4YXFA

Mups, a 3-oxoacyl (acp) reductase involved in mupirocin biosynthesis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
237
structure length
230
Chain Sequence
b'KGTIIVSGGSQGLGLTTVRCFLEAGYNVATFSRRESPAVTELSERADFHWQALDCTDYSALTAFVQQVEKRFGGLDGLVNNAATGVEGILSTMRVADIDSALDINLKGQLYLTKLVTAKLLKRGAGSVVNVSSINALRGHSGLTVYSATKAAMDGLTRSLAKELGPRGIRVNSVSPGYFSSDQTLSRIERRTPLGRLGTQQEVADLILYLVDRGTFVTGQNIAVDGGFTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MupS
publication title MupS, a 3-oxoacyl (ACP) reductase involved in Mupirocin biosynthesis
rcsb
source organism Pseudomonas fluorescens
molecule tags Oxidoreductase
total genus 84
structure length 230
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yxfA00
4G2NA 4RPJA 4G5HA 2POQX 4IXWA 3S8MA 2YJZA 3LC1O 2B83A 1LXCA 5CDGA 3SVTA 3PHHA 3W4KA 1EDZA 1ID1A 3KYCB 1XU9A 3DZFA 1YQDA 2DTDA 4PCVA 2RCYA 1YH3A 2FPIA 5L53A 4IZHA 4E5MA 3A4VA 3GHYA 3ENNA 3CMCO 1C1DA 1HDYA 1K6IA 3ONFA 4LGVA 3D3EA 5A9TA 2NLOA 3JQDA 3I5MA 1QV7A 2UUOA 1ZIDA 3W6ZA 2DBVO 2I9PA 5DZSA 5ADHA 4RV9A 3FF4A 4ZJUA 2OORA 1UXJA 1TEHA 4BNTA 3F6YA 4IGEA 4BHTA 2BD0A 4U7WA 5GZ3A 2ZB7A 4ZRNA 4EEXA 3K30A 1SBYA 1YE3A 2VHZA 5A9RA 3B70A 3GY0A 2Y0DA 3PDJA 3WGIA 2LDXA 4NBVA 1LQUA 2PKRA 4IS2A 3ICCA 2GASA 5GY7A 5ILGA 3IL2A 4MIEA 1NQTA 1JWAB 3R1IA 5BT9A 3HB5X 3RKUA 4J16A 1GU7A 1PWZA 3L4BA 5ITWA 4F46A 5A3VA 1XDWA 1JKFA 2W2KA 3U49A 2CMDA 1E3IA 3GVXA 1ORRA 2X9GA 2C54A 3Q2KA 3U09A 3U4CA 5I8WA 1K6XA 2VOEA 4XQ9A 3H5AA 4II3A 1JU9A 2TMGA 2DBZA 3ZW9A 4BGIA 1X0VA 2NTVA 5CG2A 1O94A 4Y98A 4S1VA 3FPCA 1BDBA 3ON5A 3VPSA 2V65A 3VKUA 5L45A 4LRTB 3F9IA 2X0JA 3HWRA 3H3FA 5TF4A 4NPCA 3MJTA 1T1SA 2P4QA 3PFFA 4I9UA 3RC1A 1HSZA 3WGGA 1Q2XA 1MXFA 5K6AC 1X7DA 3WGZA 1T4DA 3RC2A 2P68A 3NX4A 1H0KA 3NGLA 2HK8A 1C1XB 5KJ1A 4D43A 3VC7A 1TXGA 3G1TA 3IP1A 3LT1A 4ZQFA 3PJEA 1KVUA 3V2UA 4OM8A 3ZI0A 3M2TA 4B3IA 1PQPA 1LSSA 4HKTA 4IIVA 1E1NA 1XSEA 3E5RA 2AG5A 4EGFA 4MOWA 2QW8A 3GHHA 1WDKA 3JQEA 1YQGA 4UUNA 4WOJA 3ANLA 1UXGA 3JQ8B 3UVEA 2X22A 4ROSA 3ZWVA 5HS4A 3INTA 2IXAA 2GYYA 4B79A 3V2GA 1JAXA 4R4JA 4NFYA 1AE1A 4NBRA 3WYBA 2ZCUA 1B14A 1SPXA 2IZZA 2AE2A 1PSDA 4MPDA 1Z73A 1HZJA 2AEMA 2NU9A 4NR0A 4CMBA 4QXMA 1ZEJA 3GZ4A 3IOYA 1TT5A 3BAZA 1OBFO 3KYDA 1GTMA 2QIOA 1GQYA 2YFQA 4O0LA 4K6FA 2BGLA 3OF2A 3WQSB 3WX0A 2YDXA 4TRJA 1DC3A 4RJTA 3WSVA 4EUHA 4WEQA 1Y5RA 4BNJA 1E5LA 2VZ0A 3OQBA 4ALNA 3T7CA 4XD2A 3H9EO 3UAGA 4EJ0A 1E92A 2BGMA 4B4OA 2ZJ1A 3DZJA 4YACA 1N1GA 3O4RA 1QXSA 2J3HA 2BRUA 3JD2A 5HBRA 3VPGA 4RCVA 3A9WA 4G65A 1AXGA 3O8QA 2G0TA 3ZHZA 3CZRA 4MVJP 4O5OA 1I24A 3F4BA 3H9UA 3UH1A 3JYQA 1VL0A 5CFZA 2VWPA 3RUCA 3DZBA 2YQ5A 3AI3A 4XYGA 1QKIA 1SCUA 3V8BA 3WG9A 1EVIA 2Q1WA 1P74A 1WVGA 2DU8A 1GZ6A 4OJNA 4GBJA 5BSHA 3ZU2A 3I9MA 4EI2A 4YCAA 3ITDA 3ZU5A 1KVQA 3LK7A 1HE3A 4BKOA 1YGYA 1QYWA 1FDUA 3I4FA 3Q6IA 4TVOA 3KEOA 5G2OA 4RVDA 1KEPA 4IDBA 1R12A 4ID9A 3DMTA 3D3WB 4R41A 1ADCA 1BMDA 5G0TA 3RU9A 1VKNA 3IQDB 4DIBA 2B5VA 4EBFA 3GA0A 3VH3A 1C0KA 3NTOA 3G1UA 1L7DA 1I3NA 3LZ6A 4ZHSA 3K31A 1NQ5A 3GRPA 3G3EA 1F14A 3UCEA 2W90A 4YXFA 1X1EA 2PD6A 3W8FA 1MGOA 1N8KA 2DUWA 4BO2A 4D3FA 1U5CA 5T57A 2WYWA 2GN9A 1BWSA 3CKYA 4XQEA 2FRDA 2CDCA 3C24A 4EW6A 3DL2A 3E03A 5THKA 1O8CA 5FI5A 4CV2A 3OIDA 2GSDA 5C5IA 2GO1A 2SCUA 4R1TA 1C3VA 1XQ1A 1RM5A 4EITA 3SLKA 2HK7A 3WQRA 1R15A 3S2FA 1V8BA 2HJSA 3WMXA 4ESOA 3QV1A 4NG5A 4EUFA 4YJHA 1LRJA 3ASUA 4LCEA 3TL3A 2EERA 1E7YA 2EIHA 1HDZA 4X54A 3IDSA 1TVEA 3UXYA 1Q7GA 1NASA 3DFZA 1DC6A 1QMGA 1K6JA 3AOEC 4L4SA 4MIYA 4IDAA 4UAGA 1HF3A 5G0UA 4NJOA 5L7YA 5A9SB 1ZUD1 1UZNA 2I5PO 4BGEA 2P9EA 3AFNA 1U7HA 1A4UA 1ZXLA 3K8ZA 1ENPA 1PTJA 3QRWA 3WXBA 4BO7A 1U3TA 1I2CA 1G0OA 1P0CA 2ZKLA 3BHJA 4U0KA 4GGOA 3TZ6A 3GZNB 4FDAA 1FJHA 4J49A 4IDGA 4KUEA 4INAA 4RF3A 4OSOA 1GUYA 1EVYA 3OEWA 2OL4A 4DPKA 1JWBB 4D46A 3Q9UA 4CMEA 5L7TA 2R00C 2XXJA 3WJAA 5B4TA 2A92A 4EZBA 3GF4A 4XKJA 3DAGA 4P8RA 2GPTA 2FSVA 2B69A 5IXYA 3ZH2A 2BLLA 3JQGA 1EE9A 3H6KA 4YAGA 4F45A 1HYHA 2E4AA 3I23A 4AJ1A 1PJLA 1ISFA 1ZK1A 4UREA 2PFGA 4WLUA 1RYDA 1U4SA 5DOZA 4YJFB 2IDZA 1ZW1A 4I8XA 3EUWA 1WAMA 2PGLA 4F3YA 3ROQA 3Q11A 3TDKA 1I32A 4FFRA 3TN7A 3WJ7A 3B1JA 1NPDA 3NGXA 1PL6A 2O3SA 3HJAA 3N58A 2VUUA 3BMOB 4OMUA 4EUEA 2CDAA 4PG8A 4Z3KA 4YVFA 4DYVA 2AQHA 2V6GA 3JD4A 1CQJA 5IN5A 3PI7A 2NSDA 2HJRA 4FFMA 5LDGA 3WIEA 3L77A 2OBYA 3AY6A 4S3MA 3VKVA 5DF1A 2AQKA 2QRJA 3KSDO 1ZVMA 3QHAA 3WGTA 2AEFA 1KY5A 1RKXA 2CZCA 4WASA 2DT5A 4WK6A 2Q4BA 2UDPA 4M86A 2ZIZA 2VHWA 3EZLA 3FR8A 2HRZA 1T2CA 2X23A 5JAQA 3ZNOA 2W2LD 1E3LA 3PZBA 5TJ9A 2WMDA 4PZCA 3TFQA 5ITVA 3GGOA 4BO0A 1TI7A 4QO7A 3ETDA 4NFSA 2FY8A 1GAEO 5L51A 3TJRA 2O4UX 1HSOA 1YBVA 3WICA 1J4AA 1DOHA 1PZFA 1CEQA 3RC7A 5A04A 4GX5A 4WPGA 4GH5A 1KC1A 4ND3A 5CEJA 4YAEA 1S7CA 3UOGA 3BTUA 3PPIA 2DKNA 2EXXA 2GD1O 4I1IA 3C7AA 3CPSA 3RAJA 2EHDA 2IYOA 3H4VA 1EBUA 1NWHA 4XRGA 4XDZA 4NU5A 1WDLA 2BI8A 1UAYA 3PHIA 2Y0EA 4IJVA 5AXBA 4IPTA 5EN4A 1BXGB 2YHIB 3S2GA 2D5CA 4IDFA 1VJ1A 3RC9A 2I6TA 5CDUA 4TRNA 5DDIP 1DSSG 3G49A 4BGUA 1P3DA 1P0FA 1ZSVA 4BO9A 1RM0A 3EW7A 5JCJD 1WNTA 3D4NA 3OHSX 2B4QA 3OM9A 2I66A 4RL6A 2X5JO 4CLRB 2BFAA 4LISA 3NT4A 3SJ7A 3UCXA 1NR7A 2GZ2A 3GVHA 5IZCA 2NU7A 3ZV4A 1BGVA 3MWEB 3KXDA 5ICMA 1EK6A 4GSLA 3OMLA 3VH2A 5G4KB 1Q0HA 3RQSA 1UP4A 1OFGA 3OBBA 2AG8A 1OOEA 2E49A 1SEPA 2JD2A 1ARZA 1JW9B 2X5KO 1E3SA 2ZK7A 4RQTA 4N5LA 3TNLA 1HZZA 1JN0A 3KM0A 1IHYA 3JQAB 4GWGA 5KIAA 4A7PA 1D1SA 4GPD1 1H9AA 1XIVA 4IIUA 1LDMA 3MWDB 1BXZA 2I67A 1IOLA 1YVEI 4TRRA 2VT3A 5JSFA 2PZLA 3LQFA 4DQVA 4AJHA 1PS9A 4GQAA 3DC2A 1GFSA 2R2GA 4PG4A 4AJIA 2NVWA 3DBRB 3PIIA 2J3JA 2AEJA 4DMMA 1F0YA 4GLOA 4MKZA 4DMLA 4CV3A 1ADFA 1ZZEA 2HMTA 2J3IA 2PTGA 3TZQA 4DC1A 5IZ4A 1Q0QA 5I9NA 4CLOB 1LI4A 4ILKA 2J3KA 1Z7BA 1YDEA 1P1JA 1KOLA 3FPLA 1DDOA 3K5PA 3TOXA 4FQ8A 4I5GA 3QJ5A 2Y68A 4QX6A 4J4HA 4CMKA 3ZNPA 2Q2WA 1HWYA 4GMFA 1E1LA 4M87A 4R54A 3ANMA 4DL9A 1E3WA 4XA8A 1PJCA 3H2SA 4U0JA 4DRYA 4R9RA 3K96A 4XQCA 2HRBA 3AU8A 1Z82A 1A4IA 2C7GA 3NUGA 5F1OA 1PQWA 1QYVA 3KSZO 1B8PA 1H6BA 1Y7TA 5BSFA 3COSA 5F5LA 4RORA 2YYYA 1B8VA 3MJVA 2VWHA 4HWKA 4NMHA 3WBFA 4DREA 1I2BA 3WSWA 4OXNA 3CXRA 2WM3A 1O5IA 1Y5MA 2VRCA 3GEMA 2HSDA 1P1FA 3ZZNA 3CUKA 3FTNA 1LC3A 4Q3EA 5JW6A 3KB6A 4Y6SA 1AHHA 2Y99A 1U1IA 4FC7A 4RVHA 2D1YA 4CPDA 2QHXA 2VTDA 3BMNA 3RJ5A 4CLEA 1S6YA 3DZIA 1Q0LA 3EHEA 2BFMA 2O3QA 1DC4A 1F06A 3FRJA 4FC6A 1SAYA 1SMKA 4LW8A 3S2IA 4PN3A 5FEUA 1U3UA 1A5ZA 1HLDA 5JYEA 3W8EA 3HUDA 3UN1A 5JAMA 2Q50A 1YONA 1M6HA 5C7OO 4XJSA 4CV1A 4YJGA 3QVSA 4J7CA 5FF9A 1UR5A 1U3WA 3ASVA 5JYDA 3E1KA 4RVGA 4IBOA 1VL8A 3E48A 3PIDA 4GGPA 3WGQA 4OAQA 3H9JA 1HDXA 1XQ6A 5F21A 3S55A 4CM3A 2A35A 1HDRA 1A71A 1M75A 5JCXA 3ADOA 1T25A 3HDQA 3JYLA 3RD5A 4H16A 2FSSA 4OHUA 4CM8A 5KWEA 2C5EA 4J1QA 1QYDA 3GRKA 4RZHA 3EC7A 4XIYA 5CDTA 3HFGA 3I6IA 3M1LA 4CMIB 4RQUA 2Y1GA 4PG6A 4R69A 4TKMA 4XGNA 2HCTA 3VTFA 4AICA 2WD7A 2Y93A 1HT0A 2EWMA 2E82A 3DQPA 3ZU4A 3GMSA 3OJEA 2ZCVA 1T2DA 2O48X 5IN4A 1TLTA 4NQZA 1LLCA 4PLHA 4NK5A 5L7WA 1H6AA 4GVXA 4WCFA 2PLAA 3RUEA 3BMCB 4NBWA 4W82A 2TMDA 2O3RA 1DFIA 1IHXA 1NPYA 1U3VA 2H63A 3A06A 4Z9XA 4YPOA 4DPMA 1F12A 2I3GA 3E8XA 3JQCA 2EG9A 1VI2A 1LRKA 2VHXA 3N7UA 3OICA 1PGOA 2CVQA 1VSVA 1UDBA 1X1TA 1YDWA 3E9NA 3GVIA 3P5SA 3RKRA 1LDEA 1X0XA 3ZHYA 1GYRA 2IEDA 5IJZA 1X15A 3HDYA 3ZWNA 4PLCA 2CF5A 1UP6A 4H3VA 5TRTA 1N1EA 3DB2A 1SB8A 1NVGA 1ADGA 1M6WA 4J4BA 4GLLA 1KBZA 4WCDA 3PDUA 2FOIA 1P1KA 1T2FA 4R68A 5G0SA 2XAAA 2B4TO 4DVJA 4NJMB 4FJ2A 5T8KA 5JFOA 1PJ2A 1EUZA 3RBZA 3WOHA 1N9GB 2C20A 3TQHA 3ZN2A 4R01A 4RVUA 3TPCA 4CUJA 2JFFA 4E3ZA 2IEBA 2Q3EA 9LDTA 4ZQHA 3WFIA 1ZBQA 3IKVA 2OOSA 4LSMA 3BIOA 3NJ8A 3BMOA 3KLMX 3VZRA 3IAHA 1UXHA 4ND4A 1U4OA 2FMUA 5TGDA 2A94A 1GV1A 5KVQA 3WYCA 1LSUA 4ZQEA 4Z9YA 5B12A 2ZTLA 1I10A 3WLEA 1IPEA 1Y8QA 1A7KA 3AM3A 1ULSA 5JY6A 3QVTA 3RVDA 3QSGA 4BGVA 4TMFA 3U9LA 4PLZA 1H9BA 1Y81A 2HMUA 1LLUA 3HADA 4PLWA 4BKQA 5T67A 3GEDA 1UXKA 4IQGA 5IFLA 3UHAA 3CE6A 1NHGA 4DGSA 1PGJA 2X8LA 2VOJA 3WWYA 3AY3A 1HKUA 1N2SA 2OP1A 1GCOA 1GZ4A 4XX0A 1Y1PA 3VVCA 4NBTA 4LK3A 2JAHA 5EERA 1DAPA 3C7DB 4UEJA 1GPJA 5B37A 2OHXA 4A73A 3UGKA 5DULA 3EK2A 3LVFO 5I7FA 2DFVA 3GG9A 4J43A 4O63O 2HQ1A 3BTVA 4KDFA 1A72A 1AN9A 1NQAO 1MLDA 2O3TA 1PJSA 4WLFA 1F8GA 3RCBA 4MP3A 3STHA 4J7UA 2JCYA 2CF6A 3FNEA 4BB5A 4JLWA 3RUDA 5THQA 1U7TA 2O2YA 4F6LA 4DTIA 4E5YA 5IDXA 1PR3A 2VNAA 5KNLA 4PFJA 2ZB8A 3BYZA 3I3OA 4XIJA 3DTYA 3JYOA 5KKCA 1MC5A 4P38A 4XGIA 4YBZA 1E1KA 1DJQA 4BNFA 1UUFA 1PS8A 3QWHA 2WJPA 3GOHA 2NVUB 2NACA 4PVCA 4AJPA 4DQXA 1L7EA 4YAKA 1KETA 2B36A 3AUAA 3LT0A 4J2HA 2JD0A 1MG5A 4AL4A 3PVZA 1DLIA 3E5MA 1I01A 2AXQA 2VNSA 2V6BA 4W4TA 3QP9A 1QSGA 4J90A 3AWDA 4CM4B 3ZNNA 4R5HA 2HLPA 2ZB3A 4OKNA 7MDHA 3L4BC 1LNQA 1AXEA 1HLPA 4ALKA 1FXSA 4CQLB 3SXPA 2I99A 1NAHA 3NV9A 5ES3A 1HRDA 4PLVA 4ZQBA 5GZ6A 1ONNA 1AHIA 1NVMB 3GN2A 4CQMB 3RFVA 5IXSA 3OH8A 1LEHA 3NJ4A 4OIMA 4HFMA 2P9GA 1ML3A 3F3SA 4KZPA 1SOVA 1V0JA 3PQFA 3HB4X 1VPDA 2RIRA 2O7QA 2PZJA 1R16A 1E6WA 1R4NB 2RHCA 3OJFA 4OL9A 2Y1OA 3OJOA 1QP8A 2I76A 4UVHA 4YDRA 5IAAA 2W4QA 4J6FA 3QWIA 2CDBA 1FDTA 3TSCA 1HL3A 1B16A 1A9ZA 4OH1A 3S2EA 2J5QA 2DPHA 1IPFA 1WP4A 4YRBA 2PH5A 1XG5A 5DBIA 5DCWA 1QYXA 1ZCJA 1R4MB 4GKBA 2OO5A 4HNHA 4Q9NA 2Z1MA 3AOGA 4E13A 1A9YA 1ENYA 1M76A 3WS7A 2OXIA 3JQ7B 3PJFA 4DXHA 3OIFA 3DFUA 1I3MA 3VAZA 2HDHA 4DUPA 2NV6A 4WGGA 3CIFA 2DTXA 3PK0A 4TROA 3F1LA 4II2A 1YOVA 5JE8A 1YB5A 5AXDA 3KVOA 4FFNA 2DVMA 4BB6A 5IG2A 2PGDA 2HKIA 1DXYA 4HY3A 5JLAA 4OGWA 4E5KA 3C1OA 1I30A 3RUAA 4YAJA 4YAIA 2FPPA 3HN7A 4KDEA 5T6BA 1RYEA 2NQTA 4FW8A 2VYNA 2FZEA 5JDIA 4ZGWA 1VJ0A 1B7GO 4UVIA 2C0CA 3ITKA 4XRRA 2PK3A 1M66A 2Q2VA 1O9BA 3ROPA 3F46A 1HE4A 1BRMA 1YBMA 1ZMTA 4TKLA 1A27A 4PLGA 4KQXA 4F6CA 1JKIA 4GI2A 2X0IA 1FDVA 4PLYA 1QG6A 3PFWO 1EBFA 4I5DA 4HADA 2PZKA 4IQ8A 1H6DA 2BF7A 3GUYA 4YB8A 1XWFA 2QRLA 4MP6A 4N5MA 2GN4A 4JGBA 4JBIA 3ZWAA 1B26A 3WGOA 1QYCA 3ZWMA 1I36A 5K9ZA 3HSKA 1L1FA 3UCFA 2QG4A 1OC2A 2YV2A 3PZRA 4R1NA 2G1UA 3GUCA 1G6KA 3MCVA 3PJGA 1GPDG 1WXDA 1YQXA 3OEYA 1C0LA 3L9XA 4FR5A 4JJFA 4XYBA 2EP5A 4PIVA 4OOEA 3WYEA 1MX3A 3RFTA 4L9RA 1HYGA 3DTTA 1PWXA 3DZKA 3NYWA 2YDYA 5ILOA 1GL3A 3ETEA 1ZKMA 1V3TA 5JC1A 3TF5A 3EAGA 4DBVO 3A14A 1CDOA 3PWKA 3LT2A 4U5QA 3V2HA 2WSBA 3PYXA 4GX0A 3GN1A 4J7XA 4WEOA 1W4ZA 3QW2A 3DMTC 3OQ6A 3WNVA 2B5WA 1PGQA 4FGWA 2EKPA 2D2IA 4FFLA 1MA0A 3AM5A 3H65A 4NIMA 3IUSA 4WE3A 3C3XA 4BKUA 1B15A 2CFCA 1YL6A 5JO9A 5JXWA 1DRWA 3C8MA 1PZEA 1IE3A 5BNTA 1MB4A 5G0VA 3IC5A 1SB9A 1ONOA 2YZ7A 2QRKA 3QLJA 3K2EA 3JV7A 4WLOA 5JY1A 3PYMA 1M2WA 5CPBA 1H5QA 1XKQA 1WWKA 1PX0A 3SJUA 4XR9A 3UW3A 1VKOA 4Z3DA 3IIEA 4FFOA 1EQ2A 4W7HA 1GD1O 2OGUA 4N18A 3Q2IA 4YA6A 4ZQGA 2W8ZA 4J9VA 3I9LA 1EVJA 5IF3A 2DC1A 4J3FA 3O03A 4M49A 5JPIA 1KERA 2GZ1A 1ZFNA 1NNUA 4DA9A 5EESA 4NK4A 1EEHA 2B37A 3OIGA 2J5KA 4MP8A 4JJGA 1EUCA 1DAOA 2Y0CA 4IQ0A 1LDYA 1P1RA 4OYRA 2C2XA 5TS3A 4RDIA 3RIHA 1GADO 4DLLA 4MVJA 4C7KA 5JDIC 5FWNA 3GDFA 3VZSA 4YQZA 3QIVA 4I9NA 5T5QA 3VPXA 4G81A 3GG2A 4XJTA 3DONA 3KYBA 4WLNA 1DIGA 3PHJA 2O50A 5TNXA 4BNLA 1W73A 2AMFA 2VHVA 1DFGA 2NM0A 1Q1NA 4B7UA 1YKFA 1DBVO 2EJVA 2VYVA 4QT0A 3GLQA 2JHGA 2RHRA 1K0UA 4KUHA 3KEQA 4ALLA 4D79A 2IODA 3B1KA 4CMEC 1ISIA 1ZK0A 3L6DA 4JQCA 1MP0A 4BL5A 4JP3A 4AVYA 3KYCA 3JQBA 3U4IA 5JMWA 4UUOA 4YJDA 2YV1A 2NWQA 2GF2A 1EFLA 3GGPA 3I9JA 4JN6B 1SEVA 2E37A 1D4FA 2FR8A 5L40A 1VE9A 1Z7EA 4Z0TA 3DBLB 5KJCA 1OC4A 3GDOA 1K89A 1BW9B 4BQPA 3T7EA 4QTZA 2JL1A 1MFPA 3HFSA 1ZK4A 4BNVA 2IRWA 1J6UA 2JFGA 1ISMA 2AQIA 4BV9A 5KVCA 1B8UA 1SNYA 5GMOA 5DBGA 1GR0A 4GAEA 3D4PA 1T4BA 4O6VA 4EJMA 3LLSA 3H9QA 3NT5A 4XZ3A 4CV0A 2WDZA 2YHUA 3N74A 1YJ8A 3JQ9A 1N92A 4OQZA 4XYLA 3GNTA 3I4CA 3IJRA 4RDHA 2BFOA 3LLVA 1CWUA 1ZJYA 3KRTA 3BZUA 2VZ8A 5COBA 1GEGA 3ZWYA 2OP0A 2X1HA 1NX6A 3HDJA 4NBUA 3EGOA 1LX6A 2P4HX 1ZH8A 2Y1EA 3EYWA 3D5QA 1KEVA 3ONEA 2PGJA 2X6TA 2EP7A 4NH4A 3UKOA 4CM4A 1TA4A 3H8VA 4N5NA 4E5PA 1AUPA 4YWJA 4EYEA 3ZHXA 1ZK2A 3PYLA 5CG1A 9LDBA 2VRCD 2EKQA 5AYVA 3DZGA 3PRJA 3IP3A 4LN1A 2HMWA 3UUWA 4EEZA 5IDWA 5JS6A 1XEAA 4XYEA 3BHMA 4U8GA 4NDNE 4WOKA 4CM7A 1PJ4A 1FF9A 2X4GA 4CQMA 4BNMA 1XU7A 1C1XA 2QYTA 4IMRA 1DRVA 2PD4A 3WLFA 1C0IA 1LSOA 4D44A 4BNYA 4B4VA 2BELA 4BUCA 3Q0EA 3Q3CA 3C85A 3ZU3A 1WLYA 1NR1A 1TT7A 3PTZA 5HA5A 4J4TA 4RF5A 5COAA 3CINA 2H9IA 1MG0A 1O89A 1SZJG 3MTGA 3GAZA 4E30A 4UVDA 4HFRA 3L6OO 2WEKA 3JQ8A 3OSUA 3SX2A 1HDCA 5F5NA 2YY7A 2W2KB 4EDFA 2NTNA 3NRCA 4YYZA 3MZ0A 3OP4A 2HK9A 3OFSA 5ENVA 2AHRA 3ULKA 3DXFA 3GFGA 1BVRA 3EVNA 2VQ3A 5H82A 1IYZA 1W0CA 4GL4A 5A4DA 5IZCC 4UUMA 1D8AA 1NPTO 3TOZA 2X0RA 2GN6A 2HMSA 4CR8A 2XPCA 1IL0A 1HDOA 2UV8A 5HTOA 1R6DA 4FGSA 4FFPA 3PWZA 5B4UA 2AA3A 3P7MA 3VH1A 3O38A 2B35A 4CM9A 1WPQA 3QE3A 2QYSA 3HE3A 2X9NA 1LA2A 3DAPA 3F5SA 5A5EA 1E7SA 3FTPA 3DAFA 3Q1LA 4JBGA 1P1HA 3CH6A 2Q49A 4R1SA 4E2XA 1X14A 1PGNA 2Q46A 2Q4EA 4Q3AA 1G1AA 1UH5A 1E1MA 1T2AA 3AI2A 3FBTA 1CRWG 4NU6A 4ZN6A 3GMDA 4MINA 4K26A 3H5NA 1GQQA 5AOVA 3AU9A 4KMSA 4BO6A 3LDHA 4QQRA 1U2GA 4LMPA 4OKIA 1KY4A 2O23A 4OSPA 4RF4A 1YWGO 3R0IA 3LC2O 3WTBA 2JCVA 2Y05A 4MKXA 5HWSA 2D8AA 1U28A 4WECA 3JD0A 3ZWWA 4ZICA 4BIIA 4CM5A 2ZTUA 2AE1A 3JQFA 1MC4A 4XQGA 5ER9A 4B8WA 4B3HA 1PL8A 3SBOA 2NVBA 3WFJA 4A03A 1LLDA 4PRLA 1V3UA 3D3WA 1TT5B 4CMAA 4HFJA 3M2PA 4NHEA 2EEZA 4A26A 3IUPA 1H2BA 1I33A 3KUXA 4RLHA 3ORFA 3ZCXA 2WWRA 3QVXA 2EJWA 1X7GA 4D42A 1IB6A 3E82A 2FP4A 4YT5A 2NU6A 2WD8A 4FSHA 3U5TA 2JHFA 5AVOA 4UEKA 1I3LA 4BS9A 1UAGA 5I9LA 3PEFA 4E21A 2QZ9A 3HNPA 2PZMA 2WE8A 1NFQA 4O59O 1IZ9A 2IE0A 3GAFA 3O8QB 3PP8A 2Z95A 4FOOA 4Z9FA 5IDYA 4TVBA 3QQPA 4R51A 4B7XA 4CODB 3PGXA 2PKQP 1LQTA 2QQ5A 2X58A 4N7RA 4XDYA 4HBGA 1I0ZA 3VPHA 3JD1A 2P5YA 3L4SO 2DPGA 5F1KA 2JJYA 4JXKA 4ITUA 3E6AA 1ZSNA 2HU2A 2I3AA 4QSMA 2DLDA 3ZDFA 4ZD6A 3GR6A 4CMCA 3PLRA 3GH3A 5TIIA 5KOIA 4CMHA 3OECA 4FJ0A 1KVTA 3EVTA 3LU1A 3LSYA 5J23A 4B3JA 1EMDA 2Q45A 4IJWA 5A9SA 4BO8A 1LTHR 4IM7A 3M1AA 1MXHA 1W6UA 1NTOA 3JSAA 2FR0A 4E12A 5L4SA 4MVJM 5FFFA 5TX7A 1NXQA 3GZNA 3NKLA 2VCYA 4FD3A 3JYPA 2VN8A 4ALIA 4BMVA 1ZNQO 2Y1FA 3GK3A 4K6CA 4M89A 3R6DA 3WIDA 4TRMA 2FPGA 3WDSA 3IKTA 1JAYA 5DBFA 4RPLA 4I5EA 4IUYA 2F00A 3F47A 4Y6PA 2WYVA 3S1LA 5A06A 2YFHA 1R0SA 2DM6A 2Y66A 1UP7A 2D0IA 3E9QA 4LVCA 2F1KA 4W7IA 4WCFC 2Z5LA 1G0NA 2GNAA 1YRLA 3WGHA 2VWQA 4M1QA 1P9LA 2C59A 3OJ0A 2OMEA 1ZMOA 4Q39A 5DCUA 1U5AA 1GDHA 2BGKA 4MVJE 4R1UA 1J49A 4JX8A 2NU8A 4YJHB 2PV7A 4D0SA 1SO8A 2E48A 2WYUA 2GCGA 1B3BA 3I83A 4YJFA 1WZIA 4ALMA 4GX2A 4PGFA 3FWZA 2OFPA 2J6IA 3FNHA 5I9MA 1GEEA 3X2EA 3RBXA 4U6QA 1W8DA 2PWZA 5AQ1A 1CQIA 2G17A 2B4RO 4YRDA 2EW8A 3NEPX 3TZKA 3ZWBA 2RH8A 1KIFA 3D0OA 4P4GA 1WMBA 3HDHA 1DIHA 2PH3A 3V1UA 4L4XA 3NAQA 4KWIA 1EUDA 4KQWA 5T8KC 1I8TA 3D1LA 2BH9A 1E7QA 4TZKA 3QVWA 4R5MA 2ZATA 4KWHA 2VTEA 7ADHA 5TSDA 4AJOA 1DLJA 3C1AA 1BG6A 5A5FA 1XA0A 3OETA 3FI9A 3M6IA 3ROMA 3VDQA 4W99A 1PS0A 3INGA 3JQGB 4A10A 3VH4A 1NBOA 1IULA 4RF2A 4IMPA 3Q9NA 3DHYA 3FN4A 1IUKA 4ONEA 1RM3A 1ZO8A 4L74A 1HYEA 2C82A 3W1VA 4DWVA 1FK8A 5A3JA 1KVSA 3HN2A 2FZWA 1N7GA 4DIFA 4GWKA 4D7AA 2ZJ0A 1RPNA 3PWSA 1LLQA 2Q1UA 3NDJA 3P2OA 3WR5A 1WDMA 2JFHA 2VYND 3RSHA 1C0PA 4AG3A 4UVEA 4DIOA 4TZTA 3RFXA 3CZMA 4CMJA 1YXMA 1I2ZA 3WMWA 3HG7A 4HNGA 3PHGA 3GPIA 5JAIA 2RBEA 2C07A 3GFBA 1M67A 3UF0A 4J91A 4RPKA 3WWZA 4PG5A 1X13A 1LC0A 4FS3A 4ZVVA 3ZHBA 1ENZA 4YQYA 1BXGA 5G0WA 4L73A 2YHIA 4CUKA 2Q99A 3ZGYA 3JQ6A 4BNNA 1KS9A 3LT4A 5AXAA 3TZHA 3VHRA 3RUFA 4Z0HO 2ZYDA 4IDDA 1HE2A 5EJ2A 1P45A 2GERA 4H15A 4JIGA 3DO5A 4FPXA 2DAPA 4LCJA 3I9KA 3LC7O 4NFHA 2ZYAA 1E6UA 1E3JA 4KOAA 1ZSYA 4PZEA 4CLRA 2X5OA 2CUKA 4IZIA 2P2SA 5MDHA 1FMCA 5HRUA 1LDNA 2HUNA 3GNQA 3BHIA 4BMNA 4BKRA 1VC2A 3KLPX 3VPFA 5T64A 2G5CA 4DBZA 3QY9A 3U0BA 1GQ2A 8LDHA 5G4KA 2J5RA 1KEUA 1YB4A 4I08A 2VZ9A 2EKLA 4BO1A 4C7JA 3ICPA 3RUHA 4OQYA 5JO0A 5DP1A 4XWYA 1E77A 1WZEA 1E7RA 1YBAA 2ZQZA 3CSDA 5EMHA 1E7WA 2BMAA 3JQAA 2RH4A 1EFKA 5K6AA 4D45A 4RGBA 3W6UA 1Z45A 3GNSA 1CERA 1Y8RB 3MJEA 3HHPA 1ISGA 3LF1A 3TL2A 4BKPA 4B4WA 5KJ6A 1PU2A 4J1SA 4K1LA 5CEEA 4I9HA 4DYDA 1LBEA 1EQUA 3MTJA 5I7EA 3DHEA 1GZ3A 4B8ZA 2OZPA 4HP8A 1LSJA 1UDAA 3A1NA 1EDOA 2V6MA 3KZVA 1GV0A 4Q3BA 3MEQA 4Z6KA 4LRSB 1N7HA 1PJQA 1MUUA 3F4LA 1Z75A 2EV9A 3DBRA 3ROKA 3GVPA 2PR2A 1DPGA 1VJTA 1R0LA 4MVJI 4BNGA 1MFZA 4IDEA 1RJWA 1DIBA 4KTTE 1KEWA 3H5RA 4E2ZA 4CLOA 1DFHA 1EE2A 1O0SA 4JJIA 4PLFA 3DHNA 2NADA 4RO0A 1HETA 1DIRA 3KTDA 1T24A 3TZCA 3F5QA 5BQFA 2O2SA 4Q3DA 3KSUA 4XB2A 3TRIA 4JNKA 3C1TA 4FB5A 1HTBA 3P19A 3P2YA 3A28A 4MVJD 3DEYX 4JK3A 1LDBA 2PNFA 3ZWCA 1XCBA 1VM6A 5TT0A 3AJRA 2O3UA 5TT1A 3RU7A 4ZU3A 4PRKA 5TC4A 4FBGA 4N54A 5B1YA 2Q1TA 1PR9A 1HEUA 3ETGA 2JD1A 3U4HA 2ET6A 1B2LA 4HUJA 3H9GA 4AJEA 2VYVD 1ONPA 2D3TA 2P9CA 1GYQA 2J8ZA 4QO8A 1VRWA 1FDWA 1VL6A 2QZZA 1B0AA 5A03A 2UYYA 4H7PA 4Z0PA 3AUSA 1Q7CA 1DEHA 4R3NA 3JD3A 3CMMA 3GEGA 5L9AA 3KETA 3BMQB 2V7PA 4TWRA 5BSGA 3GQVA 3NDRA 4DLBA 3OA2A 2Z1NA 1JVBA 4MKRA 1ENOA 4JP2A 4XEHA 5FYDA 4URFA 2DUUA 3RROA 2PD3A 2PKQO 5TLSA 3DWFA 4K28A 1KYQA 1NHWA 4HX5A 4IY1A 4M55A 1K5HA 2Y67A 3R3SA 1A7AA 1E3WB 4BNWA 2JKVA 1JLLA 2R6JA 1SOWA 3PXXA 4CMIA 1H2HA 3IS3A 1XYGA 1OZAA 4R16A 4E32A 3EDMA 3GT0A 1AGNA 3T4XA 5KVVA 3MJSA 4CR7A 1YJQA 1NFFA 1CYDA 2RAFA 4RLSA 5EPOA 5L95A 3K92A 4MJLA 4ALJA 3BA1A 5L4NA 4GSKA 3O26A 3BMCA 4HXYA 2C5AA 3BTOA 4BO3A 2X0NA 3ENKA 3FCOA 1HE5A 5KTKA 3T4EA 1JA9A 4WJZA 3EY4A 3B6ZA 2PA3A 4BMSA 2GN8A 1BDMA 2OUIA 2IYPA 2G76A 1BHSA 3BMNB 1PZHA 1P31A 2BHLA 3B20A 4UUPA 4J9UE 1U9JA 1CF2O 1UJMA 4CR6A 3DBHB 3GVCA 1P33A 5U9CA 5LCXA 4WUVA 5TJHA 4D3DA 3DR3A 4GMGA 4NNJA 4YJGB 2XXBA 2Y1DA 3AOEA 5A1TA 4QFDA 3JYNA 3CEAA 4AJLA 1GUFA 4Y8VA 2LDBA 3ABIA 1D3AA 4XR4A 1K3TA 1XR3A 3C7CB 3W4IA 4C4OA 2PY6A 5COQA 1PIWA 2ZTVA 4P22A 4NJMA 2UVDA 2NTJA 2XOXA 3CTMA 4XGKA 4CM8B 1N9GA 1T2EA 4Y6RA 4CQMD 2P5UA 5JNLA 3TWOA 4P4NA 1LUAA 4GVLA 2FWMX 3D7LA 4Q3NA 3PQEA 3RI3A 2WD7B 4RPHA 8ADHA 3QVOA 2R00A 1C14A 4BQRA 2A9FA 1P44A 4M8SA 4OO3A 4WCFB 1IY8A 3ZV6A 4BO4A 5BNIA 4CMGA 1DHRA 1V3VA 1J0XO 1YL5A 4MO2A 1LJ8A 3JCZA 1E6EA 3LF2A 5KCZA 1I5RA 2V6FA 5JAZA 1PJBA 4J1NA 1CIVA 4CL3A 3H7AA 1H6CA 4J0FA 4LVUA 4RVSA 4YEDA 1TB4A 3WBBA 1E5QA 3BXXA 1PZGA 3K9QO 2GRAA 5DOVA 5CAEA 5CP8A 1DHTA 1R66A 1T26A 4BV8A 2BI7A 3PHLA 4XCVA 2ZB4A 5DCYA 4E6PA 1V35A 1BSVA 4ZA2A 4CLXA 4NZ9A 2EW2A 2CNBA 5A05A 5EL0A 4WKGA 1R37A 3DDNA 4W6ZA 3JQBC 4CM9D 2FN7A 3OQ1A 5ENDA 3H3JA 2YW9A 3BTSA 1WMAA 3JTMA 3FNFA 4AJNA 3UICA 1XLTA 5EQDA 5BSEA 2UAGA 4I5FA 4AJJA 3EZYA 1ZK3A 1Z74A 3QWAA 2VT2A 1XGKA 3QA9A 3KV3O 4YR9A 4FJ1A 3LYLA 4CM6A 5C3MA 5EQFA 4JROA 1Y6JA 1Y8QB 5B4VA 2CVZA 4B4UA 3VZPA 3WQQA 4QUKA 1RM4A 1Y9EA 4E33A 2YQ4A 3AFMA 2GUGA 2NVUA 2CSUA 2JCXA 1F17A 1GYPA 2DTEA 2W98A 5F3RA 4YT2A 4DLAA 2VUTA 1JVSA 4J1TA 1PQUA 2DBQA 3JQ9C 2GLXA 3DBVO 5CHEA 4R9SA 2NUAA 1C1DB 1PJTA 3ADPA 5DT9A 2CD9A 4Y67A 4XYMA 1O6ZA 2UUPA 4CQLA 5LC1A 4WNCA 3SC6A 4D41A 2O3JA 3I6QA 2EGHA 4PZDA 1QLJA 3TFOA 4AJKA 1GUZA 3MOGA 1ISHA 4YTEA 4YT4A 4W9NA 6LDHA 1T1RA 4L0QA 3RASA 5FI3A 1XELA 1V6AA 1H94A 1R0KA 1D7OA 4A2CA 1Y8RA 5IDQA 4O1MA 5U4QA 3DOCA 5JDCA 1GCUA 2I65A 3D64A 3NT2A 1KVRA 4MIOA 4XB1A 5F1PA 1BTOA 3ZWPA 4HV4A 4MVJF 1R4NA 5KKAA 1P1IA 2Q1SA 1Z6ZA 5JBIA 2X9VA 2AQ8A 3GGGA 3FR7A 4IS3A 1CJCA 4L4RA 3WB9A 2C2YA 1ZEMA 4WLVA 4W9NC 4A0SA 3I9OA 5H83A 1IZ0A 1QLHA 1R4MA 3ZNQA 3RBVA 4KUGA 3K2BA 5JDCC 3G79A 2DQ4A 2Y1CA 1NM5A 3G0OA 3JQ7A 3U3XA 1N5DA 4BNUA 1SC6A 4EJ6A 4CM1A 4R3WA 1Y9AA 3AK4A 5I8ZA 4BO5A 5CDYA 5U1PA 1O95A 5L4LA 3AI1A 3SEFA 3K73O 4CLHA 1K2WA 4E2WA 5KJFA 1JDJA 5MGBA 1PGPA 1U8XX 2HO5A 3EMKA 1DIAA 4UULA 1JKJA 3FSRA 4A27A 4RVFA 4DPLA 2FHSA 5LDHA 3FWNA 3ZWOA 5C37A 1DJNA 4M54A 5L3ZA 2C29D 2YV3A 3I1JA 3KO8A 1VSUA 3NDIA 3INRA 5I7VA 2P91A 1DB3A 1ZJZA 2DBRA 3O9ZA 1UZMA 1GY8A 2C7VA 5KJEA 2OBNA 3X2FA 3OA0A 1ISJA 3ST7A 1PL7A 5KVSA 1NVTA 1NYTA 3MOIA 1ZXBA 1LDGA 5C7IO 3PLNA 3FNGA 1QORA 4MVJH 5ICSA 2QX7A 3FHLA 1MV8A 2D59A 2O4CA 3GPDG 4GKVA 4HFNA 4PVDA 1KC3A 1OAAA 2JAPA 3UFXA 3AM4A 3BMQA 3F1KA 1HXHA 5C7LO 3AY7A 1CETA 1EZ4A 2EF1A 2G82A 3SLGA 4BNZA 2BFPA 1YOVB 3KYDB 4ND2A 3U62A 4IINA 5HM8A 5BNFA 3VVBA 5EINA 4AFNA 3RWBA 4E5NA 4OOFA 2X7HA 3RJ9A 2W2LA 2NNLD 4E4YA 1NFRA 2H1SA 4B7CA 4L76A 2BKAA 3HQ4O 4GX1A 3ZW8A 1BVUA 3PGJA 2WE7A 1UDCA 3RUIA 3DOOA 3FBGA 2HAEA 4QEDA 3JQFC 2IZ1A 2E6UX 3W4JA 4BNHA 1XHLA 3I52A 4ZRMA 4OXKA 1JQBA 2AW5A 1P77A 4L8VA 5DN9A 1HDGO 3L0DA 1NWCA 3KOUA 4PLPA 1QR6A 4ND1A 1E7MA 3AW9A 3R3JA 5GZ1A 1UXIA 2NQ8A 2VRBA 1JTVA 3NTQA 4JCOA 3ANNA 5HS6A 4E2YA 4IXTA 1U2DA 4IJUA 4YRAA 3L9WA 5JMPA 3PQDA 2HMVA 1V9LA 1H93A 3L6EA 5AXCA 3ZWXA 4CJXA 4FIZA 4KTVE 4BNKA 2YUTA 4L75A 3DZHA 3V1YA 4KP7A 3PJDA 4UVGA 2VUSA 1LRLA 2O7SA 5JCJA 4E0BA 2A4KA 3DBHA 4P4LA 5CDSA 3QWBA 4RPGA 3G17A 5BR7A 2D4AA 2FR1A 1ADBA 2GR9A 4PLTA 4UEOA 1J5PA 4IDCA 1LU9A 3VOSA 2H6EA 3U4DA 3HZZA 2D5AA 1F8FA 5DP2A 2ZTMA 2X86A 3D5TA 4BNXA 3DOJA 4QFCA 4RZIA 5EIOA 4J2OA 1OI7A 3AUTA 4YT8A 4D3SA 1E0DA 4DQUA 3E9MA 3H2ZA 3IJPA 3DMYA 2DFDA 2Q2QA 3MJ4A 1FDSA 6ADHA 1Q7BA 5TQVA 2EGGA 4WLEA 4K9DA 4QECA 3VDRA 4CL8A 3NTRA 5JC8A 1VLLA 2CY0A 3AUUA 3FD8A 2IZ0A 1I3KA 3WGYA 1QV6A 4IGFA 4Y9DA 2ZYGA 2VHYA 4FN4A 3V1TC 4DC0A 1DO8A 3SC4A 3K6JA 3VZQA 4AJ2A 1DC5A 4OXYA 4U6SA 4MVJG 4D0RA 3KBOA 2ILTA 4PG7A 1UZLA 5A02A 2ZQYA 4TQGA 5K0ZA 2H5LA 1BXKA 2CVOA 5ER6A 3B1FA 3VTZA 3IMFA 1DRUA 4AJ4A 3JQAD 5G4LA 1NP3A 1E3EA 4TSKA 4BNIA 2XF8A 2GZ3A 3QWFA 1RWBA 1EK5A 1U8FO 3ZV5A 4MDHA 5CEFA 3GC6A 1PJ3A 1EVZA 3DBLA 1B3RA 4JBHA 2B0JA 4FCCA 1X7HA 2IXBA 4ND5A 4BOYA 3ONDA 1NQOA 1BW9A 3WNQA 4E31A 2GDZA 4LMRA 1D1TA 1YS4A 5CPFA 1PEDA 3ZV3A 4LSWA 3E18A 3L07A 3I9NA 1YL7A 3MJCA 4BVAA 3WTCA 4CUZA 1YB1A 4Q3CA 3OJLA 1ULUA 4FOSA 3KHUA 2WTBA 5I7SA 1QRRA 2GGSA 5DNAA 4WNIA 3D4OA 4NI5A 1YO6A 3GDGA 4IJKA 3W8DA 4A5OA 1NAIA 2VWGA 3V5NA 1OMOA 1WW8A 4CLDA 5H81A 4J0EA
chains in the Genus database with same CATH superfamily
3O2SB 4DZTA 3N2ZB 3LBHA 3OWHA 1XEXA 2GYVA 4DCCA 3KPVA 5BSWA 4F3NA 1EJ0A 3IMEA 1J2UA 2B83A 3HN6A 4QQNA 5CDGA 4DV3B 3PKIA 5TXGA 2AX4A 1T9AA 2QM3A 5DKFA 3QOWA 4JYBA 3R9KA 3DZFA 2OHFA 2RGWA 2WOOA 1R8XA 2ZROA 3O1JC 1YH3A 2FPIA 1N3IA 3BS4A 3PU6A 4ZT2A 4B4DA 3IAEA 3ITEA 3ZJTA 4E5MA 3GHYA 3O8RA 2P9YA 3ENNA 5GOTA 5DIZA 1C1DA 1HDYA 3KFVA 3ONFA 4EVIA 3TXYA 1DTWA 2H4YA 4GMXA 2FI1A 3JQDA 3I5MA 5CVVA 3N28A 1PEYA 2QQEA 4AIIA 3FF4A 4LY6A 3CGWA 3MB5A 1E0JA 3IOCA 4HX9A 2TRSB 4BPRA 4TV8B 1B41A 1KIAA 5GVRA 2ZS8A 4IGEA 2O07A 4R8RA 3TDMA 1ZRNA 4BBZA 2CYAA 1KJYA 3VX4A 1SBYA 3WZMA 2VHZA 2JLWA 3GY0A 1KKMA 1TGYA 4ZEOA 1MABB 3OCVA 2PKRA 1T9CA 4IS2A 1G4UR 3ANSA 1CUBA 1F0KA 1Y1TA 4I14A 2D2XA 4RMNA 5EP1A 1NQTA 5GY7A 4B76A 4V3BA 5BT9A 3WIVA 1N5KA 4RE5A 4J16A 2B7CA 1GILA 3NIFB 1PWZA 3DO8A 1RABA 3L4BA 3P9CA 3PVSA 4NOLA 5HDQA 2GRUA 5K45A 1RRPA 4G5XA 4EJMA 2Z8ZA 2WFLB 1LPMA 1KAQA 5A3VA 1XDWA 1YD7A 2E1RA 2QTWB 1RXVA 4MX8A 5BW8A 3ZEIA 2CMDA 3WL7A 3X43A 2QPTA 2X9GA 2HA0A 4I55F 2C54A 3Q2KA 3EODA 3UJ9A 1TYBE 1MTZA 3N2GB 1M1NB 3KUUA 4XQ9A 5LXTB 3H5AA 3RYHB 4BGIA 2DBZA 4RD6A 2ODWA 1QQTA 2R6CA 2P8JA 4YHBA 3MTIA 5CT6A 5E7QA 4U2KA 3ON5A 3FUWA 3VPSA 2G5TA 3MW8A 3U81A 3UC9A 5AVTA 5JZ9A 3ABSB 5TB5A 1QIIA 3MSCA 4PO1A 4C06A 2VAPA 5F64A 1IWBB 1G7TA 3EA0A 3MJTA 1N6NA 2WG0A 3BDAA 4M0KA 4CN8A 2BJHA 2V7XA 2Q41A 3QKWA 1J0EA 2P4QA 5FKJA 3VGPA 3S5JA 2VS1A 3EZ9A 4DA6A 3UXHA 1G6Q1 2NZ8A 5K6AC 2PZBA 4IO1A 1T4DA 5H8WA 3GEEA 3KLBA 4L8FA 4D43A 4JLVA 4ZQFA 4BDSA 3LT1A 1M6VA 1SHJA 2ZREA 5AQEA 3CX3A 1I1QB 4JLOA 4REQB 4G5QA 4RACA 3OD5A 3FHJA 4JLKA 3ZI0A 3M2TA 3JQPA 1U2RA 2P2NA 4AQDA 3DCYA 1PQPA 1RKVA 3EDCA 1L6RA 1NR5A 3NFYA 3O2NA 4RY8A 1V7PC 2FPWA 3E2IA 2GZHA 2A9RA 1BYUA 3IVXA 4TT8A 3WMGA 4IF4A 2IY7A 1WDKA 3M1IA 1Y7HA 4ZO7A 1P6UA 3TZBA 3ZIAD 4WOJA 2GHTA 5T7BA 3ANLA 3VTAA 2F9MA 3UVEA 1N7JA 2X22A 4C14A 1KJ8A 5GIOE 3QUCA 1VDZA 2WJGA 5HS4A 4N3CA 4UNSA 2GZMA 3FCAA 4B79A 1JAXA 3GD5A 5AJYA 3TTSA 3HH8A 4R4JA 3J7AC 3AVQA 1RLJA 2IU4A 2HRDA 1NT4A 2IPAB 3PUXA 4KN6A 5DSXA 1ZHOA 2J46A 1JHYA 4C7VA 1F3LA 2PT5A 2AEMA 2NU9A 4UOEA 5C0OE 3JRXA 3TRIA 1T9HA 2YFQA 3LPNA 4O0LA 2BGLA 2QTVA 3D3QA 1BQEA 2OECA 1F9EA 3M5PA 2NXEA 2ATXA 2LIVA 3WSVA 4I99A 5B57C 3O9MA 3HVRA 1Y5RA 5K0FA 2FEKA 4GP6A 1GZ5A 1F4LA 1FFXA 5D01A 2VZ0A 1BNCA 3LRXA 2I1WA 3T7CA 4XD2A 4B33A 2PVSA 4F71A 3UAGA 3ZWKA 2BGMA 3I04M 3UK6A 3DZJA 5JLJA 3JD2A 4C87A 2BRUA 3KK0A 3QLUA 2VTBB 2GHQA 4RCVA 1YU6A 4DDTA 4XWKA 4WFQA 3O8QA 3KQQA 3ZHZA 2WLTA 3CZRA 4MVJP 4IV8A 4Q3LA 5ALQA 1I24A 4RHYA 4EG1A 2CLCX 2XUOA 2N3ZA 3JYQA 3TQRA 2ZBUA 3DYVA 1KY2A 1NVEA 1QHNA 2JAWA 4GNRA 3RUCA 1YTUA 1Z38A 3AI3A 3W5BA 3V8BA 3V97A 2XWBF 1M5TA 3WG9A 2NT4A 2I3ZA 4PS1A 1EVIA 5JEEA 1P74A 1VBFA 4RE6A 2J9FB 2OPHA 4GBJA 4WDRA 4M1YA 3K9FC 1ND6A 3IPAA 1OHHD 2R1ZA 3L0OA 3ZCRA 3I9MA 5BSHA 1AURA 2VQFB 2QNIA 3GQBB 4WJLA 3NZEA 1KVQA 3IJ5A 1XTPA 1HE3A 2QMYA 3M0EA 4LXUA 1FYWA 3R0ZA 3SHOA 4MUJA 5HMLA 1FDUA 3I4FA 3Q6IA 4TVOA 3N0VA 4NECA 1L5LA 1OVGA 3HLKA 1R12A 4ID9A 3QOYA 1RHMA 3H6GA 3QW4B 3EPJA 1XD8A 4R41A 3GIDA 1NTRA 4F5ZA 1ZNZA 2EGUA 3AB3A 4JV5B 5PGMA 2EATA 1U04A 2WU3A 4BC1A 3FA2A 4QICA 3OQJA 3G1UA 4EBFA 1FJXA 4OI0A 1C9YA 4QPJC 3NYRA 2XNSA 2ZT8A 3LZ6A 4ZP1A 5DM2A 2I1VB 1NNLA 2PAFA 1NQ5A 2WMYA 4OHFA 5FNVA 3G3EA 1F14A 3ZGVA 1S9DA 4GW3A 1P7ZA 3W90A 1UMBB 1D03A 3LUGA 1A95A 2O2GA 5HIJA 4HVTA 1MGOA 2PXAA 3L6UA 3W8FA 4HUQA 5EUQB 5JV5A 5T57A 1JLMA 4UEQA 3WKAA 3I5AA 2WYWA 4D82A 3TFWA 3RS7A 2BAGA 5F3DA 3HDGA 3HKDA 2OV6A 4XQEA 5HF8A 1M2EA 3PFHA 4WVFA 4Q1EA 3RPEA 4D56A 3DL2A 2F48A 4I3GA 4DBLC 4DCNA 4MEBA 3LGXA 5FI5A 3GROA 3GUZA 1LVHA 3HKEB 3OIDA 5HSGA 1JT9A 2XE4A 1BOOA 2SCUA 4R1TA 1C3VA 1XQ1A 3L49A 1OLSA 4L8YA 5E9WA 5FPQA 3V4ZA 5CFQA 2YXNA 3E9RA 2X2OA 4ODIA 3WMXA 2HJSA 3QV1A 4NG5A 4E07A 2CXOA 3TBHA 1X80B 1JFTA 1E2LA 1SBIA 4WCVA 5TDHA 4HN2A 3TL3A 1DARA 2OD7A 3W5HA 4G5RA 2H1CA 1KZHA 2EIHA 3A9UA 4X54A 1TD1A 2D1RA 2QM0A 1QRAA 3DV0A 2X4IA 1Q7GA 4S1PA 4QQ8A 1PO7A 1DC6A 5HXAA 5JDIA 4NH0A 2IY9A 3E8MA 3IE2A 5L7YA 1ZUD1 3EWSA 5EWLA 5DRYA 2AUMA 4OK5A 2JLXA 3OPXA 3VYUB 2OLKA 1A4UA 1ZXLA 3NKFA 3QRWA 1PTJA 3WLHA 1F48A 3WXBA 1SK9A 4BO7A 3K0SA 1RYZA 1G0OA 1P0CA 3DWEX 3TZ6A 2OCYC 1YHYA 1FJHA 4TTAA 4IJ5A 4MI6A 3V1MA 4KMRA 4TS3A 3KJQA 4OSOA 4RF3A 2E4YA 2QRGA 2W37A 1WPGA 3CCCA 3LQRA 1ZJ5A 3KZMA 3MTEA 2OL4A 4KLAA 2R96A 2GEJA 2FPGB 3TLAA 1JWBB 2QVZX 2O1WA 1BVYF 5BXYA 1ZR4A 4BVBA 3WJAA 5EKDA 2GLUA 4EZBA 3GF4A 1UJCA 2DE0X 1Y7LA 3DAGA 1PWYE 4ZZIA 1IUPA 1V1RB 2BVNA 1B93A 4JEMA 2IS1A 1H2RS 2GPTA 2FSVA 2B69A 5IXYA 2CJXA 3ZH2A 3BEDA 2QVCA 1NY5A 1UZAA 1EE9A 2GM9A 2P79A 3JQGA 1OQAA 2C2KA 1GTG1 3L4EA 5K2MA 2X1LA 5LB2A 2E4AA 5F78A 1Z8FA 1U9YA 1GPMA 2PZGA 3O7MA 2WZBA 5HG0A 5HUQA 5EG5A 1EXDA 1PJLA 1ISFA 3ID6C 3VR4A 1ZK1A 4UREA 1RE1A 4YXWD 1Z2AA 3Q3JB 1RTTA 2A0WA 1ZJ6A 3Q3HA 2FEMA 1CR1A 1XZCA 3H2IA 3HEMA 3BWCA 3HKCB 1TJ5A 4L27A 4I46A 4A92A 1CRLA 1R8YA 1AUQA 5CYOA 3ZWDA 4F3YA 3U1BA 2C83A 3ADDA 3TDKA 1X7YB 2G8NA 3DGEC 4P81A 1I32A 4UC0A 5D86A 5ABPA 1PL6A 1ZM7A 2O3SA 4OMUA 1JDSA 2CDAA 1R5NA 4BU0A 5J2UF 4BXOA 5HIKA 3AR5A 4KSYA 1YQTA 2XDWA 5TY0A 2AQHA 2WF8A 2FSUA 2V6GA 3ZQKA 2IV7A 4BFTA 3DP9A 4HWTA 1EUDB 4R1PA 2HJRA 4GMHA 2XHEA 2FK8A 2G4LA 2E18A 2ZIXB 3PNQA 4FFMA 4CCWA 4D0NA 3VOBA 3NB0A 1WG8A 2PIDA 3LFUA 2XCIA 1YMQA 2FE4A 3NS7A 4QBHA 1MA3A 3BT7A 3KSDO 1FU8A 1ZVMA 1KY5A 4UZEA 3CKKA 3GLTA 1OH5A 2XGSA 4DQ0A 1K3FA 1RBMA 2BFEA 3IEKA 4RETA 2QN9A 1GNPA 1QHXA 2H4HA 4ZI7A 2IHZA 2JGDA 2XUKA 1E9VA 3OQOA 1F8XA 4H27A 4XX0B 1T1GA 4H3KB 2YHAA 5JAQA 1NF8A 3VR5D 3UIEA 2G1PA 1D1PA 2C7BA 3PZBA 1PFVA 3FB1A 5TJ9A 3OTWA 4BWYA 4E5UA 3C14C 4L07A 3UYLA 3RS4A 1HFJA 4B87A 1T6ZA 4ENRA 3BRWD 5FJJA 5FWDA 4AC9A 3NHWA 3G5LA 1CC1S 1TTTA 3JZFA 4YQFA 5LQUA 4I50A 3GT7A 1TM3E 5ALZA 4R2HA 5AWFC 4A36A 3S29A 4BP8A 2C84A 2X4DA 1OIVA 4ESVA 4YAEA 3UOGA 4LFAB 3PPIA 4C4PA 1T36A 1XF9A 1B43A 1B74A 3DGFC 5IBPA 1NVKA 2EXXA 2QT1A 1E2QA 4DABA 3RAJA 3KOXA 3DBIA 3H4VA 1EBUA 1YVRA 3LGAA 2PMEA 1J56A 4DSUA 1PUIA 1WDLA 2BI8A 3ORSA 1UAYA 5E7JA 5CXXA 3WBJA 2FPXA 2OFOA 4TM7A 2G6BA 5AXBA 1E4EB 4RA6A 1EWTA 4Q4HB 4CIXA 3K2QA 1HLFA 3LRTA 3G0CA 3OPVA 3A1TA 4JH0A 1LF0A 3S7TA 3QKRB 1CVIA 3LCUA 3G49A 1V9SA 4HDNB 3Q0TA 1P4RA 1CG6A 3MINA 4KO2S 5DGCA 1RM0A 1CSEE 1WIWA 3RS0A 1RP7A 2A0UA 3D4NA 3OHSX 4ZWNA 5JCJD 4AWAA 3UJ8A 3OM9A 4C30A 1VB3A 3GGSA 3ME5A 4RL6A 4E11A 2QWXA 2ZFUA 4TQUS 4LISA 3NT4A 1JILA 3ROEA 3SJ7A 4CLRB 3ND6A 4MKHA 3GVHA 1RJDA 4W6QA 4P9NA 1RHRA 2NU7A 2VNIA 4OGLA 1N8TA 4EPRA 3DW3X 1NG1A 3COZA 2REXB 2ICAA 5BRNA 5KKNB 4P0PB 2G07A 1W1IA 1N5RA 2HF7A 4MJXA 5GONB 4Z2AA 3SJCA 1Y6ZA 1INLA 1J0BA 2MYNA 4JJ8A 3DVAB 5AH0A 2OV2A 3RVBA 4ZO4A 3TIFA 2YJ5A 3DV2A 4A8PA 2W83A 4G1CA 1ECJA 1JVNA 1UJBA 2EQ5A 3LC0A 4N5LA 1IHYA 3SSNA 5KIAA 4A7PA 2ZETA 1DEAA 4DILA 2PBRA 1U0EA 3VNUA 1VOTA 1JAHA 1V7QA 3FG9A 3NEJA 2FFJA 2PO7A 4J7AA 4L2IA 3D0RA 4GPD1 1SU6A 1N4DA 1USWA 1H9AA 1XIVA 5B1HA 1G7RA 1LDMA 2HEGA 1XZBA 1TCAA 2IXGA 3OEED 4ENWA 2ZWIA 1IOLA 5NULA 4A2WA 1NUSA 5IMSA 2AXPA 1O0CA 1YVEI 2YXLA 4X24A 1PV4A 3OCYA 4V0LA 1JKXA 3AIMA 1ZN9A 1YC5A 2Z2KA 4PG4A 3O5AA 3X3HA 3DBRB 4AJIA 4B3RB 5SYNA 1CRPA 3ETCA 4DMMA 3D02A 1F0YA 4MKZA 5CT4A 3QX8A 1LI5A 2RI6A 1KDVA 1POXA 4C6RA 1ZZEA 4DC1A 5BT8A 3IPLA 1MORA 3WY9A 7MHTA 1JLHA 3SU8A 3ZCUA 5I9NA 5JJ5A 2GRJA 3DPUA 3LGSA 2J3KA 1Z7BA 2LW7A 1TKCA 4QUIA 4CCYA 4DN6A 4DR6B 1JZQA 1DCMA 1PW7A 2HSWA 2QI9C 1QHGA 3GARA 1JQEA 5HE9A 4NS4A 5K4HA 1X9IA 4G4IA 1UPUA 1GVNB 3MWFA 1R6XA 1X92A 2F17A 2Y68A 4QX6A 4J4HA 4U4AA 3VPCA 4ZT6A 2JIOA 5AW8A 4GMFA 2GD2A 2VJKA 5I9TA 4K46A 1UT8A 4QNRA 2GBFA 4B46A 1XMSA 1KAGA 1PJCA 3H2SA 3PA6A 3Q9SA 1SXJD 3BSYA 1E2UA 3K5HA 4R9RA 5IU6A 2VJQA 3GP8A 2ONZA 1A4IA 3UMBA 4HT3B 5EPUA 4BLVA 3GBSA 3C3DA 1PQWA 4FYYA 3TSYA 1QYVA 3KSZO 1B8PA 4D92A 3COSA 4I2NA 2G3YA 2R44A 5JVDF 2I0FA 3N2IA 4NMHA 2QLBA 4HWKA 3BWBA 4GU5A 1WLSA 2EFYA 4O2AB 4DREA 3LECA 4EFDA 2ZRQA 4CBVA 4RNDB 4ARUA 4OA5A 3VSCA 2VSOA 3GEMA 2QD5A 3D2LA 4JVMA 1BRTA 3CUKA 2NP6A 1WCIA 1VHWA 1LC3A 4HGRA 3VU1A 4CL0A 6ABPA 4Y6SA 1AHHA 6GPBA 1PUXA 2I6SA 4ZVLA 1UMBA 4ZJYA 2D1YA 3ZVLA 2QHXA 2VTDA 1IOWA 2ZXEA 3BMNA 4B32A 3AF2A 1S6YA 4Q66C 3ZHOA 2BFMA 4FC6A 3K3PA 5AW0A 4LW8A 1SMKA 4FNGA 4F5EA 2XGOA 1UC8A 3OZFA 2WI8A 4KQFA 4G5SA 1DXOA 2ZUBA 3I42A 3R5TA 4MUAA 2QL6A 1KF0A 5JAMA 1V6SA 2Q50A 1M6HA 4IOMA 2R1TB 4GEGA 3EXIB 1UC9A 3L7IA 4C6TB 4D2IA 4EG3A 4JJZA 1JXMA 4C0XA 1U3WA 2HZ7A 2XI4A 3KJEA 3N5CA 3E1KA 5F2EA 5DPMA 1IM2A 3GRRA 3WGQA 2IHTA 4M1OA 2P35A 3A9VA 1HDXA 1XQ6A 4O8CA 5F21A 3S55A 4G0VA 1HDRA 4P5PA 4ZK6A 4HB3A 5F4BA 5CXSA 1JLLB 3ADOA 3JYLA 3LUKA 4HX2A 1XKXA 4JNCA 4N76A 3EGXA 1Z26A 4MZXA 2X0EA 1TAQA 2C5EA 2JGNA 4J1QA 3G23A 3EC7A 3HBFA 2ADMA 3K9CA 2QW0X 1TMOA 4RZHA 4XIYA 1GPUA 3CE9A 3DFMA 4S35A 4TMKA 1ULBA 2HCTA 4MCAA 4GPEA 5LQSA 2Q1XA 4KQ1A 3K0CA 5ESWA 5GQSA 1S4MA 4P32A 4UTZA 2O5CA 1D4ZA 3NBYC 2WV9A 4RFSB 3W5JA 1O3YA 2L18A 3LRPA 1H6AA 4GVXA 3IVGA 4WCFA 5AHRA 4C0LA 2QD1A 4OFWA 4I19A 4W82A 5ALFA 4DANA 2QIPA 1DFIA 1JEDA 1U3VA 1NPYA 3P0EA 1QU3A 3KCNA 2F3SA 1Z4MA 2CHVA 3OKCA 3A3PA 4NBKA 4CGZA 1H4VB 4FCTA 4Q37A 5CFNA 2PSSA 1E5TA 1W5AA 4C05A 4GR9A 3NXKA 2EG9A 2H9YA 3V33A 2QAJA 2W6MA 3AMVA 4MQFB 1PGOA 4P7BA 2O8CB 2WD9A 1UDBA 3PCRB 1YDWA 2PTHA 3E9NA 2YWRA 2ZRLA 2O1EA 3P5SA 2QI9F 1X0XA 1QHEA 3BQ9A 1RHKA 3ND7A 1GYRA 1EG7A 2IC5A 821PA 2PKEA 3A1CA 1OWLA 4HAXA 3HDYA 4KYTA 4BFUA 4PLCA 1J8YF 2A1IA 3EQ9A 3ZJYA 5TRTA 4YMTA 3A25A 3VOTA 5CT9A 2XMQA 4RJKA 1SB8A 3CWZA 4KH1A 1CZKA 1H2AS 3DO6A 3QY0A 3KUKA 4HH3C 4MH0R 3UAOA 4WCDA 3B3FA 3PDUA 2FOIA 4R68A 1ZWLA 4DVJA 3QPCA 1JBKA 4QBTA 1U8TA 1Y82A 3EMBA 3HKCA 5JFOA 2IVFA 3CUUA 2QR2A 3TQHA 2CGEA 4R01A 4MICA 1ZD2P 1X7YA 3BBLA 5B7NA 5BVHB 2TMKA 1FDOA 4TSRA 1JFFA 3E1SA 3THXA 1WXQA 2A86A 1NJ5A 1EX9A 3EG5A 3HBNA 4HNSA 5YASA 3BIOA 3BQNB 3ECAA 1II8B 3LBIA 5AI9A 3H8JA 1CD5A 1PEKE 2F1IA 3IAHA 3GFQA 4QYIA 4X93A 1TZCA 5L3SB 1Z4IA 1KDOA 2VJOA 4LRUA 4NAVA 2WFMA 4GPIB 3VX3A 1KNXA 2WVAA 1G16A 5K0CA 4NCKA 4YR7A 1AV6A 3RABA 2OR3A 2PXCA 2A94A 2IDKA 4A6XA 4QTTB 1I10A 3T12A 1IPEA 1Y8QA 1V41E 3BXHA 3AM3A 2IU6A 5TQ0A 3ZJUA 2VNJA 4L9AA 4Q9DA 4L5BA 2P9BA 3AINA 4FT2A 4TMFA 3A7DA 2F90A 2ZRMA 3BD7A 1QPBA 4CM9D 4YCLA 3JZIA 2VPTA 4FOTA 4G8DA 1QIDA 1LLUA 1Z2CA 2KW5A 5EIBC 1P0PA 3UHAA 4ADSG 1QIHA 1N9ZA 4DGSA 2IPNA 2XMGA 5CGQB 5CYFA 1AKNA 5DWDA 3MT8A 4QDZA 5MN6A 5EPEA 1LB1B 4W5NA 5CAEB 1JH9A 3H8SA 1UPFA 3TAHA 3B6EA 4XX0A 1Y1PA 4ER6A 3VVCA 4NBTA 4YDHB 2JAHA 2XB6A 1GTVA 3BB4A 3C7DB 1GPJA 1RWNA 1G6OA 3P9XA 2QRUA 3E61A 3EK2A 1JFRA 3DTVA 1MRNA 3GG9A 5I4BA 4O63O 1XA4A 4ZAGA 3BTVA 3QMVA 1VDMA 1JG2A 3B5EA 5F51A 3D8BA 1FP4A 1SVMA 1K7EB 3ELYA 4MP3A 1R50A 2B1IA 4BB5A 2VXCA 4F38A 2IW3A 2ASEA 2O20A 3BD9A 1WE2A 1U7TA 4UU0A 3W3AH 2AK3A 1DMSA 4DTIA 2XWQA 5IDXA 1CE8B 1PR3A 1TK9A 2VNAA 2ZB8A 2HSZA 1CY6A 3K0EA 4PFJA 2M1XA 4KN9S 5HKLA 1G38A 4BZWA 1IRXA 1YQ9A 2OORC 1N9KA 2OC4A 3H1AA 1KH3A 2C2WA 2FZKA 4DWJA 4YBZA 4X97A 3KE9A 3UNXA 4A82A 2HT1A 3QKRA 3QPAA 3PDIB 1NQVA 1UUFA 2AFRA 1DQZA 2ORWA 3CLRD 1WOMA 2VP2A 4HDNA 4RKRA 4X1YB 2OFFA 4DQXA 4YAKA 2NVUB 4PVCA 4KAAA 5TMEA 1FFBA 1L7EA 2V4ZA 1RCUA 2B36A 2ZRPA 4M0CA 3ZI4A 4Z4EA 2QSZA 5FTKA 1YHNA 2GILA 2Y27A 2ZI9A 4H08A 4GZ5A 3QP9A 2OK8A 2GZAA 5E6RB 3ZNNA 3AW8A 1WU8A 4NICA 3F67A 2WF9A 2ZB3A 2OY0A 4I5IA 3N87A 1LNQA 4JMLA 4MITA 2CLFB 1AXEA 1W59A 3QU9A 1UBEA 4CQLB 4ZYVA 2CXRA 4TGLA 1S2IA 2AR0A 5I7HA 1ADYA 2VDLB 2ZPTX 3RRZA 5JVDB 2YINC 3HBJA 4C0KA 4AROA 2FFAA 3GJ8A 5A4IS 3RFVA 5FR2A 5IXSA 2C5FA 1LEHA 1UOQA 5T3YA 3SYKA 1JI0A 1NOJA 4LZJA 2IY8A 1N2CA 3D8HA 3DBOB 5E6SB 1GNLA 4BX0A 2IP1A 4KZPA 2DWCA 4MUFA 1QMPA 3AETB 1FL9A 3RTBA 5ITZB 3HB4X 3E23A 1VPDA 2FW1A 2O7QA 2OHGA 2PZJA 2RIRA 3KWMA 1VA4A 3PEUA 3OJFA 4FDUA 3DAOA 4UVHA 1QP8A 1VB5A 4YDRA 5CVJA 2DXIA 1T1IA 3ZLUA 2AV6A 4O5AA 1EHCA 1IEXA 2CFRA 3HV0A 1L7MA 1NF3A 1FVXA 1HNXB 1SRRA 2YN4A 4YRBA 4X65B 1XMVA 4ILEA 3GV0A 3E9CA 4NATA 4RNCA 5DBIA 1LV8A 1QYXA 1R4MB 5DCWA 1VIMA 4HNHA 4Q9NA 2Z1MA 2GARA 4QU9A 1IBKB 5C35A 2OXIA 3JQ7B 3V7YA 3OIFA 3TAXA 2GJ4A 3CRRA 3NEAA 3DCJA 4M9SA 1N5IA 2DJ5A 2MSDB 2IUUA 3PUKA 3PXUA 4WGGA 3ZY6A 3NHBA 4UM9D 5A4FS 1JDZA 1TX4B 4K6HA 1FFAA 4NYJR 4NCBA 3P0HA 5JE8A 3QFSA 3OLXA 4UXJA 3RFCA 4D9NA 3THWB 2W4MA 1EBBA 1X1DA 4US1R 4X63A 4ND6A 5AK0A 3GLVA 1GNTA 5K3CA 3OOYA 1Q0UA 3M4ZA 3GLFA 4RDCA 4RVOA 2OGWA 1FU7A 1YFZA 3C1OA 4WN3A 1LBHA 2F1JA 4L8LA 2OPBA 3OF3A 4NAUA 1VG0B 5B58T 5KSWB 3HN7A 5DYIA 5T6BA 1RYEA 4RD2A 3SC3A 2FZEA 2DMRA 1DQRA 1FFEA 1PF7E 2C0CA 2V8BA 3ITKA 1G9XA 4UVIA 4XRRA 2HLNA 2Q2VA 3N05A 1WX1A 2HBRA 3HGMA 2H2IA 4HEHA 4PRZA 3U39A 4YRLA 3FJ1A 3L7OA 4TKLA 4O2AA 3CW9A 2OAQ1 3CURA 4IOKA 1O5OA 4Q9KA 2B1GA 3USES 3DD5A 4LJ7A 1EBFA 721PA 1KAOA 2RHOA 3QUBA 2PZKA 3DXXA 3AR4A 1H6DA 3U5ZB 1ZD8A 2R60A 1L4EA 3VR4D 3H1BA 4JGBA 2YIMA 3FOZA 4UTVA 4EP1A 3WGOA 1JL3A 4MI3A 5EZYA 5LQJA 4PFQA 2QMUA 1O8BA 3R41A 1HEIA 4C7MA 3BXFA 1VE5A 2WTNA 4MW5A 1OC2A 3JRWA 5EJIA 3UCFA 1ZGBA 2RGUA 5IKMA 4QT4A 1Y63A 4UFNA 4JJFA 4C2BA 1X7ZB 1YKSA 2ZT5A 2O05A 3B7WA 1RWXA 1FXWA 5PNTA 3RFTA 1G8KA 2R1TA 4HDOB 4C6TA 1HYGA 3DTTA 2FFHA 4G26A 1K5DA 4LJ9A 4CG2A 3DZKA 3V48A 2A4MA 3GPCA 5H16A 2AOTA 2YDYA 3P96A 4JJEA 4DGQA 2IOFA 1W96A 1A4XA 4Y2YA 1QGZA 2FAXA 4P3NA 2O57A 1G41A 1GL9B 5JC1A 3LSTA 3RHFA 1QTIA 2MTBA 2C9ZA 1CDOA 1S1CA 1OV6A 3WB1A 3T7TA 4MPJA 5IWAB 3HJFA 3LT2A 4U5QA 2VPWA 4FHZA 5JRJA 3GN1A 4IWYA 1Q3KA 3RT9A 1RQNA 3IR5A 4MUNA 5H3LA 1C8KA 2FEPA 4G67A 3OQ6A 1ZOLA 1RHUA 1DELA 4FGWA 2EKPA 5ALDA 1OKKA 2PUBA 4XD7A 2O0HA 3BSWA 3IUSA 3UXEA 4ZYZA 4GR5A 1ATZA 1BZYA 3HR8A 4WE3A 3VGJA 4TMXA 1Q44A 1YF3A 4C0SA 3R24A 3WBKA 1H2WA 2CFCA 1JSCA 1Z5UA 3C8MA 3AR6A 1G5RA 1MB4A 4PSDA 2EZUA 4RH1A 1K7CA 5SY4A 1B4DA 1W1UA 2YZ7A 2RFLA 1N4AA 4C6HA 2OKCA 2OBXA 1UANA 4Z9AA 2WAOA 1QIFA 1LPAB 2VHJA 1M2WA 1G5QA 1H5QA 1U90A 3ZJ4A 4F4JA 3F3MA 1PX0A 4MQFA 4RIIA 4XR9A 1KU0A 3SJUA 3RWOA 3UW3A 2O8CA 4EA9A 4PNHA 3OPYB 4W7HA 5DTJA 4LOJA 4LYHA 2OGUA 2Q1YA 4N18A 1W36C 4QKQA 3DKVA 1U8CB 2Z2XA 3Q3GE 2CL6X 4K86A 1R0XA 4F5YA 5IF3A 1AKQA 4M49A 2IEAA 1Q5PA 4LYEA 1JPNA 2G5GX 2ZBGA 5DGXA 5FH9A 3DWIA 1XAIA 4NK4A 1YRWA 2QR3A 4MQ4A 4D9EA 5HM6A 1XWWA 1XL0A 2B37A 3I6BA 1QJCA 2I22A 2J5KA 3V34A 4MP8A 2ISSD 2WG2A 1RCTE 3IAS1 1TO6A 2C2XA 4UHBA 4Y9TA 1TUBA 5TS3A 2QTMA 5HGXA 5GADl 4LF8B 1MW9X 2BCJQ 3RIHA 3WLKX 2FMXA 2QQFA 3D3JA 1FS6A 1CEEA 5FWNA 4N9WA 3ACCA 1OD6A 1NXTA 1YRAA 2XUZA 3C8HA 3GDFA 2VG8A 4Q16A 2DLCX 1XTRA 3GJ7A 2YS7A 4I9NA 4AW9A 5KTPA 3AVVA 2WKSA 4G81A 1NNI1 3UB3A 1OAOA 3D3NA 1TKBA 3QLTA 2IDJA 4KKVA 3DONA 2AG0A 5HF5A 1O87A 2EU8A 3PL1A 2WAMA 3Q12A 3IOBA 3HI4A 5FBWB 1Z63A 3KYBA 4OG2A 3PHJA 3DHVA 1PR5A 3WE7A 4AY6A 2HHCA 5MF6A 4FX5A 3KAKA 2VHVA 3OZGA 3P9PA 4LJLA 4EYQA 1Q1NA 2AFHA 2VP0A 1Y9ZA 3D4LA 1DBVO 2NOAA 3CIOA 5IC5A 4X64B 1IHDA 2V3WA 4F5DA 1DVRA 2QQ0A 2RHRA 2BM9A 4LY9A 3EIOA 3KEQA 5DNCA 4HYYA 2IODA 4CMEC 2CDRA 4EIWA 2HY7A 1NSTA 2F8MA 1QG4A 1V8DA 1SXHA 1QC5A 1W4BA 3ZE7A 5HHTA 2E5LB 1F6WA 3ZHCA 4HZGA 1UL1X 3VU9B 3VC3A 3EVDA 3OKPA 5J43A 1GGKA 1NVUQ 4AVYA 3KYCA 2K2QB 4OQQA 4Z4QA 4FN5A 4KWCA 2Z83A 3B1XA 2WKWA 4UUOA 5JMWA 4MVWA 3UAWA 2YV1A 1JB1A 2GF2A 5FI1B 3GGPA 3ZDRA 1SEVA 3AVTA 2FR8A 4RESA 3WIBA 2D00A 4TPKA 3K71B 4D3ZA 4O4LB 5T4BA 4KRYA 4HSGA 5JISA 5KJCA 3M70A 3DKKA 1FFCA 1BS9A 1OC4A 3ESCA 1K89A 1Q22A 1V16A 2GKOA 3CCBA 5F98A 3WZLA 3SIRA 3I2FA 4FWIB 3K6SA 5BQPA 1MJHA 4NQRA 3J80A 3QVVA 2QD3A 1BFUA 4BNVA 3PGMA 1J6UA 3Q8XB 1HQDA 1RYBA 1NJ2A 1ISMA 2JFGA 4E3WA 2I2CA 5KOHB 2B7BA 3FPJA 5BQOA 4UM5A 4GAEA 1MNQA 2FP3A 4S1WA 3V46A 4DWOA 4AS2A 3LLSA 2V3CC 3WYNA 1Z25A 2PKXA 1TW3A 4M9XA 4BU1A 2A5LA 4B3CA 2QSYA 1L4LA 1ZAKA 4ROTA 4DQKA 4XYLA 2VA8A 2NYRA 2PWPA 1KMMA 3IJRA 5KU7A 4PPNA 1C50A 1GZVA 4OXXA 2OMKA 2JIPA 4JVLA 3KFLA 1KAEA 1H05A 3PDIA 1ZJYA 3BZUA 1U31A 2VZ8A 4KAFA 5JSUA 5KHOC 3V7WA 3OI7A 3FTQA 4HDAA 4HVCA 2R7NA 5C5EA 2OP0A 3RSSA 1J1UA 4ON9A 2QN6A 4DLUA 4NBUA 4GZMA 2PFKA 1GRCA 3GYGA 2P4HX 3D6AA 4OHRA 3EYWA 2QN8A 4IAOA 4LDAA 1KEVA 3CUEF 3M6UA 2X6TA 3UKOA 2CB0A 2DHQA 4HNQA 4UBNA 3H8VA 4I4IA 4Y1RB 2WB4A 2Z98A 2FPSA 2OGZA 1I13A 4XB6B 3RTEA 3WK8A 4RTQA 3CVUA 4UQLA 5CG1A 4G09A 1GU1A 3R7NA 5EGNA 4L9WA 3FDFA 4Q4JB 5IJ0A 2HMWA 2KM1A 5IDWA 3H18A 3FLMA 1P17A 2I80A 2YY6A 4K05A 4KXVA 3BHMA 2C98A 4M2LA 4U8GA 4YNBA 3T5GA 5J4YA 1A8UA 4CM7A 4DR1B 1PJ4A 1OSNA 4ENUA 4BNMA 2H5EA 1HE1C 3PSAA 1C1XA 1W76A 3E7WA 4OGFA 5E6SA 3BH7A 1QKKA 2VAWA 3WLFA 2BHRA 1QF9A 2ZRFA 3FUUA 1HMPA 1X7XA 4JQZA 4EYOA 2ZU0C 4YRGA 2IPMA 3RYFB 4B4VA 2BELA 4BUCA 1CUIA 1SOUA 1SQGA 1IUNA 2DCUA 3Q0EA 3S2ZA 3C85A 3ZU3A 5HA5A 4RABA 1TU0A 4J4TA 4AZ3B 3KKNA 3W6NA 1MQSA 2WNSA 4ZYTA 4TTRA 5JCOA 1RZ3A 1CJUC 3C6BA 3PNKA 4HFRA 3GCXA 2WEKA 4PTLA 3HR7A 3JQ8A 4JP8A 3BWYA 2XB4A 3DP7A 4WTOA 4X8HA 3EA5A 3IE1A 4BCCA 1JYEA 1YSCA 5CFLA 1U1GA 2YY7A 2W2KB 4NP6A 4O0MA 4G0QA 4QUGA 4TVKA 4YYZA 3MZ0A 3OP4A 4L5YA 3GAMA 4RXUA 2F8TA 2RHDA 2FSGA 1XJCA 3E53A 1T3SA 4GI1A 4S1OA 1C7QA 4CU5A 4YRNA 4MI9A 3WXMA 4BRSA 2Y2UA 4LF6B 2BFFA 4YV7A 2WQZA 5IZCC 1IYZA 1W0CA 1LS1A 1ZGZA 2ONKA 4L78A 3ZGOA 3WLAA 2GN6A 2HMSA 4RAQA 1W30A 4CR8A 1JG6A 1HDOA 2I7VA 5CLIA 1VKZA 2FJPA 1CF9A 1R6DA 2O7RA 1JIXA 2A33A 2ZSDA 1OGYA 3FHTA 3FVQA 3RTDA 4JBYA 2ZRJA 1CB0A 4NAHA 3AGQA 1HZZC 3QF7A 4PWZA 1WOYA 2AXEA 3T5AA 4AK9A 1Y3CE 2X9NA 3DAPA 1GL6A 1AK1A 1E7SA 1V96A 2CXSA 3LBFA 3MLAA 1L7BA 4R1SA 3EQ7A 1QCYA 2HCJB 2KBFA 4E2XA 1EWRA 1PGNA 2Q46A 4IHQA 2R1VB 2WW8A 2GBLC 1H5UA 1TJYA 1YJXA 3A27A 1CRWG 3FBTA 4IKEA 4RPIA 2I03A 4GYYA 3GLFE 4WINA 1GDDA 2PR7A 5FPPA 1JEQB 2BUCA 3GMDA 4MINA 1PKEA 1U8YA 4INPA 5H4GA 5AOVA 5B58C 4I8IA 1TIPA 5JAPA 2NG1A 1TTPB 1EA5A 2O2CA 1SIUA 1FFHA 1MB0A 4LMPA 4OKIA 1ST3A 5BWLA 3ZQ4A 5EOVA 3X1JA 3UA3A 1EVLA 1NRJB 2C3OA 3WTBA 2JCVA 2RC5A 5D2CA 2CFTA 5FQNA 1TYEB 5CJ2A 4WECA 4ZICA 4B47A 2WHPA 3KXPA 1MC4A 4GKAA 5ER9A 1N2EA 4QEZA 4B8WA 1PL8A 1LK5A 1QGAA 4QXQA 4BWFB 3N6VA 5LQMA 3BWEA 1V3UA 5HKAA 4JUCA 1RMTA 4R31A 2FDCA 4JI8B 1R18A 4IXMA 4D9BA 3UMSA 4FHFA 4NHEA 3JPWA 3WYGA 2IYXA 2P0AA 2R8YA 1S5PA 2EEZA 2Z8YA 3EVEA 3LP8A 4IUBS 5FOTA 3TNJA 3KUXA 2ZW9A 4ZREA 2PRKA 4Y2XA 5HKKA 1D2CA 1VSTA 1CUAA 5DHSA 2FP4A 1FB5A 3A6EA 3SVZA 3FDZB 1MVNA 2WUWE 1XJQA 4FSHA 3EEIA 2JHFA 2D62A 4I9FA 3B38A 1I3LA 4OP2A 1G8FA 4MAAA 3W9YA 3J7TA 5I9LA 4W7SA 2R751 1MN6A 4JI1B 1L7PA 4XVUA 2VDNB 2IXDA 1GUDA 2WF6A 2K7ZA 3HNPA 2WE8A 4M98A 4O59O 2PT7A 4FB4A 1IMOA 1IZ9A 2IE0A 3GAFA 2BCEA 3K4PA 3LPLA 4KVGA 4OQEA 2WMNB 2GXAA 3HB0A 3A6HA 1QWOA 5CCXA 1E9EA 1P62B 4QPCA 4KV7A 4A8HA 1I2DA 2C3UA 2QL5A 3TW4A 3G9TA 4JKOA 1I0ZA 5KTTA 4V24A 3NGMA 4CGYA 1HQKA 3KJGA 1XLVA 3L4SO 3QK7A 1SU8A 4M76B 4JXKA 5F1KA 1G9TA 1KZGB 2PT9A 2RCNA 4FYWA 3ZZ1A 3OQNA 3DTVD 3AF4A 1N2BA 2ZYSA 5ELLA 3LA6A 3PR1A 3QTTA 3PLRA 2HLDA 3MAAC 3TE7A 5BPFA 5TIIA 3VBCA 5JJBA 1FX0A 4XVRA 1H3EA 1DMRA 1MJGA 1Z5ZA 4HGNA 2EFGA 2ZSFA 4AUNA 5TQ2B 1BVHA 4HMPA 2BKVA 2JZOA 5BSVA 2Q45A 4WFJA 3FTCA 4ZK2A 1LTHR 3C70A 3D31A 4ITVA 3WMFA 3M1AA 5LYJF 1K8YB 1XVTA 3IV6A 4A9AA 1ZONA 4F9GA 5IWCA 4DAOA 1L4UA 1KL7A 1T5OA 4Q1FA 2YJTD 4PF1A 5JWHA 1QBGA 3D0QA 2R8PA 1IXZA 1G3UA 2XNHA 3JYPA 4ALIA 4BMVA 4DE5A 3JAWA 1CEYA 1KI4A 3WIDA 3IVRA 3OZEA 2L17A 4WBNF 1MU0A 2GPJA 1JAYA 2Z56A 2A5JA 5FTWA 2F55A 3HP7A 4KPEC 3IO5A 4DV4B 1KKLA 4G63A 4D4JA 3F47A 1HNWB 3N7TA 2YFHA 1K8RA 1VBMA 2D4HA 2GM3A 2NPOA 4QPNA 4ZARA 5IPFA 1SFRA 1RR6A 3QYAA 4LVCA 5IAEA 2HWUA 1SY7A 1YDFA 2X2PA 3AUKA 4Q9HA 2WIKA 1T0UA 2H31A 1ZWKA 4EY7A 1W36B 2AG1A 4M1QA 2VJLA 4ZU6X 3TK1A 1QZTA 1ZC4A 2ZRCA 1D09A 2JGRA 2NO7A 4KVAA 3T7KA 4BQOA 2OMEA