1V8DA

Crystal structure of the conserved hypothetical protein tt1679 from thermus thermophilus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
193
structure length
189
Chain Sequence
MEGIRRAAQRAAEEFLQAFPMAPGSLFVLGGSTSEVLGTRPSLEAAHAVLEGLLPPLLERGVHVAVQACEHLNRALVVERETARAFGKEEVAVFPHPKAGGAKATAAFLRFRDPVMVESLKAQAHGGMDIGGVLIGMHLRPVAVPLRLSVRKIGEAVLLAAKTRPKLVGGARAVYTREEMLKKLEEFLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein (TT1679)
publication title Crystal structure of the conserved hypothetical protein TT1679 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 53
structure length 189
sequence length 193
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04260 DUF436 Protein of unknown function (DUF436)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Hypothetical protein TT1679 1v8dA00
1V8DA
chains in the Genus database with same CATH superfamily
4BY9E 3WNZA 2Q7OE 2XSZD 3DBHA 3MUFA 4M0UA 1Q12A 4FFSA 1P4AA 2FWNA 4GQBA 4RHXA 4HMQA 2PWAA 4X1KA 3TIXB 1IXYA 3WV4A 2R1VA 4TL9A 2QRHA 1E5TA 4FOTA 10MHA 4X90A 2WHXA 1KJ9A 1G21A 3OUUA 1MVOA 2MMGA 3JASB 2Y99A 1X92A 4CMKA 1XPOA 4R1TA 1O0BA 3OCJA 1XAHA 1H0HA 2NX2A 4Y9UA 5KDDA 3JD0A 2QVYX 3RSCA 1BXRA 2P5UA 3PHIA 4U2KA 3MJFA 5A6VA 4UKDA 2O05A 5EZSA 1QRTA 1XZAA 1EIZA 1L7PA 4UASA 3FOFC 2VR1A 2UV8A 4I50A 4YAFA 4NMHA 2AG0A 4PRKA 1MB0A 1AUOA 2OBNA 4H4EA 3UUEA 4DXHA 3KJGA 2O8FA 4G5YA 3PG5A 2ZI4A 1XU4A 3HL0A 3E35A 2F4NA 1K3TA 2B4AA 2ATXA 4KN8A 4LECA 4B4OA 5ILQA 2JFXA 2X0FA 2W6ID 4EI9A 1OXSC 2C2GA 2FN3A 5H5JA 4K6GA 5H81A 4KPEC 4KMRA 4RHTA 3OTQA 2YMPA 1W0CA 2FZEA 2IEYA 3QX8A 4B4UA 1TYCA 5IVDA 2OUIA 2W6QA 1OB2A 2FVXA 4TYWA 1H1LA 3L0SA 5AJTA 1DAIA 3DEZA 1ORHA 1OAOA 3N39C 2OHOA 3LPNA 2V6MA 1VCMA 2CBZA 1BEEA 1UK9A 1Y5MA 3G49A 4I3GA 1JPNA 3JRWA 4EX6A 1NWHA 1IXSB 4BNHA 4ROTA 3Q85A 4JC5A 1T9DA 1PJBA 1U6KA 4HB3A 3ETHA 1XMSA 3WBFA 1PQYA 5FTKA 3AY0A 2J3KA 3W6ZA 4B8ZA 4EPYA 4ZHQF 2AX3A 3OPVA 2P9EA 1W36D 1ULBA 1D1TA 4ZJPA 5HTKA 4FE7A 5LP1A 4X54A 3D7RA 2VHXA 1LV7A 5ADVA 3SHQA 2QBYB 1EDEA 4IMPA 1P2DA 1B0UA 1E60A 1ZJ6A 1YZKA 4O4JB 3C5VA 4I4LA 1QIFA 3UAOA 3W5HA 4BMVA 3G3EA 3CU5A 1V25A 3M7IA 3I5YA 2GVDC 2P9TA 2RB5A 3EPRA 1W0JD 2KB0A 1Y81A 1ULSA 3W1WA 1BE6A 2E4UA 3OLZA 1HE1C 2ROQA 1WSWA 2GDJA 2M6RA 3BJZA 3OM8A 1BS2A 3ASZA 3PQFA 1HTWA 4GSKA 4NSNA 5EQTA 3C7AA 1AXRA 2WJAA 1X8KA 5FORA 3L05A 3SU8A 2G4CA 2IHZA 4JJ7A 4DLBA 4C07A 1SUAA 4D8UA 1GZVA 5I7EA 3I2YX 3Q8XB 2QSUA 2D1SA 1ILEA 4PR3A 1I3LA 3MRTA 3HNRA 4E07A 2D2FA 2WG0A 1GUAA 3GCGA 1B8UA 3AVWA 4IKPA 5JSUA 2OVFA 1FOEB 1OAKA 1FYEA 4FZ5A 3FTPA 5FBQB 4C03A 4DSUA 4ECAA 4EL5A 1DZ3A 2ZIZA 4FR2A 4RXMA 1HOTA 3ORFA 3U49A 3ZVKA 3FRIA 4H7KA 2QYHA 3C5HA 3P2OA 3G1UA 3WGNA 1JA9A 3IDSA 4JGGA 3WJ1A 1KAOA 3A11A 1UBGA 2R6FA 2WAXA 2JVKA 2C94A 3OE5A 1RYMA 5L45A 2GXUA 1VM6A 1BGVA 1Z08A 3NONA 4ZO9A 2VUSA 3ZK9A 2ZRCA 1XMOB 3CN7A 4Y1GA 5CTAA 4IVRA 4BP1A 4H9GA 3VOTA 3TPZA 3SYNA 1WXIA 2PZGA 4FFNA 4P9NA 1U28A 4PSAA 4TS9A 2UVQA 4YJ2F 1TRKA 4NMLA 2QZJA 1BXGB 1FFCA 1MJGM 1GKUB 4N0MA 1ZRHA 1I5OA 4BVJA 4DR4B 5TQVA 5IBPA 4BNFA 1RKXA 4DW8A 2B1JA 4YRKA 5FX2A 1F2UB 5KHOC 4PTYA 5SY4A 2QL7A 4YRSA 4BVLA 5C34B 1GQFA 2R8OA 3B2NA 4KQXA 3WG9A 4AX4A 4DMHA 1ABBA 4H6WA 1EUZA 1SVKA 5LKAA 4LBWA 1YCFA 3L7JA 1JF8A 3R0IA 1DO8A 3ZGLA 2H31A 3G23A 1BX0A 1KETA 1X7ZB 4MSUA 4ZO7A 2G82A 4O2AF 521PA 3FPHA 1N5JA 2RK3A 3JVUA 5C8XA 4RTOA 1HOXA 1Z2CA 1RRKA 3FF4A 3A05A 2VJKA 2QI9C 3LM8A 3MMPA 1H66A 4YT5A 5G0VA 5CEFA 3AW8A 3TI7A 4LDAA 1W46A 4OJYA 4UEWA 2HIMA 1VP9A 1X1EA 2O3JA 4MJ7A 2NU8B 3PP8A 1LRLA 3QIAA 2AQHA 1BNCA 1F4VA 3E27A 3WAGA 3E23A 4OK6A 5IVKA 4YT2A 1KGSA 3WWYA 2XMQA 4MKZA 5TARA 3VH3A 4P36A 4OB8A 1GHTA 4RJJA 1ZQ9A 3QEMB 2PK3A 2QT9A 3N58A 2FN8A 5BNIA 3S8MA 3QFRA 4P34A 3NBZC 1CJSA 3TBKA 1HTBA 3LKBA 2VUTA 4ECEA 1E94E 5EL0A 4AY4A 2DFKB 4PC2A 1YR8A 3HYCA 4FMCB 2GYVA 3IHLA 3PDCA 2VS1A 5DNEA 2KPOA 3CNBA 4M1OA 3HFJA 4G1FA 3QTTA 3R5SA 2ZJ0A 2PVSA 3DTNA 1M1NB 1AVTA 1Z0JA 4HDNB 3EAGA 3MB8A 5DULA 3DDNA 3WA7A 1QHYA 1T0UA 3I92A 3QYPA 3OFJA 5DI9A 5LBIA 4BFXA 4YUWA 3VH4A 2FZLA 1KOJA 4DLPA 2AJLI 5JOQA 1T4GA 2DUNA 2XYHA 1KI7A 1W29A 4UVDA 5ERXA 2BP7A 2VXCA 1E7QA 4UHFA 3WLNA 2NXWA 3VNSA 1S3FA 1R9NA 2KBEA 5BR8B 1KH2A 2EX1A 3KELA 1YDEA 2EKDA 4WNCA 2WTNA 3T4XA 1KFEB 3DO6A 3PXXA 3KYDA 3ND7A 2X0EA 1B1CA 4B87A 4E94A 2QPTA 3ESCA 3TINA 3EGIA 3FUTA 3TPCA 1TLTA 5JMTA 3IESA 3CEHA 4OUDB 2WLSA 4CT0A 2QXYA 4QJ4A 4DVJA 1M2KA 4WLUA 1YOBA 2EFGA 2Y77A 4HGZA 2QGNA 1O58A 3SSMA 1DIHA 3S4YA 1XP5A 3AI2A 4N0QA 2H4WA 4ZDIA 3LVFO 1F48A 4OGKA 3LBYA 1UKCA 3L0OA 4HKTA 2Y27A 3GZ4A 2XNHA 1LPNA 2ILVA 1VKOA 3W2IA 2W22A 2B6HA 1GLGA 1JFFB 2NV2B 2RH9B 4EJSA 3C39A 4F60A 5K8VA 3V8RA 5H1YA 1RLTA 2QMEA 1DEAA 1JVNA 1TM3E 2A88A 4M7OA 4GC9A 4RADA 2F3TA 1XEFA 4AZSA 1HFWA 2SNIE 4YCSA 5L53A 2QMZA 1D4AA 3LT2A 1D5CA 4ZCQA 1ID1A 3K94A 3PB3A 5ALSA 5AOCA 1NVEA 2PGAA 5EXTA 4ALLA 4F4JA 1MW8X 1P60A 4QPDA 5DLPA 2J3JA 3AFOA 4FGSA 3SC6A 3DNFA 1BWQA 3ZWNA 2Y4NA 4UTRA 3WZ2A 1RJ9B 4QBFA 1C8BA 4EH1A 1AO0A 1OYYA 2R6R1 4OG2A 1G291 2ZRQA 3VMFA 5M29A 1V6CA 2B34A 4YS6A 3IUYA 5LLTA 1A9QA 1AZSC 4NWIA 4Y0AA 3P4YA 2WVJA 5C5EA 2HH9A 5K4GA 1UKBA 1AGPA 4MVJD 1ZVJA 2FEWB 5TQ0A 3N6XA 5HNKA 1JEOA 3ZKWA 1U9JA 2UZ0A 1USIA 4HNGA 1QQTA 1Z6PA 4J49A 4KFTA 2VSOA 4K9PA 2FA9A 5ENVA 4EG1A 2IZOA 4FFPA 1G5HA 4Q4CA 2WRZA 3BGIA 2QE6A 3N6VA 1I0IA 2GHTA 1QHFA 2C77A 4YUZA 4LV6A 3V33A 4V0LA 5CGQB 2BBTA 1F2TA 1MB9A 2WTBA 3A0UA 5AD1A 3E18A 2PL5A 5LP6F 3R3WA 3MVEA 1DAMA 5KHAA 1YC2A 4JXKA 3CKLA 1PR4A 1ZGBA 3GH1A 4RV5A 3TOVA 3V4LA 5JCJA 2HDNB 1DKQA 5CX4A 5ALLA 5K6TA 1U63A 4RPCA 4W1SA 4JEUA 3LLCA 4K6CA 3WWPA 5J4KA 1J5EB 4IS3A 2HEIA 4WZAB 2H7YA 4NCNA 1CQIA 5CFRA 4L1KA 4XDZA 5ALVA 5I9MA 4LDQA 4F86A 4DADA 1GAWA 3L6CA 5LJLA 2QX8A 2CXSA 2C8VA 1WVMA 1NL3A 4ZRDA 1GR1A 4FLFA 2A2ZA 5K0NA 1HQDA 4KXVA 3MF4A 4RACA 4ZO6A 1UFKA 3OE7D 5DBGA 3TLGA 3HFRA 1TQ4A 1GZ7A 1U3GA 1N7HA 4M87A 4RTMA 4MYSA 4G8CA 2Z6QA 1M72A 1A9ZA 3JARA 4TQUS 5TMEA 1UDAA 3DE1X 2HPVA 1E4VA 2CDNA 3D9QX 3PNBA 5IVIA 4F4FA 2C3UA 2VRBA 3S27A 3OFSA 3R74A 5JHHB 3VZRA 1IEWA 2FI1A 5EMNA 2KMLA 1SMKA 3TSOA 1PK8A 3ONEA 1SEVA 2LGJA 3ZLUA 5B7NA 3GVIA 5JQGA 5HCIA 5ICMA 3A36A 3T3GA 2XYRA 5JSZB 2O5RA 3ZU2A 4M1TA 1U3WA 1QLWA 3Q6IA 3AEQA 1A7KA 4Z0NA 3F8WA 3QNMA 4LX0A 2I65A 1Y1KE 1JBEA 1JPJA 4LY3A 1N5IA 4RNCA 1XLUA 2WTMA 5FTWA 3R7NA 5AMXA 4LJLA 4EIWA 4TROA 1U0FA 3LZDA 2ZCJA 2XWQA 3HWX1 3F3MA 3PD0A 1RCFA 2PPVA 1G42A 1GGKA 2GVNA 5IF3A 2YBDA 2LUOA 3GOHA 4OMDA 4JBGA 4BFUA 3GVXA 3P0HA 2CZGA 1JR3A 4PHFA 3FPEA 3R7FA 1ESMA 4G84A 2Q1WA 3A3OA 3GVPA 1M6VA 3EZNA 1QE5A 3NTUA 2RHRA 4PPNA 1GPNA 3VR4A 4OV6B 1N75A 3DHVA 4ODIA 4P2GA 4RKWA 2OMKA 2Q6VA 2W11A 4NG5A 1ADYA 4CLRB 2OHXA 4KPFC 1LBTA 1VGRA 2HSZA 1G7TA 4WZAE 2REXB 2DGDA 2ZPUA 3F49S 4DLNA 4PQGA 1KORA 1ULUA 3OJ0A 3OKPA 2VTEA 5JJCA 2ZRDA 4LV5B 3ZOZA 1CLEA 1GXSB 3M4ZA 1SKYB 1U3CA 4H1WA 1XEXB 4XASA 1HNWB 4H6VA 3D4IA 2D0IA 3KB8A 4JZYA 3UK7A 2DWQA 4FFBB 4ARUA 1V35A 4QRIA 4WBXC 4A91A 4KTVE 4Q34A 1KQNA 3SS7X 3OZ7A 4NOKA 3UXHA 4L4XA 3C7TA 4N12A 4N8DA 4BNGA 1GLNA 2PEYA 1M2OA 5JCJD 5LXTF 4ZIRB 3MBIA 1NOKA 3EXAA 1G3QA 3RS5A 3EZLA 1L8XA 3GRUA 4JLJA 5JH7B 2C2HA 3KYCA 3MD9A 1DFIA 1IDOA 3UWMA 4ZTUB 1P7WA 2J30A 4WCDA 3CF6R 2O14A 4CKZA 2ZEJA 5BWMA 1UPFA 1TRHA 3OZSA 4F21A 2IW1A 2WZBA 4Y8VA 1AKRA 4YAOA 2VDLB 3KB1A 3ZLJA 5CW1A 3IE2A 4P3XA 4WKOA 4U2DA 5I3ZA 1I2AA 1QGZA 2OXFA 5CBPA 1QRUA 2F3UA 1S0UA 3HE3A 1G3MA 3NLLA 5DH9A 5CLQA 5HZMA 1XTKA 3SR0A 3BHJA 1VQ1A 3USES 2VQ6A 3G1TA 2VRWA 5IN4A 3FI0A 1PNQA 4G5SA 1N3YA 4RXTA 2QM3A 3HKDB 4TZ6A 4YDSA 2VFAA 3BZBA 5H70A 2P3SA 2X9VA 4LOIA 4BAGA 4W5OA 1X70A 2Q2OA 1FSGA 5DM0A 1KAQA 1YQUA 1T8SA 1FW6A 3JQ9C 3P97A 3N7UA 2PO5A 4RD6A 2UU9B 1J25A 1T36A 2DFNA 1F6BA 3SS9X 1P0FA 1T35A 1TGVA 2Z2YA 4J0IA 4TPKA 3AWIA 4EGJA 3T5PA 4OOFA 3F67A 2QMQA 5L40A 4I5EA 2ORWA 4HJXA 2B61A 4B85A 4JN6B 2QN3A 4BNMA 4DIOA 4HFNA 2OECA 4F46A 4G25A 4CQMA 2DB3A 1XP8A 2CLCX 1M7GA 1P6XA 2G5CA 2PD6A 1AF7A 3KU4A 2RCYA 1JU9A 2Q07A 4V1CB 3DM5A 1DUVG 4KC0A 1G6KA 1QBKC 5B4UA 4OH1A 5FFMA 3HA5A 1FDTA 2BGTA 4C4OA 4J7XA 2II6A 4G5OA 1SG6A 2OCDA 4WVLA 3SFZA 4E7PA 2NQ2C 3JS5A 3L7MA 4RVSA 3C8ZA 1QC5B 4X5OA 1N0UA 2BM1A 4BNTA 4YRNA 2V7TA 1FLVA 1SKYE 4MQLA 2H4FA 4UEOA 1FTQA 1UEIA 4DCJA 2QB5A 4XGIA 1GG8A 1JR3D 4P54A 1J4AA 4PGMA 5F23A 1JPUA 2C84A 2O23A 1V1MB 4QREA 1VB3A 3D3QA 2I2AA 5FLYA 2OUKA 4J3NA 2D2XA 1LVHA 4NYIQ 4L4SA 1U9ZA 3OAAD 1Z38A 4ABYA 1M6EX 5LA6F 3VR4D 1XALA 5J5CA 3CIOA 1A2QA 3STWA 3AVOA 3CMMA 3KZKA 4HNRA 1CJCA 4IGFA 4XLTA 3ZV5A 3BPSA 4WK0B 1B15A 3QVKA 2XQVA 4XPZA 4MUFA 3T06B 1Z74A 2GB4A 1FFEA 3R6LA 5FO1A 4TV8A 3ZTWA 1N78A 5THQA 5FYQA 5CIYA 4X1YB 1WV1A 4ENVA 4DIDA 3MXOA 2YHAA 2YW9A 1E2GA 3KR9A 2MJLA 5DTQA 2AVNA 1U0RA 1L5HB 1CD5A 1YR9A 2CVHA 5BVGA 4EVIA 2WD8A 4MUXA 5B3JA 1DBIA 4MIOA 4RVNA 4ZQCB 2GUGA 2AF3C 4PAQA 3UBTA 3FWZA 3LHDA 5DPMA 2FFHA 4WUTA 2J4FA 4HGRA 1S2DA 4Y30A 3RQSA 1XMQB 1NBMD 3IBSA 2ZR7A 1W59A 2XMDA 1W88B 4JJIA 1SC3A 2C3YA 2PL3A 5AUNB 4AMUA 1NFFA 3WHKA 4IRMA 1WMBA 3FZYA 3FPFA 5DO9A 2P2CA 1E0SA 1Q0HA 4U0KA 4A5SA 4YRCA 4RLSA 3KQVA 3T7DA 4B4WA 3MIZA 5DHTA 4WY2A 3NNSA 3PDIA 1LEHA 4A0GA 3LDGA 1BE8A 3PUKA 2EIHA 1XRRA 2VAWA 4G2TA 1AT1A 4EB3A 1VG0B 3W5SA 1XNRB 3PFWO 1J56A 1FU4A 3DP7A 1ZSNA 3HV2A 4P53A 5A5EA 2WK1A 1I94B 3JZAA 3RAFC 3E9DA 3NYRA 3OQJA 5DSTA 3STYA 1A69A 4EG5A 2PMWB 2E18A 4UTOA 3QUQA 3PHBE 3E53A 5EINA 1MNAA 4A0FA 2IBSA 3PNKA 3PHGA 1PR3A 4CLDA 2RGUA 3GCZA 1R7RA 3MMNA 1U8XX 3R5HA 4G5FA 5E2BA 3UFXB 4FYKA 1DXOA 1EUDB 1Z5NA 2PKQP 3ABSB 4I9FA 3VHRA 4LRTB 4AMBA 4D41A 4F92B 3BT7A 1P5HA 2AI3A 1NY5A 3M6AA 4UUPA 1CIJA 1FS5A 2CZCA 2XW6A 2RHGB 4KOAA 5EJIA 3ZOKA 1GZHB 3FOCA 3O8RA 3UXEA 4Q6BA 4V0SA 4UCXA 4NRDA 1CQJA 4U5QA 4O4LB 4XQ9A 4PFKA 2AZMA 4AC9A 2PUEA 2PBRA 3G8YA 3I0MA 3O8OA 1KQ3A 3BTVA 3M4JA 1LB1B 2REOA 3AU9A 2GDZA 4OHRA 4B44A 4B31A 4CQMD 4R0NA 4UTNA 1N2GA 4IEEA 1DG1G 3G2JA 1UPBA 5JXHA 1SVUA 4FSXA 3VAYA 2TECE 1SD2A 1YU9A 2R1TB 2XMZA 4C6HA 3DMNA 1SRRA 1RWOA 2Z09A 3U4IA 5KDLA 3VU0A 3ZEAA 1UZAA 4DOMA 4ZJZA 1LY1A 4HXFB 3V2HA 4D02A 2DERA 1LPMA 1IZYA 1VYHA 1YL6A 2FFAA 3O5AA 5B58T 2OSVA 1JZTA 2GTPA 1NONA 2PX5A 3SMVA 3A9CA 2VDWA 3ENQA 3QELA 4OD0A 2H29A 4TUYA 4PQRA 5FR2A 3AKZA 3HY6A 5LNK6 1GEGA 3LECA 1Z33A 3EXHA 4F3YA 1B00A 2HY7A 3BQMB 3ELUA 1PV2A 1TVMA 1UDWA 2ONYA 4Y2HA 2DRIA 4FNMA 3DE5X 4DGQA 3IR5A 5LQCA 3OIGA 1J06A 2V0NA 4R81A 4K28A 3A4MA 1P72A 3IEKA 4HFMA 1G5PA 3E9EA 1D2EA 4B9EA 3ONWA 3IVMA 1EVKA 3PLNA 4HV4A 3AU8A 3ORHA 5MN6A 3WTCA 2IA5A 2R79A 4MA4A 1SUEA 1EK2A 2R751 2AW3A 4TT8A 2PMBA 5E4FA 3RREA 3W6UA 1AHIA 3SQNA 1NQXA 1WW2A 2FF5A 4FONA 1FSFA 4Z7OB 3ZE1B 1C30A 1O97D 3UGQA 5G1OA 1ZD5A 2XUIA 2G9NA 5KJEA 4U2GA 5JJIA 3FH0A 4OCZA 3RLFA 3ZWDA 1AUPA 1H9AA 3QVSA 5KYYA 1EXMA 5IZCC 3WIBA 3KS9A 3CRVA 3F3SA 1R9GA 5CNIA 5LUBA 4DQXA 4DLYA 4FHFA 4LTNA 1R4ZA 2MWMA 2W0SA 3A9WA 1D6MA 1A9PA 5JRJA 2VZ0A 3BGDA 2PUGA 2FZGA 2OTCA 4ZREA 1QUEA 4RMGA 2VQ3A 1GTZA 3C1OA 3MJRA 4M9UA 5E3IA 3MJCA 1PGPA 5H59A 2ZRJA 5TS2A 3PTAA 3JD3A 3EMKA 1ICIA 3KWFA 1F8YA 1N2BA 4L50A 3H2GA 4MS3B 1MC1A 4RSMA 2OA0A 1UQUA 2XNDD 3BSWA 4LXIA 3UGTA 2DUMA 5LOVF 3ZNQA 1RFLA 2VDNB 3FB1A 5D3MA 5K0CA 2PZBA 3GN1A 4B5KA 3PUHA 3DNPA 2PXXA 2PS9A 2RAFA 4OF4A 2AG5A 5K3SA 4BFCA 3G6WA 4COOA 4E31A 2NXCA 3BGSA 4AJ2A 2XHEA 5FEUA 3UGJA 4E4TA 4KE8A 4ZA2A 5E8RA 5IXYA 2NP6A 1DWUA 5CA0B 1Z88A 2B5OA 3H1EA 2ZBPA 3JD4A 2BMDA 4WY5A 3N9IA 4B4KA 1IBSA 5BOVA 1J9GA 5UKDA 3K5IA 1H5QA 1Z8DA 3KHUA 5ALKA 4AL4A 3QZUA 5LLDA 4X95A 2JIPA 1EFHA 2QF7A 1FTYA 1BGWA 2JAOA 4G0XA 2R44A 1Q3KA 3OIDA 1RRCA 4X66B 3ZVLA 4PYOA 1GVHA 2UKDA 3E9NA 3LZCA 1WBJB 4QTXA 4YIKA 1UZNA 4O2BB 3VU9A 2PM8A 4J7CA 4GNKA 1E99A 3KAKA 4ZCLA 4CM6A 2FPIB 2HMVA 4DCPA 4IINA 4Z9XA 3FUVA 5JI2E 5DIZA 2B30A 2XUFA 3PHJA 5C53B 4CCWA 1W85A 1ETUA 2OCAA 3F6PA 2O4UX 4OPMA 3UK6A 2YY7A 4WOCA 3BH7A 3EY9A 5IX8A 1OPXA 5CDGA 1WS6A 4JLSA 2OE2A 4OLJA 4CCYA 4RJTA 3DOIA 4RESA 2WA1A 3H75A 3IP7A 3F6EX 8ADHA 3MWFA 3OJCA 3BWEA 3R3YA 4YMUA 4GLLA 4P7KA 2EBUA 3UANA 1CR0A 4MCAA 3X3HA 5LJIA 2PSSA 5H4HA 5HDBB 3AZPA 4UOZA 1QHNA 3Q7PA 1L3IA 3R7DA 4DMFA 4IGEA 3DBHB 2IHNA 3NBUA 2EFCB 2CL5A 1Z4MA 3G88A 5KSYA 5BYKA 1E8DA 2R1VB 1EKXA 1A98A 1AK2A 3ZGVA 1TM5E 1KK2A 1NVFA 1G21B 1Y8CA 3CSUA 3TQRA 5JALA 1OBFO 4URYR 1O87A 2IP1A 4HWRA 1H6DA 2D1FA 4EARA 5AK4A 1X1CA 1DUIA 1X74A 3DJFA 1S2MA 2AV6A 3RWOA 5A3SA 2JCYA 1NN5A 2QT0A 1XB2A 4OA5A 1GRRA 1JJBA 4FEYA 3DQQA 2JI4A 1QVZA 5IKEA 1IBCA 4JR2A 3A6FA 4WASA 3C1UA 3INRA 4CKYA 1RI2A 1BE0A 4GWGA 3RYCA 3N59A 4NC9A 4I50B 1AN0A 4OOEA 4TWJA 5KAMA 4CR7A 3UWOA 5A9SB 3LQRA 5F9FA 3D4NA 4Q5IA 2O8FB 5ALQA 4GU5A 4YAWA 4LY9A 4XDHA 1V7QA 4C7KA 4F97A 1Z6GA 1Z18A 1J20A 1JEJA 1BSVA 2V3VA 2WJWA 3DA8A 3EEIA 1VGQA 1K88A 3N2YA 4GUAA 3ZH2A 5BRAA 1MO3A 5EHZA 3LFHA 4OQEA 2DMRA 4RZ3A 4H6XA 4XQCA 1AGNA 4UBLA 5CR9A 2X0KA 1TC1A 2PTGA 3THXA 3CLTD 1NKTA 5IH3A 3SIWA 2AD1A 4KI7A 3L49A 3ZK7A 3FYSA 4YJFB 5TSDA 1H1LB 3MUEA 3K4HA 4EB0A 5L3RA 4MPRA 4AG6A 4D3DA 3NEAA 1X19A 4LJ4A 4FUQA 2JKYA 4U0JA 2WAYA 4Q15A 2VQSA 1O94A 3AF3A 4NNPA 1PSZA 4KMOA 5FI3A 4RJKA 4GOKA 1B3RA 2WHYA 2QLNA 4QOFA 5K3FB 4D4JA 4POOA 5KJ6A 2EW8A 4B3FX 3B6EA 4D3XA 1DOZA 1MORA 2XZTA 3E8SA 2WOJA 3S8EA 2Y1WA 1NGSA 3HCAA 3ZI0A 2YIMA 1R9MA 1DJLA 2HI0A 3GEHA 2OAQ1 1UBOS 3SKVA 1RXIA 4F2HA 1MO5A 4R8SA 1D4ZA 1RHRA 4H7PA 2R8PA 3NVDA 4IV5A 4XWGA 1FUUA 3G02A 3UK0A 3LUGA 2H2AA 2QVZX 3CONA 3KWJA 1S9HA 2ON6A 1FTSA 3TB4A 2QZ4A 1CVIA 1G21E 1M73E 1Z4PX 2FQQA 1UBTS 3LH5A 4AZ0A 2XD4A 4W9NA 2JIOA 2FCAA 1A76A 2OFFA 1FE8A 3ITDA 3PC8C 3NVMB 3O83A 4AG5A 1CUUA 3C6ZA 1H5UA 2XXAB 2PFSA 4JT2A 4YEDA 1J49A 1EP9A 2W93A 4HMOA 1W48A 1D1QA 4MRVA 3EUFA 3S2FA 3WHIA 2XGMA 3NUGA 1QTRA 4MK4A 3TF5A 5EAIA 3HGTA 1EH5A 3P27A 2MSDB 2DOKA 1CY0A 2V6GA 3GUZA 5DT2A 5E95A 4D81A 1Q44A 3JATA 4GXQA 3NAMA 1ZN2A 1N5RA 4F45A 3FSGA 4G23A 3ICQB 1EEHA 3DFMA 3TKYA 4BTEA 4A26A 3V9AA 3I53A 5IT0A 1CPYA 4I14A 3ESBA 1T3SA 3W8DA 2IVZA 4BVBA 5BR4A 4AQYB 1YB6A 5AYVA 3P8ZA 1DOAA 4X41A 4J6EA 4BQEA 2ZANA 2JLZA 3ADCA 1L7AA 1NHWA 3DV0A 4FNOA 4ERNA 3B52X 3Q41A 2WM8A 5EKXA 4MMZB 3KAJA 3FGPA 1AS0A 3SQMA 4D82A 4XWAA 2FE1A 3PX2A 4ARVA 4Z4CA 2FSHA 2NO6A 3IDOA 4BMZA 2YZKA 1JI3A 2IXBA 3UKOA 4OXRA 2NQTA 2IX3A 5MN4A 1WSAA 3A4NA 2AWNA 3AL2A 3OBIA 1RACA 4ZODA 2A0UA 3DXYA 5JCPA 1BO6A 3ZXXA 3B1VA 3CGWA 3WE7A 4BE9A 1T34A 4OKNA 3CRRA 3W7VA 2W6OA 4XUDA 4ZRMA 4EG0A 4M8NE 2R5FA 3LT1A 3A2LA 3TEMA 4AKTA 1LW6E 2CMDA 1S89A 2R8EA 3M6LA 5F12A 4C3UA 4DAOA 2FX5A 1QO9A 3RIXA 2EFYA 5I48A 3VKHA 2PWYA 2VTVA 1D7OA 5EXEA 3UOAB 2GPAA 3CQ9A 2IP4A 1N57A 3H05A 3HBJA 4LDJA 3KQSA 3S6JA 5KU7A 3MS2A 1E0DA 4IO0A 4XYEA 4M8LA 3ABZA 5AW1A 1U2EA 4K2AA 1IEVA 1R6XA 5FI0B 4KE7A 2FFQA 4RZ2A 3RYIA 3MTAA 2JLXA 1MZPA 2QVCA 4LHXA 3C3XA 4M76B 3MMZA 4C6TA 2WT8A 3BE4A 2ZUBA 3IAEA 5AJWA 5FT9A 4CIVA 3SFVA 3ROXA 3TQHA 3OT5A 3H83A 2E3JA 3AT1A 3LF1A 1ADFA 2X9QA 4CDMA 2Z3WA 4DLXA 1EWQA 3FNEA 1DC5A 2Z43A 1T24A 3KYIB 4I1IA 1PS8A 4YCCA 1OH8A 1RXVA 3HPRA 3PFCA 2H8GA 1IZZA 2GLTA 3B5JA 1YZUA 3AEUB 3CPHA 1DQNA 1N1DA 3Q15C 4WBNA 3U44B 4V0KA 4ZT2A 5FNVA 2ZW9A 4E11A 3HKCA 1YH3A 2MU1A 4KWCA 1GPDG 3X1YA 3H9JA 3ZWVA 1N5LA 1ZGHA 2P7HA 4L27A 2L69A 4YRQA 4DEVA 5HIKA 1EFKA 1ZAYA 1D2MA 2BKUA 5DVZA 3LQFA 2QUZA 1AE1A 3AH8A 4W9RA 1JDBC 4CMIA 2G0TA 5LMCA 1BJTA 4PZPA 2WV9A 1W1WA 3L07A 1NU6A 3QMPA 3SC4A 4QBKA 2Z1DA 3L8DA 1QFSA 2H54A 4V3BA 2GPYA 1YJCA 4K9QA 5DWDA 3PT5A 2V4ZA 4DIBA 1BN6A 2KWIA 5FTMA 2ZROA 2FSFA 4N48A 3KJEA 2AN9A 1H0KA 3QIVA 3WTBA 3GUHA 4IIGA 1GYQA 3CF2A 3M6IA 3MTEA 4FN4A 4DQKA 1N2EA 1Y8QA 5JNLA 3PQ7A 1U5BA 1PEDA 3T5BA 5J9FA 1VG1A 1J0CA 3PQ2A 2OBBA 2PT9A 4CLOA 3T1YB 3FSGD 1XL0A 5EOVA 2F4VB 3DV9A 5HBRA 2FH5B 2V97A 4RQTA 4F2DA 3UM9A 3C70A 3NHBA 1CJMA 1Y1SA 3FMVA 1LJ8A 5C4MA 5EWMA 1Q1QA 2C3OA 3KAQA 3PQ6A 3BXOA 3AX6A 4DV4B 2GTHA 2ZM6B 3DKVA 3KYDB 3LCUA 2GESA 4M7RA 3TOZA 1PJ8A 2OG1A 1LBHA 1J23A 1ECBA 2ZG6A 2BTQA 2PKRA 3H1PA 2CW5A 3CG4A 1M34A 1RFGE 4MR8A 4B3IA 4AAYA 3CVWA 2QRPA 1BMDA 3QUBA 1N2JA 3S3TA 2Q8PA 2ZIFA 4DLVA 2NXEA 1TMOA 4MVXA 3FFWA 1JLKA 4IJMA 2LKDA 5DTIA 5EIWA 1GQQA 4TN1A 2ONJA 1VKRA 3KZCA 3BN3A 1G0NA 4HP8A 4IDOA 1MB4A 3I42A 1YJ5A 1IN4A 3FHLA 4LC9A 2HZBA 4FZRA 5KYVA 4C1NA 1OYVA 4D3FA 1QONA 5E4TA 4E2FA 3KLNA 4FBLA 4JBLA 4QU5A 3TGLA 1Y6ZA 2CNKA 3FNHA 3E9YA 4YAUA 2XB8A 4I1OA 4MWOA 3KCQA 4J1TA 1ZSYA 5H3CA 5CXXA 3QYAA 3R3HA 3Q1LA 4HNQA 1Z5PA 2X8WA 4EA8A 4MQBA 4K9KA 3U7HB 1NYQA 4H35A 4ML3A 5T4EA 2AOVA 3D4OA 3ROTA 5EP4A 4CDRA 4WGGA 4XEHA 2WUFA 3IMEA 4HX9A 4N01A 5ALUA 4X94A 3C8UA 3PXUA 3K0AA 3K6JA 5THKA 3ZBPA 4GW3A 4YMSA 3WGMA 2NT4A 1GPBA 3OEHA 1YS9A 2H4YA 2WJPA 1EDZA 3PPVA 3WL4A 5KB3A 1OOEA 2VP0A 3RQIA 4EB8A 3BXEA 1LVUA 1SKAA 1EU1A 2XCLA 3HN2A 3SHOA 4LSZA 4C0LA 1Y0BA 1VPVA 3O4IA 3QPBA 4IDAA 5AWFC 3ZKWB 1LPBB 4X61A 1ZI8A 1ZBDA 3AR6A 5ALHA 1LQTA 5CD9A 1FFXA 4GZ3A 2IBTA 4IO1A 5K0SA 2QG4A 2GPTA 2KI5A 2XYPA 3L8YA 2NOAA 2ZYUX 4LK2A 4TTTS 3KEOA 4TYMA 3EVBA 1RR6A 4Z9FA 4GM4A 3NHJA 4D8WA 1QSGA 1F2TB 1I1NA 1NT4A 1T3LA 4P5EA 4UM7A 4OI0A 3HUDA 4C78A 4UE2A 5EESA 2AYZA 4LY0A 1XZCA 3OH8A 1P0PA 3KLPX 3RLIA 4BFWA 1WU8A 3UCFA 3KU1A 1Q2UA 2JA1A 2OM2A 1S8FA 2D7CA 3DDOA 3FZEA 1DKNA 2FW9A 2YJ5A 3KQPA 2F00A 4YXFA 4M37A 5A3JA 3TEJA 5KDOA 3KFLA 4RY9A 3TD9A 3SF0A 5AK3A 2IP2A 1UFQA 2Q7DA 3HUFA 3TW0A 3ZCPA 4BMOB 1YDFA 4CMHA 3L4JA 4F9EA 2ZR8A 3MCTA 2WU1A 4PEVA 1CQIB 3OE4A 1M76A 3MGAA 4I19A 4CG3A 2BZ1A 3O8DA 3T1HB 2WU3A 4CYMA 2PSHA 2A59A 3B36A 5KYTA 3PQEA 1DP4A 1FYDA 1OA1A 2WABA 3SPXA 1T2AA 2QYOA 5JS2A 3SICE 2H4HA 2H4ZA 1R9JA 3KV1A 2W2MA 3QXGA 2QE7A 4FR0A 4EA7A 3JQEA 3GP5A 3HDVA 3OZIA 4ZI5A 3MQ4A 5T6MA 5C1DA 1ZL2A 4H6PA 3TLGB 4EB6B 2Z5LA 1KSJA 2F8MA 4L85A 3UV6A 2H1CA 2NUPA 4YECA 5ICCA 2XV1A 3A6HA 1ZH4A 2QY9A 2VDQB 3JARB 5JAMA 3GP3A 1IN1A 5GJBA 1IHUA 3GI1A 4LJSA 4NENB 4D4GA 5JECA 3FPKA 1E2BA 5MDHA 4S04A 2OO3A 1GIAA 2W2TA 1YRWA 1EXWA 2CLEB 3WLJA 2J32A 2QP3A 5K8CA 4WOPA 4Y0NA 1SUDA 1IOWA 3O9MA 4GYKA 4F5WA 4OBWA 1R5BA 3GX1A 2ZYTX 1YTUA 1AGRA 1TI7A 3HWWA 5AW9A 3ZXUB 3AF0A 3C98A 3E3LA 3GD7A 2K7FA 3LY9A 1ZJWA 4JCOA 4EI8A 2WWWA 2K6GA 3WLIA 1HE4A 2HYIC 2CHFA 2Z98A 5I5GA 2Z8XA 3MAAC 4N5MA 3SJCA 3SJUA 3T4UA 3DTTA 3NP7A 3QOYA 4I08A 4EA9A 1OR8A 4XEUA 3VPDA 4HNVA 1RKBA 5K3DA 2Q3BA 3INTA 1DLIA 4YP5A 3VSDA 1KIMA 3HCFA 4CCSA 2GS9A 4AO8A 2L2QA 1RXSA 4BUJA 5LOVB 2P0YA 2Q0HA 1KBQA 4RD2A 2DBZA 4A0QA 1WQ3A 4MB2A 2OBYA 4J75A 2QRQA 1CY8A 3WC4A 3X1DA 1PG2A 1UOOA 2QV7A 3NHUA 4MQ6A 4DUGA 2EQBA 1M6VB 2PG3A 3VX3A 4DYDA 3PUYA 3EUAA 5A4AA 3B9QA 4FFRA 1T2FA 5AVZA 4URZR 3ETEA 1U1GA 5GTDA 3BXXA 4OU4A 1Z63A 1NF8A 3PWKA 4ZKDA 2OCYC 4H7EA 1S3SA 4QBHA 2JCBA 2Y68A 1JSRA 3EB9A 5DYIA 3F9IA 4IJKA 3ROGA 1UWVA 4MUYA 4RTJA 2W2KA 4B7CA 1HX7A 1DJPA 2PZMA 1CXZA 1YRYE 1I9GA 3BXZA 3D7KA 5FBVB 5J4HA 2XTZA 3L7NA 4OXKA 1C8KA 4IOLA 4NJMA 3DTVA 4RM3A 3N3BC 3LZ6A 1VYTA 1N92A 1RVV1 3PZRA 4DIFA 5IT5A 5B4TA 2F3QA 3HNOA 2ORVA 5A4MS 3K6SA 2OLKA 2AWOA 2ZE8A 1C7JA 1M2OB 3KAPA 1PD0A 5DGIA 1GV0A 5JC8A 1XYVA 3EN0A 3K0SA 2ZYAA 1TM2A 1YT5A 3UFBA 4BV8A 3LY5A 1YD7A 3KYCB 4JB0A 1U4OA 3ED5A 4KJZA 4L0CA 1X7YA 1SRQA 3ANTA 4EBBA 3HSKA 3SC3A 3GZJA 5DTRA 1H2AS 1BZYA 4K6FA 5DM2A 4PHTA 5FIUA 2FKAA 1F9AA 4R2JA 3WAJA 3O1LA 2E7ZA 3RSFA 2N1BA 3VM6A 1E2KA 3ONNA 4O1HA 1YZYA 1WABA 4HDKA 4EZEA 2Y0BA 2QE7D 1WQ1R 1XZ8A 3KIPA 5BWLA 1M75A 3GLTA 3MWEB 4L08A 3BXHA 5JFOA 5LMNB 3T3NA 5JPCA 2FZKA 4V2UA 4HWSA 1KK3A 5JG7A 1M7HA 4D7AA 1M1XB 1WXXA 2I91A 3PA8A 4CMEC 1R5NA 3RG8A 1K0UA 1KEUA 2CXOA 3K1AA 1IPEA 3L84A 3F96A 1YQTA 3CZMA 4V24A 5ER6A 1BRTA 4WK4B 4AMZA 2WWYA 4CODB 5A5DA 3KSRA 2B1RA 3M9WA 4NBWA 2CB9A 1QQAA 1F17A 2Q41A 1RMYA 2WWTA 3NOQA 4UUOA 1YR6A 4TRRA 1JR3E 2PN1A 3M6WA 3WRWA 3Q6NA 1TD9A 1H2YA 1FTGA 1W25A 4C6SA 3E1GA 5IWCA 3GGDA 1NXXA 1DHRA 2XUZA 3A26A 3LMKA 4DQ0A 2OYSA 2C58A 4CQMB 4RFVA 1T1GA 1TAHA 4HLUA 4UCFA 1QAOA 4W63A 3ZHOA 3H11A 4BUZA 5KSWB 1NBAA 3IR7A 4BYMA 4QEZA 4J90A 5KVSA 3WYNA 4DV1B 2ERCA 2H1VA 5J2TF 1Q77A 3U9LA 3P26A 4ND6A 3WISA 5ERGB 4BEJA 3ISJA 2FUNB 4US0R 1NRJB 1G8HA 1RAIA 4Q9NA 1XTQA 4FXOA 3OTHA 3PFBA 4KL8S 1R8QA 4TTQA 3ZX5A 4NCAA 2RHHA 4YBRA 2KE5A 1J8DA 2I67A 2IHYA 4X60A 1FQJA 2P9BA 2UZ4A 5C7YA 1FC0A 4ZGBA 1NJ1A 4FDVA 3ZE0B 6REQA 4R7TA 2BPOA 4LRUA 3DLIA 4MLCA 4DUGD 3UT5A 4FQ5A 1RTKA 4ZEMA 2YQ5A 1EX6A 2J07A 4RTQA 3OIFA 4X1OA 2NZXA 4ZYXA 3DE6X 3W4KA 3UAWA 1Y1PA 3RJTA 3VO1A 1NMEA 4NF2A 4BX3A 4PGGA 4D0NA 1ZZGA 2YXEA 3BJEA 1QJCA 3GPDG 1SG9A 5F1KA 4TV8B 1X87A 1HDXA 4S0ZA 3T35A 2C7QA 4KFCA 2NNWB 4BZWA 4EY8A 3FTFA 1W581 5AVKA 2HK7A 2OCBA 3ROZA 3CNOA 2J85A 3OP4A 3T7IA 3K3PA 2ISSD 3S68A 4DWJA 2VHZA 3RBXA 4B3BA 1RPAA 2I1LA 3IEMA 3PJEA 1CUGA 1M33A 1RWMA 3ENKA 2EWMA 3AMVA 3VSBA 2NVUA 3X1MA 5GV8A 2JHFA 4K9MA 4CIDA 1W47A 4QGFA 4G8BA 3LT0A 1LFAA 5K0FA 3FIJA 5KNCH 4V0RA 3X1ZA 4BEWA 2AH5A 1E2JA 1CY4A 1QX4A 1TQDA 1UXJA 1WPQA 2QGZA 2XWJI 4Q9DA 4XR9A 5FV7A 3RVNA 3TRDA 3ZJUA 4JI0B 5LVAA 1Z36A 5GAJA 3UV7A 5LQKA 2X5XA 4FS8A 2IH4A 4DMRA 1EWRA 2QT1A 2XRFA 3I2JA 1ZIPA 3HKEB 5DM4A 1NQAO 2GHRA 3L8HA 4ID3A 4PZ9A 4YCDA 3QPCA 3QBVA 1FUEA 3E03A 3GAMA 3D2CA 4B46A 3P52A 3S5JA 1ZYUA 2EL9A 1S2NA 3TS1A 5DEIA 3MJSA 3MTIA 1V41E 1P2SA 1HG1A 5JV5A 2W2OA 1R16A 1AKNA 1XWIA 1XZBA 3FGNA 4OSEA 5EJ2A 2Q9BA 4OMUA 4N03A 4U3JA 5L7YA 2HX1A 1MU0A 5CNKA 1LC3A 4QICA 2NGRA 4OIFA 3RUFA 4B6RA 1AOXA 1KDPA 4PLFA 2ZS7A 2FR8A 3AR2A 3ZZ1A 1MP0A 4I46A 5E1DA 3WGOA 4JXZA 1XWFA 2PKXA 2H2DA 5J63A 2FMXA 1CQJB 2UYGA 1VYUA 2XITA 3KUUA 2ZPTX 1UEJA 4FDAA 4MV6A 3VR3A 3O8OB 4BO3A 3B6KA 1KYXA 2WUVA 2EXXA 3JZMA 1RXCA 2FSSA 2C2WA 3V32A 4YV2A 2JGDB 3AILA 4TVSA 2WUDA 1JTFA 2VJPA 4UNQA 2O2IA 3AHEA 4PYMA 3DD5A 4URVR 2FB9A 3JWIA 4JLDA 4M1ZA 1R27A 1KFBB 2BMVA 3E5RA 4IX9A 5ER9A 5GM1A 1XRQA 2OK7A 5JU6A 1SQ5A 2AC4A 1JLRA 1QFYA 2I4LA 2JGEA 2L19A 5TPZA 4C4XA 5CFLA 5JARA 5CCXA 1TF5A 2EAUA 3RK1A 1NW4A 4I8DA 4JOQA 4DY4A 1U7ZA 1NFRA 3GBSA 2RGAA 4O8CA 4UQOA 1UBLS 2ZQZA 4BO0A 2DT8A 2J4DA 4MV5A 1I3NA 5KNDH 3QELB 1QHHA 4TUYB 5CDUA 4MPDA 5NULA 5LZ5A 1T15A 3B1ZA 3TE7A 5J23A 1FFWA 1CV2A 4RFLA 2Z6UA 5IJ0A 5KC8A 2F43A 4R2LA 5L3QA 3EDMA 1E58A 3LRPA 5D00A 1KI8A 2FOLA 1UMBA 7AT1A 2R7LA 3B1WA 3K5HA 1C7IA 5IN5A 4DA6A 1W36C 1Z4QA 5CDTA 1KDRA 3GLQA 3OCZA 4XSGA 2PKEA 4EEZA 3JWPA 5JJKA 4JA2A 4CWAA 1V43A 1CVLA 3LPCA 1XMJA 4OHYA 3W2GA 1TJNA 2VQFB 1ESZA 1L4UA 1SUIA 1WDTA 2GK7A 1C30B 3JTEA 4BGVA 2RAPA 1TEZA 3NGMA 4NK5A 1DKRA 5CHEA 2WICA 2EP7A 4ZOQI 1ULHA 3R7BA 4G0WA 5KYNA 1PWHA 3KKEA 4FGWA 3X1XA 4HDQB 1IONA 3EJ6A 3QLTA 2E6UX 4PRZA 5KYYB 4OL0A 1B8VA 3UKDA 1E7MA 1I4OA 2XRYA 4L22A 3ULKA 1YKGA 4BIMA 1WLYA 3WLKX 3BTUA 4N5NA 2PMEA 3N75A 1XAGA 2VNIA 2GF9A 4HDSA 3HJTA 3QK7A 1MAAA 4MITA 1I5EA 3PSHA 1RMQA 2OFOA 1Z5GA 4S05A 1AIPA 1GZ5A 1QZ3A 5EMLA 2BFWA 3C3EA 3GGJA 4PC6A 5D2CA 3T0GA 5JNUA 3W04A 3ZXYA 3C45A 3RABA 3UH1A 5AKIA 1Z5WA 5DGXA 4Q1DA 3JTMA 1MD9A 2FMUA 5D3MB 3UAZA 2NU6A 4J4BA 4E08A 3DV2A 2D0DA 2GCEA 3MIIA 3OF5A 1AZLA 5LQRA 4DUZB 5LZ4A 2G9ZA 1PFUA 4S1TA 4D45A 4JUCA 4OHWA 1SUWA 2H08A 3S2EA 4U1RA 4MHSA 4KV9A 3RAEC 1JBKA 5FJIA 5ADHA 5DISB 4YREA 4OLBA 4C4SA 1HLDA 5L9AA 2PCJA 3S28A 3BILA 3R77A 4G1BA 2Z4RA 1RLUA 2A1TS 2C8JA 3LCVB 4I6JA 2VL7A 3EQ9A 3MERA 1KS2A 2DUUA 4RJIA 5C3UA 4PX5A 3LVBA 1SCUA 1TKAA 2VSXA 8ABPA 3H5NA 3SYTA 2OHJA 3ZHTA 2VH2A 2UUCB 1M2FA 4L74A 4IDCA 2BD0A 4D4IA 2AA3A 3KQWA 2PT7A 1Q1ZA 1FEZA 1PD1A 5DU2A 2X4LA 3PUJA 3PVCA 4TQAA 3UPTA 2ZDHA 4RPKA 2G1UA 2GEFA 3L7LA 4PINA 4R5MA 1SBYA 4WNYA 121PA 5BP7A 3C2QA 5ILGA 2HPHA 1K5DA 1VL2A 5TPZD 2C29D 4JYPA 3ZY2A 4A16A 4E5VA 1PEKE 2QJWA 2X8AA 3CO0S 3KO8A 4N3CA 3HP4A 5TXGA 3UXYA 4IF6A 3HUTA 3W7BA 1W85B 4GP7A 3E9ZA 4G0NA 3GFPA 3HO8A 3PEUA 3LBAA 1OAOC 3KOYA 1P5JA 3GG2A 4GOOD 4YJGA 2EYQA 1MENA 1JG6A 3FMOB 4F7DA 4ZMBA 3ZUPA 1J70A 1WSDA 3SNKA 3U4CA 4BVAA 3A2NA 1P4GA 4QUBA 2W4QA 2W83A 4CNBA 1HR0B 2H1OA 3KUCA 4E5NA 2C4NA 2O7NA 4R9UC 4HPWA 3FBTA 1C14A 2P0EA 2QTAA 3CE9A 2XVAA 4I99A 5KYUA 4PG8A 5JYDA 3VKUA 2OZKA 3OFKA 5E7QA 3QMVA 3NGXA 3RROA 2YVQA 2FK7A 3HXTA 3HB9A 5IJ9A 4J0GA 1U4SA 5IC5A 3C1AA 4P5PA 1NSTA 1OIWA 4KR0A 1QVWA 2VHWA 4GLJA 4UM5A 4BNVA 3OZXA 4CLEA 2VAXA 3VU3A 2VF7A 1I6KA 3EE6A 1SUFA 4N6GA 4PCAA 3IC5A 5EEGA 3W5AA 2Q3DA 3UMGA 2FSUA 1F14A 1I4TD 4IZOA 1JB1A 4HO1X 4RKFA 2W9XA 3OKAA 4G65A 1YMQA 3HG7A 4ED9A 1C1DA 1YASA 1Y3AA 4RYLA 2VLIA 3CRW1 3O93A 1PGOA 1I2BA 4PVCA 4BGUA 5F7XA 1M2WA 1P45A 2NPIA 2X5KO 1H3NA 1UBHS 3RYCB 5T67A 3RTCA 1E6UA 1JRLA 2BELA 2L42A 1I4WA 3LQYA 2EBHX 1L7NA 1UP6A 3BSSA 3CEJA 4NZNA 1CDZA 5DNUA 1WVGA 4YRLA 3I04M 3V46A 3I64A 4XUEA 5EUQB 4BLVA 4H7DA 4GDFA 4DV0B 2JHCA 3X1WA 2GNPA 3TSCA 2FQWA 4Q4AA 3PUVA 2PQ0A 4DSNA 1ODSA 4QPCA 4AROA 3FPAA 3OSUA 1BVRA 4EFKA 2ATCA 2C92A 3HKBA 2EJWA 2Z6VA 4ZWNA 5FDFA 5HGXA 2XZOA 3THXB 2EF0A 3ZG6A 3KSZO 1EFAA 1QH1A 2ZBFA 1W87A 3GEBA 2QQEA 5ALRA 4KQFA 1ZNWA 1IMOA 4FFDA 2YFHA 3ILYA 1PT7A 3CINA 1RM5A 2AI2A 3MTGA 3NFYA 3P94A 1YVUA 4MQMA 2CDCA 3DPIA 2E6KA 5BN3A 4BX2A 1P0CA 3QWAA 3RAGA 3NYWA 4N18A 5LIRA 1PR6A 2FGJA 5EN4A 4E1AA 1XD8A 1U28C 4NL4H 3RBZA 3B8EA 3RYHA 5F2EA 5AKKA 1XQVA 5DCWA 3H2BA 3O1JC 1BDIA 2HADA 3BK7A 3KRTA 4LTMA 5AKJA 2IEGA 5SZJA 3QI2A 4BQOA 5K3OA 1AO3A 2B0CA 1W5AA 1SC6A 4LN1A 4PBTA 4BKQA 4CN9A 4KN5A 3IELA 1M8FA 4BLQA 4CT4B 5FQNA 1VBFA 3RAPR 4C0XA 1IN5A 1KKMA 1QFZA 1BQEA 2MT9A 3LUKA 5JXWA 3H8JA 3OHPA 5EE5B 5T6BA 4J3FA 4ZGWA 3O26A 1UXGA 5T4FA 1ZUNA 1CFJA 3NBKA 1AU9A 4XX1A 1NVVR 1MEOA 4AZ0B 4LJ5A 4HFRA 1N34B 1ZNYA 4M0CA 3W4JA 3CVUA 4P81A 4IDFA 3NR2A 1VBMA 4B0OA 3S29A 2C2YA 2O2HA 1H4TA 3OJLA 4Q01A 1C9KA 2WY2D 2I0FA 4JC0A 1FMLA 4GBGA 5IUJC 2YXLA 4HTFA 3ZKAA 2ASEA 3G2MA 3GA0A 3NM5A 4ZOAA 4ZEOA 3QXCA 1KAGA 4AQDA 1JNYA 1AQJA 1KRWA 3WXMA 4FGLA 4HRYA 2VJBA 4LISA 3SSNA 3IKTA 5JDIA 4KH1A 4TKVA 2H2WA 3HJRA 5AOBA 1YCDA 1I6WA 1ZNZA 2WHQA 3DMTA 5K8TA 1A82A 4OU5A 4IJWA 2G7ZA 1P29A 4S1WA 2DETA 1KZ4A 5BSUA 1O6FA 3DV0B 1CDDA 4LHVA 2GJ4A 3AUTA 4CU5A 5JEDA 2EEZA 3SE7A 3BMOA 3OA0A 1K7YA 3KKKA 3X2SA 4BLTA 1Q7RA 5E0OA 4EDFA 1XXLA 2PH1A 2G9QA 5IKPA 4JDUA 2PXAA 1PS0A 5CHYA 3W34A 1DBWA 2NTVA 5LPNA 3OQPA 3C87A 5LMUB 3R6WA 5EKUA 3EQZA 2GM9A 2YX1A 5AR1A 1FZQA 3R40A 3FHJA 2AKYA 2XDYA 5CYGA 2I5PO 1ZVQA 2WE8A 1W34A 2ZRFA 5HRAA 5TR9A 3E22A 3WNVA 3Q8LA 1DXHA 4O2LA 4QSMA 5BSVA 3DMYA 4QODA 4F5EA 2CJFA 4LOAA 5H68A 4JELA 3ZIAD 1EGMB 5KPJA 3KKZA 4HH3C 3LYHA 1EBUA 1EAMA 3OMLA 4WPGA 5BWOA 1Z5ZA 3SBOA 4JB3A 3WLPA 4OHZA 2ZR0A 4WRRA 1EUQA 2JB9A 4MR7A 1JGTA 1C50A 3CRNA 4AB1A 5DOZA 3N0TA 1GKLA 2H0AA 3QE4A 3RYIB 4G1VA 4HAYA 4E4YA 1IXZA 3K4QA 2G9RA 1QKIA 3OOSA 3DO5A 2GM3A 1CUYA 1ECLA 2ZYRA 3LRXA 2HWUA 4MOWA 5FADA 2QL9A 3VOSA 1HMYA 1Q0UA 4UARA 1AKWA 1NYTA 1SGWA 5CIWA 4C0KA 5F78A 5C7LO 2QPOA 3KJIA 4LJRA 3ETNA 4GSYA 4Z0PA 3QEKA 4D2IA 5LQUA 1CTQA 2VK1A 5AJUA 1KPIA 3ECAA 4S1OA 3COVA 1HT3A 2X6QA 3N70A 4EJSC 4BDTA 3LNTA 4P3KA 5E6SA 4WBNB 5FNVB 3O4RA 4OYYA 3HKCB 4YALA 1NUTA 2OGWA 1I7QB 4LQDA 2V58A 3RV3A 5FOXA 4L6CA 1E3DA 1TK3A 2P8SA 1PJTA 1QKKA 3FCXA 4R69A 4RX1A 1D9XA 4B79A 3HVIA 1OWPA 1R12A 3TDMA 1RAHA 2BFNA 4BEVA 1CQXA 2K5UA 4YDRA 1X9GA 3B60A 2W58A 5AI9A 1W7AA 3K9QO 4M7PA 2PKYX 2XJ4A 1Z4JA 4TS4A 4X44A 4BN5A 1AV7A 2PYZA 4KJXA 4IDDA 5TT1A 2RBGA 4CMIB 4X65B 1E2IA 1IUPA 1T1JA 5CDYA 3KJQA 1VSBA 3OTOB 2XMCA 3JR7A 1OYOA 4WDRA 2ZI6A 4HDAA 1KXZA 4FC6A 4MRPA 4QM7A 1JWBB 1Z2AA 1MG5A 3LU1A 4EJ0A 3RRBA 1TL7C 2BR5A 1N3BA 1Y8QB 2IY9A 4Q00A 1U5BB 1EPUA 4XGQA 1FDUA 1LPPA 4Z9YA 4DMLA 1QO0D 3RRXA 4CLOB 4XFKA 4OGFA 3CG0A 4LW8A 1LLUA 1MXFA 1M5UA 1KK0A 3GRYA 3Q10A 3ZUGA 2QN2A 3MLEA 1YCGA 3FUCA 2C7OA 2PT5A 3HPQA 3I01A 3LRTA 4PV7A 4R84A 2WKQA 4BCDA 1IWOA 3MJHA 1A4XA 3VJLA 2BTQB 4KWTA 1F2VA 3I9LA 4MB0A 1M34B 3VO9A 2Y67A 3BAZA 5AHXA 4NTZA 5AW7A 1EWYA 1OWMA 1E7RA 3IHKA 3DLBA 4YNBA 1HLGA 5A05A 1ML4A 5JBNA 2PUTA 3ZGNA 1H4QA 3CB4A 4Z1MD 4P4UA 1NV9A 2C42A 1Z3CA 1UM9A 1PL7A 2WR8A 1EDBA 5ALFA 3EHDA 1CY1A 1ADBA 2ONKA 3IV7A 5KOJA 2C7BA 4OXXA 4YV7A 2ZOSA 3ABRB 2AXEA 3FCCA 3UKJA 1FJXA 5JZMA 1KEPA 4N65A 3GVCA 3AIOA 3ZHVA 2E89A 4ZHQA 4PCVA 4EENA 3L04A 2D8MA 4JI6B 3IRVA 2WYUA 2J1LA 1VRCA 4AY5A 4EKIA 3F4LA 3SNHA 2AVDA 3SAJA 1UFRA 1XTZA 3ACBA 4MYTA 4O4HF 3H4MA 3H84A 3U3OA 4G97A 3K1JA 2MSKA 4I9GA 4MX8A 2V03A 3DOEA 3H4TA 3T1NA 3RTAA 1APBA 4DA4A 3WK4A 1VFPA 3K0AB 3OQBA 4LDZA 3T34A 3EYAA 2QG9A 3C5EA 2ZFUA 3E3AA 2DH6A 2W37A 4NE7A 3HI6A 1ZBQA 1V0JA 3W90A 1YIAA 4ITVA 1ZD2P 2C9ZA 4LSWA 1CRWG 1NZDA 3ND6A 4GGMX 3QXXA 1QRRA 5EJAA 3CS3A 3B5EA 3G0IA 5DNAA 2XOXA 2QUHA 5AM3A 5HKKD 5JRDS 4MMXB 1N2IA 1SBNE 2RHBA 4Z4FA 2PLRA 2YFYA 3IBYA 1JKJA 2QJFA 3I2HA 1FFXB 1T6NA 1V8DA 2OQ2A 4MKGA 3AY7A 4RIGA 3SEZA 3JSAA 3PXAA 1NNSA 2PUBA 4B81A 1B14A 1G2OA 2VSQA 1W5SA 4WIAA 3W5DA 3GLRA 1G2PA 3HGQA 1P7ZA 1Q14A 2YZ7A 5H9VA 5K03A 1E1DA 3L7KA 5CAEA 2PJDA 4NZMA 5LU8A 4X64B 2ZUUA 2J5QA 3EQ6A 4AP5A 2Q4BA 1XV5A 4KV7A 4PPQA 3QVMA 4X97A 5EIHA 1P7PA 3IAM6 3N74A 1N32B 1A9XB 2JGIA 2XNSA 1JG3A 3NGLA 5EUBA 4EW1A 4FJ1A 2B1IA 2UUAB 4B3RB 1M34E 4I2VA 3VJRA 3QU2A 2QM0A 1Y7PA 2JCXA 2MYUA 1N0VC 2H85A 1Q0LA 5F3RA 4JODA 4E7OA 3MFQA 1EFRA 1KDTA 1PN3A 4JNCA 4D74A 3MAJA 3VGJA 4UM9D 3QWIA 5TJHA 1CUVA 4RD4A 3ZZ0A 1AHNA 2C8KA 3G2HA 3KQUA 3PJFA 13PKA 4JIMA 3CCBA 4LXXA 5ALDA 3QU4A 5CB0A 1IZ0A 4S24A 5EVJA 3MTQA 4RPHA 2NYVA 2Z4TA 3OCYA 1VIMA 1M10A 1QFMA 1V16A 4JFRA 4N5IX 3AOGA 5JWHA 1RPZA 4TTAA 1QG2A 3BMQB 4FYYA 2VXBA 4ZAZA 1NAIA 2O8VA 1OT3A 2NUPB 2QL6A 5H16A 2R4UA 2AQIA 4HEA1 4NXMB 4JVMA 2QRKA 3MZ0A 4PLTA 3U4AA 3HB7A 1XDGA 3RANA 4UAVA 5HZHA 4HH1A 4Y2YA 3INYA 1UDXA 3OZEA 2O6HA 3M1AA 5A0VA 2BKVA 4R2WA 3U3XA 4O2AA 3RU3A 1BAPA 1XK7A 1PKXA 2CYBA 2XUGA 2F1IA 5JQWA 4OHKA 3M3PA 4C0AC 3JAKA 2H1HA 3RS4A 1XU9A 1Q7BA 1R6BX 3LHSA 4MKFA 3IKMB 4W8OA 2JJYA 3MW8A 1C0KA 1ECGA 2WW8A 5CFPA 1RHUA 1Z22A 2XDWA 2WT9A 4J0FA 1YDGA 3EWAA 1P0QA 3IUMA 5K9ZA 4MNTA 4I3FA 1E1YA 2AEEA 1B2RA 3BWDD 4TQGA 5DM1A 2VUUA 1HUQA 3DUFB 3ND8A 4ACAA 2L18A 3ZLVA 4L6IA 5EZ5A 2O06A 2RONA 3WICA 3WLTA 3ZVRA 2G4LA 1KEEA 3T7KA 3F7TA 1QFJA 3U62A 3I37X 3NHAA 5ED4A 1V6SA 2QN6A 4ER7A 4C2TA 3CRQA 3K16A 3C0KA 3W9BA 4JEIA 1QTQA 1L7BA 1JR2A 3HJBA 4M0KA 3WDLA 2WIJA 3TLXA 3QPDA 4UE3S 2OBMA 3I6BA 5IKOA 1PJRA 4B7XA 2VWHA 4Y2RA 2ZZNA 5JW6A 2VYFA 1XVLA 3JQ6A 1DQYA 3BIWA 4PIPA 4FC7A 2XEXA 2FW8A 1UK8A 2Y1OA 2I1QA 2EF1A 1EFCA 4MULA 3BS4A 3I8SA 3S2SA 4D5EA 4EVRA 5CFOA 2W2KB 4IG4A 1QUFA 1PT8A 1QCZA 2M32A 2WDPA 3DL7A 4MVJM 3AR3A 3Q9LA 4UTXA 5LYJB 4Z3OA 4DR1B 4NJMB 3DTVB 1BD4A 1R4AA 1W19A 4N4AA 4WOBA 2ZBDA 2V7PA 2VZ9A 3EWSA 1I3KA 3TUZC 1KEZA 2XUAA 5B57C 2WMNB 3TZQA 2AZXA 3U2QA 5I9LA 3NMUF 2QJRA 1LDMA 1M9NA 2GN2A 4F85A 1CZHA 2BYTA 1KL7A 2JLYA 4JYAB 3AIMA 4AI6A 2HA5A 2DWPA 1ZU5A 1X7YB 4L8WB 1Y82A 1HNXB 3WGVA 2NUTA 1EFRD 1U2GA 2DP4E 1XZDA 3OC0A 1G8PA 3V7YA 2YL2A 3S70A 2B4QA 2JGNA 3CEAA 2G3YA 4DIMA 2AUNA 5ANRB 4KRFA 1B4DA 1MB3A 4F5YA 1Q1NA 4JB8A 4HBZA 4HDKB 4GRIA 4IIEA 3STUA 1NZFA 1P81A 3Q7QA 3S7ZA 2E87A 2YKGA 1PFVA 2B8JA 4JJEA 1UK6A 1C3JA 1U2SA 4UMFA 1IUNA 2GHIA 2RDMA 2YN2A 1PG0A 4GX5A 4NECA 3UENA 5JCOC 4KTTE 5IUKC 3ZWCA 1F8FA 3CH7A 1DKOA 3HBNA 3C41J 5FWDA 5B3JC 1UEXC 2B25A 2EHJA 4Q7EA 4BQPA 1NI5A 5JRZA 2I9KA 2G9UA 1OV6A 1KIAA 3P5BA 3KWLA 1O97C 4ILKA 2A0XA 5BV7A 4AS3A 4ZOLF 3BDVA 3K1AB 5I7OA 5GQSA 4F2PA 1D4FA 3OTWA 4YGXB 4EHNA 1JAZA 4BMNA 1ZUWA 2ZJ4A 3TJMA 1TIBA 2FWIA 3P96A 4IUYA 2G9VA 4AY2A 2VNAA 1T9BA 1TLLA 4PLYA 1M7BA 4TT3A 4ICIA 5CLHA 3WGQA 1OPRA 1GL6A 3TMAA 2VPIA 3ZHXA 5JAQA 1Y1TA 4WBSA 3ND5A 4D3SA 4O1IA 3OPYI 2D2EA 1Z5UA 1XQWA 2IYRA 4Q3NA 2I1VB 2WSBA 3DEFA 4YT8A 1NVGA 3H11B 4BO4A 1U1CA 1U7DA 4QELA 3ETDA 4L3WA 1L3BA 1QF7A 3DS8A 4JBHA 1VXOA 1TT7A 2VPPA 3HN6A 2EW2A 4QT0A 3B78A 3WLFA 3HK2A 1D0SA 1XRPA 1E32A 1JXQA 2HC9A 4FCWA 2WMOB 2XMBA 3PNQA 3QPAA 4L5AA 3UHJA 4ZZ3A 1J7JA 1W6UA 1D2CA 1SXJA 4XTRA 1RKVA 4C0BA 2IPAB 2DBYA 4EY5A 2QN7A 1WZIA 1H2ZA 3EVTA 4XLLA 1V5WA 2Q45A 2QD1A 1MGPA 2PX0A 1H2EA 4I4CA 1DEKA 4YUVA 1E1KA 2AUMA 4YMTA 4MV4A 4ZU6X 1J2UA 2MDTA 5IABA 1EG7A 2WFMA 5JY1A 2OEPA 2B8WA 4KRGA 3VO8A 3MINA 1WCXA 2N0SA 3Q98A 4TVBA 4GYWA 4IEIA 2VA9A 1KJQA 1Q92A 2EQAA 3W77A 2OESA 3NXSA 1NQWA 1GQRA 3BWBA 4IUDS 4AJKA 2FR0A 3UUWA 4C04A 3GH3A 2IF0A 4WZ6A 3RGGA 4EI7A 2C7PA 2F3RA 4WOKA 5MF6A 2ORYA 3I05A 1E2QA 1HE3A 4Y9DA 1Z56C 2P2GA 1P9LA 4JASB 4UHBA 5TY0A 3HB0A 4GDMA 1YXMA 2VAMA 4KPUA 1XKLA 5L4NA 4UBOA 2RGRA 4YHBA 3ZNOA 3L0IB 1NT2A 4KVZA 2XPCA 4W7SA 4TV9F 1SXPA 1L6IA 2RKOA 3EGXB 1FLDA 2BGLA 2CEKA 2D2VA 4JLVA 3CSSA 1F5SA 1I3OA 3EXHC 5BQ5A 1EVQA 2P2ZA 2ZI9A 3H65A 3QUTA 3TNDA 1H93A 1F4PA 4QRDA 1FJ2A 3NAZA 4FYJA 2PUJA 4IZHA 4YCBA 1OY1A 2W2VA 3L6DA 4IVNA 4R8MA 1YWGO 1RM3A 2DPXA 3GO4A 3HH8A 3O4FA 2Z1NA 4J7AA 1ZOIA 2JVJA 3AJEA 2OHHA 3FE2A 1JR6A 3K4PA 1GNVA 2V7BA 1PWXA 4EGAA 1CUZA 4QUIA 4G86A 2DFVA 2X2EA 3WGLA 1L5MA 3GJ8A 3H8WA 3QX3A 1ABEA 1PYDA 1QQ6A 1NLYA 4FCCA 3V4ZA 3VC2A 4OQ4A 1HFEL 1KPGA 4IH9A 4C0QC 1OZGA 2O7RA 2WEKA 1NW6A 4CFZA 2DYKA 1YI0A 2PZJA 1MJNA 1NYRA 3DVLA 3LL7A 4XIYA 1CZRA 3O7MA 2EQ5A 1RXEA 1Z7EA 4N3AA 1KTIA 3DMDA 1QDUA 5H82A 4BCCA 4U3JB 3D1JA 3PDJA 2R8BA 1VLLA 3NTLA 1JJAA 4TX1A 1KSGA 2HT6A 1U0JA 4FE4A 4TT3D 4WKBA 5EC8A 1MEJA 3RFFA 2QTZA 1ZIXA 4G4JA 3VKFA 2ECKA 4F3CA 2B69A 4RAQA 3STHA 3HZHA 3C16C 1UXIA 1U65A 3JZIA 1XKXA 1LKZA 2Z30A 3NAQA 3WKCA 4HPJB 3WWDA 4ABTA 3I39X 1WUTA 3H6HA 4DQDA 3O2JA 3I9OA 3QP9A 3OPYA 2O8BA 2ADMA 2BFOA 3LX6A 4JC4A 1Y9AA 3CLRD 3FW1A 4U7GA 1OIVA 1M5TA 2NV6A 2YZNA 3L6EA 2GASA 1S9DA 1ZK0A 3ICVA 4FS3A 4ASUA 1LWNA 4X3PA 3SWWA 5FKJA 3CLTC 1LZKA 2BBSA 2GH1A 1RI5A 2IWRA 3CVVA 1G4HA 1NV8A 2HIGA 3BH6A 2WMDA 3DZCA 3RGWS 2NQ8A 4DA8A 2PV7A 2H63A 2P79A 3VR4H 1QHHB 2AC7A 1FTWA 2EV9A 2I03A 1ONSA 1T2VA 3DCIA 1CUBA 4MQEA 5DHAA 5KQMA 4PY2A 1JEAA 5G02A 5ECDA 5IJ0B 1T5BA 1Q20A 1XZJA 2F43B 4QYWA 5KZMB 2FZ5A 3WMFA 2HK8A 2XQJA 5CXSA 3LF2A 4YROA 3U7QA 4EKDA 1UMBB 2P1ZA 4CF5A 4AYTA 3OQIA 1KS9A 4BZZA 2B99A 5IJAA 1NPTO 3TZ6A 3G0OA 2O0KA 5J59A 1WPGA 1JILA 2IC5A 2IYXA 3VNRA 5I4BA 1S2OA 3DEHA 4MWGA 2BEWB 4MW9A 2YY5A 5CFQA 4O0MA 1IJKA 4RMIA 4A6XA 2Y0EA 2YHUA 3DUWA 1IG0A 2J7KA 1OW3B 4W5WA 4CTOA 3UPDA 1N36B 3QEOA 5G4KA 3V7NA 1GNTA 1VCHA 2QM7A 2CGEA 2PSDA 1MGOA 3V6LA 3FPJA 4BVKA 4MGKR 4OI2A 4RTPA 1YI8A 2ZJAA 4D3ZA 3Q3GE 4CM5A 4PCUA 1VPDA 4IICA 3WK6A 2AN1A 1DBQA 3FUXA 3NJRA 2ZSKA 5G0UA 3UJ3X 3VAZA 4D9GA 2DPLA 1QPGA 3CBGA 4HDSB 3VPXA 3PNYA 3D2AA 3DKIA 3RAJA 1QP7A 4V0NA 1T2UA 3UATA 2AT1A 4N5LA 4DT1A 4RHEA 2VI5A 3INNA 4LIPD 1KVRA 3V1TC 1BRMA 1XQ9A 4Y6LA 4F6RA 4Q9AA 5C4GB 4PSCA 1L5WA 2PZEA 4CDNA 1QGOA 3ZU6A 3Q5GA 4HWKA 2DWUA 4IQFA 1FJHA 1JU3A 3TLKA 1QO7A 3EXIA 3RC8A 2NU6B 1RLOA 4N3GA 3OLWA 1EMDA 4OREX 2AMJA 3NG1A 4KQIA 4LWQA 4RWZA 4UVGA 5DLQC 1K9SA 1M0TA 3E2MA 5IMBA 3HJNA 3K0BA 4I1UA 3R3UA 4KXWA 4D9NA 3BYZA 1X77A 5BSFA 2HR1A 2B1QA 3VPSA 4R1LA 3ZZNA 2QTLA 3IAAA 4M22A 4O8ZA 4Z1OA 5ALXA 4C7JA 3GFTA 5C5IA 3VC7A 3N5KA 4Q3DA 5B3KA 3PC7A 3LGSA 2P6RA 1SCJA 2OL4A 4O08A 5BSKA 3WL7A 2DY1A 2GCGA 3DAOA 4D56A 2GETA 2APJA 1SCUB 5LA6A 2C54A 2LR0A 4YAEA 3R9XA 4D44A 4EI2A 4IR7A 5G41A 1F0YA 1YZTA 1RQXA 3CUYA 3ZCSA 3ZWOA 2PMCA 1C41A 2H59A 4A7PA 3TK1A 1ZCFA 4XCXA 2VOEA 3Q3HA 2UUBB 3DDZX 4PFSA 4YDQA 1DEXA 1ETHA 2LBPA 4ISCA 4Q16A 5K8JB 4MWTA 3IAS6 4PYRA 4HDMA 1K6IA 2DHCA 2IZ7A 2WPDA 2GAIA 2XKBA 1ZO8A 4D4HA 4E5SA 5CG2A 3F73A 4QQRA 2HHCA 3O0DA 4R83A 3GLUA 2DU8A 2C1ZA 2JI9A 5BMVF 2JZOA 4YJGB 5JJBA 1IY1A 2O2EA 5JAUA 3GFVA 2BFBB 3ZCTA 4KR2A 1IL0A 2A4KA 3I01M 4IOKA 4BVEA 1DAEA 3TIVA 2JI6A 4MUAA 1ZCZA 1ZW6A 5KTMA 4GC5A 3WKDA 3L5OA 4IWYA 3RADC 1VE6A 1RP1A 1XQYA 4GPEA 4H1HA 4BU1A 2GK6A 3IT3A 4JP5A 3S2IA 3SYKA 3WGZA 4QPPA 4BKUA 2QMHA 5KYXA 5F64A 2Z0MA 5KYUB 5DCUA 4Y2PA 5BN5A 4ZDJA 2YN0A 3KHSA 4OAPA 5KIAA 2XI4A 1LGYA 2E4ZA 3P9IA 2YXDA 4R2KA 3OWHA 3G0GA 4J2TA 4XR4A 2WPNA 5IJ9B 5KREA 4CEIA 1V3VA 3DHYA 3T61A 3V80A 2ZBGA 4R2HA 5JNRA 5CJJA 1S1CA 4DJTA 5JXIA 1WHSB 4PZCA 3VVMA 2YNMA 3G5UA 2VJMA 5I4IA 4KBGA 5IANA 3RS2A 4NJOA 1A3CA 3QVJA 2P7IA 4W9NC 4UFOA 4B3XA 5HUHA 1C1DB 3R5XA 4DILA 3ZU3A 1ZXBA 3CZQA 4RLHA 2I6UA 1GNSA 3EXEA 5HHTA 5JMWA 2FW1A 4UREA 2WBLC 1PWEA 1GFIA 3V1UA 4XJTA 1TZCA 4M88A 5EZYF 3WKBA 1HDIA 5AIAA 1AURA 4K7JA 3IX7A 4C3VA 4YRIA 5C7OO 2V7XA 2NM0A 2GM5A 2RHTA 1O03A 1V2GA 1EWKA 4OKSA 3MB5A 2YCBA 1Q95A 3CJRA 5FPPA 3GEMA 2UYYA 1P9WA 4Q4AB 1IMJA 1Z2OX 2O0HA 2YYSA 4HQRA 2R8YA 3V2IA 3WMRA 2I3AA 1MOSA 1SBCA 1XRSB 2YS6A 4COKA 1EZ4A 2NZVG 2QX6A 2B8EA 2BEUB 4PICA 2WJ6A 1LPSA 4Q4JB 3ZS8A 5CT8A 3ERCA 4YBZA 4Z4HA 5K4AA 3KL4A 3L8FA 4QL3A 1QH1B 5TX7A 4XVRA 5FV4A 1RXWA 1IWPB 1BTOA 1SOUA 2JFHA 1USWA 3IVXA 4QC2A 1I7PA 5F33A 1G3UA 5IFKA 2E49A 3VPGA 3BEDA 1MVLA 3OJXA 3GN2A 1CWUA 2G28A 1BHQ1 3EQ2A 3W8NA 5D7BA 3U6KA 2OCLA 3RTBA 4E5PA 2G04A 2C97A 1EGAA 3TSZA 1CT9A 2ESRA 3I5MA 5BN3B 5B53A 3KR0A 2RB4A 3IMFA 2HJVA 3FROA 4GRDA 2VO1A 5TQ2A 1NVVQ 3OTIA 5ELLA 4OI1A 3RYHB 3U4MA 4IIDA 4B3HA 2H06A 2QTHA 1DCMA 3IPAA 5CURA 4MQUA 1V26A 1G3IA 5DLEA 4W5JA 2R6GA 2AYYA 5K3EA 2WD9A 4K1LA 1K68A 3W79A 3OG9A 1C2TA 1JQJC 4ZQFA 2BISA 1U6IA 3GR6A 2XNJA 3I76A 4C5CA 1G6OA 3DFFA 1E9VA 4J2HA 2V98A 1AG9A 2Q9AA 1JS1X 5F1YA 3OMXA 1SZJG 3GLHB 4N54A 1EYZA 1B7GO 2GAFA 3HABA 1TKCA 3KR2A 5H80A 1VE3A 2ODAA 5IKMA 3FPLA 3DE0X 4AUEA 1CY6A 2PMKA 1R4NB 3EIOA 4N3BA 2DTXA 1RDFA 1N3LA 3EEYA 3LDHA 3AIKA 2JLAA 4RK0A 2HA2A 1ZUD1 4Q7MB 4JQZA 1DBVO 3IUSA 1ONBA 3T1QA 1GFWA 4CETA 4X8HA 1KVUA 2OXRA 4Z3KA 1IATA 1CR2A 1RPNA 1ZZEA 2E4AA 4PNZA 5HFAA 4X7MA 3TW4A 4HVCA 3M3DA 4YAIA 4AUKA 2H5LA 3GJ3A 2G77B 4JH0A 5A4JA 4LYFA 3MWGA 3PC3A 2R8RA 4ZZ2A 1N7IA 2CHEA 3U1BA 4TLDA 2YOFA 1J2TA 3G8DA 1GILA 4RIEA 4W6ZA 1L7QA 3F6YA 4AM8A 5AVSA 2JFNA 1YNSA 2REQA 3A1WA 4DF3A 5LOVA 4FOPA 4OY3A 2IHUA 2A1UA 3O3NB 3P2KA 2YNMD 1LK0A 3B6IA 1SU4A 1K5PA 5KOHB 2HGZA 4KFUA 4GXTA 2NYRA 3IH5A 1HFJA 2IOFK 1U5AA 2WYVA 2PCLA 2XUOA 2IELA 1BOFA 1IE3A 1T0BA 2JEOA 2P4SA 3BMOB 4K81B 5B37A 1USVA 5AM2A 4M9QA 5CVJA 3VNUA 2WU0A 4KLZA 4U8HA 4W5HA 1IY0A 3ZPXA 3EDCA 1SC9A 4H77A 4X6LA 1FMFA 221PA 1Q17A 4IPTA 2GEVA 2ZRGA 3DAHA 4FWBA 4JJFA 3O4VA 5JJLA 4B3JA 4R1SA 2YVUA 1E1LA 1FXSA 2BUCA 2WQZA 2ZKLA 3OZGA 4FGJA 1SKBA 3E22B 5E1MA 4QX6A 2EZTA 2GI4A 3GJSA 3NHMA 3NHRA 2XCOA 3ZHYA 3G5LA 1EP1B 1GNQA 2IF2A 4WXYB 3SX0A 3T12A 4AJ4A 1GZDA 2F9MA 2R48A 1BFDA 3GYGA 2P9JA 2Z2IA 3CZPA 3H3XA 4RHYA 4W7HA 3SM9A 4AP6A 4QBTA 2RKWA 3AEKA 2GCNA 3R6GA 4LXQA 1VLJA 5K51A 1PQPA 3A6JA 1M2VA 3LT4A 3F5MA 4MR7B 4L57A 3GPCA 1EB9A 4ZDWA 4EG7A 1IY9A 1YB1A 3FXAA 3D4PA 3ICCA 3PPIA 3U1TA 3D7LA 1MA3A 4DSZA 4GXRA 1P2GA 2QTGA 3ZK8A 5GVSA 4M1YA 4E03A 4K03A 3ZXSA 4NV0A 2CHQA 4A8HA 4X7BA 2CJYA 2J9XB 1GG2A 3B3FA 5FUYA 1OWLA 2FSGA 1UQTA 5AH0A 2N42A 3HCBA 2CVFA 4G2NA 3FAKA 1EFVB 4UATA 5JS1A 4YJKA 1SELA 4DA7A 1UBCA 4LC0A 3VDXA 2R7KA 2ZTMA 2GZ2A 3GDWA 2J3IA 4GMDA 4NFSA 3W2FA 1DJNA 1EK6A 3KV3O 5E6SB 2AEFA 4BPBA 1PJZA 2C9BA 1R15A 1X7HA 3Q0TA 3PGLA 5DM60 1NJGA 2FEXA 3GWGA 3TB6A 3U31A 4B3GA 1JECA 4P93A 2ZYSA 3RH0A 5K09A 4U6QA 5LDDC 4Q3CA 1ADJA 3PGXA 1FSSA 4TXJA 1KY2A 1DQSA 4HSEA 2VHUA 3OEYA 1E59A 4AK9A 3BG5A 3AINA 4NBSA 3GJXC 4F4HA 4BO6A 1LXCA 1YGYA 3GLVA 1F5NA 1NP6A 2BMWA 4H1UA 4G41A 1C7EA 3K8QA 2JFUA 3LXXA 4J1NA 4BGEA 1D0IA 1WF6A 3KPVA 1A5SB 3TXAA 4B84A 1JEYA 2EZ9A 1BE1A 4LJ9A 4XA8A 4H4DA 2ECFA 2ZJZA 3OJOA 4FGKA 1MDBA 4OKIA 1NRWA 3T9DA 3KJFA 5T5QA 1DDIA 1T8YA 1X6VA 1R1DA 1YR7A 1H2FA 2O7VA 9LDBA 3HLYA 3I2KA 3DZ8A 2ZT6A 1G3RA 2GN0A 2QUBA 3PFIA 4JP2A 4PGHA 1XF9A 4QHYA 3SQLA 4PAMA 2RHDA 3TZBA 1C5KA 4CM9A 2E21A 1PJCA 3FMPB 1GL7A 4EGFA 3D6VA 1LA2A 1DIAA 3MGKA 3PD1A 4MUNA 3K8YA 1U0TA 3CLVA 4P22A 3RIHA 1MQ8B 1R0YA 1P31A 4WFQA 3DBVO 3AUSA 1A2KC 3CMCO 3NT2A 4QPJC 3R8XA 3R0XA 1BFUA 4E6EA 4GZMA 1JT2A 3WLAA 2BE7A 3UQYS 4AS2A 1JDTA 4DLKA 1AZWA 1QOPB 1K4MA 2CBGA 1W52X 2YV4A 1M6HA 4HB2A 4Z49A 2BF7A 4MUGA 1UM9B 4FK8A 1XZPA 2B9VA 5F2KA 4C4AA 5C8ZA 9LDTA 3PGA1 5KOJB 2I6GA 4YI3A 5A5GA 1FQKA 1NW9B 1BDHA 1SKQA 1UAGA 2QHXA 4YB8A 2H5JA 3H5AA 2Y1KA 4P3PA 2QR5A 3NTVA 3OKCA 1VPTA 3D6TB 3G8AA 3GPIA 1Z37A 2B4TO 1RE0A 4HQ6A 3WO1A 4ZHQB 2PZLA 4CKCA 3E8XA 3RYFB 1I5RA 3WGIA 2J0SA 2PJZA 4NBNA 1R4MA 5J1TB 3JVIA 3RS9A 5JBQA 3FHTA 3L7DA 1QORA 2FVYA 5BUCA 1JIVA 3OUZA 1TEVA 1A8HA 1XCLA 2CWDA 2Z8YA 5KC9A 2I87A 3GOQA 3CV3A 9ATCA 2GO1A 3NKVA 3TNJA 3QLJA 1Q6YA 2WLTA 4P4NA 4TWRA 5TE9A 2HIHA 2Y8EA 4RGYA 1K06A 1DHTA 5L7WA 1RVDA 2H16A 1NSFA 5JNSA 3EA5A 1E96A 5EMMA 4DEXA 2PV0A 4QWWA 4BTLA 3E7DA 3QLUC 1FU8A 4W1QA 4AWBA 2CK3A 5JD5A 2JJ1D 4U9UA 4PO8A 3WGTA 1P6QA 1RAAA 4M1WA 4AJ9A 2SKEA 3DZKA 1NDQA 1PNOA 2UVDA 3E6AA 5JR3A 5CLJA 1VZ2A 2PUDA 1XZFA 1IYZA 5GM2A 4ND1A 3U4DA 2ZYWX 3NBMA 1AS3A 3AF4A 4FW9A 1XLWA 2OR3A 3A6EA 2NXJA 1UJCA 3DE7X 4HAIA 3VHLB 3SM3A 2J4CA 5BV2P 1JKJB 4ENUA 1NQOA 1RD4A 4IV0A 4EHJA 4ZJYA 3B7WA 1JKIA 3NIGB 4KQKA 3ZE9A 3O9VA 4P4TA 1G8YA 3V8EA 1WUKS 4H3VA 4QUGA 4WQMA 3GIDA 1JFRA 5A0TA 2C9YA 1TXGA 1U4NA 1NBEA 2O07A 1OD6A 4UDNA 3HL4A 4I4TB 3VU8A 5CAEB 4JI4B 4OSPA 5IU6A 1QGYA 1H2WA 2JFQA 3H3FA 4AIIA 1M2GA 4UU1A 4MW7A 5TVGA 4OXYA 1YZGA 3RKRA 2NZYA 3E9MA 4FJ0A 4Z51A 1PU2A 1R0SA 1NW5A 1R0KA 1NJ5A 2CUKA 4AFNA 5HR5A 1GY8A 1A4IA 5AHWA 1HKHA 1MXHA 3KYJB 1R0LA 4P08A 4F3NA 2W5UA 5AUPB 2CL0X 3VPFA 3MLBA 1I7LA 2FG5A 4LZLA 1HNZB 3PQ4A 2RK6A 3LCCA 2V1UA 3W6PA 2GWRA 1VE1A 4LXGA 4N82A 2JJ2A 3AP2A 1X0XA 4KIGA 2I6TA 3FMFA 4W82A 5HIIA 4CM9D 2W0MA 2AR9A 1GRVA 1V9LA 2X40A 3DFKA 4DCVA 4FPXA 3N0XA 2HLDA 1HDRA 1IN7A 1V16B 4Y2QA 1WSBA 2JI8A 2IYSA 2ZIEA 4LA4A 1ECPA 1EXNA 1UBNA 4R1UA 4D9KA 2ZUFA 2G6BA 1KNQA 2A5YB 1KP9A 1NP7A 3I4LA 4XLZA 3KE8A 4JVLA 1QQ5A 2ZBRA 1Y7HA 1C4WA 2Y1GA 1G64A 1RPTA 1X1AA 4WL0A 2ZVDA 2XUKA 3V8NA 3ZGYA 2GEKA 3NHLA 1QPBA 4RZQA 2QX7A 3B1XA 4LCBA 4BL5A 4O2AB 1KYIA 1Z83A 1EQ2A 4BVGA 1X8LA 5DNVA 1NQVA