4YXFA

Mups, a 3-oxoacyl (acp) reductase involved in mupirocin biosynthesis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
237
structure length
230
Chain Sequence
KGTIIVSGGSQGLGLTTVRCFLEAGYNVATFSRRESPAVTELSERADFHWQALDCTDYSALTAFVQQVEKRFGGLDGLVNNAATGVEGILSTMRVADIDSALDINLKGQLYLTKLVTAKLLKRGAGSVVNVSSINALRGHSGLTVYSATKAAMDGLTRSLAKELGPRGIRVNSVSPGYFSSDQTLSRIERRTPLGRLGTQQEVADLILYLVDRGTFVTGQNIAVDGGFTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MupS, a 3-oxoacyl (ACP) reductase involved in Mupirocin biosynthesis
rcsb
source organism Pseudomonas fluorescens
molecule tags Oxidoreductase
molecule keywords MupS
total genus 84
structure length 230
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yxfA00
1YOVB 3NEPX 2X86A 2GCGA 2P2SA 3ENKA 3ONDA 4RPGA 4D79A 4RZIA 5IN5A 4CV2A 1LLDA 3OEYA 1NXQA 1QR6A 3FR7A 1ZUD1 2WDZA 1O5IA 1Y1PA 3DC2A 1ID1A 3FNEA 3VOSA 4KDEA 4OXKA 3TPCA 2J5RA 3KO8A 4X54A 4XR9A 2J3HA 5EQFA 2VRCA 3ZWPA 3TL2A 1E5LA 4FFPA 2DQ4A 3GEGA 4D41A 4YDRA 4DUPA 1UP6A 2GLXA 3GLQA 5JAIA 5G4KA 3L6EA 1FF9A 4Z0HO 4CM4B 3PHIA 4JJGA 1NHWA 5BSGA 2HMSA 4ALKA 2JFGA 2X22A 5KVVA 3CH6A 4RDIA 2QX7A 3B1JA 4FPXA 1T1SA 3RFVA 1A5ZA 2NADA 3C8MA 3F1LA 3S2IA 4CLEA 1RM5A 5F1PA 4B7XA 4BB5A 4E3ZA 1YWGO 1ZK0A 3ETEA 3H5AA 3RUFA 4B8ZA 2GO1A 1X0XA 4E0BA 3ROMA 4IDBA 2DFVA 3I5MA 1RM0A 4NI5A 3MZ0A 1PS9A 1K0UA 4CMIA 3RU7A 2W2KA 1U4SA 1NR7A 4IDDA 4MIEA 5AXCA 3DR3A 4F6LA 3VPSA 3D7LA 3SXPA 1E6WA 3W6ZA 2E82A 2QZ9A 2P9GA 3Q6IA 3EC7A 1A7KA 2BFPA 3JSAA 3VH1A 3PIIA 3I1JA 1A71A 3OSUA 4GWKA 2ZTVA 1YO6A 1VLLA 3OQ1A 4TVOA 4RLSA 3A4VA 3ZHXA 4LMPA 4MKZA 1N1GA 2PGJA 1Y6JA 2NQTA 3A28A 3GMDA 2FOIA 2VNAA 5F1OA 3RUEA 3VVBA 4DBZA 1R66A 1PJCA 4YAEA 5B4VA 1M66A 4WCFA 4YBZA 4A03A 5ITVA 3ANMA 4XGIA 3JD0A 4B7UA 1J5PA 3UHAA 4RLHA 1H2BA 1SPXA 2B5WA 1MC5A 1X13A 5C7IO 1IY8A 1E3WB 3H9UA 1XEAA 4BNVA 3TFOA 1JU9A 1Z45A 2BHLA 4H15A 1FDUA 2Y1FA 1E1MA 1MXFA 1GV0A 3JQ7B 2VT3A 4NIMA 1JDJA 3BMNB 4IM7A 1JVSA 4XRGA 1DO8A 1JWBB 2HLPA 4FIZA 4ND1A 3GHYA 4ND3A 4YAGA 3PVZA 1DLIA 1NFFA 3SC4A 2B35A 4BQPA 2BELA 2GN6A 3JQAB 4ZQHA 4PZCA 1Y5MA 2PA3A 2G17A 1I01A 5JW6A 1V6AA 2OGUA 3KYDA 2VRBA 4AJOA 5HBRA 4PLVA 5JO9A 3ZNOA 5TF4A 1IUKA 1NWCA 1G1AA 4M89A 1NBOA 2R00C 4B3JA 1I10A 4ZQBA 1E7QA 1NPTO 3JD3A 1BDBA 4XQEA 5JCJA 3NX4A 2VHWA 3ZWVA 4AJ2A 2NM0A 4J9VA 1E3SA 1I36A 2JL1A 4YJFA 4BGEA 5IZCA 2Y1CA 5G2OA 4Q3NA 2IXBA 4CLOB 2NU7A 5F1KA 4BMVA 5I8WA 3DMYA 4BNZA 2Z1NA 4OIMA 3OJEA 2WD7B 3D3WB 3DB2A 1AGNA 1SC6A 1I2BA 1WPQA 1WDLA 2GSDA 4YRBA 3K96A 4HBGA 2IE0A 3Q11A 5T57A 2Z1MA 1N2SA 4BNGA 2D2IA 4DLLA 4RORA 4J16A 4TVBA 4CQMB 5DOZA 2FPIA 4BHTA 1BTOA 1HWYA 1W73A 4LN1A 4RCVA 2O3QA 4K26A 2C7VA 1Y9AA 3W4JA 1Q7CA 1ZIDA 3O9ZA 2EW2A 2A35A 3KOUA 4GMGA 4J2OA 4AJNA 3HE3A 1PL7A 5THQA 4FGSA 4R41A 3VZPA 3P2YA 5IN4A 5I7FA 3LZ6A 3O26A 4FJ1A 2YQ4A 3LDHA 4IQ8A 4YT8A 1CF2O 2VWGA 2HJRA 5KJ1A 1WXDA 3JQ8B 1X14A 2E37A 3B70A 5DULA 1M76A 2ZYGA 3HG7A 3GRKA 4LISA 4HFNA 4NBUA 4ZA2A 3L07A 1ZXLA 2VWQA 4QQRA 2YHUA 2H63A 3AM3A 4YAIA 1P0FA 3TRIA 2OP1A 2QZZA 2E49A 2ZYDA 2P91A 5TX7A 4NG5A 3PHGA 3EZYA 3EAGA 1HKUA 4CQLB 1HDCA 4MDHA 1M6HA 2OHXA 3IQDB 4CODB 2IZZA 2FP4A 1IHYA 3OICA 4I9UA 3T4XA 1O6ZA 4JK3A 4OQZA 3FF4A 4BNNA 3JYOA 4FFLA 4R68A 2NTJA 4IDFA 1GPJA 2ZQYA 5C37A 1WMBA 3H4VA 4EBFA 4R3WA 2X6TA 3U4DA 1U5AA 1SB9A 4HP8A 3E9MA 1RWBA 3GNTA 1GY8A 1LSSA 5THKA 3BHMA 5BR7A 1Q0QA 1QG6A 1W0CA 3HN7A 3ZW9A 1XIVA 4EJ6A 3PFFA 2WM3A 5TJ9A 3WMXA 3DZHA 1IL0A 4XYEA 4BKQA 1T24A 5JS6A 1V9LA 1X7HA 4BV8A 3SC6A 4R1SA 4KQXA 4J0FA 1GCOA 5TT1A 1H6DA 3WWYA 3M2TA 4BO0A 5L51A 4BB6A 3L4BA 5HRUA 2GF2A 2OMEA 3NGLA 5T5QA 4BNIA 4NR0A 1EVJA 1HLPA 2AA3A 3LU1A 4JROA 2ZKLA 5JNLA 3O38A 1JAXA 2RAFA 5CAEA 3BTOA 4IDGA 3OH8A 3HADA 3IUPA 3WGHA 1H6AA 4IXWA 2BI8A 3GVXA 2P5YA 4L74A 2X9VA 3HB5X 3U9LA 1PZHA 5J23A 3ZV4A 3F4LA 2NV6A 1YE3A 5A1TA 5EL0A 2RH8A 4O5OA 4CMIB 2ET6A 1KEVA 2GYYA 3N7UA 5H81A 1DOHA 3NT5A 4MVJH 3TNLA 2FR0A 1LX6A 1P33A 2FZWA 5DBGA 1U8FO 3TZ6A 1NQ5A 3ETGA 1PJ2A 1PL8A 5L7TA 4B79A 4DC1A 1HEUA 4IS2A 4JBHA 3LC1O 2O3UA 4BKRA 3OEWA 4BGUA 2CVZA 3NT4A 2DTEA 2O50A 4IMRA 1EK6A 1JTVA 4GX0A 4GVLA 3KLPX 2JD1A 1ZK3A 1NFQA 5C5IA 4F6CA 3S1LA 2AE1A 3FRJA 3LSYA 2NSDA 1PJLA 5A3JA 4IIVA 1ISMA 1OC4A 4NFSA 5DCYA 1WNTA 2UVDA 4FC6A 4JN6B 3BMQB 3VHRA 1X1TA 1Q2XA 3WB9A 1I24A 4O63O 1W8DA 3DHEA 1MG5A 2DTXA 3V8BA 3JQ8A 4CM9D 4W99A 4O59O 5GZ3A 2VWPA 1D4FA 4KUHA 1TI7A 2VYND 1LC3A 3KYCA 1ZO8A 4LMRA 3KLMX 1C0PA 1GQYA 1K3TA 1YVEI 4OXNA 3WFIA 5BSFA 3W4KA 4A10A 2ZB3A 2TMGA 3DBLA 2ZB4A 4PLZA 2PNFA 3OETA 3AY6A 2D5CA 1UP7A 2EKQA 5DOVA 4OAQA 2G82A 5I7SA 3CMMA 2X1HA 4S1VA 4XIYA 1DBVO 5TIIA 2VOEA 4F45A 4UUNA 1C1DB 2ZB7A 2FMUA 4RF2A 3G1UA 1EFKA 1LLQA 4HY3A 4AJJA 3BMOA 3BXXA 4MPDA 4WOKA 1GAEO 3KHUA 5IDYA 3IKTA 1G6KA 2B69A 1U7TA 2XXBA 3TJRA 3JQ9C 3TQHA 1W4ZA 5IAAA 3H65A 2VHZA 2WMDA 4U0KA 4YT5A 2R2GA 3KETA 3H7AA 1TVEA 3P5SA 4H16A 5FI5A 3TOXA 3RC9A 4G5HA 4J1SA 4TKLA 1O0SA 1Z7BA 2UUOA 2J3JA 5AXDA 1ZK1A 4MIYA 4PGFA 3DQPA 3NGXA 4PZDA 4C7JA 1JQBA 1ZSYA 4BNJA 3H8VA 4E30A 4J1QA 4OYRA 3UOGA 1MFZA 4HX5A 4Q3CA 4E5YA 2Y1OA 4J4HA 1QRRA 3RJ5A 2DFDA 1GD1O 2HUNA 1DC5A 4YEDA 2DBVO 2Q1WA 4D7AA 1PGPA 4IUYA 1XKQA 4N7RA 4RVSA 3VC7A 3GHHA 3CIFA 3K5PA 1DAOA 4TRJA 3WTCA 2YZ7A 3V2HA 4NJOA 5EPOA 2HCTA 2DUUA 4EEXA 4QUKA 3RJ9A 3RFXA 5DBFA 1J4AA 5JSFA 5L9AA 1IB6A 2DBZA 3MJVA 3QVOA 4RVDA 5JFOA 1I0ZA 2I66A 2TMDA 1ZK4A 1QYCA 4BMSA 5A06A 1KY4A 1PX0A 3CXRA 1UDAA 1X0VA 4MINA 5KIAA 3E48A 1E7YA 3OP4A 5I7EA 4B3HA 1RYEA 2RIRA 3R6DA 2AQIA 1LSUA 3D5QA 4KMSA 4BKOA 5CG1A 2I9PA 5KJEA 5L4SA 1BSVA 1UXGA 3DBHA 4HNHA 5BSHA 3KUXA 5L45A 2HRBA 1MV8A 4PVCA 4BNWA 3UN1A 1L7EA 5C7OO 2DPGA 1M2WA 1EQUA 3KRTA 2A92A 4L73A 5JAQA 1PS8A 2EGGA 4YYZA 3I83A 3FN4A 2PY6A 3ZZNA 4YQYA 3DZJA 2I99A 3D64A 4GWGA 3U4CA 4E2ZA 3FHLA 3JQ6A 4D3DA 4IGFA 1VJTA 3K2BA 2E4AA 3M1LA 5CEJA 3JQGA 4P4LA 4BO1A 5FEUA 5CP8A 5F5LA 4CMBA 3Q9NA 4XQGA 3QLJA 5ENVA 4XYBA 1ZH8A 5KVSA 1CWUA 3VDQA 5JMPA 2NTNA 1EVYA 1YONA 1ZMTA 5I7VA 1WP4A 3D0OA 3DAGA 2BI7A 4OMUA 4D3SA 5JDIA 4QX6A 3DBLB 2JCVA 1R0SA 2VTDA 5T8KC 3HQ4O 2BGLA 2BH9A 2Q1TA 1DRWA 2BF7A 1C1XA 1GL3A 4OKIA 2JCXA 1M75A 1V35A 3IJRA 5U1PA 3MWDB 4QTZA 2DM6A 4E6PA 3ZCXA 1E7RA 5JXWA 4BO8A 4BIIA 4BNHA 2Q46A 2BFMA 1Z6ZA 1U3UA 3WJ7A 4FB5A 4ZRMA 5G0UA 5K0ZA 1PIWA 1WDMA 1EMDA 2OO5A 2P5UA 3KYDB 3VH2A 4W9NA 1ISIA 4XYMA 3RKUA 4B4VA 2GGSA 3GR6A 4FJ2A 2B5VA 1DFHA 3PXXA 2QW8A 2Y67A 4D43A 4HFRA 1Q7BA 1E3EA 1GCUA 4BO6A 3RBXA 3TOZA 1QXSA 3JQBA 4R5MA 1E3LA 3MEQA 1MX3A 2YW9A 4DGSA 3KXDA 2VYVD 2O7SA 4CMGA 3DO5A 1VSUA 2FSVA 4K1LA 4DIBA 4E13A 1E3IA 5AYVA 3VKVA 1YL6A 4M49A 1P1RA 1IULA 4RVGA 1DXYA 2AEFA 1GQ2A 4ZN6A 5A5EA 4RVHA 1BVRA 2X5JO 1ADGA 3PGJA 1UH5A 3K6JA 4UVDA 1QSGA 5FF9A 1B8VA 1FDWA 1MG0A 1P1FA 4JJFA 2BD0A 4ZQEA 4JX8A 5DP1A 1A4UA 4GPD1 3C1TA 4MKRA 2ZCUA 5EERA 1HSOA 5B4TA 2O48X 1ADFA 4EUEA 1K6JA 3MTGA 1MUUA 3V2GA 1DEHA 1SOVA 4MP6A 4QSMA 3L9WA 4IMPA 3GFBA 4QT0A 1R37A 4AVYA 4G81A 4XJTA 2R00A 5CFZA 1YXMA 3GEMA 1PTJA 1BDMA 2ZJ0A 2CFCA 5CDYA 1OC2A 5EINA 1UXIA 1QYDA 4WK6A 4BMNA 3F4BA 1IPEA 2GZ1A 2HK9A 5I9NA 3AU9A 4XJSA 4RL6A 2PGLA 3GZNA 4OKNA 3OHSX 3WGYA 1GR0A 3RROA 3JQAA 1DB3A 2CNBA 3L0DA 3GGOA 3B1FA 4DC0A 3OJLA 1ONNA 1E1NA 2X7HA 4M87A 3R3SA 4K6CA 4BNMA 2YHIB 4E5KA 4E2WA 2H6EA 4PLFA 1VJ1A 4WLVA 2XAAA 4DQVA 3S2GA 3HSKA 1B0AA 5JAZA 3VZQA 3JYLA 4FW8A 3ZNNA 1PQWA 1AHIA 4ZVVA 4UUMA 5T6BA 2JHFA 1IHXA 3NAQA 3VPGA 1H9BA 3E1KA 2GN8A 1WDKA 5A5FA 1NVGA 1GZ3A 3PJEA 3A06A 4WOJA 1T2CA 3L9XA 2GPTA 4PCVA 3ETDA 3Q1LA 4AG3A 1LDYA 3IL2A 1HDYA 2X0JA 4DQUA 4DIOA 4W7IA 1M6WA 1NAHA 1NP3A 1HE5A 4U6QA 4J49A 3DDNA 3L4SO 3RASA 1P3DA 1VPDA 4A0SA 3OJ0A 2YDXA 2ILTA 2B36A 5EN4A 3VH4A 3DHNA 4ND5A 1GYRA 1L1FA 4J9UE 3HFSA 5ADHA 2P68A 3RBVA 3RSHA 2C82A 3GQVA 4CJXA 1WW8A 3NKLA 2C29D 3X2FA 1SMKA 5BNIA 1DSSG 3EZLA 3QVWA 2VCYA 3DWFA 3SJUA 2QRLA 1L7DA 1X7GA 3KVOA 4IJWA 2VQ3A 1YJ8A 4E2YA 4J4BA 2J8ZA 3MJCA 3WIDA 3VDRA 2AXQA 2JAPA 5CDUA 5GZ6A 3EYWA 4I5DA 4GX1A 3U09A 1ARZA 5EMHA 1YB4A 2VZ0A 4DTIA 5IFLA 3F9IA 3BTUA 1Y8RB 3RVDA 3ZN2A 2DT5A 2Y99A 2X58A 5GMOA 4Q3DA 2HRZA 3WOHA 3JQGB 4LCEA 3AM4A 4XB2A 3ZU3A 5JE8A 1P45A 2O2SA 4CLDA 2OBYA 1MLDA 3UVEA 4CLRA 1CQJA 2C5AA 1UJMA 1GUYA 4E31A 2WYVA 1Z82A 1ZZEA 2VZ9A 4B4WA 1PWZA 2I3AA 4OH1A 5L53A 3C3XA 1R4MA 1DIBA 5KJFA 1LRLA 1S6YA 3QP9A 3S2FA 2AE2A 4IY1A 5B37A 2AG8A 2GUGA 2EP7A 3GG2A 4L8VA 1EE2A 1KVSA 2FZEA 1KOLA 3I9OA 1U2GA 4NZ9A 2FN7A 2G1UA 1MFPA 2ZTUA 3FBTA 3HDJA 3GF4A 4GH5A 3T4EA 2VYNA 2GD1O 4MVJM 5CDGA 1DJQA 3NV9A 2W98A 4N5LA 1GADO 1H93A 2O2YA 2Q49A 3PJDA 4K9DA 3TN7A 4DRYA 1K5HA 2OOSA 4IJUA 3VZSA 2YUTA 3I6IA 4MJLA 1B2LA 1DIRA 3GVPA 3NJ8A 3U4HA 3WS7A 3PI7A 4FSHA 1NWHA 2HKIA 3RUDA 3U49A 4XGNA 1WAMA 3PK0A 3AUSA 1PGNA 1T2AA 3PQDA 5L4LA 1NQTA 5ER9A 3PYLA 1GUZA 1YB5A 4GBJA 1JKJA 2Q2QA 3OA2A 2GN9A 3K30A 1LSOA 1GU7A 3ZWAA 4YRAA 3E03A 3OJOA 2QIOA 4GSLA 4DWVA 1PJTA 2X5KO 4DMMA 5G0VA 4CQMA 3NUGA 4RDHA 2XXJA 4DPLA 4RF4A 1C3VA 4UUPA 1N9GB 1I32A 3EUWA 1DC4A 3FR8A 4RPHA 2PKQO 3ZH2A 5KJCA 3ITKA 1B3BA 3GVHA 4HV4A 4KWIA 4O0LA 1B8UA 2C59A 3ENNA 3WFJA 4ALIA 1IZ9A 3IP1A 2EEZA 4TZTA 5HS4A 1K89A 1GYPA 3BMCA 3E18A 2Q1UA 3SJ7A 1RKXA 2ZJ1A 4A2CA 4LVUA 1O8CA 2PH3A 2C0CA 2VUSA 1EBFA 1W6UA 1NVTA 3RU9A 4II3A 1YQDA 1NX6A 3TFQA 1ML3A 1O89A 1WZEA 3GVCA 3W6UA 5JDIC 1I3NA 3DTYA 1U2DA 4BGIA 2DBRA 1H5QA 4IDAA 2C2XA 4ALNA 3H9GA 4ZHSA 3VPXA 2W2KB 4GKBA 5AXAA 4BS9A 3EK2A 1XDWA 4Z3DA 1BG6A 5LCXA 3WGQA 6LDHA 4WKGA 2A9FA 1UP4A 2DUWA 1JVBA 4GLOA 3H6KA 5KJ6A 1UDBA 3UICA 1SZJG 2CMDA 1ZMOA 3ANLA 1PEDA 1PZGA 2LDXA 3B1KA 3H9JA 3S55A 1DRUA 1E1KA 4CM3A 2E6UX 4XDZA 5GZ1A 4FJ0A 1DIAA 1SAYA 3LT0A 2O3JA 3LVFO 1NR1A 1D8AA 2OP0A 3HDQA 5IDWA 2YV1A 4N5NA 4XKJA 1HE4A 3ZV6A 1HE3A 3I6QA 1QKIA 2CVQA 3SVTA 1C1DA 3H5NA 2R6JA 1HLDA 4II2A 1P1HA 1WLYA 4BO4A 4CM5A 5JCXA 5I9MA 4EI2A 3RIHA 2W2LA 2AQKA 2V65A 3FTNA 4WCFC 1PJSA 2ZK7A 5A05A 1YQGA 4D42A 3DMTC 1BGVA 1EDZA 1UZMA 4L9RA 3R0IA 4BKUA 2YDYA 1FDVA 1I3LA 4RV9A 3ZWWA 1EVIA 4I08A 2AEJA 1VI2A 3ICCA 4AJEA 4PRKA 4B4UA 1EFLA 4I5FA 5I8ZA 4BNLA 2BLLA 1VL8A 3JQFC 3S2EA 1N5DA 3UCFA 4RJTA 1ISJA 1VRWA 3INRA 4EUHA 1C1XB 2I3GA 2P9EA 1NFRA 2B4TO 4BKPA 5JYDA 2NQ8A 4FGWA 4HFMA 5JYEA 4MVJG 3OFSA 5A4DA 4DIFA 5BNFA 1IE3A 1ZSNA 2NWQA 1DPGA 4CM7A 3ZHBA 2VOJA 3WMWA 1MB4A 3M6IA 4GQAA 1P44A 1QORA 1KS9A 4JXKA 3DZBA 2GRAA 3G3EA 1SBYA 4Z9XA 3TWOA 1KVTA 3HUDA 4J0EA 3RQSA 1J49A 1T2FA 4QECA 4RF5A 1E7SA 3WGZA 1I3KA 2GZ3A 3CPSA 3FD8A 3SLKA 1VL6A 1ZCJA 2ZQZA 4E5NA 1HSZA 4NH4A 4NJMB 3JQEA 5DZSA 4Y67A 4CMJA 3TF5A 1Y7TA 3GG9A 1OI7A 4IZIA 3B6ZA 3MJEA 3MJSA 2PD4A 2IEDA 2XF8A 4EJMA 5K6AC 3BMCB 3N58A 3QE3A 1UAGA 1ULUA 1ONOA 1E6EA 5JBIA 3CSDA 3VTFA 1NPYA 1F14A 1EVZA 3NDIA 3E8XA 4AJ1A 1Y8QA 3V1YA 3RCBA 5EESA 1J6UA 1JN0A 5AQ1A 1BVUA 3MWEB 5JAMA 4KDFA 1QYXA 2YFHA 1AXEA 4TWRA 4LGVA 3NRCA 1KIFA 3AUTA 4XRRA 2HMWA 1R4MB 3L4BC 3AI2A 2Q1SA 1F12A 3QWAA 4Z6KA 4FFNA 3WJAA 3DBHB 3JQ7A 6ADHA 1JLLA 2HK7A 1ADBA 1P1KA 4NFHA 5MGBA 3E9NA 2FY8A 4FS3A 1K6XA 3HN2A 1HYEA 4O6VA 1I3MA 2Y68A 4WLFA 3V2UA 3GDGA 4TRNA 4XQCA 3ADPA 4W9NC 4A7PA 3ORFA 1PL6A 1LU9A 3GC6A 4MVJA 3WQQA 4NBWA 1SO8A 2YY7A 1B3RA 1KEWA 2BFAA 2P4HX 2EW8A 3MTJA 1ZVMA 4ILKA 4M55A 4P38A 2HQ1A 2VT2A 4RZHA 1NQOA 3ROPA 4BQRA 3U5TA 5BSEA 2G76A 5G0SA 3FNGA 4DXHA 4XYGA 5LC1A 1VE9A 3PRJA 3GY0A 4JNKA 2OFPA 3DAPA 4YAKA 1E3JA 3H3JA 3OA0A 1X15A 1DRVA 3QSGA 4RQTA 1E92A 1I2ZA 4YJFB 5A9SB 2CY0A 2DC1A 3O8QB 2OBNA 3PDJA 1ZNQO 4CLOA 4PG8A 4FBGA 3F5SA 5ENDA 2E48A 1KVRA 4ND4A 3ZWCA 3Q2KA 5ER6A 2UYYA 3BTVA 4CM8B 1XR3A 1QP8A 2V6MA 3WDSA 1E7MA 4FFMA 2Y05A 2PZJA 4CMAA 2X9NA 1CQIA 2VTEA 2AG5A 3JD1A 4ZGWA 3ZWYA 1P77A 1QYVA 4P22A 1EDOA 4BNTA 1GUFA 2X4GA 3WBBA 3RAJA 3UUWA 3C1OA 2F1KA 4E12A 4J3FA 4F3YA 2IRWA 1V3TA 4MOWA 1DIHA 3GEDA 2CD9A 3GAFA 3I4FA 4I9NA 2CDBA 3U62A 4TSKA 2RHCA 1CIVA 4OOFA 1DDOA 1R12A 3JQ9A 5KWEA 4IQ0A 2I67A 3QIVA 1DC3A 3VPHA 4KTVE 3RI3A 1KVQA 2GNAA 3PWSA 4OM8A 5C3MA 4JQCA 5TNXA 4BL5A 1B7GO 2OXIA 2Y0EA 2JJYA 3LYLA 5TLSA 1RJWA 2QG4A 3AM5A 3D4PA 1HRDA 1OOEA 4QFCA 4XA8A 4ROSA 4CL3A 4XEHA 4BNFA 1U8XX 4WJZA 4YPOA 5A3VA 3OF2A 4IQGA 1JAYA 3ULKA 4EJ0A 3HNPA 3CKYA 3PDUA 3X2EA 3BHIA 3DONA 1XU7A 3UFXA 1QLHA 3O03A 1A4IA 3KEQA 5AOVA 3EGOA 3C7CB 3ZV3A 2VN8A 1U3VA 3UCXA 1HDOA 4TQGA 4IPTA 1H9AA 1SOWA 1LQTA 3PHJA 1YB1A 1EZ4A 5TC4A 1U4OA 1KBZA 2PLAA 3ZGYA 4AICA 2IYPA 4WE3A 3D4OA 1HDRA 2UDPA 3BIOA 4MKXA 4NBVA 3BMQA 2VZ8A 5ITWA 1WZIA 4JP3A 4XQ9A 3RD5A 5JCJD 2NTVA 2VNSA 2D8AA 1LUAA 2QHXA 4PIVA 1F8FA 4J2HA 1V3VA 1CYDA 4GX2A 5KOIA 1XQ6A 4EGFA 1KYQA 1Q1NA 4MO2A 2Y1EA 4R1UA 4ALMA 3DOCA 5IDXA 4WGGA 1JA9A 4ZQFA 5DDIP 4ZU3A 3I23A 1QV7A 2VUTA 4PG4A 5BT9A 3RKRA 3UXYA 4WPGA 1PJBA 4Y8VA 4UREA 3WXBA 4CM1A 5BQFA 1GDHA 3S8MA 3WLEA 4CR7A 3GRPA 3QWIA 3CMCO 3ZHZA 1WMAA 3LT1A 3WGGA 3RFTA 3W8DA 4IJKA 4I5EA 1OBFO 3D5TA 4OSOA 1LI4A 5U9CA 4KTTE 2VWHA 3WYCA 1ZJZA 3NDRA 1NM5A 3T7EA 1UDCA 5FYDA 1GEEA 3ZWNA 3ZWXA 1RPNA 4WASA 3VAZA 2PH5A 4R69A 1XA0A 1NASA 2YQ5A 3KM0A 3DOOA 4Z9YA 1A9ZA 3PEFA 3W8EA 4TRRA 4GX5A 3DEYX 3D3EA 1XWFA 4NK4A 5T8KA 3IC5A 1GZ6A 4GGPA 1D1SA 4DLAA 5HA5A 3PP8A 4QXMA 1ONPA 2EIHA 4CUKA 1YRLA 1NPDA 3PJFA 3DHYA 4A27A 4FCCA 1OAAA 5A9TA 1QV6A 4FC7A 3IAHA 2QQ5A 3LLSA 4QO8A 1N9GA 4DA9A 4Y6SA 3W8FA 3GA0A 4J6FA 4PLCA 2BGKA 4S3MA 4CR8A 2C2YA 4ALJA 1JKFA 1U1IA 4NU6A 5F3RA 2Y1GA 3VKUA 2HK8A 2FSSA 3F47A 1TEHA 4KQWA 2IXAA 4FDAA 5KKCA 4J1TA 5KVCA 3OBBA 4Y9DA 5FFFA 3WR5A 1EEHA 5JDCC 3ITDA 4B7CA 4CM6A 3TSCA 2RCYA 2EGHA 4NMHA 1YKFA 1YBAA 4UEJA 4XR4A 1YH3A 5L3ZA 4E5PA 3GPIA 2J5QA 2PD3A 2WE7A 3PYXA 2SCUA 3KEOA 4YWJA 5HTOA 2ZATA 3ZDFA 3I3OA 2IDZA 4ITUA 4Z0TA 2RHRA 4FOSA 3AU8A 3OQ6A 3V5NA 2VHYA 3LF1A 4ID9A 4WECA 2UAGA 2HMUA 4DVJA 2Q2WA 3PPIA 3BHJA 4BNYA 2PR2A 4IBOA 1BXZA 2A94A 1Y8RA 2B37A 8LDHA 3NTQA 2YYYA 3V1TC 4OO3A 1E77A 3IJPA 5CEFA 4BO2A 2QYTA 3BZUA 4CLHA 4KUGA 2YHIA 4CV3A 1QYWA 4YACA 3AK4A 5H83A 4WLOA 2H9IA 5CHEA 4CV1A 1R0LA 3NT2A 4YCAA 1UXJA 4AL4A 4YJHA 1P74A 1T25A 2D3TA 4JCOA 4R16A 2X23A 4TROA 5FI3A 3DL2A 5JY6A 4J7CA 3OIDA 1GQQA 4IXTA 4PLTA 3FCOA 4IDCA 3DZIA 1UXHA 2X0RA 3C24A 2YV3A 3I9NA 1U3TA 1CETA 5KNLA 1LTHR 4IIUA 1ZEMA 4YAJA 1NTOA 2PGDA 3PJGA 4YTEA 2VHVA 1AN9A 2JD2A 3H9QA 4G2NA 3TDKA 3DZFA 2O3RA 3E9QA 3ZW8A 4D46A 1HTBA 1PSDA 5DNAA 5CDTA 1AE1A 3UGKA 1AXGA 3EDMA 3KSZO 2AEMA 4HADA 3FNFA 2HMTA 3GPDG 5JC1A 3DBRA 1TT5A 1XU9A 1V8BA 3TZQA 4L0QA 2GERA 3WWZA 1ENZA 3IP3A 2IYOA 4ALLA 1ZSVA 5L4NA 5DT9A 4BGVA 4DPKA 2AQ8A 1LDGA 3RBZA 3ROQA 2C5EA 4TMFA 5L7WA 2Q99A 1PJ3A 1ADCA 1XLTA 3OECA 5ILOA 5T64A 3D1LA 3ZU5A 3MOIA 2Q45A 3PLNA 1E6UA 2HO5A 3ASVA 4U6SA 2EG9A 3UCEA 3K31A 2EXXA 4XDYA 1YQXA 2EERA 4W82A 2WD7A 3GN1A 3OM9A 1LNQA 4TZKA 2O23A 5COBA 4PN3A 4H3VA 3UKOA 3CINA 4QO7A 5DP2A 3JD4A 1XHLA 4RO0A 2PK3A 3DTTA 5TGDA 2W8ZA 3QRWA 1UZNA 2CVOA 3IKVA 5L40A 1H94A 1ZJYA 3IUSA 4J4TA 2DU8A 3WQSB 2HJSA 2OL4A 1XSEA 1LLCA 1PGOA 1NYTA 4GL4A 1TA4A 1Z74A 3CTMA 3G49A 4GI2A 4UUOA 4WCFB 4U8GA 5EJ2A 3TL3A 3CZRA 3UH1A 3AY3A 4NPCA 4A5OA 1PQPA 3KSDO 1B26A 3VTZA 2OORA 3L77A 1G0NA 1PR9A 5A02A 3AI1A 4EYEA 4E4YA 1XGKA 4I5GA 4PFJA 3TZHA 1O95A 3OIFA 1HT0A 4KZPA 4GLLA 4CUZA 2WYWA 2WEKA 1VKOA 2XPCA 2BRUA 3FI9A 1XCBA 2DTDA 3HB4X 4G65A 1UZLA 2C07A 2PKQP 3PYMA 1F0YA 4R1TA 3ZNPA 2X0NA 4XYLA 5CEEA 1KC3A 8ADHA 4Q3BA 1MA0A 4CQLA 5C7LO 2Q50A 3VPFA 4RF3A 1I30A 1A9YA 1PZFA 3W4IA 3LT4A 4FR5A 1VL0A 3R1IA 3UW3A 4HKTA 2CF5A 5TRTA 1RM4A 3OIGA 4NNJA 1HYGA 4C4OA 3E5MA 3HZZA 3IOYA 1ULSA 2EJVA 3ANNA 1UXKA 1SEPA 1BMDA 4EZBA 3PZBA 3GMSA 4RQUA 5COAA 4PG6A 2NVWA 5F21A 4YVFA 1JWAB 1KERA 5DBIA 4CR6A 1P1IA 1PS0A 2VRCD 1ZFNA 2I6TA 3LK7A 1WVGA 1ZXBA 2WTBA 4YXFA 2D5AA 3I52A 2QYSA 3LLVA 4CQMD 4W7HA 1TLTA 3WSWA 1HXHA 3HJAA 2ZIZA 2OZPA 5DN9A 4ONEA 1LSJA 4BVAA 4YRDA 4CM8A 1D3AA 1TB4A 4RGBA 4HXYA 1H6BA 1GV1A 4FFRA 2LDBA 1F8GA 3E5RA 5MDHA 1ISHA 4RVFA 4UVHA 3FPLA 2AMFA 3KB6A 3MJ4A 1CJCA 1Q7GA 2HMVA 2JAHA 3LC7O 1T1RA 4BO9A 5U4QA 3WTBA 3ZHYA 1G0OA 1GTMA 2G5CA 3L6DA 4I9HA 3PGXA 4XGKA 5HS6A 4MVJD 3QWBA 3K73O 3STHA 1C0KA 1PR3A 2O3SA 2J3KA 4PLWA 1Z75A 2EP5A 3QV1A 1LDMA 1BXGB 4L4SA 2OUIA 2J3IA 1TXGA 5CDSA 1KVUA 1YDWA 3IIEA 2P9CA 5LDGA 3C7AA 3HFGA 2ZCVA 1GZ4A 1V3UA 4GSKA 3GNQA 1M67A 1Y81A 5HWSA 4EUFA 4R54A 1FMCA 4ZQGA 4HWKA 4I8XA 3GUYA 3COSA 1N1EA 3KBOA 5AXBA 3WSVA 4BOYA 3JYQA 1DFIA 4U0JA 4N18A 1B14A 4RPJA 3DZKA 3VH3A 3P2OA 4OHUA 1I5RA 5CPFA 1SCUA 3R3JA 1MXHA 5DF1A 2HAEA 1NHGA 2AHRA 1KETA 1E1LA 2A4KA 4E32A 3GGGA 2X0IA 3BTSA 3E82A 3ZU2A 2B0JA 2EWMA 3F5QA 4J91A 1ENPA 4CL8A 9LDBA 1ZKMA 2DAPA 2AQHA 1EUZA 4IJVA 2IZ0A 2PFGA 3HWRA 3O8QA 4A73A 4CUJA 7MDHA 3M2PA 3AWDA 2FR1A 4D44A 1IPFA 3DAFA 2Q2VA 1GYQA 2C54A 5HM8A 4IS3A 1H6CA 4XB1A 3BMNA 3GDFA 4UEKA 4INAA 4PLGA 1PU2A 3AOEA 4WEQA 3GFGA 5KCZA 2EHDA 3TZKA 5COQA 1NAIA 1SEVA 4NU5A 5IZCC 4PRLA 2PZLA 3F46A 5G4KB 1VM6A 1Q0LA 1UAYA 3MJTA 3DBVO 3CEAA 4XX0A 5BNTA 2ZB8A 4H7PA 1X1EA 3FWZA 3ZI0A 4ZJUA 4Q3EA 5K6AA 1SB8A 1O94A 4LK3A 5TJHA 1X7DA 2JFHA 3B20A 3JD2A 3OMLA 3EMKA 2V6FA 5CPBA 5CG2A 3AFMA 3PZRA 2AW5A 2FPGA 3JCZA 4PG5A 1LDEA 4J90A 1A7AA 1SNYA 3MOGA 2NLOA 4L76A 1DC6A 3ZWMA 4JLWA 1P1JA 4NBRA 2PZKA 3GT0A 3N74A 3PWZA 4HNGA 4ESOA 1GEGA 4J7XA 1DHRA 1LC0A 4CM4A 1BRMA 5JMWA 4UULA 2V7PA 3U4IA 4L4RA 3H5RA 3ONFA 1UR5A 4NK5A 3U3XA 3CZMA 1VSVA 3GZ4A 1ENYA 4CMEC 4BNUA 3ICPA 4JGBA 1ISGA 3FWNA 3GNSA 2PD6A 4LRTB 2HDHA 2PTGA 4FN4A 3DOJA 2Q4EA 4Z9FA 4WEOA 4MP8A 3HDYA 3GDOA 4F46A 3SBOA 3PQFA 3WLFA 4DYDA 2GN4A 3V1UA 3GN2A 2VHXA 2CF6A 2DVMA 1GPDG 3ASUA 4Y6RA 2O3TA 3NDJA 3OJFA 4IGEA 3W1VA 1LRKA 1E3WA 1FK8A 2CZCA 4N54A 1IOLA 7ADHA 3Q2IA 1T2EA 1U5CA 4UVEA 5ES3A 2O7QA 3A14A 4OSPA 2O4CA 2P4QA 3INTA 4YT4A 1LRJA 2V6BA 3PWKA 3OQBA 4DBVO 1IZ0A 4W4TA 3DFZA 1BHSA 3QA9A 4KP7A 2NVUB 1EBUA 1Z73A 3ZU4A 3DFUA 5A03A 3PLRA 1Y5RA 1YOVA 2W2LD 2PV7A 1C14A 3AJRA 1A27A 1DLJA 5A9SA 3K92A 5EQDA 3MCVA 5GY7A 4FFOA 5IXSA 3I9LA 4CPDA 3AY7A 1VKNA 4CV0A 3KYBA 4LRSB 4R01A 4IINA 1XG5A 2Y1DA 3UAGA 2IZ1A 4OL9A 1ZK2A 4R51A 3GAZA 3PHLA 3SEFA 4WNCA 1E5QA 2BMAA 1MGOA 2Z5LA 1HL3A 1ORRA 4NQZA 3WGTA 1PWXA 4JJIA 4BO7A 3JYPA 5IJZA 2RBEA 2WJPA 2POQX 3H3FA 2D0IA 1Z7EA 4CMHA 2Q3EA 1U9JA 5TSDA 3E6AA 4M86A 4AJ4A 3NTRA 1HDXA 5B1YA 1LQUA 1R4NB 2CUKA 2YV2A 3M1AA 4WCDA 3JV7A 3JQDA 4AJLA 4UAGA 5L7YA 2W4QA 2I76A 4FQ8A 3DBRB 3ONEA 4UEOA 1PQUA 1EUCA 1N7HA 3H2SA 1R15A 4DREA 5H82A 5F5NA 1B8PA 1T4BA 2J6IA 1T2DA 3ABIA 4K28A 2HSDA 4OOEA 5TT0A 2UUPA 1LXCA 5KKAA 4DLBA 4LVCA 1UUFA 2UV8A 3KZVA 3RUHA 4EITA 1T4DA 1HETA 3ST7A 3QWFA 1PGQA 3QW2A 4URFA 4EDFA 1A72A 5AVOA 4O1MA 1B15A 5JLAA 4R1NA 3WNVA 1HDGO 5DCUA 4P8RA 2NU6A 3JQBC 5ICMA 3WNQA 1AUPA 3K8ZA 3HDHA 3JQFA 4TKMA 3EY4A 3FNHA 3WGIA 4YJGB 1I33A 1GFSA 4LSWA 4NJMA 3P7MA 1K6IA 4Q3AA 3LF2A 3JTMA 4PVDA 3RC1A 5JO0A 5KVQA 1C0IA 3ZWOA 2Y0DA 4PZEA 3FSRA 3KTDA 4YR9A 4XZ3A 4XD2A 2PWZA 3G0OA 1LLUA 2O4UX 4AJKA 5A04A 1YBVA 2G0TA 4Q39A 3A1NA 4JIGA 4JP2A 4Z0PA 3QJ5A 4B4OA 1JKIA 1FJHA 1Y8QB 4MVJP 1BWSA 2GASA 3RUAA 1LBEA 2CDCA 1XYGA 1HZZA 4P4NA 4GGOA 2PKRA 5IZ4A 3RC7A 1MC4A 4ZRNA 4A26A 4DPMA 5B12A 1CEQA 5I9LA 3IMFA 5IG2A 9LDTA 4BNXA 2FHSA 2J5KA 3DXFA 4FD3A 3A9WA 3JQAD 1KY5A 1FXSA 3G79A 3RC2A 1OZAA 3C1AA 3I9KA 3EHEA 1R0KA 3AFNA 2D4AA 5JY1A 1ENOA 2ZTLA 3INGA 1U3WA 3KYCB 3FTPA 1OFGA 4RVUA 1BW9A 3BYZA 4R9SA 4XWYA 2NVUA 2V6GA 1PZEA 2I5PO 3GZNB 3WG9A 3WICA 4D45A 1T26A 4LCJA 2WWRA 4AJIA 4J7UA 2X5OA 4L75A 4M8SA 4MP3A 4CM9A 3EVTA 3WIEA 4YJHB 3GOHA 4AFNA 1YL5A 2DLDA 2FWMX 1N8KA 4I1IA 4J43A 4B3IA 4YQZA 1AHHA 3QHAA 2C7GA 2HU2A 1QMGA 4NDNE 4NFYA 2EF1A 3ROKA 3D3WA 4Y98A 3I4CA 1OMOA 3NJ4A 2ZYAA 4AJPA 1P9LA 5LDHA 2NVBA 2NU8A 1HYHA 2H1SA 3PQEA 1H0KA 1DAPA 3QVXA 4M1QA 1P0CA 5FWNA 2DPHA 4OXYA 1B16A 4BV9A 5ICSA 4U5QA 2I65A 2JCYA 4WUVA 5ILGA 3ZV5A 1PGJA 3I9JA 3QWHA 2EKPA 2FPPA 4NBTA 3AW9A 4CMKA 4E33A 4CMCA 1V0JA 3H2ZA 1DFGA 3GH3A 4Q9NA 3IS3A 1YJQA 3LT2A 3VZRA 2RH4A 2WSBA 5TQVA 1CDOA 3PTZA 3FPCA 2ZTMA 4BO5A 1HE2A 1TT7A 4KUEA 3RUIA 2JD0A 4GMFA 4FOOA 5JC8A 3ZNQA 4EW6A 4EEZA 4QFDA 3JYNA 2B4RO 3PFWO 2D1YA 3FBGA 1I2CA 4ND2A 3C7DB 4Z3KA 1I8TA 4CMEA 3VVCA 4D0SA 1VC2A 2QRKA 2WD8A 1NVMB 2Z95A 4WNIA 4P4GA 1BXGA 2GR9A 2XOXA 1D1TA 4R4JA 4U7WA 3WGOA 1ZW1A 3ADOA 1YS4A 4RPLA 1F17A 1YGYA 2WE8A 2BFOA 1EUDA 4MIOA 4E21A 1KC1A 4ZICA 3K9QO 1MP0A 1K2WA 3KSUA 2X8LA 2EKLA 5JPIA 3L6OO 2GDZA 4KOAA 1HDZA 2BKAA 2NACA 4PLHA 4CLXA 4YJDA 5T67A 1N92A 3Q3CA 3KV3O 1J0XO 4CLRB 5G0WA 3U0BA 3QVTA 1O9BA 2FRDA 3HHPA 3WYBA 4WLNA 5DCWA 1N7GA 1RM3A 2YFQA 4MVJE 4D3FA 3QQPA 4UVGA 1EQ2A 3K2EA 3GK3A 2Q4BA 4B8WA 2H5LA 1Y9EA 4N5MA 2CDAA 3EW7A 4W6ZA 2NUAA 4NHEA 3O4RA 4KWHA 2JFFA 3F3SA 5KTKA 1IYZA 4HFJA 5G4LA 4E2XA 3AOGA 3AI3A 1TT5B 4GKVA 1BW9B 3BAZA 4BUCA 3CUKA 4RPKA 3WYEA 5IXYA 5A9RA 1KEPA 4AJHA 4WLEA 4PLYA 4MVJF 2VUUA 4J1NA 4GAEA 5JDCA 1P31A 1R4NA 3D4NA 3T7CA 4DYVA 1YDEA 3BMOB 1ZBQA 3QVSA 4XCVA 2F00A 2DKNA 4LSMA 2WYUA 1DJNA 2JHGA 1U7HA 2FR8A 2YJZA 1EE9A 1DHTA 1NQAO 3SLGA 3WX0A 5L95A 3F1KA 4OQYA 4IZHA 3LC2O 3RUCA 1PJQA 3WQRA 4YA6A 1VJ0A 2Y93A 3GGPA 3DMTA 1ISFA 1YBMA 3PIDA 4GVXA 3P19A 3SX2A 1LA2A 2NU9A 4JBIA 1WWKA 1ZEJA 4R3NA 1QLJA 4OGWA 3EVNA 4M54A 2EV9A 2PZMA 4QEDA 5B4UA 4JBGA 4IDEA 5G0TA 2B83A 4YT2A 4L4XA 2VYVA 2Y66A 4WLUA 4YJGA 1R16A 3NYWA 3ON5A 2IODA 4MVJI 4ZD6A 1HZJA 4D0RA 1Q0HA 1C0LA 3IDSA 1LDBA 4DL9A 4YB8A 3ZWBA 2GZ2A 5EIOA 3C85A 1EK5A 1S7CA 1LDNA 1H2HA 4K6FA 3F6YA 4BO3A 3GVIA 1XQ1A 2W90A 3BA1A 3JQCA 4Y6PA 2JKVA 2X9GA 3CE6A 2CSUA 3UF0A 3DZGA 1JW9B 1CERA 1D7OA 2QRJA 4UVIA 4C7KA 3AOEC 2B4QA 1HF3A 3QY9A 1LEHA 3AUUA 1FDSA 3NTOA 4DMLA 3G17A 4PG7A 4HUJA 1RYDA 3H9EO 5IDQA 5K9ZA 2NNLD 2DBQA 3G1TA 1KEUA 1NNUA 3Q0EA 4R5HA 4XIJA 4LW8A 4PLPA 2EJWA 2IEBA 4R9RA 3TZCA 2C20A 1FDTA 1DIGA 1E0DA 1PJ4A 1XELA 3I9MA 3RWBA 4BNKA 2D59A 1LJ8A 3AUAA 1F06A 1E7WA 1BXKA 3WBFA 3GUCA 1YL7A 1CRWG 4OJNA 3LQFA 5TS3A 2Y0CA 4DQXA 2BGMA 4E5MA 3PHHA 5IF3A 1U28A 3Q9UA 4TRMA 1R6DA
chains in the Genus database with same CATH superfamily
3V97A 4LSGA 2XTNA 2XA1A 3T1VA 1W0KA 2GCGA 1M73E 2W6JA 1NRWA 4RPGA 2MYUA 4RZIA 5IK2D 3IUQA 2X8JB 1LLDA 1QE3A 2G09A 4E5UA 1UC8A 5C8YB 2V9ZA 2V1XA 3FR7A 3W3AA 1OLSB 1JIVA 5A6SA 3PHCA 2VNJA 2OKGA 1E9RA 2RJ3A 3DC2A 3FNEA 3ROGA 4C1NA 4X65B 4N40A 1W93A 4OXKA 4HNRA 4C89A 3KO8A 4X54A 3FPBA 2QM3A 2IIVA 3SIRA 4AMGA 1CR2A 2GAAA 3H1EA 3VR6D 4BZPA 5E8RA 2HRDA 4BE4A 1FU8A 1KQ3A 3RVLA 2O54A 3HYCA 4G1FA 3JPWA 3CA8A 1WL8A 1QIEA 3UY4A 1ILWA 3QV2A 5JAIA 1RHUA 2X1MA 4CM4B 3PHIA 4Y1EA 1S96A 2SHKA 2HMSA 3OQPA 2X22A 4ZOLF 4C0SA 1L5HA 1ZCBA 3ZCTA 1A5ZA 4M21A 1F8XA 3UAWA 2YIMA 1RM5A 1FFHA 3AIKA 4EPRA 3VR5H 1ZK0A 4TS1A 2PXXA 4CG1A 2AVNA 3NIGB 4LXYA 1X0XA 5E9AA 3PGLA 4JJ7A 3QPUA 4ZI7F 4QNMA 4X6XA 3KDAA 2R4TA 4IVQA 4RE6A 1OIXA 4QOFA 4DCUA 3DKKA 3MZ0A 1KYWA 3QVJA 4I1YA 3EJWA 2R11A 4NVRA 1RXVA 4Y1RA 1SVIA 1I7SB 2QMQA 2NUPB 2VPIA 2W2KA 4AF8A 4DDMA 1U4SA 4MIEA 1A76A 1E66A 3FYHA 5FNVA 2OXRA 4OLJA 3VPSA 1U9ZA 3D7LA 3WQBA 4D8XA 2ATVA 3SXPA 3W6ZA 1GRRA 4P4TA 1DE0A 2AJDA 1PZMA 4BLUA 1UDWA 2IP1A 1M7BA 2P9GA 3O83A 2XGJA 2D5BA 2WWXA 3EC7A 2AW3A 1FLAA 2GPJA 3VR6A 3T1YB 2AF4C 3K4HA 1KBQA 4P2GA 2DECA 5FWDA 3N9IA 4CYMA 4JYAB 3OSUA 4EW3A 1NVKA 1VLLA 3OQ1A 4FNAA 4TVOA 3AONB 3UK6A 1GIAA 3CY6A 1BD4A 3A4VA 3CFYA 4MR8A 3L41A 4L8LA 2PGJA 1U8TA 1WXGA 2YBDA 3Q9LA 4KIUA 4Z4QA 4CU2A 1B8OA 2GK6A 2PAAA 5K0SA 2NQTA 4HZUB 1THMA 2QSJA 4MS1A 1WHSB 2O0LA 2CE7A 1F60A 2F2TA 4G86A 3VVBA 1HGXA 1KMIY 1R66A 2CZGA 4YAEA 3HLTA 2VK1A 2ZQ5A 1KZ7B 4RHXA 1JNXX 2YVUA 5DLDA 2Q5FA 3TLEA 1ZN9A 4B7UA 1J5PA 3CKMA 3SYNA 2QUJA 3WHKA 1H2BA 3TLJA 4AROA 5A4IS 3JZIA 4NPHA 4B2PA 3CX3A 3UJNA 3N2GB 5K0JA 4BNVA 3LQKA 1U6IA 1Z45A 3AINA 1FDUA 1PSZA 4HQFA 2QA5A 1ZC3A 3I6ZA 3JQ7B 3COZA 4KE8A 2Y9PB 2DE0X 1JDJA 3C6QA 1EKXA 1H5UA 1CQWA 3I30X 1DAIA 2CUNA 3P32A 2F43A 4H0NA 4ND6A 4F4HA 4JKIA 2P4UA 4J0GA 4RVNA 5KTMA 2UUBB 4HJXA 4IAOA 4BQPA 5A4MS 4IEEA 2A33A 4ZAXA 3VV3A 1RZRA 3HXLA 1SU6A 2PA3A 3OKAA 3V9PA 5EAIA 4DMUB 1V6AA 5JCOA 4LE0A 4F11A 4AJOA 4NDZA 2WSYB 4PLVA 5AI6A 4AURA 2WFLB 3HVUA 1EP3B 1JPVA 4B44A 5I5EA 4OLFA 4TKVB 3IUNA 4B3XA 5AO9A 2WLSA 3N86A 3O75A 4XQEA 1JG2A 3G9XA 1MB9A 4IYJA 4URWR 2H48A 4AJ2A 2MYTA 1I36A 2JL1A 4GOXA 2V7BA 3LZDA 3Q3IA 4BGEA 4EYKA 2X0KA 1BJTA 3L7JA 4Q3NA 2IXBA 3X1KA 4B3CA 1QC5B 2QJOA 2RI6A 3A10A 4M8KA 2NU7A 4ASUD 1AQUA 1OU4A 1S4MA 3E3MA 4LY6A 5AKJA 5F1KA 4BNZA 4DQDA 3MCAA 4UOZA 1A3CA 2WD7B 3MC1A 3OEED 4HPJB 5LBTA 1PN3A 3BA6A 3L79A 1Q57A 3R0VA 4QOSA 2F55A 2GSDA 4M0CA 3AF1A 2CUZA 4JLNA 4BMPB 1X1CA 3K96A 1E1QD 1N3IA 3G7UA 4GUDA 1R3UA 3VZDA 3Q11A 2NMVA 1R4ZA 3GUZA 3S2UA 2Z1MA 3V4PB 5LQAA 4BNGA 1E3QA 2RGRA 4TLCA 4DXAA 1NKTA 2PEYA 2DLCX 2AN5A 1UPAA 2M6SA 3EN0A 1L4NA 4J16A 4TVBA 5JWRA 4G0MA 2Q3JA 1F38A 2QJRA 4RCVA 4RJKA 2FFQA 1OF1A 1U1EA 3FDZA 3LO8A 4TS3A 2IYEA 1ZIDA 3K2IA 2AZTA 4WI1A 1FP2A 2QE7A 4AKGA 3PC8C 2IX9A 3K35A 1W19A 4N0EA 4ARUA 2Q3LA 1TCUA 3L0ZA 3IIMA 4G07A 3B6MA 4KXUA 5F2EA 5H3CA 4BQIA 1EXWA 3RT1A 4OA5A 1ODCA 2IHZA 4QOGA 5BN3A 1B6SA 2YQ4A 3L0IB 4HDMB 4YT8A 1DAHA 1U7DA 2C4KA 2VWGA 5KJ1A 3CKKA 4UDOA 3JQ8B 621PA 2IQ5A 1X14A 3B70A 4S2UA 3I6MA 2BFCB 1T8PA 4WFKA 5HJ2A 1TL7C 2RSLA 3HG7A 4ZT3A 3KYJB 2IUYA 3H1TA 4ZA2A 1U2SA 3JS5A 2HJHA 3L07A 4DR7B 2VWQA 1P2UA 3EFEA 4H3HB 1RAAA 1TKBA 4EMTA 1KXZA 1KK0A 1NUPA 2XV1A 3CRMA 3J7TA 3P0EA 2GHIA 1Q74A 3B82A 3L8DA 2FMFA 4J8PA 5FAXA 2C2BA 5TQ0B 1WULS 3TRIA 1CU1A 2ZYDA 3OHMA 4PGMA 2G6BA 1ZOPA 1QE5A 3I28A 5DEIA 2ZSUA 1HKUA 2J6CA 2TS1A 1N2CE 3ETCA 3O0DA 4IOKA 3UJHA 1FMTA 1I6WA 2UUCB 4O1HA 1CVLA 4KPYA 2BCEA 4XI9A 2OHXA 3ZQ6A 2IZZA 2FP4A 4M6WA 4ABYA 1MNQA 3GYBA 1THGA 1NBWB 3T4XA 5E0KB 1O6ZA 3P96A 3AHGA 1ETUA 2VEOA 4BNNA 3D2BA 4EHLA 2VYCA 1Z5UA 1VB3A 4R7TA 3UB4A 2ZQYA 1QYIA 3I64A 4RJTA 4TWZA 3EZGA 4R3WA 2X6TA 5GVRA 3CRNA 3L1HA 4OU4A 5CT6A 4HP8A 3UV3A 3LH5A 2YTZA 1QIHA 5CFPA 2IS4A 4D0GA 1UMKA 5BR7A 1Q0QA 1WQ1R 3ZW9A 4F56A 2ZBEA 2HLDA 5HIJA 3CH7A 3N7TA 3DZHA 5C31A 1M83A 1DCMA 5HG0A 5F77A 1QFZA 1X7HA 4AYXA 4BV8A 1SKYE 3AKYA 1BS9A 4MQEA 5F64A 3SP1A 1GCOA 3SLGA 1H6DA 3N2ZB 3M2TA 4BE9A 5A6VA 2PLNA 3NCTA 3KPWA 5L51A 1PJAA 1JG1A 5IM5A 2HCJB 2VF5X 2GF2A 2OMEA 3O1JC 5T5QA 4BNIA 3R5JA 2P5TB 4NR0A 4CETA 4JROA 3RS7A 2EBHX 1I6MA 1IM8A 4G4JA 3BH7A 4YRLA 1C3OB 5GP1A 5I9IA 5JNLA 2BH2A 3NBZC 1Y9JA 4IDGA 3OH8A 1HFKA 3HADA 4IV5A 3GLHB 4RMNA 3DV0A 4I9GA 4IXWA 3GVXA 4U2BA 1KI4A 3WLPA 1SCNE 4G26A 4A91A 3AIMA 4TM8A 2YQZA 5BQXA 2OECA 3LDGA 3K1AA 3KTAA 1KA9H 4P4UA 5A1TA 2KQUA 2P0YA 4Y1RB 3S4YA 1H4QA 1ULZA 2Z0MA 4G8BA 4ENUA 2RB5A 4DUGD 4TXNA 3ROTA 1DOHA 3NT5A 5H3HA 3TNLA 2GTPA 2C4NA 1F1JA 5H70A 5EZ6B 2OMKA 3VSEA 3K6SA 1NNSA 2P67A 3FNRA 1RPZA 3ADKA 2YN4A 3ETGA 4PFSA 1RTKA 5ALKA 4C3VA 5BV0A 2PQMA 1TZ2A 2BGNA 4HDKA 1YVPA 3D54D 3TCNA 3JALA 2ZYTX 5L7TA 3DMFA 3GRYA 2ZJ3A 4R2WA 2MSCB 4BV3A 1TZMA 1B41A 3TKLA 1AS0A 1G5PA 2LIVA 2GF0A 1YZHA 2GILA 1DEOA 4FS8A 4Y2SA 1N6RA 4AS2A 2X2PA 2XCOA 4GVLA 3WBKA 2PWBA 4C03A 3F6RA 4R9VA 2QZPA 3L5KA 2AI3A 1JILA 4EELA 1AO3A 1PJLA 3WK7A 5FWXA 2DP4E 3ESYA 2IYNA 2XWSA 3Q4GA 2FCAA 1T0HB 5ALWA 4D3ZA 2Z9BA 1E8DA 3IB6A 4OUDB 2P6NA 4FC6A 3LP8A 3F9CA 4JN6B 3VHRA 2AX4A 2X8WA 4KE6A 4U7JA 4JDPA 3A04A 1ILEA 1N2GA 1MG5A 1XWWA 5DYTA 1U2EA 1YVRA 3D8BA 4LA4A 1LWOA 4Z5XA 1DV1A 1WTCA 3U7GA 2BOVA 5EE9A 1DKPA 5FEMA 4WBNF 3R2JA 3V4OA 5JBNA 1AKWA 1C0PA 1US8A 4OXNA 1MH1A 2FH5B 4MUMA 1R9JA 1SC3A 1ORDA 1TRKA 2WG2A 2ZB4A 4JL8A 3VGJA 4PR0A 4E5VA 5C8XA 3DLHA 4LJ4A 3AY6A 4EARA 4A2WA 1KQOA 1Z8FA 5CVEA 2QIPA 1FX1A 4UFOA 5I7SA 5ALDA 3IP7A 1PVDA 4S24A 2X1HA 2Q0HA 3BF7A 4IIJF 2KW5A 4XIYA 5ESDA 1B1AA 3AXTA 1OX4A 4F45A 7REQB 3QXHA 4ND7A 2HU7A 2A9VA 2EQ5A 2FMUA 1JZQA 3G1UA 2CLSA 4I14A 4XWTA 3X1YA 4D9CA 2PXCA 2ZBFA 2PWAA 4R9NA 3LQYA 4MPDA 3AB7A 4RCYA 8AT1A 1GAEO 3KHUA 2XD9A 1W34A 3H86A 5CU7A 2UZ3A 1VPVA 1Z6GA 3I0ZA 1U7TA 4FZ5A 2O07A 3LFUA 5AVXA 5IAAA 3H65A 2QM7A 2WMDA 3KETA 3EOZA 1C7QA 1HC7A 2D1FA 2D2EA 1OXKB 1PO7A 4H16A 1QVAA 2FPGB 2Z6AA 4NXNB 3IX7A 4G5HA 3L4KA 4TKLA 1O0SA 3O1HB 2BMWA 2UUOA 2YW2A 4OVKA 2Q1XA 2PZGA 4RSRA 1GNSA 2VF7A 4HYEA 4PGFA 3VZCA 1PQYA 3DQPA 2D5LA 4ZU6X 1ZSYA 1MN6A 2VSXA 3O93A 3OSZA 4I19A 3ZDEA 4S1NA 1LJUA 3QXXA 4XVRA 5GTDA 3O5AA 5KYWB 2F8SA 2H2HA 4DIDA 4A15A 4LWOA 4M38A 5MN5A 3VR2D 2YMQA 2JFQA 4HX5A 4Q3CA 3W3ZB 4Z7OB 4NCAA 2PSEA 1WJGA 2YXDA 3KJGA 1VIYA 4J4HA 3SBDA 3U0VA 4DXDA 3K70B 3WE7A 4C04A 1K2VN 2VZEA 1VG9B 1G8YA 4M0MA 4CIVA 4QZVA 4NMXB 4XCQA 1E69A 3PDHA 3SX0A 1WQ4A 1E4OA 1U7OA 4OQDA 3SY8A 1XKQA 4RD2A 2BE9A 4RVSA 4BWVA 2WUGA 3GHHA 4BP3A 2HNBA 2YZ7A 4TWBA 4EHJA 3DLCA 4NJOA 3ZEAA 1TIPA 3M5DA 2A0UA 5EPOA 5GPBA 3AVVA 2HCTA 3DFKA 1DMSA 4QDOA 3RJ9A 5JSFA 2AMLA 1CUIA 3QVOA 5JFOA 2I66A 1XTVA 1RLUA 3D7SA 1ZK4A 3QY0A 2WBLC 2XRYA 3OCYA 1XRMA 1YJ5A 3DZDA 1M34E 4MINA 2ZULA 2VDVE 2OBXA 3E48A 4LX8A 1L7MA 4L0DA 4XFKA 4B3HA 5JHHB 3BDIA 1QQ6A 4NEQA 4RM2A 4J94A 3A1VA 4LPKA 3D5QA 4TV8A 2FYTA 4U5XA 3PD1A 3VFDA 2WZDA 2I9PA 5KJEA 4MXDA 4C78A 1BSVA 4HNHA 1CYEA 3IMCA 2O14A 3NHAA 3S8YA 1G8FA 5L45A 1O6BA 2AKEA 1P9OA 4BNWA 4BFYA 3UN1A 3R5HA 3AR2A 3TS1A 4GM0A 4N03A 3D8HA 3IVXA 4L73A 1GWNA 1NVEA 5JAQA 2EGGA 3CO0S 3DQQA 4J0CA 4AXBA 3AYXB 5B3KA 5BN1A 3ZXXA 5CA1B 4QYSA 1K63A 1OAOC 2BZSA 3HCWA 4RHCA 4HQRA 4A3SA 2BEWA 4K86A 5KC9A 3IT3A 3N28A 2DX7A 2JAXA 2NXEA 4YQYA 3DZJA 4GWGA 3VRHA 3FHLA 3M49A 4K88A 1UJ2A 4IGFA 3URKA 5TIIA 4ZT5A 3ONWA 1CRQA 2CLLB 4GMDA 4KQHA 4BO1A 1PUIA 1JHZA 5D85A 1N4AA 5CP8A 2CKMA 3ZDBA 2YHSA 3F49S 4GYWA 5K6RA 3EG9A 4TL6A 2XYGA 3FZYA 4ZYUA 3CB4A 2Q5LA 1Z26A 4XYBA 1P80A 3HBFA 4KSBA 3RG2A 4D8TA 5KVSA 1YFZA 5JMPA 2NTNA 1EVYA 3WRXC 5D5QA 1E8NA 3BRSA 5JJLA 5I7VA 2B78A 3PA6A 1QCYA 3D0OA 5FUWA 2P65A 4EG3A 3NWOA 2G80A 2JCVA 4IHJF 5FWAA 4PXSA 3N75A 3HQ4O 5T8KC 1JKMA 2BGLA 3NFYA 3OFNA 4YGXB 4Q66C 5LJIA 1YCHA 3JARB 1Z4KA 4B2LA 2D7CA 1W25A 1WCIB 2IP2A 3DVLA 2F1HA 4LYHA 5BN5B 3F78A 3MWDB 1OHHD 2DM6A 2O9JA 4FEAA 3UXMA 3ZCXA 2IFTA 1WNFA 1VYUA 1Z2EA 2H1RA 2Q46A 3GI1A 4AKTA 1Z6ZA 4GP6A 4N6GA 3WJ7A 3DO8A 4FB5A 4MH0R 2GM9A 2OO5A 3DE4X 3BQMB 3FM9A 1Y8AA 4XYMA 4PX2A 1SA0B 1VA4A 2GGSA 4TLLB 3MTBA 4PM4A 1EGAA 1DFHA 1X3LA 4LZOA 1EWRA 4W5QA 1R7RA 3FWHA 3BMXA 2ANBA 5D2CA 3TPZA 4G5FA 4K9QA 1L5FA 4LTMA 2NV2B 3RBXA 3TOZA 1GGEA 4B09A 4MTLA 3FGNA 4JSYA 3MEQA 1JA1A 2ZYSA 3O47A 1HQYE 1R0CA 1CR4A 1RR6A 2BWJA 2XUJA 3OPXA 3VQTA 4LNUA 3KT0A 1YB2A 1BE1A 3HB9A 2LR0A 4DIBA 3KAPA 2YS7A 2BT4A 3H1BA 2ETXA 4E13A 2ORYA 5AYVA 2H7XA 4MS3A 4EG1A 1K8RA 3D4LA 4M49A 1IULA 2ZYWX 3UJ9A 1R6UA 1WB6A 1AT1A 1ECJA 1Z0UA 4MNTA 3OM1A 3LAWA 4WKOA 1LD3A 1BHQ1 4HLQB 5DSTA 1UPBA 4RVHA 5IVKA 2W2OA 4L0CA 4A23A 2AJ8A 3EUEA 1W76A 2WHPB 1UH5A 4NONA 4IILA 3K6JA 2B7BA 3LECA 4ME6A 4RMHA 4HD8A 1B8VA 1P1FA 1AKVA 1GKUB 1KI2A 3KIPA 2RHJA 4G01B 4UPDA 3KLBA 3KR1A 4G0PA 4BVFA 4GPD1 2ZR8A 3C1TA 3DDSA 3CVWA 2OAGA 1K5DA 2ZCUA 4E51A 4P7JA 4HUTA 4ZYXA 5BUCA 2PIAA 1H2EA 5EERA 3QW4B 3WL7A 1X1RA 2QP9X 1ADFA 1KK1A 2I6XA 1M0WA 1WXEA 2I4IA 2J30A 1K6JA 3WMFA 4EY6A 5AJYA 2IV7A 3EZ9A 3B6JA 1GGHA 3O2JA 4RACA 4IMPA 1QF7A 1HNZB 3P8ZA 4YO8A 2J3LA 4AVYA 5B1HA 1JUDA 3D6TB 2QN9A 5EXDA 4RH3A 2ZVQX 4WKCA 4UDNA 2R00A 1YXMA 4GL2A 3T3OA 2CFCA 4ZYZA 1TDJA 3ZCRA 4LGYA 1UXIA 2D2VA 5KJCA 4WK6A 4BMNA 3F4BA 1OX4B 4ZAVA 1Q95A 1RWQA 5EJMA 1N57A 2HK9A 1YJAA 2B1JA 3HJCA 3LS2A 2PGLA 4RL6A 2UXDB 4RD4A 1V71A 3NHPA 3P45A 2HA0A 2DFNA 2Z08A 5DSZA 4QT4A 2FV8A 1F4PA 4NNOA 4P4SB 2KB0A 3OJLA 3LY7A 2Z57A 4DSTA 5F7XA 2BUBA 3PXGA 3NU1A 3R3SA 4J7AA 1DWQA 4AUKA 4JEIA 2YZKA 3ENZA 2YHIB 1QHNA 4E5KA 5AKLA 4E2WA 4WLVA 4WFQA 1VJ1A 3TW6A 3C15C 5BV1A 3UJCA 4EHDA 4QLOA 4N5IX 4MKIA 1FVXA 4MRVA 4RA6B 1OTYA 5CNKA 2ODAA 1MJGM 3ZNNA 1PQWA 1AHIA 3AEQB 3PI6A 4UUMA 1N6IA 4WXPA 4XSVA 1CQZA 5T6BA 3CH4B 5ITZA 4CXMA 1H9BA 1NXTA 2FVXA 3VO1A 2O8EA 3JZAA 2G4LA 3L01A 2UYHA 3W7VA 2ZUDA 1R8QA 4NMWA 4RQAA 1S8AA 2G06A 2A5JA 1KI3A 4RY2A 4UTRA 1NA5A 1UBOS 2XBMA 1Y3CE 1XMIA 2QZ4A 5GGXA 3LZCA 2X0JA 5IAJA 4DIOA 3OFKA 4FYHA 4WXEA 1NXOA 4ZU1X 4LJ6A 4QU9A 4B3DA 4Y2TA 1NAHA 1NP3A 3D3KA 4BX8A 5LZ5A 3IIIA 3PRYA 3UT6A 16PKA 5K3CA 3SFVA 4LJSA 1DXHA 4RPIA 3PGMA 3L4SO 3RASA 4GECA 4B46A 2V7QD 4H1WA 1MAHA 4A0SA 5T4HA 1EWYA 5HKKD 2B36A 3OTIA 4KE7A 4YDQA 3I32A 5EN4A 1SVKA 3IP8A 1MVOA 2PX6A 3VH4A 4A2QA 3ZR4B 3DHNA 4BBPA 3B3FA 1COZA 2NTYC 3BREA 2CNNA 1KYXA 1L1FA 1R88A 5FI0B 2VRNA 2YZMA 1VJCA 4CJXA 3GQVA 1G21B 3GOQA 2P1DA 4OMDA 2F3PA 2QROA 1SMKA 3NYRA 5BNIA 3IYLW 1UADA 2X6RA 3ND5A 4L8WB 1TIKA 5C81A 2EYUA 4CKCB 4RTRA 2Z6UA 3QGMA 3FZEA 4IJWA 3PHBE 4ZZ3A 3GJYA 2IEIA 4WDRA 1U28C 1JIXA 3BSWA 4D6PA 3C2QA 3FOCA 3WIDA 2AXQA 1UM8A 3HWWA 3A0UA 3IQXA 5GZ6A 4MQLA 4UAJA 5BUSA 2NSHA 1P9NA 1RYBA 2BJVA 2VZ0A 3MCWA 2ATCA 4P1ZA 5EMHA 4DTIA 2FLKA 4EFLA 3OJWA 4EGAA 4YIHA 3BTUA 5KNDH 1KEKA 1Y8RB 5I7WA 3CLHA 1VPEA 3CGWA 2DKOA 5CIQA 2Y99A 1P0IA 2X0DA 3JWIA 2PT9A 2BHSA 3LIPA 2KPOA 2H1HA 1X19A 2DWUA 1C3EA 1GZ5A 2O2SA 1QZUA 3NBKA 4L8YA 2CUTA 3UK2A 5BSWA 1TEVA 3LXXA 4CLRA 3M1IA 4EB3A 2VJCA 2CV1A 1D1QA 1T9AA 2C5AA 4BMZA 4KN9S 2G40A 1AQIA 2BKUA 3KQUA 3GLIA 5DK4A 1UBKS 3C3WA 1P2SA 1BE8A 1NXSA 2C99A 2WABA 1J5XA 1LPOA 1SXJC 2H57A 1CD5A 3C3XA 3PL5A 5M3BA 1DIBA 3RU3A 1LRLA 1S6YA 1A9RA 3O92A 4GW3A 5KSZA 1P7VA 2AG8A 2R751 3EWNA 2HTEA 1E9SA 3PR3A 4RWEA 2RMKA 1Z6AA 4IHKA 4L8VA 1G9XA 4QHSA 1BXRA 3BORA 1PEAA 1FJGB 2FN7A 5FJJA 2XUKA 5HIMA 2XTJA 3IVMA 1VHLA 3FSEA 4RENA 4G0VA 5I4KA 1YC2A 3QHQA 1PZXA 4NXMB 2NYVA 2P9FA 3T4EA 3ZXUB 2VYNA 4OCZA 1RP1A 1P8AA 1DJQA 4TUYA 1OLOA 1FFYA 1RRFA 1ZGJA 3QI2A 3PJDA 2PQ2A 4M9SA 1PEKE 2F3QA 2YXNA 2ZJFA 1K5HA 5HA5A 2X76A 3I6IA 1VLJA 5A0FA 2IOQA 3NJ8A 2ZYHA 3U4HA 2YWEA 4FSHA 5AUPB 1NWHA 1S8FA 3UB2A 5AR1A 3RUDA 1G41A 3VMFA 3ED1A 1USGA 1IQPA 4CF6A 4LEIA 3PK0A 4D4LA 1Z47A 1TU3A 2FW7A 3UJBA 4DNFA 3UAVA 2AT1A 2PRZA 1GUZA 2X8JA 4EL5A 4WN9A 4A4DA 2M98A 3L0SA 2Y1WA 3I76A 3VR5A 2VP9A 4F4DA 3A11A 3UKJA 4I36A 1G19A 3V32A 2ZPTX 3N6VA 5AW8A 2QIOA 4GSLA 4M36A 3BT7A 1G4AE 1OGYA 1ZIPA 2XE8A 2XXJA 3FROA 3QZUA 1ACMA 1C3VA 4QE3A 4ZOAA 4DPLA 3AESA 1JDVA 4FYPA 2HA6A 1KZYC 1U0FA 1JSLA 4C0HA 3ITKA 2COUA 1B3BA 3PA8A 4GMKA 3VI3B 2QBYA 1EB9A 4JJ6A 2C59A 3E27A 3RG8A 4EF6A 3PJRA 3PXCX 4WIAA 4UEWA 1SQGA 1L4LA 3FB1A 3H3XA 3JZFA 1GGNA 1WX1A 3W9UA 2P9HA 1N36B 4TZTA 2EVWX 4M7WA 2IQIA 3ABSB 3I04A 5E6SB 1VL1A 3LUDA 3S7TA 4BECA 3RHZA 1FU7A 3GMTA 4MV6A 3SJ7A 4QBGB 1MAWA 4A2CA 2Z2YA 3FG9A 1XAIA 2JH9A 2B6NA 1KPGA 1TCVA 2VUSA 4PICA 4H7JA 1W6UA 1NVTA 2I6QA 2JF0A 4HDNA 4I50A 1WZ2A 5KPDA 1YQDA 3IHLA 4GM4A 2Z9CA 1FY2A 3ZC3A 3E5HA 3U1VA 5JDIC 4TL9A 3LBYA 4KRXA 3GCXA 3FJOA 1XD8A 2DBRA 1KIMA 4HQ6A 1WE2A 4Y7DA 5F51A 4BGIA 4EUSA 5C4MA 4R2IA 3A1UA 4FYVA 2PH1A 4ALNA 4ZHSA 3VPXA 4BEVA 5AXAA 3NHJA 4QDTA 3UAOA 3A4MA 4DLPA 2AV6A 5I4CA 3DEIA 3QLUA 1XDWA 4KV7A 1BG6A 4Z3DA 5LCXA 1J70A 3L1IA 4ZEVA 2DUWA 2B4AA 1QFXA 4TMKA 3TSWA 5B1SA 3I6YA 1O9HA 4L6IA 3H2BA 3H84A 4LQLA 3UICA 1DWPA 1SZJG 5J2UF 1GGJA 1SBTA 2HQOA 1PZGA 2LDXA 3B1KA 3H9JA 1R2QA 5BMOA 4PHFA 2PUDA 1C30A 1JSCA 3WP1B 4QYXA 1P2BA 5CLHA 1JDSA 3A1CA 2GPBA 3O4JA 5GZ1A 5F98A 2C9MA 3IMGA 4FJ0A 1DIAA 2BV3A 4MWGA 4PQEA 4Y2UA 3ZHSA 2I78A 2O3JA 3LVFO 1MJNA 1NR1A 5LNK1 5IDWA 1G17A 3AL0C 4XKJA 5E6UB 5TARA 4LPSA 1HE3A 3ZV6A 3B9RA 4NZPA 3HM2A 3U7FB 4MEBA 4QQKA 1C1DA 4TX1A 3MMPA 5IUNC 2R6JA 1HLDA 4ZO7A 4UASA 3NPAA 1YMQA 4ZPXA 4II2A 5GJWC 1P1HA 1OFVA 3OPYB 3ZKWB 5JCXA 1FP4A 1YIDA 5FR1A 1NIJA 2V65A 1T5TA 3B8EA 2FPSA 4ZVLA 2ZK7A 1BA3A 2ZIGA 4U7TB 3AEQA 5T7BA 3VU9B 3DDWA 5AI9A 1UZMA 4L9RA 4LJAA 5FX2A 3V4VB 5HVNA 3TSAA 4R05A 3QK7A 3CBQA 4BKUA 4A6EA 3CHYA 1FDVA 1YNSA 4H6WA 3FPJA 4URYR 1NT2A 2O8VA 3GDHA 3HN6A 1M1NA 4I08A 2VPPA 4XB6B 5F2NA 5EP2A 3ICCA 3SR0A 4AJEA 5B36A 5H68A 5ALGA 5A5VA 1NN0A 2O7VA 4B4UA 3A1WA 1EFLA 3OZVA 3WHPA 1YJXA 1DJPA 2CCGA 4K9KA 4AP6A 1GZHB 4HWGA 4IIBA 4ARZB 2DG2A 1IVYA 1N34B 4LJRA 1CXZA 1CQXA 2ALJA 4G1UC 4DILA 1ISJA 1OASA 1VRWA 1FLNA 3DQZA 2H4JA 3DVQX 3EC1A 3INRA 3LVBA 4P7FA 4WXHA 4BAZA 4DE5A 4F84A 2C7RA 2B4TO 5TQ2A 2P0AA 1WZNA 3LKVA 1MEEA 4K6KA 4MVJG 3BE5A 5HCNA 2QR2A 3PNLA 3ZVMA 3VYWA 3FZNA 2ZIXB 4QOHA 2NPOA 1E9AA 2A30A 4CT4B 4TKVA 3OT4A 5J59A 4QJ4A 1GKIA 1EK0A 1DQSA 1M6NA 1PT5A 3AJDA 4A0GA 2WLTA 4L6CA 2O7RA 3B7GA 1KZ6A 1I3OA 2VJAA 4GQAA 4AYWA 2XNKA 4NE7A 5CDFE 1UJ6A 3DZ8A 2EQAA 4KAJA 1F6WA 2BP7A 1V8DA 4Z9XA 2ISQA 2DUJA 2NUTB 1DBWA 3HUDA 1J49A 3O8OB 4HHEA 1T2FA 3A2NA 4PC3A 2PSDA 3ETNA 1E7SA 2QT0A 1XEWY 4UBKA 5H16A 3HDTA 3C70A 4JGIA 3FD8A 2N47A 3EXEA 4TQUS 3GMIA 4PQYA 1KE1A 4KN6A 1HSZA 3FHOA 1ESMA 1F9AA 4R8LA 3I9V1 2WF9A 2AC2A 5DZSA 4ANFA 4CMJA 1Y7TA 2YIJA 4PYJA 2BC9A 3B6ZA 3MJSA 2R62A 4HN4B 2PD4A 4CTJA 2IBSA 1CF9A 1U8ZA 1DOAA 1L8XA 1T8SA 3ZZUA 1Q22A 4OA8A 2JLQA 3IDZA 1T5LA 4GWLA 3DWGA 3BMCB 3N58A 4JUDX 3PGA1 5F7OA 4I4IA 5JEDA 1AKYA 3U80A 1F14A 3Q7IA 3DWIA 3SEAA 3I62A 2Z5VA 2AG1A 4AU1A 5LQDA 1JN0A 1FFDA 1L4HA 2P6UA 2RFLA 3MWEB 4HBZA 4FKZA 4S0ZA 4DDKA 3A6DA 1OXSC 1G66A 1F2UA 5LYJA 3L1JA 1AXEA 1I4DD 1B23P 3BWYA 4N3CA 3NRCA 3UQYS 2PT7A 2A59A 3DVAB 5I3ZA 3DCIA 1PNOA 1Q16A 2IC5A 1ONSA 4WNYA 2GBIA 3AI2A 4GE3A 4R8VA 5GV7A 1X86B 4RK1A 5KSOA 1V41E 1ZGHA 3E9DA 2FU5C 4R2LA 4RFSB 3FKJA 3ISJA 4GP9A 2PUVA 3VPCA 1X8KA 3QFRA 2DB3A 4QPCA 4AZVA 5JZOA 1K6XA 3HN2A 2CJFA 3S1SA 1NULA 1D9ZA 5JSZB 4O6VA 4WLFA 2Y68A 2K2WA 3GDGA 2MMCA 4DY6A 3UWMA 2Z1DA 3D8RA 1JLSA 2ABWA 1QBGA 2RBKA 3ADPA 4MLDA 4ND8A 3ORFA 4A7PA 3HU1A 2NZYA 3KL2A 5AW1A 4D4KA 4H17A 1NZDA 1SM4A 5KNCD 3RHSA 5EJFA 2FWPA 4M55A 4ILKA 1SCUB 4RZHA 3CZPA 5JSKA 3TIFA 4BQRA 3U5TA 3VYVA 3RVNA 1OH8A 2JBHA 2PUHA 5KX5F 3N7AA 1VE9A 1NBME 3E0QA 5HE8A 3V7UA 2H1FA 1Y7PA 3A7DA 3DAPA 2IZ7A 4H7EA 3OA0A 4TYQA 3W05A 1P0MA 4KRYA 2XB8A 4HDAA 2R6ZA 3T7DA 5EWMB 5GOZA 3RF7A 3KC2A 5PNTA 1QIGA 3ZLBA 1Q3TA 2RONA 1EFUA 2AD1A 2DQYA 2NO6A 1ZNQO 2JIPA 2PDAA 1KKLA 5EWJB 1MDBA 4BWGA 4DHEA 4G85A 1ORTA 4PG8A 1K9VF 2W2PA 4ODIA 1EVEA 5I45A 3CN7A 4ZOCA 2E48A 1KVRA 2IPAB 5KNBD 3O90A 2E3JA 3Q2KA 2P40A 2UYYA 2DRIA 1KFEB 4YO7A 4M3NA 1R1DA 3MGKA 2XXAB 3LPNA 5SZIA 2V6MA 3WDSA 2Y1KA 5DMHA 1RXWA 3FKSA 3TO5A 3OAAA 1CQIA 2VTEA 4KXXA 2AG5A 3A9RA 5E38A 4ZGWA 3RE1A 1MAUA 1AS2A 2LTAA 3QYAA 3MT7A 4F9GA 1WETA 2QSUA 4IEIA 3UXHA 1O0CA 1S1MA 3W34A 1V37A 1NI3A 1RHJA 1Y42X 2B8WA 2X4GA 3HYRA 3TR0A 2F1KA 1D09A 3DYIA 3WB1A 3OY7A 3QE9Y 4U4AA 4MOWA 5H1YA 1CBUA 1DIHA 3GEDA 2XJ9A 3GAFA 3I4FA 5I9SA 1T4CB 4PZLA 4JUFA 2E1RA 4G6ZA 4EO7A 2ZJ6A 2RHCA 2ZAYA 4IDOA 4CZ2A 1R12A 5KWEA 1X8XA 5FOWA 3O8DA 3ESBA 1DC3A 2ILVA 4N0MA 4RIGA 5SYAA 3GAMA 1NBEA 1ESDA 3ZLTA 2PLWA 2FFBA 4XM0A 5LLTA 3HJTA 2CXPA 5DNDA 2GPYA 3HGQA 1QP4A 4PHTA 1XP5A 3H99A 4YPVA 3KEMA 5AVYA 3MJFA 2QG4A 1QIMA 1TEZA 4MPPA 2J9GA 2JVIA 4M9QA 1OOEA 3HRHA 4QFCA 2JC3A 4RTQA 5K09A 4G0QA 3JAKB 1G4UR 2P9BA 5A3VA 5NLLA 3T1QA 3BH0A 2QORA 4N3BA 3L0BA 5J5AA 1DTWA 4PAWA 5DFAA 1KXJA 1YZYA 1OX6A 1NBMA 2C4VA 3O03A 1GPLA 1NX9A 1W5AA 4QXPA 4S05A 4QULA 5LIRA 1FTNA 2VN8A 4DLTA 4V0ME 3TDNA 3UMGA 2RGNA 1E6CA 2G5PA 1KQNA 1EI9A 4CI9A 4HNTA 1K06A 3EF1A 3KQQA 3K9HA 3M6VA 3WLTA 3O73A 1MV5A 2KLBA 1T36B 5TC4A 1WB9A 1PI3A 4O4LA 3MCUA 4POOA 4AICA 4QLBA 2XYVA 3MQ2A 4WBNB 1XAJA 2X2EA 2R6R1 2V58A 2EBFX 4DMGA 1WZIA 4FONA 1H4TA 4JP3A 3RD5A 3KWFA 5ITWA 2R44A 3VGPA 4EUKA 2O8CA 4KREA 2VNSA 1E5DA 1DMRA 2MYNA 4U39A 3PE6A 4PIVA 4J2HA 5KOIA 1QIKA 1Y3FE 1OT3A 3L43A 1NP7A 1WOMA 1S7GA 3AWIA 3ORYA 1Q1NA 1VI5A 1QPGA 2B9VA 1BKDR 1O4VA 2P2DA 3FB4A 3JVVA 3QNMA 4GRAA 4IIJA 4JLJA 4ALMA 3TINA 1EUQA 4WGGA 1JA9A 3F98A 4B76A 3KR2A 2G9VA 4ZU3A 5LM3A 1GNTA 1UFRA 2VUTA 5ALLA 3RT7A 4M0PA 2NP7A 1ICIA 4WPGA 3WXBA 4UREA 3TQQA 4EG7A 1P75A 2EC5A 1WY7A 2DKFA 4JU9A 1JMKC 3GRPA 3T34A 1L9XA 4KO8A 4BQNA 5JYBA 2G8LA 3CMCO 1WDTA 3L7LA 3W8DA 5LN1A 2ECOA 2JLSA 4I5EA 4IJKA 4MA0A 3I5YA 3D5TA 4OSOA 3E7PA 4FR0A 4JUBA 4KTTE 2D13A 4P3KA 3NDRA 1NM5A 2NO4A 5T4EA 2DFLA 3ZE2B 3RADC 3QENA 4GQIA 4TTTS 4WZAB 3ZWXA 2B2XA 4C2AA 5TVGA 3FI0A 3FYCA 4WASA 4AZ3A 2C2WA 2PH5A 3DL0A 4X64B 5IM4F 1SFRA 1KJ9A 1SOUA 1U9CA 1XA0A 1NASA 5JADA 4Z9YA 2ZJAA 5JH7F 2GFIA 5KYXA 3PC7A 5EJ5A 4B0PA 4JI2B 5DTQA 4GX5A 2QLBA 3WA6A 3EXEB 1J56A 3DEYX 4HXGA 4KCGA 2BM8A 3D3EA 1T8YA 5T8KA 1FPQA 2BM9A 2RHGB 4WXRA 3OHPA 2FPWA 2ZUBA 3OX3A 3TD9A 1WVMA 3PP8A 1ONPA 2AN3A 4JELA 5KSWB 3L6UA 1K8XB 2ZREA 4FCCA 4GRIA 2QMUA 3B89A 5ALIA 3T5AA 3PUKA 1YI0A 3RIGA 3S5UA 1JHYA 5KI6A 1OA0A 4ENWA 1BVYF 3EODA 1XQWA 4LOIA 4QO8A 3MYYA 1ZW6A 1WQ3A 3OTWA 2J9XB 3EVZA 2Z6VA 4B83A 3GA0A 3L1UA 1K27A 4F1JA 3I61A 1EUYA 2CLEB 1K4MA 1KMNA 2BGKA 2GVZC 4S3MA 3GRAA 2WVGA 3A70A 1X9HA 4MA4A 1QVRA 2HK8A 3CWZA 1OKKD 1TEHA 4HRVA 4MQ6A 3M6XA 1KYZA 2EHJA 3OBBA 4Y9DA 2ZVPX 5FFFA 1L5MA 4MV8A 2K7ZA 1IN5A 1M2EA 1JG7A 1ODTC 3K16A 4ESVA 2FUKA 1NURA 1MCZA 1PV1A 2H65A 2Q3BA 3PIRA 3Q7PA 2PD3A 2XMZA 4R81A 1ZUNA 4FD2A 1ZY2A 4RK7A 1F8UA 4YWJA 5HTOA 2ZATA 3RM3A 1D2HA 4WKPA 1O95C 2IDZA 3N2KA 2Q41A 3UTCA 4I66A 3AU8A 2ZJ2A 1IEVA 1JQDA 1Y82A 4QGHA 2ZUUA 3IUBA 1QO0A 4XW2A 3EXFA 2WJ6A 2XMBA 3BHJA 5I7OA 2HSGA 3OQOA 2AZDA 2OQIA 2A94A 5A7FA 1SXQA 1J0AA 4I46A 4LZNA 3WNBA 2YYYA 4YMUA 1NVVR 2RH5A 4OO3A 3B8HA 4DGQA 1UMCB 2W37A 3EQ2A 1PNQA 2B8TA 1C7FA 5FNZA 4BO2A 1LV7A 1XMJA 5JSUA 5LQJA 3QTBA 3YASA 2ZPUA 1QYWA 1OILA 4WLOA 3AVYA 4XOIA 1EJ6A 3T35A 4HWSA 1SBCA 4V0KA 1JQLB 1GXSA 3OCVA 4AL4A 7GPBA 1QIDA 1L3CA 3ND7A 1P74A 4LI0A 4YJHA 2JATA 1T25A 4PBRA 4TROA 4J1TC 5CH5A 1GGKA 3DL2A 1L5VA 4HDRB 1FLVA 5JVDA 2O5VA 4B7ZA 4PLTA 4IDCA 2P3OA 3IAS6 2QD2A 4O2BF 3RRBA 2V03A 3QFHA 3A05A 5E6RB 4DDHA 2G83A 2PMKA 5JSYA 3PQ3A 1WUTA 3VSBA 4IOJA 2PGDA 3ZK8A 1U3DA 2C7PA 1RWVA 2VHVA 3IQFA 4QJIA 2FEXA 1AN9A 3H9QA 1V16B 3FJ1A 3I6BA 3ZW8A 4F9TA 1MB3A 3GIWA 5DNAA