1V8DA

Crystal structure of the conserved hypothetical protein tt1679 from thermus thermophilus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
193
structure length
189
Chain Sequence
MEGIRRAAQRAAEEFLQAFPMAPGSLFVLGGSTSEVLGTRPSLEAAHAVLEGLLPPLLERGVHVAVQACEHLNRALVVERETARAFGKEEVAVFPHPKAGGAKATAAFLRFRDPVMVESLKAQAHGGMDIGGVLIGMHLRPVAVPLRLSVRKIGEAVLLAAKTRPKLVGGARAVYTREEMLKKLEEFLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein (TT1679)
publication title Crystal structure of the conserved hypothetical protein TT1679 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 53
structure length 189
sequence length 193
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04260 DUF436 Protein of unknown function (DUF436)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Hypothetical protein TT1679 1v8dA00
1V8DA
chains in the Genus database with same CATH superfamily
5DSTA 1AXEA 2JHCA 2AW3A 1OLXA 3OP4A 4G1CA 4W7IA 2FPLA 2FMFA 4QGBA 3AKDA 1H2BA 2H51A 2WJVA 3BHMA 3MFQA 3EVGA 3WRWA 4BLOA 5FI5A 2VSOA 1JFFB 2XRMA 1T5OA 1M2OB 3A4LA 4GLOA 2ASEA 3BFVA 3BE6A 4WHMA 3U44B 4MDFA 3JQAD 5A3VA 2Q6OA 3SFTA 1VE1A 2PX2A 2V6JA 2YIJA 3LPNA 3QEBZ 2I80A 1UBUS 2G9RA 3ZV3A 3GFRA 4OM8A 1KY3A 1I3CA 4BLSA 3FOWA 5EC8A 4D3FA 1C0IA 5GJCA 3H4TA 1I7QB 4KHZA 4BB5A 1IZ9A 1DX9A 3G6WA 3TLGB 2PH3A 4G1FA 1YR8A 4OM7A 5FPYA 2MSWA 2OBNA 2HGSA 3ORQA 3FSGA 3PGJA 2XVYA 4UFOA 4I36A 3HG7A 5GY7A 2UYGA 4LSMA 4P5DA 4QEDA 3VZPA 4RF3A 2ZVQX 3IUBA 1WQ4A 2GAFA 3ZDQA 4EPRA 4F6RB 5JC1A 1YHZA 2WSBA 1XHLA 4I8IA 4WLUA 2WM9B 3RYFA 4CDMA 4IGEA 4D9KA 5BMVA 3OJWA 2GRAA 4IKOA 1EZ1A 3OUUA 2QG6A 1G5RA 1MQAA 4YEDA 1KQGA 3VC7A 3RU3A 1ZJWA 4EYEA 4D46A 2W6OA 4FN5A 4C78A 4J49A 4TV8A 4RESA 1ZYUA 3DCIA 4YAIA 5M29A 1EP9A 3Q8WA 4I6EA 2JIMA 2H0RA 4GPZA 3CSUA 4DIEA 4XVCA 4AYWA 4F85A 2I55A 4EL0A 3M6XA 4QRHA 4J90A 1F8YA 2XH8A 1Z13A 4JNKA 3CLHA 2CLOB 5DBOA 3K96A 3P45A 1VHQA 4M9CA 1QP0A 1SWWA 2ODBA 3QTBA 4QXOA 1P2VA 1T4CA 5B7PA 1I7NA 2WKQA 4HMQA 3LPDA 4BWGA 3RSSA 2WAMA 3ESZA 3KJIA 4U7HA 4R98A 3FYSA 1EBBA 5EIHA 3EW7A 3S7ZA 1I1NA 1OXKB 4OQYA 2PZBA 5IULC 4PVDA 4ZDKA 3F3KA 2I4LA 3LRPA 1UJMA 2FUKA 2VA9A 3KHKA 4HWTA 4KC0A 4JELA 2C77A 3EG9A 1XXHB 3H9EO 3MZ0A 3S3TA 5BV1A 4CLDA 4FD3A 5HBRA 1O6FA 1DWPA 2L42A 4KR0A 4NE2A 1AMUA 5A2QA 3NBKA 3WWZA 4RKWA 6REQA 1T6BY 3QVKA 4UE3S 5L51A 3NBMA 3BIWA 5KSPA 1CUIA 1N6HA 3IVRA 3MTJA 1SUAA 3OCJA 1P73A 3U49A 4JJAA 5LLDA 3M6AA 1PK8A 3V4ZA 5CB0A 1MO2A 2EP8A 2WF8A 4KRGA 4ZRNA 5G1PA 5H3CA 5CFNA 2HYIC 1DG3A 4MW1A 3G9ZA 2WA1A 3THXB 3TQIA 1E0JA 1SD5A 3Q4GA 5ICGA 4D4GA 5JD6A 4ED9A 2BIFA 9LDTA 1E3WB 1SUEA 4B74A 2V58A 2JGIA 3OQIB 4IDOA 5KYUA 3WGLA 2GPJA 1I5EA 1L4FA 3U48A 3OT1A 5IJXA 2IPOA 4HNAA 3AV0B 3BJZA 4S12A 4ZQHA 1ZIYA 3HWWA 1MLDA 2B2NA 3PDIB 3QE0A 3B9RA 2Q5JA 4Q93A 3VR3A 4BMCA 2P1DA 4JP2A 1RC1A 2JDID 1ZCAA 2WBLC 2VAPA 2Z83A 4P2BA 3FM9A 2KW5A 1KI3A 5FPTA 4YECA 1N3LA 1R10A 4RXTA 1SZCA 1UFQA 3QEMB 3SF8A 3SC2B 3T7IA 2XZOA 4QPPA 3RAFC 5E8RA 2IQ5A 2Z8YM 1LD3A 4RLSA 2EGHA 3KPWA 4ENVA 1M33A 3RC7A 5P8WA 3PRYA 5KINB 2I29A 3H17A 5JG7A 4ZI7B 2PGXA 4NC9A 1M1YB 2PKEA 2NXNA 2G40A 2WMOB 1G4AE 3NXSA 3MJVA 4WAUA 2VTEA 4YP5A 1YT5A 1H2WA 3Q3VA 1PZFA 5JPIA 3ZK7A 5CB8A 4DQXA 4KQIA 4IGIA 1AMNA 1H8EA 1WOYA 4RORA 2XXBA 2X1MA 3E18A 1G4UR 4ZHQF 4RTOA 3DDUA 3DULA 2ZROA 4H1UA 4QDTA 1JP7A 3DFIA 2XCOA 1FE8A 3DCNA 1YRYE 5BUSA 4JI2B 4Z9AA 4K9NA 3NHMA 2VCHA 4NL4H 3T5DA 3IFSA 1QBKC 4L7VA 1KC3A 2O3RA 3RJ5A 2PVSA 3OZEA 4DEVA 3PGKA 1PJRA 5F78A 1ECFA 2DFDA 2HXGA 4XVRA 3HNRA 1JB9A 7REQB 1Z7EA 5HDQA 3L4SO 4HQ0A 1CQIB 3P2YA 4MJLA 4F2WA 4W5TA 3AINA 3E23A 1JDBB 3QV2A 3VSEA 3ZW9A 5IJ9A 5T6MA 5KZMB 4NV0A 1J1ZA 3SBXA 1G2OA 1P5RA 3ST7A 3K6SA 3OU2A 3WIBA 3CGWA 5K3DA 1SK8A 4X1IB 3G85A 4BUZA 4QGFA 1RZVA 5IC6A 3WYNA 5LP6B 1YNSA 3NYWA 4AQDA 2Q27A 2I6QA 1Q1GA 4Z8YA 4LXHA 2PWAA 4FZ3A 3ENZA 3VR0A 2I87A 1OSNA 2PV7A 1PJAA 1XROA 8GPBA 1NE2A 5AH0A 2IOFA 5DP2A 4CT0A 3R3JA 1FLDA 3EMVA 1EK1A 3FYHA 4N82A 3TGLA 6LDHA 5F1OA 1SVMA 2GFQA 4DCUA 5FV4A 4I4TA 4OIMA 1LY1A 3MMZA 3WB0A 4OAQA 5KYKA 2HSEA 5IVHA 2Q0QA 2WU3A 1BXRA 2YXLA 3GA5A 4I1YA 1D1QA 4YV1A 1CYEA 1J2JA 2Z2IA 5DM70 1J24A 4W9MC 4TROA 4IJ6A 4ZAWA 2Y3IA 4RA6A 4E5YA 3MCUA 1DX6A 2ZJ3A 3WGKA 1EK6A 3ZE8A 2HWUA 3E27A 5DNCA 1J09A 1Q95A 2P69A 2K7FA 3ZD6A 1VECA 2IYWA 3IEXA 2QT0A 1IM5A 2PG3A 2VJYA 4DYHA 2A5LA 2YS6A 3D8NA 4OHWA 4OYRA 2WU4A 1SKMA 3PTLA 3QWFA 4RHFA 3U16A 2QS9A 3GVHA 4N0DA 3EY9A 1WBDA 1YDGA 3DFKA 4GZLA 5D5QA 3TTUA 3O5AA 1U8CB 3OP1A 5IDVA 4ZHQA 3NOOA 5B1YA 1H2RS 5I9TA 2VSQA 1QHSA 1WSDA 1Y3CE 2EDAA 3PEEA 4QTUB 4BE4A 5A5VA 3SBOA 4JOBA 3FZNA 4V39A 4ZJYA 1YDEA 1U80A 2LWIA 1XZQA 2W4QA 3NETA 3R3VA 2CDNA 4JJ8A 5T8KC 1I4EB 4OYHA 5U4QA 3IT1A 5IJZA 1YDHA 4NZNA 2YWCA 4CXMA 2Q50A 2BTEA 3SQDA 1E2BA 4QYIA 3VNAA 3K8OE 3KKNA 1A3CA 2COUA 2JVKA 3OH8A 3HRHA 3GDOA 2Q5QA 4XIFA 4ENPA 5JTTA 4DL9A 1YVPA 2CLDX 1LWNA 2GETA 4JU9A 5D8DA 2V5VA 2VYFA 4D4IA 4IKPA 4RELA 5CYPA 4ZMSA 5AI8A 5E38A 3SLKA 1N6KA 3BL6A 5KCMA 2GEBA 1AS2A 5JZVA 3CE6A 4H77A 1RI3A 4CNQA 2QZ9A 2Q0SA 4RD1A 1X7HA 3TR6A 1CQJA 3AONB 2A8YA 1LX6A 1MO5A 3IJ5A 3I37X 3GDHA 1S3SA 2GARA 3A14A 4KVGA 2WSMA 4UBOA 2UVQA 2WSSD 4L6IA 2H2AA 3V1NA 4XYGA 3HVUA 4DDHA 4HT3B 1W9MA 4D2IA 1DBIA 2VL7A 3SGLA 3DLBA 1HLPA 1OPRA 2VSFA 4DCGA 3TDKA 4YAUA 4EENA 5AW9A 1FFXA 2YFKA 1KH1A 1VB3A 2CFSA 3A7EA 3LBNA 4B6SA 3CNLA 3NRBA 4EJMA 4B6PA 2PD6A 1Y33E 5AJZA 1A4RA 4CV0A 3HO8A 3ZU5A 1X80A 1Z6YA 4B3GA 2Z5FA 1PI3A 3W9SA 3ZXIA 1JDVA 1OX4A 1I30A 2V7BA 2Q3HA 4OREX 5GOTA 3SK0A 1NTOA 3VKHA 4D0RA 5HA5A 4E4TA 4EYGA 3I52A 4K26A 1U7OA 2Q4OA 3PXAA 4J43A 4JGGA 4JFAA 1ND5A 1RRFA 3IRVA 5EP4A 3T52A 2RSLA 1WTCA 4IQFA 1G4HA 3VGPA 1YFKA 2F90A 3QFTA 4FYKA 3SBEA 1KRXA 2J9XB 3I1YA 4PSVA 2WYIA 3BJRA 4IVPA 4HZUA 2P2LA 4S2UA 2OQRA 4X5OA 2V54A 3H4MA 4IG4A 2OD2A 3SX2A 2WG0A 3D6NB 2AG6A 4OATA 1UK7A 1T3GA 1YQ9A 2GNOA 2R97A 4I3HA 2HRBA 5DRYA 1DRWA 1KEEA 2PUJA 4M0MA 3BJMA 2A58A 4NAVA 4GFDA 1L4YA 4ZXFA 3K0SA 1U1FA 1Q1BA 1V3VA 2WVJA 1CF2O 2QF7A 3SR4A 3O8NA 4D5GA 2MYNA 5FI0B 2VBCA 3UAWA 1DQRA 4MHOA 2PKQP 4L95C 3ESCA 1JTEA 1ONOA 5EKXA 1VMEA 4FYIA 3AFMA 2ZQYA 3I2YX 1FQWA 2P9TA 2F1JA 4HDMB 4RD6A 4D5EA 1HDIA 4DLBA 1K6JA 3A3OA 3I2FA 2XD4A 2CXNA 3AO0B 3CZPA 3JQAB 3PFFA 4OHKA 3UA3A 3W1VA 1E9EA 5FOQA 3AETA 4KE6A 2F9LA 1AKNA 4R1NA 4AG5A 4TTRA 4CIYA 3W06A 1ZH2A 3KU4A 1X7XA 2XMZA 2ZRDA 5AIAA 3O4JA 1P0CA 4AMGA 2H2GA 1E2FA 1ELOA 1QE5A 5D5HA 3WLEA 5H8WA 1JILA 2E2WA 4NLLA 1S8OA 1CDOA 4X7PA 1U5BB 2GEJA 2FZGA 4CE6A 3KR2A 3RC8A 4DILA 3NB0A 3LNTA 3MTIA 4W8HA 3E1KA 2VDWA 4KB5A 3FCCA 3UJNA 3NIWA 4X1OA 2C1XA 1IQUA 4IKEA 4FNAA 4WOPA 3T6KA 4AP5A 4C08A 1A9TA 3WQHA 2RAVA 4Q15A 5KC8A 5D87A 1HE8B 3B6IA 3NHWA 2GZAA 2PRYA 1NUTA 5KKAA 4J7XA 1XG5A 3ZWWA 4O3FA 3O21A 2O8CA 2FJ0A 2ZUCA 4FPXA 1ULTA 4Q3BA 2OGSA 2ZZNA 2ZT5A 2R65A 4EYQA 1LDNA 2AHRA 3ROFA 3LQRA 1F6DA 2BZ1A 4FE3A 4IZIA 4U63A 4YDHB 5ECWA 4FC6A 5LA6B 4BJHB 4H0NA 3IPAA 3UM9A 1LBTA 1XDDA 3EGIA 3GAAA 1K5GA 2FKNA 4N39A 2YN2A 2ENWA 3MT9A 3K9NA 4EKYA 1PJ8A 1M0EA 1FNDA 2YN4A 3OAAD 1YB7A 5THXA 2IEIA 4Q4JB 5F5NA 4ENRA 1KI1A 5LYJA 4DMHA 4E6PA 3M0EA 4L78A 3PJEA 1PFGA 1HLDA 5BRNA 2F1OA 4CKYA 2P9FA 1KFKB 2JFUA 3RHTA 4DWJA 2PQ6A 4UOEA 1QSGA 5EJGA 3TGPA 3BK7A 5BV8A 3EZ6A 4TTIA 3G7UA 2PLRA 3QA9A 3CXUA 3D8RA 2BRUC 4O2AF 4U2CA 3NASA 2OCKA 2ZUSA 4W1RA 1N1MA 5TDHA 3JQFC 3HK2A 4PTLA 4ARZA 2WJJA 1B41A 1MKYA 3B2QA 3DZHA 3WLTA 3DV9A 4YDSA 4C4XA 4HMPA 1IQ0A 1G3IA 1SVWA 2JFBA 3WAJA 3ZDYB 4MWCA 3JATA 4RFLA 1UPBA 2HV8A 1KBZA 1G21B 1CUDA 2IY9A 3RTBA 4YQEA 2B5WA 2PZEA 2OYRA 1JIKA 4MRVA 1E2LA 1EVYA 4HYTA 2A5GA 1GAEO 5KVCA 1DKOA 4OFWA 3OD5A 1TEXA 1BU5A 2QUIA 2QLJA 5IS2A 4Q6WA 5JFGA 1KIAA 4DY4A 5DLYA 2FZKA 4URFA 2AFHA 2JAXA 3VH1A 3OF3A 5LYYA 1QTNA 3BHNA 2XMBA 2KB0A 3WYCA 1B0ZA 5HTKA 1B43A 2FFAA 1RPTA 2UZ1B 2VH1A 3Q8LA 1G6Q1 2Z2ZA 4GG1A 2Q3LA 4CMJA 4FFBA 4TL9A 4BOYA 3EDOA 2P2CA 4WKCA 4H3VA 4DFDA 2FZCA 4H1TA 1NMSA 3K8QA 4UDNA 5BQPA 5E1DA 1I13A 3DOFA 2R6DA 3FTEA 4KYTA 5AICA 3TIIA 1YQEA 3ZNNA 3H0CA 4Q82A 4B3MB 2J7PA 2Q29A 1EWKA 1KVUA 2WAOA 4HWRA 1I3MA 2HXYA 1I4OA 1Z5OA 2IITA 1NKVA 2X7HA 2FN4A 1JI3A 1T2AA 2DCUA 4QPNA 5DBEX 1OBHA 3AUKA 2NT3A 3F6RA 3NR2A 1AV7A 3WRXA 5AVSA 1KMCA 3EOBI 5CB4B 3R7DA 5KYXA 3ER9A 4WUVA 5ESXA 1RTTA 3F6YA 1GPWB 2UUCB 3HH8A 1QHIA 4YXWA 2L17A 2GF2A 4NYJR 2ZRAA 5IANA 2O8DB 1GRQA 3LVFO 3B7GA 3UB4A 3FDFA 4LDRA 4JI1B 3GLIE 1AUXA 1R5BA 3LWNA 1OXSC 3FSEA 4OAOA 5FPHA 5AWFC 1HYGA 2W8BA 1C14A 2JS7A 2QHXA 1AF4A 1OE0A 1W96A 1YUNA 1K3TA 2BFPA 2CHEA 2ECKA 2X0DA 5KDDA 2WDZA 2QG9A 1PT7A 4M46A 2B92A 1ZK1A 3B1FA 1K8XB 2QAGC 5CX1B 2Z2JA 3OUTA 3VM6A 3WLJA 4GC5A 2QXTA 2O1XA 4C1NA 4O2AA 1GFIA 2SNIE 4YBRA 5B37A 1CPYA 4OBWA 1LRJA 5SY9A 2BBOA 2OGUA 3ILXA 3WK6A 2XY4A 1SCKA 5LD2B 1ZI6A 2EJVA 1ADYA 1DCFA 1Y0BA 1QVAA 1SKYE 2W2LA 4E2XA 3T5TA 2ZM5A 1RKXA 1RYEA 1TYCA 2E55A 4LZLA 2BOVA 1KY2A 3PZRA 4X93A 3H5LA 5CM8B 5LM3A 1EX9A 3DC7A 1YQWA 2QP9X 3OOWA 4PZDA 3R7WA 1T2UA 2VJCA 5JSKA 5JRJA 2IS6A 4RZIA 4D97A 4BNZA 3WQSB 2IOHA 4G8DA 3X2SA 2XXAA 4IHJF 4ANFA 2XB9A 1Z73A 4NMWA 1WABA 4BAZA 3EGEA 3HDJA 5EIAA 4P4UA 4KO3S 3MJRA 5EZSA 4G9GA 1PJ4A 2P75A 2H31A 2NSLA 4MR9B 3GGCA 1U02A 3V5NA 1DAKA 1NMEA 2XA9A 4JJGA 4BEBA 1EMDA 2F4NA 2LPMA 1JPNA 4ZGBA 1VCIA 3VU9A 2Q5CA 3C98A 1ISMA 4R51A 3CR7A 2H4ZA 3TQRA 4CF4A 2PZGA 1SPBS 3V2UA 4GBJA 1K08A 1DI0A 3HM2A 3PKZA 4B80A 3AX6A 4KLZA 4D6PA 4IIEA 1XJ5A 4M0PA 5AJUA 3E9MA 3UG6A 1T1GA 1X7GA 2O7RA 4X85A 1AC5A 3BBPA 1RJGA 1XMSA 3CKMA 3EODA 3PEVA 4PCUA 5EHGA 3SHWA 2APJA 2YJ6A 5JALA 1X42A 4IMIB 3ZLBA 3ZWNA 1QIGA 4H1VA 2AOUB 4TTAA 3OPQA 1DKPA 1BD4A 1U0EA 3HUUA 1Y9DA 4W5RA 4Q37A 1JG7A 2PX5A 3EGOA 2ONYA 4G26A 1WMFA 4K9SA 3TFOA 1YRQA 1FJ2A 5FNVA 1YL7A 5FOUA 3V3TA 3LQFA 3SDBA 2WABA 5JXJA 2HDNB 2RCYA 4V24A 5F9MA 4KHPB 3DJYA 2RBKA 3ZQKA 2PT9A 3DZFA 1Q83A 2JARA 4X8MA 4GE0A 1UOOA 5B64A 2BYTA 1P4AA 4B6EA 3U31A 4IZ6A 3NV7A 2XYQA 5AUQA 1W6UA 3PNYA 1IFXA 4K8RB 3WL4A 2H6EA 2W0MA 4UOZA 3VTFA 3G82C 1SOWA 5ABPA 1DOZA 3ZDBA 3EGDA 4YMTA 3AFGA 1XZFA 2ZSBA 4YRPA 5AJYA 4A2QA 4Q7EA 3O3CA 2JEZA 2CXRA 4LQCA 2RK6A 1RWOA 2AJ8A 2QPTA 5JLAA 3UWKA 2QENA 2FR8A 1LJ8A 3FPGA 1C7ZA 3P9SA 4J0KA 1C7IA 1EGMB 3LLSA 1EYZA 3MWEA 1N0IA 2VHCA 4KQ9A 3S99A 4D9BA 4IHJA 1WY7A 3KWJA 1DWOA 1ZRNA 1BROA 1RBQA 4LRSB 3EQ9A 3WISA 3ZBPA 1EDZA 1HDYA 1U3FA 2XIJA 1G0NA 4NK4A 3U7QB 2Y9MB 3D2BA 2XYGA 3RF6A 1IUPA 3DDZX 2Q6LA 2ZSFA 3S55A 2OCXA 2Y0PA 1NJ6A 2DVMA 3DOEA 1IG0A 2G9UA 1U7PA 3HKEB 3NWEA 1KI9A 4FX5A 4NBLA 3L7KA 4GICA 3BKWA 1IC6A 1XCOA 1EGAA 5JS6A 3IVGA 1GL7A 1R0XA 3FG9A 3FVWA 5DWVA 3GIWA 4O02B 2WIDA 5NULA 4TOIA 2N47A 1W88B 1N5KA 5BSEA 3IR7A 3DNPA 1D2NA 4XR9A 1A9XB 1C7JA 5IKPA 1VL0A 1S2MA 3RO7A 3BWXA 2L82A 3M6MD 1XUOA 3DO6A 3GFQA 5J4KA 2R84A 1WXQA 2K4MA 2I99A 3GNLA 4DCNA 2ZRJA 4GMFA 1J8DA 1SKQA 3SKXA 1E79A 2C5BA 1ENPA 2VDQB 2RIRA 3BRWD 3DMTC 4DLNA 3LX8A 2XQJA 2WHRA 2LZ0A 1G0OA 1M7HA 3R7FA 5BSGA 4LRTB 2BISA 1J99A 1TCCA 1W5AA 1ZOLA 5BR1A 1FP4A 5IYZB 4UVEA 3PENA 3MSXA 5KTKA 3RARA 5K4GA 4DVJA 5IARA 8MHTA 1KH2A 3TPCA 4CLOA 4TLAA 4F3RA 4GMHA 3IDQA 2FW9A 3KJNA 5FPSA 2YCLA 4RQBA 5H80A 2B3TA 2UUPA 4JQOA 4IOJA 4WCVA 4WE3A 1SBCA 4BX3A 1JPJA 2CSUA 4P3KA 2BBTA 3G0IA 4G81A 2XSZD 5BN5B 1CUHA 3WG9A 2XQKA 2PR2A 2M1XA 2VVTA 3OOJA 1RI1A 5EE9A 3VR6D 4OHRA 1OXBB 5D1HA 1KORA 1UCFA 3GU3A 4B7ZA 1CUUA 2O6HA 3BDVA 3B8EA 3AGPA 2GK3A 2WKPA 5J47A 2OKGA 5TEVA 4JX9A 1LC0A 1S6YA 1WXIA 2G77B 1X1TA 4KIUA 5FA6A 4BGEA 3DBRA 1TAGA 1Y5LA 3HLTA 4IVNA 4TKUB 3R2JA 5AI9A 5DLPA 3TR5A 4OMFG 4C0WA 1GPH1 1YU9A 2WI8A 3GLRA 1FSZA 1RS0A 3U4DA 4U39A 3LBFA 2AC4A 2F8LA 1TMGE 2ZUDA 1JB1A 4QWMA 5JSZB 1HEIA 1ZX1A 3DE5X 3U1TA 2XLCA 4OL9A 4N5MA 2GCIA 1ISPA 3FPFA 1L9KA 1LPSA 1F6WA 4IXTA 1AKWA 2H18A 1TA0A 2IHTA 3N2GA 3TLCA 5IVKA 5FIUA 1GCAA 4PWZA 4PNZA 2HRDA 4WFQA 1ZUNA 1W36D 4EVIA 3B6JA 3U2QA 1RRMA 3PF9A 4G84A 4Q18A 4BAUA 3F5FA 3SLRA 4HNVA 4W8GA 3NEYA 1RQGA 1VDMA 4CF5A 2JAHA 4CMCA 1FP7A 2NIPA 1PV2A 4E0BA 2WKSA 5EZ6B 3OG9A 2H0QA 4XDYA 5AHOA 1GFSA 2BLNA 2ZT7A 2DJ5A 2Q5HA 3GRCA 3MWDB 4IIBA 4MQUA 2ZWVA 5BY2A 1DAOA 5L3QB 5CK4A 1D5WA 4MDHA 4R9SA 2X5OA 2HQOA 2WFAA 4ZI2A 3MCZA 3QLTA 4K6FA 3FR7A 3PHCA 1LW6E 5FLKA 4ZVOA 4BZZA 5FBZA 5C81A 4N76A 4CV3A 3UUFA 4BCBA 3OPYB 4MKXA 2FK7A 1U6IA 2PN1A 3RF7A 4JQZA 1JBKA 4NCJA 4O63O 4ZVUA 3ZWAA 4EDHA 1P7WA 1E2GA 2FYTA 4ZYLA 5SZJA 1A5AB 4WCFA 3TSOA 4C4PA 4F11A 1EAYA 2QRVA 2MSKA 4AG3A 4DSUA 1Z0KA 4R9RA 3CLKA 1AQYA 1E62A 1LCIA 3H19A 1I24A 4RAQA 1VCHA 5KYXB 4RTMA 3GO4A 4IIXA 1TECE 4UNRA 3QXHA 1QTQA 1WR8A 3ADKA 3G3EA 2XUQA 3RFUA 5MDHA 1YKGA 5ALJA 2H52A 2JAUA 3HYTA 3CX3A 3OECA 5JSQA 2WIAA 5C5EA 2E89A 5AW2A 2AXEA 1CJVC 2WDPA 4CEIA 1WHTA 1JG1A 2GKSA 1U04A 5CAEA 2C5LA 5ARCA 2WMDA 1PBNA 1P6QA 4HBGA 1WKVA 1DO0A 1EFPA 4PSAA 3TUJC 3MVEA 4FE4A 1L4BA 5TSDA 4ES6A 4AW9A 3TL6A 5I7OA 3ROMA 2D0PB 1HF3A 3MS7A 1JKJB 1AN9A 2WHXA 4BNKA 5IDWA 3L04A 1ECPA 5M5BA 2QTVA 3WWOA 1KY5A 5DCWA 4W1PA 1FVHA 2ONCA 3PFHA 2Y4NA 2P2GA 1VIYA 3DEAA 3H97A 3Q7QA 5E4YA 7MDHA 1PZMA 2D5IA 2D54A 1I7PA 2R79A 3QSGA 4J75A 4CGYA 1E7SA 3OOHA 1MTZA 1WZEA 2JAQA 4R2LA 1ZS9A 4JWTA 4AKEA 2AT1A 6ADHA 2O7QA 2XNCA 1N2CA 1W1IA 1ZN8A 3TLXA 2DUJA 3KVYA 1ORDA 4DLZA 4E31A 2DHQA 3ILVA 1QCZA 1TF7A 5KTNA 4HYYA 2X7JA 3NTVA 2GZ1A 1A2BA 3UKJA 3USES 4F60A 3ZGXA 4QIHA 1A8QA 2P0AA 6ABPA 2UUOA 1T6XA 1A0OA 2B4QA 4F12A 4EHBA 4JI4B 3UWSA 3C5WP 2AJDA 2WV7A 4RZ3A 2FK8A 2PWYA 1ZD3A 2A5JA 5A5DA 1IBRA 1NRIA 2FQWA 3MOIA 4QVKA 3W4KA 5AM1A 1GR0A 2CL6X 3D4IA 3OM1A 1CETA 1MPTA 2CLIB 2ISCA 2V4ZA 1KR2A 2CVPA 3KPYA 2W43A 3BICA 2FPOA 3KYDA 5T67A 3HHPA 3RU9A 4BZPA 3FNBA 1ZOIA 1OI4A 1A7KA 2FOXA 3L1KA 4JKYA 3P96A 5T3UA 5F12A 3MBOA 3GG9A 2HRRA 2BC9A 3T5GA 4BASA 4GWKA 4YUXA 2GXAA 3ZKWA 1MW9X 4BVHA 1KTIA 3VOSA 4J1TA 3TLZA 1DFGA 3I6MA 4A26A 3R7SA 1KXZA 2AC2A 3U56A 3BXOA 3BAZA 3CZRA 4IRUB 2BGLA 1MAWA 1C7RA 5D5PA 5FBVB 4V0QA 2ZUEA 1FX1A 1E3QA 5K03A 1YFZA 4CBVA 2GHTA 4CV1A 4RTJA 4L7QA 1LBHA 2Y1CA 1VL5A 3JASA 3UIEA 1GLVA 1V4BA 2FX5A 3H9QA 3PRHA 1YB4A 4KFTA 3SJBA 2W2KA 1E7RA 4NE7A 3IR6A 1XP5A 1I0IA 2O07A 2INGX 2J6HA 2V7GA 1IY9A 4WNAB 1C0PA 2WIBA 5TJ9A 2F4VB 1ZBDA 3BMCA 3QF7A 3QEAZ 3AR7A 3OFSA 3S2UA 8ATCA 2ZCUA 4C6TA 4F4CA 2JJ2A 4W5NA 5H02A 3Q10A 3LXMA 1XCLA 4IMJB 4OK3A 3TSAA 3W4IA 4E33A 3R3HA 4AL4A 1DEKA 5K8TA 3CVOA 4UC0A 2A7XA 2J59A 2OHVA 2X3YA 5AVWA 2NWQA 4CKCB 2PDAA 2QRPA 4FGLA 1RFGE 4CQNA 2P2YA 1RWKA 3P9PA 1W7AA 3BULA 2C2HA 1G1AA 3IV6A 1U0TA 2W6ID 2C9OA 2QMYA 1GNVA 1KZ4A 2QTHA 3G2HA 5F5LA 4BE7B 3EMDA 3FYUA 1DAIA 4OIFA 4QECA 4DSOA 2B5OA 3EWAA 1EVLA 1FDSA 1X77A 3I76A 5I7VA 4AO8A 1JKMA 1IB6A 3BQNB 2QD2A 3WGJA 4FMBB 4YYZA 2G72A 4KITB 5EJ8A 2AIRA 3FLMA 3E4CA 3IT0A 4JBHA 4RM2A 2Z3VA 1J5XA 3THYA 2YHIB 4GXQA 4NEQA 3UENA 3RVJA 2GYWA 4YMWA 3KB2A 4FKMA 5ITVA 5LXTB 4ZQBA 2XKAA 2YZ7A 3S8YA 4D8UA 4QM6A 2EKQA 2AJLI 1HM5A 3OCUA 3PWZA 3HUFA 2BGRA 1RXUA 1DJLA 3L9XA 1R5OA 1QF7A 1YV9A 3E81A 2CNBA 3OWHA 1BE0A 3FRIA 3GPCA 2D1RA 3FA2A 3RT7A 3WFIA 1AHPA 3ITKA 4XD2A 3SMQA 2BZGA 4TXJA 3BB3A 4AMVA 4BFUA 5TS3A 3ESYA 4BZXA 1KEKA 3EH1A 2AN5A 3S68A 2HO5A 4TS1A 2CNWA 3FCUB 2EEZA 4C88A 3SXPA 3UYLA 3KE9A 3TG8A 4I5DA 4X3PA 5AQEA 1RHQA 5IC5A 4KWIA 4LYEA 3PL1A 2GH1A 2RI0A 3KQVA 3QMVA 5M34A 2DSNA 3C48A 2A5DA 4GOXA 3CGGA 4CL0A 1XZCA 2AC7A 3S5JA 3GUCA 2ZYHA 3NGLA 2QM0A 4FGKA 3U7IA 1T6ZA 1XU9A 2QUJA 3AVXA 4RDHA 5TPWA 1DJNA 3MLBA 2W6JD 3RADC 4ESVA 1JKIA 2QTLA 4IRXA 4L2IA 5CA1F 1O97D 3NO4A 2FEPA 1DDIA 4DCOA 4IMRA 2IYUA 3O82A 3UMVA 3CNHA 3IEUA 1J0CA 1GPUA 4KRFA 2R1TB 2YXDA 3O73A 2HBRA 4R1LA 5CR9A 1ZLYA 4X20A 4HDQB 3ZNPA 1K7SN 4BQNA 2J4CA 3K4PA 1DJPA 3N3AC 3P9ZA 4ZOLF 5BSMA 5KKCA 4S04A 1LPMA 5FUYA 2C4TA 4GP9A 3RVPA 2V7QA 4B4KA 4CUZA 4G1MB 1ZUIA 4I5GA 1QG0A 4XPIB 4O25A 2X5JO 5GZ3A 1DV2A 1RP7A 1WVGA 2EJCA 5DTIA 4WH0A 3RTDA 1TK3A 5LJIA 1M0WA 1PSWA 3ETEA 4Q47A 2OGZA 3ENWA 4YK7A 3ILHA 2Z04A 3UWDA 4J94A 5FR2A 5DSXA 4IWNA 3WMWA 3ZHOA 2HCTA 4ICIA 2ZRPA 5IXYA 1Z5NA 2JB9A 3IUQA 3MS4A 4Q7MB 1FYWA 4MARA 4W5JA 2C54A 3HO6A 3OICA 4RDXA 1FY2A 3NTUA 1MHTA 3OZRA 3LTNC 3QJGA 4UCFA 3EQ7A 1BW9A 1MC1A 1GGJA 2AOWA 4OY3A 4CL2A 2QU7A 1XYYA 4UE2A 3ECAA 4BLWA 1HRDA 3E9YA 1FUIA 1I51A 1UP4A 5ELMA 1MOZA 4A4DA 2SCUA 4JODA 4CMGA 4DMKA 2F67A 3QNMA 4LF6B 5F4BA 1TRKA 3I34X 3LECA 1FQOA 1QUEA 1ZVJA 3P4XA 4RHXA 1ICIA 3RFFA 4WK6A 4XB6B 3UJ8A 1J0AA 4MQLA 4HN9A 5C8YB 1J1UA 3PBKA 1KJ8A 4HEA1 4INOA 3S40A 4AMYA 5JIBA 1XNQB 5KREA 4YIHA 4PWYA 4BB0A 5IN4A 2RC6A 2VBIA 2Q46A 1Q1NA 5CJ2A 4CL8A 1ISFA 5JAPA 3ISJA 1XX6A 3VX3A 3OQNA 3K6RA 3GFFA 5HRAA 1YBVA 2NZ2A 3TRFA 3UCFA 2O8NA 5EE3A 4EMSA 3TG2A 4DA8A 5TV2A 1H3FA 1NJFA 1V3QE 2JFPA 2P41A 3LK7A 4G1EB 4MCAA 8ADHA 5IUJC 1GYQA 1TIPA 4HDAA 3HJHA 3K9WA 3V7UA 2OILA 3WGOA 5EKDA 1XWFA 5JDCA 4X3CA 1ABBA 1RWNA 5FP0A 4Y8VA 1G8FA 5CA1A 1LLUA 2OCYC 2ZJZA 2VLBA 1E8MA 3LT1A 2Y0CA 4Q9AA 2B8WA 4EKNB 5E9WA 3BD8A 5A4AA 3KXKA 1UZLA 1C7QA 2X0NA 3X2EA 2XHZA 2X8JA 3NUGA 4PQEA 1KOLA 3CNOA 3UWOA 5I7SA 4B4DA 2WTEA 2GBPA 4LDAA 5D6OA 3WLOA 2VKTA 1BXZA 4NMLA 3UPTA 4ZOLA 2F3QA 1XZKA 2RIPA 1N5LA 3B1VA 3NJRA 4JEIA 1ISJA 1K4MA 1R0WA 2ONKA 2QVGA 3ANYB 4IL5A 1JX6A 1LNQA 2XTMA 4X1YB 1Z7WA 1BG6A 2DZDA 4H7KA 3NDJA 3WWDA 3QENA 1W36B 5K3OA 3FOZA 4B3JA 3QVGA 5KYWA 1M0TA 2GGSA 4JIGA 4Q4LA 2CVZA 1QKIA 4WSOA 2H0AA 1UADA 2ATIA 3EZXA 4EELA 2EHDA 3Q88A 5CBPB 3HY6A 1BRMA 2WMNB 1KMIY 4IY1A 5KBYA 1L1FA 2AFRA 1H4SA 5LDDC 2GXSA 1ZD2P 2TSYB 2J07A 2RDMA 1E2KA 2QE6A 4PPQA 1RPZA 1JT2A 3FVTA 4QFMA 4M89A 5BN1A 3B70A 4LYYA 1L5NA 3DO5A 4M8NE 4MIOA 2BMEA 2GQ0A 1FXWF 2Y8EA 4MUKA 3GC6A 1YJCA 1J33A 1T91A 3QVOA 4PLTA 2H00A 2PJDA 3UTCA 1QIMA 3ZKAA 1VIDA 1ZGCA 2BM9A 3IEVA 4CM9A 4LRYA 3O6VA 3FYCA 3RNOA 3L8MA 3S4YA 4XIGS 3E9NA 1Y8AA 2GD2A 3CEJA 3U37A 2JFFA 2CHQA 4PTZA 5EKTA 2ZJ1A 1KVRA 2XGOA 1UDCA 3GEIA 1OIWA 2R66A 1RAAA 4PBTA 2P11A 4DV5B 4E5DA 1QP4A 1CRLA 3DHYA 1NF2A 4BGVA 1KOJA 3ASZA 4CEJA 2AZMA 1KEZA 2P6MA 2PBRA 3GRVA 5HVNA 1KZGB 3HCNA 2QPLA 4JSYA 5KWIA 2OZLA 2H2WA 2QRMA 3JVUA 5SV2A 1NZDA 4R8KA 2TYSB 2HA3A 2WSYB 1YZ3A 3NTOA 1WCWA 1X7YA 2J9ZB 3EC1A 4YV2A 1ZG3A 4N3BA 1AA9A 2BR5A 1U28A 3CG4A 4QO7A 2E37A 3WL3A 2QV0A 3DLIA 3MQ2A 4G1VA 1N2GA 3TL2A 1DT5A 2GK7A 1TA9A 1KGDA 2FPIA 4FP9A 2RFLA 3F1KA 4L3OA 4Q9NA 3SVLA 3GNSA 2P8JA 4KXVA 2VUSA 3ZE9A 5DYWA 5KI6A 1E2DA 5H3LA 1C0LA 1NUUA 2C7VA 2DQZA 1NBMD 4TMTA 4XYEA 3TD6A 1P72A 1JG6A 3JTMA 1EVQA 1QRAA 1MRSA 2F8MA 2VZ0A 2QTNA 3DMNA 1UF9A 3I23A 3NTLA 2QX8A 2PV0A 4OF4A 1FLAA 3NKVA 3R3ZA 4YJ3B 4WFKA 4ZCIA 4LQDA 4R5MA 1T4BA 1Q17A 2DWQA 1W4BA 2HTEA 3GJ4A 4KTVE 1E6CA 3QE3A 1J7KA 3V6LA 3KSRA 4RGVA 3ISTA 1OCEA 1QF9A 2ZXFA 1U1EA 4GH5A 4IV8A 4ND1A 2ZPTX 1IOZA 1FXWA 1U31A 3B60A 3I1IA 3M5PA 4HJXA 4M83A 4OP1A 1HG0A 4CM8A 5E4FA 5DBFA 3WA7A 1Z2DA 1SHUX 2PH1A 3G79A 2JGJA 4RDIA 2GD0A 2DTEA 1I4DD 3IESA 4D56A 4YN3A 1TMKA 2JH9A 4JB0A 4BFXA 2YUIA 1DQSA 1M1UA 3JYQA 5MF6A 1Z4LA 3HGQA 2CMKA 4I55A 1E2JA 5JVDB 3H5WA 2V4MA 1F0PA 5TJHA 2C3PA 4ENUA 2OO7A 2F43A 3TVDA 3KYJB 5TX7A 4Z0HO 2OCAA 2XKKA 4ARCA 4EB0A 2QR3A 2G1UA 1E18A 2R6CA 2I34A 4GZ3A 2A1TS 4HDKB 1KP2A 2IDZA 2NW6A 4JLAA 4J0IA 4D9FA 3KRTA 3TBHA 4BFLA 2XZLA 3D54D 3CZQA 3PXBA 3LL7A 3F78A 3HKCB 4Q1AA 3C6BA 3ONFA 5C1IA 4I1IA 3ZH2A 3UWPA 3U61B 1N0UA 2VPIA 1ANKA 3DHVA 4L08A 4MGZR 3EULA 3U39A 2IHZA 4BS9A 1AF7A 1Z8NA 2DM6A 4I19A 4TRMA 3U1BA 1KYIA 4L6AA 2CYCA 5JH7F 5FAKA 4WXMA 1U65A 3T5CA 1WCXA 4EI8A 2QYHA 2IDMA 3PFCA 1GV1A 2Q99A 5H9WA 5F9HA 3AF3A 5BURA 5CURA 2EFYA 3Q3CA 4L8WB 4F04A 1KYVA 3TRHA 1UBNA 5I3ZA 5BWMA 3IPXA 3CG0A 2ZGVA 1GQQA 4Z53A 3LC0A 2CK3D 2QRKA 1CB7A 1CQWA 5IZCA 3L5OA 5BPHA 4ID9A 4E5PA 5FUQA 1QNFA 3FNRA 4K1LA 3NBZC 2EW8A 2WUDA 4HUJA 3W5AA 2IUEA 3ZH9B 4GD3Q 3FGOA 4KOEC 1Y82A 3OLXA 3KUXA 1I9CA 3NWOA 5KOHB 4BBAA 5JZMA 5I7FA 1TC2A 2LIPA 1AM4D 1BC5A 4D9EA 2W8ZA 4EDFA 4Y1EA 2I22A 2VRCA 2PM8A 3K72B 3KZXA 1C3OA 2WT9A 3IDSA 3AL3A 3SHOA 4DLLA 2GZRA 4ZJPA 1NGSA 3AHJA 4FWBA 4KDRA 4US2R 1KRWA 1KO8A 4QLBA 1CC1S 2NP6A 4JSTA 1G9SA 3N6XA 2GXUA 4MX8A 3PNLA 3WNQA 1R3DA 3FFTA 4HLUA 1Q0PA 4CKEB 5A06A 2IBTA 3P2MA 1DFHA 1ZC4A 2C3UA 2HSJA 3D0QA 2V03A 1R4NA 4OLJA 4F91B 2IL1A 2AKEA 3V46A 1A9RA 4KQJA 4L3WA 1CUJA 2A33A 3INRA 2D3TA 2C5GA 3I3OA 3JVIA 1Z6AA 2HBYA 3JARA 4EG8A 1UJ4A 4FU0A 3RT1A 1B6TA 1XZGA 3R74A 3PX7A 1A88A 2BKEA 3QHPA 4J91A 5KQLA 1YWGO 2H1OA 3GEEA 1ZHFA 2PKRA 4IIHA 2DPGA 1KPHA 4EJSB 4C4AA 1EM8A 4A03A 2C03A 4GKBA 3UK2A 4DZTA 2J0UA 1XRSB 3EOAI 3O1JC 2EJTA 3ANMA 4NDAA 2IYZA 4X60A 2VTBA 2PX6A 2HU8A 3BXXA 2W2PA 2ZJ4A 3UHJA 4J7CA 4DDKA 1LI7A 2A4KA 1O5OA 2ZQ5A 5FBKA 1N2OA 5JYCA 1WAMA 3DZIA 3LP6A 1NV8A 2D06A 3UGQA 2DETA 3WLKX 1OJ7A 5JH7A 1AX9A 4IW3B 3K0AB 1LVHA 4EW6A 4BRSA 3ZJ5A 3EUFA 2VDNB 5C4IA 3I0MA 3Q9UA 2PZKA 1CUGA 5ALZA 5A3QA 3ORHA 3B12A 4NMXB 5FA5A 3B5EA 1Z28A 1J9GA 3BWMA 3BFPA 1T5BA 3EF3A 4KX5A 2J3HA 1M34A 1P7YA 2CL0X 2HO4A 4IDPA 4TXMA 3U1VA 4UREA 2J5KA 3HVHA 3VYTB 4ETWA 4M0LA 5CT4A 4HWKA 3RYCA 3Q11A 2HMTA 1ZNWA 3X1MA 1PZNA 2QVCA 3PGXA 3X1ZA 5AVYA 5LL6P 2GF9A 1X7WB 4Y9SA 1HQKA 1VLLA 2AV6A 2NOAA 1E5TA 5ALGA 1IDOA 1P7CA 2BGMA 4EG0A 4IV0A 3HXQA 1XCBA 1C4OA 5J23A 1SC3A 4B75A 4M88A 4GEGA 4HVAA 4JLKA 4PZYA 5F21A 4DM7A 1TTPB 4O0LA 1KZ6A 3AR2A 4LISA 1Z4IA 3TMKA 4J1NA 1RIFA 1YQGA 3CLTC 3FHCB 4C03A 5FBQB 4UHKA 1PGJA 2YWXA 4FCWA 1JFFA 4IG9A 1EQUA 1M8JA 1M2OA 1E6UA 3U44A 1NG9A 1JN0A 3IRUA 2VDMB 3ZXYA 1XYGA 3LY8A 3SM9A 3L4EA 5BWOA 3OQMA 1ZU4A 3FW1A 3T54A 3EAGA 5HXAA 3KQNA 5KNDD 3T7KA 3TLGA 4CFYA 2X8AA 4ATNA 2AK3A 1LU9A 4JEMA 5F1PA 3ONNA 3CTPA 2E87A 2I03A 4WDQA 9MHTA 3HN6A 3KB8A 4F6RA 3D6JA 3VR4A 2BFBB 3EEYA 3IIEA 5AESA 4LF5B 2FRVA 3REOA 2NVWA 3JQCA 1X7DA 1ZL2A 3TECE 5F9FA 4P98A 1TW2A 3DLHA 4OV6B 2XDYA 2X2PA 4E07A 3G68A 4NHOA 2H9IA 4M86A 4HTAA 4MS4B 1VPWA 2JHFA 3EZ2A 1EG7A 3OQVA 2ZB7A 5G0WA 2OMKA 2OK7A 1T25A 2H9AA 5TPZA 1BHSA 4F4DA 2GEDA 4NBKA 2JK1A 3ZCXA 4KMOA 1X14A 3H2HA 4EUKA 2QNBA 3IIMA 1Q44A 4FE7A 2UAGA 3V8NA 2VQ6A 2FSGA 4CUKA 4ZI7F 3HCWA 5ALMA 4MITA 3ELUA 3C24A 1E69A 4FFLA 4U0JA 3GVCA 4ARAA 4F2GA 2P91A 1CJKC 3DCYA 3EIUA 4JN6B 4M8LA 1ZONA 1DXYA 4LWOA 2PYZA 3V1KA 1YOVB 1Z07A 4A8JB 4M9QA 1CKEA 2XUJA 1GNQA 1ECBA 1PR1A 5K2MA 5FJJA 1N5MA 1IZ7A 1KGSA 2AG5A 2PUCA 4G4IA 2PBLA 2N1BA 3CRNA 3IQIX 3QU5A 5JR3A 2DC1A 2R1VB 2WJPA 1KJZA 3I72A 4TXLA 3FPAA 4CIDA 2Y1KA 2AUMA 5SYMA 3K73O 1VI5A 5H16A 1O97C 5K4AA 2DUWA 4O2LA 5KTPA 1GUBA 5I8WA 4R3UC 2VJNA 1D0VA 1XXHA 4FM9A 3D7SA 1NZFA 3UNXA 2A5YB 3O2JA 4O4IB 5IRCD 1R3UA 4KBFA 1C80A 2FMIA 3E1SA 3IE0A 4AJ1A 5C4GB 4JNCA 4RKEA 3EVCA 5BMOA 3CUWA 4G8BA 4R2XA 2EZUA 2JI7A 3I6QA 4ZPJA 2IWRA 4N7RA 3EXHB 4QC2A 4DSNA 1RLTA 3HE3A 3PHGA 1MNAA 3ANTA 3ZEIA 5LP6F 4TTJA 3NCTA 2TMKA 3LWDA 1EI9A 1UEJA 2WJAA 1NJ5A 3QKTA 1N2CE 1N0VC 4Y7CA 3REFA 1EFKA 4IZOA 4QATA 2X6RA 4R5HA 5ES3A 1NWCA 2H4YA 4NZZA 5F64A 4MSUA 1BS1A 1K7CA 2PGLA 5EQDA 3BILA 3ZGOA 3THXA 3MUEA 1QRDA 2EOAA 2HJRA 2GAJA 1E3WA 1ZXXA 2QZSA 4LOLA 3OQIA 1UDXA 1EVJA 4ZO9A 4MA5A 4X00A 4HAYA 1L3CA 3KB1A 3SC4A 3TVTA 2QTTA 1U2PA 4M4SA 5BSFA 2A9KA 2O23A 3PDIA 3AM5A 2Z3ZA 1D4ZA 4B5LA 4BDTA 3BHIA 1R6TA 4S24A 3ROEA 2ACKA 1VA4A 1JDSA 5LMNB 2ZW9A 1O89A 1WIWA 3CINA 4Y1RB 1CJCA 1THZA 3FPCA 3AHIA 3QEMA 3Q8MA 3SC2A 2IOQA 2KI5A 1AKYA 1Z12A 4J2HA 4K87A 3UT0A 1U0BB 1PS8A 1ZXLA 3A05A 4K2AA 4UXIA 3DAYA 3VR2D 5I4KA 4CKBB 1BN6A 1ZU5A 3W5BA 2PZLA 4NZMA 5JWHA 4ZI7A 1M1YA 5EHNA 3ILSA 1V5IA 5G2OA 2WD9A 4YC7A 4DLKA 3CKKA 4W7SA 1GUZA 5CVEA 4BKMA 5FH9A 1Y42X 1AG9A 1MEEA 5KOJB 1MJNA 2QTFA 1MCZA 3DM5A 2DEUA 4ZCQA 3WK9A 3Q1KA 1MAVA 2N0SA 3P9RA 3DWEX 5SZIA 1V4NA 3QEJA 3GYBA 4WRRA 5CVUA 3HB9A 3WGUA 1N34B 4EUEA 2Y2UA 2HHHB 3HKBB 1CZUA 1ZP6A 3U3RA 1KYTA 1H2FA 1QH8B 2PJZA 4JOCA 1VLVA 1NM5C 1I2BA 4OQNA 1S89A 4AULA 3FWKA 7REQA 3D6TB 2C8VA 4M1SA 1DUSA 1CQIA 4N5DA 3LA8A 3LT0A 3CUEF 3PUIA 1T0IA 1Q0QA 1JQKA 2NU6B 4JBIA 4KE8A 5KVAA 3JQ9C 4BLRA 2WF7A 4IIYA 3RFXA 1DEOA 3H1BA 3HUEA 3MGKA 4GLFA 4L0CA 5J9FA 4O1MA 4CR7A 1BX1A 1YC2A 4X1IA 4DIOA 3UG7A 3F5SA 5LP6A 2GWHA 4KO1S 1O96B 5CDFA 2W6ZA 3L4JA 4YJHB 3KKEA 4MYUA 5FCDA 1P60A 2PZ8A 1U90A 2E1PA 2W2OA 3LSYA 2O59A 2I3AA 5D3QA 2Z5GA 3L6RA 1OI3A 1JT9A 1F8FA 2R0QC 4HUQA 1IAVA 1CF4A 1HTTA 1IBCA 2I2WA 3I0ZA 2FSPA 3RD5A 5JY1A 3KHUA 2FW6A 3CSDA 3FTCA 3TI9A 4X44A 4CDGA 1WDTA 2HF2A 1ZLXA 3NT2A 2R5NA 5IT0A 3FDIA 3OHPA 1R8JA 1W35A 1ZZGA 2A35A 2G76A 3DQPA 5FJIA 1K5PA 4C89A 4ILEA 1T5HX 5HKLA 3JD1A 5IEJA 2DX7A 3N39C 3LDHA 3WTCA 4BVEA 2X0IA 3JPYA 4M49A 3LX4A 5CH8A 4KV9A 3S27A 1HQYE 4OL0A 4CIBA 2QQ0A 3VJRA 3G0BA 2G4LA 4GPTA 3DUFB 2X19A 2X9LA 4OOFA 1QPBA 2QNIA 4UUPA 2FPKA 4XJVA 2NUAB 4UPVA 3SOZA 4NY1A 3NS7A 3DDSA 2AQHA 3CPHA 4O5AA 5JO0A 3VH2A 2ZSJA 4G2NA 3P52A 3V7NA 2PRJA 4A10A 1GR1A 1B8OA 5C32A 4YCNA 2XIQA 3L49A 1D0IA 3BGOS 4ZV4A 4HXYA 1QG2A 1G5TA 3OPVA 2PEYA 3O1LA 2V7XA 4DLUA 3O7WA 5B53A 1SN7A 3D0RA 5ED0A 3A70A 4EHHA 2G63A 2QUKA 2XGJA 1DIHA 1G98A 4QDKA 1P0PA 4MKHA 4RIGA 5CEJA 3OKAA 3U4MA 1R9MA 4KMSA 3CCCA 5KU1A 3IP6A 1RYYA 1RLIA 1YIAA 4LY9A 3ZDRA 2PIAA 1IN5A 2ILTA 2F2TA 2HJHA 1L5GB 3ZU3A 4ETNA 1GTMA 4Y0AA 1I5OA 1F5SA 2SHKA 4OKIA 5HPYB 4FI3F 5AW1A 2ONZA 1ZVMA 2R4UA 3UXEA 3WA6A 3FR8A 2PUAA 4KO2S 1HORA 5LPNA 5BOVA 1JQLB 4KQ2A 2IV3A 2Z8XA 4BV2A 1IN6A 3HJCA 1DVRA 3ITNA 3K9QO 3BSYA 4X8OA 4WT7A 3RWBA 3DL4A 1P9NA 2WJ6A 5AJWA 4DMUB 1PEKE 4FDLA 4G09A 2QNRA 3EXG1 2IBMA 1E6KA 3N87A 1C9MA 1WXHA 3CRVA 3K9GA 2VPTA 4HRYA 4YRFA 4HVTA 4B83A 1IUKA 3P9CA 1OVGA 3ZI4A 4OYLA 1KWKA 1TM2A 5FKJA 3DV2A 5FRDA 3T3PB 1KETA 2QSZA 3UJCA 4RACA 2CKDA 1OLOA 2MHCA 4KFSA 2A1TR 1CIPA 1PS0A 5J2TB 4M54A 2D2FA 2IF0A 1K5DA 3IOMA 2HIHA 4ITUA 4NP6A 4P84A 1HFKA 3NWPA 2MWMA 2QJTA 3GFSA 4FYPA 2NXWA 1VJ1A 2FRDA 1ZVVA 5BN3B 2XT0A 2WQ6A 5A7HA 1WZCA 5LUAA 1I2CA 2NO7A 3HJFA 1U6JA 5ALYA 1HXHA 1S7GA 5FUVA 3UFXB 2J5BA 4U3JB 3BE8A 4Z8XA 5BR4A 3K70C 3LMKA 4X41A 4LF9B 2D0IA 1G7TA 2DUMA 3TQTA 3GEPA 2HC9A 5LA6F 2P62A 4U8GA 4CMIB 4MOWA 5IXSA 4PANA 1O8CA 1UEXC 2Y93A 3EG5A 3IO3A 5T64A 3V8MA 4KMRA 2R7MA 4V1CB 1KKMA 2RGBA 4OTZA 5BXQC 5LZ4A 4DSAA 1JUDA 5JHHB 3H16A 4JEHA 5EXTA 5A1TA 5HZGA 2Q4RA 3NHRA 3SG0A 1T1JA 1W581 1W73A 2QLBA 1ORTA 3HJAA 1DAGA 1UPXA 2FUCA 4RAOA 4BPRA 3BIXA 4OX9B 1IB0A 3A4NA 1LKZA 5TQ0B 3BFJA 1QAQA 3D6MA 4AJJA 3KK0A 1XRRA 1ST2A 3EQ8A 1CP3A 4HNUA 5F52A 4EQZA 1ZIDA 5F23A 2VDUE 3B3GA 4E94A 1ULZA 3W78A 1I3KA 3FCEA 4EF5A 4UCWA 2UKDA 4DQDA 1T34A 3IMGA 2BI8A 3OTWA 3M8KA 5B36A 1I01A 1U0OC 5KS2A 5FQNA 1FVXA 2WK1A 4E3ZA 3ZTWA 1R8XA 3PWKA 4WKGA 1ID1A 2V7EA 5IAGA 2XAUA 2PUDA 4LFAB 3IT3A 1G17A 1EM6A 4MQFB 3RUEA 4E51A 4Z1MA 4EFDA 3NAGA 4MYSA 2E4VA 3WYGA 5CHYA 3JQAA 4TX1A 2J3KA 1WU7A 1JHAA 3OLWA 4RPJA 3UTDA 2PHZA 1FRQA 2PTHA 1J2TA 1OAOC 3LBIA 1MAUA 2BM8A 3KG2A 1USVA 2AUTA 2GFIA 4ZANA 1T8YA 4KQ1A 4DY6A 1LPBB 1O6BA 3N75A 5CPFA 3VZCA 3ZW7A 3NRCA 4YRNA 3EPKA 3EPHA 3UO8B 2OFFA 2YJ3A 4BFCA 3IBTA 1Z39A 1JBEA 1KYXA 2XTZA 1IL0A 1U5BA 4JY7A 4U00A 5MGBA 2ZU6A 1L3BA 1NL3A 4NWIA 1VL2A 4HB3A 2EKPA 4RJ2A 2ZAGA 2UYQA 3HDHA 1XWIA 3M33A 1SUWA 3ZY2A 1RXVA 3ADCA 2R44A 3B13B 1P9OA 1VGRA 2GAAA 4GPD1 1J6UA 1FRFS 2I67A 3OQ1A 4LV6A 3CEAA 3L8EA 4MDEA 3A1FA 4LJ4A 1XNGA 2BI4A 2GBLC 3N74A 2BEUB 3IVXA 3PK0A 2D8MA 2PGIA 4F3NA 5LWQA 2YYZA 1XLUA 3SNKA 1I2ZA 3C3WA 1G8HA 1CBUA 1L5OA 3IBCA 4I6JA 1SXJD 4MHSA 5LA6A 1R6AA 3IQZA 1DXOA 3UT5B 4Q4CA 1KTVA 4UBIA 2IY7A 1GNRA 2VDJA 4BNXA 5DCLA 4DV0B 1T5SA 4FGZA 1FFCA 4O6VA 1FPMA 3JZMA 3AK4A 4Q4JA 1O03A 3VYWA 1XMQB 5C7IO 1F4LA 1NJSA 3HBJA 4JUAA 3PPIA 1PJCA 4P58A 5G4LA 1F5NA 5DWDA 3KSBC 5ALDA 4OQLA 4XLLA 5E8JA 1YRBA 4HX2A 3EH2A 2ZYSA 4BLUA 1I33A 1F1JA 4ROTA 5J5CA 4G0UA 1QJ4A 1KP9A 2GHQA 3DBOB 4FINA 1WMSA 1I32A 5GM1A 3WO1A 4BLVA 4B73A 3FCAA 4PR3A 1COWA 5ALPA 1CUVA 3VDNB 5EJ4A 5JD5A 1XQ6A 3WOHA 4XSHA 3T1VA 1IHYA 1RYZA 5G3ZA 3P71T 3HABA 4QXRA 3NCHA 1T0UA 1XQYA 1M3SA 1IBMB 4QAQA 1G21A 4WV3A 4AJIA 2I76A 4LOKA 4MW5A 4U7PB 3KSMA 5HF5A 3J80A 1SUFA 1KDZA 1CUSA 2VDOB 3N7TA 1YZQA 3DE2X 4ZCSA 1FF9A 2V3CC 3K0CA 2C7OA 3D8SA 1ECLA 1Z74A 4J2TA 5DHRA 5CFZA 4XFJA 2IU0A 1FBTA 2PQMA 4O4LF 1YQUA 4NF2A 3DTVD 4IJMA 3LUJA 1ZMRA 3PT5A 3E5NA 2UZ1A 2VZEA 2WILA 3AQIA 1IZ8A 3I6YA 1TAQA 3H75A 4EY7A 5I7EA 1ILWA 1J2UA 2ZYWX 3L7LA 3DL0A 3GH3A 3ANSA 1XMIA 1ZXBA 3DBHB 2DTXA 2VF7A 2BMAA 2RMKA 5C7OO 1GARA 4LHSA 2YBEA 2BJWA 5SZKB 3WIUA 1SMKA 4XVUA 2XW6A 3HSKA 3L8HA 3EWNA 1TAUA 1FSGA 1XF1A 2JIRA 2PQ0A 3AJ8A 3DLPX 4URUR 1N2IA 3T3EA 1UQTA 3IMCA 1PTJC 3TPFA 4D96A 4GM1A 1LVGA 1G8KA 2VEOA 1AVTA 5HKAA 7YASA 1UKVY 5EIOA 5ITSA 3L3BA 3KTFA 3EFOB 2R8BA 3OX2A 3C6YA 3WNVA 3Q85A 3ZQJA 3ZCVA 1N57A 2ZYDA 4D74A 5CB4A 2VJQA 4R7GA 4LCEA 5KWJA 4MMYB 2E7ZA 4GT1A 3SCZA 3C4QA 4GLLA 2CMDA 1R9NA 3GUVA 3TL3A 1CTQA 2P4SA 3T3GA 2W48A 2D6FA 2QXYA 4MMZB 2O8DA 9GPBA 3QPDA 5DT9A 2I7XA 3WFZA 2YC4C 3IUYA 2Q6KA 2IP1A 2SKEA 4ZRMA 5KDOA 3VRHA 2B4RO 4N6OA 4TLMB 4DYVA 1H0RA 4MI3A 4EL5A 2XBMA 1XZIA 1KMHB 1SUBA 2EZ4A 4ZAGA 1PKEA 5CX1A 4D8WA 4DC9A 1RQ7A 1FMTA 3IV7A 3M70A 2B1RA 4QL3A 4Q9DA 1TGVA 1GCIA 4I9NA 2HLPA 2PMFA 4F7WA 1GVNB 4M1QA 4KQMA 2IGBA 5F98A 1LQ2A 4WKNA 4HGPA 4IFEA 3H5AA 3AHHA 3DHWC 4LN1A 4I8XA 4AX4A 5IAAA 4ZYYA 1TZ2A 3K05A 5IX8A 3DMHA 1BHQ1 1P0IA 1PE0A 2QSYA 1QLHA 2Z4SA 5CYFA 5B3JA 3WK8A 2ATVA 2SBTA 3GEGA 1QHNA 2IEDA 4B45A 3NH9A 1BS9A 1A5BB 2C4HA 2W6PA 2FP4B 2Y05A 3H99A 4MAMA 4MJ7A 5AKHA 1QKKA 5HBGA 2XCUA 2XMDA 2JGDB 1VPTA 2RCNA 2FPSA 3H05A 2GSDA 2REBA 2XHEA 4BO4A 1ZW1A 4RD0A 1JALA 4MR9A 1FMJA 3FWNA 3H8WA 1Q19A 4BIIA 3KXPA 4GYYA 4G5OA 1NP7A 1UC8A 2VJDA 4Q3DA 2HU5A 1D6SA 1Z0JA 3ZWYA 1OYOA 2DMRA 4Z4EA 1JIXA 2HM7A 3BSSA 2Y67A 4K88A 3UC9A 5JI2E 3OE1A 1C3XA 4R2WA 1FNCA 1JE0A 1JMVA 2W9XA 3H2KA 4G41A 4LVNA 3B1ZA 4OB6A 1Q3TA 4MWDA 1DPFA 5AXBA 3VR3D 5B30A 1QWOA 1I8TA 2AN3A 3ZJYA 5B2ZA 3MJDA 4H08A 1YXMA 1N32B 5AW7A 2OM2A 4QNRA 1TUIA 2I7TA 4X62B 3VA7A 4H15A 1EDEA 3UB3A 3G8AA 3FPEA 5DU2A 1Y98A 2AMVA 1BDMA 2ZRQA 4EMUA 3KEMA 3MOSA 2C98A 1X3LA 3DT9A 3ML1A 4PFKA 3IAFA 2G8LA 2AOUA 1LDMA 3FUWA 3OE7A 4GSKA 1QJCA 3F90A 2X1HA 5IYZF 4CN9A 4J0HA 1IEQA 1JR3D 4TTQA 4B33A 1DFIA 3QUBA 1ISSA 2BGJA 4KGZA 4MUGA 5CT6A 5DNUA 1H8ED 2WTNA 3MMPA 1VJGA 2P35A 1KARA 4KWCA 3ESDA 3RV3A 3SC3A 1QQTA 4AJKA 5DCYA 4TM8A 4KH0A 3IAUA 2AYXA 3KLMX 3OE4A 3SZ3A 3FTQA 2Q6TA 3INGA 4MUIA 1HDXA 5F77A 3UBTA 2X2EA 2JFYA 2CN1A 2CDAA 2DHRA 1FQJA 3KQPA 2IV7A 3N86A 1FFEA 2DT5A 4URHA 1YC5A 1TMYA 1C1DB 3IUEA 3PGMA 4NONA 1QYCA 2KYRA 1Q57A 1SQGA 3R5KA 1W6RA 4OU4A 5AUOB 2FPXA 1HMPA 2P5YA 4ZEXA 3DDCA 3CEPB 3QG1A 3O95A 1VP3A 4LOJA 5EQJB 2E4YA 2G4CA 3GWZA 5IW8A 2PS9A 2ID9A 4TYMA 5DX8A 4GUAA 1GUFA 1W4CA 2BCEA 2PBFA 3Q3HA 2B98A 3U62A 3U7QA 2O8EB 3V34A 1QGOA 1WA5A 1QVRA 2IYXA 2OQVA 5JAHA 2P5SA 2WSSA 1BGXT 1NUPA 2I5PO 4KWHA 3WVNA 2Y27A 3AZQA 1M34E 3HKEA 1B14A 2WWXA 2ZS8A 1VG0B 1JI0A 3D8UA 3DVLA 3LA6A 4QOIA 3GMIA 1H05A 2PL9A 2GLTA 5CTAA 2I1VB 4H35A 4B8ZA 3DPIA 3H83A 1ZOPA 1C8VB 1ZWLA 3MJTA 6PFKA 2JA1A 2PO7A 3KAJA 2ZUFA 1EWYA 4U7GA 1E66A 3F9IA 1W88A 1ZUHA 3BF8A 1MJGA 3G0DA 3HTXA 1IPEA 5CVJA 3TUIC 1A9XA 1PVDA 2XRFA 2YWRA 3WGMA 4C05A 3VOTA 4WEQA 3DNMA 1P91A 5KEIA 3RWMB 1ZKDA 4P7JA 2W6CX 2Y1EA 1OLUB 4P54A 1T3SA 2CMHA 2ECQA 4DR1B 4KQKA 2ZCJA 4TZ6A 2AQKA 1Y48E 3RW9A 1DKNA 4G0WA 2B0JA 5IYZA 5HW0A 1X8XA 5TMPA 3C6KA 2PXHA 4OP2A 2VT3A 3TM4A 4QLOA 4Z7NB 5LKAA 3STYA 3VVCA 4PNPA 1YE8A 4LPKA 1BCSA 4RSMA 4TS3A 2PX3A 2F8SA 3ONEA 4Q19A 1VYVA 3M82A 1P3DA 1JNYA 4WLEA 2QM3A 5C3UA 5BN5A 2YBDA 2J33A 3GP3A 2XZPA 4MV0A 4ZOEA 4B84A 2ZE7A 1ZNYA 2OECA 3QW4B 1RU3A 3FWHA 3QMMA 2QGNA 2H1WA 2ZVJA 3DV0B 4QT0A 1RJ9B 1RHKA 1ZY2A 5LQCA 4P93A 1S02A 1JAZA 1QGZA 3G2QA 1MXFA 2DKFA 4UAGA 2EP5A 2H2FA 1T2FA 1NBAA 4KAXA 4TKUA 4WA8A 3PE6A 3SJAA 4C04A 5H1YA 4HDSA 1H9BA 2IEZA 3NWBA 4YUYA 4F2DA 3A6PC 3SEZA 1VB5A 5JSZA 2O2ZA 4ACBA 2CFIA 1N6OA 3F6PA 5SZHB 1NVDA 5IZ4A 2CSXA 3A6FA 1YU6A 3FPBA 3RBAA 4YB8A 1RQ2A 5JCZA 3WJAA 3E7DA 3TKYA 3SQXA 1MVNA 4HGYA 3JR3A 5EEGA 1FNNA 1HA3A 2B7BA 2NUTB 1JH8A 2EBHX 3D4PA 2YWHA 1JR2A 3O94A 4IFTA 2J9FA 4YONB 4DEYA 3JQQA 3PE4A 3CCFA 1BE6A 3ZYZA 3SHVA 1C4KA 2GPBA 3AF4A 5AK3A 3K20A 1IXYA 3A6LA 1MX1A 1FVFA 3HBNA 1B26A 3JQBC 1RYFA 2A9PA 4BUCA 2P4EA 1YZNA 3MWDA 4PAQA 4LSGA 1DPGA 2GWRA 2O2GA 2XJ4A 2G5CA 5L3QA 3EVNA 1JA0A 3U6BA 2IY8A 2RGGA 1CG6A 2R6JA 3FH0A 3T7CA 3LVQE 1QYVA 1SXJB 2H8KA 1KI8A 2V8OA 3GT4A 3JD4A 2DBVO 5K1ZA 4LE2A 3LCUA 1QFSA 3SP1A 3OPYA 1VGVA 4FUQA 3ZZMA 1TUGA 5I4IA 4RKFA 1QIKA 1PK9A 1O95A 4F46A 3OAAA 3W1WA 4ISCA 4X84A 3HU2A 1K63A 4C4RA 5FOTA 1XC7A 1QG4A 3SSNA 4WEOA 3ZZNA 2FV8A 3N0VA 1NBEA 1WDKA 1CR4A 2Q8QA 4FIZA 2B21A 3DD5A 4FNOA 1X3SA 5JWOA 1AOXA 1YD7A 4L5JA 4HC4A 4MYCA 5AOVA 5ADHA 3ORRA 1JEQB 4ZK2A 3UHFA 3EMBA 1QCCA 4NI5A 4BO6A 4G5HA 4AUNA 2ZYGA 2MR6A 3ANXA 3C0KA 3OA2A 2XUOA 1T0PA 1OC4A 5C3MA 1XAJA 3N8KA 2ALJA 3NHZA 1K7YA 3H0EA 2FU5C 2RHMA 5CDHA 3HCDA 1TO2E 3U6KA 4ZTZB 1OB5A 3N2KB 4EX7A 4OHUA 1EP2B 3NM5A 3P4UA 2WJYA 2FCRA 5JJIA 1SU4A 1N4AA 4XM2A 3WHIA 4LJYA 5FDFA 1JKJA 3BZWA 4J03A 3S2FA 1R0BA 3WXMA 3K15A 3I09A 1M1NB 1RAHA 3VZQA 2FR1A 1GV0A 1M1YE 1BH6A 1MB3A 2ZI6A 3DTVB 3GD7A 4GI2A 4I1RA 2RH4A 1BOFA 3E4DA 5T57A 3W5VA 2XCRB 1GAXA 2G1AA 4K9PA 4JVNA 4UBJA 2ILVA 1T4GA 4FCVA 1NKSA 2OHXA 4DBZA 5I4BA 1IN1A 3A3YA 2EKDA 2GVZC 3VPSA 3WI7A 4DPKA 4E4YA 1YDMA 1XVIA 3BMQB 3GD5A 4IVRA 4EFNA 3PUXA 4DUPA 5HOEA 2BLLA 3HDVA 3ICEA 1BDJA 2VPYA 3UXHA 3AVTA 1VLMA 4ER6A 3QVXA 3JVVA 1PYDA 1HY3A 4V03A 3TTWA 2RGNA 3CIOA 5EXDA 2D1SA 1HMYA 2VI5A 3RUCA 2CVQA 5HM8A 1SKUA 3MWGA 3WLPA 5CGZA 3D0KA 2CBGA 5LXTF 2Y99A 4YMVA 1HPLA 3LUPA 5C37A 4QAJA 2GN9A 3X1KA 2O14A 3PHLA 2WFZA 4IUYA 1Q2UA 3R9IA 5E0KB 2DHEA 4CR6A 3Q2KA 1A04A 2CJFA 3UZUA 3GJ3A 3L4BA 2UZ3A 3RRXA 4BGUA 2YV2A 4EKIA 1Z25A 3ANNA 3PTAA 4FNMA 4CWAA 4N65A 5CDFE 5KHOC 1ZCZA 2I7DA 5K4HA 4PYOA 1B0UA 1UODA 3PDJA 4OFBA 1J5PA 1L3IA 3A9WA 3JQEA 3RKRA 4EY3A 5JCOC 3N0TA 3GYGA 5TQVA 1ILEA 1VMIA 3C3XA 4KJXA 1FTWA 1RMTA 1VXOA 3J7AC 3G2PA 3HR7A 1GZ7A 5THKA 1WXDA 2EC5A 3LXUX 1WDMA 4FVTA 2Y2VA 1WWKA 1YO6A 5FBWB 4DJDC 4PIVA 4K2HA 1BD3A 5HIJA 1OWOA 3QSYA 3RSQA 4RPGA 1PZGA 5F2KA 5HGJA 3N8NA 4CYMA 1OOEA 2QW8A 4HBZA 4AQYB 1OXMA 2C7PA 1MQ8B 2ZULA 2VG8A 1FCJA 4I1VA 3S2IA 4LJRA 3K32A 3RASA 1ZD8A 4XWYA 1P9WA 1ZUWA 3H5OA 1B0AA 1H2HA 4LXIA 4WNAA 5DNDA 2C29D 1ZINA 2RONA 3SJUA 4KBYA 3I32A 2CY0A 5F3RA 5DLQC 2MYPA 3RYHB 4R4JA 4RGYA 1UUFA 2ZIAA 2AX3A 1ZGZA 1YZYA 1FDIA 1J1IA 2IYSA 3C8DA 2Q7XA 2QTWB 3NC0C 1IY1A 4LDNA 3G2NA 1IN7A 2LW7A 1O3YA 2WPNA 2X7XA 3F96A 4FFNA 3F4BA 4LV8B 4RV9A 4CKCA 1L9XA 4Q24A 4MVJF 2P7IA 3ZY3A 2XQVA 1SKBA 1UT6A 4BJ3A 3RB8A 4D8TA 4LYHA 4JDUA 1U7UA 3HBMA 3C2QA 4R3WA 1K0FA 4FYVA 2IE0A 4CI9A 2IW3A 3SSMA 4LF7B 3W4JA 4IXMA 3X1DA 3PQDA 2J7PD 4GC9A 4KNVA 5EZQA 1NBWB 1HEYA 2GM3A 3IYLW 3LQYA 3QKIA 3GMDA 4J6FA 2DRIA 2QT1A 3QU9A 2GYYA 2YHIA 2GLUA 4KQEA 1YDWA 2FDRA 4RMGA 1VOTA 4PCLA 3NKLA 2NZ8A 2OHHA 2CVOA 1VKHA 5LXTA 2CUNA 3IPLA 1V6SA 3LT2A 3IR5A 4IDHA 5I7RA 3LQ1A 2V45A 2J8ZA 4J9UE 4WTOA 4NOLA 2Q1TA 3NV9A 3RC3A 1GGHA 1L4NA 3FNEA 3KJXA 3COJA 4P80A 4YXWD 5A5FA 1MV5A 1TK9A 4RH1A 5C8YF 1CNMA 4Q01A 4DTCA 1FK8A 4OQXA 5EIBC 3Q0TA 4FD2A 5FTMA 1Z17A 4P3OA 4A92A 1IH8A 3EXEB 1TJNA 4Q3EA 3EWIA 3OQPA 2PANA 3OKPA 1XV5A 3HYNA 4NBVA 1VRVA 3FGNA 1Y3BE 5EJ7A 4I5FA 1SOUA 3RVLA 5FV7A 4Y2RA 3PC3A 4EEXA 3D3NA 1NLMA 2AXNA 2XEDA 1UWVA 4UNSA 2AFIB 4NKRA 3R40A 4OUDB 2RHDA 1IBKB 2YL2A 1W0KD 1QLWA 3F4KA 4N3NA 2RHGB 2OLKA 1JYFA 4MV5A 4B3IA 4DLRA 2W2LD 4IPTA 2LKDA 2OTCA 3VAAA 3NBYC 1BDHA 4K6KA 4BNMA 2EZ9A 1P2SA 3ZVMA 2BBWA 2CW5A 1MNQA 1QK4A 2R1TA 3ICWA 4ZYWA 5EJ9A 1Y6QA 5AVRA 5I7WA 1CZLA 1Z7YA 3M1LA 3RYIB 8ABPA 4N8SA 2VHUA 1IM2A 1YMQA 2C92A 2WYOA 3DF9A 4I4NA 1J42A 1HYQA 1ODLA 3D6HA 1AQLA 1NQWA 3IOYA 3W04A 2C9BA 4UM5A 4E2WA 5T4FA 3T3IA 3AC0A 3QP9A 4LA4A 4ZU3A 1E5VA 1SXHA 2J9RA 4XPIA 4MVJA 3H8VA 1VL8A 3T41A 3NDPA 2BT4A 3TD9A 2YWEA 2N3ZA 4IEIA 3MSCA 4QHTA 3IDFA 3GNQA 1Z7BA 2G6TA 1P1BA 3P0HA 4CQMB 2D13A 4TSKA 4TYNA 2ZBDA 2WTMA 3ONDA 2RJ3A 3R6TA 3QVMA 3FOCA 2FGJA 1U8ZA 2VF5X 1HNNA 1KQNA 4AZ3B 1LV7A 5HQ3B 3K1AB 5BORA 2IHKA 2HZBA 3EB9A 3I04A 4JR2A 5ALFA 3OZUA 3WGYA 2B2XA 3IILA 1Z8DA 4OMUA 3ROXA 1IZ0A 2LRHA 4LDZA 1TM3E 3I61A 2Q3CA 4Q7KA 2D5CA 2YWGA 2OXTA 2GK4A 4Z1OA 3I01M 2RH5A 4YRZA 4DCVA 1C3EA 3AJDA 5DXJA 2JL1A 1H8HA 4LJAA 1S2LA 1MT0A 1D7AA 2B0CA 2WE8A 3CW8X 5C8YA 1Z2OX 5COQA 3PEWA 2ZYIA 2QKYA 3NIFB 4L76A 4MP6A 3JQGB 2OGWA 5ALEA 4AVYA 4CEHB 3ED5A 3C1OA 3L7DA 1NR5A 3UAXA 4GSYA 4OQEA 3PLNA 5BOSA 1A9YA 4G67A 4KIGA 4RH3A 3RBVA 2B30A 3VHXB 4DIBA 3VV3A 4L0MA 3AUYA 1NX9A 3EK2A 3IC5A 1GDHA 3PHBE 4FXPA 1NF9A 2JLBA 4KLNA 5TLSA 3H18A 1S7CA 5D3MB 1Z08A 1DAHA 2BFDB 4KQXA 4DNOA 3VR6A 3MA0A 4QXPA 3T34A 621PA 5B1SA 3X1JA 2WTAA 3OX1A 1ETHA 1YR6A 1M1XB 1GPYA 1YHNA 4N03A 2IEGA 4RH0A 4PO1A 5C8ZA 3O9MA 4UW9A 4OQZA 1JTVA 2A7QA 3DP9A 4HXFB 1NHGA 3E0QA 4KWTA 3G5MA 4QX6A 3FVRA 3FHJA 4ZT7A 3TVYA 3ZCQA 1GKLA 5KOJA 1MQSA 1UBGA 3F71A 4L22A 3N58A 2IXAA 5HX7A 2AN9A 1MC8A 1P1RA 1YB5A 2IHYA 3IS3A 1EHIA 3QEKA 1EXMA 1UBRS 2HFJA 1U9ZA 3QVTA 4H27A 4IBOA 4RK1A 1MUUA 4Y6QA 1Z5VA 4X1YA 2CGEA 1LDEA 2WJ4A 3M3PA 1MC5A 1V0JA 1Y4DE 3ZE2B 3LS2A 1XU7A 3VVLA 1S2DA 2J85A 4RJTA 3VKFA 3ZQ6A 4C2TA 2D59A 1TUBB 2EATA 5CXSA 4A23A 5KX5A 2JD2A 4E15A 4Z7OB 4YJ3F 5CBPA 3QX3A 2K87A 1LTQA 4L9WA 4CCSA 1JWBB 3M6LA 4KLAA 3N2NA 4NYIQ 3NUZA 4QU5A 4OI2A 3SZRA 3A1EA 4IS2A 2PUWA 3H2IA 1YRLA 1FL9A 2EW2A 3SIRA 1YS1X 5DPMA 5ER6A 4QODA 4GOOD 1G21E 5AM2A 1WCV1 5E3HA 2RARA 1O8BA 4YFVA 1SCDA 1VC2A 2C42A 2AB0A 1VJDA 5DW0A 3WZLA 1G16A 4D1YA 1LVUA 3VZRA 4LXGA 3LC2O 4OFXA 3H11B 3ITEA 1UDAA 3PQ2A 3LDFA 1GTRA 3F6SA 3O90A 3P0JA 3VPFA 1ADBA 1YVEI 5E1BA 1VYUA 2W2XA 1AHNA 5JVDF 5HWSA 5B7QA 1DRUA 5K45A 4IDNA 2EXXA 1H9AA 1YJ8A 1N6PA 2HBQA 3GT7A 1V43A 1MO3A 4YAFA 3JQ6A 2M32A 4P53A 4AK9A 2QQ5A 1ODKA 1E96A 2VYND 2QDKA 4KQWA 4YUVA 2WTUA 4E7PA 1BWQA 1U0FA 3I8XA 3O74A 1TCUA 3X44A 4HQ6A 1K2WA 3K35A 1GSIA 1JH9A 2OQIA 3MJFA 1XK7A 1DT3A 3EVDA 1X8KA 4KPYA 3QU2A 4JP1A 3IKVA 3STUA 3QVSA 2W70A 2DUUA 5EUQB 3DJFA 2Q2WA 2BZ0A 2C4MA 1PX2A 2I1LA 3KLOA 2UZIR 1AXGA 4M76B 1J70A 4FOPA 5K0TA 3CISA 3K71B 4G5SA 4DV6B 2H4JA 1IHPA 1FIUA 1XNHA 3EYAA 1LPPA 4CMKA 4TYYA 4HN4B 1OR8A 4JVSB 4NCHA 1ZN2A 1NI4A 4BVBA 3A1VA 3WK5A 4EUSA 5AKKA 1NN1A 1PCXA 2KLHA 1J2RA 4DIUA 5BQOA 1XFDA 3O4HA 3UAVA 4BX9A 1E6EA 1PQPA 1R0ZA 4IGFA 4QICA 3RS2A 5LQJA 5DBGA 3JX9A 4G4SO 4YJ3A 3SMVA 2KJQA 4BO9A 5DE3A 2BMWA 3LFUA 1GY8A 4OHPA 2H11A 5JI3E 4E03A 4IXNA 1D04A 1F48A 1Y1PA 5B7GA 1BX3A 5EJ5A 4Y2PA 5JFTA 3CE9A 3NOXA 2PT6A 4KE9A 1HFWA 2IIQA 5H7XA 5HKOA 3W5IA 5DHPA 2AF4C 1NURA 1UXKA 1UWCA 2RGCA 4Q4DA 1PU2A 4RPKA 5FOXA 5J40A 4E32A 2GJSA 3ZWKA 4NCBA 2VDLB 1SVNA 4B4VA 3GRYA 1KKLA 1ZGHA 2ZTUA 1LBSA 1GG9A 3BKXA 4REQB 5CDSA 4LVUA 3DFZA 4Q0MA 1MG0A 1AKMA 2ZPAA 2R1ZA 2GLXA 4EY5A 1KI7A 4IQGA 3PNPA 4YCJA 1GRRA 3RROA 5JVDA 5K3SA 3ZD7A 4TVKA 1FJXA 3F8TA 3IBYA 1DO2A 1CHDA 2CCJA 2C3OA 2W5UA 3M9WA 1X6VA 4NEHB 2AXPA 2EJBA 2QSJA 2QLTA 1NV9A 4WY8A 1H4TA 4YAWA 3VHLB 1KDTA 1FFDA 3AB7A 4ETMA 2BW0A 2GM9A 3OZWA 3WSVA 4L6CA 4Z7JA 3FDXA 4JB2A 1J2EA 2J48A 3LHDA 4HDKA 4LWZA 2I4MA 2XKJE 3H2GA 2VKQA 3H3JA 1O6ZA 1YR1A 3BE4A 1ONNA 2R7KA 4HDRB 5K5EA 1JVBA 2B25A 4XQ0A 2VJLA 4B3TB 2JZCA 1U8TA 1OV6A 4HWSA 1QO9A 2YMPA 3HKCA 3C74A 4Z54A 3RODA 2OHGA 4S1TA 2HA5A 4EM6A 4G8JA 4MVJH 1P7PA 1P1KA 2XVAA 1WG8A 3KNZA 1KYWA 1O4VA 3B3AA 3IEPA 3Q3EA 3HCOA 1PT9A 2YVAA 5DTQA 3W05A 5AUNB 4QYSA 1TU0A 1NXOA 5KWVA 4JD5A 2JIPA 2W6IA 5IBCA 1N7IA 2IF2A 3C16C 4L15A 4ZV9A 5IP5A 1HE1C 1Z34A 2MR5A 3I5YA 2PLNA 2W83A 4IIFA 2ZANA 3PZBA 2RKBA 3R3WA 2G82A 1GKUB 4E2FA 4BGIA 4LWPA 4AZTA 1YCDA 5B6PA 5D3ZA 5JT1A 3KPUA 1UBJS 1V25A 3M6VA 4OHYA 2NYUA 5IMBA 1QV7A 1R37A 2WIFA 4UMFA 1BKYA 1I2MA 3FI9A 3FJYA 1WF6A 3LFHA 1JFSA 5D84A 4P38A 3KKQA 5KOHA 4HVLA 2NO9A 4Y6OA 4MYRA 5DW3A 4PGFA 2J9GA 3RFVA 3DOOA 4W6ZA 5SY4A 3V2GA 4E5MA 4DSTA 2NUPB 5FUXA 3PUKA 3H7IA 1QF6A 3ZD9A 2Z6QA 5F5XA 3FSJX 2WAXA 2HA4A 2BFAA 3SYTA 2JKVA 2C78A 4PS1A 2EFJA 2QRNA 2O5CA 5JXHA 1F8GA 1U7DA 2GAIA 3A1TA 3BEDA 2FH5B 1N25A 2HT6A 3H2SA 3HVKA 4GXNA 4HH0A 4KU4A 1J49A 4MNTA 3GHYA 4XSGA 3AUUA 3ZYCA 1TM1E 4CKEA 3VR6H 4QJ3A 4EZEA 1N8SA 2G17A 5FPPA 5E4JA 1DOHA 4MWEA 3O8QB 1ZM2A 2V4UA 4EHAA 4GRAA 4KKVA 3GLGB 1IOLA 1XCMA 2X3FA 3GRRA 3KQYA 5JXWA 1FB5A 4RTLA 3R6DA 4MV3A 3ZOKA 1UBKS 1RKUA 2FN9A 4RGQA 4CLXA 2W6JA 1AGRA 1Z0ZA 4CLRB 3W90A 3WWCA 2NSDA 4U2KA 2PRSA 5E7JA 4EJSA 2E5LB 2CT8A 1XAGA 3H5VA 2VUTA 1LLCA 4QTYA 1ADGA 5EKSA 2KWIA 3GRFA 4L0QA 4BX0A 4DRYA 3ZVLA 2Q0XA 2IPNA 4G5YA 4RPLA 4OQFA 2BBSA 2JJ2D 3AU9A 4JC0A 3AESB 4TYQA 3EGXB 5EMHA 1X87A 1JEYB 1TADA 4IUCS 1N9ZA 1K7XB 2BY4A 3FHLA 3K0AA 1U99A 2Q21A 1CDDA 3GLVA 4Q4AB 5DDIP 1NU6A 5K05A 2BMFA 5CM9C 5AOCA 4BQSA 3WL6A 3RFTA 1LXCA 1ZI8A 3I9MA 3WHKA 1CLEA 2QJFA 1RAFA 3Q41A 4AZSA 2ZB3A 5LZ5A 2Q6VA 3PICA 4JHXA 1U9IA 1UH5A 1NVEA 2O7VA 3PE3A 2PE5A 4HH3C 2P9YA 4EB8A 1CF9A 1U5AA 1M74A 3JRWA 1ZC3A 4RULA 4JR1A 1ABFA 3VPBA 5DV9A 2QX6A 3OJCA 4FSXA 4AKIA 4NR0A 3L1JA 1YA4A 1VJRA 1ACJA 2JASA 3OMXA 3W6PA 1X7WA 3CNNA 4IOKA 4TWRA 3R09A 2VP2A 3IIJA 1WMAA 2GJ9A 1WL8A 2L18A 5E9JA 4S3MA 3RAPR 1FNSA 2H5IA 2Q1SA 2FW1A 3PCXA 3KTAB 4NJEB 2H1LA 4PG7A 1UIMA 4KO8A 4E5SA 3GRZA 2WQZA 3SZGA 1P18A 2BGKA 2HNAA 3ETLA 3ON5A 4O4IF 3SF0A 3UH0A 4A16A 2BDTA 4XWOA 1V9LA 5BW5A 5JU6A 4P6VF 5IABA 4FB5A 2MMGA 3A32A 3HJUA 3D9QX 4M1ZA 2CZGA 2G70A 4O33A 5K3EA 2QIPA 3PUWA 3IURA 1Q92A 4PAGA 4V0KA 4LGCA 4MPJA 4WFJA 4HXGA 2Y68A 2N9UA 3I73A 4MAAA 1I0LA 1W59A 1W4LA 2FY8A 3IV9A 4WPGA 1UPFA 3I12A 4C4YA 2EZTA 3RK4A 3TW8A 3VR5D 1W25A 2CLEB 3ABOB 2HJWA 3DKKA 2BFBA 3QKWA 2O52A 4N3AA 1E9BA 3F3SA 4G0PA 3NORA 2QP3A 3GBSA 4OJNA 3TM5A 2O8EA 3ICOA 1TZJA 2MYUA 1WB5A 3EQ6A 4RVDA 4Y6LA 1ZNQO 1EUDB 4KFCA 1BQ3A 5DVZA </