3N0XA

Crystal structure of an abc-type branched-chain amino acid transporter (rpa4397) from rhodopseudomonas palustris cga009 at 1.50 a resolution
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
371
structure length
371
Chain Sequence
DLKIALIYGKTGPLEAYAKQTETGLMMGLEYATKGTMTLDGRKIVVITKDDQSKPDLSKAALAEAYQDDGADIAIGTSSSAAALADLPVAEENKKILIVEPAVADQITGEKWNRYIFRTGRNSSQDAISNAVAIGKQGVTIATLAQDYAFGRDGVAAFKEALAKTGATLATEEYVPTTTTDFTAVGQRLFDALKDKPGKKIIWVIWAGGGDPLTKLQDMDPKRYGIELSTGGNILPALAAYKRLPGMEGATYYYYDIPKNPINEWLVTEHQKRFNAPPDFFTAGGFSAAMAVVTAVQKAKSTDTEKLIAAMEGMEFDTPKGKMVFRKEDHQALQSMYHFKVKVDPAVAWAVLEPVRELKIEEMNIPIKNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible substrate binding protein of ABC transporter system
publication title Crystal structure of an ABC-type branched-chain amino acid transporter (RPA4397) from Rhodopseudomonas palustris CGA009 at 1.50 A resolution
rcsb
source organism Rhodopseudomonas palustris
molecule tags Transport protein
total genus 130
structure length 371
sequence length 371
ec nomenclature
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n0xA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n0xA01
1LJLA 2DRIA 4KK3A 4F11A 1BDJA 3T95A 2F8SA 2NZUG 1M2EA 1T34A 1QKKA 1D1QA 4EGSA 4Z4GA 5CNJA 1DJMA 5GQSA 2FQWA 4RK5A 4MLDA 5IEJA 4MRMA 1EFAA 1EWTA 2MYPA 4ZJPA 1NXSA 3KYJB 4YV7A 1PNTA 1ZH4A 3LTEA 4QYMA 1DBWA 4MS4A 4DN6A 3OMXA 1VKRA 3CFYA 3QLUC 4XLTA 2IDMA 5T7BA 3IDOA 1A2OA 5B3JC 3MM4A 4LE2A 1ISSA 3EGCA 1BDIA 1A0OA 3LUHA 3EDCA 1L5ZA 3I5AA 3S99A 2PE5A 3JTEA 1DC8A 3D02A 1MAVA 1P8AA 1QP0A 5KQLA 1U2QA 4RV5A 2MSLA 3DLHA 1DC7A 3QLUA 1CYEA 3BRQA 3QX8A 5IC5A 3ROFA 5B3JA 2QVGA 3L6UA 1E6LA 2JVIA 1SXIA 2FEWB 4O5AA 1FFGA 5KC9A 2PLNA 4Z9AA 3BBLA 3CRNA 3QEKA 1VLZA 4YWHA 3FGZA 3M9WA 4P98A 5TQ2B 4Z4FA 3O75A 3MMNA 2RJNA 2IPNA 1JFTA 4ZYLA 3I09A 4NQRA 1ZVVA 1RXEA 2JCGA 3FFTA 4MGEA 1USKA 3BRSA 4N0PA 2JVKA 4DADA 3HUTA 4KPYA 1Y1LA 1OXKB 4LDZA 5TPWB 1DCMA 4L4UA 3HXMA 2FW0A 1Z16A 4MR7A 1BAPA 1QPZA 4EY3A 2PUDA 3OO0A 2QV0A 2FSPA 3OM0A 4GNRA 4QYWA 3SQNA 1Z26A 4KRFA 1TM2A 2MYNA 5F64A 3URMA 4HNRA 4KVFA 4MS3B 5TQ0A 4KQ9A 4W5QA 1DBPA 1USIA 3HS3A 1A04A 2IYNA 4MQEB 4G0OA 4HNQA 5IEBA 5FWXB 3RVKA 5IBQA 4XAQA 3G85A 5C5EA 3HV2A 1IIBA 2L19A 2PL9A 4FE7A 3CG4A 2KYRA 3MIZA 2PUGA 3KYIB 2QZJA 2NT4A 3Q15C 2VYCA 3KCNA 4LRQA 1Z13A 2PL1A 3BILA 3MA0A 3H5WA 4Z4EA 3GV0A 5KQPA 2PUBA 3IP5A 3IP7A 1USGA 1FFWA 2JB9A 2MSWA 1RZRA 4TLMB 4EVQA 1QO0D 4RKRA 1K68A 1QMPA 4NCAA 2PUEA 4XXHA 4G86A 5CNIA 3QLVC 3GA5A 1GCGA 3C97A 1LBHA 4O1IA 3HDGA 3LUCA 1AB5A 1BA2A 4IILA 3RVLA 3N53A 6CHYA 3LUFA 4UHJA 4KNYA 1W9HA 2FQYA 3M6MD 3HDVA 3ILYA 3GYBA 4MAAA 5T3YA 4MR9B 2ZWMA 4MS3A 2W42A 3BREA 3SM9A 1ABFA 4MQEA 2WWVD 4F12A 3A0UA 5FWXA 1P6QA 1APBA 2IKSA 1ZGZA 2MSKA 1TLFA 1YS7A 1L5YA 1Z2DA 2VUHB 1P2FA 3QLVA 1ZAYA 4TN5A 5IUKC 1VPWA 3EULA 3N8IA 3HZHA 5JS2A 5HM6A 1U04A 5JNSA 1R8JA 1GUDA 2YHBA 4EUKA 2ZAYA 4JAVC 1YIOA 3VNAA 1QP7A 3CZ5A 1RZRD 2HJ9A 3JPYA 2RDMA 1DRKA 2NZVG 4W5NA 1MVOA 2WMYA 3KG2A 5IULC 2E4YA 3VNBA 1B00A 4L85A 1JFVA 5FWYB 2QSJA 3NBMA 2PUAA 4H60A 3A0RB 2CHEA 3F7NA 1P6UA 2HQRA 2OENG 3QEMB 1NTRA 3C3KA 2N9UA 4KFCA 5GOTA 3H1EA 3RVSA 1HEYA 2IOYA 4MQFA 2PMCA 3CHYA 4Z0NA 3LUKA 4HYEA 4MR9A 4UHKA 1RNLA 2GX6A 1FQWA 3FDFA 1MB0A 3I45A 1D2AA 3HSYA 4GPAA 1S8NA 3N6VA 3LUJA 1YMUA 4ZMSA 2HPHA 2B1JA 2H0AA 1GUBA 4O1HA 4KZKA 3KKEA 2FMIA 2LP4Y 3W9SA 4LE1A 5C5CA 4RY0A 4RKQA 3DZDA 1ZITA 4LZLA 4OLAA 3K9CA 4H3KB 4OTZA 2B4AA 1ZHHA 2A9QA 1SXHA 1LBIA 5HSGA 1URPA 1J56A 4MYRA 4KREA 3LMKA 3CKMA 1NXWA 1NXVA 1E6MA 1Z18A 4F3TA 1KMIY 2XDYA 3H1GA 1SXGA 3M9XA 1DG9A 1M5TA 1RXIA 4KV7A 2MYUA 5FBKA 1K66A 5KWSA 1E2BA 1EWVA 5ED4A 3OLXA 3H1FA 4ZPJA 4B09A 3HVRA 2WB4A 1NXOA 5KQGA 3RVPA 2R47A 2FKAA 1DP4A 1JHZA 1I3CA 4ML3A 5ABPA 2JVJA 3EAFA 4G0ZA 2JK1A 1YS6A 2A9RA 3N0RA 5DCLA 1KRXA 2L17A 6ABPA 2IPMA 1JYEA 3LFTA 4MR8B 4EYQA 1LK0A 1ZN2A 1QO0A 4JB0A 1JX6A 3H75A 1ISRA 2AYXA 1CHNA 3GL9A 3FFWA 2GI4A 3Q9SA 4S05A 1WETA 3R0JA 3LUAA 7ABPA 3JVIA 2CWDA 1JBEA 2IPLA 8ABPA 3A3KA 1JDNA 2PAFA 4ZMRA 3ILHA 2LIVA 5JNTA 2E4UA 4RS3A 3RVOA 3JY6A 3EODA 1UDRA 4N0QA 3B2NA 4ETMA 2A9PA 4RK7A 3I42A 4JA2A 4YR7A 3Q41A 1F51E 1C0EA 4D6XA 4EYGA 3N0WA 4ETNA 4YS6A 4YGXB 3QK7A 4YO7A 4N76A 3CTPA 1JH9A 1YTUA 1Z17A 3C3WA 3DBIA 1BVHA 3OQNA 4E7OA 3JPWA 1Z12A 2PUFA 2QU7A 1DCFA 5TQ2A 1TMYA 4MS1B 4XASA 1NXXA 2HSGA 1Z2EA 2YHAA 3C3MA 4Y9TA 3OQOA 3DLBA 1U8TA 3RVRA 3LKVA 5JNRA 5E3JA 2E4VA 3DGEC 1JYFA 1EHCA 4RK1A 3HK2A 4G0QA 1SD5A 4HNSA 5TPWA 4TMYA 3RVJA 3NNDA 1XWWA 4MR8A 4RSMA 2AYZA 2X7XA 5HKOA 1YK0A 3F6PA 1DBQA 4G0MA 1GCAA 1EAYA 3JVDA 5DGCA 4DQDA 1BDHA 2GWRA 3TB6A 1F4VA 2M98A 5EWMB 2O20A 1NATA 1D4ZA 4N47A 5TE9A 3RQIA 4RU1A 5DLEA 4MLCA 4OBBA 1XHFA 2WRZA 3KS9A 2FN8A 3DGFC 4Z4CA 4W5RA 1QQBA 3OLWA 1YVUA 5JS1A 1KRWA 2GBPA 4OG2A 1PEAA 2FXIA 2FLWA 3O2QB 4H3HB 3RVNA 1JF8A 2FLKA 3CNBA 4Q6BA 4RK6A 5I4CA 3TX6A 4RXTA 3MF4A 3NHZA 4F06A 1PHRA 3IP9A 1PUXA 3NNNA 4MS1A 4KMRA 5BR1A 1DCKA 2QR3A 5IUJC 3H5IA 3N0XA 1FSPA 1ZGGA 5CHYA 2ID9A 1ZESA 1DZ3A 3T38A 1JDPA 2FVYA 2BGGA 3HJFA 3L49A 4WUTA 4PICA 2LBPA 4JASB 1SRRA 4CBVA 2E4XA 5KC8A 1M2FA 3KSMA 2P9HA 2RGYA 2QVCA 3CG0A 1EWKA 3LKBA 4RY9A 2QXYA 4N41A 1GLGA 5JNVA 1ZH2A 4IF4A 3H5LA 2R25B 3KHTA 2NT3A 3SAJA 3O2SB 3KTOA 5EWMA 4Z4IA 1YK1A 1ZDMA 3LOPA 3NHMA 2ID7A 2MYTA 4PYRA 2OQRA 4WXEA 3HM9A 3QLTA 2QW1A 1XHEA 2FN9A 2PKXA 1PEYA 2FQXA 1MIHA 2VK2A 3O1IC 1C4WA 2M1ZA 4W5TA 3H6HA 3OM1A 3GBPA 3HO1A 3O1JC 4RXMA 5IUNC 4N03A 1JL3A 2GKGA 3D8UA 1ZY2A 1MB3A 4IMJB 3N75A 4NCBA 1ABEA 1U0SY 2R48A 4JP1A 1M5UA 4Z99A 3H5TA 4Z4HA 1E6KA 3TO5A 3QX9A 3IPCA 4MR7B 5CNKA 4PE5B 1Z15A 4G97A 1KGSA 1W25A 3CS3A 3OO1A 5JNWA 1QP4A 3K4HA 3IP6A 2FTKE 3IPAA 1JLKA 4MPTA 1QQAA 3OMWA 5FWYA 3EJWA 5CNMA 5TQ0B 4F8JA 3KJXA 3O2JA 4RWEA 2FMFA 3FFXA 3C6QA 4KK4A 4RXUA 3QEMA 1NY5A 3GWGA 3CLKA 4JOQA 5TPZA 3UUGA 2FMHA 5JNUA 3EQZA 3Q7TA 3H5VA 5KI6A 3UK0A 4FE4A 4IRXA 4P1ZA 4LX8A 3TD9A 4LDAA 1YMVA 1AB6A 4G0YA 3GRCA 4D74A 3OLYA 4EYKA 3E61A 3OLZA 2WJAA 3SG0A 3LUDA 2CD7A 4G0XA 3NNSA 5KQMA 1Z25A 2E4WA 4OATA 3F6CA 4NICA 2L2QA 3SY8A 1TJYA 2E4ZA 4EVRA 4WZZA 2I6FA 2F8TA 5TQJA 4OLBA 3CZCA 4XFKA 3QELB 4WT7A 4ETIA 1CEYA 4PZ0A 5BQ3A 5PNTA 5EWJB 3FMVA 3O74A 4YLEA 5EWLB 3O1HB 3GT7A 3GBVA 4YP9A 2WJWA 5TPZD 5DTEA 1PNRA 4RY8A 4Q7EA 3LUGA 2A9OA 3RH0A 3ROTA 5BRAA 5D2CA 2FEPA 4JB2A 4EYOA 1DRJA 1FFSA 2CHFA 3HCWA 1H9CA 2TMYA 3A10A 3KLNA 4M88A 3T8YA 4W5OA 4NV3A 3F73A 4RZSA 4QICA 2JBAB 4WWHA 4EVSA 2RJOA 5BRJA 1JWLA 4LE0A 1D1PA 2LUOA 4RK0A 3RVQA 2PUCA 4QPJC 3RVMA 2LPMA 2P4UA 3MQ4A 2J48A 2WY2D 1NXPA 1RPJA 3E3MA 1LJUA 3EQ2A 3HUUA 4S04A 2VUIB 4IMIB 4XARA 4IGAA 3UKJA 4MRMB 3HEBA 2PJUA 3H6GA 3G1WA 1NXTA 3OQMA 4FB4A 3QELA 4D6YA 4YRZA 4Q6WA 3T6KA 2HQOA 4E7PA 4TLLB 5HQJA 4MS4B 3Q7RA 5EWJA 5DKFA 4MQFB 1JFSA 2H3HA 5EWLA 2HQBA 3TMYA 3SNKA 3OLVA 4YCSA 3H5OA 2FMKA 4WXMA 1VRVA 2JRLA 1U2PA 9ABPA 1TVMA 3Q7SA 2IPAB 1OXBB 1D5WA 2Q5CA 2NUBA 4KQCA 4RK4A 5IX8A 3O21A 2JBAA 2L18A 4G0PA 4Z9BA 2R4QA 3CU5A 3KLOA 1QNLA 4RDCA 4PEVA 2V0NA 3MYYA 2FEKA 3JS5A 3P9YA 5FBHA
chains in the Genus database with same CATH superfamily
4R8LA 1O54A 2XCUA 2ZAIA 5HJ7A 4F1KA 3QVGA 4PC7A 2XA9A 4YUAA 2G9NA 2ZIAA 3SJUA 4DA0A 2WAAA 1L5QA 4R1NA 3LK7A 3VYUB 4QJ5A 3HB5X 1OXXK 3N2LA 5JY6A 4M0UA 3B6IA 4GI1A 4JX8A 5FEMA 3ZE7A 1TVCA 1FSSA 3FGNA 3GZNA 1QUEA 3HH8A 3L4BC 3RRXA 4ZJPA 1XQVA 4NPHA 1XU9A 4EAAA 1VGVA 5AHWA 3I73A 3IUSA 5ALFA 3ZWBA 5FBWB 4PZLA 2V6GA 3A1UA 4XGKA 4DIUA 2JAUA 2V5UA 4DUYB 1UBOS 4JUIA 2G0NA 3WRVA 1NKTA 2B5OA 1KO1A 5FA5A 4Z8YA 4KUEA 2J3LA 3BCSA 4ZAVA 3L7OA 1T4CA 2HA3A 3JQ9C 3U9TA 4HYTA 2BBTA 2NZJA 1E2DA 2ZYDA 4B5KA 1EZ4A 1ADJA 3G2QA 5AOVA 4PO8A 4R2HA 4XQCA 1U8AA 2JNWA 4GDFA 3VBEA 3WWEA 1XPRA 4TUYB 1SD1A 1G60A 4LEIA 2IEGA 4NZYA 2D2FA 4M3NA 2XUPA 2Y4OA 1EINA 1TRKA 3ZKWB 4YRSA 1SCQA 5EKDA 5IKXA 4G0WA 1QV7A 1VJRA 1XMSA 4G8BA 4HEA6 3DEZA 4PNHA 1EK5A 2HRRA 1LD3A 2NG1A 2YY7A 3LNCA 1W8DA 4JUDX 4C87A 5JZBA 3KWJA 1LC0A 3P9ZA 4UMFA 4EQ6B 1XMVA 1FP7A 1K8ZB 4YAJA 1T8YA 1G41A 3THWB 1LS1A 4WLUA 3IKJA 1XD2A 2X0KA 3DNFA 5LSAA 1IAQA 3RC1A 1JMKC 1CC1S 4ZYLA 3TBKA 3WRYA 1TE2A 2BF7A 3CUTA 2H16A 1TEVA 3EPPA 1JG3A 1M3SA 2IS2A 3DF7A 2XWJI 5CITA 1LEHA 4JLOA 2HHLA 4MVJM 1JQEA 5CK4A 1N1GA 2XE6A 4N5HX 4DNOA 4JYBA 4QUBA 5AKHA 5CEFA 1B3BA 3VNSA 4J8PA 2ODPA 1GSAA 3H97A 2NO5A 1XPJA 3CGGA 3CW8X 4Z53A 3U7QA 2O3SA 4ZI2A 4GGMX 3AF3A 4MS3B 2D7JA 4PSDA 4Q9KA 4V3BA 1HL7A 2PJDA 4HNQA 1EK1A 1G42A 1Q22A 2A1IA 3FAKA 2EG9A 1F0NA 1QO7A 2MR5A 4XOIA 3FPAA 1XWIA 5TMEA 4F4IA 1N36B 5ALNA 3OLCX 2I6QA 4NULA 4X1YA 1DX4A 4HO1X 4W7IA 1NW3A 5DFAA 3UJ8A 4FKZA 2ODQA 1L7DA 5A4AA 1SAYA 1B2LA 3H11A 1CP3A 2Z09A 1Z13A 2CNLA 5DN9A 4W7HA 1F5NA 4I7EA 4B44A 5JHGB 5JCPA 3P1JA 3LD9A 1R0CA 1V9LA 2X3YA 1P4AA 4RVSA 3GV0A 4WSOA 5DLPA 1THGA 3O95A 3HCRA 4ER7A 4Z7OB 3I1YA 1I3MA 4RVFA 3IMGA 3GJ6A 4B2PA 5KYNA 2W6QA 1XKLA 4J16C 5EG5A 2P6OA 2WABA 5A0VA 1JS1X 1DXOA 1K68A 2IA5A 1EE1A 4R01A 1TZ2A 1U5CA 4OPMA 1JDBC 4WASA 4RPHA 5CNIA 5E9WA 3RSCA 2GEUA 3MLAA 1IQPA 4FS3A 2ESRA 2WTEA 1V7CA 2QUHA 3T5TA 5MGNA 1KO4A 4KAJA 3OY7A 4Y2QA 3SCZA 5H4GA 4YJ3B 3DEKA 4LXIA 5CGQB 5JYCA 1APBA 5G0UA 1FB5A 2JIBA 4WJLA 1Z2DA 5H9VA 4QXRA 2ZQYA 3B8EA 3PQCA 2GSWA 4IJWA 4QOFA 3SQLA 5C8XA 4AJ4A 3KAQA 1WOMA 4Q12A 5BN3B 4ID3A 4IWNA 2C4KA 1XT6A 4CF4A 1GZVA 3GFRA 2GZAA 1WDTA 1K5PA 3D0RA 1ZISA 3C3XA 4C0WA 3TINA 1DAEA 2RH8A 3WJ1A 2RGXA 4XSHA 2PS3A 4HAZA 4IDOA 1ZFNA 5DW3A 1DKUA 3PPYA 5HBRA 3S28A 4QPZA 5LOVF 4HLQB 2RGUA 2EHJA 4MGKR 4W5NA 1FXWA 2Y2UA 1A71A 2IELA 1MVOA 1ID8A 3L04A 1USVA 3TN7A 2BM0A 2ONCA 1UJ6A 3FNGA 2Q3BA 4IJQA 4L85A 5EL0A 3RWMB 1LPPA 3AI3A 1QH1A 2BI7A 3PHCA 3HPQA 3X1YA 1P6UA 2HQRA 2OENG 3EASA 1A5AB 1B41A 1VIVA 1V41E 4L0DA 3KVOA 4QQNA 2FOXA 3A2MA 3P2OA 1UC5B 1BD3A 2IYFA 3LUKA 5BW4A 1PO7A 3C3AA 5K3FA 3FNRA 3J80A 2I03A 2XCTB 5BVHB 4YRGA 3L7YA 4H7KA 1OE0A 4GPAA 3TRKA 5FEUA 5BSUA 1TU0A 1UDAA 1YQEA 2GCOA 3KVYA 2B1JA 2MIIA 1X7WB 2OBFA 1T4GA 3KKEA 1CJBA 1LFDB 1NSFA 1RWKA 2IYUA 2JI4A 3GARA 4EY8A 2YRWA 4EW3A 1HDOA 3OP4A 1M2KA 4P93A 1QHIA 4RKQA 2FF7A 3NCTA 4AD8A 4GYWA 5DYNA 5CLIA 1MV5A 2Y6VA 1KU0A 5FLXA 3OWOA 1A5ZA 1Y82A 4YT4A 4MKXA 4X8HA 3QBVA 2X5KO 3QIVA 4BLTA 2BHRA 4Z8XA 1NXWA 5HXAA 4A91A 4KV7A 2ZJZA 3N5CA 4L9SA 3OLXA 5HUHA 3JD2A 2WB4A 5A5EA 4CIBA 1OAKA 1TTPB 2OBXA 4NMLA 5AXDA 1E60A 2GXSA 3R5JA 1LLQA 1B1AA 2M6RA 4HOYA 3ND5A 4D42A 4B2YA 4YDHB 4ES6A 3KKPA 1GRCA 1UZUA 4RPCA 4ZANA 3NWJA 1A72A 2VPZA 1V1RB 3GJ0A 1NHWA 5FT9A 1I7PA 3LFTA 3PNMA 4HB2A 5CM8B 1YZVA 3E18A 3HABA 4PO1A 3ZCQA 1GZ4A 2GI4A 3RKRA 4NG5A 1QHHA 3E82A 1QK5A 2C4HA 4YMSA 1C7RA 5AJXA 4LNUA 1TZMA 2V3VA 2AA3A 1EXWA 2DH6A 4HLUA 2BDUA 5IYZF 1UAYA 1GNQA 1V25A 3U44B 3TLXA 2GVDC 1MVNA 4GAEA 4I4TB 2PFSA 1M0WA 2QZ9A 2CNKA 1T2CA 2XR1A 5JAQA 1PBNA 7MDHA 3IMCA 1G66A 1U3WA 1NJ2A 2Q2OA 3GDGA 3IC5A 3PENA 4US1R 1YF3A 4H7FA 4E5MA 3C3WA 1G8JA 2ZW9A 3LPAA 4E7OA 4CM9A 2H2HA 1F2VA 2Q7XA 1U02A 3FOFC 5LZ7A 1KORA 3HA2A 1K0UA 3A26A 3OAAD 1NVVQ 4Y9TA 4RL6A 5IT0A 3AV3A 3FB4A 2IV7A 3WE7A 3RVRA 2PNFA 4D5EA 3IGFA 2HJWA 3LKVA 3ZGVA 4J2HA 4J43A 4DJ5X 4HP8A 1P91A 4NMWA 4C06A 3W7BA 5YASA 2BFNA 2WIKA 3LI2A 4YCNA 1NF3A 5LR6A 2GHTA 5BW6B 4PGHA 5B7QA 1C3LA 4MR8A 1ZD9A 2IBMA 1WCWA 4J4HA 2ZS7A 2J9RA 3H0KA 1TAQA 4ND8A 3UJHA 4I3GA 1AUQA 5JPCA 3OFVA 4I46A 3WFJA 5FBLB 3BN3A 3G5UA 4ZGGA 3GZJA 3C70A 2PL3A 1A9QA 5J4LA 1OT5A 1Z0KA 4TS9A 2IS1A 1IZ7A 3GAMA 1ISPA 4UEJA 3X1KA 4D4MA 1XCOA 2EGGA 3P94A 4IXTA 3G8CA 3VX3A 4IV5A 3MWJA 1YA6A 4ABYA 2ZSEA 3BAFA 3BFVA 1KOGA 4DPMA 3NCHA 2NZXA 4RU1A 1T1SA 1SUAA 2VJKA 5FHQA 3ZV4A 4II3A 1UPUA 4BPRA 2FN8A 2UUBB 1QH0A 6NULA 1QQBA 3GPBA 1RI3A 3RSFA 3S7ZA 4ZYVA 3KXPA 1NVWQ 2OL4A 2I6SA 3RSOA 4OV6B 4GSLA 1T4DA 3G7UA 3EN0A 1N6OA 3L8YA 4ZOCA 3LPNA 3NHZA 3STWA 2FG6C 2Q3MA 4F06A 2O14A 5FKJA 4BFCA 3ULKA 2JI7A 4X45A 2FE4A 1K0FA 4ZARA 3SQXA 4ZVSA 4WLVA 1IULA 1XF1A 1ZMRA 2HDNB 2XRMA 4LWOA 4PZYA 4MV6A 1ZJ5A 2WU3A 1CP2A 2A0WA 5F51A 4UTVA 1ATIA 1S2NA 2GJ8A 3IAXA 3V42A 5KYXA 3AUFA 2YWHA 4ZD6A 2OCAA 4C4PA 2XWPA 2CFRA 4PPGA 3BL8A 5ALMA 4D92A 1BG6A 1Z56C 1A77A 1NRJB 2WJIA 5HA5A 5HS4A 3JYNA 4QGHA 1RCTE 3AIOA 3L0YA 1C50A 3UQYS 5H3LA 4AROA 2NT3A 2ZWIA 4JZYA 3C1OA 2N1MA 4U7JA 4XLZA 1JDJA 3SDBA 1EP1B 1FTGA 5M3BA 3IQEA 4YPOA 2ZZNA 1BCSB 1XYYA 2FPSA 3BGSA 4LI3X 5JHHB 4PNZA 4MCJA 2GBIA 4Q3OA 3UICA 1VSBA 2BV3A 3OJ0A 1KP9A 2FQXA 5IBCA 3TVTA 3MUOA 3CVVA 3DFIA 2VHCA 2Y0CA 3PDUA 4WLEA 1IN4A 4F9FA 1E9AA 3JAWB 1C9NA 3AEQB 4MDEA 1J06A 1E61A 1KFEB 1FC0A 1XTKA 1AF7A 1CWUA 2PSFA 2Z2IA 3LPCA 5JCJA 3AILA 4KPUA 1BKSB 3VR3D 3KQMA 2GKGA 1O9GA 1KO8A 1I2ZA 1V4VA 3HXTA 4FPXA 4A8TA 3WZMA 5LMUB 3I01M 4FNMA 1Q6ZA 1Z7YA 3TBHA 4JP1A 4Z4HA 3BE8A 3CSUA 1UK6A 4RVGA 1CS0A 1L9XA 1U1DA 2D54A 2TMGA 3C7KA 3L4EA 1JMVA 4ZT2A 5C5EA 5KNBD 2GKSA 4QBIA 4J4BA 1I0IA 3WMRA 3VV3A 2ZULA 5D3MA 2Q29A 1LH0A 1GA1A 3QXGA 3H19A 1O89A 3ETDA 2DFNA 4RXUA 1TTHA 1KEKA 4ZVRA 2A5FA 3K0AA 5M2QA 1MRZA 2O3RA 1P1IA 4FEGA 3UJ6A 4XZ3A 5K0GA 4ZJYA 4GPZA 1H0KA 1R0YA 2FFBA 2GYVA 2QRGA 1FX1A 2DFLA 5IM4F 3R44A 4F2HA 2HPZA 3T34A 3JCZA 2QJTA 1XTIA 3QVXA 2PUHA 1ZGJA 2OVBA 3H1PA 4P1ZA 2CJYA 3GUVA 2IS4A 5HE8A 2QRKA 1UM8A 4C7KA 5FOSA 4XWKA 1Z6GA 1T8UA 4EO7A 1OYWA 4HWGA 3PPXA 3I9FA 5BYBA 4ZKEA 5B3LA 2D6FA 2RHWA 3R2JA 3B7PA 4GOJA 4RIHA 4B3BA 3R5TA 3OESA 1F8GA 2CD7A 4G0XA 3SJBA 4L4SA 4YRAA 4HRAA 1TYCA 3B20A 4PXYA 3CQ9A 1ONNA 1M6VB 1GZHB 4UAGA 3IE1A 3WLAA 2W4MA 1D2NA 2YVUA 2REOA 4C9BA 4F1JA 5A3JA 4PZAA 3BJMA 3IALA 4IH4A 1XTPA 5FL3A 5ARBA 3PD1A 4IHJB 4AMGA 4PSAA 1OLXA 4CFZA 4NNOA 2WFMA 3FMVA 2OAEA 1XUOA 1SD2A 2WHRA 1RP1A 3QWBA 4U5XA 5CGZA 1Y4DE 3RIXA 3NO4A 3UCXA 4L72A 1DIAA 1PQUA 2W6PA 1RQLA 2VPYA 3NS7A 4O4IA 1IBMB 2NU6A 3ENWA 1WCYA 4LA4A 1FFSA 3EZ9A 3FPJA 1T9GR 2VR1A 3BJRA 2AG8A 2O7VA 2FPKA 2Y1EA 5L4LA 1RYBA 1Z6PA 4J0GA 4RZSA 4OEHA 1JEDA 1NBEA 1XCLA 4X6UA 3SEFA 5E6UA 5DM2A 5B37A 1VZ3A 2RGNA 5CFOA 4BNFA 2QLBA 3RVQA 4YYEA 4XUCA 3OJCA 4KWHA 1AKNA 1UP6A 4X1KA 5C3MA 3UANA 5BP7A 5TEVA 1T13A 3B13B 3JWJA 4RKFA 3LRPA 1RTTA 2PUJA 1RWBA 3EQ2A 4YAGA 2OGWA 3L8DA 1L4GA 4CQJA 7MHTA 1VL8A 4MQBA 4IMIB 2W4QA 4MWSA 3BMOA 3RB8A 4MVXA 5AMXA 1FDUA 4C6SA 4BUCA 4IYRA 1CJTC 1YNOA 2I4TA 3EVNA 3MRTA 4X0EA 2XMDA 1G5FA 1X92A 3T3IA 4RH0A 2I5PO 1BX0A 1SCAA 3GJ3A 4AMBA 3KQVA 1PGOA 3LKZA 2QTAA 4ER0A 2HQBA 3O0TA 3U49A 1RM5A 2IUEA 1T5BA 4YJ3F 5CB4A 1KZ4A 3IAFA 3GR6A 1G98A 3OIGA 1OGJA 4PSUA 1RWOA 1KBOA 4UDXX 4ZVOA 2PUVA 5FUXA 3U9LA 3RPEA 2R8RA 5CXXA 3NAZA 3RBZA 1A2BA 3AXTA 3JYLA 2R6FA 5EKUA 2P5SA 4ZU6X 4HDNA 1JPJA 3D54D 3GBSA 4G1MB 5IHXA 1N6RA 1NZFA 2BRUC 2ZROA 1IPHA 3WMWA 3E1SA 4L6CA 1UXOA 1KTIA 3VO8A 1KQNA 2V0NA 2QU8A 3HU5A 3R6DA 5FRDA 2G5CA 2O0LA 4RLSA 5MGBA 4M1ZA 3T5BA 1W4LA 1O6CA 1QHSA 3WNCA 5CMLA 2YXEA 2OXCA 4HWRA 2VP4A 3PC8C 4I6GA 4S1PA 1I1NA 1CUHA 1HKUA 4AY2A 5KSOA 5K01A 5K9ZA 1O0SA 4I1RA 4BBPA 1W94A 2VQ3A 3GK3A 4RHYA 5KIAA 2Q4TA 2XOKA 1CQIA 5JZVA 5TLSA 1LK7A 4WKCA 4M9ZA 1UADA 3HN7A 4MSUA 1JBKA 1IY8A 3VDNB 4ND2A 4L22A 3AX6A 3TSZA 3W9BA 1PNOA 1RPTA 3A4NA 4NYMR 4ENQA 2A6PA 4ZQIA 1US8A 3IO3A 2G40A 3Q4GA 3VZSA 4QOSA 4A8JC 5IN4A 3PEEA 1J8VA 2IDMA 4DMHA 3GP8A 4Q1AA 1VE7A 2DFTA 4REMA 1EVLA 3WL4A 3I28A 4RQTA 1A2OA 3I2IA 1BDBA 3MM4A 1NKSA 2C8JA 3EWAA 4OQFA 3GLGB 2DF8A 1Y5LA 2OLEA 3JYHA 3RGGA 4XR4A 2HBQA 5F33A 2CFOA 2BMWA 1QP0A 3FUVA 3VYVA 1U2QA 4K9OA 4BJ5A 1NLFA 2NVWA 1ZN8A 2F17A 3HFJA 1SC6A 5H68A 5KNCH 3M70A 4C08A 2A14A 3R9KA 3WK7A 4INZA 1HEIA 4L0MA 3G79A 3E2PA 3Q3JB 1SXIA 5E1MA 1ZONA 1JJ7A 3R7NA 3VHRA 1E6WA 3O6VA 4I0WB 5A02A 1PW5A 5E7JA 1CZHA 5K03A 5BPFA 5JNLA 2O59A 3SR4A 3SHFA 1EBFA 1OV4A 3HHEA 4OH7A 1EQ2A 5BW8A 3FGZA 2AVNA 2ZI9A 1I9CA 1GCUA 1XDUA 5T5QA 3CNEA 4Z9FA 4AP6A 1EXDA 4JYPA 4GMDA 1XA4A 3G59A 3UCFA 4RA6B 1P2DA 1JLLA 3TSOA 4FDUA 2PSEA 4WECA 5LUBA 4B3IA 1RJFA 2DT8A 1OXKB 1RYFA 2QBYB 1XRPA 5KYYB 2ZI7A 5H82A 2GEKA 2ZRNA 3ACDA 3L40A 1VJ5A 1MX9A 4PGAA 5L45A 2R84A 2VEDA 3M83A 5AI9A 4DVJA 1P0IA 2AN3A 2ZGVA 5LA6B 4AULA 4WXPA 5KYKA 4PC1A 4E0BA 2EBHX 5FPSA 2AS0A 4TQ9A 4UMEA 5TV2A 2QXTA 1QIFA 2A2ZA 3TG8A 1QIHA 4V03A 4XWWA 4JLNA 3RVKA 4ENSA 1QTQA 4OF4A 2B78A 1E1QA 3C3BA 4EO4A 5JXWA 4EI2A 3ELDA 4I4TF 2AR0A 3CA8A 4MJXA 1XEFA 2VH5R 4F8EA 4DVGA 1PX2A 5JEEA 2PS1A 1L8LA 2DH5A 2KYRA 4NOLA 1K08A 1T5IA 1N92A 5G2OA 2A5LA 3CR8A 1BXKA 1GFZA 1H8HA 3OPNA 4LNAA 5T4FA 4CLOA 1F7VA 2VYCA 2ZBVA 3N70A 1CJSA 3P9PA 2PL1A 4L3WA 2OUKA 3EGDA 4EUNA 1XTRA 3PUIA 3U16A 3CXUA 2BIFA 4F7DA 2NUAB 2IC5A 3UAYA 2QLTA 3K9BA 3SVTA 3GMSA 2N1BA 3LDUA 1AHNA 1Z5WA 4QXMA 1F8FA 3RAPR 3ZE6A 5C80A 1USGA 5K0CA 3Q9LA 2BBSA 1Z0UA 3FOEC 3SEQA 4CDMA 2W6ZA 1OXUA 4LGMA 4CQMB 1JG6A 2PGNA 3GW8A 2HK9A 4GC5A 2JDID 4Z9YA 4CM4A 2VAWA 1A7KA 3RVLA 1QK3A 1KVRA 1O1YA 3QVKA 1QQ6A 1QZXA 5T3YA 4BV2A 1SNYA 4WZ6A 2CHVA 4XEUA 3SF8B 1HZZA 2OLKA 2Q5QA 3DQZA 2XWBF 3IVGA 1Z45A 5CK5A 4LFCB 4F12A 1P6QA 2CMFA 4H59A 4JEUA 2C82A 4K3UA 4KLAA 4BO6A 4B7AA 4LXHA 1OFVA 5H80A 2JIQA 8MHTA 4F6RB 1GTVA 4Q16A 1AO0A 1DQRA 1J42A 4R8MA 4IBOA 2J0UA 3M4ZA 1RJEA 2C7QA 4NABA 5CAEB 3DZCA 2X2EA 4BX0A 1ABBA 3SJZA 1WHTA 3HE3A 4M6WA 5IVIA 3O84A 1GUDA 5E2AA 4IIUA 4ENUA 3EWIA 1DAOA 1YSCA 2AN9A 4PCLA 2VF7A 4JAVC 4R1MA 3VQTA 2VK4A 1LW7A 1TEXA 4IV0A 5JSUA 5A7HA 1RZRD 3AP2A 2CL5A 1OFUX 1II8B 4FN4A 3WGYA 4QVKA 4NV1A 2Z2JA 2WMYA 4CF7A 1N9KA 3QY0A 4WZAB 1E9BA 4LC9A 5EJ2A 2BD0A 4YHHB 3HJNA 3IX7A 2ZSAA 1QHFA 3LX6A 3OT1B 3PQ8A 4A26A 4AF6A 1N2OA 5K0BA 3MAJA 1K7EB 1H2YA 2KX7A 3PU6A 4QYTA 4QJ3A 1Y1KE 1JHYA 2XX3A 2N9UA 2ON6A 2WILA 1EK0A 1U11A 2Y66A 5GOTA 4MQFA 3C7DB 4EJSA 3V4RA 1KY2A 4QA9A 3F3MA 5I9SA 3P97A 2Z0MA 1YKSA 4HEQA 3IJPA 2WVGA 1QS0B 3ZLVA 5EZ6B 4OA5A 2QL9A 4HPXB 3HCPA 3NOOA 2FVXA 4EZIA 2XZDA 1WDLA 5B3AA 2GEDA 3ZGZA 2K2QB 2OO5A 2X19A 1A96A 4FT2A 4TMXA 8ATCA 5EA2A 3ZH9B 2NPIA 2ZRDA 2X40A 3QTTA 5AHXA 3ZX4A 4XTCS 5DBIA 4PSVA 2IUUA 1FW6A 2D5IA 3T4UA 4G6ZA 3JSAA 5HSGA 2Q2VA 4BLSA 3SNHA 3TB4A 2DOKA 2W83A 4IZHA 2RGBA 1E7WA 3CKMA 2ZI5A 1AGPA 3EVTA 3M0EA 2XDYA 4X61A 4ALLA 1QH8A 4DAOA 2VS1A 5LBUA 4MKIA 1VPVA 5C7YA 4O8CA 1YOVA 2JIRA 3GD7A 2WSLA 5K51A 4BWYA 5I8WA 1Y3HA 1E3LA 1JI0A 1MVLA 3OCYA 1C1DB 2DLCX 1IN5A 4YVFA 1DP4A 4Q9IA 1N3YA 4NSNA 4UHFA 1ZI6A 2ZE5A 3PQFA 4NHOA 3FHOA 2FLVA 3O93A 2CZQA 2X5JO 1N2IA 3OZFA 4U2BA 3N0RA 1RC0A 1YS6A 3BJZA 1XFDA 3GJZA 2PUTA 1UAAA 2COUA 2C7PA 1NNI1 3HEMA 5B64A 2WB2A 1QVWA 2LKDA 1LK0A 2APJA 1YUNA 3C87A 2EJVA 3HWX1 5D1HA 5AW0A 4JYZA 2J4CA 1CUCA 5JJ5A 3R0JA 4D0SA 1OQAA 3AUJB 4LIPD 3RTCA 3L01A 2AQKA 3TKYA 4MUYA 4Q4AA 4PLVA 5LN1A 4RY2A 1PL6A 4IDGA 5EHGA 5FWAA 2H63A 4GQAA 3HFSA 5DI3B 1R6DA 1U8UA 4ZC1A 1AZWA 4MYSA 3JY6A 5BUZA 1JJIA 2GO7A 2I3DA 4WNAA 3DL4A 5LLDA 1WXFA 2YMMA 3B1JA 3GFSA 3DTVB 2XI4A 5EN4A 2X0DA 2QAGC 1YBVA 2XVMA 2QLMA 3VHQA 4RJLA 4JLWA 3WGMA 1FVOA 3H16A 1EUDB 1WXHA 2X5OA 2WD7A 2I1QA 2H1LA 5REQA 1L3CA 2YXPX 4IHJF 2ATEA 3QA9A 1J8MF 4G9GA 4I2NA 2X2PA 1CRLA 3B6KA 1U8TA 2BE9A 3D3QA 3P20A 1Q16A 1SHLA 3MMZA 4BIMA 5E3JA 4A16A 4ZOLB 3AM5A 5ALSA 1RYYA 3V7FA 4MTCA 1AXRA 2ZUDA 1V11B 1N5MA 3U4QB 4D7AA 2GEBA 4YUWA 1WSAA 4I1VA 3KZXA 2Z2XA 3I6YA 2NU8B 1YK0A 3DDCA 3LL4A 3RIHA 5D3QA 3PQ5A 4DSZA 1EAYA 2PHZA 1WPQA 4LHEA 1ZXXA 2O2IA 4X91A 1UODA 2BTQB 2IUSA 4AWBA 2EFEB 4XYMA 1T4MA 3B12A 3CUUA 2HL6A 2GPBA 3CH6A 3KQLA 1JFFA 4DCGA 4LAFA 1C7EA 5COQA 1RKUA 3PB3A 2X0JA 1GAJA 2TMKA 5BMOA 2Q9AA 1WCXA 4DB4A 2WTAA 3CCFA 2HIAA 2E6KA 1DKQA 3FVVA 2EFCB 3H2KA 3WMGA 3BMNB 3LC1O 3QE2A 4LJ8A 4CCYA 4O4JB 3K6RA 4UW9A 1H9BA 1RAIA 3TZLA 5CBPB 5I4KA 1NVTA 1JF8A 1E5VA 4ICIA 2IRWA 2OCKA 1M67A 1CSEE 3QOWA 2C5HA 4RIEA 3L93A 1R74A 3H2BA 4JVLA 4KQ1A 3G17A 1UP7A 1LSOA 3EDYA 2OLJA 2IY7A 4G09A 4HX9A 1V5IA 2WNHA 3QTBA 4LQ4A 4UNRA 2R85A 3GUZA 1U28A 3ZUPA 4U9IS 1T4CB 2Z9CA 2BFAA 2ZJBA 3DBLB 3KOXA 2OV8A 2BJWA 2WDZA 3IT1A 4PXAA 3MXTA 4TSKA 4AMUA 3TSYA 4BFZA 2BL4A 5CYOA 2YV2A 4XJXA 2E4XA 2IYRA 3VPGA 1JE0A 5JAIA 4BNIA 2DQSA 3F47A 3E8MA 3LKBA 3RYHA 5LYJB 1R6TA 4N41A 1QVRA 2ORED 1Q20A 4LECA 4ECAA 2RIPA 1LDMA 2YS6A 2EHDA 1NTOA 3PQ7A 4BGIA 2XVAA 2FSVC 5EWMA 4HZUB 3NBFA 4FP9A 3NDPA 4UBNA 4CJXA 4KR0A 4LF6B 1BJTA 1DMRA 2PR7A 2XOXA 2FDCA 3ZOZA 2QMZA 1IHPA 3W5HA 1SCNE 2YZKA 5AIAA 4E70A 4AY4A 1Z6YA 2BRUA 2RI6A 2VIIA 4LJAA 2PEYA 1FX0A 2WAMA 1EGMB 3HVIA 5HKBA 2C0PA 2B1IA 3K20A 1V26A 1MO2A 2FW6A 1ECLA 1B16A 3LVRE 5B2FA 4D9KA 1G6HA 3VKWA 4F86A 5A6SA 2NNLD 1E3JA 3AVPA 1X42A 5H1YA 2VYVA 3A36A 2ZJ3A 1NUHA 1TFUA 2R751 3IPCA 3BFKA 2XTZA 4QXAA 5DM1A 1K7CA 1EA5A 3PCXA 3GQVA 4HX5A 1VHWA 1KBQA 3GIDA 3VR6D 5SZHB 1E1CA 3K4QA 3EGWA 2ALJA 4K9MA 3RUHA 2PZLA 4KK4A 2QZSA 3U1VA 2FWBA 2I29A 4HQ0A 2EF1A 4A8JA 4GL4A 3CJRA 2PO7A 1FOEB 1O7JA 1D7AA 1JIIA 3OTGA 4PRLA 4C6TB 3UUGA 3IVMA 1DX6A 2QMYA 2Y05A 3UHAA 3E0XA 4E5YA 3HM2A 5AM5A 1H4VB 2DFDA 3NDBB 4RPGA 4BDTA 4V0ME 1ZJWA 3CUEF 3OOEA 1UZAA 1XJ0A 2VJDA 2VQ6A 3GWZA 3SHTA 2AI2A 3BXOA 3WWOA 4RGYA 3AHJA 4RQUA 1T5SA 5JMWA 2FZGA 3C2QA 5A04A 4OJTA 3EISA 4AJNA 2VQDA 1K86A 1R6UA 2UVPA 4BMZA 4CG0A 1K63A 2X5NA 2PDAA 2QRNA 2M9MA 5COAA 3UJDA 1WS6A 1U6JA 3FFAA 5IW8A 1VA5A 2IEDA 2IPOA 4F3RA 1ESZA 4IJMA 4U0JA 4OM7A 4PZUA 1G4AE 1XZAA 2CJFA 4EDHA 1ORRA 3C4QA 4RDHA 1F3OA 2B1RA 1YS1X 3UMCA 4ER6A 3UJCA 3PA6A 3DFKA 4ME6A 3TH5A 1RRFA 1ENZA 3MPUA 3ORSA 3S40A 1U7XA 2IYTA 2EBWA 4DQXA 2Z6UA 2XQIA 2P9YA 4KC0A 5LA6F 1YR3A 3AF5A 4MW5A 4DLYA 5F23A 4JI4B 1R12A 1I2BA 1G5TA 2VHUA 3KUKA 1SVOA 3OURA 3K9FC 3LUGA 3WRXC 3N86A 2H08A 4FD3A 3E35A 4UEWA 3TZHA 4AMVA 4BRWA 2DUWA 3HCWA 3LGXA 3MJDA 1JSCA 3TSAA 3O3CA 4NV3A 3BEDA 2DT5A 2WMNB 4BEBA 1ML3A 3NYRA 5JU6A 3N07A 4JSTA 1BMFD 1AMOA 2OCIA 5FUVA 1P7YA 4C7XA 2O2XA 1Q95A 4OQPA 4XUGB 4QPJC 4C0LA 2LPMA 5DO9A 2H52A 2O2HA 1L8OA 1JLRA 2BDEA 2YZ2A 1Q5PA 3OJXA 5EQJB 3DCJA 2Z6AA 2VH2A 4RJKA 1G1MA 5FD8A 1S3FA 3RRFA 2BKEA 1SKMA 4QPNA 2VWQA 4P92A 3S1LA 1T3SA 3W5VA 3I6MA 3WL6A 2FQ1A 1A76A 2Q5LA 4U8GA 3QVLA 1LB1B 4G8JA 3NH6A 4LMRA 4PM4A 4TSFD 1T36A 3R20A 2QRJA 4GR5A 2JGJA 3L6EA 3KL4A 4LYYA 4Q6WA 3QP9A 4ZT3A 5D3MB 1RP7A 4L4RA 4BOYA 1QRAA 2YDYA 2PE5A 3VKFA 2OD2A 3H9JA 3I37X 3MOGA 1SIOA 5ALHA 5AOAA 4BE4A 3IEXA 4MRPA 4R2WA 5HHTA 1DQNA 2QGNA 4WXMA 5A5VA 1QLJA 2AOTB 1U98A 2G08A 4BJ6A 1MRNA 2VYNA 4U2GA 3UFXB 2GCOB 1FUEA 5LQUA 1OPRA 4QE3A 1E9DA 3KCQA 1KAGA 1X13A 1QYIA 2A4KA 5EMKA 3OIDA 4N3GA 5F1OA 5G1PA 4CV1A 1F3LA 4D5GA 2R5WA 4HNTA 5JXJA 1GPH1 1NDHA 2QN3A 1M9NA 2WZQA 3SBDA 1NJSA 2TRSB 3PVSA 2VP5A 2C8LA 3ESYA 2XMSA 4YFVA 2HSEA 3BGDA 3O8NA 3DOOA 1LA2A 4JVSB 4F2GA 1PU2A 1BFKA 1QIDA 4NBSA 1N78A 2QUAA 1KOLA 4CLEA 3FYUC 1CNMA 1MKYA 3CUWA 3HCAA 4DQKA 2KSQA 2QVBA 3RDPA 3O8DA 2AW5A 1NPDA 4ROSA 3V1UA 3T3OA 2PKQO 1WUIS 4W9NC 2XD4A 5KVCA 4P83A 1YZTA 3NASA 3SXUA 5TC4A 2IODA 2QK4A 2GF9A 5GAJA 5IKMA 4DR4B 4HSEA 2CFCA 3AO0B 1QH9A 4O0LA 5KJ1A 3GVXA 4E3ZA 4QYMA 1SUIA 3FUXA 2XADA 4RD6A 1WZCA 4DJJA 4KYTA 4XLTA 3BWVA 5FOUA 3AF0A 4ZN6A 5EZ5A 3N6RA 4NBKA 4AZSA 3AR7A 1OREA 4RF2A 3QU2A 1WXWA 4LYGA 2CMHA 4BV3A 4TYYA 1QHHB 1JWBB 4E22A 3H2YA 3LUHA 3KL2A 2FPUA 1DOZA 1HLFA 2C61A 1DC8A 1EJ0A 3D02A 3DNPA 3GLHA 3GRZA 3JTEA 3KR2A 4OBXA 4EWLA 1J24A 2CXHA 1RQPA 1X3LA 4C7OA 1R0RE 2R1VA 2ZB8A 4U4AA 1BXGA 5B12A 2QV7A 3N2GA 4AG6A 3EPLA 5KSPA 1CF4A 5JRJA 1JQKA 4WK0B 1EFRA 1XRNA 5HKAA 1W19A 4BNKA 1RBYA 2Q5JA 5KC9A 5KMGA 2ZBQA 3Q3CA 3GRPA 2WWHA 1CY8A 1ZUD1 5JYDA 2AJDA 3LT4A 4RL4A 1P9LA 5SYAA 3STYA 4TZTA 3ZHXA 1F17A 2IHVA 4BASA 4EIWA 2K6GA 3A6JA 821PA 4MW9A 1YQGA 3AR4A 1FQKA 1W0JD 3W6ZA 2ZUBA 4HV4A 1SU8A 2FEAA 1E18A 2BF4A 4I6EA 2OYRA 3ZDZB 4KPYA 1B0AA 2OGTA 1JZSA 2YC2C 3O8CA 2YXDA 3BDVA 3VHXB 1Q0RA 3VM6A 1Y5NA 3OF5A 1TCVA 4Q3KA 4HYYA 4MGIR 3OIYA 2QV0A 2FCRA 5JSKA 4J0DA 1OU4A 3U62A 3WA6A 3EIQA 1ZK2A 2NTNA 3BDAA 3ED1A 4KXXA 4FGWA 3QLEA 4ROTA 3LDGA 1VBKA 4CCWA 4U63A 1CY1A 1Y1PA 3EVCA 1DBPA 3IJ5A 5ELXA 2PX4A 2CDNA 5LXTF 2PFKA 5FWXB 5KYWA 1P1FA 5ENVA 4EARA 3CRZA 2BFBA 1E7RA 3LZCA 1A8SA 1DC3A 2Q4DA 3A1FA 4TT3A 5I7AA 2ZITA 5FQNA 4D82A 8AT1A 4RHXA 1RYZA 5CDYA 3MTIA 1CDZA 1HMYA 1TJ3A 2PLFA 1W29A 4J0EA 1U2GC 2WHPB 3BK1A 5AK3A 4MW2A 4IS2A 5LM3A 2X13A 3V1TC 2I8LA 2OG1A 4WK2B 3WB0A 1WOYA 1DDGA 1I2CA 3H5WA 2RBKA 5TT0A 3A9VA 4YONB 4P0QB 621PA 2IYEA 5HPYB 2B1QA 2WNIA 2X4LA 5FCDA 2G88A 3IP5A 4ZVTA 3D8RA 3O90A 2JB9A 4ZOLF 1BXZA 3ZWYA 4EGQA 4DNXA 1VJCA 1GNTA 2QAGA 4EVQA 5A71A 4LUCA 2FF5A 3OCVA 2VPPA 2BP7A 4MQ6A 4D9GA 2HDOA 2VWGA 3AB8A 5D01A 1GXSB 4M9UA 2V8OA 3UHJA 1V5GA 2C29D 2XDQB 1NJ8A 5MN5A 1AB5A 1WR8A 1P9RA 4Q4CA 2CVZA 3HDVA 3ILYA 5ES3A 5IAJA 4BLPA 4EJ0A 3BICA 4MOWA 1CUAA 3T9DA 4PLFA 2ZWMA 2ODEA 1A5BB 2IX9A 4IINA 3A6LA 4G1EB 4PS1A 3NH9A 3Q7PA 1YS7A 1Z47A 4UAVA 1IQUA 1JIQA 1ES9A 4EHIA 1RS0A 3DC2A 2NZ2A 3NHFA 5DTJA 3GEEA 3QG1A 1RBZA 1LI5A 2W2OA 2VDOB 5LKRA 3UV6A 4KPGA 4O4JF 1ESDA 1O94A 1EG7A 4QDTA 1U04A 4TWBA 1XTVA 3FNEA 1OLSA 2H6EA 4MDYA 1QVVA 2GZ1A 1CT9A 3ESCA 2RARA 1DIBA 2BCEA 3BK2A 4IEEA 4M7WA 4HI0E 1IY0A 5L9AA 1AK2A 3PQ3A 4MIEA 5D84A 2ZUUA 3T35A 3GZTB 2NNWB 1LW6E 1OWMA 3KBOA 2IIQA 2J9ZB 4MMYB 4L2IA 2IL1A 3CNLA 4PY2A 1L4YA 2D59A 2OD7A 3NATA 4GU5A 4X3OA 4XVUA 1VMAA 4XVHA 1ULSA 1ND6A 3WSVA 5A9SB 3ASVA 3D4PA 1DIGA 4PQEA 4H4CA 3AIIA 5LCXA 4IVQA 1DDIA 2PXHA 1IEQA 2ISSD 2AI3A 5LYJF 3ANMA 5IARA 3UXEA 1SVWA 1QZ3A 2YDXA 4Z0NA 2GXQA 3DOFA 3WLMA 3CY6A 1N5DA 3MRSA 5KHLB 1G4HA 1H8ED 1PK7A 1VB5A 1G17A 1Y5MA 3UEOA 4D8VA 1D2AA 4Q5IA 5KDOA 4U3JA 1IOWA 3BC1A 4MUNA 1P4GA 2FSFA 5BWMA 3U0BA 1GT6A 1LDNA 2EATA 3VZQA 1NQUA 2JGLA 2ZJFA 3QUQA 4IIYA 3HXLA 4DZTA 3ZHCA 2Q6LA 4O33A 4IX9A 1TFRA 4JJEA 1BJRE 1TUBA 1ZEMA 3EC2A 4H3KB 4Q1EA 1Z8NA 1N3IA 2DP4E 3A6EA 1KSGA 4ER5A 1SC4A 1T35A 4GM1A 1N1MA 4ZRNA 2HTFA 3KZ1E 3YASA 1RRCA 3ER8A 3QKWA 1ZVJA 4FYWA 3RREA 4E5NA 2QN2A 1DXQA 4TLAA 1Z18A 1E6MA 1G7RA 1KJ9A 2VPQA 4NZPA 1Q2UA 1SXGA 3I2GA 4HUQB 1DG9A 5IVHA 1W44A 1GPDG 1YA4A 3JD0A 4M0MA 4KP7A 4RH1A 3HY6A 5K8LA 1SELA 1JTFA 1PR4A 1WEKA 3UM9A 4V0LA 1NUPA 1TGVA 2GMWA 4FBGA 4HDCA 3RVPA 1FS4A 1NC3A 4HRVA 2Q4BA 3RKSA 4DC1A 2DPXA 4YBRA 1M74A 2DB3A 1G5RA 4O4IB 2OXFA 1WWKA 3P7MA 4HLNA 2E49A 1IAVA 4EYQA 3DDUA 1L1FA 1VYHA 1SKUA 5EXEA 2C5SA 4K6HA 4TRNA 1P31A 5EHQA 4MA5A 4K1LA 3AM1A 1P4RA 1YRYE 2BMDA 3HA7A 3ZWWA 5E6UB 4X6YA 1HM5A 1A82A 2QQEA 5EXXA 2GLTA 3AVQA 4KWEA 1VLQA 5AJWA 3Q88A 4X1KB 1P2BA 3W6NA 8ABPA 1FNBA 4I8DA 4DC9A 1QX4A 2E4UA 3AU9A 5CLGA 2Q7OE 2LRHA 5A1TA 1W8IA 4Q66C 1SUDA 2J31A 1DHTA 5ICGA 2EXXA 5FR2A 4KN6A 3CINA 3FOAA 2RHBA 5EZQA 1YTUA 4ED9A 1SZJG 1YRQA 2VRBA 3U4DA 3FKJA 3FUUA 3ZEIA 3NUQA 1VKJA 4IO1A 2PIAA 1O95A 2ZRHA 3TW8B 4WJKB 1MOZA 3KYCA 3ONNA 3P4UA 1DEOA 1T0IA 2HXYA 3A3OA 3LU1A 3O8BA 2ZUWA 4JYMA 4IICA 3OU2A 4FOSA 4ZV4A 3TDNA 5L6LB 1PFYA 4O3FA 4IZIA 4LY0A 1C0LA 4JITA 4WZBE 1HDZA 1QGUB 3CH5A 3LWBA 2OZLA 3A1VA 4PLYA 3FBGA 1XZDA 1ZHOA 4LHSA 3QX3A 4PPFA 4IH1A 4E4RA 2HA5A 3CE6A 4JQSA 1JDTA 1GCAA 2B0CA 4OAQA 4YAFA 1CZLA 4FDVA 4NMHA 4PAWA 1RXWA 1KEUA 2JA1A 4JLUA 4P4SB 3OX3A 4KSBA 2OV3A 5AI4A 2FV8A 3W3ZB 1B1CA 4DLRA 3LBAA 2EIHA 4DDVA 2J6HA 1NQ5A 4K05A 3KQYA 4C4XA 3WNVA 2Q2NA 4RSRA 1JBQA 4WFIA 4WOKA 4YC7A 1G21A 4IFIA 5JS8A 1VGQA 2GBPA 3ZDYB 5LZ8A 3C3CA 3EEBA 1V16A 4CM9D 4NYIQ 4Y1RA 3RVNA 4P5EA 3CZRA 2JAPA 3GCDA 4B3RB 1NX9A 3MF4A 3W3AA 3VYTB 1D4AA 1U0EA 5JBQA 5BR1A 3T7CA 1F6BA 1M73E 1CQJA 3T1VA 4B3HA 4NK4A 2I7VA 4DNQA 1E0SA 1L1QA 2DCMA 2X58A 1GNPA 1MTOA 4MARA 5CHYA 3PRHA 3H2SA 5FIUA 2CJWA 5EEGA 2O2JA 4X54A 4HTFB 3RLFA 1X14A 4JASB 2OG2A 4K9QA 1ZO8A 2J3DA 4FEAA 4WVLA 3GPLA 1W4RA 1F4LA 1PL0A 3PNBA 3WDMA 1SU7A 4R40A 4RKWA 3PSHA 1FMTA 4UFOA 1NM5A 2ZB4A 3RIYA 1SURA 4MIKA 2FX2A 4UBJA 1Z0DA 2C95A 2ZK7A 3TIFA 1HNNA 5EZSA 1VKOA 2DPGA 4DABA 4KE7A 3UNXA 1FFHA 2GEFA 3KJNA 3ND9A 2JJYA 3NHMA 2XBLA 3FI0A 4HNUA 3QY9A 1G2QA 1QMGA 3DD1A 4G5RA 1NWCA 1DQSA 1F1BA 3WK5A 4R7GA 4D4JA 5HFNA 1ORVA 3O2NA 5DYWA 4PHGA 1QGZA 2VK2A 1Q1QA 1GN9A 1QG6A 3OTWA 2EX4A 4ARZB 1CF9A 4ZIRB 5CA1B 1GEEA 4ESVA 4UXIA 1PV2A 3OE7A 4NKRA 1FA9A 3IP1A 1ZD1A 1JLLB 2Q2WA 3O1JC 4P2BA 3WR5A 5KAPA 3ZQ4A 1WW2A 3UA4A 2XBUA 1OHHA 5DGIA 3ICOA 3RFTA 3C5HA 4MO9A 4FC6A 4OL0A 4NCBA 3MS2A 4ND6A 4EY5A 3MJEA 1CF2O 3V8QA 1W4BA 3TO5A 3QX9A 3WK8A 3EXG2 2AZXA 1RQGA 4W9NA 4KQ6A 1CUXA 4GM4A 1FNDA 3O73A 2IUTA 2JGEA 1P19A 3CONA 4WV3A 4ZZ0A 3QKUA 2JAQA 1FU4A 1UXHA 1D2CA 5GOZA 2POQX 3T41A 4EEXA 3JWHA 5B7GA 2NAPA 2C00A 3C6QA 3ET4A 3GWGA 3QPAA 3TAHA 5IJ9A 2UYOA 3DAFA 2I4NA 1KYQA 1L7BA 3HCBA 3WLJA 1KK2A 2ZSDA 2B92A 1M34E 3RSSA 1T91A 4NWIA 2EW1A 4NESA 4KO8A 2Q1TA 4G07A 2HQSA 2QL5A 3ZJYA 4QU8A 4A5SA 2GPYA 1AGNA 2R00A 4E6EA 4DMMA 3EPKA 2P1RA 4LX8A 1YVPA 2REQA 1GO2A 3GH1A 3SX4A 3L8ZA 4A0SA 2YZMA 3HP1A 3BIFA 1NL3A 2XUGA 4M8LA 1F4PA 4QUEA 4E14A 1N2BA 1HT3A 5JBNA 2IJGX 4HATA 1QF9A 3PR1A 5GM2A 2FHSA 3E53A 3FVWA 4XIJA 1W6UA 2QNRA 2X0EA 2QTVA 3QJGA 2JFFA 2E4ZA 4IKEA 2QE7A 3O8QB 1X2BA 4PBTA 1Z4NA 5KS2A 3FOZA 1ACMA 1U9IC 1FFXA 1XXLA 2F9FA 4LDPA 4UM9B 4RMIA 4M1WA 3WYNA 1D0IA 3EXAA 3SJAA 3A6GA 2QLLA 1Z38A 2VI5A 2A1UB 3H2GA 3IDAA 4POAA 3EEOA 4NC9A 4OXIA 1LV8A 3KEOA 4YA6A 3P0EA 5EWLB 3GT7A 2PUAA 4JXZA 1QLHA 5JSYA 4R2LA 3DYVA 4DA4A 3OE4A 1SCBA 4R8VA 1QGOA 2A9OA 2YX1A 4WGFA 5BRAA 3WLOA 1Y98A 3L84A 1GOTA 4B4DA 3KD3A 2GEJA 1G5PA 2VJLA 4U00A 5CYFA 2QZZA 1XVLA 2J4FA 2J9GA 4R41A 2J0UB 1ACLA 2BM9A 3NV7A 2Z2KA 3C98A 3LY9A 1SGWA 4LE0A 2PANA 2ZIZA 4UVIA 1PN3A 3L8HA 3ZDDA 3R7BA 1J00A 721PA 1ESCA 5GV8A 4J9VA 2WJ3A 4M37A 2ZE8A 3MQ4A 1Q14A 2YWBA 4CKXA 3L9XA 1INLA 4OL9A 1ODKA 3OE1A 1UOPA 3KB2A 2O7QA 5G0TA 2QB5A 4DREA 4N48A 3WQSB 1SVLA 4WPGA 3RROA 2PJUA 1Y5RA 3PR3A 5IKEA 1JLHA 4KO3S 5BORA 3DUFB 2V7UA 5ALIA 3ZV7A 5JVDA 2YYZA 1V2HE 4RNCA 1KJQA 3BTVA 1KI7A 2JZNA 2RAUA 3L02A 2XYQA 2BGTA 3OEEA 4KBGA 5F3RA 5DKFA 4MQFB 1XAJA 1ILWA 4JZKA 5EMMA 3UB3A 2Z8YM 2CCKA 3RUIA 3ZHVA 5CB0A 2CEAA 3A04A 3KWFA 1H69A 3VR4A 2JARA 2XH8A 3OX2A 2CUNA 1DO2A 4Y2HA 5CT8A 3ZE9A 1PS8A 3ZIUA 9ABPA 3GLFE 4N7JA 2ST1A 4X85A 3M6IA 2Q1SA 2RC5A 7YASA 3RM3A 1Z34A 1RWVA 1H1LA 1O8CA 1P0FA 1W46A 2VJAA 2J5KA 4CMJA 1TF5A 3UMRA 2R5NA 4G0PA 4Z9BA 3VZPA 5ADVA 3PXDA 3QMWA 1G7CA 3BCRA 2CLKB 3QWHA 4YPFA 4PIMA 1I10A 1PBTA 2OB1A 2JPDA 4GLLA 2WJGA 5F7XA 2FRVA 1UINA 1A1SA 2I3AA 5FDFA 2GOYA 3OMLA 3BBPA 4AQ7A 3AFIA 4YV2A 1E9VA 3E22A 1D1QA 3CXRA 3GCWA 3R09A 2Z4RA 1P4HA 4TYNA 4C7VA 1YOVB 5F73A 1QPZA 3VU9A 5AK0A 2MCFA 2VSNA 4O4LB 1EFAA 2V9CA 3V7YA 4BNDB 1HT2E 2FMXA 2OWDA 3RBAA 2I99A 3S0JA 2CLOB 4FINA 3I9V1 3O8OA 1FW8A 1B14A 3ICQB 3EHEA 3UMJA 4AJ9A 4IF6A 3NBAA 1XOIA 4Y6GB 5K3SA 3W77A 4YAKA 2DMRA 3EPRA 1VDZA 4GDMA 4F96A 2HA2A 4QSHA 1RHJA 4UKDA 2NMVA 3VZRA 5ITWA 2O54A 2HLPA 2F3SA 1RE0A 3M8KA 4B34A 4AJ2A 4Y1GA 1VMIA 1E2JA 2W22A 4KYIB 4D9EA 4CMGA 1Z88A 2YFQA 3S8YA 1Q7RA 3DOCA 1U7HA 4KO4S 4Q4AB 2PRZA 1XIVA 3I52A 1G291 1XD9A 4YH1A 4Z5XA 2E1RA 3IKTA 2R8ZA 1OTYA 3KHUA 5EIWA 5FI1B 4ZVPA 3PTAA 1UL1X 1F5SA 2DHRA 3JVEA 2QTWB 3QLUA 3GG9A 4JODA 1ZBDA 3P2KA 4N5IX 2ZJ1A 4R1PA 1GQOA 2WJYA 1ESMA 2ENUA 5TVGA 3UJBA 2R8YA 1V47A 2ZR9A 4TL9A 4O5AA 3NORA 3RHFA 2JFGA 4EABA 1DO0A 2XOKD 3BBLA 4G5FA 4YEDA 3RFUA 3WLTA 2WD7B 5REQB 1IXRC 3FR8A 3I5YA 1G2PA 2TSYB 5EOVA 1EX6A 2RJNA 3GLUA 4Q3DA 4CDRA 5CYGA 4G0NA 1SUWA 1ZVVA 4DQ0A 1KY5A 2XUFA 5ALZA 2BMAA 5F5NA 4L4XA 1T8RA 3SKYA 5IWAB 3IQFA 2QROA 1KU6A 3RU7A 2VDVE 2BKLA 5KNLA 1Y9EA 3OZIA 4PC2A 4HG2A 2AHRA 2PBFA 5CJPA 1G0OA 2ZYUX 3RCBA 4MULA 4CGYA 3WAGA 3K6SB 3STXA 4J7UA 1QTNA 4DEXA 3U7FB 3CO0S 1KDYA 2BR4A 2DTDA 2OESA 3ER9A 3OM0A 4MUGA 5A7FA 2NO6A 4C4YA 4JL5A 1LQUA 5ALXA 4YV0A 5DHPA 1JFFB 4M21A 2ONJA 2HDWA 4H1UA 3ABOB 2IHZA 1YRBA 4MVJA 4TM8A 1K7YA 1QCYA 4QQRA 2GCEA 2PZGA 3UGTA 2YH2A 1D1TA 4NMXB 4JJ7A 1MF7A 4QTXA 3DONA 3JW8A 3ERCA 3VA7A 1JECA 1K06A 3R3WA 4QODA 2O0KA 3K1AA 1A8IA 3GZ4A 1HTBA 5ELLA 1Z8DA 4CCYB 4KE9A 4LJLA 3HRIA 4LJ6A 1P7ZA 5DHAA 5C52B 3V2HA 3NANA 4WNCA 1Z0ZA 2D1SA 3ASUA 3NPMA 1DMSA 6Q21A 3AUYA 1NGSA 4B74A 1NW7A 1GPUA 4ZC8A 2WUFA 2JD0A 2ZSFA 1RMTA 5ALPA 3OCWA 3T54A 2NXJA 2W2MA 1U9YA 1VPTA 1VXOA 3ZQKA 4EG1A 5KQPA 1QE5A 3NKVA 5D7BA 1H85A 1X1DA 2KI5A 4HXYA 3HJTA 4C05A 5JC1A 1RKBA 3QPUA 1N6NA 2QJOA 5DLQC 1E7YA 2PUWA 3QLVC 4Q9AA 4R4JA 1QUFA 1VECA 1LBHA 1Y7TA 2CXSA 3HDGA 2OHFA 3IS3A 3NBXX 4YCJA 4RM2A 3B38A 3TLEA 4KSYA 4UDNA 2WAOA 3THYA 1DXYA 2W42A 4DG9A 1N2CB 1VMKA 1E1QD 2IDKA 3CW2A 4MQEA 4BJ1A 1GZDA 4QATA 5FTWA 1W1WA 1H2WA 3ZHQA 4O3MA 5JZSA 3GLIE 4KIUA 2IWHA 4PYMA 2NX2A 1JYSA 3HN2A 3G2NA 5HIKA 1MC5A 1H8HD 2V5AA 4LVUA 5CLFA 2FRXA 2GESA 2H07A 3HP4A 4PNEA 3HY3A 4LXXA 3AF4A 3QOFA 1XCJA 4F21A 2W93A 4CQLA 2OWEA 5LD2B 4EUKA 1RAHA 1QSGA 4QEZA 3R7AA 1FPQA 1MX3A 1B0ZA 3PS9A 5A6SB 3ZY2A 2HF7A 4KDFA 1UPXA 1DLJA 2YQ4A 4HS9A 4L6AA 2IYPA 3ACCA 1AHPA 1P39A 3C39A 1L6IA 1PEDA 2SCUB 4OK6A 3RC8A 3TQCA 2I4OA 2AFHB 1YA8A 1WCIB 1XP5A 2H0QA 4RPLA 5AHOA 3P9QA 1CEQA 2P0YA 4TXNA 4UHBA 2WYOA 3GJ5A 3HJGA 5TGDA 2LE0A 4GFDA 4MW1A 4KQIA 7REQA 3R8CA 2V65A 4EPXA 4BLWA 3ACBA 5BN4A 4Q4DA 5BNWA 2O8NA 3H5AA 3EVAA 3I6IA 4H1HA 4W4TA 2Q1YA 4IQGA 5DGTA 5F1YA 3VMMA 2G9VA 3QEJA 2C0CA 1S8NA 3EQ6A 4GLFA 4OHMA 5LQSA 3SC6A 1YZHA 5M5BA 2QN6A 1NRXA 1PJZA 1W52X 2H0AA 4O1HA 3OZUA 4WK4B 4YRNA 5L40A 1XL1A 4NBUA 2BKAA 2HW8A 2YJ4A 4RY0A 1L8AA 1FUYB 4HAIA 3OZXA 2HGSA 5CA1F 3TPFA 3ZXUB 5KTNA 2C5EA 7ADHA 3O7MA 4WMLA 4IMPA 3TLCA 1RZ3A 1E3SA 4KDCA 4QRHA 5KCZA 2HIHA 3LH5A 1M2JA 1FDSA 2JAOA 4G63A 4X7RA 1LCIA 5AK4A 1K9SA 1M5TA 2C78A 3KWMA 3REGA 1EZZA 1VL2A 3DZGA 4TVKA 4MV7A 4I9UA 3X2SA 1QM5A 4L3OA 1Z5ZA 1TM4E 1DAKA 4DM3A 4YMIA 1TW3A 4JLDA 1GL6A 2R47A 4UPDA 3V8PA 1N8NA 2YVAA 4J03A 1NOKA 1BROA 1CY4A 1FUKA 3LHKA 4KH1A 4V2IA 4CF3A 2F8MA 4ENWA 5KTMA 3FHTA 3TR6A 3TD2A 2V98A 4M0FA 4FVTA 1OGYA 3L82B 1M8FA 2DEUA 1N8TA 2CNNA 4LC1A 3SN6A 3B60A 5EE0A 4QM7A 1VBFA 1UWVA 3AKDA 2L42A 4S05A 1XWFA 2E6UX 3KP1A 2JIMA 4GPBA 3HBFA 5CFPA 1MW8X 4MICA 3U3XA 5JLJA 3HCNA 3ILHA 3Q2KA 4N3NA 1ZUHA 3OFNA 4LYHA 3TG2A 1UFVA 1SVSA 1UDRA 1DINA 3HG7A 2GDJA 3PLRA 1ZYUA 3QXJA 3G0DA 3JQ7A 4TLDA 4NZNA 1VPLA 1E1RD 4TV9F 2J67A 4D6XA 3D8BA 2ZBUA 3U7EB 4BQNA 5HEKA 5FFFA 3UB2A 4CL2A 2IFTA 1JH9A 2NP6A 3DBIA 2HSJA 3QFHA 5LU9A 5AH0A 3TAUA 4DA6A 1ZS9A 1R2QA 3ZJUA 1GGHA 1HE2A 3A1NA 1YCHA 2QVXX 3IOEA 3NC4A 2QU7A 1YR8A 1ZL0A 1JU4A 3W4IA 9ATCA 2DX7A 1DIHA 3DCYA 1FJGB 3NBUA 2BFPA 3KU1A 3GLVA 3FKSA 3ONEA 4J6EA 3DGEC 4LY3A 1JYFA 1N8KA 1U9IA 2NVBA 3ENKA 4UXHA 4RK1A 4A0QA 5AWFC 2MMGA 4FGLA 3T12A 1SG0A 1L4LA 2OILA 5D87A 2PTGA 3ANSA 5I9MA 3CEJA 1KE2A 4RD3A 3ST7A 3G88A 3LKDA 4Y6QA 1GEGA 4G0MA 3KO8A 3QKRA 2O7SA 2CXOA 4B0OA 4GZLA 3LLUA 1D0VA 4DQDA 4TZ0A 1UKVY 2K7FA 4FOPA 2F67A 1RVDA 5F4BA 2HEIA 3QX7A 3GEIA 4QASA 3REQB 4DSNA 3MT8A 2EBUA 1NW5A 1HUQA 3EZFA 2I6GA 4JC4A 4P7KA 2ECOA 3K96A 4RFVA 5HZGA 1PVOA 1XHFA 1RD4A 1Z4KA 2IZ7A 2WRZA 4JCOA 4W5RA 1L5RA 1LWOA 3MWYW 1GU0A 3H9EO 3STTA 1W581 1J0BA 3JQBC 4E2FA 5HRAA 2QMQA 4OHPA 1M83A 2VJMA 3ANLA 1SVIA 4GKKB 4NAUA 4P32A 2WKSA 3VSAA 3RFFA 4MS1A 3JWGA 2I4RA 2FFHA 4FFSA 5L4NA 5AM1A 4L8VA 1QVAA 2BHNA 4UUPA 5BT9A 3AOGA 2QPTA 4XCVA 1KETA 1VYVA 2EKLA 3T38A 2PRIA 2PXXA 5BUSA 4DCVA 2HD4A 1Q0UA 2R5FA 2BFOA 2XYPA 1NMSA 3H83A 1M1YA 1OKKA 3H9BA 3KFLA 3TI9A 3GLHB 5C1BA 5IMSA 4DJTA 4NJEA 1LPBB 3BSWA 1E2UA 2KLBA 4IDDA 1OIWA 2R1VB 4PR0A 3RBVA 5KYTA 2O2DA 3I30X 1P7CA 4MA0A 4NONA 1H6AA 3N2GB 3Q0TA 4QWMA 1YRAA 3T9CA 2IZ1A 1HG0A 3BWYA 3IA2A 4JGBA 1MQ8B 3NVMB 2EERA 3IULA 3R3SA 4MW4A 4PLHA 1MABA 3P5BA 3M33A 5JYEA 2FFAA 2JHFA 2I54A 2C97A 2XB8A 1U2EA 4WXEA 1R0LA 3T61A 2QW1A 4AG3A 2WG1A 2GN1A 1SOMA 1YB2A 4O4LF 1RJWA 1XA0A 3RW9A 1EE9A 4AYTA 4B6JA 4EG4A 4AYXA 1HTWA 3GO4A 3ESRA 4WHMA 4MWEA 4FIZA 4WEQA 3JAMA 2QXUA 3D8UA 4GXNA 3RS3A 3K1JA 3AH8A 3D1JA 5IRCD 1D0SA 1NW4A 1TMOA 1COWA 1KFJB 3PZBA 4DLWA 1N6LA 2PAAA 5ICMA 5K99A 5KINB 1DARA 1H9AA 1MAHA 4JGIA 4FFRA 3V2IA 1Y3DE 3VJKA 2QUIA 1WZ2A 1W25A 3W9UA 2CF6A 1Y6QA 2PRSA 2X8BA 3OO1A 4O2BF 4PINA 3T99A 3ZK8A 1PUJA 3THSA 3BD6A 4LVOA 3ZX5A 3PGJA 4CN8A 3K9WA 1XZBA 3I01A 1I0ZA 4RWEA 4WKOA 3IEVA 4S3MA 2BCJQ 2WJJA 3BMQA 1I1HA 2EP7A 3IDQA 4ZCLA 5BQPA 1M1NA 4C7JA 5KYWB 3SSNA 1MGOA 2H9AA 3V6MA 1O97C 4KR2A 3G8YA 4QAQA 1GFIA 1TUEA 3NFYA 2GPJA 4ZCQA 3GLTA 3H5VA 4KODA 3ILSA 3NKLA 1U7ZA 1I6LA 4NOKA 4FGSA 1NUQA 4JQOA 2W48A 4GKVA 1HQYE 3I2HA 3RRMA 4G0YA 1SA0A 3GRCA 3G2LA 5CJ2A 5LP6C 3DHEA 3AHIA 5GINE 1OI4A 2O2YA 4B4VA 3P9CA 2JLXA 3SG0A 5A4KA 3MCWA 4TWRA 5HF8A 3ZY3A 1CUEA 2C88A 5H3HA 1LU9A 1AG9A 1B6GA 1RLTA 3DLCA 4XKJA 4A1FA 3SY8A 2VYVD 5HJ5A 1ZJ6A 2PKQP 2REBA 4WZZA 5HOEA 1WE2A 3HZZA 2I2FA 3M5DA 1G0NA 2RONA 3TLGA 4DEYA 2PGXA 4P3YA 1YU6A 4R68A 4ETIA 4XWGA 1ECJA 3RRZA 3MGCA 2NYAA 4PZ0A 4BLRA 5H4HA 2GO1A 1GTL1 3KXDA 4R9RA 2EFJA 5C3UA 4TKUA 4F9GA 1CW2B 4RTNA 4RNDB 3LQ4A 1C4KA 3GBVA 4PFSA 2NP7A 1DFIA 4JUAA 1KIAA 2WWGA 5DTEA 4V38A 2ERCA 2ZPUA 2C9YA 3KZVA 5LPNA 1Q0SA 1VG0B 3E5HA 1AXEA 1EUCA 4ALJA 3HR4A 3KX2A 4JU9A 3I05A 5JWHA 3PEWA 3M82A 4KKXB 4ZK6A 1BWQA 1RRKA 3AK4A 3FHLA 1AC5A 5J47A 3NRBA 4OB6A 1HDYA 1U4NA 3ZU3A 4BFVA 4EVSA 2AJCA 5HK9A 1RI4A 1WG8A 1X87A 1GPAA 1OLSB 5JO9A 2AG5A 5ALOA 3RVMA 3LOQA 3W06A 4CV2A 2EJBA 4WXHA 3EIOA 3IOBA 5AUNB 1HNXB 3FPGA 4GX2A 2H4WA 3UKDA 2J6IA 5D6OA 3CB2A 1H0HA 3IP8A 3KXLA 5EE3A 1LVGA 5IASA 3BHIA 3A2LA 4LV8B 4IOKA 4M49A 4CKZA 3AHCA 4Z4QA 3F9RA 4L2IB 3ZGLA 3ZTYA 8ADHA 3DTNA 1ZR4A 1BOOA 2X2OA 1KS2A 4MPJA 5KVQA 2QN1A 5H83A 3CWZA 2ETVA 2NGRA 3T6KA 3OOSA 1QYDA 2CHUA 1RYEA 1SZCA 4B2LA 2RHGB 2O7RA 3DOIA 2IDZA 2XHEA 4KZPA 4MIYA 2N47A 4MS4B 3AF6A 2A0KA 3OLVA 3KELA 4AXBA 5CVJA 2UVQA 4JEMA 3ZD6A 3UXYA 3GD5A 1ZXLA 5AVQA 4X00A 1N1DA 1QJCA 1YKGA 3FJOA 1A7AA 3MTDA 2EU8A 5EC8A 2RHOA 2OV6A 2MTBA 1EFTA 3DW1X 3FRJA 1Z39A 2ZTHA 3IXLA 3IV6A 3M2TA 1U1FA 1F20A 3WFIA 5HOQA 2R6R1 3NTOA 3OPYI 4FYMA 4QNRA 5E9QA 4DCNA 3G5LA 1AQUA 1TUBB 3ANXA 3EZXA 4JB3A 3F6RA 5GJWC 4G56A 4U7DA 2OSBA 3NETA 2B8NA 1XQYA 3PL1A 3G9XA 5IABA 2YHIA 2HJGA 4MXDA 4IIJF 4AZ0A 5CIQA 4XDZA 4BQSA 5EE1A 1OI3A 2JIZA 1U0RA 2C04A 3RGWS 4PN7A 3VR5H 4EGSA 1FK8A 5EINA 2CC2A 3QHQA 4HF7A 5E4JA 2VJBA 1IN7A 1I5EA 3DMDA 3HRHA 2JGDB 3VSBA 1SBIA 3FPLA 2VSXA 4MLDA 3W9YA 2CV2A 5DOZA 4MHTA 1EWTA 1JKXA 3JQDA 1H94A 1TJPB 3P27A 5DX8A 1KI6A 2GFQA 3MIIA 5ESRA 3TMAA 2D1QA 4XA8A 1KIFA 1T8WA 4HN2A 2Y0DA 3CE9A 4KU4A 4WKGA 1X1EA 3A06A 5B57C 3D2BA 3OZDA 4ZT6A 3TFOA 2F48A 1QDEA 2Z3VA 5LL6P 2DY1A 5CHEA 3WAJA 3OKPA 2Y1LA 4QQ8A 4UCWA 4EB8A 5HRUA 1WIWA 3GP5A 4FZJA 4M60A 5CTAA 3PXAA 3TNLA 3W05A 3DV0A 1BH6A 1IPEA 2NXNA 2VUUA 3JYQA 2V7VA 2PBRA 4CLHA 1CD5A 1SKYE 2EKPA 4UMDA 1Q92A 1RPZA 4LZZA 3L1UA 3VZBA 4P35A 5KQLA 2Q9CA 3NM4A 4CM6A 5K6TA 1RLIA 2XUZA 3ZW8A 5IC5A 5C4GB 2B20A 4K9PA 5B3JA 2QVGA 1FS5A 3UWOA 5FOQA 1HR0B 1WMSA 2JVIA 3AY3A 3CF4A 3G2JA 5E8RA 1XDSA 3UB4A 3V8BA 1WHSB 1S2LA 3EG5A 5CG1A 5EJ5A 3PHIA 5A06A 3OT4A 4WGGA 4IVNA 1DELA 2O5CA 3SYRA 2C7BA 3ZNOA 2ILVA 1CIJA 1U3GA 4HVCA 3AI7A 3MC1A 2DXIA 4FWBA 2P9EA 3IFSA 4X90A 2IPNA 3KVVA 5FLKA 3ER6A 3IBFA 4R3WA 1R8QA 2WZDA 1EWYA 1TT5B 1OI2A 2CVOA 4WVFA 3O3MB 4E32A 3O4GA 1UJNA 1DCMA 4FK8A 1E79A 3M4XA 4OHFA 4GW3A 2IYLD 3P9RA 4HVTA 4KO2S 4RANA 4EY3A 2PUDA 4EMUA 3VISA 5KTYA 1CR6A 3WL3A 1C8BA 4GNRA 4XGQA 1NKVA 1W75A 1ORIA 1EBUA 1O03A 2Q4RA 4X60A 1UQTA 1NBME 3R76A 2HB6A 4NZ9A 1USIA 4KXFB 1MFPA 2CUTA 2ZVQX 4YJKA 3ML1A 5FULA 3SZUA 4LJ5A 5IBQA 3BB3A 2BGNA 4HEA1 4DARA 3SDSA 1EFRD 3QYAA 1AMUA 4AJ1A 4MI3A 3FVRA 3RUFA 3E7FA 3ADDA 4KQ2A 1TKBA 1DV2A 3O7WA 3A7DA 1V16B 1MQ9A 4EG5A 4YP6A 3NVAA 2CFSA 4JIGA 2Q1WA 1L5LA 5HZMA 3M9LA 1ZC4A 3WI7A 2D06A 2M1XA 2GBLC 3MN1A 4IHKA 4PX3A 5AKLA 2GAJA 3OZVA 1GPKA 3SXPA 1VA4A 1IH8A 4M76B 5JATA 4DC0A 2ZJ5A 1L4NA 4HAOA 3AF2A 2OA0A 3B9PA 2ZYHA 1GZ3A 1VGRA 2XE7A 4H3SA 2EVWX 3VPDA 4QNNA 1N57A 3HY4A 4FNGA 3LF1A 1GRVA 1YE5A 1PQWA 3GA5A 3C97A 4FN5A 4M1YA 1CIVA 4E1VA 3JATA 3PQ4A 4JOCA 4LBYA 4UHJA 3A8TA 1ZCAA 5A3RA 3M6MD 1X7ZA 2Y1DA 3KKZA 4I8XA 4CMIB 4BX2A 2CV0A 3AB7A 2RHRA 2E2WA 1CYDA 3DEYX 1U6IA 3DL7A 3LA8A 3EMVA 1TCBA 4TT3D 3UFBA 3RU3A 3Q6IA 3D6FA 3IURA 1VFPA 4IDFA 4IRMA 1SCUA 3N2KA 4IGKA 4OHZA 2ZETA 3IQDB 3RIGA 2YOFA 5A2GA 5JALA 1AKVA 3KSUA 3K0CA 4OHVA 5JYBA 1PR2A 1BRMA 5BN5A 1KI4A 1YUBA 4AJOA 5JNSA 3VTFA 4UC0A 1SJ9A 2FR8C 4FYJA 4EZBA 2QS9A 2XV1A 4D99A 1LBQA 5KSWB 1Q3KA 5KQRA 3K32A 3N8NA 1DEAA 1ZD5A 4D1YA 3AHGA 3KEMA 3M1LA 4LXUA 2F55A 3U6KA 2VL7A 3C8MA 2HFJA 1ZVQA 1B00A 2BFEB 3EG9A 2D8MA 4LCJA 5KWJA 2O05A 2JJ8A 1ZSYA 3CF0A 2NACA 2X6QA 3Q9NA 2QRVB 3COVA 4LDJA 4RE6A 5HMMA 5JAHA 2FQQA 2X8AA 2OC4A 3ANNA 3L1JA 4FMCF 2D74A 4CWAA 2GZHA 4KFCA 4QJIA 4O25A 1HEYA 4A92A 2CN1A 4EK9A 5DHFA 1EGHA 3AGPA 5LQRA 4FGUA 1AGXA 2QDXA 1JSXA 4J2TA 4URHA 2WHYA 1YFKA 4JYAB 1Y4AE 1PZFA 3O9ZA 1U81A 4FLFA 4MQUA 4B6SA 2VTDA 3B7GA 1PJAA 3ORQA 4CR7A 2DPMA 1C81A 1IBKB 2ORYA 4PPQA 3ZLBA 4KDEA 1O94D 3ICCA 3KLPX 3WLEA 4BB0A 3LO8A 2IS6A 2VBIA 5C5CA 3WIBA 3WL8A 4JDPA 1LI7A 1ZITA 4R8KA 3RRJA 3OSUA 1A9XA 3WO1A 5BWOA 4BNJA 3V3TA 1ZHHA 1R18A 5A5GA 1HYQA 1M2OA 1HA3A 4BCCA 3CSDA 5BNTA 4LGCA 4WDRA 4ZEWA 4AG5A 1YGPA 1FFXB 1KZ6A 4FXPA 5A05A 3TQQA 3WYEA 1RLOA 2Q5FA 1E2LA 3AEUB 5EHNA 3GT3A 5K1ZA 1ADFA 1WVIA 3ABSB 1RXIA 2MYUA 3G2IA 4DRXA 1PX0A 5AM4A 5L3VA 4E5KA 4J29A 4JNKA 4DCUA 4NI5A 1S4QA 1ZRNA 2YVQA 3JARB 5FNVA 5F9MA 2OQIA 5KQGA 4AKHA 1Q11A 3K53A 1JB1A 3BB4A 3DMYA 1ISIA 2Q5HA 2ZE7A 2GVZC 4MGYR 1FE8A 4QLOA 2XE8A 2JVJA 4OXKA 4WCFA 2RG1A 2FMUA 1XMJA 4P4LA 3LWZA 1YCGA 1OWOA 5CP8A 4BP8A 4CKBB 2A3NA 1Z74A 5EYPB 1L6RA 1JE1A 3FBTA 1D6MA 4PGFA 3WGJA 3JASA 5B2ZA 5L7YA 1PWXA 1N2JA 3AFGA 2W5UA 3GLQA 3ROMA 3UHOA 1PFUA 4DAEA 5JT1A 2ZJ8A 1H5NA 2NYUA 2RI1A 5E4FA 2HA6A 1GR0A 5J4HA 3CLRD 4IJUA 1N7IA 4GH5A 2OSVA 2ZI6A 4HXFB 4CL8A 1E62A 2HK6A 2BT4A 2LIVA 3D6TB 4NH4A 3SIXA 3KWLA 1PSWA 3TZBA 3V80A 3PEUA 1KO7A 3UHFA 3WK6A 1LPOA 2NWQA 4N0QA 2AWNA 4BMXA 5AVVA 2Q2QA 2JGFA 2VHXA 3GMIA 4D9CA 4JA2A 4YR7A 1Y3CE 1H1DA 2LV8A 5AVUA 3N0WA 3QK7A 4XM1A 4DLUA 2AJBA 2XLBA 4W8OA 4YACA 4QO8A 3IMKA 1SPXA 4NE9A 2AN5A 3RT7A 3UUFA 4ZTUB 1SBZA 2VF2A 1PLKA 4JC5A 5KO2A 4V39A 1GA6A 1SZPA 1V9SA 2WM8A 3UXHA 2GA9A 4DWVA 3EW9A 4LZWA 4DL9A 3VO9A 1PJ4A 4OVKA 2YYSA 1VFNA 2RK6A 2UVDA 2Q99A 5ALYA 1OW3B 3RVJA 3RT9A 3NNDA 1XXHA 1H1LB 1KMNA