2XZDA

Caspase-3 in complex with an inhibitory darpin-3.4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
141
structure length
140
Chain Sequence
b'DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQARGTELDCGIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 51
structure length 140
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xzdA00
2J30A 4ZVTA 1BMQA 2QL7A 4IEFB 4ZVSA 2XZTA 4D3XA 2J31A 1RHJA 2H5IA 3R7BA 3V3KA 5LUAA 1NMEA 3GJRA 4D3ZA 3IBCA 2HBRA 1RHQA 3R5KA 4PS1A 4QUEA 4QUHA 5IAEA 4JJ7A 4JJEA 1RHRA 2H4YA 2C2OA 4ZVRA 1M72A 1RWXA 1SC1A 4QUGA 2CJXA 4AWBA 4QUJA 4DCJA 1I4EB 4NBLA 4QU9A 4HQRA 4AW9A 2CNOA 5LU9A 3H11B 1PYOA 1QDUA 3GJTA 3OD5A 2QL9A 3DEKA 3PD0A 2H48A 4JQZA 5IARA 4EHHA 3EDQA 2QLJA 4NOKA 4FEAA 5IAJA 1SHJA 3BIJA 2C1EA 2CNLA 4JR1A 1RWKA 4ZVOA 4QTYA 4EHKA 5IC6A 1I51A 3QNWA 1RWPA 4QU5A 3S8EA 3P45A 4PRZA 4EHDA 2QLBA 3E4CA 4I1PA 3ITNA 1I3OA 1CP3A 3SIRA 1SHLA 4ZVQA 1F9EA 4FGUA 4N5DA 5IC4A 3D6HA 3V4LA 3RJMA 3GJSA 2J32A 4NOJA 3GJQA 3H1PA 4M9RA 2C2KA 3V4OA 4NOMA 2WDPA 5H0IA 3V55A 1I4OA 4QU8A 1K88A 2H4WA 1K86A 1SC3A 4QUDA 4QUIA 3S70A 5IBCA 2P2CA 3D6FA 2HBZA 3KJFA 3H13A 1GFWA 3H0EA 3PD1A 5JFTA 4N7JA 1JXQA 3SIPA 2CDRA 4ZVPA 3R6GA 5LUBA 4N7MA 4NBKA 4QTXA 5LU8A 2FQQA 2K7ZA 2NN3C 1IBCA 2CJYA 3NS7A 2CNNA 1RWOA 2XZDA 2DKOA 4N6OA 4QUAA 1F1JA 1RHMA 2Y0BA 4QUBA 4PS0A 4D3YA 2AR9A 2H65A 2XYHA 3KJNA 4HVAA 3DEJA 3H11A 4N6NA 4PRYA 5IAGA 4EHAA 2FP3A 4IYRA 4DCOA 2C2ZA 4QU0A 5IAKA 5IBPA 1QX3A 3R5JA 4LSZA 2XYPA 3DEIA 3NR2A 1NW9B 5K20A 2XYGA 3PCXA 4N6GA 2HBQA 5I9TA 1RWNA 1RHUA 2H54A 3EDRA 3R7SA 2HBYA 3R6LA 4EHLA 3UO8B 1KMCA 3R7NA 1CVRA 4FXOA 2C2MA 4I1RA 1ICEA 4JR2A 5IANA 2H5JA 2Y1LA 4EHFA 4EJFA 4NBNA 4JB8A 4HQ0A 4JJ8A 2QLFA 1RWVA 1PAUA 5IABA 2CNKA 3V6MA 4JR0A 1RHKA 3K7EA 3IBFA 3P4UA 1NMQA 2QL5A 1GQFA 2J33A 3V6LA 5I9BA 2H51A 4FDLA 1SC4A 4AWAA 1RWMA 3UOAB 4ZVUA 5IBRA 2FUNB 1RWWA 4DCPA 3D6MA 3NKFA 1NMSA 1RE1A 1QTNA 3KJQA 4NOLA 4JQYA 3DEHA 4EHNA 5IASA 4QULA
chains in the Genus database with same CATH superfamily
1XAGA 4FQ5A 3B38A 3B89A 3L8HA 3LZCA 3LK6A 1K68A 2EZ8A 3P0FA 3EQ6A 2RONA 4R7TA 1AUVA 1SJ9A 2IDZA 1GZSA 2QSUA 3E7PA 2MSEB 3KXLA 4KQ1A 4O1HA 3RHFA 4PLGA 1G3IA 1IN5A 2VJLA 4ES6A 1UBRS 3FZNA 3KQSA 3OZGA 1RABA 3EIHA 3BXZA 4FNOA 5AI6A 3TZEA 2V6JA 4TTPA 1FE8A 3WSVA 1GAWA 4F4UA 3I3SR 2IE8A 3NCHA 4JEUA 5CDUA 3FOFC 1PNRA 1KZ4A 1P9LA 2YIDA 2B8EA 3ZDRA 3NOOA 1SM4A 3SVZA 1EHCA 1GSOA 1RYHA 4UUQA 3KM0A 4ACAA 2GXAA 1PTKA 4ECAA 1KAGA 3K6RA 5IARA 1D6NA 1RBMA 1X80B 3H99A 1PNTA 2J4DA 4FSDA 1RRMA 4UDOA 5LBIA 1UM8A 3QKIA 3S68A 5AVQA 1NT4A 1BCRB 2JDIA 2XOXA 2IX3A 1X1CA 1OXTA 2PGAA 4X00A 5AW2A 4V0RA 1Y6ZA 3ZBTA 1WUYA 3KQWA 3GJXC 2OBXA 3AEYA 4G4IA 1I7SB 3K05A 1QU2A 3JXEA 4FFBA 4QA9A 3I5MA 1A5AB 3R6TA 4CM8A 4C76A 2RHCA 4KKVA 3L4JA 3F7OA 4MUEA 1U8CB 4XB2A 3S1AB 1BDJA 3IR7A 4KNVA 3SNHA 5FTJA 2GBLA 1I6MA 1HQKA 2QEQA 4KO4S 4NESA 5DBEX 5JJBA 2ZRQA 1AM4D 4OMFG 1RAHA 4CIXA 1N9KA 1UWLA 2PZMA 5EQJB 1G8YA 2JANA 5EWJA 5B3LA 1CR0A 4ALKA 4UUOA 1G4AE 4F4CA 1GA4A 4QDUA 4A91A 1S7GA 2IZZA 5EFOA 3AERB 1I1QB 1OLSA 1TD1A 4YRJA 3ULKA 2Z04A 1UT6A 1N3IA 3DZ8A 3ITDA 1R3DA 4MUKA 4X8LA 3CNBA 3NV7A 4QTXA 4UAVA 1Z37A 1L3CA 3AJ8A 2CJYA 2J3LA 1YDGA 3IAS1 3VA7A 1Q17A 3DXYA 2Q4TA 2DKOA 4Y6LA 1JDZA 1KAQA 2CZCA 3BWEA 3E05A 2FPLA 1G60A 1DCFA 1GDDA 1U2DA 1ZGHA 2HL6A 3MTJA 1U0OC 1A8HA 4MQEB 2XD4A 2ZJ2A 3VYTB 5CLHA 3AY3A 4L5AA 1H69A 5DHUA 1L5OA 1NN3A 2TS1A 4YPOA 2GCPA 5K0ZA 4KQCA 4EMUA 5KYWB 1FJ2A 1SZJG 1KTIA 1BX3A 1DIHA 1F2UA 4JJFA 4B1FA 2WINI 3C6ZA 3HYRA 4GQBA 4CQMA 2FQYA 4Q4CA 4DUZB 1MB4A 3O93A 1JDUA 3RG2A 3TPCA 1CEEA 4X7PA 5DSZA 1YR9A 1OLXA 4FFWA 4HQ0A 1E3SA 3NNSA 3FY4A 3SC2A 3PPYA 5DWDA 3UN1A 3ZU2A 4A8HA 5E38A 3KYCA 5L3QA 3W3ZB 4GSKA 4NMWA 1EFCA 1P4RA 5BYJA 4KLCA 4ZODA 3QU9A 3IMKA 1JJIA 3M1YA 5BW6B 5THKA 1QUFA 1NRWA 2JBAA 4MAMA 4DXAA 1R6VA 4NF2A 4ND3A 3RK1A 1CSEE 3PDCA 3PQ4A 1TZKA 1Z28A 2BZGA 4RD4A 2P6PA 4Y0NA 5HM6A 2BKLA 1D8AA 4R68A 4FZ3A 3SJUA 3D2LA 2H3EA 4F8EA 4XVQA 2ZI7A 4P22A 1MABB 3U56A 2DFNA 4BO4A 1KIAA 3MXOA 1BNCA 4FFRA 4O2AA 3QLVC 5CCXA 3E3LA 2FDCA 2BFAA 1Z17A 3FPEA 2RE8A 1W76A 1NXVA 1DV1A 1GWNA 2PGJA 2B8NA 3PR1A 2JJ2A 4RGQA 5EPUA 5CB8A 5KIAA 3OM9A 2GVDC 3CF4A 3L0PA 1N5DA 3ECAA 4PG7A 3K8QA 3QE2A 4QJIA 1LS6A 3ZE9A 3S40A 2YC4C 5TC4A 5FIUA 5LYYA 3IEVA 3GVHA 1H1LB 3M0EA 3OOWA 3PJGA 1MBZA 3HL0A 3GLFB 4MQLA 3BFKA 3CLKA 1Z22A 4DNXA 2BELA 2WHEA 2PUDA 2YZGA 1KY3A 4LRWA 4EB0A 5EE5B 4M86A 3TKYA 3VPBA 3LWDA 2E85A 5LA6B 1GZ5A 3IT0A 2KJQA 3RNLA 2I1LA 3BIJA 3L4SO 1OXMA 4MV8A 5EERA 5IH3A 1W0JD 3DMDA 3FSEA 4PQFA 3SF8B 3URKA 4D4KA 1K98A 3K0FB 1ZNZA 5F73A 2APJA 2B34A 2EFJA 4QDZA 3DV0A 5TJ9A 2JLZA 5AXAA 2G0AA 1V1RA 3OQMA 3GPCA 3G2IA 3I9NA 1C1YA 1VYTA 2YFHA 2ZU6A 3K53A 4FDMA 4ZVQA 2FR8C 2X5JO 4PIPA 2VCEA 2ONKA 5BY2A 2FJUA 2QT0A 1DKLA 3E5NA 1I30A 1XZBA 2IEBA 1IM8A 3M33A 4YAUA 4FHDA 2WTEA 4JXZA 2OSBA 1PLKA 3LSTA 4KUEA 5HKKA 5IWCA 1C4KA 4KSBA 1Z45A 2O8NA 3E84A 2I7VA 3JZMA 3IOEA 3AXSA 3ZI4A 1PSDA 3E8XA 5KKAA 4KXXA 3GW8A 3Q3HA 3SN6A 1F06A 4P3XA 4EF4A 4N01A 4RY9A 4EJ6A 5KWJA 3CLRC 1XLWA 3DE5X 1I3NA 2GLXA 4Q9DA 3L8GA 1DRUA 1FK8A 3FBTA 3OLYA 1V8BA 4GPBA 3OLWA 1L4HA 2DUMA 5AI5A 2QRZA 3C39A 1IQUA 2ZANA 4N6NA 5DBHX 3C1UA 4DV1B 3SYTA 4L0CA 4DQ0A 5JNRA 3LUKA 1UKAA 3A2KA 3FDJA 1IY1A 2HWUA 3NDJA 1K89A 1SZDA 2WHRA 2X3UA 2XB9A 2DBYA 5LPNA 1QANA 1GPLA 1F4PA 1MTOA 1W4ZA 3A4MA 3MWKA 4JBYA 2PS0A 2ZE7A 1UH5A 3ZGLA 2JIRA 3LKDA 2VDWB 1NUSA 1SCIA 3OAAD 5J2UB 3IELA 2W5UA 1I10A 4G4SO 2HYDA 1KDRA 1XLTC 1SVMA 2XVYA 1DO8A 2GAJA 2VJMA 3NBUA 4YUWA 1JLKA 3FPCA 1WHSB 2UUCB 1QWOA 3U4IA 2RHRA 4HV4A 4EKDA 4P4UA 1SRQA 3MWYW 2VF5X 2P65A 4M55A 3G0OA 4IIVA 4J4HA 5LZ9A 3V6LA 3VOBA 2NO0A 3FHLA 2R1ZA 3DD1A 3KOOA 5DHRA 2QORA 1YS4A 1J9GA 2BF7A 2P2ZA 3COSA 4LX8A 2PRIA 2XW6A 4M54A 3IBSA 5C32A 1M2VB 4OTZA 5EIWA 1TAQA 2R8BA 1NUUA 2AXEA 3CT6A 3MUOA 1CK4A 1G6Q1 4HH3C 4BQEA 5JMTA 1E6MA 3HXTA 4DKJA 1SKMA 5E6SB 3M6FA 2R7AA 4CIBA 3Q88A 1Q20A 2I66A 1KQOA 1P44A 2VRNA 2GF2A 4OSPA 5EVCA 4XWTA 5T4HA 4KRGA 4D79A 4BO0A 2D54A 3M6AA 1W2GA 2O1WA 2OFXA 1N2XA 3AI3A 1JDBC 2YHAA 2RAPA 1O9GA 2Q5IA 2SECE 1PFGA 2FQWA 2ZUCA 4UOZA 4KQGA 2IV7A 4FJ2A 1NF2A 3UPUA 4IJWA 4DUGA 4ZZIA 1B14A 3AV0B 3QEMA 5JDCC 4A0SA 5EG5A 1F4VA 2P4EA 5C0OE 5K0CA 3PEWA 1ESCA 1QNFA 2PKXA 1O2DA 2ZVJA 1R6UA 4AJKA 4HDRA 4CR7A 4TQGA 1Y9AA 1L7QA 1Z0JA 3SD7A 1ZIXA 4TMTA 1A9XA 2PQ0A 1JB1A 3PD0A 4ZGBA 3SQLA 4C5BA 2Q5OA 2YJTD 3FDFA 3K4PA 4BNLA 1YR3A 4KVFA 4YJ2F 4BZZA 1QIIA 1Y1LA 3MS4A 4EARA 5JR3A 2EKZA 1M2OA 2E6KA 3LX8A 4ALNA 2ZRAA 4MWBA 4QXRA 4PNPA 2TECE 4DOMA 2BHNA 1NM5C 3T3GA 3I4CA 4AJPA 4O2BB 2I55A 4D97A 2O8BA 1B4DA 4O4IB 5TNXA 2R1VB 2QU7A 4EJSC 1KYWA 2DR0A 3LQ2A 4H9GA 3QWHA 2PBFA 1INLA 3F46A 3A04A 1H2EA 3QXCA 4LXQA 3UMVA 4DMGA 4PX2A 3DNFA 3NAMA 1AHPA 2Q99A 1RAIA 1ZNQO 3GRZA 4MUHA 2I03A 3UQZA 4HB3A 1ZVQA 1BN6A 1JE0A 3P2EA 2EKBA 4WZZA 5HIKA 5T7BA 3T1HB 3M6UA 2QE6A 3EEYA 3CF0A 4OATA 4OHOA 4QODA 5EJEA 1M1XB 2P11A 3KT8A 3LDUA 1YL7A 3HKDB 4YYEA 1J99A 2RHOA 3O4IA 1K7FB 3H1AA 3TECE 2IT1A 4QARA 1O6GA 3BK7A 5DIFA 3D0RA 5EKUA 1JXAA 2PCLA 2RARA 1P2UA 2YZ2A 1U1FA 4JB2A 2JAQA 5T57A 2QR3A 2TYSB 3AVVA 2NYVA 1PGJA 4GQAA 1WR8A 3HA5A 4C08A 4BV8A 5F7OA 4BMSA 1AKVA 5C3UA 3RC9A 2GZHA 1J33A 1Q1EA 1ODFA 2IPOA 2QD3A 1X80A 3ZJ5A 2E49A 2JCYA 5EZSA 4ZYUA 1BCRA 4G67A 1BKDR 1NVUQ 3OJXA 2V3CC 5AKZA 5LIPA 3PIDA 1AS0A 1K97A 2B1IA 3E6AA 3IIMA 4HFRA 5TMPA 3ZJ4A 3VJKA 1N9ZA 1JTFA 2G4LA 4YEDA 2F8LA 5IN4A 4U7WA 2V96A 5K4HA 2DLCX 2PKQP 1Y48E 2ZITA 1J21A 3G2NA 3S1AA 2YWCA 3TSCA 2QLFA 4PLZA 1ZMBA 3DEAA 4LFCB 2HCBA 2IW1A 3F97A 3NBMA 3R9XB 2W70A 3WMWA 5JBIA 4A8JC 3IJPA 1MRSA 4V24A 4CXMA 3FJ1A 4EMBA 4D0RA 1HL7A 5E2BA 1ZM2A 4ZEWA 3LPMA 3G0CA 2H7YA 1C0IA 1JSLA 2CL6X 3AERA 3MN1A 5K3BA 1SBIA 2PV0A 1IZ7A 1K66A 4W8HA 4OU5A 1P7CA 1VMEA 4QBIA 3RT7A 2XODA 1XTSA 3BXPA 2FETA 4CG2A 4X94A 2LIVA 4R1NA 2X9VA 3MYRA 4N03A 1VDZA 4V3CA 3PI6A 3B6JA 3NJ4A 4GI5A 5CCEA 1PR0A 3AP3A 4NFLA 4MQEA 4K8OA 5LZ5A 3JD0A 1RPNA 1KAOA 1GY8A 5JV5A 2B3TA 5KYWA 3FHJA 1U4OA 2Q5HA 5JC8A 4FDUA 3Q8KA 2EF0A 1YUBA 3MK31 4MINA 2CUKA 1N0VC 4JP8A 4HAIA 3VUEA 4I5FA 4EPVA 4K6CA 2H06A 1J2EA 4D6XA 4L22A 1Z5VA 2PT6A 2RC5A 1ZSYA 2IYAA 2VAMA 4LA4A 1EXVA 4WBNB 4QHSA 3B6EA 4FKBA 5BUCA 1IBKB 3T7SA 1H9AA 1PQUA 3OQBA 3RJZA 2R8ZA 4MQ5A 4Y3UA 4DIMA 3GEMA 4QU5A 2P6UA 1NP3A 3LD9A 1VPTA 4N1AA 3UW1A 3TOCA 2NACA 1T1JA 3PK0A 5AK4A 1UFKA 4C4AA 2DZDA 3OETA 1BE1A 2BMFA 4WL0A 1OBOA 1X13A 4ENUA 4BUZA 3UGJA 2O2CA 4FP9A 3RU9A 1BFDA 3COWA 1T26A 1MXHA 1MF7A 2GAFA 4GP7A 2HSEA 4JOQA 4NPCA 4C1NA 4C3OB 4YS6A 4BAGA 1MABA 5CDSA 2RGAA 1IHPA 2OXTA 2IYSA 1QHGA 1OB2A 1GU7A 3TTXA 4R01A 1FNMA 3D6FA 1Y4SA 4QJ3A 2OLKA 3C3MA 3H0EA 1P7ZA 1OQAA 4MUNA 5FTKA 3UAOA 3P2JA 4AMVA 5HG0A 5EQFA 1Q1AA 3L4KA 1SURA 1H1LA 2ZPAA 3GLFA 4E7PA 4ZO7A 4JL5A 2QXTA 3GCDA 3V8QA 4G85A 1YR8A 2OXFA 3S4YA 1K3UB 2AOXA 2GS9A 2I1VB 3JSXA 3MERA 2QAJA 3MG9A 1JI3A 1BVYF 5LA6A 3PXDA 1E63A 3BRSA 3TZ6A 9ATCA 3H0CA 4HRVA 1CRPA 3FPGA 4HNUA 2Y77A 2XYGA 2YBEA 3R7SA 3K0FA 1W46A 1PK8A 3B5IA 4YCJA 3IA2A 1XP8A 3IOYA 3EOAI 1KQGA 4KFCA 1O6CA 3LRXA 4IMRA 4AK9A 5I7EA 4RZ3A 3AGPA 2QA5A 1YQ9A 4MWSA 4QOFA 4UD6A 5IMSA 1DNPA 1QGED 1VCOA 3E03A 2FEMA 1YZHA 4I9GA 2VNJA 2GCNA 2HI0A 1ZEJA 2QPAA 1U5BB 1N0WA 2PO5A 1ZOOA 2RGXA 3H5AA 5COAA 3UWKA 1MJGA 1NLYA 3MJSA 4WBXC 2J85A 5K8VA 4HQFA 3RVNA 1IY2A 2JFFA 1TCUA 3GYGA 1XRJA 4K9PA 5L6LB 2VQDA 5FAKA 5J47A 1Y7LA 3DMNA 4RU1A 2AB0A 1GT6A 1N5KA 2XYVA 2BT4A 4RKWA 4G65A 2DXIA 1UAAA 1ENOA 3FWHA 1R0BA 2NSHA 3EAFA 4YAEA 1B8PA 4KE6A 1DQZA 3THRA 1H2BA 2OTCA 4DSNA 4E51A 4N0QA 5F9FA 1U7OA 3OHSX 1J9EA 2RHGB 2XT6A 5EWLB 2GD6A 5HRCA 2HWKA 1UZUA 2BC9A 1BQ3A 2O0MA 5AH0A 1O03A 5FNZA 4KQ9A 5I8PA 2EDAA 4OUKX 2OV2A 1GAEO 3EGIA 4HAYA 5ENVA 5H4HA 3OE4A 3V7YA 5JOQA 2PX5A 2ATVA 3W8FA 4HQLA 1W6RA 5TB5A 2V7XA 5KSWB 3E7FA 3JTEA 4N0MA 4LDZA 4HUTA 2NZJA 4FEGA 4ICIA 2ATCA 3H8VA 2B2XA 3TR6A 3T0GA 5LOVF 3IEXA 2VDWA 4C0LA 4DLKA 5J2UA 1Q0RA 2W8BA 2PDAA 3P1JA 1WB9A 3ZIAD 3E5RA 1J24A 5KVQA 2CLEB 3K0SA 1SHZA 2VNKA 4Q48A 1ONOA 4QWWA 2AK2A 4YDHB 1WHSA 5I7UA 3BCSA 3HYCA 4KACA 2ZSJA 1KFBB 1FW8A 4G0MA 5JMPA 8GPBA 3HI4A 3G6WA 4P7BA 1DE0A 1EX7A 5EYPB 3L8DA 2GDZA 3CMMA 3TUZC 1DQRA 1I3OA 2ZT7A 2UUPA 3D7SA 4FB5A 5I9LA 5B4UA 4I8IA 4JGIA 3OIUA 3OUUA 1M2VA 1PUXA 2H08A 2Y99A 3CWQA 1N4AA 4DBLC 3LLMA 4DT1B 2QV0A 1XCJA 3CUYA 5E6SA 1DAPA 1HDRA 3GGPA 4BNGA 1NVVR 1VCNA 1F4LA 1XXHB 5BV0A 4GYWA 1HTWA 3EEBA 4PLYA 5TF0A 1P7WA 1Y5LA 3DOCA 3W06A 3SS8A 1ZUHA 1SBNE 4MA4A 3DMGA 4MKXA 3NHYA 1GL9B 1IXZA 4FQ7A 3O75A 4O2RA 4RHTA 2NXCA 3UF0A 4ATNA 3H16A 3TLXA 4UTRA 3ACDA 1P18A 4PTYA 1KNQA 3QRWA 2LNDA 1TM1E 3VO1A 1N36B 1SU4A 5BMVF 4PG5A 3PX7A 2WWRA 5I4CA 1YCHA 1E4EB 1WQ3A 4OGWA 4JLBA 1I5OA 2Y3IA 1SD2A 1W87A 3IOBA 3P2OA 5HMLA 3CKKA 2J6BA 1VE1A 3SR4A 3OZBA 4CF3A 2AKAB 1DZ3A 1XLVA 4EITA 2FP3A 4ETWA 5BQ3A 4RGYA 1WULS 2IYFA 1YCFA 3W2IA 1QU3A 2A2ZA 1HOXA 1BO6A 1CDZA 4IIJB 2ZCJA 4V38A 2R25B 1GFIA 5WRFA 2C98A 3I42A 1E6CA 8OHMA 1EDOA 1T4CB 4YQZA 1O5OA 2EKPA 2HBYA 4O2BA 3E9CA 3ETHA 4RF5A 1NXSA 1GA6A 2A0YA 4HNSA 4O4IA 2R1VA 2Y0CA 4BV9A 5KHOC 2PX4A 1BH2A 5DB4A 4RTPA 4AIIA 4UMEA 4IDQA 1FUUA 1ODIA 3TWOA 1M83A 2O3SA 2KBFA 3C6XA 4GZ3A 5EMNA 4C87A 4DTIA 4AICA 3CNEA 1C9KA 1R8SA 2R6FA 1PAUA 4MICA 4TL9A 2BFOA 3AUXA 1T3HA 1ZHOA 2VBFA 2OAGA 5FPKA 5L51A 4EYSA 1I1OA 3ZOKA 1EJ2A 4AXBA 2ECKA 1UIRA 3ZLVA 4LNAA 1KMHB 3NC4A 4WV3A 3FOBA 4JJIA 2RGDA 2WWFA 3O2QB 4YHBA 3HKDA 1GPH1 2UYYA 3RS8A 5ETJA 5L7TA 1UXGA 1DIOB 4BFLA 1E60A 1FP7A 1Y4UA 1YSCA 2X19A 3NKFA 4Q03A 3VU1A 3KTFA 3MGKA 4K40A 4PBSA 5AK0A 1NHGA 2XADA 4KBGA 4WSOA 3JY6A 5TV2A 3EVZA 2W4IA 3TRIA 1Y6JA 3R7LA 3TBKA 4IVNA 1XRMA 1JS1X 4YCSA 1N7JA 2ZWOA 1SIWA 1U7ZA 1XKLA 3MAGA 1RYFA 2B4KA 4ZCQA 4JP1A 2EP8A 1OAKA 3Q3CA 4HHEA 4W5HA 4R7ZA 1D9XA 1U0JA 1XD9A 3PUJA 1NFFA 2FLWA 1AK9A 1JQ5A 1N5MA 3MGGA 5CA0F 3FFBA 4DRYA 3DFKA 2Y1XA 3L6BA 1O97D 2C20A 2OHFA 4YLEA 3NI2A 4NC9A 1Y3AA 3NWEA 2WA1A 3A3YA 2I4OA 2OESA 4LYDA 1USUA 2ENWA 2FW0A 2FG7C 3EDYA 1GG9A 1W9HA 2W2KB 5ADWA 1YS9A 3K1YA 5K3FB 4F2WA 5C1PA 3R9XA 3V1KA 1NQOA 1UM9B 1CV2A 5FI1B 2XDYA 1ZS9A 1Q7TA 2VHXA 1FUKA 4FHZA 2CCGA 1SHLA 3HZRA 3Q4GA 4FGUA 4GPEA 2FW7A 3CG0A 3EFHA 4X6LA 4CKWB 4MV1A 2Y1DA 3NTRA 5E9AA 5JMOA 2YV1A 2LVBA 4U7HA 1G1AA 1I80A 3C4QA 2ID4A 3F6SA 3DQQA 2A0KA 5HWSA 3TL3A 3AVPA 1OJLA 2F3RA 2VIIA 3CH6A 4N0PA 4CV3A 1ISSA 5K4AA 5LLDA 2JD1A 4KO2S 4ND6A 5G2OA 4B44A 1KEKA 2TMKA 3TLEA 3GP5A 5D00A 3UGKA 3VNUA 1FUYB 2BFCB 5TQ2B 1T9CA 3SE7A 3LNTA 3UYLA 2BYTA 5B58T 4PG8A 1AKQA 2CK3A 2LTAA 3OESA 1N8KA 3FI0A 3R3ZA 1VHLA 3OFSA 2QNBA 5TQ0A 3QMMA 1K2VN 3MMXA 1ZH0A 2BCJQ 5ALHA 3ZIDA 1G5IA 1TCCA 3O4GA 4UD2A 1Z4QA 4DHWA 1EFVB 2PY6A 4PF1A 3ZOZA 4JEHA 5IAGA 4C4ZA 3M7IA 4HYQA 1ZA1A 2CYBA 9GPBA 5BSEA 1RP7A 4LHSA 4G5QA 4WBNA 1N6PA 1R64A 5TS3A 1BYUA 1GFZA 3AJ9A 3UK6A 3WFIA 4JH0A 4EG8A 3UH0A 3B1YA 4YIKA 3OFJA 3DDWA 3I83A 1TA0A 1PQ4A 1AUXA 3MCVA 4KZPA 1LW7A 5BNIA 4IDCA 4JFAA 4ND4A 4BWFB 2B25A 4MKRA 5LZ2A 4PPYA 1E64A 3T95A 5KQMA 1M7BA 2I34A 2VK2A 2PPLA 4IVQA 4ZDIA 2NG1A 1ZDMA 1ZGAA 3D8SA 3WR5A 1RIIA 4WN3A 3O47A 2FFHA 5EINA 5IAAA 4D1YA 4U7FA 3ZGZA 1LTKA 1YZFA 2PFGA 2PD4A 2B37A 2PJZA 2H8GA 4ZT7A 3UJDA 1CNMA 3H3XA 5JQGB 3MELA 2B20A 1CNEA 1DX6A 2HFJA 1YRHA 4TSFA 1MEEA 2F7SA 1P1FA 1G8SA 3KVOA 3RIYA 3T3HA 4UNNA 3W78A 3QVVA 2VRCA 3LZDA 4LHZA 1YIDA 3TD2A 2IODA 2X2PA 2C54A 1VYVA 4DY4A 3N3AC 4HMOA 4OIMA 5CRIA 1FSZA 2RHDA 4JBWA 1PJCA 3B1ZA 1ZUWA 4W8OA 3S2UA 2BM9A 1XRSB 5AUNB 5B1EA 1JMKC 4LMAA 1V8DA 3ABOB 4X1YB 2A9QA 1N8NA 1PIWA 1XEAA 2CDAA 2VSFA 2J87A 3AI2A 3HWWA 4INJA 4X92A 4ZC8A 5TGDA 4CMKA 3J7TA 2R0QC 3ZD6A 3X2EA 4HDQB 2H6EA 1VL1A 1DKRA 1IN6A 1LX6A 4FSHA 5DK6A 3ZTWA 3C98A 3SYLA 3W2TA 3IPXA 3OKFA 4DIFA 4GMHA 1SU8A 1QG4A 4CMEA 5J2TB 1X1EA 2AXNA 3RRJA 1T0JB 2QD1A 4P81A 3ZCQA 2DWPA 4RCVA 3VKFA 4X93A 5CYGA 2NVBA 3C8UA 1NI5A 1D09A 1U80A 4NZYA 1KH1A 5FWDA 2F67A 2HUPA 1J0AA 4WTOA 1ACMA 1QRUA 2QVZX 1PS9A 2AJCA 2C97A 4QTYA 2RH9B 1X7XB 1N1MA 4MRPA 2QTZA 5C3MA 1YO6A 3HM2A 1CJMA 5FT9A 3IUQA 3NJRA 5IEBA 1XMPA 4ZMRA 1I6KA 3ITNA 2GN0A 3H2JA 2VXYA 3LWBA 4YJ3B 4ZQGA 2QPOA 3PC2A 2DR3A 4MV7A 5IZ4A 4XTCS 4EOGA 4AP9A 2HDHA 3CJTA 3ZCRA 3G02A 1JLRA 2GXSA 3OQOA 1JH9A 5EWLA 1NF8A 4FK8A 4JYPA 3UUEA 4BCBA 1ZD2P 2OCYC 3FWPA 4F5YA 1KC3A 4QUIA 1YWGO 2DPYA 1DJQA 2POCA 5IKEA 2ZBEA 3JQQA 4NV3A 5SZIA 2G80A 5D6NA 4IICA 2B5VA 1XZPA 4KQJA 3W5UA 1HEIA 2VCYA 4OP2A 4TWZA 1GCUA 2Z2YA 5IUNC 2O0JA 2JRLA 3UPTA 3TG2A 3ZZTA 3L02A 5MFZA 4GOJA 3DOJA 5FORA 1UXKA 3BRQA 3GN1A 4LJ5A 3R3JA 2IWHA 4E5MA 4FSXA 2J6HA 3HKBB 2WHPB 4IF4A 1A9TA 3PLAE 1E7RA 4BFWA 3CUTA 2C2HA 3IQXA 2O14A 3Q5EA 4IIHA 3T94A 4N12A 2IUEA 4KVAA 3I2FA 4EYGA 3ZE0B 3DBIA 1S3SA 1G8JA 1F8XA 3HGQA 5FOVA 5LC1A 5U4XA 3ZLUA 2F8SA 2IHVA 5HE9A 3DAYA 1GKYA 4JYAB 3TLZA 5EYPA 1EEXB 5AHOA 2RB4A 2R00A 1G6KA 4L2IB 2YJGA 3U17A 2O8CB 2DFKB 1PSWA 1TFRA 2ZOSA 5CLIA 4G8BA 3RAJA 5CB4F 1G8AA 2XGJA 3VO9A 2FFJA 4FZ5A 3CCCA 5CX1B 4DT1A 3KTDA 1QHSA 4G97A 2F1RA 2XBMA 2QQ0A 1XXHA 1VECA 3S2EA 2YWBA 3HBNA 1Z7GA 3MJ4A 4LBZA 4YAWA 4KOEC 4JSYA 3TFQA 1UC5B 2AFRA 4XWKA 1LVUA 1GRQA 4IHQA 1C1XB 2PKQO 3IE1A 3D8NA 1QTNA 2JLCA 5HXAA 1Z5OA 4CLOB 2EEZA 3GBPA 1TW2A 5CEEA 1E4EA 3IPRA 3TB6A 1HBJA 1SCDA 1UOEA 1SUBA 4UVGA 1PFVA 3AVUA 1YFKA 1XZCA 2GZ2A 3HVUA 3R5KA 3ZGVA 3EA5A 4E2WA 1YA8A 1AC5A 1UJNA 5LJLA 1J2RA 4C2AA 4CFZA 2H4YA 4IIJA 2OR3A 3O4FA 1KL7A 2PUFA 4R0VA 4K1LA 3L79A 2A9JA 3F1LA 3PX3A 1DX9A 4Z0HO 3SCZA 2WD8A 3U4AA 3PUKA 4M3NA 1D0VA 2ZULA 4HNQA 4UEJA 5FDFA 3HUDA 2QKYA 3LOPA 4OMCA 3T9EA 2QTTA 3GRUA 1Q6YA 2PHZA 3ZU5A 4IXDA 2B3DA 5KTOA 4P3YA 4QE3A 4EDFA 4L4UA 2Z57A 3U31A 1ZJ5A 5C5CA 1HQCA 1Z8FA 3FLMA 1IY0A 1WP9A 1H2HA 3TNFA 2ORED 3IKTA 4MW6A 3RO7A 3OEWA 4NI5A 3ZWWA 1XNRB 2A1IA 2A5FA 3QWFA 2QUJA 2B4TO 1L5WA 1OLOA 2HSWA 3D7RA 5JU6A 1KMHA 2W2LD 4Q9IA 2VYND 5IEJA 4MB6A 1U04A 2GNOA 4G8CA 1PDVA 3CX7A 1VIMA 2ZJBA 3PHLA 4U5QA 1ZYUA 4G24A 2FX2A 3EEFA 5AKHA 5TXGA 1IBSA 1Z2PX 2B8TA 3ORHA 3WGIA 5BYKA 1OFUX 4PYRA 1CUGA 1TO6A 2MSCB 3BSSA 3PQFA 3QVWA 4BFCA 1FLDA 1Q19A 3HNRA 3EXFB 1VHDA 2JNWA 1P60A 4NY1A 1AQYA 2YS7A 3FVRA 4GI3A 5GM2A 5TE9A 3S5UA 1A1VA 1PU2A 3DGFC 1VKHA 4LOKA 1YKFA 4Z3KA 3RASA 2DSTA 2OC4A 2UVQA 4I50F 4D4MA 3LQRA 1D07A 3L9XA 3LT5A 4ZEVA 1I36A 1WXWA 2QJTA 1GUYA 1XWFA 2ZTLA 5DHQA 3LP6A 4E6EA 2O05A 3UB2A 5KC9A 1FFXB 5B6PA 1BHQ1 2XZDA 2FR1A 1E7SA 2HJWA 2ZXFA 3NOXA 4M4SA 4WK0B 1LBHA 3FGNA 4RE5A 2J7KA 4DLNA 2I5PO 1MB3A 2UYOA 2HIMA 2IEZA 2I7XA 2V7VA 3AF1A 2C9CA 2PXHA 3JQPA 3MUNA 4MP3A 4OHUA 4FVTA 1H22A 1T9GR 1A76A 3DUFB 3WQRA 1D4ZA 1SXJE 2VAWA 2VNAA 2Z83A 2JHPA 3HDGA 3NHLA 3UAYA 2W2KA 5SY6A 3DEYX 5K3FA 1FFCA 1IVSA 2HXSA 4G0PA 4P4GA 1UM9A 4ZJZA 3D4LA 4J2TA 4B6QA 4CTKA 4US0R 3NW9A 5JJKA 3T3PB 4CHTA 3V2IA 3F47A 4JXXA 4KGXA 3QXHA 4CKWA 3G23A 1HC7A 1RMTA 4M8IA 4DJDC 3JTMA 2FSUA 2DBVO 4N48A 1XVVA 2QSZA 1I2MA 2QT1A 3CHYA 3RUDA 3SFTA 5IYZB 2V8BA 2Q2VA 4KQIA 1O9HA 4BO2A 5CU7A 2RG7A 2J33A 2H1IA 2NZ2A 3ESAA 4AB1A 1PZMA 1X38A 5ARDA 4ZV7A 1WDWB 5KDOA 5TQ2A 2BFCA 1PL0A 3H3FA 3FNIA 4QUBA 5ALJA 3THWB 1QDLB 1H6AA 1YGPA 4UU1A 3UB4A 4PGAA 4JI7B 4Z7NB 1KYYA 1ZD8A 3JRXA 3VNVA 2QZPA 3I32A 4IJKA 1CUSA 3S2IA 4OI0A 2ZRFA 3DEHA 4OI2A 4HXFB 1UAYA 4ZVTA 2P7HA 4KWCA 1ENZA 1X2BA 2YXNA 3ADPA 1LNQA 5KSOA 1KZ6A 2WKWA 5M29A 5E7MA 3KR1A 2OFOA 1EFVA 2AE1A 5GOZA 1EUCB 1C8KA 4FFNA 3IUSA 4ZU1X 3GK3A 3GLRA 1HTTA 1VHJA 3A1DA 1XROA 3UA3A 1WKVA 1CQZA 3F6RA 1P8JA 3N2YA 3K1AB 4EF6A 1TEZA 2AT1A 2ZIXB 3CXUA 1HX7A 4OH1A 5HZHA 4HAZA 2WHXA 1LS1A 3C6QA 3QQPA 3GUZA 1X39A 2QRVB 2W6ZA 2WVAA 3AYXB 4G0UA 1U5CA 3FCAA 3LC7O 5EE0A 2GSDA 1Q2XA 4TRJA 5DM70 3E9ZA 4GPAA 4G89A 1YV9A 4ESEA 1UBTS 5F77A 4HCJA 3TPFA 5IXSA 1D1QA 3INGA 4R8MA 2VTEA 3FNRA 2X0FA 1M0SA 3M6LA 2HB6A 3CKYA 5JQGA 2LR0A 4NBWA 2X7XA 1JHVA 3BZUA 4EHDA 1WZ2A 2A1TS 2ZSFA 3OHPA 2WIDA 3OZCA 2XT0A 1H9BA 1VYUA 3BYZA 1YCDA 3IV7A 9LDBA 3QTTA 4Q3KA 3AR9A 4LOLA 2G9NA 2J0QA 1YR7A 4BRSA 1KI2A 4ZOEA 4MWCA 2P4QA 1TK9A 3WQHA 2VN8A 3Q85A 4IP0A 4RK0A 1EFLA 1WDLA 2AN4A 4EJ2A 3QBTA 2R8OA 5IAOA 2OGWA 2H18A 1PX2A 2QLNA 4ZD6A 2XGMA 4OQLA 4NCBA 2CJPA 3FVQA 3OX1A 3NGMA 4DAOA 2HDWA 4X1YA 4RGVA 4RV9A 3S70A 1EK5A 1W1UA 3PT5A 1WDTA 4JJAA 2JG3A 2BHTA 3RYIA 1V4BA 3B9RA 3HXQA 3TM4A 4YROA 4PLVA 4R69A 5IDYA 4CRWB 3AR3A 5A4JA 5EC8A 5C81A 1TK3A 2CNDA 1W29A 1ZN2A 2V0CA 5J2TA 5ALGA 4C0AC 4IJUA 3ISJA 1WX1A 4MUMA 3VPAA 2OBFA 5J43A 1Y7PA 1JV2B 3U9SA 1M2HA 3L7YA 3AKEA 1GITA 1H42A 2YRFA 2HFKA 1A82A 3I01A 3LCCA 1TM4E 3AY6A 1E61A 4B31A 4ENPA 3ESBA 1E2PA 1K7YA 3BJIC 4AKTA 1TM2A 2B21A 1R3UA 1X7XA 2HHJA 3P9XA 3N5KA 1PGOA 4MVJH 1KHTA 4XIJA 3AM4A 3T5BA 4XWYA 1VGVA 3VTZA 2MYNA 4FXOA 4HZGA 1ZK4A 4GSYA 4LRSB 2X9GA 4YJ3A 4EELA 1KJIA 2CVOA 4EATA 5LMUB 4F92B 4KIUA 4BO1A 1J9ZA 1EWYA 3MUFA 5FWYB 4AZSA 3ANLA 2IS2A 1QTQA 2P35A 1HT2E 4NYIR 1D7OA 1Y4DE 3B60A 1E7YA 1NMQA 1R50A 3G49A 2QM0A 1NBMD 2V4MA 4U9IS 2P0AA 4V03A 1SIBE 1JWLA 3R5SA 3IHWA 1CG6A 4XAQA 4L5YA 3WZLA 1JA9A 5JZ9A 3DE7X 4OK6A 3SKYA 2DC1A 1O0BA 3ESZA 4RQAA 1L5MA 1IZ8A 2PQMA 3FPAA 3PFFA 4OY3A 5GONB 3X1DA 3AESB 3NIFB 4YRPA 1WA5A 4D3FA 3SEFA 1IVYA 2C5AA 4INPA 4OHKA 2J3MA 5KMGB 1S3GA 3HKBA 5DF1A 5KYGA 2WHPA 1XPOA 1UJBA 2BH9A 4RMJA 1Z5ZA 4L9RA 1QRTA 5L7WA 2I8CA 2YJ4A 3B5EA 3QJGA 3WGVA 4XM1A 1G38A 2CUZA 1Y1SA 5AM2A 1CS0B 1JG1A 2J9FB 4N7BA 2XWJI 3L01A 4BP9A 1R5NA 2P3QA 4OYRA 3RUIA 4NZMA 1EP3B 1T2DA 1C41A 2GVNA 2HF9A 1UCFA 3I37X 3RFXA 4BQRA 2AWNA 2J5KA 2AQKA 1FVFA 1O95C 2DX7A 3CUEF 1N9GB 1V11B 2DT8A 4R05A 3N76A 1UDRA 4L2IA 1IG0A 2C8LA 3KL4A 5EN4A 3WAGA 3GG2A 4NATA 2O8CA 3K4QA 4N76A 3JYOA 3OO1A 4FBGA 3LUJA 4XGKA 5FR2A 4GOOD 1ZSVA 1TO1E 5CX1A 2AUNA 3G89A 3HFGA 5IC6A 1PFYA 4MLZA 4QLAA 4R31A 1YULA 3CTMA 3EVGA 2R6CA 3OZFA 1XJQA 4IGAA 2TMYA 4PRZA 1HYHA 3PF8A 2X76A 1J8VA 1U6IA 5FPQA 2HLDD 3IURA 3DMPA 1NMXA 4M0FA 1GG5A 3A9UA 6NULA 1C7ZA 2OP0A 4WNAB 1C1XA 1KFJB 2ACEA 4ZAXA 2R66A 4TTJA 2BDEA 4Q12A 4CLOA 5JCZA 5B1SA 2FI1A 3IP6A 3TRJA 4QVGA 4ZYXA 1Y3HA 1SVNA 3BH6A 1TC1A 2YZNA 3OQ6A 1EIZA 5GQSA 3U5ZB 4YPFA 3INRA 4MKFA 3NHAA 3X1XA 5FX2A 1L1FA 1U8XX 1G8KA 1QHYA 5BSWA 1ZIDA 4M0UA 1OWOA 1EZZA 1U3VA 3KBOA 1I0IA 1O54A 3PUVA 3WDMA 2BE9A 3ZU6A 2QZSA 3AM5A 3OP4A 2E89A 4R3UC 4NYMR 4ZIRB 1KPIA 4D82A 3O1IC 4R1LA 3U3MA 1ECBA 3B82A 3TQSA 2YY7A 4LJKA 1Z0IA 2I6SA 4UM5A 1W0JA 3EIWA 4AJ2A 2J09A 2IK8A 2FUCA 1LEHA 3PD7A 5LD2C 1KO1A 2PVCA 1DAKA 3SG0A 1VLHA 3ENZA 2Y9MB 3RYHB 3KSZO 2C00A 1TX4B 2GERA 5ECGC 3ZGNA 1HXHA 1MX1A 3T1TA 1RBZA 1MFPA 2XB2A 1CQXA 1ZY2A 2FPMA 1NJGA 2W2TA 3MBOA 4IUBS 4IIFA 3ZU4A 1BXKA 1NX9A 1NMYA 3IT2A 1KQFA 3X43A 2IGTA 4HI0E 4EY3A 2DCUA 3ET4A 2XQVA 3QFRA 3U3OA 3RS5A 4JR2A 2WVHA 3R09A 1RCTE 2H5JA 2FB9A 4O29A 3SZGA 2REXB 5DGTA 3LDGA 1YUMA 1ZJ4A 2G04A 4LX0A 4WZBE 4H1UA 3VAYA 4CLHA 4IDGA 3O8RA 3CF2A 3TDNA 4DEXA 5HZMA 1YMUA 4KE9A 1JR6A 5I8ZA 1LX7A 3Q9LA 4EX6A 3LM8A 3U7GA 1ZH6A 4EO9A 2CZQA 1LPMA 2CHVA 3EXFA 5FOTA 2ZLBA 2JATA 1U1EA 4IOLA 3K70C 3BE4A 3HXLA 1WY7A 5CIWA 5LCXA 1D2EA 1QQ7A 2FRVA 2OAP1 2IC5A 3LFHA 3MXTA 3V2UA 4JJZA 3KLPX 3O03A 3CLRD 3GGGA 1NXOA 1TKCA 1HRDA 821PA 1ECFA 2H1SA 1OI4A 5C8ZA 3BHIA 1PJ2A 4RGBA 4LQDA 3C7DB 4X45A 1FFXA 1Q0PA 2VI5A 3PGMA 4ZVMA 5J5AA 3WA6A 5FNVF 3KAJA 5HIIA 1MB9A 3TZCA 2P62A 1EPUA 2K5UA 5EE1A 3UTCA 1Z82A 4YI3A 2JLBA 2ZRDA 2ZYTX 3EFOA 2AK3A 2IL1A 3HXKA 4GI7A 4PZPA 4C14A 5IWAB 1SKYE 2CUTA 4QQFA 4U2DA 4AZ0B 3OAAA 3ZHYA 4G5YA 1VXRA 2Q8NA 3DUFA 3JQ6A 2X7HA 4FGZA 4IYJA 2W37A 3E35A 5DO9A 3LCMA 3I4FA 1C8LA 4ZU3A 1N1DA 5AM4A 1GQYA 2W6ID 2O7RA 3QFHA 1CUAA 1NW4A 3K0HA 1XALA 4BBPA 3NPAA 4U9UA 3PNQA 2EJTA 4OD0A 3A28A 3COVA 1WV0A 3PGA1 2VS1A 4UBNA 3I6MA 4HN2A 3T5GA 3W1VA 1E2QA 2QP4A 3O84A 3RTAA 1PGPA 2XUFA 3X2FA 5CBPB 4HLDA 5IYZA 4QDOA 1RBYA 1X9GA 1B2LA 5TRTA 2BGWA 4TMVA 2YYZA 2AH5A 3E61A 1L8AA 2G6TA 3TXYA 1MRNA 3EODA 1JG7A 3E8SA 5I7OA 2ZYDA 4A16A 1DUIA 1U8FO 3GMDA 1O0SA 4GMKA 5HUJA 3THWA 1T4BA 3DF9A 3IEPA 3LSYA 1ZM7A 2DUUA 3F3SA 3FDZA 3EPLA 1Y4AE 2FSVA 5K8JB 1L5HB 1JQBA 1U9IA 1XOIA 4YIHA 1M1NB 1P74A 4EUSA 2ORIA 3UZUA 1Y8AA 1ZCJA 5AVVA 2QENA 3EXEB 2QD2A 1TVMA 2D2FA 3TCKA 2FRDA 1VL2A 4JI2B 2WQZA 4YAFA 4H6PA 4PR0A 1HYBA 1EUCA 2YHSA 3I2YX 3C5CA 3I6QA 1RLIA 3FZGA 2PVPA 2QQEA 3PNYA 5IM5A 1I9CA 1TC2A 5BN1A 1H6CA 1V0JA 3K1AA 2VG8A 2NLOA 2R6R1 2ZIXA 1YDHA 1Z74A 4E70A 2ZBVA 2C57A 2PXAA 1CZRA 2QRVA 4LXHA 4P82A 4A73A 1U2DC 1AK2A 1IEXA 1VPDA 4RZHA 4H1WA 4AG5A 1MCZA 4URXR 1QB7A 3N75A 4I4NA 3U4MA 3AF4A 2X14A 1MAVA 5ENZA 1R0ZA 4XJXA 2H2IA 2WT4A 4ZCIA 1SVIA 2JGDB 5DCWA 3H6KA 4DV2B 4K6KA 4TKZA 4PNEA 1QGDA 3KQLA 5TJHA 4Y18A 2UU9B 4AL4A 2IF2A 3C16C 1CR1A 3CPHA 2ZSHA 5TQJA 2Q5LA 3Q3VA 5ALEA 5BSVA 2BFEB 3QYAA 5AKXA 3TQFA 4RQBA 1LK5A 3BKWA 3K1TA 4TKUB 4W82A 2GJ8A 3LI2A 3MHTA 3VR5D 1PQYA 1P4HA 5F23A 3JQEA 4PYIA 1YBHA 2IZ1A 2YCLA 3DBOB 5FO1A 3GD5A 5A9RA 4PTLA 1P4JA 1UKVY 4IOMA 4QO8A 1DTWB 1J25A 1CVLA 3KK0A 2ODTX 4AF6A 1DBWA 5I01A 5JAHA 2QZJA 4O5OA 5BYAA 4DV7B 1XMIA 4I66A 1J8QA 5EL0A 5IRCD 4AWAA 2GKSA 5DHPA 3X3HA 2JGKA 4LGMA 2POQX 4LTMA 1VOTA 4ECEA 3REGA 2Q46A 3JRWA 4ZQFA 4RYLA 3Q7EA 4GXNA 2QX8A 1QPGA 1LPPA 1YJAA 3O0DA 2J30A 3BXGA 3GAAA 4GMDA 4B3HA 2VJPA 1VLZA 4F9GA 3ELWA 3P9SA 2XMZA 1GFSA 4J29A 2WSBA 1L2TA 1QG6A 5H16A 1J20A 4IQGA 3E9RA 4QT0A 4BCCA 5J40A 1POXA 4OQEA 3ZV3A 4C0XA 3P0EA 5B7QA 1KI4A 4Q7QA 1G291 4F1WA 5DT9A 3OZTA 2YUIA 8ADHA 2V7GA 1SBHA 3V1NA 4R9NA 3S1LA 3V1UA 4KXFB 5F35A 1WPXA 5J4LA 5DYYA 5GJVC 4W6QA 1KJJA 1M7HA 3DVRX 3GC6A 3DOUA 4L9AA 4OREX 1X0VA 3OF5A 3U3ZA 2D7JA 3O92A 3OQPA 1GSHA 3RBVA 4D8UA 1H2YA 5FWYA 1US8B 1VG8A 1AS2A 3U3DA 4XI9A 1J09A 3HLKA 5CFOA 1I3LA 2AFIE 2JFGA 3RFFA 1Q21A 3VJMA 3H42B 3Q7RA 1OV4A 4BEJA 2E5LB 4G9BA 3AKZA 3WNZA 4NAHA 4IG4A 1JEEA 3L49A 4XIIA 2O2DA 4Y9RA 1OI7A 2G9QA 1L1RA 1NOKA 1UZAA 1WB6A 3ASYA 3I0ZA 2A1UB 3O3MB 4ESHA 5GONA 1E1RD 5T8KA 3AESA 1LBTA 2QRJA 3T4XA 5K3EA 2FTKE 1I4OA 2H2AA 3IBGA 2HA2A 2VP0A 3K8OE 4QUDA 5JHGB 1MQAA 5KMGA 2PWZA 2EP5A 3DE4X 2JLSA 3ZWOA 4BPRA 5GZ1A 1G7RA 3N0VA 1M2WA 1GFWA 2NIPA 1CS0A 3IPYA 2J9FA 4FBLA 3UHOA 2WJ3A 2IQ5A 4ARVA 4EM6A 5KJFA 2RGCA 4DDWA 2PN1A 1IC6A 5HCNA 2B4AA 3ZD9A 3MVEA 5BUZA 1G6HA 3C7TA 1PCXA 1RCUA 1IPHA 4NE2A 1N9GA 1V11A 4YY3B 1Y6FA 2F4NA 1K2WA 1TT5B 1GG2A 2I33A 1TQ8A 4CIYA 3FETA 1IHUA 1UP7A 1ACLA 2O3JA 3NP7A 3QYPA 1M34B 4BC1A 1Z3CA 4RQTA 2A6PA 1HYGA 4BLQA 1HR0B 2C78A 1SB9A 5AXBA 3NR2A 4HGZA 4Q9NA 1DOAA 4RMIA 4EPRA 1UBGA 2HA4A 2R79A 2I4LA 2BD0A 1UFVA 2X9LA 3EDMA 1KORA 3L1VA 3PDHA 1Y1RA 1DFGA 4RFLA 1ESNA 4EHLA 3BWVA 1CVRA 3U4HA 3H3JA 4LPSA 2GKGA 4MNTA 4V0SA 1O94C 5KVAA 5LR6A 3ZYCA 4BDTA 3ELUA 3RODA 4WNAA 3HJRA 3GIDA 1FQOA 4L51A 3HTXA 1CJVC 3A1CA 3KR0A 4UHDA 3PQ2A 3WP1B 5C1DA 3LUAA 2FXIA 3UBTA 3CNNA 4RETA 4J2OA 5I9SA 5CFZA 3GO4A 4ARUA 2ZJ7A 4RA6B 4WJKB 1PJQA 4J9UE 1Q0HA 2H8KA 2Q5QA 4XQ9A 4GKVA 4EIWA 5B55A 1RYMA 2PSEA 1FXWA 3CRQA 2C4KA 3GEPA 4H2DA 3KTAB 3ENQA 4B3DA 4POOA 1AN9A 2Q6OA 1QCCA 1K8QA 3O6VA 2A5DA 4LVNA 4ZIRA 2HCRA 3OCVA 1NRIA 4FGSA 1ZBQA 3ZVKA 3BCHA 3REQB 1MO5A 3T7KA 3VTAA 1TM3E 2Q0QA 2WG1A 3AP1A 4PS1A 4Y2HA 3ZE2B 1MJGM 4WOJA 1T1EA 3RYHA 2I3AA 2JGEA 3VO2A 3CVWA 1I0ZA 3F3YA 1Z4PX 1N7GA 3FBGA 3KVRA 1A5TA 1NTRA 2PXCA 2AOUA 2DFPA 4E0BA 3T1VA 5EKSA 3K15A 1ACJA 4JFRA 1UFOA 1ABEA 2IIQA 3C3AA 5HCUA 5I5GA 3TE6A 3NVMB 3V8PA 1P0QA 1VJTA 2GPYA 4N5NA 2YWRA 4YLGA 4CV2A 5KJ6A 1G66A 3EW9A 1VL6A 4MGHA 2FN7A 4HH0A 4G6ZA 3L1UA 2VUSA 1TPZA 4QBKA 1DP4A 1LGYA 2VBCA 4OV6B 3RAEC 3QI7A 3HR7A 3EK2A 4MVJA 3UJPA 4GOLD 4BTEA 1L7MA 2PX3A 2YWHA 3RRMA 3RSGA 1PR6A 1OMOA 4PGGA 1MUUA 421PA 2C83A 3A6KA 1JRLA 3FGPA 4BV3A 4XX0B 4FFLA 1RAAA 2II6A 2GD1O 2Q7DA 4BFSA 4YR9A 2CCJA 5EKDA 1GN8A 3KXDA 4BNDB 4OP3A 3B7GA 1GRNA 2HRCA 1KR2A 1QG0A 1ND5A 4JT4A 4O5AA 4H3VA 2XQIA 2V7QD 4B0PA 3V55A 1P1JA 1U2GA 3QUBA 2NUPB 5B36A 3LUFA 3E2MA 3O4RA 5CG1A 1T5DX 1XQ9A 2C7QA 1W8IA 4IUDS 4ZKDA 2CV2A 1JQAA 3WWDA 1RJGA 3I5AA 5DX1A 5H02A 3RM3A 4PX3A 3DNPA 2VQFB 3FTPA 5FOWA 5KI6A 1G19A 1XTZA 1T3LA 3ZIAA 1EH5A 3L5OA 4RVHA 3V9AA 1SO8A 2GNAA 2QD5A 2QYTA 3OUTA 2ID8A 1IM2A 4C06A 2O52A 3IEUA 2BBOA 1OX5A 4NU0A 2A7QA 3NEPX 5CEFA 5A7HA 1ZZEA 1OU0A 2WFAA 1P2TA 2ZRJA 3EDOA 1O8CA 2WU4A 3AG6A 5J59A 1XU9A 3S81A 1OAOA 2JEZA 3D8TA 4C78A 5M34A 2WJZB 2C2ZA 5MF6A 1W30A 2VKQA 1VB5A 2XZOA 3F5DA 1P5HA 2OQ2A 4M1QA 3HCNA 1JZSA 4G07A 3FTDA 1R66A 2Z3WA 4KTTE 4ZGWA 5JD6A 4XEUA 2B6HA 1Y4ZA 3W7AA 4ZHQF 1QM5A 2PUVA 1DDOA 4EFDA 1RQNA 3TVTA 2SBTA 4POAA 3HVIA 1T34A 4X95A 3WMRA 1QHFA 2CHUA 1SOAA 4REQB 2Z08A 3FSGD 4C0QC 2HH9A 1NN0A 5IDQA 1RQ2A 2AFHE 3L5KA 4GUDA 1U3TA 2QX9A 4N9WA 4AY3A 5CFMA 3GLGA 5AD1A 3MS2A 4PRLA 1M1NA 5J1SB 3L1HA 4MARA 4P98A 4PZDA 3EXEA 4BB9A 2PFKA 3L4EA 1J0XO 2H0QA 1Y3IA 3EZ6A 2VF8A 2AF3C 1G7CA 2QY6A 2OZEA 4ZOLF 4LV5B 2FP4B 4WXYB 2DJIA 1NUAA 4FYYA 4V0MA 5IASA 2C7PA 2G5PA 2EF1A 4ZDKA 2JGLA 4LWOA 4BBJA 3RVOA 4DREA 4OQFA 1QRSA 1ICIA 4HVCA 1JAYA 1QO9A 4QECA 3NUQA 1C9JA 3MWJA 1WMSA 3QVUA 4ZRNA 1SK8A 3IKJA 4IUYA 4FMBB 1COWD 4OHCA 1U1IA 3OLZA 4DQKA 3FTNA 3AX6A 3IIKA 4AF7A 1FUIA 3QIAA 1WW3A 3Q3GE 2JGDA 1P62B 3OOSA 4BNUA 2D7DA 1LDMA 2W90A 2YQ5A 5F5XA 1B6GA 4CJXA 3U6BA 1FIUA 1ZK3A 2DUWA 2DAPA 3SFVA 1OIXA 1IHDA 3IBYA 4KFSA 3D1LA 1DEKA 4I55B 1VBKA 1IN8A 3DBLB 1HE3A 2NXEA 2MSDB 4Q37A 2BFEA 2QUAA 3HCPA 3U7EB 5LNK6 1ILEA 1Q1QA 4U2BA 4TKUA 4FR0A 4ZYVA 4MCAA 3NFRA 1TMYA 4ALMA 4CWAA 4DCVA 1H4QA 4K6OA 2VZLA 5IM4A 1T29A 3MJFA 2WJ4A 1IXRC 1GTJ1 1TM5E 3THSA 1IXKA 1DVRA 1T2UA 1DTWA 1RWPA 1UMCB 1EKXA 1XDZA 2L18A 3IVCA 4FGKA 2NU7B 3LY7A 1V3TA 4MWOA 3KOXA 4XWAA 4DN6A 4B3GA 5F3RA 3UAVA 4X41A 3KKEA 5KSZA 1ULAA 3K9QO 1CJSA 4PSVA 4PFKA 2IHKA 4A8PA 4OLAA 2GT1A 2VBGA 4IDDA 3TDMA 5H3CA 4EUFA 1B23P 2ZBFA 5JS1A 3ZLTA 4BNMA 4LDPA 4XXHA 4OLHA 4TLMB 3LYHA 1OC4A 4TTVA 4O59O 2IHBA 4M88A 1EXDA 1LLDA 1BRTA 3M6VA 3WICA 2SNIE 1YZKA 5AK3A 2VSYA 1KIMA 2PWPA 1BD3A 1DEXA 4K6MA 3Q0EA 1EXNA 1VI5A 2AC2A 2AQIA 3UMBA 1TCAA 7MHTA 2YWGA 3SJ7A 3NS7A 4GM1A 1DC4A 5ALMA 5AW4A 5B5SA 3R3YA 2C2BA 4WXPA 3RLFA 1RC1A 5HZKA 1X1AA 2UXDB 2HMAA 3F4BA 4PGMA 4RLSA 1JMYA 2X3YA 4RZUA 2WOOA 2AR9A 3ZXUB 1MZVA 5I3ZA 1CC1S 2C31A 3EGEA 3D31A 4G25A 2V7EA 4MUBA 4H7KA 1ZQ1A 4ZP1A 1JKMA 4K26A 1XD8A 2XYPA 1EFRD 4MCJA 5KOYA 2DTEA 1US8A 1JGTA 2P77A 4P36A 3CZ4A 5I4BA 2AW5A 1S2OA 1SVUA 2HHCA 3AWIA 3BWYA 4QGHA 4FMDF 2BGKA 3WLAA 5C1BA 1LWNA 4DM7A 4IS3A 1OXBB 4TOIA 1E79A 5GVRA 2NTYC 4G0ZA 1KAMA 3OT4A 5ED0A 3NQ41 4C22A 1QCDA 1ISJA 4E2ZA 4QGBA 4G9EA 1UQRA 2A1UA 4RKQA 3U81A 4ZZ1A 1QIMA 1U2PA 5ERXA 4YRGA 2VSOA 2UZ1B 4F4DA 2GHTA 3EQ2A 4Q9LA 3GFTA 1GSIA 1OB5A 3ZKAA 4YB8A 1C9EA 3VOSA 3EZ7A 2WICA 2YH2A 1SC4A 2OUIA 3L8YA 4TM8A 2GPWA 4OMDA 1X87A 3W4IA 1YU9A 4UNSA 1DBSA 2O8EB 2L2QA 4JDPA 1XLUA 4UVDA 3WOVA 3WK6A 1DL5A 4IHJB 2AMLA 4UQPA 1VSVA 3U40A 2GD0A 1KR5A 2N1BA 1HUQA 4B73A 3LNCA 3R7BA 2DJ5A 2H5IA 1VCIA 4PNZA 3FTFA 3FDXA 2A9PA 4JV5B 6REQB 5C53B 4URZR 4KMRA 4EY6A 4UHCA 1TT5A 3X1KA 3TMAA 4AURA 1A8QA 3EC1A 3N1UA 1M34A 5CVTA 2P2DA 3N59A 4MPRA 5DTEA 4V39A 3AV3A 1ZOIA 3NU1A 2Q29A 2VNSA 2QXYA 3L4BA 1XZIA 3NHPA 4OI4A 4BKQA 4J9VA 4RX1A 1ISFA 4XB1A 3RT1A 1I4EB 1HQDA 3OPQA 3UV3A 3RYCB 2VH2A 1M8PA 1TNDA 2GK7A 4EDHA 1QF9A 2QGFA 2XF8A 3B3QA 4W9NC 2ZXUA 3ZV7A 2HSDA 3HFJA 3QI2A 1M6YA 1PHRA 1O3YA 2PA3A 4BLOA 4EABA 3NVDA 4CF6A 2O8VA 2FUEA 2F9FA 1LRJA 4F96A 1RNLA 4EFLA 2CSXA 3N5CA 1GVNB 4LBVA 3TQQA 1FF9A 4RA6A 5I7VA 2VDLB 3IGFA 2GKOA 1WETA 3X1WA 2YDXA 5C8XA 1AHNA 1X1TA 1Y82A 5FA6A 1XMXA 5CMLA 5LKAA 3DULA 3RRYA 3KB2A 1KJ9A 3KTAA 2WTMA 1AGYA 4IUCS 2W42A 4RELA 5LQNA 2GM9A 2QVYX 2H4XA 1JQLB 4DA4A 1YFLA 4E46A 3HCBA 3ONWA 1Z73A 3Q7IA 4KQWA 5K51A 3OA0A 3REQA 1HG0A 3GEEA 3ZNPA 5A9SB 1E2MA 4AJHA 1IH8A 1QRDA 3GU3A 3O7MA 3PYMA 3UMSA 4BMCA 2GCEA 3QP9A 1NKVA 2RAUA 4FLEA 4JOBA 4LWQA 4BBAA 3AJRA 1H23A 3HBLA 4A7PA 4YQFA 4RD3A 1XDWA 4I2VA 3UWPA 4QTUB 1U0BB 1N6LA 1NWHA 2RBKA 1KJWA 3MOGA 5L3RA 3IVXA 3UA4A 5BSHA 3KZNA 4HYYA 4NZ9A 4F7DA 3CEPB 1U3CA 2PZEA 4BY9E 2H1WA 1P81A 1RKXA 4RMNA 3RU3A 5JZBA 4XDZA 2UAGA 4AC9A 4DV0B 3JQAD 1LJUA 3IE2A 4K9DA 4OJYA 4Y2GA 3K6SB 1Y8QB 4M7RA 1CHDA 2ONCA 3A1WA 4RY8A 2Y0DA 1T13A 1DGQA 1BG6A 2G4VA 2C3PA 4IY1A 2W4QA 4DSZA 5B2EA 3NBAA 3R6LA 2RI0A 1QG2A 2P2NA 5IHPA 5IP5A 4JLJA 3Q8MA 5JS2A 4GKJB 4XX0A 3DDOA 3TLBA 3MLEA 3IMFA 3CNHA 1M6EX 3QYJA 3T9CA 4BNDA 2AMFA 3QVGB 2Q4EA 5JAPA 4MX8A 5EJ2A 5LLTA 3R7AA 1C7QA 3GDFA 2CDNA 4HC4A 2BFFB 4IRMA 1HRKA 3HC7A 1YHZA 2XVZA 3D0OA 2W6JD 1A95A 2F3TA 2NUPA 2QL5A 4CLRB 5C34B 2GN8A 4IDAA 4EEKA 4KYIB 3C3JA 3TTYA 4RESA 4J16C 4DDKA 2X4DA 4EKGA 3AR4A 1A4XA 1NZDA 1WM1A 2AV6A 4JN6B 5DGCA 2QOEA 5I47A 2NO4A 3IQWA 3KG2A 1VE3A 2D1YA 4DGQA 2PMFA 4Q9AA 2CHQA 2IU0A 1WMAA 2Z0MA 5KX5F 4ZRDA 3BFXA 4EI7A 2PIAA 1FMFA 1QOPB 2CKDA 3MTBA 2A0FA 3GRKA 1MP0A 2IEIA 2BGLA 2FWJA 1NW8A 2JHCA 2EZUA 3AUSA 3CPSA 4RAOA 4QT4A 2E82A 4WEQA 5IF3A 4OFXA 5CH8A 2DF8A 1M72A 1U7UA 4BNYA 4YRQA 3B2NA 3AZOA 4RVDA 3PNVA 1C0LA 1L7EA 3R0XA 3Q8WA 4UASA 4A2WA 2IZ6A 2Z8XA 2Y1KA 1YI1A 4OPMA 4REQA 3RSSA 2FPWA 2BTEA 2VPIA 1PYGA 3WLJA 5IUKC 1TVKB 2IEDA 2YZKA 4F86A 1UWCA 5D3MB 1O4WA 3GZNB 3QELB 1KYTA 1RU3A 3WK4A 3H9UA 2X8LA 3QOWA 4KPFC 5BR7A 5JATA 1MAAA 1NT2A 2QTVB 2XNCA 5EPEA 5K3CA 2HYIC 3CEJA 2IYPA 5M5BA 5G41A 4NAVA 1NQ5A 2XE6A 4WN9B 5G40A 1CUFA 2E1PA 1IYZA 1OT5A 3KSDO 4GIBA 3K20A 2OYCA 4ZYZA 1D5CA 2L17A 1SOMA 3A4LA 2FP4A 3FRHA 2Z95A 3BGVA 4EGFA 3GLHE 3T4PA 4HNAB 4TVOA 1XF9A 1YZ3A 3KS9A 1U65A 5JZSA 5K9ZA 4PIVA 2IP1A 4P2GA 5HF8A 4P0QB 4EK9A 3BQNB 4QPDA 5K8IA 4PLCA 2VO1A 1L5QA 2OV8A 4TYMA 1XR3A 1L4EA 1A2KC 4LXGA 1WTCA 1IUNA 4O4JF 4RKYA 2A84A 3W4JA 3WZMA 4CM5A 1NWCA 4DBZA 1MV5A 4N7JA 1ZGCA 3AL2A 1GUAA 2W48A 4PYQA 2XBUA 2GYYA 1E3EA 4UVEA 4BQSA 1RLMA 3WL6A 1SG9A 1T8SA 2LKCA 4TL7A 4XEHA 1XT6A 5LBTA 2AG8A 2VEDA 4V1CB 1DX4A 2VR1A 3HZHA 3VR5H 3E7WA 1T2VA 2GHIA 2GR9A 1XJWA 2ZJZA 4GXQA 4I55A 5FOXA 3TOXA 3DBLA 2WUFA 5JVDF 5KHLB 4QM7A 4AFNA 2ZZKA 1E5XA 3MC1A 4HY3A 3VTFA 2YV4A 3SC3A 2A7XA 2W2LA 2VYNA 1U0TA 2OORA 3V46A 3DEIA 3BFJA 4TS9A 2NNWB 4O4LB 5EJIA 2J4CA 3G85A 4YYZA 1A5ZA 1RW4A 2EAUA 3AF2A 3SQNA 2HV9A 1CZNA 1UMCA 5TPZA 5AM3A 2NU7A 4WGGA 3BEDA 1L0BA 4GD3Q 1ATIA 1E3QA 3I8SA 3R5FA 1ICEA 1RRPA 1TI7A 2I1WA 3CYFA 3P9PA 2Z2KA 1EDEA 3ELBA 4FYVA 3GRCA 4JIGA 1EUYA 4FIZA 3LHIA 1BE8A 3QVJA 2GJAA 2X4IA 3E7XA 3M1LA 3N2GB 4J6EA 4P7JA 4WY2A 5HMMA 1ZONA 1UOQA 2IXAA 4DLZA 1M9NA 2HU8A 4LE1A 5I9BA 2MR6A 1Z2NX 2X6TA 2OA0A 2CXTA 1Y42X 4CVNA 4Q7MB 3PGKA 4J0GA 1OI2A 4RFVA 4B17A 4EKYA 5A1TA 1Q0UA 1A77A 3KNZA 1LNSA 1ADYA 2OBLA 4IV8A 1MJNA 4JLAA 5GZ6A 1L7PA 5AYVA 4F1JA 4Z1MD 4GL4A 1IJBA 1W8DA 2X1LA 1YQQA 4X7MA 3U1TA 3JYLA 4EPTA 1L7AA 4NMMA 4YRDA 3T0FA 3VR2D 5LZ7A 4KYTA 4MI6A 2X0JA 3A14A 3PHGA 2IWRA 3WRWA 3ZCSA 4E5VA 4NCJA 5A2QA 1O5IA 1SQFA 3L2OB 1HMPA 4CMAA 3O3NB 4DLUA 4Q3OA 1NATA 4TYPA 5CVVA 4CMEC 5HUQA 1QZ3A 1THZA 3DHYA 4MW4A 4IQ0A 3DHEA 3KLBA 2B78A 1FFWA 4C0HA 1SXQA 3KCQA 3MGAA 3TOVA 1QKJA 4BMNA 3B1JA 1JAIA 5CH3A 4QOGA 4BP8A 1AJEA 4D80A 1EBBA 4KYUA 1MC8A 1K4YA 3E9EA 2UZ1A 5HBRA 1RPTA 3ICCA 3ZXXA 5B2ZA 1XGKA 3P45A 1R9JA 4A27A 1TUGA 2QTLA 3HCCA 2GA9A 2QLBA 4U2EA 3WHPA 1FW6A 2NQTA 3CR7A 3QLTA 4MW9A 3MA0A 1Z2DA 3V1MA 3NTQA 1PWZA 1GLGA 3UOGA 1NLUA 1QGAA 4BJHB 4F56A 3VJRA 1ZCZA 2O8EA 2HREA 4TS1A 3I9LA 1H4VB 1JDBB 3A7EA 3KWMA 4IHJA 4RF3A 2Z2JA 3JRNA 4EEZA 1HGXA 4BLSA 3LHSA 2FMXA 4LQLA 4PO3X 1NZFA 3S2SA 1K88A 3BF8A 3WV5A 1F6BA 1LU9A 3D5QA 4D8TA 3E1SA 3V4SA 6REQA 3TB4A 1JILA 2F2TA 2I8AA 5INTA 2MMCA 3N2NA 1E2BA 2O50A 3DAGA 4RH1A 3I5XA 3QXSA 1SVKA 2HJVA 2H1HA 2WF8A 4Y6PA 1FU8A 4NBKA 3CV3A 2C5BA 3JWIA 5DU2A 2HQRA 5CIQA 3PICA 3HU2A 5HFJA 2HPVA 1FYXA 3H2HA 4AJ4A 5JSHA 3VC3A 1J6UA 3LHKA 3MWGA 5FULA 4GMXA 2GEFA 2ZG6A 1DKNA 1ZVKA 4Q9JA 3RYCA 1AXGA 3DKIA 2HX1A 2WJIA 3T7DA 2BFBB 1RDFA 2QPTA 2XWSA 2MCFA 1QGUB 1TZ2A 1CZOA 4P7GA 3WL5A 3QH4A 4UNPA 3LQQA 4JKIA 2ZUBA 4RZSA 4RXMA 5JCOA 2P9QA 1E9RA 1V9CA 4RANA 3KSBC 2IYRA 2B9VA 4GMGA 4JT9A 4H6WA 1ODCA 4I9UA 4JKYA 3HJTA 3VZBA 3VZSA 1M76A 2GARA 2CLLB 4BAZA 4BMDA 4UTOA 4IH1A 3CXRA 2DULA 2R00C 1QDEA 1KERA 4RO0A 3ON5A 4HWOA 4UC0A 3A06A 2CLIB 3V7WA 2AEJA 2FDRA 3D4BA 4N65A 4NBNA 3WB0A 5BWNA 5A9TA 3GY0A 3OMWA 4MIYA 4O1IA 3ZK9A 3RWBA 1T2FA 2Z6VA 1N92A 2VDQB 5AK5A 2P41A 3FPLA 2CXQA 3A9SA 1WS6A 1NULA 4O25A 3ZH2A 3C8DA 4GBMA 1WKBA 3FMVA 4B87A 1PL7A 4WRRA 3I01M 2PR2A 3EPPA 4JLKA 4TTSA 5A9SA 3B3GA 2ZGVA 2I3DA 1UDAA 4NFYA 3GRRA 4XR9A 2P78A 3B7WA 4JWTA 3ZCPA 4HPXB 4YN3A 2DPXA 2E4VA 1QK3A 3WYEA 3BMXA 3OA2A 4YXWD 1D4FA 1MXFA 3Q6IA 1PVDA 5FR1A 3U4QB 3NH6A 5CEJA 1DCTA 1E2UA 2C9ZA 2GZRA 4S1OA 3EPHA 3ZQKA 1G98A 1ADJA 4FCCA 1XUOA 4DLRA 3FYDA 4B6FA 4EH1A 4ZTUB 3FKQA 4BCDA 4KIGA 1UMDB 4ALIA 3TZKA 1ZW6A 4KB5A 3FMIA 1F6DA 1KQPA 3ZWXA 2B5WA 1Y7TA 1YGYA 1Y8QA 2JLUA 3K6SA 5K8CA 3L6UA 1ZXBA 2JLWA 3OTQA 2PL9A 3HXMA 3Q6NA 2D0PB 4JC4A 3RYFB 4M6WB 3CJRA 4R51A 1N8TA 5IDVA 5JSKA 3TOSA 2WTUA 2GK3A 3KPYA 4HQKA 1DQNA 1B42A 4JXKA 2X23A 4CU5A 3N3BC 4DWJA 2P2GA 3B2EA 1BKYA 1OWMA 3GD7A 4A8JB 1EDDA 3NFYA 4X7RA 4YDQA 2H48A 4L9WA 2YV2A 3C6MA 1N6KA 1NBMA 1PLLA 2ZTMA 2R97A 2C2GA 2J9RA 3Q12A 3QVGA 1TZBA 4I8XA 5K3OA 2JFHA 3KFVA 4NICA 4NJMB 2BFFA 3KQMA 4ZVOA 5BO5A 4LQCA 1W44A 4CEIB 3H2KA 2F8MA 5E7IA 4CLRA 3HLYA 1QFYA 5ALTA 1Y7HA 4V3BA 4D8VA 4D0NA 2GN1A 4EAAA 2CBGA 4G2TA 2HCFA 4BO7A 5IVPA 5KPDA 3AFMA 3E3NA 1ETUA 4N5DA 1U7XA 1PJSA 2K4MA 3HL4A 4N3BA 5JD3A 3V8EA 4BN4A 1SAYA 4X24A 4I4TB 2QTGA 1SCJA 3EXG1 2XYRA 3RW9A 4DANA 5BVHB 5JS8A 3COPA 2RI6A 1D6JA 2BMJA 2V03A 3DPSA 3AEZA 3OCXA 1V39A 4I46A 1K75A 2JD2A 5FF9A 1MA3A 3SGLA 3WI7A 4L8GA 3AEQB 1TYEB 4WINA 4N3NA 4IHAA 3VO8A 5DEOA 3V8RA 5DNUA 4OQZA 3IQEA 3RABA 3TQCA 2HWYA 1PD0A 3AHHA 5I7FA 4IF6A 3U7IA 1O6ZA 1X7YA 5EWMB 3SVLA 3OI7A 1O95D 4EVQA 1I4WA 5JRJA 3WRXA 1CY7A 2XCUA 1JPUA 3E58A 1KS2A 5EFZA 1R4AA 3LC1O 3N2KB 4IFBA 4QXMA 4Y2UA 5BQ5A 4EVIA 4RK6A 4RD6A 1TVKA 1LDGA 2OMEA 1EVLA 2B4QA 2WI8A 3DM5A 2HLDA 3DPIA 3ES9A 5D3MA 2A14A 3GZNA 3QELA 5FAXA 3RVLA 4IIBA 3IMGA 2F43B 3OFND 5E1OA 2QTVA 2ZYIA 4IZIA 3S7ZA 1IIRA 1YQWA 2PD3A 2D0DA 5BV8A 5BUQA 3OF3A 1Z4IA 2C2MA 2SICE 3FCYA 5ES3A 4IV0A 5ALPA 1WF3A 2ZYHA 1CY8A 5DCYA 1ZIPA 3UK7A 1TTPB 1U2EA 3QLVA 3UENA 4FKZA 3ZS9A 3T5TA 4GVXA 4P92A 4M89A 5FADA 3G8DA 1T8WA 3BK1A 4HNAA 4B6PA 1QH0A 1STOA 4Q18A 4BRUA 3C3WA 1QRRA 5H3HA 2Y92A 5HIAA 2HIGA 4DMFA 4E1VA 4BL5A 3I30X 4EGAA 3IVAA 3O3CA 3WL3A 3ZZ0A 1S5PA 1HDEA 1O5TA 2ZEJA 3S99A 4CW7A 2C03A 4MTLA 2XMRA 1S01A 1ZZGA 4H15A 2QM8A 4V1CA 2QQ5A 4PCAA 3TG8A 1PDWA 1IJFA 1RXYA 4GYJA 3NC1C 3LRPA 5HM8A 5EUMA 2WUGA 4JUCA 4N18A 3VSBA 1DCKA 4DDVA 2HBRA 1B26A 1OJ7A 4KXVA 3OX2A 4GRDA 1OVGA 2GILA 4NYJQ 4D74A 4FINA 1AQNA 1P7VA 1HYQA 4B6RA 1P33A 1MFZA 4C4TA 1Z4JA 4WCDA 4C7OB 3MYYA 3GDOA 1OI3A 4GOKA 1UMBA 4KW7A 4F91B 1PWXA 4O4LA 4KFRA 1A5BB 3Q2KA 4CM1A 1A4UA 1QIKA 3AEKB 1WRBA 3N7UA 3IAS6 5BSTA 5FL3A 3UAZA 2VRBA 1MNAA 3RK4A 5LJIA 3P9ZA 2WLSA 1B76A 3BOSA 4IIXA 2Y1CA 2QWXA 5JXJA 2P8JA 4URHA 3L05A 3NMUF 4PLHA 2G1AA 4DR6B 3N2GA 2PXXA 3W2GA 1BEZA 4N5IX 3NBFA 2ZJ1A 3K70D 1KS9A 3O1LA 3I28A 3WHLA 2VQ6A 2F62A 5LMCA 1JKIA 2RGYA 1EUQA 2PUHA 2C7VA 1NC1A 2DH5A 2ERXA 4FCWA 5CNJA 4F3RA 5IC4A 3V2GA 3ANNA 5CBPA 3H5RA 4A0FA 1SXGA 2H16A 3H1PA 2BCGY 4KQHA 1CUBA 3F6BX 5ADHA 1E2NA 1LZKA 3PUHA 2Y1GA 2YXLA 3G1WA 2CYAA 3I45A 4Q3DA 2GAIA 3G82C 1LF0A 3RAGA 5DYWA 2XXAB 2OBMA 2VRWA 4AJOA 4CL8A 4CTMA 1P9NA 2W6IA 4R7GA 1K6MA 4PX9A 1BE6A 3MWDB 4JQCA 3BUSA 4HH1A 4FE7A 5JS7A 3JVEA 4K9SA 4Y6QA 3GNQA 5EY5B 5F2EA 1XLTA 2P1ZA 2HV8A 2Q5EA 1KKLA 1F5SA 1PS0A 4G26A 3T52A 4MUIA 3A1UA 4PHFA 3HZZA 3V42A 4RNDB 2X8WA 4B7AA 1SCAA 3KJEA 4PLTA 1SU6A 3NEJA 3GT7A 3MRTA 3FJYA 1OD6A 4DLVA 2H1FA 5FBHA 1NBWB 3DV9A 2PGNA 3OBBA 1U0LA 1N25A 5DHAA 4PXAA 4OVKA 2ECOA 1IZ0A 2R86A 1FC0A 1Q44A 5EXXA 2H29A 2ZP1A 4LNHA 4P0TA 4C4SA 3KETA 3LU1A 3JZIA 4REOA 1RQRA 1DXQA 3CZAA 3LIPA 2QN9A 4LRXA 3FR7A 1H2AS 2AZXA 1WL8A 1XB2A 2FSPA 2WFMA 2WIBA 1KOGA 3ZGYA 1GCGA 1YQGA 2EQBA 1R8QA 4E88A 2XDQB 4Q1EA 2Q0HA 1IULA 2VAVA 3C5WP 3NVAA 4WKGA 4YRFA 4ER3A 2P5TB 4OCZA 3MCTA 4ARSA 4UARA 1R0KA 3SLGA 3EWAA 4JLMA 4Q4JB 3ROEA 3P8ZA 4GR5A 3X1YA 4JVMA 3GOQA 3R9KA 5HHTA 2IYWA 4GWGA 1H8ED 2OG1A 2QN6A 3NYQA 4OX9B 3WA7A 2PU7A 1G9TA 3BJEA 2PKEA 2I6TA 2PG3A 2WHQA 3L8MA 4RQUA 4B8ZA 1QYRA 2Y6VA 4ZI2A 1FTYA 4JVOA 3T3DA 1CULC 4MRSA 4K6FA 3R76A 4BMZA 3DZJA 5ED4A 4LV6A 4ZVSA 4U02A 5HS4A 1RQLA 3GRVA 3T7TA 3SHTA 5BPFA 2YZMA 3HSSA 4DDMA 1OIWA 3RADC 1CP2A 1NXTA 5FLYA 1E1YA 4C7KA 4ZQHA 1B93A 3KYIB 1QGUA 5ALDA 4J0QA 1H85A 5EI5A 4E15A 4INOA 5ALRA 2CEAA 2CN1A 5ALFA 4IRXA 2XUAA 3PVSA 2Y0EA 1Y5MA 1WG8A 1RYBA 1XZ8A 3BWDD 2IXGA 3G7NA 4H0NA 3VR5A 3DE6X 5TGTA 4IKEA 1K5DA 4DJEC 2WM8A 3DONA 2A0XA 1KFCB 4QU9A 3O90A 5EGSA 4CIVA 4D45A 1CY4A 2J1LA 4UDXX 5TS2A 5HOEA 1DKPA 3NDBB 1Q7EA 3VH3A 5IKMA 1DEAA 3K3PA 1PNQA 1XHFA 3ETEA 2W2NA 1UPBA 2ZI9A 4NG4A 4FGJA 4UXHA 2D13A 4X20B 1GEEA 2X5KO 1D2CA 1UC4B 1WCWA 2DRIA 1PGNA 3OTHA 4H7DA 1QH8B 3LUDA 1LDBA 4NS4A 4DGSA 5IK2D 1SB8A 3STHA 2X0EA 3TZLA 4CTOA 2Y71A 4TRRA 2OCLA 1PX0A 2I7DA 5ALIA 3WG9A 3KUUA 3DXZA 2RAFA 4V0NA 5IM4F 4XYGA 5EZQA 3GFBA 3U4QA 3CNLA 3PEUA 2V9CA 4FMPA 5AHWA 3CINA 2B2NA 2WK1A 3PFNA 2EJBA 4XB6B 1YBVA 3WGKA 4HVLA 1O8BA 5A2GA 2JVKA 1UMDA 5HRUA 3LO8A 5KSYA 3V34A 4L6CA 1DAMA 4EI8A 1X8KA 3AWDA 1DO2A 3B1WA 2X5OA 2J9XB 3G9QA 1GXSB 4TX1A 5DBIA 2Z2ZA 4P6VF 3RUFA 4CQNA 1C1DB 3HDYA 4L75A 2JHAA 1RJDA 3PFKA 5BSUA 3ROXA 4JIMA 5LZ8A 2XJ9A 3AF6A 3QWAA 3RYFA 1RQPA 1RWOA 2H2FA 1ULHA 4IBOA 4M6WA 4NJOA 3VYUB 3N8NA 2D1RA 1KSGA 4AKIA 1K08A 2JH9A 4Z51A 5JASA 4A8JA 4J4BA 1XA4A 4PHCA 4UXIA 4ZOQI 2FOXA 4J1SA 2XXJA 4LOJA 1Z63A 4NJMA 2PWBA 4CF5A 2Q7XA 3LBIA 2F1KA 5E7JA 4CEIA 1XZQA 1KI3A 1A1SA 1V48A 4OSEA 4BBZA 1E1RA 5TY0A 5BN3B 3TLAA 1LXCA 3DC7A 1KC1A 2YVQA 4LF5B 4B82A 4CMBA 2WJJA 4G5FA 4CEHA 4EJFA 3IAM1 5DE3A 2QPLA 2BGMA 2CJWB 2XDWA 4NDZA 2J5QA 3ZZUA 4K8RB 2AQHA 5AQEA 4P4SB 4I4TA 1D5WA 5BVHA 1Z38A 2AN3A 7REQA 1HO3A 5EHNA 3L04A 4GQIA 2FSIA 4M1SA 3EZGA 4BVKA 1NNI1 1OFUA 1Y63A 2WYVA 1VG9B 3T0IA 4AIRA 4G1CA 3AEQA 4IJVA 4V2IA 1XZJA 4KTVE 3RCBA 1C14A 1QIDA 3G1UA 2OBYA 2QQGA 1DELA 2H2GA 4DCPA 4B48A 5DN9A 4ER0A 4B2YA 1WMDA 1VMKA 1W88B 3SDZA 1T8RA 2BIFA 3MNFA 4PQYA 2GPTA 4RSRA 5EWMA 1UBKS 2F3SA 1X70A 4UXJA 2GLTA 3TD9A 4EY7A 4MJ7A 5CDGA 3EF3A 3N2KA 2VQSA 3KD3A 1LI5A 1YZYA 5BXYA 2IOHA 1OWPA 1H3EA 4UTNA 1CZLA 2XE7A 2NSDA 3ZWNA 3QEJA 2F43A 1WBBA 3AFHA 3G2JA 3PENA 4MWZA 3DZHA 1RAGA 3SM9A 4K0RA 5LMZA 2NTEA 4WAUA 2W11A 2WVGA 5EJ5A 1RI4A 2X0DA 4PO1A 3RVMA 1H05A 1O94D 1U11A 2QL9A 3KJIA 2XHZA 4B4DA 5CLFA 1YQEA 4AJ1A 3DYIA 4GE0A 4RHFA 5G0TA 3DDSA 3PDIB 3UV6A 1X42A 4HEHA 3IPLA 3ROTA 3WGTA 3EZ9A 4QQRA 3WIBA 3DEZA 5U4QA 5HTOA 4ER5A 3UH1A 5DNAA 4HUJA 1BJRE 1QVWA 4Q66C 1V5EA 2HK8A 1XQWA 3E4CA 5CM9C 1U28A 3OO0A 3ED5A 3BIFA 4FX2A 2BMVA 1NJ8A 4DA6A 2P67A 1BJTA 2FSVC 5EEGA 5C7OO 5HSGA 4YJ2B 1ORVA 2OV3A 4QICA 2AN9A 1VCMA 2QGNA 2UYQA 3GJQA 3ZY2A 5CYFA 3INYA 5BN5B 3REFA 1ZVVA 4NU5A 1SIOA 2R1UA 2FRDC 3PGJA 2B92A 2P90A 3BIXA 3H7AA 1N2OA 1OA0A 5AESA 1BVRA 1CEQA 2ECQA 4K6GA 1G20B 3N8KA 4U3JB 1WW2A 2X5XA 4O8ZA 4BVGA 2AYXA 4KI0A 5SV2A 1NVVQ 3ZYZA 5ABPA 5LYJF 4MO9A 5SZKB 2DECA 2GRUA 2YQZA 3K8Z