1SUDA

Calcium-independent subtilisin by design
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
275
structure length
274
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASFVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAKSGTMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(serine proteinase)
molecule keywords SUBTILISIN BPN' CRB-S3
publication title Calcium-independent subtilisin by design.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 99
structure length 274
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1992-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sudA00
3DE0X 1SIUA 3DE1X 4JP8A 5JXHA 3Q5GA 2W2QA 2W2PA 1ZVKA 1AU9A 1NLUA 2G4VA 1V6CA 1BE6A 4Z2AA 1XF1A 2Z56A 1TECE 2WWTA 2Z2YA 1AF4A 4KG7A 1Y34E 1T1IA 3VYVA 1R0RE 3DWEX 2B6NA 1OYVA 4NMXB 4OMDA 1ST2A 2PWBA 2XRMA 1Y1KE 2XTJA 2ZWPA 4J94A 3DYBA 1S01A 1KDVA 1EA7A 1BFUA 2W2NA 1ST3A 4I0WB 2PWAA 3I37X 1Y3CE 4HVLA 1S2NA 3A3NA 2SECE 1V5IA 2Z2XA 2ZWOA 1UBNA 2PKCA 5JXJA 1AK9A 1SH7A 5B1DA 2Z30A 1SCDA 4MZDA 1Y9ZA 1OYOA 3DE5X 1R64A 1BJRE 1LW6E 1P7VA 1KE2A 2SBTA 4AKSA 2V8BA 2WUVA 3DE2X 1P8JA 4CFZA 3F49S 3GT4A 3F7MA 5AQEA 1SBIA 3A3PA 3VV2A 1AVTA 4C3UA 4RYDA 1BFKA 1JEAA 1AH2A 1AQNA 5FFNA 1GA1A 4C3VA 3DE7X 5CW1A 3VSBA 1T1EA 1SIOA 3WQBA 1YU6A 1OT5A 3P5BA 1CNMA 1HT3A 3CO0S 5JXIA 1Y3BE 3LPCA 3TECE 3BPSA 4WOBA 1GA4A 1NDQA 5AMXA 1SBTA 1TM4E 5AVKA 3DE6X 3BGOS 3LXUX 3WIVA 1Q5PA 1KDYA 3EDYA 1GNSA 2ID8A 2Z2ZA 1SCNE 2GKOA 1P7WA 3T41A 1Y4DE 3H42B 3TI9A 3LPDA 1KE1A 4YN3A 3VHQA 1R6VA 4K8RB 4KPGA 1AV7A 2DUJA 3F7OA 3QMPA 1SUCA 1YJAA 1MPTA 3DVQX 5ARBA 4BWGA 1ZVJA 4DWWA 1TM3E 4H6XA 1NDUA 1SVNA 1GTL1 3OSZA 2WV7A 4GI3A 1THMA 4DZTA 1EGQA 3SQOA 3WHIA 2IY9A 3A3OA 1SBNE 1Y33E 5K7SA 3VV3A 1WSDA 2WUWE 4AKTA 4WOCA 5FAXA 3DDZX 3DW3X 1SUBA 1SBHA 3TI7A 1A2QA 2SICE 1PEKE 5AVJA 3GT3A 3L1KA 3PTLA 4H6WA 1IAVA 3D9QX 2X8JA 1TMGE 2X8JB 1GTG1 2PMWB 1WMDA 4NE9A 2ID4A 2Z57A 1IC6A 1SN7A 3GCXA 1TM1E 3CNQS 1GA6A 1SCBA 1SCAA 4OMCA 5SICE 1SIBE 5FBZA 2P4EA 2E1PA 3EIFA 1SUPA 5JXGA 2PQ2A 2PRKA 1SUDA 4CFYA 1Y48E 1PJ8A 1WMEA 4H6VA 1GTJ1 1PFGA 1SELA 4OV6B 1VSBA 1C3LA 1GCIA 2ZRQA 3HJRA 3QFHA 1WMFA 1SPBS 3AJ9A 1SUAA 2QTWB 1CSEE 1TK2A 3AJ8A 3Q40A 3QTLA 5ARCA 3DVSX 3ZXYA 1KDZA 2W2OA 1TM5E 1SBCA 1SUEA 4KB5A 4B5LA 4CG0A 4ZOQI 2DQKA 4NE7A 2W2MA 2TECE 1DBIA 3EE6A 1TM7E 3DVRX 3UNXA 5JMOA 1Y3DE 1TO2E 3VTAA 4LVOA 1GNVA 1BH6A 3WIUA 3DE3X 2HPZA 4ZARA 2PYZA 5I9SA 5ARDA 3SICE 1YJCA 3BX1A 1YJBA 4M1ZA 2HD4A 1C9MA 3DW1X 3I2YX 1DUIA 4LVNA 3ZXXA 1S02A 4DJ5X 1GT91 3LPAA 3AFGA 1PTKA 4FONA 2SNIE 1Y3FE 2IXTA 1MEEA 2DP4E 1Y4AE 1TO1E 1BE8A 3PRKE 1C9NA 1T1GA 3I34X 5B1EA 1C9JA 3DE4X 4HX2A 1SCJA 2ST1A 3D43A 3GCWA 1WVMA 3I30X 2Z58A
chains in the Genus database with same CATH superfamily
3LCRA 4QASA 3R23A 1ZP6A 4ZEOA 4O2BA 3JPYA 1IMOA 2RGCA 4O63O 2XE4A 4KN5A 4D8VA 2XGSA 3EMDA 5JE8A 4A5SA 1B6TA 3I1IA 4X45A 3IV9A 5JXHA 1EVZA 3GN1A 3Q5GA 2ATXA 1ISIA 2FWMX 2ENUA 1IJBA 3BJEA 1C7JA 4B6EA 4HVLA 3NU1A 1DCTA 3LX6A 3OTGA 3TQQA 3D3JA 4YRTA 4BECA 5JAUA 3WYDA 2WEKA 4GWLA 4LJSA 3HABA 1QYRA 1RI5A 3AZPA 4QFBA 3RIGA 1ZVMA 4JZKA 5G0SA 3TSCA 4FYKA 4P38A 1S6YA 3SKXA 4F3YA 5LU8A 3UMCA 2VWPA 1ZOLA 3PUHA 1ECPA 2FRDA 4RKWA 1AQJA 1RXCA 2A0UA 1RDFA 1L5YA 3BERA 2IXFA 3RO7A 2VK2A 1LLUA 3M4YA 4B74A 3JSXA 4P3XA 1QH8B 5D5PA 1RXVA 1Z6AA 3H75A 2BFWA 2JGLA 1KSJA 2PLRA 2RARA 2WPNA 3NT4A 4JGIA 5KNCH 4S24A 4C4XA 1OT3A 1XFAA 2A5DA 2VT6A 2MSKA 1T1IA 1W2WB 3I04M 5WRFA 3EWAA 5GIOE 3FZQA 1OI3A 3C3BA 3RBAA 1KYXA 2F67A 2WTMA 1VBMA 2FY8A 1JHUA 1XKTA 1NJ8A 1XAGA 1KBQA 1UDAA 1XKLA 5D7NA 5E6RB 2VHZA 1XRQA 2O0LA 4O02B 4KDFA 2ZRJA 1NVDA 3B3GA 1N5LA 3C3YA 4OMDA 3EZ6A 4G23A 5IAGA 3B3FA 4OLHA 4EF5A 5B57C 5HUQA 4M0CA 1HL7A 4HP8A 5LQUA 3GYGA 1BXGA 4QE3A 2IBSA 5DI3B 2BH2A 4R0MA 4IXTA 4OU5A 1MX3A 1Q16A 4QU8A 4UCWA 1N5KA 2OZVA 2PL5A 5KYYA 2LZ0A 4C0QC 1UC5B 1ORVA 1XWWA 4JI8B 2ZZNA 2FMIA 3F2VA 1RRVA 2AVDA 3K5WA 2O8VA 3MQ2A 4FMDB 1DAOA 4NS4A 5EMHA 1PWXA 1TFRA 3TVYA 3FPCA 3UAGA 1LWNA 2QZPA 1DX4A 3VM6A 2LKDA 1AN0A 2JFGA 2O2IA 3OCXA 4Q3KA 4PPGA 4BUZA 1GZUA 5JYDA 1A5SB 2MSEB 4PSVA 3FKQA 4I99A 5LDGA 2SECE 3HKBA 4FE4A 2QX7A 1KTVA 5I4BA 3C7DB 5ECWA 4Q1CA 6PFKA 2JJMA 3C3JA 3LQ1A 1C8LA 1WXXA 4EEZA 2VPZA 2HB6A 3V7NA 3NHBA 1ZKDA 3GJ5A 4PYNA 3BL8A 5F5LA 4OMUA 3T0GA 2CE7A 3KTDA 4KE6A 1UM9A 2YC4C 1PG0A 2WJPA 5HIAA 5TJ9A 1R8YA 1TLTA 2GVNA 1TX4B 4XB6B 3WGKA 2HRDA 3L7OA 1DQSA 2P69A 5CDFA 1ZH0A 1QORA 2X0NA 2X1HA 1H8ED 1Q14A 1UJMA 3BH7A 4RLQA 3O1JC 1KMHB 1K4MA 3VVMA 2JHAA 4KQXA 2F3RA 3OT1B 3JD1A 4DL9A 4TV9F 3UPDA 2IYLD 2ZVDA 3MFYA 3IPLA 3QFSA 4NHOA 3AESA 4O4IF 1MXFA 4URFA 3BB1A 3JATA 4JD5A 4TRMA 4Y2PA 3WWZA 1U2ZA 4LPKA 3CJQA 2P9EA 3OX1A 4E1AA 4Q37A 4R6XA 1DEHA 5E3HA 4MDFA 2UXCB 4YI5A 3OD5A 3OT5A 3LUJA 4F92B 2DPLA 1E62A 2WHQA 2QAJA 4LOJA 4Z7JA 1SG6A 3OM9A 4G5SA 2FFJA 4A27A 3DOUA 2VATA 2HA4A 4AB1A 1FJXA 3OQ1A 2A0KA 3B8HA 4DIEA 5JSZB 4B3HA 1D1SA 1EHCA 1NSTA 2G5GX 4M1QA 4TTQA 3TOVA 1KETA 4KV9A 4X92A 3HR4A 1SKMA 2PJDA 3VYSB 4X95A 4XQ9A 4OYHA 4GQIA 3SFTA 4I1YA 1DFIA 3O8CA 1C81A 1XGKA 1CF4A 1X1BA 5BQ3A 5I7SA 4ZRNA 1XTPA 3H2KA 2ZU6A 1K4KA 3M34A 4RULA 1HKUA 3TX6A 1IBSA 1N92A 1TUEA 3BMNA 1IIBA 3ADPA 1FX0A 5JAMA 1Z2NX 2XE6A 3DYIA 3B13B 4Y8VA 3ADCA 3VJRA 2J30A 5CB0A 3R8FA 3I8OA 1PNRA 3MHPA 4PNPA 1CB0A 3RFCA 2A9JA 4QDKA 4J75A 3CR3C 4NBWA 1DO0A 4C7OB 5BWMA 1XCPA 2P27A 1GDDA 4KI0A 5DOVA 3BEDA 3K15A 3MRVA 3LD9A 2XKJE 3I5YA 2Z95A 5JXIA 3GWZA 2IT1A 2W6PA 3HUFA 2C2WA 4MV3A 1I3LA 2KLBA 2R96A 3LOUA 2CLIB 4DVJA 1F6DA 4MVJI 3D02A 3C8ZA 2FWRA 3MOSA 3PCRB 5CH3A 1XNQB 3BB3A 1F51E 2D7DA 3R75A 4C0LA 1EKXA 4I9UA 5CVJA 2ZRMA 3RVBA 3FWZA 1JSLA 2B7CA 3KG2A 4LXQA 1JNYA 4RQBA 3SM9A 4D9CA 4AYWA 3T5PA 1J2YA 1SXJB 4M99A 1LA2A 3GCZA 1CR2A 1V3QE 2G82A 3A28A 1ZU4A 4WCFB 4Q9JA 5KNBH 1KY2A 3ADOA 4CNQA 4PN7A 3BN3A 1AKTA 2W6QA 3EDYA 4NU5A 1CDDA 1X1CA 3A1TA 2HR1A 2Y1FA 1UADA 3DPSA 1JQ5A 2B78A 1UMCB 3N2EA 1U5AA 5D2CA 4BMSA 3WKAA 4ZIRA 4QG3A 5F3WB 1A2KC 4PHFA 2AUNA 2JCGA 2DKNA 3DMRA 2VSQA 1X19A 4Z0NA 3JALB 3ZHBA 2CLOB 3PVCA 3KKEA 4YUZA 1WCIA 1U8XX 5E4YA 1W0KA 3ITDA 3OJEA 3PI6A 5CH5A 2DKFA 2Y1KA 4BVAA 2KS6A 1R9NA 4BKRA 2K2WA 1CUSA 2IITA 4IIGA 5EIHA 4C7KA 3IULA 5BR8B 1K2WA 1ECJA 2BONA 1N2ZA 2H4FA 1MENA 3R0JA 5ICSA 5KZMB 1L8QA 2C92A 3G8YA 4KWCA 5DHRA 1KYIA 1HE4A 1Z0FA 3SX0A 2ZIWB 2GCPA 1DC7A 1SBYA 2MR6A 3GNQA 2XVMA 3E48A 2XJ4A 5E2AA 1M54A 3M1YA 4TGLA 2H7YA 4UZFA 3ZPXA 4C5BA 3FTDA 3L93A 2GAFA 2XXJA 2PLAA 3RAEC 2OY0A 1E3JA 4QXRA 2JANA 2WYVA 4F4JA 1RI2A 3KDSE 4XPIA 3HVRA 2W6JA 5E1DA 3GLTA 2ZIGA 1PJAA 3C43A 3VDNB 1P0QA 2HT6A 1JEEA 2NUAA 2VHEA 3RANA 2P3OA 3OQ6A 2JKYA 2OLKA 4C03A 4EMTA 1SC1A 1I9CA 4AFNA 5LD2C 4RJTA 1HEUA 4W8OA 3CX6A 1O3YA 2I2FA 1JEDA 2C4NA 3CKYA 4IHAA 1E89A 2QW0X 5CIQA 3DMDA 5KTMA 3X1MA 3MCZA 3WG9A 1NW6A 4WFKA 2XYHA 3ZNQA 1QGDA 4OQDA 4E0BA 5C1PA 2YZNA 1QGZA 5CA1F 4LSGA 2NYUA 3KYCB 4LJ8A 3W3ZB 3PKZA 1GPMA 4M9ZA 1GRRA 1Y1TA 3H2IA 3A3OA 1PYDA 1XTIA 2FP3A 1SBNE 2QXTA 4B80A 2D59A 3ST7A 5FORA 4WACA 5A7HA 4Q0MA 3VKHA 2FZ4A 3E1GA 3I0MA 2CXUA 1ZH4A 2IH2A 5CFLA 2EWMA 1CDZA 2FDRA 4LC0A 3QF7A 4AKTA 1W1WA 4L50A 5B64A 1WETA 2QBYB 4LX0A 1QSGA 1PLJA 3L79A 1Z35A 3D4PA 4D25A 1Q3TA 1O97C 4DGSA 3WA6A 3HJTA 2M1XA 4GX5A 5T64A 1DLJA 3IAAA 1HO3A 4R8RA 1A2QA 4G0OA 4HB3A 4E4YA 3BXXA 1L5LA 3SIXA 3EVGA 1MAVA 3EXHC 4GPAA 3AU9A 4KR7A 2XAAA 3BH0A 4G5RA 1JSRA 2QZZA 2R1UA 3G02A 3KR2A 3AL3A 3I4CA 1CQIA 1T8WA 1XXHE 1LD3A 1OVMA 1WA5A 1OBCA 4F9EA 2KX7A 4Q1BA 2AJBA 3KKKA 1VGVA 1CJCA 4K9NA 5FBLB 1NXPA 4KITB 1LPOA 4CI0B 3AEKA 1I8TA 1N6KA 3DFFA 5L4SA 2XECA 3HFSA 4HGZA 3ZDAA 1GQYA 2WM2A 4V0NA 4Y9TA 3T9CA 2HY7A 3LQFA 3ENQA 2V7VA 1X80B 3FKSD 4OVKA 1WMDA 2IIPA 2JIDA 3ULKA 2WJ6A 3FCYA 3TQIA 3II6X 4EPRA 1NBHA 3K16A 4RGQA 3TR5A 4O5AA 4F2WA 3DDCA 6REQB 4R2HA 2YZKA 2PMKA 5JD3A 5ALVA 3TNFA 2G6BA 4OMCA 1ZBQA 3PUIA 1XDGA 1LF0A 4FYJA 1SIBE 1XTSA 5AJUA 1JLLA 2F1IA 2TMYA 2Y2UA 1GILA 4LXXA 2OHXA 3QNWA 5TQ2A 2R6DA 2XMRA 4EZEA 5ALFA 1Z25A 1K8ZB 4R6WA 5JDCC 3V6LA 4RK4A 4JP1A 4RFSA 1S8AA 2JGMA 4Q3EA 4RA9A 1UR5A 1VGQA 3ITEA 1R0ZA 5FR2A 4AJIA 3PYMA 2FVXA 1VYHA 4WOPA 1DIBA 2VTEA 5CUQA 2QPAA 1G7SA 5FA5A 4K87A 3TZ6A 3QQPA 3H4IA 2E4XA 2ZRDA 1SC4A 5KJCA 1LNSA 2H48A 1NBMD 3K09C 5BYJA 1N4DA 1ZQ9A 2EZUA 3DGFC 4W8HA 4MWCA 1QYWA 3GCGA 2YWDA 1G20E 5L3SB 2IOQA 2E6KA 4PU0A 1C30B 4A10A 3QNMA 3TTTA 1U9IA 4V02A 2FJ0A 5DTEA 4AICA 1E94E 4AJ9A 1GCIA 4HUTA 3KFXA 2GZ1A 3FZEA 3L8ZA 4FGSA 4A8PA 3FN4A 3BQMB 1EVIA 1KGSA 2ZRLA 3S0JA 3Q5DA 5TR9A 3BFJA 3FUTA 1K6EA 2QRPA 5FWYA 5K8LA 4DCOA 2BRUC 1U1EA 3WK7A 1Q0TA 4OYLA 2ZE6A 1JH9A 2XUHA 3RH0A 2X4GA 1WCXA 1CZOA 1WM1A 4LYFA 1CUYA 4YJ2F 5EWLA 5AW7A 4BO7A 1LK0A 4MPTA 2WJJA 1W5BA 2R5NA 1ES9A 1NR7A 3AOGA 1W5SA 4GYKA 4EGJA 3CC8A 1Q91A 2Q1YA 2GCNA 3R3ZA 2E3JA 2NU9A 1GPJA 2QVBA 3HCEA 3ZXYA 2RCNA 4L85A 3M2TA 3B82A 5IVIA 1NY6A 2OHJA 1P3Y1 4NEHB 5BVHB 4EB0A 3L7BA 2PZJA 3CB4A 1SBQA 3HYTA 3K0AA 1ETHA 4JLDA 2OXTA 1RYFA 1U1CA 3MGGA 1SHTX 2VK8A 4G97A 3FNRA 1XR3A 3RHTA 3EBOA 4A2QA 4CU5A 5IG2A 1USKA 1Z15A 2IHTA 3IP8A 4JVMA 2BGLA 4PXSA 4ZOQI 3HBFA 2CNKA 3FXAA 1R8JA 4KX3A 5EJFA 1HTTA 4QAQA 1H8EA 2JS7A 2NSHA 3JARB 5JMOA 3VISA 4Y3UA 2LGJA 3K0CC 3TW8A 4YJ3F 1PQPA 4ZVSA 3RKRA 3V8VA 1TJYA 3GJ0A 2HF2A 5JQWA 3J7AC 2Y4OA 3TEMA 3WQHA 5EJ6A 3CG4A 2W00A 3AF0A 5J1TB 1K7CA 1X14A 2C2YA 2BD0A 1EX1A 1Z4QA 3OBBA 2DBYA 1KIAA 4RMGA 1DRWA 2DF8A 2PJRA 3P2KA 4MS3A 1DRVA 5A9SA 3SSMA 1U0SY 3TLGB 3Q2IA 1B8OA 1T9CA 4MW6A 3DTVD 1K7YA 4JHLA 1Z2DA 4M1ZA 4XASA 2CDRA 4RTRA 1PFYA 1KBZA 4XARA 1NULA 1AT1A 3H8VA 4FI3F 1JPVA 3R7FA 1MB4A 2D7CA 2N3ZA 2TYSB 3A7EA 2X0JA 4H4EA 1H0KA 1QIKA 3OOWA 4IDPA 3A6DA 1NVUQ 2XTNA 3DWGA 2PPVA 2ES4A 5FA6A 3D7KA 1W0JD 1CF2O 3LPAA 3UJ3X 3PA8A 4TS1A 3ONVA 4WKNA 1N6LA 4H1VA 5T3YA 3ZCXA 3NDPA 3GMDA 2Z0MA 3LC1O 1THZA 1WVIA 4IIJA 2QSUA 5HJEA 4EX7A 2ZREA 5JJLA 5FQNA 5C8YB 1KAOA 1ZXLA 2FMTA 3O8DA 5LZ8A 1HFEL 3H0EA 2O8FA 3G0DA 3F7NA 1GRNA 4NG4A 1EUQA 5C3UA 3PHBE 3RJZA 1Y8CA 4BMXA 1ODJA 1WNFA 2I2BA 2PO5A 3CJRA 3DEJA 1U6KA 1DWUA 4HK4A 1ISJA 3CH5A 1JFVA 1JGTA 1CUZA 3NM6B 4MJLA 5D8DA 3DKPA 5DXAA 2O8BA 3AU8A 3N6VA 2B69A 4P6VF 1JQ3A 1KJYA 3W6ZA 4U7WA 3P9QA 3UTDA 1OXVA 1A2BA 2A84A 3ZXUB 1U1DA 3W2IA 3EOAI 1GOTA 3KXPA 1BD3A 3DNPA 2IHUA 3GY0A 3EGEA 3IT3A 4BE4A 5J43A 1Z3IX 3A6ZA 5K6TA 2FZKA 4OBEA 3T7CA 1SG0A 2BR3A 1M2OB 3THWA 5HR5A 4RH0A 5H5JA 1T8TA 3HV0A 3A9UA 3IXQA 1P39A 4MV7A 4MVJF 4DV4B 5GQSA 1FVXA 4RELA 1NUPA 4G1BA 1TAGA 1M6VA 1Q1BA 2ZYIA 1BEEA 1RJ9A 3DE1X 5JH7A 1VLVA 3ZHXA 4IXNA 3ZHYA 4PQEA 1ZWKA 2NV6A 1BA2A 1H8HD 2J46A 3EQ9A 4Y6QA 5ESXA 2YS7A 5KTSA 1NHWA 2HUNA 3NTVA 3OD1A 4OK5A 3W8FA 2E5LB 1W19A 1JEYA 2FWIA 3GB9A 4R8LA 2XYRA 2V45A 2CZQA 2ZRFA 3EUEA 4TMYA 3KWLA 2RJOA 3K72B 4OD0A 4MHTA 1JIKA 4NQZA 1MZPA 3M8KA 5HW0A 4N0DA 2G9VA 1OH8A 3CXUA 5F52A 1KJQA 1NSFA 4Q3AA 1I33A 3H87A 1J21A 3U1BA 4C43A 2YICA 2R751 2VJBA 2Z2YA 3HB4X 4NBUA 3U9LA 1AKVA 3EVFA 4FKBA 1PRYA 4MK4A 4ZALA 5EMMA 5LOVB 4PYIA 3L8EA 4V1CI 2PNJA 5IK2D 3WLPA 2XA1A 3GF4A 1EFHA 3HCBA 3ZD6A 2NSDA 5TARA 2GYYA 4M0UA 2I0FA 3KYIB 4WUVA 4MYDA 3FYUB 3IP6A 5LP6C 4JC8A 5AJTA 1DC5A 1NXVA 3ET5A 3H8WA 1R6AA 2Q5LA 2HREA 2I7CA 4IRXA 4NMXB 4URYR 4X54A 4Y0VA 1KC1A 5GONF 4DUGD 1UBLS 3AFMA 3HO8A 2C7VA 4RSGA 4GI1A 1O95D 1EZ4A 1XYGA 2OZPA 2EZ4A 1XMPA 1VHWA 2G8LA 2PUJA 2X86A 1PT7A 1V1MA 2PWZA 4C22A 1Z2CA 4F93B 2WSYB 4JI3B 1XTBA 2A4KA 4MR7A 4BLQA 2XGGA 4M9RA 2C82A 1K7FB 3SG0A 3UQYS 1BHO1 4LDJA 1W49A 2O2ZA 3UENA 2H16A 2EJBA 4EHAA 1J1UA 5DYNA 5DM4A 1IZYA 3H99A 1T2UA 1C80A 4D5EA 1TZBA 3B1WA 1QKKA 3B89A 3G0BA 1B8VA 1C1XA 5G4KB 5LVAA 2W58A 1DOAA 1JHOA 1OMOA 4G8DA 4QNRA 5F7JA 5IAJA 1L7NA 4ZTZB 1T3HA 3B2QA 2OKGA 1IFXA 2HF7A 1SCKA 5I7UA 5IT4A 2P4HX 1UMDB 1N77A 2Z2XA 2BGKA 4AG5A 5BMVB 4YUAA 4BPRA 5BXQC 4Y67A 1WPRA 5G53C 3VR6H 4RUKA 4JI7B 1T3SA 1UJCA 3HKDA 4NZPA 2VL7A 5B1DA 2V9PA 4QGGA 3JQ7A 3B20A 1T0BA 2GKGA 3KT6A 1XD8A 1W47A 2R8ZA 5DRTA 1ZUWA 1AO0A 3PCTA 2HCJB 1K8YB 4P82A 3I6IA 3MCVA 4KQWA 4ZC8A 3IBGA 2IA5A 1O57A 1UC8A 3HWRA 1SHUX 4DJJA 1OYYA 1PZGA 2CWWA 4NV1A 4NZ9A 3PPYA 1GNQA 1K6IA 1TU3A 2A30A 1XU9A 5EJMA 2D2FA 2DTDA 1I4WA 3NZEA 1MTOA 4IP0A 2Y05A 2WUVA 2C7RA 1CEEA 4RLHA 5J1SB 2W7TA 2ZM5A 1L7DA 721PA 1Z4OA 1XZMA 4M0LA 1NRWA 1VLZA 5M5BA 4TKVB 4P0TA 2Q3BA 1EJ2A 3EEBA 3LUBA 3U39A 1VCMA 2XOXA 1W96A 5C9ZA 2IW1A 2HJWA 3FKSA 1SBIA 2OBMA 2CSXA 5REQB 3OM0A 4BN5A 3GJ7A 1X9GA 4U7PB 2X1LA 5L3QB 4YO8A 2H54A 1JEQA 4K6CA 1X94A 2VHYA 2X4LA 1SURA 2KQUA 1FNNA 1Q19A 3EWSA 4AZSA 3ZHTA 5LL6P 3U44B 3WHPA 1SY7A 1XI2A 3PRHA 4RF3A 1PE0A 1AQNA 1MXHA 1L8LA 5TEWA 4FWIB 2ORVA 3EDCA 4DCTA 3FMGA 2JH3A 2LIPA 1FSSA 2H57A 4D7AA 3N7TA 5EOVA 3QMWA 3EVAA 3PC6A 4ESOA 4AY3A 1V4VA 2WB4A 3AKYA 2C0CA 3IJ5A 4ZV9A 3S2ZA 4AY6A 3LGAA 1EFPB 1NBMA 1Z6TA 3MIZA 4CGYA 5J4HA 4FZ3A 2EG9A 1GU1A 1XKQA 1L4EA 4UFPA 3V8PA 4B3IA 4ER7A 1IN7A 1DAIA 1PVVA 2GTPA 4IZOA 4BZZA 5C53B 2O3UA 1HRKA 2W4IA 1AKUA 1U9JA 3ANMA 3H2JA 1E5VA 4LIPD 2OZEA 5IAKA 4FEAA 3FB1A 4DN6A 1UKBA 4NENB 3NHAA 1GA4A 2ZYHA 3DFKA 1U3TA 3BF8A 3G2OA 3WMRA 3RK1A 2V7WA 4LZLA 1TM4E 2I4IA 5CM8B 5FBQB 2O9JA 1ZRHA 3VU9A 3ORSA 1NQVA 4ZEXA 5SICE 3V42A 3LUAA 5IDXA 2QP3A 3FDZA 1FRNA 3RWBA 5BWOA 3LRTA 4S05A 1WXEA 4Q18A 4TX1A 3IE0A 7YASA 1CJKC 2IYZA 2NX2A 4K9OA 3VHXA 3F97A 4NYIR 1VKOA 2YVKA 5AQ1A 1RWBA 2WZQA 1DGQA 4OQFA 1VC2A 1GTSA 1V4BA 2Y6VA 1I14A 2Q9UA 4I4TF 1OLOA 4CCYA 4ZYTA 5I01A 2GWRA 1TU4A 1BFDA 2RGXA 1IQUA 2QTVB 1KGDA 2HRQA 3C3KA 4MS1A 3TVDA 3BMCA 3KALA 1F4PA 4G56A 1QTQA 3JSAA 1P7WA 2BHLA 3E8SA 5K45A 4PE5B 5LYJF 3TLBA 1KOJA 3AY0A 3T41A 3C74A 1MR3F 5BW5A 4B09A 5CLFA 5M2QA 3CLRD 3TG2A 3M1AA 5CK4A 5F64A 3VC2A 5GJVC 3UCXA 2HWXA 3RVLA 1UMKA 4R40A 4O4HA 2QWXA 3NHMA 3TAXA 2P9JA 1TI7A 3NO4A 1RP7A 4LV6A 1BKDR 1M6YA 2H1SA 3P9CA 2WSSD 3MMZA 2H4YA 4LJ5A 1JW9B 1ACJA 1LC0A 2BBTA 2GA8A 2PS9A 3IMFA 1E69A 1QFSA 1SUCA 4RQUA 2ZSFA 3Q2KA 1X13A 2PU7A 2VQ3A 3IPXA 3E1KA 4GU5A 3PUKA 3NEYA 2PAAA 1MIHA 2LDBA 2R2GA 5CVEA 1U04A 2C4KA 2AEEA 4LJ6A 1D0VA 4LOLA 3SN6A 3PFNA 2BBOA 3RVSA 4TLLB 5JBNA 2WYWA 2FEOA 4RVCA 3FVWA 3WX0A 2WYHA 1EDBA 1FSFA 2O3RA 4LY9A 3DTVA 4KTTE 2GD6A 1L4LA 4X66B 1WU7A 1IVYA 1U65A 2KE5A 3AF4A 4PAQA 1PGPA 4OHRA 5CX1B 5DIFA 1K3UB 4DIUA 4ZPJA 3DHVA 1N8NA 5C34B 3RIEA 4P3OA 2B98A 5KVVA 1GKYA 3S3TA 4XX0B 3KPYA 2QE7D 3VSAA 3VMFA 1N1GA 2PXXA 4YYEA 4U1RA 2QD4A 1KORA 1W0JA 2Z04A 2MT9A 2HHAA 2QJRA 2P67A 1Z7YA 1C8VB 1ZU5A 3P97A 3I61A 2C5SA 1HF3A 1J8MF 3GZTB 5B7NA 5IXJA 5A71A 3DEKA 4QECA 1OV6A 1Z34A 1ZEMA 2WSIA 2YASA 1ZLXA 4HD8A 1NW4A 3A7DA 4KIUA 1OXSC 1ZRNA 4FZ5A 4H7JA 5FUYA 3ZWPA 4BNDB 2Q5OA 3UEOA 1QGOA 1ND5A 1PCXA 3B5EA 2BUBA 2J3QA 3AHJA 3Q3IA 4PWZA 4Q9LA 4BC1A 3QVLA 4BO6A 4C0SA 2C3OA 2G1PA 4LHSA 2G72A 3JS5A 4QXPA 5F3DA 5T4HA 1DIAA 1DOHA 1H2HA 1RRFA 5KTOA 3K9GA 5ENZA 4QG7A 3T5GA 3WGHA 5AVVA 1PTJC 1YONA 1P60A 1ZL0A 3QPDA 2B1IA 2XBMA 5AJHA 5TVGA 2G9NA 3KX2A 1YZ3A 3NC4A 1VMEA 3RU2A 4YT4A 1SBHA 3VOTA 4WZ6A 3C48A 1OBVA 2GJ4A 3DOHA 2Q1SA 4XAQA 2WICA 3ELUA 5AM0A 3EBLA 5H8WA 2X8LA 1B3RA 2WJGA 4H1WA 2VQ6A 1OFIA 5LJIA 4MUHA 2QTRA 3GFFA 2HRZA 4OJNA 1ONOA 4J2HA 1WEKA 1TEXA 2GESA 4L6IA 4YJGA 4Q1VA 2N1BA 1U6IA 2FW0A 4WZBA 5DEOA 4IZHA 1LJUA 2GK6A 2P6PA 2I6QA 5GM1A 3TUZC 4CEJA 2Z6QA 1H8HA 3MTAA 2NZYA 1J39A 1EFRD 5FL7D 4ZYLA 4LZPA 4NFYA 1ODSA 1YQTA 3R9KA 1CE8A 3EVZA 1C4OA 5KYWA 4AG6A 4P7GA 1BMFD 3WK9A 8ADHA 1HDZA 4YP9A 2JRCA 1T5HX 1FLDA 3NBKA 2W8BB 4WN3A 2A88A 1VRWA 3KC2A 4HDAA 4G0QA 3E7FA 5EZYB 1X1TA 4E4TA 3U5TA 2NYRA 3C6KA 4IOKA 4UC0A 1RVDA 1KZ9A 1ZCZA 2CVPA 3D2BA 4Z9BA 4CIWA 5E0KB 2HU8A 5CCXA 4JXZA 4H4CA 5TDHA 3BBPA 3DO6A 4PRLA 5DXFA 3ZG6A 3B6JA 1G8FA 1KHHA 2C7GA 2QT0A 3JU3A 2P2DA 3K94A 3F1LA 3QENA 4GBMA 5IK2A 2EGUA 1ATZA 3RW9A 3TZEA 4LGCA 5A7FA 1V96A 5JIBA 2YV1A 3WJ1A 2PWPA 1DIHA 3DHNA 2WWXA 4FMDF 1N75A 3MT9A 4WKCA 2PKQP 3M5CA 1XAHA 1JR4A 2GN4A 3CY6A 5DNAA 3CZ5A 4YFYA 2BKEA 3FETA 2F90A 2PSHA 1JBKA 5IC4A 3NBZC 2BFPA 3LMKA 3KQHA 1O95A 4WV3A 2CVZA 3RRZA 2O3JA 1BVHA 4B43A 4KPEC 4B35A 1EDOA 1B00A 1GPUA 2WM8A 3I5UA 4FVTA 2VJQA 2R7LA 1O08A 3PICA 4HWPA 4DLNA 3JAWB 4G1VA 1WV1A 2C8LA 2Q2QA 1WX1A 3KPWA 4Z9YA 4G81A 2A3NA 3DUFA 1Y3IA 1NNUA 4PPYA 4Y2JA 2QMUA 1QQ5A 4M9QA 4RZQA 4ZVKA 1VDMA 1Z22A 1CQPA 1YCHA 1X7HA 2CXRA 2E0IA 2OILA 2Q41A 1SUAA 2H9IA 3HJHA 1MOQA 3I0NA 2P5TB 4B71A 3STHA 3NRCA 3FYHA 2OCGA 1KI8A 2FF5A 2L19A 4A4DA 4C08A 4AQYB 1DXQA 3R40A 2H11A 4IUCS 5FB3A 1KFBB 3GLRA 4JB2A 5EWMA 4HNSA 4EYSA 1ULUA 3TOZA 4EHLA 7MHTA 4V0KA 1H0RA 5HTOA 1ZC3A 1WMAA 4P58A 2IHKA 1M2JA 1SCIA 2IPNA 1QVZA 3KPUA 3SZMA 1TIKA 2PUFA 2JDIA 2GOYA 4RTOA 2AV6A 3G2NA 1KQFA 3NWJA 3DJFA 3RYFB 3CE9A 2COUA 3TK1A 1FNSA 3ISVA 1L6RA 3EGWA 4Z54A 2YWGA 4Y2RA 2O2EA 3G79A 1H42A 4RJ2A 1R5OA 4HWTA 3R7BA 2XNHA 2A1UA 2Q6LA 4FBGA 4BQOA 4NE7A 4QUHA 1NQOA 4JP5A 3FPEA 1ZMRA 3FPFA 1W4AA 4G86A 2PQMA 8ABPA 2OORC 3UJ8A 4JEUA 3CF4G 2JRLA 3UNXA 1TO2E 4FYHA 1WUIS 1SQ0A 1CUCA 1NI4A 4KQFA 3GLQA 3IAFA 2JAXA 5SZIA 4OXQA 2CFCA 3I39X 2NUTA 3VTAA 3ZD8A 1GL6A 3ES9A 3KDAA 2FSGA 1OI4A 5GIPE 1KI2A 2A9PA 1XLWA 3KXDA 4CFSA 1XVAA 1YA6A 1AZSC 3MELA 1O89A 2AJLI 2YN4A 3ZHQA 3U48A 3GO4A 5E4JA 3OLCX 1NQXA 1SVLA 2J4FA 2JZNA 2QROA 3NTRA 4OQPA 4X1OA 3CW8X 4F45A 2CEKA 3BSYA 2GEKA 4FFDA 2ZIXA 1GPWB 2AXEA 2ZJAA 5FHRA 2FGKA 5I7FA 3T3OA 3E9EA 3C8DA 4RVGA 3AEQB 5DBFA 1H2WA 3JQ8A 2WWWA 4ZOLB 5F98A 1Z6YA 3A3KA 3RK4A 5EHNA 1YQ9A 3QLTA 3PEUA 1I01A 4QJ3A 4EL5A 5JCJD 1II0A 1RAEA 3H86A 5J5CA 5E9WA 3MB5A 3ERCA 1G8KA 2I4TA 3DVAB 4LHWA 1XCBA 2CBGA 1Z6XA 2XCQA 4TOIA 2BPOA 4CIDA 1HDEA 3RGWS 5FTLA 2AOUB 5LSAA 5ITZA 3M5WA 3TRDA 3AWIA 4ZVUA 4DB4A 4ZVQA 1WF3A 5AHKA 2FMFA 5I7VA 2CV2A 2D6FA 2QVZX 5BQXA 4YGXB 1O5IA 4FONA 3QXSA 4EYOA 4DSTA 5JNWA 2FW9A 4E13A 3AIOA 4FIZA 2BFDB 4V0SA 1KMIY 1RPJA 1W88A 1SHLA 1X74A 2HNAA 2VBIA 2GPWA 3LK7A 5MGNA 3A6KA 4EW1A 3DBHA 1NVGA 2EP5A 1A69A 2QNRA 1D1QA 3SXUB 2NTYC 4G1UC 5DTMA 3C8HA 2R1VA 4DY4A 5FUQA 1MJNA 4EVSA 3C15C 3FUVA 3W5AA 4JJGA 4YAEA 3B9QA 4P9NA 2LIVA 4BQSA 5CHEA 3V4SA 2H2IA 4R1SA 4JB0A 4GZ6A 3OP4A 4CPDA 1PR3A 2C2KA 2L42A 5JADA 3PSHA 4Q9NA 3ZV5A 2FN9A 4L27A 3C4VA 1NJ1A 1GR1A 3T1NA 2WQ7A 1H85A 1YTUA 1RXSA 1Q7CA 3VNBA 2B5WA 4DA8A 4E5PA 2JFOA 5I7EA 1XYYA 2QLTA 5JV5A 2B5OA 3IL2A 1OWMA 3LUCA 2RH4A 4LGMA 9LDTA 2FSIA 1V7QA 3AEYA 3TEFA 1ZSYA 2DH5A 3QYPA 2EJVA 3UJAA 3UMFA 2C2GA 4EGAA 4V2IA 3CLTD 3R41A 1D8AA 1T0PA 3UZUA 3EH1A 4O3MA 3GWGA 1UBCA 3DV0A 3PDHA 1D2RA 3N3AC 4MZXA 4IWXA 4JZYA 3UFXA 4ESVA 3TQSA 3F3MA 1H2FA 1LPAB 2RK4A 4IH1A 1ZGHA 3Q5EA 2P2SA 4ZQEA 4B8YA 3L07A 8MHTA 3IAXA 1GUDA 1U2QA 4EECA 4PX2A 3KEGA 5LBTA 2F9FA 4CCWA 4H3KB 4B3XA 2O3SA 1H9CA 4UEWA 7REQA 1FYWA 3PF9A 5AJWA 5D6NA 4D4IA 1V6CA 5NULA 2JASA 1N2CB 2FYTA 2IUSA 1BE6A 1JAHA 1XF1A 2H2HA 1P17A 1YWGO 2IYAA 3PFGA 1CZUA 1XDDA 4RANA 2R8OA 5LQKA 2I1LA 2ZXEA 1VJTA 2QVLA 3GDHA 3V33A 3O1LA 4FMCB 1BE1A 3AC0A 2RGYA 3HGMA 1RKQA 4V24A 3RCBA 4DWVA 5LXTA 3S55A 2POQX 3CRNA 4FUTA 4RBNA 3FDXA 5EMKA 4EA6A 2JPDA 3PRYA 5A06A 4Y0NA 3WMWA 3PFFA 1N6IA 1YE5A 4R8MA 3CUEF 3HYLA 3B7WA 6ADHA 4A1OA 2MCFA 5CB6A 5B5SA 4HDOB 3L0ZA 2A0WA 3CS3A 2BF7A 3DWEX 1OYWA 3EXIB 3GT7A 3IOCA 3PC8C 4FXPA 5DFAA 2P62A 3T12A 1GYRA 2J0SA 1HBJA 3TZQA 2I3AA 1DWPA 1H5NA 2B4RO 2V74B 3AV3A 3F4KA 3NW9A 4C76A 4YAOA 1GM5A 4KBYA 4U7HA 4N49A 5T5QA 4QTTB 2JAOA 2ZJ6A 3FIJA 4MWGA 1H4TA 2QE7A 3IP7A 3OTWA 1Y8RB 3M0EA 1VCOA 3ABIA 1XROA 3JD2A 3F9IA 4TMVA 4YCJA 3VYWA 1U0NA 4R81A 4JBIA 4EJFA 4AWXA 3HZHA 4GWKA 1S01A 2VUSA 1COZA 2LVBA 3QJGA 2XPCA 1JDBB 1RXEA 4EHHA 1LLQA 5HQJA 1NMQA 1QANA 4C14A 1EXVA 1N1EA 1NF2A 1RLIA 2BFFA 3OWXA 2HJ9A 4FR5A 3GP3A 2P9GA 3AXTA 3MILA 4OGFA 2B3TA 3L1VA 3SFVA 10MHA 2WAAA 3IBCA 2R79A 3GAAA 1D2MA 1YULA 2XCOA 1SVKA 4CZ2A 1Z2PX 2W2LD 3CRMA 5CXXA 3RASA 3MCTA 1W59A 4TVBA 4UBKA 2A0FA 4OI1A 1DRUA 2KHZA 4UU8A 3PI7A 2VRNA 2X77A 4P08A 1I9GA 2Q6KA 1WDLA 3IVGA 1C3EA 2AYZA 1UBNA 1F8XA 3G0CA 4CLHA 1TW3A 1U7PA 3B6EA 1RPTA 3IMCA 4WL0A 5C5DA 3GARA 5DYGA 2WHPA 3S1AA 3GIDA 4PZZA 3JYOA 3ZC3A 3ZWDA 3FRHA 1XG5A 3LKVA 2MU1A 5KOJB 2W11A 3ZY2A 3GRYA 3KEMA 3OQPA 1CJUC 5IP5A 2Y0EA 3M7IA 1PLKA 3U16A 2SHKA 2EGGA 4AS2A 4A2CA 4KR2A 4XFDA 4U9IS 5FWAA 5C3MA 2GSWA 2GZRA 1LBQA 3GX1A 3NGMA 1PD1A 4WVFA 5AKYA 2F2TA 5MFPA 1U8EA 1NW8A 2F43B 2PA3A 3CINA 1C9DB 3DBLA 4IDNA 3BWCA 4ZT4A 2FCRA 1I5OA 2YOHA 3EAGA 5FYQA 3PHCA 2EFGA 1AKRA 2HRRA 5M34A 2RGNC 1DQYA 3ZS9A 5FL7A 1EFRA 4QPJC 2H1CA 2WBLC 3J7TA 4FGUA 4MPPA 1P73A 3OPYI 4IVPA 1V3VA 3PEVA 1V6SA 4H18A 4MDYA 2LP4Y 5DHSA 1QPZA 4WKOA 4C21A 4FCTA 3U7FB 1BMFA 3RUAA 2FK7A 2JIMA 3CVXA 1FFDA 2E48A 2MSCB 1ULBA 2UVPB 5KDDA 2UYHA 1OE0A 1FXWF 2DCMA 4OHKA 4BFCA 2AE1A 3SEFA 5KTNA 4N8DA 2HXYA 4W63A 1BYUA 1CR1A 5C37A 2UUOA 2YL2A 1F2TA 4LHYA 1AVTA 1PQUA 2P0AA 3ICPA 4FFMA 4GMXA 1ZMTA 1CQXA 4GPD1 1LVUA 2BY4A 5CGQB 4ZO4A 5DOZA 3S8YA 4CM7A 1LVHA 1OX6A 3KQVA 4JY7A 5I9LA 3BIJA 1ELOA 4TLAA 2PE5A 2QYSA 3A8TA 4H0CA 3GMIA 3ETNA 2QYHA 2QY9A 3T5DA 4ETIA 2WB2A 3P9XA 4IZIA 3MUOA 1BG6A 1ZPDA 2C7PA 1CQJB 4RSRA 1CUBA 2UVDA 5FPQA 3I45A 4I9HA 1TM2A 3O4IA 3MRSA 3WK4A 3SSOA 5ALQA 5A4AA 3QXHA 2XODA 4MIEA 4BBJA 1Y1LA 3ZDBA 2G04A 2P40A 4W1QA 3VJKA 2IYQA 2PZLA 3NWEA 4F1WA 3JWHA 1EIZA 1ZX1A 4FE3A 3OQHA 4TTAA 3RAJA 4ZGBA 1IUKA 2DUMA 1Z6GA 3EY4A 4WZAE 5CX4A 1CZLA 2P11A 4GPTA 4JI1B 1XELA 1H69A 4TV9A 5B6IA 1VXOA 2HN9A 3EXFB 5JTTA 1ADFA 1UXGA 3W78A 1UJ4A 2Y1XA 4C7BA 3ZJVA 4MRSA 5AUQA 5LNK6 1H3EA 3ZH9B 2ZAGA 2ANBA 3TH5A 3BHIA 4R7TA 3RSOA 2BTQB 3VQTA 1HDCA 2OE2A 5HIKA 3H3FA 1PLLA 3GJ6A 3QYFA 4EL0A 3Q7SA 1ITZA 3FNEA 4HLUA 4OUDA 3P20A 3UWDA 3V1UA 3PZRA 3IV6A 2IS1A 3UYKA 1OC4A 3ER6A 5YASA 4XYBA 3RYIB 3Q6IA 4F9TA 1PL0A 5AD1A 3K9QO 2OPHA 3RIMA 1EG7A 2JKVA 3CSUA 3ILHA 3AH8A 4P0QB 4QGFA 1AUXA 4KV7A 4KVZA 1RKBA 1EB8A 1N2BA 3H11A 1KRWA 1P4AA 3NMUF 4P2GA 4WXYB 4I4NA 5AIBA 1CT9A 1FUUA 2GXQA 2XLCA 3C3WA 4H6PA 3RVPA 5CHYA 1IQ0A 5KWIA 3PSAA 2RC6A 3OU6A 1E3TA 3WGMA 3ILVA 3G13A 1UBMS 3K8OE 4KW7A 4MRNA 2Q99A 3A9RA 1CBUA 3ML1A 4LBWA 2ISSD 3SJAA 3TO5A 4DADA 1W36D 5ULLA 3Q98A 3RJ9A 1WOMA 4AZ3A 2QR3A 3SZ3A 2HJSA 3H19A 4HRVA 4JOCA 4L3VA 4XSHA 2YV4A 2BR5A 4J7UA 5IDYA 4PHCA 4BJ6A 3ZLTA 1LBHA 3DOOA 1ZMOA 2QRVB 5JZSA 2C3PA 3DMYA 4OSOA 2P90A 4JUDX 2JEOA 2QG4A 4Q01A 5ERXA 1MB9A 2FPLA 5K0JA 1B8PA 3IAS6 3WDSA 5BPHA 3U3JA 2F6RA 2GHQA 3CNEA 4W4TA 3PQCA 1B0AA 2FPOA 4M22A 4U7GA 2O48X 1E6UA 1TE2A 4CIVA 1PJ2A 3AQ4A 3RE1A 3BK2A 1E0SA 5C8YF 4W5NA 1WWKA 3JZMA 2RH9B 3AM5A 2IHYA 2TMDA 3ABZA 3F5QA 5BV7A 3V4FA 2GPJA 1DCKA 5JCJA 5CEFA 4DWWA 3DMHA 4NMMA 1C7QA 5G1PA 4CN9A 1TIBA 2NACA 4MVJD 3I9JA 2GM5A 4YRJA 4MQEB 2ZKLA 4E3ZA 5BUQA 3HJFA 4X1KA 4YXFA 1XXLA 5JWOA 3DB2A 1KO7A 4ITRC 5DM0A 1GAJA 3ANTA 2VQDA 3K4HA 2QTBA 1AM4D 3U13A 5CYPA 3ENNA 1OAKA 1A3CA 1M74A 4B5KA 3FOWA 4B76A 3GROA 4CMGA 2M2IA 2XE8A 4HNAB 2XUZA 4OHXA 2E4AA 1JVSA 3BWBA 3PJFA 3RS0A 4L5YA 3HADA 1SKBA 3TRJA 3WRYC 3WZLA 4BQQA 4NCBA 4R8KA 4BV9A 3OE4A 3PGA1 5I8WA 5KKCA 1X7DA 3NRJA 4Y7CA 4BRWA 3WS7A 4PIVA 4WPGA 1C3OB 1W52X 4K9DA 4YIHA 5JZBA 2V6IA 3MLEA 1HNNA 3LH5A 1RRPA 1TF2A 5JCXA 2WUWE 4NU8X 3F46A 2VJDA 4YAJA 1XMQB 3I3SR 3EQ6A 3H2ZA 1QIIA 3R24A 5AI6A 2OQRA 4WT7A 2XNCA 3K5PA 5TMBA 4DDUA 3VVBA 4DT1A 3OURA 4A82A 4MS4B 4PZLA 2YIMA 4G25A 3HXLA 4MINA 3DO5A 4HQ6A 4I2NA 1KF0A 4YDHB 2NUBA 5B2ZA 2R2AA 1PW5A 3TKLA 1KTIA 4OYRA 4B6OA 5EY5B 2CSUA 2XHEA 3ZE2B 1XZLA 5FTNA 5HDBB 4R54A 3GRVA 4FFLA 1L7MA 3KVOA 1E4YA 4ONEA 3SR3A 1CLUA 3TOXA 2XZOA 5H02A 1U2TA 1U3VA 2F3TA 5FOSA 2G06A 3JY6A 3TZKA 3VH2A 5AW0A 2H1FA 5BSTA 4Y9SA 1N0HA 2VLBA 1FDWA 2ZRPA 3F2IA 3SJ7A 3ZI7A 3HY6A 5KMGB 2OHIA 5DRYA 3SQWA 3EF0A 4IXWA 4MI6A 2YWXA 4L76A 5KQPA 5LOVF 2D0PB 4UUOA 3B1FA 3F3YA 3EXG1 2QAGB 4M46A 3UB3A 5L6LB 3IKVA 2GPSA 4UNRA 1KEEB 3M6WA 2HK7A 3DHWC 1XU7A 1IULA 1RWXA 1OZ0A 1NI3A 4A9AA 4BMCA 4CEIA 2C03A 3M1LA 1E3QA 2AG8A 1C7EA 4OFXA 3WLQA 1UFVA 2NSYA 4H17A 3FNGA 4I19A 1JG3A 1E2NA 2SKDA 2JLCA 2VAPA 2AG1A 3CNQS 3GCXA 3PQFA 5KPJA 1I1NA 4WLVA 2ASVA 2R11A 3M6XA 1L9XA 1FP1D 3T3PB 3H05A 2IYTA 4ARIA 1G63A 2ZRNA 3H5AA 3FROA 4KQCA 4MTLA 2P4EA 3GGDA 3K31A 4H15A 1A95A 3TLAA 3VA7A 1QFZA 4PO9A 1RHKA 4EGSA 3FCAA 1KFJB 3EIFA 4IFIA 5DYWA 1L1FA 1ZHOA 1F1BA 2A5JA 1F5NA 1EBUA 2CYBA 2X19A 4G67A 3ZWQA 4CTJA 4ZDIA 1SUDA 4HGNA 2DHCA 4RLSA 5JRDS 1TMYA 2G70A 5DDIP 3T7TA 4Q05A 1QYVA 1S2MA 3K5IA 3L92A 2Y77A 4GI5A 4GR5A 2IY8A 5AVTA 2PD4A 5A05A 1HYBA 4U2GA 1L4KA 3OOEA 5AOVA 4C0XA 5JY1A 3ONWA 3LX4A 2R7AA 4J90A 5BSGA 1JTVA 3TWOA 5B3JC 4MHOA 5BMVF 1VHLA 2IP2A 2NZWA 4AMZA 2P1RA 2RHRA 4EELA 5A02A 5CG1A 4L1KA 1X3SA 4L78A 1VKRA 5AK5A 3LX8A 4IXDA 5KO2A 1TJNA 2YNMC 1IHYA 1L5WA 1GLVA 1XTZA 2G28A 4TKUB 3V8BA 3EZ2A 5AESA 3VPBA 1M1YE 3QTTA 5CW2A 3WGIA 2DAPA 3X1XA 4PLCA 5SYAA 4TSRA 1EINA 2C9CA 3UW3A 5J4LA 1V11B 2FSVC 4P98A 5EYPA 3L02A 4YRIA 2HMTA 2HPVA 4FFRA 3JWIA 4CNBA 3K9FC 1BWQA 4IAOA 3W6PA 1WD7A 2IUYA 4NK5A 2ZUVA 1K3FA 2W2LA 1TCCA 3GVIA 1IVNA 1IXKA 2NW6A 3HQ4O 3HRKA 2PVPA 5CYFA 1QH1A 1KDZA 1OKKD 1TQ4A 1TRHA 2FP4A 3R7WA 2WG1A 3AUFA 4CKWB 3HACA 3PGXA 4P5PA 3BMQA 4REMA 4B3BA 3U62A 1QRAA 1D6MA 2GAIA 4UQPA 1CIJA 4LJKA 3E1SA 4B5LA 2PKYX 1W44A 3ANSA 5KSZA 2JGAA 4BKMA 2FHPA 1ENYA 1GFSA 4Q4AA 4KR6A 2A33A 2CUKA 4NULA 1Y3DE 4ZYYA 2O1SA 1YGYA 3DZJA 4E03A 4M4SA 1M72A 1DWOA 3UY4A 1U8CB 5LWQA 4HDRA 3DP7A 2OFPA 3AIKA 4D56A 4AVYA 3FMFA 2M9MA 3X0DA 4GOND 3OPMA 4HN9A 1G2PA 2V59A 1ZK3A 2AG6A 2I6XA 3DAHA 1PJBA 4OHBA 3QKRA 4MWZA 4DOMA 1WD5A 2ATEA 2JGEA 3MJ4A 4UHCA 5DGDA 1IK4A 1CJSA 3TM4A 1E4VA 5EC8A 4FHZA 4M9CA 3BX1A 3RYTC 1XQVA 1I0ZA 2HQRA 4LGYA 4BB9A 3B53X 3UM9A 1NV8A 5JU6A 1L5VA 3WFZA 1FS5A 1NQUA 4DQKA 1NZJA 4X6LA 1TOAA 5HYVA 1G2IA 1U99A 3KIPA 4J1TC 4Q1FA 1F3LA 3LS2A 3N0RA 3ONFA 3IUJA 1CD5A 3QSYA 3AEUA 1BTOA 1V71A 3AUYA 4PBSA 5B1IA 1IXZA 2JBHA 4YV7A 4DR5B 3DAYA 4EUEA 2QDKA 4OGLA 3VC7A 4IIEA 4ROSA 1ORIA 4HQKA 4ACBA 4R3WA 5ISMA 1P6XA 1T8RA 2W70A 3IXLA 3ZDXB 5E0OA 4ENQA 1RQXA 5FNVA 3D6JA 2RHGB 3UKDA 2DFPA 1XTUA 2DUNA 2HBZA 4QJIA 1LH0A 1EM6A 1OLSA 1Y5RA 3E3AA 3ZHZA 4P84A 4L08A 4MAAA 4ZCSA 3K2QA 2J3EA 4QUEA 4OAOA 1YRBA 2C9YA 2GASA 3RS8A 3VZBA 1N78A 2E2WA 3OEHD 1EFVB 4YJ3A 3D6UA 5KS2A 1C9JA 2Y93A 1XJ0A 3DC7A 3GAMA 3QPWA 5KHAA 3PUYA 4E11A 3Q88A 2GM4A 5ALEA 1U7DA 1XD2A 3CEAA 3VX3A 4KBFA 4DLWA 1D04A 3EG5A 5FYDA 1J70A 1TZMA 3IQIX 2QP4A 2C29D 3K8QA 4JKOA 4L9AA 3SZRA 1W4LA 7AT1A 5KQRA 2YZMA 4FBLA 2AXQA 2H59A 1U28A 2QGZA 3H9QA 2HSJA 3INYA 1SOUA 4RPLA 4TZTA 4DCMA 3U6BA 2HQOA 2ZFUA 2XQGA 4LRXA 3KXIA 4TT8A 4LAFA 1FPMA 1CK4A 2BUAA 2ODBA 3LIIA 1JALA 4L6AA 2BEJA 2VKQA 4NARA 4QYIA 5BWCA 4NMLA 1IRXA 5LZ4A 2ZROA 1CR0A 5C8ZA 2HEIA 3OJWA 4FEEA 2H07A 1FRFS 1I36A 1E20A 2DHRA 4XGKA 5FR1A 3WTBA 1PP4A 4HG2A 4XLLA 4KYUA 4ABTA 3SMVA 1OXXK 2R5FA 4H0NA 3SBOA 4G1FA 3T9BA 1RZVA 3L0IB 4LA4A 2Q5EA 1SRRA 2PRSA 2HWKA 3T4PA 1VKHA 2GRJA 4KPYA 3AUXA 3L46A 5DN6D 4Q7KA 5I3ZA 2ZJ4A 2IEZA 2XCIA 5CH8A 3RKSA 5J2TB 4LE1A 1EXMA 2XZTA 3FWPA 5DCWA 2OB2A 3M6AA 5AH0A 2J5BA 4PG6A 1U11A 2C99A 1FFYA 4FT4A 3DLIA 4IUBS 4OL0A 4NIMA 4KBGA 4CKXA 2CF5A 1JV2B 4PGMA 1DZIA 4X20A 3K20A 4JEIA 2C07A 1XNGA 4BVEA 1Z29A 2C1XA 5F77A 1T25A 1XZIA 5EIAA 1D4OA 2QVGA 3ESBA 3F6RA 4PG7A 4YLEA 3QVKA 1A9QA 1L7QA 2YJZA 4EFKA 4RFLA 4W99A 2CXXA 1K3TA 1UFRA 3GZ4A 3CPJB 2CJWB 4M8KA 3EPRA 5ELMA 1NYTA 4FLEA 3RC2A 1YZYA 3E22A 3S2IA 3GRZA 3STWA 1RU3A 1LQTA 1AGNA 3C6QA 1UK6A 1SB8A 3NR2A 4GPIB 1QX3A 4GVLA 2FJUA 4ZQFA 2O3QA 3VOSA 3O8OA 3CNLA 1EHYA 2XTJA 4L8YA 3OMWA 1WXGA 1BXGB 2QTFA 1MRNA 1SAYA 2Q4BA 4MVJA 1NFQA 4J94A 4KOEC 3RM3A 4E5UA 4F56A 4MEAA 1U80A 1ZMXA 4AO6A 1AMNA 5ECGC 1JTEA 2XCLA 1ABFA 3H8JA 5UKDA 2ONJA 1NXQA 1WNTA 2GDJA 2JHGA 4IRMA 4YAUA 1DT5A 4DLBA 3EG9A 4JBNA 5JXWA 1HNZB 4Q5IA 1X0XA 2V6GA 4JUBA 4IH4A 3OQIA 4O2RA 4P3PA 3K0BA 3AB8A 1HMPA 1WHSA 3QVWA 1UBHS 1DC3A 2R4QA 2R85A 5B1SA 4P33A 3ZVMA 2R8BA 4BLWA 4U2DA 4W1RA 2HWWA 3U26A 3TSYA 2PZ8A 3U7QA 2FMUA 4CL2A 2PX5A 3DLTA 4GZLA 4L3OA 1R0XA 4B79A 2HCFA 1YZLA 3HKBB 3DZHA 2I1WA 3ESCA 3UMVA 1RT9A 1QDEA 3KWMA 1H9BA 2JB9A 1IZ9A 3KD3A 3WGQA 4DKXA 2HCTA 3PDUA 1AK9A 3NRBA 3NHKA 3VZSA 2BEUB 1T9ZA 5IH3A 4KR0A 4CDGA 3EDRA 4RD3A 3UMJA 4ZYUA 3FCUB 5IKMA 1KPHA 5E3IA 1BAPA 3O7WA 3EA5A 1UM9B 1ZL2A 3GJRA 4DLUA 3DL4A 4P7JA 2AQIA 5FIUA 2ZIUB 5LD2B 5ED0A 5LQJA 4JC0A 2QQEA 2OMEA 1BGXT 1PJLA 5DK4A 1PV4A 2XB8A 3OZUA 5EAIA 1NFRA 2ZRHA 4LDNA 5EZYF 2CB0A 1HX7A 4N5MA 4UOZA 3UH1A 4ENWA 1OFUA 2WQZA 5MN4A 3EOBI 2WF8A 3P9RA 5ALZA 3E3NA 4KGDA 4P35A 4F1KA 2WYOA 3C5EA 4YT5A 4EW3A 1N32B 4ZT5A 4BLTA 3O82A 1JF8A 8GPBA 3JATB 3IIEA 1HQKA 3DEIA 5EP2A 4E5MA 3K1AA 4ZYZA 4EYEA 2XSZD 1XRMA 3GT4A 5TPZA 521PA 1JXQA 1FK8A 2CL5A 2AC2A 2J0UA 1ZIPA 4H1TA 5A3SA 4R2JA 5K3EA 4QQ8A 3CNNA 2I6UA 5DYTA 4X8MA 5CDGA 2BJVA 3QLVC 4X60A 3GLGE 3A3PA 1RS0A 1DX6A 1Z38A 3FW1A 1FLAA 2R8XA 4DIKA 2WTAA 4PLFA 3C3PA 1TD9A 2A78A 1EK1A 1N2GA 1UP6A 2ZBQA 4C3UA 2WWIA 4HDMA 2GK4A 1AKNA 1CERA 1EPUA 3SYKA 4LDQA 4D80A 3NIBA 2PY6A 3RC3A 3VPXA 2B0JA 3TOCA 4RHEA 1FDOA 1T1EA 4Y2HA 3PP8A 3KUXA 1M8GA 4BHTA 1N2OA 1WY7A 2R1TA 1CS0B 1K89A 4UU7A 1SIOA 5C1OA 1Q12A 3KAJA 1K27A 4XQGA 4UMFA 1AUQA 4Q3BA 3G9QA 1GGFA 4EWLA 5HMLA 3PNYA 3RPEA 3RC8A 4X9XA 1KMMA 1OT5A 3JYLA 3UOAB 1V3TA 2QHXA 1EQAA 2CZGA 2RHCA 2VAXA 4RLFA 3OZDA 3U19A 4ICIA 4LJ9A 4PX5A 3U4QA 4ZTUB 1NUUA 2YX1A 3ZX4A 2QSYA 621PA 3DZCA 1MG0A 3I4FA 5LZ7A 3VAYA 3HB1A 1JU4A 1WZNA 4AQDA 2VDLB 1KSHA 3LUKA 2IEIA 2F3QA 3WGGA 5K20A 1DE0A 1YDGA 3WNQA 2R3SA 3W5IA 4QJBA 1GZDA 1EFCA 2GX6A 1P4GA 1DBSA 2QTZA 1E59A 3IQGX 3NFRA 4JJFA 3RVKA 1CDOA 3WWCA 4ECEA 3U7EB 2VCHA 2QYOA 1J2UA 4EP1A 1Q5PA 3V1MA 2BFEA 3VUEA 1MA3A 1SGWA 4KEAA 1V9SA 4F6RA 2CV0A 1A8SA 3U09A 1OKKA 1EJ0A 3I9KA 1FDTA 2GCOB 2DFLA 4OLFA 2B3DA 5DCLA 3IGFA 4PYMA 4YBRA 3GMTA 3HA7A 1WW3A 1DG1G 5AM2A 2PKQO 3EMBA 1V43A 1LCIA 2WJZB 3A05A 1J06A 1XTTA 4Q9KA 1VIMA 4EKGA 2J9FA 2C2OA 4P22A 4RPHA 2O52A 1X8KA 2UZ1A 5EE5B 4A8TA 4YRMA 3OT4A 4LOHA 3HZRA 4IDAA 3FYSA 3PQ2A 4WXMA 4UZSA 3EH2A 4ZOLF 3O2SB 2ZPUA 4WNCA 4BN4A 3FPGA 1EFDN 1NY5A 1OHHD 3VHQA 4E1BA 3DD5A 3RS7A 3N76A 1NJFA 1BDIA 4JLPA 2HHLA 4MUGA 2C00A 3FG9A 3AHCA 3H8SA 3I01A 2O2HA 3UAXA 4L7VA 2B36A 3B1XA 4JLVA 4DYVA 4KQJA 4NFLA 2WJ4A 3X2FA 2PMBA 3NASA 1CUUA 2HXGA 4OM8A 4COKA 3DKVA 1B7GO 3DVQX 1Z0DA 4L7QA 4NZNA 4Z8XA 4CR6A 1OREA 1ZK2A 2P3LA 1B8NA 2V6JA 4AP6A 1BDMA 2X1MA 2XVXA 2DM6A 2YMLA 3IIIA 2I7VA 4XH9B 1W75A 3S5JA 4DMFA 2ZBRA 1T2FA 2XB4A 2A9OA 1MC4A 3GZJA 2VJLA 2A7XA 3WNBA 3WRXC 4CMIA 3ESZA 1TYAE 2UV8A 4Q66C 2NUAB 3QVOA 1NR1A 1W8IA 2Q5IA 3GLHE 3M83A 2IF0A 2EKDA 2W90A 3A0RB 3OZRA 5HUHA 1XKXA 4CF7A 2IHNA 1UF9A 4MUKA 5FPYA 4KTVE 1QB7A 3UMYA 5I5GA 3RRNA 1KI7A 3AINA 2HADA 3GZNA 4IMIB 4BV3A 3NHUA 3OIUA 2GO7A 1Z74A 4MV4A 4JCCA 1XZGA 5CIYA 1E2FA 1FY2A 1VPEA 3JCZA 2A0XA 1WMSA 4I4TA 4JIMA 4GI3A 3TIVA 4HX9A 3V1TC 2BM0A 1XU4A 4HGYA 2EOAA 1HYHA 3WO0A 4IBOA 4ZO9A 3DF7A 1G21E 5ANRB 3LZCA 5LYJA 4DF3A 4E09A 1Y33E 5C4IA 4BEBA 1L4HA 4JMLA 4JJKA 4KDEA 3ZKWA 5IDQA 4X93A 3OY7A 5FBWB 5IYZF 1XRRA 3OEHA 3ZGZA 3IKTA 4X3PA 1ZGZA 4RHUA 1JXOA 4RF5A 1FFAA 4M1WA 4Y2TA 4LNAA 1R18A 2C3MA 1UJ5A 3UAOA 3CSSA 1CY0A 1KYWA 1NJ6A 2JBWA 2SICE 1IDOA 3GHYA 5AI0A 5AVJA 3W34A 1WXWA 3A2MA 1NW5A 4P3KA 3LSTA 3IYLW 2I2CA 2D1RA 2F3PA 3P8ZA 1CQIB 2IDZA 4MYUA 3L04A 4G0NA 4H6WA 2Q6IA 2JFZA 4GOLD 3OFJA 4G2NA 5ESRA 1NAIA 3PF8A 1OGJA 3GD7A 4FMCF 1Z5NA 2XI4A 4OY3A 4ZEMA 1Y9AA 3QEOA 2X8JA 3H04A 3I53A 4HLQB 3A14A 1ULZA 4MR9B 1V35A 4HDQB 4BLVA 5JPDA 1XL0A 3AEKB 1IEVA 3IUMA 3OIFA 3NKVA 1ZS9A 2Y2VA 2H6EA 1H5QA 3LHKA 3R74A 3TLKA 2G0NA 1QUFA 2EW2A 4YI3A 5J59A 1SVOA 5DN6A 2ZRCA 2HA7A 2IE8A 4PQYA 5JAPA 3IJRA 1E32A 3LYUA 3DEZA 2QF7A 3LHFA 3KCNA 5JSQA 3GUZA 5E8RA 5JZ9A 2H4WA 3Q11A 3N07A 2BDTA 3SF8B 4ENRA 3ZD7A 4YTEA 3GPDG 3OCJA 4PLGA 3O2QB 2X9GA 3GEDA 1JLLB 4Q02A 4ND7A 4B46A 4LI0A 4BMNA 1BNCA 4B4VA 5LYYA 2XEXA 1FMJA 1RWMA 3QI7A 4FILA 1ZKMA 2YJNA 3C87A 5ALTA 5TQ2B 4AJJA 2GZAA 4MGIR 1GL9B 2YMQA 2JA2A 2A5LA 2TSYB 2ODWA 4XIIA 5H0IA 4EKNB 1KEZA 1AKQA 1NC3A 1X92A 2H2FA 2AJTA 4RA9B 4S1WA 1B0PA 4CKEA 4LMRA 3IO3A 3K0SA 2IYXA 1TK9A 2GN8A 1XZPA 1JDJA 1JT9A 2NPFA 6ABPA 1DAPA 3RVDA 1MB0A 1Z5VA 4GUDA 1GIAA 4CCAA 3WA7A 4C6TA 2OAP1 2GZ3A 3LVRE 3UANA 5C32A 2RH8A 5KX5F 5FULA 5C8VA 4H9GA 1KO5A 4KUEA 3ZIAA 3SS8A 4CT0A 1KZHA 3NT5A 3A1UA 4NZMA 5CYOA 4MARA 3SVLA 1VIAA 4EY5A 1HDYA 2V0NA 3ITNA 4IHKA 3CT4A 1TF7A 1NOIA 3LZ6A 1PJCA 5FWYB 4QVIA 1KVTA 1O4VA 2F00A 3C14C 1PKXA 4FZJA 4V0QA 2YWJA 4AKEA 3A2LA 3MEQA 3P0IA 1G2OA 1NXSA 1Q92A 2YJ4A 5EWLB 3PJEA 5ECYA 3BA1A 2FCAA 3OI7A 1T6XA 5BW4A 1SHZA 3KXKA 3W8EA 1D2GA 1YO6A 2FPXA 3MAGA 3RAPR 1QO7A 2V03A 1JAIA 1X8JA 3IT1A 1W35A 3MWLA 1I10A 3K71B 2NU9B 2Z3WA 4BMPB 3VR6D 2WPDA 4FM9A 5FLXA 1J1IA 4JVOA 5LP6B 3NT2A 3CUKA 3JZAA 5JD5A 3K0AB 1A77A 1XX6A 1PZNA 2LV8A 5ETJA 1LX6A 1CY2A 3AY7A 3QEJA 4NATA 4ZV4A 4WK2B 3PNOA 4QLOA 2IXEA 3PXAA 1G0NA 2ZJ7A 5FJJA 4B7ZA 1V5GA 5FQOA 4RIGA 2JF0A 2K4MA 4HPJB 3LA6A 4V1CA 3AOEA 2PD3A 2JZOA 3OCWA 4GOJA 4UVDA 5FL3A 1E9DA 2KPOA 3SLRA 1RIIA 2VYVD 4C07A 4ZQHA 1OXMA 2EFEB 4IJMA 3KNZA 4QHSA 1NUSA 2RBEA 5CNJA 1QVWA 3M3DA 1GSIA 1MFPA 2HA6A 4UEJA 2Y1CA 4ERNA 1U2DC 2XSZA 4TMZA 3P0JA 5E2BA 4IF4A 4B6PA 3TFOA 1P0FA 4MS3B 3SICE 4E5YA 1GL3A 1YJBA 1NX9A 3M49A 1P1KA 5HE9A 4KVGA 3CH7A 4UHJA 3U0BA 1TAHA 1HWYA 1JB9A 2GCIA 3SI7A 2GAJA 1ZD4A 1RM4A 1FTWA 2ZU0C 2BZ1A 3FY4A 5EJGA 4QQRA 2E9SA 4F4IA 5JHHB 3K6JA 4XTRA 2ZJZA 2NPIA 1P19A 4EBBA 4BBZA 4G1EB 2ZWAA 3MTGA 2OMKA 4RZSA 4DJFC 4RGBA 5KYXB 4C9BA 1H2RS 3NATA 3W5SA 4C7JA 1MH9A 4K0KB 1XPUA 4TL8A 4C0JA 8AT1A 3FTCA 4KMSA 3VZQA 4NS1A 4R68A 2R62A 3T38A 5EKDA 3OUZA 4KACA 1DEAA 4XQEA 4HAZA 2Q6VA 5MF6A 3VZPA 3IO5A 3PRKE 3DONA 2O8FB 4KPUB 4L5BA 1IAQA 2Q7DA 4LKOA 4MJ7A 3T0IA 1GSOA 1HUQA 4ZOCA 5F2KA 1TGYA 3FPBA 3QFCA 3N8KA 4IVNA 2H0AA 2VHQA 2QMEA 3TL3A 1SCJA 1VLJA 4J29A 5D3KA 5AJZA 3HCRA 5KNBD 2PBLA 5JLAA 3UCEA 4P5EA 3NNNA 1XSEA 4WQMA 2GARA 3I5XA 3IUPA 2OCKA 3OWHA 5DX8A 3ODPA 4YX9A 2IL1A 1YA4A 2NZ2A 2R87A 2XQIA 3I92A 3G2KA 3I30X 3NQ41 1SR8A 3QUSA 4ZCQA 2WUGA 1NVMB 4WMLA 4PNHA 1IPHA 2XDQA 1KC3A 4LK2A 3A1CA 1NLMA 1M6VB 2P6NA 5G2OA 5IARA 5JH7B 1RJ9B 1QQBA 4J7XA 1JHDA 1UOEA 1YQGA 2R48A 2NV2B 1WUYA 4HEQA 4C7OA 4EY8A 3LWDA 4W9RA 1NUAA 1LJLA 3MA0A 4FN5A 2A5YB 4XEHA 1KAMA 1HFJA 2QB5A 4D99A 3PR3A 4UBIA 4C7XA 3UHOA 3W0LB 2RAUA 5BSVA 4Q3CA 4TXLA 1EESA 3CCCA 4DXDA 1SD5A 1MKYA 1M9NA 1MO4A 1VE1A 2WUFA 4BNFA 1AKYA 4DCGA 1LSJA 4E08A 4Q1EA 1DKNA 3R20A 2DLNA 2H4XA 2Q29A 4GC9A 4I4CA 5JW6A 1QCDA 2VWHA 1OHHA 2IHVA 3QWBA 2IF2A 2VSOA 2F1KA 1CUHA 2WNIA 3QY0A 3TNDA 4PTZA 4K6MA 1Y7HA 3VGPA 4MJXA 4DSAA 4AL4A 1JH8A 2AEMA 1E3SA 1YI8A 1K75A 4N6GA 1ODIA 4WCFA 4WHMA 4CLRA 3UMGA 4UEKA 4BNHA 1SC9A 4CN8A 2PFSA 1E77A 2YJGA 3HY4A 3OTHA 4PIMA 4ZYWA 5KWEA 1UMCA 1U7OA 1WUKS 3C3XA 3L1IA 3VYVA 1KYTA 5TMDA 2VT3A 4CTNA 3I2JA 1KRXA 5AKZA 2DPHA 4EW6A 1NUTA 1OH7A 1GNLA 3CX3A 1Z17A 1K5HA 5K0BA 4AROA 1UANA 4PBRA 1QC5A 2EP8A 1N5OX 4M98A 5GV8A 3UKJA 4X7MA 3FBGA 4G26A 4MCJA 4D81A 3N2IA 1QR2A 2DWPA 1Y5LA 2H8GA 1LLFA 3LUPA 5F1OA 4YNBA 3IUQA 1TZKA 1RNLA 1RWQA 3LFUA 4L4XA 3WFJA 3CVWA 1A7UA 3KOUA 1PX2A 2DJIA 3LCMA 2PL3A 4MR7B 3RF6A 3CPSA 4OP3A 4F3RA 1ZUNB 2R66A 4BNXA 5EIEA 2HBQA 4R4JA 2PJZA 2E7ZA 2D4HA 2PX6A 2ZBPA 1BFUA 1MP0A 4XA8A 3NLLA 3W1WA 5I6DA 4EJSB 3P94A 4ZAZA 3TIFA 3UGQA 1JR2A 3EYAA 3X2SA 1E9VA 5BNZA 2PUBA 3R6DA 4BCCA 2ZKIA 3AR7A 3F3SA 4HQNA 4YREA 2PN1A 3NFYA 1LI4A 4H7IA 5A1TA 5JTUA 3KYBA 5JAIA 4WBXC 3IB6A 3KJNA 4TL9A 1X7GA 2FMKA 4RTJA 2IWHA 1SCQA 5JSYA 4URVR 4BX0A 1R4AA 2HTFA 4M0FA 4BO8A 4ML3A 5H7XA 5IHPA 4CLEA 3ZY5A 3DMGA 1YCDA 3IJPA 4JT8A 4MAFA 4O59O 2LKCA 4IGAA 1G18A 3ZE1B 1DRKA 1ODCA 1SVMA 5EZ5A 3AL2A 4CHTA 2PBFA 2PEYA 3EIHA 4JI6B 4UUNA 1RFLA 3WWOA 1S3FA 4D98A 1D2NA 3J80A 1ISPA 3JQ7B 1OC2A 1FYEA 4PCVA 3LW8A 5T57A 1H5UA 1YFKA 3OUTA 1DTWB 3U4GA 1Q22A 4JROA 5GY7A 2J59A 2RE8A 4IQ0A 2R8YA 3HLTA 2IWRA 1X9HA 2IXGA 2G8NA 1HKHA 3I9MA 3QTBA 3W7VA 1UJ6A 1A1VA 2JIOA 2ZI3A 3KM0A 3VRHA 4DLAA 1MABA 1WDTA 5EP3A 3QVUA 5LNK1 4HFRA 2QBYA 3CZRA 2AI3A 3IBFA 1FQKA 3LU1A 2ZYAA 3AL0C 2KLHA 3IUYA 1YDHA 2IZOA 4G0MA 3RJMA 2WIBA 1R0KA 1CEQA 3B6ZA 3C1UA 3L43A 4BB0A 3S2FA 2GRUA 2JL1A 2H5IA 4TRJA 1LU9A 5JCOA 1VI2A 1OF1A 5I3CA 4GBJA 4FKMA 4LZWA 4KI7A 3PQ5A 4INJA 4LXUA 2XWSA 3NDIA 3QLEA 1YOVB 2H7XA 2IZ0A 5FPPA 2XWJI 1XQ6A 5JNRA 2ZWVA 2YBEA 1KOGA 3R7LA 3GT0A 2OTCA 3Q0TA 1HQCA 4XDGA 3ZV3A 2AD5A 2I66A 3D2AA 3KSRA 2UZ3A 1R8QA 4Z4HA 4REQA 5DP1A 1AZLA 1ZVVA 1UQRA 2B61A 3BXFA 1DO2A 1O8BA 2ZXUA 4G1CA 4HOYA 4Q6WA 3UW1A 1SOWA 4HSGA 1E9BA 3T35A 3UK2A 5FX2A 1MRSA 3EQZA 2CXSA 3AHEA 5M3BA 1XJQA 3JQBA 4WK6A 4RA6B 3G7UA 3HBLA 3BD7A 3LI2A 3EZLA 4AD8A 1GGEA 1YR7A 2OCDA 1IPEA 2IYNA 2O7NA 4N6NA 3VDRA 5BV2P 4LQDA 4ZVPA 3IAS1 4AK9A 2NWQA 4RVFA 2PX0A 1JG4A 3SQLA 4AN4A 4BN0A 5D51S 4BP8A 3TW4A 1I4TD 1N6NA 1ZDMA 3UHAA 3UO8B 4ALLA 1XLTA 1UBGA 1VB3A 2ACVA 3ZCPA 3OETA 4ZJYA 2J1LA 4UBLA 1G9TA 3V3TA 3JASA 1Y0BA 2ZVJA 3ORFA 4DJDC 2OCPA 3RFXA 2X6TA 5KWVA 1N2XA 5DNYB 4DR4B 5HGJA 3L0BA 2C59A 1SBZA 5DTQA 1FXWA 2IZ6A 1GO2A 1YS9A 4JQCA 3DMPA 4F5DA 1F4LA 3I58A 3GDOA 1GD1O 1E3WB 4Z9AA 2PVCA 3ZW8A 3VR6A 2JFHA 1JX6A 2JLXA 1GG2A 2QZ9A 3FTQA 4UHEA 1Q15A 1JRLA 4OHWA 2FV8A 2V65A 4B1FA 4BYMA 3LBAA 5JZMA 4MA4A 4UFOA 2FLVA 2P5UA 2XAUA 3BMCB 5TQ0A 4AZTA 3ZCQA 1R9MA 1B1AA 2BDUA 3SYTA 2NXJA 3Q8WA 2RK3A 2I8AA 4PR3A 5IM4A 4NL4H 1SU4A 4TMXA 1E0KA 4KGZA 1X77A 1UFKA 3BD9A 2ATCA 4IDQA 3RC9A 1X7ZA 4KHPB 2GKSA 3NCHA 1TJ5A 3ASUA 2CL0X 1GKLA 4CU2A 1R8SA 5IJ9A 3TLCA 4WASA 3ER9A 4GBGA 4KDRA 3SOZA 1NQTA 3Q6NA 4IS3A 1VKJA 4K6KA 5B2FA 2VYVA 2REOA 3HSYA 3ROQA 2C4HA 4MMXB 1D6SA 1NRJB 2YWEA 1GG8A 1PD0A 3HN6A 1JE1A 1G8GA 2PRZA 2UDPA 5BVHA 3J81A 5TT0A 5JBQA 4GL2A 3PVSA 1FYFA 3UUWA 1S8OA 1KS9A 2AF4C 2GM3A 2XOEA 5BOSB 5BURA 2B4KA 1FVHA 2VP9A 3E9ZA 1GU0A 1CULC 5KAMA 4R51A 2VUIB 4Z49A 1LEHA 3GW8A 4Q15A 4LYYA 4G5OA 1GKUB 4Q21A 2WY2D 3WNDA 4OA8A 3WAKA 3BAFA 4K2AA 3JARA 3PTAA 3QE2A 2XF2A 1MPXA 1TM3E 1NVFA 1WKCA 2IH4A 4P4UA 2ECKA 3G8BA 3G0HA 1ECGA 1NM5C 1VL2A 3BQ9A 1ZA2A 1W5AA 2QUHA 4HWSA 5BRJA 2GBLA 3OIVA 3EFEA 1CUAA 4DSOA 3B12A 4LRQA 1Q57A 2WOJA 4P53A 2JFQA 3IR6A 4GOMD 2V5UA 1QH0A 3BBLA 5EMLA 3VR5D 2ZPAA 4RVOA 4DDTA 3C4JA 1XJ5A 3NHLA 2A1IA 4PX9A 2XUPA 3NJRA 4XR4A 4AX4A 3BWMA 4L22A 1VJGA 1W8DA 1KFEB 4IV0A 5HK8A 5C7LO 3QMMA 2HIHA 5EHIA 1QTIA 4KH0A 1DPGA 2EIHA 4FYPA 2RHHA 1P6UA 2YW2A 4IL5A 3LGSA 4YONB 5AOCA 4AMYA 4EK9A 1ZI6A 3G2PA 2HV9A 3SYRA 4N76A 5K3SA 4RM2A 5PNTA 1OPXA 4UDXX 5J2TF 1G19A 4RAOA 4G0PA 1Q1AA 2HJVA 3EYWA 1H4SA 3W90A 1IZ7A 2WF6A 4XCVA 4HWOA 3WP1B 4MKRA 5C8YA 4RTKA 1O6ZA 3LYAA 1YZHA 4BO9A 3QW2A 3T3NA 3R5TA 3TFWA 2OFWA 2ZRAA 2DBVO 4N47A 1EFAA 1CFJA 1ZY2A 1JAYA 3QEKA 2WWVD 1CE8B 1ENZA 1X7XA 3O2NA 4I4IA 3T9DA 3UUGA 4E31A 3L6BA 4ZMSA 5K6AA 4QRDA 2IZZA 2H65A 3JQFC 2HYIC 3NUQA 3R4CA 4TV8B 4CDRA 2ID4A 3OPQA 1DAFA 1L5RA 4FYVA 3DEAA 4HQRA 1O1YA 4MHSA 2IV7A 5EPEA 5L95A 3KLMX 1G8YA 4OOFA 4ND8A 2ZAMA 3F4LA 1L7OA 1A04A 3OQVA 4YECA 1O5OA 1OVGA 1XCOA 4YH1A 3ZBPA 1QQ6A 4RKRA 5ALRA 2P2YA 3GELA 4M88A 5AP9A 2OCIA 3AJAA 4FS8A 4DAOA 4AJHA 1TFUA 2QD2A 4BBAA 3IELA 2IP4A 1A9OA 2INGX 2EHJA 2CFSA 3NONA 3MD0A 3ZE8A 2X6RA 5F7XA 3CIFA 2E55A 2NTEA 2BKAA 2FN8A 3LZDA 5AHRA 2FJPA 3RVMA 2VT2A 1EMDA 2B8JA 3HYSA 4PYLA 2LCFA 4C5CA 4D4HA 5IKPA 1YHNA 2A8YA 3L8MA 5CVDA 3W9SA 2G40A 1BVRA 2XNSA 1IXYA 3UV3A 2VYCA 4H6VA 4WZAA 3D81A 3WYEA 1UT5A 4D9FA 1F0NA 3KB8A 1TYBE 4RABA 1H4VB 4E15A 4GKKB 5DHFA 1EP1B 1V8BA 4RACA 5ALJA 2V3VA 3SCZA 2P8SA 4C3OB 2JJYA 3QU9A 5IRCD 3DCJA 3HJRA 2WE8A 3KOMA 4AZVA 2AQ8A 4QDJA 4TUYA 2I1VB 5M04A 5SZKB 4BRUA 4KWTA 4TYQA 3DUFB 2J3IA 5K0FA 3QRWA 5LCXA 2PLFA 4IQFA 3HEAA 4II2A 5JSKA 4B4OA 2Z6VA 1PWZA 1X2EA 1ZW1A 2BVNA 2WKPA 3UG6A 2QTWB 3Q3GE 3VVCA 3FVVA 3V8NA 1ZHHA 1P2GA 3HLKA 1F2UA 1LBSA 1YASA 1CNEA 3G9TA 4L8LA 5TE9A 2JJQA 2ZUBA 3EUWA 3MWYW 5CLJA 1I51A 3K35A 1CJVC 3WL8A 4NH0A 5BXYA 2XLBA 2R6GA 1Y3AA 3PXEA 4QHTA 4JYMA 4YMLA 3G2MA 1G66A 1NE7A 4L02A 3LKDA 4PSKA 1R10A 5CJ2A 5EFZA 3PD7A 2LRHA 5B58C 4TYYA 5HZMA 2IUUA 5CFNA 1J5PA 1Y8QB 3OZVA 4J7CA 4TYMA 3TL6A 3WL6A 2G83A 2FUEA 1BU8A 5DGIA 3ESQA 5C7OO 3HYNA 1HETA 4MB6A 1QVVA 3GBSA 3R9XB 2DQKA 3IA2A 2A1UB 4U5QA 1A7JA 4OG2A 2AE2A 5JZOA 1TM7E 4I14A 4G8BA 1YS2X 2XYVA 3SR4A 4BE7B 1EUCA 5G4KA 3RKUA 3ZWMA 4ZJUA 2DFNA 1ETUA 1I0IA 1AC5A 1NPTO 4KOAA 1MF7A 2NUTB 1MG5A 5F7ZA 2LDXA 1HFKA 3LQ2A 3TQTA 4E94A 3GA0A 4EUNA 5FFFA 4ZARA 3QFTA 2ZT6A 1UMDA 3LLMA 3W2TA 2W6OA 2C95A 3MN1A 5I9SA 1YJ5A 2RGDA 3QBVA 1MNQA 1V0JA 2PH1A 3AUSA 3UBMA 4HEA1 3BZWA 1CCWA 1TJPB 1ZM7A 3C6XA 3AF6A 3DZ8A 5EIBD 3LY8A 2CXQA 3JQ8B 2HD4A 3B78A 1BO6A 1IH8A 2XT6A 4DWJA 3QHQA 4EO7A 1I3MA 1Z4JA 4RH3A 5G3ZA 2ZUCA 3EJ6A 2OBFA 3IQXA 4EKIA 2O59A 3PFWO 2ZB8A 3D6NB 1VA5A 4GZ5A 4F97A 4MV8A 2XV1A 2IELA 1HDXA 1KJ9A 4FU0A 4OREX 5H82A 1V7ZA 5EGNA 3QVJA 1PGJA 4LOKA 3OTOB 4HFMA 5E7IA 4IGEA 1ORHA 1FUIA 5JEEA 2VQEB 1D07A 3R0XA 4YT8A 3G1WA 2J9ZB 2QTLA 2XUJA 4UM5A 3TXYA 4IX9A 3A1WA 2IXTA 4MGHA 4LXYA 4Y9UA 3SZUA 1QP7A 4TKVA 4WLFA 5FBVB 1YI1A 2IYEA 1QGED 3PKIA 4O1IA 1PSZA 4NPHA 3U7IA 2VTBA 1TPYA 3P2EA 3DBHB 5CT5A 3RG8A 5F76A 3V2UA 4KIFA 3HNPA 1P45A 1T1GA 4KC0A 5HWSA 3D3WB 3TSAA 1TLFA 2IUEA 4LZOA 4PAMA 3C3EA 2R1VB 2BFCB 3RRFA 4FMPA 1E63A 3UHFA 3MHTA 1LJ8A 4WBSA 3QBDA 4KRYA 1QO9A 1D09A 3SC2B 2F8LA 2P91A 4PR0A 3SAJA 4KFTA 9LDBA 2JHPA 2HWUA 5DW0A 1GFWA 4NI5A 3D43A 1CB7A 3HNOA 1T0IA 4KZPA 5ADVA 2D62A 1GNTA 4RTNA 3UA3A 3VOBA 3DLPX 4F8YA 1MW9X 3IEVA 1FC0A 3L9XA 1CIVA