1V8DA

Crystal structure of the conserved hypothetical protein tt1679 from thermus thermophilus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
193
structure length
189
Chain Sequence
b'MEGIRRAAQRAAEEFLQAFPMAPGSLFVLGGSTSEVLGTRPSLEAAHAVLEGLLPPLLERGVHVAVQACEHLNRALVVERETARAFGKEEVAVFPHPKAGGAKATAAFLRFRDPVMVESLKAQAHGGMDIGGVLIGMHLRPVAVPLRLSVRKIGEAVLLAAKTRPKLVGGARAVYTREEMLKKLEEFLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein (TT1679)
molecule tags Structural genomics, unknown function
source organism Thermus thermophilus
publication title Crystal structure of the conserved hypothetical protein TT1679 from Thermus thermophilus HB8
rcsb
total genus 53
structure length 189
sequence length 193
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04260 DUF436 Protein of unknown function (DUF436)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Hypothetical protein TT1679 1v8dA00
1V8DA
chains in the Genus database with same CATH superfamily
2W7TA 2BGIA 1Z16A 4TZ0A 1PKEA 5I7AA 1IY8A 1W5FA 1IXKA 1TEXA 2RHLA 3BDVA 4LSGA 4TLEA 5KQPA 4BASA 4S35A 1T13A 1FFBA 1NAIA 2GZAA 3ELWA 3O8DA 1F7UA 2JCXA 3T99A 4D4KA 5LMNB 1ES9A 3GAZA 1NBMA 3FKSD 2RH5A 3DVRX 3EWNA 4JSYA 5J1TB 4E1AA 4MTLA 3NOOA 1X2EA 2B2NA 3JR3A 4NE7A 3QJGA 2GJ8A 5HBRA 5HHTA 1DKNA 1B15A 3FWNA 3CLUC 3EZYA 3ZV5A 1GZUA 1ZH6A 2I8CA 4KUGA 4HNUA 4W8HA 4B3GA 2WD7B 3HSYA 3ONEA 4DZZA 3K96A 3TL2A 1DJPA 5LIRA 1U11A 3LDGA 1CDZA 1NDQA 1PL7A 3R24A 5TT1A 1QHIA 1WQ3A 2HLDA 2LCFA 1Z29A 3N0WA 1IOZA 4JHLA 2OC9A 1EZ4A 2VSOA 4OK6A 4AZ3A 2H7CA 2VHCA 2LXNA 1NVKA 2V7UA 2QE6A 1LH0A 4BYGA 4MP8A 2R86A 3BXXA 5LDDC 1WEHA 3CURA 5EUCA 5AH0A 5ILQA 3EVBA 3ZE8A 4JFAA 4EQ6B 1E3WA 2OHXA 1JBKA 1XUOA 1XXHB 3HJGA 4FX5A 4WGFA 4J91A 3X2EA 2FG5A 1VL8A 2Y68A 3G85A 3LRXA 2KBEA 4RADA 1EVYA 4Z9FA 1JQAA 2AR9A 3DV2A 4WLUA 2GO7A 1J8YF 1EFLA 2MWMA 3I6YA 1GZVA 2DTXA 1YRQA 3TM4A 3CR3C 3CWZA 1AZSC 1U1GA 1UT5A 2KW5A 2PBZA 2XVZA 2YBEA 3GMDA 3RV4A 5KI6A 4W9MC 1D6SA 2AJLI 4WL0A 4MUEA 2R6CA 1RAEA 1RWNA 3WLLA 2R0QC 4F9TA 2WOJA 3K8ZA 1TD9A 2BR5A 2GD6A 3WGTA 3GR6A 4MRRA 2CHQA 5DM60 3BIWA 1A76A 1YVDA 5KWSA 4M4SA 3GEGA 4FEAA 1B14A 2HJ9A 4MYSA 5BY2A 5FTLA 3O4GA 3CNQS 4F8EA 3TSOA 3C16C 2IE0A 2GCOA 4KB5A 3L6CA 1PU2A 4OSEA 3LNTA 3N2YA 3ZIAA 3OKFA 4JI8B 4N41A 2BHLA 2AFIE 1B8NA 5K4AA 1KFEB 3KBBA 3KQQA 4IF6A 1PGQA 1GNVA 1QFSA 3CRW1 3HNPA 3OCZA 4ZO7A 4B3JA 2FSPA 2QZJA 8OHMA 2WYIA 4N5LA 2PN1A 1KFCB 2UVPA 4H3HB 4CKCB 1XYVA 3NWBA 2XUOA 5DULA 4AJ4A 1Y37A 3H04A 4KACA 2Q6OA 4QTTB 4PYNA 2OD7A 4UW9A 3DFFA 3OBBA 3P7MA 2PBLA 3VYVA 1AUQA 4LF9B 3K2EA 4QNMA 3VTFA 1ICEA 3AP1A 1R4ZA 1JI3A 2QE7A 3OPQA 2BM8A 4MV8A 2H0QA 5FI0B 4QXQA 5CDUA 1YMUA 1G291 4ZOLA 1XTSA 3D6VA 3CR8A 4MQLA 4CQJA 3TTXA 4FOOA 1UIRA 1GG5A 1OH8A 2NQTA 2I4OA 4BB9A 1EXDA 3EAGA 4X64B 3UHFA 2WT4A 3RSCA 3BSSA 4GYYA 2Q4TA 3BGVA 1CS4C 2OQVA 2QQ0A 4C7JA 3RKUA 1TOAA 1YC5A 1AHPA 2CY0A 1MX9A 3JQ9A 1HRDA 5B2FA 4B0PA 2IT1A 4MQFB 2BWJA 2C96A 2PX6A 3HJBA 4LOKA 3THXB 4QJ3A 4O5AA 2ONCA 3SR0A 4HWPA 3ABSB 5EA2A 1YA6A 3O93A 1KZ1A 1XQXA 1EFTA 2X8JB 2ZDGA 3VR3D 4C14A 1XVAA 2CUNA 4FWTA 5KWJA 2MSNA 2Q9BA 4C0JA 5CLJA 1ZHOA 2XB4A 2Q28A 5J47A 3W5AA 1H6AA 1XN4A 2QD1A 3QUAA 4I4TB 2HU7A 1RIFA 2AOTA 2IU0A 4OFZA 3W7BA 3JQAB 2ZRAA 4KTVE 2I3AA 1JNYA 4ZAYA 3PFIA 2BTEA 1SUFA 3DMRA 4MCIA 2R1VA 2ZK7A 2I7VA 2HMSA 4UTVA 1JHAA 4AIIA 1OFIA 4JX9A 3WKDA 1V8FA 5KWEA 3VBEA 2QXUA 1EVQA 1XLVA 2FMFA 3T7IA 3OIUA 4PWZA 5B2EA 1PGOA 3HWX1 1C9MA 2PX5A 5FPTA 3VMFA 2Z4RA 3S8EA 5K3FA 4MLCA 1YQUA 2WJPA 3HDVA 4M83A 5KNBA 1EXVA 2OZEA 1DBQA 2VF2A 3NT2A 3ZZNA 4YUXA 1MGOA 2IYVA 1G3QA 3SVZA 2YW9A 1NQUA 4XVUA 4YMHA 2BGGA 1GRNA 1BX1A 1SKAA 2GBFA 2UZ4A 1N2CB 1ACJA 4R9VA 4YUWA 4FONA 2XUPA 1T9AA 4JJ6A 2YXPX 3Q2KA 3DFKA 3Q7PA 4PZDA 3QI7A 1LSSA 2Q4OA 2X3FA 3FR7A 4GOMD 5ERXA 1XF9A 3GP3A 2ZRHA 4PVCA 5REQA 1WZIA 1CYDA 2V7TA 4JLDA 2QTBA 5ALKA 2NZUG 5FF9A 3FMPB 1GPAA 1DFHA 2EBWA 3H1TA 4OQEA 5SYNA 4N0DA 5I7SA 5EJ5A 2CE2X 2XBUA 3AR8A 3PNQA 1I0ZA 2WHRA 3R3XA 2I55A 4FNAA 2VPXA 2V8OA 2ZR9A 4CGYA 1QF7A 4MQBA 2A88A 1NJGA 1GGEA 2OESA 1FRNA 3CEJA 2G4VA 4CG0A 2HCRA 3MRSA 3NKVA 2JJ1D 4E5KA 1ODFA 5BOVA 1NQXA 1AF7A 4OJQA 1NXXA 1FS6A 1C1DB 2C2WA 1HDZA 2XBLA 3DEZA 3ENKA 5KOIA 3UV7A 3L4BC 1QVVA 3BXEA 3JVIA 1OIXA 4FD3A 2YWRA 4ZCLA 4FDVA 3PXEA 1IHPA 2Y9PB 2DLCX 3FTQA 4DFDA 1XEWX 2DETA 3PA8A 1U2RA 3C8MA 1X2BA 1JIIA 2NU8B 3WSTA 1Y98A 2L0XA 4Z1MA 1D2HA 2D62A 1E2KA 1D0IA 2OAGA 3KPWA 2WF5A 3M1YA 5J59A 3WQBA 2GDJA 4Q4CA 1EAMA 1LF0A 3TLGA 5CDHA 1MFPA 1R9MA 3ROFA 3QVSA 2XQKA 4MKFA 1ZGBA 3GRCA 4LS3A 2F1RA 1LPBB 1QIEA 1JU4A 1NDUA 2EF1A 2QGNA 2I6XA 3R0ZA 4IG9A 4TTVA 3VZRA 4C6HA 1VBKA 3QHAA 4DDVA 1ESMA 4L72A 1KPIA 1G5PA 1VZ3A 2JHCA 1RAIA 3ASVA 4TX1A 1ZRMA 3T38A 3W8RA 4A2WA 3ADCA 4Q7QA 4L3WA 5I8ZA 1IUKA 4ZI2A 5EEHA 5TGZA 1RJGA 5ITZB 3IP6A 3EULA 1KDZA 1MC8A 1USIA 4W82A 3I39X 3MERA 3TFOA 1DBRA 1AC5A 1Y7PA 4HLUA 3CJQA 3I6QA 1OROA 4UFNA 5FFNA 3GH1A 4ZQGA 2X1MA 2YY5A 2FZCA 1C9EA 2RJNA 3E27A 4MIKA 2XCQA 2WPDA 5E6RB 1PJTA 2GFQA 1DPFA 2F43A 2Q1SA 4CMBA 1L7EA 5DHQA 5FV4A 5IJ9B 2QY6A 1JLMA 2Q5IA 2HK9A 3QXXA 2W6MA 3ZLVA 1Y33E 3DFUA 3FOCA 1P7WA 1X8LA 2BFBB 1AKUA 2JGDB 3FTPA 3CX7A 3GRFA 4G3XA 5FTKA 3TDNA 2HGSA 3GRPA 3ZHOA 1LF5A 5ECYA 3V7FA 1EM8B 1JEQA 1SKUA 3OJFA 2J67A 1SQFA 1N5DA 2ZJ1A 5J2UF 5HJ2A 5TMDA 1KO4A 2FPPB 3AONB 4HXFB 4TOIA 2HX1A 4KXYA 1LV8A 1FLAA 5K0GA 5A0VA 2UUOA 3LE8A 1FTGA 3QVGB 1YDMA 2FB9A 2Y4OA 3QHPA 4ZANA 1UMCB 3IKVA 3L4SO 4NYIQ 3WB0A 4PGHA 2ZJZA 1Q0PA 3A58B 1FU8A 1P5HA 1ILEA 4PN7A 1D9XA 1XNJA 2HMUA 3PEVA 5F12A 3RW9A 1WUHS 1QGZA 3NEYA 4YPOA 2C9MA 4GR4A 5A2GA 3C6KA 3D31A 1WBJB 1E1CA 1ZUD1 4MUIA 4X1KA 4WFKA 4DDTA 2MSCB 1V96A 3LX4A 5DPMA 5FAXA 3ZPXA 2IHTA 3I23A 1Z75A 1A88A 2FSIA 5EJGA 4AMZA 3ZDAA 4UUAA 2HTEA 1NN0A 2IEBA 4TXMA 2I62A 3SEQA 1BFUA 4L50A 3DBLB 4V0SA 2GPSA 3TIXB 1W94A 1K4KA 2WJ4A 3EFEA 4EMBA 3GLVA 1WS6A 4B6QA 5KDDA 4J6FA 1WW2A 5JD4A 4GKAA 4AXXA 1IBLB 1OHHD 2IYSA 3PUXA 1YOBA 1UKCA 4RIGA 4GRIA 4R3NA 5TPZD 3L79A 3RWMB 2ZTLA 4FSHA 4RO0A 4BO7A 1SY7A 1RS0A 3H84A 3OKPA 5G0SA 2GKSA 4L4ZA 2BMWA 3CE9A 1J97A 1P19A 2FX2A 2PKCA 3PE4A 3Q98A 4OXYA 1VG9B 5SICE 3W8FA 3ZXYA 3PZRA 2IXDA 1WB6A 2ZYAA 4WLOA 3TB6A 2WF6A 4WOPA 3UXMA 2XKAA 3WL3A 3ENZA 5D3QA 3AYXB 2L2QA 2V6JA 2ID8A 3PDWA 4R7ZA 5K3OA 2JJMA 3OC0A 1KAHA 4KR9A 3P4YA 2YWJA 4KJZA 3M4NA 5DW3A 1TCVA 3BH6A 3FVQA 2J1LA 4M1KA 3SOPA 3WYCA 4BCCA 2BKAA 3QPVA 1FXWF 2VPYA 2XPCA 3BULA 3PHLA 4H7PA 4Y2RA 4C4OA 1B41A 4EHNA 4IPTA 4IEIA 1I3OA 1CEEA 5A5FA 3VH4A 5DBFA 5AKYA 3CT6A 2MJLA 4PLYA 4ARBA 1K0UA 4DNXA 1KJ8A 3EIQA 3KJNA 4RD4A 5CTJA 1FUIA 2I4LA 4DDUA 1JR6A 4EKGA 5KYYB 3A2MA 2AXNA 2FUG1 1XP5A 1JALA 1O95A 2LBPA 2ZI3A 4O08A 3RB8A 1E9SA 4RTSA 2DHQA 1PZXA 4G65A 1UKEA 4GSLA 5ALDA 5DNEA 3S1SA 1YIAA 3DLBA 2PO5A 1IU9A 3JZDA 4B46A 3IKTA 2VAVA 3AOEA 3EDMA 3GNTA 4DTCA 1V1MA 3LUDA 2C20A 4ZTBA 2GVDC 3PUVA 2P30A 2DJ5A 3EARA 3O3MB 2WJ3A 3IPLA 2JVIA 4FD2A 4HVAA 3DO6A 5EUQB 5CFNA 1S8AA 4H1TA 1DNPA 1GU0A 2WWVD 2BFCB 1VL2A 1JP7A 4YMVA 4DCUA 2ZROA 3GLHE 4HAOA 4M54A 2I76A 1G21B 5JFGA 4QM6A 1W19A 3E3OA 5KTKA 2GVNA 2J6BA 2GZDA 1M2JA 3WGVA 2O0MA 4NCNA 4MMZB 3WYDA 3RBZA 4Y30A 1LTKA 2Y27A 1NW8A 2W8ZA 3RREA 3UW3A 3ZIDA 4LEIA 1JWAB 4R2XA 4XDGA 1V7PC 1FX0A 4TKZA 1BKYA 1R6TA 4PBTA 1NHGA 4RVCA 4RSRA 3USES 3KLBA 2PXXA 3O6VA 3Q6MA 1IJBA 1OZGA 4I2NA 1X87A 3A3PA 3ACDA 5TS2A 3TW8B 5JRZA 4XQ9A 3N7UA 4K9SA 2X0DA 5HVNA 4GDFA 2A1TR 3LWZA 3JQQA 3GQBA 1ZH4A 2WYUA 1ULSA 4HLUC 3EDOA 4AB1A 3WGIA 3H4IA 3U40A 1CY4A 1I1OA 2AOUA 2G5PA 2RGGA 4C01A 1ATIA 1U8FO 3NBQA 3PHBE 4IHQA 3FWHA 4H4EA 5CW1A 4Z1MD 4XJSA 2XKKA 4U7WA 1KZ7B 1F38A 3BREA 1F4LA 3HFRA 4CT5A 4E6PA 1KK3A 5B4VA 2AUNA 2PKEA 1SU4A 3FUTA 3H9UA 1COWA 4FUTA 5BVHB 3WRYC 4TTIA 5ICFA 4J0QA 1M34B 2UUCB 4JJEA 1X9IA 1YJ8A 5JNUA 5L7YA 5ALEA 1ZI8A 4P6VF 3UB2A 3FFBA 1L3IA 1T3ZA 1M6EX 2FW1A 2JARA 3SXUA 5AUOB 1SCQA 4C30A 4ZIRB 4QYSA 1XCPA 4NAVA 3AUUA 1JZSA 2FW8A 1KDOA 5EMMA 4ESVA 1G9XA 1XZCA 4QD3A 4WLVA 3QW4B 1P2DA 5GWXA 2VNHA 1B74A 1RHQA 2XYHA 1BXKA 4JEHA 3OFJA 4OJYA 4YRDA 4CV3A 3DUFB 5H0IA 2FZ4A 2GEFA 1ZAYA 1DE0A 1I9CA 2A5YB 3IEVA 1AHNA 3UGQA 2XZPA 1RR6A 3OTHA 4QBTA 4O4IA 1G2QA 2CHVA 5DP2A 4UOEA 4CKEA 1HEYA 5CA1F 2J0VA 2E1RA 2QTCA 4D4HA 4IWYA 3K1AA 3PJGA 3RABA 4P3KA 4PIMA 1T1JA 4GQBA 1V4NA 4Q6WA 1UADA 3WXMA 3A1UA 3GNLA 4HDRA 2GHRA 4I4NA 3UKOA 3JVVA 1E0JA 2CF5A 1RKUA 2KMLA 2YZ2A 5TQVA 3U7IA 4AZVA 5JDIC 3COPA 2XHEA 1HFWA 2X8JA 2O14A 2IOFK 3GRUA 5D3ZA 3DO8A 3GFVA 4ZEOA 3IESA 1M6HA 2QM0A 1USVA 4IDPA 1M8GA 4QFDA 1FMJA 1MD9A 3OLZA 4I1SA 4U3JB 1RYBA 1NA5A 3AI2A 3RF6A 1J6UA 4UMEA 4N47A 4Z53A 3GGJA 2JLCA 1NV9A 4NARA 4BP3A 4EVIA 2FWJA 3IS3A 3VXKA 2BKUA 1HBJA 2XUGA 2GEBA 3O1HB 4O33A 3ZI0A 5FOWA 4KWIA 3K7EA 2V6IA 5E4YA 4CLOA 1DEXA 1IQRA 1J2JA 2EF0A 4Q9LA 4XSHA 3S27A 3WK4A 1TK3A 2G0NA 5LWHA 5C4GB 5KU1A 5HP4A 4DAOA 5AXAA 1V1RA 2XUIA 4DBLC 4BN5A 5JJKA 1PQ4A 1NY6A 1V7CA 1W4ZA 1NMQA 4YN3A 1FSZA 3GJSA 2BFWA 4MOWA 3ZGOA 1KEWA 3F46A 5FIUA 1SVOA 3DZKA 2PSFA 3I4CA 4N0MA 1OB2A 1IIBA 4G5HA 3E5RA 3HI4A 4M8SA 4WA8A 4MR9B 2CXPA 3FZYA 2VJKA 3O21A 4PGAA 4QAJA 1GPNA 5AJZA 4DQXA 4HYQA 2EFDB 2R00C 1WXHA 3MJCA 5DX8A 4EDFA 1WXQA 4UNQA 3D8SA 4YMUA 2MINA 4I7EA 1T24A 4KXFB 1SCUA 3IT1A 3OZRA 4ND5A 4C04A 4F2WA 5A3QA 4GX2A 1VA4A 1LB1B 2Z30A 3D3QA 3MWYW 2IWHA 2D2EA 2IDMA 2YIVX 4RQBA 3CUKA 2VJQA 2O9JA 3TOXA 1SCAA 2NZ8A 3MM4A 4RJIA 1NR7A 5GGYA 4D9KA 4MVJD 1XELA 1O94C 1UJCA 1GARA 4TVBA 3U39A 1MNAA 2GEDA 4BC0A 1UP6A 3T3GA 2XIJA 3EPLA 3X1MA 3HB5X 5K6AC 2AKAB 4L6IA 4V1CI 4HADA 3IIJA 4AJOA 3LLVA 2O2HA 3R6WA 1GCIA 4P0TA 4EY4A 1IPHA 2FXIA 5ARDA 4ZYTA 4E88A 3I45A 3EG5A 4TSFA 1N5LA 3GX1A 4NBRA 2BFPA 4W5HA 3KT3A 1J2UA 4CT0A 3LVQE 3IPAA 4ASUD 4A0SA 2DPYA 1EX1A 1VGVA 3L4EA 2RGDA 4ZV7A 3LSTA 3VNAA 4A6EA 4FB4A 3L46A 5JS6A 1CR0A 1MT0A 1BVRA 3AQIA 4PZ9A 3PPXA 2HM7A 1TW2A 4MGIR 2O20A 4DJFC 3DEFA 4EAAA 1NPDA 3TFQA 2P7IA 3AU9A 3OQOA 4BFUA 2HIMA 1SXGA 2JASA 2QQFA 1GT91 2XF2A 4UBLA 5LVAA 1MX3A 2YOFA 3D8NA 4WV3A 5JQGF 2H2IA 3NRBA 3PQEA 3GMTA 2XTJA 1GEGA 5EUMA 5HA5A 3K70C 2Q9UA 1BE0A 1L4YA 1VIVA 1BXRA 3BF8A 3FUUA 3N59A 2Z1NA 4RMGA 4C0WA 5ITVA 1F0KA 3QF4A 3R2JA 1C3LA 2BFNA 2CMKA 3F3MA 3FYDA 3IP3A 4MDYA 1ISMA 3HFJA 4URYR 4ES6A 1DO8A 1SG9A 2R8XA 3F97A 2CLIB 4IW3B 4W8GA 5EZ6B 5IDVA 2GK4A 2VBIA 2YWGA 3HVUA 5EERA 4BGEA 4PG4A 1V43A 5DO9A 1JXOA 1L3CA 2ATXA 1FTSA 3EH1A 3KT0A 4M8LA 5HJEA 3CSUA 3V3TA 2ZRDA 3WL8A 1EINA 4K6MA 3TZCA 1XZEA 2RFLA 3WG9A 3MVEA 5J4YA 1AK1A 3AF2A 1K86A 3TRFA 4H17A 1QTNA 3PUWA 3UG7A 2K6GA 4FLFA 5HE9A 1G64A 1Y4DE 2C1XA 3HCEA 5FBRB 2GD0A 3USZA 1NW9B 3IP5A 1O96A 2XB2A 2OFFA 4FDUA 4QATA 4PE5B 3O83A 1E64A 1T3TA 3QTBA 1ZIOA 3F7TA 2GF2A 3V32A 1OUMA 2DWUA 3D7MA 3VSDA 2Z2JA 3ISJA 5TXGA 1A04A 4I08A 4EFLA 2G08A 3PR3A 1D6NA 3ETDA 3JZFA 2JAHA 1RYYA 1SJ9A 4OCZA 1U5AA 3QBJA 4FDAA 3UWOA 4UREA 8AT1A 2BKEA 2PLNA 5E2AA 1FRVA 1HE2A 2XMCA 4YUVA 3VR0A 1E9FA 4MV0A 2AC2A 4XX0A 3U3RA 1H6BA 4A91A 3OQNA 4X1KB 2Z4SA 2KB0A 3WE7A 1F6WA 4EJ6A 3RRJA 1RBZA 2O4CA 3AK4A 1V4VA 3PA6A 3WYNA 5ALYA 3G17A 1XZLA 3I2JA 2CWWA 1E59A 1QJ4A 2IU4A 4HFJA 5LP1A 2NU6A 5CT9A 5CFRA 4YAOA 2ENUA 1WWKA 1CQXA 1XJQA 1TD1A 4IDCA 4J1TC 3KUUA 5BV8A 3EVGA 4AF6A 1D2RA 1JDSA 4OATA 4O1MA 1B93A 1U1FA 4FR5A 1LI7A 2MSEB 3ZHCA 3FDIA 2WYWA 3EE6A 1CUAA 3DAGA 3OFVA 3L0PA 4IHJA 4Q02A 1E2PA 2PZJA 1LSUA 3M6IA 4U7TB 1XMIA 5D7BA 3R7WB 1JA1A 1HE5A 1SCJA 4K6KA 3LPDA 2ZBDA 5B7QA 1JKMA 1QIDA 4AUKA 1RM0A 4JP2A 2B1JA 3R1IA 4KR7A 1ZQ1A 5P21A 4GRAA 4R0MA 5CH3A 4MDFA 1F51E 5DWQA 4JXJA 1Z62A 2OKCA 3CRZA 4O4HA 4QGSA 1AX9A 3Q9LA 1NUPA 1XZPA 2FPRA 2ORED 1TU4A 3IDAA 5FFFA 2QVCA 2WZBA 1ZBQA 2C9CA 2CVHA 3IURA 3QPCA 1JEEA 1OMOA 2H1SA 3NTXA 4DR7B 1ZM2A 3IAXA 2J41A 1R3UA 4RD0A 3U9LA 1SCKA 1Y5RA 3NEPX 5A04A 3ZTWA 5IVHA 4WMLA 1JSXA 4PAMA 1G7CA 2DHCA 3D02A 3LF2A 2WWXA 3OLQA 2XE4A 2X2FA 3QVLA 3V8RA 4IYRA 3RVSA 5JAIA 1YRHA 5ER6A 3ZNNA 5K5EA 2Y71A 4LJ5A 3I9NA 4HDNA 1CG6A 1YZUA 1R9GA 2PSJA 4RDIA 4RFSB 1XLUA 1IK4A 3R5KA 4ISBA 4LF7B 4RK7A 2I3ZA 2Z4TA 4Z0PA 2QRHA 3ED5A 1GPMA 4RNCA 1P2SA 2PCJA 2NLOA 2PEYA 3LO5A 2A86A 4UBOA 4EHLA 4EY6A 2HYDA 3MW8A 4U2DA 1QGDA 1Y9JA 3U4IA 1KEZA 4DC9A 4E0BA 4H7KA 4E46A 1DG1G 3HB7A 2HRZA 2C42A 4O4LF 3GQVA 4NESA 4FFWA 3SEAA 3SHFA 4FQ7A 2GKOA 4CTMA 1R0CA 4GICA 3A8TA 2NO4A 2Q8NA 4MVYA 1U7TA 4LDNA 1M8PA 1HDRA 1T8PA 2WT8A 3UCFA 1UBTS 1YMVA 1FMFA 2FQYA 3B85A 1DOHA 2CWDA 3WLHA 3L6EA 2QR2A 2XW6A 3AFHA 1TLLA 2BAGA 3ZXUB 3EIFA 2XODA 1F3LA 2RHBA 2Y2VA 3QZUA 2Q8PA 1E7WA 4HOYA 4MA5A 4US0R 3TEJA 1VKRA 3LJKA 4ETMA 1HT3A 2KS6A 3QVTA 2R7LA 2VP3A 1UOPA 1RVV1 2Q5HA 2NUAB 4Y67A 1RJ9A 1G41A 2Z57A 2YV5A 3FB4A 1XN1A 1UDCA 3BHJA 2GPNA 1V5WA 4KQEA 1Z08A 2DBQA 1VE7A 3BTOA 4LDJA 2IHKA 5FNVF 3V1KA 4BMYA 3N8DA 3KALA 4EA9A 5JCOA 1GT6A 1Q17A 2ID7A 2C2HA 3X2SA 3EEYA 4ZK6A 1ID1A 4ITRC 3TECE 3BC1A 3EOAI 4IL5A 5EESA 3DKIA 1CTQA 2ZT5A 1CUBA 2ZJ7A 2YXLA 4I6EA 4N48A 1T0IA 1HDOA 1D2AA 1NVDA 2E4UA 2BZSA 3IOBA 1TIBA 2BMJA 4ICIA 4Q1CA 4RBNA 1U94A 1WAMA 1Z2NX 3BMCA 2XUJA 3BMNA 3I1IA 3T9EA 3TQOA 1IAQA 5IK2D 1GPWB 3H0KA 3EGXB 3L8YA 3LM8A 1UL1X 5HCUA 1CB7A 2IZ6A 4CLHA 2PBFA 2D7JA 3U3XA 3C3DA 1I1NA 2ZAYA 1IN7A 2PVPA 2ECPA 3KD2A 2HBRA 3QVKA 4GDMA 2ZJFA 3MCWA 2F9LA 2B7CA 5ADUS 1A8PA 1TQDA 2VTDA 3F47A 3HKCA 2G71A 5EKTA 1MB9A 2ZTHA 1C4WA 4D96A 3LU1A 3KVNA 2YN0A 1HC7A 4YDSA 4DMCA 1BWQA 4HBZA 1U0GA 3I0NA 4BX9A 1L4BA 4KC0A 1ZRNA 4EENA 3L8MA 1JEAA 1QAOA 4R05A 2XCLA 2G0TA 3RRNA 3SX0A 3WDMA 4W1PA 5JH7A 1U7HA 2A58A 3TQCA 4E14A 5F2NA 4PRYA 2YWXA 4Q48A 1H4SA 2YDXA 3UJHA 2C7VA 2EC5A 4RGYA 4BWGA 2I2CA 2WJIA 3BWVA 5HK9A 4OX9Y 1IZ9A 1JYSA 3PJEA 4IS3A 5FOVA 3P2MA 3M7IA 4JLAA 4TXNA 2QUKA 1QP0A 4BB5A 1ZK3A 2J4FA 4P33A 3HY4A 5AJXA 3UV6A 4F45A 1J24A 1Z12A 2B9VA 3GT3A 4P08A 5A62A 1NULA 3VR5H 1Z06A 2JFWA 4KIJA 1SVNA 4RV5A 1HG1A 2YS7A 4YRPA 4LXYA 3PXGA 3E7PA 5IXJA 1ARZA 3E70C 1W2GA 4IO0A 1FF9A 4KO4S 4FFNA 4DG9A 3BEDA 1E5QA 1QCCA 2YUTA 1K0FA 2AHRA 1E94E 2ZWIA 4MVJP 3KJIA 3OA2A 3VM6A 2WUGA 1A7AA 4OBBA 5HKBA 1IUNA 1TDJA 2GZRA 2OA0A 2JFBA 2OHHA 3HUEA 4ZVOA 4ED9A 4CQNA 2YOGA 3ETGA 1FDRA 1DC5A 4Q82A 3D6UA 1POWA 5DM0A 3T1NA 3DWGA 3IAUA 4YP1A 2XZTA 4KVFA 3SHQA 4EECA 4ZD6A 3SR4A 4LC9A 1V9SA 3OE5A 1QIGA 2FN3A 2IZZA 3MELA 1T9GR 1MB3A 3MGKA 4GGMX 4GP9A 1WLSA 1WLYA 1ZU5A 2JDIA 4LGMA 4WINA 2B0JA 2MINB 2P9YA 3MGBA 4M89A 5F2KA 3UO8B 3UUEA 1TUIA 1ODTC 1GA6A 1KRWA 3ODGA 4ZVTA 1MC1A 2A9VA 5JZSA 4WHMA 1U63A 4JUFA 1VDMA 1QMPA 1T0BA 2APJA 2DKNA 2ZRMA 3DBVO 1J20A 3DBIA 3S6JA 2HLPA 3AVXA 2FSGA 5E0KB 1K6JA 5JARA 2XKJE 4WEQA 4XDYA 3C1TA 4C87A 2NO9A 4HVLA 4XB6B 2AE1A 2QNBA 3HXOA 4HZUB 4FFDA 2I65A 1VTKA 4Q6BA 4B8YA 3I3SR 3ND5A 2DSNA 4YR7A 5A5DA 3GLIB 2O8EA 4JBLA 1F20A 1SO8A 4ADSG 2BEUA 2X2OA 5CFZA 1KBQA 3LY9A 5KYGA 3GLHA 2GYVA 3NHMA 3VTAA 3I5UA 2ZYDA 1ZKDA 2XEDA 1Y6RA 4KQHA 1ZNZA 4BMNA 3RFTA 3I30X 4WCDA 2O23A 1I51A 5LSAA 1X1RA 4IG4A 5LIPA 4X00A 4DCTA 1L5OA 3INTA 2C5BA 2A0UA 3CCCA 3S2YA 9LDBA 2VNSA 4DV5B 5BMOA 2O6HA 1PWEA 2ZT7A 4HQKA 3ZTYA 4UZFA 3B6EA 3CZMA 5D6OA 1AURA 5MF6A 4GPEA 1C3XA 2DLNA 1W0JD 4RVOA 5ESRA 5FHQA 1PSZA 4UNIA 4Q3CA 2C0QA 3QUBA 2P9QA 2JJ8A 1QFYA 4B6RA 2V03A 4H1VA 3L0OA 5BV0A 1MLDA 3AHHA 2HSJA 2RSLA 2BP7A 2PU5A 3I01A 3TCXB 3I0MA 1IZ7A 3HCNA 5EJIA 4QOEA 1J5PA 3U4CA 2ZRIA 4LHVA 4HPJB 4M9SA 4WXEA 2OGSA 4AYXA 3KOMA 2ACVA 2ZAGA 4BFXA 1V6AA 1BOOA 3D1LA 3A1WA 4WZAA 3ABIA 3BH7A 1S3IA 1UPUA 5MFZA 4JC5A 4RF3A 4J0DA 2Q29A 2RCYA 1NKVA 4LYFA 4FHEA 4CYMA 4HH3C 4IVRA 2MYPA 3MJ4A 4LHZA 3WWYA 2I2BA 3KPYA 5A71A 1FDSA 4XUEA 5B1IA 2KI5A 4B7ZA 4ZI3A 2IVFA 2J0QA 2ILTA 1E1CB 4IIBA 1N6KA 4KH0A 5B7PA 5F23A 4BLRA 2D74A 2JLRA 5C31A 4IMIB 4TVSA 1K89A 3AZPA 2JBAA 4WIAA 3D7RA 1JH8A 4E5SA 2X76A 1Z68A 4DQKA 3CB2A 3KR2A 4ZJZA 2FF7A 4ZGGA 3G0DA 2QRUA 3DLTA 1JE1A 3WFIA 5DYYA 4NH4A 1FFGA 1BWRA 2ZVQX 2A3NA 2ZTMA 4NU6A 1JU3A 2W2PA 1CP2A 3VSAA 1PR4A 4CG3A 4QKQA 5IABA 2JH9A 2BELA 4RD3A 1LDBA 4R1UA 5IP5A 1OXBB 1J8MF 5AI4A 5L3ZA 5LP6C 3LVRE 2HPAA 3ERCA 3R9XA 3MF4A 4FE3A 1HQKA 3QUQA 3H6GA 3LUCA 3BL8A 4R01A 4YRRA 5JR3A 1I30A 2ZXUA 4Q7MB 4PZPA 1RI2A 4YV2A 3I8XA 4ZK2A 2IP2A 3FF1A 2WC1A 3SXPA 2CXTA 1YKFA 2FVYA 3DBRB 2VNAA 1ZUIA 2FEOA 1IFXA 5K8TA 4OEHA 3BOSA 3PPVA 3VX4A 4A0QA 1K5DA 1MVLA 3RT7A 5C81A 1IC6A 4LMRA 2EFEB 4LOLA 3B9BA 4OHCA 4CETA 1FJ2A 1KMHB 2V0CA 4JL6A 1VB3A 1D7OA 2BR4A 4PHCA 4NPHA 5EINA 2C8LA 3EDYA 1JAIA 2C04A 4I5IA 4UUPA 4BX0A 5JCZA 4NATA 2JGAA 3NGMA 3ANLA 1CX9B 4WBNB 4RELA 1UBOS 3GG9A 2QVZX 2ZWOA 3COSA 2BM9A 3T5TA 1QNLA 3C7CB 2BFOA 3AF4A 3BMXA 1NI5A 3A6FA 3B8HA 2B4YA 3NJ8A 4FJ1A 4C76A 2QBYA 3RSOA 1SCNE 1GKYA 5EZYF 2C3PA 3JTMA 3ELBA 4F5DA 1CS0A 2A5LA 4F2HA 1B7GO 1RI5A 3U26A 3E6AA 4YALA 4EQZA 1JB1A 3GWZA 3IKLA 3LQQA 4QGBA 4YQYA 3V4PB 4BLQA 5CITA 3ACCA 2UYHA 1NBWB 4F46A 2VP0A 2AMYA 1DAHA 1GG2A 1H6DA 3ML1A 3OHMA 1L5KA 2LE0A 4BDTA 4BV8A 1V6CA 4ECAA 4LRTB 1OTXA 2R4TA 2Z3VA 4DGQA 5CB4F 4KITB 3ETHA 1XWFA 5FT9A 1H66A 4NK5A 2FFHA 4YRIA 3HR4A 1KY3A 3L4BA 4EITA 1M2VB 1Z39A 3GPIA 4CKWB 2IBMA 3BRSA 1I9GA 3JYLA 1GLNA 3QLVC 2XRZA 1AS2A 1UBMS 2JFFA 1L8QA 4TMYA 3TL6A 4R9RA 4Y1GA 1GRRA 1M1YE 4RFLA 4NCKA 1QWOA 1OXXK 4HATA 4IUDS 4KYVA 4C7BA 3V6MA 1VECA 1KO8A 3TLMA 2WJYA 3VC7A 3DZHA 1BMFA 1JEYA 3QF7A 1BJRE 2PUGA 5F1YA 3AB7A 2OBFA 5DHSA 4LF5B 3KQNA 3EIEA 2R4QA 4DR5B 5BUCA 2H2WA 3V8VA 1IQ0A 2DH5A 1OZ0A 1YC2A 4YXFA 5JXJA 1T4DA 2DY1A 1WZ2A 2DFTA 1LI5A 3I04A 4ZIRA 7ABPA 1QV7A 4MPJA 5DHUA 4AUNA 4EL0A 5CBPB 1BN7A 1DKUA 1ETUA 3UJ6A 3P0EA 5A4KA 5EUBA 2GAJA 1HYHA 1LEHA 3LQ1A 4MNTA 5EIBD 5FWYB 4K0RA 2E5LB 4MB2A 1MB0A 1HF3A 1L7NA 2G9ZA 1XDUA 2VJAA 1TFUA 3GJ3A 3ROXA 4EYGA 4F5YA 4TKMA 5C80A 5JISA 2JCYA 1KAGA 1DIAA 3N0RA 4RW0A 1Y4ZA 1I5EA 1Z7BA 2YZMA 3JVEA 5ALWA 3ELYA 4UNPA 2CUTA 1X15A 3IBYA 3W1VA 4F9EA 3THYB 4JLSA 3GK3A 2CHFA 1UPBA 2C9DA 2NG1A 4CTKA 1X9HA 1NDHA 1XVUA 1BMQA 1GD1O 2ZE6A 4G89A 4RE6A 1W6RA 3EXEB 4B3XA 2HHCA 3DOCA 2BY4A 5EJ2A 1AO3A 1NWHA 3SEZA 3W9UA 1T91A 2F1HA 4GGPA 3V1NA 3R75A 5IT9A 1QJCA 2WVJA 2VN8A 1WL8A 2Q1XA 4RHXA 3V3KA 2WJJA 4MUKA 1YCHA 4OHXA 2JCVA 5EGNA 3AVYA 4L3OA 4MW2A 5I3ZA 2FGJA 2G88A 2C4NA 2CW5A 3IPCA 5I7FA 1U4OA 4YASA 2DHRA 4JD5A 5HZGA 3CY6A 2P4UA 3PLRA 2C3UA 4YJKA 3T4XA 3OP4A 1NRIA 4JODA 5DGHA 3IHLA 2YMMA 1VG0B 3CNEA 3U44B 1QPGA 1G1MA 4D46A 1QF6A 1JJIA 3KAQA 5DTIA 4O2AA 4ABYA 1F14A 1OFUX 4RORA 4TT3A 2P0AA 4C2TA 1P1KA 1WG8A 2MSKA 2Q3BA 2AQ8A 1A8QA 3PHJA 4OOEA 4WNIA 1EXNA 3AV3A 3ORYA 3I5MA 1R8JA 5BVGA 1KDYA 4PAWA 3PLAE 2QLJA 3PJDA 5FUVA 4HAXA 4N7RA 1XF1A 3VO8A 4AI6A 5DLPA 4HGNA 3I76A 4LDQA 1W76A 3DTNA 3L9WA 5BR7A 3A14A 2C0PA 3FHJA 3AI1A 4HQ0A 5C32A 4V1CB 5HKAA 1L5QA 4BIMA 1ZLXA 1ZSYA 2BEWA 2P69A 1YZVA 2YWFA 1D2GA 1NATA 3MWDB 1KZ6A 3SYNA 4B5KA 4IILA 3BX1A 5U4XA 2B1GA 1UAYA 3K8OE 3CH4B 2WTNA 3DSRA 4U7DA 2C1EA 2QY9A 1SHTX 2XMQA 2ZETA 2M98A 3BZBA 4IJMA 5H70A 1UXJA 3U1VA 2GN6A 4BP9A 2X0RA 1AXGA 1EBFA 2CXQA 3X1YA 2FK8A 821PA 1E5VA 1HA3A 5DCYA 5E0OA 1KBZA 1WTCA 5EWJB 4E94A 4F5ZA 1WDTA 2NO6A 3JZIA 1X42A 2GBPA 1Z4NA 2DSTA 4G86A 1ZM4A 3V1UA 4BQFA 4EELA 3NWEA 4KK3A 4RGQA 1GGJA 1PJLA 1TO2E 2RHHA 2VDKB 2BKVA 2O2SA 2NUTB 3HVKA 3MOIA 1CDDA 1KH3A 1M0SA 3OMWA 4F85A 5LXTA 1SH7A 2PZBA 2HRCA 4I1RA 4XQ0A 4AS2A 3PTLA 4N7JA 5JYDA 1DVRA 3ZS9A 5CFQA 3KQUA 3K72B 2V45A 1G3IA 1VBMA 5AVJA 2FMKA 5CCDA 2XWPA 5AKIA 3PVSA 4LECA 3IAS6 2D2FA 5FA8A 5KYWA 1K8YB 2OFWA 2Q3DA 3Q7TA 1X1QA 3TAHA 3UUGA 3VGJA 4AJLA 4DN6A 3IEXA 4LRXA 3U1TA 3LI2A 3MRVA 2P5YA 4BNUA 3ANTA 2VF7A 5BN5B 3IO5A 4HDKA 1T3GA 3P4XA 2OV6A 4NEGA 2N46A 3FPKA 3BXPA 2QD4A 4I99A 1H8ED 1OWMA 3EIXA 4A8TA 3L9XA 2OUKA 1X92A 1I13A 2COUA 2ZGVA 1N2ZA 3A2KA 1DQNA 1K7EB 1PR1A 3P0IA 3TFWA 5LZ8A 1TGVA 1NXWA 4G1BA 1NVWQ 2P3SA 1W1UA 4LKRA 4YT8A 1IEWA 4KDEA 5F9HA 5HX7A 4X6UA 3AUFA 5ED0A 4TSFD 2Y1CA 1CUVA 3TTWA 5DNCA 4PRLA 2BONA 1QRRA 1C9DB 1XQ9A 5E8RA 5JNLA 3N70A 5L51A 1O9GA 9ATCA 3DL2A 1FUKA 1G5RA 5TGDA 4BX8A 4E5MA 2HEIA 2VQ6A 4IX9A 4B3BA 3IDSA 4I4LA 1VL0A 4QYMA 1XEFA 2XTZA 3KKEA 1PGNA 2HC9A 2NIPA 3BAZA 1PK7A 5H83A 3EXFA 3PXBA 5CK5A 5D51S 1AXRA 4RPHA 1Y3CE 4YGYA 3DE4X 5DXFA 1PS9A 1V71A 3FOWA 3DEAA 3LFHA 2ETVA 3NHKA 2PWAA 4C7OA 3C4VA 4G0UA 3U56A 1G60A 3PUZA 2V4UA 1TQ4A 1E58A 3HYTA 5HUQA 5KOYA 1Z6XA 3K0HA 1N6HA 3SQOA 3SFVA 1KAQA 5DYIA 5EHXA 1OR8A 3Q2OA 2H1LA 4YJGB 1QBGA 4H6XA 4BN0A 1QQ7A 3ZHTA 2UUPA 4CCSA 4CIWA 3EGVA 1XKQA 3SI7A 1CFZA 2HV9A 1GUFA 2AYXA 4O4JA 4Z3DA 1V7ZA 1WBDA 2Z9CA 4DLWA 4CU2A 3TB4A 2WKPA 3TZBA 2EGHA 1THZA 4ZHQB 2B21A 4D9MA 4YT4A 2JIRA 1S3SA 1UUFA 4HCJA 3UKJA 1F9EA 1SCIA 2VCHA 2RAPA 3GAFA 3T5CA 2D4HA 3DYVA 5ALRA 3OLYA 1DUVG 1UZMA 2P4HX 3CUWA 6CHYA 3ZDEA 1GSIA 1U2QA 3RTCA 4OH1A 3WL4A 3K0AB 3RHTA 1E1QA 1J2RA 1H0HA 3WRWA 3GLGB 4DANA 4Y9DA 2WI8A 4KAJA 3DYIA 5BWCA 3V8BA 5FWDA 4BGUA 4F3CA 3S1AA 1FFSA 1XR3A 4L0CA 3TTTA 4QT4A 5EJ8A 1UXKA 1A5BB 4ZZ2A 5IAOA 3PX7A 4OHYA 2Z83A 4HJRA 3QXHA 4M1WA 2WFLB 4MR7B 3FWPA 2K7ZA 1XZBA 3TNFA 3W4IA 5JJBA 5DGIA 1QGED 1QOPB 3LF1A 3EYAA 1H2ZA 5IN4A 1FTYA 1CUFA 2H07A 1OWLA 3HYLA 3Q0EA 3TZEA 4IHJF 4CM1A 5G0VA 3LO8A 4NBNA 1KYIA 3LHDA 4BNWA 2IPMA 2IIVA 2VYQA 2G0AA 1W47A 3PI7A 4HEHA 1GGKA 2Z08A 4JH0A 3M3DA 3TQRA 3UT6A 3O5AA 2EGGA 5EJ4A 4L07A 4CFYA 3D6TB 3WYBA 1ETHA 3RARA 3GJZA 1ZOPA 3CWCA 3FNEA 1CD5A 1DKMA 5JG7A 3THRA 1YQXA 4EGAA 3R7WA 4J03A 4HEA1 3NDIA 4O59O 5KKCA 5ED4A 2O05A 3CCBA 5JT1A 4RCYA 4ZC8A 4E15A 1MOSA 2HJHA 2QTFA 3WNCA 3GCGA 3GUVA 3WV5A 1WCXA 5I48A 2FG7C 1XA4A 3S28A 2DP4E 1XXHE 3N5KA 3GYBA 2A4MA 3QU2A 4FEEA 4M1YA 4HNTA 1BXZA 3A9TA 2PHZA 1R9NA 3JWGA 3UN1A 2JJYA 5GMOA 1QDEA 5BMVF 2DG2A 1K88A 2GAAA 4DCCA 3VFDA 5A4FS 4CEHB 1TRHA 5HFJA 1OX4A 2H1IA 1JDZA 2DLDA 1LTQA 2LKCA 3T1QA 4M7OA 1W1IA 5K8IA 3BCHA 2CXOA 2PGIA 3EIWA 2NVOA 1V7QA 3CLRD 1WXXA 1ZIPA 1NFRA 2F3PA 1O97D 1MHPA 2HRBA 3GGOA 1M33A 3RBAA 3SLRA 3VO1A 2HA4A 2OOSA 3OJOA 1ENPA 4HH1A 1N5KA 4LRSB 3CX3A 4ZJUA 1S2DA 1JIUA 3T3HA 1QYCA 1V5GA 2RCNA 3G9QA 4S1NA 4TMTA 4RLHA 4AN4A 4UQLA 1WXDA 2FJ0A 1U5CA 3EPHA 1Y1QA 1M2FA 3AL2A 3N2GA 4OQNA 4DQVA 1EBUA 4C4XA 4D43A 5JWHA 3OPXA 1L7XA 1S2IA 2PQMA 1W29A 1DIBA 2JFQA 2XF8A 5CCXA 2Z6VA 2Z6AA 1JDBB 4JB0A 3E81A 1U04A 1KYTA 3QLUA 3AHGA 2R7AA 2QTAA 1RM4A 3PYLA 1NNEA 4OX9B 1YI1A 1TZJA 1D9ZA 1I1QB 1QLJA 1HL3A 3P8ZA 4FS3A 1RWWA 4O2BF 4XFDA 2VWQA 4YRSA 1D5WA 3NANA 3IEUA 5A5GA 1IYZA 4YI5A 3UF0A 5IAAA 1CV2A 2HFJA 2GI4A 2PL3A 4FNOA 1HGXA 4C5CA 3A6HA 2EJCA 1E9RA 2MSLA 3K9NA 4LWPA 1HLPA 3NVKI 4A2QA 2J0UB 4OM7A 4Y1RB 3ZU2A 3LLMA 4YMLA 4YT2A 3F3KA 2YY6A 4ARAA 1XTTA 1JAZA 3PDCA 4QTZA 1KI1A 4DCNA 3L1VA 4ND8A 1KKMA 1BDHA 3CKLA 1Y42X 4GLLA 3E58A 2ESRA 2UZIR 2ZIXA 2VAXA 2OCPA 1DARA 5LA6B 4KXNA 1A7UA 2P1RA 5FFMA 4HMOA 3H1PA 5AQ1A 3PDIB 1E9DA 1I2ZA 2CD7A 2FP3A 4OU5A 1ZITA 3IBFA 4X92A 5BO5A 1FNSA 4QXRA 1NJ2A 2EW8A 4ZARA 4HV4A 5IDQA 1YH3A 3GDHA 4YQFA 4X41A 3RVNA 1IHUA 1QX3A 2FW7A 4H1UA 1J9ZA 5IEBA 3WK9A 3BFJA 1DQZA 4EBBA 5K01A 2Q2VA 3WLJA 1NHWA 1PGPA 1T9KA 4M53A 1NXOA 4MWTA 3RC7A 2CUZA 2HHAA 2X0IA 3QBTA 3PGVA 5A9SA 4C6TA 4BNTA 5E6SB 5KQSA 5BP7A 5ALPA 4UTRA 5AK6A 3RVOA 4NOMA 4MARA 3EN0A 4AP9A 2WABA 3EGOA 4RKRA 1FS4A 2J6HA 3NXKA 3UWMA 5AVWA 3ZHBA 3JQGA 3ZLBA 5K3BA 4B45A 2L69A 1AY0A 4MV3A 2OV8A 3NIGB 3F8WA 4UZSA 1XNHA 5ALXA 2FJPA 4CM9A 4D98A 3SJZA 4B9AA 1U0TA 5KOJB 3C5VA 5JXHA 3R0IA 1L1RA 2JFXA 4M1OA 5EHGA 3SSMA 1P9WA 1N2SA 1NXPA 2ZSKA 1XAJA 1YQ9A 4RJKA 3ZV6A 2GO1A 2CGEA 2VQDA 2RD2A 3RUIA 3EPPA 1KS9A 3MJSA 2JLYA 4DIMA 3DE5X 4QUGA 4GPZA 4A7PA 2QN2A 3UFBA 2R1VB 2IEAA 2G83A 2XMSA 3NBFA 1GL7A 1NU8A 3G9XA 2EXXA 2A2ZA 4XLLA 1WX1A 2QRJA 3MINB 4HWSA 3BK2A 4TLMB 5FXMA 1ZUWA 1T6NA 3ILHA 4IRMA 4L4YA 1PJ8A 5B1YA 2FPIA 2CFOA 3ASUA 3WLOA 4Z4FA 4K9KA 1EYZA 1KYXA 1RE1A 3LXRA 1LCIA 1YZTA 2XE6A 1C2TA 5A6VA 2J9GA 2Y1XA 5AW2A 1E18A 5CEEA 4ME6A 1RRMA 2Q4DA 4CLDA 4GKBA 2IYQA 4YVFA 5CXXA 1RKXA 1FLVA 2JAQA 3O4RA 3NNNA 1G3UA 1OLSB 3OUUA 4U8HA 1F6DA 2HK7A 2NO1A 4N5HX 3KPVA 3NBUA 5EZ5A 5FJIA 3RIGA 4TMZA 4Z4GA 3L0ZA 4NI5A 3LW8A 2FMIA 2ZREA 1DC8A 2I7DA 5FBLB 2VDMB 4AS3A 5E9AA 1Z33A 4I36A 4IUCS 1EFRD 1YI8A 1DAMA 1Q6ZA 1FP4B 1VPDA 3G2JA 1XMOB 5AKEA 3WNBA 2H9YA 2G4CA 2HNKA 1BMDA 1XCBA 4D2IA 1OI7A 2DF8A 1XVIA 1Z74A 2KLHA 3KQPA 3LYLA 4P3OA 4TXLA 3SBOA 5C5DA 4JXKA 4DY6A 1LNSA 5JEEA 2F55A 1FEZA 3C8HA 4N8DA 3DV0B 4DBVO 1RYEA 2NTVA 3CCFA 5FORA 5IXSA 3VKHA 3U4DA 2CJXA 2PZAA 3VR4D 5KMGA 3FDFA 1ULZA 2CD9A 2IU6A 1KEVA 1R0YA 4DPKA 4Q9NA 4FHCA 4N12A 3G5LA 3WI7A 1DEAA 5JPDA 3NUQA 4E2XA 2FCRA 5GINE 3K1JA 4Q9JA 3ELDA 1UC8A 3JARA 2BEUB 1NP7A 3OTGA 3B6KA 5AI6A 1UMKA 1UKAA 1VG8A 1U28C 2C4VA 5IT4A 1XMSA 1PTJA 5DCLA 4XE5A 2F2TA 2PGXA 1J0CA 5CUQA 4UATA 1T4BA 3BWDD 1HOXA 5IJXA 3FH0A 5FBHA 5DM4A 3HJHA 3FGNA 3QFCA 4Q4HA 5A5EA 1E96A 2D0PB 2B30A 2VK4A 2XGGA 4YX9A 2ISSD 1G9SA 2O8FB 1T15A 2P9BA 4PYQA 4HXYA 3TXXA 3CXUA 4A10A 4DL9A 2IH5A 2XSZD 2A7XA 1A50B 3KOUA 3UC5A 1LTHR 4MW5A 2DKFA 4GOJA 3HY6A 3HH8A 4HS9A 3B52X 1S2OA 3QWIA 4X1IB 1YE8A 2OO5C 3E18A 4KMOA 4J4BA 1WBBA 4TPKA 3A31A 1NVMB 1V37A 2HCTA 4CTJA 3PNYA 3H17A 3O92A 1P6XA 1TF2A 3NKFA 3S1LA 5J1SB 2FETA 3AHEA 1CQIB 1T5IA 4RZ2A 1EA5A 2PGLA 1IY1A 1VYHA 3NNSA 1CETA 1NN3A 2O1WA 3T61A 8GPBA 2IS1A 1N5RA 2IZ7A 1GPJA 3QWBA 4QREA 3MHTA 2PS0A 3HN7A 2IFTA 2C2ZA 2ZUFA 3FZGA 1IRIA 1KPHA 2C2OA 1BW9B 1HDYA 3K5WA 4WN9B 4EPVA 4MS1B 1B2RA 1NC1A 4LWZA 4EUSA 4FYJA 1SKQA 3HADA 2GEJA 4S1WA 3HQ4O 1OZAA 1ZOLA 5BOSA 1JR3A 1Q0LA 3H97A 4M0EA 3ZLJA 1JQLB 3OC6A 2N3ZA 4MWOA 4RH3A 1LBTA 3GDWA 4ZCIA 5DTRA 3OEEA 1IOVA 1K6IA 2JGLA 3B1KA 4OB6A 3BE6A 5T6MA 1G42A 2I71A 3H99A 1Z4JA 2Z1DA 3MUOA 4IV0A 1QYWA 4O2BA 5D8DA 4DCJA 4ENPA 3U4MA 3Q0TA 2QVXX 4EB6B 1XVVA 2OXCA 3P9IA 1ZR4A 4AFNA 1ZLYA 2P78A 3LOQA 3PCXA 4R2LA 4YYEA 4INPA 3FDJA 3S2EA 4CMAA 1V8ZA 2EIXA 2A33A 3OOYA 1WVMA 3L0SA 3ZWXA 4BRWA 4CIAA 1GOTA 1XAGA 3L77A 9ABPA 2OORA 2IS2A 4OGLA 2CK3A 3UC9A 5E1MA 1YR8A 1S2MA 3RUCA 3LL4A 3RYHA 3TQHA 3ZWVA 1AK9A 3PRKE 4ZU3A 3NHFA 4JP1A 1H2HA 3GMSA 3EMKA 4F6RB 1NG9A 2QUHA 1A9QA 4CMCA 2W43A 2OPBA 1BMTA 1SEPA 2VJBA 3A3NA 3C3JA 2WW8A 3A1CA 3IQDB 3UEOA 1VOTA 1H4QA 2ZR0A 2AKEA 4MWBA 3ZW9A 4D0SA 5BSMA 1W2HA 2F9FA 3SBXA 4UM7A 2BHRA 2HUNA 4HDNB 4IO1A 4MV4A 5BT9A 3VISA 2CDRA 1I3MA 4XVRA 3SBDA 4WN3A 1GPH1 4X7PA 5KTPA 2QRMA 3E7WA 1C5KA 3Q3VA 4WBNA 3DT9A 4MVCA 1LPSA 2VT6A 2VKQA 4I55A 4M55A 4HBGA 3WO1A 3DNPA 3QOYA 4V0RA 1XJ5A 5BMVA 1DU4A 3TSCA 3HV2A 3FTDA 5EVCA 1ADBA 4B75A 5BYAA 4MQ4A 1RHKA 4Q18A 1LQ2A 4CIVA 4WBNF 1Y6ZA 4G8DA 3UXYA 3FTCA 4AKIA 3PX2A 4UDOA 2R6AA 3FUXA 1D2CA 1LWNA 4OSOA 4BAUA 4M8KA 3URKA 1PFQA 3BA1A 3GEMA 3IHKA 3TNJA 4WWHA 2ZQZA 4FGJA 2MCFA 4J2OA 2AZDA 3ZTTA 2IHVA 3UT5B 1N8KA 4RGBA 2OAQ1 4XIGS 3H5OA 3N8GA 3OCCA 2IYZA 3MIZA 1HZJA 3WL5A 3HYSA 3JALA 1WDMA 1Z4OA 1N8TA 4NOLA 4QBHA 2P9JA 3TVDA 1WF6A 4D6YA 2QTTA 2R5NA 5U4QA 3ZDYB 3VH1A 4QUAA 1FDVA 1P72A 2ZJAA 3SM3A 1UF9A 2QZPA 1VPVA 2CVQA 2GYWA 3CLSC 1DB3A 1NUSA 3A6PC 3G9UA 3GWGA 2QPTA 1EQ2A 3H8WA 2XNCA 4Q01A 3KQTA 5JCOC 5EE3A 4UNSA 3IDOA 3CU5A 2R6GA 2QUBA 3D6MA 3T06B 1XMQB 3PWSA 2H57A 3RCBA 4WZAE 1B1CA 2C83A 2I9PA 1ZH8A 1YS2X 4Q7KA 3E7XA 5GM2A 1PQYA 3UAYA 4EFKA 2PM8A 2QZ4A 4NZPA 4LK2A 3OJCA 5CJ2A 5KYXA 1A1VA 4TUYB 2IS4A 1Y8QA 4OKNA 4C4AA 3BWMA 3EZNA 4HNGA 1QWSA 3HR8A 4FMBB 4XARA 2BEVA 2REQA 1QRTA 4IEEA 1N3IA 1THTA 5LKAA 1VHDA 3G2PA 3PC6A 4HNAB 3V7NA 4WK2B 3LUAA 3WNVA 3LW7A 2LW7A 1UDXA 3JPWA 1A4UA 3AI3A 1ZHFA 3R6TA 1YUMA 1UZAA 2B6NA 4IJ6A 4XIYA 1L5VA 1YOVB 3DOJA 4KOAA 5I3CA 1YZNA 2ERXA 2QVGA 2WZCA 3DLAA 4XPIB 2DWPA 4LXUA 1MB4A 2FOIA 3AM4A 3OX2A 5DB4A 2PT5A 4MRMB 4P92A 1CY6A 4F4UA 5JQWA 4CGZA 1PVVA 4KSBA 2IH2A 4WADA 4HVCA 2OP1A 4R1NA 4JB2A 2OAEA 1A4XA 2O7QA 1CJBA 4KTTE 4QPZA 4Q7JB 2CZQA 2W8BB 4TV8B 4O2AB 5DHRA 1UQTA 2JIQA 3FMFA 1L0BA 2XT0A 1GAEO 1FDIA 2O7SA 4MHSA 4W9NC 4YAJA 4ETWA 5H3HA 2ODNA 9LDTA 2O1XA 5FR2A 5I9NA 1F2VA 4ISCA 1K06A 4MO9A 4RWZA 3UJDA 4YCLA 3T3OA 2D2XA 4IF4A 3LDHA 4YAGA 3NTLA 2Y1FA 1IQPA 3GLIE 3WIDA 4O4LA 3MTJA 5D84A 5FTMA 2UVQA 2G80A 3RC2A 5C8VA 1KK2A 3BKXA 5KUTA 2NU9B 1XTRA 4ZT2A 2X5KO 1UJNA 4P34A 3FIJA 5ICSA 3GBPA 3IP9A 1PJSA 4FXPA 1GNRA 1U2GC 1W25A 2FZEA 5TDHA 4R81A 2PXAA 5I7RA 4BB6A 1WXGA 1XU9A 2PJRA 1RRVA 3B1YA 2HQSA 2VDNB 2FVXA 4CF3A 4KGXA 3R76A 2WB2A 3REFA 2CCGA 221PA 4MWEA 1W6UA 4JR1A 3ZY3A 5LFAA 3ZQ4A 3O8RA 3NETA 5GADl 2J9YB 2YINC 4PLWA 1T4GA 3KBOA 2VRCA 1Z35A 1ECPA 1FLNA 1SQGA 2QAJA 3DGEC 1T10A 1DDIA 2WFMA 1TVEA 4G1MB 4QFCA 4Z9XA 2IYOA 4J1QA 3BHIA 1BHO1 1IBKB 2H59A 1Y5MA 3DOOA 2GZ1A 3IYLW 3I6BA 2F8TA 1YK0A 1ZXXA 1B8PA 4FKMA 4OQYA 4RD6A 3TW6A 1I3LA 3GLIA 1BA3A 1NP3A 2ATIA 4L5CA 4D9EA 3ZVKA 4M0KA 2ZIFA 3LIIA 4O5OA 1UMDA 1E4VA 3ZI7A 1NVEA 4IMPA 5BSVA 1JSZA 1RT9A 4MW4A 3Q7IA 3D7NA 2XUHA 3IAM6 2PGOA 4N5NA 1NZJA 3MGCA 2ONJA 5JASA 1O87A 2AEJA 3FYCA 3QXGA 1BS2A 2V65A 1E1NA 2V6FA 3JRXA 3SYMA 3PC4A 4KN5A 1SBNE 3NFRA 3QLTA 2R79A 4TZKA 1PNOA 1XZGA 3BVPA 3EGEA 3WJAA 1WDKA 4HFRA 2ZDQA 1VMKA 3IHWA 1KI3A 1B8VA 1GEEA 3IIKA 4AX8A 1FVXA 4YO7A 4RJ2A 5HCIA 1Z0AA 4ER3A 4BVJA 4KFSA 4YLGA 4ZAZA 3F3SA 3FPLA 4M9XA 4CIXA 3VU3A 2MTBA 1RQ2A 2CZCA 4RPJA 10MHA 4TYWA 1H8HD 1MOZA 1BRTA 3FSGD 1ZOIA 2EV9A 1IATA 1LLDA 1YV9A 3DMTA 5FLKA 1EK5A 3NIFB 3VO9A 4BKOA 5B4TA 2JIPA 4RVHA 3WGNA 3LY7A 4RLQA 2VJMA 2RB5A 4GXNA 4YROA 4YAEA 4C6RA 4BYMA 4YAUA 3BEOA 5GV7A 2FUEA 2AFRA 2Z9DA 3TCKA 3GT0A 1U5BB 1GSAA 1OV4A 4GNKA 5KHLB 2FYTA 2RKWA 1NPTO 3PNLA 5LQKA 4DNQA 5FAKA 5I51A 1RHRA 5COAA 5MN6A 2Q6TA 3IEKA 3HKDA 1J8DA 1R12A 1W59A 3AY0A 2G17A 1TLTA 5M29A 1CULC 1X3LA 3ZJTA 4BZWA 2D7DA 3A6JA 4RKWA 1SBCA 2GPTA 1G4UR 4LNUA 1RU3A 3RU2A 1ZD2P 4KZKA 1A97A 4OUDB 2D59A 2QM7A 1ZW1A 3T54A 1L1QA 5HZHA 1JR2A 2C97A 2J59A 3FA2A 1N78A 1P6QA 3BWCA 3LRTA 4S1TA 3KZ1E 4NH0A 3O4HA 3RRZA 4CM6A 1CVRA 5CXUA 1EDOA 2C7QA 2YHUA 1FB5A 4QOSA 5FH9A 5KO2A 4C4TA 4HI0E 5JAOA 1ECFA 2YV1A 3BSYA 1G8JA 3OZFA 3AFNA 5DYTA 3E9RA 1ZN2A 1H22A 4MQ6A 4ZHQA 3D0RA 4M38A 3WJ1A 3R8CA 1YFKA 1X7XB 4G0YA 4J16A 3SZOA 1QC5A 1C1XA 5FLXA 5K0LA 2Z9BA 3DHNA 3QF4B 4WFJA 1RXWA 1ANKA 1F0PA 4G2NA 2XKBA 3PG5A 2XMBA 3CISA 1KDTA 4MJ7A 3ZXSA 5F7XA 5I5EA 1YJXA 2CYBA 1DIHA 2HWKA 3EMBA 4LE0A 5AR1A 4J3NA 3TAUA 4Q24A 1Z4IA 4W7HA 3ND6A 5AKJA 3SJAA 3VR1A 5H5JA 1T9GS 4RTRA 1G2PA 3C2QA 1A27A 4JHXA 2DM6A 5JO0A 5KWIA 4AJEA 1JHZA 4I46A 4AP5A 4DPMA 2WFLA 4MR7A 3ZWKA 1YRBA 1GL9B 2QTNA 4FFRA 3VC2A 3CUEF 5EE1A 2HEGA 3GGDA 2QJWA 4R68A 1BMFD 4TRRA 4UBNA 5IYZF 2YJNA 2I67A 5ENDA 4JJ8A 2CEKA 4S0XA 4BJHB 2J32A 3Q3GE 1VG1A 3NBKA 5F4ZA 4C03A 3IUPA 1C0EA 1LJ8A 5DNYB 5KDOA 1HTBA 5FNZA 2YZ7A 4XB1A 2IGBA 3HZOA 3RVLA 1W4RA 4NBUA 3UYLA 4YCMA 3OE4A 2IZ5A 3TBFA 5LQCA 4M8IA 1ZK1A 1JLSA 1SHLA 2PWPA 4RGVA 1OKKA 2ZDHA 4BCDA 3VVCA 5CTAA 2ZI6A 2RHDA 3IE1A 5BQ5A 2DXIA 1M34E 4XIIA 3IUYA 3O8LA 2EDCA 2I6SA 1SPXA 3EW9A 1CUXA 2QU8A 3ZD9A 2X7HA 3C1AA 4QYWA 1ZZEA 1CPYA 2YRXA 3GLFE 4LJYA 4WOKA 5K3EA 4MKXA 4D6PA 3DKKA 3AETA 3M3PA 1MIHA 4KQWA 4ZT5A 4YWHA 2Z6UA 4RDCA 1Z18A 1YB4A 2BUAA 2GVZC 2XB8A 3B82A 4FE7A 5EG5A 3NB0A 3HRIA 1EXWA 4P7FA 4XPZA 2CL5A 3MSCA 4D6XA 4N5DA 3Q85A 2REBA 2PPVA 4RNDB 1FP6A 4Y7DA 3MTQA 1K5PA 1WTAA 3LUPA 1FQWA 3DJYA 3PIRA 3TR0A 4M9RA 2DR2A 4EARA 1BJTA 4NMMA 1G98A 2PEZA 4QYTA 4ARIA 4WLEA 4EATA 3QTLA 2Y1DA 3EB9A 4B35A 5COQA 4C0HA 5MGBA 4KO1S 1YVRA 3EJWA 3D43A 3WP0A 5DWDA 2JBWA 5E2IA 1EWQA 1Q1QA 3B5EA 3WV4A 1H65A 1QH8A 2EKLA 1XPJA 4HRVA 1EI9A 1TQ8A 2JH3A 4CN9A 1FIUA 1Z2PX 1QH9A 5LXTF 3TTSA 3CLUD 1I2CA 1MCZA 1ZVQA 4K88A 4NFYA 4V2UA 3MILA 2NVUB 1HTWA 3E8XA 1RFGE 4MWZA 4HUTA 2WWYA 2YFQA 4LJSA 1KEPA 2UVPB 4IX1A 1E66A 2YVAA 3D4LA 1OH6A 2J08A 3HYCA 4U9IS 3OEHA 3WOVA 3V42A 4V24A 5IDWA 2AOWA 2BCGY 1IVYA 1MC5A 1SBQA 2Q5FA 2WMNB 3CEAA 5JO9A 2LV8A 1MW8X 3OEYA 4OGGA 1V95A 2MHCA 4RHYA 4D7AA 1OLXB 3EF0A 2ZE8A 1NYTA 1WCWA 1ZSVA 2R97A 3A3YA 5CAEA 4PC1A 3I2HA 1L5GB 1U2TA 3IIEA 3LUGA 3L1KA 4FFOA 4LGVA 2BVNA 4X9XA 4ZOLB 3QU4A 4CL0A 4JSRA 3UT5A 5BYJA 3ZY2A 2CEAA 4BMCA 4I2VA 2XVYA 3HBAA 4DJAA 1AN9A 2YYYA 2I0FA 3H5LA 2DMRA 3UTDA 2P6OA 5GJVC 4JGIA 3VC3A 1E99A 4AY4A 2O5EA 3PFHA 4OPMA 1T2VA 5KVSA 4P80A 4FYKA 1BEZA 4IJWA 4KPYA 3UOAB 1XMPA 2EFJA 5THKA 1P1RA 3M3HA 3PDUA 3TG2A 3U7FB 2J3EA 3BIXA 4KGZA 5B7NA 1U81A 4XRGA 4QUEA 4YP5A 3CTPA 4EA7A 2XMGA 3FCCA 1Z2DA 4Y9SA 1YDFA 4WY8A 4IRXA 3UYKA 2HH9A 2IOFA 3ELUA 3OESA 1JKIA 1N1EA 5KJ6A 1M2OA 1XD9A 2P27A 1QYIA 4R3UC 4F84A 4IWXA 4YRFA 4BP8A 2CNBA 1MUUA 2BBOA 2H7YA 1JMKC 1QF9A 2PFKA 2Q3CA 1NMSA 4NMWA 1A9SA 4CM9D 3L1UA 4PYLA 1INLA 1NRJB 2E5FA 3SXUB 2YICA 3BYZA 2B4RO 3FWYA 1J8VA 1T5OA 1GN8A 3NC1C 5CX1B 1QRSA 1PFUA 1BTOA 4G5GA 3LL7A 2PYZA 4XCXA 1MGPA 1NJ5A 4GEKA 4GMGA 4DDWA 4Y6QA 1JILA 4K8RB 1M2GA 4GMDA 3GEHA 3SX4A 1YZQA 3DLPX 5DGXA 1H4TA 2WP0A 2X19A 2ZVDA 4HKTA 1YJ5A 3RWBA 3GCDA 5DH9A 3CPHA 1ZD1A 3F67A 3O4VA 4HHEA 121PA 3V4VB 2XITA 4BRSA 5IJAA 4YJ3F 4MLZA 3ZV7A 1JW9B 2I6QA 4B6SA 1XCOA 4B6EA 2OFPA 3PVCA 2OO3A 2QLMA 5ES4B 1PLLA 4IR7A 3OU7A 1WHSA 3QKRA 4Y7CA 3UFXB 2W8BA 3W90A 1CKEA 4IJVA 4B7UA 1DX6A 3E1KA 4LHWA 2NXNA 3C7AA 1K2VN 2OWDA 4XVHA 3UXHA 4F71A 3BB3A 1IDN1 2I6UA 5JC8A 2O3SA 3I6ZA 5IM4A 2R8OA 3O75A 3P0FA 3AM5A 3TMKA 1DV2A 1G5TA 4EHDA 3K5HA 3TX6A 4BXOA 1NIJA 3U7GA 3CN9A 4ZDKA 5LJLA 2Z2KA 3EDCA 4JT2A 2JIBA 4MI3A 5JWRA 1DRWA 2C5HA 5D5PA 3HP4A 3MINA 1NBOA 1DCMA 1T0JB 1VP3A 3NBAA 1PL8A 5TPWA 1IG3A 2A35A 2V0NA 4BKQA 4D0RA 3DDUA 2ZWMA 4QAQA 1EZZA 3GMIA 4WKCA 5JNRA 1KVQA 4NZZA 3L7IA 4LBWA 5FEMA 3TMAA 4WOJA 2Y0EA 2J3HA 3FCXA 1H94A 1IONA 2XUKA 4MYRA 4V38A 3RUFA 3Q3IA 2ZWVA 1SZJG 2JZCA 3KKPA 1WMEA 2C54A 4Q1EA 1MNQA 1PNTA 3A6KA 3RTEA 1W8DA 3STTA 1ZJYA 1HG0A 1Q15A 3MUFA 2VTBB 4J4TA 2Y77A 4X7RA 3CZCA 1L4LA 1GQ2A 1ZEMA 3G5AA 1Z0UA 2RH8A 3N8HA 2Y1WA 1UM9B 3MWGA 2UV8A 1S6YA 1QHHB 4NAUA 4KP7A 4RAQA 1VSQA 3GJ8A 4ZEWA 2CXRA 3DD5A 5JSZB 3DC7A 2H63A 4NXMB 1KAEA 1YGYA 3NT5A 4MAMA 1GTRA 1VJDA 3Q41A 5KNCD 3G0HA 3ANNA 3WFJA 2QL5A 4MULA 1J2TA 2D1FA 1IEQA 4BJ6A 4BMZA 5HIKA 1CE8A 2V98A 3E23A 1KC3A 2NV2B 1ADGA 2HT6A 5EKUA 3ZDCA 3EODA 4HYTA 3NALA 1EDEA 4UD2A 1YAJA 1NUAA 4PCUA 5CYGA 1SD1A 4II3A 1ZOSA 1O1YA 2JHPA 1KR5A 3FFAA 3GL9A 4JNCA 1R16A 4LHEA 4QDTA 3UGTA 2B6HA 2POCA 1T5SA 1UDBA 3DCIA 1FFCA 3H86A 3SIPA 3FB1A 4EJSC 1UK8A 3I61A 3VJRA 3AHIA 3UB3A 1AMOA 3GC6A 2GTIA 2ODBA 3K1TA 3LT5A 4XDZA 4B17A 2I1LA 5CDYA 1JIJA 1D09A 5JI3E 3NX4A 4KMMA 3D6NB 4A5SA 1N2XA 3P97A 4L57A 4HEA6 4TRJA 4EJSA 1R0LA 4Q05A 4DKXA 4AJNA 5HSGA 5JANA 3LCCA 2ZJ0A 3RVBA 1WIWA 3YASA 4EPXA 4L8LA 4I8DA 3F2IA 5JS1A 4OHFA 2PY6A 3IA2A 4F3RA 5I4BA 1RNLA 4JI7B 5HRCA 4CKXA 1VHTA 2D3WA 2VATA 4Y6GB 4BTLA 1T2UA 1QSGA 3Q88A 4LYHA 1XDZA 3KHKA 3ABOB 1L5NA 1W52X 3ZZTA 1HNWB 2RHOA 4BTEA 4RM2A 3KZVA 2V58A 2G70A 2HJGA 5WRFA 4CV1A 3DO5A 5B1SA 3DW1X 5D5QA 1BW9A 5K1ZA 1IZ8A 1OT3A 4RULA 3EZLA 3GXOA 1QB8A 1L7BA 1X7YA 2SECE 3M49A 3V2UA 4FCTA 3LDAA 5AHXA 5LMZA 1IBMB 4ZWNA 2QENA 3HK2A 1USKA 4UM9B 1V16A 3O3NB 3ESAA 5AYVA 3RIHA 5IJZA 4MQUA 2XE8A 1NLZA 4Z0TA 3JQFC 3HDHA 3C6QA 4CRWB 3ETCA 5C53B 1IZZA 5LM3A 4BKUA 1O8BA 3TX2A 4AKTA 2Q0QA 1J5XA 1Q12A 5TSDA 5KJ1A 1R0BA 2I9KA 2Y0DA 2OWEA 3P4UA 1OX5A 3LPNA 5K3DA 3D5QA 1L4GA 1Q50A 1S01A 1KNXA 1OIVA 5CEFA 2ZAIA 3HKEA 4HN9A 3W1WA 1E3JA 3P2OA 1WCIB 4HAIA 1E3WB 2PKWA 1II8B 1J06A 3IUMA 1MABA 4N6NA 4ZAGA 5JC1A 1TRKA 3GFRA 2I5PO 4D8XA 1I0IA 2BF4A 4QUBA 5FWXB 4HG2A 4G26A 1IBSA 4BO8A 4XTRA 4XX0B 1J0EA 4AJ2A 1A7JA 2B4QA 2R8PA 1G2OA 4OBXA 4UPEA 4MHTA 2IXFA 3LCJA 2JBAB 2VOEA 2Z0MA 4J3JA 1RBQA 1NYLA 3RANA 1WP4A 2CYCA 1TYBE 2FWIA 2NAPA 4FKZA 3C24A 1SBIA 5TJHA 2A9JA 2AYZA 3HJUA 1A9XB 1KWKA 3OCUA 2AN1A 4D79A 2P2NA 4JCOA 3R7AA 3I32A 4GBJA 3RFFA 3T52A 4D45A 4Q1DA 3VSEA 2WIAA 3AR5A 4DGSA 1YQGA 3OEHD 1IPEA 4EB3A 3RVDA 1Z82A 4KR0A 5EKSA 1IHYA 1PFGA 2O8CB 2ZT6A 1U0BB 1K98A 1OBHA 2OCXA 1GTVA 1SVLA 1JHDA 2VHXA 4QGGA 4RJJA 4W5RA 1JFSA 5TMPA 4X84A 2CMDA 1N3LA 3V4ZA 3T34A 2G5GX 3MMZA 3STHA 4AJKA 4CR8A 3ER9A 2GZHA 1F1JA 3P5BA 5TF0A 3ONWA 3AESA 3A1VA 4KGVA 4EF5A 3HSKA 3SAJA 3TUIC 2RJOA 1C1HA 2PRKA 2ET6A 2PQ0A 4ID3A 2PD6A 1RJDA 2CFCA 3AOEC 2OHGA 3WZ2A 1RXEA 4CKCA 4E1VA 3F6PA 1NIPA 1TYZA 3H3JA 5M04A 4MVWA 1T25A 5DJ5A 1O6GA 2WSBA 3ZQUA 1JYEA 4EM6A 3EY4A 4GS5A 3ZH9B 2AZ4A 4JVMA 4JJFA 1Y3BE 4PG7A 3FNBA 1Q0UA 1TMOA 3G13A 3OX3A 4RXMA 1SQSA 3WMEA 5IASA 3GLGE 1NN1A 3CIFA 1DXQA 2QTRA 4EMSA 4P81A 5H8WA 5FWNA 4JP5A 2RONA 1PJ2A 6ABPA 5IKXA 3WFZA 5H68A 3KSRA 1VIAA 4Q9IA 5ALJA 2EZTA 3BD8A 1A5TA 2PUDA 3F6EX 4YRAA 5CDFA 1ZKMA 3MUNA 5AIAA 2YR0A 3ZHRA 1OKKD 1GAWA 1P9OA 2NVUA 2PTGA 2PJDA 5FNVB 1BCSA 2FEKA 3VBCA 3QM1A 3FBGA 2H7VA 2H4HA 3NZEA 4B2LA 2CLCX 2ZIXB 5AM1A 4TKVB 4P35A 3GVIA 2XYRA 3E0QA 2IHJA 4MS3A 1LK0A 1JHOA 1VJTA 2WTMA 3PFKA 3I52A 4YRCA 5E4JA 5AOVA 2P2GA 3O31A 5MN4A 2ZWAA 4KAXA 5I47A 2OXTA 5FOTA 4M8NE 4Z8XA 5DTMA 1CR2A 2HKIA 5EZSA 4NG4A 4D9IA 3DZCA 4LRWA 4YCBA 1TYDE 5KYXB 5AM4A 4AVYA 2E18A 3K9LA 2WDZA 4XUDA 4Z9BA 4TZTA 1X7GA 3U17A 1M2HA 2CV0A 3CMCO 5BQFA 3ICOA 1KI7A 1YB1A 1D4FA 3SC2B 1QP7A 2ZYSA 4K3VA 1RLJA 1NLYA 1ONSA 1RM3A 3HZZA 3MQ4A 4TUYF 2WU1A 3MQ2A 1KVSA 1R6UA 3UH0A 1XZKA 3A28A 5A4IS 3DAHA 5I4IA 2O54A 5LOVA 1S9HA 3O9MA 3VI4B 1K97A 1ZA1A 3A1SA 4LYAA 5IBQA 3I9V6 2EBUA 4QGHA 5KKAA 3HMQA 3UOWA 3IE0A 2WP8J 4V0OA 1AUPA 4Y9UA 1K3UB 5J4LA 1YZFA 1SA0A 2QLTA 2NQ8A 1BQ4A 1NW7A 4C5AA 1I33A 1T1EA 5L40A 4JKIA 1JXAA 3KJFA 2YVLA 4K9OA 2F4VB 1NQ5A 3I5AA 3KB8A 3AZOA 1AS0A 2IYWA 2JFHA 5DTQA 5LU9A 3HEMA 3IPYA 3MBKA 2GXSA 2OLJA 3QW2A 4JR0A 1QOZA 1F2UB 2C57A 2P9CA 4KLRA 4J2TA 2H9AA 5AJUA 3UVEA 3CLRC 5ICMA 3JWPA 3CUYA 3RVMA 5C7IO 5KCZA 1L7VC 3RU9A 1SKBA 2J5KA 4UNNA 1OAOC 1Z0DA 4QDKA 5HKKD 2XA9A 5AJWA 1PG5A 2NSLA 3Q8WA 1JTEA 4KWTA 2PUBA 3BQNB 3ORQA 1N2JA 3ANYB 3O4IA 3E84A 2H11A 4NBLA 4UE6A 4RTPA 5FA5A 5DBHX 3QUTA 2O3RA 4I9GA 3GFGA 3LCMA 4K86A 3Q3JB 3RYFA 3IE2A 4QPCA 4HWKA 5AJYA 5F5NA 1LDGA 3PE6A 2N9UA 1E2QA 2Z5VA 3Q9UA 2CHUA 2ASVA 2Q1WA 4ZVSA 3TZ6A 1MRZA 4PU0A 2ZRQA 3OT4A 4BZXA 5ETJA 2NVBA 4E09A 5GIPE 4TYMA 3COVA 1DAGA 2A14A 1FP4A 3V80A 3T7EA 2XYGA 3WZMA 5KNCA 5CNKA 5ICEA 4DMUB 1FXUA 1Q91A 1Q16A 2WKRA 4HX9A 4N3BA 4XLTA 2Z5LA 4HH4A 1RLTA 3VUEA 2YV2A 1KOLA 1I36A 2JATA 4JN6B 1SOAA 3GJXC 3WKBA 3X1DA 1QLWA 4DJDC 4EA6A 5JAHA 1FY2A 1QQAA 4FGUA 4AJIA 2GZMA 2Y66A 4EKEA 4ZVKA 1TECE 5CLFA 3FCYA 2V55B 2NT3A 3AMVA 5TQ0B 1AUXA 2VOJA 2M6LA 2GNOA 3RSFA 3ENNA 1WOMA 3O26A 3V55A 2PJZA 4FW8A 1DOZA 4N9QA 3GG2A 1CZNA 1S7GA 1R5JA 1PNQA 5MFPA 5L4NA 4DV0B 4U0JA 1JDUA 2ZQ5A 2QRPA 3C7KA 2ZRBA 4L4SA 2ZS7A 2DERA 3C3YA 4TVKA 5FI1B 2VRCD 3AXSA 1WXEA 4HQFA 4NHOA 1HK7A 4JP8A 5NULA 1T2NA 4UD6A 1E6MA 1XZ8A 1J2YA 2OCIA 3PYMA 4RHCA 1SIOA 1UWLA 4F2DA 4X91A 4JJ7A 4GAEA 1FE8A 2EWWA 2E6KA 1OILA 5GP1A 2BE7A 2FUCA 3WGQA 4DBZA 2B3TA 1TKAA 1FZQA 1JV2B 1U5BA 4UM9D 5THXA 5E1DA 4IZHA 4OMCA 1I3KA 2HLHA 3WGKA 4I0WB 3FPFA 4OQQA 5ULLA 5LXTB 3R6LA 3TN7A 3AJ9A 4KQJA 1OVMA 4WY5A 2YHSA 1Y1LA 5FR1A 4YJHA 3KVOA 4UTNA 5AM3A 1J4AA 5KTOA 1XO1A 5C1DA 2FZ5A 4NV1A 3UHJA 7GPBA 1P1BA 2VF5X 3UCEA 2X8WA 2A1TS 5G1OA 5KBYA 1U9IA 5GONA 3V8QA 3V9AA 1J1ZA 4OO3A 2WU4A 4A9AA 4AQ7A 1R9JA 1XTIA 1PD1A 4YCSA 1L1EA 4RACA 4CKYA 3KL4A 3MWEB 5C2JB 3U7QA 4B2PA 3TUJC 2G28A 2WT9A 3C39A 1N3YA 4NVRA 4LQCA 1SB8A 4BMDA 2X22A 1P0PA 4LNUB 1NTOA 1P9LA 2QR5A 3JQRA 1U0EA 4YAIA 3IR6A 2BGMA 4QUKA 1MAVA 5F21A 3VDNB 1G8KA 4Z49A 3NDBB 2R3SA 3NGXA 2DQZA 1XQYA 4OHPA 3PENA 5F35A 3IQEA 3WB1A 4EA8A 4EFDA 1MO2A 1UBEA 1HWYA 2CJWB 3FDXA 4KXLA 2C2GA 4QIHA 2Q3JA 4CIBA 2AWNA 2W58A 1QZZA 5HBGA 3V1TC 4EJSB 3TRHA 1N2BA 2W93A 2JVKA 1E5DA 1E3IA 4HUQA 4HWGA 1ISHA 4G5SA 1N1GA 2H00A 2SKDA 2CJYA 5AVSA 2ANBA 2P3LA 3AY3A 4ZXPA 2BTQA 1P2FA 1AMNA 5CURA 5AW4A 3UA3A 1L7PA 2X6QA 4J0JA 2B92A 1R5BA 4UBJA 2HA2A 3C70A 1RPJA 3D8UA 4F93B 4K6HA 4QEZA 1J00A 1DC3A 1E20A 3EXFB 4NHEA 5BR4A 1Q22A 2NWQA 3LT0A 1JKXA 5TC4A 1MBZA 2OENG 4EO9A 1OE0A 4DPLA 2IYRA 4CQLA 2V3CC 3T5PA 3SVTA 2I2AA 4X94A 2AFIB 4L5YA 2P6RA 2AFHA 2CB0A 2Q21A 3CGGA 3KE9A 1FMTA 5GZ3A 1S4MA 1KR2A 3IXMA 2VNIA 5K4HA 3HB4X 4A03A 1VL6A 4F1JA 1XU7A 3OM8A 1Y7IA 3X1JA 5KHAA 4FC7A 4Y0NA 3P71T 1OAAA 2XQJA 3I2FA 1ZESA 2VC2B 4HGRA 4J76A 3K05A 1KARA 3TGWA 1J9GA 1KA9H 3KXPA 3ROQA 1GZHB 3TNLA 3VNSA 1NAHA 3PL1A 3PFGA 3K0AA 2YH2A 5F1KA 2JFNA 2BLLA 5T57A 1G21A 1UAAA 2QJRA 4I1PA 1UBJS 2NM0A 4IOJA 4J4HA 1N25A 1LQUA 3VYRB 4C08A 4BJ5A 3JSAA 3HUUA 2D1TA 1YQDA 2J7PD 3QOWA 4KWEA 4PPQA 3O1LA 3ZCRA 4D9GA 1Z36A 4O4HB 4PAOA 3GUHA 5EMLA 4L27A 4MINA 1W87A 4UQOA 1TIPA 2PV7A 4B1FA 3AR4A 1JKJA 4GHWA 1KMHA 5KJEA 3WHIA 5LOVF 5LZ2A 5JLAA 2ZAMA 1Q0ZA 4HDQB 5GZ6A 3W7VA 3PFNA 1HE3A 5DI9A 3HCFA 3TL3A 5I01A 1KTIA 2P68A 4O2LA 1RQRA 3A0RB 1XRJA 1U9JA 5K7SA 4Q3BA 4XJVA 2X23A 3K70B 2Y05A 1O03A 4RDHA 4S3MA 1C3JA 3A2NA 3W9BA 1DC7A 3L41A 4KPGA 4C0XA 4DV1B 3COZA 3HP1A 1XMJA 2J3QA 2UYQA 4P4SA 3NHBA 4BN4A 1P4RA 3NVDA 3NAZA 3IFSA 1E2JA 1G18A 2CUKA 4RMJA 4CM4A 4PO8A 3RRYA 3I5YA 4ZA2A 1EJ2A 3O1IC 2IXAA 4CZ2A 2PWZA 3A9WA 4GM0A 1KAOA 1Z4KA 3U09A 3LC0A 1Z9BA 2VVTA 3HS3A 4RS4A 4ZZ3A 1SXJC 1YULA 2H0AA 5DBGA 2ZB7A 5EP2A 4CNQA 2R00A 1U0OC 4DV4B 1R10A 1ZZGA 1KI6B 5AIBA 4B31A 3C15C 1ZCFA 4R83A 3NAGA 3HVRA 3F3YA 3WWOA 2AYYA 3E8MA 2IEDA 4RY8A 1SZDA 1ZSNA 1LA2A 4QO7A 1ZD5A 2ADOA 1WPRA 1WF3A 3JD0A 2GEKA 5KX5B 1Z6AA 1ZG3A 5CDFE 2AEEA 1FBNA 1LV7A 1P7YA 3WZLA 2P62A 4CKEB 2R8BA 2LCQA 5LQNA 3ICWA 2QIOA 2Q46A 2P75A 1ZGJA 3PEFA 4CR6A 4JJZA 4BO3A 4JEUA 1G8MA 2X0JA 3MMXA 3VPBA 4CCAA 2L82A 4FYYA 3ZG6A 2XZOA 1AKYA 4A1FA 3NWOA 3ETEA 1J7JA 2IX9A 4INAA 2VHEA 1QIJA 2CL7X 4D5EA 1NBHA 3PKZA 2PSSA 4GMXA 1VQ1A 2Q5LA 4KQ9A 4NKRA 1W96A 2RC5A 3UJ9A 2XJ4A 1GZDA 1T2FA 1LVUA 2YWEA 1SMKA 3EBPA 3PC8A 1PS0A 4QXPA 5KQMA 2OILA 3RKSA 3VUFA 2HAEA 1LFDB 3SHWA 1N0WA 3M6WA 3PZBA 4NIMA 4ZI5A 2Q9AA 3DZJA 5JCPA 3N2IA 4A0HA 4NR0A 2W0SA 3HA7A 3N3BC 2ZB4A 3PUHA 4OXXA 4AAYA 3G23A 3G7SA 4FZVA 1PSDA 3FUVA 1V8OA 3M5WA 4UTZA 1VPWA 5GM1A 1GCUA 3K71B