4YXFA

Mups, a 3-oxoacyl (acp) reductase involved in mupirocin biosynthesis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
237
structure length
230
Chain Sequence
KGTIIVSGGSQGLGLTTVRCFLEAGYNVATFSRRESPAVTELSERADFHWQALDCTDYSALTAFVQQVEKRFGGLDGLVNNAATGVEGILSTMRVADIDSALDINLKGQLYLTKLVTAKLLKRGAGSVVNVSSINALRGHSGLTVYSATKAAMDGLTRSLAKELGPRGIRVNSVSPGYFSSDQTLSRIERRTPLGRLGTQQEVADLILYLVDRGTFVTGQNIAVDGGFTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MupS, a 3-oxoacyl (ACP) reductase involved in Mupirocin biosynthesis
rcsb
source organism Pseudomonas fluorescens
molecule tags Oxidoreductase
molecule keywords MupS
total genus 84
structure length 230
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yxfA00
1OOEA 4EYEA 2VWQA 3G1UA 1LLQA 2EIHA 2O23A 3JQ7A 3LT1A 5DNAA 2O7QA 3ROMA 3ZV3A 2DTEA 3VH2A 4ZGWA 1VJ0A 4B3JA 1TT5A 1XIVA 2CF5A 2P5UA 4E6PA 2ZTLA 3H9QA 2WEKA 4EGFA 2AEFA 1U5CA 3ZHZA 5CEJA 3U4IA 4JROA 3V2UA 3R3JA 4R1NA 3T7CA 1AXGA 1F14A 3K5PA 5L4SA 5IDQA 4E2YA 4WOKA 2DBRA 4CPDA 4HWKA 4E2WA 1PZHA 2HK8A 3ZWNA 3VH1A 3OA2A 4CM9D 1GUFA 1KYQA 3E8XA 5F1KA 2NM0A 2H63A 2OOSA 1YOVA 3CMCO 3CPSA 5JMWA 1PIWA 3DZKA 1BTOA 3ITDA 3Q9NA 4DBVO 1HYGA 1LBEA 4RLSA 2DTXA 5CG1A 2XF8A 3ANNA 2LDBA 4D45A 4DXHA 1U4SA 2WDZA 4NBTA 2H9IA 3H9JA 2WYVA 1Q0QA 2B4TO 2Q46A 1YDWA 3G0OA 3QJ5A 1CJCA 3LC2O 4KWHA 4LVUA 4M86A 4HNHA 4CM7A 3IUSA 1GV1A 5IZCA 1EVJA 2RIRA 2X0RA 1YOVB 2AQKA 1H9AA 3HUDA 3TQHA 1VL8A 5BSFA 4RL6A 5I7VA 4J7UA 5H81A 2BGLA 2VCYA 3L77A 5A5FA 3NDJA 2GF2A 2E82A 3IIEA 3JTMA 1AHIA 3U4DA 3VHRA 3OECA 1KS9A 2VHVA 3K30A 3DBLA 5IJZA 1ARZA 1R37A 5ITWA 5JC8A 3VVBA 3WTCA 1ZMTA 3ZHYA 4W4TA 1C1DA 3AU8A 2X0JA 5EMHA 5IG2A 3TN7A 4IDGA 5CDUA 4UUPA 1PJCA 4IGEA 1ZBQA 4D42A 2E4AA 2VUSA 3GZNA 3IC5A 4GSKA 4BQRA 3RUDA 3GNTA 4HFNA 3FTNA 3NDRA 4BV8A 1X13A 2WD7B 3AOGA 5TT0A 4RF2A 1U3TA 3U62A 4JBHA 3OBBA 5KWEA 5CFZA 5EQDA 1DFHA 2HK9A 2WSBA 1DB3A 1PS0A 1OC2A 2FHSA 3U3XA 3U4HA 4AJKA 2GPTA 2QIOA 3CINA 2ZJ0A 3ENNA 3E82A 4NIMA 5T8KA 3ZH2A 4Y67A 1C1XB 1A5ZA 3SVTA 1DRUA 2OZPA 1ZVMA 3S2IA 1NNUA 3DONA 2UUPA 3BHMA 4F46A 3ONFA 1LA2A 1R4MB 3QSGA 4B7XA 4D3SA 1OI7A 2HLPA 3PJFA 1IZ9A 5T67A 1VSVA 5TNXA 3TZ6A 1NR1A 2X22A 1GU7A 1KEWA 3WFIA 1EFLA 3AW9A 4J1QA 3GGGA 4IXWA 4BGVA 4PG4A 4EDFA 1CRWG 4NHEA 4CMJA 2O3RA 4I5DA 1E3EA 3IKVA 4TWRA 3C1AA 4UVIA 1LLCA 1PJ4A 4XYGA 5HM8A 4R51A 4URFA 2RBEA 4IMRA 4BNKA 4I5GA 3CZMA 4U8GA 2NLOA 2WD7A 4XB2A 1CERA 2G17A 1D1TA 2X4GA 1QYXA 1Y5RA 3VPXA 2YHIB 4OH1A 2PLAA 5TS3A 3EUWA 4YT8A 1VJTA 2IRWA 3Q6IA 3UXYA 3ZNOA 4BKUA 5K0ZA 4C7JA 1BRMA 1U2GA 2JJYA 4AL4A 4OGWA 2H5LA 4WCDA 1C1XA 1EBFA 2PD6A 4F45A 4DGSA 2NU9A 2YV2A 3P2YA 4QFCA 2PH3A 3K9QO 2I5PO 2WMDA 4PZCA 1NFQA 1HT0A 4MVJI 1FXSA 4TRJA 5G0WA 4W7IA 4J9UE 1N8KA 3WWYA 4WLFA 1F8FA 1BXGA 3HDQA 3OA0A 1ADCA 4DVJA 4E21A 4RZHA 1QLJA 4IDAA 2DM6A 3ZU4A 1X7GA 4QT0A 5AXAA 2ZQYA 3KHUA 4FFLA 1Y9EA 1ZXBA 2BKAA 1MG0A 4UVEA 5KVSA 1ADGA 3KSZO 4IQGA 3HFSA 7MDHA 3HB5X 2ZTVA 4M89A 2WM3A 3B20A 3JQBA 2J5QA 3ORFA 4OKNA 4QSMA 3AK4A 3VAZA 2BELA 3MZ0A 1HE2A 1AXEA 1P45A 3INTA 1KIFA 4YAGA 4KTTE 1E5QA 2P4QA 2Q2WA 3HHPA 4GQAA 4HNGA 2EWMA 3CTMA 3C7CB 1IY8A 3WBFA 1ONNA 2GD1O 2Q4EA 4UEOA 2EG9A 3D3EA 4X54A 5KKCA 3O9ZA 1QYDA 2P4HX 2VZ8A 3LF1A 1F17A 4H7PA 3LC7O 2PZLA 4IXTA 5TIIA 5ITVA 4UEJA 2EJVA 4J6FA 1EDZA 4BNHA 3BA1A 3PQFA 2I99A 4Z3DA 4NJMA 4MVJG 1JLLA 1YH3A 3VZPA 1SC6A 2YV3A 5JW6A 3CH6A 2Y05A 1BW9B 3N7UA 3DOJA 1E77A 1A4IA 1TLTA 2JHGA 4J4TA 1HSZA 5EESA 1T2EA 3D5QA 2BH9A 1NTOA 3MJEA 4JK3A 3W8DA 2YJZA 4HBGA 4C4OA 4UUMA 4Y98A 1U1IA 9LDTA 4ALJA 2YW9A 1R12A 4OXYA 1ZZEA 2F1KA 4BQPA 3C1OA 4GI2A 3TL3A 1RYDA 1YL7A 2VOEA 3L4SO 1LRJA 4RVFA 1HDZA 2RCYA 2FZWA 2ZB7A 1JKJA 3TFQA 2O50A 2EXXA 1E1MA 3PHLA 3U9LA 1Z82A 4IQ8A 5JBIA 3E6AA 2IEBA 5T57A 1TT5B 5G4LA 4DLBA 4KQWA 4CUJA 3HWRA 3H4VA 2I3GA 3ZWYA 1NP3A 5KKAA 1P0FA 3ZWXA 1X7HA 2SCUA 5K9ZA 1QYWA 2E37A 3OFSA 5EIOA 2HUNA 1DIGA 5DCWA 1R4MA 3PFWO 4Z9YA 5IN5A 4XYBA 3JQ9C 4LSWA 1EK6A 3MWDB 3JV7A 2XPCA 3JD2A 2OUIA 4GKBA 1BVUA 3UICA 4IMPA 4FC6A 1YE3A 2AE2A 2PGDA 3HADA 1IL0A 1LLUA 1NQTA 8ADHA 4YJGB 3RC9A 1UJMA 4WK6A 4DC1A 4XRRA 2Q1UA 1PQPA 1HTBA 4KDEA 4M1QA 3V1UA 1YO6A 3PQDA 3K92A 1S7CA 3A9WA 3GH3A 1X1TA 2J5KA 4PLHA 1NR7A 5TT1A 3TOXA 4QTZA 1K89A 1WP4A 2PD4A 4CR6A 1Z73A 3G79A 2JFGA 3ULKA 2Z1MA 3EYWA 1Y81A 5KJ1A 4E5PA 3MOGA 2Y1OA 5G4KA 2FPIA 4B4WA 1NPYA 4IS3A 1OBFO 4S1VA 1A7KA 3R1IA 2VHYA 4CQLB 2PNFA 4FDAA 1E7RA 3L4BC 2O3SA 4E33A 4L4SA 1LSSA 3GUYA 4XGIA 3ZWOA 4YJFA 3V5NA 4JN6B 3S8MA 1I36A 3DBRA 4ALLA 5AVOA 4PZDA 4RF3A 3WG9A 3P5SA 2Q2VA 1PGPA 1ZJZA 1ZCJA 4B8ZA 4Z9FA 2O3QA 2RH8A 4HX5A 3DDNA 5JCXA 3DAGA 2IXBA 2ZYAA 1XLTA 1I2CA 4R4JA 2NUAA 3FWNA 1NHGA 3SC4A 4FFNA 3WFJA 1C0LA 1HL3A 4DRYA 1JAXA 3GN1A 1I01A 4MP3A 1UZNA 3GEMA 1JN0A 3EDMA 1UUFA 5L53A 3TFOA 2G76A 1UDCA 2EERA 2AW5A 4Y6SA 5DP1A 5A02A 1GD1O 4NBUA 2A94A 2Q1TA 4ZN6A 1FF9A 3MTJA 5ER9A 3Q3CA 5IZ4A 1YB4A 1Y1PA 2PZMA 1Y7TA 3DQPA 3FTPA 3I3OA 1QP8A 3KZVA 1ZK3A 3KLPX 4Y9DA 3H5AA 1OAAA 5KOIA 1MC5A 3QV1A 1GZ3A 1NX6A 3NAQA 1NQOA 3E9QA 4Q3EA 4YWJA 3FPCA 3HB4X 2FR8A 2W2KB 4DIFA 3DZIA 2BFMA 2X7HA 1P44A 1YBVA 1EVIA 1PEDA 1AHHA 3E48A 4CV2A 1VPDA 2OMEA 4TVOA 2GDZA 3VDQA 4B3IA 4HXYA 4AJEA 1T2CA 5A1TA 2GNAA 2VHZA 2Y93A 1PJQA 1KY4A 3K96A 3WLFA 4CMBA 1YGYA 1H6DA 3DFZA 3PJEA 4NDNE 1DXYA 5F1OA 5JO0A 5KJCA 4PG5A 1Q0LA 2WD8A 2Q1SA 2CVZA 2PK3A 2X58A 1IYZA 1DIRA 2B4QA 4XEHA 4I5FA 1UXGA 2X8LA 4J0EA 3V1YA 4ZQBA 4AJ1A 4B3HA 3LK7A 4NFYA 1XR3A 3GDGA 1W8DA 1DJQA 1BDBA 4IY1A 2D59A 5F3RA 4FIZA 4PLPA 5G0UA 3RCBA 4EW6A 4Y6PA 4ALMA 4FN4A 4MPDA 1ENYA 3VKUA 1V3VA 4AJNA 4MVJP 3WIEA 2VNSA 1XDWA 2EJWA 4J4BA 2BFAA 1MP0A 2V65A 3WS7A 1P31A 1QV7A 4AG3A 2C2YA 3DZGA 3BMCB 1JW9B 5A03A 2B35A 2EP5A 1B8VA 2HJSA 2O48X 1C0PA 5JDCA 3P19A 3E9NA 1XCBA 2POQX 3OIDA 2D5CA 1P33A 3IAHA 1E3WA 3F1LA 3JQAD 2GCGA 1PQUA 1M66A 3HE3A 1IULA 4IJVA 4BO1A 4LISA 4XGKA 2FR0A 2DLDA 4H3VA 4MVJM 9LDBA 4GX5A 4DUPA 4CMCA 3BHIA 1PR3A 3WYEA 1N1EA 1QMGA 2I3AA 5C7LO 1JWAB 4N5LA 5LDHA 1SZJG 2OXIA 4I1IA 1CYDA 2DTDA 3BYZA 2ZQZA 3OICA 4OJNA 2CUKA 4JBIA 3RI3A 3ROPA 4ROSA 4NH4A 1XHLA 4P38A 2NADA 1WMAA 3SJUA 1LDEA 4TROA 5FYDA 3OJOA 1CQIA 1M6HA 4GX0A 4EITA 3PI7A 3OJFA 1KOLA 4W9NA 3ROQA 5B4UA 3ENKA 1HXHA 1YL6A 2R2GA 4WCFB 1LSOA 3QQPA 2GGSA 4CMHA 3OEWA 2GN4A 4R3WA 2Q49A 4L75A 3TZQA 3RIHA 4Q3CA 2I6TA 5MDHA 1T2AA 1LI4A 3VKVA 4XB1A 5GZ1A 3PWSA 5DOZA 1VM6A 2OBNA 5COBA 1EBUA 1TT7A 2BMAA 4O59O 2YV1A 4A7PA 6ADHA 4CLRB 5HTOA 4CLHA 3FNEA 3IL2A 3KBOA 2HMSA 2G5CA 1O0SA 2H6EA 3H9GA 4HFJA 2FY8A 1HE4A 3TF5A 1NVMB 2Q4BA 4FJ1A 2C29D 1HETA 3I5MA 2HAEA 1JU9A 1TI7A 1H5QA 1LJ8A 3GMSA 4TRRA 1KEVA 3PGXA 2GZ2A 2NTNA 2Y1FA 4XZ3A 1E6UA 4H16A 4WCFA 1ENZA 3OJ0A 5CHEA 1V0JA 2ZTMA 3K31A 5G4KB 2YDXA 1N7GA 2HSDA 3B1FA 2Y1EA 4D41A 3TZCA 4BGIA 1G0NA 1U8XX 3JQ6A 1EQUA 1H2BA 2OHXA 5A3JA 2QQ5A 2VZ0A 2QG4A 3GRPA 1GFSA 4RQTA 3JD4A 4MVJH 4AJJA 1I2BA 5EINA 2CD9A 1M2WA 1FDVA 3E5RA 3PTZA 3PP8A 1YRLA 1HDRA 3DMTC 1HLDA 3OP4A 4L74A 4E5NA 2CNBA 2WE7A 1UH5A 2VWHA 1HZJA 3ICPA 4E5YA 4DQUA 4PVCA 1D4FA 1YL5A 2GZ3A 2X5OA 4HP8A 2NU8A 3WQSB 3AM5A 3FF4A 4CL3A 2GR9A 3UHAA 4INAA 2ET6A 2C82A 3S1LA 2BRUA 6LDHA 1QR6A 2ZB3A 5U4QA 1NPDA 4UEKA 3ASUA 1S6YA 3BMCA 3JQEA 2OO5A 7ADHA 4DPMA 4I5EA 2W90A 1HDOA 3IUPA 5LDGA 4J16A 1EQ2A 1Y6JA 3W4IA 2XAAA 4NFSA 1VKNA 4ALIA 3PIDA 4OQZA 4XYEA 1VLLA 1BWSA 5COAA 3L9WA 4R5HA 1ISMA 1QSGA 4U5QA 5THKA 3CUKA 3RROA 3W6ZA 3HN7A 4ID9A 5B12A 4Q3BA 2Q50A 1R4NB 4Z0PA 4IGFA 3OH8A 3DFUA 2DBVO 2JD1A 5HBRA 5HA5A 3I1JA 4HUJA 5TSDA 5JS6A 3EVTA 3DL2A 4FQ8A 3MOIA 4PGFA 2B0JA 1KC1A 4QO8A 3TZHA 3DXFA 1NWCA 4BNLA 3EK2A 4YTEA 5BSHA 5BNIA 3Q9UA 4R1SA 4BO8A 3EZYA 5A06A 3HQ4O 1EE2A 3I9OA 5IZCC 5JSFA 1XKQA 2Y99A 4PRLA 3MJTA 4CM6A 4CMEA 2C54A 1Z75A 3QP9A 4RZIA 4E3ZA 2NVWA 5J23A 1XSEA 2QHXA 4ZVVA 4BB5A 3H65A 1PR9A 3WOHA 1I3LA 8LDHA 3ZZNA 2JD2A 2BFPA 2LDXA 1ENOA 4NPCA 1E7QA 5DCUA 4FFOA 1GCUA 4BNIA 2CDBA 1MXHA 5T5QA 3H3JA 5GY7A 2Y68A 1ZO8A 4CM9A 3RUHA 1ADBA 1B26A 2W2LD 3GVHA 3TOZA 3V1TC 1H9BA 1W6UA 4AJ4A 1NQ5A 4PLZA 3MCVA 2UAGA 3DBVO 3NV9A 4RV9A 1RWBA 4LGVA 4YR9A 2HMTA 2BI8A 4HY3A 4DA9A 4Q3DA 3K2EA 1DC4A 4DC0A 1B14A 3EVNA 1Z7EA 3V2GA 1Q7GA 3VTFA 3DHNA 3WIDA 3W8FA 1MGOA 3GEDA 3H3FA 5A9SB 2B69A 3H5NA 4J90A 1CWUA 1ENPA 4S3MA 5JCJA 2NTJA 5JE8A 4NFHA 3DO5A 4WKGA 2PGLA 1XELA 1JWBB 2NWQA 4ZA2A 5KIAA 2A4KA 3BMOA 1GADO 4FFRA 1DJNA 3KYCA 1GL3A 5L51A 1KVRA 1XWFA 1JQBA 3DOCA 1CIVA 3EY4A 3JQAA 5IDWA 1GQQA 4W9NC 2R00C 2ZK7A 1P3DA 4KUEA 1NVTA 4YRBA 1ZIDA 4YVFA 2DT5A 4NR0A 4GMGA 2UV8A 2B36A 3GVPA 5EN4A 2YHIA 1E1LA 4FGWA 3RKUA 4K6CA 3SX2A 5I9NA 3F47A 5A9TA 4XX0A 3ABIA 1V9LA 1GAEO 2WYUA 1PTJA 1SB8A 3W1VA 3GT0A 4B7UA 4PN3A 3DC2A 5JY6A 4JP3A 3ZGYA 4BNGA 4CMIB 3VC7A 2O3TA 4CV3A 5JAZA 1KVUA 3JCZA 2D8AA 3KTDA 4ZQGA 5AXDA 3ZU2A 3H7AA 3KETA 1K6IA 1DEHA 4ZJUA 1F0YA 3INGA 2J8ZA 5AXCA 5JAMA 3G17A 4MIEA 2FSSA 3MEQA 4UVDA 1HKUA 3D4NA 2NQTA 3RC1A 3T4EA 4BKPA 4D0RA 1UR5A 4RVUA 2Q2QA 4A0SA 4GKVA 3PEFA 4BB6A 1N1GA 3AJRA 3NKLA 5DBFA 2P9EA 4E0BA 1OZAA 4CM5A 3ITKA 1PGQA 1LDBA 3BMNB 3QHAA 4KOAA 3RKRA 1YDEA 5KCZA 4MKRA 3VPSA 1F06A 3WJ7A 1H6AA 5KVVA 1ZUD1 3TWOA 4CODB 1K6XA 3ZWCA 3BTUA 4RPKA 2AMFA 1EZ4A 1OC4A 4O5OA 4XKJA 5C7OO 1OMOA 2X0NA 2ZB4A 3O03A 2FR1A 1NBOA 2X86A 1BVRA 1QORA 3PK0A 3MJSA 3WYBA 1IE3A 1JKFA 4Z3KA 4XR9A 1FMCA 2DFVA 4OHUA 3F3SA 4YRAA 3GRKA 1XG5A 3ZV4A 3L4BA 1YQXA 2NVUA 3KRTA 2C5EA 2DPHA 4AJPA 4CJXA 4D46A 1DIHA 3L6OO 4K9DA 4GBJA 3FBGA 3QWIA 1D7OA 4WLUA 1NQAO 2IYPA 3ASVA 5ENVA 4B4VA 1AUPA 1FK8A 1TXGA 1DAPA 3EMKA 4BO6A 3GNQA 1KERA 1NASA 2NVBA 1Z45A 2C20A 4M49A 2VYNA 3E03A 5TLSA 4Q3NA 2IE0A 4XQGA 4OOEA 3WMWA 1JVSA 4CQMB 5ADHA 1K6JA 4KMSA 4Q3AA 4HKTA 2FMUA 3AY3A 3KM0A 1I3KA 1X14A 4UUOA 4LMRA 4K6FA 4ND3A 1GEGA 1XQ1A 4J7XA 3VPGA 1JDJA 2X1HA 3N74A 3GLQA 2I9PA 2VNAA 4R41A 3EAGA 1MLDA 4L4XA 1ULUA 4XA8A 1WAMA 4BGUA 1WVGA 2DFDA 2Q99A 3D4OA 2J3IA 2YHUA 1XU7A 1Y5MA 2O2SA 4RPHA 4CM8B 3GK3A 1CETA 1AE1A 1ONPA 5AQ1A 3H2ZA 4U0KA 3KLMX 4CUKA 3KVOA 4CM4B 3VVCA 4OIMA 4DL9A 5KJ6A 1YQDA 3N58A 3A06A 4MIYA 1P74A 1QV6A 1VC2A 2HCTA 3BHJA 4B79A 1U7HA 3DMYA 1SAYA 4JP2A 5T8KC 2HQ1A 3RUCA 3ADOA 4LSMA 4D43A 4MVJD 4DBZA 3ZWWA 5TJHA 1A4UA 2NQ8A 5CDTA 2AA3A 4QECA 3LT4A 4HFRA 2YFQA 2PZJA 4DLLA 1P1JA 4NJOA 3SEFA 3AUUA 4DREA 2ZTUA 2B5WA 3NX4A 3ONDA 3FNGA 2NU6A 1LSJA 2Z5LA 3EGOA 4J0FA 2PA3A 5I8ZA 5T64A 4MJLA 4ZQFA 3BAZA 4YBZA 2UDPA 4HADA 4U6SA 3RFVA 4FD3A 1G0OA 2PKQP 1A9ZA 3FR7A 3IS3A 4Z0HO 5JPIA 1RM5A 3B1JA 3AOEC 2VYVD 3PVZA 3DBHA 4PFJA 4BO7A 2J3JA 3ICCA 5IF3A 4BNZA 1ULSA 3GFBA 3DHEA 3GUCA 2BD0A 3V8BA 4E5KA 3UN1A 3S2GA 4DYVA 2AQIA 3ZNPA 1B2LA 4JXKA 1DHRA 5JDCC 3ZW8A 1GCOA 4JX8A 4U6QA 3FCOA 2TMDA 2CDAA 3X2FA 1RYEA 1GQ2A 4RF5A 2D2IA 1ZSNA 4R3NA 1SOVA 4FBGA 5A3VA 1I30A 1PJ2A 1WPQA 2FN7A 2VN8A 4AJ2A 4NG5A 3WSVA 4IJUA 2AG8A 3F5SA 3AFMA 3JQCA 3RBXA 1SO8A 2DPGA 3L6EA 1O95A 3ZDFA 4IBOA 3O26A 3SC6A 4IZHA 4PLFA 4CV0A 4Z6KA 1G6KA 4LRTB 4H15A 4BMNA 5JYDA 1LRLA 4F6CA 3DZBA 5AOVA 4R01A 3I9MA 4OL9A 2DC1A 3KV3O 3ST7A 3LT2A 3KOUA 4MKZA 4EUHA 5DF1A 4IDFA 4Y6RA 4DQVA 2G82A 2NU7A 2PWZA 1R16A 3HNPA 1RKXA 4ALKA 1R6DA 1HZZA 4CQLA 1EMDA 2ZYDA 1QYCA 3FBTA 3MJVA 3Q2KA 3GGPA 4LW8A 2VRCD 2QRLA 4NU6A 3TZKA 4EEZA 1E7WA 1K5HA 2O2YA 1PZGA 4XD2A 2HJRA 1U9JA 3C7AA 3C7DB 2GYYA 4YAIA 5DCYA 3RVDA 1BXZA 4IDBA 5ENDA 5MGBA 3LT0A 3RQSA 5GMOA 3M1AA 3H2SA 2DUWA 5L7YA 2WWRA 2GERA 3ZWPA 1X15A 4FJ2A 3RC2A 2P2SA 2GN6A 3KSDO 3OIFA 1W0CA 5HWSA 4OYRA 3FNFA 3DBHB 1LDYA 3NTRA 3RBZA 2CVQA 3WQQA 4WLNA 1EEHA 1WZIA 3QVOA 1R0LA 1ML3A 3M6IA 3DBLB 1TEHA 4U0JA 3WX0A 1KEPA 1KVQA 2G0TA 5JC1A 4YJHA 4E32A 5KJFA 1VKOA 4BO9A 1JAYA 1HF3A 2HK7A 4B4UA 4ZICA 3QVXA 4YT2A 5BNTA 2YDYA 4MOWA 5LC1A 3F4BA 1I32A 4B4OA 5JY1A 4ZQEA 2Y66A 3JD1A 3GZ4A 1J4AA 4CMIA 3QLJA 4O0LA 3BTOA 5IN4A 5K6AC 1UP6A 5DDIP 1LRKA 2E6UX 4JGBA 4MVJA 2O4UX 4PLVA 1ZK0A 4BGEA 3O8QB 5TJ9A 4JBGA 4IIUA 3PFFA 5CDYA 3VH4A 1CF2O 1GZ4A 1Q7BA 1K3TA 3PDUA 1HE5A 5IFLA 1ZNQO 4N5MA 4W7HA 2A35A 4RJTA 3LVFO 3HDYA 4PLYA 2HMUA 3X2EA 1HDGO 2D1YA 1N92A 2EV9A 2QYTA 3AM4A 2C7GA 4A26A 4NU5A 1UDAA 1YWGO 3MJ4A 4E2ZA 5CG2A 1QRRA 1X7DA 2P9CA 4A10A 5ES3A 4R68A 1V8BA 3NDIA 4NJMB 2ZCVA 5DULA 2QRKA 4WPGA 1FDTA 3W4JA 1O94A 5A9SA 3U09A 5CPFA 2OGUA 3D3WA 4FW8A 1WDKA 4OM8A 3PXXA 4XJTA 2XXJA 4P4LA 1EUZA 3LF2A 2V6BA 3CSDA 4LCJA 4D3FA 3T7EA 3I9JA 3QWHA 5ILOA 3UFXA 4RVSA 1AGNA 1R0KA 3ZNNA 3GPDG 4I8XA 4KZPA 1RM4A 3PLRA 1HDCA 2VYND 1F12A 2X5JO 5H83A 2C07A 2ZATA 1BDMA 1PL6A 1VRWA 1H6CA 2HKIA 3JQGB 1I0ZA 2XXBA 2GO1A 3PHHA 3A4VA 4KUHA 1BMDA 2R00A 2DAPA 4WLEA 3WTBA 2W8ZA 2FPPA 3NTQA 1SMKA 4F6LA 3I9KA 2QZZA 1U3UA 3AOEA 1H0KA 4PLGA 2GUGA 4BO2A 3WXBA 3LDHA 4XIYA 1B7GO 5KNLA 2RAFA 1XGKA 3UCXA 3AUSA 3AY7A 2J5RA 3F46A 1BSVA 5IDXA 1E6EA 1LX6A 1W73A 1WMBA 3S55A 1YONA 1JA9A 4PLCA 1PGJA 3DZHA 3B1KA 2CMDA 3RC7A 1YB1A 2W4QA 4WLOA 3D1LA 4FOOA 1E7YA 3WGTA 1LLDA 3ZHBA 3JSAA 3OEYA 1HWYA 3HZZA 1PQWA 1IHXA 4PG6A 2Z1NA 4TRMA 5BNFA 3WGZA 3ZU3A 4E31A 3I23A 4BNJA 1WLYA 1Y8QA 3QE3A 4E5MA 5IXSA 3RUIA 1P9LA 3WGHA 3JQ8A 4J3FA 3BXXA 3PJDA 5JXWA 2EKQA 4ONEA 1KVTA 3ETGA 5CEEA 4XJSA 2BF7A 3G49A 1ORRA 2AEMA 2O7SA 1T4DA 3TRIA 2B4RO 4MP8A 2CF6A 3WMXA 2A9FA 1FJHA 4WJZA 1SOWA 1U8FO 1Z6ZA 3AWDA 4CMEC 3S2EA 1PS9A 5TRTA 2B83A 3KUXA 4M8SA 3STHA 3T4XA 4P4NA 1WDMA 5BQFA 1FDWA 3DWFA 3O4RA 1WXDA 3UH1A 2JFHA 1WZEA 3BIOA 3JQGA 2X23A 4MIOA 1ZK2A 1ZK4A 1ZH8A 2OP0A 3I4CA 1XYGA 4KP7A 1UP7A 3UCEA 1KEUA 3GG2A 3P7MA 2V6FA 4IQ0A 5G2OA 5IXYA 4YEDA 1XA0A 4BO4A 2V6GA 2GSDA 1LU9A 3U0BA 3KYCB 4UUNA 3L0DA 1ZSVA 4PRKA 1Q1NA 2JL1A 4FB5A 1YVEI 4E2XA 4OQYA 4M55A 3FN4A 4WLVA 4BO5A 3RJ5A 1UXIA 5T6BA 1VL6A 5KVQA 1M6WA 5F5NA 3Q11A 4D79A 4II3A 4CM4A 1A7AA 1B0AA 1LTHR 3GZNB 3GY0A 3OMLA 1XQ6A 1B16A 2GN8A 1P1FA 2X9VA 3AI2A 2W2LA 1C3VA 4TKMA 3CMMA 3C3XA 1DOHA 1WWKA 1X0VA 5JDIA 4AJIA 1BXKA 3SLGA 4TVBA 3OETA 3D3WB 2H1SA 4TQGA 1PWXA 3AUAA 3D7LA 4XQEA 2PD3A 4N7RA 1GEEA 4BNMA 1I10A 1L1FA 1ADFA 3KYDA 4CMGA 2OORA 3LYLA 5U9CA 1RM0A 3GF4A 4E12A 5IAAA 4P22A 1KETA 3RUAA 4WGGA 4UVGA 1DRVA 3KYBA 3QA9A 1A71A 1NFFA 3ON5A 3AI3A 1PU2A 4PVDA 4OKIA 4YJDA 3O38A 2Y1GA 3NT2A 2YQ5A 4YYZA 3WSWA 3UKOA 4PCVA 4OMUA 1HRDA 1YKFA 4A03A 3KYDB 2G1UA 2EP7A 1Q2XA 3Q0EA 3W4KA 3PWZA 1M67A 2AHRA 1R0SA 2EF1A 2JAPA 3LU1A 3WDSA 4CUZA 4CLXA 2I67A 1PZFA 3OIGA 2BLLA 4QFDA 1CQJA 1O89A 3AY6A 4J4HA 2Y67A 2QYSA 1T1RA 1LDGA 1MV8A 2P5YA 1DO8A 4ILKA 2HU2A 3ROKA 1LC0A 2CZCA 1NFRA 4LCEA 4QEDA 2GLXA 1SB9A 5B37A 2Y0EA 3M2PA 3UOGA 3CZRA 4L4RA 4DQXA 1PX0A 1UXKA 1T4BA 2XOXA 3FNHA 4FCCA 5ER6A 3GG9A 4BMVA 4IDCA 5BT9A 5L7TA 1D3AA 2YZ7A 1RPNA 4BS9A 2PKQO 3DEYX 4XDZA 1PJLA 2VT2A 3NYWA 3WGYA 1UZMA 4KWIA 4CLDA 4IINA 4UVHA 1E3IA 1YBMA 2C2XA 2EKLA 3L07A 3DMTA 3GDOA 4RVHA 3OQ1A 1U4OA 3DAPA 2C5AA 5B4TA 2FSVA 4NK5A 4MO2A 4P8RA 1RM3A 1PL7A 1E1NA 2JCYA 4RF4A 5JLAA 3VH3A 4BNVA 3WR5A 4G5HA 3E1KA 2CY0A 2NVUB 3MJCA 4TZTA 1LQUA 2BHLA 1IOLA 1NM5A 1DAOA 3I83A 3I6IA 4RPLA 2FPGA 4B8WA 4EJ6A 3PIIA 4LMPA 2YY7A 4CLOA 2B37A 3WWZA 4KUGA 3D5TA 1LSUA 3LQFA 4NBRA 1T25A 4YQZA 3JYLA 3PZRA 4JJIA 1L7EA 1E3LA 4GVXA 5A4DA 1SBYA 3PHIA 2VUTA 4YT4A 2IDZA 5JYEA 2EGHA 2DU8A 3QIVA 1XEAA 4Q39A 2P68A 3UGKA 2F00A 3FHLA 2DKNA 1HSOA 2D0IA 5DOVA 1Q0HA 5F21A 2ZCUA 1NXQA 2WTBA 4FSHA 5G0SA 5COQA 4WNIA 1YJQA 4GWKA 4ZQHA 5JMPA 2E48A 2UVDA 1H2HA 1HDXA 4IIVA 3OHSX 5GZ6A 3K73O 5EQFA 2GN9A 4OSOA 4CR7A 5CEFA 2DVMA 4I9NA 1YBAA 4L0QA 2NNLD 3OJEA 2FWMX 4I9HA 3C24A 4GGPA 3U4CA 3RAJA 2ZIZA 1P1HA 2JAHA 3OQBA 5FFFA 4N54A 3CKYA 4EJMA 2TMGA 1M76A 4AVYA 2WJPA 1QG6A 3CIFA 3E5MA 5TX7A 1ZEMA 4XRGA 4IJWA 5EERA 3DOOA 3NRCA 3TNLA 2DUUA 3F6YA 4XIJA 1B8UA 1PJ3A 3C85A 3EW7A 1GYQA 1YB5A 2X5KO 4U7WA 1QXSA 5HRUA 3NTOA 4L8VA 3QRWA 3GC6A 1ZEJA 3QVWA 4R9RA 3NJ4A 4ND4A 3RFTA 1IPFA 4E13A 4CMAA 3GPIA 2X9GA 3VPHA 5C5IA 5L7WA 3SLKA 3PZBA 3ZWBA 1T26A 3Q1LA 1Z74A 2DQ4A 4UULA 5L3ZA 3UW3A 2J3KA 2IZZA 1E5LA 4P4GA 4N18A 3FSRA 5G0VA 5I9MA 3WGOA 1I8TA 3IDSA 5DZSA 5THQA 3VTZA 4BMSA 1BHSA 2JKVA 3I9NA 3IP1A 3LC1O 2IZ0A 3BMOB 1E6WA 4UAGA 1P1IA 1C1DB 3QWBA 5I7EA 4A73A 1X1EA 4QO7A 1G1AA 1GYRA 2JFFA 1T24A 5DP2A 4GMFA 3A1NA 4K1LA 2OP1A 3P2OA 3PYMA 2BFOA 3MTGA 4HFMA 4TKLA 5A9RA 4XDYA 4NZ9A 4BO3A 3GFGA 1MG5A 4BIIA 2Q3EA 1NPTO 1SEVA 1L7DA 2PZKA 3CXRA 4DLAA 4O63O 3FD8A 1DRWA 1DLJA 4YDRA 5JO9A 1JTVA 3GDFA 2AQHA 3JQFA 2DBQA 2CVOA 3PPIA 5I7SA 2EKPA 2BGKA 4BNTA 4RPGA 3VZSA 2JHFA 1AN9A 1VE9A 3GGOA 3WICA 1I3NA 3NJ8A 1B3BA 3TL2A 2EEZA 1Y8RA 3RWBA 1T2FA 1ZK1A 3TJRA 2Y1DA 5JAIA 4CV1A 4W6ZA 1EE9A 2RHRA 3ADPA 4CQMD 3WNVA 3IJRA 2HRZA 1TVEA 4MVJE 3GA0A 3IKTA 2QZ9A 3JQDA 4ITUA 1MFPA 1O8CA 3L9XA 3ZWAA 1LQTA 4J7CA 1IHYA 3PHJA 1IZ0A 4NQZA 4DIOA 1QKIA 4IDEA 4NNJA 1DDOA 1R4NA 1B3RA 1W4ZA 3GOHA 4GX1A 4DYDA 4J9VA 3RFXA 3VZRA 4RCVA 4A5OA 1GTMA 5CAEA 4FFPA 2FZEA 1PGNA 1A9YA 5KJEA 4G2NA 5FF9A 2AQ8A 4RVDA 1A27A 2P91A 2IYOA 1N7HA 2Y0DA 1EDOA 5ICSA 4FR5A 3OM9A 2BGMA 1V6AA 4J43A 1MXFA 5DT9A 4FC7A 1EUDA 5L9AA 4TZKA 4R1UA 1B15A 2NSDA 4AICA 4L76A 4FPXA 4RDHA 5ICMA 4BUCA 1WDLA 3AU9A 3DTTA 3JQFC 4O1MA 3ANMA 4A2CA 1QYVA 3UF0A 4CM3A 4EZBA 4KQXA 1LNQA 2FRDA 4ESOA 1TA4A 4NI5A 1U3WA 1PZEA 1ISGA 1P1KA 4Z0TA 1DFIA 5BSEA 3A28A 4F3YA 3UVEA 3M2TA 4XQ9A 2CSUA 1DLIA 1ONOA 4RVGA 3WGIA 1WNTA 5G0TA 2VT3A 4I08A 3LLVA 1ISJA 4MINA 3VZQA 4IS2A 4BVAA 3IP3A 1DFGA 1NAIA 1J0XO 1DC5A 1A72A 3H6KA 2E49A 3F4LA 3JQAB 4GGOA 4YA6A 1SCUA 1BW9A 1SEPA 2VUUA 2OL4A 4GPD1 2I76A 5U1PA 3WYCA 4OAQA 3GMDA 1VI2A 3IJPA 1ZXLA 3R3SA 3F5QA 4IZIA 1T1SA 4EUFA 3ANLA 5CP8A 4BO0A 1Z7BA 5TC4A 4W99A 1I3MA 1F8GA 4EI2A 4BNNA 4XQCA 1PL8A 4IPTA 5AXBA 3QVSA 1IUKA 4CM8A 3PQEA 1EVZA 2VYVA 5KVCA 2YFHA 2C0CA 2O3UA 2VWPA 3BTVA 1EFKA 4MDHA 1H93A 1BG6A 3E18A 2Y0CA 1LC3A 2R6JA 4RGBA 2UYYA 2ZJ1A 3JQBC 3SXPA 4DTIA 4ND2A 1N9GA 3K8ZA 3AM3A 2NV6A 2GASA 2P9GA 2ZKLA 4XWYA 3NGLA 4LN1A 1NVGA 4TRNA 5ILGA 4J1SA 5JNLA 2PV7A 3KO8A 1RJWA 3AUTA 3NT4A 5IDYA 3DZJA 1V3TA 1Y8QB 1Y9AA 4WEQA 4CL8A 3ZCXA 2ZYGA 3PYLA 4WE3A 2ILTA 3NGXA 1DSSG 3K2BA 3GHYA 4WCFC 4IJKA 1BXGB 3G3EA 3FI9A 4NMHA 3WNQA 1E0DA 1MX3A 4R54A 4HV4A 3IMFA 4LK3A 3WJAA 2W98A 1U2DA 4OSPA 3QWFA 4RPJA 1K2WA 1UAYA 1GY8A 1D8AA 4NK4A 4FJ0A 4J2HA 3V2HA 5A5EA 1ZFNA 5I7FA 4CMKA 1U28A 1J6UA 1Y8RB 2IEDA 4C7KA 1E7SA 5JAQA 1ZW1A 3RBVA 4ALNA 2D3TA 3EHEA 4GX2A 3TDKA 4JLWA 4BOYA 3JYQA 2IXAA 4XYMA 4I9UA 1M75A 3DB2A 1UAGA 2X0IA 2AG5A 4BKOA 1MUUA 1YS4A 2Q1WA 2W2KA 3ZN2A 3ONEA 1LXCA 3ZV6A 2FP4A 3KEQA 4KTVE 1SPXA 3PYXA 1DC3A 2WE8A 3PGJA 3JQ8B 5FI5A 1E3WB 3HDHA 4LRSB 2NTVA 3HSKA 4JJGA 3INRA 4CR8A 5C37A 2QW8A 3D4PA 4DMLA 1HLPA 4YT5A 5DBIA 1K0UA 1N5DA 1IPEA 4IDDA 3DR3A 3H8VA 3HN2A 5B1YA 3B70A 3F1KA 1ZMOA 2OBYA 4NBWA 3ZV5A 2PY6A 4M54A 4XYLA 5L95A 4CQMA 4EUEA 3GQVA 4O6VA 1YQGA 4RDIA 5EJ2A 4CM1A 4PLTA 1V3UA 1TB4A 5F5LA 1Q7CA 2PH5A 3GR6A 1HDYA 3DAFA 4JQCA 2V6MA 2HO5A 1CEQA 1MB4A 1E1KA 3MWEB 1N9GB 4BNWA 3R0IA 5L40A 1GUZA 3AFNA 1NAHA 2VRCA 1O5IA 4ND1A 5A05A 1E3JA 4WEOA 3IQDB 1VJ1A 4AJLA 5JDIC 4PLWA 3GAZA 3ZWVA 3VOSA 4YAEA 2VHXA 2GZ1A 1MC4A 1PS8A 4E30A 1EVYA 3HDJA 4G65A 3W6UA 3RD5A 4CLOB 1O6ZA 1P1RA 2AXQA 3LLSA 3JYOA 4K26A 4WNCA 4UREA 3BMQA 3COSA 1I33A 3I52A 3C1TA 1C0IA 1R15A 1XU9A 4D7AA 1R66A 2X9NA 5K6AA 5EPOA 1GZ6A 3ZWMA 4LVCA 1GPJA 2OFPA 3LSYA 2V7PA 3D64A 3VDRA 3JD0A 1UXJA 3OJLA 3CE6A 3WB9A 3RU7A 3RUEA 1J49A 4EJ0A 1PSDA 4D3DA 1JVBA 3WGQA 3KB6A 4Y8VA 4AJHA 1IB6A 4YJGA 5BR7A 4MP6A 3W8EA 4GH5A 4E4YA 1B8PA 1GYPA 3ZNQA 4TSKA 2PTGA 4R1TA 2J3HA 2VZ9A 3GEGA 4ND5A 3GVXA 1E92A 3I9LA 3WGGA 2RH4A 1E7MA 1UXHA 4J1NA 5FWNA 3WLEA 3GN2A 2JCXA 1DC6A 1GV0A 3L6DA 4OXNA 3QVTA 5CDSA 1P77A 2A92A 3ZI0A 1VSUA 3FWZA 4L73A 3LZ6A 2UUOA 4CLRA 4FFMA 2PR2A 2ZB8A 4YRDA 3TSCA 2C7VA 1UDBA 2VWGA 3JQ7B 3NEPX 1CDOA 4ZU3A 1KY5A 4BNUA 4YAKA 1I24A 1I5RA 1O9BA 3BMQB 1FDSA 4GSLA 3GVIA 4J91A 1ISFA 2EW2A 1GR0A 3JQ9A 4YJFB 1V35A 2CFCA 3FR8A 1DIBA 4YB8A 2IODA 2AE1A 2QX7A 4EEXA 3ZU5A 3PWKA 4N5NA 2B5VA 3DBRB 2C59A 1NHWA 2I66A 3KXDA 2I65A 5FEUA 3R6DA 5C3MA 5JCJD 1PWZA 1UP4A 3OSUA 3I4FA 1HYEA 4XGNA 1NYTA 2YUTA 4IM7A 2VTEA 4JIGA 4ZRMA 4J49A 4BNXA 1U5AA 5BSGA 3DZFA 2DBZA 1EK5A 1H6BA 3S2FA 3CEAA 4DPLA 2QRJA 2YYYA 2PKRA 2BI7A 4ZRNA 2VRBA 1FDUA 1PJSA 3DHYA 1LDMA 1KBZA 3RASA 1ZKMA 1GPDG 4R9SA 4RQUA 5C7IO 1D1SA 3GHHA 4YAJA 5EL0A 3KSUA 3EZLA 4DMMA 5HS4A 1PJBA 4BL5A 1ISIA 1HEUA 3FPLA 5L4NA 3HFGA 4R69A 2D4AA 3HJAA 1ID1A 4JNKA 3H5RA 4RORA 4L9RA 1ZSYA 2O3JA 4BHTA 4GL4A 2PGJA 1JKIA 2J6IA 4EBFA 3SJ7A 1KVSA 3I6QA 1PJTA 3BTSA 3O8QA 3OF2A 3PHGA 1DHTA 4II2A 4DWVA 1HYHA 4J2OA 2D5AA 2IZ1A 3ZW9A 3NT5A 1GDHA 4BKRA 3ZHXA 2VTDA 1HE3A 3GAFA 5DBGA 3DTYA 2PFGA 2NACA 4PIVA 3H9EO 4DPKA 3K6JA 1DBVO 1UZLA 5L4LA 4BNYA 1PGOA 5LCXA 1GUYA 2Q45A 3E9MA 4PG8A 4FGSA 3AI1A 3HG7A 4MVJF 3B6ZA 4NBVA 4AFNA 4GVLA 3RUFA 5A04A 1DPGA 2EGGA 3H9UA 1J5PA 1C0KA 4CLEA 3BZUA 3NUGA 4YJHB 1YJ8A 4OO3A 4RO0A 3RSHA 3QWAA 3U49A 3C8MA 2CDCA 1ZJYA 3VPFA 1P0CA 1DIAA 4WUVA 4KDFA 3WQRA 2JCVA 5TQVA 1BGVA 1GQYA 4Q9NA 1I2ZA 3SBOA 1X0XA 4PG7A 4OOFA 4DIBA 3FRJA 4FS3A 4K28A 5I9LA 3F9IA 5HS6A 4WASA 2X6TA 4YXFA 1T2DA 1KC3A 3G1TA 2WYWA 3PRJA 1MFZA 5H82A 2HDHA 1LDNA 3BMNA 1EUCA 4Z9XA 2HMVA 4J1TA 4BKQA 1OFGA 5AYVA 2VQ3A 5JFOA 3PLNA 2VHWA 4QUKA 5CPBA 4YQYA 4B7CA 2Z95A 3QW2A 4QX6A 4QXMA 3UUWA 4GLLA 3A14A 3JYNA 4R5MA 3PDJA 4MKXA 1QLHA 3UAGA 4WECA 3GVCA 3EC7A 5DN9A 4A27A 4YPOA 5I8WA 3RJ9A 1YXMA 3GNSA 4YCAA 3OQ6A 3U5TA 4JJFA 3WBBA 4GAEA 3TPCA 1E3SA 5TGDA 2EW8A 4OXKA 5GZ3A 4BV9A 4ZD6A 4R16A 3QY9A 4BNFA 1H94A 2Y1CA 1LEHA 1N2SA 2O4CA 2GRAA 3M1LA 1C14A 4W82A 1WW8A 4GWGA 1LUAA 2HRBA 2YQ4A 4XR4A 4G81A 4ZHSA 4IUYA 4D44A 2EHDA 4XCVA 3D0OA 1MA0A 4PZEA 3UCFA 4M87A 2RHCA 4JCOA 3JYPA 4FOSA 4GLOA 4YACA 5L45A 2HMWA 1VL0A 3JD3A 3RU9A 5B4VA 1SNYA 2VOJA 5TF4A 4AJOA 4D0SA 4QQRA 3Q2IA 1U3VA 5F1PA 3PJGA 2FOIA 2JD0A 1ISHA 4WOJA 3KEOA 1U7TA 3IOYA 4TMFA 5KTKA 1NWHA 4RLHA 3ETDA 5FI3A 2AEJA 3ETEA 5CDGA
chains in the Genus database with same CATH superfamily
3R3YA 1H23A 4EYEA 4L0MA 4F4DA 4IFBA 1T9ZA 2AXEA 2JIQA 5DNAA 2O7QA 3FW1A 4A16A 4EKGA 3VDNB 4ZGWA 1EI9A 1W2HA 1FYXA 3LMKA 4E6PA 2D5BA 2PMBA 2WJGA 3AZOA 5HUQA 1K5GA 4HEJA 3U7QB 5KINB 1MO6A 2D1QA 4E88A 2HWKA 1JBQA 1A0OA 2ANCA 2ZSDA 3G2NA 4YUVA 5L4SA 4FZVA 2TSYB 1K7XB 2G36A 5IDQA 3GJTA 2M6RA 4E2YA 1RXIA 3I72A 1N0VC 3G8CA 1AZTA 4E2WA 1UOPA 1TRHA 1Z28A 1I6MA 1I4WA 2YYAA 4CM9D 1QTNA 1G8FA 1YQUA 3BH7A 2YN0A 3Q7IA 4R2JA 3WC4A 4RLFA 1RT9A 5JMWA 1LPAB 3K2IA 2QZJA 4YHBA 3P0IA 4B2YA 4Y1RA 4E2FA 2ZJ3A 2QTRA 3NTVA 4OU4A 4S12A 1QDEA 4EVIA 1TKAA 2R1ZA 2E18A 5EMMA 4RLSA 3T3OA 3EVBA 3K0BA 2AIRA 2FU5C 4RM3A 1IHDA 5CG1A 4QDOA 4MA5A 4ZOLA 5KSWB 1FYVA 3AEUB 1RQLA 4M0PA 3STWA 1P6UA 2DP4E 4D45A 3Q12A 4DXHA 4TXMA 3ELDA 2VFAA 3TCKA 2RGDA 1Q0QA 2Q46A 2Z0MA 3AHIA 1W36D 3HCAA 1WUIS 1U3FA 3MUEA 3S5JA 1Z0DA 3E3AA 4HNHA 4CM7A 5ABPA 3HXTA 5IYZB 3ZDDA 4I4NA 2XGGA 1GGMA 3M5WA 1E1RA 2AC7A 3BK2A 3B6EA 3GV0A 2JLWA 1KJ9A 3CKKA 1RS0A 3UMSA 2XUFA 2RIRA 1AMNA 4NZOA 2XOKD 1E9RA 4K7JA 1QIJA 4DLVA 1YOVB 3TR5A 4WACA 4AP5A 2DG2A 3C3EA 2AQKA 3IBFA 3INYA 1KSJA 1FFXA 1XYYA 3HUDA 3N3AC 5BSFA 1NMQA 4RL6A 2XCOA 5DNYB 4RELA 1VYTA 3QX9A 5H81A 1VPVA 4EHDA 5JJ5A 4GQBA 4LZLA 4KRYA 4JYMA 4FHDA 3TSAA 4B76A 2GF2A 3E61A 3C5HA 1SVSA 5EUQB 5LP6A 4E14A 1R2QA 3JTMA 4OHXA 1AHIA 5AI0A 4RXUA 2R87A 2QN2A 1HV8A 1KS9A 2XMZA 3LX6A 4RIHA 3ZUGA 3IB6A 5ESDA 2VHVA 3VR0A 4A0RA 4YRZA 1ACJA 2YWCA 3D7NA 3K30A 4ZKDA 1UPBA 4YRLA 2QJTA 1R37A 5ITWA 3OM1A 4L0CA 2A1IA 3ZHYA 3NH9A 3O95A 4W4TA 4N0MA 3IQZA 5EKXA 4NZPA 1DUIA 2C3MA 1MENA 3ZYCA 4ZZ2A 3HN6A 4OMDA 2XLBA 5FOTA 5CDUA 2D0PB 2L19A 2WUWE 4I6GA 4WI1A 1I7DA 4UUPA 4ZAWA 4IGEA 1V1RB 3HNRA 1XZCA 4OBWA 2JGDA 3PQCA 4CBVA 3BE8A 2VUSA 3GZNA 3WYGA 4WFKA 1KJIA 1P2UA 3F6EX 3IGFA 3VJLA 4PSDA 2NUTB 1V48A 1A95A 2BDEA 1MO4A 1SCNE 1W94A 2XGOA 3PRYA 3RH0A 1E2FA 4UBMA 2HSGA 4OHWA 1S1MA 3W5UA 3C41J 1CUYA 2XRFA 1R4ZA 1X13A 2YHBA 1NW5A 5DI3B 3T3GA 1PCXA 1Y89A 2DKFA 3U62A 5JRJA 1NIPA 1XRSB 3HWSA 2ALJA 2YFYA 5FL3A 5TMDA 2QUAA 3DHVA 4FNOA 1O4WA 3K35A 2GPTA 3CINA 2Y3IA 2IITA 2ZJ0A 1EK1A 3E82A 4LI3X 2VK1A 3Q7PA 1Y8CA 4N65A 4Y67A 4CRWB 1WB9A 3WWPA 1ZVMA 3S2IA 3WKBA 2X9QA 1I0LA 4F46A 2DH5A 1KZ4A 2YRFA 1WNFA 3ANXA 1JQDA 1WM1A 3RYTC 1WZ2A 3LPLA 4B7XA 2CUTA 1J23A 2ETXA 1PUJA 3TZ6A 2UYGA 3LVRE 1HL7A 1ORIA 2BFEA 4EO9A 1KKUA 1KEWA 3F74A 1D0VA 4N3GA 3CBQA 2FWPA 1WULS 3C3MA 3JVUA 4BGVA 1XZGA 4PG4A 4NHEA 1G6HA 4Z4HA 2OKGA 2O3RA 4I5DA 4Q15A 4TWRA 3ZCVA 2J9RA 4C4RA 3C1AA 3DE4X 1ODFA 1LLCA 1MMFB 1PJ4A 4XYGA 3X2SA 5HM8A 4URFA 1ULAA 4IMRA 1BWRA 4BNKA 1BVHA 1SD5A 3L01A 4C04A 1IBLB 3CZMA 2WD7A 2G17A 1HYBA 2BCJQ 5F2KA 3KD2A 3LHIA 1Y5RA 2ORED 5KWVA 2YHIB 3M3DA 3FWPA 5TMEA 3IBGA 3OLCX 4UTOA 3UXYA 3MPUA 1VMIA 3B3FA 5HIAA 1H8EA 2IV2X 5BW8A 1U2GA 2PT7A 2FUNB 4ON9A 5LKRA 4L27A 4OHMA 4AL4A 1K63A 2H5LA 5CU7A 1U2DC 1WCXA 1A5SB 3BDVA 3IBCA 2YV2A 3P2YA 4QFCA 5FTWA 1EVKA 3PI6A 4TRJA 1NFQA 4MVJI 4B6RA 2PEZA 5KU7A 1VFPA 3OPYI 4W7IA 1HMPA 4GOMD 5G0WA 2J0SA 4J9UE 2E2WA 3RAPR 4WLFA 4IHJF 4Q05A 2BTQA 3DE6X 1YKSA 2WYOA 5UKDA 3AQIA 4N7MA 3ZU4A 5AH0A 1D9XA 2QTMA 5AXAA 2ZQYA 9GPBA 1E20A 2JGIA 4R0NA 1IXKA 2BKAA 4UVEA 5BY2A 4MR8A 2ILVA 3DDHA 1E1CB 5BOSB 1ZD2P 3DLIA 4IQGA 4KIUA 2X9LA 2FGJA 2XMDA 2O2ZA 1B00A 2ONCA 3HB5X 1XTSA 4RJKA 5KTPA 3W5BA 2H4ZA 2JVJA 1MC1A 3B20A 3TW8A 2IPAB 2PX6A 4D57A 1BEUB 3ORFA 4C30A 3LWBA 3VAZA 2H7VA 2R4TA 1HQYE 2ZIXB 3OY2A 5JVDB 3TH5A 1FQKA 3W7AA 4OHVA 2GXUA 3INTA 3H84A 4YAGA 1GPYA 1EA7A 3HJCA 1HT3A 4KTTE 4PGGA 2QLLA 4BQQA 2QTNA 4WFQA 2Q2WA 2OD2A 5FULA 3HJNA 1ULHA 3C7CB 1IY8A 1UFRA 1EH5A 1OA1A 4UEOA 1C1YA 4JYBA 4MKFA 4TM8A 4F21A 3KKQA 3TD9A 4OHZA 3USCS 3W6PA 4B40A 3E3NA 1PTKA 2P4HX 1F17A 8MHTA 2Y76A 3UZUA 2AFIA 1LKZA 3OFJA 4K9QA 3RGGA 1AA6A 2GEUA 5B2EA 4BNHA 1EDZA 3GELA 3H0KA 3BA1A 3TNJA 3PQFA 2Y9PB 1BGXT 5IKEA 2RH5A 4QDKA 1R6VA 4FKBA 3G0BA 1JLLA 1S0UA 3VZPA 2N0SA 1EM6A 2HK6A 2WICA 3WY9A 3EIXA 1XUOA 3V4SA 1BW9B 3TRHA 1H4SA 3GZTB 3HKEA 3HYCA 3E0QA 1AZSC 1E2MA 1Z8FA 2HBQA 1A4IA 4ZTUB 1PRYA 3V6LA 4KX5A 4N6NA 4AZ3B 1P0PA 2PCLA 2JHGA 2MYTA 1HSZA 1OLXA 4UU8A 1W1IA 3MJEA 2C98A 4HBGA 2BFCB 4BLOA 3HP7A 2HXGA 4URUR 4WKNA 3R9WA 1Z6XA 5AW6A 2QT0A 2OD9A 4QD3A 2YW9A 3PITA 4AF8A 2O07A 3CONA 2QVZX 3HA5A 2QNBA 2WTAA 2AN1A 3G85A 4GI2A 4GOND 4GYJA 2WK1A 3ACCA 2VOEA 2C9YA 3L4SO 5BUCA 3A4TA 2FZWA 1W88B 2ZB7A 3TFQA 4B75A 3MINA 3QEMB 3PHBE 1IATA 2RAVA 4JKOA 4IQ8A 4LOJA 5DH9A 4EL0A 3MSXA 2BR3A 3WRVA 2HSEA 2IEBA 2AC4A 2V55B 2RGNA 1TT5B 2I3BA 2W7TA 4CUJA 1BH2A 1UMDB 4L16A 1LJLA 1VTKA 3N2GB 4GW3A 2I3GA 4AZ0A 1FRFS 2PVCA 1E66A 4HTFA 4LYEA 2JH3A 5KKAA 2R0QC 3O31A 3AKDA 2GYVA 4OBEA 1HM5A 4RA9A 3FDIA 4TV8F 5H4GA 4U2KA 2AHOA 3CX3A 1RWVA 1ICEA 2JJ8A 4AY4A 3WLOA 5JMTA 1UCFA 5TE9A 1A98A 2HTFA 2OUIA 3JR7A 3WI7A 3TDMA 4QGAA 3DLPX 4HS9A 3U7RA 1QH1A 3PL5A 4L7QA 1PBTA 1V39A 3R5FA 2ATIA 5IJ0B 3EPLA 3L7JA 3AXSA 3NRBA 1QQAA 1RXSA 3I04M 4GOKA 4M0EA 2GPYA 4ZPXA 1AUQA 1X7XA 3IAAA 3IRUA 2WW8A 1Z2CA 4AKSA 2FFHA 2GN1A 4XRRA 1VLJA 4OQ4A 4B3BA 4YJKA 2RJOA 2A0WA 1HTBA 5KYUB 3DP7A 4FFDA 1YO6A 4BMDA 4PLHA 2J5KA 5DEOA 1J22A 1OROA 2C9MA 4V38A 4UD2A 3KAKA 5TT1A 3SDBA 3UFBA 2WWYA 5CYGA 2F3TA 5CT4A 3IERA 4A2PA 3FI0A 3FPEA 2N9UA 2I6XA 3RJTA 3ZE8A 1JHPA 1Y81A 2H1FA 3CHYA 1DV2A 4NYJQ 1DJMA 1DZIA 3P20A 2P90A 2FPIA 1DQNA 2OK8A 5F73A 4PX9A 4IS3A 5AVQA 1Y1TA 4JJAA 3AF2A 1Z47A 2O3SA 4ETMA 4L4SA 4ZDJA 2Z8YM 1OX4A 4JN6B 4MTCA 1TD9A 1I36A 3DBRA 3LXXA 4Q9DA 5AVOA 3IPLA 3OKPA 3RK1A 2YC2C 2FMIA 1JDSA 1Y33E 3HWX1 3VBCA 3ORHA 1LV8A 3OF5A 1CJSA 1ND6A 3CZ5A 4Z9FA 3A31A 3SQLA 5K8VA 5LP1A 3DAGA 3O4GA 1E1RD 2QTGA 3TUJC 2ZJOA 3W9YA 4D80A 4ZGGA 3I53A 3L8ZA 3CE9A 2BMWA 4FFNA 2QX4A 4M0MA 1QH9A 1ZUNA 1C0LA 1OHHA 5HVNA 3V6MA 1H2EA 3W5JA 5DTQA 3GEMA 4LKOA 1UUFA 1CJUC 2XNJA 1G2OA 5E4TA 3EG9B 2AW5A 5A02A 4LJ5A 5DP1A 4EFDA 3L0ZA 4NU0A 3KQOA 1Q7EA 3EWSA 3KAPA 4PFQA 3WLKX 4IO0A 2PQ2A 1JHZA 3RARA 1QDUA 3VR6D 3CNLA 5J1TB 2EFJA 1Y1PA 3J7AC 2CK3D 2PZMA 4S05A 2CJWA 3D3JA 3DQPA 3EQZA 5ES4B 2YWBA 3FTPA 3KZVA 3NBAA 1ZK3A 4WSOA 3SHOA 1XJ5A 2R6GA 3QF7A 4QOEA 4ZOBA 5DHFA 1LK0A 3OLVA 1MC5A 2DGDA 1GAQA 3ZLTA 5A5VA 1GZ3A 4M9XA 1UL1X 1J9ZA 1KAGA 1OE0A 3E9QA 3T7SA 4AN0A 3ILSA 4TN1A 3FMFA 4U9HS 2FR8A 1MDBA 4DIFA 2WMYA 4I1YA 2Q5IA 4B3XA 5B5SA 2ID9A 1SVLA 5B6PA 1W52X 1YBVA 2BFDB 3LKVA 3UV6A 4EYQA 2FE1A 4MUYA 4MW0A 2P9TA 2YJTD 4TVOA 2GDZA 1E63A 3FDZA 1YZHA 1IUNA 1T2CA 2XNSA 5U4XA 3T8YA 3QYJA 2GNAA 4AJEA 1JT9A 5HZKA 2Y93A 4LRWA 4ND7A 2MR5A 1CFZA 2YWFA 5D5PA 3HVJA 4Y9TA 4S0XA 4F84A 1V5GA 4MWSA 1NXTA 4CMBA 2BLNA 3CLUC 1ESCA 1Q92A 2WIGA 1H6DA 3DFZA 3P9ZA 7REQA 3CNBA 4NDNE 1DXYA 3W34A 5JQGA 2QQEA 4R2WA 4CG2A 3TW6A 3EZXA 3HJRA 5IAJA 4MW2A 3EQ8A 4F38A 2CVZA 3FUCA 1RQGA 1T9BA 1IYZA 2WINI 1YQTA 3PQ7A 1UXGA 2X8LA 3CGWA 4J0EA 2IHKA 2X42A 3HYRA 2ODPA 4ZQBA 3OD1A 2OGTA 5DM1A 3FZYA 4MWGA 5JYBA 3OFKA 2XSZA 1NU8A 3UJ8A 3VR6H 4EY4A 2D59A 4NEGA 1N5OX 5BYJA 2YY5A 2L18A 3L4JA 4FIZA 4PLPA 2JANA 2SBTA 2BGUA 1HK7A 4JEIA 2XDAA 2VAMA 2FWRA 3LNCA 3BSWA 4MPDA 1XNHA 3VKUA 3WHKA 1V3VA 4Y6GB 4YBRA 5ESWA 2KPOA 4C5BA 2VF5X 2VNSA 1XDWA 4QOJA 4F92B 5EZQA 3PFHA 2JDID 1L4KA 1P31A 4QSHA 1W0KA 3QPDA 2G8NA 2OEPA 2ZPUA 3ASZA 3EDRA 3OUZA 5FPSA 1ABBA 3CVYA 4MDFA 2YUIA 1C4WA 1IRXA 3P9SA 1B8VA 2H1CA 2X2EA 3GX1A 4YRNA 2B7BA 1SKYB 2AZDA 2ZS8A 2WNHA 4N9QA 4Q4CA 1XCBA 2GFIA 1OF1A 1SCKA 3OIDA 1CXZA 1JSXA 4ZO8A 3R75A 3KQNA 2D5CA 4IJVA 1QH0A 3W5CA 4KDRA 2P6MA 2APJA 2QS9A 2ZUDA 3HDVA 1HZZC 3UKJA 4EGSA 8ABPA 1GRVA 2IYQA 2QLNA 1A8UA 1NVDA 2C2ZA 3TEMA 5C7LO 2I3AA 1U8EA 1YCGA 3HJUA 4IICA 2FSVC 5M7EA 2AJ8A 5FWXA 1N2IA 4Q1CA 3BJIC 3NOOA 1SJ9A 3DZDA 1GG5A 1CYDA 3K9BA 1UEIA 1SUFA 1VECA 3HGTA 4R2HA 5ALFA 1VG0B 4BFSA 3C48A 5B3KA 3PPXA 1Z07A 1XTUA 5GADl 1WMAA 3KJFA 2ZUVA 1KE1A 3BH6A 5FBLB 1LDEA 4UXJA 1SKBA 2CXPA 3FVRA 2OV2A 2BTEA 3FMPB 1Z0IA 3N8DA 3NPAA 3ZD8A 4DCGA 3RLIA 3OJFA 4HYYA 4KCGA 4YCSA 4YK7A 3EZ9A 2PDAA 1RRKA 2C3OA 2OHIA 2X6RA 2Q6TA 5B4UA 2XZLA 1C7FA 1DBWA 2R2GA 2GUWA 2Y1LA 3EQ7A 4P7BA 1L7XA 2YN4A 5CURA 4L6CA 2GGSA 4R3WA 2GN4A 3ESDA 3EVCA 1YA4A 4RY9A 4MRAA 3JQRA 1KNXA 1WV0A 4RSHA 4ZYVA 5MDHA 2C7QA 1PJ8A 4HLUC 3Q5DA 4MJ7A 2BM8A 4RHEA 4XB1A 4L1KA 3O84A 3BIJA 3S68A 4NENA 3KELA 4FDLA 1K68A 5FLXA 1K27A 1EBUA 2BMAA 2O0KA 4TQUS 5COBA 3VQTA 1ZUNB 1GRRA 3ESCA 4G56A 4PONA 1QE3A 3TUIC 4QJ3A 1Z5VA 4NMMA 1UOQA 3KWLA 2G5CA 3M6WA 3KOXA 5AD1A 3SSOA 1LF0A 4QPNA 4HFJA 2FY8A 1T4CA 3AHHA 1L0BA 3KJGA 1MABA 1GJRA 2RK3A 1V8ZA 1BS9A 4HB3A 1LH0A 2YZKA 4RXMA 3FZNA 2XJ9A 4ILEA 1Z3IX 1BO6A 1TI7A 1YS9A 5HJ7A 5JD4A 3ZV7A 3CLTC 5CCDA 3GMSA 4AMBA 4DJFC 4UOZA 2UUCB 1S2IA 2HBYA 1K8XB 2NAPA 5B2ZA 2QMEA 4NYJR 5B12A 2Y1FA 3M82A 4XZ3A 1E6UA 4H16A 1GUBA 1NRIA 3ONNA 3A9CA 1E9FA 3QTBA 1ENZA 3O4JA 1T5HX 3OJ0A 5AM3A 1LZKA 3VNVA 3A27A 1Z2AA 4NEQA 2HSDA 1CQWA 3LY9A 3ZY3A 2Y1EA 2DERA 3ZD9A 1L4NA 2A1TS 4L3WA 2PL3A 2JARA 4GLJA 1AS2A 1EQUA 1R0XA 2OHXA 5A3JA 4P08A 2YOHA 4Q1DA 4ISCA 3OQVA 4MVJH 3AFIA 1NVWQ 2ZROA 2WP8J 4NDZA 5EINA 1FDVA 1C7EA 1Y5IA 1Q14A 2P0EA 1DT3A 2WFAA 3KSMA 3ND9A 3OP4A 4Q34A 1GLVA 4E5NA 2IHZA 4TXHA 4FZRA 4KU4A 2V7WA 3KV1A 4NAVA 4TYQA 4XX0B 4BFCA 1LBSA 3LY7A 5E8RA 4E5YA 4DUGA 2FOXA 3D1VA 4MWBA 4HP8A 1MQ9A 2CLEB 3AM5A 1ZIOA 3RC8A 2BF4A 1MRSA 3FF4A 4H7JA 1MABB 3FJ1A 1RHJA 4WA7A 1GPBA 1U9IA 1SUAA 3QFCA 4W8OA 4DM4A 2VAVA 1QZXA 2ZB3A 4YIKA 2Q9AA 2ODNA 1NPDA 3ASUA 13PKA 1S6YA 4HL6A 4JY7A 2FWIA 3BMCA 3LQ2A 4G4IA 5E95A 3D6FA 4CL2A 1SHLA 2V1XA 3KZNA 7ADHA 4DPMA 1HLGA 4I5EA 3H4MA 4QM6A 3ER9A 2W90A 2VJQA 3OFND 4QHYA 5LDGA 2IUUA 3IX7A 1Y6JA 3VMFA 3W4IA 1AKYA 4OP1A 2XEXA 4ALIA 2OCDA 1PK9A 3EXFA 2VUIB 4YWHA 5KKNB 3H0EA 4HC4A 4XYEA 5AICA 2Q3LA 1BWSA 3NVAA 4DA6A 3Q7RA 1MX5A 2QL9A 5LFAA 3L9WA 3W6ZA 2JFNA 2FH5B 5THKA 4HDRA 3CUKA 1JZQA 5LQMA 4ID9A 2HMYB 1SQGA 3WB1A 3IELA 1XL0A 4FHFA 1C30A 4M7PA 3EZNA 2P6UA 3ABRB 3OH8A 2H4YA 3HSYA 5HBRA 3FPBA 1WX1A 4N3BA 3RREA 5TSDA 1H8HD 3NC4A 1KFBB 2H9YA 1WHTB 4PGFA 1KC1A 3CLSD 4PANA 4BNLA 3EK2A 3MFQA 4YIHA 4D6XA 4H60A 3HEMA 4GM0A 3EIWA 3A1FA 4WXPA 3WRXC 5BNIA 3DNFA 3U7HB 4CF4A 2Q3MA 3QBJA 4O3MA 3HQ4O 5FV4A 2POCA 1E4EB 4N8DA 1O95D 4PRLA 2QLMA 1NBMD 4C7OA 3W7BA 4CM6A 4CMEA 1Z75A 4OSEA 2O8CA 4E3ZA 4IIGA 4ZVVA 2ORWA 4HNSA 5ECYA 4BB5A 3RYIA 1KYYA 3NHKA 4D9CA 4N6OA 1E6KA 5E0KB 1GLNA 3E7WA 3OPMA 2XZDA 5H1YA 5A6SB 4DA0A 2LDXA 4NPCA 4OUDB 3TQOA 2QYHA 3B8EA 3RS3A 2CSXA 1FMFA 1GCUA 1QZUA 4ZHSA 2HI0A 3QPBA 4YC7A 4COOA 4YRGA 2C5SA 1W75A 2BFFB 3PG5A 2VZEA 4FHGA 4DV5B 4DSOA 1HFJA 4KQ1A 2H1RA 4K9NA 2P6PA 1B1CA 2W2LD 1FRVA 1D09A 1W6UA 1WP9A 2GK3A 1BIFA 5HQTA 5JRZA 3BGOS 3FMGA 4PLZA 4OAPA 4X91A 4QQKA 2BSXA 3NV9A 4F5DA 3VGPA 4LGVA 1WRBA 3IBSA 2FPOA 3O9MA 5EE3A 2VR1A 3WGNA 2HHAA 3FLEA 4DA9A 4Q4HB 4JITA 5CYOA 5JR3A 5CYFA 3EVNA 1Z7EA 3V2GA 1YB6A 4A8JC 4EF4A 3UENA 2RJNA 4HQ6A 4DUYB 1MGOA 2W6ID 2LD4A 2VT6A 3QG1A 3Q3GE 4AECA 3H5NA 4KFTA 3C1UA 4FILA 1PT5A 4FYIA 1LTQA 3VYSB 4HH4A 1SXJE 3T9CA 4C0KA 2K6GA 3T5TA 5A2GA 1RAIA 5LQKA 2PGLA 4JI2B 1EDEA 4FGUA 4OFWA 3SX0A 3N05A 5DLDA 1JMVA 1GADO 4FFRA 4G37A 3QF4A 3WLIA 3DOCA 3OZDA 1SOUA 1CIVA 3RW9A 3QLUA 4FR2A 2EP8A 2GBIA 1L5HA 1Z8NA 3UAXA 5EHZA 5KC9A 2ZK7A 1NBEA 1OTYA 1NVTA 4YRBA 1MN6A 2FPGB 4H6XA 4Q03A 4I2NA 4IKEA 3RSLA 1R5NA 2Q3DA 3WB0A 3GVPA 1WBJB 1FOEB 2YHIA 3S99A 4ZI7A 3IILA 1N3BA 1FLDA 4JKYA 2GRJA 2ZXFA 4OYLA 3QU7A 3F47A 2VTBA 3UAZA 1Y3CE 4UPEA 3NWBA 1XHEA 3H9BA 3MBOA 4MV4A 4YCDA 1V9LA 3BGVA 3EXHB 2X5NA 3FYUB 3GT0A 3FYUC 3CU5A 3T95A 4L02A 1N2ZA 3QPVA 5EWMB 1QZZA 2ZBPA 4X1IB 4G67A 2QVBA 4JOSA 2NU7B 3F98A 4ZV4A 3B53X 4G0PA 3OJCA 1KVUA 3NWPA 4QUIA 1B73A 2YYSA 1N5KA 2WU0A 3HZHA 2H2AA 5DN6D 2G6BA 3ABSB 1PR1A 5K3FA 3ZU2A 4D9GA 2GCEA 2Q5CA 3GW8A 3K9NA 4X6XA 3LO5A 2P1DA 3WWDA 5LXTA 1PZMA 1JYFA 1NKSA 5CT6A 1PUIA 1UODA 3PC3A 4EFLA 2RGBA 4O4HB 4OG2A 4RABA 4BQEA 4ZJUA 5DYNA 1F0YA 2X1LA 3INGA 2J8ZA 4H6WA 4X62B 1UT6A 2ZYVX 2Z57A 5EC8A 4LJKA 3Q3VA 1FVHA 3RC1A 4HN9A 1BOOA 3NJRA 3PFCA 4FD2A 2QTAA 4KPUA 2PT9A 1WV1A 2HDOA 3NHRA 3PF8A 4GKVA 3PEFA 4GUDA 4JGGA 1IK6A 2DFTA 2QTWB 2AXPA 3AJRA 4PQYA 4TTRA 4U2FA 1ZW6A 5AW8A 3SR0A 4E0BA 2ECQA 2HMAA 2QG9A 1BKDR 1S8AA 1IDOA 1LDBA 1G8SA 2H0AA 3ROGA 1KMHA 3H1BA 5JZMA 5LIRA 5IKMA 2ZJYA 4BIMA 1F06A 3WJ7A 1H6AA 1W19A 3CWQA 4DUZB 1C3OB 2VQEB 4ACAA 2QJOA 1E64A 1K6XA 3T9AA 4O2BF 1L8OA 3BTUA 5BW5A 4DDKA 1OC4A 1PDOA 4A6XA 2YWHA 3T4PA 1A8SA 4PO3X 1OXVA 2R7MA 2X86A 3WLLA 1SHZA 4MCJA 3RHTA 3MJSA 2FWBA 2FEXA 2XQIA 4HDSA 1JKFA 3K4PA 1SPBS 3PDIB 4XR9A 4TTQA 3BWBA 4YUXA 1XZNA 4EVSA 4R2KA 2DFVA 2G6TA 5AFSA 3V4VB 3ISTA 5HTKA 3PQ6A 4JVSB 2WT9A 1RWQA 4K81B 4K6MA 2V9ZA 3RWMB 3ZV4A 3L4BA 3ZKAA 1CB0A 1VL5A 2NVUA 4AJPA 4CJXA 5K3EA 4EFKA 4GBJA 5THXA 3QWIA 3CQ9A 3SC2A 1DAFA 3ASVA 3VJMA 3ZJTA 1AUPA 4KV9A 1TXGA 5AW5A 3ICVA 1P4RA 2P5TB 2O7NA 4KO2S 2EFEB 3GNQA 2OGWA 1JPUA 5B3LA 1JMKC 4M49A 2VYNA 1D5CA 2Q3BA 3PKZA 4OOEA 4OHRA 1WS6A 4MUJA 3LCMA 4EZIA 1K6JA 3DM9B 3LCRA 3QOYA 5E4FA 3LBNA 4MW4A 2FMUA 4CKCB 5C8ZA 3KM0A 5KPJA 2G9QA 3EBLA 4OGGA 3EHDA 5LYJA 1WKBA 4DCSA 1QHFA 1GEGA 1XQ1A 4DDUA 4YCBA 3TGLA 2ZPAA 3N74A 1DZ3A 3GLQA 5JSYA 2I9PA 2VNAA 3IVCA 4M1OA 3HM9A 3P0EA 1ULUA 4RV4A 3PEVA 1WAMA 5JG7A 3D4OA 3TXYA 1Q12A 2O2SA 1YCHA 3RS7A 2Z4TA 4IWXA 2C84A 5CT5A 4J07A 3ZGXA 4U5XA 1SWVA 3P4UA 2E4XA 1HT2E 3CS3A 4JWKA 1E9AA 2XUZA 3GT4A 3H2ZA 4URWR 3KLMX 5EVJA 3N6XA 5ALMA 5CA0A 5FWDA 4CUKA 2JFOA 4L5CA 1NY5A 4EKDA 3NIBA 1YI8A 3UH0A 3VVCA 1X1CA 3WSTA 4OGFA 1RZ3A 1YQDA 4ZCRA 4MIYA 1P74A 3MBKA 3A1EA 4UOQA 3G2QA 2HCTA 1NYRA 3BHJA 4XD7A 3RIEA 5K0LA 3G0HA 2FXIA 4D0GA 3AHGA 2HQ1A 3ADOA 4LSMA 4XWOA 1YRHA 3LDFA 3SMVA 4ESHA 1U7OA 2QRQA 1A4UA 5TJHA 4QYWA 3MMXA 1TDJA 2AA3A 3HYLA 1JEOA 4Q7MB 1LFDB 2YFQA 2H65A 3GI1A 4YLEA 2AV6A 1P1JA 2MOKA 4NJOA 5HW0A 5LQRA 4HLCA 2OWEA 4EX6A 1ESDA 5FTLA 3A3YA 2GBPA 1US8A 1BE1A 1XTRA 4M0UA 1FU8A 1QO9A 4AZ3A 1VIVA 3IALA 1UFOA 1KYTA 4BWYA 1GSAA 3UW1A 3TX6A 4AWBA 5AHKA 1LSJA 6YASA 3USES 2I4TA 4KJXA 3VNSA 1GP2A 5DXAA 3KJZA 5T64A 5FBZA 2D7JA 4IUDS 2HWXA 5BQXA 2I7XA 1R3UA 3BAZA 4YBZA 2RMKA 2HHLA 2UDPA 3IP6A 4HADA 2CJFA 1ZUIA 4AWAA 5IM5A 1V5WA 1A9ZA 3IS3A 2VAPA 2EHJA 1MPTA 2F3QA 2WNIA 2QAJA 3F7MA 4OFXA 1TJPB 1RKVA 1E79D 4X85A 3C4QA 3IURA 1IXSB 1PSZA 1MAVA 1VGQA 4MUGA 4YFVA 4LJAA 1ULSA 3PNOA 1GQRA 4B6PA 1RWWA 1P7ZA 3MLAA 2RHHA 1LCIA 1UBUS 2IY8A 3UJ6A 4QLAA 4BX9A 1SUSA 1YI0A 1QGAA 1J8DA 2GHQA 3RVRA 4WESA 4FHZA 1J7JA 3FG9A 4UASA 4HAIA 4JX8A 2XI4A 2YIJA 4EHBA 3PA8A 2TMDA 5AJUA 1EESA 1W76A 4X63A 2CLFB 3B7GA 4LJLA 4TPKA 1TC2A 4P32A 4RF5A 1VL1A 1ZSNA 2XVAA 4H4EA 3W05A 1ODCA 1I30A 3ESZA 4PQGA 4JUDX 5C5DA 1A9RA 2PCJA 1ZD3A 2AG8A 3FMIA 5M2QA 1C9MA 4DJDC 1W5EA 4PZ9A 1P18A 1A4RA 3EIOA 3U7IA 2P4EA 5C9ZA 2EDAA 1O95A 1ZCAA 4IBOA 3O26A 1H2FA 3SC6A 4YMTA 2XWQA 4Z6KA 3D7MA 1TM2A 3RS0A 1ODSA 3WL8A 1LRLA 2GFHA 2NZ8A 1MVLA 3DZBA 4L7VA 2NUPB 4LYHA 4R01A 5AOVA 3VNRA 1FUYB 5IUJC 1XMQB 4G1FA 1D7AA 2A7XA 4GPEA 4A6PA 4DW8A 2DC1A 2J85A 2J0UB 1FEZA 3J7TA 1YZYA 2OCKA 3IV9A 3KOUA 3LT2A 3GLGB 1P9WA 5BVGA 3QENA 2I4RA 1C9DB 3ANTA 3I5XA 1WY5A 1P2GA 5DMXA 1R16A 5JBQA 3I5YA 1J70A 5J5VA 1RKXA 2GVZC 3DWEX 4N5DA 1R6DA 2NXEA 4PNHA 1HZZA 4KE7A 3ZGVA 4QULA 3ZW7A 2RHBA 1QYCA 3MJVA 2FFQA 3GGPA 3PVSA 4F5WA 3KR9A 2MHCA 4AUEA 4XVRA 3AFOA 4Q12A 4EEZA 1E7WA 3TQCA 1JDTA 2J9GA 4IW3B 4K5QA 3IVAA 1HTTA 3C7DB 4YAIA 1ESEA 2KBEA 3RVDA 5MGBA 1U9ZA 3LT0A 4JLNA 3H11B 2I7DA 1FS4A 3G5TA 5LSAA 1Z18A 1KAEA 1KOJA 2GERA 3ZWPA 5JZ9A 5EQTA 2I2CA 3I9V1 3TLKA 1W581 2G88A 3RC2A 2HHJA 2P2SA 4QBTA 5TB5A 3RSZA 3RG8A 1HYQA 5HWSA 3FNFA 4N5HX 1Y3IA 3RBZA 2OG1A 4IYJA 4CF6A 1R0LA 1ZHFA 2J5BA 4RMHA 3M6IA 3DBLB 1G9TA 1WXWA 3LG2A 5FI1B 4ATNA 4DSTA 2D13A 5CTJA 3A25A 2LV8A 4YJHA 3HC7A 3COPA 2HR1A 1TQ6A 3PENA 1A9SA 2JLQA 1WSAA 5JS2A 3IPXA 4I81A 5C53B 3AKCA 3FRHA 3NNSA 5LP6B 2AN3A 5LD2B 1TVKB 1DKPA 1YAJA 2MSCB 4QNNA 2HK7A 4M8LA 5LMUB 1FFYA 4S0ZA 2Q1XA 2XT0A 3NM4A 1L5OA 4L8WB 5CB8A 2Q6OA 3LECA 4F3CA 5LC1A 5LYYA 2X8AA 5AM1A 3HBNA 2I22A 2VDVE 4M7WA 3ZWKA 2Y2VA 4ZQEA 3JD1A 1QIDA 3U7JA 1IMOA 1S96A 3OX1A 1IXYA 3QLJA 4O0LA 1GNPA 3R2JA 5K6AC 1USWA 3AR3A 3ZK8A 4ZT5A 4DA7A 4F2DA 721PA 2E6UX 3IA2A 2C4TA 2O4UX 4V39A 4G0UA 5JJLA 2FQQA 4BGEA 1RMYA 1T9GS 3AP2A 4QQFA 4IIUA 1BFUA 3PFFA 3DUFB 5EI5A 5CDYA 2PWYA 2AK2A 3I3SR 4NCAA 1H3EA 2C4WA 1XRMA 1CF2O 4FN5A 3U61B 2G28A 2V7XA 1RXEA 4W9RA 2ZI5A 5GPBA 1JDPA 1ZWLA 5B6IA 1RPAA 4W7HA 2R60A 4ZAVA 4E11A 1EB8A 3KPVA 4G09A 4IXNA 1KZ9A 2AWNA 2OCIA 3UM9A 3X2EA 4EAAA 4F8YA 1RAHA 2QYTA 3L0SA 1UDAA 2CFSA 3KQQA 1YWGO 3O8CA 1G19A 4PZUA 1TVKA 4BWGA 3RVBA 1J2EA 1UM9B 2Z9BA 2X8JB 1JG1A 2P9CA 3Q5GA 4GM1A 2EZ4A 5ES3A 4CIDA 4FT4A 1IOZA 1V8BA 2H16A 3ZI0A 4Z7NB 3L7KA 1VLZA 2ZCVA 4N7JA 5DULA 4HNQA 4WPGA 1BN6A 1NVFA 3MUFA 3FGPA 3C98A 3QI2A 4MWEA 5JAPA 1OX6A 3LGSA 2BZSA 4DV3B 3HR4A 5F3WB 1UZAA 3D3WA 3WQBA 1WDKA 5BV0A 3OZIA 4RA6B 4P4LA 1E8NA 2QY9A 5K1ZA 4G07A 3PXGA 3CNEA 2WR8A 3ECCA 3K0FB 2A9VA 3OQIB 3GLHE 4HEHA 3VU9B 1W46A 1DAMA 4M83A 1RM4A 1HDCA 2VYND 3CJRA 4KPYA 2X5JO 4DSNA 4CEIA 1NLUA 4H9GA 2IELA 2DSNA 1NDHA 2ZATA 3RC3A 3MCTA 4TVSA 2HKIA 3JVDA 3IRVA 5ILQA 4GQIA 1I0ZA 2Z2IA 3BSYA 2GO1A 2CLCX 3EC1A 2A9QA 3WLSA 2AR0A 3A4VA 1SOMA 4KUHA 2BPOA 1YZKA 3AG5A 5ADVA 5BXQC 5HM6A 5IKXA 2WWFA 3E7XA 5K3SA 1VBNA 2SKDA 3WTBA 1PL0A 4UZFA 1I7NA 2FZ4A 1ZG3A 1DI0A 1Y98A 1CNMA 1U3UA 2AYXA 2P3SA 1GU0A 2QZZA 2GUGA 3AOEA 1O96A 1Z5UA 3D3QA 3CUWA 3DMFA 1KTVA 2CLKB 2Q3HA 3PTLA 4GOOD 4XIYA 4BO2A 2NUPA 4D82A 3RS4A 3TLGA 1FSZA 2BFDA 2RAFA 4RHCA 3HXQA 3VM6A 3ZY6A 5KTTA 1LI5A 4KR7A 3NI2A 2YBDA 3KJIA 3FHTA 2BEWB 1E6EA 1CX9B 2OENG 3QHPA 1WMBA 1R0RE 4LG1A 1VQ1A 1M0TA 1Z8DA 2IVZA 2Q5JA 3UJ9A 3VNAA 2EFGA 3ERCA 4NQRA 4PLCA 4UNPA 1PGJA 3FBWA 4CXMA 1WZUA 1KI9A 3KKMA 1WJGA 4BEJA 5A2QA 1JKMA 2XCIA 4W1SA 4WLOA 4GOXA 1KJYA 3I2HA 2PLNA 3H17A 1KOFA 2W2NA 4JAVC 5AR1A 4B6QA 3ZJUA 1E7YA 4EUSA 5BNWA 4CTOA 2PX8A 3MMZA 1K6MA 2FQYA 3KQWA 5JXGA 2MSLA 3OEYA 3UG6A 3FNRA 4LBYA 4TRMA 2J67A 2Z58A 3ZU3A 1OJLA 2WSSD 3JR3A 2HPVA 5CD1A 1WLYA 1Y8QA 3A9TA 2HQSA 4E5MA 3GFQA 3RUIA 1Y1QA 4Q19A 3QXGA 2IDKA 3JQ8A 2CHVA 3PJDA 3NIFB 5JXWA 1L5KA 4ONEA 4DV2B 2CD7A 1LVHA 2VPIA 4HN4B 5C18A 1CZHA 4PPGA 2BF7A 4D99A 1IPHA 3SEZA 2RGNC 1KJNA 5E6RB 4LV6A 1YR1A 2EU8A 5EXXA 2IPLA 3MUNA 5DN6A 1ODKA 1CSEE 2EBUA 2PKWA 3AJDA 2AVDA 1MAAA 3DDZX 2CF6A 4ML3A 4MP8A 4QGGA 4WJZA 1KORA 1U8FO 1Z5WA 4D25A 3ZCQA 1XZPA 3KFXA 5ED0A 1S2DA 1E2QA 3KE8A 1PS9A 2DQKA 4IIXA 4LYJA 4RY8A 5TRTA 2QF7A 3BORA 2CFOA 4LVOA 3KEFA 1VHJA 4QUHA 1IBSA 1FDWA 3MYYA 1ZR4A 1ZVVA 3BIOA 5DYGA 3PC6A 4HOYA 4PO1A 2FKNA 2X23A 1JAHA 3OO0A 1OFUA 4BQSA 2JIBA 1ZH8A 2QDKA 4QHSA 2EX4A 1UP7A 4REMA 5DGTA 2J0EA 3GG2A 3DF9A 4H31A 4ZV9A 3TIGA 3UCEA 3IIIA 1NRJB 4FLEA 3T9DA 3TQFA 3RRJA 4BWVA 1LU9A 2AR9A 3IQIX 4UUNA 2ZTSA 2E85A 3PXEA 2W70A 4B8YA 2NSYA 2P62A 1U0SY 3A2KA 1Q1NA 3EG5A 4QIHA 4R2XA 2DZDA 4B83A 4FB5A 3PDCA 4W8HA 5DBEX 3VSEA 4CDMA 1X3SA 4RHUA 5BWLA 3L1VA 1K75A 2CXXA 3RJ5A 3WL5A 3F78A 5MN4A 5T6BA 3AERB 2R751 3EIEA 3QX7A 1E69A 1YRAA 5DX0A 2GFQA 1EX9A 4AYWA 4Y2QA 1JILA 5J4YA 1R0BA 2WMNB 1ODLA 2RKBA 1LTHR 4TMYA 3AHFA 3GZNB 4M2LA 4DADA 3OMLA 4BLWA 2QAIA 4Q4DA 1W0KD 1RW4A 3SVLA 1XFAA 4Q16A 2W2VA 4MW5A 2VZLA 3AI2A 5BPFA 3P2EA 2W2LA 2VA8A 1YR9A 4ARBA 2GZSA 3CMMA 3TIVA 2IWHA 1Q95A 3QE4A 3AO0B 2Q6LA 4P35A 5IAEA 1G9SA 3E9EA 3N0WA 4IHJA 4U2BA 3G9TA 4LSZA 3SLGA 2YXPX 4D8VA 4YV7A 1XZHA 4TS1A 3W5DA 3D3WB 2R79A 3OTOB 1PWXA 1TU0A 2L82A 1ZLYA 2XYGA 3AUAA 2HRCA 3R7FA 3OQJA 5LYJB 4BNMA 1I10A 1ADFA 1I9CA 1UBKS 4R05A 3W7VA 4BP1A 3LI2A 1RM0A 4E12A 2F4VB 2JEYA 4ZV7A 1ZGBA 4NE7A 5L8VA 1SC9A