1SUDA

Calcium-independent subtilisin by design
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
275
structure length
274
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASFVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAKSGTMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN BPN' CRB-S3
publication title Calcium-independent subtilisin by design.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase(serine proteinase)
total genus 99
structure length 274
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1992-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sudA00
1P8JA 1KDZA 1Y3CE 4CFZA 1TM5E 2XTJA 2HPZA 5JXJA 3DVRX 3DE0X 3GCWA 1SH7A 1A2QA 3UNXA 4AKSA 4H6VA 1LW6E 1NLUA 3DE2X 1VSBA 5ARCA 2PWAA 2SBTA 2X8JB 1S01A 3VTAA 1C9NA 2HD4A 1Y48E 1TO1E 1DUIA 1GA4A 3VYVA 5AVKA 2V8BA 2ID4A 3Q5GA 2ZWPA 4LVNA 4CFYA 2W2QA 2PYZA 1IC6A 1GA6A 1WMEA 4K8RB 2Z58A 2WV7A 3DE1X 3ZXYA 3BPSA 1WMFA 3TI9A 3LXUX 1Y9ZA 3D43A 5JXIA 1OT5A 1SCNE 1SBHA 3A3NA 3QMPA 1BFUA 1C9MA 1GA1A 4NE9A 3A3OA 2DP4E 3AJ8A 3AJ9A 4C3UA 3EE6A 4JP8A 2Z2ZA 1R6VA 1Y3BE 4ZOQI 3TI7A 3DDZX 1SELA 3DYBA 3DVQX 3ZXXA 4H6WA 2WUVA 3DE5X 4FONA 4B5LA 1SUCA 2PKCA 1GTL1 2PQ2A 1SN7A 1ZVKA 1MEEA 1SIOA 4Z2AA 1SUPA 3SICE 3D9QX 2P4EA 4HVLA 3I30X 1TO2E 1XF1A 2PRKA 4LVOA 1IAVA 1EGQA 1SCDA 2QTWB 4OMCA 1OYOA 2ST1A 1SIUA 1V5IA 2DQKA 3HJRA 1PTKA 1SUDA 3DE6X 1SBNE 5B1DA 3GT4A 4OMDA 3DE3X 1TM1E 1PFGA 1GNSA 5SICE 1CSEE 1TM4E 3GCXA 3F7MA 2W2MA 2WWTA 3I34X 3A3PA 3DW3X 1C3LA 3QTLA 1NDUA 3I2YX 3GT3A 1SPBS 2E1PA 3VSBA 1KDYA 1DBIA 1SCJA 3LPDA 1Y3DE 1TM3E 3SQOA 1AK9A 1S2NA 2Z57A 3DVSX 4DZTA 1WMDA 5JMOA 4BWGA 1SBIA 1ST3A 1Y4AE 2IXTA 1SBCA 1PEKE 2Z56A 3QFHA 1AVTA 2ZRQA 3WIVA 5B1EA 1ZVJA 2WUWE 1AQNA 5I9SA 1T1IA 1P7VA 3VHQA 2SNIE 1UBNA 3DE4X 4KG7A 3DWEX 2PWBA 3EDYA 1PJ8A 5FBZA 4H6XA 4OV6B 1EA7A 2TECE 3I37X 2GKOA 1SCAA 3WQBA 1AH2A 1C9JA 3WIUA 4CG0A 1TMGE 1T1EA 5K7SA 1SCBA 4J94A 1SVNA 1V6CA 1GCIA 1R64A 1Y3FE 5JXHA 3BGOS 4ZARA 3AFGA 2Z2YA 4KB5A 3TECE 2W2OA 5CW1A 1BE8A 2ID8A 1GTG1 1TK2A 2SECE 1SUEA 2ZWOA 1BE6A 4M1ZA 1AF4A 2B6NA 4C3VA 4GI3A 4DJ5X 1BJRE 1GTJ1 1GT91 2W2NA 1GNVA 1KE2A 5ARDA 3DE7X 1Y34E 2IY9A 3OSZA 1Y4DE 1YJAA 3L1KA 4WOBA 1YJBA 4AKTA 1ST2A 2Z30A 1MPTA 2Z2XA 5AQEA 5FAXA 1Y1KE 2SICE 3CNQS 1S02A 3Q40A 5AVJA 1BH6A 4KPGA 1JEAA 3BX1A 1NDQA 3PRKE 3PTLA 2W2PA 4MZDA 1Q5PA 1AU9A 1AV7A 3CO0S 3F49S 5FFNA 3F7OA 1YU6A 1Y33E 4NE7A 1SBTA 5JXGA 1OYVA 3H42B 1R0RE 3LPAA 1SIBE 4WOCA 2PMWB 2X8JA 1SUAA 4RYDA 1SUBA 3EIFA 1TM7E 2XRMA 3VV3A 3VV2A 5ARBA 1KDVA 1CNMA 4HX2A 1BFKA 3WHIA 4DWWA 1YJCA 1WSDA 4NMXB 1T1GA 3T41A 1THMA 1KE1A 2G4VA 1HT3A 1P7WA 3DW1X 2DUJA 1WVMA 1TECE 4YN3A 5AMXA 3LPCA 3P5BA 4I0WB
chains in the Genus database with same CATH superfamily
3JAWB 1XZFA 1Z3IX 3GZTB 4EG1A 4OBEA 3SSNA 1KVUA 1PZMA 2EXXA 3L6CA 4JS0A 4M6WA 4RXUA 2H1FA 3W2HA 5BWNA 1QGUA 2XI4A 2FPGA 2I6SA 2BFCA 3PR2B 4EHKA 3RJ5A 1LQTA 2YV4A 1TPZA 3MIIA 4YQFA 1QB8A 1WXIA 3KB2A 1W8DA 1YFLA 1M34B 1VSUA 3SP1A 1B6TA 3UNXA 1WY7A 4LY6A 3MTQA 1NYTA 1SVSA 3WGIA 2ZIZA 1NLUA 1Z4KA 1D8AA 2EZ9A 3UJCA 1Z8NA 3AM4A 3EGXB 1XRPA 2WILA 1E20A 4LDNA 4R3WA 5REQB 4B6FA 1EVYA 2WVHA 5J1TB 2X1LA 4GX0A 1M1YB 2WJWA 3KVOA 3VFDA 4XQGA 3QE3A 1W47A 3AFHA 3QOYA 1UJ6A 2ZRNA 4EJFA 1X6VA 2FSUA 3Q7TA 2P30A 1Z37A 1N2CE 2JIOA 2DMRA 2EG5A 1DUIA 3TQSA 3S81A 1G8AA 4EY5A 2P40A 4U39A 4JLKA 2Z0MA 2V8BA 4UHBA 3T3MB 1OLUA 4KO2S 3RTAA 3VR1A 1J9EA 2IXAA 2JGFA 1IY1A 2DTDA 3F5SA 4FYMA 5KQGA 2BVNA 1R4NB 1KC1A 2H8KA 2XVXA 1G8MA 1ENZA 1FMJA 1PK8A 5LLSA 3AFMA 3INTA 1ILWA 3SKXA 6GPBA 2A5DA 2GERA 1FS6A 5BMVA 1OVMA 1YU9A 3WZLA 3GNLA 4YP1A 2IEGA 3L7OA 3BWXA 4FFSA 4GBMA 4NC9A 4ZGBA 2ZP1A 4GI7A 1UP7A 3GCZA 4R9NA 1X8JA 3DP9A 4GSKA 4QA9A 4J2OA 3LC7O 1MGOA 2GD6A 3C87A 3K30A 3Q7IA 4X85A 2LDBA 5IYZA 2PY6A 3R3HA 2I6XA 2FSVC 2DPGA 4HRAA 3KYIB 3OEYA 5L7TA 4OBBA 4CR6A 2GSWA 4MV7A 2XEXA 3IESA 1ZJYA 3S2UA 2XADA 1T26A 1FSPA 2Z1MA 1VQ1A 1JUDA 3PUWA 4KHZA 5GQSA 2NLOA 3GN1A 2FMKA 2RGGA 1T4BA 2G9UA 2GFHA 5JS8A 4O4HA 1V7CA 3HB0A 4OKIA 3WNCA 4Z99A 1FQKA 2JC3A 3GJYA 3I2JA 4QQ8A 3QV1A 4YPOA 4S2EA 5JAMA 5TMPA 2MSNA 1SBHA 3TTSA 3DXXA 1WKVA 4N3AA 5JI2E 3K94A 4CLDA 3MMXA 3K0BA 2QQ0A 3ZD8A 3I1JA 1W4RA 2BFOA 4QREA 2ZIXB 1F9AA 4CCYA 4PPQA 3QYPA 2Z8YM 4CMEC 5JNVA 3QE2A 3OZCA 2Q49A 3DLTA 2WIKA 1TIKA 3R7BA 4LW8A 5BNWA 3BL8A 4RFSB 5JCXA 4AP9A 2R8YA 2X0RA 3AF4A 5AW8A 1JMKC 3OX1A 2W2VA 4XZ3A 1CB7A 3OLVA 2YMQA 4YYEA 4F92B 4KO8A 4CR8A 5DN6D 1H4QA 4YXWD 4FYHA 5CB4A 3Q5DA 1N5MA 4Q3DA 5BV7A 2BAGA 4P31A 2RJNA 2V6MA 3E48A 5G3YA 4U0JA 3SGLA 1MNQA 3U1TA 3WJ7A 3UFXA 4E5SA 1USWA 1HDOA 1U7UA 2YHSA 2ATXA 3BAFA 4KR6A 3MOSA 2VHTA 4TMZA 1G3UA 1ICIA 1QF9A 1ZI9A 2CFOA 2O2YA 1K2VN 1LRJA 5DYTA 4RULA 5IBQA 5J4HA 1CQXA 3QKIA 1SN7A 2VP5A 4QEZA 5AI8A 1LJ8A 3UOGA 4AQDA 5L45A 2P1DA 1B0PA 3JQBC 4W99A 4Z6KA 5A2GA 4JR2A 4HVTA 5KPJA 1LK0A 2YICA 5GP1A 3CVJA 4LK3A 4PG7A 2OCLA 4LV6A 4R7TA 4EVSA 5C4MA 1TO2E 1HMYA 7REQA 1W1IA 4WCVA 5EP4A 4FEEA 5JZOA 1NQUA 5JZSA 2WOJA 4LVOA 3TH5A 3NIBA 3QVSA 2IHBA 5K0CA 1C30A 3TDKA 3NVKI 2LCIA 4IO0A 1TW2A 2IGBA 5ESDA 5EHXA 2QTTA 2C9MA 3ETNA 2BJVA 3DCIA 4FDUA 4G24A 4PLVA 5IZCA 2PUWA 4A26A 3NHBA 1N25A 3CRW1 1N5DA 3FPCA 1FXUA 1OZGA 5JASA 3FPJA 3I4LA 3T7KA 3TLKA 2YVKA 4ALJA 3WP0A 10MHA 4OSOA 1H0HA 3BMOA 2YXBA 2IA5A 4IEFB 3VI3B 3WTBA 2X5NA 3K35A 1KTVA 5JBQA 1N5KA 1N9GA 2F1HA 5DHRA 3CM0A 3RWMB 4DBZA 1I6LA 4N3GA 3PNOA 4I6EA 4E5UA 2QPAA 3HUTA 1E7QA 1X42A 2AGVA 4FEYA 4TTPA 3ZYCA 3B48A 4NCBA 2KYRA 4RGVA 1XZLA 3WYCA 3GCXA 2NYVA 4PLZA 2WNSA 3T5DA 4PFSA 1O2DA 1P2UA 3VR4H 4NZYA 3CIOA 5FTNA 4BLWA 2E21A 2YFKA 2HXYA 1AA9A 4KN5A 5DJ5A 1PS9A 3O94A 3QTLA 2JAOA 4MV8A 5E1OA 2P2CA 3UQZA 1H2WA 4NABA 1YBHA 4Q7EA 3WL8A 4AP6A 1BOFA 1XK6A 2FX5A 4G65A 3KJIA 4TWRA 3T7RA 3LP6A 1EE2A 4IJVA 3KXKA 2KB0A 5I7AA 1K7YA 4UM5A 3UJAA 1OX6A 2HR1A 2J08A 4JQCA 4OBWA 1WNTA 4IOKA 5ALPA 1UP6A 3PDIA 3Q2KA 1I6MA 1UPCA 5F21A 3UGKA 3VSBA 4F97A 3JQQA 4I6GA 5LA6B 3SFVA 1IZ7A 2ZJ7A 8ATCA 4RIHA 3WMFA 4D56A 2YXDA 4J1QA 4H27A 1P7PA 3I61A 4YAFA 2JGDA 2XWBF 1T5TA 1RWMA 3KOYA 5G3ZA 5J2TF 3W34A 3R3WA 4XWYA 1RKBA 3JSAA 2J30A 4HH3C 3ZDXB 2VLBA 4FINA 2HXSA 3CONA 3E22B 4NLLA 1C9EA 1FYVA 4MIEA 1ORRA 3ZWWA 1SJ9A 1M2GA 4UQPA 3UUGA 2C5SA 4B8WA 4A3SA 1P5ZB 3JQAB 5KS2A 3A3YA 3N0TA 1S2IA 3NVAA 3EY9A 4LJ7A 5IDVA 1DWUA 4TVSA 5CA1B 4DMRA 1ZJ4A 4JR0A 4N7JA 1KRXA 2G1JA 1AF7A 1NX9A 2RIRA 1CJCA 1ZDMA 2VDVE 5T4EA 2E55A 4FJ1A 1H1LB 1LD3A 3BZBA 4EGSA 3AX6A 3S1AB 2VATA 4PU0A 1U81A 3ON5A 4NATA 3O90A 3L7AA 2NUTB 4IDBA 1EHYA 2J3QA 2LCFA 4N49A 3WRVA 3L9WA 2WYHA 1VHLA 5EUMA 2C9CA 1JE0A 4PICA 3B5JA 3UBMA 3ESZA 3UMRA 2EZUA 3VZQA 2MJLA 3I09A 5GZ1A 3ESAA 1ZVJA 4AJ2A 4UXIA 2F9MA 1WZNA 3ZV6A 3GH3A 2XBMA 2XUOA 5IM4A 1U2GA 1NVFA 2FEKA 3GMSA 4ZHQB 5GJBA 2BFWA 3DDSA 2ESRA 2HA2A 1BOOA 3E7FA 1IB0A 5KNDA 2Q0SA 1FFEA 4XLTA 3RUFA 2ATEA 3SJZA 3EXIB 3ZBPA 3ESYA 4IDAA 4ENQA 3SF8A 3D4OA 4NDNE 3T5PA 2QRUA 4DIDA 1CR6A 2GK7A 3PEUA 4I9FA 2AZDA 1WSAA 4MKGA 3BXGA 1EWYA 3BDAA 3IJEB 2LP4Y 2VP4A 3VYTB 3DULA 2HF7A 3CU5A 4E3ZA 5DM70 4AMVA 3IKTA 3T7EA 4X6XA 2I4TA 4FOOA 3LA6A 5P21A 3QZUA 2ZE6A 3N5CA 4FXOA 2AZXA 3L0PA 5T57A 3WNQA 3OHPA 2BKVA 3AUAA 3CB4A 1LGYA 2YTZA 4DV0B 3O7MA 3COZA 2VF7A 3NAGA 3QU9A 4H6XA 3AKYA 3T1TA 5I9MA 4JNCA 3K32A 4HXYA 2XITA 1ZGGA 3OZ7A 4TX1A 3WAKA 1WZCA 5SY9A 1IEXA 4V3CA 1B76A 1G6KA 2Q3FA 3OQBA 4KGXA 1SVOA 4PRZA 2M1XA 5CDFA 4NU6A 5BVHB 1N36B 1OQAA 3UCXA 2RCYA 2MSWA 1U99A 4AZVA 4D5EA 1AHIA 1NVTA 5E9JA 1Q6YA 4PYQA 4TRMA 5ER6A 5IM5A 1R5JA 4J0HA 3RLIA 2ZVDA 1J07A 2W4IA 1Q0HA 1T1EA 4UOQA 2GASA 2QX9A 1KBZA 2WG1A 1R50A 3K9BA 3DSRA 3UXMA 2EJWA 3B9BA 2JEYA 2GFQA 4GQBA 2A7QA 3IOMA 3QEMB 5C8ZA 1JDPA 2CB9A 2E4VA 1S6YA 2G72A 1ZJ6A 5IXJA 1XT6A 3ZJTA 2PAFA 2ZS8A 3JR7A 5EUBA 1G4AE 1J2TA 4YRIA 1KERA 5IJ9B 4C4SA 3D4PA 3UAYA 3K6SB 3F9RA 5HP4A 3DEIA 3EZNA 2GDJA 3G2PA 2GTPA 3OP1A 4H7PA 5KX5F 1O8CA 3ASYA 4KSCA 2NXWA 5TS2A 3TL3A 5JXHA 1T9HA 1UPBA 2QUIA 3P2YA 2V7BA 1WCIB 1UMDB 2YBDA 5E6UB 3HUDA 1RWVA 2Q9BA 2Z2YA 4DVGA 1EWVA 1NMQA 1MTOA 3UJPA 1WP9A 1L7MA 1PRYA 4LV5B 1SXPA 1DC8A 1X87A 3IP3A 2ZS9A 3JATB 1K98A 3LP5A 1WPXA 3ABSB 1K66A 1U1DA 2Q50A 4TQGA 4WXEA 3UJ9A 3RNOA 1D7OA 2OCGA 1QP4A 4TT3D 2JASA 1I4OA 2OPBA 4ZC8A 621PA 2E5FA 5A3RA 5I7SA 1W7AA 4YT2A 4W5NA 5CBPA 3LCVB 3E9NA 4YRTA 3FGOA 3ZQ6A 4BTLA 3PSHA 4PRKA 3QE9Y 2Q46A 3QUSA 4U3JB 4AROA 1WMAA 4RK1A 1IBMB 1R6BX 5DASA 1OWPA 2VZ0A 2QX6A 1XHFA 1ZIXA 3O1LA 3PHGA 3GFFA 1JAXA 2ZVPX 2O2HA 1TAHA 4COKA 2V0GA 3OFJA 3O95A 3V3KA 1M6VB 4QFMA 4ID3A 4BJ6A 3SE7A 1B0AA 3IVGA 3VDQA 2OBFA 3DE7X 2IUSA 4FM9A 5KYXB 3KOWA 4F46A 3CNNA 4UASA 3IKVA 1MAWA 1M2OB 1NBMA 1XUOA 4U2GA 2G6BA 4FMPA 4QM7A 2PE5A 4XQ0A 5KYWB 2BP7B 3IVMA 3K9HA 5KSPA 2CNBA 3EH1A 3DMHA 3LOQA 4XIIA 3ODGA 1YZVA 4TSKA 1NRXA 5EGNA 2IDMA 1SEPA 1BCRB 1MPTA 4F11A 1ORTA 2GZHA 4MVXA 3V5NA 3SC2B 5EJIA 3R9XA 1P5RA 2Y2UA 2FSIA 1VGRA 2OGSA 4EUNA 3UBTA 5FAXA 3IC5A 1M34E 2PGAA 3FE2A 2OEPA 1Y9JA 3Q9LA 4O0MA 1IIBA 1OBHA 5CB0A 2ZT7A 5T8KC 1BH6A 3HU5A 4NJEB 4NZZA 4QJ4A 3MGKA 3ZG6A 4CDGA 5AW7A 1NN3A 2I66A 1Z45A 4J2HA 2JK1A 1DC6A 3KJHA 3A2LA 1HLFA 1SPXA 1DO8A 1UFRA 5D3ZA 2II6A 2UXDB 3BHNA 4IGKA 4L2IA 1OWOA 5JH7B 1NIJA 1OH5A 1W35A 3IQGX 1R37A 1Z39A 1O6ZA 3MS7A 3NUZA 3OLXA 1Q0SA 1Z56C 2W90A 3DDUA 4BMDA 5EVCA 1DI0A 1LTKA 4IG9A 3D8UA 1OBFO 3LWDA 3O8BA 5KVAA 2ORIA 5JD5A 1MVNA 1UJ2A 2PMFA 3RHSA 3BJRA 1WB4A 2ZB2A 4OQDA 2EFHB 1VKZA 2HSZA 4IIGA 4Q3EA 3T52A 1FTNA 2Z9DA 3NWOA 1TXGA 4RK7A 4D46A 2JLWA 2R47A 3KC2A 2OFFA 5BWMA 2E7ZA 2JFNA 4XKJA 5CNIA 1DJOA 4PBRA 1K75A 1F20A 1PQPA 5TQ0A 4C2BA 3WHLA 3ENWA 2P77A 3JZIA 4L3OA 3OJCA 4W5HA 5C4GB 1SQSA 3ZHUA 3LCJA 1FFXB 3G2IA 4NDAA 1E2LA 3PGVA 1R0RE 1VMKA 2FSSA 2WM2A 4I66A 1RXEA 2P4QA 3KXDA 1EBUA 1ENPA 2Q07A 4TZKA 5F7XA 4HDQB 3AFOA 1UBKS 5C46F 1W4LA 3NUGA 3VR0A 2C95A 2NX2A 4BL5A 2ZBEA 4KZKA 2IHTA 3PC8A 1OXUA 1E6MA 3DAPA 3PWKA 3UPUA 1T5LA 3A4VA 4WK0B 4DLKA 1VL5A 2J33A 1T2NA 4L4YA 3R0IA 1CJKC 4KH1A 2M1ZA 4KREA 3DL4A 4UE6A 1DBQA 5HG0A 3P71T 4CMIA 2Z5LA 2PS1A 3GJ8A 3OJWA 4EB8A 4N8DA 2H31A 3B7GA 4NEGA 4AP5A 3DTVD 3PNQA 3DLPX 2H59A 3AEUB 2CD7A 3IUYA 4TXJA 1SUWA 2YWXA 3QVVA 5TY0A 1NUHA 4R3UC 1MG5A 3LQYA 4PZCA 3LT5A 4MW4A 4XVHA 2O2ZA 3FF4A 4A23A 3IDZA 1ILEA 2ID9A 2GCPA 4LF6B 4HAZA 5IEBA 2VYND 3TKYA 3ZNNA 1SKYB 2M2IA 4Y1EA 4B81A 2AJBA 4G0PA 4TYWA 1VBNA 4BO6A 3D8BA 2WZDA 4ZVVA 2CL5A 3M5PA 4TKMA 1Z5WA 4NR0A 4O8CA 3IUBA 2JJYA 2QU8A 4OG2A 4YN3A 1CUBA 2AMLA 2VPWA 3EEBA 2IEIA 3OZXA 4NS1A 4PG6A 5G40A 5FTKA 4ZO9A 3JALB 3HADA 4D26A 2HAEA 2Z08A 4YRNA 1LBEA 3GDOA 4DARA 1U8UA 4GRIA 2H11A 2CXHA 3FG9A 2R1ZA 5J63A 1SQ0A 3VHRA 1T43A 3WKCA 1DBRA 4Q34A 4DV5B 4RKFA 5INTA 3OQHA 4X54A 3GJZA 4BAZA 1B1CA 1P4JA 5L95A 3EPJA 5JNRA 1CQIA 2PPVA 4OLJA 1BFDA 2DSNA 1FB5A 4CR7A 3TTTA 1NY5A 1XC7A 1PGOA 1Y3CE 2JA1A 2HHHB 1GRRA 2DY0A 5K6TA 3BCUA 2WP0A 1G8HA 4MAMA 1HQDA 3V34A 4S1WA 3ZY6A 4B4UA 1TF7A 1A2QA 2ZR8A 3F6SA 3LXMA 2EDCA 3FSJX 2XRYA 4EA8A 2BKLA 1BMTA 5D3QA 1F8YA 4NJMA 1YULA 2DBVO 1IOLA 3O9VA 3E8MA 1ZCJA 4JC8A 3TE7A 5DNUA 3W3AH 4I9UA 4ZXPA 3TZEA 4R98A 1N92A 5LOVF 1OC2A 3LC2O 5ARCA 1RQNA 4KITB 4RHUA 1KOGA 4PZEA 3CN9A 4IIJB 2P2GA 1MEJA 2J9GA 4DSOA 3CUTA 5CLHA 2QX8A 3E81A 2VPTA 3L8HA 3ZCQA 3WQHA 3KCNA 4KMMA 4L95C 4R1TA 4WK4B 1OFHA 5FUMA 4R8MA 4E3WA 1SXJE 3KEFA 5JWHA 1DHTA 1TO1E 2D4AA 5CCXA 2WDZA 3VDMA 1XVAA 1H2HA 3KE9A 1KS9A 5B2ZA 3UK6A 3LUFA 4XUCA 4KHPB 2APJA 1TDJA 3SEQA 4HBGA 1SXIA 3B13B 2JI7A 5D87A 5FYDA 5THQA 1KVRA 2ZBFA 2YS7A 3LQ2A 1SU7A 2F3TA 2PKRA 2BZ1A 3VMFA 1E1RA 3GDGA 5HKLA 2ZSKA 2P7HA 3MCWA 2BY4A 4UHCA 5JG7A 1G3QA 2CLLB 1KI6B 4YRPA 5T7BA 4CFYA 4FS8A 3JQFC 3SDBA 1X3LA 3E7DA 1MBZA 2GPJA 3HXPA 4URZR 1PLKA 5IBCA 2BGGA 1TZBA 3HBJA 2NTJA 1JYEA 5DIFA 5DXFA 2NV2B 5DHPA 1EFUA 5DHFA 1YDGA 3C8UA 1NKSA 1XMQB 5KX5A 1S8FA 3E0XA 1LFDB 1NF8A 4JI3B 4D3FA 1Q0QA 4YXWA 4N65A 1UKVY 5K0GA 3HKEB 4B87A 4A0FA 2BDUA 3IFSA 5AO9A 2GM4A 3DLAA 2LD4A 3W7BA 5ICFA 4MV0A 1HEUA 1YL7A 4GP6A 3R4VA 2XQVA 3UJ3X 4BB0A 1EXNA 2XHZA 3JSXA 4G4SP 3ABIA 3A3NA 4OOEA 5ALQA 5E1DA 1GPUA 4YAUA 2YUTA 1ZGCA 3I9NA 1JHZA 4LJRA 2X4GA 2GN8A 1VMAA 1VPVA 3U4QB 3RYIA 4RABA 3BL6A 5SYMA 1CLUA 1Z83A 2RHMA 1Z8HA 3ZCUA 1ISMA 3L1JA 4MVJH 4JUBA 5LCXA 1MW8X 3QXJA 2LBPA 3VKWA 4ZC1A 2JFOA 3HCNA 3U9TA 4DLYA 1GWNA 1PKXA 2HFJA 4Q39A 4UFPA 2XDQA 3EZGA 1I4TD 2PGNA 4NENA 3KDSE 2FP4B 2GTIA 2NIPA 3B51X 3DDZX 3HKBB 1SELA 2NU6A 5CVVA 5FPHA 1XTJA 5AVQA 4KUGA 4PWZA 5K3DA 3W5CA 3C3JA 2CY0A 1CQZA 4G09A 4H6WA 4F6RB 1TT7A 3ZGXA 5C1BA 2J9XB 4IGIA 1JXAA 2VDRB 4RGQA 4CM9D 4ZMBA 3GVXA 3VUFA 3KTFA 1H6CA 2PT6A 2ZDGA 2XNCA 2XB6A 1P0CA 2WG2A 3I4FA 4IEIA 3RIHA 4H1HA 2PSSA 3EYWA 4P4SA 1GZ3A 3MUEA 1IBKB 3ZHSA 1QHYA 1E1LA 4M7PA 4OSEA 1H1TA 5EJFA 3UMGA 4NHOA 4EECA 4H6PA 5LOVB 3ZI4A 4MUHA 1JIQA 4FT2A 1VYUA 5B6JA 2XCSB 4YUXA 2XSZD 4UDNA 5IXYA 2QW0X 3D3QA 4MCJA 2HU2A 3P52A 2P4EA 3R3YA 4EA7A 1P60A 4HVLA 1A4IA 1A5SB 1Y7LA 2JEOA 3FROA 1U6JA 3HCAA 1EQAA 5E38A 2BGTA 3C3CA 4HQFA 2GRAA 2VS1A 3EGWA 4K26A 5HQ3B 3CWCA 1TAUA 4KE6A 4R0NA 4CLOB 3B6KA 4I1VA 1H8HA 2WICA 4URXR 1VCOA 4QJ5A 1E3MA 3TRHA 4UEOA 1DE0A 2QV7A 1DDOA 4BHTA 1J2UA 1IBCA 4ESOA 5BVGB 3AF1A 3SOPA 3K09A 2I22A 3LY8A 2VNAA 4N3NA 3S44A 5ELXA 3BRWA 1VPEA 1UMKA 2P27A 3NONA 3QHQA 4KNWA 4PY2A 2DT5A 1QDEA 1SUIA 1Y5NA 2IIQA 2P6OA 2R84A 3WHKA 4EFLA 1ZR2A 2ZDQA 5DEOA 3BIFA 4LJ4A 2B2XA 2C4KA 2P7IA 5I9TA 1N32B 3K2BA 2VRWA 4V0SA 1BMFD 2FPRA 3UENA 2PBFA 4JQSA 1KQPA 1LK5A 1XTSA 2H4WA 2QRNA 2VEDA 3G1WA 3OQJA 4X60A 3N9IA 1LUAA 5KSOA 2I6UA 2DWPA 4UEKA 4V0MA 5KTSA 5LVAA 3DOCA 3A6PC 4IRMA 1C3VA 3UOWA 5JVDF 1ML3A 3R77A 1KK0A 2Q3DA 4NDZA 1QVVA 1UKAA 1K5PA 3I2YX 2G7ZA 3ZC3A 3AGQA 1F8UA 1FYDA 3V00A 2VWPA 5FNVB 1ZA2A 3ORSA 4LVCA 3KR9A 1FU7A 3GRUA 5I45A 5IUJC 2O6HA 4Z2YA 2IHVA 4Q9AA 4XRRA 2X5KO 3WJ1A 3VISA 4DDWA 5ITWA 4IYRA 2Z6AA 3PGMA 5NULA 2BGRA 4Z3DA 2TMGA 4FBLA 4TXHA 5IKEA 1MRZA 3SXJA 2OSBA 1ADBA 2D0IA 5DBFA 4CCWA 1NGSA 5A4DA 2CYCA 1JJVA 3JYOA 1CS0A 3CLRC 1FNDA 5LOVA 4YNBA 3ROEA 1CQJB 3ABOB 3FUXA 1JZQA 2E82A 3ZPXA 4B3JA 3W1VA 3G6KA 3W9BA 1OLXA 4AJIA 2A3RA 4JGGA 4B31A 5KWSA 2QAGA 4B4VA 1BRTA 2DG2A 8AT1A 5H1YA 2IL1A 2H52A 2W5UA 3QVLA 3NHWA 3H7IA 1J0AA 3TQOA 4CUZA 3A9TA 5ECWA 4F3KA 4YUYA 5MN6A 3RJTA 2K2QB 5BWCA 1QP0A 4MHSA 1O0BA 3DWIA 1DCKA 5ALYA 4OX9B 1O57A 2AG0A 1D03A 4LI0A 3DOJA 5K99A 5K8JB 1E18A 4E13A 3LTNC 3ESQA 2QTBA 2WU3A 3GPDG 4UBKA 4XM1A 1HYHA 1V3VA 4WN9A 3OKFA 3QH4A 4HEA6 4IVPA 1KZGB 1NW5A 3PC8C 4F60A 3ZHOA 1FYXA 2E4XA 3PRJA 4CL8A 1N3BA 3U7HB 4QGBA 5DCYA 4O02B 1YF3A 3KIPA 2AG5A 3IUJA 1KIFA 4RMJA 1XWWA 3OOYA 1XE3A 3EZ7A 4G07A 3I2HA 2G1AA 4C0XA 3IPLA 4E15A 3I5YA 3PLAE 4HRYA 5A1JA 4AJEA 4YAOA 2ZYAA 3GUCA 3IOCA 5DEIA 2XNDA 4KDFA 3DBLB 3I5AA 1FQJA 1TIPA 1BEZA 3AHDA 3RJZA 5BR1A 4BMVA 3OZBA 2BEUB 3PHHA 5LQDA 1H05A 1P18A 2O3RA 4QU8A 1T6XA 3TLJA 1GYRA 3OKAA 4RH3A 3MCAA 3AWDA 2ZTVA 5FBZA 5T5QA 2ZRIA 4IIHA 3OOHA 4M36A 4CG2A 3F3KA 1MQ9A 4JSTA 4DHEA 4RAQA 4CVNA 4I8DA 4F5DA 1GSOA 4MB0A 4DUGD 3HB7A 2ZAYA 2AK3A 1KAMA 1W1WA 3OTIA 3O21A 2BSQA 4ATNA 1NE7A 3WHPA 5J3JA 3VPSA 4QUBA 2ZYWX 4NBVA 2MR6A 1HTBA 3VU1A 2EWVA 1TLTA 3UTCA 2IHYA 2JHCA 1QYXA 2V7QA 3I83A 1T5BA 2PRIA 3K0FB 4PRLA 4FW9A 1W5TA 4TT3A 2C1ZA 4JQOA 5K2OA 3RU3A 1E2HA 2IXEA 4GLBA 4UVGA 5IDYA 3VOAA 4NBUA 4C22A 3LYUA 3MYRA 4G0XA 1FJ2A 2VCEA 4X41A 5I9IA 1K89A 1ZONA 1XMXA 2IBMA 1PL6A 2W6ID 3LPLA 1W75A 4H1VA 5DOVA 1UZLA 4DN6A 4S1VA 3EAFA 3S2FA 2WC1A 1QC5A 4OHFA 2WW8A 4ZYVA 3R8XA 4MQ6A 5DLPA 1DZIA 1VKRA 2BHNA 5ALEA 5FTJA 2GXAA 3ETGA 1ONSA 1T1JA 3SHFA 1X80A 4R5HA 4YJGA 2ASEA 2Z09A 5A0TA 1J97A 2JCBA 2ZI5A 1RAIA 3LBAA 4GYYA 3UJBA 3WYFA 1NNEA 4FQ5A 3AVWA 3USES 3RYCB 4GZLA 3IXLA 4OXQA 2RK4A 3QY9A 3S7TA 3SC6A 3RVBA 3ET5A 2EERA 5LQNA 1K6JA 1LA2A 4QJ3A 4Q4HA 4X8MA 4FLFA 2GA9A 2HA0A 3BIXA 4M9QA 4Y2QA 3T7TA 3IBGA 4M2LA 2QQ5A 4H16A 1NQXA 1NY6A 4I1IA 4HYTA 4YMIA 2QQEA 4CM3A 4F45A 4MDEA 5ABPA 1J23A 1SKYE 3A6HA 5J47A 5TPWA 2IH2A 3Q88A 2GDZA 1QCZA 1XRNA 2C00A 2CEAA 2FUNB 3EZFA 3K16A 4EMUA 1HFEL 5BSVA 4FR0A 3Q3CA 4M1TA 1M73E 5T6MA 2RAPA 4J0IA 3F5MA 1E3WB 3OF2A 3OPYB 5B7QA 1LJLA 1GUDA 2EP7A 3STVA 4C89A 3PTAA 1ZJ5A 5ARDA 1ZMBA 4KXUA 1BEEA 4CU2A 1XEWX 1JWBB 1BCSA 2H0QA 3IH5A 1XDWA 4AULA 3PQ8A 2HMTA 3GP8A 3H2BA 1W0KD 3QXHA 1CJTC 1L5WA 1IY2A 4YO7A 4BNMA 2ZSBA 3IELA 1XAGA 3VPFA 3T12A 2X2FA 5DN6A 1RYEA 1Z75A 1V7ZA 2AYYA 2RGBA 3A9UA 3CNHA 3AEKA 5ECGC 3KJQA 1YRAA 2OGTA 4DCOA 4MUYA 4MYRA 4CEJA 4AS2A 3QENA 4Y1FA 1G7TA 4WKNA 4PYMA 1KMIY 3RUPA 4RVFA 1N1MA 1QVWA 3TQCA 3KZCA 2PUVA 3E27A 2VA8A 4U63A 3VR5D 1PBNA 4KRGA 3SPXA 3GOHA 1ZD8A 2FK8A 2XT0A 5SYNA 2V9CA 4WVFA 5EXSA 1P7YA 2HTFA 2WM8A 3L79A 4OY3A 1SR8A 3LQRA 1Q84A 4BBJA 3E70C 2ZXEA 3HFGA 3NC4A 2BMEA 3BX1A 3RWBA 3QNWA 1LC3A 2DPYA 4F38A 3PTLA 2GXSA 2OAQ1 1V2HE 3BHJA 4KQ9A 5AIBA 1JLLB 2JFBA 2P4UA 5HPYB 1LRKA 1RADA 3DMYA 2IHKA 3C3MA 3DDNA 2ZBUA 4FE7A 3GROA 2F59A 7AT1A 4G0ZA 4CDMA 5FFNA 2HC9A 5BUCA 3DTVA 1PNVA 3URMA 4UULA 1N4DA 3UC9A 1KEEB 3KKEA 2GESA 4RZUA 2BBOA 4DM7A 4I9GA 3EODA 5A9RA 2OBLA 5JXGA 2X4IA 3FUUA 5U4QA 1TU4A 2R6HA 3N0WA 3FVTA 3U19A 2O19A 2HRRA 2J3LA 4XQEA 1N57A 3HJGA 1QHEA 2N47A 4H7FA 4L4RA 1NW6A 2VKTA 4PLFA 2IIPA 3LK7A 2ZE7A 1Z34A 1ZCFA 1AY0A 4F6LA 3BHIA 2WLTA 4LTMA 5CCBA 1JA0A 3GLFB 1E2BA 4YIHA 4X84A 3T5CA 5FI3A 1CZLA 1U0RA 4JYPA 4MUBA 4HWPA 2IZ1A 1EG2A 4ZMSA 1DTWA 1OOEA 5THKA 1EUZA 2IYVA 1GPJA 2WIGA 3CTMA 1CV2A 3PKIA 1K2WA 3QUQA 3UK2A 5I9BA 3ND5A 4ZALA 1FU8A 3NJRA 5IMSA 2J0QA 5JTUA 3H2YA 1DJMA 4OFBA 4M38A 2B2CA 4OGGA 2DETA 5E0KB 4CTJA 1DIGA 4WDRA 2PD4A 5KSWB 4AF6A 3UMJA 1IQUA 3S2EA 4D96A 4E5MA 1JJ7A 1UMBB 4WLUA 4DPMA 3C97A 4YI3A 4QAJA 2VPPA 1R9MA 3J7AC 1X7GA 1HNNA 1MB4A 2CJFA 3NH9A 2W43A 5BW5A 2EGUA 1KDVA 1J2RA 2QS9A 1FLVA 3K09C 3BDVA 2IY7A 3CRZA 3IEKA 3M1LA 5ALZA 2PH7A 3WHIA 1YJCA 2YOFA 4IF6A 4M1KA 1NV8A 1IJBA 3AI7A 4I3FA 4NQZA 3RFUA 1L4YA 3DDWA 5JYBA 5JHGB 2W6JA 3UGTA 4M0MA 1GZ4A 4XTRA 1ID8A 1ZK0A 2C54A 2JANA 1F2UB 1GSHA 5DRTA 1QUEA 2VNKA 5JI3E 1BQ4A 3NHYA 5BNTA 5JNSA 4BKOA 1TCCA 4U1RA 2COUA 4LJ9A 5AMXA 1ZA1A 4OA5A 4IH4A 4LY0A 1GOTA 1GRQA 3KEMA 4I55B 4DCPA 1NR1A 2I3BA 4QXMA 1SC6A 4G0WA 1OVGA 3BJZA 4W8GA 1ELOA 1RXCA 4BBPA 2J6BA 4JZKA 3TLEA 1E0AA 1Q0RA 2WFZA 4IOJA 2G08A 3OQIA 5FR2A 4R0MA 1UR5A 3MBOA 3MELA 5TQ2A 3PB3A 4BLSA 4UM8B 1LDGA 3NWEA 4GAEA 2J4DA 2HA3A 1W46A 1DIHA 2ZYRA 4XRGA 2VRNA 4Z54A 1DKOA 3KTOA 3P96A 3NCHA 4C4RA 5GGXA 2UZ1B 4AY4A 4AIIA 1A9RA 1P4RA 1Y8AA 2VHEA 4MB2A 2R6ZA 3HYSA 3IXMA 2GN4A 4ZOAA 4AKSA 1QH0A 1SOVA 2L69A 1PUXA 1E89A 4OQYA 4R05A 2WOOA 4EO7A 3VKHA 1Q1EA 1UPUA 1LV8A 3DUFB 1ZM7A 1NXWA 3HXLA 5AM4A 1KI9A 1BHSA 3EQ9A 3IAEA 1LRLA 3FTDA 4MUGA 5DGIA 2YDYA 4K9LA 2FG6C 2N3ZA 3I1YA 3JYHA 1O6FA 3PFHA 3PXEA 4JBWA 4HNTA 1R5OA 4ND8A 4LOAA 4X6UA 2AX3A 3R5KA 1UXGA 4OJNA 1YRLA 2HD4A 2AJ8A 2AR9A 4BY9E 2AFIE 4KXQA 3RG8A 1DCTA 3ZEAA 2PFGA 4C5BA 3A6LA 3KJEA 4QOSA 4TYMA 1GA4A 4EATA 1NR5A 5JJCA 2FFQA 3DFZA 4ZPXA 2QRGA 1YS4A 1DP4A 1YRYE 2OK8A 3DAOA 5G0TA 5JFTA 3ENNA 3PX2A 4X5OA 5GONB 1N1EA 5K3CA 2VUHB 1VSVA 2IJGX 4F5WA 5IUNC 4I5FA 4EBFA 4W5OA 2ZPTX 3QEAZ 2WQ6A 3EVAA 4UVDA 1JAIA 1LZLA 3Q5GA 4D6PA 3TLMA 1TTTA 3U7GA 4E08A 2I65A 4MQEB 2IPAB 3VPXA 1I4WA 3PCRB 3K2IA 3PE4A 2D1YA 3S2IA 4KXWA 3B6JA 1PBTA 2GILA 2QUZA 4XAQA 5LWHA 4KTTE 2EX0A 3T5TA 2WEKA 4E5NA 2PM8A 2J3IA 1RW4A 2V8OA 5CX1B 2J0UB 2OTCA 2QNRA 4D41A 3DZKA 2JFZA 2Y2VA 3LU1A 4P5EA 1T1SA 4YRFA 4FGZA 2OMKA 5ALOA 4Q9DA 3R5HA 3ELWA 2O2EA 1UBTS 4TXNA 1A7JA 2HQOA 1JH9A 3F6EX 3L6UA 2Q21A 2PX4A 3EG5A 1A3CA 4Y18A 2VUSA 3RIGA 4B75A 5JCJD 5K8UA 4JQYA 1T9BA 1WR8A 2VTVA 4DAEA 1ZH4A 1A04A 1KAOA 4UUMA 3SAJA 1O58A 3CR3C 5E1MA 1K1EA 1L8XA 1Z4NA 2ZRFA 5BY2A 1MAHA 4D4MA 2PJRA 1SAYA 1JYFA 3OJEA 4IJ5A 3C74A 2CXNA 2GBLC 3MCUA 4OJTA 4CM4B 1K9VF 2BM9A 5CW2A 1KIAA 5JR3A 2FPWA 2P78A 4TQ9A 3M4YA 3I5UA 1QCCA 2LVBA 3FMVA 4G0YA 2Y6VA 4KVGA 1C1XB 4EB6B 2EARA 3DVAB 2YV1A 2ZIEA 3NC0C 3TJRA 2Q7DA 3BM5A 2PNFA 1E58A 4C6TB 4ZV4A 2XMSA 3G7NA 3DZCA 2SKDA 3JQ8A 3VU9A 3KZKA 1XRRA 3SZOA 3WGLA 4K7JA 4YJ2F 2WU0A 2ZWAA 3QLTA 2EU8A 3T5MA 4H0FA 1QVAA 1CUXA 2VJMB 3HN7A 4C08A 1KI4A 5I5EA 4UTZA 2N9UA 2X1MA 3HA7A 2XGMA 3A2KA 5AKLA 1RMTA 4YK7A 2O54A 4B6EA 1UXOA 4MWBA 2HCJB 3VSDA 1XPJA 1N7GA 2XJ4A 2XQIA 3D7MA 1SU8A 4LXXA 4XXHA 3C70A 4FFMA 2V3CC 3AHFA 2P5UA 3I2FA 1ADJA 4PPFA 5HKOA 3AOEA 1SUCA 3FSEA 4HDMA 4IQGA 4YAJA 4CQNA 1L4FA 5AJVB 3TMKA 1Q15A 5HE8A 3LNCA 2I1QA 2CSUA 1FDWA 2OWDA 3G17A 4UVIA 4ER5A 3LVRE 4PVDA 3M49A 4FB5A 2IP2A 4TRJA 3UG7A 2PUJA 1AUPA 3NJ8A 1NUSA 2CDAA 2HH9A 1OD6A 3WIBA 1L9KA 1F12A 1WX1A 1X92A 1Z08A 2HGSA 3JCZA 2CNLA 2F7SA 5L7YA 3EWAA 3KPYA 3G2LA 4HB0A 1KJYA 3W7AA 2PX5A 3BK2A 4IHKA 3C85A 2J3DA 1OC4A 4RZHA 1DAPA 1ZIOA 1SEVA 2J67A 2PJDA 2H57A 3BH0A 3IJPA 2WAYA 3QVUA 4L28A 1R8QA 1W2GA 4NYIQ 4WKGA 4ZCQA 5LBUA 4EJSA 3HJRA 3Q6NA 1QYIA 1RHQA 5BRJA 3DE6X 2XVYA 2JCVA 4QHTA 4BVEA 2IYQA 5LXTB 1NULA 2RAUA 3F97A 2UUOA 4CBVA 5A05A 5JQGF 1UODA 3BD6A 4MA5A 3RU2A 1TKCA 1LLQA 2QD5A 1M6EX 1PFGA 2D2EA 2YASA 1PJRA 1U2QA 3DBRA 5HIMA 3H11B 2R4UA 1EK1A 4DCUA 4PC7A 3ITKA 4JH0A 1K4KA 4CMAA 1KP9A 1AZTA 5IANA 3IODA 2EBFX 3U44A 2ZYDA 1V39A 3ZWMA 4M99A 3LI2A 2ZSAA 3B78A 3H75A 2UKDA 3N5KA 2R8BA 3P5SA 4IVRA 4EI9A 4YRMA 1MR3F 3CPHA 4QXQA 4X0EA 3JVVA 2EKBA 1BS9A 1NATA 3E7PA 3Q12A 1TD1A 1YKGA 4KQMA 3GJSA 1Z2DA 1R2QA 4AX8A 1AN0A 2ZKLA 2ZRKA 3DWFA 2BMAA 2G88A 3NH6A 2JDIA 4BAUA 4BNVA 4MOWA 1F6DA 2GI4A 2HPVA 2JL1A 1ZKDA 3GJTA 4GM0A 4R2IA 5EJAA 1KVQA 3RKUA 5JSZB 1GZ7A 2Q6TA 1H93A 1A2OA 5AKJA 5A2QA 3V4LA 2XUDA 2NADA 1B8VA 4RTLA 4WH0A 1U1GA 3DGFC 2Y1DA 2YYZA 2V74B 3DZJA 4POAA 5BR4A 3E9ZA 4HK4A 2JAQA 2HW8A 2ZXUA 5FQOA 1XTPA 4E5VA 2H2AA 3WO1A 1UPTA 3NIFB 4DW8A 1I3OA 1SG0A 2JIBA 1ZJZA 3TNYA 5I7FA 1PT7A 1GADO 1ADCA 2AZTA 4L9AA 1EK5A 4QVKA 3VOSA 3SQWA 1KJ8A 3C8ZA 3WDSA 4LGCA 3LT1A 2P9BA 4Z9AA 3H65A 4DZRA 2XNHA 4FZ3A 2VPZA 2OCIA 3HP7A 1K8XB 2QP3A 2BN4A 4FOLA 4CKWA 4ROTA 1Q19A 3X2SA 4EL5A 2X41A 2OHOA 3M6WA 5DYYA 4JXXA 3AFNA 3GLTA 3O8NA 4DBVO 3NOVA 1KQGA 3G0GA 1BDIA 3OOJA 4JUCA 1TADA 4MPTA 1KJ9A 4W5RA 2O0MA 2QZJA 2AN4A 1Q3HA 1P2VA 2HRBA 2HV8A 5C8YF 4ZGGA 4IDQA 3D3WB 1PSDA 4FYKA 3JYNA 1SWWA 4KPEC 1Z5OA 3FLAA 5JXWA 4UATA 3KFLA 5AUQA 1A5BB 4BNKA 3R6WA 4KPYA 3PEWA 4A36A 4BMNA 1CR0A 3IUEA 2ACEA 3MWDB 3BQMB 5D3KA 4CU5A 4ML3A 2BKUA 1A8QA 1JNYA 1JHQA 1JZTA 2O05A 4K9KA 4UPVA 2B25A 4B35A 3TOZA 4EL0A 5JNWA 2D1SA 2GZ3A 5JS2A 3VR6A 4YI5A 5JFGA 5EIFA 4C6RA 1NQVA 3IUQA 1Q1BA 1J0DA 1ESDA 2F1KA 2X5OA 4OFZA 2QRPA 4R1UA 4XFJA 5K0NA 4EFNA 4ZCIA 3ASUA 2GEJA 4IJ6A 4Q1AA 4FPXA 4LF8B 3R9WA 1W93A 1WHTB 1J56A 1T9CA 5FYQA 4A91A 1YCGA 4G2TA 3TPZA 3A6DA 1U2ZA 3OZEA 3WLIA 3EVFA 3ZV4A 2NSHA 2C77A 3RSLA 3L0BA 5F7ZA 1EM8B 3C6XA 1YMVA 3P94A 4PCUA 1P73A 4RD2A 3UKJA 1C7RA 3EAGA 5CMLA 4ZQGA 1ID1A 3MJFA 3H83A 2O3UA 2EC5A 3VR2D 4TKUA 4WI1A 5LQJA 4C7OA 1XCLA 2BMJA 2WD7A 1WXDA 4ZK6A 4I4TA 1O94D 4YT4A 4GQAA 5L3ZA 2HF8A 1JPVA 1V16B 4B6QA 3KDPA 5AM5A 3BCHA 3WZMA 3V6LA 3G7SA 3HP4A 4ZJUA 1Z2OX 5CFRA 3TLGB 1V7QA 2XOKD 3M3DA 2H1OA 1SC9A 1TCBA 4OGWA 4CTOA 1HG0A 1RWBA 2HK7A 4ILKA 3MW8A 4LX8A 4PAWA 4JP3A 5EZSA 5TX7A 4DCGA 4EHLA 1EK2A 2BH2A 3SCZA 4NMWA 3OCZA 5DE3A 1EVLA 4YV7A 1M66A 3OCXA 2B30A 1M6YA 1Y8ZA 1RQLA 4J90A 4PO1A 4FBMA 1AZWA 1OPXA 4G9BA 1XDUA 3WGTA 4A7PA 4BQNA 4TXLA 3QPDA 5AWFC 1KBQA 3OIUA 2B37A 5EKTA 3ORHA 4P82A 1GCGA 4KVZA 4LZJA 3REQB 1QU3A 2ZUWA 2ASVA 1PJTA 1OTHA 4EW6A 2WQ7A 1HOXA 4ITRC 4EPTA 4Z86A 3HBFA 2EGGA 4GPAA 3WL5A 3WWYA 1OJ7A 3WYBA 4FMDB 3AJDA 3RVLA 3IAAA 4RD4A 2G71A 2ZTLA 4GQIA 1GTSA 1NNI1 3IURA 1DQZA 3A3KA 5IFKA 3NAMA 3B1JA 1R0XA 4P8RA 2IIBA 3C1AA 4M9UA 4HCJA 1W0KA 1COWA 4CWAA 1XZDA 3H1EA 1JDSA 1MJ5A 1DINA 3MGCA 1XJ0A 1OB5A 3C14C 3PHCA 2Q1YA 4D8XA 3TZBA 3QUAA 3PGLA 4ZZ2A 1IULA 3K1ZA 1TUBB 3AEZA 3LBFA 4EEZA 1IIRA 3ZHRA 2IE8A 4BASA 2EW1A 2OHXA 3AI3A 1OIWA 1B41A 2BTEA 3X44A 2FEWB 2BFPA 4TS4A 5EE1A 2WSIA 1J21A 2HBQA 3OJXA 3B52X 4M1QA 4BO7A 1TJ3A 4Y0NA 3VGPA 5CTJA 5KMGA 2OM2A 3PQ3A 3RC3A 5KTTA 1XZIA 2PZMA 2A0YA 3U17A 2J87A 5IT9A 1MRNA 3PA6A 2PS3A 2EATA 3IX7A 5K3FA 2I6FA 3FDZA 1H0KA 1PAUA 3S29A 1XCPA 5BYJA 4WFQA 2CHFA 4P58A 1CW2B 2HA5A 2Z6VA 3THWB 1ZX1A 2WU4A 3N6VA 5IC6A 4F4JA 4JVLA 1ST2A 1AGNA 2W93A 4WBNF 5CA0F 1MX9A 3IPYA 4KLZA 4MGYR 2HK9A 5JCOC 1EAMA 1FUYB 1C4XA 4AWAA 3IEXA 4BBAA 4GFDA 4L15A 2CDRA 2A5GA 4UKDA 3VM6A 2XXAA 1DMRA 5G0WA 2CE2X 4B4OA 4NFHA 3SDSA 3GP5A 3G23A 5EY5B 4DYVA 1NX6A 2EP5A 4CV0A 1E7YA 4LOJA 1QG2A 1UQTA 4IUYA 4GPZA 1C8BA 1DSSG 1N7JA 4H0NA 1VB3A 1Y6FA 4S1PA 5EWMB 4KRFA 4AU1A 2XCQA 3L0YA 3PLRA 1E1CA 3K6JA 4Z0HO 1XJ5A 4CCSA 5L3SA 3AEQB 1G21A 4OQPA 5ALMA 3HR7A 4IMJB 4JVMA 3H1TA 1NA5A 1LX6A 4RW0A 3ZIUA 1GPYA 3O8LA 1BWQA 2R9VA 3FJOA 3KFXA 5F2OA 2WB2A 1TJ5A 3LGXA 5EPEA 3R7FA 3V32A 4PR3A 1EX1A 3D4NA 2BCJQ 4N54A 1B15A 1ZI8A 5AICA 2JVIA 3HJBA 3REFA 1YR8A 4IHJF 3DOFA 1JL3A 2GN9A 1DGQA 3AOEC 3C0KA 3T3HA 4BNWA 2Q3HA 4ZAFA 3UMBA 1DADA 2ZZKA 2PFKA 4NJOA 1R6TA 1IN1A 2HXGA 2I76A 3GAMA 4A8JA 3V1UA 2I7DA 3PD0A 5FIUA 4QT0A 4F9FA 4QDKA 3T3PB 4B6JA 4RTOA 4DMKA 3VU3A 2Q2WA 4YJ3F 5ICSA 4LRXA 4BP3A 3MG9A 3QVGB 1G5HA 4XWAA 3VH4A 5LP6C 1HYBA 1VECA 3LTEA 5LDHA 1JP7A 4MV3A 5AVWA 5DNYB 3H18A 4RU1A 1AS3A 2BEWB 5L51A 1LLFA 3DHEA 1FUEA 4JX8A 4ACAA 1X94A 1JBQA 3ONFA 4KE9A 1RJ9A 2YJTD 4V0RA 3QFSA 3FBTA 4PVCA 4OLBA 4XSVA 1SXJD 1HEIA 4NAVA 4EJSC 2AOTB 3IP9A 1ONNA 3CNBA 2BISA 4FFNA 3DV0B 4R2WA 1I36A 1U11A 2VDQB 2A0FA 1DBWA 1NL3A 1EVIA 4PCLA 1N75A 3CT6A 4OYHA 2D5BA 1GZUA 1YS1X 2GPYA 3AI2A 1G63A 1T0BA 2JKZA 3TPFA 3LBHA 4EYOA 4HH1A 1C4KA 5BUSA 5CGZA 4ZJZA 5ILGA 4UM7A 2VHVA 3KSZO 1P5HA 5AVZA 1DLJA 3I0MA 5DU2A 1DLIA 3TSOA 4DB4A 1P7WA 3FKSA 2DUMA 3VA7A 3QLJA 2JVKA 1NVUQ 5SZIA 2ZATA 2WY2D 2WJZB 4DCJA 3A9SA 5BYAA 1GRNA 3FWPA 3Q2IA 1L5MA 3L6DA 1N78A 3K9GA 5H9VA 2FQWA 3BB3A 3WJAA 3LCUA 3ZW9A 4HZUB 4XWWA 2MINB 2R3SA 2EKZA 2FFJA 3SKVA 3ENVA 4E51A 3ZXIA 5K6RA 3AHCA 2I7TA 3QELA 1QIMA 3PICA 3EIEA 2FQXA 1QGDA 4C76A 1RKXA 2O8FB 3D6FA 3T1OA 3THSA 3C4VA 4YAIA 1TMYA 3NKVA 4Z0NA 1AXEA 1QKIA 2ZI3A 1QLHA 2JARA 2YJNA 4FCCA 2GZDA 4HC4A 3STWA 4ENTA 2ZZNA 3RSZA 1YGPA 4HY3A 4CTMA 1N2XA 2VBGA 4FD2A 5JXJA 2VSXA 1SH7A 3HM9A 2P2DA 1T5IA 4XJXA 3TTYA 4BO4A 3SXUB 3O03A 1OR8A 3C5EA 4TV9F 1Z82A 1N8KA 1EEXB 4QGGA 1F2TB 3TG8A 2CJWA 2BI4A 2XUIA 3LS2A 2VTBA 3H3XA 2HU8A 5KHAA 2FSGA 1YJQA 1B93A 1OAAA 4G3XA 4EW1A 1J0BA 1JFFA 1NVEA 2SBTA 3W5SA 4X65B 1E7SA 4J0JA 1SBQA 4OX9Y 1VE7A 4P7GA 4LI3X 3EASA 1XGKA 2OZEA 2OD9A 4UJ3A 3BHMA 4RX1A 1GQSA 2RK3A 3DZGA 5CK5A 3HN2A 2WQZA 1WD7A 2RB5A 2WZQA 4HNSA 4QHYA 1W6UA 4WOPA 5F3RA 3ZKWA 2GF9A 2MSCB 4ZAWA 1RI2A 1LDEA 5ADWA 2O0LA 1RRFA 2JF0A 4YWHA 2YZ7A 4WZAA 3G0DA 2DF8A 5ALVA 4GEKA 4JXJA 1UJBA 2PL3A 1J0XO 2J1LA 4WE3A 3Q98A 4D8TA 5DV9A 3TZQA 3P9IA 1CCWA 1RABA 4X9XA 3AGPA 4R8KA 2ZIAA 1X1RA 2ZJFA 2EZTA 3ZU2A 4Y2RA 4ARIA 4QRDA 2HIMA 2DQSA 2JI4A 2HADA 4OB8A 4RD6A 3T7CA 1U3TA 1ZU4A 3R7SA 4EHAA 5AW9A 4EWLA 3K4PA 3LLCA 4P38A 3WISA 4YJHA 1EGAA 3PQ4A 3EW9A 4FX5A 4NZNA 2RI6A 4EHJA 1QTIA 2TRSB 2AC2A 1NVWQ 5B1YA 2HF2A 2WTMA 2YCLA 4RDIA 2QBYB 1H3EA 4TUYF 4YJ2B 1WMEA 2B82A 1YJ5A 2FUKA 3DHWC 3KSRA 3U6KA 1LLUA 1NHGA 5I4BA 1B23P 4BO8A 4WN3A 2XZLA 2IK8A 1MO3A 3CG0A 4RNCA 1YFJA 3HO6A 3PGJA 1FNBA 2CL0X 2JH8A 2PRSA 4QASA 1E3EA 1O9BA 3U4DA 1PFQA 1JF8A 1Y9ZA 1ZESA 1QDUA 2VRBA 4JENA 4JELA 1ZAKA 4LYAA 3ZZUA 1SUSA 4CKBB 5BV2P 4G2NA 5CM9C 4C88A 4DA0A 1RKUA 4O4JF 3MBIA 2X8WA 1C2TA 2NQ8A 4ZZIA 1NXOA 1GLNA 3IMGA 1QGUB 2CNOA 3K8YA 2R60A 3M9XA 2FPGB 3GL9A 2BFCB 3LC1O 4TN5A 2PCLA 5C80A 1P45A 3BKWA 1YUMA 1Z6PA 4J7XA 1CB0A 4NCXA 5H9WA 2NP6A 3JYLA 4FC7A 4DRZA 1YO6A 5IRCD 4GMDA 1VP3A 1ZL2A 1KRHA 2CCKA 1RWQA 1ZISA 1YZTA 3FR8A 6LDHA 1HQYE 2B92A 4AG3A 1GZSA 1OHHD 2B3DA 2O2JA 4OQMA 4PGMA 5KU1A 2FZWA 1H0SA 3S8YA 1J70A 3DV9A 3FCAA 4LXIA 3OWHA 2PUTA 1E2EA 1C7EA 4PX2A 2LNDA 2VPIA 5E2AA 3ZOZA 1EK6A 3BTSA 5DNWA 4P3PA 1MCZA 1XPOA 2IT1A 4UHJA 3GLGB 3CXUA 3DAGA 4E03A 1VIMA 2BHLA 2EEPA 1E96A 2YZMA 3KPJA 5I47A 1XA4A 5L3QA 4EFKA 1R6UA 2VZEA 3HBLA 4LWOA 1E2NA 1OX5A 1R5NA 1XDSA 2XE6A 4RVOA 5HZHA 1OLUB 3ICOA 1FP6A 5GZ3A 3IVCA 4ARZA 3ADPA 2HMAA 3DCJA 1G8JA 3ZGLA 4E7OA 2IXDA 2P2LA 3IOEA 3V42A 3V4RA 2JLBA 3OTHA 3EVEA 1R0LA 1DQRA 2VR1A 3Q6MA 3FFXA 1JIVA 1GD1O 2HN9A 4O4LA 3FKJA 4UBMA 3ZUPA 2RGCA 1RFGE 1P72A 3CIFA 1GKKA 2G28A 1E3QA 1OKKD 2SCUA 5IYZB 3AF3A 1ABFA 5HQTA 2H2HA 2QVXX 2YCBA 1ECCA 1U9IA 1Z6YA 2ST1A 4IFBA 1FTSA 2WBLC 2OYSA 4NOLA 5H4GA 1N9KA 4FFBA 1TTPB 3DL7A 1UBSB 4R1SA 1N1DA 3STHA 4BFXA 1XXHB 2C2HA 2GHIA 3E2PA 4LTDA 2X8LA 3YASA 4C01A 3EVZA 2JIPA 4O4HB 3LUDA 3VJRA 2OAP1 3F5FA 4Q18A 4JMLA 1AJEA 5DYNA 1JG1A 4ZO8A 4OAQA 1UMCA 1GNSA 5ICGA 5IG2A 3C1UA 4KAAA 3U3XA 1SM4A 1IMOA 1YBFA 1W5AA 2JJ2A 2UAGA 2YS6A 1BN6A 4KX3A 1A9TA 2VSNA 4RHYA 1HQKA 5AKEA 3O8DA 3QKTA 3SC4A 3Q3EA 2I54A 3KLOA 4CCYB 4D43A 4X71A 4QXOA 4KX5A 1N0WA 3FMFA 2MR5A 3AR2A 1USVA 5AW3A 3A3PA 1L6IA 4ZEXA 5CFZA 4QOJA 1W4BA 1DXYA 2CBZA 1EP9A 1M0SA 1L6RA 3EXHA 4HX5A 2BM1A 3KU1A 4LZOA 1BXRB 2FEMA 2HNAA 4WBSA 2FW1A 4WKPA 3ESCA 3TJMA 5FJJA 3JQ9C 5K8IA 4DV2B 3F6PA 1KWKA 1SCKA 3PGA1 1IE3A 3G2OA 3RBZA 5JNTA 1BWRA 2H3EA 4HAWA 3KLMX 2QZZA 3E9CA 1RC8A 1V1JA 2YHBA 1ZC3A 1P5FA 3GJ6A 3SXPA 3PPWA 4BN4A 2VBIA 1OWMA 5CB4B 1MC1A 9ATCA 4XFKA 4B71A 1VFNA 3TW8B 1DV2A 1Z7WA 2QLMA 3TTVA 1ZN2A 1GFWA 3O73A 1PSZA 1RM0A 2AOVA 4MO2A 4W7IA 1HKHA 3T8YA 4ZYYA 5HRCA 5JT1A 4URYR 5LYJF 1WP4A 4B8YA 2AHOA 4HSEA 1NQWA 1QAOA 2UZIR 2GA8A 2XNJA 3DOHA 3W5BA 1Z4QA 4WUVA 3TW4A 2BKEA 4FGKA 1FJXA 2O1SA 1JIJA 4KVFA 2IZ0A 2VF5X 2VYFA 1KSGA 1A50B 2XIJA 2FY8A 2GXUA 3AHEA 2FXIA 4K6KA 1SBIA 4C03A 1OB2A 1W44A 5A5GA 1N3IA 1P81A 1FDRA 4ZAYA 4HO1X 1PVOA 1KYWA 1P4GA 4EZEA 3L4BC 5A0FA 3CLUD 7REQB 1DRKA 1NMSA 5EJ6A 4Q4JB 1C30B 1Z2PX 2IYSA 2O7NA 3DA8A 3WWOA 1ONBA 1LKZA 4URHA 3AETB 2CLDX 3JW8A 2Z56A 1UJMA 3EGOA 1JPUA 3K92A 3HVJA 4BKQA 4D1YA 1JBKA 1O8BA 5EEGA 2W8ZA 4N5HX 2PS0A 2OM6A 2ZJ4A 3M4ZA 3GPIA 4YT5A 1FNSA 3CZRA 3B8HA 4V02A 4HWGA 2LPMA 2PU5A 2WUWE 2W6PA 3BMOB 3GQVA 5L6MB 1AQNA 1DCFA 1N9GB 1PQWA 2AOXA 1YGYA 1KAEA 2XOKA 2B20A 2QD3A 2V7UA 3OPQA 1KU6A 1FQWA 2Y1XA 4UAJA 1VE3A 1IVYA 1T35A 2JLRA 2OXFA 3HVUA 3RH0A 3BWVA 4A6EA 1UBCA 3MUFA 5AJYA 3EYAA 1Y37A 4H60A 4KC0A 1BA2A 4AZTA 2J6IA 1C3OA 2W6QA 3L0IB 2BE7A 2W6OA 4HLUC 2HO5A 2ENWA 1ECFA 1HTTA 1IY9A 2L82A 4HQKA 4UW9A 3TVYA 1W49A 2GCOB 2RGWA 4RPKA 3MOIA 3ER8A 3EPRA 1EFPA 4EZBA 4HYQA 5AW0A 2A86A 2WF9A 4BNFA 2REBA 1KGDA 4JC4A 2BELA 1JQLB 1YI8A 3U37A 3BC1A 4ZDIA 4HH0A 4GX1A 5L3VA 4HDNA 5IARA 4KYUA 3UXYA 3QMWA 2FWAA 3CCBA 3MTDA 3VKGA 2TECE 4G0MA 3U26A 5IAKA 2JGDB 3C4JA 3ND7A 2OVBA 3ERCA 3RC9A 1YMUA 3WQBA 3KV1A 1Q7GA 4KFUA 4ND6A 2IPXA 2GEKA 4ICIA 4IO1A 3ZGVA 4NYJQ 1VYTA 2REQA 2P0EA 3WGKA 4P5PA 3ELDA 2FQYA 2A1TR 3VNVA 2YV3A 4X1IA 2F6RA 1PTJC 2UDPA 4X1OA 4RHXA 1FZQA 4AMBA 3A1CA 3K1AB 5EQJB 4PZDA 1Z36A 4NESA 4Q47A 3HXTA 4ZVPA 1YHNA 3DT6A 1CFJA 4AQ7A 3GNQA 2BMWA 3VAZA 2HYIC 5GPBA 4ZEVA 2H1RA 4AWBA 3T38A 4EBBA 4LJKA 4ZARA 3J81k 3KVYA 3MTBA 4HQOA 3I32A 4M87A 2O8NA 1Z6XA 4I9HA 5KOYA 1ATZA 3T94A 5JSYA 3L1UA 2W2OA 2YW2A 4YO8A 2Y68A 1Q16A 2WTXA 2JFQA 2RIPA 3NDIA 3PIRA 1Y6JA 3KK0A 4JIGA 4BE7B 4D99A 2YIVX 3R9KA 5BR8B 2XVZA 3NIWA 3OA2A 3OQMA 5PNTA 2ADOA 2B4TO 2JCSA 1P7ZA 3ZV3A 2D59A 5IVPA 1BROA 1TK2A 2DR2A 3BS4A 3HDVA 3G8BA 4H3SA 5F1KA 1DKMA 1YE3A 4B6OA 1VI5A 1S8OA 1KETA 4X20A 3PFIA 3DD5A 3OQ1A 3QW2A 4JITA 1QZUA 1L3IA 5CPFA 4ZOLA 2ZUFA 1K88A 4P84A 4KWTA 2XUGA 3RK1A 4QUGA 1JG6A 4LZAA 1NXQA 2G7MC 5CT5A 1IBRA 4RE6A 4BFVA 3PL5A 2YXPX 1D6SA 1GCUA 2H1SA 2OAEA 1GPDG 2BFDA 3EXEB 4RTPA 2DCUA 5DRYA 4HLNA 3UJ7A 1FSSA 3K0AB 1D6JA 2LIPA 4HFJA 2XRFA 1GV1A 4JLMA 1TW3A 1E7MA 3M5WA 3L6BA 2CEKA 3ISTA 1EJBA 2YQ5A 3PDUA 2Z1DA 1C80A 1U3GA 1Y4DE 5HK8A 3U7JA 3W5HA 1R0SA 2GSDA 2Y99A 2O8CB 1YJBA 1UK9A 1T5SA 4FR5A 3EFOA 4EPWA 3GUYA 2DTXA 4Y6SA 3THRA 1TEHA 3IPRA 4JB8A 2XAAA 3N3BC 4JBHA 3EXG2 1Y5IA 2Z5VA 4IHJB 3GRVA 4NBKA 1KBOA 1EHIA 2Q7OE 1WBJB 4BE4A 5FOQA 5K3EA 3PC2A 2V65A 2DR0A 4M0KA 4Y0VA 1NJGA 3BB4A 1S02A 3IALA 4X95A 4CF3A 2IS1A 1OI2A 3C16C 3RR2A 4NU0A 3EOAI 5TNXA 3DC2A 3DVLA 2FUEA 3SBOA 4YRDA 4BP9A 1Y1TA 2D3TA 1KEZA 4YJ3B 5A5EA 2AFHB 2PMKA 2W4QA 2GLUA 3NZEA 2WF7A 3EMDA 2RGRA 3ZE2B 4QOGA 1KYZA 5BQ3A 1KQFA 3EQZA 1IHPA 1T4CB 3BB1A 1S89A 2J45A 3KPWA 1WW8A 4K5QA 5IF3A 3GJ7A 1NAIA 5CPBA 5HKKA 4HMPA 1VLZA 2NZ2A 3OZVA 4NBWA 1A7AA 4KXLA 1NVGA 3RI3A 4BLPA 4LYEA 1XL0A 3CF2A 1ZH8A 3F3YA 1HH4A 4D97A 5J2UF 3ED1A 4KO4S 4E14A 1N5RA 1TA9A 1CJUC 3TGPA 3TDNA 2XECA 1WXXA 4KQHA 3BJIC 3VNQA 3SR0A 2JJMA 4DA8A 1O6CA 4PG5A 1BGXT 3BBLA 2IIVA 3I73A 3V8BA 4CUJA 4R2XA 1ZNQO 4JKIA 1L7RA 3SSAA 2O7SA 4X62B 2IPLA 1G3RA 1LVGA 3WJ2A 2XYPA 4DR2B 1O95D 4MS4B 4B76A 3T35A 1F4VA 2VJQA 1ADYA 3OETA 4RVCA 5JQWA 4UNRA 2NPFA 2CHGA 1PZXA 3KYDA 1WIWA 1GG9A 3CPJB 4HUJA 1XYGA 4V0OA 3RS5A 2H92A 1Z6AA 4DTIA 4DNOA 4RF3A 1ECGA 2XCIA 3K20A 3A4MA 4LWPA 4N6GA 1GAQA 3L4SO 3WSWA 4DANA 1V8DA 1A88A 2VA9A 1P44A 4CETA 1H2ZA 2ZREA 3H5OA 3ZVRA 1WEHA 4NYJR 4C5AA 4E7PA 1WMSA 4B85A 5AIAA 1IDOA 2Q4TA 4HG2A 2OC4A 3DTNA 1DOHA 2C3UA 2QVBA 2WHRA 1WBBA 4I2NA 5LBIA 3CZQA 2YVUA 4HX2A 4MGIR 4YVFA 4BN0A 1PJCA 4XH9B 3GYBA 3R9XB 4OHRA 4V0QA 1C2YA 1UBRS 2CLMB 4JU9A 3NMUF 3P0JA 2D06A 2DSTA 3NYQA 2NNLD 3ZE6A 4DXAA 3HB5X 4LGVA 1IN7A 1P33A 2I87A 3O4FA 4ZI7B 2QZSA 5AHXA 3RT1A 2CVZA 2FJ0A 5KDDA 1RLMA 3FHCB 1ABEA 1C1YA 1KYYA 4LTNA 4OUDA 4TMKA 3MXTA 3CJRA 4PZLA 1A5ZA 2AFRA 2C4MA 4HXGA 3W3ZB 1Q14A 2NZYA 2M6LA 4EDHA 1TM2A 3GU3A 4Q05A 5DOZA 4ZFNA 5A6VA 5MF6A 4L2IB 1GCOA 3V7YA 3UH0A 3IQDB 4J43A 5LWQA 2A5JA 4H7IA 3FWKA 3F8SA 3EGEA 1YC5A 4LKRA 1QZTA 2ZYSA 3SIWA 1F7UA 1NI5A 4V39A 1RTTA 3TMYA 4OI0A 4QGFA 3CFYA 2VXYA 1TMOA 5TQ0B 5KREA 3DVRX 2KSQA 3BK7A 1XTIA 1RRVA 4C0WA 3WK4A 1XVIA 2I1LA 4WNAA 1G5PA 4FDTA 4XQCA 3F5QA 2A3NA 4W5TA 5C3UA 1V35A 5DW3A 2IYNA 4R2LA 4FNOA 4MRMA 3NYWA 2INGX 1U0LA 1FVFA 3OE4A 2G9NA 1P0PA 4AJHA 2IY8A 2RGEA 2X2OA 1PO7A 2QIPA 3LVBA 1J00A 2JFFA 1DBPA 1GGKA 3A4TA 1U2TA 1JDZA 3L8DA 5LN1A 4F96A 1D2EA 5G41A 2EHDA 2MYUA 3L01A 3CX4A 5KOIA 5K45A 1WV0A 4BX9A 5D5QA 4O4IA 4Q93A 1SFRA 4B2PA 4F1KA 2BR4A 4J91A 3DJFA 2WJPA 4GT1A 5M34A 1QK4A 1JI3A 3FD8A 3T5BA 3D0RA 4KQFA 1NNSA 2OMEA 4YUAA 5EIOA 5TT0A 4H9GA 3TNFA 3H5WA 1E2KA 3C41J 4O4JB 4QNRA 4XWGA 4RK4A 1F3OA 2FDRA 1O94C 4QTTB 3R7AA 1X9GA 3NBQA 2JFYA 4G56A 3TIFA 3D4IA 3ROXA 1YQGA 1WWKA 3LYHA 1F2DA 2X14A 5C4IA 4WZBB 4ZTUB 2ZW9A 1SIWA 1LF5A 3CLSD 1IC6A 4R68A 1OHHA 5AJZA 5DNCA 2IOQA 4IWXA 2PD6A 4HATA 4JJ4A 1WW2A 1OX4A 4I4IA 3P4XA 5F2EA 2NYUA 5A3QA 1MJGA 4XPIA 3P4YA 3DNPA 1MO2A 4CMCA 3MOGA 1K92A 4FMBB 3K9QO 1FFCA 1K3TA 4DMHA 2J7KA 4D3XA 4M54A 3R20A 1RHRA 1TQDA 3GG9A 3UMSA 1EWQA 3BAZA 4UXJA 2ZRJA 3BF7A 1B0UA 3T9AA 2WI8A 4GXTA 3AF2A 2Y93A 3SDZA 1V9SA 1ULTA 1X1AA 4B17A 1POWA 3IQEA 3CVUA 1X9IA 2EEZA 4B84A 1WJGA 1BJTA 4KLNA 1AMOA 5TVGA 1TX4B 3NTUA 1NT4A 1SB8A 2J09A 1S9DA 2VBCA 3C39A 3H6GA 4HPJB 5IT5A 4MUMA 1GQ2A 1Z4JA 3O1HB 1HNWB 1Q57A 3BSYA 3OT1A 4KWIA 1WSWA 5DHTA 4FCWA 2NOAA 4ZRNA 1NLZA 1XZCA 3A36A 1NTOA 1T9GS 3OMLA 1U1CA 2O4CA 4BRWA 1DXQA 2B7CA 2XNSA 4GSYA 1A9SA 1OKKA 5GIOE 5IH7A 4I1PA 2XA2A 3TNJA 5TLSA 1W48A 4FT4A 1M72A 3DVQX 1E2QA 4KXVA 5TV2A 3NT5A 3E3AA 1DQYA 3OCCA 2P2ZA 3CZ4A 2F43A 3ITEA 1XDZA 2BDTA 3ORYA 4D8YA 5CDTA 1VE1A 1H66A 2I0FA 1YHYA 2C9BA 3CH5A 4WX2B 4XCVA 1ADGA 2CXTA 3OE5A 1RM4A 3TFOA 1ZUNA 1KY3A 3LBIA 4HDCA 3RTCA 3O84A 1OTYA 4R1LA 1QF7A 5EPUA 2XCTB 3OX2A 5BNIA 1Q92A 2EL9A 3PKZA 3VNBA 1C4OA 4WZZA 3FTFA 1EPUA 2PSDA 2G8NA 2WHQA 1N2GA 1I13A 2Q5IA 3MM4A 4MP8A 5TGTA 4QTYA 5B4UA 3KLPX 3ICQB 4Q03A 2R4TA 2VZLA 2WYOA 3IULA 3KOZA 4IRXA 2ZIUB 4LRQA 5FUBA 4BGVA 1R4MA 2E4AA 3EDOA 4N40A 2PRKA 5EZ6B 3L84A 1VCNA 3ST7A 5TMEA 2G9VA 1F1BA 2IOYA 4IZHA 2ON6A 1SCDA 1XIVA 5KX5B 3PR1A 5ECYA 1KJNA 4MI1A 3U5ZB 3ZDCA 1FVOA 3GYGA 5FLEX 1Q3KA 1WVIA 2D00A 3OT5A 4GI5A 4D92A 1L2TA 4DOMA 2VDKB 3GT4A 4HT3B 3HWSA 3ELYA 3OWXA 5JLAA 3WK7A 2R96A 3HV0A 3IEIA 5D01A 1X3SA 1JU9A 2VC2B 3ZU5A 5DH9A 5BMOA 2FN9A 2LDXA 1TD9A 4GPTA 4WJKB 3VZSA 2AXPA 2IHZA 3NM4A 4L16A 5JECA 5LYJB 1I24A 4C1NA 1T9KA 4U5QA 3K0HA 2XZTA 3RYIB 5AK3A 4X7BA 4F5EA 1LZKA 3JAKA 4D9EA 2WWTA 5H5JA 4GW3A 3E15A 3EDCA 3U81A 2QLNA 1RIIA 1Z6QA 2J46A 1NN1A 3OEHD 3DW3X 2QJOA 4J3FA 3ZHCA 3V48A 4AS3A 2Z9BA 1C3LA 4PC1A 2DYKA 3HZZA 3INYA 4LOIA 1F3LA 2D54A 4IH9A 4L6IA 2EZ8A 4UNSA 1Z15A 2XDQB 1YBVA 3FPLA 4PQRA 5CYFA 1F2VA 4GPBA 4YRQA 2Y1WA 5JANA 1RC0A 5LZ4A 4K9MA 5KNDH 1ZS9A 4OATA 2PZJA 4MPDA 4F72A 2XVAA 1Y8RA 2NU6B 3R6GA 2PJZA 3CUWA 2MDTA 4EYSA 2V45A 4RCZA 3U48A 5HJEA 2BH9A 5IMBA 2UZ4A 5FWAA 3BZUA 1EIWA 4PC2A 5JUWA 2Q99A 1G7SA 1Z35A 5FBVB 3K5WA 1JQAA 3ML1A 2Z3VA 3DMNA 1EFKA 2R6JA 2OHFA 1Y1QA 3ETDA 1E2IA 1E7WA 2ZB8A 4HQRA 3C3BA 4G1EB 3O47A 3U80A 1WMDA 1A8UA 1XMPA 3HFJA 3VPDA 5JMOA 2VSYA 4IIUA 1ZJWA 1R3DA 1SXJC 5TJHA 3SX4A 3O2SB 1QFJA 1XZQA 4XCXA 5DHSA 2XHEA 2WZCA 1D1TA 2NVBA 4BIIA 4MQ5A 3TUIC 3WBKA 1SG6A 2YWBA 4B4KA 5IHPA 3HCEA 4Q6BA 2YXLA 3V1TC 2Z9CA 4U00A 2HDHA 3KSUA 4B3MB 2QQGA 2ZRGA 4ZTBA 1R6DA 3W5DA 4BWFB 2C58A 4OREX 5DYGA 3WV5A 3I2IA 1G7RA 3U3MA 3QVMA 1BG6A 4J0GA 4CODB 4L08A 5EMJA 2WFAA 2FZVA 2QL6A 4FJ0A 5BRAA 5CDFE 3N2KA 4MQLA 4X6LA 2FPSA 4XUDA 3EOBI 2RBGA 4UHHA 2QRKA 4BO2A 5A4AA 3DB2A 1U5BA 1K5GA 4ODIA 5IBRA 3HY4A 1KZ9A 2A1IA 4Z1MD 1THGA 2CV1A 3QWIA 1DC4A 1PS8A 3QITA 2AB0A 3B7PA 1KAGA 5HSGA 1T8UA 6REQA 1GL6A 3TW0A 2HKIA 3HSKA 2OQIA 3C7AA 3KTAB 3H8JA 4M0UA 5M7EA 4HDRB 5LP6F 2CF6A 4HWKA 5U9CA 3D1JA 1JDUA 2Q4DA 3L8FA 3M70A 1GZ6A 1VRVA 2JFVA 4QQKA 1ZGAA 3AV0B 4Y1RA 3LGAA 2YMPA 1YHZA 3FZGA 2EIXA 1ZI6A 1US8B 3RDPA 5FTWA 1QIIA 5C18A 4JMPA 3U16A 2B1IA 3VPHA 3B1XA 1JAZA 4WY5A 1UKYA 3D81A 3IIMA 2JBWA 1TF2A 1QYRA 1V4NA 5FOXA 2HIAA 1U3UA 2VPXA 4Y2SA 3SG0A 4WL0A 3WLRA 3BFJA 2H2GA 4BC1A 3E3OA 3JD1A 5AW1A 2YWCA 3P9NA 3AHIA 2UUPA 2PRZA 2GJKA 3F46A 3I37X 1VSTA 2YV2A 3RD5A 1TAGA 3X3HA 2AR7A 3VTKA 5CG2A 2FR1A 3H8SA 3ONWA 3LA8A 1UC4B 2F4NA 2ZT5A 4AW9A 4P7KA 4G5GA 3EF0A 3WIUA 1VJ5A 1CS0B 1CX9B 2QRLA 1VJGA 3DT9A 1S4MA 1ZITA 3FI0A 3MWYW 1WHSA 3QMMA 4HDKA 4JUFA 4K87A 2LRHA 2RKOA 3D2AA 5IXSA 2PKXA 3U7RA 5TVKA 4E88A 5C2JB 5MFZA 4HX9A 4QRHA 4C05A 1OLXB 1CC1S 2VJNA 2C61A 3ABQB 4YRRA 2I4NA 1PUJA 3PDCA 1GTRA 2QAGB 2XBUA 1DL5A 4QARA 2VJYA 1UBOS 3NRBA 2EQBA 3N58A 3ITNA 3QHPA 4GZ5A 5B3JC 1LPMA 2PKWA 2AE1A 5CVUA 4JKYA 3I58A 3L1VA 4S35A 4YUZA 5DTJA 1VL2A 2DUUA 2O2CA 3CZMA 2KBEA 3QPUA 2CMDA 2GPTA 2QTMA 3SFTA 1UC8A 3KQHA 1NBME 1SVMA 1D1SA 2BEVB 1Q7RA 2WKQA 3HGTA 3PC6A 5K8TA 3S28A 3CCFA 1BGVA 2OLEA 2BBWA 1N6KA 2G40A 4WGFA 4UU0A 4B82A 1U4OA 1B7GO 4D79A 1RCTE 3HUEA 4ZZ0A 1COZA 3I3OA 3ICWA 1NG9A 1WNFA 4ARCA 5I8PA 2IP4A 4CF5A 4QJBA 4D81A 1ULSA 2GTHA 4A1FA 3HU2A 3LZDA 1YQDA 1GDHA 2OP0A 4MR9B 1EH5A 4CQLB 3HRIA 2G04A 1BO6A 3DOEA 3FGPA 4UHDA 1EGVB 5I7VA 4L02A 5H3CA 4M1ZA 1DQNA 4GZMA 4XDHA 3KS9A 4HQNA 4CLXA 1KNQA 1P31A 4Y6LA 4ZCPA 1FP2A 1K6MA 1FDIA 5EP1A 5IW8A 3P45A 3NRJA 4F84A 3O26A 2UYYA 2VJBA 3EY4A 3OMXA 4KRYA 3MWJA 4KWEA 2Y27A 4C0AC 5K0EA 4CDNA 1UBGA 4NPHA 3QW4B 4UBNA 4FYJA 4KW7A 1R4ZA 1XLUA 4HNAA 3NTRA 1I5RA 1GL3A 2ILTA 4EUEA 1G8PA 4PSDA 3BSFA 2GR9A 3VO9A 2C4UA 2FP3A 1BW9A 4L85A 1YCHA 3OE7D 3A4LA 2JAWA 1CY1A 1TC1A 3HDTA 1S0UA 1DEOA 2ZBDA 4LN1A 4EYEA 4JYCA 1P74A 2JGKA 2QV0A 2V7WA 4D8WA 5CDSA 3UF0A 3C8MA 3HA5A 3FRIA 4KGZA 4X64B 4NIMA 1R3UA 4MRSA 2P4SA 3NBYC 1RWXA 4RLSA 5D6NA 2ODNA 4K3VA 3WWDA 4RTQA 3MERA 3Q9SA 2CK3A 2A4KA 5FHQA 4LWQA 1Z06A 4TV8A 1T4DA 5BPFA 1EB8A 5HNKA 3KSAC 4WBXC 3ZY4A 1JB9A 1ZN8A 5P8WA 3FFTA 4K9QA 1O95A 5JAPA 3QG5A 4HEHA 2P9ZA 1PW7A 1DWPA 1X19A 4RADA 2QM7A 3TD6A 4N0QA 1TVCA 3VQTA 2JFGA 2QSUA 5DWQA 4BKMA 4F3NA 1Z16A 4MS1B 5JY6A 2GPNA 2AG8A 2W2PA 1ZCAA 3CEJA 3MUNA 2IH4A 2Y1EA 5KQLA 4RWZA 3KHUA 1SKBA 1QNLA 5AK0A 4YJGB 2J3KA 4ARBA 3B6EA 4M0DA 3GG2A 5CXXA 3PV0A 4O3MA 1A4UA 1C0EA 2OHGA 3OM0A 4F9GA 4BO1A 4H2DA 3K0CC 4ZN6A 3FPFA 4RIFA 4P3KA 1A9ZA 1I80A 1YB5A 3RAGA 5LDDC 2GVZC 2MIIA 3LHIA 1IXKA 4O2BF 2DGDA 1U7WA 4AJPA 3CEHA 1P2GA 3RLFA 3WNVA 2FG7C 3ZY2A 3VHXA 4L9RA 3T4PA 5ED4A 2ANBA 1GPH1 1JHPA 4FR2A 4IR7A 2BKAA 5AM0A 3K3PA 1V1MB 1CQWA 2C9OA 2L18A 1OYVA 3ZGYA 1LV7A 2IYLD 2Q27A 4C7BA 1SKQA 1PYDA 2PIAA 1KIMA 1DEXA 1NXXA 1U8ZA 2NU7A 2Z8XA 5EERA 1I9CA 1QYVA 2B8WA 3N8IA 5KNLA 4XUEA 2OCKA 4R2MA 4MYUA 2ZAIA 1XXLA 2CXSA 2E6KA 4AJJA 5JRJA 1WS6A 1RRPA 4FGJA 4MQFA 1HL3A 2HU5A 5B37A 2XCRB 3V1NA 1Q44A 1UAAA 4I9NA 4MYCA 1CR4A 1NRIA 4EW2A 3ABRB 4PZUA 4BB6A 5LQMA 1C5KA 1BCSB 1T2AA 2WJ4A 2FEOA 3T5GA 1H5NA 4HOYA 5DK6A 5FUVA 1CUGA 5BN3B 1OA0A 2Q4OA 2SKEA 1WOYA 2B61A 2CCJA 3F4LA 1JSCA 1YOBA 3NLLA 3AEKB 3NAZA 5KJEA 3OF3A 4A5SA 1ZNXA 3L8GA 4I1RA 4HB4A 2HK6A 3E1SA 4JCCA 5CVDA 1HDCA 4CEJB 2IS2A 4D4KA 3BH6A 4L8FA 1U7ZA 1JALA 4GPIB 4KQJA 3SX0A 3GHYA 3MAJA 1BKYA 4M8NE 3AUUA 2RHDA 5D5HA 4OKSA 4PQGA 4E0BA 1X7WA 1RCUA 2QTVA 1DAHA 3H84A 3W2IA 1Z7BA 1I1QB 3NATA 3AVTA 4KIFA 1QGYA 2J32A 4IAOA 2PGIA 4B46A 5K03A 1TECE 3P0RA 4LXHA 1OAKA 16PKA 1XDDA 3HL0A 3K9CA 5FO1A 2ZTSA 4C5CA 4RORA 3HO8A 3CC8A 3ORQA 4EHBA 1T0UA 1AQJA 4HFNA 1ODJA 3M1YA 3RBAA 1DT5A 4Z0PA 2BCEA 3CLUC 1X1TA 2R6R1 1F7VA 3GY0A 1GIAA 4Q4CA 1H9BA 2GPWA 4LY9A 4KE8A 1KOJA 1WCWA 4P1ZA 5HS4A 3SLKA 4DEYA 3SQXA 2OD2A 3OESA 1Q0UA 3BMNB 2PWZA 3DTVB 5EP2A 3MGAA 1O9HA 2FEPA 3W2FA 3ZJ5A 2QJWA 2RI0A 3D3NA 4ZZ1A 3PQEA 4LJAA 2GN6A 2YQZA 1CDOA 4PZ9A 4JJKA 4C87A 4O5OA 5JYDA 3LQ1A 1YRWA 1DB3A 5F2NA