3N0XA

Crystal structure of an abc-type branched-chain amino acid transporter (rpa4397) from rhodopseudomonas palustris cga009 at 1.50 a resolution
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
371
structure length
371
Chain Sequence
DLKIALIYGKTGPLEAYAKQTETGLMMGLEYATKGTMTLDGRKIVVITKDDQSKPDLSKAALAEAYQDDGADIAIGTSSSAAALADLPVAEENKKILIVEPAVADQITGEKWNRYIFRTGRNSSQDAISNAVAIGKQGVTIATLAQDYAFGRDGVAAFKEALAKTGATLATEEYVPTTTTDFTAVGQRLFDALKDKPGKKIIWVIWAGGGDPLTKLQDMDPKRYGIELSTGGNILPALAAYKRLPGMEGATYYYYDIPKNPINEWLVTEHQKRFNAPPDFFTAGGFSAAMAVVTAVQKAKSTDTEKLIAAMEGMEFDTPKGKMVFRKEDHQALQSMYHFKVKVDPAVAWAVLEPVRELKIEEMNIPIKNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Possible substrate binding protein of ABC transporter system
publication title Crystal structure of an ABC-type branched-chain amino acid transporter (RPA4397) from Rhodopseudomonas palustris CGA009 at 1.50 A resolution
rcsb
source organism Rhodopseudomonas palustris
total genus 130
structure length 371
sequence length 371
ec nomenclature
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n0xA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n0xA01
2LP4Y 4OLAA 3OM1A 3NBMA 1NXPA 5JS2A 3KYJB 5EWJB 3H75A 1HEYA 3F73A 3LMKA 2TMYA 2IDMA 4MS3A 2JRLA 5B3JA 3KSMA 4N0QA 2FKAA 4MAAA 6CHYA 1Z12A 4G0OA 3CS3A 1JLKA 4WWHA 4H60A 1WETA 2FLKA 3LKVA 3CLKA 3HEBA 2L17A 7ABPA 4N0PA 3GV0A 3KYIB 3TO5A 4FE4A 4PZ0A 5FBHA 1DG9A 4EYKA 4TMYA 4W5NA 3CNBA 1DBPA 2F8TA 3QLUA 3GWGA 1QMPA 1PEYA 1K66A 3KJXA 3UK0A 1GUBA 4WUTA 4LE2A 3IPCA 5FWYA 4KFCA 1Z17A 2E4ZA 1U2QA 4F06A 5IX8A 3O75A 1ZGGA 3S99A 1FFSA 2E4UA 2W42A 4Z4EA 3JPYA 2GBPA 5HQJA 4W5TA 1GCGA 2IOYA 4RK1A 1DP4A 5EWMB 4KV7A 2MYNA 5FWXB 1TLFA 4F11A 4F8JA 1LJLA 3OLVA 4ZJPA 2RDMA 2FSPA 4QICA 5CHYA 5TE9A 1BVHA 5KQMA 1DBWA 4Z0NA 1QPZA 3HZHA 2VYCA 2IPLA 3OO0A 5GQSA 4OBBA 3CHYA 5HKOA 5BRAA 4YRZA 4KK4A 5ED4A 1EHCA 1ZH2A 3D02A 4WXMA 2E4YA 2PUGA 1J56A 1F51E 3E3MA 2PL1A 4KQCA 1M5UA 2H3HA 3CG0A 1XWWA 1TVMA 4LZLA 3DZDA 2WY2D 1JF8A 1ZITA 4QYMA 1JFTA 3QEMB 1P2FA 4E7OA 4ETNA 3BRSA 2L2QA 3MYYA 3A0UA 2RJNA 2CD7A 1MB3A 1L5ZA 4L85A 3UKJA 4MYRA 1P6UA 3OQNA 4MR9A 1MVOA 4KVFA 1L5YA 2LUOA 1TMYA 5TQ0B 3MIZA 4RK4A 5FBKA 1NXWA 5D2CA 5KQPA 2PUEA 3HXMA 2RJOA 4MQEB 1QKKA 4Z4FA 3F6PA 2LPMA 4Q6BA 1KRXA 4Q7EA 1YS6A 3H5VA 2WJWA 1XHEA 2FMHA 3R0JA 1BDJA 3L6UA 1JFSA 4RWEA 3D8UA 3Q7TA 5TPWB 4MLDA 1FFGA 2R4QA 4WXEA 5EWJA 1TM2A 2GKGA 2WMYA 3N0WA 8ABPA 3SQNA 2OQRA 1W9HA 3CG4A 3H5WA 5DTEA 2QU7A 3ILHA 3HJFA 3M9XA 1ZESA 3N0RA 3SG0A 1DCFA 1NXXA 1OXBB 2JVJA 1QQBA 3LUAA 2QV0A 4D74A 4XXHA 1NXTA 1D5WA 1DC8A 1ISSA 4GPAA 4LDZA 5DGCA 1DRKA 2FEWB 3QLVA 4LRQA 3Q9SA 3T38A 4MLCA 4DQDA 3I42A 3MA0A 1DC7A 4RSMA 2PUDA 5DKFA 1E6LA 4DADA 3P9YA 1NY5A 2QVGA 3FDFA 1USGA 1PUXA 1RPJA 1Z16A 2JB9A 4IMJB 1TJYA 4ML3A 4YR7A 2FQXA 2HJ9A 4JAVC 5GOTA 3KHTA 1DZ3A 1W25A 2QR3A 2WJAA 1T34A 1RXEA 1PHRA 3N53A 5JNUA 1YTUA 4KNYA 3FFTA 1USIA 4IMIB 3QLUC 4MR8B 5EWMA 2FQYA 4HNRA 5FWXA 3FFWA 4W5QA 5DCLA 1D1PA 2IPMA 4GNRA 5KWSA 1U2PA 1MIHA 4ZMRA 3I5AA 1ZH4A 5JNWA 2PUAA 2YHAA 1NXOA 4F3TA 1E6MA 2M1ZA 1USKA 1QP0A 3LUDA 3N75A 4XASA 1A0OA 2HQRA 4G0XA 2PLNA 5KI6A 1JH9A 3HV2A 3HCWA 1JYEA 3TX6A 4IF4A 4OTZA 6ABPA 3HM9A 1RXIA 1Z15A 1VLZA 2IPAB 3QELB 1SXIA 3QEMA 4YS6A 2F8SA 1QNLA 3IP7A 1P6QA 4O1HA 3HSYA 3CZ5A 2FXIA 3IP6A 4RDCA 3SAJA 1EWKA 2LIVA 2NT4A 3A10A 4F12A 1KMIY 1A04A 3QEKA 5TQ0A 5IC5A 2FW0A 1BAPA 4H3KB 2PUCA 4YLEA 5BRJA 5E3JA 1SRRA 3OLXA 1ABEA 1K68A 1QO0D 2O20A 4MQEA 1ISRA 4UHKA 1Z25A 1VPWA 4RK6A 1JWLA 4KRFA 2B1JA 2YHBA 5TPZD 4RKQA 5HSGA 1YMUA 5KC8A 4Z4GA 3H1GA 3EQ2A 2MSKA 5DLEA 4MGEA 4MR7B 3JPWA 3URMA 1URPA 3CU5A 1GUDA 3EODA 2V0NA 3F7NA 1A2OA 4G0YA 5IUKC 3N8IA 5TQJA 4QPJC 2JK1A 3KLOA 3OQMA 1CYEA 4YGXB 1Z13A 3CRNA 5C5CA 2ID7A 4Z4HA 3I45A 1RZRD 4EYOA 3OMWA 4MRMB 4QYWA 4ZMSA 5BQ3A 1B00A 5C5EA 1XHFA 2FVYA 4LDAA 5CNKA 1S8NA 4D6XA 3O2JA 1ABFA 4N41A 5F64A 1GLGA 3Q15C 1JHZA 3HUUA 4P98A 2VUIB 1I3CA 3KTOA 2PJUA 4W5OA 3CFYA 4RU1A 3G85A 3QLVC 4ETMA 3H5OA 2JVKA 1D4ZA 4G0MA 3GBVA 2HQOA 3H6HA 2QZJA 3CTPA 4Y9TA 3CZCA 3LKBA 1YVUA 3B2NA 3FFXA 1Z2DA 3LUKA 2A9OA 1Z26A 2WB4A 2JBAB 4PICA 3RVMA 4ETIA 1M2EA 1DBQA 2NT3A 3DGEC 3ROFA 4KK3A 1DJMA 3CKMA 4H3HB 3H1FA 2HQBA 3C3WA 5IEBA 2HPHA 2FEKA 5EWLB 5T7BA 3JS5A 3RVKA 2ZAYA 1QP4A 1JL3A 3HS3A 4EUKA 3Q7RA 4RXMA 5CNJA 3GL9A 4G0ZA 4NICA 4RK7A 9ABPA 1ZHHA 3KCNA 5JNSA 3LUGA 3QELA 3M9WA 1JFVA 5B3JC 3C6QA 1OXKB 2R48A 3OM0A 1JBEA 1IIBA 3N0XA 4RKRA 4MS4B 3DBIA 3RVSA 1ZAYA 1C4WA 2P4UA 5T3YA 1VKRA 1AB6A 1YK1A 2L18A 4PYRA 1PNTA 3L49A 5TQ2B 4B09A 5JNTA 2FMFA 3K4HA 3MQ4A 3KLNA 3UUGA 4Z4IA 2AYZA 1QP7A 2P9HA 1SD5A 1NXSA 3ILYA 1ZY2A 3A3KA 4P1ZA 5CNIA 4M88A 4E7PA 3O74A 3DLHA 1E6KA 1Z2EA 4RY0A 4RV5A 3BBLA 4FE7A 1RNLA 4MR7A 1JDPA 4YO7A 4IILA 4EYGA 4KZKA 5JNRA 4NV3A 3GBPA 4JOQA 4Q6WA 4EYQA 3RVPA 1APBA 5BR1A 2IKSA 3RVRA 1SXHA 3FMVA 1JDNA 3JTEA 1R8JA 4Z9BA 3HDVA 4LE1A 3RVJA 1CEYA 1PEAA 3BILA 1MB0A 4G0PA 4MR9B 2J48A 3C97A 3GT7A 2ID9A 3H5LA 3K9CA 1NTRA 2Q5CA 4FB4A 4MRMA 3H6GA 5ABPA 3DGFC 5IUJC 2MYPA 3O1HB 3O1IC 2BGGA 4O5AA 1LBHA 3NNSA 4TLLB 1YMVA 1C0EA 3IPAA 1P8AA 5IBQA 2JVIA 3JVDA 1FQWA 2A9PA 4MQFB 4EY3A 1EWVA 2GI4A 1DCKA 3BRQA 2PL9A 1EWTA 5CNMA 4XLTA 3EGCA 4NQRA 1LBIA 4RY8A 1F4VA 4MS1B 4HNQA 4Z99A 3C3KA 5KQGA 4D6YA 3Q7SA 1QQAA 2JBAA 2JCGA 5TPWA 4W5RA 3OLYA 2FN9A 3LUFA 2FN8A 1BDHA 3H5IA 2CHEA 5EWLA 2FEPA 3HDGA 4S05A 2IPNA 1D2AA 2DRIA 2OENG 3BREA 1BDIA 2MYUA 4XFKA 1ZVVA 1ZDMA 1KGSA 2B4AA 1NATA 3MM4A 3JVIA 5IUNC 4Z9AA 4RY9A 1QO0A 3QLTA 1KRWA 4TLMB 3OO1A 3I09A 5KC9A 4NCBA 4XARA 4YWHA 2QW1A 2PUFA 1DCMA 1EFAA 5TPZA 4JP1A 2E4XA 1YS7A 4MS4A 2IYNA 3NHMA 1AB5A 3HK2A 2E4WA 3IDOA 3NNNA 1FSPA 3RVOA 4LX8A 3IP5A 4N03A 5IEJA 3O21A 1YK0A 3MMNA 5TQ2A 3T8YA 4EGSA 3EJWA 3C3MA 4IRXA 2E4VA 1Y1LA 4MS3B 3RVQA 5JS1A 3HUTA 3LOPA 4EVQA 3RH0A 4EVRA 3T95A 2N9UA 5JNVA 4MR8A 3VNAA 4WT7A 4JASB 1RZRA 5PNTA 2FQWA 1U8TA 3T6KA 4MPTA 1DRJA 1LJUA 3LTEA 3O1JC 3A0RB 1SXGA 4LE0A 1H9CA 3O2QB 2L19A 3LUCA 2AYXA 4G97A 3TD9A 5IULC 3LUHA 4RK5A 2VK2A 3EULA 4IGAA 2MSLA 1U04A 4O1IA 3IP9A 4G86A 4PEVA 4KREA 2PKXA 4JB0A 4G0QA 3TB6A 4WZZA 2NUBA 2QSJA 4JA2A 2I6FA 3Q41A 4UHJA 2RGYA 3M6MD 5FWYB 3LFTA 3N6VA 4S04A 5KQLA 3LUJA 2HSGA 2QXYA 4KPYA 4N76A 3RVLA 4DN6A 4NCAA 3O2SB 1CHNA 4YV7A 5I4CA 3G1WA 3OQOA 1JYFA 2PAFA 1VRVA 2FTKE 4HNSA 4RS3A 4Z4CA 3GA5A 2NZVG 3H5TA 5HM6A 4XAQA 2QVCA 2XDYA 4YP9A 1ZGZA 3F6CA 2GWRA 4MQFA 2X7XA 2NZUG 2ZWMA 3EDCA 4RK0A 3MF4A 1D1QA 1ZN2A 2FMIA 3VNBA 1JX6A 1E2BA 3HO1A 3SNKA 4RZSA 4MS1A 2LBPA 4PE5B 4OLBA 4EVSA 2R47A 2FLWA 4N47A 2A9RA 3EQZA 4KMRA 2R25B 3QX9A 1Z18A 1YIOA 1GCAA 2FMKA 2GX6A 3OLWA 3OMXA 1BA2A 1MAVA 3OLZA 1M2FA 4L4UA 3SY8A 3FGZA 2CWDA 4ZYLA 4OG2A 1PNRA 3H1EA 2PUBA 1LK0A 2VUHB 1U0SY 4HYEA 2M98A 2H0AA 2WRZA 4YCSA 2MYTA 3GYBA 4JB2A 4CBVA 3KG2A 4ZPJA 3GRCA 3DLBA 3SM9A 1NXVA 1M5TA 4KQ9A 2CHFA 3EAFA 4OATA 3RVNA 2PE5A 3W9SA 2A9QA 2WWVD 1EAYA 3NNDA 4RXTA 4TN5A 4RXUA 3TMYA 2PMCA 3QX8A 3KKEA 3E61A 1UDRA 3QK7A 2MSWA 3HVRA 3JY6A 3KS9A 1FFWA 3ROTA 3NHZA 2KYRA 3RQIA
chains in the Genus database with same CATH superfamily
2BKUA 4YT8A 1RW4A 1XZJA 3DMPA 4BMSA 1K9SA 2H63A 3COYA 5AOBA 3HPQA 5FFMA 3IR7A 5H02A 1F5NA 3WK8A 5A4IS 3F73A 3G8CA 1T9ZA 3PTLA 2JRLA 4R1NA 2MJLA 1Y4AE 3UHPA 1K3FA 4EFLA 4X44A 2QTGA 4N0QA 3U7HB 4OOEA 2UXBB 1XTSA 4MAAA 4IHAA 2QN3A 2C92A 3T5TA 1YL5A 3COWA 3I9MA 3ANXA 1FTGA 3QIVA 4H1TA 3ZLBA 4OGFA 2AFVA 5FOUA 4UUAA 5IDVA 4UTRA 5T6MA 1BW9A 3NT5A 2I3AA 4B2YA 4X6LA 4KN9S 1PR6A 4RORA 2P9JA 4LHEA 4EHAA 1XXHA 4RF4A 2P0EA 3K9NA 4GT1A 2Y1GA 3U40A 1YZTA 1B93A 3A3OA 4TV8A 4URYR 4D0NA 4EJSC 3O8QB 4Z2YA 3TTVA 1ZN7A 3QLUA 1CETA 4AZ0B 1U98A 1FDIA 2EAUA 1IN5A 3E35A 2WYUA 4P4TA 4EDFA 4EIWA 2WAAA 4ZT6A 2Y6VA 3ZI0A 5FWYA 4MVJF 4KFCA 1H5NA 1FUEA 1QHSA 1PWXA 4HCJA 4NU8X 4CEJB 4DV1B 1Y1PA 2Q1YA 1QCCA 4YAKA 3K0KA 3AM5A 5CLJA 2YQ4A 2OP1A 1BSVA 1V26A 2KJQA 1HFEL 1KO8A 2W4IA 2XNKA 2DFTA 4IM7A 4ND2A 1QRRA 4QPNA 1I8TA 4UFOA 1GT91 1SBHA 3OG9A 3K9HA 3WAGA 4MHTA 5J4VA 3COSA 1D1TA 4KFRA 2GJ4A 4GQIA 4YRDA 5KB3A 3KKMA 3PV0A 1R9GA 3JALA 2NO1A 2XHEA 2MOKA 1GPDG 3NKLA 2JFWA 1W5SA 2A58A 5H8WA 2GLXA 4D81A 1BKDR 1KWGA 3ZIUA 1KQFA 3EIFA 3HVKA 5L51A 2OILA 2H59A 1KI9A 4RMHA 1ZH2A 1QBKC 2PX6A 1MJFA 5KNBA 3DAYA 2G71A 2JI4A 4EFMA 1J56A 1T9HA 2JA2A 4YK7A 4YPVA 5AVXA 4MQMA 1SCNE 2G5PA 5F2NA 3DZDA 5LQDA 4QYMA 1VSQA 2W6CX 2IKQA 1U7UA 4I4LA 4M4SA 1L8XA 4DM7A 2DQSA 3H18A 4BJ5A 2FW8A 2BI7A 1KTVA 1P9NA 4UFPA 1LSOA 1CK4A 1NL3A 1H3NA 3R5KA 3WFZA 4G24A 4NQZA 4EGCB 2QN6A 4A2PA 3L8HA 5J40A 1CIVA 1EUZA 5A7HA 4M1KA 3UGQA 1N2HA 1MVOA 4RA6B 1HMYA 4TSRA 3RIMA 3TUZC 1D7AA 2ZWAA 5EIAA 2QRKA 4KFSA 2IS1A 5JMTA 4Q7EA 1U9IA 2WJIA 5K8LA 2D8AA 1VMDA 4J75A 2E5LB 2GERA 5K3CA 2BH9A 2D1RA 1Z34A 2WOJA 1E0DA 1Q0TA 4Q47A 5JARA 1RVV1 2C3YA 1HFKA 5AJUA 4DXHA 5IXYA 5HUJA 4OYHA 1R6DA 4LECA 3I39X 2ZPUA 2YJ5A 3EUFA 7MDHA 5FX2A 1YS9A 3KVYA 2VHJA 3LA6A 4II3A 1WG8A 3KL4A 5BPHA 5F7OA 3PX7A 3Q5DA 2GZ3A 4Z8XA 4Q9KA 1ANKA 3OCWA 1GRNA 5KJ1A 3EGDB 3IV7A 1NRJB 5C1PA 1Y1RA 3V4LA 4WCFA 5AW2A 4ZCSA 3G2KA 4DHEA 5K7SA 4YP7A 5ENVA 2X86A 3BXXA 1SEVA 5FBRB 3WQRA 2VPYA 2X14A 5FI0B 1EFKA 1P75A 4JC5A 3WGZA 3PKIA 1LPPA 1VXOA 1SK9A 2GEVA 2NU9B 3C39A 3RHSA 3EGXA 2PJZA 2VC2B 3RFVA 4DZRA 1ZGHA 3R6DA 3ZKWA 4KDRA 2O2SA 1NNI1 2MSNA 3K2QA 1GEGA 5AHXA 4CM8A 4ZDKA 1OGIA 3GRYA 1JHMA 1TVKA 1RJ9A 1PGNA 3AU9A 1NY5A 4I1UA 1U28A 2IF0A 2GOYA 3A3NA 1RPJA 3ABOB 1V1RA 2QSYA 3P96A 4PLHA 3V7YA 1ESMA 1K9VF 3EC2A 1MKYA 1Z22A 2FQXA 2PZJA 3ODGA 1CB0A 4P36A 2ZSAA 4UCQA 1K98A 5GOTA 1K7XB 2AMFA 2FB9A 2HT6A 4NECA 5B58T 5JRDS 2GAJA 5EIFA 1YCDA 3G1UA 5EWMA 3W5VA 2C7QA 2ZRKA 5AJVB 1XD2A 5D7BA 3VHQA 2UKDA 4C6SA 4UBLA 1Y6FA 4N6NA 1X3SA 1Z47A 4LZJA 3P9NA 5EMLA 1DEOA 3DV2A 1JBQA 3M2TA 2V0CA 2GCPA 3ZDEA 2Y2UA 5C4IA 2LDBA 2GRUA 5JW6A 5TQVA 3EGOA 3WIOA 1N2ZA 2XMQA 4Y9RA 2WWIA 5JSKA 4HQ6A 1SD1A 2Y2VA 3P2YA 4F3TA 3RF6A 5FCDA 4DE5A 2QE7A 3N75A 5IAEA 4L9RA 4XASA 1WP4A 4B83A 3AM1A 4JH0A 5LB2A 3JR3A 5JWOA 3DBRB 3G13A 5BW5A 1JH9A 3N9IA 4U0JA 2ETVA 3EG9A 1WZUA 5H70A 5BN4A 1YO6A 1W4BA 1MENA 4MGYR 5D5HA 4GYWA 1Y1KE 3RBAA 4UDXX 4CQNA 2BKAA 4RHCA 3P2KA 1UJ4A 2EFEB 2ZB7A 3HSYA 4YACA 5I9SA 4DMFA 1DAKA 2QRZA 3HQ4O 5IZCC 4DNPA 3LSYA 5JBQA 2NTYC 1CQIB 2ZFUA 4ZJYA 1XNJA 2HQ1A 2QVXX 3QUBA 3LBAA 4G2NA 3UKDA 4AUKA 1UC5B 1OASA 2RK3A 5TGTA 1XTIA 1JKMA 3LW7A 2WTMA 1EH5A 1JVSA 2PHZA 1I7SB 1IL0A 1T1GA 3MMPA 5B4VA 3NALA 4IIJB 4MUAA 1GJRA 3ZOKA 2FW6A 2VZ0A 3K6KA 4ZVMA 2P5TB 2ZT6A 4A6DA 3QA9A 2XMSA 4HMQA 3L82B 4ZI7F 3REQB 3RD5A 4RKQA 1U0TA 4ZZ1A 3KELA 3THYB 4ZZ3A 1W5FA 3BT7A 1UPCA 3FF4A 3JQAB 3R5XA 5FOVA 1OBCA 5ECYA 5L6LB 1LVUA 1DVRA 3HGTA 1ORWA 2IHKA 2R84A 2Z1DA 2BUAA 2QQ0A 5EZ5A 1A8UA 2ZQYA 1GAXA 1MG0A 3CRNA 5IJWA 1PQUA 4RKWA 2C9ZA 1J5XA 3NFYA 1S7CA 5DISB 2YWXA 4NU0A 4WACA 1N7HA 2HADA 5A9RA 3WLAA 3NJ8A 1GSIA 3QNUA 4B84A 3P1JA 3WV4A 1GQYA 3BH7A 4P22A 4DCUA 3UB3A 4UM9B 5KWJA 1L3CA 3A7DA 1AKVA 4UOZA 4MEBA 1N34B 3A4LA 3VVMA 4HR7A 4MPPA 2XIQA 2VUIB 3SZLA 4F3YA 3HL0A 1OWLA 4W5OA 2A1UB 3JSXA 2CJWB 2PRZA 4NBRA 2J3JA 5U1PA 1RLOA 1RT9A 2FQQA 4ALLA 4XB6B 2JJ2D 3GBVA 4QNRA 1W76A 1TM4E 4XIGS 4YLYA 2Y6UA 4KJXA 3WTCA 3A2MA 3D5EA 3LT5A 3B82A 2B2CA 4Y9TA 5KKCA 4GBJA 2Z98A 1GZHB 3KJIA 3LGXA 3H16A 4LYDA 1JLRA 3AIIA 1ORDA 1KI7A 4RMGA 2QRNA 4JQCA 2JKYA 2NT3A 4N9QA 2WM3A 2NOAA 1FLDA 2V5UA 2NNWB 1AKMA 4U2DA 4EG0A 1O95D 3H1FA 1NW5A 4U9HS 2FE4A 1MG5A 1QWOA 1XXHB 2C31A 3A2LA 3BWDD 2X6TA 3IERA 2BHSA 3F96A 4TV8B 4Y2UA 1JIQA 1JL3A 5B4UA 2Q5EA 4IQGA 5BN4B 1XE3A 4IS3A 1KSJA 1M1YB 1R9JA 2OCYC 5FF9A 3UXMA 2H54A 2ECQA 3IH5A 4J1SA 4NICA 4NESA 5EXSA 4W8HA 4AYXA 4RWZA 3LDGA 4ZODA 2QD1A 4CR6A 3DC2A 2JGNA 5C32A 4GMXA 4UM5A 3RNLA 3DF7A 5LVAA 1EFTA 1Z28A 3FUWA 1A69A 2V97A 2Z3VA 4RKRA 2GN2A 4UDYX 5MN5A 2CNWD 3BWBA 5K3BA 3PPWA 5I51A 4RD3A 3B7PA 1NRIA 4OHPA 4Z7QB 1HDIA 2YFHA 2ZJBA 3D43A 4W6ZA 4WLUA 1V4BA 4ZOAA 2O8BA 3AH8A 1BCSA 2ZZMA 4QQKA 5K0ZA 5B36A 1UL1X 2PPVA 3N7UA 4LXHA 4P1ZA 3VU9A 1N25A 2B2XA 4BDSA 1X7XB 4NXMB 4KYIB 2WVGA 5K6TA 1NYRA 4DBVO 3ND7A 1IBMB 1X80A 3EXFB 5F12A 4IGFA 1WSAA 4BVAA 5LSAA 5ALWA 4R8SA 2MDTA 2GJ8A 5JXGA 2DCUA 3R9IA 1SCAA 3UMYA 2Z09A 1SQFA 4NVRA 3NTUA 4Q3LA 4M83A 4UKDA 1ADJA 3T1TA 1PV4A 1E6EA 1RLMA 3VR2D 2HYDA 1C81A 3GU3A 2ZRQA 3LCJA 3ZCRA 4YAOA 3HB7A 2QF7A 1I14A 2I2BA 3C6MA 1PI3A 2G28A 4ZI2A 1SM4A 1Z8FA 4MKRA 1H2FA 4MRMA 4XDHA 4GKKB 1X92A 3UB4A 1QPGA 1LC3A 1Z0UA 4TOIA 2JL1A 4I1YA 2EC5A 5LD2C 1XJQA 4L22A 2BGGA 4QHSA 4QZVA 3VSCA 1QNFA 5HHTA 3CX8A 3SKYA 2ERYA 3Q3JB 4FLMA 2EEPA 1RQGA 2UV8A 3MOGA 4MP6A 5JBIA 2C58A 3TLEA 3H5NA 5IM4F 1U8ZA 2FX2A 3M81A 4HZGA 4FFRA 1AXEA 5LXTF 3PR2B 1WNTA 2XUAA 3P20A 1KP9A 2CVQA 3PGLA 3KSRA 1DCKA 1H69A 3R23A 5AVKA 1T3TA 4NJEB 2FWJA 5HIMA 3LYHA 4MMXB 4HLQB 4JLNA 1IY8A 2ZIVB 4FMPA 2PMEA 2DVMA 2VDWA 4ND4A 4PIPA 4WA8A 5FL7A 1VOTA 3V42A 1RXYA 2H4HA 2CL6X 2I3GA 2X8AA 1ZCBA 4H0FA 4RANA 4ACBA 5KQRA 3QW2A 1L5MA 1A50B 3EGXB 2W2PA 5CT4A 1N8NA 2Q21A 4HKTA 1R3DA 4MIKA 4PSDA 4B4WA 5JHHB 2YFYA 1CDZA 1F4LA 2W6NA 1T3SA 3EYWA 1ZI9A 1RKBA 3FAZA 3PPIA 1TVKB 3QVJA 3IQDB 4WK4B 1FP4A 1IB6A 1NFRA 1T9CA 3C15C 3QPAA 2OC4A 5K4AA 1O9GA 2CL0X 4I1IA 2PQ2A 2YVKA 5TIIA 1KRWA 2WUWE 2D1TA 2H9AA 3I09A 1PP4A 3RRFA 5B6JA 3DE7X 2BC9A 4EA9A 2G08A 1E4EA 2XWSA 3R5JA 1JAZA 4Q1CA 2ZE7A 3V8MA 3HDHA 3D6NB 4IEFB 1T2UA 4DA7A 5C1BA 1XGKA 1L5LA 2B1GA 1J23A 3G7SA 4N8SA 4OJQA 1XD2B 3TQQA 2ZIZA 5H0IA 4TVKA 4EK9A 3FLEA 4XLZA 5BXYA 5EKXA 4RVFA 4D8VA 3S1AB 2DHEA 4IRXA 5HQ3A 4TL8A 2BMWA 2BI8A 3DMTC 5KOJB 3IT3A 5JS1A 3ADBA 1HX7A 4QWMA 3KQNA 4M0CA 2GPYA 2I03A 4FQ7A 3WNZA 2C5EA 4ZICA 2FZEA 2XUOA 5FBQB 4CRWB 4GGMX 4DIOA 1NWCA 1T13A 3L06A 1W6UA 2C4KA 1BQ3A 2OFPA 2O2JA 1TAUA 4HXFB 4P4SB 5F52A 3EOAI 4I50A 1GNQA 1TCAA 4JJFA 2Q8QA 5KINB 1C41A 1QUEA 3DFKA 5DN9A 5FUXA 3VDQA 5L4NA 1RC8A 2PH5A 3PNBA 2NWQA 4O4HF 1DIHA 2G4CA 1LLUA 1M5RA 3R3YA 1QTNA 4K03A 4PEVA 4ZU1X 1NBAA 3KD2A 3L8EA 2ONYA 3S81A 1Z37A 3AJDA 1DO2A 1FVXA 3AQIA 3EZNA 4LRXA 3LFTA 1DDIA 3P94A 2HRDA 3UW3A 1YBHA 5C81A 4DN6A 2VHYA 3QVVA 3MSCA 2YUIA 1T2DA 1I3KA 3SLKA 5G3ZA 4DBZA 2DPGA 5HF5A 4JLJA 3KYBA 3MPUA 4A27A 4W9MC 4RHFA 1LW6E 2LVBA 3T94A 3JQFC 4EQZA 2HSDA 4V0ME 2AX3A 2W71A 3VXKA 1QGOA 1NW3A 3M70A 2I4TA 3QVXA 4XD7D 4FOPA 1YUBA 3HO1A 3DO5A 2F3PA 2CMGA 3I2YX 4TQ9A 1A1VA 1IBRA 2ZWVA 3BERA 3MTQA 1JI3A 2ODAA 2Q3LA 4Q7KA 5JFTA 4GEKA 5A3SA 4ZEWA 4ARVA 3TI9A 4FYVA 3U4HA 4B1FA 5CD1A 4CL8A 1RDFA 4ND8B 3WGGA 2GBFA 3DB1A 4NFYA 4F2DA 1PR2A 3AHGA 3R4CA 4WBXC 4ZYLA 1YS2X 1WLSA 4OJTA 1O0CA 1C8VB 3H99A 3TPZA 4KRXA 2P90A 4ZU6X 2I4IA 3OHMA 5HK8A 2DPHA 1N57A 4AD8A 2N0SA 1O6ZA 4LOLA 4IFEA 5I7SA 2AJTA 4AMVA 5JCOA 5JFGA 2H2DA 2FFHA 2HF9A 4UCXA 2XZTA 3B6JA 2M6KA 3GD7A 5ISMA 2OC9A 2A9QA 2WWVD 3C45A 4V38A 4WOKA 4C21A 4EW1A 4EVIA 2H1VA 3KKEA 4INOA 4HT3B 1JG2A 1KJNA 1VJ0A 3N8DA 3P5SA 4DA6A 3HB9A 1GQQA 3NHBA 2HMYB 1H5UA 2B7LA 2DBYA 2H2FA 4X65B 1R0ZA 2X9LA 4LHVA 4OLAA 1XTTA 3W5UA 1I5EA 3AEZA 4C22A 4ZO9A 1IM8A 2P1RA 4IHQA 3C3BA 3EG5A 3LBFA 3L7YA 3VH3A 2BMEA 2WIKA 1U0EA 5KYVA 2J6HA 2P91A 3L1IA 3VNRA 3LPCA 3E03A 3KEMA 3LQKA 4QE3A 1E59A 3QP9A 3P2JA 1ND6A 1FU8A 3CS3A 2CXHA 3H6KA 5ALKA 1GPH1 3QE0A 4TL7A 5ES3A 2O3QA 4AJ9A 5E4TA 5DK4A 3IT1A 1FC0A 2O0LA 2BFEB 2W2TA 3AERB 1U1GA 4JODA 4U6SA 3TO5A 1UFVA 4PZ0A 2BZ0A 5HF9A 4B82A 1XA3A 3OBIA 1DX9A 4K87A 3F7OA 5EAIA 2ZRCA 5L3SA 4D80A 2FN4A 3W06A 1OFVA 3ASUA 2IZZA 3O1LA 1HNWB 1FTNA 1T9BA 3WGMA 1TRHA 1UDWA 2IF2A 4QSHA 5BP7A 2O8BB 4DPMA 1JA1A 4XCQA 1BCSB 3WMXA 1DEAA 2KBEA 4PRKA 1OIXA 3DEFA 4JBXA 4RZ3A 5TXGA 5J3JA 1UM9A 4PZ9A 5AJTA 3WMRA 4GLFA 3MRXA 5D5PA 1RJFA 1CSEE 1E63A 1NI5A 1Z2NX 4F8JA 1TX4B 3N76A 3QMWA 1X80B 4WADA 4YJ3A 4LFBB 3K16A 3WJ7A 4FBLA 3IMFA 3NWBA 2VTDA 4IL5A 2P2DA 4TROA 1XQVA 2HY7A 3HBMA 5A0VA 5FV4A 2C29D 2IPLA 1TUGA 2VF2A 2EJCA 4A6XA 3VU0A 4FFNA 3NBYC 1L7PA 3ZY4A 1DBIA 1OH8A 3JQ7A 1VHDA 5J2UF 3QVGA 1RWOA 5IC6A 4E2YA 3V1KA 1GNTA 1LDNA 1F0YA 2PUGA 1E7WA 2WU1A 2D0OB 5L6MB 3HDQA 3UW1A 1XTJA 2VUSA 3FNGA 4CM4B 2UYYA 5BT8A 4QASA 1BN7A 4HAZA 2WTXA 2L2QA 3W2GA 1ZK0A 3MYYA 3OQBA 3HA2A 2GZRA 1FUYB 4ROSA 1A27A 1QC5B 2CD7A 4YRNA 3IVMA 2VLIA 4E15A 1H2BA 1P31A 1G2OA 4EPTA 3FPAA 1O94C 2B21A 3Q8LA 5CX1A 4RQAA 2OAP1 4R2WA 1VYTA 5HK9A 2I71A 3BQNB 2BFFB 4OVKA 5TVKA 4FXPA 1NFQA 2BEVB 2JS7A 2WP8J 4U8HA 4C0JA 2YS7A 4NABA 1EFPA 5F9HA 4MB0A 3L6UA 1D6MA 1AMOA 1DIOB 1QKIA 4Y2PA 3TLKA 5F3RA 2VDWB 2C2KA 4IXDA 1X7WA 5DM70 5LZ8A 3WGVA 4AJ2A 1Z0AA 4CFYA 1U0JA 2M2IA 2HOQA 4JBLA 4E5PA 3LD9A 1UCFA 3N0RA 1M54A 1M76A 2AHOA 3D31A 1PBTA 3IR5A 4FYIA 4Q1AA 1YZUA 3IJ5A 3C7KA 4UEOA 5TS2A 1OXBB 3WKCA 4WNCA 3WLJA 4CIXA 3N87A 1NR1A 4B43A 4MVJG 2EWVA 5FQNA 1E1LA 3WICA 3DAOA 2I3DA 1RE0A 4IDPA 5JPDA 4X95A 3SYRA 4I5EA 1E4EB 1SOUA 2FEWB 5KDLA 1YRBA 1VHJA 4B8YA 1N6LA 3TZBA 1TA4A 2A5DA 2G6TA 3FVTA 4K9MA 4DLTA 3N6RA 5KVQA 3PC3A 2PSDA 2A5LA 3ADCA 3T4UA 3FYUC 3OFVA 4EKDA 4F86A 4TL6A 2QLNA 2BSQA 2A9KA 1C1HA 3AR9A 3CWCA 3NIFB 3UYLA 4JAVC 2I4LA 3TBKA 4ESOA 2FX3A 2DULA 4EFKA 1YH3A 1E2LA 1A88A 4MI6A 1UBLS 1KDVA 3RUIA 3UCFA 3MJFA 1N2EA 3T06B 2B2NA 1QQ7A 1GA4A 3FGOA 1NTOA 4PPNA 4YA6A 2IPMA 4HC4A 5JTUA 2ZIWB 3BAFA 2O0MA 1YZKA 1Z8DA 4HH1A 1LU9A 4O4IF 4OIMA 3DZKA 4R6XA 3RASA 3RYHB 1OX4B 3EZYA 5IKOA 3HL4A 3WHIA 3DWEX 2GN9A 1NXOA 1T3ZA 3QJ5A 1JTFA 3U1TA 1H0RA 4ZJZA 1M2VB 3E3NA 3T7DA 4Q9AA 2WMDA 3VGPA 1D6NA 1G2IA 2QXTA 1Y8RA 4UD6A 3ZHOA 4G8BA 3SIXA 5IZ4A 4GVLA 4S2UA 5FBLB 5KI6A 2J6BA 3SHFA 2FWPA 4W82A 3JD2A 4E5UA 3L18A 4CG1A 1MH1A 1KWKA 4C4YA 4CIVA 4CR8A 4DLZA 4O02B 3EIQA 3A9UA 3WHLA 1RQ2A 2PEYA 3MCWA 2ILVA 2VP6A 3QFRA 2B8NA 4FZJA 3IP6A 4G56A 1DJQA 3RS4A 4MWZA 4OMUA 3HKCB 1H1LB 4KQMA 4JLUA 3QEKA 3H2HA 1RYDA 4LVNA 2FW0A 2WSYB 4XTRA 2I1VB 4LJ8A 1D9XA 3GJTA 4A0RA 4WBNB 1PU2A 4QRHA 4DSUA 3K6SB 4MQEA 3A70A 5JG7A 5IPFA 1VPWA 3COVA 1XKTA 4P84A 4Y6RA 1P0IA 1V8ZA 2ZBUA 3E70C 4P6VF 3ZCXA 4B4VA 2RK6A 4P9NA 5CB4A 3FCAA 1EEXB 1I30A 2BT4A 2B1JA 2RBGA 1YMUA 4IZIA 1P1JA 2ZI3A 2E6KA 1RWNA 2F64A 3T52A 1C1DA 5AKXA 1R0CA 4H31A 1RP1A 3NUQA 4L9SA 4RGVA 4E5DA 4DA9A 4ER7A 3MTJA 4ZGBA 1M6EX 3LNTA 3RYFA 3NHRA 3KXPA 3JQCA 2WSMA 4G0YA 3RWBA 3V32A 3IEUA 4AK9A 2AV6A 2FPPB 2HLDD 2J3QA 1K7CA 1JE1A 2Z30A 3B51X 3R0XA 4B6QA 3Q3VA 5IXJA 1V39A 3GDFA 3PEEA 3TECE 1HI9A 2ID7A 1QAMA 1Z4OA 2WILA 3M5WA 3V4FA 3PPXA 3TKAA 3C43A 4AU1A 4CI0B 3WV5A 3DVRX 4CV1A 5BMVA 3QVWA 4QYWA 1ZG3A 3CRRA 1NA5A 5ESWA 2WPDA 1ZBQA 1SG0A 5ALXA 2X1LA 3EWIA 3O2JA 5LWQA 2OGTA 4P4LA 5CDTA 1A7UA 2GF0A 2YYZA 4XWOA 5BYJA 4UE6A 3ZLTA 2H1IA 4MYSA 3VDRA 4W7HA 4YJKA 1TADA 5D8DA 3F6SA 3UWDA 4KPEC 4XJTA 3H5OA 5EJMA 5IYZB 2GILA 1ULTA 1GU0A 3NBUA 1R8XA 5CEFA 4RTPA 3LUBA 1SXPA 3Q12A 1TLTA 1GZ5A 4J3FA 4E5NA 1T8SA 2P2GA 4BUJA 3FFAA 5DNVA 4QGSA 1F2TA 2VRWA 5KVSA 1CULC 1HE3A 1EX6A 1GYPA 4RKYA 2P3LA 3FZGA 4ETIA 4Q9LA 3FI9A 4PZYA 3O8CA 1ZKMA 2VTKA 4ND5A 4BO8A 2DPMA 5JZVA 5J2TA 1UKCA 3EXHC 3S4YA 1VKNA 3JZMA 4R83A 4NS4A 1L9KA 5AM1A 1EK1A 2HV9A 1GLVA 2IVFA 3H0CA 4ARUA 4GE0A 4GHWA 2H5IA 3AG5A 1OC2A 5L3QA 3LWDA 3N8KA 4E11A 1S8AA 2FXVA 4D8WA 1NURA 3DEZA 2NX2A 3QFSA 2J59A 4NOKA 4ZQBA 1NSFA 1P0MA 2J5XA 4K3UA 4F4HA 3NHLA 4HB4A 1D8TA 3K8OE 3ZHCA 4JBHA 3NM6B 3UG7A 3QU5A 5KOYA 3GLHE 3GFQA 3DBIA 1J2TA 1C4WA 5LZ7A 3RUDA 1C4KA 4B7CA 1RWMA 4YB8A 2B35A 3FYHA 3LXRA 5DHUA 2DLCX 1JQAA 2C5AA 3A2NA 4W7SA 3D59A 4QU8A 1HTBA 4OHMA 2YJ4A 1MB9A 4BFLA 1IM2A 3KLNA 4KN8A 5EXDA 2WJ3A 3RC8A 5CW1A 1XMPA 3QE2A 1UFRA 1ZY2A 2W2LA 3B2EA 4AJLA 3JQ7B 2GVZC 4NCXA 3PC8A 4O2BA 2CHQA 1XLTA 2PLFA 3AEQA 2V6JA 2YNMA 3K2IA 3CSDA 3T1VA 1PTJC 4LXIA 3PLRA 4D4IA 4QU5A 3P27A 3R24A 5TJHA 1RBMA 2VSNA 1FW8A 4YO7A 3A28A 4NEGA 4EYGA 1H8HA 4C3VA 5JMOA 5LU9A 3NBXX 1JG7A 3E9EA 4IRUB 1EMDA 3RVPA 4MVJA 1DAGA 1CNEA 1SXHA 4EY6A 2NXEA 3FOBA 3JQ6A 3OICA 1TZMA 5JMPA 2ZT7A 1CF2O 3VSDA 5BV8A 4PAMA 2CYAA 1TF2A 2F62A 1U9YA 3F71A 2ZTLA 3H5RA 5KWIA 2FPLA 5LYJA 2YJNA 3K9CA 3EAQA 3R2JA 4I9GA 1E9CA 1NUUA 3H6GA 4KO8A 3WGNA 4UCFA 2DBQA 1ACJA 1BJTA 3LX8A 5DI3B 3TL3A 1FYWA 1GTRA 3CC8A 3X44A 3UK2A 4BB5A 3H84A 1TO1E 4TLLB 4J9VA 4LJLA 1X7WB 2PGOA 1R5BA 5BWCA 1IAQA 3F5MA 2JIPA 1JR2A 4S3MA 4LZAA 2J4FA 3JZDA 3P71T 3QYAA 2GBIA 4GOKA 3VYTB 5DYWA 4MQ4A 1UAYA 2E82A 2WUEA 5JZBA 1XL1A 2VJQA 4UXJA 3A4YA 2P8SA 3RTCA 1E4OA 2CBZA 3BSFA 3INGA 1SXJB 2GZMA 1T0HB 4OBXA 2JFFA 3STHA 5TSDA 1PX2A 2Z9DA 3EASA 5KCZA 1DWPA 4MCHA 4J0IA 2NM0A 3LPLA 2PGAA 5HOQA 1F4VA 4Z99A 5KYGA 3R7NA 4BJ6A 4CEHB 4L78A 4W5RA 7AT1A 1R0LA 3B1JA 3EGIA 1OROA 3FMGA 5EMMA 3ZJ4A 4BNMA 4KDEA 4X60A 5JECA 1KU0A 1BDHA 3FRHA 3IQIX 2XBMA 4KCGA 1WCIA 1N7JA 2PWAA 5IAGA 1SG6A 1N6HA 2PTGA 3UGTA 3SICE 2PA0A 4UOEA 1FNSA 4IHJF 4U2CA 4C0WA 2DWQA 4C0HA 1QHYA 1PJAA 3WRVA 1KS9A 5AT1A 5CGZA 4N3GA 3UK6A 3DBHA 3FUCA 1BG6A 3HYCA 2XAAA 4JLDA 2QW1A 1H2EA 4XFDA 4YRLA 1JPVA 1QOPB 1OI4A 1O8CA 4MROA 4BV3A 1J0AA 1N2JA 3ZVKA 2C9OA 4D56A 4UAVA 4K26A 2H08A 2OHVA 3G79A 1BN6A 4K28A 1XLWA 4O4LA 1KJIA 5CK5A 3CSUA 3O8OA 1POWA 1EVYA 4JI3B 3BWYA 5K8CA 2CUNA 1UJNA 4OP1A 4F9EA 2G9QA 4TRNA 3EPHA 3C3MA 3LH5A 2GM5A 5DM60 1FFXB 2F43B 1Q0ZA 1OE0A 4US1R 2A6PA 5AHWA 3BSSA 5DBHX 3RG8A 1ZK4A 4QEZA 3T7RA 4DQUA 3G6KA 1IWPB 3SU8A 5EIOA 5ADVA 2ZB8A 1GOTA 1QGUB 1U99A 2RG7A 5GIOE 2XCRB 3UFBA 1QHNA 1OLUA 2VQSA 4TXMA 3CR7A 4BKPA 1FS6A 1RAAA 1LJUA 4I6JA 2VPQA 3IEXA 2F90A 2V65A 4Q9DA 4A6PA 2OTCA 4QQNA 5KU1A 5AK0A 1H9CA 2Q2VA 4ZVKA 4R1QA 1DRVA 1T8YA 2IBTA 4RIEA 4CKBB 3IXMA 3RRMA 4JP8A 2H06A 5F73A 5U4XA 1XVLA 2XTJA 4G86A 1NX9A 2AFHA 1YRQA 2B4QA 3B6IA 2I2FA 3FYTA 5EGNA 1IULA 5HZKA 3M6VA 4S04A 3NIWA 2ZJFA 3IEKA 1PJRA 2IP1A 4ALKA 2QJTA 1DTSA 1DX6A 1YR3A 2GVNA 3LC1O 2C20A 1OAKA 2Y0DA 1QDLB 1XC7A 2OFFA 3ZZ0A 5F3WB 5F5NA 3QY0A 1SVLA 4KKXB 1JLHA 3K31A 3AGPA 3I04A 3TIIA 1GPMA 2Y1WA 4JL6A 3D4NA 3UXYA 2DHCA 2AQKA 3B6KA 4XGKA 5DTRA 3WBBA 4KITB 5TR9A 1U3TA 1MTZA 3GFGA 4C89A 2ZWMA 3D54D 4JKOA 4ER6A 5A4FS 1G9TA 2FMIA 1F2UA 5K8UA 4GXTA 1XYGA 1UQUA 3DEYX 1W0JA 2LBPA 3LG2A 2EX1A 2R6DA 4GF5A 5HYVA 3H11A 4E2ZA 4EGQA 4Z7OB 3PLAE 2O5RA 2XB9A 1SKBA 4DXAA 5IASA 3WYEA 3DT6A 2HMTA 1YRWA 4WY5A 4D6PA 1FTQA 1V11B 1JEAA 1EVJA 1QJCA 3AF5A 3I9V1 2H0AA 2CK3D 3NBZC 3FNEA 4H3SA 4QFBA 3T12A 1YI8A 3KG2A 4X1KA 3EC1A 3FJOA 3E7DA 3GRPA 1MNQA 1DAHA 4V02A 3PGA1 4XVQA 1MN6A 1E5DA 3ZU2A 4QJ5A 3OCUA 4QAJA 2ZATA 3MT8A 3W9YA 5A6SA 4K8RB 1K4YA 1IN8A 1OU0A 3QU4A 5E2IA 4LZZA 4Y1RB 3K9BA 3OWHA 2EX0A 5IDXA 1GU1A 2FOLA 1MIOA 1VLJA 4IJ6A 2O23A 1DZIA 1F2TB 2F3RA 3GLTA 4XX0B 3ZCSA 3VJKA 4B4OA 1A2KC 3QWFA 3ZXYA 4OHCA 2I2XB 3ROZA 2B4YA 4CMGA 4K1LA 2TMYA 2IDMA 2Q5IA 5E2AA 1NC1A 2AFIB 3KSMA 4L8GA 2EATA 1JNYA 1NOJA 2QTHA 4RV9A 5TDHA 3ICEA 2NYUA 3QENA 2FY8A 5D3MA 4JVLA 3QTLA 2RH9B 2IEYA 4I2NA 3IAS1 2JI8A 2P0AA 4WD3A 2X0KA 4E2WA 3HEBA 4F5WA 3GFRA 1U2DA 1RPTA 2VT2A 4C7BA 2B0JA 4LDPA 4TTPA 3RT9A 4KACA 4FE4A 4EABA 6PFKA 2PJRA 2JAPA 3OZXA 4TYPA 4EYKA 1SQ0A 1FSFA 3BMCB 3UGJA 1ADCA 4ZALA 2G7MC 2EFJA 3BGOS 2Q4TA 3A4VA 1BKSB 3I6IA 3GHYA 4A5SA 2VJMA 4XVUA 1K66A 1GUBA 2HLHA 4G9GA 1P5RA 5IN5A 2P2ZA 2IHNA 3LQQA 3OPVA 5H82A 4B6JA 4JS0A 2GN8A 4JXJA 2C2MA 2YVUA 2IV2X 5KCMA 4B7AA 2I8CA 2G9ZA 2J3IA 1UWKA 4J0HA 5BXQC 2AFHE 3GFSA 3DMRA 2UZ1B 3TTSA 5L3VA 3KSDO 1O6FA 2O2XA 1RBQA 1Y9ZA 2PFGA 3FTDA 1KHHA 3GZ4A 4PN7A 5B7PA 4FOTA 4M7PA 1X3LA 3SFVA 4Q01A 1XZFA 5MDHA 2W6PA 1S4QA 4H9GA 4UTZA 4F3CA 1N1MA 3MAGA 1IM5A 2WJPA 3OC0A 3REGA 4WN3A 3ZE9A 1OVGA 3T15A 3TNDA 1I3LA 2IC5A 3WVNA 4FJ0A 1N1EA 1PR0A 2ATIA 2W6QA 1SR8A 3DKVA 4C30A 5CYGA 1ZR4A 4PSCA 3AI3A 1O95C 1TQ2A 1Q19A 1Y33E 1KHTA 3JD0A 1NJ5A 3PD7A 1PJCA 4P0QB 3LWZA 1O4VA 1S5PA 4BO9A 1P6XA 4EG8A 1OZAA 3IHTA 4P86A 1JA0A 4KFTA 1M5UA 4LZOA 1CS0B 3MJ4A 5KYNA 1E3DA 2Z2JA 1DKUA 1KARA 2XE8A 1XD9A 3KPYA 3KZXA 4RVCA 8ATCA 4CLHA 3JTMA 5BYAA 1Q1NA 4BQQA 1G6OA 4LRTB 3U13A 5CH8A 3WBJA 3LF2A 2W43A 4JLKA 3EVNA 4DXDA 3MWGA 4HBZA 2DBRA 1WBDA 5FULA 3UJNA 1B15A 1GITA 1SN7A 1KC1A 3DCJA 3OZTA 4IOKA 3IGFA 3PQDA 4PQRA 3TZKA 1ZH8A 3EXIB 4TWAA 2FMXA 5EP2A 5KQPA 4JI2B 4FDLA 1E60A 4D96A 5IG2A 2WJWA 4CTKA 1RMYA 2FMHA 1VBKA 1JN0A 1ZICA 1YOVA 3GJ8A 4WLOA 4B31A 3FWHA 1SU6A 3L7NA 1FRZA 4QVKA 4MLDA 1Q7EA 4E4RA 3U44A 2I76A 2WMYA 4HNVA 5EPUA 1C2YA 3PWKA 1EE1A 1V3TA 2Q5OA 1MMFB 2Q3MA 4GPBA 2CHVA 3TVYA 1XAIA 3F1KA 4J9UE 1MF7A 4B6SA 1VP9A 1ZESA 1G6Q1 3KIPA 1PVVA 1TA9A 2B92A 2GCEA 3M9XA 2D00A 4YHBA 3UICA 5HGXA 3IUYA 3FPSA 4UTXA 3UJ7A 2FZCA 1AKNA 3BL8A 4M76B 4UTNA 5IT4A 3GGSA 2PPLA 3V8BA 3ZY3A 1L5HB 3KOZA 2QM0A 2CFOA 1NXTA 2GHTA 4FXOA 4RPGA 5K0JA 3T35A 1DU4A 2E1PA 2P5SA 5ALLA 1R5NA 5CPFA 4DCCA 1MV5A 2K4MA 5IM4A 3L4JA 4KIGA 2FSVC 2C2YA 2Z8YA 1TT5B 3JQAD 4GRDA 1SCQA 3JVUA 1X9HA 1V96A 1XA4A 3DBLB 2YMPA 5CA1F 2D59A 4QT0A 4N5HX 5BN3A 1PFGA 4A6EA 2RAVA 1C0PA 1CVIA 2ZJOA 3VUFA 3ACCA 3EVBA 4AG3A 2OZEA 3TNJA 1C7QA 2G0NA 4Y0AA 4PONA 1XOIA 4X7BA 2PIDA 5CM8B 1IY9A 5C1OA 6REQB 1NKVA 2NTNA 3UAYA 2H48A 3FFTA 4WDRA 4XUCA 4FFPA 3EVCA 4WHMA 5AKJA 2E2WA 4ZTBA 4G01B 3UWSA 2UUAB 2AEMA 4HNRA 5JSHA 4XVHA 4UM9D 1G3IA 2Q3DA 3VHXA 3GLFE 4N6OA 5EIXA 3I30X 1E2HA 2P9TA 4M8SA 3LIIA 3FWYA 3H17A 3KUCA 3CRW1 4Y2YA 2YHAA 2Z0MA 1GPUA 1M1ZA 4I4CA 5CVDA 3ZWVA 2Z9BA 4UTOA 1P9RA 3SYKA 2NXCA 4QDOA 4MRRA 1USKA 5EJ9A 6ADHA 3UZUA 4IJVA 3TNYA 5BNIA 1RHJA 4BRZA 2OLJA 3S0JA 5IHPA 4D9MA 3MGGA 3UK7A 3T5BA 2QX8A 3HM9A 4OA8A 4Y2GA 1Z15A 2E21A 5J1TB 2I4MA 3BTUA 4B9AA 1SXIA 1Y63A 4L6IA 2R44A 2XTZA 1WV0A 1G18A 1ZRHA 3CO5A 3P9SA 1P91A 3PQ6A 3QX7A 3C48A 5FORA 2R1VA 1JFRA 3EZ2A 5DM1A 4CCSA 4X92A 1G21E 3PG5A 3FIUA 2OO5A 5K0BA 3K70D 1E1NA 1CE8B 2NAPA 3TK1A 2ENUA 1DI0A 1N7GA 4KXFB 2IUTA 2MWMA 4TRMA 2VAMA 4IG9A 2HDHA 5PGMA 1SVNA 1NP7A 4M0FA 1KYYA 1PL0A 2PMWB 1W1UA 3EVZA 1H3FA 2QM3A 3FUUA 3CV3A 1F2UB 5CBKA 4I9UA 2MSCB 3E1GA 3V2IA 2WA2A 2ZTHA 3OM8A 3V46A 1WQ4A 2P2CA 4HVLA 1GKIA 2I91A 2CZQA 3EQ2A 1LDYA 3DO8A 2K7FA 4O4HA 2BGLA 3OE4A 4V0SA 1UANA 5FJIA 2GNOA 5KREA 4Y6OA 1P1IA 3AF3A 4D4MA 3F9RA 2NGRA 2CJYA 2QTWB 3BRCA 4L6AA 3BZWA 3Q8MA 3M3HA 1Z2OX 2W4MA 3DTNA 2VP4A 2X3FA 3H0EA 5HP4A 4TTJA 3MXOA 1D2GA 1J8QA 5FDFA 3NJ4A 1CYEA 5A1TA 3S8MA 2IW3A 1RD4A 2ZUSA 3MBIA 4UUQA 2VHTA 4ZI7B 2FFJA 5HUHA 5JTTA 5H1YA 4ZQIA 1K06A 1DO8A 2FSSA 3ICQB 1WQ3A 2XXAB 4JKYA 5H9WA 1QRTA 4W99A 4DKXA 2DEUA 1Y3IA 2NSJA 2ZREA 4FD3A 1SBQA 1DWUA 2UZ3A 2DJ5A 3B5JA 3LF1A 3GGJA 1PO7A 3EWAA 5JPCA 3VU8A 5DT9A 3D3EA 3KUUA 4DR3B 4LF6B 3KVOA 4P31A 3AUTA 5BV1A 1YQXA 3GZNB 1Z9BA 3DVSX 1CKEA 1OI7A 4RLFA 3C87A 2PX0A 3FPLA 3SSNA 3ZTWA 1DQRA 1X8LA 2OESA 1HKUA 4JWTA 2ALJA 1E3WA 4OFWA 1T0JB 4WCVA 4DBLC 1ZA2A 1PQ4A 2JCVA 2B9EA 4B73A 4R9RA 4C4AA 5L95A 3VGJA 3T3GA 2I4RA 3DYIA 3W6OA 4XH9B 4CUJA 1XRLA 1KI6B 2PZEA 2WB4A 3UMMA 4EUEA 3L05A 3EX7C 3GG9A 2FUCA 5E6SA 1YHZA 4C0SA 1W85B 1U1DA 2WJ6A 3ON5A 4KMSA 4C88A 2PMKA 4DMKA 2JCBA 5KYXB 2XDAA 3L9XA 5T7BA 3OPXA 3ESYA 2ZLBA 4RKEA 1AXRA 3LC7O 3S40A 1RKXA 4QWWA 5F21A 5A5EA 2O1WA 2W8BA 4D99A 1OI3A 3GL9A 3DTVB 3PFWO 1VPTA 1Z06A 4FYMA 4P93A 3V8VA 4MPDA 1Q5PA 2O2IA 3IILA 3L0YA 4HFNA 4UZEA 1VKOA 5JNSA 4DV7B 2GF2A 3B52X 1QVWA 1N8TA 4BNZA 4LXXA 1U8XX 3FYCA 1ZN8A 3CR3C 3GPCA 1P4HA 1RIFA 2OD2A 1V25A 3VH2A 4EJFA 1VBMA 1PVDA 1OAOC 3L1UA 3B1ZA 1JEJA 4TLDA 4WKPA 4DV6B 3A14A 2VTBA 1TKAA 2QD5A 4XIIA 3E4CA 3RWOA 2GEFA 1Y3FE 3BKWA 5GZ3A 3X1MA 1TQHA 5BWMA 1VJDA 4MYDA 1QB8A 4IIFA 3NWOA 2ADFA 2MTBA 4RJJA 4ENPA 4G0UA 2XOEA 4PF1A 1HTTA 1QP7A 1E3SA 1ENZA 1ZNXA 3QI2A 4K9QA 4M88A 4FJ2A 3OTHA 2GESA 4G41A 4LGYA 1Z4PX 2CUKA 3NKFA 1KI3A 3I4LA 5DNAA 3ESDA 3T9BA 4KC0A 3LGSA 1ONNA 4U0KA 1Z4QA 3PCXA 4MCIA 3GLUA 3QBTA 4KIJA 5GP1A 5AVJA 2Q45A 3OU6A 3DNMA 1CUCA 5FEUA 4CXMA 3PITA 1TTQB 3GI1A 4WW0A 2EYQA 2WUDA 2IY8A 2VBFA 4JEUA 4MUBA 4GC5A 4NDZA 4FGKA 2HK8A 3MFYA 3U2QA 4IKOA 5HVNA 4U7TB 4HWKA 2R751 4UM7A 3O5AA 1KAMA 3IE2A 4XB1A 3WK9A 1CEYA 2OWDA 1MOZA 3DE0X 1BE0A 1MB0A 1PSDA 4QDTA 4QECA 2OUKA 3SKXA 2XUKA 4CPDA 4F71A 3GRUA 3S3TA 2P6OA 1GR0A 2WJYA 1QX4A 3DHYA 2BKLA 4B80A 5ABPA 3LLUA 4URVR 2OMKA 4IUYA 5GONA 5IF3A 5KDDA 4JFAA 4NULA 4K81B 3D1JA 3JU3A 3CUUA 3BGDA 4GX2A 4X1IA 3U44B 3JVVA 3T1QA 2BGUA 1M0WA 1RP7A 3NXSA 5ELXA 3KKZA 3AVPA 1TMGE 1E92A 1TM3E 2SBTA 2JVIA 3ANYB 3E2IA 3P4UA 4QBKA 5J2UA 1E9AA 3DMHA 1XRRA 3HVHA 4L1KA 1E79A 1L7EA 2WJHA 4YRTA 1KJ9A 4FYJA 4DJTA 3VV2A 1JR3A 1XDGA 2G9UA 3QTTA 4XOUA 1PL6A 2VH2A 4BKMA 4U7GA 4B3JA 2I7VA 1KXJA 3FOFC 3HMKA 5REQA 1F9EA 2ZYIA 4KB5A 3SJUA 1N9GB 1O08A 3DFMA 4R31A 2FEPA 4S05A 5JAZA 3KR1A 5LXTB 1QH1B 3RB8A 1DHTA 1OZ0A 2FE1A 4CF7A 2AG0A 3MM4A 4V0QA 4CG3A 3ZJ5A 3OJCA 4E2XA 1O2DA 2MSDB 2O50A 2J0EA 2V9CA 2WV9A 3ONWA 4I9FA 4MKZA 2AZXA 4MQBA 1QR2A 3E8MA 1T2FA 2VYVA 1QXSA 2ZJ6A 2Z8XA 2RGNC 1B2RA 1LRLA 2Q9AA 3BEDA 3X1DA 3ANSA 3TG8A 2AKEA 1NY6A 2QRHA 3HP7A 4LS3A 3RSHA 3HJUA 3WGYA 5G53C 1T4BA 1W0KD 3E9YA 4FM9A 4BDTA 4OK6A 1DKOA 2B99A 3D8BA 3NHMA 4TKVB 4CLOA 2CFTA 1OKKD 3B20A 1QYCA 3CX7A 2OORC 1KOFA 3F3MA 3QU2A 4LV6A 2NVUB 4B6EA 4YUAA 3FMIA 2F3TA 4M38A 4INAA 4A0HA 1HNZB 4FEAA 3OHSX 1Y8AA 2PWYA 4MS3B 2UDPA 4FHCA 3TSOA 1VZ3A 1NLZA 3R40A 4Z2AA 4MGZR 3ZG6A 1NMZA 2AOTA 4FQ5A 1RWXA 5GAJA 4I0WB 4DTCA 4EJSA 2ZBQA 4Z7NB 2F7SA 2GRJA 3NOOA 3O3CA 4CQLA 1L4LA 4WKNA 1PT6A 2GZ2A 4OD0A 1XDBA 1JT9A 4TV9F 4YFYA 3CLHA 3T6KA 2R8RA 4AMGA 2X4GA 1I2DA 1UR5A 3KEOA 3LPNA 3SC2A 1FBTA 3LTEA 3WR5A 2NUAA 3PL5A 5CU7A 2DFVA 4BO4A 5JZ9A 2IWRA 4OY3A 2XTAA 1N3IA 1P19A 2LR0A 2WVAA 4NZOA 4I7EA 3HP1A 3TOZA 2FEAA 2QY6A 3HEAA 5LDGA 2BLNA 2DT8A 2VRCA 5G2OA 1PAUA 4JA2A 2I6FA 2ORED 4JJIA 3Q41A 3DFIA 3A6HA 2WIJA 3R76A 3ZJVA 1H66A 4LUCA 3RRYA 2BN4A 4JBGA 4KPYA 3RVLA 3W5IA 2PJDA 2C59A 4YT5A 3QU9A 3G1WA 3GJYA 1G291 2VAWA 3IVAA 4MQ5A 2OB1A 1ECPA 2QPAA 4JBWA 3OU7A 5AK5A 2M6LA 3VI3B 1PJBA 4CEIB 1UOOA 1GRCA 1WMDA 3IAAA 2FOXA 2ADMA 3C4JA 4FN4A 2OQVA 1KI1A 3QZUA 4V3CA 4X6UA 5HS4A 5ER9A 1NYQA 3GLGA 1BMDA 1T91A 2Z5FA 2HHAA 3K1AB 2VDVE 3JAKB 3ENZA 4L16A 2LV8A 4UZSA 1E2UA 3QWAA 1ZN2A 4MK4A 4X6XA 2PH1A 3I01A 2UVPA 2D2FA 3PCTA 4FHEA 4M99A 1JU9A 1E2BA 3QHQA 4CCYA 4OAPA 2FSGA 4X20B 1BQEA 4X61A 4BO1A 5IHXA 3T34A 2GX6A 2CFCA 4R2LA 3PXCX 5I7OA 5J4HA 2GO1A 4X8LA 2R5NA 2VJCA 3M2PA 3H1EA 4NBNA 1M66A 2OZLA 3K9WA 1Z6TA 1U0SY 2ROQA 4YRRA 3A1WA 4IVPA 1KY3A 5D87A 3ER8A 1T3LA 2D2XA 4AKGA 3BXHA 4JHXA 4P2BA 1UEJA 1QF7A 1NJ8A 1ZYUA 4DLUA 4NP6A 3VC2A 1XVVA 4QTUB 5LA6F 3BTSA 3WGQA 1GA1A 1T5DX 3D1LA 4I1SA 4WJKB 1N9ZA 1AG9A 1XWIA 4L27A 4KGDA 4R0MA 4AMBA 1VA4A 1MQSA 3FMOB 1EAYA 1E3WB 4RJ2A 1NJ1A 4RXUA 3DULA 5AD1A 3LY9A 4N7BA 5KVCA 4AQDA 1QG2A 1N92A 2HIGA 3KUXA 4ZC1A 3BE6A 3DT9A 4UEWA 4YJ2F 2A84A 3C1TA 4ZARA 4EG5A 5JS2A 5IVPA 5KS2A 3I61A 4I55F 1VPDA 1P1HA 3A6JA 5E6SB 2X42A 3B9PA 4QT4A 5K3OA 1TD9A 5EESA 3M4ZA 2RGAA 4EPRA 2B8WA 2QRUA 3A1SA 1TE2A 3GOHA 5K51A 2HA6A 4BN5A 1GKUB 4XSVA 5ADWA 2ECFA 1DRWA 3MD0A 1MHPA 3PB3A 4WWHA 5ARBA 4K9OA 1SCJA 1T25A 1XCGB 1Y6RA 1RZ3A 1Y4UA 1Q11A 1Y9AA 2W48A 3FNRA 3PHJA 4L0QA 4XYGA 3OZUA 3H8VA 4AM8A 4C5BA 4N0PA 5LP1A 1LQUA 1RQRA 3JATB 4NENB 2GPNA 4WLNA 2J0UB 3OOHA 1I2BA 3T61A 1SURA 3HCEA 5E0KB 3RGGA 4KUHA 4XEUA 1Y7PA 2QENA 3P5BA 5DASA 5TT1A 2R6GA 1SVMA 3F90A 3UHJA 1L7VC 3GWGA 1KH2A 3IJPA 4K6CA 1W73A 4EKEA 3M82A 4IIGA 2CKMA 2CW5A 4LE2A 3C3AA 4N54A 4AJEA 1Z17A 4AL4A 1U8FO 1NG1A 3TEFA 5ITWA 4B7ZA 1UMKA 3STXA 3NRCA 5IX8A 4OQXA 3T1HB 4OXNA 5EQDA 4MV3A 3WO1A 2GBPA 3PUHA 3P2MA 5FA6A 3HCBA 1I4OA 5DV9A 5KYWB 1TVCA 3TVDA 4OXXA 3KDPA 1CUZA 1FUKA 3KEGA 4H08A 4S0XA 3TQHA 1E2MA 3M9LA 4GZ6A 5JAPA 4JYZA 1BVHA 3TDMA 4AVYA 3PJFA 2YZ2A 5IK2A 4ZZIA 1TTPB 3OO0A 2ZRFA 3T5CA 4HJRA 2VAVA 4JITA 1CX9B 2HSZA 2C9MA 4L5YA 3V97A 3LHSA 5JATA 5IZCA 3PK0A 5HBGA 1V71A 1KI2A 2H4JA 4H27A 4D45A 2H3HA 2FJ0A 5BR7A 5JLJA 3UMSA 2X4DA 4RZXA 1BWQA 1R16A 5FTLA 1VI6A 2ZI6A 1AGPA 3Q72A 3UAOA 2C2HA 5C3MA 3C3XA 5F5XA 3A6GA 3RDPA 4LMAA 4X1IB 1E62A 2V7EA 1EFRA 1CQPA 2XRYA 4TWJA 4DDMA 3K20A 3YASA 3LP5A 4JROA 5J2UB 4AO6A 4D43A 1TMYA 3TTUA 3DD5A 3MIZA 1R2QA 4D5GA 2C7GA 1SHJA 2YZGA 1O57A 3T7JA 4Z4FA 3VNUA 3HH8A 1JRLA 5HJ5A 2GAIA 2QL6A 1LRKA 1JTVA 5DIFA 4CMKA 3E7WA 1WUHS 3LLSA 4RCYA 3S2YA 2VWGA 2G1JA 5A9SA 3MUFA 2OA0A 3CKKA 2Q2NA 1OU4A 3CLSD 4J0DA 4WXEA 5EWJA 3N0WA 2JLWA 1A96A 2V6FA 4C01A 1YQEA 2AEFA 2IHBA 2Q0QA 3X2EA 5C34B 1HG0A 3W9UA 1UH5A 2GJKA 2I6TA 3KOYA 3PA8A 2J30A 4ZHQB 1I5RA 2H57A 1UKAA 1XFDA 3RODA 2RSLA 3D3QA 3R3ZA 2AZ4A 4D5EA 2R86A 1KPIA 2VK8A 3BJMA 3C4QA 3QBEA 4QATA 3CKLA 1V4NA 3MPOA 3MJRA 3VR5A 2AQIA 4DL9A 3MBOA 1S8FA 3IBYA 2HWXA 3ZV7A 3G2HA 2H2GA 1DOZA 2XOKA 1JKXA 3Q7PA 4OQDA 3RSSA 1YZFA 2QVGA 4YRQA 3OFJA 1FY2A 1LBQA 1Q1BA 3BSYA 4J4TA 1XU4A 3EF3A 2IS6A 1AV7A 2LTAA 3LHKA 3WDKA 3E23A 1XPUA 4DPKA 1NE7A 2NZWA 4KXYA 4Q39A 3RR2A 1DZ3A 4EOGA 2XZDA 3DE1X 3GC6A 1P0PA 1TXGA 3IPRA 1IU9A 1UXOA 4F38A 2HJVA 4JJEA 2QP9X 5MN6A 4HB2A 1N6PA 5ALTA 2X58A 1HO3A 5DLPA 3TEJA 3ZC3A 2HJWA 5FNVB 4DV5B 3KQMA 4RPCA 3I9KA 1KFBB 2XDQA 4PZEA 1L8LA 5JCJD 2EZTA 2RCNA 1E6MA 2OLEA 2O2ZA 4DSZA 1M7HA 5FWAA 1XROA 2RK4A 3V2GA 1T6ZA 1A0OA 3WLLA 2CLLB 1QK4A 2WG1A 2WSIA 3ELUA 4XIFA 2C57A 1CNMA 3DM5A 2JI6A 5DU2A 2XKKA 2CVHA 2FP4A 5ILGA 5IJZA 5ILOA 4CG0A 1XX6A 3A36A 3KFVA 4QPZA 3ED1A 5D5QA 4MTLA 1RPNA 4O4IB 4EKYA 4IDHA 3IUEA 4I08A 4PPYA 5JQWA 5MF6A 2SKCA 1II9A 2JLQA 1QHGA 2JH8A 2WMNB 2ZU0C 3HY3A 4MV5A 4QQFA 2FPUA 4OXRA 4A03A 1FZQA 1F1BA 2PAAA 1A04A 2R3SA 3LVBA 1NM5C 1P39A 4ND3A 3RQSA 3GEMA 4PGFA 2Q9UA 2BEUA 2ZI7A 4ZOLF 3AESA 3PNQA 1M0SA 2YDYA 3ADDA 3SXJA 2BFCB 4OQEA 3A6KA 3PFKA 5G1PA 1G7SA 1II8A 3KSZO 5F7ZA 1V5FA 5CAEA 3E22A 2NVWA 5IH7A 1JWLA 1PS9A 3KDSE 2ZRAA 3ORFA 2GS9A 2MSKA 3LFUA 4E09A 4HVCA 5AMXA 4L72A 5DYGA 4PFJA 1YRHA 5JYBA 3TR0A 3EODA 3FIJA 4GVXA 4UEJA 5G41A 1XVTA 4IGIA 1ZL2A 4LXTA 4NHEA 3H5AA 1EQ2A 5CIQA 5HDQA 2EGGA 2IYVA 3BCHA 4RPJA 5I3ZA 3BC1A 1A8HA 2H0RA 5JCZA 1UPAA 2ZYSA 4FNAA 4LCBA 2VZ9A 1RWKA 3K0AA 1F3LA 4MYCA 3VH4A 3WYAA 3UAGA 5M04A 2O54A 1Q74A 2XSZA 2PKCA 3HKEB 1G3QA 2O4UX 2GZHA 4PQGA 4MARA 4FJ1A 5BSTA 3ZJYA 5T4HA 4KKVA 5CPBA 2C2GA 1NVWQ 4J16C 1JQJC 1K0UA 1DPGA 1ZD1A 1ABFA 2B8TA 4NAVA 1DS6A 1UXHA 2EZ9A 3B5IA 2BAGA 4IZ6A 4G65A 3WSWA 4CLRB 3WGHA 2QX9A 4K9NA 1R8YA 3OWOA 5HIAA 5ICSA 3U1BA 3HZOA 2Q2OA 3W8FA 3P2OA 1WVGA 2HQOA 3OECA 1ZJYA 4GMGA 4IGEA 1FTSA 4OU5A 1T9DA 2ZTSA 4OHUA 5LLSA 1EGQA 4AQYB 1BTOA 6NULA 3KYDA 2YXEA 1ZIXA 3UHOA 1CF9A 3CJQA 2BHRA 4AJJA 4WCDA 1I10A 2JBAB 3GT3A 3H3JA 2D7DA 3ENVA 3VPAA 3AY7A 3VTFA 2C07A 5HCIA 1ML3A 4DMCA 3ROKA 3JARA 5IH3A 4BX8A 4RZQA 1NRXA 5AI5A 4JV5B 4RHUA 4EUKA 3OE7D 1SXJD 5CT8A 5A5FA 2ZYAA 1JS1X 5L45A 1M8PA 1FTYA 3DH0A 4BVBA 2ECPA 2XNDD 2ZW9A 3BRWD 1BEUB 1FVFA 2VXYA 3M6WA 5IEJA 4KXWA 1EXMA 2GD0A 3BORA 4LFAB 4ZYWA 2NO5A 3DW3X 3DMTA 2PG3A 2IW1A 3OE1A 1GKLA 2JD1A 3CPSA 4FT4A 4HAWA 4NK5A 3S2FA 3UJ6A 4AJ1A 4MS4B 5HZGA 3S8EA 1Q1QA 4XEHA 5CVTA 3ODPA 2Y76A 4YCJA 1VKRA 3IX7A 1GILA 3ELBA 2ORVA 2P3SA 1N2CA 4CDNA 1FU4A 2HI0A 2B82A 2VYNA 5CFNA 5AW0A 2AW3A 2OCXA 2Y9PB 5JDCC 2QR5A 1W87A 5CLHA 3OJLA 2J32A 3KSUA 2OXFA 2P9HA 1L4NA 2QQ5A 1YB5A 1F8YA 1U2TA 2YZKA 4PGGA 4R9VA 1QHIA 2Q6VA 2GFIA 5EYPA 3PX2A 3IULA 4IJMA 3G0OA 4WBSA 5FO1A 4L0CA 4Q4AA 5EHQA 1C3XA 4Z9YA 5AXCA 4ON9A 1VC2A 2PNJA 4B44A 3W8DA 3GBPA 1S2DA 5GTDA 3EN0A 4C2AA 1B0UA 3TEMA 4BVJA 3SHQA 2Q3HA 2B25A 3OVMA 1AV6A 1WMFA 4GQAA 3DOFA 3W1WA 4KBGA 3C6KA 4P3KA 5A6VA 1KJWA 1Z68A 3BILA 4FNGA 5DB4A 1ID1A 3BE8A 1XJWA 3VX3A 4MULA 5AP9A 3JQFA 3BL5A 1HDYA 2ACEA 2ID8A 3GJ0A 2BFOA 3L7IA 4QEDA 1H1DA 4E31A 4TZ6A 1YZQA 3ROQA 4QGGA 3PR1A 2V45A 3ABSB 4O33A 1DT5A 4YJDA 2GCIA 4FBMA 1TPZA 5GGXA 4EB3A 2IL1A 3LSTA 4M8KA 1MO6A 2VSQA 1KEKA 2JGDA 3DG9A 3ZZMA 2X3YA 1TYZA 4N5IX 4BWFB 1UZNA 1EHIA 1RQLA 3CZRA 3H2BA 3BXFA 3I0MA 3H87A 1YNSA 4R6WA 3T4XA 4H6PA 4NF2A 1J22A 4IQ4A 4P80A 5BORA 4D0SA 2ZU6A 2A9FA 3MTBA 4ODIA 1N0WA 1DAMA 3H97A 2YASA 4ZVQA 4O63O 4HXEB 1MAUA 4COKA 1F3OA 2Z57A 3IUNA 2XMZA 1A3CA 1Z4NA 1J09A 1E99A 3NC1C 2IZ6A 3VA7A 2WG0A 2YMMA 2D0DA 3NHYA 4DEXA 1C3OA 2IUFA 5HTOA 2FN9A 2PKWA 3L1KA 4M86A 4D9EA 1ETUA 1WCWA 5KVAA 2Q1UA 1HQKA 3E58A 2VSOA 3F8WA 3FCEA 3OIWA 4FI3C 3SYLA 3VR3A 3WK6A 1KQGA 2GNAA 2I7XA 3C7DB 5FUYA 1ZVVA 3I4CA 1FDSA 5KWVA 1WPQA 5HW0A 3FMPB 3V00A 1NXQA 4PRYA 2XQGA 4DDHA 3HU1A 3STWA 3TKYA 2HC9A 2VPXA 1JVBA 1O54A 2XKJE 1LCIA 4WI1A 1Y7IA 1EUCA 2PGXA 3Q9UA 5AKLA 1I1QB 1NX6A 3NYQA 4URZR 5JXIA 5F23A 2ZUBA 1I6KA 2XVMA 2WNHA 1UMBB 3L0OA 4FFBB 5FH9A 1OLXA 5KNCD 3AOGA 1YS7A 3ZLVA 5EP1A 3KOWA 3LBNA 4HDSA 3K9FC 3CLRD 4NATA 2WYIA 2BGNA 1QFMA 1TO6A 4NTZA 3GO4A 4JEIA 1KO7A 1TEVA 3QKTA 2P2LA 1KVTA 1MX3A 5IXSA 1LBSA 1GZ4A 2XE6A 5EPEA 3TR5A 4IHJB 3EJWA 4EGSA 4FGZA 1SBNE 3A1DA 3S1LA 2I1QA 2X8JA 3GMTA 4L07A 4TS4A 4AECA 3UV6A 3KQHA 2GZSA 3HBJA 1I01A 4IO0A 3RH0A 1F6DA 5CEEA 3D4IA 4QJBA 5JNVA 1YA6A 1JDUA 3I37X 1RXCA 5SY9A 4ED9A 1ORVA 1SHKA 2LIPA 3BMOA 3L6DA 4Q3BA 1XD8A 1HE5A 1TQDA 4WECA 3PVZA 4RE5A 4DDKA 1YR2A 2A4MA 1WMAA 1ISJA 1DQSA 2FP4B 1JHPA 2H52A 3HM2A 4MYHA 5CA1A 5CBPB 1NSTA 3O4FA 3ZNOA 1HYBA 3A0RB 3DKIA 1JFFB 5HG0A 3V3TA 5IULC 2Q3FA 3F8TA 3PXXA 4WOPA 5GZ1A 5CXSA 2BI4A 4UNIA 1N0UA 2AQHA 4PGAA 4CUKA 1ULSA 3O91A 4NH0A 1CY0A 3PXAA 4F93B 3CJRA 2YVAA 3EVEA 4BEWA 3GEGA 4HEHA 1AF4A 2G77B 3A1EA 2BTOA 2FZ4A 2P9FA 4MRPA 1ODLA 4LRSB 4QJ3A 5JZSA 2NU6A 1XDZA 1JEYB 1O9BA 5FTNA 1R0RE 4WXRA 5JJIA 1NDHA 4O3FA 4A73A 1FP1D 2I99A 2X8LA 1VGVA 4RS3A 1G59A 1OTHA 5CJ2A 4Y6QA 3VI4B 1YJXA 4JBYA 3GJ3A 2J0VA 4JLPA 4MKIA 2GBCA 1CFZA 1EK5A 4DGSA 5IAAA 4BBJA 1P2SA 1VLMA 4UCWA 5F77A 1Q2UA 2OUIA 1RMQA 1OT5A 1PFWA 1G8MA 1FJGB 4LBYA 4Q19A 5AR1A 4BYGA 2ZK7A 2X2EA 3O9VA 1Z5GA 1JIKA 3OJXA 3CF2A 1ECGA 4YTEA 2E5FA 1DCTA 5COAA 1E9FA 4EVSA 2FSFA 3ZNNA 5BQFA 3UB2A 2PQMA 5IWCA 1S2IA 3I2FA 1UUFA 1MFZA 2G4LA 2QNBA 4PVDA 3OMXA 2POQX 3SY8A 1P2TA 1O94A 3ZE8A 3H9JA 5E3IA 2PKQP 1VHLA 4B3CA 4GGOA 2IIBA 5AIAA 4FFDA 5I7FA 1WB5A 1NW7A 4PX5A 1K6IA 1XZPA 4ERXA 5B6PA 4X8OA 2RI6A 4KQ9A 2H1FA 2AUTA 2VDMB 1EVLA 4G36A 2FWMX 4LQ4A 4MI9A 4BUCA 3NTQA 1Z7GA 2IH2A 4AJHA 1GL3A 1G5IA 2DFDA 3LRXA 3K70C 5KNLA 3FDIA 5EKUA 3OFKA 1BGWA 1KPHA 1U81A 1TK3A 3FE2A 4LDJA 1KPGA 3IDFA 5A7GA 4KE7A 5K6AA 3KYDB 2MSWA 3QSYA 3JY6A 3LGAA 1FFWA 4LF5B 2ZR8A 1LW7A 4IUDS 3SC2B 2BMFA 2Q50A 5K0GA 10MHA 1GDTA 2Q2WA 2V7PA 3LX4A 3BMXA 2EBHX 4GWLA 5E6RA 1QQ5A 1KQ3A 3ELDA 3ZDAA 2OGWA 5JXHA 4Q4DA 5LL6P 2X41A 1PJ3A 3I8OA 5THXA 3TE6A 1H93A 1B2LA 4AIIA 1IZ8A 3ADKA 3RU7A 4RF3A 4F8EA 3G2NA 4XR9A 3KFLA 1C9DB 2G63A 1XMJA 1C8LA 1IHDA 2AE2A 2I0FA 3FYUA 3LXMA 3KAJA 2W2VA 2VL7A 2QQEA 1B8NA 1BXZA 1AZSC 1JHAA 1S0UA 2GK3A 3I8SA 2HV8A 2VOEA 3A58B 4X1YA 4QDJA 1HOXA 2O06A 1MLDA 4KLRA 3W79A 1OMOA 1QIIA 4U2FA 5A5VA 1IY1A 3EIWA 3U1VA 4UNPA 3OOSA 4BNDA 1H8ED 4IG4A 4PTYA 4CIDA 3VH1A 3TLAA 2IZ0A 4NPAA 5CB6A 4AI6A 4S35A 2I1WA 2XMRA 3QEOA 2D5BA 1GTG1 4CDRA 2O0HA 3G5UA 4GW3A 3H9BA 4YFVA 4C4PA 4ARCA 2XAUA 1QHHA 3O75A 3C8DA 1FFSA 1U3GA 1VLQA 3HABA 2QN1A 4EFNA 2QJFA 3A9TA 3G59A 4XKJA 5FLXA 3PXDA 2V4MA 1F7VA 4N3NA 1NN0A 1C8BA 4TT3A 2F1KA 1KOJA 5KNCH 3DCNA 3OLVA 3TMKA 1E2NA 2RFLA 5IMSA 1L5GB 4Z0NA 2MT9A 1O8BA 2FNAA 2AOUB 4BN0A 5I4IA 2FF5A 3AUUA 1YWGO 5JQGB 3K0EA 3W8NA 1WZ2A 1JHOA 1FJHA 3D7LA 5HKOA 3MUOA 1CLEA 3FR8A 1J24A 1Q1GA 7MHTA 4K2AA 2OBBA 1YACA 4MEAA 1P4AA 3HXTA 1I7PA 4LOIA 3KT6A 1L5SA 3VZPA 3EF0A 1DQPA 3U4QA 1LLFA 4GOXA 5COBA 1OREA 5JU6A 4EQ6A 2IYUA 3TRKA 1C3LA 1UMDB 2WY2D 3NAGA 4OJMX 4G0WA 4IQFA 1KYVA 1JQKA 4A92A 2FPSA 2HA5A 1E1KA 5IWAB 3WWCA 2ZAGA 5DEOA 1QTQA 2QVZX 3O2NA 5K6AC 4KSCA 4UHHA 3WA6A 4CM9A 3BK2A 3U0VA 2H4WA 4FOSA 3CEPB 4KQ1A 1OBFO 3HKBB 5FOXA 4ENSA 5F76A 1UFQA 3L46A 1E20A 3CCFA 2GPSA 5DM4A 2BF4A 3U39A 4B4KA 3FHCB 4M1TA 5E9QA 2IH4A 1DHRA 4N9WA 3AKZA 1FSSA 2V7QA 4BBZA 4JFRA 4AY5A 1WUYA 1N6IA 2WSSD 3KOMA 1YS6A 1L7OA 1TIKA 3MTIA 3MHTA 1XMQB 1NUQA 3KTDA 1DC4A 3R0JA 2C5LA 4J1TC 5MFPA 4BNNA 2D1FA 2P4QA 3N2EA 2ZB2A 5HA5A 1JHQA 4FW8A 3P19A 2BTEA 2ARKA 2WG2A 3GCWA 3IPXA 2UAGA 3HJFA 1XV5A 2VWHA 4GL2A 1B0ZA 2YXDA 1FYFA 1G8YA 2PVSA 2HWKA 3W05A 1DCFA 4P4GA 5CH3A 4LVOA 4B3SB 2PYIA 1MC8A 2P9YA 3QYPA 2AC2A 1OILA 1QQBA 1HWYA 1N3YA 1TYDE 3IUQA 3KWFA 1ZJWA 4H4CA 1NVFA 2YVLA 3WB0A 4P0TA 1BHQ1 1EWQA 3GIDA 1PYDA 4RENA 3K8ZA 4E14A 1DRKA 1BHSA 1P7WA 1TJ5A 1OLXB 1IVNA 3T3IA 1NFFA 4F2WA 3NEJA 3UV3A 2AEEA 1IOLA 4C6RA 2VF5X 1AH2A 3FOAA 1XMSA 3DWIA 1G41A 2A5FA 3N2GA 5HFAA 1KDPA 3LO5A 1MC5A 3KOUA 4HJXA 1ISPA 3QIAA 4FS3A 1KDTA 1LX6A 2OHFA 4CMCA 3TDNA 4ABYA 3RYIB 2PXHA 3G5MA 2DWOA 4CF4A 1T34A 2BFPA 3AZPA 5JNUA 3AETA 3EXHA 3OQIB 3Q3HA 3T9EA 3VAYA 2QG9A 2ZSBA 5D6NA 4S2EA 5FWXA 2JFHA 5BSRA 4YUYA 4F4FA 1B8VA 1RRGA 4MAFA 5JAUA 3A32A 3X0DA 3S68A 3DDNA 3RU2A 4KR9A 2PTHA 3GR6A 1WB9A 2HW8A 3MGAA 5CB8A 2ZYVX 4CTNA 1XU7A 1NUTA 3BMNB 4UDNA 4ERNA 4EMTA 1QIKA 1WDTA 4Z6KA 3NIDB 4JT4A 5FL3A 1VJTA 4O5OA 4BMNA 4OI1A 3C14C 3OA2A 4DEYA 5JHGB 3QELB 3PJEA 1H85A 2F1RA 1CXZA 3OZEA 3GB9A 4PS1A 3OCCA 3IFSA 4TVSA 4UUBA 3QEBZ 2SNIE 5KQSA 2V3VA 1AF7A 2WYHA 4RSGA 1ZK2A 1V3VA 3A7EA 1ODIA 2N46A 3OPNA 3VU1A 2QMQA 4DLBA 1OOEA 3ZNQA 4M49A 1PTJA 3AVOA 4JOCA 2AF4C 3MAAC 3WLNA 1SRRA 3DTVD 1G3UA 1EINA 1QO0D 4M1YA 2O20A 1RQNA 4TV9A 1V6AA 2Q7DA 4ID3A 5KYTA 1Z25A 3R6WA 2JZNA 2GFHA 2W4QA 2DG2A 3R3HA 4YRJA 4RK6A 4TMWA 5TVGA 4ZIRA 2F55A 2WSBA 1TDJA 2HJHA 4MQ6A 1MB2A 1XN4A 2X0IA 4FEEA 3PEUA 4MR7B 4S1OA 3PFNA 5AJWA 3L0SA 3U4DA 1LGYA 4NYIQ 5ALQA 4E6PA 3FRIA 4LMRA 2A14A 1ZHOA 4PTLA 5M3BA 2QN9A 1Y98A 4LSWA 3ENNA 4Y2RA 2DWCA 3Q3IA 1OBOA 1X7DA 3GH1A 1QV9A 4OU4A 2J3HA 2Q41A 5IUKC 4P83A 3NU1A 3AKCA 2JK1A 1R3UA 4YGXB 5ALHA 1S9DA 1G64A 2DC1A 3I8XA 5C5CA 3KK0A 1GP2A 3KTAB 4ZREA 5B58C 2ZJYA 1LPBB 5AW5A 5ADUS 4OUDA 1IC6A 1MC1A 2CVPA 3GJQA 3GXOA 1FMTA 2Q6TA 3MTEA 3GLHB 3QFTA 1RZRD 1NOIA 2Q5HA 4MLPA 4MUYA 4QUBA 1SQ6A 2C97A 2WW8A 1F0PA 4XQCA 1LPAB 1E2JA 1Z7EA 2FVYA 2VRBA 3GVCA 4IQ0A 3TQTA 2O8FA 3IMCA 4NS1A 1O1YA 3GJRA 4Q4LA 2X1MA 2HM7A 4X0EA 5GY7A 2HB6A 4X7RA 1A8IA 1LS6A 2J85A 4FU0A 3D3KA 2HCRA 1R4MA 2Z5LA 1K4KA 1EJ0A 1KU6A 2QB5A 4A9AA 2QZPA 3IA2A 5FTMA 4B4UA 4DWWA 2QUKA 2VCHA 1Z2CA 2B1QA 4CKZA 5AVTA 5AM5A 3LZ6A 3RVDA 1UQRA 3RJ9A 2Q5QA 3LKBA 3ESZA 3B2NA