4YXFA

Mups, a 3-oxoacyl (acp) reductase involved in mupirocin biosynthesis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
237
structure length
230
Chain Sequence
KGTIIVSGGSQGLGLTTVRCFLEAGYNVATFSRRESPAVTELSERADFHWQALDCTDYSALTAFVQQVEKRFGGLDGLVNNAATGVEGILSTMRVADIDSALDINLKGQLYLTKLVTAKLLKRGAGSVVNVSSINALRGHSGLTVYSATKAAMDGLTRSLAKELGPRGIRVNSVSPGYFSSDQTLSRIERRTPLGRLGTQQEVADLILYLVDRGTFVTGQNIAVDGGFTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MupS, a 3-oxoacyl (ACP) reductase involved in Mupirocin biosynthesis
rcsb
source organism Pseudomonas fluorescens
molecule tags Oxidoreductase
molecule keywords MupS
total genus 84
structure length 230
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yxfA00
2I67A 1ZKMA 1GD1O 1TT5B 1VJ1A 3HHPA 3DMYA 3M6IA 4UUNA 2HAEA 3PLNA 1YGYA 4UVHA 3GRPA 4J0FA 3V1TC 2Q2QA 4YRDA 4R4JA 3OP4A 1DHRA 4MO2A 4BS9A 2GZ2A 1LDYA 2NVWA 5TT0A 2FHSA 5EPOA 3GR6A 3QP9A 1FDTA 4YYZA 3ZNPA 4GH5A 3UCFA 5J23A 4RDIA 1YDWA 2J8ZA 4IINA 2ZCUA 2B37A 1PEDA 2B36A 1LQTA 3RROA 1GY8A 3BAZA 1ZK3A 3GN2A 3NUGA 1YB1A 3AU9A 2UYYA 5TS3A 4MVJI 1LDBA 5KKAA 3TOZA 3U49A 5L4LA 3JQBC 2YHIB 3KM0A 1KBZA 3KUXA 4U6SA 2NVUA 3NGLA 3HB4X 4O5OA 4B3IA 5A4DA 3H3JA 1EQ2A 2FMUA 1BTOA 3WX0A 4NMHA 3S8MA 3DFZA 4UULA 1ORRA 3HN2A 2VHVA 3I9NA 1XR3A 3HDJA 3BYZA 2TMDA 4CMGA 3H2SA 2UAGA 4Z9XA 3WGTA 3DZGA 1PR3A 2VCYA 1E92A 2XF8A 2J3JA 3JQBA 2X0RA 3W4IA 4E13A 1PL8A 2B4TO 2OXIA 4F6LA 5CDYA 3RKUA 4GWKA 4P4GA 1R6DA 4OIMA 3OEYA 4WASA 4G65A 4CV1A 1EVJA 1ULSA 2AA3A 4NJMA 4FFMA 1N92A 4ITUA 3V1UA 1FDWA 4PG7A 3U0BA 3QQPA 4LMPA 4R01A 1VJTA 1XEAA 4JJIA 4A2CA 3WSVA 4Z9FA 2Q50A 3LU1A 1I36A 1FJHA 4NFSA 4YAGA 3PJGA 4OQYA 1CERA 1TEHA 3JQ7A 2IEDA 3W1VA 1KEUA 2DT5A 3HQ4O 3C85A 4PLFA 2RCYA 4QTZA 1MB4A 4HFMA 3JV7A 4YEDA 3NJ4A 2JJYA 1PZFA 4GMFA 3EGOA 2O3SA 4JNKA 1Q2XA 3I6QA 3NKLA 3NT4A 2X5KO 4PG8A 1TA4A 2EKQA 1IB6A 1LLDA 1R37A 1HT0A 1DB3A 2NUAA 4XEHA 3QVTA 1EUZA 3Q0EA 4R3WA 1J49A 4CODB 4ZVVA 2DAPA 4R51A 3CZRA 3ROKA 2AEMA 4RVDA 3IUSA 5LDHA 3L4BC 2AEJA 1E7RA 2BFMA 2V6FA 4YT5A 2GN6A 1PJQA 3OEWA 4FFOA 4K6FA 1DBVO 4TZTA 1I32A 5CEJA 2FSVA 3G1TA 4B7CA 4FFNA 2R00C 3ZU5A 4N18A 1GTMA 1W73A 4MVJM 3RASA 3TF5A 4BUCA 1P0CA 3OM9A 1N7HA 4HUJA 3PPIA 5TT1A 4CM4B 2XAAA 3CE6A 1YB5A 1RPNA 1PZHA 1U7TA 5L4SA 2PD3A 1HE2A 4XQ9A 2DFVA 3DZKA 1LJ8A 4JROA 4UVEA 4FFRA 3SLGA 2JAHA 2IZ1A 5IDWA 3RUDA 4FQ8A 3WBFA 1K6IA 1E3WB 3DBRB 2AXQA 4L76A 1NFRA 2VOEA 4N5NA 4FGSA 3OQBA 2A94A 3ZWOA 4B7XA 5JLAA 1QRRA 3KV3O 5F1PA 3WLEA 4MVJG 2O3QA 1XGKA 1ZXLA 4K26A 3UGKA 3WGQA 1LLCA 3QRWA 1GQQA 2IEBA 1E6UA 3OQ1A 4CLEA 4CM5A 5KIAA 4UVIA 5JMPA 3EAGA 4CR6A 1I3MA 3IUPA 2Y1FA 4Z3DA 4RF4A 2O4UX 3P5SA 1ZXBA 5JDIC 4QO7A 2DBZA 1P74A 1MXHA 4WOKA 4Q3EA 1MX3A 4XGIA 3ZWAA 1T25A 5L45A 1Z7BA 1KS9A 3KEOA 4D41A 3RFTA 1CIVA 3JD2A 4IZIA 3NT5A 4ND5A 1E6WA 1ONNA 3FRJA 1F8FA 5AXBA 2VYNA 1PX0A 2D5CA 1VL6A 1VRWA 3E48A 1GYQA 4M8SA 2VNSA 2EHDA 4M1QA 4RPKA 3ZHYA 5CFZA 3KLMX 3GVPA 3WLFA 3ONDA 3DBLA 3DBVO 1ISFA 3G3EA 4BO2A 1DFGA 2PZKA 4ZQHA 5L51A 2O23A 4YA6A 2OL4A 3AM3A 4DPMA 5CDTA 1J6UA 2WEKA 4B3HA 4PFJA 3O03A 2Q46A 1AN9A 4I9NA 4EEZA 2CY0A 2R2GA 3I6IA 4CLRA 3QIVA 5KTKA 1DO8A 3ZNNA 2IXBA 3ZHXA 2X5JO 3CKYA 2YHIA 1GFSA 2VUSA 3PQFA 3AI3A 1DIBA 1MLDA 1C0PA 3PRJA 5BSFA 5G4LA 4M86A 1E0DA 1HSOA 5LDGA 3PDUA 4AG3A 3R0IA 5JDCC 2HK9A 3AY3A 3JTMA 2HQ1A 4R1SA 3SC4A 5T64A 2DQ4A 2Q49A 4BGEA 4XGNA 4R1TA 3LK7A 4J90A 2HMVA 4Z0PA 1U3VA 3PEFA 1ZMTA 3TFOA 1PTJA 2BGLA 1ZK1A 2PKRA 4WK6A 4IDDA 1DRUA 1X1TA 2WD7A 1WPQA 1EDOA 3ZH2A 4PLPA 4ID9A 3F46A 5CPBA 5G4KA 5ICSA 1LRKA 2AQIA 2C2YA 4Y67A 5H82A 1E7MA 4RORA 3DB2A 4HY3A 1N8KA 1EBFA 4AJ4A 1HDGO 1OOEA 2QRLA 4E4YA 3DBHA 4GX2A 7MDHA 5JAIA 2J3HA 4YT4A 3TPCA 1VI2A 4EW6A 1WWKA 4DYDA 1XSEA 4E5NA 4XX0A 3PWZA 3E9NA 3S2EA 4YXFA 2QHXA 1LA2A 3L77A 3KSUA 3VZQA 5A1TA 3NTRA 4ZD6A 4OKIA 1X7GA 3L07A 1JN0A 2VHXA 4MVJP 3M1AA 4P22A 4DPLA 1T4DA 1X13A 4BB6A 1MV8A 3H9QA 3VHRA 2VYVD 1I3KA 1U3UA 1YWGO 3A1NA 3CMMA 2VTEA 3I23A 3JYOA 4EI2A 5JPIA 3EZLA 3TZKA 4JJFA 1HDXA 4GSKA 4NH4A 1R16A 1C0LA 3I5MA 1V9LA 5ENVA 5K0ZA 3PIIA 2Y1EA 3WQRA 4E5PA 1U8XX 2WWRA 4FR5A 4CMKA 2HJRA 1U5AA 4QT0A 5G0TA 4CM9A 4H7PA 2EG9A 4GKBA 5JDCA 3RUFA 2DM6A 4YAEA 3SLKA 4A03A 4PZEA 4ZGWA 3RC1A 4J7XA 3KHUA 4U7WA 5COQA 1LU9A 3WFIA 1LSOA 2BFPA 2BI8A 5DF1A 4J1TA 1EMDA 4RPJA 5EN4A 2BD0A 2P2SA 2ZYAA 4BO7A 3W6ZA 5CEEA 4BNTA 4CV3A 2I3GA 1ZZEA 1CWUA 4YJGB 4DLLA 1ONOA 1P77A 2Q3EA 3EHEA 4DGSA 1OBFO 1LDMA 2BH9A 1M6HA 1Y8RA 4N5LA 3E9MA 4BGUA 1ZSYA 2ZQZA 3NEPX 1R4NB 3ST7A 4DBZA 2RH8A 1IZ0A 5FYDA 3QWFA 1NHWA 2FN7A 4WLOA 1XELA 4ALLA 1N2SA 1R66A 4BB5A 5IXYA 5A03A 3QVSA 4RVHA 4DBVO 3ANMA 4BKQA 2C7VA 5JAQA 1DAPA 4F45A 3OIGA 4EEXA 4Q3CA 5A9SA 2Q1UA 3JQDA 2FPGA 4G5HA 5TLSA 3WNQA 4NHEA 2HDHA 1Q7GA 3O8QB 3UW3A 4BNIA 5TIIA 1E3SA 1U28A 3OJLA 4LGVA 1PQPA 1R0KA 3T7CA 4GI2A 5IDXA 3MZ0A 3TNLA 1P0FA 1DRVA 2Y0CA 2UV8A 3V2GA 1UJMA 3H4VA 4W7HA 4AJHA 1LDGA 1ISGA 1GADO 3JQEA 3CEAA 4MJLA 3MOGA 3UHAA 3IC5A 4IS3A 4BO5A 5DOZA 3QSGA 1BXGB 3RUEA 3RWBA 4TZKA 3KEQA 3IOYA 5JCXA 4CPDA 1JLLA 4RV9A 2B4QA 3GGPA 3LSYA 4Y6PA 2IXAA 3U9LA 3PDJA 5A02A 4J0EA 4U6QA 1NAHA 3DWFA 4XR4A 3GN1A 4I9HA 3GQVA 2G76A 3LF2A 2VT2A 5F1OA 5JCJA 4U0KA 4CUZA 3ETDA 3B70A 5EQDA 1LEHA 4GBJA 1WW8A 2IYOA 4LCEA 4N54A 4WCFC 4R9SA 5U4QA 3BMNB 4IDBA 1JKJA 3U09A 4BKRA 1TB4A 1XU9A 2NLOA 3F3SA 4ZU3A 1U4SA 4R54A 2IRWA 2DPGA 3DC2A 4OH1A 5GMOA 2QG4A 1GR0A 3VVCA 1DEHA 3AI2A 3JD0A 3DTYA 2R00A 4JJGA 1SAYA 2VWPA 1JAYA 4RGBA 5G0WA 1QP8A 5JNLA 3ZWPA 4AJEA 2I3AA 8LDHA 4PLHA 4DQVA 3AY6A 3L4BA 2OP0A 4BGVA 4E2ZA 5BNFA 2YFQA 2EW2A 1ZSVA 1SZJG 5T67A 5KVVA 3QA9A 4YB8A 2EP5A 1NX6A 4NNJA 3Q11A 1GV0A 1B0AA 1NQTA 1PJCA 4CQMB 2GRAA 2X9GA 1DC3A 4TRMA 1H9AA 3ETEA 3ZHBA 3OJOA 2WYWA 1H5QA 5FEUA 4XKJA 1XG5A 2Q4BA 4L4XA 5L7YA 3ULKA 2I6TA 5BNIA 4U0JA 2AW5A 2ZB8A 3BTOA 5COAA 4FOOA 3CTMA 1B3RA 2C5EA 2Q1WA 4LVCA 3DR3A 4RVGA 4NU5A 4UAGA 3RD5A 1K6XA 2G0TA 1O89A 1QV6A 2BHLA 4EYEA 2ILTA 1DFIA 3VH4A 5BR7A 4BO0A 1IULA 1JAXA 3H9GA 1PS9A 1WDLA 3LT4A 3AOEC 3DONA 3CSDA 4DLBA 3E18A 5DBIA 2C5AA 4IQ0A 4WE3A 2BGMA 4QXMA 5KJEA 4CLOB 2GPTA 5JY1A 1K2WA 4W99A 5THQA 3WWZA 3A4VA 4EJ6A 4FCCA 3GAZA 1XU7A 3HDQA 1LX6A 4YJGA 2JAPA 3UUWA 1ZMOA 3FPLA 4J7UA 1O5IA 3DTTA 4LSWA 4DQUA 2G5CA 3SJ7A 1Q7CA 1I24A 2BMAA 2GR9A 2WE8A 2VN8A 2W4QA 2PLAA 5DBFA 1V0JA 2JFGA 4WOJA 3U4HA 1K6JA 4XQCA 5G0SA 3I9LA 4YQYA 4BO8A 4YT2A 3RKRA 4UEJA 1PIWA 1LQUA 4TRRA 1JA9A 3GPIA 4J91A 3TL3A 4FN4A 4JBGA 4F46A 1HLPA 3DFUA 3PP8A 3SC6A 4HV4A 1NVTA 2GD1O 3AJRA 4N7RA 5TGDA 4L74A 1YONA 5AXAA 3ZU2A 4INAA 1B8VA 4A27A 3KLPX 4IGEA 4J1QA 1BXGA 2O2YA 1PJTA 3L0DA 3ZWMA 3WIDA 1BVUA 5DCUA 3W8FA 1XYGA 2HRBA 2QYTA 4FB5A 1MA0A 3INTA 2W2LA 4FJ2A 1KETA 1V3TA 1NP3A 2WE7A 3D64A 5ER6A 1EFKA 2OMEA 3FD8A 2Q2VA 4K28A 4E32A 4NJOA 3FBGA 1PQWA 1WXDA 1UDCA 1GV1A 3ON5A 1D1TA 5JYEA 1GCUA 2VWQA 3VDQA 4RO0A 3ROPA 3X2EA 3I83A 1GUFA 4KUEA 4ILKA 4BQRA 1C3VA 3O9ZA 3FCOA 3RI3A 4XYLA 5A3JA 2D1YA 3ZWYA 1SPXA 1BVRA 2OO5A 3JQ9C 2E48A 1ARZA 1UZMA 1V8BA 4ZICA 4OSOA 2IDZA 3A28A 1NHGA 2VHZA 2JCVA 1EEHA 1CEQA 2BFOA 3BHJA 3VPFA 4XIYA 1GQ2A 3U4DA 3WGOA 4MP8A 5A9SB 4DC0A 1EVYA 1LI4A 1NXQA 3H2ZA 3JYLA 3ZWVA 4B4WA 3K31A 4Q39A 5DBGA 5L53A 1J4AA 1N7GA 3EMKA 1YL7A 1HF3A 3HB5X 4FFLA 4XYGA 1YJQA 4O6VA 3D5TA 3DMTA 3LLVA 4PLZA 3UFXA 5U9CA 4CMEC 1ISHA 1Q7BA 3BXXA 1YL6A 4XR9A 4IY1A 2DU8A 2HMSA 1N5DA 4IBOA 1LSUA 3KVOA 3I52A 1AXGA 2HMTA 3RU9A 3W4KA 4ALJA 3VZSA 3WGHA 3ZDFA 4JN6B 3OMLA 4WPGA 1NWHA 1Y8QB 1TLTA 3GG9A 3GHHA 3DHNA 1GUYA 1V3VA 1Z6ZA 4DRYA 1UP4A 4BO6A 4Z6KA 4Z3KA 3FNHA 3FNEA 1PGOA 1E7SA 2P9CA 3E5RA 4Q9NA 1H2BA 3W6UA 1P3DA 3GAFA 1A7AA 1NR1A 1CYDA 1S6YA 4GGOA 1YBVA 2I65A 5COBA 3VTFA 4C7JA 4IXWA 2GO1A 4IDAA 3CIFA 3WIEA 1YQDA 3OIFA 4MDHA 3DDNA 3F5SA 1MG5A 2QRJA 3GGOA 8ADHA 4ALIA 3P19A 4RZIA 3UXYA 1ADFA 5BQFA 1SMKA 3WYBA 2NU6A 3JD3A 3MTGA 3ICCA 1MG0A 3VZPA 5IFLA 4U8GA 1BW9B 1T26A 5DDIP 4PRKA 1QMGA 3ONFA 3RBXA 1WP4A 4WLVA 4DTIA 3ZV3A 3GMSA 4MIEA 1LLQA 5EINA 3Q9UA 1OFGA 1L7DA 1ONPA 3SJUA 2Y0EA 3O8QA 4G2NA 3BTSA 4DWVA 1YKFA 4MOWA 3EW7A 3S2GA 1DAOA 4YAIA 4PIVA 2VQ3A 2ZJ1A 3FPCA 3GK3A 3I9KA 3KYCA 4J43A 5JC1A 3ITKA 3N7UA 3NYWA 4YWJA 2CVQA 4NPCA 5L9AA 1C0IA 3RSHA 1U4OA 2PGJA 3QWBA 3WGIA 1OC4A 1ZFNA 3VC7A 2BKAA 3S2IA 4Z0HO 1E3EA 3FN4A 1CDOA 4XZ3A 1Y8RB 4EJMA 1NPTO 1LRJA 5F1KA 5DP1A 2G1UA 4A26A 4KQWA 2OBNA 4E5MA 4ZN6A 2D3TA 1D8AA 3PYMA 4PVDA 4RVUA 1MP0A 1GL3A 1XWFA 4FC7A 1Y7TA 4IQ8A 2VRCA 1I10A 1VL8A 4BV9A 1P1KA 5H83A 3ZV6A 2AQHA 1DJNA 2Z1MA 1B14A 4OOEA 3GFBA 4OXKA 4JGBA 1N1GA 4PZCA 2I66A 4IUYA 3WJ7A 1DXYA 1KYQA 2VYND 3D3EA 2EW8A 3F4BA 3O4RA 2BRUA 2DKNA 1NR7A 5CHEA 1PGQA 4RDHA 1G1AA 1C1DB 2WD8A 3CINA 2Y1CA 1LRLA 3DQPA 4AJ1A 4WNCA 5MGBA 4NBUA 3ZGYA 1P9LA 4E33A 2AMFA 2O7SA 1ZJYA 4YJFA 1CJCA 3K96A 5B4VA 3G49A 5HBRA 3JQ7B 3INRA 4DQXA 2JD2A 3JYQA 5ADHA 2FSSA 3RBVA 1XLTA 1C0KA 1NFQA 3HJAA 4RF5A 2WYUA 5TJ9A 1HYEA 2CZCA 5A06A 4E5KA 3AFNA 3WICA 3U4CA 2X5OA 4ZQFA 4CM6A 4RQTA 3RCBA 1E3IA 1R0SA 3OJFA 2QX7A 4EZBA 4O0LA 4RVSA 2DUUA 4MVJE 1A5ZA 3TZHA 3WQSB 1GZ4A 4TVBA 3WXBA 3ZNOA 5CDGA 3D3WA 3FTNA 5TQVA 2GDZA 1NQ5A 4R1UA 4QO8A 1ADCA 4KDFA 2CSUA 1E1MA 4EGFA 4KZPA 3LT2A 1EE9A 3AFMA 2PV7A 1PGJA 3DOJA 4R5MA 3P2OA 2P5YA 4BNWA 1E1NA 2SCUA 1Y1PA 1XA0A 1O94A 3KO8A 2Y99A 4XDZA 1T2EA 3KRTA 5G0VA 4NDNE 1DFHA 3BHMA 4XRRA 2AG5A 1EE2A 2DC1A 1R15A 1GUZA 1O0SA 4I08A 4NIMA 4BVAA 5C3MA 3BMOA 2RBEA 3JYNA 2P68A 4IDFA 4E12A 2VZ9A 4JBIA 1KEWA 5A5FA 5IZCC 4MPDA 1YE3A 3HDHA 1H9BA 1RYEA 1UP7A 1ADBA 1CETA 2DFDA 1Z45A 2GCGA 4PLTA 4L0QA 1WMBA 1SB9A 4DYVA 4I8XA 4YCAA 4JXKA 4CL3A 1KY4A 4CL8A 2GN4A 1PS0A 3E5MA 3GEGA 4ND3A 4B8ZA 2ZB3A 3PJEA 2J5QA 3RAJA 1NM5A 4NBWA 3H5RA 3MEQA 1LC0A 2FR8A 1FDSA 3GVCA 5IDYA 3JQGA 1IHXA 1C1XB 1KVTA 3JQFA 1KVUA 4HFJA 4ALKA 2B4RO 1D1SA 6LDHA 4HFNA 4XJSA 3F4LA 1GEEA 1T1RA 3AWDA 1TT5A 2HO5A 4XCVA 4PLYA 5EESA 1HYGA 4A7PA 5DCYA 4NI5A 2CDCA 3K5PA 3PHIA 2A9FA 1HE3A 2H6EA 1Y6JA 1PU2A 2PD4A 3WGZA 3WTCA 2X8LA 3EVTA 4DMLA 2Y1DA 2CVOA 3C1AA 3WYEA 4KWHA 2JKVA 1EVZA 3DL2A 2OOSA 7ADHA 4PLGA 4FBGA 3PYLA 2E4AA 3HN7A 3FR7A 1SB8A 4LRTB 3H3FA 1PZEA 2Q1SA 3UVEA 2I99A 6ADHA 4FJ0A 4FC6A 2OP1A 2RIRA 2HRZA 5F3RA 2PTGA 5T57A 1O8CA 2OBYA 2FPPA 3CZMA 4HWKA 4JQCA 4PLCA 5EMHA 3PVZA 4HNGA 4D46A 1ZEMA 3A06A 3ZWXA 3GNTA 1GPJA 2EXXA 4GPD1 5C5IA 2UUOA 4F3YA 2WM3A 1ULUA 4RCVA 4N5MA 1HZJA 1T2AA 4J4BA 4RLSA 1WNTA 2Q2WA 1EFLA 3H9EO 4GVXA 4CUKA 4ROSA 4GVLA 2RHCA 3H6KA 1E5QA 5G0UA 3DHYA 3P2YA 3V8BA 1H6BA 4K6CA 2YQ4A 4IIVA 5L40A 2CDBA 3U5TA 2X0NA 1KC3A 2O3JA 5A3VA 5K6AC 4B4OA 5ENDA 3FF4A 4KUHA 5KJCA 2C29D 1GQYA 4AJLA 5K9ZA 3L4SO 1H0KA 1JKIA 4E2WA 3BA1A 3ZV4A 4CMIA 4KOAA 4XYMA 4AICA 3ABIA 3NJ8A 2PD6A 2NTNA 1QYCA 1W6UA 3GLQA 2OZPA 4FOSA 4EJ0A 2F1KA 3D0OA 1WDKA 4F6CA 2DVMA 3TZQA 1QYXA 1SEPA 3STHA 2EJVA 4O1MA 3FSRA 3W8EA 4YT8A 1EQUA 3ICPA 4BNMA 5BSHA 5ER9A 4BQPA 1I3LA 4RPLA 3FTPA 4IJKA 4CMCA 3LC1O 1H6DA 3LQFA 3PI7A 4A10A 1PJ4A 4KTVE 3O26A 1X0XA 1HLDA 3VZRA 3NGXA 3VVBA 3S55A 3OETA 1OI7A 3EK2A 3ZNQA 2Z95A 3LC7O 4IDEA 4L4RA 4BNYA 3GVXA 3QLJA 4D0RA 1E77A 1ENZA 4PVCA 4DXHA 3U4IA 1TT7A 1LLUA 4IDCA 3WS7A 4BNHA 4GLOA 2DTDA 2QYSA 2VHWA 4R16A 2G82A 1H6CA 4ONEA 4AJNA 4E0BA 1PJ3A 3MJEA 2NVBA 3ENNA 3IIEA 3TRIA 3I4FA 4AJPA 3IP1A 4WLEA 4EBFA 4RPGA 5T8KC 2A92A 4BOYA 2DBQA 4NFYA 1J5PA 4II3A 3KYCB 3V5NA 1CQIA 4QFDA 1QKIA 3IS3A 5F21A 2PA3A 4OM8A 3C1OA 4I5GA 4DVJA 5AYVA 3JQ6A 4L9RA 3AU8A 4R3NA 4ZRNA 4QEDA 2B5WA 3WMWA 1RKXA 2IE0A 4I9UA 3DOCA 3WBBA 4ESOA 4HXYA 4OYRA 1SOWA 5F5LA 1W8DA 2Q45A 3VOSA 1BW9A 2YJZA 3NAQA 1VL0A 1A4IA 1XKQA 4J7CA 3UF0A 4CR7A 1PL7A 4DMMA 2Y0DA 3KOUA 2HK7A 3G0OA 5TF4A 1A4UA 3LT0A 1W0CA 1JKFA 1AGNA 3Q6IA 5CDUA 4NK4A 3HFSA 3M1LA 2CUKA 3D1LA 1A27A 1HZZA 4L75A 3E6AA 4D42A 1K3TA 4J6FA 4A73A 4J49A 1ISJA 1SBYA 4OL9A 5F5NA 4UUMA 2BLLA 4CMAA 5KOIA 1UXIA 5DZSA 3AM5A 3JSAA 4HADA 2YHUA 1HTBA 2XOXA 1DOHA 4R68A 3BTVA 5KWEA 4AJ2A 1DLJA 4NBRA 3AI1A 5JCJD 4GMGA 1NAIA 2I9PA 2Z5LA 1HETA 3MJTA 4BNNA 4YRBA 2QIOA 3TQHA 1FK8A 2GF2A 5B37A 3K2BA 3CPSA 1Z74A 1YQXA 3FNFA 4H16A 2WMDA 3TJRA 4LISA 3MJ4A 3C1TA 1UUFA 2POQX 2R6JA 4CQMA 3GZNA 2J3IA 2O50A 3BZUA 3OJEA 2FRDA 4QQRA 1XCBA 1BG6A 5A9TA 5ITVA 1BRMA 1KEPA 4ND2A 4CMIB 2HSDA 2X6TA 1I8TA 2YY7A 1I30A 3P7MA 2EV9A 4PGFA 4TRJA 3DZJA 2QW8A 3FHLA 4R41A 1GZ6A 2E82A 3GDFA 3MJSA 3IMFA 4FD3A 3HWRA 2WSBA 3CUKA 4Q3DA 4Y98A 2ZCVA 4CLHA 2ZTUA 4Y6SA 4A0SA 4YAJA 1U8FO 2B83A 5HS6A 4EITA 5CDSA 3GVHA 4DIOA 2I76A 3AW9A 3MWEB 4J2OA 2VNAA 4W82A 4JP2A 1UAGA 3UKOA 3WNVA 4IXTA 1IZ9A 1UDAA 3B1FA 1UDBA 2NACA 4LK3A 4RF3A 4D43A 4TKLA 1Q0LA 4WLUA 3KETA 3R3SA 2LDBA 5THKA 4DIFA 2FOIA 1F14A 2ET6A 3AUTA 2VRBA 3FBTA 5BSGA 2E6UX 4IJWA 5T8KA 4IGFA 4D3SA 4FFPA 4MVJH 2AE1A 4EUEA 5EJ2A 2E37A 4MINA 2GERA 3TL2A 4JIGA 2VTDA 1HL3A 1X0VA 4AJIA 1Y9EA 1P33A 1M67A 3EY4A 3Q1LA 4J9VA 4R9RA 3QWIA 1AE1A 1NYTA 3ASUA 2W2KA 1DIRA 1OZAA 3D3WB 3WTBA 4CV0A 1NQOA 2HLPA 1QLHA 5C7OO 1L7EA 4XQEA 2DLDA 1D3AA 4FW8A 3UOGA 3SXPA 3LC2O 4ZHSA 5JBIA 5KNLA 1SC6A 4CQLB 1HDYA 3ZU3A 2DTEA 1SEVA 4OSPA 3AK4A 1BXZA 1E1LA 5C7LO 4OXYA 2E49A 2CVZA 1G0OA 3AY7A 3DXFA 4XYEA 5FI5A 9LDTA 4E2YA 5A04A 3C8MA 1DDOA 3IKVA 4XGKA 2PR2A 4HFRA 3VKUA 2C54A 2AEFA 1NPYA 1C1DA 3Q9NA 3HFGA 3ZHZA 3JQAB 1ID1A 1PQUA 3GC6A 3U62A 4WGGA 2PH5A 2DUWA 3JCZA 2OHXA 1AXEA 5T5QA 3GH3A 4UEOA 1NWCA 1LBEA 2V6MA 3L6DA 1I2CA 4W7IA 1U9JA 3LZ6A 3KYBA 4W6ZA 1XIVA 5A5EA 3Q2IA 3WSWA 3PK0A 2H5LA 1M6WA 4BMVA 1LDEA 2UDPA 4ND1A 4Q3AA 2ZJ0A 2C2XA 4E2XA 2ZKLA 2NNLD 4Q3NA 4YBZA 1GCOA 4DL9A 1IOLA 4P8RA 3KTDA 1I3NA 3RVDA 1X15A 1KEVA 1KC1A 1YJ8A 4LW8A 5I7VA 5GZ1A 4PRLA 4WLFA 1BDBA 1YRLA 1B16A 2CFCA 4TVOA 3ADOA 3MCVA 4OOFA 2W90A 3VPXA 1VKOA 2XXBA 3VTZA 5CP8A 3RC2A 4OKNA 2WDZA 1N9GB 5TSDA 2X9NA 3ITDA 4NZ9A 4WLNA 1SNYA 2BI7A 3QVXA 4P38A 2EGHA 2O48X 1A9YA 1PR9A 2YYYA 4XJTA 4GL4A 1HXHA 2EF1A 4YVFA 1GU7A 2FZEA 5DT9A 4ZQGA 4PG6A 1U2DA 1NQAO 2DBRA 3EYWA 1BHSA 1BWSA 2PNFA 3K2EA 2C59A 2ZQYA 1H2HA 1MUUA 4FPXA 3GVIA 3QVOA 3JQCA 5CG2A 2FR0A 5EERA 4CQMD 1WZEA 2PY6A 5L7TA 1YB4A 4FS3A 3JD4A 2O3TA 4PLVA 5TX7A 3GHYA 1WLYA 4FGWA 4OJNA 4CQLA 1PZGA 1WDMA 4FDAA 4NBVA 4XB1A 5HM8A 4K9DA 1VPDA 3K73O 3LT1A 2JCXA 4NU6A 3IAHA 3D4NA 3ZWBA 1RM5A 2H63A 4MP3A 4CMBA 5KVCA 1UXJA 4CMHA 4YJHA 3L9XA 2FR1A 3GOHA 3E03A 3NRCA 4KWIA 2DBVO 2OGUA 3V2HA 1E3LA 2ZB7A 1MGOA 4O63O 3S1LA 3QJ5A 3T4XA 1T2CA 1EVIA 4IDGA 3G17A 3OF2A 4IPTA 3OH8A 4W9NA 5JE8A 2A35A 2CD9A 4H3VA 3ZCXA 3GDOA 1FDUA 2Y05A 3BMCA 3OHSX 2ZB4A 2I5PO 1M76A 2FZWA 1ZJZA 3KB6A 2HMWA 5AOVA 4W9NC 5CEFA 5IZCA 4C7KA 3FWNA 4TSKA 3QHAA 1Y5RA 2HMUA 5DNAA 4ZQEA 4R69A 2GZ3A 2P5UA 2W98A 1DRWA 4U5QA 4HKTA 1V6AA 3NV9A 5DULA 1P1HA 1Y81A 1AHHA 3GF4A 4RL6A 4HBGA 1TVEA 1LTHR 3M2TA 4XDYA 3ORFA 1UR5A 1XHLA 2YFHA 1EK6A 3TSCA 4O59O 1VE9A 3ETGA 5IAAA 1GZ3A 2GNAA 3C3XA 3AUAA 3RIHA 4CM7A 3S2FA 5DCWA 2C0CA 3EZYA 3R1IA 1P45A 3F47A 2CF5A 1VSVA 2HCTA 3GDGA 1GYPA 4NG5A 3BIOA 1T2FA 2EERA 1D7OA 1EUDA 2YZ7A 4BMSA 2YDYA 1SOVA 2EKLA 3IKTA 4Y6RA 4IS2A 1B3BA 5CAEA 4YAKA 1A7KA 1PGNA 3PTZA 4ZA2A 2P9EA 5TC4A 3VH2A 2HU2A 1YBAA 4TKMA 2YV1A 3C24A 4E5YA 3DBRA 2NU7A 3PYXA 1LSSA 5KCZA 4NJMB 4AFNA 5BT9A 1O6ZA 4NR0A 2YV3A 1B8PA 3PLRA 4WECA 5EL0A 4CUJA 4J3FA 1XQ1A 4UUOA 3NT2A 2PWZA 3ONEA 2O4CA 2EGGA 3QV1A 1U3TA 4NFHA 3PZRA 3KXDA 3IDSA 4BNXA 3H7AA 1WAMA 3H5AA 1K0UA 3PHLA 4GX1A 2NM0A 1ZO8A 3ZZNA 1ENOA 4ZJUA 3JQ8A 4J1NA 2CF6A 3TDKA 5I7SA 4CLXA 1P31A 4I5EA 5L3ZA 2IZ0A 2ZYDA 5IXSA 4QFCA 1O95A 3WQQA 5ICMA 2H1SA 3PHHA 1YL5A 4RJTA 2Y93A 3ZU4A 3MJCA 3A14A 1DLIA 5JAZA 1ZUD1 3CMCO 3H9UA 3RBZA 3RQSA 3PJDA 3VPHA 1RYDA 3UCEA 1Y9AA 2QQ5A 4ND4A 2Y67A 4WJZA 1ZNQO 1IHYA 3BMQB 5JO0A 2AHRA 2AE2A 5IN5A 1F0YA 4B3JA 3OQ6A 3RJ5A 3HUDA 4IMPA 4MP6A 5JFOA 2GN9A 4AJJA 1ZCJA 1FDVA 1O9BA 3E8XA 3G79A 5CPFA 1X14A 2VZ8A 2C20A 3LDHA 1WMAA 1C1XA 2YW9A 3RUHA 1PGPA 4QX6A 1NBOA 3DZBA 5AXDA 1PWXA 3RC7A 4M54A 4CM1A 1ADGA 5BNTA 1HEUA 2D2IA 2YQ5A 1G6KA 1QLJA 3WYCA 2EP7A 5FI3A 4EUFA 2HK8A 1ZBQA 3WJAA 1YH3A 2B5VA 2VUUA 1PJSA 1I01A 2V6BA 3DZFA 1KIFA 1R4MB 1UXGA 1VJ0A 4CR8A 2NQTA 4PZDA 1ENPA 1KVSA 2ZTLA 4LCJA 4L8VA 5I9NA 3PGJA 1RM4A 3KBOA 4TROA 5L95A 3PGXA 4B4VA 2C7GA 4D3DA 2B0JA 4TRNA 2LDXA 1UXHA 1VSUA 1IPFA 2JCYA 5A05A 4UEKA 2AG8A 1PWZA 1Y8QA 4JLWA 1IE3A 5JAMA 1U1IA 5GZ6A 3W4JA 1A71A 3WGGA 1RM3A 2EEZA 1E7WA 1YXMA 4AL4A 4RVFA 1FMCA 3TOXA 3WG9A 1PJLA 1HDOA 2X86A 4PN3A 2GUGA 2UUPA 1Q0HA 3BMNA 2P4QA 1P44A 4BO9A 2J6IA 4J2HA 2PGLA 3OFSA 3RUIA 1D4FA 4JK3A 3R6DA 4OXNA 3B6ZA 3COSA 3GA0A 1TXGA 4BO4A 3ROQA 1CRWG 1T24A 1LDNA 3K9QO 2CMDA 4YJDA 4DIBA 4KP7A 4I1IA 5ILGA 1FXSA 3ZWCA 3PWSA 4J4HA 3IJRA 4MVJD 4BNZA 1F06A 1RJWA 4BNFA 3WMXA 4CLRB 2D0IA 5GZ3A 2BFAA 3OA2A 3PFWO 5I8WA 2GN8A 3RFXA 3E9QA 4E3ZA 3N58A 5B4TA 2EWMA 1WVGA 2VWGA 3L6OO 2W2LD 1Z7EA 4IJUA 1EDZA 1XQ6A 1BSVA 1N1EA 1YQGA 3DBLB 3V2UA 1I2BA 4TWRA 4J16A 1HSZA 3JQ9A 3LLSA 2RH4A 3VPSA 1ZVMA 1Z82A 2V7PA 2Z1NA 3WWYA 2C82A 2PZMA 3B1KA 4ALNA 5JC8A 4WCDA 4P4NA 3FNGA 2EKPA 3RU7A 1DIHA 3CH6A 1J0XO 4ALMA 3EC7A 4CV2A 4Z9YA 5AXCA 2WD7B 4BHTA 1Q1NA 2VZ0A 3UICA 3I1JA 4WCFB 1X7DA 4CJXA 2GYYA 4MVJA 1S7CA 3VKVA 4BNVA 1HDCA 1ISMA 3VH1A 4B7UA 5G4KB 3JQ8B 4BIIA 5ILOA 3IQDB 1I0ZA 1QV7A 4GGPA 4C4OA 5JYDA 1QXSA 5TJHA 1R4NA 2X58A 4S3MA 4OAQA 4XIJA 5EIOA 1R0LA 3ZV5A 4PCVA 4NQZA 2QZ9A 4W4TA 1OMOA 1KVQA 1WZIA 3AUSA 1DC5A 1HYHA 2VUTA 4B8WA 2X23A 4YJHB 3HG7A 4GAEA 5HA5A 3RFVA 3ZN2A 1E3WA 1UAYA 1XDWA 5FWNA 1E1KA 2V6GA 2NU8A 3QWHA 4QSMA 1QG6A 3DOOA 5HRUA 4XYBA 4RQUA 4E21A 1B15A 2RAFA 1KERA 3ENKA 4KUGA 3UN1A 4BNLA 4GSLA 1QSGA 1QR6A 3K30A 5GY7A 2GASA 4D0SA 3F1KA 1YVEI 3TZ6A 1NVMB 3Q2KA 3QY9A 5DP2A 1SCUA 2AQKA 3ROMA 4CLOA 2X7HA 4CLDA 4TMFA 2EIHA 3MWDB 4MKXA 2JD0A 1B2LA 3DHEA 3JQGB 2D8AA 2X22A 1ZK2A 3PQEA 5JW6A 3LYLA 5I9LA 1Z75A 3NTOA 2VWHA 5IJZA 4FJ1A 1BDMA 1RM0A 4ZQBA 4OQZA 1I5RA 1K89A 4LMRA 1I33A 1JW9B 4Z0TA 4DA9A 5C37A 5KJ6A 3AOEA 1ZSNA 4E31A 1H93A 2NADA 5K6AA 3PHGA 1A72A 2PK3A 2P4HX 3NDJA 4IJVA 2Y1OA 4YDRA 2P91A 2QRKA 3H5NA 3DAPA 3HZZA 2V65A 3HNPA 3GRKA 2FY8A 5G2OA 1ENYA 1UXKA 5I7EA 1TI7A 1VLLA 3HSKA 4RLHA 3RUAA 3HADA 4AVYA 1PJBA 1BXKA 1VKNA 2GZ1A 3K92A 4XQGA 2OFPA 1E7YA 4JX8A 3EVNA 5L4NA 1SO8A 1H94A 4D79A 1EK5A 1QORA 2D5AA 3AM4A 3K6JA 2O2SA 1JU9A 1NFFA 1E3JA 1GAEO 2NV6A 2PKQP 1P1RA 3I9JA 5IF3A 2D59A 4GWGA 1UH5A 2NWQA 4JP3A 1EUCA 1H6AA 1Q0QA 1CF2O 1HKUA 4D44A 5ITWA 3DAFA 2CNBA 1RWBA 1ZK4A 2HJSA 2B69A 2PFGA 3WGYA 2NTVA 4MIYA 1OAAA 1X7HA 1UP6A 3I4CA 1JWBB 4UVDA 1DIGA 2X1HA 3OECA 3PIDA 3FR8A 5I7FA 2W8ZA 5LCXA 1M75A 3C7CB 1HE4A 2X0IA 3F9IA 1T2DA 4CM8B 5B1YA 4TQGA 1Z73A 1PS8A 4M89A 4WCFA 2DPHA 4CMJA 5ES3A 4D3FA 1KVRA 2XXJA 1GPDG 3GNSA 5I8ZA 1P1IA 3BTUA 1R4MA 3D5QA 1DIAA 3I3OA 3GZ4A 3ASVA 2FPIA 2YUTA 4R1NA 1VM6A 1PL6A 3JQFC 2Q4EA 2GSDA 1LSJA 3KSZO 1YDEA 4AJKA 2OORA 4B79A 3GUYA 4RPHA 2D4AA 2VOJA 3H9JA 1NPDA 1LC3A 1I2ZA 1ZH8A 2ZK7A 4P4LA 3F1LA 3L9WA 4BO1A 3UCXA 1X1EA 3VH3A 3MJVA 4ZRMA 4IQGA 1DSSG 3RUCA 2WYVA 1IL0A 4KTTE 3GY0A 4R5HA 4NK5A 3K8ZA 2J3KA 1LNQA 3EDMA 2O3RA 1DJQA 1IUKA 1NTOA 3SEFA 2J5KA 3VAZA 3WDSA 3DO5A 2Q1TA 3QW2A 4AJOA 1NASA 3B1JA 2P9GA 3GUCA 3GEDA 4HP8A 4BNGA 3H65A 1E7QA 1P1FA 2VYVA 2J5RA 3ANLA 4UREA 5JMWA 1V35A 4I5DA 5T6BA 3WR5A 2PH3A 3IP3A 2Y66A 3TWOA 5JXWA 4J1SA 2JD1A 3ZW9A 1FF9A 3ADPA 1ZK0A 1BMDA 1YOVA 2H9IA 3UAGA 4D45A 4L4SA 3KZVA 2C07A 1HDZA 1F17A 3W8DA 3KYDA 4XWYA 3RC9A 3WB9A 5JDIA 1GEGA 3GEMA 3ZI0A 3WFJA 2BF7A 3C7DB 1HE5A 3NDIA 2ZATA 3F6YA 4DREA 3BMQA 1AHIA 4WUVA 1OC2A 1UZNA 1E6EA 3AOGA 2HKIA 4YTEA 2ZTMA 2JL1A 4DUPA 5JY6A 4YRAA 5KKCA 3LF1A 3AUUA 2UVDA 4CM4A 3PJFA 1K5HA 1EBUA 2VHYA 4GX5A 4BV8A 3L6EA 3OBBA 2X0JA 2CDAA 2ZYGA 1F8GA 4OO3A 3VDRA 4Q3BA 4YQZA 3QVWA 2A4KA 3GZNB 2YDXA 1DC6A 5B4UA 3EUWA 2AQ8A 3T7EA 1HWYA 1MFPA 2FP4A 5H81A 3JYPA 1B26A 2YV2A 3DZIA 3I9OA 4GQAA 4H15A 4MKRA 4E30A 2PGDA 5B12A 3DBHB 2VRCD 3CXRA 4LN1A 5HWSA 4XD2A 3UH1A 1W4ZA 2WTBA 4J9UE 1LXCA 4M87A 4M49A 3OA0A 4BNKA 5C7IO 5HTOA 3INGA 4URFA 4DLAA 3JQAA 1GDHA 4JCOA 5LC1A 1KOLA 4D7AA 4DC1A 4EDFA 4GLLA 3Q3CA 2WJPA 4PG4A 3GGGA 3M2PA 2O3UA 3C7AA 1JVBA 5FFFA 3OJ0A 2JFFA 2Y1GA 3OSUA 2ZTVA 4FSHA 5IDQA 4WKGA 1YO6A 4WEQA 4QUKA 3HE3A 1C14A 3ZW8A 1JVSA 5EQFA 1PJ2A 9LDBA 4G81A 1CQJA 4E6PA 3HDYA 4BL5A 1DC4A 4IZHA 1IYZA 1T4BA 1PSDA 2OUIA 2W2KB 5KJFA 1G0NA 3VPGA 2ZIZA 1IPEA 1B8UA 4S1VA 3PXXA 4K1LA 2NVUB 2B35A 1F12A 5TRTA 2JFHA 3D4OA 1IY8A 3KSDO 4HX5A 2NTJA 4NBTA 4I5FA 4OHUA 3NTQA 3PZBA 2BELA 3FI9A 1U5CA 5FF9A 1LUAA 4EUHA 1DHTA 1UZLA 2NQ8A 1Y5MA 3D7LA 2Y68A 3BHIA 4XB2A 1V3UA 2XPCA 4XRGA 1VC2A 4HNHA 2JHFA 4LVUA 1MXFA 5I9MA 4M55A 3LVFO 4LRSB 4YACA 3JD1A 1M66A 1MFZA 3B20A 1QYDA 5AQ1A 1JQBA 1ISIA 4GKVA 1EZ4A 3SX2A 3I9MA 1HDRA 4UUPA 5JS6A 5IZ4A 4MIOA 1KY5A 2GLXA 3NX4A 2EJWA 3MTJA 3QE3A 4B4UA 4X54A 4BKPA 3RJ9A 4GX0A 2X9VA 5L7WA 1AUPA 4BGIA 3DZHA 3IL2A 2NU9A 4J4TA 3X2FA 1T1SA 5U1PA 1NNUA 4MKZA 4OGWA 2PKQO 3GG2A 2HUNA 5JO9A 4XA8A 1JDJA 1QYVA 1U7HA 2DTXA 3V1YA 1P1JA 3TN7A 1ML3A 3GFGA 3SVTA 3SBOA 5AVOA 3PFFA 1ZW1A 3G1UA 3ANNA 4RF2A 3GMDA 4L73A 2PZJA 1BGVA 1NVGA 3T4EA 5HS4A 1U3WA 5A9RA 4YJFB 4IMRA 3N74A 1B7GO 2IYPA 3DAGA 3NDRA 4MVJF 4IM7A 2JHGA 2IZZA 4BMNA 5CG1A 5IN4A 4LSMA 2BGKA 3E1KA 3WOHA 2Q99A 1YBMA 3GPDG 4BNUA 5JSFA 5DOVA 2G17A 2TMGA 4WEOA 1U2GA 4Y8VA 2F00A 3DEYX 3ZWWA 4BKUA 4YPOA 5TNXA 4CM3A 4QECA 4UVGA 3BMOB 1JWAB 1DPGA 3F5QA 1MC4A 1N9GA 1M2WA 4CMEA 3JQAD 3FWZA 2O7QA 1L1FA 5KVQA 5IG2A 1QYWA 2GGSA 3GNQA 2FWMX 4JBHA 1MC5A 2VT3A 3DMTC 4KDEA 5BSEA 1A9ZA 1ZEJA 3O38A 3BMCB 4CM9D 3TZCA 3U3XA 3OICA 4PG5A 4FIZA 1YS4A 4BKOA 4A5OA 3TFQA 2IODA 3GT0A 5KVSA 3A9WA 5DN9A 3KYDB 4II2A 2QZZA 3PHJA 4BO3A 3OIDA 4BNJA 1YOVB 3PWKA 4YR9A 3ZWNA 5KJ1A 3MOIA 4IIUA 1R12A 3R3JA 1GYRA 5MDHA 3E82A 3D4PA 3H8VA 3IJPA 3PQDA 4RZHA 4WNIA 1HRDA 2PZLA 4DPKA 1JTVA 4Y9DA 4OMUA 2RHRA 1E5LA 4KMSA 4PLWA 1ZIDA 2NSDA 4CM8A 2X4GA 4KQXA 3QWAA
chains in the Genus database with same CATH superfamily
2IK8A 1ELOA 2I67A 2OPBA 2YUIA 5KYVA 1VGQA 1K4KA 4ACAA 4AYWA 3HKEB 1FFCA 3ISVA 5ADWA 1UC5B 1GCIA 1K92A 4QLBA 3DMYA 1E9BA 1EFDN 4J0FA 4YRDA 4R4JA 2QS9A 4RFLA 5EHQA 3R74A 4KN6A 4DC9A 3N1UA 2HTEA 1VP3A 3I9FA 3PNSA 5TT0A 3CX3A 3GR6A 3SKXA 1T6YA 2A57A 5B3AA 3KQHA 2CFSA 3N6RA 2Q5JA 4JV5B 3CT6A 4OQEA 2J8ZA 1JL3A 3E58A 2BUAA 4F38A 3CEHA 3AB7A 2Q3HA 3FPAA 3L7JA 1W6RA 1ECPA 1GUDA 1YZKA 2FE4A 3FW1A 3WYDA 2Y8EA 4GOLD 3RROA 5ALVA 1BXRB 1I7DA 2QM7A 2ZYIA 3BAZA 5CYPA 2B92A 3Q98A 5FBLB 5TS3A 2DP4E 2G06A 3U49A 4KAXA 3TOZA 1P4SA 2WM9B 5L4LA 3JQBC 4RTPA 1J0DA 2YHIB 3HSSA 1PNOA 3KUXA 3OEHD 5EE3A 4U6SA 2NVUA 4RIHA 3ORRA 4A91A 3IVCA 4FFSA 1Q0TA 3HB4X 2Q62A 1BCSB 1YBFA 1UBLS 2OSBA 3H3JA 3KT6A 5BRNA 2FZGA 4FFWA 3UG7A 2R25B 4N01A 3S8MA 2H11A 3SZGA 2GYVA 5E9JA 4MYCA 3OZUA 2OXCA 16PKA 3HDJA 3SE7A 4B6PA 4C4TA 3BYZA 4G09A 2QYHA 3D6UA 5ALKA 4YY3B 2OZLA 4ZKDA 3AEKB 6AT1A 1FDIA 2NYRA 5CB4B 4Y2HA 2A33A 4Z9XA 3WGTA 1I6KA 5MHTA 2VCYA 4U39A 2I4OA 1USKA 2J3JA 2PX6A 2XF8A 4E13A 4FWBA 2OXIA 5LXTA 3O3OB 4F6LA 3PC8C 4QJ5A 1R6DA 1O5OA 3QFTA 3GT7A 2ZJFA 5FOUA 3OEYA 1N1DA 2YJTD 4G65A 4RMHA 1BYIA 1V7CA 2FPKA 5EWLA 8ATCA 1NJ2A 3JVEA 3R7BA 3H75A 4PG7A 3WNDA 5AW7A 3I2GA 4BY9E 3PD7A 2RG1A 2I71A 4Y2QA 1G20B 3UENA 4DDHA 4Z9FA 4I99A 4LBWA 4JB2A 3IKJA 2KQUA 4I2NA 1FJHA 1UEJA 2O8DB 3B89A 1C8BA 1NT4A 3GJQA 4EGCB 4OQYA 3GZTB 4ER6A 4YAGA 1TEHA 3HCCA 1FFXB 3CZQA 1KQOA 2BGNA 3W1VA 3R7DA 3H6GA 2ZUWA 4PLFA 4EW1A 2IWHA 1OHHD 1OVMA 2P9JA 2WYIA 4Q7MB 4L9SA 5H7XA 3JV7A 5EHNA 1SCJA 3NJ4A 2DGDA 2JJYA 3RFCA 3KHSA 4GL2A 3EGOA 4JNKA 5EWMB 3GFPA 1AV6A 2HDNB 2GZSA 2OYCA 1ONSA 3FGNA 1V6SA 3NKLA 3NT4A 4R0MA 4PNPA 1TA4A 2EKQA 3B8HA 3H13A 3N0TA 2QB5A 4B40A 2CXNA 1L5SA 5BW6B 1R37A 1HT0A 2IDMA 1G5RA 4XEHA 2PQMA 2PMDA 1YMVA 1EUZA 3GUVA 3JATA 3MSCA 3H1BA 1I0LA 1QX3A 2EQAA 2HPHA 2DAPA 2QTFA 4ZDWA 3RDPA 3ROKA 1T6BY 2AEMA 4BWYA 1RQXA 1T0HB 1T3SA 2HBZA 5LDHA 1E7RA 2BFMA 2V6FA 3ES9A 5EOVA 5AUQA 3OEWA 1FQOA 3NFRA 1GKIA 1H85A 1I32A 1UQTA 2V7VA 3TE6A 4GI7A 1WU7A 3VR2D 2R00C 4N18A 4ZC1A 4YRGA 1MTOA 3HVRA 2EQBA 5CM2Z 1A2BA 4F3TA 1BS1A 4BUCA 4NENA 1I5OA 2Q1YA 1MW9X 4CM4B 3HJTA 2IYQA 3CE6A 1PWYE 3E22A 4QTUB 1L3BA 1PZHA 1XEWX 3EASA 2P7HA 2HXYA 3U6BA 2H2IA 2PD3A 4EHAA 2DFVA 2ZZKA 1HQDA 4JROA 1EP1B 1KK2A 1G8MA 3OCJA 3LBNA 1SR8A 3SLGA 4A2WA 3T5PA 4FX2A 3IPLA 4QBHA 2R1TB 4PGGA 3GMIA 1K7SN 3I2FA 2AXQA 3IAS6 1Q3KA 4L76A 4L5CA 4C5CA 3VYWA 1U04A 3BRCA 2Q3BA 3BULA 4FGSA 2A94A 4ZOCA 3E53A 4MUAA 3ZWOA 2JKYA 5JLAA 1S2OA 4AMZA 5GIOE 4MUJA 1GRNA 2UU9B 3KV3O 2IP4A 2FEWB 4F04A 2O3QA 2X2FA 1C4XA 4C3UA 3TMKA 4D9HA 3WGQA 1S3FA 5BQ3A 1KHHA 3VYUB 1GQQA 3D8NA 3LUGA 1E6UA 4LZOA 4RULA 3KJGA 4RY8A 4CM5A 3L0PA 4KH0A 1IHPA 4OIFA 5L3QA 3C70A 2QNIA 1ZLYA 5KSPA 2F9MA 4AD8A 2Y1FA 1Q0UA 4RF4A 5FPSA 2E4XA 1I1QB 3P5SA 2IV3A 2J9XB 3PE3A 2W6QA 1WUHS 1WUIS 3AHIA 3PD1A 3PDWA 1NUSA 3QG5A 1P74A 4D4GA 4HVCA 4A9AA 2WYHA 3CF0A 3VGJA 4PE5B 2V5VA 2W42A 3M6AA 2QPAA 5L45A 4GXQA 2R8OA 2PRIA 1YR6A 3KYIB 3PUKA 3AEXA 2WHYA 2Q1XA 2ZAYA 3KE9A 3O8LA 3OPQA 4XVQA 2FZVA 3WMGA 2O8EB 3E3MA 1F8FA 3LA8A 2OHHA 2GAFA 1PX0A 1U3DA 2D5CA 4BRSA 1A9RA 4TTPA 4UMVA 2C31A 4M8SA 3BJRA 2XEDA 5CFZA 2EHDA 3ZHYA 4RPKA 2HA2A 4CNBA 1P2BA 1RYYA 4FUQA 1S2DA 1RJGA 3G3EA 3S29A 5E0OA 2QM0A 4IXDA 2DWUA 2HEIA 4YA6A 3B6KA 1IDOA 3GQBA 3SHWA 3PCXA 1PNTA 4PFJA 3CLHA 1L7BA 3GUHA 3JRXA 4Y6GB 2BZ0A 3V3TA 2AF3C 3FWHA 3I6IA 3PTLA 4NZNA 4B2PA 2BEJA 4C43A 1YA8A 4ZYWA 5KTKA 1L8OA 3LYUA 1RPJA 3ZNNA 1QPBA 2YASA 4YMSA 3ZDRA 2BTQB 3HB1A 3U17A 1GLGA 3SFVA 3BFJA 2GLTA 2EX0A 4GS5A 5BSFA 3IHKA 3U19A 5LDGA 4TZ6A 1JKJB 1T5DX 3D8HA 3PDUA 4J0DA 4OFZA 3L0OA 5JDCC 3UJ9A 2HA4A 3UKDA 1SVNA 2PV0A 4LNUA 3AY3A 3JTMA 4CF4A 2BKLA 2DHEA 1X7XA 1SBCA 2I2CA 2A1TR 3E5HA 5T64A 2GPBA 4IDQA 4LBYA 3WA7A 2XNJA 3RTBA 3LK7A 1U7PA 1KDTA 1R74A 4AY5A 3RREA 1KORA 2CFTA 4Q1EA 3U56A 1U3VA 2QPOA 3GL9A 3LY7A 3GIDA 4G41A 2IXGA 4TL6A 5LOVA 2R7KA 2PKRA 1N5IA 4WK6A 2P11A 3C3JA 3PCRB 4TL7A 2HF2A 5EIBD 4ZT4A 5LMCA 3V4LA 1QC5A 1KZYC 1BFDA 4ZWNA 1EDOA 1KDZA 5GVRA 1CFZA 4PLPA 3DDSA 4NXNB 4P31A 5K6TA 4YP1A 4QYIA 4ZAFA 5G4KA 4JODA 3ADBA 3DTVA 4A5SA 1LRKA 2XQGA 1YD7A 2C2WA 3GCZA 4MR9A 5H82A 2AWNA 4RORA 4F4FA 3OTHA 3DB2A 1T13A 4N5DA 4DUGA 1EG7A 5AKJA 5EXSA 3NALA 4AYTA 1VB5A 4I6EA 4RIEA 5CA0B 1RBZA 2BCEA 4C22A 4IR7A 3F2IA 2ENUA 2WU8A 1COWA 3TW4A 4L50A 2VJYA 4FR0A 3LCUA 1ULZA 5F33A 5A7FA 1ANKA 3TPCA 4EW6A 3EVCA 4N5IX 4JI3B 3QJGA 4DYDA 2I8CA 1ZINA 3IUYA 3E23A 3E9NA 5FA6A 4YRSA 2YNMC 3S5UA 1XPUA 4HQFA 4NONA 1FUIA 2JGEA 4ZD6A 1X7GA 5T7BA 2VHXA 3RSFA 3M1AA 1UBOS 3WLSA 4P22A 3S2YA 1I94B 4DRXB 4LJ7A 1U0LA 1X13A 2DE0X 3KUUA 4NAUA 3W7BA 2GHTA 3SEQA 1EB9A 1TKRA 1VIMA 3DS8A 3SJZA 2VTEA 4EI2A 3JYOA 5EHXA 1PNVA 4DLYA 2NO4A 1NU8A 2QZ4A 3UK7A 4L3WA 3WMEA 5KC9A 1HDXA 4GSKA 4X1YA 1N34B 1F3LA 2X2PA 3I5MA 3IJEB 1OX4A 1V9LA 3GCDA 3PPWA 4DM7A 1U3CA 2ZEJA 5K09A 1NXXA 1ZMBA 3N0WA 3M4YA 1CJUC 1JXQA 2PBRA 4CMKA 3JQPA 1AKUA 5G0TA 4B6QA 3GYGA 1IEXA 4GKBA 4RD2A 1JR3A 5K8VA 2EP8A 2W0MA 5AOBA 2DM6A 3BAFA 3BJZA 4WCVA 1SOAA 3A3NA 4YAEA 2C0QA 2WAXA 5IULC 1JG2A 2VZEA 4PZEA 1XXLA 3NETA 4B0OA 3VC3A 3U31A 1K9VF 4XIIA 1S02A 1ZWKA 2F3TA 2FEAA 4UXHA 5IW8A 3FLEA 3CBQA 5CIQA 2ZRMA 2PGNA 3ZDYB 2ZYAA 1MO6A 4FVTA 5CEEA 2MSDB 3ND7A 4MUGA 5GV8A 2G9VA 2UYCA 1P77A 3EHEA 1FSFA 2XMZA 4ESEA 4GT1A 1FMFA 1M6HA 4UJ3A 1ZSYA 4QFMA 3ST7A 4DBZA 1KSJA 1PFUA 2RH8A 2XUIA 3STTA 2XDQA 4O2BF 3N07A 2PUTA 1XJQA 5JD3A 2L42A 1J06A 3CH5A 3ECCA 1R66A 2WVGA 3ND8A 5IXYA 3IODA 1P2VA 1X87A 1ZY2A 3ANMA 2BP7B 3GFTA 3CWQA 1USIA 3FZYA 3M4JA 3OPVA 4F45A 2YKGA 3HUTA 3OIGA 1T2VA 4OCZA 5GZ3A 4EEXA 3MINA 2OLJA 2Q1UA 2FSPA 4OAPA 1SA0B 3G2PA 5G53C 4KXVA 5CIYA 2OQIA 2QSUA 4NHEA 2XKAA 2Z6QA 4B47A 5EZSA 4LGVA 3Q8KA 13PKA 2W2TA 1QIMA 1R0KA 4R2JA 4HJXA 3GFVA 3MZ0A 1L5YA 3QF7A 3FPSA 1DRVA 1S4MA 5TGTA 3SMQA 4ARIA 3H4VA 4LZWA 1H69A 4KGZA 3KELA 1ISGA 3ZDBA 1RYMA 1C2YA 1FP4B 1JB1A 1WA5A 1JVNA 2BGJA 3JQEA 4G9EA 1Z6AA 3ELWA 3IC5A 4Q15A 5DM60 4D2IA 4XEUA 5KDDA 1UKEA 4D9GA 2ESRA 1MOZA 4KLCA 4OP3A 5DOZA 3QSGA 3RWBA 2OORC 4CIWA 3AEZA 5CFMA 2BEKA 3C1UA 2HO4A 1JLLA 1GP2A 4RV9A 1EXWA 3HU5A 1RLMA 4AXBA 1JALA 1N2CE 2Z8YM 5ERYA 4Y6PA 4GZ6A 5CDFA 1TJNA 3OD1A 1E32A 1V11A 3V8PA 4C2BA 2CFRA 4AZ0B 1QCDA 4ZCSA 2Y1KA 4Q4JA 1F4PA 1GTVA 4G0NA 4XR4A 5ALHA 3GN1A 5A2QA 1SJ9A 3GQVA 4HGZA 1D2HA 2GPSA 1CNFA 3GU3A 4MRPA 3B3QA 4U0KA 5GONF 3VX3A 3V4VB 1WW8A 3WLHA 3LRTA 2F43B 5H5JA 3INYA 3BMNB 5LLSA 1MOPA 1NMQA 4WK0B 3U09A 5TPZD 4TKUA 4BKRA 4RD6A 4LS3A 1JDSA 1FTWA 3TBHA 1NSFA 1U2EA 2AG0A 1ZPDA 4H6WA 4DBLE 1DAHA 2IP1A 1Z0IA 1MOQA 2FN4A 2QG4A 1YGPA 4OH1A 4R1LA 2BFEA 3FB1A 5IVIA 3ZE8A 1DEHA 3T1TA 1M2HA 1RKBA 1C7ZA 2B8NA 4AF8A 5BSKA 2VWPA 2GD0A 4LXTA 3P97A 1QP8A 4AJEA 2CLSA 2JASA 1RWMA 1VRVA 3MWLA 1YVRA 2PU7A 3AY6A 3Q5EA 4DQUA 3UMRA 5IPFA 2PBFA 1JHXA 2RGNC 3ITNA 5T67A 1SZJG 5TPWA 1P5ZB 4XQ0A 4N4AA 4LBVA 4N0MA 1WY5A 3EIEA 2QTAA 1GV0A 1NQTA 1JHYA 2HU7A 3G89A 4HAXA 4CTNA 2GRAA 1U1DA 2JZOA 1DC3A 1RZ3A 5ESWA 2DWOA 5CNKA 3OJOA 5FV4A 5BV1A 4TWAA 4B4DA 3D8TA 1VB3A 4GE3A 3MTIA 1GGMA 2QWXA 1QJCA 4RTMA 3D31A 4MAAA 1R8XA 3PDHA 2FCRA 4MV4A 2QRHA 3CTMA 1OT5A 3DPUA 2Q2OA 2Q1WA 3WBKA 1G21E 3L0CA 4RVGA 2VBCA 4NU5A 2QD5A 1HFKA 2QDXA 5AJHA 7ABPA 4HDKA 1RFGE 1VJCA 1O89A 1QV6A 2BHLA 1WTAA 2BV3A 2GK3A 4JEMA 1JTFA 4KXLA 5IEJA 2X0DA 2C77A 2R97A 4OQXA 3RB8A 4BO0A 5BR7A 5AVQA 4K9SA 1N2EA 3HA2A 3PL5A 1KJZA 4DLBA 4R98A 1VSQA 2C5AA 4P86A 3V8EA 2J3MA 4YCJA 2BGMA 2N9UA 3BL8A 4J0HA 4EMSA 1UFOA 2HPVA 2Y2VA 3PE4A 4G97A 3QLUA 5JY1A 5THQA 2PANA 4FCCA 5HQ3A 1H0SA 3HDQA 4YJGA 1TAUA 1XTJA 3QXHA 3CZCA 2RHDA 1O5IA 4G0YA 4N3AA 4RD1A 3L7AA 3TTXA 3WRVA 3VOTA 3TQQA 1ZH6A 3BFVA 2G9NA 3FVWA 4J29A 2HFKA 2DYKA 2Q3LA 4ZMRA 5KTNA 2WE8A 3V80A 3URMA 1NQUA 3RHTA 1A82A 1XMPA 1SVWA 5AKKA 5BMVF 1T8UA 2GUWA 4FN5A 4WUTA 2Q4OA 4L6AA 1QQ5A 2W22A 4B34A 2BONA 2PLNA 1PF7E 1VYVA 2DX7A 1L4NA 2VAVA 3IGFA 3NNSA 5EJAA 4YT2A 1YZLA 3GBPA 2FVXA 4UEJA 1NXTA 1PIWA 2W8BA 5I3CA 4J91A 1P81A 3VO1A 5BVHA 1AZWA 1GRCA 1T5TA 3MJDA 4LVOA 2R4TA 4FN4A 4NAHA 1HLPA 5JVDF 3PP8A 1KK3A 2WBLC 5E1MA 1E1RD 3NAGA 3C8HA 3DCNA 2GD1O 1B23P 5AVZA 3ZKWB 3NBQA 2PX3A 4FUTA 3DLCA 4AO6A 4L74A 3HO1A 5HKKD 5KNCA 1E2MA 3HZHA 2OFXA 1SCQA 1LJUA 4D74A 1IBRA 2VDOB 3FUVA 4ITRC 4WZBB 5ALNA 4B35A 4R2XA 2O2YA 1Y8CA 1ZZGA 4P3PA 3ZWMA 1JA1A 2N1MA 3QKRA 1NNEA 1BVUA 1TGVA 2XA1A 1EGHA 3W8FA 2EZ9A 1XYGA 2MINB 2AD1A 3G2JA 2HHHB 2WA1A 3J7TA 1PR2A 1YZYA 1QG4A 1MA0A 3IPXA 4EHDA 1Q1EA 1GNLA 3CZ4A 3WLLA 3B2QA 4RJLA 4DMRA 3TJMA 3B51X 1TJ3A 3D64A 4HAWA 3OZFA 4BCCA 2OMEA 4CT4B 3MWFA 2Q2VA 2GMWA 2JK1A 3IBYA 3P94A 5CJPA 2OC4A 1THZA 2JJ2A 3IEUA 1US8A 2QMHA 1W0JD 2RJOA 2ZYRA 3NDPA 2PL5A 1VGRA 1QOPB 4HDSB 4REOA 2Y77A 1E79D 2QBYA 2BR3A 4KRGA 4RO0A 4LGYA 3W8RA 1FE8A 5E38A 4P34A 4XYLA 1SPBS 5A3JA 5HCNA 1VKRA 2PVSA 3L02A 2I2BA 3TSYA 3QZUA 1SPXA 1BVRA 2P67A 3OCWA 3JQ9C 2X2EA 1ARZA 1UZMA 4V0ME 3V4SA 5HKBA 2IDZA 2J87A 1NHGA 1XMSA 3MYYA 3QLTA 3CLRD 1CEQA 3F8SA 2BFOA 3IJ5A 4ARBA 3VPFA 4G89A 5FQOA 3U3RA 3WGOA 4Q7EA 4MP8A 4NL4H 2OD2A 4DC0A 3I92A 2JIDA 3K31A 5DBGA 2Y2UA 1UMKA 4KX5A 3S4YA 2B4AA 3ZZ1A 3EMKA 3HB5X 2XYQA 4JLUA 3WLJA 2I2WA 3QUCA 5LD2B 4YCBA 2ICAA 4Q4DA 1WCIA 3ZU6A 3ZZMA 1QIFA 3NMUF 1G5TA 3CUTA 2WJ3A 3F5DA 2YRXA 4UQPA 2FEXA 1Q7BA 1EXMA 2PSFA 3ZGNA 1DARA 3DE0X 2JCGA 4MKIA 2IYNA 2EJBA 5FOSA 2PJDA 4CG0A 3LHDA 1GNQA 3EDYA 4M4SA 2HMTA 2PMBA 1YNSA 1Q1GA 3RTEA 1EFRA 5BN4A 4A1FA 3VZSA 2QI9C 2H59A 4X0EA 2XUAA 2SKCA 4JQOA 2OVFA 4CCYA 3DHNA 4QDZA 2NIPA 5SZHB 5HP4A 4DRYA 3TMAA 2HSGA 4Y7CA 1V25A 1FUEA 1WB4A 2HA5A 2A1IA 1EP3B 1XOIA 2F8SA 2F8MA 2GEUA 2P9CA 5CVCA 3TLGA 3NONA 3TB4A 3VMMA 5B6IA 2VYCA 3E0QA 4Q6WA 3SICE 1S6YA 3QVGB 1NRXA 4GGOA 1WSBA 1RU3A 1J0AA 3DUFA 4IDAA 2VJAA 4B82A 5ELLA 4M1WA 1YQDA 4LWQA 4MDHA 3DDNA 1N6OA 3U7HB 2R86A 1D2RA 2QRJA 3NR2A 3ZGZA 5E4YA 1IY2A 3EFOB 2JEYA 4ZAGA 3MD0A 3Q9LA 2Z2YA 1D4OA 3VR1A 3UWOA 2YWBA 2IWRA 1V16A 3N3AC 4ESHA 2Z83A 1OXXK 2ZI6A 4F8EA 1E79A 5SZJA 4BPRA 1GGKA 3ICCA 2OKCA 1M6NA 3CGGA 4P53A 4Y9TA 1YJAA 3VZPA 4AMBA 5IFLA 1BW9B 3UV3A 1CUCA 3RBXA 1C1HA 3HR8A 5AUNB 221PA 4X20B 4N7JA 5GPBA 1RYNA 3UIEA 1YS7A 3ZV3A 4FYMA 4BFSA 4IKEA 3A9RA 2RKBA 3KWFA 1OFGA 5EINA 1EAYA 4KPYA 3VOAA 1L7DA 3D4IA 1WXQA 1A9SA 3TM5A 2ZI3A 4X8HA 3P45A 2PMFA 2WJJA 3N0XA 1EFRD 3FZNA 4LJSA 4MOWA 1UMDA 3D9QX 4CI9A 3LCRA 5LOVB 5LMNB 1HEYA 3AI7A 3E7PA 3DYIA 4PIVA 4PNZA 5SZIA 3RSQA 3KSBC 1RZRA 3NXSA 5JC1A 2KLBA 2OR3A 4HTFA 4J43A 3SX4A 3WGKA 1TKBA 4WZBE 1ZGJA 2CVQA 4FYHA 5L9AA 1C0IA 2G9QA 1WETA 3PGKA 3RRJA 3WKBA 3UNXA 1XAHA 2XUQA 3MK31 1U4OA 2PGJA 2B7CA 4U9IS 1OC4A 1JJVA 3PKZA 1X39A 3F97A 2OFWA 1FNCA 3S7TA 3LKZA 2WKQA 4RZUA 1LRJA 5F1KA 1YI1A 3IHWA 5DP1A 4EJMA 2ORIA 4FDVA 4KE7A 4A26A 1UBSB 1IU9A 1D8AA 1I3OA 1K2VN 3THYB 4FC7A 1KZHA 4IQ8A 2ZM6B 2VRCA 3VSEA 3GRRA 1Z4LA 2P8JA 4P3YA 1X7ZB 1Z12A 4DNPA 1LW6E 1VL8A 1N2IA 2CNWD 4G85A 2AMJA 4FGUA 2XT9A 4X65B 1KKMA 1E61A 1YS1X 1B14A 2AQHA 3C6MA 5EIWA 5FTMA 1TDJA 3F9CA 2NXCA 1DXYA 2G8LA 5KWIA 2JAUA 2KHZA 3QUAA 2GNPA 2FLKA 2Q28A 1J2UA 2BRUA 2QAGA 1EH5A 2DKNA 2ZYUX 4G63A 5EA2A 5CD9A 2IPNA 3A9CA 2JBAA 3G0IA 1XDGA 4URXR 4RHXA 2JB9A 5GJVC 2A0UA 1QJ4A 2L0XA 2QMUA 5CYGA 4NX2A 2DHRA 1NXVA 3AFHA 1CJBA 3FF1A 3ELBA 2AMFA 4YJFA 1ZJYA 2FB9A 2WQ6A 1R8JA 4DA6A 5ARBA 4P0QB 3H16A 1I80A 2Q5QA 3G49A 3JATB 5B4VA 2YJ6A 1Z7WA 1VL1A 5LZ8A 3EEFA 3OPNA 3MS4A 1ZM2A 5BR1A 3E05A 1WD7A 4Q4CA 1T9GR 1SC4A 2D2FA 4L5BA 2C94A 1E2LA 5KTPA 1EWYA 1ACLA 4E03A 1NFQA 4QPDA 1HT3A 1K6MA 3HJAA 1QQ7A 1MAUA 3E9YA 3IMKA 4E6EA 5ADVA 1ZLXA 1M0SA 3N59A 1EHYA 4G5FA 1UJ5A 2PRKA 2VAXA 5BP7A 1J8QA 3WICA 4QDUA 1MEOA 1Q7TA 1XVAA 1HK7A 1SIBE 3RCBA 5LYJF 3NNDA 3OJFA 1KH3A 2QX7A 2BTEA 2B2XA 5AI0A 3NBKA 2A9OA 4FZ5A 4O0LA 3U81A 1WLSA 3CJTA 2OY0A 3K32A 4OPMA 1AQIA 5KNCH 1A5ZA 2VHCA 1XL1A 4KQJA 4TVBA 5GWXA 3WQSB 3ZNOA 4AXXA 5CDGA 5MN5A 4KYIB 2OWEA 2XNDA 3AKCA 2F6RA 4R1UA 1SVIA 4MQUA 5EWLB 5L8VA 2GYWA 2VF5X 3AWIA 2XB9A 4TLMB 5JAHA 3O4HA 4EGFA 4FFVA 2J9FA 1C8LA 1GAQA 1YJBA 1WNFA 1WQ3A 1M2KA 5ELMA 4B3BA 2C7RA 2JFXA 2Q5EA 2P5YA 3P2OA 4DCUA 1NVBA 4K0RA 1D2EA 1Y1PA 4D5GA 1FFDA 3KFXA 3TLEA 5CB4A 1O94A 3LV8A 1C7RA 1PEKE 2BHTA 3ADDA 1KBQA 3RIYA 4XRRA 3G82C 4LGMA 2DC1A 2Q6TA 3H86A 2CK3D 3VHXB 4WN9B 3C39A 4S1TA 1KTVA 4I4TF 2IP2A 4QZVA 2ZRQA 3JR7A 2JFOA 5DGHA 3LX8A 3VNBA 4H2DA 3JR3A 1U0BB 2RBEA 3THOA 5M7EA 2IGTA 3BT7A 3DGEC 4JBIA 4UNQA 3H4MA 3IA2A 1RXCA 1NI3A 1RYEA 1OLXA 4KGDA 3RQIA 3LY5A 1CETA 2ZYWX 4DT1A 4URWR 4EW2A 3TE7A 5A3SA 4PAOA 5AHWA 2OA0A 4L85A 3W2FA 4AUEA 3PNKA 1LPPA 2QT9A 1F4LA 2J46A 4L0QA 4PLTA 3OQOA 2G28A 4O2RA 3T0FA 1JECA 1RWOA 2F17A 1ECJA 4H0CA 4LI3X 1RCUA 3K1ZA 4YCAA 4JXKA 3WBJA 1P75A 4CBVA 2XR1A 3ROZA 4H1UA 2E5FA 4QG7A 1HR0B 4FKMA 2JW5A 1SCAA 3EODA 5BURA 4ND3A 3I34X 5EP4A 3HKDA 3WSTA 3DLPX 1I4DD 1U9YA 2BFBB 4FP9A 2YMLA 4C0HA 3H5RA 4OB6A 2WPNA 4QAQA 4Q7QA 1LC0A 2FR8A 3EAQA 4DJTA 3VFDA 2CSXA 4X60A 1GG8A 3BE4A 3IMGA 4MUMA 2ZDGA 4Z4IA 1C1XB 1P4RA 1DAFA 2IUSA 3BXPA 5FNZA 1W2GA 3G5LA 5IU6A 3HV0A 4P93A 2WHPA 1D9XA 1FRVA 5EZYF 3F4LA 4D9MA 1VG8A 1X1CA 5BWOA 2ECOA 1O97D 1RS0A 3N7TA 4EL5A 1HYGA 4A7PA 5DCYA 3ZJYA 4A36A 1MRSA 3K5PA 4AP5A 3PHIA 5FX2A 2A9FA 1OU0A 1HE3A 2BWJA 2H6EA 4C76A 1Y6JA 1ZHOA 2PD4A 3OX1A 2W93A 3TR0A 5I4KA 5B7NA 3IP7A 2X8LA 3M49A 4EY3A 3C3PA 1SXHA 1VBKA 3FPEA 4C08A 3MTBA 1TYDE 3PV0A 4KWHA 4YRZA 1G2IA 1EVZA 3HABA 3DAYA 4DCGA 2RSLA 2PL9A 4ZXFA 1N4DA 3UATA 2H0AA 1RI5A 3N70A 4IWYA 3EYAA 2GBPA 4XLTA 1QLWA 4B2YA 4R2KA 1RP1A 2Q5HA 1MVOA 1KI2A 1SB8A 2ZRAA 5K03A 2I33A 3JWPA 2H2DA 3UVEA 1RBYA 5EMJA 2OP1A 2HRZA 2JZNA 1DG1G 1O8CA 1W4AA 4M37A 1BS2A 1SXGA 2R4UA 3A1WA 3DCJA 3KQQA 4RXUA 3UCEA 5HSGA 2AKEA 4M9ZA 2PIAA 5B3KA 2A0FA 2AGVA 1BXRA 4EF4A 1E2PA 1U1FA 2GJ8A 3F7TA 2PJRA 1ZEMA 4GPD1 5ALPA 1Z8NA 1SN7A 2AN5A 1T9BA 1ULUA 1XAIA 4M1OA 5C5CA 1HZJA 2WPDA 1L5MA 2FEKA 4C5BA 3L4KA 2J09A 4RLSA 1WNTA 3UMVA 4BRUA 2GT1A 1QGAA 3RR2A 4RJ2A 1HI9A 2RHCA 4JYMA 5BQOA 1ZD4A 3H6KA 3KWMA 3GBSA 2QMYA 3GEHA 5AVSA 2RK4A 3HHEA 3D1JA 3QYJA 3FDZA 1SXJC 4JJ6A 1DJPA 1MQ9A 1BFKA 2X0NA 2CBGA 4Y9RA 2NZ2A 3OQIB 4B4OA 5ENDA 1V7QA 3TZEA 3FF4A 2ZU6A 1GNRA 2B8EA 3H7IA 3KLBA 2C29D 2ZJZA 821PA 1L4FA 2QRNA 5K9ZA 2HJHA 4IZ6A 3T1NA 2P3OA 2C61A 4S1OA 4RQBA 5EZ6B 4CMIA 1R5NA 3STVA 5FAKA 1KRHA 1S9HA 1W6UA 5I9SA 1DV2A 2PIDA 4ZU1X 1HTWA 1Y37A 1WDKA 4F6CA 1DX4A 1SEPA 3T38A 3TS1A 3TZQA 2Z57A 2HCJB 4O1MA 4IKOA 5B1HA 3V7NA 1FYWA 2JLQA 3SF0A 1K88A 2C2OA 4L5JA 4YT8A 3ICPA 1XROA 3A32A 5FJJA 3ET5A 1Z2DA 3P52A 4BNMA 3TOVA 2VBIA 4KYVA 4L4YA 4EHKA 5FAXA 4UD2A 1IB0A 2O7NA 4IJKA 1CHNA 2ZJ4A 2RONA 3PI7A 1TZ2A 3LQFA 4QPPA 1KE2A 1D2AA 2PVCA 4A10A 2IC5A 3CSSA 5HIAA 1HLDA 4I9GA 1K5DA 3DUFB 3VZRA 3L0ZA 3L2OB 3L8FA 2XWSA 4NOKA 3EK2A 4E1AA 1ZOSA 2Z95A 5IKMA 5DTIA 3F5MA 4IDEA 5KQGA 1ICEA 1W36B 3GVXA 5IWAB 5FUWA 2JI6A 1E77A 1ENZA 1NQVA 3OZTA 4ZCLA 4HWGA 4X63A 4YHBA 3ZJUA 4YC7A 5FWYB 3WS7A 3P0IA 2QYSA 2VHWA 2YJ4A 3FKJA 3MTAA 4BQFA 4LZNA 1BAPA 4ID3A 1IY1A 2YVLA 5GOTA 4E0BA 3MJEA 3ENNA 2PXHA 3IIEA 3Q1KA 4O4HB 3AIKA 3AUJB 1WR8A 3IP1A 2NN3C 3R3UA 3UT0A 3NHSA 1OFIA 5A2GA 4C4XA 4OJYA 1ZRNA 1P72A 1NR5A 5ALLA 5LYJB 2WWHA 5K4AA 4Z3OA 1OT3A 3V5NA 5KTMA 1IBCA 1XZDA 2P5TB 1QKIA 5BVHB 3RS2A 4C29A 5B3JC 5F21A 3NAZA 3O2QB 2PA3A 4R8VA 1RXUA 1E66A 1B1AA 2BW0A 3JQ6A 3REQA 4FSXA 4ZRNA 1Q12A 4R3NA 3HEBA 5KQMA 5DNDA 3KWJA 3JSXA 3WNZA 2B5WA 1EE1A 2I03A 1KDOA 2EATA 2IE0A 4X93A 3UAZA 3WMWA 1AGYA 3DOCA 1KFCB 1ZM7A 2YWDA 1JYFA 1FCJA 5A4MS 2O8BB 1A76A 4O4IF 2OFFA 1E9RA 3OP1A 1MENA 2DQZA 1X1BA 2Q45A 3RK0A 1BW9A 1VFNA 1MQAA 3S1AA 4EEKA 3NAQA 2X8WA 1C50A 1XKQA 4J7CA 1L5KA 1Y1RA 5LU9A 3IAAA 4WADA 5A5GA 2HK7A 4DA7A 1KS2A 1UODA 5TF4A 2WT8A 3X1JA 1AGNA 1WHSA 4NEQA 1P5RA 2FQXA 3Q6NA 4L75A 1HZZA 1L8XA 1W44A 2OCDA 4DSZA 5BW5A 1YT5A 2WAAA 4UJ5A 3N2LA 4J49A 1ISJA 1TJ5A 1SBYA 4OL9A 1H2RS 2Q6IA 5CVUA 4QUDA 2QY9A 3A2MA 3B1ZA 4AT1A 4CMAA 4HDNA 4KQKA 5DXFA 2CUZA 1ND6A 3JAKA 1YR9A 4CDMA 1ZD3A 4G37A 4F1KA 1PUIA 4R68A 5KWEA 1PLKA 2IKQA 2X8JB 1DLJA 3DL0A 4MV5A 3AI1A 4OSEA 5JCJD 1Q3TA 1HURA 2GH1A 1NAIA 1WV1A 4GMGA 4HDMB 1P7YA 5CIWA 2W48A 3KP1A 4C05A 3QIAA 4JUIA 4I14A 1ODLA 2FWJA 3TQHA 1BH6A 5B37A 2VDRB 3N2ZB 3FNFA 2V03A 1XXHA 2ZS9A 3CH4B 4M6WA 3T7SA 3D7NA 4HLQB 2VDLB 4CVNA 1V5FA 2POQX 1N2BA 2FAXA 2P6MA 3GZNA 3P4UA 2G8NA 4UBMA 4UMDA 3BZUA 3LDUA 1KI8A 3NM4A 3VBCA 3RTGA 2VJPA 3ZIUA 4ZV4A 1DC7A 1WUKS 2AOTA 1XCBA 4YLEA 4WNAA 4ND2A 2E55A 1F2DA 3BQMB 5A9TA 1HZZC 3TLKA 3W9UA 4CMIB 2X6TA 4MJXA 3NWEA 1Z4OA 1I8TA 1TM2A 1K7CA 4BBAA 1RPTA 3P7MA 5GJBA 1XD2B 2X1LA 2G0NA 4R6WA 1GZ6A 2G83A 3GLSA 3MJSA 3NHMA 2RHTA 4MVXA 3L1HA 4O2BB 2XBUA 4Q3DA 2G4LA 4X1OA 4Y98A 2IYXA 1IIRA 2ZCVA 4BU0A 4ZVMA 4URUR 4CKXA 2QN2A 3K5HA 4S1NA 4A0SA 3DB1A 3OPYA 4Y9SA 1QV9A 5HS6A 4DUZB 1CQJB 3GVHA 1D5WA 3FIUA 4RV5A 2ZRHA 3DEHA 4HGQA 4L8LA 3A36A 2DLNA 4TVKA 1RR6A 2XMRA 2H1OA 2F43A 3UKOA 3LI2A 5BY2A 4JBYA 3DM9B 1V4VA 3EGEA 4JJEA 2B30A 4OBXA 2B61A 3BWXA 4WLUA 3PXGA 4I19A 2C5BA 5INTA 2LDBA 1LVHA 3FSGA 4FZVA 5BSGA 2ET6A 3AUTA 3U80A 4K6KA 4U7JA 4C3ZA 4DLSA 5DTEA 3SFZA 3HS3A 1U0FA 3KOMA 5E6RA 5JRJA 1CS4C 1D5CA 5K3FB 1W52X 3OPXA 2AE1A 4RD4A 4EUEA 2E37A 2O7VA 4YI5A 3TL2A 5A4KA 4U7HA 2CXSA 3A26A 5LDDC 2JGIA 1JJ7A 3IBFA 4FEAA 4MV7A 3EY4A 1YQUA 3UFXB 1GPH1 2FPGB 3VU0A 4D9NA 3SJCA 3H2IA 4YDQA 4BV2A 4N7BA 1JFFB 4JCCA 1GXSB 2E9SA 2WVHA 3TSZA 3WTBA 2XVMA 2D00A 1NQOA 2E5LB 1JT9A 1MA3A 3B13B 3C7KA 1L7EA 3PUHA 2DLDA 1JU4A 4XQEA 5IAJA 4FI3C 1Q57A 2WF5A 5DMHA 2FTKE 2RGAA 4MWGA 3SXPA 4ZHSA 1TQ2A 2VNKA 5KNLA 1S3SA 3EWIA 4WFJA 4CQLB 3A1SA 1Z2PX 2CHEA 1Z5VA 1JIVA 3AZPA 3FE2A 4OSPA 3AK4A 1KMNA 4J0GA 1E1LA 1TUIA 4OXYA 2E49A 1UFRA 2GKGA 3U9TA 1O9GA 5CBPA 4E2YA 1UKCA 4XVRA 3OU7A 4RKWA 1DDOA 5E3IA 4X71A 4XCQA 4PZAA 4XGKA 3ZC3A 3VKUA 5FB3A 1KYZA 3SNHA 2W8BB 5HIMA 1C1DA 1M0WA 2G36A 2X6RA 4XM1A 3Q3GE 3EZFA 4TN5A 2CK3A 4D02A 1PQUA 1OFVA 1Q44A 2IYEA 4WGGA 5LNK1 2OILA 3RHFA 2DUWA 3UHFA 3UAOA 1VPWA 1LS1A 5KOYA 2YZKA 3DLIA 3MN1A 2PKCA 2L19A 2WIJA 3L6DA 4D9FA 1B6TA 4MZDA 1U9JA 4W6ZA 1HT1E 3RSCA 3Q2IA 2XUFA 2WF6A 1AGRA 2OZKA 3PK0A 3U7JA 1LW7A 2DFPA 2EOAA 4LXQA 3CPHA 4NV3A 4YALA 1TEVA 2OBXA 1PT9A 4DJ5X 1FS4A 1XX6A 5FL7D 4AN4A 1RRGA 1L4YA 3LOUA 4GZMA 4LMAA 4DL9A 1BMTA 1I3NA 3KS9A 3OZEA 1X15A 1KEVA 1YJ8A 2V8BA 4K6MA 5I7VA 3PNQA 4PRLA 5LXTF 1JBQA 1BDBA 2P0EA 1YRLA 3LLUA 4I1SA 2PL3A 4UM7A 3VXKA 1GPUA 2QTVB 3HVUA 4LSGA 1H65A 5K0JA 5HTKA 3MCVA 3BDVA 1WUYA 1YC5A 3T61A 4YO7A 4Q7LA 2H7CA 1O3YA 4RE6A 4G07A 2PEZA 1J00A 1TCVA 1AO0A 4DHEA 2QVGA 5I7HA 1JLLB 5KTYA 1TTQB 2NSYA 2X9NA 4WLNA 1CJVC 1SNYA 2BI7A 2R48A 3QVXA 1VLHA 1NW6A 1ZHHA 1NKTA 3LYAA 3TJRA 3CURA 2YN2A 5CTJA 1P91A 4HT3B 4D82A 4AYXA 3ZIAA 2AJTA 1GU7A 1KI3A 3JAKB 4BQOA 3E2PA 4RFSB 2B1QA 5JAOA 4PG6A 1ZN7A 5AD1A 1JFTA 2PNFA 2O2DA 3K2EA 1WVIA 4NF2A 2PZGA 2ZQYA 3RS9A 5IASA 2QA5A 1H2HA 4I3FA 4FPXA 3DVRX 3Q7SA 3QVOA 4MWBA 5ALWA 2V3VA 1ZCBA 1WZEA 1C7FA 2PY6A 3G85A 2DCUA 3HCBA 3OE5A 3O2NA 4OQPA 2V54A 2JGLA 3BKXA 3ND5A 4OU4A 2O59A 1G8JA 3L46A 5EI5A 3FMIA 4BX9A 2QUIA 5FFNA 1KGSA 2C5FA 3K1YA 1PZGA 5CJ2A 4MR9B 5K1ZA 3K73O 3LT1A 4OU5A 2IYWA 2VL7A 3IAHA 4MAMA 2VJKA 5MF6A 3PJRA 1QE5A 4G4GA 1RHKA 1OWPA 2IZ7A 3COYA 2O8BA 1THTA 1BHJA 3EXFB 4CMHA 5BOVA 2FR8C 1Z37A 4O5AA 1L9KA 3GOHA 3VKFA 2JGAA 3NRCA 2C58A 3WISA 4AP6A 5ADUS 1CCWA 2DBVO 2RH9B 3V2HA 4AURA 2AN9A 3IDQA 4Q93A 2F1RA 5B5SA 1T1GA 2DR3A 1MGOA 2P6UA 4MI9A 5DWVA 5IT4A 1IVNA 1SBZA 1ZU5A 1U98A 2P75A 3G17A 4YP0A 4IPTA 4ZVRA 4NICA 3AGQA 2NX2A 4F06A 4W9NA 1O8BA 1SG9A 1A98A