A 1RTKA 4OHWA 1P5RA 4IMJB 3ZI4A 3GT7A 1NBME 4CMEC 3U3RA 4R0VA 3WLKX 5HKKA 5K09A 3AL0C 1V8DA 2BGTA 2L2QA 3VR6D 1FSFA 1J56A 5JNTA 4LXYA 3NTUA 5G4KB 1V11A 2QD1A 4PLPA 4YJGA 3THYB 4RIIA 3TIIA 5LDDC 1WHSA 3RI3A 2O4UX 1FNSA 3PVSA 2X0FA 3BMQB 1F2UA 3G9TA 3AP2A 3NOVA 1DG3A 3MWLA 3FR8A 4I99A 4JBLA 1BDIA 3BFJA 3B89A 4BDSA 2C4MA 5CFQA 3ITEA 1EVQA 1XK6A 4I3HA 3V7WA 1KGSA 3V46A 1SXQA 4UMEA 3G9ZA 1AF7A 5EIOA 2XQJA 2PVPA 4LK3A 1UC5B 2AMVA 5BO5A 4X8MA 3RJMA 4NOLA 2EYUA 3RK0A 3S5UA 4CF4A 5I3CA 2BTEA 5ILQA 5ALWA 5GOTA 5TE9A 3F8TA 3ZGLA 4TZ0A 1MZVA 3VVCA 4EW2A 3KCQA 5A9SB 2C8JA 2IZ1A 3CQ9A 5ESRA 2DMRA 3IMKA 2UUOA 3FDZA 2HDWA 3C6KA 3JQAB 3QP9A 2HSWA 4B6GA 5ALYA 1KI3A 4W1RA 2GBCA 2XTNA 1OY1A 1TCCA 4H15A 3SY8A 1TVKB 1E6WA 1XD2B 2I29A 2PD6A 1R37A 2ZRMA 1H22A 3FW1A 4MQEA 4R1NA 4TKLA 3GPDG 4YRRA 5HA5A 4EX7A 3EMVA 3ESBA 3KC2A 5IXJA 4LFAB 2NZ8A 4KQWA 3FVWA 2W4QA 4GRIA 2GLXA 2R5FA 4UW9A 5J5CA 2ATIA 3ABQB 2NUPA 3JALA 4CDRA 2WSLA 1GRQA 5IJ9A 4FQ5A 4ALIA 2W8BA 3AFNA 3H8SA 2XZTA 1QKKA 3IYLW 1AN0A 3UVEA 1HEUA 1QSGA 2ZUCA 5ERXA 3NOQA 1PNVA 5BN1A 1SZDA 4RLFA 3GAAA 2BZSA 1B8UA 3H8VA 4JASB 4MR9B 4F3RA 2ZATA 2NO5A 3PPIA 3ZZNA 2IBSA 2O0JA 1TI7A 2PKRA 1V6SA 2XI4A 1ZRHA 1U0NA 4L8YA 1NG1A 1XN1A 1QDLB 5AJZA 4P0TA 2WJGA 3Q2IA 1EB8A 1RBQA 1V16B 3M9XA 4D26A 1IY0A 4BFCA 2GM4A 1XMQB 1PKXA 3MC1A 3EA4A 2V3VA 3ZD7A 1JLLB 5YASA 1CTQA 1VHJA 2Y66A 1BFKA 1I33A 4KXFB 2AI1A 1Y4ZA 5BQXA 4PRYA 1IB0A 4ZU6X 2I7CA 3TR5A 2R6DA 1X7HA 3GRYA 3UNXA 1Y8ZA 3U0BA 4WADA 2VYFA 3HN6A 4OHZA 4OL9A 4ADSG 3TFOA 3M3PA 4D3YA 2O2CA 2OO3A 4H1WA 3IAHA 4Y6OA 3CWZA 3TQHA 4NBSA 2BV3A 3NM4A 5HFJA 2JFYA 5EAIA 3SJUA 4OP1A 1Q6YA 2CJWB 4QNMA 2QG4A 1FDOA 4X60A 2W6CX 3PR1A 1E62A 3F90A 3QBJA 4KLCA 4RTNA 3JX9A 4C04A 3P2MA 5EKDA 4QFCA 5T4EA 4B48A 1I7DA 5F64A 1Y4AE 5G4LA 2OYRA 1U9ZA 1YOVA 3MOIA 4RKRA 2WSIA 4HJXA 4LQCA 3GRPA 4Y6QA 4KGXA 4I9NA 3THOA 1ODCA 1X0VA 3BRCA 3RFXA 4N8SA 4EUNA 1Q74A 4LKOA 4N3AA 4L3WA 1VPEA 1U0OC 4TLAA 3K9HA 3B7PA 4II3A 4YEDA 2HN9A 4J0JA 2PO5A 1R50A 2VHXA 1T3GA 2J31A 5T4BA 3IAXA 4GPZA 2YL2A 5IUJC 1ZJ6A 5SV2A 4MB0A 4D9FA 3JRNA 3RYHB 2W6IA 2ZWAA 4M88A 4X1IA 2XVZA 1EUCB 4K9RA 4DUPA 4C4XA 3AJ8A 1KRHA 2JCYA 4EJSA 3UGJA 1C5KA 2QTAA 5EL0A 3M4NA 4WMLA 3W1VA 3HACA 5KDDA 2JBAB 3ZWXA 1N0WA 4YCMA 1NL3A 4OSPA 4ER7A 1RZ3A 3JWIA 5KNBH 1BQ3A 2IHBA 5JS2A 3CGWA 3BEDA 1LQTA 4II2A 3K1AB 5IM4A 3K0BA 2QE7A 2VHTA 3TQQA 4XGRA 2Q6VA 4QFMA 3MMSA 2CYCA 3RFVA 1EWVA 2R25B 3ROEA 2BMWA 1NU8A 2FF7A 4YJ3B 4KLAA 4KN9S 2W2LA 2FLKA 4PNPA 2IS1A 2V3CC 2O8EA 3IDSA 1EQ2A 1LB1B 3FPKA 3I12A 2ZWIA 1RP1A 1OZHA 1J4AA 3AL2A 1M1XB 5CA1F 2OGSA 3RYFA 2ODQA 4AYTA 3ZVLA 1N6RA 1RM5A 3GG9A 2VSOA 4I4TB 4N0DA 3BAFA 5AI5A 2ZIGA 4NV1A 1LLCA 4BLVA 1TGYA 2JIPA 2J1LA 4HWRA 2VAVA 2Y93A 1BVUA 4JQSA 5CGZA 2R4QA 1RC1A 2I55A 1VP9A 3VPBA 1V39A 2HWXA 3SICE 3VR2A 4EOGA 1GLNA 1C9NA 3D7RA 3QFRA 4UUBA 3VYWA 1YA6A 4Z4EA 4FU0A 2SKDA 4KAXA 4RK0A 4AF8A 5L3SA 4IUCS 1N9KA 821PA 3RHFA 1CJCA 3G6KA 1ZVKA 3PITA 3T95A 1UMBB 1GXSA 2GF2A 5D1HA 5C7YA 3MUNA 1RS0A 1R6BX 3I9V6 3RG2A 4BLUA 3LECA 4YJHA 2X3FA 4L07A 1I9GA 2C3YA 4M9RA 1R4AA 2W98A 5LZ9A 5KMGA 2G70A 2IEBA 1UBNA 2VNSA 3GZNB 3LD9A 2WWHA 1UWLA 2P0YA 4NBKA 4Y9TA 5C7OO 4S1PA 4YJDA 4G2TA 4H2DA 1KO1A 3AY3A 2J7PA 1OI3A 3QV1A 4ZZIA 4QSHA 4B31A 4JFRA 4A8JC 2ZI5A 5CB0A 1EHIA 4M9CA 4N7JA 3EIFA 2VSXA 2OC4A 3T9EA 4IMIB 5L9AA 1Z9BA 1E9SA 4NULA 3QX7A 1C9EA 1BDMA 2ZOSA 1SWVA 3DHYA 5DLPA 4L2IA 3H9UA 5BR4A 5LWQA 3V55A 2VYVD 2BMDA 2WYUA 4RGQA 4OAPA 4KO2S 1DAEA 2PGXA 1Q1AA 2JARA 3E84A 4C4OA 3B82A 4HEJA 1WUTA 2MYNA 2PT7A 1XRPA 3DKKA 1RJWA 2ZYVX 3C2QA 3R7NA 1EXMA 1DEHA 1RVDA 5E8RA 4JA0A 3BK7A 3UGKA 1MW9X 4MROA 4X66B 4GVPA 3HGTA 3LQKA 2FWMX 5TPWB 3IB3A 4FMDB 1IBKB 1LPBB 3PQCA 5T4FA 2RHRA 4G0VA 3HBJA 3D4OA 3TZKA 4KODA 3V4PB 1PR4A 3CJTA 1NJ6A 4GGMX 3ZJTA 1YGPA 2HTEA 3SYLA 1YUMA 3WLEA 2QTCA 3HG7A 5G0TA 2IHUA 1X39A 4TM7A 5GMOA 2OBFA 2JAQA 1ENZA 3V9AA 4CMKA 1RQGA 1O6CA 1PGNA 4LRXA 1HDIA 4BFZA 3CRW1 2AQHA 3KAKA 5F52A 1IEWA 1S3IA 4ZMSA 1IM2A 1YQTA 2OD9A 5BWLA 1AQJA 1NSYA 2OHOA 4N0MA 2NUAA 4BJHB 1Q17A 2JLZA 3COZA 1Q91A 4HEHA 4DILA 4LYYA 3GAFA 5HEKA 2MMGA 4PYQA 1L7VC 5EE9A 1OIVA 2BGUA 2C2KA 4TYMA 2OXCA 3HO8A 2H85A 6ADHA 3DOJA 5J5VA 4UHEA 5DO9A 5JU6A 3WBBA 1Y82A 2W2MA 3HH8A 1QQTA 1KDRA 1KI6B 1RKBA 5HMLA 1L5SA 5DZSA 1S1CA 5A4MS 1L8XA 1IVNA 2FMXA 2WTEA 3SDBA 3V3KA 1XWIA 1ARZA 1ORTA 1TUGA 4KQ6A 1T26A 1GQSA 5JWOA 3SFTA 1RWKA 4H6XA 6REQB 1JIIA 4KMRA 1SMKA 2VH1A 2IH5A 1KJ9A 3MTAA 1H94A 2ZRLA 3EUAA 1PYGA 2VIIA 3AMVA 4DAEA 4F45A 5JSFA 4DUZB 4Y2TA 3CA8A 4CMCA 2XCOA 1IEVA 1QQ6A 3K8OE 4ER3A 3GV0A 4G36A 2NO0A 2OCBA 2XEDA 5KJ1A 4FFRA 1OHHA 1BWPA 3JQGA 4GXTA 3G88A 1BD4A 4K8OA 5DHAA 4UXIA 3AFOA 4L0CA 5E6SB 5KZMB 1G9XA 3X2EA 1PDVA 1T4MA 4MKRA 5EINA 5H3HA 1HKHA 1QQ5A 1WAMA 2E4UA 3BMNB 3KPWA 3OMWA 5F12A 4LJRA 1TLLA 1Z2CA 2PRZA 2XZPA 5CA0B 1SXIA 1Y63A 3ACBA 1ADCA 3JAWA 1DIHA 3PIDA 1Z4NA 2A78A 4YQEA 4CPDA 3QVXA 4IW3B 4YGYA 4DR4B 1E1LA 3T5DA 3WISA 3GUUA 4XYMA 1W5FA 1M1NA 2P11A 4MICA 1N3YA 2W6QA 2YVUA 4I9FA 4NHOA 1MTOA 3PDHA 4GLJA 3BKXA 5FBRB 2DVMA 4LXXA 4D0RA 3S8YA 2ASEA 1NATA 4L0MA 4L28A 4LN1A 1TVEA 3R8XA 1S8AA 2HPVA 4ASUD 2DWCA 5IUKC 3DT8A 3N2LA 4P4GA 1H1TA 2FJUA 2H5JA 3L04A 3ZHXA 5KVSA 4R8KA 2B8WA 5E0OA 4YREA 2D00A 4O1MA 2GI4A 4COOA 3SX0A 3UXYA 2HWWA 2IYZA 1II8B 2XXJA 5EKXA 1VE3A 2DHCA 2IBTA 1IHDA 3HU5A 4W9RA 4PPQA 1N7IA 4A92A 5K0FA 2BL4A 3HY3A 3QEOA 3PQFA 2WFMA 1B76A 2II6A 2IKSA 3IE0A 4FCWA 5T67A 3VPAA 2VEOA 5EUMA 1PS9A 3WSTA 3ZI7A 3ROZA 1BAPA 2QLMA 2VDUE 3N74A 2J3HA 5B4VA 5COQA 1QAMA 3M4ZA 3HUEA 1NXVA 3L1HA 3J81k 4RW0A 5H5JA 4UCFA 1HURA 2JANA 4Q7EA 4XGQA 2ZRKA 4UOQA 3RBXA 4NPCA 4IOMA 3G2KA 1B8OA 2O14A 4FHCA 2NOAA 5DNCA 1MAUA 1Y5NA 3O83A 4H3SA 4P5PA 4A8PA 4MCHA 5H3LA 3PC2A 1SU4A 3OURA 2RGWA 1UBFA 3IAFA 4EO9A 1QK4A 2H0RA 3WFIA 1Y37A 5ELXA 5CT8A 2WPDD 1QIMA 2XGJA 4IQ8A 5AJUA 4OHMA 2QLTA 2FZEA 2JC3A 2YKGA 3H6HA 4TOIA 5LBUA 3ETNA 4CI9A 5BWMA 2OQRA 1MC4A 3GZ4A 4QYSA 4TZKA 2A9PA 2PYDA 4IQFA 1I2CA 2R1ZA 3KFXA 2OGTA 2KE5A 1GZ4A 5DGTA 3T4PA 3DZIA 3JPYA 3CW9A 4NBLA 1ZK2A 3LCCA 5CG1A 5JAUA 1J23A 1VJRA 1U0JA 2J3LA 2WF8A 1PL8A 1VHWA 1PX0A 3K0FB 4N7MA 2ZFUA 5BY2A 4MRNA 4OLJA 1FFXB 4J0HA 3CZ5A 5H8WA 2Q2NA 1W6UA 3OO0A 2VDVE 1QG0A 3TIXB 3DQPA 1BE1A 3X3HA 1IHXA 1GT91 2E49A 2P65A 1QGOA 1U2PA 3E27A 3GH1A 1ECLA 3W5JA 2EZ4A 1WNFA 5FTLA 1PUJA 2F6RA 3EMBA 4J16A 4A15A 5EMLA 1P7VA 3ADPA 2VHZA 4D8TA 4FNGA 4RL6A 1AF4A 5FWNA 2ZIAA 3DFIA 1H65A 3KLOA 1YU6A 1I3NA 3H2SA 4PZ0A 4TXHA 4YJFA 4D42A 2H1FA 4ARZA 1T43A 4N0EA 3LX8A 4M8LA 4NOKA 1H2EA 3QFSA 1A2KC 5IBPA 3WLRA 4LCEA 2YZKA 4WXPA 3IR5A 3RS3A 2BH9A 1UZNA 1VXOA 4G6ZA 4YS6A 1WLYA 4YBRA 4YR7A 5LA6F 3KSUA 2Z1NA 4JNCA 4IJKA 3W9YA 4U63A 3L7BA 3JYLA 1QH1B 4LYGA 2H11A 3VNSA 2RGBA 5FI3A 3DH0A 3ZE9A 1HE5A 1ZJZA 2HY7A 3Q6MA 2FX2A 1ZL2A 1H2ZA 2J9ZB 1BE8A 4PTLA 2YS7A 1PLKA 1E89A 4GOJA 3H1FA 2RAVA 3TJRA 4BAUA 4ZK6A 4MYCA 4PNHA 4DCUA 2P75A 4K9QA 4GKJB 1L0BA 4X6YA 3EA5A 1OLXA 3GA5A 3LO5A 4IDFA 4PX3A 4D79A 1SCAA 1GNLA 4QFDA 1G9TA 5AOAA 2P9HA 4CM8B 2HA2A 4CMHA 1Z74A 5KTSA 1ZM7A 1IJKA 4TN1A 3KQVA 4XWWA 2I2BA 2IH2A 2I3GA 2V9ZA 1QP4A 4YDHB 2AOUA 1ZXBA 4NBTA 5L7WA 3RKSA 2CBZA 1C9DB 1D2AA 1D4ZA 1W59A 2PL5A 3LYAA 3V1LA 4MUHA 4HGNA 3TRIA 1MB9A 2C7VA 1CUVA 4MJLA 4RY2A 2VXCA 3ZV3A 2DECA 2Z6QA 1TTQB 1SZJG 2IWHA 1XYVA 3A14A 4S12A 1KDPA 1XWWA 4NE2A 4RMNA 1DSSG 2QZZA 5ECDA 3VOSA 3ZW7A 3ZY5A 4DA7A 3L6EA 3LLMA 5KQGA 3VO8A 4YQZA 1NW9B 4RH3A 3IQDB 3P27A 1FP6A 1UBOS 3D2LA 3HM9A 4QXAA 2EW8A 1ZD2P 1SM4A 3B13B 5TQ0A 4EFMA 4WLOA 3F74A 2FPXA 4GMFA 5EP1A 4TMKA 1W2HA 2V4ZA 1NT4A 3KTFA 1KGDA 3EAQA 3DEKA 3M34A 3T1NA 2Z9BA 1VHLA 3RG8A 5LYJB 1X80A 4LDJA 4Q3BA 5MFPA 2P4HX 4MVJP 4UCXA 3VKUA 2ZVDA 5IH3A 1ABBA 2JRLA 3EXFB 4TV8B 2DBVO 3JARA 1R6XA 3TXXA 1SUEA 2GXSA 2Q2QA 4XIJA 1KJYA 1SC4A 1PQ4A 4NNOA 3R9XA 1FK8A 1V7QA 3DPUA 3KP1A 5C8ZA 4JXXA 1EFLA 2P41A 4BQQA 5A3SA 1P1JA 4ERNA 5JYCA 2FE1A 1E69A 5GJBA 3H4MA 3ESXA 1SU6A 2ADOA 3EF3A 1W4LA 2IPAB 2PGOA 3FBTA 5FWDA 4DJ5X 1AKRA 4LCJA 4UDOA 1QTIA 1SPBS 2FN3A 4P31A 3LCUA 4RKQA 1NX6A 4W6ZA 4XDYA 3DEIA 4PX9A 4F5EA 4P0PB 4UC0A 1D07A 5L4LA 2B9EA 1K8ZB 3I2JA 3SVLA 1GA6A 1XALA 2YMQA 1U2SA 1LRJA 4RY0A 4HVTA 1Z3IX 1E2IA 1KSFX 3I6BA 2RAFA 3WL7A 4BWGA 2HLDD 3SWWA 5CNJA 4DXDA 1GDTA 1NY6A 1ZD1A 5E3HA 1HEIA 1G21A 1U8UA 1GGEA 3G68A 3QPUA 1ZCZA 4FZVA 3SE0A 4HTFA 5E9AA 2FQYA 4LJ6A 3NGLA 3BWEA 4DG5A 5EZ6B 2Z2ZA 2Z2KA 4NFHA 1U0RA 1S9HA 3VKWA 5FX2A 1AXEA 3RIEA 4I1UA 2QP9X 2VJBA 1ULAA 2EIHA 2FSFA 4U8GA 2BEKA 2QRZA 4X3PA 1GQOA 2BW0A 2FVXA 4Z9BA 2R79A 1NNLA 5DI3A 4PGHA 4Z9YA 5HM8A 4UNNA 5LZ5A 5JC1A 3W06A 5C35A 5JJKA 1L7AA 2F1RA 3VYVA 2H48A 1Z88A 2GEUA 4Z51A 3FH0A 3ENVA 4YAUA 1BHSA 1IM8A 3B70A 3TOSA 3VNQA 4OI0A 1Z0UA 4Y2XA 2R1TB 2VN8A 3KZ1E 4PRLA 2IDMA 4R8LA 5DBGA 3WLSA 3QELA 4OXNA 5EZSA 1UBHS 1WSDA 2G67A 1I1QB 1WD5A 3B51X 3TL6A 3DDWA 3NATA 3A1EA 2UYOA 1XCOA 3V2UA 4BNLA 3Q7PA 2GHQA 3ELUA 4C7BA 2VJMB 4RZ3A 3T6KA 4MW0A 4BNDA 3K2EA 3RGGA 1H2HA 2QUBA 4PZYA 3G0BA 9ATCA 2PZ8A 3ELDA 2QLNA 2MSDB 5SYNA 4QDTA 3RF7A 2V5AA 1Z6QA 1EIWA 3LY8A 3R7LA 3HMQA 5CDFA 3K31A 3BCHA 5FWYB 5DHRA 5ALGA 3SBDA 3VDRA 3CLRC 2WT9A 2H7XA 4FFNA 1D6MA 3KYBA 2XR1A 3SXUA 2CHVA 4L4XA 4I19A 4RC9A 1JR3E 3UJBA 4JOSA 3K0KA 3RNOA 4GPTA 2O0HA 1PW7A 3D0OA 1M8JA 2PRYA 1X2EA 2YICA 3BHJA 3JQ7B 2DHRA 4URZR 4D43A 5CB4A 3AR9A 3GA0A 3KWJA 1G3IA 3LGAA 3STYA 4WY5A 1YCFA 3O4VA 2XHEA 3U7HB 4BE4A 1KFJB 1QK3A 3ZE7A 1Q57A 3Q8WA 4Y18A 1T2VA 4ZI7A 1KDTA 3B1ZA 3UKJA 1N8SA 1QV9A 3GJ6A 4CTOA 3Q3EA 4WK0B 4QVIA 5JD6A 4YDSA 2FSIA 2GNPA 2HA4A 3EA0A 1QZ3A 2HHAA 3HGQA 2GHRA 3MBIA 2CNOA 1ODIA 1OPXA 4PX2A 2W4IA 1QO7A 2F43A 3Q87B 1SOWA 4TWZA 4W99A 4CL0A 3FUTA 5U4QA 4LQ4A 3WWZA 4TS1A 1LVHA 1RE0A 2HK9A 3NV7A 3ZWWA 3U6BA 4NZZA 4CKBB 3AF4A 4A1OA 2JPDA 4LTNA 3QOWA 4G81A 4RPGA 4HUQB 3EGDB 5ITVA 3AF2A 2TS1A 2PSJA 4UZEA 4EB6A 2MYTA 1E8DA 2QS9A 4L8FA 1WY5A 1U0FA 3EDMA 2QUHA 4C9BA 4B3XA 3W3AD 1XCPA 1HY3A 4K6GA 2GAAA 5FR1A 5L4NA 2BEUB 3LPCA 4IDGA 1C8LA 1U1GA 3K9FC 5IYZA 2PFGA 4IZIA 1KVTA 2XLBA 1VCIA 2FPKA 3T0IA 1TMOA 2DU8A 5IBCA 3IUEA 3ZV4A 2O2IA 5DHFA 3ZDBA 4E13A 5IS2A 4MX8A 3RVMA 1NMXA 2ZVPX 4C1BA 4EJFA 4JHLA 3NDBB 1HMPA 4RKEA 4ZEVA 1L5YA 1E2MA 2A0XA 2OZEA 3CMCO 4CIAA 5IJ0A 5HM6A 2IPNA 2WOJA 2PWYA 3A4MA 2QPLA 4CEHA 3AESB 2UVPB 4I81A 1V1MB 4R98A 1Q20A 3GF4A 1P74A 4N18A 1BH2A 4L4YA 3MWKA 1XF9A 1XZCA 4YJ2B 5ALHA 3SMQA 3VRHA 1IE3A 4HMOA 4KLNA 2DWQA 2ZIFA 3UICA 5G1OA 4RD6A 2J3JA 1BG6A 3R7DA 4ND2A 1XRNA 2JAXA 2JKZA 4J03A 2GCPA 1BMFD 5TT0A 1C2TA 3ZCUA 1G20E 3OSUA 3BSWA 3IHWA 4KIFA 1P4GA 4YO7A 3S6JA 2I34A 3B1YA 3JD2A 2ESRA 1UDBA 3VJLA 1OFVA 4LV5B 4EUFA 1ND5A 5L51A 1O9GA 1RHQA 4FZ5A 2OSVA 2B94A 4KRYA 1IBLB 5IDWA 3FNHA 4ZICA 4OK6A 4QUHA 1O6FA 1EK1A 1PI3A 1J39A 1T5BA 5KTKA 1A9YA 1D8AA 2I3DA 2C83A 1HL7A 1SHTX 1G5FA 1NR1A 1V8ZA 1X9GA 2A5GA 4QL3A 3T5CA 2QZ4A 5HZMA 1A9XB 1UK9A 3OI7A 4ZGBA 1Q15A 4XLLA 3R9KA 4JIGA 3D6VA 5CDFE 1Q14A 2P2ZA 4I6GA 4MQ5A 5MGBA 4U7TB 3EVDA 3L84A 3DEHA 5KKAA 3C43A 1P5HA 4FR0A 1M6NA 3T5TA 3EXHA 4BLSA 3S27A 2EV9A 3JWHA 4O4JB 3CNHA 1MO2A 1B2LA 2QPAA 4X54A 3VR6H 2YFYA 3L06A 2KSQA 3GD7A 3Q0IA 5DPMA 2D54A 4FZJA 2IA5A 5EZQA 2HSGA 4ZZ0A 1MO6A 1OFTA 1VJ0A 4E6PA 1VJTA 1DPGA 1Z2OX 3X43A 4C0LA 2JGAA 3RUIA 5JS6A 3INGA 3VXKA 1C81A 3QEAZ 1VG9B 2ZYWX 1F7VA 3GGPA 3ZDAA 4OLBA 1SUWA 3OM8A 2RBEA 2NZUG 1NRJB 1RW4A 2Q6KA 1IIBA 4GLBA 4RADA 5TS3A 1TU3A 1Z7GA 2VJPA 3B1WA 1PKEA 3IBGA 1RIIA 1BEZA 3JASB 1ILEA 3ONEA 4HLQB 4O0LA 4R1LA 4UUNA 4YRCA 2O9JA 3CR3C 4E0BA 2GRAA 5LFAA 1C7ZA 1J0AA 3O3OB 5B2ZA 4OOEA 1QV6A 2OAP1 1GL9B 3NTVA 3EBPA 1VKHA 4W7SA 3DYIA 4JQOA 2D1QA 1R5BA 3IP5A 3L7IA 3ZJ4A 2UYYA 3T3IA 1ZHHA 4DCNA 5BRNA 1T8YA 3N2GB 1QRRA 1THTA 1N25A 2BTOA 2V9CA 3LZCA 4WESB 5CNKA 2QJFA 4U5QA 4EZEA 5JMWA 4DR2B 1CQJB 2JFZA 3M1AA 4RFVA 4Z8YA 2GA9A 4GH5A 4JJ4A 4NK4A 4CKZA 3UMYA 3PNKA 3ZGOA 3FRJA 2GBPA 3A6HA 3EVEA 1L6RA 4D57A 3DQQA 3OOSA 4ACAA 4DFDA 2Q4OA 5I7UA 4OGGA 4PZUA 4XASA 3OQMA 1SULA 2Y0DA 3THRA 5C32A 1RI1A 3PDWA 1JKFA 4WEOA 3SIPA 4CIWA 3L8GA 3KM0A 4MGYR 4N1AA 4PC7A 4HQ0A 4U4AA 1SGWA 5F9HA 2DLCX 5HQTA 3PC7A 4C29A 4CMJA 3O31A 2WNSA 1V6CA 2W42A 4EHFA 3ZZMA 4Y7DA 3CEJA 3HA2A 4B35A 4CR6A 3TF5A 1A4XA 1FRZA 3B1VA 3L5KA 1MUUA 2QDKA 1OTXA 2OPHA 3BXHA 3ONDA 3JVUA 4XUGB 1LS6A 1NNEA 4INZA 2R66A 3HSKA 2ZS7A 4CN9A 4BTLA 4PLHA 2VRCA 1N3IA 1U1FA 2OSBA 1XC7A 1HI9A 5KOJB 4J3JA 2FHSA 4KQXA 1RRGA 1XA4A 1KI1A 3FYDA 5JIBA 1PSWA 1UINA 1X8KA 5GV8A 2CYBA 5CX1B 4LXHA 3ROKA 3ZK8A 1VIVA 4FOSA 4IV0A 5KC8A 1UMDB 3BICA 1GZ5A 3RIXA 2PKYX 3PKZA 4YCJA 3OZIA 2P7HA 1UPUA 1LSOA 2QD3A 3M6MD 1SXPA 1ZNYA 4QDOA 4X7RA 2XRYA 3IO5A 3PT9A 4QRIA 1P45A 2BD0A 1EP1B 4Q82A 1ACMA 2XQGA 1NLUA 1MVOA 2AOTB 2JGLA 2WSYB 4A16A 2EKBA 4KQ1A 2A5LA 1ZBQA 1DT5A 3N39C 3O38A 4ZD6A 3DBRB 1YO6A 4I5FA 1CHDA 1ORDA 3G2NA 1FFSA 4KKXB 1OW3B 3A9SA 1TZ2A 5T7BA 1P29A 4KQJA 3O1HB 2O2DA 1WBBA 1LDBA 3TLXA 1SKYB 3FOCA 3IDAA 4ZAFA 4ARBA 4RXMA 2XMCA 3ULKA 3PEEA 3KPYA 5AVOA 1IJEA 3COJA 1GA1A 5ICEA 3KX2A 1QDUA 1XU4A 5A4JA 1N6KA 4M46A 1YOBA 1NIPA 4UPDA 3B3AA 4IHJF 2Y6UA 3GDWA 4BJ1A 5CA1A 2WA2A 4FZRA 1TT5B 4J2HA 4P93A 3PYXA 2F1HA 4MJ3A 3WV5A 1JU4A 1KZ4A 2CHQA 4KAFA 4GOMD 4R1PA 2QM0A 1FTQA 2R7AA 3AF1A 3PF8A 2IW1A 5FL3A 3V4RA 1R7RA 3TPCA 3QRWA 1X70A 2WF5A 2QROA 1SA0B 2PS9A 3EN0A 3O1JC 4KYTA 4CLEA 3QU7A 4OXRA 1WMEA 1ZUD1 5LYYA 2HLPA 2YC4C 4YALA 5LQUA 3WWEA 3TJZA 5HMMA 2I4NA 2QVBA 3UHAA 4D3ZA 4DSAA 3AQ4A 1E2DA 3NHZA 4XIFA 3BUSA 2UZ0A 5B37A 4EP1A 3WLLA 2ZRFA 2QQEA 2CKMA 5E8JA 4CV3A 2X40A 4FMCF 5JYBA 2JKVA 3PK0A 3H2ZA 2YWHA 4R69A 3RRNA 3NM5A 3PNMA 3EVFA 2W93A 3GGJA 4HJRA 3O6VA 1P6QA 2WU3A 5KCZA 3DMNA 1U5BB 2ISCA 2WZBA 3BULA 5AVRA 3DZHA 2J85A 3CEPB 3I5MA 4MAAA 4YCCA 3HGMA 1QIFA 4HXEB 3SF8A 2AC4A 4HN9A 4IOKA 2ZYRA 3GDFA 4CU2A 1M1ZA 3JQFA 3QXJA 1JI0A 1NBOA 3WBKA 3R6DA 4TYPA 3CJRA 1ZAKA 3G2MA 1V1RB 2VTKA 3WK5A 1KDYA 2EWVA 4B5LA 4BFVA 2FPOA 2G0TA 4DLLA 4ENTA 4Z4FA 4I1YA 2ZRHA 4X95A 1M1YB 3HYRA 3A6LA 3UJCA 5CHEA 3QEMB 1FTNA 1DBQA 3M6XA 4PYLA 1M2OA 1RCTE 1OFUA 2HMWA 4RTKA 1GKYA 5JRDS 2R4UA 3S8EA 3TQFA 2ORIA 3GG2A 4J4BA 4R2XA 1HYEA 3K71B 2EATA 5T5QA 4WZZA 2HGSA 2YWBA 5AW0A 4E15A 3QXHA 1QYCA 4ZC8A 5ELMA 1QZXA 1QU2A 2NXEA 3PP8A 3FTNA 1WB4A 4Q3EA 5FNVF 3D3KA 1ZW6A 3SJZA 3UV6A 5KNBA 4JLBA 2EBUA 1UIMA 2HD4A 3F6CA 4JXJA 3V4SA 2BIFA 3BWXA 1RXSA 2E89A 4D02A 3WQRA 4J76A 1I24A 2FUG1 3KKZA 1N1GA 4K26A 1J1IA 1WCIB 4IHQA 2QRVA 4IYRA 4DR5B 3THXA 3ZDDA 3KB8A 5D00A 1CDDA 3DNFA 3BQ9A 2ZJYA 3KZXA 4ND5A 4UTNA 1GZ7A 1J2UA 3B5IA 2QAGC 1XKXA 3V1YA 2CNKA 3MRVA 4W5NA 1OTHA 4B8WA 3SNKA 4YAIA 5LOVF 1K8XB 1N34B 4A36A 2ZAMA 2B0JA 1FP4B 4OJMX 1T15A 4ZWNA 3K0EA 3PBKA 4AJLA 4XB1A 5LLTA 5JOQA 2XB6A 3GWZA 2NU9B 3ZC3A 1EWRA 2QP3A 5KTPA 5HR5A 4MUIA 4EENA 1HNWB 3HKCB 1O95D 1X7ZB 3H86A 2HCJB 4HAXA 4H7DA 4W1SA 5K3EA 3C6YA 2OBLA 2Q3DA 3ZH9B 4BLOA 2HMYB 5H70A 4MQUA 3ZU4A 3OCYA 4NDAA 2YX1A 3HRIA 3WGZA 3AVUA 1XWFA 2GBLA 2OILA 3EAFA 4P80A 2JIBA 2Q2OA 4BB6A 3FF1A 1DRKA 2OE2A 2PS3A 4KE7A 4AJ1A 3MGGA 5CCDA 1XKQA 4E3ZA 3Q7QA 1G1MA 3R3SA 1TA4A 4OBEA 2BR5A 3BX1A 4QSMA 2VEDA 5TMPA 3HCAA 3WO0A 3GW8A 4B3TB 4B33A 2G5TA 3GJTA 4CQMB 3RVQA 1ZRSA 3DM9B 3WHKA 2EX0A 5M3BA 1R9JA 2Q5QA 5ESWA 5EZ5A 2J0UB 4FJ1A 5GONB 3RVPA 1BTOA 2OXEA 1BJRE 2OQIA 3A6DA 3VPDA 2WQZA 4BAZA 4DV4B 1R8JA 2Q5HA 4Y9DA 3RYIB 2OTCA 1WKBA 4HEA1 3UAYA 2D06A 2WF9A 5CFNA 1T0HB 4OHCA 1S3GA 4RVHA 4C14A 3OCVA 1NW5A 1O1YA 2BSAA 4S1TA 2JGDB 4HGRA 3ZD8A 5AM3A 4GS5A 3H5WA 2LCQA 5HIKA 2CLCX 2CD7A 3ZVKA 2CN1A 5IFLA 3WDSA 3LKVA 1N2EA 1JW9B 2DFDA 1ZONA 1M8FA 5EIHA 2WHQA 4IGIA 2Q49A 3NIBA 1EHCA 5BMOA 4P38A 5FBLB 1SUCA 3OA2A 3AUJB 4FGUA 4LJ9A 4GLFA 5CU7A 3OZEA 1K3TA 1HH4A 1KP3A 1IN5A 1NNUA 1G7SA 2Q2WA 2QX7A 3DR3A 3H9QA 5EPOA 2FMKA 1U0TA 2HCFA 5EIWA 2A0UA 5K3FA 4Q02A 2WU8A 1IN4A 3LBFA 3VZDA 1XTTA 2IXFA 2Z6UA 4X24A 3UJ7A 2C4KA 1FQWA 1GPNA 1V95A 4JX9A 1VA5A 1A71A 3BL6A 3CX7A 4YP0A 4A6PA 2VJDA 2ZRAA 3DDUA 4LXIA 5DBHX 4ZTBA 3GFQA 1N5KA 1QBKC 5GINE 3MUOA 1Q3KA 2FQXA 4KR3A 1OYVA 4XVHA 4YMUA 2VDOB 1Y98A 3R5FA 1W0CA 1KHTA 2WJ4A 4INJA 5FWXB 1RAHA 2DGDA 3I3OA 2ZSKA 5TB5A 1T13A 3ZIUA 4YCDA 1LK5A 2O3SA 3PKIA 3INTA 4BNZA 4C22A 5A5GA 4FXPA 5KOIA 4E1BA 4E5UA 1ADGA 1ZKMA 4RU1A 5D3MA 4BBZA 4YT2A 3QY9A 3G8AA 4W4TA 3EZ2A 4HRVA 4REOA 4HB0A 1X8XA 1EFVA 3BH0A 4JH0A 1KO7A 4YT4A 3R3WA 1WHTA 4NBNA 4A0FA 4BECA 3KQUA 4R41A 4ACBA 2EZ9A 2PNJA 4Z4IA 2ZT7A 1NQWA 4OBWA 1Y1RA 1IVYA 1O3YA 4HPJB 1AB6A 5HE8A 3TRDA 3T99A 3W8DA 3A2NA 1ZGGA 3I45A 4B6FA 2N0SA 1AS0A 2LZ0A 2XMQA 2VDLB 4IJMA 3ICQB 3HEMA 2XYPA 3IKJA 4G5RA 5HX7A 4DHWA 5K0CA 4RA9A 1RC0A 2X3YA 2PUHA 2YHAA 4JJKA 2VHVA 3EY4A 1KC1A 3M6WA 2OWEA 2I91A 4BNGA 3LC0A 3RC1A 1IZ8A 1GA4A 3H75A 3WSWA 4IEFB 4N3GA 3LIPA 4Y0VA 4EFNA 3BF8A 1W1UA 4R1UA 5J40A 5C1IA 4KZKA 2BMVA 4JODA 3O4FA 5FOXA 1ABEA 1Y5RA 4ZT6A 1T29A 1NRXA 2A86A 1C1YA 2AN9A 2BTQA 3CYFA 3L4BC 3P94A 1MABA 4KWIA 4D9GA 2J33A 2FFBA 2I6XA 3IB6A 5F33A 5LBTA 4ZTZB 2PD3A 4K46A 4IDCA 2GVDC 3F6EX 2XVXA 1VMEA 3ONVA 3EDOA 1LV7A 2NYAA 2ZLBA 4MI6A 3RC8A 1AGRA 2X14A 3EUEA 2X8WA 5G3YA 4MMXB 5C5CA 3EWAA 3FJ1A 5EXTA 1MR3F 1NWHA 1D7OA 1EEHA 1RADA 3QPVA 5LA6A 4TSFD 1Z4LA 1VC2A 3K70C 4G0OA 1WNTA 5KYWA 1E3DA 1NHGA 3EG5A 2O2EA 2GZ1A 1K9VF 4FHFA 3BIXA 4YRJA 1IBMB 1NPYA 1CS0A 1NBIA 3MA0A 2OV8A 3UJ8A 3OOHA 3LPMA 4JLNA 2H1CA 1DG1G 1W85B 5EE1A 1R0XA 3T3MB 4NYIR 1BVYF 2DHDA 3GFOA 1TMKA 1CS4C 4AMZA 5A5EA 1K7EB 2FMIA 3T1HB 4EVQA 2IU6A 5AVYA 3UAWA 3D8HA 5JEEA 4JP2A 1BCSB 4BCBA 4BFXA 3MWFA 2FR0A 5BXQC 1Z18A 1H9BA 4NECA 4O4IF 2HXSA 4S2EA 1W73A 1QHFA 3ZHUA 3AIMA 3BGDA 3SU8A 4HXFB 1EX1A 1EGQA 2X9NA 1W1IA 1TUBA 3GGGA 4HDNA 4V0LA 3U4GA 1GSOA 5AHWA 1G17A 2OXIA 2Q07A 1DJMA 4L7VA 3CVVA 1FU4A 1DCKA 5DSXA 5BNTA 4MP6A 1P72A 5B58T 5JQGF 1N6LA 3VVBA 5K8LA 3FTFA 4XCQA 4DJEC 1P2FA 2CDRA 2XAUA 3X2SA 1RWVA 2O52A 5A7FA 2XUOA 3ZZ0A 5DJ5A 3GP5A 5CNIA 2WE7A 2IKQA 2BFDA 3GJ5A 4Z9XA 4REMA 5BV2P 2CMGA 4ER5A 3OMXA 4JJ6A 2X1HA 2V4UA 3H18A 2CV0A 3VA7A 3DJYA 1UMCB 4GDFA 5KSWB 5JI2E 1NAHA 3ZLUA 1GYRA 1RBZA 1NLYA 2JDID 3BFKA 3F6BX 4AULA 4QC2A 4LMRA 4X7PA 2I2CA 3VMFA 1C41A 1Z34A 1H6CA 2W70A 3KXIA 3O95A 2IYXA 1T4CB 3O21A 1ZD5A 1USVA 2BFOA 5LJIA 4YC7A 1EP3B 1UBEA 2B4QA 3A1FA 2FUG6 3G23A 4DLWA 5JC8A 1B6GA 3DMTA 1EFTA 1LJUA 4BGIA 1UBMS 1MRSA 3BMXA 5JS8A 1L4FA 3HCNA 4EARA 1K6IA 4JBHA 2WB2A 2QJTA 2A0YA 3W5UA 3HDVA 2JVJA 5BV8A 1NQUA 1ZIOA 4TLCA 3GQBB 4DY6A 2IPMA 2XHZA 1ORIA 4D41A 1XNRB 4GNRA 1M2NA 2C20A 2ZT5A 4LV6A 3SQLA 1KR2A 2OCYC 3FOAA 2QMZA 4FSHA 4QPZA 4U2GA 1ZO8A 1BS1A 1AM4D 2XMBA 4J9UE 4UVHA 4DIUA 2QTVB 4JQYA 4WY8A 1K6XA 1WSBA 1QO0D 3OJFA 5CW1A 3WNDA 1KEPA 3VV2A 3WLMA 2OO7A 4TN5A 5AVXA 3QVUA 1ZI6A 3WGNA 5H9WA 1V5IA 2Y92A 1GV1A 1OFGA 2F8MA 3AH8A 4GSYA 3LKZA 1UKZA 2GK4A 2QSZA 3IIIA 4NL4H 3BCSA 1TM5E 5EJFA 2KBFA 3KQSA 1AU9A 2H5EA 1GAQA 3IQHX 4GBJA 3KYCA 4O2AA 5C8YA 4RO0A 4AF6A 2CJXA 4OI4A 1CQWA 1KZ6A 1WF3A 3DFFA 2AJTA 2E1PA 2W11A 3EXEA 3GIWA 4M0UA 4H60A 1XJ5A 1USGA 3OY2A 4BEWA 4B74A 5CFRA 4CNQA 4ZYLA 2B1JA 4P3PA 1KS2A 1JTVA 1B1CA 3F2IA 4BEBA 4QEDA 3FDJA 1F20A 4S2UA 1P5ZB 3INRA 4ODIA 3JQFC 4ZVUA 2HT1A 2K6GA 3FETA 3FPAA 4WXHA 2B1GA 4E5PA 3RYCB 3GFSA 3ZD6A 3BD9A 4EA9A 1W34A 4HAIA 2JASA 3U44B 5AKYA 3KOOA 4HEA6 5ADVA 4X1YB 1MO3A 2QD4A 5K6AA 3W78A 5KVVA 2B7BA 4YAOA 3GXBA 2GJ4A 3KB6A 4RF5A 2ZCVA 4R54A 3VR4D 3NVAA 2WMYA 3FMPB 2FN4A 4JT4A 2ZXFA 4WJZA 2Z9DA 1SIWA 4YP5A 3MD9A 1D0IA 3BJMA 5B1YA 2BFPA 3IT3A 3CX4A 3JD4A 1FS5A 3CUUA 3O0DA 5FXMA 1MJHA 1GZVA 1JR4A 1JVSA 2RIRA 3KKMA 3NVKI 5FOTA 1GV0A 1SBCA 1C3OB 1M2WA 1EX6A 1XDWA 5JAOA 2G25A 2ZAIA 6PFKA 4HF7A 1H1LA 5IHXA 3V1TC 4R68A 5LQAA 3ESZA 1SBHA 2WUWE 4MZXA 1OXSC 1A7KA 1ZM3A 2FKNA 3HU2A 1P0CA 1PO7A 1XELA 3U7EB 1B23P 4PQFA 1JBEA 2ALJA 2M6LA 3G7SA 4MW1A 2FDXA 4ZDJA 3H19A 2QGZA 3E7FA 4KNWA 1DX6A 1QGZA 1AO3A 5JFOA 3L4KA 2RE8A 1FVHA 2JL1A 4PR3A 5B3KA 3HP7A 5LR6A 2UKDA 3VH4A 4WNCA 2B25A 4B2YA 1GN8A 3VKGA 4DDWA 4M0LA 5FOUA 1FDIA 2BFBA 4J3NA 2H2GA 2I62A 1DXOA 2AG5A 3FYCA 3QVTA 5EXSA 1KARA 2VDQB 4HQNA 3SX4A 4D8UA 4QKQA 3CRVA 3U5ZB 2PQ2A 2C2YA 1ZZEA 2MYPA 1IN7A 3LZ6A 3S29A 1YE3A 5D7BA 4CL8A 1NTRA 1H2AS 3H65A 3FPBA 5CBKA 1YK1A 1XMXA 1JEJA 2A9KA 2R62A 4TV9F 5K0ZA 2H54A 1T5LA 1LPSA 1KI2A 1PTJA 4N40A 4XW2A 2XMGA 4LEIA 4HVLA 5HQ3A 1MRZA 3FFBA 4BMZA 2YWDA 3GJZA 3ZVMA 4MEAA 2XZOA 1K27A 2BGWA 4FUQA 1RLUA 4TTVA 3IKLA 3M5CA 1IBSA 5CX4A 3J80A 5HW0A 5A9TA 2JLUA 4Q1BA 1MEEA 3BA1A 1VGQA 3KNZA 2PXCA 3M8KA 3S2UA 1DC6A 2VT6A 2ZJ8A 3BXXA 3N53A 4F4FA 2PGAA 2EP5A 2IYSA 4QTUB 1YMQA 2E6KA 2CXRA 2ZRGA 2V7GA 3R6LA 4YLEA 4YRDA 3K32A 3WLJA 3N6VA 4L8WB 4BU0A 2JS7A 1QIEA 4GOOD 5EJ8A 1WXIA 1P7YA 4FKBA 3WAGA 4C01A 2DFKB 2QG6A 3ZQJA 3GAZA 3A1NA 2BJVA 3IDZA 2FW8A 4C7JA 1A5ZA 1YJCA 5I5GA 1CDEA 4URXR 4PLVA 2O8VA 3OLYA 4C4TA 3IQGX 4OX9Y 4AZ3B 4RYLA 2RC6A 2QM7A 5E4FA 3D3QA 3IX7A 3ZDXB 4NPAA 2DETA 5EIBC 2AOWA 5HF9A 5AKEA 2V7TA 2LBPA 2WDZA 4FHGA 3EK2A 2QRUA 5ETJA 1HQYE 3LWBA 1OXVA 3JYHA 3U4QA 1U0LA 1GQYA 5A7GA 3D02A 1RI3A 3ZCPA 5HS6A 3RF6A 1JG4A 4H3VA 2FPGA 3A4VA 5T41A 2QAGB 5DHTA 3K6SB 1WPQA 3OKFA 2YXLA 1JHYA 2DLDA 2JATA 2QVGA 5L4SA 2Q9BA 3L7MA 1GTZA 4OHPA 5TPZD 4JB3A 4L95C 4JB8A 2CXUA 4Q01A 1G2PA 3WLNA 5KC9A 1KHHA 1H2FA 2W2KA 1M7BA 1LDNA 4DV2B 4ZIRA 1OH7A 3K9CA 2YYYA 5FOVA 4E31A 4AS1A 3DHWC 5C9ZA 2NZ2A 3TLYA 1TJ5A 3W3AH 2NXJA 4YRKA 3LUGA 4A0SA 1RYEA 4JQCA 6LDHA 3C14C 5TGZA 3DZDA 2Q4BA 4IXDA 2IPOA 4G4SP 1M66A 2AF4C 5HDQA 4EJ6A 2JD1A 1TKRA 3IERA 2QUAA 2WAMA 3OLWA 1FYDA 4FOTA 4ZV4A 1FSGA 5H0IA 1NC3A 3LRXA 1UEIA 2VF5X 4ZZ2A 2VTVA 1JHDA 3L6OO 4C1NA 2WKSA 3HKBB 5BSMA 3T1QA 4I08A 5CCEA 2IEGA 3HN7A 3Q9LA 1F4VA 4MCIA 2O8BA 1FFGA 5EWLA 4XPIA 3DAFA 3EPPA 4MYHA 1KMHA 2PR2A 3DQZA 4DKJA 4EF4A 5JZSA 3DJFA 5EVCA 1OLUA 1M1UA 2V3WA 2XADA 1VJCA 4R1OA 4OSOA 3C6XA 2FSPA 2AZTA 4FYKA 1W52X 4LC0A 3C87A 4JBIA 1KEVA 1ADFA 1FLVA 2J3MA 2LDXA 3HBFA 4B83A 4Z4QA 1O97D 2JG3A 1JGTA 4GO1A 3V9PA 1ZH6A 2P35A 3COYA 3F78A 3JVIA 3LK6A 2DLNA 3LQRA 4JKYA 4N9WA 4Y3UA 1NBHA 4UUPA 4XARA 4CM7A 4ZJYA 1KPHA 2BSXA 2C78A 2CFCA 2Q3EA 2G1PA 2XCUA 3NRJA 3TZCA 1DBRA 2CLFB 5T8KC 1NJGA 3U31A 3EXAA 3RADC 3ASUA 4RPKA 2O06A 1N2JA 2JIRA 4K3UA 8AT1A 5BSUA 2I6TA 2V98A 4DWOA 2AX3A 3HKEA 5BP7A 3L3BA 3UJAA 4AJ4A 1F2TA 4F91B 3S1SA 2ES4A 1Q84A 1VLQA 3LHIA 1NQAO 1WX1A 3AHFA 4QTZA 3ZYCA 2XE4A 2UXDB 1CEXA 2R7MA 2AQ8A 2WT4A 2OCAA 4WNYA 3U9LA 3W90A 3S70A 1I3MA 4Q9LA 3D3WA 2IRWA 1VCHA 2I8LA 2C4TA 5DIFA 1JS1X 3WIDA 1MLDA 2WB4A 4HDSA 3CRZA 1XDZA 1Q1QA 3MJRA 4RKFA 5KTOA 4NLLA 2DSTA 3HBNA 3LC1O 2QUJA 3B8EA 3KS9A 3HUDA 4O63O 3R7BA 1UP4A 4RKYA 3TOZA 5A02A 2Q5LA 5ER6A 3THWA 3I32A 1J0CA 3ZE0B 3W5HA 4BFLA 1XEXB 3TNJA 4DIBA 1K5PA 1U3CA 3G2OA 3RS4A 3SQDA 4WBNF 3HB4X 3GEDA 3LUFA 1V9CA 3H1BA 4Q9IA 4Z2AA 4PCUA 2RI1A 3UC5A 5F3WB 1ZN8A 4KQHA 5GV7A 1IY2A 4NABA 2AXNA 3IO3A 3DP7A 2GR9A 4AJKA 2JFNA 4G85A 4RD3A 3Q8LA 2OCIA 2V7EA 5C4GB 3URMA 3B20A 5ERGB 4I50F 1EFPB 1F51E 1WZCA 1Y7HA 2BHTA 2WD7B 2XTJA 2NM0A 3FDXA 2C8VA 3FSRA 3LS2A 5J1TB 5HKOA 2EHDA 2AEEA 3EDQA 5EFZA 1AKNA 2FUEA 3QU5A 1ZGCA 1XTJA 3HYLA 3LBHA 5CP8A 2NNLD 2OORA 5TX7A 1E3SA 4HI0E 2HNKA 1C14A 1ESMA 3QV2A 4JMPA 3JTEA 4RA6B 3M4JA 3UG7A 4M36A 4YVFA 3FNEA 1AKUA 4H1VA 3ZBTA 3PXBA 4H7PA 1H4VB 1V9SA 4BX9A 2DAPA 2QR5A 2HPZA 2ONYA 4R2KA 1SD1A 3C16C 1CY2A 1NW3A 1JZTA 4B6QA 2EJCA 4RY9A 4X8HA 1VE7A 3A28A 3RQIA 2PLAA 3ZEIA 1JJVA 1N78A 1KERA 2PMKA 3ID6C 5FBWB 3U4DA 4DQVA 3ZXUB 3GCGA 2IUSA 4Q9DA 4MWBA 4YX9A 4I4IA 1O94D 3C39A 4H6VA 4TVBA 5K0EA 1DAKA 2ATXA 4U2DA 2XZLA 3RD5A 2UYCA 4DHEA 3ASVA 2VDNB 3FG9A 3JR7A 4RVFA 4REQA 4U7WA 5EJMA 5JSZB 3I61A 1M0EA 1GFSA 5J58A 2PZEA 4Z8XA 1Y6FA 1STOA 3UWPA 3DD5A 4N54A 3VYRB 3ONFA 4FHDA 3ZE2B 4ESHA 3UO8B 1U99A 1SKAA 4WOKA 2XMDA 4JLWA 1DQYA 5LQKA 3K70B 1FP2A 4MINA 1N2BA 4MW7A 4YCSA 4MKXA 3GGDA 5EJ4A 3AOEC 1TIPA 3V32A 4URYR 3WA7A 3FM9A 3FFTA 3MRXA 1YB2A 4P4TA 2KM1A 3L0IB 4ND4A 3WSVA 1XRSB 1H66A 3WI7A 4CGYA 4OD0A 2RI6A 5EPEA 4MAMA 1YVEI 4RH0A 2WM3A 3B6IA 3D81A 4DV5B 2QJOA 3ENQA 3IVGA 2XYHA 1UPXA 1EDOA 2WZDA 4LC9A 4O4HB 4AKTA 3WL3A 4MV6A 2YVLA 3K1YA 4JT8A 1N1MA 2O3QA 1CU1A 1O8CA 1PDOA 2E21A 1EH5A 2F59A 2XUJA 3JD3A 3MQ2A 1ADBA 4QBTA 2NZXA 2PQ6A 3NTXA 5FP0A 2QY6A 2VDKB 3GJ7A 4IXWA 1A72A 4LJ8A 1YBFA 4C6SA 1Z7EA 4W1PA 4QRDA 1K8RA 5HJ5A 1OPRA 4DEYA 1VBMA 4GE3A 4Q12A 4YRMA 1D5WA 4W5RA 1RQNA 4P81A 1XRLA 3CPHA 3DMFA 5CMLA 1IK4A 5JW6A 1X6VA 1XAHA 3KKNA 2EL9A 1I5OA 2PM8A 2QQ0A 3E3NA 4N6NA 5BSWA 5JJIA 2AS0A 2CF5A 3GDHA 2MSNA 2RONA 3BH7A 3FOWA 2ZJ6A 2QYHA 2EFCB 4P54A 4LX0A 4UFOA 1S4MA 2CE2X 3EEBA 3LT1A 4F2HA 3CUVA 2XSZD 2YDXA 3PJFA 1FXWF 2C4HA 2RG7A 1Z6AA 1DIBA 2GM3A 4AIRA 2JJ2D 5ARCA 3OHMA 1XYYA 1Z13A 2C31A 4MO9A 1CUDA 2O54A 3TLZA 5DK6A 5BMVB 2SECE 1XZPA 2HK6A 4NMWA 4Z3OA 2J4CA 4AFNA 3PQ5A 1HETA 2R00A 1E20A 2ZR0A 2VXYA 2QB5A 4PC2A 5FNVA 1BKSB 2V58A 1P3Y1 5KU1A 1RIFA 3EGXA 4PO8A 1XLTA 3I0MA 4F7WA 4OUDA 5KYNA 3QH4A 5DNUA 4LPKA 5DM1A 4EG1A 4LNHA 1BKYA 1XLWA 1YR6A 4G1UC 1JNXX 3LBNA 3PNPA 1Y4UA 3A4LA 3FZQA 3NWJA 3I2IA 2PLFA 3QNWA 5IKMA 4DM7A 1QVRA 3F7NA 1F9AA 2PUWA 1EE9A 2EF1A 2RGNA 3IOCA 2AN4A 3FDIA 4CUKA 5LOVA 2FW0A 2WAOA 2ZWMA 2ZYUX 4G4JA 4G41A 3IJRA 5KCMA 3UCXA 3W05A 5FYDA 4EABA 2Q8QA 1GADO 4YMWA 2H9YA 4G5SA 4H4CA 5EXPA 1WB9A 3PZRA 1R5OA 2H1VA 4FFLA 3TLMA 2EZUA 4IIJF 3SPXA 1PR1A 1VHQA 1PFGA 1F0YA 4ETIA 2PWAA 2OV2A 2WYHA 3EARA 3M82A 3QFCA 1WMBA 4BP8A 2ACKA 4IO0A 2CDCA 1UWCA 3ICOA 4E2WA 1AKQA 4RIHA 1RQXA 4Z49A 1XZKA 3LW8A 4EW3A 3IEUA 5AICA 1DHRA 1XPUA 2OZLB 5CDSA 1SXJC 5JYDA 5L6LB 5EZYF 4ND3A 1I7PA 1W0JA 1YB1A 2M1XA 4W8HA 3IEVA 2X1VA 2JCXA 2OP1A 3BXPA 3OIVA 4KVFA 3ZJYA 4KPYA 1XJ0A 3OZWA 4ZAYA 4MVWA 1OFHA 1TU4A 4XLZA 2O7NA 3F9CA 2ZBUA 4C21A 3LQ2A 2DC1A 3CKKA 3RR2A 4B3CA 3EPRA 3EF0A 4CLRA 1GPUA 1DJQA 4IFBA 3QE4A 4JUBA 3EG9B 2Z5LA 5F2EA 1D2MA 5JNLA 2JCVA 2OFOA 1NBMD 2UYHA 1CPYA 2IYRA 4XWGA 2J5XA 3RS9A 5CEEA 5JANA 3QLVC 3SC2A 3TFQA 1RRFA 1WSAA 3ML1A 1YUNA 1CVLA 4DNPA 4HSEA 3ZZUA 5JJ5A 2HYIC 4J0IA 1GKUB 3R2JA 4W7IA 1OYYA 4KXQA 4C03A 4AI6A 2E9SA 5MDHA 3K2BA 3A0RB 1PZGA 2QIOA 2YNMA 1EK2A 3DPSA 3O7MA 4A10A 1YF3A 4FGKA 3KKOA 3W4KA 1ISGA 2H1IA 3NMUF 1RI5A 3QYPA 3ZU6A 3NBXX 5LBIA 4D1YA 3PLAE 4H7IA 2NT4A 3C8HA 2BCJQ 3AHIA 3OJXA 3QU4A 1H8HA 3N86A 4PC6A 5CDGA 2ONCA 1YDMA 2H0QA 1CZKA 4X94A 4ZEOA 4BX2A 3K8YA 3RU7A 1Q12A 5BVHB 1J8MF 4EI2A 1ODJA 2I4OA 4IIFA 2XWBF 1XOIA 3IP8A 2QMHA 2ZJ4A 3SLGA 1RWOA 4ES6A 2O3JA 4X5OA 1VLMA 3NC0C 1SHZA 5FTNA 1JFFA 1L7EA 2LTAA 3VC7A 1PX2A 2FK7A 1CJSA 4X45A 5BN3A 1OVGA 2XA1A 2Q1TA 1S2GA 3MJVA 3OCXA 3ZXYA 5JBQA 2ZVJA 1U0EA 3FRHA 5G40A 3QSYA 3D6AA 1OV6A 5C4IA 2BVNA 5IC6A 3OPVA 2X58A 1I32A 4ARUA 2GLTA 5HZKA 4B4UA 1DBVO 1C4KA 1UDCA 4PYNA 2PZFA 4R3NA 4QPCA 4YAJA 2VNIA 5DLQC 2NP6A 3TH5A 3PJDA 3GIDA 4QQRA 4ZQEA 5JQGB 1WDKA 3F3YA 4GI2A 5CTJA 1L5QA 3ABIA 3GFGA 3QWIA 4XQGA 3AEUA 3H0CA 3C24A 4YAKA 4LKRA 5AP9A 2QRQA 4A6DA 1ZI8A 4W5JA 4LVUA 3IPLA 3L49A 1E9VA 3SJBA 5JT1A 1AUPA 4CUZA 2FQWA 2WI8A 2ZBEA 4F6RA 2QPTA 3RSZA 4HV4A 2ZQYA 2GZSA 3ZIAA 1OJLA 1DXQA 2ZJ7A 4FSXA 1GG9A 4NZMA 2OO5C 2C07A 2JKYA 5I7HA 3L40A 5JAMA 4JI7B 2CMKA 4JITA 4HLDA 1FP1D 4EMUA 1QH8A 2DFNA 3G8YA 4PPFA 4V0ME 3F49S 1T5IA 1DAPA 5JVDF 4PYRA 4R05A 1QYDA 5DHSA 2IUUA 3UB4A 3BE5A 1SPXA 1T9HA 1XA0A 2LGJA 4NFLA 4E33A 3SZ3A 3FAZA 3DW3X 3BK2A 3L6UA 3BRQA 4MS1A 2DBZA 2VWHA 3QUTA 3GUCA 2J9FB 2WWXA 3D1JA 1U8ZA 4IMPA 5IMSA 1MQSA 1P2VA 2NV0A 5E2AA 1QIHA 4QVKA 1N57A 2XBUA 1ZXLA 3BMCA 1S9DA 4TUYB 3NAZA 3WAJA 5EXEA 3SZOA 1EDEA 1W5SA 3TZLA 2LCIA 4G07A 4ZRNA 1VECA 5J59A 2DPLA 1W76A 2QRPA 2YRWA 1XZFA 4M55A 4QLAA 4NI5A 5FKJA 4UQLA 3VH3A 1ZLXA 4WBSA 4M99A 2BM9A 3VPHA 1D6SA 1ONPA 2ZQZA 5AVVA 3LXXA 3QVLA 1S2OA 1UMKA 3JYPA 1IOVA 5B7GA 4G1MB 3B53X 4KTTE 1QE5A 5CVTA 5HKKD 1IYZA 3S1AB 1JQAA 2F00A 2HZ7A 2A30A 2J08A 1DUIA 1HTTA 2NGRA 3FMFA 4NZOA 3O7WA 5FJIA 3RREA 4IO1A 1XAGA 3EWIA 4BXOB 5DW0A 3BSYA 4UU7A 5JNSA 3NKVA 2BE7A 4QT0A 3OBIA 4B6JA 3I92A 4PXAA 5H4HA 3R7FA 3DV0B 1QVWA 5EPUA 1CUUA 1VBFA 1YQ9A 3QUCA 4QYWA 2GXAA 1ZBDA 1KJQA 4MWTA 3B5EA 4Q6WA 3N07A 1GCAA 4N3CA 4WVLA 3AVTA 1IWBB 2WMNB 2QAIA 3IMCA 1O9HA 1XD9A 4K86A 4M0FA 4ML3A 4O4IA 3O8DA 2R8RA 4E07A 4NYIQ 1ZMTA 2FY8A 1JEDA 4KP7A 1BNCA 1K2VN 2H4ZA 3HKDA 4O5AA 5KTYA 5JCOA 4WUVA 1LD3A 4P98A 1GUYA 5B4TA 4N76A 9ABPA 4DYVA 4JJGA 3DXFA 3GRZA 1JZSA 4FSDA 3NHWA 1TECE 4Z0TA 4C7KA 5JQGA 3IURA 3NHPA 2D5BA 3AI7A 5GVSA 4WFQA 1WXHA 3Q0EA 2R48A 1Q1GA 1ZGHA 2JVIA 1B42A 1OWNA 3NGMA 5MN6A 2FW9A 2XUAA 5K6RA 3EW9A 3OT1B 4QOFA 1PJ4A 4ARAA 3M3DA 2GAJA 1EKXA 1FP7A 5F7ZA 2CUTA 5IK2A 1KSGA 1XYGA 2DPXA 4FDLA 2Z6AA 3HB1A 4J94A 4BX8A 1WUKS 2XOXA 3DWGA 3P2JA 5K8VA 1CR0A 4R1MA 1P1BA 1XBTA 3ZX5A 1DMSA 2IYFA 1NBAA 3BB4A 3PRJA 4WDRA 4CEIA 4MUNA 1QNFA 3UFXA 1Y8AA 4ZJPA 5CAEA 4B3RB 5CVEA 4INOA 4BHTA 5K8UA 1PWEA 1XTSA 2C2ZA 3CLSC 1E3LA 1D2HA 4QBIA 3R9WA 4Z53A 1FTYA 4AW9A 1QP0A 3O4RA 2DB3A 1GNSA 1ZM2A 1DC4A 3I4LA 5AI9A 4RK6A 5LU8A 3QG5A 1JHMA 2OFFA 4EM6A 2WVJA 3K5IA 1TIBA 1G8YA 4NS4A 2PBLA 4S1VA 1MX9A 4HPWA 4MULA 1D9XA 2Z6VA 5SZIA 3B12A 3ZCTA 1T0IA 1HR0B 3U26A 1R0SA 1H5UA 4OGKA 4YV0A 1LWNA 1RLMA 3NAGA 1VPDA 5AI6A 2NVBA 3MAGA 3DFMA 1O5TA 2W00A 3R0IA 4XYGA 5CITA 3O73A 2PANA 1TQ6A 3BE8A 4BFUA 5T3UA 3O8RA 1ODKA 4GI7A 4B3SB 3HUUA 1U3DA 1K9SA 3GEGA 4O4LF 1EVIA 4JU8A 1CEQA 2O3UA 4BTVA 1XRMA 2GWHA 3GBPA 4ZN6A 4F2DA 3IBTA 3I73A 4D4KA 2PXAA 3HA3A 1P0QA 3L7NA 1M0SA 3DSRA 3CH5A 2X4DA 2ZSAA 2AR7A 2G82A 4QA9A 4CMGA 3CS3A 3ECAA 3PYLA 3EZ6A 2D5CA 3WK8A 4IIXA 1ZRNA 3TCXB 1JEYB 4AY5A 3LY9A 1VLHA 1WW3A 3LKDA 4IDBA 2H52A 5LMUB 1YI0A 4NNJA 4DM3A 1AZLA 4K1XA 1R0CA 4JP1A 3C3AA 1VQ1A 2Q99A 4XFJA 5KOHB 4OX9B 4QATA 3H9GA 2W6JA 1JDSA 3K0CA 4LXTA 1ZD8A 4UM7A 3IT1A 1S0UA 2C4WA 2VS1A 3ILXA 3OT4A 3Q10A 1IVSA 4QECA 5BT8A 1IB6A 2LKDA 2FMHA 3O4HA 3PFBA 4W8OA 2Q5EA 1CETA 3OEHD 4L15A 1A7JA 4UHKA 3FOFC 5I7RA 4KPUA 4R6XA 1LW6E 4DA9A 2LP4Y 1I1OA 4LC1A 1P8JA 3L6DA 3O90A 4IXMA 2Y27A 4C88A 3WNZA 3Q3VA 2WPNA 5HYVA 5EKSA 3TTUA 2MSWA 2W6ID 3WK4A 4DM4A 3ZCQA 4OHKA 5KQLA 2ADMA 4LNAA 1YHNA 1ZD9A 5K3OA 4KH1A 1XPOA 1C7IA 2Y1LA 4IDAA 3P32A 4Y9UA 1MPXA 3D6UA 2VK2A 3PWTA 1CCWA 2GEDA 3AUAA 2NQ8A 3ANSA 1AZSC 2ZBFA 3GUYA 4GOLD 4K03A 4BNTA 3QVGA 3DEZA 1NUAA 2G07A 3LXMA 3RUAA 4MSUA 4DEVA 2CXTA 4HR7A 3ZWVA 1G8AA 1Q22A 1B6RA 3RAFC 1L6IA 2D4AA 2DPGA 3EDCA 3GVIA 3JZFA 3OX4A 4GI3A 5H83A 5DI9A 1IL0A 4N47A 3OE5A 3VYTB 4JP8A 4M7WA 4J8PA 2CXPA 2OC9A 2XW6A 4U7JA 4BB9A 3I8SA 2QE7D 2BFNA 4HHEA 2VFAA 3UH1A 2FV8A 4O33A 1M2GA 4DTCA 4F11A 1V4NA 4LMBA 4WLFA 2HHCA 1YZVA 3FGNA 3MJHA 4JL5A 4K9PA 4AZVA 1MJGA 2W2LD 2RGNC 5AQEA 5FDFA 1IEQA 3AUFA 3BXGA 2PEYA 3T1VA 4KR6A 2WFAA 2Y99A 5IAGA 3EXG1 1GDDA 4FKZA 3GX1A 4AB1A 4PC3A 2P3SA 2FSHA 4A23A 4MW5A 3D0RA 1G8GA 1VE1A 2BI8A 1Z5GA 2J48A 1EWQA 3FAKA 3F6PA 4AMUA 4ZAVA 1NI4A 1Y3BE 1P9RA 4RE5A 4EKGA 1KVRA 1E9RA 1Z15A 2WSMA 4DMRA 3WAKA 1KJIA 4EHHA 4RUKA 4Z7QB 4TV9A 5KOYA 2UZ3A 2CVOA 5GVRA 3VR2D 1KP2A 4F21A 3VR4H 2WUEA 2D7JA 2C1EA 2XUIA 3OKCA 2Q6IA 4G5XA 3U4CA 4B4WA 4FOOA 1YHZA 1HEYA 1HGXA 1CEYA 1UT5A 4Z0PA 5IBQA 2Y1OA 4M0PA 4AZ0A 2JAPA 1GG8A 5I7WA 4OFWA 1US8B 2YHIA 1BH6A 2CVHA 1DWPA 2ZYIA 2C9DA 4GX5A 4HDRA 3STVA 3TM4A 1UAYA 1JWLA 4X20B 4CTMA 4EJMA 1IZ9A 1E1DA 4A1FA 5JH7B 1LU9A 1YJ5A 1GQQA 4ZV7A 4RCVA 1RNLA 4ZGGA 3IT2A 2P9FA 3IXQA 1P61B 3O26A 1MVLA 1BDJA 2OXFA 3O8BA 5AKLA 4P7KA 1K86A 4F72A 3ELBA 2WJHA 3WY9A 4WN3A 2QTRA 1WMAA 3FLBA 1R0ZA 3DZCA 4J0FA 3WRVA 4KOAA 1I6LA 1DO0A 3N5KA 3PSAA 4MGZR 1PJZA 1YI1A 4ZQBA 1R8YA 2GAFA 4JOBA 3L8MA 4LOKA 3ROXA 3RRBA 4HZGA 5AVSA 1GD1O 1LPAB 1D4FA 2QY9A 4EO7A 3H9CA 2BYTA 3ICVA 4UNRA 4YJ3F 4BQSA 3CBGA 5CLJA 2O05A 4M8KA 3UT5A 3EX7C 4ND7A 4HZUA 5K03A 1DLIA 2Q9AA 4F3CA 5K8IA 4CE6A 4R1QA 1Q0PA 2YHUA 4GM1A 1U98A 2O8FA 4JELA 1RPJA 4NPHA 3U56A 2AFVA 1EK5A 3IDFA 3N0WA 4RWZA 3L8DA 2J30A 2P3LA 4XEUA 2WYVA 3SKYA 2D74A 1L4UA 1THGA 4K81B 5EYPB 3GYBA 1GTMA 3SVZA 4GVXA 4WSOA 3LBYA 3ZUPA 1EESA 3ZBQA 3LG2A 3I1FA 4QAJA 4RBNA 3EW7A 2N75A 1O89A 2P4QA 3CLRD 4ZYVA 3CNNA 2CXSA 4HYTA 4XX1A 2GEVA 2IOHA 3WWDA 4RZUA 4BRSA 4KPFC 3MS7A 5I8WA 3UMMA 2VQDA 1UC4B 3LWZA 3OVMA 2HO4A 2I6FA 1QOPB 3DTVA 2IHNA 1JLMA 4LJAA 2R11A 3PQ8A 2YH2A 2DY1A 3BDAA 3GLHB 4YGXB 4G5YA 4WZAA 1I10A 5AW4A 5IEBA 2FMTA 5JE8A 2C7RA 2C1ZA 2H9IA 2V96A 1N75A 3ANNA 4UBKA 3VZBA 3WGQA 4E7PA 1SXJB 2A7QA 4XLTA 3LCJA 3HDJA 4AJEA 1KAGA 2C2OA 2R1VB 4OH1A 2C0QA 4BWVA 2AB0A 3ER8A 4UQPA 3RAEC 5FUYA 3KTAA 2H2IA 1NVWQ 5ALMA 1HL3A 1YZNA 1H5NA 4Y6SA 5DH9A 4RF4A 1D09A 1QM5A 2VTBB 3D6HA 1NY5A 3NYRA 1Y6ZA 4MWSA 3F71A 4WZBA 2H5IA 3E5HA 1OX5A 1H2RS 1T10A 1DIRA 1SQ6A 3UK6A 5DBFA 4LJKA 3QU2A 2PBFA 3B9QA 4X92A 4BVEA 2FSGA 1JL3A 4ZYWA 2YIDA 4I2VA 1G8JA 2AZMA 1CLUA 3LC7O 2C4VA 4OP3A 1GUFA 1OBHA 1NTOA 2OHHA 3UC9A 3NQ41 4CLDA 1FY2A 2C00A 5BRAA 8ADHA 5ECYA 1OHHD 3H87A 4OQ4A 5DDIP 1MDFA 4IDQA 1NVXQ 3DF9A 3LUAA 2GK6A 4UAGA 4ROSA 1UPTA 1Z4PX 4QHTA 4WW0A 2VP0A 4FMDF 4BVGA 1F6BA 3QUSA 2X76A 4TM8A 1LDYA 1C30B 1G8MA 2P0AA 2WYWA 3MOSA 1ZQ9A 3ROPA 1P73A 2C99A 2PKEA 1KC3A 1Z4OA 2ZE8A 2ZIXB 2B35A 3QJGA 4MQEB 3PPWA 1WUYA 4Q4DA 4Q9NA 2NZJA 5EQTA 2J0VA 2IVZA 5BUQA 5ALOA 2A9FA 1PJ2A 1Z5VA 1NN0A 3DBHA 2WKPA 1RC8A 2NUPB 2D1TA 1OX4A 3IAS1 3K3PA 2W7TA 4EAAA 1H3NA 1E2HA 1NJ1A 3Q6IA 2LPMA 4WEQA 4Q4CA 1UP7A 3OJWA 4G0ZA 3ZLVA 3L77A 4KL8S 3ENWA 3OFVA 421PA 2Q5JA 4GEGA 2P5SA 3WE7A 3FOEC 1E61A 3URKA 2ORVA 1DRVA 3DE4X 1H4TA 1W29A 4I3GA 5J5AA 3WRXA 2INGX 2JFBA 3K0HA 1ECPA 4TL9A 5M5BA 4DZTA 5D51S 4TMZA 3GUHA 4WBNA 4BFTA 1HRDA 1R0LA 1R74A 3W7VA 5KIAA 4DJJA 3JS5A 3GXOA 3TMYA 3H3JA 3PHIA 3WXBA 5IAAA 1Y1PA 4US2R 3FTQA 1EJ6A 2ZI4A 4Z7OB 1HDXA 5GZ3A 5JCOC 1RZRD 1GTRA 2K7FA 1E0SA 4HDOB 3SZUA 4RFSB 1E3MA 4F5DA 4DLYA 4PTYA 2RKBA 2GKOA 1Z26A 2BHLA 2ZTLA 4ZANA 4MHTA 4MVJA 4AD8A 1OUMA 5I7VA 3QF7A 1W2GA 3D54D 1XZ8A 4MIEA 1EDDA 4LBVA 3BSSA 3SYTA 2C9BA 3WNBA 2GESA 1N2CA 4BMNA 3BD6A 2IQ5A 4Y6PA 1M2VA 3D8RA 1YOVB 1XDGA 2EBWA 3PXDA 1E1RA 3AO0B 3WBJA 1PBTA 1ML3A 4TWBA 5F5NA 3ZHSA 5C3MA 2AH5A 3GLQA 3A9CA 4JKOA 4MIYA 4JBYA 2EC5A 3X1WA 4F0JA 4XPZA 2EEPA 5KQMA 1GTSA 4JS0A 1DAIA 1DXYA 4WZAE 1LA2A 5JRJA 4L51A 4B44A 1CKEA 3F7MA 1TCAA 1DC8A 4D9NA 4DG9A 1XI2A 4TYQA 1BMFA 3DC2A 3AC0A 3PYMA 2HMSA 3C70A 3D0KA 2REQB 5E4JA 2C5HA 1X1SA 4O0MA 2FPRA 1N6HA 1CE8B 3TQIA 1TCUA 2P9JA 3RTAA 1FMCA 3KHSA 4JJZA 1G5PA 5ENZA 5FIUA 1IOLA 4EJSB 3FNIA 2GJ9A 2VWGA 2W43A 3C3BA 4H4EA 4Y0AA 2I9KA 4PPNA 4HYQA 3E8SA 4KNVA 2YY5A 4IJ6A 5KYKA 4DCSA 5G0SA 1G7CA 4NTZA 1I80A 3CEHA 3GUZA 4D4LA 5A3JA 1PJSA 4CKWA 3GLFB 5K8CA 3CVJA 4NU8X 3FY4A 4PG5A 3Q8MA 3ETLA 3HBMA 2HIMA 1SU8A 2SCUA 1T36A 2HDHA 1QHGA 1IY9A 3DBLA 4FCTA 1HE3A 4LHXA 3TUJC 1RU3A 4PVCA 2H2WA 2XQFA 1GCGA 2IL1A 5D6OA 4B17A 2LVBA 3R41A 1G7RA 4KKVA 3HNOA 1IEXA 4Z1MA 3GR6A 3LF1A 1CY8A 5A7HA 2WQ6A 1IULA 3BT7A 4WACA 3FNRA 4A8TA 3PQ3A 1ECBA 2R60A 4DNOA 4YROA 3AUUA 4JJFA 2QRLA 4DT1A 2CFOA 2VUSA 2FSSA 4FDTA 2GPYA 2V5UA 3VJRA 2JGIA 1YONA 3G1TA 5ESDA 1TKBA 4P5EA 5AOCA 4Z1OA 3ZNQA 4XSHA 2R2GA 5CR9A 2G77B 2WFLA 4RS3A 1IRIA 1YA4A 3MT0A 1U11A 1PDWA 1XR3A 3IVXA 4W9NA 5JMPA 5REQA 5AXBA 5IKPA 2A1TS 4MR8A 3P9IA 1SCKA 4JY7A 1GU0A 1R8XA 3K0CC 5A2QA 1IWPB 4HLCA 1M7HA 2JIMA 3WRYA 1BHO1 2HM7A 2ZE7A 4YXWA 4HVCA 2YBDA 4FXOA 3HMKA 3KDAA 1P1KA 2J46A 2JGRA 4MGHA 1J99A 3RASA 2J59A 3JQ8A 1YS4A 5J63A 5EWJB 5D5QA 1ZA2A 2NNWB 3BFVA 1DX4A 3SBOA 1EG7A 1FXWA 1R18A 4MV1A 1XZAA 5EP2A 1MRNA 3V4VB 1JR2A 4YJHB 6GPBA 4BPBA 2XJ4A 1KYZA 1N2XA 1RPTA 1FC0A 4MUAA 4UTZA 5HCIA 2H1HA 2LR0A 4QYMA 2DFLA 5EY5B 4JI4B 1J5PA 2YTZA 2VPWA 1JG3A 3KKKA 1F0PA 1HE2A 2NU8A 4G09A 3AFMA 3VC2A 2I1LA 1DZIA 3COSA 4FBGA 4V0QA 2C2WA 3GJ3A 1UBGA 1TM1E 1IUKA 3DLIA 5TMBA 1ZISA 2JI7A 1DI0A 3N2KB 3EJ6A 3T7SA 1J7JA 2EYQA 4E2XA 1AK1A 2GDJA 1DUSA 5EEGA 3GI1A 3OLVA 3Q2KA 4DLXA 1A9ZA 2XUGA 4MVJE 3PXEA 1NULA 2PKXA 1OT3A 1T9AA 5PNTA 1FB5A 2XUPA 5JY1A 1OA1A 3PI6A 3U62A 4I4CA 1RYFA 4UU1A 2VAWA 1IXSB 1Y89A 1BJKA 3DZKA 3G2HA 1KJJA 1NSTA 4BLTA 2VUUA 5ULLA 1P9NA 1HTWA 5IHPA 1J9GA 1JSLA 3IOYA 3KUUA 1C29B 2H4JA 4QUGA 2ADFA 3I30X 2POCA 5LN1A 1DCTA 1P2UA 4HC4A 4DLAA 3EODA 1DVRA 3KQPA 1A2BA 2FN8A 4IIJA 5LQCA 4EA8A 3L0BA 4QD3A 4FVTA 1J9ZA 4MQFA 1XJWA 3ZHRA 4UEOA 5FA5A 1HMYA 4BWYA 3AB7A 3G0IA 1R9G