3N0XA

Crystal structure of an abc-type branched-chain amino acid transporter (rpa4397) from rhodopseudomonas palustris cga009 at 1.50 a resolution
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
371
structure length
371
Chain Sequence
DLKIALIYGKTGPLEAYAKQTETGLMMGLEYATKGTMTLDGRKIVVITKDDQSKPDLSKAALAEAYQDDGADIAIGTSSSAAALADLPVAEENKKILIVEPAVADQITGEKWNRYIFRTGRNSSQDAISNAVAIGKQGVTIATLAQDYAFGRDGVAAFKEALAKTGATLATEEYVPTTTTDFTAVGQRLFDALKDKPGKKIIWVIWAGGGDPLTKLQDMDPKRYGIELSTGGNILPALAAYKRLPGMEGATYYYYDIPKNPINEWLVTEHQKRFNAPPDFFTAGGFSAAMAVVTAVQKAKSTDTEKLIAAMEGMEFDTPKGKMVFRKEDHQALQSMYHFKVKVDPAVAWAVLEPVRELKIEEMNIPIKNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible substrate binding protein of ABC transporter system
publication title Crystal structure of an ABC-type branched-chain amino acid transporter (RPA4397) from Rhodopseudomonas palustris CGA009 at 1.50 A resolution
rcsb
source organism Rhodopseudomonas palustris
molecule tags Transport protein
total genus 130
structure length 371
sequence length 371
ec nomenclature
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n0xA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n0xA01
3H5OA 1MB3A 2FVYA 3Q15C 4DADA 4N41A 2A9PA 4JAVC 3H5IA 1DCKA 1E6KA 3BRSA 2H3HA 5EWJB 3LKVA 2WWVD 2QW1A 3NNNA 4MPTA 3HUTA 5TQJA 1LJUA 1AB6A 1ZITA 4W5NA 5CNJA 1CYEA 5KWSA 4D6YA 4Z4EA 4Y9TA 5JS2A 2F8SA 4Z4HA 1NXSA 1PHRA 4G86A 3RVQA 4G0ZA 1XWWA 3DZDA 3ILHA 1EWTA 4JB2A 5IEJA 1A0OA 3QX9A 2CD7A 3Q7SA 5KQPA 5DCLA 3DGFC 1F4VA 4MS1A 3RVSA 4YGXB 5B3JA 2FQXA 3H1GA 3O1HB 4Z4FA 4KQCA 3N0RA 4H3HB 4WT7A 1MIHA 4YRZA 3FFWA 4RK0A 4W5QA 4MR7B 1TM2A 3MYYA 2HQRA 3QEMB 3RH0A 2P4UA 1D4ZA 2I6FA 5IC5A 5EWLB 3QLTA 6CHYA 3O1IC 2KYRA 2ZWMA 3LUJA 4S05A 2FW0A 4EGSA 1JFSA 4RV5A 4YS6A 5EWJA 5JS1A 1M5TA 2FXIA 1ABFA 3P9YA 4OATA 4KQ9A 8ABPA 1YVUA 3SNKA 1D1QA 5TPZA 4LDZA 3SM9A 4QICA 1E6LA 1Z17A 3GT7A 1ZDMA 2QSJA 3EODA 4S04A 3RVRA 3O21A 3HK2A 1ISSA 1QP0A 4YCSA 1Z26A 4ETNA 5FWXA 4IMIB 3GBPA 2W42A 4EYQA 2A9OA 3JVIA 3KLNA 4EUKA 3LKBA 5I4CA 3LUCA 4ETMA 1H9CA 3EQ2A 3F6CA 1FFWA 3CZCA 4MAAA 4ZPJA 1IIBA 3H1FA 1NXXA 1USKA 4MS4B 2PL9A 1VRVA 5FBKA 2ID7A 4Z4GA 2M1ZA 3GYBA 1GLGA 1JYEA 4OLAA 5B3JC 1SXIA 4KNYA 4ZJPA 4DQDA 5BR1A 3RVOA 4B09A 4Q6BA 4E7OA 2PJUA 2NZUG 4MR9B 4LE1A 2PUFA 1C4WA 5IUKC 4W5RA 4Z99A 4F8JA 4KFCA 1Z12A 1FQWA 3KTOA 2GWRA 4KV7A 4JP1A 1RZRD 2RJOA 3JY6A 2AYXA 4OTZA 1JBEA 3KS9A 3QELA 3C6QA 1JX6A 3LFTA 2PUAA 1QQBA 2IKSA 3DBIA 3C3WA 3DLHA 4OG2A 2FLKA 1DC8A 4XASA 4KPYA 3A3KA 3N53A 4TLLB 1K68A 5KC9A 2FQYA 2L18A 1FFSA 3T6KA 5IUJC 1EWVA 3H5WA 4MS4A 3OLZA 2E4XA 1K66A 1PUXA 5BRAA 2FMFA 3N0XA 4LE2A 1USIA 3T8YA 3QK7A 4W5TA 2CWDA 1M5UA 3GA5A 2VUIB 4XXHA 5DGCA 1A04A 1SXHA 1Z25A 1JF8A 4YR7A 1DRJA 3FFXA 2JBAA 3ROTA 2F8TA 3O1JC 1DZ3A 1YK0A 1NXVA 4MS3A 2Q5CA 2HJ9A 3IDOA 4RKRA 5IUNC 5IX8A 1ZESA 3F7NA 3OLXA 5TQ0B 5KQMA 3A10A 2TMYA 4KMRA 4RY8A 1DBPA 1E6MA 4JOQA 1MAVA 2FMHA 5KC8A 3ROFA 5TPWA 1M2EA 1YTUA 5TQ2B 3TO5A 3HO1A 3Q7RA 3OO1A 3H5VA 4RK7A 4GNRA 4RDCA 1D1PA 2WJWA 2NT4A 1ABEA 3CZ5A 1JFTA 1APBA 1BA2A 2J48A 2ZAYA 4H60A 1EAYA 2FEWB 4YLEA 4KK4A 2JVIA 2WB4A 4OBBA 2ID9A 1LJLA 5JNWA 4MQEA 5JNTA 4EY3A 5JNSA 3A0UA 1JYFA 2LUOA 1NATA 2FKAA 4UHKA 1DG9A 1B00A 2A9RA 3O2QB 4MR8B 2PAFA 2E4VA 3GL9A 1BVHA 1NY5A 3EDCA 1CEYA 4Z9AA 3LUGA 5TQ0A 1U8TA 3HCWA 3LMKA 3H6GA 3QLVC 3R0JA 4RKQA 1U2PA 4YO7A 3UK0A 4WUTA 4Z0NA 4GPAA 2VUHB 4LDAA 5EWMB 1L5YA 3A0RB 5KQLA 1SD5A 1BDJA 3K4HA 5CNKA 3QEKA 4QYMA 1QP7A 4WZZA 3TX6A 3C97A 1P6QA 1ZY2A 2P9HA 3GRCA 3HVRA 1ZAYA 4PYRA 2JRLA 3OM1A 1L5ZA 3D8UA 3GBVA 4N0QA 2B1JA 3HUUA 1Y1LA 3OMXA 3CLKA 4PE5B 1JLKA 3B2NA 1C0EA 3I45A 4NCBA 2E4ZA 5ABPA 1DBWA 1QO0D 4OLBA 4EYGA 2FEKA 2OENG 4O1HA 4MRMB 5GOTA 3IP9A 4YP9A 9ABPA 3G1WA 4RWEA 5KQGA 1RXEA 1JDPA 1NXOA 1Z18A 1BDHA 4P1ZA 4D74A 4PZ0A 5JNUA 3HEBA 2DRIA 3NHMA 2NT3A 2PUDA 2IYNA 3JVDA 3SQNA 4ML3A 2IPAB 2JVKA 4RK4A 4KZKA 3IPAA 4RXTA 3DGEC 5JNRA 2JCGA 1PEYA 2RJNA 3Q9SA 5EWMA 1TMYA 4WXMA 1JWLA 3C3KA 1DCMA 2LPMA 1RXIA 2AYZA 4MR7A 3N6VA 2MSWA 3FFTA 3QEMA 1M2FA 1U0SY 3OMWA 5CNIA 3FGZA 5HKOA 1U2QA 4IILA 4L85A 4PEVA 2FN9A 2L19A 2OQRA 5EWLA 3OQOA 1YS7A 1LK0A 2MYTA 3HDGA 2O20A 1R8JA 2XDYA 1KRWA 1MVOA 5FBHA 1JHZA 4E7PA 1JDNA 2NZVG 1WETA 3CG4A 2CHFA 5HQJA 1I3CA 4Z9BA 4CBVA 4PICA 4G0QA 3Q41A 2FEPA 4N76A 2FLWA 1EHCA 5GQSA 1P2FA 2FMIA 4MYRA 2HPHA 2QVGA 1D2AA 3QX8A 4O1IA 3HS3A 5IULC 1A2OA 3M9XA 3HSYA 1U04A 3F73A 2GX6A 1Z2EA 2IPNA 3KJXA 2LBPA 3NNSA 3LTEA 2PUEA 3ILYA 4TN5A 4KVFA 3H6HA 3CS3A 4RK1A 3HV2A 3IPCA 1ZHHA 2MSLA 2H0AA 5HSGA 1Z16A 3CFYA 1KRXA 4G0OA 3KLOA 4L4UA 5DKFA 2LP4Y 3RVKA 4EYOA 4MLDA 1JL3A 3E61A 2GBPA 4MR9A 3RVJA 3UUGA 3LUHA 4O5AA 4XARA 3MF4A 4XLTA 4Z4IA 3H5LA 4HYEA 3SG0A 1QQAA 1ZN2A 1BDIA 3BBLA 2QV0A 5IBQA 3EAFA 2QZJA 3CRNA 3SY8A 3TMYA 3KSMA 3O75A 3EULA 3M9WA 2WRZA 5TE9A 5DLEA 4F06A 1E2BA 1ZGGA 3OLWA 5PNTA 3KCNA 3LUDA 1DP4A 1RNLA 4NV3A 4LRQA 2LIVA 3EGCA 4FE7A 2FTKE 3RVPA 2GKGA 1JFVA 1SXGA 3L49A 1DC7A 2E4WA 4RK6A 3IP5A 4N03A 2PUBA 4W5OA 2MYNA 5KI6A 1GCGA 4LE0A 1QMPA 1ZGZA 2RGYA 3QLUA 5BQ3A 1KGSA 1FFGA 3N75A 2GI4A 4H3KB 3O74A 1S8NA 4RXUA 1D5WA 2WMYA 3JPYA 1LBIA 1AB5A 3I09A 5TPZD 3G85A 5T3YA 3EJWA 5IEBA 3FMVA 2M98A 3LOPA 1W25A 4UHJA 2MYPA 4IF4A 2A9QA 2N9UA 3OLYA 1URPA 4RZSA 1NTRA 2VK2A 3K9CA 5TQ2A 4ZMSA 3H1EA 4LX8A 3D02A 3W9SA 4EVSA 1JH9A 1HEYA 3CHYA 2PUGA 2QVCA 4JA2A 5FWYB 2FN8A 1GCAA 1MB0A 3EQZA 3HDVA 1TLFA 3F6PA 2HSGA 4Q7EA 4HNQA 1CHNA 1EFAA 1QKKA 1RPJA 2QR3A 4IMJB 3BILA 4Z4CA 5C5EA 3E3MA 2BGGA 2L17A 4RY0A 3CNBA 2R48A 2NUBA 4F3TA 1W9HA 3MM4A 5FWXB 3CKMA 2YHAA 3MA0A 1NXTA 1VLZA 4RY9A 4HNSA 1ZH2A 6ABPA 4MR8A 1ZVVA 5ED4A 4FB4A 3OO0A 1Z15A 1XHFA 4ETIA 3RVLA 2JK1A 1XHEA 3OQMA 4P98A 4WWHA 1YK1A 1Z2DA 2WJAA 3T95A 4DN6A 3QLUC 1EWKA 2CHEA 1LBHA 2X7XA 4G0XA 3RQIA 2FQWA 4WXEA 3DLBA 4QPJC 3N8IA 1USGA 4RXMA 3VNBA 1KMIY 1NXPA 5HM6A 5FWYA 3CTPA 1QP4A 1ZH4A 5CHYA 1UDRA 3O2JA 3JTEA 4NICA 3NBMA 3GWGA 4RU1A 1J56A 2QU7A 4IGAA 3C3MA 3HXMA 1Z13A 3NHZA 4RK5A 2HQBA 2RDMA 3KYJB 3QELB 3VNAA 4QYWA 1OXKB 4ZYLA 1QPZA 2E4YA 4HNRA 3OQNA 4G0YA 3OM0A 4G0MA 4MRMA 4JB0A 3L6UA 3MMNA 3UKJA 4JASB 4MQFB 3RVMA 4N47A 3M6MD 2IDMA 3H5TA 1DRKA 3TD9A 4NQRA 3BRQA 2R4QA 1PEAA 3H75A 3KKEA 4F11A 4IRXA 5BRJA 2FSPA 1YMVA 1BAPA 4YWHA 3SAJA 1DJMA 1DBQA 1QO0A 3LUKA 4D6XA 1P8AA 3BREA 1VPWA 3GV0A 2JBAB 2VYCA 3RVNA 2PE5A 1OXBB 1TJYA 2PUCA 4MS3B 2PKXA 1PNRA 2PL1A 5D2CA 1TVMA 1YS6A 2R47A 4EYKA 5TPWB 5E3JA 3LUFA 4XFKA 4EVQA 1PNTA 3HJFA 4LZLA 4XAQA 1GUBA 4F12A 4RS3A 2IPLA 2QXYA 1P6UA 3JS5A 4KK3A 4NCAA 4RSMA 3IP6A 4EVRA 4YV7A 4M88A 2WY2D 3IP7A 5T7BA 1YIOA 3FDFA 4Q6WA 1QNLA 4MQFA 1FSPA 1ISRA 2E4UA 2HQOA 1SRRA 2JB9A 2R25B 3I42A 1YMUA 4MGEA 3MQ4A 3Q7TA 3LUAA 4MQEB 3MIZA 4MLCA 7ABPA 4TMYA 3HM9A 1DCFA 5JNVA 5F64A 3NNDA 2L2QA 3T38A 3QLVA 4KRFA 1F51E 3OLVA 2PLNA 4ZMRA 4N0PA 1RZRA 3JPWA 2V0NA 2IOYA 3CG0A 5CNMA 3KG2A 3N0WA 1GUDA 3HZHA 5C5CA 2YHBA 2MSKA 2MYUA 3O2SB 3I5AA 2IPMA 3S99A 2PMCA 4MS1B 3URMA 3TB6A 5DTEA 1T34A 1VKRA 1NXWA 2B4AA 4G0PA 4G97A 3CU5A 3KYIB 2FMKA 4TLMB 3KHTA 4FE4A 2JVJA 4KREA
chains in the Genus database with same CATH superfamily
1E0DA 3S3TA 1B41A 2EAUA 2G70A 1SB9A 5CLGA 3VR0A 1R8YA 3DW1X 1H2EA 1NMQA 1NYRA 2BHNA 5IJWA 1YQWA 4RTJA 1W52X 3C6YA 2PGOA 3X44A 3FZNA 1Y1QA 4DR3B 4MPTA 5JD4A 5AKEA 4ZCLA 4P3OA 3PIRA 2HHCA 1RTTA 5KAPA 1QAMA 4HDKB 3QTTA 2BI8A 3X2EA 3MWJA 1AA9A 4DTIA 1AHPA 3OQBA 3HN7A 2V7EA 1S8AA 2OECA 3QVTA 3M89A 3H5NA 4GE3A 3UQYS 1HKUA 2H9YA 4MVJP 5FBQB 1AZLA 2OAGA 3OT1A 2PX8A 1YT5A 5KS2A 1HEUA 1TZCA 2R86A 1WXDA 4ADSG 3EZXA 1MFPA 1DQYA 2LIPA 4ZI7A 3DGFC 3BFXA 3ZGOA 5GONF 2YIJA 4L1KA 2HHJA 4IS2A 1QJ4A 5JZSA 3IQIX 3ESQA 4MR7B 1CY0A 2H5IA 2WWXA 4ZREA 2OGZA 4DSTA 2GVZC 3P27A 3CJRA 1UMDB 3PHLA 3SR0A 3I5YA 1LPBB 3UUWA 1Z5VA 3RUIA 3WK6A 4S05A 4ZOLB 3LDHA 4M99A 1KAHA 3ISJA 4P7JA 5EWJA 5CXXA 3VPGA 1KBOA 3O3MB 4L6AA 3IJRA 3WKDA 4EHHA 3V9PA 1YJXA 3AI3A 2IEYA 4IICA 4L4SA 1I9GA 5AJYA 2I87A 1EXNA 4LDZA 1E3JA 3KWJA 4C5AA 5CK5A 4CWAA 4AVYA 1Y5LA 3FHCB 3V00A 4JJIA 1Z8DA 3R6TA 4H18A 5LC1A 2YUTA 2C4TA 3I9JA 1N32B 1ZI8A 2GLXA 1NUPA 1YZTA 4R31A 4F45A 1F4PA 3MINB 1EB8A 3GLFA 1IN6A 4RANA 3ZVKA 3PC3A 1SVMA 1QX4A 3GJTA 2C9CA 3EQ2A 2PPVA 4DUYB 2Y6UA 1K7FB 1NWCA 4KPEC 1QYDA 2YQ4A 1FX0A 1TLLA 1USKA 2HA3A 2ZRFA 4BO6A 4CCAA 2DHRA 5HXAA 5AXBA 1KAQA 1H9BA 2HTFA 3PQFA 4N8DA 3WZMA 4BVKA 4ESVA 1GLGA 5B3JC 4KNYA 4UVDA 4J3NA 4B1FA 1EE1A 5KZMB 5FLYA 1XZMA 2XGOA 4RZUA 5JDCA 2FWBA 3I39X 2H0RA 1RCFA 1HE4A 3JQAD 3DD1A 1LRLA 4LHEA 1Y5NA 2MSCB 4MULA 4QGGA 2Y6VA 3ORHA 2AOUB 1LLUA 2C9OA 2WV9A 4DWOA 3V8EA 1QH9A 1KAGA 3MD9A 4UM8B 2GEDA 3A6DA 2PXAA 3BJZA 3HP1A 3WHIA 5IKEA 4EELA 3NLLA 1L7BA 2A57A 4ITVA 4DUZB 3EHEA 4J7CA 4XX1A 4ENQA 4WK2B 4YAOA 5JPCA 1T6NA 5E4JA 1DC8A 1XMVA 1XRSB 3GP5A 1FFBA 3M6WA 1XD2A 3NM5A 2EP5A 4TLBA 4TSFD 4TV9F 5EQTA 1M0WA 4ESHA 2XZLA 3IKJA 5JARA 1YA4A 1ZA2A 3IE2A 3WLLA 1FNBA 1XSEA 3JZMA 3O8NA 2ZBVA 3GT0A 1WCYA 3M6IA 5IZCC 5KX5F 2E4XA 1QB8A 1A88A 2EJCA 3AEXA 4J0JA 1V6SA 4NULA 5HGJA 1J9GA 1L1FA 3A9WA 3QK7A 4GO1A 5G2OA 1RW4A 3VOAA 5CD1A 2CWDA 4EEXA 5DGCA 5F7XA 1YC5A 3DE1X 2FCRA 1KC1A 4TYMA 4KQHA 3ERCA 1CZNA 1C1YA 2R00C 4TQUS 4DDVA 4AWXA 1KVQA 2GOYA 1P73A 1CFJA 1OR8A 1U9IA 2OD7A 4DBZA 2OHVA 4WRRA 5J1SB 1EVJA 1DKLA 2QRKA 5FP0A 1MAVA 2AI1A 3RF7A 1BDBA 4RPLA 2DBYA 3EYAA 5TPWA 1KZHA 1D4AA 4JYBA 4QVIA 3OPXA 3EWSA 5CEEA 2IA5A 1O6CA 2IT1A 4FWBA 4XIGS 2B94A 4M22A 3G8AA 2LE0A 5C1IA 4NCKA 1DC6A 4X20A 3UYLA 3QVWA 1D1PA 2ZT6A 2KQUA 2NT4A 2F1RA 1G5PA 2IDKA 3OEED 5E1OA 3VR1A 2HJWA 4UNSA 4CRWB 5FBVB 3I6MA 4FOLA 4ARIA 3V34A 3BWYA 1EDOA 2GO7A 3MB5A 3LW7A 3H8VA 3E3LA 3V6MA 4E4YA 4ZV7A 2VDWA 3DL0A 1XFDA 4NXNB 2ZDQA 3STYA 3O3OB 4PBTA 3RLIA 4I6JA 1N0VC 1ISJA 4IR7A 2P8SA 4C21A 1I2AA 1TZBA 2P41A 3OFSA 3T0IA 2GAOA 5IKPA 5L4SA 1B8VA 4B35A 4TTPA 3GFRA 3SIPA 1W4CA 2DTEA 2A78A 3M4XA 3N07A 3FR7A 4BX8A 1XPRA 3AEYA 5MFZA 3NVMB 3ZVNA 4HQFA 2IZ1A 3D8TA 3TTYA 3KBOA 3N8HA 1P0IA 4X8OA 2RHTA 3R7AA 2AOVA 5M04A 3A0RB 1BDJA 4HLCA 1IFXA 4F72A 5D51S 2AGVA 2HMSA 2VPYA 1DJQA 2XSZD 5AI5A 4TTRA 4MEJA 5GJVC 1L8AA 1BS2A 2QN3A 2YFHA 3BB4A 3GRCA 3RW9A 4JU8A 3HXLA 3O91A 1OIVA 1AGXA 2IE8A 2OV3A 1EPUA 3DEJA 4JC0A 4N18A 4BDTA 3FPJA 4NR0A 1RFLA 3TVTA 3PQ4A 1JUDA 3PNVA 3TFWA 2O8DB 2YWHA 3B2NA 3REGA 2D06A 2XOKD 4CR6A 5I7WA 4ZICA 1PBNA 3PYXA 1Z0ZA 3P0JA 4AW9A 2ZI7A 2OGWA 3OJFA 4WIAA 5DO9A 4EY8A 4X7MA 2DKOA 1K3FA 3ZCXA 4RM3A 4GLFA 4X7BA 4QOIA 2XNSA 1DEAA 2O3SA 5CJJA 1R5OA 3K96A 5LQNA 1ZCFA 4B3IA 2NZXA 4FN4A 1OROA 3WKBA 3RAFC 2C61A 3AP3A 3PNQA 2EZUA 1QG0A 2VK8A 1F2DA 2ZAMA 2HWYA 3NBYC 4GYYA 5CITA 4KYIB 4IG9A 2WA1A 1E9BA 2C31A 1QV6A 1Z6PA 3F5DA 2BKUA 4RHEA 5CDFE 1F12A 3ABIA 1RXIA 1X1DA 3HA7A 3NIWA 3TINA 3LLCA 2EP7A 1K97A 1KVRA 3FFTA 4ZO6A 2HXGA 5CLQA 3M2TA 4NE9A 2ZS9A 2FN9A 1T5LA 2OQRA 4X6YA 3RTCA 4UHEA 2FX2A 4F2PA 3QW4B 4UQLA 2VQ6A 4DUPA 3WLFA 5KBYA 3IMGA 4TZTA 3SEQA 5LLDA 5CJ2A 4R98A 4R3NA 4IUCS 4UXJA 1IBSA 2D1TA 1FFXB 5GGYA 4CGYA 2COKA 3AVUA 5EERA 4ZCRA 4NABA 1F3OA 2BZ1A 3SQXA 4IY1A 1G3QA 2CHFA 4FC6A 3CVJA 2NYRA 3E6AA 3STHA 1H3FA 5KNDD 3KOUA 4MAMA 5IKXA 2A3NA 5LU8A 2H54A 4JBLA 1EINA 4QIHA 3Q98A 5LP6A 2RGRA 1TJ3A 1YHZA 2QTAA 2ZBEA 4OQ4A 5IULC 3KQKA 5FHQA 2QVBA 1PDOA 3HH8A 1WD5A 5FORA 1U0TA 3DTVD 5CDUA 2AXEA 5F7JA 1C1HA 1QBGA 3FJ1A 2QRNA 4EKYA 5IJZA 1Z5OA 2WT4A 1E4YA 1P9NA 2BFMA 2WINI 1UBCA 4Q21A 4TKVA 3RSCA 4IVRA 4J7AA 1GA6A 4UVIA 3W5BA 3OCXA 5TEWA 1Y9ZA 8GPBA 1N3LA 1VL2A 4LJSA 1FEZA 2GARA 2WUFA 3MXOA 4D57A 3V7NA 4CDMA 4L2IA 1GTMA 4BQPA 3IEMA 5EJFA 1PJ3A 3F3KA 5AVWA 1QNFA 3ECCA 1OU0A 5D87A 2BBOA 4O0LA 3QXGA 4II3A 2X6QA 4O5AA 3TZEA 4DVGA 2YTZA 4EECA 5I47A 3DOHA 1PJLA 1OYOA 3GRKA 2RGCA 1ODTC 2NUAA 3QEJA 1X1AA 3A3YA 2QN1A 1FFDA 1BEUB 4G4IA 2XUQA 3HCNA 2J9FB 1DDOA 1GP2A 3LK6A 5H9WA 3RSSA 1GSHA 2RAFA 1E2LA 1I0LA 5H02A 4JR0A 4QGFA 3GOHA 5HIMA 1VI6A 1HH4A 4ZVSA 2QM7A 5C80A 1TU3A 2E5FA 1I1NA 3CW8X 2VH5R 4FYIA 4LBYA 3FLMA 4JODA 4OKIA 5HF6A 4CM3A 3SIWA 3H2HA 1G8HA 4B7AA 5AI6A 2DHEA 1N0IA 1YR1A 5D86A 5EZYA 3RUDA 3TLGB 3VPCA 4B45A 5DM70 3VDNB 1ZVMA 3GJZA 3CNQS 2CEKA 1D2RA 3HYTA 1LC3A 2IXAA 3PI7A 4HNGA 1M2HA 4UU7A 1MW9X 4JQYA 1B6GA 2OBFA 4R7TA 3TQHA 1XCLA 4DR5B 1SWVA 4AY6A 4MKHA 3RK0A 1B76A 1S8NA 4C88A 2WC1A 4RACA 4F9GA 1JJVA 3KM0A 3ZHRA 3THSA 2C97A 2JJ8A 3E27A 3QU7A 4Z86A 1Y7IA 1ORIA 1YQXA 2NU9A 1B8OA 2VHXA 3ABSB 4E3WA 4HF7A 2EFJA 3PQDA 2AKYA 4BFTA 1I2CA 4I50A 3N1UA 4GOOD 5B1YA 2PS3A 3BMQA 4CV0A 2I67A 4LWZA 1L7EA 3FRHA 3PHCA 4BFWA 4JBHA 4YAJA 1VP9A 1KK2A 3HDVA 4K1XA 5FBLB 1WM1A 1ZXLA 1UM9A 3PVCA 1U90A 3QF4A 4BV9A 4DSOA 3KEMA 4E07A 2ZUSA 4MVJF 5C5EA 3LRXA 1K5PA 2FDRA 3CQ9A 2O8BA 3BD6A 1JJAA 2TRSB 2VLBA 3O0DA 3GVHA 1CVLA 2NUBA 2R48A 4L15A 5FPYA 3VHXA 5DV9A 4F3KA 2DFKB 4CF7A 4MPRA 3SVZA 1W2WB 3KT0A 3QUQA 3N8GA 2FHPA 2OLEA 3NIFB 4RD3A 2C7RA 1SBZA 3E9CA 1JSZA 2JAQA 4OKSA 4OAPA 4A6XA 1DOZA 1JIVA 5CU7A 4BZQA 2XTJA 5AVKA 3KR0A 4ETIA 5HBGA 5JPDA 5LNK6 3HWSA 1JLHA 2JK1A 4M1EA 5J43A 2M9MA 5ISMA 4CM8A 4UULA 3AM1A 1L4BA 4Y6GB 4F9EA 2RHHA 1EWKA 2PZBA 1W4ZA 4KAAA 4ZRDA 2G8NA 2MT9A 3RADC 3ZE0B 2BEVA 1QHYA 1E3EA 4G4GA 5GY7A 5EKXA 3UATA 3V5NA 1ZR2A 5JBNA 4EA9A 2VNJA 5AIBA 1HGXA 1JIQA 5C8VA 2PMDA 4QTYA 4YRSA 5EHXA 3LP8A 1VI2A 3GWGA 3M1YA 1E8DA 3J80A 4LYYA 2DPXA 4JY7A 1HTBA 4Q4DA 4BZWA 3V7UA 2ZUDA 3TM5A 3EEOA 1JZTA 2G88A 4JLSA 2YV3A 4FYPA 5T64A 2AK3A 4H3SA 5KSZA 3OM0A 2UAGA 5FTJA 3C5HA 4MUMA 4Q3LA 4Q1DA 4JQCA 2EF1A 4IFIA 3MHTA 1IVNA 4E4TA 5MGBA 1KYWA 1L4FA 1UWLA 2GZ2A 1R6BX 2HJVA 3FYSA 5EIBD 4D97A 4YT8A 4YMLA 1KK0A 2BBSA 1FFAA 1MXHA 1J7KA 4TM7A 3UGTA 4JXKA 1PEAA 1XXHA 1Z6AA 1DJMA 1YMVA 1BAPA 2HPAA 2JA2A 3HVIA 4INZA 2XMGA 2ET6A 3MJDA 1NN3A 4I55B 1NVXQ 3BREA 4G65A 4B3SB 1PKXA 1E92A 1JG1A 1DKRA 3RC8A 1C50A 2N75A 2L69A 3DZGA 3JARA 2IUUA 4FHEA 2X2FA 5AVVA 3RNOA 3MB8A 4DLVA 4AD8A 3TJZA 1RXSA 1ESZA 1K27A 2QTVA 1GDHA 1NDUA 5FR2A 1CUUA 2YN0A 2R6GA 1FJ2A 4OO3A 2Z95A 1XO1A 1Z22A 1EDEA 3IP6A 5FNZA 3URKA 2I7CA 3RFUA 3PT9A 4LK3A 3IVGA 1NRIA 4QOJA 1HSZA 4EKDA 1NP6A 2FFRA 1I2DA 3D43A 3PFKA 3Q8WA 4A6PA 2GCNA 2W0MA 3BXHA 1DV1A 3ZY2A 5J9FA 4BMYA 3IT0A 4EG6A 4HDOB 5AD1A 3RYFA 4A7PA 1BCRA 3UT6A 3L77A 2P2ZA 4J43A 5E2IA 4JL5A 4AQYB 2HOQA 2F7SA 1GLNA 2JLBA 4FGUA 2WQ6A 2X7JA 2GHQA 2G71A 2C0QA 2IOYA 3PPIA 1LNSA 1N8SA 5T4EA 1D04A 2PLWA 1AF4A 1Z5GA 2WOOA 5AOVA 4RJ2A 2QD5A 4F6RA 2YHBA 1QF7A 3VZCA 3IH5A 1D6NA 4KXQA 4IIYA 4X1KB 4CMJA 1VPLA 4OM8A 3TW8A 4WFKA 1B0PA 2XUKA 1DIRA 3EMVA 4G0PA 3INNA 1HRKA 1S1CA 2C4KA 1FLDA 1OXSC 2O7SA 4QFCA 4XR4A 2Y9MB 4YTEA 2GXAA 1UPUA 2BF4A 4OHFA 4RM2A 1Q21A 2JGJA 2NTVA 3M2PA 4CMIB 2BFPA 4FFPA 2C96A 1SBHA 1BX0A 2ZCUA 3EY9A 2OPHA 3ZIUA 3D2LA 1MAAA 3GJ0A 4BNMA 5H80A 1RLIA 1LEHA 4IXNA 1RAFA 2P11A 4PXYA 4YFYA 4OXIA 1MN6A 4D3DA 1CE8A 3EZ2A 2O0LA 1ZOIA 1YCHA 1H6AA 2EL7A 5DNDA 3DFMA 2C57A 3OZTA 4IS3A 2VQFB 3WDLA 1XLTA 3JQ7A 3A05A 4V0NA 3PUKA 2NU7A 3F6EX 3ENZA 3H9QA 3NWBA 4XOUA 1Y3CE 5EJEA 4HDQB 5LKAA 3DZDA 4GRAA 5IEJA 5GJWC 1UODA 5EJGA 3NGXA 3TH5A 1E7QA 5C4GB 3WKCA 2F1HA 1YUMA 1UAAA 4LFAB 1H4TA 2F6RA 3N2GB 4FGJA 3Q0EA 2W2TA 1JEEA 1L7QA 1RJFA 3DNFA 2GJ4A 1EG2A 4YRZA 2ZREA 5ILOA 1KAMA 2EG9A 3UJ3X 4I2NA 1XZCA 3RTBA 4YAGA 3OHMA 5K0JA 2ZUWA 3USZA 3K70B 1T2VA 2B35A 3IC5A 3TIIA 5JLJA 1GYRA 5GMOA 1X39A 2PTHA 5L95A 1NOKA 4CEIA 3ELUA 1AUXA 2BMVA 4OBWA 1CNEA 1EB9A 1XQ9A 2H0QA 2X40A 3ANMA 2ZDGA 3SHVA 3PGMA 4KSCA 5EYPB 4BO8A 3P9SA 4OHWA 3NQ41 3PHJA 2E3JA 2P9ZA 3M5DA 3BSSA 1DTEA 4RZQA 1IBLB 5H59A 2JFFA 3L0IB 1LV7A 3K0SA 4KQKA 1UK9A 4QTXA 5GZ1A 3G2NA 4GD3Q 4OL9A 1SCQA 2PTGA 4QO7A 1QOZA 1STOA 5T57A 1QZZA 3HJTA 4BNYA 1ZN8A 2QE7D 1OH7A 1P9OA 2BUCA 5L7WA 3LI2A 1MB2A 1P1FA 2B83A 5J2TF 5BYKA 1UWVA 2QD4A 4NESA 5F7OA 3LYHA 3L7NA 1MTOA 1T8UA 4X24A 4ZPJA 4DYHA 4YUYA 1YR7A 3N2YA 1U3UA 3IXMA 1C8KA 3NPMA 1XK7A 2I9PA 5K2OA 5H8WA 1GTSA 5D3ZA 4Q1VA 5BOSB 1ICEA 1KIMA 1XZAA 1IVYA 1XE3A 2J6IA 1SG0A 3DVSX 3GQVA 3WSTA 2GB4A 3QYAA 4E7OA 4N1AA 4CCYA 4LE1A 4B3XA 1J8MF 5CHEA 3HG7A 2HI0A 2J3LA 2AFHB 3A9UA 2AUTA 2WDZA 4N3CA 5AMXA 1OMOA 2CMHA 5AK6A 4EG8A 4AUEA 3D3EA 4YAKA 1NGSA 4LGMA 2NO7A 3JY6A 1SKUA 1FDTA 4NFHA 3CLTD 1JX6A 1I8TA 3DWIA 3VKGA 1GV0A 2DQKA 1ONNA 2Q6VA 1BKSB 2FN3A 2VN8A 1XEWX 2Q7DA 4UNRA 2J5QA 2AYYA 5F2NA 4XASA 4FOTA 1KS2A 3D6JA 1E59A 1IYZA 3PVSA 3W1EA 2G5PA 1N6HA 3ZHQA 1EBFA 4MV9A 3ABZA 1N9GB 1UADA 1Y8QB 1R9GA 5DZSA 3PE6A 3OLZA 4GX0A 4AJEA 1BO6A 1RXUA 1ZIYA 2VBIA 1EIZA 3KJEA 3HO8A 2BFFA 3KQQA 2FUCA 2YVUA 4KTVE 3KQOA 4GC9A 4LE2A 4LOAA 2R6AA 2JAUA 4RHTA 3REQB 2IGTA 4RORA 5JR3A 5DP1A 3ZY6A 3B53X 3WZLA 4XXHA 4BGEA 3K5WA 3OTWA 1NP7A 1RT9A 4JI3B 1R1DA 3F3SA 3OM9A 1E5TA 1SQFA 2TYSB 5KYUB 4NSNA 4KO8A 1OWPA 1LDMA 1U5CA 3I73A 4LBWA 4KMRA 4KPGA 1M8KA 2F1KA 1PJTA 1I3NA 1TI7A 2HBZA 1T6ZA 4CL0A 4D26A 3DJYA 4MZDA 4WCFA 5E3HA 1DRUA 3FCOA 1ISMA 1Q1EA 1G63A 2VF8A 5KYKA 1AGYA 5AM0A 4E3ZA 4B80A 4JCCA 2GZDA 3Q7RA 5LD2B 2YY6A 3H5VA 4NJMA 2J0UA 3HEAA 3UJAA 1ZH8A 1G9SA 1JFTA 1EP1B 1L4LA 2GNAA 3DMHA 3IBGA 3WNDA 2K2QB 1HG1A 3E9EA 5EVJA 3RUEA 4Q3CA 1KMHB 2PMEA 3OIVA 1GNTA 3ANSA 3SC2B 1M2OA 1XNRB 4OGWA 3D8RA 3HKEA 5K7SA 3EVGA 1Y5RA 2XECA 5F7ZA 2AR0A 2BJWA 2RJ3A 5KUTA 4PG6A 2BM8A 4OYLA 2DCMA 1PKEA 2OMKA 3GMSA 1ADCA 3S8MA 1YJBA 1Y6ZA 1H1LA 4Q1EA 3AEUA 3C74A 5LMUB 2WUDA 3Q9LA 1EGMB 1WKBA 4KDEA 1ZP6A 2E4VA 3HPRA 1NY5A 3EDCA 4EK9A 1G60A 2OLKA 4PFJA 4JR2A 4U5XA 5AT1A 5JAHA 1NFFA 2A5YB 2B30A 3BL5A 3R3SA 1FZTA 1W29A 4YO7A 2XNHA 1G291 3H6GA 1GL3A 2W2NA 2WJYA 1MEEA 1QVVA 3EGXB 2P9QA 3D4IA 4FX5A 3OUZA 3TOCA 2B8EA 2CGEA 1T5OA 1BTOA 2WT8A 3D2BA 3V4OA 3FZQA 4O25A 1QHEA 1AUPA 1P4JA 3TX6A 4FYJA 1H3NA 3G2HA 3HR7A 3U4IA 4JUFA 1IM2A 3W4KA 1RHQA 1MXFA 4LV8B 5F4BA 5KO2A 3BMCA 3SQMA 4TWAA 3T5PA 5JDIA 4OXNA 2YS7A 2W71A 1DKMA 5CJPA 4XVCA 1V1RB 2B34A 1HOXA 4S1OA 4UBNA 4QKQA 2XYPA 5CYPA 1SCJA 3F3MA 4UARA 5C34B 1OZ0A 3MBOA 3P26A 2IP4A 1NQOA 2I7VA 2NSYA 3AY0A 3RUFA 4GEGA 4RD6A 1Y5MA 2J7PA 3A6JA 2GCGA 2XNDA 3CZPA 4M9CA 1T3ZA 4Y2VA 2J5BA 5T8KC 1JAZA 4YECA 2JA1A 3RODA 1GZ5A 5KJEA 4S2EA 3R8FA 4OK5A 5ENZA 1MRNA 4KR6A 1WUIS 1Z0FA 3RHFA 1B8PA 3T5DA 2LXNA 5D7BA 5HOEA 3KKKA 4PZ0A 3NTQA 3ZHXA 3IIKA 3SJZA 1N6NA 4L74A 3ES9A 3NBAA 4GECA 2NT3A 4CR7A 4Z53A 3PQ3A 3LBNA 4AROA 2EZTA 1YJ8A 4XYMA 1G17A 1VM6A 4MMYB 4NBVA 3TQIA 1Z34A 1S2IA 5AI4A 4ALLA 2CXOA 2F1IA 3PSAA 5IAJA 5A4JA 3HXTA 5L4NA 3HTXA 2CZCA 4LC1A 2CXPA 4B8YA 1JG3A 1GYQA 5FNVA 4ZVQA 3LC2O 4MUYA 4Z8XA 1ULHA 3I52A 3M8KA 4D80A 2YCBA 4UM7A 3BN3A 3LQYA 3T0GA 1QIIA 3W3AA 3OQOA 4A8HA 3BJMA 1V3VA 4A8JA 1E3MA 4B6JA 1A8IA 1TKBA 5M34A 1UJMA 2HHAA 2O20A 3DR5A 4I8IA 3DUFA 1QIDA 3DSRA 1RABA 4X44A 1MVOA 3VJKA 3B78A 1SQ5A 2HN9A 2ZWPA 5ICCA 3THWA 4LJ9A 4GOMD 4Z4IA 1K0UA 1R4MB 4DDWA 4OXKA 1JHDA 3KJHA 5ALTA 3OKCA 1QMGA 2CXSA 3K6KA 4ZODA 2JHFA 1D2AA 1XQVA 1CNMA 1MVLA 1IWBB 1WHTA 3DC7A 5IJ9B 2CV1A 2OBNA 4GM1A 1RQ7A 2H7XA 5BP7A 1U04A 1JG4A 4D42A 3Q3CA 2PGIA 2C99A 4EVIA 5FTLA 1V3TA 4A4DA 1ZAKA 4ECEA 2I6TA 1JP7A 1Z8NA 2J31A 2A4MA 3R24A 5JZMA 1YH3A 1T4BA 2OD9A 4AJNA 2E18A 2C8VA 5IVPA 2UUAB 4KGVA 4OQEA 4PF1A 4W7SA 1ZGBA 3DO5A 4FBMA 4D8YA 3E05A 3PUZA 4FXOA 1B6SA 2H0AA 2WHEA 3P52A 4LRXA 4MX8A 4AJOA 3DLIA 5D00A 2NTJA 5HILA 4CT0A 3FTFA 3JSXA 4X6UA 4YN3A 1EUCB 2B6HA 1FRNA 1SC9A 4F21A 4MUEA 2O8EA 2R5WA 1USWA 2QJFA 2ZAIA 2COEA 3O26A 2N0SA 4MI1A 4MP8A 3AI1A 1CBUA 4AL4A 4TMVA 2PEYA 2QV0A 1YNOA 2DFVA 4BKOA 2OM6A 3A1SA 5T3UA 3KSMA 5AW7A 3PUJA 1FXSA 3HVJA 3A3PA 4P33A 3MW8A 3ZDQA 3MGAA 5BV0A 5JADA 1TVKA 1TZMA 4YRNA 5DLEA 4EHIA 2IYZA 2OAEA 3WIUA 3S2GA 2D0OB 1IXZA 4AAYA 5AFSA 1TYEB 5KVAA 4GMKA 1VPTA 4RKWA 2QR5A 1PT9A 4DL9A 2VHCA 1SUCA 1RNLA 4W9NC 1JA0A 2F4NA 1W0KA 5ADHA 3IAS6 5J63A 3FNFA 3OUUA 2CB0A 3IRVA 1E32A 1X2EA 2GMWA 2AN1A 1DWQA 3LQQA 1UDCA 4RLHA 5F98A 4YWJA 2C2GA 3IBCA 4OHMA 1O0SA 1P8JA 1OT5A 1XALA 2WAAA 3DB2A 2XKJE 3HI4A 1FFGA 3BM5A 1FVXA 2ZM6B 4H27A 4HN9A 3HDYA 3K9BA 1A5SB 2Y93A 3QKWA 1XL0A 2LD4A 1M2VB 4RD4A 3RB8A 3WY9A 3X1KA 5JAPA 3U5ZB 2QPTA 4Z9XA 3DPUA 1NULA 1NJ2A 3IDAA 3FMVA 1MH9A 4J9UE 3W4JA 2DQSA 3Q3EA 4ZEWA 3O38A 5G4KA 1UJ5A 1J23A 5FO1A 1RS0A 1NTRA 1CQWA 3FWZA 3L82B 5ERYA 4D9FA 1MO3A 1NX6A 1XNGA 1EZ1A 3KYDA 1UJ6A 3DXFA 3R3WA 4Q19A 5SV2A 3SFVA 2CHVA 1TLFA 5DHRA 3DC2A 5G40A 1PQPA 1LPOA 4OJKA 3ZLVA 3Q8XB 1SCBA 2PH3A 3MJRA 2C1XA 5BN4A 1QGOA 3GNLA 4BO5A 3H11B 1S2GA 1ZZEA 1MBZA 3LCCA 4KQIA 1DRWA 4EJ0A 2XWJI 5KREA 3NOQA 1U2EA 2PU5A 2AEEA 2Z5VA 3Q0IA 2BDUA 4QNMA 4E2WA 1E64A 1Y3AA 4YJGB 5KKCA 2D2VA 3AP1A 3CT4A 1JFRA 1IZYA 2BBWA 2EQAA 4RD0A 2ZUEA 1MAUA 3VJLA 3FDIA 4G4JA 1CR6A 2Q0QA 3ZW8A 2ZYRA 1I51A 1OX5A 3ZZUA 2V9CA 4BPBA 3HV0A 1UDAA 4R83A 2C2WA 1O7JA 4NK5A 5LYJF 3S7ZA 3P96A 4AZ3A 3EGWA 3TVYA 1GD1O 1PT6A 2PZFA 3CUTA 1PWEA 1Z2DA 3H8WA 4G0XA 1MT3A 1LBHA 3V8VA 2JW5A 3PDIB 4EFDA 4ZK2A 1VRWA 1XEAA 3LY5A 4HQLA 4V3CA 4EI8A 1XI2A 1W0JA 2PY6A 2IHVA 3R3ZA 2IC5A 2XUPA 2YYAA 4ARZA 3DEIA 4BOYA 1KFCB 4O4HB 4PGAA 1D7OA 1SIUA 3GK3A 3PNLA 1PZFA 1C1DB 1Z35A 3A4MA 3E7DA 3JZIA 4M9QA 5DRTA 4A6EA 4DMHA 2VYNA 1C8LA 3EWNA 3EVEA 2X58A 1J56A 2DHQA 3NIBA 3WDKA 3C8UA 1V8DA 2CLOB 2TECE 3I2IA 5H16A 3VNAA 1T9BA 3ZCUA 4UQPA 1C7IA 3PZBA 3QE3A 4HJRA 4EUEA 2A88A 5E9QA 1TYBE 1FXWF 1ZJJA 1UPBA 5CDGA 4BAZA 3DE7X 1V3UA 3QW2A 4YBZA 3IEKA 2A5GA 5K3AA 3ZV3A 1I7DA 4E5PA 5CYGA 3B5IA 4KMSA 3TG2A 1IQ0A 4QEKA 3E8XA 4FLMA 2Q3DA 1EI9A 2YY7A 4NBLA 3HL0A 3H75A 2W2MA 2C2OA 1ZK0A 1PFVA 1N6LA 1PGPA 2QG4A 3GARA 3WV4A 1NVWQ 3B1VA 5K0ZA 2CDBA 1VL8A 3TR6A 3U4DA 1ZL0A 2ZIXA 3GV0A 2HBRA 1G7TA 1KYVA 3R20A 2VJYA 4TVBA 4P92A 4ENSA 3VVBA 1I30A 5CVUA 1X38A 3F8WA 3HO6A 3IT2A 3TUJC 1QSGA 5C7IO 2F00A 3I9MA 2IIPA 4B2LA 3OWXA 5JS6A 2ATXA 4DRXB 4DV2B 4WBXC 3VKFA 2V97A 2OBLA 2IOQA 5ARDA 4MUKA 3U81A 3LUFA 5FADA 1FP6A 3HJFA 2AC4A 4EI7A 4FKBA 2G04A 2OHJA 4O4JA 4KK3A 5ILGA 1RE1A 1E61A 1QFZA 3RIHA 8ADHA 1E9SA 3VFDA 3IPLA 1U7WA 3L9WA 1PSDA 1UPCA 2FUG1 1KI1A 2JLYA 1MOQA 1CJKC 2GSWA 4YRGA 2O14A 1H69A 3I2KA 1VDZA 4P22A 1KZ6A 1T5DX 4Y2PA 3E9NA 4DJJA 3IAUA 4X60A 5IKOA 1KDRA 1PZHA 5EJMA 2H4FA 2V3VA 4Y2TA 4CLDA 3O2NA 1WB6A 1PAUA 3QHQA 4LOJA 3NYIA 5AVTA 1AUOA 5JRZA 1WPQA 3LQ2A 4D4GA 5H3HA 1OSNA 3MMSA 2AV6A 4JFRA 1LDEA 5LJLA 3U9TA 2RGAA 4FMPA 1Z7BA 2QD1A 1QQ5A 4GR5A 1L7NA 5F51A 1C0LA 4G01B 1J0CA 2BFWA 4G41A 2NO0A 2ZFUA 3DKRA 3OT1B 3H86A 2X9NA 1HR0B 2FZCA 2C2HA 4QUEA 4BBPA 1C7JA 2A0YA 2GBFA 1U9ZA 4RPCA 4KBFA 5IT4A 4Z3OA 2WF9A 1KL7A 2DSNA 3I0ZA 1NBHA 1IWPB 1Z4OA 2X0FA 2VAWA 4BO3A 3WL4A 1VC2A 2QIOA 1LCIA 3EUEA 4XJSA 1HY3A 2CLCX 1G64A 1H3EA 4MYCA 5JRJA 1TYZA 3FPAA 2JEYA 1NR1A 2A9PA 2PQ0A 4R8VA 1DCKA 2REXB 3UO8B 3UJ9A 5EWJB 1ONSA 3LKVA 4RADA 2REBA 4GSYA 3FX2A 1I3MA 1WO8A 3DBOB 4PYLA 5KEIA 2GGSA 4WGGA 2AL7A 1BCSA 4WESB 2DG2A 3HJGA 2WKSA 3WICA 1E98A 1LPAB 3OCWA 4MWDA 3SSOA 4JXXA 3VDQA 1VP3A 3A2LA 3RSLA 1SJ9A 2R6DA 1ISIA 2PIAA 4G1MB 2BE9A 2OD2A 4RH0A 2QP4A 4AZ0B 1KSHA 4FR5A 3RQSA 2XCTB 3W6ZA 3KQYA 7MDHA 4EO7A 4GLLA 3WLJA 2WU3A 1AXRA 3THOA 2ODAA 1FX0B 1E6UA 1G7SA 3COVA 4KOAA 2YJGA 4F5WA 2XGSA 3A1EA 3D81A 5C8YA 3I23A 3WRWA 2PL3A 1BXZA 3MYYA 3F96A 4HTFB 1N3BA 4OI4A 1B2LA 1WNFA 2DULA 3VOSA 4YJ2A 1OV4A 4J4BA 2NSHA 1FTNA 2BGWA 1VBMA 3HC7A 4JLBA 3GAFA 1Z5UA 1V48A 3RS8A 4HHEA 2Y0PA 1T9GS 1VMDA 1RBQA 5DT2A 1AS0A 1JIUA 1UFKA 2HU5A 1E6CA 2IXDA 3THXA 2FYTA 4MB0A 2V7WA 4I6GA 2RAUA 2Z9BA 4I4LA 3W2GA 2J3MA 5EFZA 2O23A 2Q9BA 4JWKA 1FLVA 4QXPA 2B0CA 2X4LA 3FOWA 2Y0DA 4OHCA 4BKQA 3ZIAA 1OXVA 4LDNA 4C0XA 1CWUA 1CZHA 1XD2B 1RWMA 2PMFA 2CB9A 2VG8A 4NDZA 4ZO8A 3UENA 4FB5A 2VZ9A 5AKHA 2W2KB 2H18A 5HUQA 2P2YA 3OPQA 2BH9A 3G23A 4O2BB 3VU0A 1BE8A 3W5IA 4D8TA 1FVFA 4ERXA 3PG5A 2HBQA 1GZVA 3EFEA 3I04A 4IHAA 1LF5A 5CFLA 1H2BA 4C5BA 5DYYA 4MUAA 4PTZA 3O94A 3D54D 5E9AA 4CEJB 5DULA 1UDBA 5DHUA 3KD3A 5ECYA 5JO9A 3WYGA 1BHSA 1VE9A 4ISBA 4RVUA 5A4MS 1GT91 1RWWA 4YMSA 5BORA 1P0MA 3AJ8A 4U0KA 4EHKA 4LYJA 5T67A 1DDGA 1WDMA 4IW3B 4W4TA 1BQEA 2PM8A 2CYCA 4YR9A 4DR7B 2IYYA 1QWSA 4PXAA 2AYXA 5EGSA 3RBAA 1JAYA 3F2VA 3WLIA 3OTQA 1SIWA 4P2GA 1R6XA 2X77A 2OV1A 2H48A 2VDNB 3DBIA 4Q1CA 1YS1X 4PZZA 1ATIA 4XYGA 3OUTA 4U3JA 1BXGA 2PYDA 4JH0A 4X20B 3KT3A 5AHKA 4ER3A 1S4QA 1GR0A 4O4IA 1FMJA 4RVSA 1PDVA 4ZVUA 3R7WA 4ENPA 2B3TA 2BWJA 3TDKA 1FFSA 4OXXA 2ZJ7A 1GTZA 1THTA 1G66A 1MEJA 3I6IA 4EL5A 2Y1CA 3VNUA 4OAQA 2EX1A 1P1BA 2Q3JA 1NLZA 2GAIA 4FHFA 2VDWB 1PUIA 1Z3IX 2Z9CA 3AOGA 3S4YA 1T8RA 5JLAA 3NZEA 1P6XA 1KBQA 2Q29A 3PJEA 4KQMA 4UUMA 2VUIB 2XMPA 4DMMA 2RE8A 1M33A 3FFXA 4QYIB 2G4VA 3GNSA 2VDVE 2QAJA 1DFIA 2XI4A 4NONA 4ZO7A 5T7BA 2H1WA 1OBFO 1QDLB 3A10A 4UAVA 4KIGA 1NR7A 3O92A 3Q0TA 3QUCA 4FMDF 5HQTA 4A10A 4DLBA 1Q17A 3ROFA 1YTUA 1M2EA 3MJVA 3C85A 1T3TA 3NB0A 3JQ8A 3ZC3A 5IU6A 1YDMA 4FYHA 5DIZA 2A1UA 1L3CA 3V2HA 4BMVA 1P1RA 1IK6A 1KF0A 4GNRA 1GPBA 1S3SA 1JPVA 2GJ9A 2IXGA 4LZJA 3IUNA 4NCXA 1BA2A 2G83A 4EZEA 1I0ZA 2FZLA 1ID1A 4C0JA 1P1IA 4GGPA 3TRJA 3NEYA 4ATNA 5TLSA 4R1MA 2ORWA 2RHMA 1FRZA 1NQVA 3K8YA 2ZPTX 4K0RA 4I8DA 2C94A 5CGQB 5E4FA 4ENVA 2XD9A 1XMOB 1JQ3A 4MQ6A 4B6RA 4AI6A 4KX3A 1RI1A 3AC0A 3RAEC 1X8JA 1ADJA 4E11A 1QONA 1YKGA 2C04A 5G0TA 5CAEA 2BTEA 2KS6A 1ESNA 1B00A 2GRUA 3I62A 2XXAA 2PAFA 1IC6A 1KI2A 1KQPA 3SF0A 3WP1B 2JI7A 4BZXA 1ICIA 3QWBA 4FYWA 4XUDA 1MX1A 2PS9A 2ZTHA 3R0JA 3RRYA 2AJCA 2O0KA 3U1BA 3TD2A 1H9AA 1YAJA 3LL7A 4KACA 4Z0NA 3ICEA 5DBGA 2BSAA 4O3FA 5KQLA 1HL7A 2HZ7A 1Y34E 1RWVA 2KSQA 2QWXA 3ER6A 3QEKA 4BNJA 3HWX1 4ZCMA 1GR1A 1SGWA 2CY0A 3AI2A 3M6VA 1CQZA 1MQ9A 4GMGA 3DFIA 4FIDA 3ZX4A 3WYCA 4OM7A 4ZYVA 4I36A 4P3YA 1XRNA 3AF2A 2H4WA 4HPJB 3U0BA 5C3MA 5BNFA 1SH7A 2H92A 1G3IA 1XG5A 6PFKA 3W2FA 1CFZA 2OFXA 3FUCA 3IQHX 1ZI9A 2C2ZA 3TRFA 4EFMA 3OWOA 4CDNA 1TUGA 1QG6A 2TSYB 1JQBA 2FK8A 2G4CA 5KNBA 3H1AA 5IARA 4O2AF 2IHNA 3G1WA 1LSJA 2J09A 3DBVO 2W00A 3PE4A 4F1WA 4RF4A 5THQA 4EGFA 4AP6A 3ZD7A 1M0EA 3SZMA 5LP6B 1UKVY 2JGDB 4NOKA 3TEMA 1T8YA 3ZJ4A 1R0CA 1XCBA 1UJ2A 2R1ZA 4P54A 4RFLA 5DH9A 3DDHA 4FWIB 5K0GA 2XB6A 2ZJZA 1P0CA 5EHQA 1JWLA 1DWUA 3KQPA 3LA8A 4LYGA 4A36A 3ZN2A 4EATA 4KTTE 3NV9A 5HEKA 4URXR 2ZUFA 5FUXA 1T5IA 2IRWA 3I2GA 4DCSA 4U2DA 3JQ9A 2O54A 3WKEA 4D8XA 1G5TA 3BE6A 4RHXA 5HKOA 5CNIA 4I2VA 2VF5X 4AUKA 1U2QA 1ABBA 3TF5A 4PGGA 3PWTA 4P82A 3H05A 3GDOA 2VTDA 1LK0A 1OX4A 4N48A 1J90A 2Z2XA 1GM5A 2HDWA 4FYVA 1V45E 2Z2KA 1F2TB 1IHPA 3ELWA 1RLJA 4QUIA 5FWDA 3WI7A 3GDFA 2XR1A 4DMUB 1RJ9B 2XUOA 1I3CA 3MT7A 1GLVA 5D1NA 5TVKA 1Z08A 1YRHA 5LZ2A 5CX4A 1U1EA 1PD0A 3RYCB 1HDCA 1YZYA 1PNOA 2GD2A 1K5GA 1Y7TA 3NYQA 3PHGA 4NYJQ 5JZBA 4Y98A 3CRZA 3AVVA 2AMJA 4QBGB 1Z88A 4URHA 1GKUB 2R4UA 4MUFA 3U7IA 3ZPXA 2N3ZA 3GZNA 4CN8A 4FS3A 3J7AC 1TMGE 1QR2A 3RUAA 2XYQA 3DXYA 3MELA 4OXYA 5JD5A 4R8KA 1RVDA 1IHYA 5TMDA 1R37A 1DB3A 3KEFA 4BECA 4CJXA 1VE5A 3FUVA 3A6ZA 1OQAA 4PVCA 3EE6A 5EZYB 3CS3A 5SZHB 2I6QA 3BA1A 1Y4DE 1ZRHA 3HVUA 3CFYA 3VR4H 1ZISA 1CUDA 2OZEA 3EXHB 4M54A 4MLDA 5DM60 1Z07A 4HH1A 3UIEA 4KHPB 2II6A 4UBIA 4HEHA 3K70C 3R3HA 2B36A 5F9HA 3H5LA 3IBYA 4HYEA 5D1HA 3OIWA 1QQAA 2JIRA 1BDIA 3NC0C 3PRJA 1BJKA 1K6EA 3CRNA 1TKRA 2QT0A 3NX4A 4I50B 1L0BA 3ZK8A 1DKPA 3NPAA 3ZWQA 1VG9B 3KAPA 3OX4A 4I4NA 4F4CA 4B75A 1KP9A 2BZGA 3IOBA 2ZITA 1FS5A 4M0PA 1GQOA 5J3JA 3LOQA 2X8BA 1Y3IA 2QLLA 2X9GA 2Z30A 3VDMA 5CFMA 3C45A 1E1MA 1UM9B 3QF4B 4O63O 4Y9DA 3DVRX 2GRJA 5AOCA 2I6GA 4LY6A 4LRQA 3W8EA 1GDDA 3KSDO 4G07A 4TUYB 1OZGA 2C92A 2MIIA 5AUNB 2O8BB 3LCMA 1JFVA 4WBNA 4TSKA 3VHXB 5B30A 5SZJA 3MZ0A 4EM6A 1BWQA 1CP3A 1Q7CA 3L8HA 1ID8A 1H5QA 4QNRA 4RABA 2JKZA 3SEZA 4LC0A 4P34A 5K3BA 4RW0A 5CG1A 2I8CA 2WAOA 4CG0A 3C3YA 1YZ3A 2F9FA 2J7PD 2XNDD 4MTLA 3HJAA 1LPNA 4MKZA 4ZC1A 3RTEA 4DC9A 1AB5A 3LW8A 3RABA 4MHTA 1UAYA 1VB5A 1JPUA 1NBMD 1WU7A 3B8HA 3IQWA 3K15A 4TTAA 3WWCA 3V8PA 4D9HA 2H1IA 3T4XA 4F91B 4DQVA 1QQ7A 3WJ1A 1V7PC 2BVNA 3H4IA 4I4CA 4XFJA 1XDWA 3AF6A 3STTA 2Q07A 4CF6A 4L8VA 4OQDA 1GWNA 1PJ2A 3FJYA 4OQXA 1ZUHA 2PFSA 5JBQA 4QDKA 5CA1F 1EIWA 3PR1A 2QMQA 3NAGA 3OOHA 4YDSA 5B2EA 1XTZA 3W8FA 3IERA 2E9SA 4X3OA 1GG5A 4W1RA 1JDJA 1BMDA 3FR8A 2CMDA 3IIMA 3MT9A 1TAQA 2HA4A 5TMBA 2VTEA 1AX9A 2E2WA 4PRZA 3X2SA 2PVPA 1GCOA 1ADBA 1W9HA 3CCCA 4RLQA 5CH8A 4ARVA 4LMBA 5DTRA 1XP5A 4J6EA 3W3AD 1I6KA 3L1UA 4S1WA 3VYRB 4NCJA 4BIIA 1LY1A 4EZBA 4ZDJA 1DARA 5EEHA 1D07A 4GLOA 2ZXEA 2ASEA 2XIJA 1D8AA 1X3LA 4OHUA 2C82A 5BRAA 4BXOA 2CJFA 1EBBA 3G9XA 4QEDA 4GP9A 3HDHA 4B6OA 4MO2A 1XXHB 3O4HA 4NCIA 5HX7A 3ADKA 2XD4A 1F7UA 3WK9A 1XTJA 2D3TA 4KE9A 4L5YA 5F1OA 3OX3A 4IKPA 1PFYA 3IR5A 4LMPA 1W8DA 2OGSA 3DPSA 2VJLA 1T10A 2A58A 4R3UC 3RCBA 2YC2C 4Q82A 3TQQA 1USGA 1WXHA 5H5JA 3VNBA 3NETA 5FWYA 1E5XA 3B3QA 3EGDB 1H2ZA 3JARB 5CHYA 5EZ6B 4BAGA 1L5VA 4NFSA 1KJWA 2QU7A 2OY0A 3P2YA 1GL9B 1ECPA 4N3NA 3NHZA 2QYHA 1UDWA 1C3EA 2G8LA 2QTVB 3V4PB 4Z51A 5K6AC 3IKTA 1XCPA 3W5DA 5A0FA 1UXGA 3C5EA 4O2LA 4XM0A 4ZTZB 3PFNA 3PV0A 3SNHA 1QPZA 5I7UA 3WYFA 5EE0A 2XLCA 1DIAA 3E5MA 5AM3A 3KSZO 3UWSA 3V9AA 4E1BA 2HNBA 3IMCA 5KMGA 4CETA 4AT1A 4JL6A 4IJKA 1U4SA 2IW3A 3M6MD 1YACA 4WASA 3NHLA 3H16A 3GCXA 3CKYA 1N8TA 2ZR9A 1NUHA 4IH1A 5BSMA 4F0JA 1E1DA 1L4YA 1T9GR 5U1PA 1IPHA 2R7KA 4YAEA 1DRVA 1NMZA 5IT0A 5IBPA 1PL8A 3LYLA 2XMCA 2WSBA 5D7NA 1N25A 5CX1A 3BIWA 1R10A 1XN1A 2ERCA 2VYCA 1WD7A 3DBRA 5AM5A 3U49A 1JMVA 2DQZA 2NUPA 1QO7A 2MOKA 1PW7A 3VVLA 4I1PA 1KYYA 1FDVA 2HU7A 3IOEA 1PNRA 1TM1E 3EHDA 1W0CA 2BEWA 2FA9A 5JCPA 1SAYA 1Y3BE 2IXEA 3F6RA 3R09A 1RIFA 2PMKA 3AKCA 1QB7A 3R7DA 3M3HA 1J70A 1QPGA 3KSUA 3RFCA 1E89A 1NN5A 1JLSA 2OG1A 3LT1A 3EUFA 3PEEA 4HBGA 4EVQA 2P40A 5JW6A 3PKJA 4Q15A 1HRDA 3TW4A 3SYNA 5HFJA 3TW8B 5A03A 2ISCA 4JKYA 2QROA 2FUNB 4HDMA 2F43A 1OFHA 3BZBA 4M88A 4YV7A 1E7YA 1YIOA 3FDFA 3R8CA 4OYRA 1Z4KA 3GRAA 2OCXA 1PT5A 2JB9A 2Q6KA 1AOXA 4K3VA 4PG7A 3QLEA 4Q3BA 4ACBA 3MQ4A 3A4NA 9LDTA 5LQKA 4QOHA 2VPXA 1MU0A 3I5XA 3KV1A 7ABPA 5DX0A 4O1MA 4B31A 2GCEA 4ERNA 2FPLA 2I1WA 2IY9A 1IZ0A 1XCJA 5HJ2A 1WMEA 1YZLA 4LBZA 5JG7A 1HFWA 2XQGA 1CE8B 1WSBA 4QUKA 3H6KA 4TRJA 3C48A 2V0NA 5BV2P 2B61A 1DINA 4GYJA 3JQ7B 1R6UA 3B60A 1T3GA 4EI2A 2I0FA 1FS4A 3B9RA 3C3PA 4LNHA 3I9OA 2PT9A 4D81A 2Y05A 1EK1A 1O95C 1XD9A 3C4QA 5F1PA 4H2DA 1VKRA 4C4SA 5K45A 3FFBA 5TNXA 1UF9A 1WTAA 1XZNA 1UWCA 2HF8A 3LDGA 2CE2X 4RVOA 4GKVA 2V9PA 1ORTA 1AS2A 3BD7A 1QORA 3INRA 4JP3A 4JIMA 3WRXA 3ZE7A 1O96B 3NDBB 3VJRA 3KUCA 3MUFA 8OHMA 4A5SA 4QJ4A 5BUSA 2A14A 2L42A 3IQZA 1Q3TA 3GN2A 5FQOA 5J5VA 1LI7A 5G1OA 1QTQA 2OQIA 2ZROA 4F6CA 2ZVPX 3DUWA 3V1UA 5IYZB 4CEIB 2VP3A 3S2UA 3LHSA 1GHTA 4KJXA 4ZZIA 1QK5A 1W0JD 3AZOA 3OOWA 4MVJH 2NG1A 1JXMA 2PKYX 2YN2A 3P9RA 4LYDA 4V3BA 4ZAVA 3VXKA 4CTKA 2O1EA 4WXPA 2YQ5A 3T9DA 2VYND 3GLKA 2VA9A 4WNAA 4JI8B 2NW6A 3K09C 5DASA 2A30A 5CB6A 1L4GA 4PANA 4B4OA 1QTNA 2BKLA 1UK6A 4FGSA 4MWEA 3GRRA 1HNWB 1CDZA 5KQPA 1EG7A 5C7OO 1IK4A 3AO0B 3BMNA 3CF2A 4H7EA 1E66A 1LZKA 1G1AA 1M0SA 2YMQA 2VTBA 1XPUA 4WT7A 1XROA 5REQB 4BMNA 1MIHA 5C1BA 1ULAA 1XQYA 5FF9A 4W1PA 3U17A 1ZM3A 3QEMB 3V8BA 5K01A 1NM5C 3RH0A 5JJBA 4MZXA 5KYXA 4HZGA 4J7XA 4OJYA 4NV0A 4RQBA 4BE4A 4Y8VA 2QKYA 3BVPA 4D9NA 2ZVQX 1N3YA 5B1SA 1SWWA 1E4OA 3MHPA 4HDRA 3G0CA 1OB5A 3HZZA 3D3NA 2RB4A 3F7TA 4CKCB 2ZG6A 4EMTA 2I8AA 3SKXA 1GPKA 4RBNA 3GXOA 4IVQA 4I08A 3VO8A 4DUGA 4JZKA 2H7VA 2UVPA 3QE4A 1RHMA 4N7JA 2AZXA 1D2HA 3O5AA 4QICA 1JEYA 1P4AA 4Z5XA 2PU7A 3TRKA 1SUSA 4DIMA 3EODA 1CUYA 3K35A 3RKRA 1DVRA 1Z5PA 4J75A 1XTPA 4AJKA 3GFQA 2Z83A 4DIUA 1Z26A 1B1AA 4H7FA 2VI5A 4FR0A 3ZCPA 3EXEA 3MEQA 1ADFA 1DO0A 2B1QA 2JLZA 5E38A 2Z1MA 5ANRB 2GJKA 3HKBA 5F52A 3HN2A 1SXQA 1ETHA 1R15A 2HB6A 5ILQA 2IX3A 4IDQA 4MAAA 2BFNA 4G26A 3DTTA 4INAA 2I3GA 3F7OA 4KGXA 4B5KA 2HQSA 4UQOA 4WZAA 2VHVA 1TQDA 1QIMA 2BFFB 2PX0A 2W0SA 4IIHA 1F17A 1PT7A 5I8ZA 1P9LA 1NUQA 1LX7A 1PFUA 1RCTE 2A4KA 2JHPA 4OLAA 4ZJPA 4BUCA 2CUZA 4FGLA 3U7GA 1XV5A 2NZUG 4MR9B 3SBDA 1YZHA 2X13A 2QX9A 2WYOA 3HNOA 1JEQA 4ZPXA 4DCJA 1DAOA 3FAKA 1PF7E 3WRVA 2WTBA 1XLUA 1RI5A 2H1VA 1ZWKA 2AXPA 3KL2A 3UTCA 1GAQA 2X2OA 2WD7A 3NWEA 3KFVA 5IJXA 4XJVA 3VSCA 1K86A 1P17A 3KPUA 1GNVA 3KS9A 3G2MA 3C6QA 2XRZA 1VBFA 2HTEA 3LS2A 4CXMA 1L5HA 1ORRA 2PUAA 2WAYA 1SUIA 1I7LA 5KHAA 3L7IA 3LKDA 3PWKA 5DFAA 3ESDA 3AB3A 4K28A 4D0SA 2OO5C 4D4LA 1CS0A 4WW0A 2QXTA 4OH1A 4UMFA 1NFRA 1A1VA 3JQFA 1RMTA 3MWEA 3K0CC 4QQ8A 2QXUA 3T4UA 1BS9A 1M2OB 4MS4A 3LWZA 4E14A 1P31A 3HKEB 4CIAA 3T1HB 3FJOA 2WUEA 1OFUA 4QUDA 4H0FA 2CVHA 1NKVA 4F2HA 4H77A 3AEUB 3GD7A 4UD2A 3QG5A 4H17A 3C5WP 4X94A 1ZMRA 3FZYA 3MQFA 2IYRA 2RGBA 4RPIA 4AZSA 3A36A 5I4IA 5JAZA 3F7NA 3EDRA 1JHMA 5F23A 2CHQA 2Q3HA 1GG2A 1WVGA 2TMKA 3B6ZA 1QGYA 3BH7A 4GR9A 4W5WA 1I7SB 2AG6A 1DHRA 3WNCA 2NTYC 2YXBA 3B38A 4FTWA 3FN4A 4B4WA 3EZLA 2O19A 1HF3A 4P0PB 3PXUA 1T9DA 4K6MA 3HO1A 3PC8C 2OC9A 3KPJA 3IP3A 4D9JA 3UPDA 1G2QA 3IP8A 4R9SA 3QKRA 1ZVJA 2PX6A 4U5QA 1V8FA 3I1JA 4KK4A 4ESEA 3TDMA 1D5CA 1F2UA 2E5WA 3AF5A 4DREA 5G41A 3HA5A 5H70A 5CM8B 5I5EA 5JNSA 3KQNA 2WWWA 4P83A 5F33A 2IU6A 2ID8A 4HH3C 4V2IA 3DZJA 3UWPA 2NVWA 1HX7A 2LUOA 1FFCA 1ZO8A 1ZMBA 2IFTA 2PBFA 3DV2A 3LPAA 2A9RA 3TTVA 4ZAFA 5AKZA 3A27A 3I61A 4KXFB 3INGA 4OV6B 3G82C 3CJTA 3CY6A 3HCWA 4QBKA 1N2CA 4NDNE 2P27A 3IJ5A 2VJAA 4K2HA 1RRMA 3RRZA 4EG5A 1AKWA 2ZSBA 4LKOA 2D8MA 2FSUA 4LPSA 4KUHA 1YVEI 1TW3A 4US1R 3AJRA 2HWKA 1ESMA 3VM6A 3ZIAD 3Q7IA 3ZU3A 3AHIA 1JDUA 4WZZA 3DDNA 4IIJF 5FNVB 1CPYA 4QC2A 1TQ8A 5F76A 1L5ZA 1CK4A 2ZAGA 3AILA 4KODA 3CLKA 3EIQA 1JDTA 5EEGA 4A0FA 2YCLA 1YQEA 4A8JB 3WZ2A 1S5PA 2FFHA 4DLLA 1D4FA 3I45A 5KVVA 1E3WA 4ZT2A 4FEYA 1KDPA 2BHRA 4HCJA 3TLAA 3U3JA 4ZVNA 5JH7F 1F0KA 3UAYA 4EYGA 1EM8A 3HXOA 2OENG 1Z7WA 4V39A 3KUUA 5JNLA 1RHJA 5B4VA 4PLFA 4DMCA 1FTQA 4M1KA 4JB3A 3RSOA 1XU7A 2HAEA 3VTFA 4B3GA 1X13A 2YINC 3COZA 1MFZA 1RQPA 4LHXA 4ZQIA 3CVYA 3MCWA 5EVCA 3QJ5A 3WBJA 4QX6A 5EIHA 3PENA 4RK4A 1EX1A 4IVPA 2HV9A 5K3EA 2YZNA 1YBVA 3TBKA 3ZLBA 2JCGA 4LDJA 3L7AA 2NPOA 3QPDA 5BN1A 4OI2A 1U2DC 2OUIA 5IDQA 3CJQA 3HGQA 1FPQA 1LFAA 1I80A 3JD1A 2VAVA 4POOA 4GYKA 3IUEA 1IXSB 3KLMX 1GTJ1 4F3RA 2LKCA 1DJNA 3AXSA 4B3FX 2DXIA 4WXYB 3VU1A 3SP1A 4I99A 5L3QA 3FGZA 1ZRMA 2PN1A 1F1JA 4ZDWA 1FXUA 1AMUA 5EWLA 1FSFA 3EGEA 2MYTA 4AY4A 1K9SA 5EIEA 1G5HA 1M1YA 1R8JA 2P4HX 3NDRA 3FOAA 1GUFA 1WXFA 1J21A 2IYWA 3E5NA 4HMPA 4QJBA 2C7VA 1R8QA 2OG2A 4ROTA 1EE2A 3MPOA 5JMTA 5BNZA 3DAPA 1RRCA 2VZLA 1LSOA 4D0NA 5KWJA 2JZOA 1SY7A 2PEZA 4XPIA 2XDAA 2WLTA 4PM4A 4WN3A 1CZUA 4QM7A 1N2XA 2AHRA 3JWPA 1O5IA 2QN8A 2X9QA 3KYCA 4GRDA 1J0XO 1V43A 2ZJ6A 1DT5A 1PK8A 1E2HA 1W85A 2I54A 2OOKA 3PKIA 2ZE6A 1WHSA 4JSTA 4KPUA 2H1HA 3U62A 1GT6A 2BR4A 3F74A 1X7GA 1U98A 4CNBA 1V41E 3Q2KA 4MYSA 1NAHA 2EKDA 2PUEA 1HT3A 1PGNA 2Q1TA 3A6PC 3H6HA 3R6GA 4PBRA 2OCAA 4RK1A 4ZJZA 3G89A 3WQRA 2B5WA 4CM1A 4TQ9A 4WOCA 1GEEA 3ZYCA 5DKFA 4BLRA 4J6FA 1A9ZA 2HY7A 4V1CI 4B2YA 2E21A 3D9QX 2NP6A 2PSJA 2ZP1A 2I55A 1AZWA 5FQNA 4AB1A 2UYHA 4FQ7A 2P9YA 2ZRIA 1XDDA 2XF2A 3N3BC 4FWTA 5FBWB 1GG9A 3OP1A 1KS9A 3TPCA 2RIRA 1OH5A 4XQ9A 1A2QA 4TT3A 1T8PA 1S9DA 2B7CA 2R1UA 1EP2B 4KIJA 3ZQ6A 2IODA 2QRQA 2H1FA 5EJAA 2WEKA 1Y4ZA 3F4KA 1QU2A 2C58A 4TPKA 4ZWNA 5TE9A 2E4AA 3TTWA 3AVQA 2RG7A 1ZGGA 5EA2A 2PIDA 3OLWA 5PNTA 3P4YA 2XCRB 2OWDA 1P7CA 1GPNA 2QQGA 4YV2A 2E37A 3LUDA 3OZUA 2O5CA 2FWPA 4CUKA 2Q1UA 4BBJA 4UKDA 3HXPA 2O57A 5DI9A 3EYWA 3W77A 3RVPA 4YRIA 5KU1A 3KQUA 3B89A 5A06A 2BIFA 4GMXA 4XRRA 3EFOA 5K4AA 2NXNA 4X8LA 4CM4A 4GBJA 4N03A 1DCTA 5JCOA 3GRVA 2CNNA 1FB5A 1T9HA 3D3QA 1ZGZA 1HI9A 3KVNA 5JCJA 1IN5A 3II6X 1JEOA 5JTTA 5L3VA 2H2AA 2Y1GA 3D7NA 4G3XA 2ZEJA 1H05A 3JQEA 5DHQA 2Q5HA 4XIJA 3SJUA 4PC3A 1UMCA 4REQB 5C3UA 1JEAA 4P7FA 3K8QA 1ZRSA 2DYKA 2ENUA 1OTHA 2WU1A 1J0AA 1O94A 3JAWA 4PCUA 2BE7A 2FUEA 4D82A 2QUHA 4KGDA 4QXMA 1Z6TA 4ARZB 2QUIA 3CX7A 3RTGA 5IFKA 2YWCA 3NM4A 1KH2A 1MB0A 2XQVA 1IWOA 2NYAA 1R0KA 3PXBA 1RXWA 1D9XA 1A3CA 1O4WA 2BCEA 4LNAA 3A1UA 3ROMA 4WERA 4F46A 1JDVA 3UHFA 2MWMA 1TNDA 3CEHA 2FP4B 4GNKA 1RFGE 1VE1A 2D1QA 5JXWA 3G88A 3CKMA 3BK2A 1CB7A 2WAMA 2ZSIA 1VLZA 1JQKA 3L6EA 1UBKS 2IWRA 2OVFA 2E55A 3PFHA 3EPHA 4RVGA 4ZVTA 4MV6A 4TL9A 2CJWB 4O8ZA 4HVLA 1A9XA 2XE6A 4R6XA 1OBHA 1Z8HA 2UZ0A 4LC9A 4R8MA 4FB4A 1OXMA 2WIJA 3RS0A 3R0IA 2YS6A 1IBKB 3O9ZA 1P29A 1MGPA 2CHEA 3DOFA 2JH8A 4ARUA 1AKUA 4YPVA 1UOQA 1DOAA 1VIVA 3REFA 3WWYA 2FQWA 2ZIXB 3PUYA 2B6NA 3CGWA 3N8IA 5M7EA 1BROA 3BQMB 4S12A 3NHBA 4L0DA 2RCNA 5FPSA 1K6JA 2QUZA 3D7RA 2XWBF 2WZQA 3FPHA 3VR2D 4BP3A 4WZAE 1Q16A 3AF4A 3KQWA 3C6XA 2BEUA 3DM5A 2HLNA 2YZ7A 2Q62A 3AM5A 4IKEA 1NI5A 1UUFA 2C3YA 3K2QA 2H1RA 1NVKA 4DDKA 1JHRA 2ID4A 1LBQA 1Y63A 2I33A 2N42A 5GONA 4L5CA 1A8SA 5DBEX 1AKNA 5ECDA 3TWOA 1JKJB 1YFKA 1K0FA 1MEOA 1ZU5A 2EZ8A 3K31A 3PF9A 2R96A 2KWIA 3IMEA 1KE1A 3GB9A 2NZ8A 3KR2A 5AW6A 2V3CC 3FLAA 4G6ZA 4BIMA 2R1VA 3NM6B 6ADHA 4F11A 3IVAA 4GICA 5ICFA 3AHJA 3OOYA 3DMTA 3MJCA 4KG7A 2R4TA 1IMJA 1QO0A 5LQSA 5COQA 4GH5A 1E1KA 5KTPA 2E0IA 4PPFA 1ZCZA 3W2EA 4YMWA 3KOOA 3GLIA 2Y66A 3IBSA 4Y9UA 4AYXA 3DLPX 2ZRAA 2QRJA 1IL0A 1KKUA 1TVMA 3I32A 1EMDA 3I2JA 3O4GA 4J0CA 3D5TA 1P7VA 4B81A 2B20A 2EJTA 3CRW1 721PA 3G2QA 3O4JA 3WGTA 1GUBA 1U1FA 4F12A 4EWLA 3CZ4A 4MQBA 2IPLA 3G2KA 5TGTA 4QLOA 1QHXA 3WGNA 1E7WA 2O5VA 3T3EA 4RSMA 1Y1RA 2QMHA 3ORFA 3IURA 3D0KA 4IIFA 1NXQA 4HN2A 4L5BA 4LSZA 1Y4SA 3LX4A 3HJCA 2HQOA 2WHPA 2D2FA 2W8BA 3HJRA 4TTQA 4IBOA 3E81A 4UTNA 2QJRA 2RAPA 4DABA 5CFRA 4JI2B 4AECA 1U9YA 2Y1LA 4MLCA 4OFBA 4BEBA 2P2SA 5DHPA 1P2TA 2A0UA 4C4OA 5F64A 4RFSA 4A03A 2JLRA 1KI9A 4ZQFA 1V7QA 2L2QA 5LP6C 2HJSA 3Q7PA 1A4UA 1CEXA 2WIFA 4A0HA 4ALJA 4C6RA 5K0BA 5AVQA 5FXMA 3O8BA 3UYKA 3JPWA 4GW3A 3DZCA 1UBMS 3N0WA 1GUDA 5D6NA 4YHHB 1A96A 3GRZA 4BBZA 4CU5A 1JR4A 2CLFB 3D1LA 5HM8A 2XZDA 1NVVR 1KZGB 4J1NA 5IM4F 1PLLA 1XT6A 3KE8A 3O93A 4RZXA 4TV9A 1F8UA 5DTEA 1QXSA 4ZFNA 1VYTA 1NXWA 2IW1A 1P62B 2XEXA 3DDCA 4H31A 2GUGA 3DOOA 2R1TA 3QMVA 1LF0A 5C8YB 3GEDA 3OSZA 1ZD2P 2VJKA 2I78A 4GPD1 5KX5A 3BH0A 1YE3A 4ONEA 3OCCA 2PZKA 2DU8A 3RC9A 3LZCA 3B48A 1L5QA 4N41A 1ACMA 1A2BA 1QBKC 4PO1A 1KO1A 1XVTA 3AZQA 1G2IA 1ZM2A 1R5BA 5I7AA 1ZBDA 3W1WA 3VJMA 1M1UA 2X6TA 5CVVA 3OFVA 2I7TA 1BFDA 1UK7A 1ZG3A 5DNVA 1LJUA 2IIBA 1K89A 1MKYA 4J16A 1VLMA 2DPMA 1DKNA 1SHJA 1CUZA 2YWFA 1DJLA 2ZRHA 5KWSA 3HYNA 3WWOA 5JS2A 2XAAA 1NXSA 4IXWA 2FPGA 1RRPA 1D0SA 3IE0A 4HP8A 3JYLA 4M53A 5G0WA 3SU8A 4EKNB 3V4VB 3HU5A 4D3FA 1QH8B 2R97A 1CZOA 1XYGA 1H4VB 1JDSA 1N0HA 4GKBA 2Z5GA 4AJ4A 5K8JB 3L46A 1QTRA 2XYRA 4NBUA 3RIMA 4HNTA 4BLVA 3THYB 4ND5A 1WWKA 3R7NA 3CO0S 3V7WA 3CR3C 3N0RA 4H3HB 5K5EA 1X7WA 3P7MA 2ZTUA 3EDMA 1JW9B 3EXHC 4MMZB 4JLDA 3L43A 1P2UA 3V8MA 1N78A 4M1WA 3ROQA 3BWDD 4OREX 2WSMA 3HKDA 4UZEA 5AOAA 1CR0A 4M1OA 1GQRA 3U40A 1Y3FE 3QLTA 4JK3A 3MGKA 4EGSA 1YOVA 4RV5A 3FCYA 2PCLA 4FONA 1FZQA 4YS6A 1Z0IA 4AXBA 3VI4B 1XJ5A 4IFBA 4KH0A 3OAAA 1EU1A 1AV7A 1ZJ4A 3ABRB 3EAQA 3T61A 2NZJA 3DO6A 3DM9B 3S1AB 4EJFA 4EOGA 1GOTA 4W8HA 1GFWA 2ODQA 1N7HA 3QBEA 4ZEMA 4UUPA 4S04A 1LBTA 5AKLA 4LSMA 3R3JA 4BNDB 2X1VA 4IHJF 5FWXA 4U3JB 4OHPA 3TCXB 1XOIA 2WKQA 1HT0A 4C7OB 1E3QA 4O4IB 5G02A 1IZ9A 2RGNA 1HFJA 1U2GA 4D79A 1YZVA 4G1EB 1EUQA 3ZY5A 4CIBA 3QFTA 3DOEA 3I0MA 4DA6A 5JXJA 2OXFA 5FOWA 4BCDA 1NVDA 3SICE 3OEHA 3DTYA 3QFSA 4L7QA 5B64A 4FZ3A 3GYBA 2RGEA 5DEOA 1G8FA 4IUYA 4OK6A 1YJCA 3KL4A 1E2DA 2OE2A 4R0NA 1AHIA 1VSUA 1GA1A 2FSHA 1IZ7A 2M6KA 1J7JA 3GUZA 1FP4B 4QBFA 3L84A 5DW0A 2HEIA 2IV7A 2G9VA 3T12A 4Q3NA 2DX7A 4KV7A 1YVPA 3RT9A 4EL0A 3FYTA 4RTMA 4E46A 1FQJA 3FG9A 1ENPA 1SQ0A 1GGMA 2OBBA 4JQZA 1Q84A 5BUCA 3LFTA 5MGNA 1CP2A 1LVHA 2A1UB 3OCUA 1SKAA 2JGNA 1Q7RA 2FRVA 4FD3A 4GC5A 2VNSA 4MVJG 1Y9DA 5KC9A 5COAA 3ZEIA 2VSQA 2R8XA 3E4CA 4PS0A 4HQNA 4D56A 4LFBB 1DGQA 2ATEA 2ECQA 1W4BA 4AJPA 1BRMA 2WIBA 3CMCO 5LJIA 2JI6A 5IFLA 4HLUC 2WFLA 3E3NA 4UBJA 1AXEA 2ETXA 2DBZA 3MJTA 3T8YA 4B74A 5ALKA 2WTMA 3ZOZA 1QFJA 3LA6A 4XQGA 4KBGA 1A04A 5CAEB 2YJ6A 3V46A 1BW9B 1U4OA 1ORWA 2FGKA 3Q3HA 4YR7A 5I51A 2QGZA 2IEAA 2VDKB 4YMVA 4UUOA 4TRMA 4MS3A 3E2IA 2ROQA 4KQ1A 1V6AA 1JRLA 3NI2A 3W1VA 1QZTA 4UCFA 5BMVB 4B0OA 2WDPA 1QRDA 2P2NA 3T3GA 1LRKA 1DS6A 2WTXA 1HYEA 1KO5A 2OZLB 2XKBA 1N33B 1RI2A 1RI3A 3S1SA 5E6SB 3IEIA 4GPEA 4TMWA 2R11A 2GM4A 3T1OA 2B2NA 1VZ3A 1YAHA 4ALKA 2ZXFA 2JF0A 3O8OA 4ZYUA 5AM4A 2OTCA 2ZETA 1YQQA 5HQ3B 4EGQA 2LGJA 1IBMB 3AFMA 1UC4B 1UXOA 2JBWA 5FLKA 3SDBA 3T15A 3TXYA 4DZRA 2YJTD 2WFMA 2AS0A 3DW3X 4JJ6A 4R01A 5AVJA 2JGKA 3TLCA 3VKVA 1LC0A 1DIHA 1XJCA 4MI3A 4YA6A 1KI4A 3QFFA 4MQEA 2XUZA 5F35A 1EUZA 2C9DA 3STVA 5J1TB 5DHAA 2NQ2C 1GVNB 4U2EA 3WGOA 1JYFA 3Q2IA 4M98A 3IKVA 1WZIA 3W6UA 3X0DA 4F60A 4KAJA 1MLDA 1LRJA 2GR9A 2O3UA 1GG8A 2GSDA 3H9BA 3L7DA 3P2IA 4KE6A 5LZ9A 5K0TA 2BSXA 2RHOA 1N2OA 1A8QA 2GZRA 3L40A 2OAQ1 1BVHA 1CEYA 4N6OA 3L7KA 1RPZA 4MQLA 1S4MA 5KTSA 3HWRA 3ADPA 2C1ZA 4K9OA 1CF2O 3SYKA 2HF9A 1ZU4A 3G9ZA 3LPLA 3VI3B 2RIPA 5HDQA 5ELLA 1BYUA 3FGOA 3A6KA 4QPNA 4IX9A 1YSCA 5NLLA 4JYZA 2FG5A 5D3KA 2B4QA 2XT6A 3AEZA 3E7PA 1FBTA 3OIGA 4CL2A 1SO8A 3SBEA 4JXJA 1SD1A 1DFGA 4L7VA 2Q5OA 1XF9A 2HCTA 4TL8A 3VPXA 4NBNA 5GGXA 1KYXA 4F4UA 1JT2A 1ZK3A 2IUEA 4JBNA 3DOUA 4NU0A 2VSXA 3RV3A 2G5CA 3C3BA 1DC5A 1EQ2A 4YQYA 5M2QA 1OX4B 4QZVA 3V2GA 1PLJA 3VU9A 1SUPA 2FFBA 1DADA 2CDNA 2GN9A 3D6HA 4I6EA 3DMGA 4O1HA 4C06A 2HL6A 3IP9A 4EUFA 3TW6A 5KU7A 1IUPA 3C43A 1AUQA 2N47A 4FHDA 2CLHB 3RIEA 4CM5A 2O7NA 4K9QA 3R6WA 2B7LA 1V0JA 1MC5A 2G72A 2QZZA 3BCUA 4QDXA 1H0RA 4UDOA 1E1RA 5J5CA 1QLHA 2GPBA 2WU8A 2I2WA 4FJ1A 1MABB 4G8JA 2JCVA 1P72A 3EVCA 4HLQB 2YWDA 4TMFA 3WLTA 4C0WA 3GZNB 2DERA 4LQLA 2V6JA 3TZ6A 3VTAA 5TJHA 4C3VA 1BOFA 4XDHA 3JRWA 3OTGA 2J4FA 1T8TA 2ESRA 4MVJA 1O8CA 1XAJA 1IUOA 2JLQA 3K2BA 4RMNA 3OMWA 3UMMA 1N77A 1IBRA 1ZUNB 2QK4A 2ZJBA 1VJ1A 4G25A 1INLA 2L19A 3ONNA 4YAFA 1F8GA 4C43A 1W5EA 2EKBA 4R54A 2XRYA 1UXIA 4M0CA 2R60A 4I55F 4A0SA 1NW4A 1E9RA 5HA5A 4F2WA 4MUNA 1AHHA 2VSNA 2P2GA 1EVLA 2WPDA 3I8SA 4NG5A 2OZVA 2HR1A 1I01A 1QP8A 3CH7A 3ZNOA 3EXFA 1OOEA 2FPWA 2XCQA 5B58C 2AE2A 1U9CA 3M5WA 2Q21A 1CUEA 1SCNE 5TX7A 3WSVA 1JXQA 3BA6A 2PGLA 3FAZA 3UG7A 1ETUA 1K7EB 1UM8A