2XZDA

Caspase-3 in complex with an inhibitory darpin-3.4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
141
structure length
140
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQARGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords CASPASE-3
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 140
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xzdA00
3OD5A 3V4LA 5LUAA 4QTYA 4IEFB 2C2ZA 3SIRA 2XYHA 2H48A 3H1PA 3H0EA 1RWWA 2H51A 3H11A 2FP3A 4QU9A 3UO8B 5I9BA 1SC1A 2P2CA 4ZVOA 1F1JA 3NKFA 4LSZA 3SIPA 5IAEA 4EJFA 4PRZA 4N7MA 5IBRA 2HBQA 2CNLA 3R6LA 5H0IA 4N7JA 2QL5A 2H4YA 3D6MA 4QUDA 4NBNA 4D3ZA 3GJRA 2CDRA 3DEJA 3S70A 4QU5A 5IAJA 3V4OA 4NOKA 4ZVSA 5IARA 1RHJA 4FEAA 3RJMA 2QLFA 3DEKA 2QLJA 4QUHA 3V55A 4QU8A 1PYOA 2QL9A 3KJFA 4EHHA 4AWAA 1RWKA 2Y0BA 1RHQA 3R5JA 4EHDA 4HQRA 1IBCA 4QUIA 2Y1LA 5IASA 4EHNA 4DCJA 2XZTA 4JQYA 2AR9A 2H54A 4QTXA 3D6FA 4N6GA 3EDRA 4QUAA 4HVAA 2CNKA 4JB8A 4PS1A 4D3YA 5IANA 2H5JA 4JR2A 2C2KA 2H4WA 4IYRA 5LU8A 1SC4A 3GJSA 2QLBA 3V6LA 1QDUA 1RHRA 1NMSA 4ZVRA 2J30A 2HBZA 2K7ZA 3R6GA 1GQFA 4QU0A 1I4EB 4DCOA 5JFTA 1SHJA 1KMCA 4I1RA 1JXQA 4JQZA 4QUEA 1RE1A 1I4OA 4EHFA 5LU9A 2C1EA 1RHKA 1RHUA 2J32A 1QX3A 1F9EA 3P45A 3UOAB 3V6MA 2XYGA 4N6NA 5I9TA 2DKOA 3PD1A 4EHAA 3NR2A 4NOJA 3E4CA 3D6HA 1RWOA 2HBYA 5IABA 1I51A 4JJEA 1SHLA 4FDLA 4EHLA 2WDPA 4PS0A 4EHKA 3GJQA 3QNWA 4JR0A 4QUGA 2XYPA 2C2OA 3H11B 4JR1A 3H13A 2CNNA 3ITNA 4JJ7A 1RWVA 5K20A 1NW9B 4I1PA 3V3KA 1RHMA 1SC3A 2H65A 5IBCA 5IC6A 3DEHA 4ZVUA 4JJ8A 4ZVPA 3R7BA 4AWBA 1CP3A 1CVRA 1I3OA 3K7EA 4FXOA 5IAKA 4DCPA 1K88A 1RWXA 3PD0A 4N6OA 3IBCA 4NBKA 1GFWA 3KJNA 5IBPA 2J31A 2CJYA 4ZVQA 4HQ0A 1BMQA 2FQQA 4QUBA 2NN3C 2QL7A 1PAUA 4NBLA 3S8EA 3PCXA 3R7SA 3R7NA 4D3XA 1RWPA 2CNOA 3BIJA 4PRYA 2J33A 3EDQA 4NOLA 5IAGA 3R5KA 5LUBA 3DEIA 1NMEA 4QUJA 1K86A 1NMQA 2CJXA 4AW9A 2HBRA 2C2MA 4ZVTA 5IC4A 1QTNA 4M9RA 1RWNA 2XZDA 3P4UA 3NS7A 4QULA 2H5IA 4NOMA 3KJQA 3GJTA 3IBFA 1ICEA 4FGUA 1RWMA 4N5DA 1M72A 2FUNB
chains in the Genus database with same CATH superfamily
3PQ2A 4RGBA 2VSNA 4DRYA 4FFDA 1QFMA 5JR3A 5LL6P 4J43A 3ID6C 2FZKA 4IIBA 1UP6A 2W2XA 4MGZR 1S2MA 2EX0A 3FCXA 2IEBA 2QAGC 4HWRA 1IZ9A 4Q3CA 3OLCX 4Q7QA 1RMTA 2AZ4A 1Z2PX 4J6FA 1PN3A 2P2CA 2BTEA 1QF6A 1URPA 3OZCA 2NZUG 2H4FA 2IE8A 3WG9A 4PRZA 2GZMA 5JY6A 3FZYA 3WGYA 2RKBA 2CFCA 1ABFA 2B2CA 1XZFA 1YJ8A 3EG9B 5FR1A 5LNK6 1TEZA 4JLUA 3GAFA 5DGTA 4CHTA 1C7JA 1N5OX 2SKDA 2PLWA 3E7XA 5T5QA 1TYZA 4GPIB 1Z2CA 3UWSA 2WG0A 4D3DA 3W5IA 1MTOA 2G1JA 5CFLA 2VSYA 5JZBA 5SY6A 1C81A 3DWFA 1RXYA 2FX3A 4W5JA 5EPUA 4JELA 5EP3A 1JF8A 4WBNA 1E9RA 3PNKA 4Z9FA 2WIDA 3ED5A 3U3XA 4CR7A 2CL7X 3GLUA 3IKMB 4J76A 1Q5PA 1RPAA 1XQ6A 3NJ4A 2JD1A 3UAWA 2IPNA 5KYYB 3H9CA 2WV7A 4WUTA 1XTKA 3C6BA 4PHHA 4K9PA 1SC4A 5D00A 1JGTA 2QLBA 3FMVA 4AXBA 5FLKA 4HAOA 3CH6A 1VB3A 5EE9A 2DR3A 2K7ZA 3IERA 1NN3A 3T3PB 1RQNA 1R9MA 3NU1A 4AJ9A 1M1NA 4XIJA 4Z7OB 4IGEA 2V0GA 4OM8A 3IE0A 4RVGA 3N7AA 1PEYA 1TPZA 3KIPA 5AVWA 1XJ0A 4MYRA 4PANA 3CVWA 3DAOA 1Q83A 2XNSA 4TZTA 3FGPA 4JEUA 4WCDA 1HOXA 4ZCPA 4UM8B 4GI3A 4MRRA 2IX9A 2VYQA 1WUKS 4DABA 1ORDA 2W7TA 4EPRA 5KPDA 1P74A 4IFBA 1YNOA 5IDVA 3S2EA 1YQDA 1GNPA 4HUQB 2BWJA 3I23A 2QLMA 3LZDA 3VR3A 1N5DA 2OD2A 2TS1A 4B3JA 3KUKA 4ND2A 2BMEA 3OPYI 5IVHA 1SC3A 2Q5OA 1DAKA 2QYSA 2HZ7A 4DNXA 2VBFA 5AOVA 2BLNA 1ZZEA 3IT0A 2GN6A 3LC0A 3STXA 3VHRA 2A0KA 2Q27A 1NVVR 3FCOA 3M9LA 5SZJA 4GICA 1A77A 4V0MA 5IBPA 1T3SA 1SNYA 4Q93A 1J39A 2VQSA 5A06A 1RYFA 4LY9A 1NYRA 2PLAA 3UCXA 3VNBA 5BPFA 5JMWA 3NDJA 4OIMA 2FLVA 4EJSB 5LXTF 1RQ7A 1TJNA 1R6VA 2GHRA 4IX1A 3TI7A 2UYOA 3UT0A 3UMRA 1NQOA 4BP8A 3TG2A 2X3YA 4R0VA 4N3BA 1UOPA 2YC2C 1ZJZA 2WMDA 3A27A 2O05A 3RT1A 4LDPA 1QP0A 4D4LA 4ZRMA 1T0UA 2HBRA 1JEEA 2Q3JA 4QO8A 1QTNA 4WKGA 5FA8A 1QV7A 3ZH2A 4HVLA 5CFQA 1Z13A 2VAVA 3TEJA 1OI3A 4QOGA 1YJXA 1X87A 2J6HA 2VJOA 3DLAA 3OOJA 3QOFA 4H7KA 4TMVA 1XF1A 3HK2A 5JW6A 4MUIA 4EVIA 1XXHB 3P71T 5FFMA 5JQGF 2G5CA 5G1OA 2QE7D 9LDBA 1LH0A 3KFLA 1HE4A 2LPMA 3VC3A 3BOSA 5I45A 4HH3C 3ZV6A 5EWJB 1UJMA 1Y9ZA 2GUGA 1DT3A 1GYRA 4KQFA 4QNNA 3D5QA 2J48A 2W11A 4YWJA 5H0IA 5IX8A 1AUQA 1JPJA 2YWGA 4E94A 3OFND 3MPOA 1PGNA 5K3BA 1P39A 4KU4A 2E87A 2R84A 2QX9A 2XB4A 2XEDA 1N2OA 2ZKLA 1CRQA 3R09A 4JUCA 1I2MA 5E7IA 3WA6A 1Q7RA 1EXMA 2QL9A 3DDWA 3K94A 3QMWA 1RWKA 3NHYA 3C8UA 1L5SA 3R5JA 4WXEA 1AO3A 4Z9YA 4G41A 1Y1RA 1XZPA 3BTVA 4ZYLA 3CXRA 2XSZA 4F6RA 1SVMA 4RW0A 1RKUA 1FZTA 3WIEA 3RRFA 2YBDA 4TN1A 3FBWA 1WXGA 2XUGA 4HDKB 3K9LA 4AUKA 4YO8A 2A0UA 2C2WA 3ORSA 3W3AA 3NP7A 4RHEA 4WFQA 5BVHA 2IH5A 3COSA 3TQRA 1GQFA 2Z8ZA 1RJEA 5KQSA 4B84A 2LUOA 2O2YA 4I1RA 3ND6A 1R4AA 5AP9A 4TXLA 4DPMA 1CNEA 4AF6A 4AJIA 1WEHA 4D8UA 2VT3A 3S1SA 2BOVA 1SKMA 3K0CA 1J97A 3BJIC 4IOMA 3ZWPA 2I33A 5IEJA 3QI2A 1BCSB 2AMLA 3BMOB 1VLJA 2G6TA 1DBSA 2JZNA 3JU3A 3OZBA 3BDVA 5L3RA 3VOSA 2Z6AA 1GT6A 1G5FA 1WXEA 5LBUA 5D5PA 2BE9A 3AVWA 1SBZA 3CONA 2ENUA 4JYBA 3VSAA 2FSUA 3L7YA 2HSEA 2Q5HA 3EG9A 3S3TA 1YCDA 1N6NA 3M6VA 4JC4A 2W2KB 3C5VA 5BSRA 4UOEA 3SYTA 3HS3A 3E8SA 1L7XA 1QHHA 2FX2A 4NBWA 3NVMB 3SFZA 1QU2A 2IU3A 2CT8A 1JR6A 3ZGOA 3AUUA 2X22A 1E1LA 1Z25A 2OBLA 3ZDQA 4AF8A 2I2WA 4B6SA 1F2UB 3WB9A 1WSWA 1I0IA 3GIDA 4NLLA 1GFWA 4FX5A 4LWQA 4OMFG 3LG2A 2PGNA 3IA2A 3PC8A 3IQDB 4CDNA 4DA8A 3LY8A 4JYMA 3KHKA 3QYJA 3ED1A 1MTZA 1Y6QA 2J5RA 1U28C 3PCXA 1HRDA 1HRKA 2I6GA 4DIUA 821PA 5HA5A 5L3QB 2I4MA 1AUPA 2R8XA 3OHSX 5HJ5A 4MW1A 3RVRA 3JR7A 1L8XA 3R5SA 3E5NA 4LYGA 3T7DA 4HLCA 3NDBB 5TQ2B 4N8SA 1U8FO 2O7QA 3P0EA 3MSXA 3P0FA 5J1TB 4BJ6A 4OAPA 1Z8HA 4UVIA 5CFZA 3FMIA 1JVNA 2J45A 2ZCUA 3F2IA 4EGSA 4WXHA 1DELA 4G26A 1XEFA 1ZO8A 2GAAA 2GCPA 2OO5A 4MUNA 1ZUIA 4RJJA 4X6XA 4F21A 1IRXA 1VBKA 2ZUVA 3C8ZA 3GHHA 4IEFB 2WJHA 4E33A 2NP7A 1DFHA 3OFJA 1UKZA 1ZEJA 3UJPA 3OTOB 2D4HA 2QMHA 4PNPA 2OG2A 3Q2OA 2H51A 4PZPA 5JEDA 4B32A 2FW8A 2ANBA 3EARA 3V7UA 4J94A 1HDEA 5AW7A 5D86A 1AQJA 3VKWA 1ISIA 2LRHA 2PSHA 3F3MA 2GPNA 1XZDA 1F3OA 4RYDA 1T4DA 4URYR 3P2YA 5AKZA 1C41A 2FR0A 3L8EA 3KQKA 1XZGA 4LJ9A 2I3AA 3WLOA 3PYMA 4R8VA 2BRUA 3CKYA 5HCIA 1MOSA 1WDTA 3DG9A 4M4SA 5FTNA 3PC2A 1TF2A 3PPVA 3UMFA 3T1VA 5JSFA 4Q9AA 4YMHA 5ADVA 2PBZA 2IOFA 3Q5GA 4X71A 3L7AA 4XVRA 2A4MA 3ZHRA 2B8JA 2DY0A 1XRLA 3PGKA 5IP5A 2B0CA 2W4IA 1VJTA 2GZAA 2RH5A 3A3OA 4Q3BA 3RB8A 3RT7A 4FYXA 4LDAA 1UFVA 2EX1A 1YZLA 1GPBA 3HC7A 1JSXA 4HC4A 4LRYA 2Z6VA 3SZUA 4HDNA 2HF2A 4GKVA 3GLGB 3D8TA 1HNWB 1GAJA 2ZI6A 1CRPA 2EZ9A 4FKMA 3HTXA 3RRNA 3PXXA 4A6XA 3DMPA 5LZ8A 1NOJA 3VC2A 2VEOA 1I3LA 3M33A 4OATA 1RJWA 2F43A 2X40A 4P0TA 3WIVA 1XEWY 2QK4A 3OT1B 3RTEA 4IQ4A 5J9FA 1WKBA 4V1CI 4PG8A 2C31A 3LQ1A 3ZCRA 1MJFA 3SN6A 1U0JA 2VA9A 2FWPA 5BV7A 1XVAA 2R62A 2DMRA 2QZJA 5EWJA 5LJIA 3IULA 1RRPA 2GBCA 2P3LA 1A8UA 5DMXA 1MB3A 2HH9A 2NTEA 3JRNA 4D8XA 4M38A 2C9MA 2QD3A 2EGGA 3H5IA 4X7RA 1OWOA 3W5JA 3MERA 3N74A 2ZUTA 5I47A 4JLBA 1QBKC 1GXSB 1UKBA 3UHJA 3ZNQA 4CL3A 4EKIA 4I4IA 5GZ1A 4YCLA 4PFJA 3EZFA 4OI2A 1CVRA 3EVCA 5LDHA 2JF0A 4FYYA 3T5CA 3GROA 3RU2A 1Y3FE 2QGFA 2HFJA 5E6SB 3QEOA 3OIDA 2ZSKA 1YBVA 1QIEA 3EW9A 5JSYA 2OECA 1HMYA 3TM4A 3IMKA 5FV4A 4ZTZB 4G0YA 2QD4A 1K8XB 2IHTA 4IPTA 3TW6A 4HDKA 4LVNA 2EOAA 4OJTA 2XMPA 3REOA 3RS8A 1IQ0A 1K4KA 2PNJA 2IEYA 3H5LA 3U3MA 1YZTA 3K9WA 1OD6A 5IH3A 4P38A 5EGSA 3K5PA 1YS6A 2VT6A 2DWOA 2H0QA 2G9UA 3NJRA 5DTQA 2JD0A 4CF7A 1NY5A 3WOVA 3EWSA 3G2JA 4YP0A 2GEBA 2D5IA 3EMBA 3OKPA 1YIDA 5EQFA 4Y9SA 1EZ4A 1TXGA 4Q3KA 4Q9DA 2PTHA 2X6QA 2X0NA 5KOIA 5FHQA 1K9SA 1ZOSA 4YECA 1BCSA 1LPNA 1M0WA 5JSQA 4PWYA 4D25A 1WMAA 3BD9A 1U3UA 4LVOA 2CL5A 4MLPA 3UW3A 1DKQA 4YRMA 2ZZMA 3IEXA 1WL8A 4Q4JB 1V8PA 3T3MB 2YXPX 3O8OA 1KFKB 2W2KA 3PCTA 3NKVA 3X44A 5BV8A 1R0CA 3F5DA 5EJ6A 5CXXA 2Z5LA 4M86A 1KI6B 1MHPA 3CUEF 1C9EA 3KC2A 3SFTA 1MC8A 1RVV1 5CK5A 4FHCA 1XMIA 3KPUA 1RT9A 3LO5A 3MW8A 1F2UA 1NV8A 4G6ZA 4ALKA 3P2MA 2K4MA 4FBMA 4CM9D 5HIKA 1P2DA 1XDZA 3RSFA 3F6SA 3ZV3A 4W1QA 2JIBA 3KV3O 3FW1A 1UC5B 1Z07A 3CZAA 3VTKA 4PONA 1ZITA 4P54A 4I4CA 3L0PA 1T8WA 5CCDA 3IPXA 4L16A 4QUIA 3B1YA 3BH7A 1ZSYA 5KTSA 3D0OA 1JAHA 2X86A 1IG0A 4PAWA 1C9JA 3OZWA 2QM0A 4TQ9A 4YAJA 3KE8A 1EM8B 1YBHA 3D3EA 3IT2A 5TQ2A 2ZRKA 4F5YA 5KCZA 3AF5A 4BE9A 9ABPA 3ITDA 2ESRA 3O4IA 3JQ7B 4M9UA 2NG1A 4CG2A 2C2KA 3HCBA 4RXTA 1XKXA 3FLBA 4GBJA 4ETMA 4ARZB 3NT2A 1BMFA 4S35A 5AI0A 1F12A 4OHFA 3R75A 3RYFA 1ENZA 1CVIA 2BFAA 1SU6A 3Q3VA 3HB0A 4IZHA 3WYFA 4Z1OA 3DH0A 1DEHA 3ESDA 4MR7A 3NHWA 4ZMRA 4ZT2A 2Z2XA 5B6IA 1ISGA 3LNCA 3RNLA 4B3FX 5EHGA 1MIOB 4BFTA 3JYOA 3DM9B 1QX3A 1C9NA 3JWIA 4GQBA 4E30A 1PNVA 1Y4DE 4OB8A 2R2GA 3EIQA 3WP0A 4C21A 2VHZA 3CTPA 1G1MA 3M49A 3N9IA 2XB2A 3EPHA 2Y67A 4KAJA 3ZX5A 2CYAA 1WF6A 3O91A 4TMWA 1SQ6A 2ZAGA 2BSQA 1Z0SA 2D62A 1XCBA 2R8BA 3OU7A 4IHJF 4C88A 1P4GA 2W4MA 3V97A 2O2CA 1BHQ1 1SXJD 2OCPA 4BX2A 1UMKA 4I8DA 1XEAA 1T4MA 4DIOA 4EF4A 4D0SA 1OASA 4RPCA 5DWQA 2JCXA 3ZCPA 4N48A 3LW7A 5L4LA 5J4HA 3AXSA 3H75A 3E1GA 1QYXA 2O4CA 3WK9A 1KI8A 1CP3A 5C1PA 4M60A 2CW5A 4BNJA 1ODLA 3AVPA 3BIFA 1N0UA 4CM8B 2FP4B 2H52A 1Q6ZA 3CKLA 2Q0SA 1HNXB 2FUKA 1VSQA 1LK5A 1EP1B 4NFYA 3ZD6A 2X8JB 1JJFA 4BWVA 2CYCA 1Y8QB 2BPOA 1N2CE 4YT2A 3QFHA 3L0ZA 1QH8A 2LE0A 1D6NA 4UHDA 4GI5A 1MJGA 3S2UA 1UBFA 3BFVA 4PX9A 4Y9RA 3RUEA 3WZ2A 4B4WA 4MO2A 3RVJA 3TQCA 2JLRA 2PZAA 3DHYA 4HQOA 4E0BA 3ESCA 3K96A 1DZ3A 1AS2A 1LWOA 5IN5A 2P7IA 3O8DA 2FEAA 2IPXA 5IC4A 2WHRA 3ANXA 5BW6B 4FN5A 1GZ3A 3RAJA 4BUJA 5HOQA 1BVYF 2ECQA 3JYLA 3STYA 5BNWA 2ZPTX 3DYVA 3ESAA 4XPIB 4AG3A 5H8WA 2XMCA 1N3YA 3HHEA 4P4SA 1NNUA 3WOHA 1K6MA 4WXPA 5ULLA 3BZWA 1DT5A 3B20A 4P7KA 2YVQA 1KZ6A 5DSTA 2PS0A 3SIRA 3FOFC 5FAKA 3AVOA 4QE3A 3SX4A 2PU7A 3R4CA 3G8DA 1NBOA 3ASYA 4NQZA 5EG5A 1XVTA 3LX8A 3WNDA 3P5SA 2BMFA 3TNJA 3FWHA 3ZWMA 2X9QA 3N2KA 3ESXA 1NMYA 4F04A 1EFAA 1PO7A 2FXIA 4BLRA 2AJLI 5JYEA 1JMVA 4YRTA 1T1JA 4I55F 2ZE8A 4W5RA 4WPGA 1IQRA 3KKPA 3QUTA 4XDHA 5KDLA 2I2AA 3EMKA 3L6UA 4FR5A 4WASA 1DTEA 1Y7LA 2QY9A 5E6SA 2E4YA 4FILA 4BNWA 4YCMA 5HRAA 1JHYA 1EE1A 2CMFA 2RJOA 2VS1A 1SFRA 3CRQA 3IAM6 3QM1A 4PR0A 3B51X 3N53A 4JJ6A 4W9RA 5LC1A 5EKXA 3HXQA 1XDGA 3SKVA 4BNKA 5J43A 4JBLA 4FEYA 4EG4A 3GGPA 1P0IA 3R0QA 4K6GA 4QOSA 1MO5A 4HRAA 5K3SA 4D1YA 5C1DA 2JCYA 3A0UA 4X85A 4BQSA 2O8DB 5EJ8A 4BLWA 2NU8B 2QV0A 4A9AA 1PE0A 1YZHA 2OV8A 3ZWKA 1JMYA 1S1MA 2OYSA 3MTDA 1T5HX 3L6RA 2JW5A 3HFRA 3QVSA 2QJTA 1E89A 3RCBA 3DHEA 3S68A 4O1MA 1ECBA 1Z4MA 3LSYA 2BP7B 3C3JA 3OKCA 3PQCA 1EXDA 1EFDN 3REQB 4ZWNA 4X64B 1PWHA 1RHUA 1SKYE 1LNQA 1VP9A 3I2HA 4WZBE 3TQHA 2IK8A 1Z5WA 1E3DA 1SZDA 2PANA 4HPJB 2QE7A 1FC0A 4PLGA 4Y2RA 5BWNA 1NJ8A 3JWGA 2G77B 3PDUA 4OMCA 4ZPJA 5FFFA 3QFSA 3VZRA 3QBDA 5REQB 3U60B 5G02A 1YU6A 1UFOA 1D2GA 2ZRIA 4M1SA 4WDQA 4TS4A 5ALXA 1JKJB 2PN1A 1KI6A 2RHRA 2VK2A 2YHIB 1QOZA 3V8MA 2Q49A 1VHTA 1WF3A 3K8YA 3RW9A 1GTVA 4U2EA 4LYHA 2XYVA 4YALA 3IMFA 3OFNA 2GB4A 4AY6A 1M6HA 3FSGD 3G68A 3BH0A 1EQ2A 3RSOA 4H1UA 2IKQA 5CLJA 1X1AA 4QDTA 4Q24A 2FXVA 4MJXA 4WRRA 5FBRB 3QY9A 1K6JA 3BMNB 4EYQA 3MWJA 1DRJA 3MWYW 2WZQA 1R8SA 2PX3A 1XDDA 3RTAA 5ABPA 2HV8A 2WJ3A 2BR5A 1QO9A 1YRQA 2WJPA 3K0CC 4LJAA 3AFMA 5CD9A 2XQFA 1ZJ4A 2VP3A 4X54A 4JA0A 3AB3A 3GBVA 4GRIA 1SVWA 3JQ7A 1R18A 1RLUA 3V42A 2C1XA 3CNOA 1EB8A 2SICE 4ARZA 3UHAA 1HT0A 1AK1A 1YR9A 4LYEA 4KQMA 1X3SA 5GPBA 3RFCA 1E6MA 4XYLA 3E84A 2RHLA 1DLIA 1L4HA 2O57A 2WA2A 2XW6A 1DOHA 4GQAA 4ZVTA 1L5NA 1P5FA 4ID9A 3VAAA 5ED4A 3QITA 5AIAA 3BXOA 1C3EA 1MIOA 3CT6A 2F59A 2D2EA 3UM9A 3C3AA 4WZAA 1XCJA 4FE4A 4YJ3B 4G8CA 4GZ6A 3UK0A 1RWMA 2HWKA 2LCFA 4OSOA 2XBMA 4PG7A 5FOSA 3UZUA 1U9YA 1YC5A 3OESA 4LZJA 4BMPB 1OE0A 2E5WA 2VA8A 2ID8A 4Q3DA 5A9TA 4CN9A 4IJWA 4WKNA 2EEZA 2C8JA 5IXSA 1WXQA 1N77A 1E0AA 3GJXC 5HCNA 3FD8A 4O4IA 3QTBA 4IQ0A 4EF5A 1A72A 4RIEA 3Q8KA 1XMQB 3N2EA 1L7MA 1ZH8A 2CLOB 3R3UA 2WU3A 3BA6A 3HB5X 5DRYA 1MRSA 1G8SA 4QO7A 3I3SR 1U1IA 1IOZA 5EAIA 3N2GB 4Q1BA 4TVBA 5ER6A 3Q41A 4LC9A 4UEWA 1JG1A 1T0BA 2FMTA 1VE6A 6LDHA 2Y9MB 1IJKA 3VOAA 1T0IA 4KX5A 1K5HA 1ZMTA 2FP4A 2VSQA 4UEQA 4KR0A 5AM1A 5T4FA 3SR3A 2GN0A 4EBFA 4OGWA 4EP1A 4LHYA 2RGXA 2WSBA 3L8ZA 2X8JA 5BOSB 1K8QA 5AT1A 5F1PA 5C1BA 4RA9A 3TUZC 1FTGA 4YCNA 2OO5C 5FTJA 4H59A 5A6SB 1KEKA 1LBQA 3CPHA 4JX8A 3K1AB 5IASA 5EZYF 1E9FA 1A76A 1F0KA 3CH5A 4BP1A 1OZFA 3CZ4A 1ADCA 2B83A 1OB2A 1WXXA 1Z29A 1MX1A 2IOYA 2NSLA 4MRVA 4B9EA 2UYHA 3AETB 1R0LA 4TTVA 5KQPA 1NLFA 3BXZA 1VE5A 2XNDD 4EF6A 3W1VA 1NBHA 1RU3A 3QLTA 2QWXA 4GT1A 4JVSB 4KGVA 2YFYA 1ILEA 3CWQA 1U2ZA 3VC7A 1CP2A 3EULA 4HGQA 4P80A 4UBIA 5A5DA 3SEFA 2FVYA 3NALA 3TPCA 3VZCA 3PQEA 4HXEB 3FDIA 4REMA 3LHIA 2FEXA 4FJ1A 1NUQA 1GZSA 4LXQA 4EG3A 5LU9A 2IDMA 1V9SA 1F4LA 1UBOS 2H1WA 2IIBA 3EUFA 4RDCA 5JBNA 1ONNA 2RC6A 2VJDA 1BKDR 3RF7A 3C4JA 2C03A 5CBPB 1O0SA 3R0ZA 1GUZA 1RAIA 3RSCA 4EJSC 1AGPA 4FZJA 1FPQA 5CT8A 2C4TA 4MYDA 2PMKA 3AHEA 5BMVB 4BQFA 5F21A 2O3SA 5C4GB 3WSTA 4BN0A 1T3TA 4ZN6A 4PQFA 3WTCA 5DPMA 1GUAA 3M4NA 2GCEA 2QUBA 4YMTA 1JYSA 2VVTA 1JB9A 3G59A 3EF1A 3QK7A 1O0BA 1ZNYA 4PPNA 1G5IA 3W8RA 2QG6A 3P9YA 4RIFA 5DBGA 2GF2A 2QQ5A 3IJ5A 2ZJ4A 4W5WA 3ZWXA 5BWLA 4QM6A 2YV2A 2IXTA 2GBGA 5AK5A 1YJCA 2RI1A 4U9UA 3HGQA 2PUTA 3DBLB 4GPD1 1M6VB 4J2HA 2IV7A 1SHUX 4AYWA 4D46A 5K0SA 1FMFA 4JP2A 4C0KA 4QIHA 2DFLA 4MVJE 3AKCA 4ZEWA 3BXEA 2C9CA 3PE6A 5TMPA 3MA0A 1RIFA 1U7DA 4HH4A 2D13A 2P7HA 1PGQA 4NDNE 4RQUA 2IYLD 1CU1A 3MGGA 3VPGA 1G8YA 1RACA 4U7PB 3HKBB 1G18A 1KP9A 1SPXA 1DIRA 4DR7B 4XQCA 2KS6A 2BP7A 3ZKAA 4E2FA 1VPDA 1MKYA 1R0KA 3V1MA 4F8JA 4O5AA 5E1OA 1RE0A 1VE7A 3A8TA 1RYZA 2HY7A 2YXEA 4C3UA 1O57A 4O2RA 3AUFA 3WYGA 3WA7A 1Y6RA 1KYIA 3N8KA 4CR8A 2DWUA 3AILA 4M9XA 3O1LA 1FA9A 4NDAA 5REQA 1F14A 2HHHB 5KQLA 3JZAA 1V16B 1JKJA 2BM0A 4I5IA 2YHIA 4Q1EA 5F52A 2BKVA 3VHXA 5KOJB 4KQJA 1PL0A 1VXRA 1YACA 3MLBA 1PTKA 4LMPA 1GAEO 1BOOA 2LDXA 5DW0A 2OC4A 3DCIA 1QK5A 1QYIA 4CFSA 3OX1A 4MZXA 3ZW8A 3CHYA 3BSSA 4URUR 4FQ8A 1R0RE 2HMSA 4W5OA 1Z2AA 4G9BA 4ILEA 3BMNA 3WJ2A 3AINA 3DDCA 1WZNA 3FZQA 2QE6A 1TMOA 1X80B 3A70A 3VZDA 1TU0A 3DTYA 3HKEA 3CNQS 3ZI0A 3E61A 4LGVA 3RNOA 1N7GA 3VTAA 3GV0A 4Q34A 7ABPA 1PQ4A 1D4AA 3BGDA 4NCAA 1VBNA 2LKDA 1AN0A 2HF7A 3P0IA 4M99A 1TADA 5BSMA 1YJQA 3DKKA 4MS3B 1CUWA 4OUDA 2M6RA 5EWLA 1E0JA 4MIKA 5FNVB 5B7GA 4HEJA 4V0OA 1I1HA 1I13A 1Y89A 1R15A 2AJCA 2W43A 2VJCA 3IUQA 4IUDS 5AQEA 3ZTTA 3GLFB 4CKWB 3X1MA 3GGCA 5F23A 2IS6A 2D2XA 3R5FA 1PFKA 1A9XB 2QRJA 1ZW1A 3CO5A 3S1AB 2XCOA 4GX2A 3UPUA 4CLOA 1ISSA 1G4AE 3LGSA 1UJ6A 3FXAA 3NWOA 3RV4A 1BRTA 2XUPA 5KVCA 1KYYA 3LAWA 2G5GX 4DSOA 1HQYE 3NETA 2D8MA 1O6CA 4BB0A 3HCFA 3NC1C 1TX4B 5BYBA 4DBLE 4HNTA 4H6WA 4TKVA 4AJEA 5EJ2A 1MF7A 4NYIQ 4A8HA 3QG1A 1OFHA 3CEHA 1PX2A 2FQYA 2A0YA 3AG6A 3D3KA 3FCSB 5KVSA 3AXTA 4Y2TA 1CF9A 3HBFA 2EKDA 2BBSA 2FMFA 4P5EA 2HJSA 3UJDA 2JKVA 2IODA 1Z8DA 2NWQA 5DOZA 2ZE6A 1U9IA 1KJQA 1EJBA 1HPLA 2VJNA 4JY7A 4LNUB 4UM7A 3MJFA 5AHWA 5FWXB 4I1PA 2OOKA 1KJ9A 1XTZA 3H4MA 4YDQA 1NUAA 1JHQA 2YV3A 1UDBA 1Y1QA 1I01A 5EGNA 1CUJA 2HA7A 2DT5A 1UPUA 5I48A 5IZCA 2LW7A 3FHLA 1L5OA 4PZDA 1JL3A 3ABZA 3NP9A 5CT5A 4CM9A 3A9SA 1NLMA 1CY0A 4QLBA 5TDHA 2HJHA 2PMBA 3JQBA 4N8EA 2VHWA 3W1EA 3K1AA 4KI7A 4IZ6A 3M6WA 2PNFA 4NI5A 4JXKA 4IVRA 4JLAA 3NIFB 4BNLA 3UHOA 1Z06A 1BTOA 4U3JB 2C1ZA 1M5TA 3QXGA 3R5XA 1NJSA 2YINC 3E3LA 4MARA 1BXGB 1UFQA 4EL0A 3TSYA 1CXZA 4EUNA 3E2PA 2IHNA 1S9DA 1DI0A 4MRMA 1I4TD 2FMHA 2Z83A 1JW9B 2X42A 2AIRA 3CUYA 1DG3A 3PHIA 4IQ8A 4IV0A 2JLYA 2FE4A 2F3RA 2LKCA 3NCTA 1N2SA 4G5HA 5GV8A 3O0TA 2A9PA 3CZQA 4YREA 3LBFA 4AXXA 4R9SA 2FW7A 3N58A 1HETA 3O4RA 1YDHA 4FYHA 4NJEB 2BUBA 2NYAA 3A6DA 2VP6A 2YZGA 3IP8A 2NACA 4HNSA 1R4ZA 3W2GA 1WBJB 4LY3A 5L53A 2DB3A 5ICSA 4N5DA 1C3JA 5CBPA 3NHFA 2VZ8A 2IHYA 3UVEA 4ZU6X 4MUJA 4BNFA 1JG7A 4MW9A 2P2YA 1CHDA 2A8YA 4RTLA 1LDEA 5KSYA 3Q72A 2EBHX 5IZ4A 1GITA 4XD7D 3AVQA 5I7FA 1Z3CA 3K6SB 4PIPA 5B1DA 2ZFUA 5I7EA 4P32A 1VMIA 1SXJA 3B9RA 3I34X 3DA8A 1IN1A 4N0MA 2J3JA 5EJGA 1Z0IA 3G0OA 1D8TA 4B0PA 2LP4Y 3TBKA 2AJBA 3I9V6 5SICE 1LVUA 2K2QB 3A31A 3W2IA 3ZOKA 1ZNQO 4DBZA 2R8ZA 1ZL2A 5LQAA 2H06A 3GZNA 3PE3A 1TQ6A 4R3WA 4E88A 1G3IA 3KOXA 4DYVA 4E14A 4DMRA 1NP3A 3MD0A 2JATA 4A0HA 1FNSA 3BFPA 4O2BA 3QMPA 4YRBA 1V8FA 2WINI 2CUTA 1C8KA 4ESHA 3D8RA 3K35A 1XTVA 1NVUQ 4CKEB 4MJ3A 5JDCC 2B4RO 5IF3A 1U65A 1Q20A 3MS7A 4UAJA 4IJKA 5DT9A 2E1PA 2VH5R 1GUFA 3PDHA 3LOPA 3HKBA 1RYYA 3W04A 2IITA 2HGSA 3GUVA 3I04M 5HF6A 5C18A 1N5IA 5I7UA 4GP7A 1S2OA 2GN2A 4LMBA 2JVKA 4BU0A 3HEMA 1JU4A 2FPKA 3CINA 4EA6A 5EYPA 5FEUA 1IPFA 1C1HA 4FNAA 4P81A 5BR8B 1XJWA 1NXXA 3B70A 3SYKA 3WJAA 1F8GA 2QF7A 1Q1BA 2ZATA 3EG5A 2YVKA 1V43A 1DQSA 3K2IA 4I14A 3UYKA 3WWCA 1UKAA 4I5FA 3HCRA 5KOJA 4IMRA 4PG5A 1NFQA 2O1SA 3AU8A 5JAUA 2V3CC 3SSAA 1N36B 3KHUA 2XPCA 5DASA 4TYYA 4M6WB 2WT9A 4TKUB 3INYA 4UHJA 4LDJA 1W36B 3KAPA 2Q1WA 4C04A 1NIPA 1RAEA 3FDZB 1VKOA 1IH8A 1FIUA 2NZWA 3C39A 4B34A 4DM4A 4XCXA 1ZUHA 1X15A 1EWVA 2NADA 1HDZA 2R751 5HPYB 1Z6PA 3DC2A 1DDGA 5K0EA 4OU4A 1YKSA 3FTPA 3JQFC 3PWZA 3SM9A 3ND5A 3WYDA 5ISMA 4QUBA 3K73O 3RHZA 1V5IA 1VLZA 1OFUA 1Z0KA 3LPLA 4YWHA 4PBTA 4BGUA 1GZ5A 4BQPA 1PR6A 2MJLA 4TRNA 3GLFA 2NTNA 4RLHA 3KZNA 3VA7A 2R1VB 1OXBB 4RFLA 1THGA 3O4JA 1GPNA 3SAJA 3S1AA 3TLGA 4FI3F 4YTEA 1RRMA 5D6NA 2JH9A 5FT9A 4EI2A 4D9BA 2CXXA 5IG2A 4FHGA 2JJ2D 4PZ0A 4U0JA 1U0RA 5DCYA 1P19A 1EK6A 3UMJA 3NHKA 2J59A 2OSVA 3AESA 3G49A 3KOYA 3KQQA 4RVDA 3GFTA 3WX0A 4BB9A 4QU5A 1Q7TA 4B7ZA 5EA2A 1RC8A 3L7LA 4KK4A 4U2FA 1A82A 1NA5A 1GKKA 1H5QA 4K9NA 2EKLA 2P9FA 4MDYA 1V6CA 4DT1A 1YO6A 2X1VA 2FP3A 4AY4A 3KVNA 5AVTA 3DE5X 1MDBA 2V98A 4E6EA 4LC0A 4OL9A 2HU2A 2VBIA 3WDKA 1GG9A 1USGA 5DLEA 4CIVA 3HB1A 1H9CA 2B3DA 3LXMA 4GKAA 4PN7A 4CCSA 3KVVA 4BPBA 4HMPA 2AB0A 1JSZA 1QJCA 1IOVA 3JV7A 1M2NA 5LQUA 1CNMA 2GWRA 3FSGA 3VRHA 1JHZA 2OT3B 4HQLA 2VBCA 5IVIA 2VHVA 2VKQA 3MN1A 3U62A 3UMCA 4N03A 4TV8F 4RSGA 3U16A 1Z6ZA 3R9XB 1DBVO 1GZ7A 4BLVA 1DVRA 1GGFA 1YA4A 1ZI6A 4MW4A 1W5EA 3BE4A 3A4VA 4OQZA 4F5ZA 1E79D 4DC1A 3I2GA 4KLAA 4QOIA 5K45A 1BXGA 2JEYA 1Q15A 1SU4A 3FMGA 1P5HA 3K9QO 2G1KA 2VQ3A 2B98A 3HSSA 3NEAA 5KSOA 4HZIA 2O2EA 1VBMA 2OCYC 1EFUA 2R44A 4HVAA 1XCPA 1SCIA 1XK7A 3A6KA 4KH1A 3GJ4A 1CRLA 4QEKA 1Y3BE 4PHGA 3R1IA 2EFHB 1PT7A 3CUTA 3KVYA 4MGIR 1FSZA 5AKEA 5U4XA 5KTTA 5EINA 4JLJA 4EELA 1QGUB 1JQEA 2A14A 1LPPA 5F7JA 4FC6A 2NTYC 5HZMA 1SVOA 2QX7A 1F0PA 5ENVA 2OLEA 3PLRA 5AK6A 4CGYA 5TJHA 4F85A 2AX4A 5A5FA 1AGNA 1DC6A 3IPYA 2OM2A 5C52B 3BB3A 3QEJA 3Q6MA 4HN9A 4INZA 5HEKA 5ITWA 1WB5A 1GM5A 3ADBA 3IA7A 3ZI7A 2VHQA 3SLGA 2Z1NA 3FYDA 3QXSA 5DYWA 1XZAA 4G8JA 5IC5A 3ZHYA 2NUPB 3O7WA 3AV0B 3V34A 1JDVA 1XU4A 4Y2QA 4ARBA 1E9CA 1YBFA 1DC5A 2AQ8A 3PGXA 1LF5A 2FUEA 2P5YA 5DU2A 1YCHA 1VL6A 4B75A 3DHWC 1IN5A 4RF5A 3AZQA 3IP6A 1I6KA 2HF8A 2C7VA 3CUWA 2PAAA 1KAGA 2JS7A 1FUEA 2CYBA 1NG1A 3DOFA 4PZAA 2EJVA 4KAAA 4CYMA 4DQ0A 1GAQA 3NW9A 2IHUA 3RV3A 4EZEA 3NIWA 3R7DA 3NAMA 4CKEA 5JD6A 4BNHA 3CISA 3JD2A 4KH0A 5JNUA 1LZKA 1PAUA 4BO2A 2SBTA 2ICAA 2Z9CA 3AL2A 2OCAA 4U63A 5KX5F 1H66A 1ZZGA 3ENZA 3SG0A 3UICA 2EEPA 3DF9A 3PLNA 2QXTA 3JQ8B 3S2FA 3AB8A 3W9SA 1DWUA 2YN2A 1HDOA 1NUSA 3N0VA 4WDRA 5FOWA 3MJRA 3SXUB 3TIVA 3RUIA 2UDPA 4Z86A 3WLTA 4BX8A 1MAAA 2DFVA 2XNDA 1P73A 4R3NA 2PZKA 1R16A 3JD3A 3BILA 3MTBA 3KZXA 2A3RA 1WB4A 2C7GA 4PSCA 3EEYA 4EG1A 3WQRA 2F17A 4ALMA 3QNMA 1LRLA 3DMNA 3GJTA 1R64A 5TMBA 2DSNA 1CRZA 1D2CA 5F1OA 1Q0HA 1DG1G 3AGQA 2JLZA 4TWRA 2OO3A 3KSBC 4QOEA 4WKOA 1LPBB 3K0SA 1F2DA 2AMFA 4POAA 2XYHA 4X60A 5FLEX 4H6VA 1HFJA 5F1KA 1GPAA 1LX7A 1XJQA 4OQPA 1QIHA 1RCFA 2WPDD 3O9VA 3PXCX 3ETLA 1V4VA 1KDPA 1DFGA 4F06A 4XSGA 2W4QA 5I9IA 1E3TA 4QBIA 1JHUA 3U5TA 3VDXA 3UGKA 4JLMA 2L18A 4KHZA 4ZU3A 2FSVA 4CUZA 1UPFA 2JJQA 2AOXA 2RHGB 3PEEA 4J0FA 3KT6A 5BUSA 3IJRA 3ZVKA 1DFIA 2CCJA 2H7XA 4YEDA 5G0SA 4EARA 4EHHA 1ZK2A 4CQJA 1VE1A 1P0MA 3AZOA 3PUIA 4XRGA 4ZCRA 2QX8A 1M7GA 3KYBA 4OQDA 5IYZA 2FLWA 4CTMA 3MZ0A 5KEIA 4CTNA 4B4VA 1LKZA 4IIJF 1RD4A 4GOND 5HQTA 1IZ7A 3HYTA 3UJHA 2UKDA 1PS9A 2ET6A 5I7SA 1VI5A 2VUIB 3ODGA 1FYWA 2C4VA 4EUKA 5CD1A 1JFTA 1NX9A 3OIGA 4QUAA 4MPTA 3TX6A 2RGDA 2AFHE 5BW5A 1KL7A 4MYHA 2FPWA 2P9GA 4KR2A 4OXNA 2WF7A 1LPMA 4X0EA 1QLWA 2RGBA 3D3WB 3QE0A 2V9PA 2QMYA 3WMFA 4M9CA 4BVHA 4MB2A 3WLIA 3B9QA 4NL4H 3X2FA 2G09A 2OCKA 1HE3A 1NNLA 1C3VA 1U02A 4LOIA 3A4YA 4ND4A 4BNXA 5JTUA 2WU4A 5HOEA 1VIVA 2XUJA 3HJNA 1KQGA 2I34A 3H2SA 4RPIA 2FPGB 4M3NA 3JVVA 1J8YF 1T9ZA 3GEPA 1ORHA 3GDWA 1G2PA 7MDHA 1NVBA 1NF2A 3IAFA 2Q4TA 3LCVB 4EKEA 2CE2X 2DBRA 2XKJE 3IV7A 4J0CA 3AFIA 4Z4IA 3M6FA 5JVDB 4DJJA 2GMWA 1QP4A 3TZBA 4XDZA 4WEQA 5JDIA 2NUTB 5CAEB 1L4LA 3OJFA 4AP6A 2IF0A 4GUDA 2QGZA 4CF6A 3ANYB 1B6SA 3CGGA 5DIFA 4B43A 4DLTA 1DV1A 3L49A 3OCWA 1JT9A 3TW0A 1I3OA 1E5TA 2CXRA 1Z16A 5EJ9A 4XLLA 4WAUA 1GNLA 3RFVA 2VK8A 4L28A 5BV1A 2P2ZA 1F6WA 3Q0IA 1JAZA 4DF3A 5KNBH 2WG1A 2X5KO 1TZMA 1NUPA 3EUEA 4R40A 3ZHUA 2R85A 4Q3EA 5I8ZA 2OQRA 1Q6YA 1UOOA 2N0SA 3BG5A 1T13A 3W7AA 4RLFA 4LPSA 2HYIC 5J2TF 2P78A 3BWEA 3LPMA 2RK6A 3HVKA 4R01A 4NOLA 2I76A 4TZKA 3R9IA 4RZHA 1P0QA 3IELA 3W5SA 1FFWA 5MGBA 3DEIA 1XP8A 4HI0E 1SRRA 3C3MA 4ZMBA 4LBZA 4Z2YA 2IW1A 3TTWA 4PLWA 2TMKA 2J67A 3ESYA 3AR9A 4QXAA 1HZZA 3P19A 3PVZA 3NPAA 4WECA 4AF7A 4MIOA 3ZGYA 4CDRA 1Y7HA 4LZNA 4GWLA 1ADJA 2J3QA 3PA8A 3NVKI 3GGJA 1KA9H 2AYZA 1L4GA 1R0SA 1IBCA 2FUCA 3HNRA 3V8EA 4NEHB 1N6RA 4H27A 3V48A 4JI3B 3JQBC 3EUAA 1PNOA 4GVXA 2YYZA 4E07A 1BG6A 3K09A 1MT0A 3FWZA 2NUPA 2DQKA 1PJZA 3AF0A 3L0SA 4TWIA 5JAHA 4QGAA 2WT8A 2HMTA 3BMQB 1NWHA 1G6KA 3BJZA 1PQWA 1GGHA 2QRNA 2DH5A 4Y8VA 5I7WA 3SBDA 4II7A 1SOWA 3LPDA 4MWEA 4IDCA 5JZMA 1T5IA 3IRUA 3GRVA 5GY7A 1CHNA 4A0SA 4H7FA 4RX1A 5CX1A 4R1TA 4B3IA 3ENNA 1N0HA 2WQ7A 4LSMA 1CF4A 3FE2A 3ORFA 3RUHA 1ZIXA 4LXGA 4OOEA 1E5XA 4WFJA 3RC1A 4CG1A 2GHQA 5JS7A 1D7AA 1SC9A 1ZJ5A 4OCZA 1EHIA 1Y63A 1Q77A 3JQ8A 1XZIA 2H0RA 3HZRA 3OLWA 3UAZA 4A92A 3HXPA 1NKTA 5JS2A 8ADHA 5BORA 1GKUB 4MV8A 1E1CA 1LI4A 2FGKA 3ET4A 3I09A 4UHEA 4WLUA 1JTVA 1FSGA 5AO9A 3A25A 2JKZA 4IIUA 5A3JA 1BD4A 1D6SA 1G21E 1O4VA 2C20A 3HJCA 4JLWA 3KFVA 2I6UA 4G65A 3FR7A 1WETA 1N1GA 1XTPA 4D99A 5FL7D 2AK2A 2FB9A 1P81A 4IXMA 2PGLA 4D8WA 1J49A 1OIXA 1X9IA 2RHTA 1E61A 5K51A 4YQZA 1AMNA 1M5RA 3P45A 2XUAA 1ZIPA 3M8KA 5MDHA 4XOUA 4MSUA 1AB5A 3W7BA 5EXSA 2O9JA 4EHAA 3OIUA 5IHPA 1G4HA 3QPUA 4HFRA 5CRIA 3TTSA 5JY1A 1O5OA 1MO3A 4KXYA 5CDTA 1XX6A 1W52X 2Z2IA 2C57A 3PK0A 2ZIFA 1B6GA 2WEKA 3OJCA 4WH0A 4XD7A 5J47A 5JARA 2J5XA 3JZMA 1XHFA 1HFKA 4FUQA 4O4LB 5KVAA 4BGEA 4C0QC 4BEVA 1Q2UA 2WUGA 1BH2A 4MV7A 4Q4LA 4FJ2A 4BO3A 4PQGA 4ZOQI 1V5GA 1JI3A 3L82B 3HCCA 4OQFA 4PO1A 1QQAA 3PNSA 2VQFB 4RD3A 2A9JA 4N82A 2HIHA 3EC7A 3SC2B 3ILXA 5F9FA 3SMQA 1NN1A 2NZ2A 4IV5A 5COBA 2SKEA 1LQUA 2WF5A 5L3ZA 5H3LA 1U0SY 4DEXA 3ZD7A 2EERA 4A03A 4BNVA 3K9CA 2ZCJA 3WMRA 4C4YA 5CCBA 5GONA 2MCFA 1ZHFA 2WUVA 4TM8A 1ZRNA 2Q3BA 2IHBA 2AOWA 2F1JA 2G6BA 1RPNA 1WMFA 2ZI7A 3HU1A 3OZXA 3EGDB 4OL0A 1Y3AA 4QPNA 4R0NA 3RS5A 3JQQA 4KWIA 3UJAA 1PSZA 2HFKA 3C8HA 3FNRA 4B4KA 5EKDA 4F6CA 1IQUA 2HXGA 3D3WA 4MPDA 3HBJA 3TAHA 4WY5A 2BGNA 4G85A 4BJ3A 3RD5A 1GUBA 1QZUA 2W2TA 2HN9A 2RGUA 3O2SB 4W5HA 3QRWA 4B2IA 2HKIA 4NHEA 1WSDA 4QGBA 5TGZA 3W77A 3JQRA 1KHTA 2FPGA 2O7SA 3IXMA 4QDOA 4RPLA 3EVTA 4JK3A 1E7SA 2X23A 4QICA 1YZKA 3DL7A 1KRXA 4K3VA 2RG1A 1FDUA 2IHZA 4G1MB 1P80A 5E4JA 4YPVA 1I7DA 5CEJA 2J7PD 1OLUB 2XB9A 1DU4A 1TYAE 2W2OA 1WPGA 3B1JA 4H0CA 4FW8A 3I5AA 4XM2A 2AI1A 2PGOA 2X2FA 1MB0A 3I32A 5E1MA 4DCSA 3Q1LA 5CAEA 5DXAA 3OVMA 4C4TA 3RIMA 3B36A 3DVRX 4EO9A 3CVYA 3V00A 1U1DA 2E49A 1X8XA 1LJLA 3GVXA 2NU9B 4EVRA 4S1TA 1G64A 5AI6A 3JAKB 2FETA 1MAHA 1Z2DA 2ZYUX 4NENA 5HQ3B 4AROA 2D54A 1A9QA 1VGVA 4WBXC 3AR7A 2P1DA 4G5XA 3ONDA 5ECGC 1CR6A 3RRJA 4GQIA 5DZSA 3PT5A 2JFGA 4DM7A 1PZHA 2AQKA 4YA6A 1Q95A 1QF7A 4C5CA 2GT1A 1NUUA 2NYRA 4JX9A 2XI4A 3HJTA 4OFBA 2ZJ5A 1JZQA 2P3SA 3QG5A 5CB4B 2BKAA 2XE6A 5IJAA 2YZ7A 4DREA 2C61A 2Q5LA 2XADA 1GGMA 4AJOA 1BU8A 4HVTA 2ZBGA 3NV9A 4TS1A 5LBIA 1E7YA 1QORA 3ROPA 1ORIA 1FS6A 2Z8XA 5JHHB 1SKUA 3FFTA 2JJ2A 1QK4A 3WWOA 3QFRA 2AG6A 3GLSA 4JD5A 2FMUA 2Y99A 2OBYA 3CBGA 3QV1A 3SZLA 3D5TA 1UOEA 1MHTA 2G9VA 1HFEL 5K0JA 4YBZA 5JASA 3KOWA 1FDVA 4MW7A 2JL1A 3QX8A 2WJZB 3DMTA 2RB4A 4PF1A 4AU1A 4H3VA 1BNCA 3IVCA 4OM7A 1I7NA 2ZT8A 4CMBA 1P5RA 3EQ2A 2B69A 1EU1A 3BMQA 5AVVA 5TEVA 2QMQA 1IHXA 2XCSB 4KO3S 5A4DA 4KSYA 3RC2A 3R3WA 3B7WA 4F4CA 1A8PA 1PKXA 3ZKWB 1XPJA 5E4YA 4U7GA 4EAQA 5BYKA 4KO2S 4KNYA 2AEEA 1TTHA 1CDOA 1GZUA 4B82A 4PO9A 4TQUS 3RR2A 4K6MA 1DAOA 3W2TA 1JKIA 2HA5A 2FU5C 2LV8A 1HDIA 2C54A 3U7GA 3LXUX 4ND8A 1FFDA 4U0KA 5EE1A 4BQNA 5JH7F 5KC9A 2O5EA 1NIJA 5A02A 5FB3A 1WW2A 4OQ4A 1M2GA 2X15A 1JYEA 4RQBA 3KR1A 3OZGA 1XMPA 5LZ7A 1IPEA 1E79A 1T6YA 2PQ2A 3GP5A 3FCEA 2HLPA 3M1YA 2EG5A 4QGHA 4AZ3B 2NLOA 4IHQA 2I9KA 1QXSA 1W9HA 3KELA 2NVUB 1YR8A 3P9XA 2GCGA 2WB2A 5JQWA 1O6ZA 4L9RA 3D2CA 4GU5A 1T0HB 4MKHA 2PGJA 1C4XA 1CY7A 4L07A 4NE2A 1NBME 1IZZA 4TYWA 1FCJA 3T5GA 4ZZIA 1LRKA 1RLMA 2EQBA 3DBOB 3I6YA 3DP9A 4JN6B 1H1DA 3ORYA 4X94A 4YJHB 4BFCA 1P6QA 1S4QA 4FCCA 4UDYX 4TGLA 4ZO8A 4BX3A 4OJQA 4QZVA 3PHLA 2J4DA 2PIAA 3GNTA 4HG2A 4OH1A 1SQ5A 3G8CA 4KLRA 4QU9A 4O4LA 3DNMA 3KHSA 3EMVA 1Z88A 2ZRDA 4Z49A 2PFKA 1W1UA 1P7CA 2IPOA 2XE4A 4IBOA 1IHDA 4L2IB 5ESXA 2PZLA 3GFQA 3Q9NA 4XARA 4DDHA 4JWTA 1USVA 2Z3ZA 2OHIA 3RJ9A 4C3ZA 2D0OB 4K26A 3KT3A 4KIFA 1QHGA 3EC1A 3RTBA 2FZGA 1U94A 1XVIA 4MROA 3AR5A 4ENVA 5DNCA 4KKXB 2J08A 1KAEA 1Q0ZA 1JIQA 1I0ZA 1J06A 2NUBA 2YY6A 2QUKA 1FP1D 2ZVJA 3G8YA 3KWJA 4YB8A 4ZODA 5EMLA 4DG8A 4EY8A 2MYTA 2XKKA 1UR5A 1XMXA 1WUTA 1JNXX 1H05A 2M6SA 3JYNA 4GX1A 4CM5A 4ZYYA 1A7AA 3FFWA 5LQNA 1XFDA 5DKFA 1MEOA 3EGDA 3ZD8A 4B31A 4BUZA 3FNGA 4HCJA 4AMGA 3UMSA 2HSGA 1P9NA 2QVGA 3HGMA 1CUBA 4RE6A 3WFIA 5LOVB 1Z56C 2ZTSA 4CW7A 4RA6B 3KOOA 4OY3A 4X95A 4E46A 4ZDJA 1W36C 3SQXA 1KVQA 2PDAA 1T2DA 3SF8B 1QDUA 1XN1A 1CE8B 2CK3D 2XMGA 4YUXA 4LQCA 5MFPA 1QG2A 3BYZA 3SX2A 2W9XA 3TR0A 4CIXA 1S8AA 4XWAA 5JZVA 3GUZA 2PRIA 3EIUA 4OYRA 2FSVC 1USUA 3R7FA 4ZAXA 1YZUA 1G41A 3CIFA 3F9RA 1F9EA 1T1IA 3B1WA 1OLUA 3CH7A 3H9EO 1FMLA 3N8DA 4ODIA 4ZEOA 3OFVA 4FWTA 1JILA 3BGWA 1R6AA 4MXDA 4Z7JA 1P2BA 3PITA 5CUQA 3TZQA 3NWPA 2OK8A 1DKNA 4F96A 4KR3A 2WPDA 3GNQA 4IY1A 1Y98A 3R7AA 4Y2XA 2CXSA 1XVVA 5FP0A 2ZJOA 4ZT7A 5TQ0B 5JWRA 4FHZA 3F7MA 2CD9A 3KHTA 1TW2A 1QCDA 2NU9A 2QVYX 2Y0EA 3ZE7A 4NKRA 1YMQA 2DPHA 3C5CA 5BV2P 5HQ3A 5MFZA 4YAGA 3KTOA 1GYPA 1TT7A 3WGNA 1YUBA 2PSEA 5HP4A 3V80A 5TLSA 2ERXA 2GYUA 3AVTA 4R8KA 2FPXA 3N7UA 1EUCB 2VWGA 4JUFA 2ZZNA 1CR4A 1CS0B 2JAPA 4KB5A 2PRJA 2PYIA 4D2IA 4BASA 2RAVA 2W93A 4QLAA 1J2JA 2MYUA 1NZFA 4JT8A 3ROGA 4HNAB 2Q2QA 3IC5A 3FYCA 3N2ZB 4LYFA 5LA6A 4CKBA 5CB4A 1IN7A 5AUNB 4DEYA 4YP6A 3PVCA 3SE0A 3KS9A 4NYIR 1L4FA 4IWNA 3FYSA 3E3NA 3IOBA 1X13A 1UQUA 1GLNA 2GD6A 2YIDA 3D31A 1Q7GA 1YB6A 3NTRA 4X8MA 1ZRMA 4BUCA 3AGPA 1PTJC 1YI8A 3QQPA 1CKEA 4QARA 5LMNB 2IYQA 2YWJA 2Y0PA 1P0CA 1U0OC 3L4BC 2XHEA 3FHJA 5JDIC 2YKGA 1D1PA 1RBMA 3QA9A 1J0AA 1N5LA 4HO1X 3OJLA 3AFHA 5DM60 2CLLB 5B1EA 4YV1A 3OEHD 5B4UA 1E63A 1DX4A 3H17A 3NV7A 1G4UR 1Q0SA 1XLTA 3QE3A 4M9ZA 1ODTC 5EJ7A 4IIEA 3P5BA 2DUJA 2G72A 3M3HA 1KQPA 1SU7A 4IH1A 2IYRA 3HXMA 2R8RA 3PD7A 2FN8A 4Z0TA 1SIUA 2AC4A 3JD0A 1YL7A 1ECJA 1SBYA 1XHEA 3D4LA 3P9PA 4MCJA 4ZV9A 4Q1CA 3ZU4A 4EPTA 2IPMA 1NVMB 4KACA 3T35A 5BW8A 1O77A 2RIRA 1VCNA 2E7ZA 4J4BA 4PQEA 5TQJA 1W581 2Q4EA 4LOAA 3RHFA 1NU8A 2IVFA 3D2BA 3VZBA 3E35A 2YJZA 2IIVA 4KQCA 4QU8A 4NCHA 3ADDA 5C34B 3DPUA 4JI5B 4C4XA 4XPZA 2PYZA 3GEIA 4DA7A 5K5EA 3NB0A 5JE8A 4JOQA 1Z68A 3NRCA 4KPYA 3MJEA 4I5DA 4A5OA 4BV8A 4D98A 3DXFA 1A1SA 3FZNA 5HUJA 1SA0B 4RKEA 4HX2A 1V1RB 2NVUA 2O2JA 1F0YA 3GMDA 2HK8A 5COQA 2PZEA 3QELB 3NHMA 1AK2A 3C1TA 3HWX1 4KG7A 3JQGB 3KB8A 3RVPA 3H9QA 1M8FA 1X7GA 3MGKA 1KI7A 1VPEA 1FYDA 1VGRA 4NZPA 3QNUA 2OOSA 2H4ZA 1HLGA 3FWYA 3N0XA 1I1QB 4ZOLA 1RBZA 2AMVA 3E27A 1IXKA 4L3OA 1P61B 3P0RA 5EFZA 2NO4A 2QZSA 5DLDA 1YRHA 3GLGA 3RI3A 2V0CA 2J4CA 4P7JA 1JKXA 4NATA 5EE5B 2CZQA 5EHXA 1T2FA 2P69A 2ZE7A 2G67A 4HOYA 2B21A 1RKVA 2NYVA 3GHYA 4J90A 5D1HA 3ZWVA 2CJPA 5ALVA 3ZTYA 1ANKA 1M0SA 1Z6XA 2J5KA 4LY6A 2ZWPA 3DOIA 1ZMXA 4L2IA 4C3VA 4LV6A 5HS6A 3L4KA 3JY6A 1ZFNA 3U81A 3JWPA 2GI4A 1J00A 3BEDA 4I3FA 4PG6A 4YJFB 2QMZA 1TEHA 2PZGA 2XVAA 2C2BA 3I8OA 3QUAA 4NHOA 2QLLA 5EE3A 3R74A 1RYHA 4OA5A 2C2HA 1TA4A 2O2XA 4MTCA 3QPCA 1KYVA 1ZI9A 5J5VA 4FVTA 1R9JA 2H6EA 2ZRFA 3FWNA 5ED0A 3KUXA 5IM4F 1K4YA 2GRJA 3BQNB 1VJ1A 2IYXA 1E5VA 4KXNA 3HVHA 1DEOA 1A9RA 1YCFA 2HSJA 3K9HA 2BEUA 4MQLA 5HBGA 5DNEA 5FKJA 3RSZA 5F98A 1A04A 2YJGA 4O3FA 3L93A 5LLSA 4BV2A 3U9LA 2ODPA 5LOVA 1WU8A 1JFLA 1RKBA 2PL5A 3UK6A 4S1OA 4N7RA 1L7DA 4ZVVA 4FLFA 1M8PA 1CE8A 1YZNA 4GC5A 1IQPA 1LBSA 3E2MA 1YB5A 2HHAA 1RYNA 2QAIA 2ZJZA 1H2WA 2HK9A 1OT3A 4K81B 4BXOB 1XUOA 5HWSA 2OQVA 4DNOA 1D0IA 3O1IC 5DTRA 3SY8A 2Q7DA 3KJEA 1FNDA 1NBWB 4P4UA 4OP3A 3IVMA 5FL7A 2OPHA 3R7WA 3LV8A 1OI4A 3SR4A 4PR3A 1UL1X 2CLEB 1PLJA 4TTQA 1G6OA 3I61A 3TVYA 1L7NA 2HGZA 4M1TA 1L4NA 3UPTA 1B0ZA 1LLDA 3F5MA 3SQNA 3H1EA 16PKA 3PF8A 1MG0A 3OC6A 4XAQA 2QRUA 3N0WA 421PA 1O54A 2OP0A 1NY6A 3COWA 4E1VA 1ZGHA 1GKYA 5LLTA 3VBCA 2YIMA 2XWSA 2H4YA 3P7MA 2ZRNA 3WLKX 3DVQX 4E5YA 4C4RA 5KINB 3S70A 4CWAA 4G8DA 4EK9A 1XAGA 3E7WA 4LXYA 3RGWS 4OF4A 3ISTA 1CS0A 3BCSA 3GZTB 3LQ4A 1JU9A 4HADA 4TX1A 8ATCA 1NJ2A 2GEJA 2QROA 3HVIA 4GP6A 1KJIA 3FUXA 4V3CA 4WT7A 2HHLA 1EX9A 1FYFA 3FG9A 3FOAA 3G89A 4PYQA 5CVJA 4HNAA 1WBBA 4ZCLA 2CE7A 2Y1LA 5KTOA 3QLUA 4R0MA 2HTFA 1B16A 4BAUA 1UT6A 4MVXA 1F8FA 1W59A 2FN7A 4UU8A 2O20A 4ZVNA 1CR2A 4IDQA 2V5UA 3BHNA 3R0VA 4K6HA 1E60A 2C7QA 1XU9A 4C07A 3T9CA 3TEFA 5JRZA 5KJCA 1QAQA 2MINB 1N33B 2ZRBA 3KB6A 1ZM2A 1IY0A 2QW0X 3EJWA 3RRBA 3RAFC 1Q1ZA 2C00A 2P0YA 3FSRA 1WA5A 3P9QA 3QKUA 4LHEA 2JLVA 1OYVA 5I7HA 4KO1S 4DR3B 4MUMA 1M6YA 3KQSA 2FKNA 1K7EB 4S1PA 1QF9A 3VO1A 3PPYA 1GGEA 4UBNA 4WI1A 1SIWA 5K8LA 1RJGA 3F73A 2PKQP 1AJEA 2OHFA 2J7PA 3FHCB 2AVDA 3LPAA 4C7XA 1MVLA 3RVSA 4KNWA 4D26A 1Z22A 3DE7X 5M2QA 1IY8A 2VOJA 1AHNA 1T91A 1TZKA 2Q3LA 1JXMA 1A69A 2QS9A 3FKJA 4H1VA 4GZ3A 4IHKA 4YONB 4RTNA 5EJMA 2VK1A 2VTBA 8GPBA 3UUFA 1P6XA 1R6BX 1UBUS 2Y0CA 3R6TA 4QYTA 1O96A 5IDXA 4M1KA 2C9YA 1OX4B 2QAJA 4WQMA 2JJ1D 1XTUA 1YFKA 5B37A 1QS0A 2PXHA 1Z4NA 1NURA 2AOTB 3KZOA 3OZ7A 4HDSB 4HTAA 1UT5A 2I8LA 3D6VA 4J1TA 4XIYA 1FUYB 4B4UA 2EJCA 5E3HA 5K8TA 1QTQA 2ZWVA 3H86A 3OQJA 1SUCA 1O87A 4D9KA 1V1RA 4K9OA 5JYCA 1KZGB 1MC1A 1ZIYA 3AOEC 1A4UA 2WUDA 1MNAA 3U44A 3DMTC 3A2KA 3EODA 5FFNA 3ZQKA 1OI7A 2OYCA 3T8YA 3A4MA 3WLJA 3DD1A 3HR7A 2TMGA 4WUVA 5IAGA 4DW8A 1S2LA 4QFMA 1AKMA 2Q6TA 1Y48E 3REFA 3E8MA 2UXBB 3MJHA 2C2MA 2C84A 4GLLA 1PJQA 4LOKA 4H3SA 2QT1A 5CIYA 2HB6A 1UBLS 1WKVA 2IDZA 5FBHA 3CNBA 1HEIA 2H5IA 4CMCA 1ZSVA 3B1VA 4JQOA 3BF8A 4IP0A 1JSCA 1IDN1 2QI9C 3THOA 5GVRA 1ABBA 1U7UA 4P1ZA 2I3GA 2W22A 3WGZA 1Y9AA 1H85A 1M5UA 1Z4QA 1AQ6A 2VTEA 3KVOA 5GOZA 4HDOB 1KQNA 1EXVA 4JI7B 4HR7A 3TIGA 1J8QA 1YHZA 4UHCA 5I9BA 4YJFA 5KYVA 2CF6A 1AZWA 1K5DA 3R23A 1GN8A 4I4NA 5EIAA 4E5MA 3ZYZA 4MGEA 4DWVA 1YAHA 4I6JA 1KTVA 1VSUA 1PL6A 2B25A 1WKCA 2GX6A 2O2IA 2VNSA 2YOFA 4F93B 3ZE0B 4Z3OA 3A9VA 1EE2A 3OWOA 1UK8A 4YAOA 5JQGB 2PV7A 2ANCA 1G291 2J0VA 2XV1A 1FP4B 2NT4A 3ZBUA 1X8KA 3BL8A 3HLYA 4ZRDA 4LJRA 3ZGZA 1KSFX 3SBXA 2BELA 2GTHA 1IMJA 1E5DA 3BHJA 4RDIA 3TOXA 4JSYA 3UXEA 1IAQA 3AU9A 2BI8A 3NG1A 4UUOA 1BXRB 2GZHA 5FI5A 1R0YA 3NGLA 4PLTA 1N2XA 3M1LA 3AX6A 4HB3A 5IS2A 1WZEA 4YR7A 4CM4B 1D9ZA 1NPDA 1ZD9A 1BXKA 2V74B 2ZYTX 4H7EA 1JLKA 2YBEA 1JG6A 1HYHA 4P83A 4C03A 4X9XA 4ZYUA 5FI0B 4IYJA 4B6GA 3ITEA 3C0KA 1IXZA 1M54A 4JVLA 4B8ZA 2CCKA 1G6HA 3C8DA 1ESEA 3KWFA 3LP8A 4CLEA 4JCOA 5CVVA 2FH5B 1UJCA 1U8AA 2WWTA 3OZAA 1WXIA 1IC6A 2I71A 3FKSD 3LUKA 2PD3A 5GJWC 1F1BA 1FSFA 1HT2E 2PMDA 4GL2A 2H2WA 3V8QA 3IFSA 4N3CA 5JCJA 3ZE8A 4OU5A 4MWCA 2P6RA 2DE0X 4DR4B 3H8SA 1RLTA 2Y4NA 2ATCA 1MCZA 2JK0A 5EEHA 4OHCA 4GLFA 3CRW1 4V3BA 3VNSA 1YL5A 2GM9A 4K03A 1V3TA 3AUKA 2PIDA 1OV4A 1ZU4A 3INNA 2ZOSA 2P35A 4WTOA 1VA4A 1TNDA 1XQWA 1SOUA 2AMYA 2IUSA 4R2HA 4IIHA 3WS7A 4B3XA 5CGQB 5ELLA 1WVIA 4HNHA 5K0NA 1N3IA 4LCEA 3RRZA 2FX5A 1WTAA 2Q3EA 1AKUA 1PF7E 5J58A 4CQNA 3A2LA 8AT1A 1X42A 4J29A 1B73A 4DVGA 4EGJA 2V4ZA 4TTPA 4U7TB 8LDHA 5IJZA 4R1OA 1YVUA 1M2JA 1XZEA 3U4DA 3ITKA 2ERCA 1D2NA 5E9WA 5JMOA 2XUHA 2HT1A 1E4EA 1GCUA 4CIYA 1ICIA 4BNMA 2W37A 3DJYA 4BFZA 1NM5A 1US8B 3UBMA 1HL7A 1EHCA 3BCRA 1DCFA 2Y6UA 4JQSA 4I1OA 3W3AH 5I7RA 2CHQA 1PI3A 4V0ME 4B6QA 1NQXA 4N1AA 4MI9A 2XVMA 2CK3A 4K9DA 2PWPA 3GPLA 1DXOA 2QVZX 3AFGA 4TN5A 3C1AA 2ZT6A 2VSOA 3B5IA 4B4OA 3ZJUA 2EC5A 1KMNA 4RANA 3PQ6A 2I7DA 2FUNB 2LWIA 4FD2A 5ALEA 4ARCA 4GP9A 4MCHA 5AH0A 3ZHQA 4RTSA 5JJLA 4DV3B 4LWPA 2C2ZA 1ZXXA 2JLAA 1S3SA 3SX0A 3R8FA 3EIXA 5ALFA 3QF4B 3B2EA 4XWGA 5F4ZA 1WB9A 2XQJA 4UBOA 4OLBA 1Y5LA 3RH0A 3K9FC 3L18A 4TLCA 4WZBA 5IDYA 4OOFA 3T3GA 1TKCA 3E9RA 3R76A 3ELWA 3U31A 4PY2A 2EFJA 1TM2A 2H3HA 4YRSA 3VR0A 3K4HA 4MKXA 1KNQA 2ZRPA 3JVDA 1OX4A 3WGLA 3ZLTA 5IJWA 3S6JA 3M2PA 4H08A 1FVFA 2P4QA 2WIJA 2XDWA 1PR4A 5LNK1 1YJAA 4LYJA 4KPUB 2PRZA 1HYEA 4RMJA 5L45A 3CLSD 3PNLA 4L78A 2OB1A 5F5NA 4K0RA 2D59A 5TGTA 3RO7A 5AK3A 3M6IA 1QNLA 1JIKA 3RSLA 4JXZA 2GPTA 1XLTC 4GKBA 1L3BA 4GRDA 4X62B 3D4OA 1TM3E 4NE7A 1M34A 4V38A 3EXG1 4Y1RB 3O73A 1NJGA 5BWBA 3OM0A 1FK8A 1WPQA 1PSDA 5H4HA 2BGGA 1GU1A 2PKQO 3DMYA 4WOKA 2J41A 1JA0A 2L69A 1VA5A 2OV3A 2Q2OA 2YWBA 3L4JA 2WWIA 5JCJD 2Z4SA 1IXYA 4E3ZA 3CLTD 1OWNA 5LXTA 1H93A 2GN8A 2Q28A 5I7AA 3C3BA 1WMSA 1GQSA 1YR7A 3ZU5A 3QEMB 4J0EA 2VUSA 3OEHA 2OD7A 4M0LA 3BERA 4EY7A 1F60A 2DKOA 1XAJA 3LBIA 1X2BA 1BH6A 5DCLA 4CPDA 4YMLA 1T9CA 1XA0A 3CY6A 3DGFC 3EZLA 3SD7A 3LT1A 4RK7A 4WIAA 3IR5A 3UMMA 2O7NA 2N1MA 3EQ7A 4RCZA 1H3FA 3OTQA 4BAZA 1UBMS 1QIFA 3E22B 4LISA 1W29A 1YR3A 4KQEA 4YLYA 1OBOA 5JQGA 1BKYA 1KY3A 4W6ZA 2BJHA 3OF3A 3PE4A 4PICA 4NBVA 4DZRA 4QBKA 1FP4A 3RUFA 5T4EA 2DM6A 4QXRA 1BVHA 3EEOA 1MUUA 2O6HA 2CJYA 3T12A 1UQRA 1BXRA 1RAHA 2BGWA 2IYPA 2FR8C 2PT5A 2YJ4A 4DN6A 2DJ5A 4OLFA 3S8EA 3HVRA 3KXLA 2HDOA 4EYSA 2FZCA 3ACCA 2WHQA 3BAZA 3UH1A 4AJLA 2FRVA 1WABA 1MJHA 4CM4A 5LYJA 2HMVA 3BIJA 3CF0A 5DYIA 3SI7A 1A9YA 1DQNA 2EFDB 3OM9A 4P7GA 4C4OA 3NOOA 1MRNA 1YS4A 3D43A 1TRKA 4JC8A 2EHJA 4FFPA 1QVWA 1M7BA 2NXWA 3PDJA 3K92A 3WDMA 5BMOA 2XCQA 1HY3A 3L07A 4TL8A 1U2TA 4TL9A 2EDCA 2Q4RA 5HSGA 4NOMA 5K3AA 3P32A 4OGLA 9ATCA 3I76A 1N3BA 3L1IA 3LBAA 4BQRA 3OFKA 4F9TA 2OILA 3IP9A 5LJLA 4RTPA 4ITRC 1ZUNB 1U90A 2HM7A 5G4KA 1P5JA 1U7OA 1LUAA 1CEQA 2FWNA 4I1IA 1ZH2A 4X61A 4RABA 4HFNA 1Y8AA 4PZUA 4YAWA 2L42A 4R05A 2QRVB 1SUDA 2BFBB 3S1LA 5I9NA 2VRNA 5DO9A 1L5QA 4OHPA 2VXYA 3LBNA 2FV8A 5K9ZA 4MH0R 4UTRA 5JNSA 4YFVA 3O9MA 4HDMB 4A10A 3U48A 2WR8A 4U7DA 2GCOA 2P91A 3H8JA 1UZLA 2JZCA 2ZSJA 5EIHA 4YRLA 3M6UA 5BN4B 2J3IA 4JOBA 1ZHOA 3PXUA 4X7PA 5CFMA 1FJ2A 2ISSD 1OFGA 2QLJA 2I4RA 3I6MA 2O1XA 2PVPA 3WZLA 2CJWA 5B2FA 2B94A 1JU3A 1MFZA 2ZBFA 2EFGA 1DOZA 5LLDA 1EI9A 3ENVA 2ZVPX 3CRRA 3E0XA 4HBZA 5FBZA 5GAJA 3VVCA 3CSUA 4RCVA 5ETJA 4TWBA 3EHDA 1GTSA 2XITA 2FPUA 2XXBA 3P9SA 1GPYA 3T0FA 3ZLVA 2R7NA 1ISJA 4EB6B 3IPCA 4UXHA 2EGHA 2X4DA 1SN7A 2YOGA 3QKRA 3SYNA 1W2GA 1GRNA 4GMDA 2BTQB 4JJ4A 1WP9A 4JUIA 4XDYA 2HJRA 4K9LA 1GG5A 3FKQA 1GGKA 2X14A 1U9CA 4R1SA 1G7TA 3U9SA 5F3WB 1MJNA 3ORQA 5FI3A 3ROTA 3M5CA 2XGMA 4F84A 1NG9A 4DE5A 5CB6A 1SCKA 3ZOZA 1ZISA 4GD3Q 1J2RA 1HDYA 1UXHA 1B2RA 1P9WA 4ZIRB 3TE6A 5JFOA 1T5OA 3SE7A 3G2HA 1X0VA 1AU9A 4F3RA 5K8VA 2VP2A 3AJEA 4LRWA 1TUBB 2IQIA 3ZV4A 4YJ3F 4Z3DA 2FFJA 4M22A 4ZXPA 3QF4A 2VDUE 4YI5A 1AXGA 1Y5RA 1JXAA 3U40A 4D4GA 3AHHA 3E4DA 2UYGA 3OHPA 2ZUUA 1T3LA 3LYHA 3NAGA 3LUFA 4GGMX 1ZCJA 4PFKA 5DM0A 3CVXA 4JJAA 1MV8A 3NOVA 3QLUC 4MV9A 4JR1A 2E89A 3DZDA 1K89A 3P2EA 5FBKA 3CG0A 3NYIA 1J0XO 1NYQA 2FWAA 1X7ZA 3F90A 4DUGD 4DQDA 1DE0A 4U02A 3TBHA 1UC8A 3EX7C 1JIIA 2RH4A 1JEAA 3DEHA 2QT9A 4J0GA 4MKZA 2QUZA 4NCJA 2E4AA 4O4HA 4TTJA 3SOPA 4BATA 4KPUA 4BO6A 2ODNA 4UM5A 4BO7A 1X9GA 4N6OA 3TLMA 5AUOB 2I6QA 2FAXA 3G5LA 1X1TA 1REQA 2DU8A 3F7TA 3IBCA 4IEIA 2HU5A 4MULA 5CHEA 4JZKA 3L92A 4BCDA 4GI2A 4DCMA 1XZKA 2FQQA 2VUTA 1UMCA 1YJBA 2VZLA 3OPQA 4IHJB 1CJSA 4J7XA 5M29A 1UIMA 3BC1A 3GPDG 5B7NA 3K1ZA 1MPXA 4GMKA 4NYMQ 1ULBA 1TEVA 3GFRA 3OC0A 2H17A 4LBWA 4ZAFA 4ALIA 5GZ3A 5CM8B 5T41A 2BH2A 4XGQA 2YUTA 4K40A 2PKXA 5KU7A 1P2FA 3HH8A 2ZUFA 4YUVA 3A05A 3C3YA 4HWTA 1P6UA 3UOWA 1QJ4A 1U7WA 3VSCA 4G0VA 4GOOD 1OXUA 1K86A 3QP9A 4Q19A 3WB2A 2CUZA 2COUA 3BGVA 2D7JA 3NT4A 3PHGA 5AMXA 4G24A 1U7XA 1U0NA 1WUJS 1PKEA 2BGTA 3LX5A 3RFFA 3VBEA 1S9HA 1W73A 2ZR0A 4MK4A 1KU0A 4QAJA 4CBVA 5KNCH 4I2VA 5EZSA 3P2IA 3K70D 1VPLA 2IOFK 3C45A 1M8KA 1TZ2A 4US2R 5JLJA 2P1ZA 2HSDA 4DLKA 2Q7XA 4B3BA 2W5UA 4B47A 3U4MA 1T9KA 3ZU6A 2GN1A 4LG1A 2O4UX 1UBEA 5CXSA 4EVSA 5HRUA 2WTAA 4CCYB 1PJSA 4EQ6A 2YFHA 5KYGA 1F0NA 3D0RA 1SD5A 2YZNA 3GAAA 2FPRA 3MWGA 2JPDA 5DI3B 5BMVF 3HDTA 4UW9A 4CMEA 3JVEA 5DOVA 1PLKA 3CV3A 2Q62A 3LBHA 4FEAA 2BFEB 5C46F 1C80A 2YMMA 3NBQA 2P2SA 1FOEB 4BLUA 4QG3A 4G5GA 2UXCB 4NJMA 2JJ1A 1T36B 5AIBA 3GEHA 1ZM9A 1E1NA 3KKEA 2VT2A 1IHOA 1ZM3A 4Z6KA 2UUCB 2VSFA 3IHLA 3LP5A 4JVOA 4ZOEA 4HQRA 1OHHD 1XROA 1BDIA 2EKQA 4H2DA 4HSGA 1HDRA 2FJ0A 3OZUA 5FUBA 1ZNWA 4MI6A 4PLHA 3RVBA 2AG5A 1R66A 1K3FA 1UZMA 3CNEA 2JLWA 1BOFA 4H3HB 1MA3A 1E2MA 4TZ0A 1KDRA 2WE7A 2ZIXA 1SCQA 2IPAB 3GOHA 4I55B 2QBYA 4H1HA 3HQ4O 3PL5A 5CNMA 2BHTA 4F60A 4XJVA 4XR4A 3E23A 5LU8A 3UN1A 2XODA 2XB6A 1T25A 3QI7A 3WQHA 1IB0A 3V1TC 1C9DB 1XVUA 2HT6A 1L5HB 2IPLA 5T8KC 1XDUA 2F1RA 1H3EA 2C7BA 2DUMA 2K2WA 4JLDA 1S96A 5H1YA 2YY7A 1UJNA 1R0BA 4C0BA 1GTMA 3UMGA 3LZ6A 4ZT4A 1M3SA 3B9PA 1X1CA 3AW9A 3KYIB 2XH8A 1OJ7A 4M37A 3W6OA 1E18A 1HSOA 4NMLA 4DNQA 4CU5A 2VHTA 1TC1A 3ILYA 1RNLA 2CWDA 3OX2A 4D41A 3CZCA 5F2EA 4EMBA 2UU9B 3ONNA 5E3JA 3I1JA 2GJAA 1QH9A 3G5UA 5EHZA 2V7QD 4LC1A 2O3QA 4ZI7B 1FDTA 3RVQA 5D3ZA 5BN4A 1XRPA 2FPPA 1CK4A 1YONA 2OB2A 1ZA1A 2ZYAA 5FOUA 3TDKA 1TAUA 2JNWA 3LLCA 5IAKA 1AZTA 3GFGA 1ZH6A 2OGUA 1PG2A 4MQEB 4MEBA 1WVGA 3KLMX 3EVNA 3RJZA 1RI5A 4KXFB 1IZ8A 3K0KA 3NTUA 4AZ0B 1ZVMA 3GO4A 1W35A 1PR1A 2BSAA 3CEMA 2V54A 3G0IA 2IHKA 3KR0A 2P79A 3LYUA 3PLAE 4L9SA 1FDOA 1LS1A 2C2GA 4HAUA 4J2TA 4Z9AA 4OI0A 3DZCA 1KZYC 1NQTA 2XT6A 1KMMA 2CNOA 3W4IA 3SDSA 4Y9DA 2HV9A 1U4OA 1UEIA 3EGXA 4RSHA 5FNVF 4ZZ3A 4J75A 2MMCA 2FA9A 4EFMA 1FZQA 4Q39A 4TSFD 1QHYA 3U4HA 3G0HA 2WW8A 3ELBA 4XR9A 1GFZA 2GPSA 4PC2A 5CU7A 2IGTA 4ZIRA 5KMGA 4JYPA 4GXQA 2V7PA 4O5OA 2XUZA 4AN1A 1V7PC 1WZCA 4ZCTA 3PC6A 2IYZA 2OCBA 3FKSA 4DAOA 4AI6A 4GIBA 1DRVA 2FSPA 3L8DA 4X3PA 1A9PA 3MAJA 1PNQA 2A33A 5IBQA 2WAOA 4MYSA 1KYZA 3HM9A 4WSOA 4DR1B 2HAEA 3AL3A 1Q3TA 1RJ9B 2QZPA 2G82A 4ROTA 3HDVA 4H1WA 1E96A 1IBMB 3KLBA 4PCUA 5JCXA 5IDQA 3F4KA 1NM5C 3AR8A 4KXUA 4MWSA 3SJBA 3TSOA 5EEGA 6REQA 1NSYA 2HRQA 4TRJA 3V9AA 1Z8FA 3O0DA 2C5LA 4WLFA 4CF5A 5K6AA 1J07A 4RD2A 2JDID 2P2LA 4YDSA 3I04A 4PHCA 5I4KA 4RETA 1SGWA 1OW3B 2O07A 3T7AA 1SJ9A 1E9VA 3Q9UA 4O0LA 2YZKA 3ZQ6A 3PNQA 1SQSA 2Q6KA 3UFBA 1KXJA 3LKDA 1JQLB 3F78A 4LCJA 3CB4A 3WRXC 5KPJA 2O8FB 3ILSA 3KEMA 1H2HA 5A4JA 2PFSA 2NVOA 2YJNA 4N39A 1PZEA 3Q8LA 2PT6A 2IIPA 2QRMA 1IVSA 5HF9A 5KO2A 1KE1A 3RKUA 3C5EA 2JLUA 2VK4A 3QE9Y 4FT2A 1HC7A 4LJ5A 5D8DA 2ZR7A 4JMPA 2Y1GA 4YN3A 5FI1B 4RM2A 2R4UA 5SYMA 1RYMA 4E5PA 2HADA 4F6LA 4B44A 1XHLA 1J8FA 3UJ7A 4AQ7A 3SIXA 2VCYA 4GOMD 1V8BA 4FQ5A 1DB3A 4KSCA 1LJ8A 5JAPA 2IA5A 3W6ZA 5ES3A 2FY8A 4DIMA 2I5PO 2QR5A 3TSAA 3NXSA 4MX8A 4B6EA 3AEQB 1IBLB 1GPLA 2C1EA 4QELA 5D3MB 2RGNA 3H97A 3UW1A 1KOGA 5EZYB 3B53X 3KKKA 2P8JA 2BJVA 2F3TA 4GHWA 4DIDA 3T3EA 2P30A 5D1NA 1U1GA 2Z5GA 4RVFA 5IABA 1PT9A 3K6KA 5E9QA 4Q05A 2MSDB 3Q98A 4G4SP 4WJKB 2WAAA 1HV8A 3H99A 3H9UA 3QBJA 4XUDA 3ZXIA 4XYBA 1DTWA 2TYSB 3EOZA 5DI3A 5EESA 2F3QA 4XRRA 3F6YA 3L8GA 3WGHA 2C5GA 2BFEA 3QIVA 1I3MA 2QRPA 3AIKA 3HRKA 4D92A 3PXDA 5LB4A 4DR6B 1T36A 2X2EA 1G5HA 1ISHA 3ILHA 3VH2A 4XB1A 3B1FA 1I4DD 1T5LA 1G60A 4DV2B 3KKOA 2FJUA 3NOQA 4D9MA 4IDNA 4CL0A 2F67A 5H9VA 3G9ZA 2DKFA 2AXQA 5FF9A 3WWZA 5K0BA 3H0KA 4BNUA 3WLPA 2BAGA 5B4TA 1JUDA 2QIPA 2VDJA 1J56A 3WHKA 1XRJA 2JGDB 3B13B 4I55A 4L85A 1F8YA 5EWMB 5MGNA 2WTUA 4FSDA 3HMKA 4G67A 1B42A 1JDPA 3VX4A 3WHLA 2Z2ZA 2ERYA 4Q48A 1UWVA 3VR5D 2EYUA 3BCUA 3AHFA 3GPIA 2BCGY 3R24A 3KQTA 4N5HX 1TE2A 2X7XA 2ZRGA 3ABIA 3STWA 4LRSB 4UAUA 4YK7A 3QBVA 1TCCA 2B5VA 5TRTA 1L5HA 2FPSA 1SBTA 4UD6A 3PA6A 2GRUA 1ENPA 2RK3A 3AR4A 4US0R 1GA6A 4MV0A 2JZOA 4KNVA 1PGJA 3MGAA 3ASUA 3OOSA 2YXDA 2OXCA 1Y37A 1KEEB 3A32A 3D0QA 1Y4AE 5F78A 2BFWA 3U3RA 4C9BA 1MAUA 5BOVA 1J2UA 3L05A 1DIBA 2XA9A 2G88A 1H0KA 4MWGA 3T99A 1CJUC 4D3SA 2XCLA 1GPUA 2PXAA 4NBTA 4YASA 2QRLA 5K01A 1JFSA 1N5RA 3OPYA 2GBLC 4JP3A 5I3CA 3RG8A 3SIPA 1QWOA 2NT3A 6ADHA 4EDFA 1Y82A 1B7GO 3NTVA 1OWMA 4H7HA 5IAOA 3CB2A 4MQFB 1E59A 5AD1A 3HWRA 4GVLA 2GM5A 2Q3HA 4KN6A 4YQFA 3RABA 4A5SA 2DBVO 3PFGA 3WMXA 4ETNA 4YR9A 3BFKA 3DT8A 3DXXA 1M7HA 1PV4A 4GSKA 2CZCA 4LFAB 3ICWA 3QEAZ 3M4ZA 2ZS7A 1ZJJA 1V7ZA 1Z12A 4BFVA 1A9TA 2I4OA 2A6PA 2J9RA 2QJRA 3AEKB 4KYVA 2BF7A 1FNBA 4QDXA 4Y2YA 2X2OA 3I4FA 1U7TA 2WHEA 5ADWA 3FVQA 3HFJA 1IEVA 2WSMA