3AIMA

R267e mutant of a hsl-like carboxylesterase from sulfolobus tokodaii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
283
structure length
283
Chain Sequence
b'ASVEEIRSLFKQFSSLTPREEVGKIEDITIPGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDSAGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTREHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVEFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVFYGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 303aa long hypothetical esterase
publication title Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobustokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 95
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2010-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aimA00
1BROA 5FPPA 3RK4A 1UOPA 1UK6A 3O4JA 4IH9A 3QITA 5A7GA 5I8PA 2J3DA 4CFSA 3GZJA 1TAHA 3FLAA 4UUQA 1QIIA 3R41A 4GHWA 5DJ5A 4BATA 2QXTA 4ZV9A 4YPVA 5HK9A 1JMKC 3WJ1A 2QMQA 1BN7A 3ED1A 1AGYA 1XQVA 5IVIA 2DHDA 3WYDA 5K3FA 1CIJA 2QR5A 3G7NA 2IX9A 4MWSA 2JIDA 5FOQA 3WKCA 4DMCA 5JAOA 4ETWA 1UWCA 5AKYA 2HU5A 4C6HA 3E1GA 4W1PA 3M3DA 2WJ3A 4W1QA 4QE3A 1IUOA 5AM3A 1L7QA 1MU0A 4BC0A 3M83A 1QO7A 5A7FA 1JI3A 4GWLA 4EY5A 2H1IA 4ZRDA 1HLGA 3FYUC 4X90A 2XQIA 4B6GA 4BE9A 4WFIA 2XUHA 5AK5A 2P8SA 1AURA 3T4UA 1L7RA 5ALMA 2BFNA 1Y7IA 3SX4A 3HXKA 4OU4A 2Y2VA 3C6XA 3V1LA 1HDEA 4J0DA 2CBGA 4LXHA 5CTAA 2XMDA 2DCMA 3O9MA 5FRDA 1ZI6A 4WDRA 4O08A 2Y6UA 4BZZA 4G4IA 4IO0A 5ALZA 5F4ZA 5BWBA 1EDBA 1MTZA 4DM7A 4LXGA 1CUXA 5K3DA 5AOBA 2GBGA 2HRQA 4MYDA 2H9YA 1Y37A 2DQZA 5FV4A 4KAFA 5DNVA 1T4MA 4WDQA 1DINA 2ZSIA 3DS8A 2OXEA 1TK3A 2ZJ7A 1HBJA 5AKJA 1BN6A 4DMFA 2UZ0A 4KYVA 3DEAA 4X91A 3IUQA 3C8HA 1AKNA 1CUGA 3WKAA 2ES4A 4H0CA 5HKAA 5T4FA 2VATA 4HXEB 4ARAA 4QWWA 3QH4A 5AIBA 1CUWA 2XUJA 1SCKA 4BB0A 3L1HA 3HACA 1CUBA 2XMRA 4G1FA 4OD0A 1GZ7A 1EK2A 4AZ0A 1DWPA 3WZLA 2IIVA 4XX1A 1U65A 4C89A 4S0XA 1F0PA 1ZJ5A 3G9UA 1EDEA 3I2HA 3A2NA 5AKXA 4CG1A 1K4YA 4ZI5A 1VZ3A 1ACJA 3G0IA 5IKXA 4OYYA 1J2EA 5CURA 4FOLA 4WY5A 1JMYA 4B9EA 4UFPA 1ZJ4A 1EDDA 2PKYX 4C4YA 1E66A 1YA4A 5ALIA 2PX6A 3R3UA 4HS9A 3O95A 3IULA 1VA4A 4J0CA 2RAUA 2XMZA 2G4LA 2WILA 4UHHA 4LKOA 5JARA 4H7EA 3GROA 1FFBA 5EIEA 3FOBA 3A2MA 3QPCA 5ALQA 2Z3WA 3WL7A 4Q82A 2LIPA 1UK7A 4HAIA 1MX9A 5ALFA 2FJ0A 4FBMA 4KR0A 1AC5A 3B12A 1C7JA 4K6HA 1E8DA 4EY7A 5IH7A 5AKLA 1UK8A 1DX4A 4DTCA 2VAVA 3QBJA 4ZREA 3B5EA 3DOIA 2X76A 5AM2A 5AIAA 2GBFA 3WKBA 1CUDA 3WL6A 3IA2A 3QM1A 2VJBA 4BTVA 1RWQA 3UUFA 4F21A 5ESRA 5A7HA 2QJRA 1XQXA 2K2QB 5EIHA 1ODTC 1GKKA 3GA7A 4B85A 4F60A 2YASA 4ITVA 2VT7A 3H17A 2DFPA 4RNCA 4X95A 1ETHA 4NMWA 2WIGA 3OC0A 4RE5A 4N5IX 3AIOA 2XUKA 4KRXA 2JGIA 5JD6A 1R9MA 3FBWA 2HM7A 3V48A 5K3EA 3AIKA 4UFNA 1EB8A 3DD5A 2VA9A 5ALTA 5ALKA 5CMLA 4Y2RA 4K2AA 4B81A 1H2XA 1ZD5A 3D7RA 5CT5A 1RP1A 3RKSA 3WZMA 4FMPA 4P08A 1XKTA 2RIPA 2HA7A 1NX9A 1LLFA 2EDCA 4FLMA 4JNCA 1J07A 1H23A 1SC9A 5LKRA 5HQ3A 2H7XA 4FDMA 4KRYA 4G8DA 3O9VA 1W76A 1P0IA 4KAJA 3W04A 5CXXA 3AUKA 1EB9A 3AIMA 4GI1A 2PM8A 2VJCA 2VTVA 5SYMA 1VLQA 3MUOA 3L1IA 3C45A 4PO3X 1CUSA 1TCCA 1XZIA 4QEKA 4KEAA 1XZMA 1VZ2A 1C4XA 5AI5A 4BYMA 5ALVA 2WG0A 3AINA 3NUZA 4GECA 3WWDA 4OU5A 4AO6A 5AP9A 5CW2A 4F0JA 2WUDA 3R3VA 5LZ8A 3FCYA 2XMBA 1TCAA 2XUFA 3FLBA 5C7YA 5JD5A 3ZWQA 4EHBA 4DSAA 1TKRA 2I3ZA 3O4HA 3ILSA 2XMGA 1CR6A 5JAHA 1IUPA 1LPOA 5E4TA 5KWJA 2ONCA 4L3WA 2BAGA 1OXMA 5LIPA 2RI6A 5K3AA 1VJ5A 1LNSA 1DX6A 2HL6A 5AO9A 2C7BA 3R0VA 3CN7A 2XDWA 4Q3KA 1GT6A 3R3WA 3K6KA 1LPNA 2WFLA 3WMRA 4Y7DA 1CUHA 5LYYA 4BC1A 2WU3A 3BE8A 1CUYA 1L7AA 3R3XA 3GBSA 2C58A 3V1KA 3W05A 3BL8A 3RARA 1Q83A 4W1SA 1VE6A 4TPKA 4N8DA 5JASA 1FJ2A 4UBNA 2G5TA 4DMHA 3K9BA 1R3DA 5ALDA 5ALSA 4CIAA 4EB0A 1I6WA 3SC2A 2ZJFA 3ESDA 1XZCA 1WB4A 4H7DA 2BGNA 3STTA 4EY8A 1JFRA 4AB1A 1UT6A 3QMVA 2AJDA 3DL7A 5E4JA 1MT3A 3H19A 1WB5A 3FVRA 5DTIA 1MNQA 5JAUA 4B7ZA 1H2WA 3A70A 4TGLA 1ZOIA 1ORWA 4UBOA 1XFDA 5JYCA 2WHPB 2QOEA 4QZVA 1Q84A 5AOAA 2OGZA 5K3CA 3STYA 3H2GA 1JU4A 1MX1A 3E3AA 4KE8A 2WIFA 1X2BA 5ALGA 4AMYA 3Q0TA 3G02A 3JYHA 2WKWA 4X3CA 1CEXA 5ALUA 2PUJA 4UHFA 4BCCA 1A8SA 1S8OA 2H7CA 5BV7A 3SK0A 4X6XA 3EIOA 2HHAA 2V9ZA 4UBLA 1BCRA 5YASA 2BJHA 5HFAA 4BE4A 1DT3A 3IDAA 4MEAA 4Q3OA 3WWCA 5LZ4A 5AKKA 2XT0A 1AX9A 2HRRA 2QZPA 1J06A 4H35A 3AJAA 3E0XA 5D3ZA 4G9GA 2XMSA 3M81A 1CPYA 2VEOA 4B83A 3HJUA 2WIJA 1B41A 1P0QA 2XUIA 4E14A 5LZ2A 3WKEA 3HYSA 2JGFA 1EVQA 1K63A 5JAPA 2RONA 3A6ZA 1XQYA 2VF2A 1USWA 3AZPA 5C8VA 1FFEA 2HDWA 4DYHA 4X97A 5AI8A 2XUPA 3STXA 4L9AA 3O4IA 3WK8A 5EHQA 2XLCA 4W9RA 4KACA 1LPSA 2GYUA 1FFAA 1ODCA 2Z8XA 1VXRA 3ANTA 4RE6A 5AKGA 3FCXA 2OCGA 1HQDA 4QDTA 2YXPX 3K2IA 2B9VA 3KDAA 2Y1KA 2ZYRA 4MWTA 4L0CA 5A62A 1YB6A 1UKCA 2CJPA 2PU5A 1LGYA 3KWFA 5LLSA 4DGQA 3DKRA 3GUUA 3LIIA 4W1RA 1YSCA 4H7FA 1MAHA 4V2IA 2R11A 3S2ZA 1CUUA 3TJMA 1U2EA 3W9BA 1F8UA 2XQFA 3ESBA 1VXOA 1QIGA 3NGMA 4DNOA 5LP1A 4IH1A 1PV1A 2JGJA 1WOMA 2BGRA 1XRMA 2WFZA 2YYSA 3D2AA 4X7BA 3DYVA 3VVLA 3Q8WA 1G4HA 1B6GA 2AJLI 5AH0A 1QTRA 2AJBA 4ARBA 1LZLA 1UOOA 3C70A 5LZ5A 3FAKA 3WL5A 5T4BA 1SOMA 1BEEA 5HFNA 2XI4A 2G63A 2BUBA 1YCDA 2GZRA 5AKZA 1EK1A 4X00A 5JIBA 2FUKA 2WUEA 3BXPA 4OUKX 4PF1A 2HA2A 3ZI7A 1XZDA 1XZBA 3PFBA 4B0OA 5D3KA 3N0TA 4AXBA 2HA5A 2WHRA 4EY6A 1YA8A 5DYWA 5AKHA 2C4HA 4CCWA 1YASA 3C6BA 1LPAB 2WTMA 1GXSA 5ISMA 2DSNA 3LCRA 3I6YA 5SYNA 1ZGCA 2Z8ZA 4X92A 3WA7A 1H2ZA 5CXUA 4Y2UA 2HA3A 3ANSA 2VSQA 2WG1A 4FNGA 4N8SA 2JGKA 1BCSA 4KAAA 1QLWA 4Y2PA 2GBCA 4FKBA 1K5PA 2BUAA 1Q0ZA 5ALPA 5FXMA 1DWQA 3HC7A 2C0PA 1ACLA 4UHEA 1KU6A 4E11A 4BRSA 1KU0A 4QDXA 3ICVA 1QFMA 3GFFA 3NWOA 4GDMA 1BU8A 2HA6A 2WSLA 3ZV7A 1THTA 4OSEA 3PUIA 2OG1A 5C81A 5T4HA 3G9XA 5LKAA 3WJ2A 2JGMA 4JYMA 4CG3A 5KREA 2OCKA 1Q0RA 2DR0A 5J3JA 1WPXA 2J3QA 5JD4A 3I6ZA 3IIIA 4FFVA 1QE3A 1LPPA 2O2HA 2AJCA 2XQKA 1BS9A 3DOHA 3WK6A 2XLBA 4J0HA 3C87A 5CRIA 5A71A 4LHEA 5ALYA 4G9EA 1YS2X 5K3BA 3I1IA 5I9IA 1CQWA 3I2JA 3I2FA 4C88A 2PUHA 1CUFA 5LZ7A 3WK9A 3OPMA 3WYNA 1W6RA 3DDUA 2ACEA 3WQHA 1AMNA 5HF9A 2QXUA 5FP0A 3EBLA 3HEAA 3VJMA 1DU4A 5AKEA 5LZ9A 2OQIA 1ISPA 3HLKA 1ORVA 2ZVDA 5IVDA 4QLOA 3I6MA 1N5MA 3M82A 1QONA 2GBIA 1QIHA 4G8CA 3OG9A 4MEBA 3C6YA 3C8DA 2B61A 2IITA 1VE7A 4DNFA 4G4GA 4K5QA 3FSGD 2G5PA 4X71A 2JBWA 3P2MA 5AK6A 5ALXA 4U2BA 3EQ8A 3N2ZB 1CV2A 3WIOA 1DQYA 2ZSHA 3IBTA 1LBTA 3I2KA 4FNMA 1NU6A 4FHZA 3ESAA 4YK7A 1A8QA 1CUIA 5DNUA 1EX9A 1YAHA 4J03A 5I7UA 1WHSA 3F67A 2OGSA 5CT8A 3OM8A 5EIAA 1THGA 4ZXFA 5DYYA 2PSFA 4A16A 5AM5A 4BTLA 4XVCA 1PJAA 3D2BA 1VOTA 3VVMA 3ZLTA 1UKBA 3FSGA 1HL7A 5IVHA 1XRNA 1ZIXA 1QTIA 1CQZA 5ALRA 1F6WA 2OPHA 1XQWA 4J0JA 2QS9A 1PFQA 3PI6A 3V9AA 2QRUA 1A88A 1U4NA 1W52X 2VAXA 2Q0XA 1T2NA 3F96A 4HXGA 2I03A 4FFWA 3DCNA 3MUNA 3G8YA 4M0EA 4UPDA 3ICWA 1ZGBA 3CCBA 2CEKA 5DNWA 2V97A 1K6EA 4BBZA 1XLVA 2B4KA 3NOXA 1XROA 1XRPA 1QOZA 4OCZA 2V96A 2QJWA 1XLUA 2WHPA 2R8BA 3VDXA 1EA5A 4UFOA 3BJRA 1DTEA 1JKMA 2H7YA 4Q1VA 4HRXA 3H2HA 4RGYA 2OAGA 4AN1A 5KBYA 1IUNA 5FDFA 2BCEA 4EA6A 2EEPA 1GPLA 3WWEA 1TQHA 5HF6A 1EH5A 2XUAA 1E8NA 1BRTA 4A23A 1IZ8A 1K8QA 1GKLA 5AHXA 3KXPA 2VT6A 1JJFA 3B3QA 4H77A 3G0BA 4LYEA 4CIBA 1IZ7A 5HKBA 4QNNA 1DWOA 2ROQA 2WJ6A 3DNMA 4BAGA 1G66A 2RHWA 3C5WP 4FTWA 3FYUB 3I2IA 4PSCA 4DIUA 1QIJA 5A2GA 1N1MA 4PQEA 1CUCA 4BVLA 3CXUA 4WY8A 3STUA 1W75A 4C4XA 2PSDA 1QIEA 1QIMA 3H1AA 4X6YA 5AI9A 3WWPA 3KWJA 1YB7A 3D4LA 2ACKA 1TCBA 2BUCA 4P9NA 2J4CA 4AZ3A 3X3HA 1FFDA 4BP9A 3O0DA 2DHEA 4AN0A 4HRYA 4NZZA 1ZI9A 1X2EA 4UBJA 3QMMA 2WIDA 3IUJA 3BWXA 4BCDA 5JZSA 2WTNA 3JWEA 1JJBA 5AK4A 3HI4A 3QMWA 3TGLA 1QIFA 1YAJA 1CLEA 3VISA 3D2CA 3QPAA 5FUMA 4G8BA 3L1JA 4H7HA 1JT2A 4EUSA 1MX5A 2ECFA 3QZUA 3D3NA 4U2EA 3BDIA 1FFCA 2ZYIA 4CCYB 3BIWA 5DWDA 5AM1A 4KE9A 3WWOA 4YX9A 1N5RA 1XRLA 4WFJA 1H22A 5EHNA 2XQGA 1CUEA 1XZLA 4FWBA 4HXFB 4AO8A 2WU4A 3VXKA 4NVRA 4ZV7A 5IVKA 2HU7A 4MYSA 4K6GA 4N8EA 4Q3LA 1XZGA 1Y7HA 4B82A 2V98A 5E4YA 1WHTA 1GQSA 3A2LA 3HSSA 2C5FA 5AKIA 3E4DA 5BOVA 1GPKA 1M33A 5HF5A 3PUHA 3OTQA 1MAAA 5CH5A 3IVMA 1G42A 4K6KA 2OCLA 5DTJA 2ZJ6A 2WG2A 4FBLA 4EBBA 4KJXA 4GW3A 3V1MA 4WCVA 3DQZA 1CRLA 4Q34A 5KWIA 1XZFA 4QWMA 3H2IA 4PV7A 2NW6A 2HIHA 3IB3A 2YH2A 2CUTA 3WLAA 2PSEA 2QUAA 4L72A 2GYVA 3W06A 2XUQA 2OQVA 4B9AA 1AZWA 4XJVA 4AO7A 3FYTA 4DLNA 2PPLA 4Q05A 2WHQA 5JZBA 4CI9A 3TEJA 4DMKA 5K5EA 3VKFA 4BDTA 2WM2A 4I4CA 1SCIA 1R4ZA 4XIIA 2O2IA 5ALNA 5BWCA 2HADA 2FJPA 5ALOA 5CT4A 4X93A 3U0VA 4Y2VA 1MNAA 5ALEA 1UXOA 1QJ4A 4BZWA 1RYYA 4YASA 2WJ4A 4HTAA 4A5SA 4Y2YA 2PSHA 3DYIA 3AZQA 1AQLA 2I3DA 4PW0A 5CT9A 4B84A 4GBGA 4P92A 2HA4A 2HFJA 3LIPA 3DKKA 3IURA 2GZSA 3PF8A 4GLBA 3C43A 1EVEA 5ALLA 1LZKA 4W63A 1N8SA 4BDSA 1UZAA 2QUBA 2XUDA 4UBKA 1LPMA 2JEZA 1P0PA 3F98A 1UOQA 4QA9A 5EFZA 4ROTA 3WA6A 1YS1X 1QO9A 3ZLVA 4C87A 4AQDA 3OOSA 1R1DA 1E5TA 1TIBA 2PVSA 4MQLA 3VJLA 1QGED 3MVEA 5K3FB 1MJ5A 4JH0A 4UHBA 3VJKA 3W2TA 2CB9A 2JF0A 3QYJA 5AI6A 1BEZA 3WK4A 3D5EA 3QPDA 1P0MA 3I28A 3YASA 3FLEA 5AI0A 4Y2JA 1MN6A 5D6OA 3C6ZA 2ZYSA 1FSSA 4GEGA 1VKHA 3GELA 4ZGBA 1IVYA 5AJHA 4Y2SA 4QLAA 1ZIYA 1E8MA 1XZAA 2OLEA 2RGUA 3EQ9A 1SCQA 4PSDA 5CH8A 4PSUA 5HF8A 1HKHA 2PBLA 1QIDA 4DSZA 4X94A 4H18A 3H18A 3AFIA 2VJAA 3WL8A 5E2IA 3RLIA 3H1BA 2QM0A 4J0IA 5ALJA 3D0KA 3ESCA 3I2GA 3ZPXA 3MGAA 4B0PA 1XLWA 3LLCA 3OURA 4H7JA 1X70A 3F9CA 1CUVA 1CVLA 1R88A 2Z5GA 3DLTA 1ZD3A 2PL5A 4AMZA 1WPRA 2ORYA 3G0DA 1EI9A 2OGTA 2W22A 4Y2TA 5FKJA 4C4ZA 3ZLUA 4M0MA 4BVJA 1OCEA 2QKYA 4OB6A 2WIKA 1JU3A 4MXDA 4Y2XA 1E3QA 1UK9A 4U2GA 3WI7A 4UBIA 3PICA 3G9TA 1XZEA 3T52A 3WKDA 4UHDA 3S8YA 3F97A 4LXIA 4Z49A 4H7KA 4HZGA 1H2YA 4Y2QA 3W9UA 1KEZA 1SFRA 3BJMA 1CUZA 3R3YA 5A6VA 1XRQA 3H2KA 2J4FA 3RM3A 3G0GA 3R3ZA 1CUAA 4JEIA 5T4EA 2WFMA 3U1TA 3V1NA 4EY4A 1A8UA 2JGEA 4OB8A 1W1IA 4N5HX 4BAUA 1O6FA 4LYDA 3WIBA 5EI5A 4UBMA 4X6UA 4FLFA 3H0CA 2HU8A 1HPLA 2C5GA 2ZYHA 1QIKA 1QZ3A 3SWWA 5AM0A 3HZOA 1WM1A 5CT6A 2QT9A 3BDVA 5HZGA 3G0CA 4G4JA 1UFOA 2W6CX 3PF9A 4U2CA 4WFKA 5DYTA 5EGNA 1WCYA 1ZD4A 4Y9SA 5JZ9A 4LIPD 2XUOA 4F5ZA 1C7IA 5ALWA 2X8BA 2DHCA 4B80A 3F8SA 2CZQA 4I19A 5DLPA 1DT5A 1TRHA 2BKLA 2X5XA 1W4LA 1GPNA 1ZD2P 3FWHA 4DNQA 5CBKA 4G5XA 1A7UA 1JJIA 2WQZA 1YR2A 4PNZA 1E89A 4JUIA 4IQ4A 3H04A 1Z68A 1R50A 5FLKA 2DQYA 3O4GA 2RHTA 3R40A 3FYUA 4BCBA 4INZA 1GGVA 2OAEA 1CUJA 4RPCA 1XZHA 2OCIA 2HFKA 4IH4A 4BRZA 2JGLA 1DQZA 1XZJA 1UKAA 3DL4A 1CFJA 5D7BA 1IMJA 2XE4A 4CG2A 3IUNA 2E3JA 1BE0A 4KE7A 5C8XA 4DNPA 3D59A 4IHAA 4HVTA 3CCCA 4J0GA 4J0KA 2AJ8A 4J7AA 3AILA 1NU8A 2EDAA 1EXWA 1XRRA 5AOCA 3FNBA 4GXNA 2JEYA 4E46A 5AK3A 5CH3A 2Y2UA 3KD2A 3DJYA 2PU7A 3PFCA 4U2DA 6YASA 5ALHA 1WB6A 3LS2A 4CCYA 2C0QA 2XMQA 5FPQA 4OYLA 3G9ZA 3WK7A 3JW8A 3UMJA 2WUFA 5EHZA 1O6GA 5JATA 4TVKA 2XMCA 4J3JA 5JADA 2GYWA 5HCUA 2FX5A 2HA0A 3WK5A 1LPBB 2I78A 3CN9A 5JALA 4D9JA 2B20A 2VQ6A 5HQ3B 3BF8A 3LP5A 3QVMA 1G5FA 1EINA 4FLEA 4EZIA 4QDOA 2XB6A 1D07A 3C5VA 1ZI8A 5HK8A 1F0NA 1OILA 3IUMA 3EF3A 4H7IA 1LBSA 5AI4A 4BP8A 2O7VA 3STVA 2Z3ZA 4AX4A 3HRHA 5C8ZA 2XUGA 1MO2A 1J1IA 1U8EA 4M0FA 4XWGA 5EHXA 1QFSA 2O2GA 4BVKA 4ZWNA 4MQMA 2CKMA 3AZOA 3PDCA 1VA5A 5JANA 2QTBA 1R9NA 5AM4A 7YASA 4JYPA 2O7RA 5H3HA 4QDZA 4P93A 2WUGA 3BF7A 2D5LA 3KOOA 1ODSA 4X85A 3EQ7A 3STWA 3UUEA 4C01A 1GQRA 3KSRA 4E15A 3H2JA 4U2FA 4WJLA 3FVTA 3BIXA 3HABA 4OB7A 3TRDA 2CMFA 5AICA 4NS4A 3I1YA 1XZKA 1AUOA 2PSJA 4I3FA 2WLSA 4BAZA 2VJDA 3PE6A 1XKLA 2XQJA 1EHYA 2AXEA 4UHCA 2WFLB 2D0DA 2Y6VA 4OPMA 1MPXA 4KE6A 4QDUA 1ZICA 2QVBA 4MJ3A
chains in the Genus database with same CATH superfamily
3CW9A 1BHSA 2J48A 3HKBB 3QQ5A 4H1VA 3A32A 3RK4A 1BOFA 4NP6A 1JJAA 3HSKA 1SQ0A 3FR7A 4IH9A 1LS1A 2IS4A 3QITA 5I8PA 1XDDA 3PGVA 3EY9A 4HO1X 3KQWA 3MJEA 4H3VA 4NLLA 1BXRB 5IK2D 4ZT4A 3IC5A 1V6SA 1VHWA 3WYAA 1M34A 1Z2PX 2IA5A 4NAVA 5TXGA 1NXQA 1P5JA 1JGTA 1P4JA 4XEUA 1QIIA 1ZLYA 1Y1QA 3GCGA 4UU8A 3TZHA 1H85A 4BNWA 5KCZA 5LN1A 2QTVA 2GKSA 4GHWA 4DLXA 4ZK6A 3BJZA 3SM9A 4BATA 2IYEA 4LJKA 2YZ2A 1OBFO 1E1DA 2VDUE 2JLAA 2X4GA 3M9XA 4RK4A 4JFRA 2P2YA 2JIRA 1BXZA 3KYCB 3TM5A 3TZEA 4WZAA 5HK9A 1XTSA 1P4GA 4ZT5A 2GHTA 1W47A 3OQBA 3LYUA 4G97A 4E6EA 4B5KA 4QGHA 1K08A 2BFPA 1QCDA 1QP8A 4WZAE 1BN7A 1QS0A 3LUKA 4D0NA 2B1QA 3CTPA 4OP3A 2JVIA 3B53X 4KPGA 1R4NA 1Z6TA 1TPYA 1CRWG 3KJNA 4JLUA 4XA8A 2IYYA 3TSWA 1GUYA 3EHEA 4C5AA 2DFNA 2Y9MB 4MWSA 1II8A 1WRBA 4NK4A 2XWBF 3ODGA 4L7VA 1N2CA 2JGRA 2Q7OE 3U3OA 4KWHA 4XW2A 2ZBEA 2HMYB 4LXXA 2ZCJA 3M33A 2XDYA 1KPGA 5IM5A 5JAOA 4OM7A 1JVBA 1UWCA 1OXXK 2XWSA 3ANYB 3FFTA 4KLNA 1AKRA 1OC2A 5DMXA 5GM2A 5A06A 4Q16A 1MXFA 3JZMA 1RM5A 3UQYS 1N7JA 2QTHA 1OXUA 10MHA 5DI3B 1QQBA 2R2AA 3M3DA 2O6HA 3UUGA 5C18A 2O7QA 2Q6VA 3O8DA 4AKSA 4QE3A 5CBPB 1SXIA 3AJDA 2XGOA 1L7QA 1HOTA 2PZLA 1MU0A 4MA4A 4XUCA 4BC0A 4KN5A 5ADVA 3MPUA 3M83A 1IVNA 4KLRA 3FG9A 4RJTA 5J4KA 1KI7A 1YL7A 1J70A 2ILVA 3UMSA 1JG2A 4DJTA 1M8FA 5AXAA 3PVZA 1P4AA 1G38A 3A6GA 2WAYA 4ZRDA 1U8FO 3CPJB 4UOEA 1UIMA 1KI4A 4TVOA 4ZYXA 3CUEF 4A82A 1COWA 2CZGA 1RT9A 3MIIA 1KIFA 2YWCA 4IP0A 4E5SA 2AQHA 2XQIA 5IDVA 3V8MA 3OOWA 4P54A 1NHWA 4WWHA 3RVPA 4BE9A 4OL0A 5C32A 3DHEA 3E53A 5E6SA 2P8SA 1AURA 1RABA 2J3LA 3DHYA 3EIUA 4ABYA 8ABPA 3MCZA 3T61A 1X7ZA 1B6SA 4F04A 4IIBA 1FP2A 4ER0A 4BXOA 3WHLA 3DOOA 3DXYA 2WFAA 4OU4A 4P4TA 3ZDCA 1B26A 3FKSD 4N7BA 4QYXA 3ORSA 4BV3A 1ZITA 2GN4A 5KX5A 1I1QB 3UM9A 3E81A 3C8MA 2DOKA 1HY3A 4J0DA 4EF5A 4FK8A 4RVOA 1IHOA 4JZKA 4LXHA 3FX2A 4ERNA 3AP1A 2O8DA 1K8YB 1GNPA 1D3AA 3JWIA 2RBEA 1YRLA 5JO9A 2NYVA 3BOSA 2AN5A 2PGIA 4MCIA 3PQCA 3EMDA 1G4AE 3L8EA 5DGHA 1ULBA 4PE5B 2GM3A 3IAAA 1LWNA 1PBNA 1PVVA 2IQIA 2PLRA 1XWWA 2Y6UA 3MS4A 5AVTA 1VB5A 1P81A 2VCHA 1NFFA 1T2UA 3EGOA 3QENA 5G02A 5LP6B 3GR6A 2HWUA 5ITZA 2H18A 3ZHTA 3E35A 2AD5A 1U0NA 1W0JD 1E59A 2GPJA 1CJVC 2VUTA 3TE7A 4OMDA 4WLNA 3PDWA 5KDDA 4AMGA 3EVZA 4JFAA 2BRUC 2QX8A 3GFBA 1DHTA 1F06A 2FN4A 2JLXA 4Q1EA 1N78A 4X64B 3TLBA 2H9YA 2DQZA 4JQZA 5K0NA 3WLSA 1FDVA 1MA3A 1OGJA 2AOUA 5K0TA 3V6LA 1H3FA 1DINA 1B0PA 4U6SA 4V38A 5IBCA 5K45A 4TS3A 1TK3A 2ZJ7A 2I76A 5CX4A 3N58A 2WU1A 4NMMA 1HBJA 3RGWS 3CF0A 3RRZA 2COKA 2IBMA 1B6TA 1JB9A 3DEAA 5DSXA 3SR4A 1WZNA 1MO5A 1FNDA 4ITRC 3R5KA 3MERA 5M7EA 3GMIA 4BX9A 2SKEA 3U7QB 4F4DA 5CA1A 5CFNA 4M0KA 2ZR7A 3AM5A 3O38A 1CLUA 1KBZA 1Z3IX 2I22A 4IDFA 5F76A 3QOXA 3IQFA 5T4FA 3RWBA 2P9FA 1Q3KA 1Q7TA 1S2IA 1VMIA 2MYNA 2INGX 2WE7A 4JAVC 4KWTA 4QODA 1R00A 4ZEVA 5CHYA 1FFYA 2PD4A 1V11A 2A0UA 5LOVA 4KXUA 1FE8A 4MAMA 4BLRA 5JQGB 5ERXA 3T1YB 1CHNA 4ZDJA 2AEEA 1LK0A 3HACA 1B93A 5AESA 2XMRA 2Y1OA 4M9ZA 2JD2A 3OQPA 4G1FA 3HY3A 5EJIA 2AFHA 4PFSA 5CTJA 1H1LB 3W4IA 2I1VB 3GEHA 3P26A 3N2GB 4OD0A 2RHMA 3WOVA 1X94A 3IAS6 1GZ7A 2W71A 4OQYA 3DVLA 1KP9A 3QVLA 4YP1A 4WESA 4U02A 4AM8A 2IXGA 4CYMA 4N3AA 2IIVA 1RAGA 4PIPA 4DCNA 3JU3A 4S0XA 1F0PA 3G9UA 1W49A 1EDEA 3NOOA 3B5JA 5TR9A 4F6LA 3QEJA 5K0LA 5EQFA 3IP7A 5A5EA 3EZ6A 4OYRA 1GLVA 5AKXA 1VZ3A 2KPOA 2Q2VA 3W3AA 2LE0A 3AEXA 4A0RA 1RJDA 4F5EA 1IFXA 5IKXA 3ZGYA 1IVSA 1S8AA 2PA3A 4H4EA 4OYYA 3WLKX 5JNTA 4G25A 5L6LB 4KH0A 5FPHA 2VNAA 3PRHA 5EYPB 2GBLC 1KDRA 1P7YA 2B1JA 2GFIA 3BWVA 5JCOA 1A5ZA 4AG5A 4E7PA 1UJNA 5AW3A 1DMRA 1KO7A 1TQ8A 1VSUA 3V9PA 2O2EA 3JZAA 5CIWA 3V5NA 4TS1A 4KL8S 5H9VA 5BWMA 5ER9A 2J9FB 3LMKA 3OJEA 5I7WA 1WF6A 1YA4A 3MRVA 621PA 5IASA 2DLCX 3J7AC 1V2HE 4LZAA 4GI5A 5KPDA 2PZAA 4IDGA 2PUEA 2HSJA 5ALIA 5B3KA 1YT5A 2IUEA 4R71A 2YFHA 4BGVA 1WUHS 4H60A 3GEBA 4O2AB 4XJTA 4CLDA 1NXXA 1XBTA 3WIEA 3VHLB 3LLVA 3IJ5A 2QLJA 4Y2HA 1HFWA 3RVKA 2B98A 3O95A 3KSMA 2OP1A 3S1LA 5BMOA 2PMWB 3QEAZ 3VOTA 2OESA 2IE8A 1Q1ZA 1TYEB 4CJXA 5JSZA 2EJTA 3DKIA 4M8SA 4X61A 4JROA 1NL3A 4HY3A 1Q0QA 2BC9A 3Q72A 5TDHA 2G4LA 4JC4A 4EJ6A 3K4HA 4D0RA 5I8WA 4YCSA 2HUPA 3GCZA 3T1TA 1AN0A 3SEQA 2DPYA 2C3MA 3E6AA 4FD3A 4UHHA 3V2HA 4EJSC 1DEAA 3T1OA 5JARA 4HGPA 5L7WA 3QWFA 2Z6AA 3FOBA 2O5RA 3AR7A 1ISMA 3QPCA 4YMLA 4R6XA 3PGLA 4F84A 3ONWA 3SOPA 4M46A 3WL7A 3EASA 3HRIA 3SS8A 4DLTA 3EG9A 3FUXA 2ENWA 1LDEA 1GCOA 4FN5A 3GGSA 4R2MA 2ZBRA 4Q82A 4E5UA 5C4IA 5JC8A 3PGXA 4AC9A 3VAAA 5HUQA 1M0TA 2PE5A 3K70C 3L6UA 3N86A 1L9KA 2OCDA 4YBZA 9ABPA 3VOSA 1JLRA 3EBPA 1P9LA 4HG2A 1OGIA 5BW4A 1FVFA 1J7JA 2QAIA 1NQUA 4GE3A 3INRA 3B12A 4HWSA 1JU9A 1P73A 1OY1A 1SURA 2B3DA 3THRA 3HCBA 4EY7A 4MO2A 2G07A 4R1QA 5G40A 4AKTA 4D4GA 1ZNXA 3NFYA 4EOGA 3REFA 1RADA 3LCCA 4N82A 4YROA 3VPFA 4DTCA 3GZNA 4URVR 2Y71A 1ZGZA 1AO0A 4HGZA 2QX9A 2VAVA 1ZN7A 1WNTA 1NFRA 3DMGA 3A9CA 4DEYA 3S44A 1EFVB 2CLLB 4E2WA 2WWHA 2DEUA 2OORC 3B5EA 3CX4A 2AR9A 2FSVC 1QVRA 3HN7A 4WBSA 4Z2YA 3CLHA 4BOYA 2MYTA 3HYNA 3UKJA 3OE1A 2GM5A 2X0IA 2OO7A 3CUYA 5FJIA 3EZFA 3U80A 2BFCB 1EPUA 2H52A 2B8WA 5EJGA 3RVOA 3W8EA 1LX6A 3KVOA 3TN7A 3WQSB 5HNKA 1F8GA 3UHJA 2QU8A 2GMWA 1NVVR 3WGLA 1VSTA 1DJLA 1TNDA 3R3JA 4OBBA 3ANLA 4LDQA 1ZMXA 1RWQA 2O07A 3ZJ5A 4ARZB 5ESRA 1BO6A 1U0SY 1KA9H 3ONNA 3PUKA 2IYPA 3PKJA 1JAYA 3UATA 5BUQA 2QJRA 5T57A 2K2QB 2OXCA 5EIHA 1REQA 3ETCA 3VUEA 3NBUA 2C2MA 1NXTA 3NI2A 5DASA 1GNRA 2GJAA 3IBGA 2CZCA 2JHCA 3CRVA 4LISA 2G9NA 3L2OB 3WRVA 3CNQS 4WA7A 1X14A 4X95A 3GFSA 4OHPA 2NTJA 4NMWA 1LSSA 4LHXA 1H0KA 5CLLA 1XEWY 4DR1B 3QVOA 3GA5A 5G0UA 1EFAA 3DEHA 3LHDA 1GDTA 4ZVVA 4NFHA 1YZYA 4RWEA 3BILA 3PC4A 1ZFNA 2V7QA 4KRXA 5KDLA 3LTNC 3I62A 2X6QA 2Q5EA 4JBNA 3AYXB 1W94A 1R8YA 1Y8AA 3UJHA 1SD2A 1TIPA 5DHRA 3IP6A 4C7XA 4EW3A 2YFYA 3RYIB 1E4EA 2VA9A 3G5MA 4PSKA 3K0AB 1K1EA 4LOAA 2Y8EA 4F5DA 1NQXA 4UAJA 3EGDA 4PYOA 4RTPA 1Y3HA 2H06A 1RZ3A 3GCDA 4EH1A 4ZYVA 4CKCB 2YV2A 2ZAGA 3EWSA 4TMWA 4W9NA 1H2XA 3D7RA 4YAOA 2VCYA 5DBGA 5KNDD 3IEMA 5KIAA 2D2FA 1NLUA 4NATA 4Q12A 3QLJA 1IY1A 1U5BB 3KK0A 5BPHA 1Q2XA 3IGFA 3ONDA 3C24A 1RZVA 1ZCJA 1FF9A 2YBDA 4FLMA 3DYBA 1J07A 1VL1A 4H0NA 1O97C 4J90A 4MW1A 5HIJA 1L1FA 4IF4A 4J16C 5CAEB 3A4TA 3QBVA 1FUEA 1P0CA 4KRYA 3T7RA 4OIFA 1J1UA 3IDFA 1XFAA 3NT2A 3JQ6A 1Q20A 4BFLA 1GRCA 1OASA 4KYIB 1DKUA 3LBNA 1JDNA 2ADMA 4WKPA 3O9VA 5LVAA 3E1SA 4KAJA 1DJNA 1WCIB 2OTCA 3NV7A 3OIFA 5BSVA 4HHEA 1XAGA 1P0FA 3EXG2 4G24A 2FJUA 4LE1A 4L22A 1EB9A 4UCWA 5BNZA 4E31A 4WV3A 4E2FA 1Q95A 2VJCA 1M2FA 1N5JA 2NPOA 3R6TA 2VYVD 4HMQA 2M2IA 4N4AA 4OF4A 5E1OA 5SYMA 4C6TA 1VLQA 1PR2A 2W42A 4RIIA 4ZAYA 4UVHA 1XL0A 2VP0A 3OFKA 4YJGB 3A36A 1W2HA 2Y1FA 4EKNB 2X7HA 2QJOA 3BRWD 1KDZA 1J5XA 3M4ZA 1GSIA 1MQ8B 3JZFA 5TRTA 4IIJF 1SR8A 3FPEA 4W5HA 1X1RA 5AJWA 3N2EA 3TIVA 3BTUA 5L3QA 2AV6A 1PL0A 5DM1A 1BX3A 5ALVA 5FLXA 4MW0A 1NVKA 1XN1A 1KI3A 4KO4S 2Q3JA 3R6LA 3TE6A 4AO6A 5ED0A 5CB4B 5CFPA 4PZUA 5DF1A 3AUXA 2PX4A 5BY2A 4TS9A 3IE1A 3ND8A 5ULLA 1T35A 2VL7A 1JIJA 1T8RA 1G19A 2WIAA 4KGZA 4C2BA 2XCLA 4E1AA 2FP4A 3PT9A 2BONA 2X1VA 1DJQA 1VLMA 3FCYA 5EZSA 3E8SA 3MQ2A 3KUKA 2BGTA 2SNIE 3OPVA 2PAFA 3NHYA 2ZTSA 4HB0A 5FLEX 1LDNA 3PDIA 5JD5A 1XALA 3GI1A 1G9XA 1Z13A 3FAZA 4B3IA 4CMHA 4CMEC 4DSAA 5E6RB 2O5CA 3SSNA 4NDZA 1KYWA 3T0GA 2JAXA 1D4OA 1P17A 2A1TS 3RSSA 3VR2A 4EL0A 2PUBA 5JAIA 3BFXA 2X5KO 3HGTA 3WLLA 2SCUA 3EC2A 4IUCS 4OQDA 1T4DA 4F1JA 1RNLA 5JAHA 1IUPA 3ZGXA 1PRYA 4JR1A 4HNVA 2XVMA 1TLFA 5LJIA 1PT7A 1XPJA 2D5CA 4EY3A 1ZGGA 1YMVA 1OUMA 1TKBA 1U81A 2PO7A 4L3WA 3C6KA 2NQTA 4YXFA 3EVAA 5BQPA 1CBUA 4I1PA 4QGFA 2JIZD 3OQ6A 5CB6A 1K5GA 4URZR 2YVQA 1VJ5A 1UWVA 4LBVA 3DTVB 4PZYA 5FEMA 1USIA 2ZWPA 3GLIA 4DSOA 1O0SA 2J9GA 3OFND 1U94A 2C7BA 2HO4A 3CINA 3K0HA 1KIMA 3T3GA 3CN7A 4IUDS 3TOZA 4WBNB 1SHZA 1CZOA 5EJ6A 5KNBH 3VKGA 3D7KA 1PDOA 1RACA 2W6IA 2ZRMA 3FCUB 1WHSB 3IP5A 1G5TA 3UYLA 4P3OA 3WMRA 3BG5A 1HR0B 1Z7WA 2HF7A 2JHGA 3CB4A 4RVFA 4DXAA 3DAGA 2EKZA 3B60A 4IZ6A 3HB1A 4K03A 2DZDA 4N6GA 2C0CA 3RLFA 2WU3A 3DGFC 3RJ9A 2IEGA 3FSJX 3CF2A 1AGPA 1CF2O 1CRZA 4MCJA 4P4UA 4FDVA 4MGHA 3RJMA 4TLBA 3S8EA 2CL6X 2Z8YM 2NP6A 4UASA 4YP9A 3V1KA 2VJLA 1D4FA 4E12A 4OUDB 3B82A 2I1LA 2QY9A 3HBNA 2DYKA 4JJKA 2BISA 4LGVA 4XYMA 4MQ5A 2C9DA 4K9PA 4TPKA 5KTNA 3U1BA 4K81B 5ARDA 1BXRA 4D9IA 1ZVMA 3Q10A 2ZSJA 4UBNA 2DLDA 5BSUA 1IXRC 4A73A 4LVOA 2R7KA 2VKQA 3CLRD 4RACA 2CLEB 1R3DA 4BLSA 4URHA 3PU6A 1T25A 4LGYA 4M54A 1O94A 4NG5A 1TAGA 2JASA 1L4LA 2J5BA 4CIAA 3C8UA 1I6WA 1XKQA 1CB7A 4F9TA 2FZ5A 4TSKA 3WX0A 4TLLB 1ZEJA 3SC2A 1CP3A 4CPDA 2C4UA 3ESDA 1CZLA 1XZCA 5L4SA 3WGZA 2P78A 3NH6A 1AXRA 3D64A 4XWTA 4Y0NA 5LQMA 3HR7A 4XDHA 3QXGA 3UY4A 4BBPA 2VPYA 3M1AA 2HLPA 5E9QA 2Z4TA 2GVZC 1Y6JA 3R6WA 5JCOC 1ZL2A 2XEDA 5BN1A 3CRW1 4JB3A 4QBTA 4LRTB 4IIUA 3QMVA 2NV2B 4F92B 2F1JA 3UZUA 1Q7EA 4XGRA 5E4JA 4RADA 3SYTA 3UJAA 1NVBA 4FS8A 3ZWPA 1LC3A 1OX4B 1P60A 2QLLA 1U0TA 4BNJA 2IRWA 4KTTE 3TOCA 3IBCA 4UUAA 5LD2C 1MNQA 3PFGA 1FJXA 2WU8A 1A9OA 1L4YA 4U7PB 2QL6A 3C7DB 2YVLA 2OO5C 3QVWA 1ULHA 1X1EA 1XTKA 2EX1A 2YV5A 3COVA 3B6JA 3BGDA 3MAAC 4TGLA 3F2IA 3FCAA 4OREX 5DI3A 2FW1A 1EWYA 1YJCA 5JYCA 1U0FA 2VPPA 1H3EA 1Z4IA 2ON6A 1L4BA 2QOEA 4JNKA 1Q84A 5CBPA 4QZVA 1SXQA 4C2AA 3KBBA 1IJBA 2A9OA 3LWDA 2GN8A 1LLQA 3PQEA 4NBNA 5FAXA 1Q21A 3STYA 2NVWA 1JLMA 3B1FA 2PNJA 4A9AA 1TM5E 1JKJA 3OKAA 4K7JA 2A3RA 2F64A 4JKOA 5J2TA 3MGKA 1SIUA 3T3EA 4RTRA 3A1SA 2Z9BA 3L0PA 3IV9A 3RGGA 1Y3DE 1A5SB 4EG0A 3IJRA 4RK7A 2XT9A 3A26A 3KQLA 2HRCA 3RW9A 1TF7A 1Q3HA 5G0WA 2GN0A 4GRIA 1KVUA 3H5TA 4B40A 5JV5A 1NC3A 1PBTA 1YUMA 3DBVO 4LUCA 5TEWA 2WKWA 3V42A 1AUVA 1VG1A 5JMPA 4QO7A 1JHRA 4MR8B 2W2LA 3ZNOA 4DLAA 4I99A 4Z9AA 2BEWB 2NTYC 3QVJA 5KTOA 2PUJA 1UMBB 1ZN2A 2OZKA 4EGQA 3IELA 4PANA 5BV7A 3VSCA 1NVUQ 2JGAA 3P9RA 1S9HA 4GPIB 3RJTA 3B7PA 4EHLA 1QSGA 1NR7A 5FR2A 1EP2B 1QLJA 3HFJA 1O5IA 4UVEA 3FROA 5HBGA 4B74A 1OFHA 5CLFA 1GZ4A 2OC9A 3DF7A 1I4LD 3M1LA 5H02A 4MWDA 5DOZA 4B31A 3WGUA 4LDNA 4I9UA 1I0LA 2XGSA 4LHZA 2BJHA 4HB4A 1A50B 2HD4A 3Q0IA 3LFTA 5C0OE 2G0NA 5HFAA 1JNXX 1JEJA 1OXBB 3G2NA 3U39A 1DT3A 4BE4A 1XGKA 4JQSA 2YXLA 4B8ZA 4MEAA 3P8ZA 4ZVKA 4NEHB 1CW2B 3D6VA 4K40A 1Q7RA 3L8GA 4IOMA 2XT0A 1AX9A 2YWBA 1D1PA 2HQBA 1L3CA 2ODNA 1RHUA 1KP3A 5KI6A 2QR2A 1ZHHA 3A6KA 4DB4A 2ID8A 3OLQA 1T6NA 2QWXA 2Y99A 1SU6A 1PK8A 3EDQA 3OX2A 4AP6A 3TNYA 3IQHX 2CMKA 2B35A 5LP6A 9ATCA 2IPAB 1VTKA 3LPLA 5EXSA 1EESA 4YP5A 3NTOA 1RZRD 3WLHA 3HVHA 4EARA 4P81A 4FSDA 4B4DA 3II6X 4JI6B 1YQQA 3LO5A 2OCXA 1RRMA 3HJUA 2J3JA 4GLFA 4B83A 1B41A 4E4YA 4X54A 4EFMA 4NONA 5JRZA 5KVVA 4ML3A 3RRBA 1NF9A 1H66A 1L5HA 2PXAA 4F4FA 1JR3E 1GV1A 4ZQFA 4R01A 1UBNA 4TKZA 2ODBA 4Z0HO 5I4IA 1ADGA 2FUNB 3OQNA 1T1IA 3SJAA 4CN9A 4ZOAA 3OKFA 1O6BA 3MTQA 3A6ZA 2PYIA 3G79A 1QV6A 5EP2A 2FZGA 4BZXA 1S8FA 1N6LA 3AZPA 3GMTA 4MYHA 5C8VA 2GASA 4I9NA 4KDEA 4B4OA 1SELA 4F9EA 4RSMA 4IXWA 1G8PA 1M8KA 2UUPA 4S35A 4KBFA 4UUMA 4XOUA 2VDVE 5CB0A 1Z56C 1G8KA 5FOVA 1L5RA 2YHUA 2I67A 2B8NA 5EHQA 4HJXA 4ZAFA 4OJYA 2OV4A 3ZDAA 5MN6A 5CVVA 3MWDA 2XVYA 1A9RA 4XSGA 2GYUA 3H9UA 3PR1A 3T4EA 5JQGA 2C7QA 3G6WA 4YEDA 4FC7A 4FYWA 2R79A 2CJWB 2YXDA 4P33A 4R2HA 4LTNA 2GFQA 1KQGA 1SG6A 2FGJA 3U4MA 3ABSB 1Q44A 2CMGA 2YVUA 5LMZA 3NT4A 5K05A 1WS6A 5DBHX 3N2GA 2OCGA 2ZWMA 4MV7A 1Z73A 1N2XA 3JQGB 1FPMA 1WUYA 2BD0A 1MA0A 4MTCA 4DLBA 2FG7C 5DEOA 3KDAA 1CC1S 2Y1KA 3BXEA 4ILKA 5BYAA 3DLPX 3JTMA 2JAQA 4FVTA 4YCLA 3EVCA 3EIXA 3HFGA 5NULA 2JK0A 1OHHD 1FLAA 1U9IA 2H2AA 3N2YA 4LRXA 1E63A 2J59A 2RH8A 1EZZA 3A05A 2C3PA 3Q9UA 5F1KA 2O23A 2R8RA 1RHKA 3KJHA 3CEJA 1N2GA 3NM4A 4MPPA 4E4TA 3L82B 4PTLA 4XYEA 1EFRA 4ZAZA 3GLGA 1FXUA 4H1TA 3L7NA 2PU5A 3T35A 4BNVA 4ZMSA 2GDJA 4B71A 5KOJB 5EIWA 2JFOA 4ARIA 4XM0A 4GF5A 1M1UA 3GUUA 4RZIA 2UAGA 2BGMA 4W1RA 1U2DA 4WQMA 1YE3A 1XL1A 1O6ZA 4EPTA 1PG5A 1H2AS 4Z4QA 2I2FA 1EWRA 3S2ZA 4P8RA 4A03A 1CUUA 4IVRA 1U2EA 4IDOA 2XQFA 3ESBA 4ZO6A 3HJAA 4OBXA 3W9BA 1QIGA 3OM9A 4LDJA 4UNQA 4DA7A 3LHSA 2BIFA 4JXJA 5BSRA 5KYXB 4HNGA 4DNOA 4Y18A 4O2AA 2IUYA 3R8XA 5K99A 2PRZA 5K3OA 1H65A 2DG2A 2JRCA 1O08A 2P5TB 1L7OA 2WFZA 3G2MA 4E3ZA 5HR5A 1E32A 2FWNA 1WHTB 2J5XA 1GFWA 1Z7EA 1B6GA 2AJLI 4ZZ0A 1QTRA 3DDNA 4QPDA 1ZOSA 2FG5A 5HCNA 2HCFA 1YZTA 3NAZA 1E7SA 3IB6A 1HYHA 1LZLA 3AEYA 5H3CA 3G89A 5JU6A 1X74A 3EGEA 4M1KA 2R7LA 3ISTA 1C41A 1SCUB 4JQCA 4QLBA 5BUSA 3G5UA 4TYWA 3FA2A 4ABTA 1VI6A 1DQPA 2QPLA 4KBYA 4IIGA 2Z4RA 4ENWA 2ZAMA 2HDOA 2KSQA 3F4BA 4MKXA 2AKAB 2DQSA 2BUBA 2PD3A 1YCDA 3NUQA 3EEQA 3L5KA 4IS3A 3K0SA 3GLTA 4I4NA 2UUCB 5F2KA 4NBUA 1KPHA 4JR0A 3S29A 4ANFA 3MMZA 2H8KA 5LA6B 1RR6A 3CX3A 2D8AA 3N3BC 2HIGA 1PV2A 4X00A 2IELA 4YXWA 1QHFA 2C7PA 5I45A 2OSBA 4CXMA 4L8FA 3COJA 3ROKA 3IIJA 5B1DA 3BXPA 4NNJA 1LNQA 1XVIA 3M4XA 1T9CA 3DC7A 2J87A 1OX6A 4BMNA 1WL8A 1KL7A 3RFFA 1XZDA 3L04A 3Q7TA 5F7ZA 4B0OA 2POCA 1ICIA 4OXRA 5BW6B 5KWEA 2CE7A 3NBQA 2I66A 1L7BA 3QKSB 2HMAA 3Q4GA 4PPQA 1R0WA 5CFLA 1RWVA 1Z0UA 4PNHA 1QOQB 5HJ2A 4LFBB 2BMVA 4ZOLF 1EFVA 3FTEA 3I9V1 1K06A 4WK0B 1Z12A 3L7IA 5HIIA 2Q99A 2BZ0A 2K87A 3PTZA 2XRYA 3WQBA 1MD9A 4WOKA 2GD6A 5CUQA 3RC3A 3X44A 3SP1A 1ECFA 2QTRA 5C3UA 4J1QA 5DHQA 3UJ9A 3B1KA 1LQUA 1LPAB 2BFCA 2PZMA 4GQAA 1P80A 3H9EO 4ZXPA 2DSNA 1GUDA 1K75A 1SNYA 2AYXA 1IXZA 3GRAA 3FJYA 5E4FA 1ZD9A 5SYNA 1ZGCA 4MVJD 2Z8ZA 1QHHB 1T9DA 4X92A 3DAFA 3WA7A 4EIWA 2DBZA 1C7RA 1DC5A 1EVZA 1YR9A 4NJMB 1KI9A 3O8OB 3DG9A 4PFJA 3H3JA 3OLXA 4WERA 5JFOA 3EA5A 3H11A 1NUAA 4B3FX 5CXUA 1I7DA 1XHFA 1T2CA 3H9BA 5SY9A 5EWMA 1C0KA 5KWVA 4FDTA 2VSQA 3AF1A 4I9FA 3D8TA 1YQ9A 2PVPA 5CFQA 1YC2A 3IPXA 4N8SA 2JGKA 3UHOA 4D6YA 2GXAA 3VH1A 2RAFA 3W2GA 3PUVA 1NYRA 4G81A 3U44B 1QLWA 1W4BA 2OVFA 4XASA 1S7CA 4HQOA 2L18A 4Y2PA 2TMYA 2BHTA 2HJWA 1C8KA 4HQ6A 4G1EB 4XRGA 3L7LA 4URFA 4E5DA 5FA6A 3JCZA 5J4YA 1LI5A 3AFHA 1JDTA 3SMVA 1T13A 4TRNA 1A71A 2FNAA 4X60A 1O94C 2C5EA 1ACLA 2AW3A 4ZQEA 3L6DA 4FQ5A 1F2DA 4CHGA 2AMLA 1DQRA 3A3PA 2KMLA 1X87A 2UZAA 3O1IC 1U2GA 3A6JA 4J3NA 3G8DA 3KB2A 2OUIA 3GYBA 3TQTA 3RYIA 4Z51A 1J0XO 2LCFA 3ENQA 4GX2A 4F1KA 3QPBA 2PRJA 3F2VA 4CLRB 1KU0A 3K0AA 1N2HA 4QDXA 3W78A 1RKUA 4PG8A 1LBQA 3CY6A 1DAIA 5ERYA 4RLFA 4WY2A 5DH9A 5LQCA 4DRYA 4W4TA 3H42B 3NAGA 3PC8A 4CKCA 4Y7CA 5IFKA 2JVJA 3GFFA 3W6OA 2QPTA 1DZIA 4W99A 3RS8A 5GZ3A 2ZJ4A 3NWOA 1WSWA 4KX3A 2P41A 3IR6A 2ECPA 1MJNA 3ZV7A 4BNGA 1THTA 4N6NA 2DPMA 2OG1A 5C81A 4A26A 1J97A 2K2WA 4E88A 1DEKA 1GGNA 3LX5A 3LGSA 3USCS 2JJ2A 1E2BA 1KNXA 2C9ZA 2R97A 4JYMA 3C4JA 3EVBA 4O2BB 1W2WB 3FHLA 2NO7A 1GUZA 1ODFA 1VI5A 1IK4A 2RI0A 3GUVA 1YB1A 1Q0RA 3NBAA 1M74A 4ENVA 5JH7F 3L4BA 2FA9A 4XD7A 1AXGA 2JLYA 3OEED 2YNMD 3EH1A 4WKNA 1WCIA 2JCBA 4DG9A 1NSFA 4UM8B 4EFKA 5AJXA 3FBGA 4NJEA 3ZY2A 2XQKA 4HZIA 2JFXA 2OSVA 3ETDA 2R5NA 4M76B 5AVYA 3MELA 1QGAA 4Z3OA 2Q3HA 4BP3A 2G67A 4AQYB 4HYEA 3PHCA 4HNAB 4DFDA 1G8SA 2XHZA 1H2BA 1ADJA 3KG2A 4IICA 5CRIA 5A71A 3WL4A 4QD3A 4FI3C 1UAAA 4YJGA 1G5HA 3T15A 4N03A 4RKFA 4X65B 3I1IA 5I9IA 1CQWA 1PYOA 3T3HA 5A3VA 3KQKA 3WK9A 4QXAA 3W7VA 5KOIA 3QU5A 4BO8A 1G8MA 3NVMB 4UDXX 5F64A 3OZVA 3GFQA 3GLRA 3CT6A 4PPFA 3DDUA 5JSUA 4PX5A 1YRBA 3PWZA 3SC3A 1RQPA 4U7WA 3TMYA 4DY6A 5HF9A 4AJIA 3IIEA 1KH3A 1KI6B 2VA8A 4HWGA 1DKMA 4CM8A 1Z37A 3W8RA 3ADDA 1DAKA 2UVQA 3VJMA 1Y8RB 3D9QX 4BMOB 1TIKA 4UU1A 5LZ9A 5C34B 1FSFA 4NBWA 2W6JD 1OI4A 4KXFB 4OI1A 3BMXA 4C4TA 4LXYA 5A5VA 1N77A 5LQAA 1QX4A 5TMDA 3VR6H 3UB2A 4F06A 3HLKA 2ZRKA 2PMFA 5DFAA 3UWOA 4JCOA 2WPDA 3PTLA 1AE1A 1L5OA 3O3MB 1R4MB 3QE2A 1G6KA 4LYGA 2OCPA 3MD0A 2CMDA 3F7TA 4MYTA 4WD3A 4MEJA 4OVKA 3RFTA 3IAHA 3GHHA 3M82A 3KFLA 2QX4A 2GBIA 2HR1A 3BQ9A 3ZCRA 1OIXA 5DGDA 1RLUA 4I4TB 5E6RA 4ADSG 4DC9A 1F6BA 3GQBB 1M1XB 2IIBA 2ZYAA 4UZEA 1Q50A 3CEAA 1C4KA 3DBOB 1M2OB 2XXBA 1JLLA 3C8DA 5JRJA 4EB6B 2YZMA 5DN6D 5K8VA 2R44A 1EE9A 4AWBA 4R9UC 1VPDA 3EJ6A 1VE7A 4O4JF 5JLAA 2BMEA 3FSGD 3RO7A 2X9QA 1QPZA 1KOJA 1SOWA 3CF6R 4HZUA 1N5KA 4OEHA 1Z0ZA 3EGCA 3EVGA 3TLMA 2VUIB 3LCVB 4HQRA 2HSZA 2CNBA 4ZODA 1AQYA 3P2MA 2EEZA 3AOEA 3AHCA 4ICIA 3PC2A 1JDZA 4MV1A 4O1HA 5IM4A 2YMQA 2CHUA 3KZ1E 1YD7A 4DJFC 3Q6IA 2CF6A 3I04M 1W25A 1ONOA 4IIVA 1HLDA 3FMGA 3IBTA 3V1YA 5LQSA 2IYZA 4FNMA 3ZX5A 5JNWA 5EINA 2HK6A 2VWPA 1TM2A 4EM6A 121PA 1CUIA 2VHVA 2I0FA 4DJDC 5DNUA 1MB9A 1IBRA 2GJKA 3EYWA 4WBNA 2JI4A 4WIAA 2EOAA 4I50B 4ZAWA 4K6CA 3DOUA 2BH2A 3CGWA 1WHSA 1PWYE 3AEKB 3VNUA 2I65A 2NV6A 2YV3A 1VL0A 3GEIA 5CT8A 4CL8A 1G16A 2NQ2C 2HYIC 1DELA 2A5DA 1GRQA 5HGJA 2EZTA 2Q07A 3GGCA 5IT9A 4ZXFA 3GEMA 4JX9A 5DYYA 2IXTA 1HEUA 2O9JA 1LNZA 4N40A 4ZD6A 3SJUA 3ZBTA 5L7TA 5BW5A 1H2FA 3HZZA 1O87A 4MTLA 1N6RA 3JTEA 4OK6A 4A16A 1P3JA 1Z08A 5ITVA 3SC4A 5AM5A 4XVCA 4QGSA 4NXNB 3EEYA 1VOTA 4U5XA 4YRZA 4FFBB 1MAVA 4KR3A 1KY3A 2GPTA 4Z4CA 4OGGA 3VVMA 3ZLTA 4C6SA 3SJCA 2R84A 2R47A 5AD1A 4L2IA 4MGEA 1IM5A 2NTNA 1DHRA 1V26A 1R8SA 2XX3A 1F3OA 3BD9A 4AF7A 4HUQB 1CQZA 3C5EA 1EFLA 2HCRA 3PRKE 3MT8A 1XQWA 2XF2A 2LW7A 3AR3A 3FCOA 1NI3A 4HH1A 4QICA 4I1RA 1QO0A 3PJDA 1PHPA 1U9IC 2A57A 4M8NE 4P7KA 2K7FA 4N1AA 4AMUA 5CB4F 1L1QA 2WA1A 3ZWDA 1BWSA 4H1HA 3BCSA 4WMLA 4KOEC 5KO2A 3FRHA 2B8JA 3CF4A 2PV7A 2VDJA 4UVIA 3ROXA 4AULA 3Q41A 3SF8A 2V7XA 2C9BA 4D4MA 4E08A 5BWNA 2VAXA 2G0TA 4HXGA 1T2NA 5FTKA 1V3QE 4LXQA 5B2ZA 1THZA 2AN1A 1U2DC 2PDAA 3ND7A 4KLCA 3L79A 1IHDA 4P53A 2VHQA 4Q1AA 4FFWA 1OFUA 3DCNA 2H5IA 4BY9E 1OX4A 5K3SA 4M0EA 1H8ED 1HYQA 3ICWA 1ZGBA 2ISQA 2FLWA 4FDLA 5HTOA 4RJLA 1KP2A 2W2OA 3GUHA 3JYNA 3VYUB 1XLVA 1UUFA 2B4KA 3NOXA 2FSSA 3SZ3A 2GS9A 5CHEA 2Q0SA 1ENOA 2V59A 4OCZA 3G1TA 3ZUPA 5D85A 2ZRNA 3OCXA 3AHFA 1T34A 2QJWA 4L4XA 1XLUA 5CK5A 3BXGA 3KZXA 4RPIA 1SG9A 2QNIA 5KQMA 2R8BA 4GPAA 2G1AA 3TF5A 5HW0A 5KKAA 3LQ4A 1EA5A 2IHUA 4OYHA 4X7MA 3PJFA 2UUBB 3AEQB 3S2GA 1MIHA 2O4CA 4RJIA 1EBBA 2H85A 4HQLA 3AY7A 1J0BA 3KWMA 5CDUA 5K8TA 3OE7D 3F6RA 3LHIA 2ZDHA 1N5LA 1P9WA 2Q9UA 4IXDA 1KDYA 1U6JA 1QRDA 2B0CA 4L5JA 5KAMA 3H2HA 5BQFA 5C53B 3SQWA 3V4RA 2FPLA 3HTXA 3AI7A 1FS6A 1ODKA 4ZGWA 5BSFA 1ULAA 2V45A 1XD9A 4UE6A 3GD7A 4V0KA 4GMKA 5B64A 2AKEA 1KEPA 1T15A 2H29A 2Q1WA 1WUKS 3A1VA 3R5SA 1Y5LA 2X42A 4PNEA 4PXYA 4EA6A 1GPLA 1PWXA 1SVUA 3D0QA 3G2IA 1C5KA 4N5MA 3FWZA 3WWEA 2B6NA 1OPXA 3I9JA 3HUFA 3OCCA 1B1AA 5HF6A 2BGUA 3HUDA 3OZXA 3B6MA 4M6WA 3U3ZA 1XMQB 1KYXA 4EO7A 3EZYA 1W88B 3WP1B 5A4JA 4ZOCA 3EWAA 4QBKA 5FFNA 3ZIDA 4GR5A 4UTOA 1FMJA 4QYIB 2PQ0A 4HDOB 3MJHA 2GI4A 3H13A 2ZBQA 3B89A 3HMKA 3RVMA 2HN9A 3AV0B 3B2EA 3PC7A 1SHTX 3HP1A 2NVUB 4MKIA 4ZHQF 3KXPA 1L7XA 2Q1YA 3FMFA 4R41A 4WVLA 3KVRA 5LBIA 1JJFA 3IILA 1LQTA 2JI8A 3B3QA 4CTMA 1VJGA 1UBKS 5KHAA 3WSVA 2ODPA 5HA5A 5LYJB 2WMDA 2CV0A 5JECA 1Q6YA 4A7PA 4ZDIA 1GUFA 4U3JB 2ZZNA 2J45A 5HKBA 2FQYA 3DL0A 3PA8A 5JPDA 3V7UA 1VCIA 2A35A 2EC5A 2Y4NA 4N7JA 1ZAKA 3DNMA 3IQXA 3C7KA 4FEEA 4RVSA 1DIAA 1G66A 1KRHA 3RE1A 3OE4A 4V03A 4JP8A 4YFVA 3GLVA 1E1KA 3GT0A 4HGRA 5K4AA 4EI8A 2QV0A 4PSCA 4GMDA 5KTPA 5JFGA 2DWQA 2VC2B 2VZEA 5ICFA 1OBOA 5A2GA 1NVTA 5AHRA 2G08A 4B09A 1E9FA 2R8ZA 5JCJD 4OJQA 1T6XA 4JC0A 5AHOA 4BVLA 2VLIA 4RD4A 3I9V6 3WGGA 4WY8A 3KJIA 3STUA 1ZW6A 2GSDA 4G1MB 2VP6A 4TVSA 1C0LA 2P68A 2YDXA 4X6YA 3ZDQA 4E33A 5JTTA 4P5DA 1YB7A 2D1YA 4B7UA 4LV5B 2BFFB 5DVZA 2PXCA 2BUCA 1FYEA 2ZXUA 1F2UB 1TCUA 4XPIB 4B5LA 1D2NA 2J4CA 3I5UA 3HA2A 3UW1A 3X3HA 4ZYTA 4LVUA 3Q9SA 5B1EA 1GO2A 3U16A 2VHUA 1SCJA 2V6JA 1B15A 1NRXA 2ZPUA 3MRXA 4MGIR 4WJZA 1XHEA 3L8ZA 2DE0X 1U2GC 4UMDA 5CVUA 5HILA 4AX8A 3U7FB 1DE0A 4KIUA 3N6XA 4QELA 3P2KA 1XPOA 4UBJA 1GWNA 2D00A 2OAP1 2P75A 3IUJA 4INPA 4OLFA 2WD7B 2RAPA 3K8OE 2CJWA 1OLSA 3G1WA 4XCQA 3JWEA 1PFGA 2Z1NA 2JW5A 2G72A 1GL9B 3PC8C 1EE1A 5EE0A 4HEA6 3HSYA 4B3XA 1RD4A 3OOEA 3VRHA 3RIGA 3ZW9A 4W9MC 5TEVA 5IDYA 5JDCA 3JQGA 2JI6A 1RYFA 1OWOA 4IDBA 4YAGA 2FY8A 3K35A 4KXXA 3L1JA 3KQTA 3LTEA 5G1NA 1JT2A 4EUSA 2ECFA 3QKTA 1Y6RA 2OBXA 5C1OA 5F5XA 1OLOA 1N8TA 3BDIA 3LKZA 1HDZA 1JW9B 3NCTA 2XE8A 4NYIQ 2CYAA 4PAWA 4XXHA 5FUVA 3SC6A 4UUPA 2IBTA 3BFPA 4CCYB 4N7MA 1FS5A 3L4BC 3N2KB 4IGEA 1FTYA 3QFHA 1A7KA 2O8VA 2V7EA 3L6CA 4KE9A 5AM1A 5FBKA 3WWOA 4YX9A 1W8IA 3RBAA 3PFIA 1ZNWA 2HOQA 1JR6A 5CW1A 1P39A 5KOJA 3H5WA 4LTMA 4QSHA 3BWMA 3VXKA 1NRWA 1MO4A 1ADFA 1X1SA 1E6CA 3K8YA 4ZV7A 3UK7A 2ZB4A 4DEXA 4EG4A 1L5QA 3BGOS 4NE2A 5TF4A 3BH7A 1E9SA 1C2TA 2ZRDA 4K6GA 1OXTA 1VP9A 5KYXA 3V33A 2OBFA 3B9RA 4N76A 2XUZA 2CFOA 5CVDA 1XZGA 1L4HA 1Y7HA 3QOFA 4I8IA 4QRHA 3KJZA 1DVRA 2ZUFA 2QUHA 3K05A 1YVDA 1M2WA 1EIWA 3LBAA 4RMNA 5E4YA 4GKVA 1WHTA 1GQSA 2GPWA 2IK8A 3PXAA 5G0VA 4YCBA 4BMCA 2CMHA 1H4QA 1IEWA 5DM60 4M98A 1BMTA 3GRYA 2WVGA 3ZHVA 2W9XA 3TW8A 1M75A 1TF5A 3ELBA 3TOVA 2ATXA 3VDQA 5BXYA 2K6GA 3PUHA 3X1YA 2HHJA 3PYLA 1IG0A 1MAAA 1YUBA 1U5AA 1A2BA 1E2MA 1XMJA 2LWIA 3IVMA 4PBRA 3UCXA 5DTJA 1JSXA 1JG4A 1A8IA 1U1FA 3CJRA 3KR1A 1NBHA 4AF6A 4C07A 2Q5FA 2TRSB 3W77A 1MG0A 2PJDA 2QORA 2YN0A 2WG2A 4L50A 5LA6A 3V4SA 3P2JA 4KJXA 1RAAA 2XKAA 3R7NA 3V1MA 3LYLA 2AOVA 5TQ0B 1M7BA 2GF0A 1RBQA 3DQZA 1ZMBA 4Q34A 1G7TA 4WXEA 1GPJA 4Z54A 3GB9A 4QWMA 1DIOB 3H2IA 2NW6A 3K92A 3GUCA 3IB3A 2X1LA 3PFHA 1RI4A 4KDCA 4C6RA 4B3GA 1AJEA 2PSEA 2QUAA 3AOEC 1GTZA 1RJGA 4JUBA 4PLWA 3ZTWA 1DUVG 5EXEA 2DFDA 2NSDA 2M6KA 5BR8B 1FXSA 3HQ4O 2XUQA 1SKUA 1EXDA 3UWKA 2GPBA 1FBNA 1DIHA 3AR9A 3IBYA 4Y1EA 3UG6A 2V4ZA 2WVAA 4B9AA 5HOQA 2P11A 4PYLA 1VIYA 2EWMA 3DTYA 1R0XA 4E21A 4AO7A 2V7BA 4YQZA 1IDN1 2PPLA 1P2SA 1NBIA 2WHQA 4Q05A 3I5AA 1C7ZA 4CI9A 4IF6A 3TEJA 4B34A 1B74A 3Q7IA 3WHIA 4GP7A 3PWTA 1RWNA 3P2OA 4W7SA 4D9CA 4US2R 1R2QA 2GAJA 5EE5B 3UAWA 1R4ZA 4XIIA 2NU9B 4X1IB 5BWCA 4G1VA 2WB2A 1X39A 1TJNA 1WXEA 2QN7A 2K7ZA 3T95A 1LVHA 2R7NA 3LECA 4JELA 3U0BA 1W7AA 4JBIA 4EQZA 2PUWA 1UC8A 3NUGA 1RXWA 1I5EA 3COSA 3T5GA 4CQMB 5HEKA 3HDVA 5IK2A 3VO9A 4Y2VA 1MNAA 4D0GA 4N3BA 4JL6A 1IOLA 5ALEA 1VMKA 2GR9A 3U44A 4YAFA 1T3GA 1THMA 2MSKA 4N5DA 4CR6A 1RYYA 4YASA 2WJ4A 1Q19A 2HH9A 4HTAA 4F11A 3VBCA 5IT0A 1X92A 4R1LA 3VYSB 3BD6A 1EZ4A 4LNUB 4Y2YA 1D4ZA 1PFKA 3UBTA 3DYIA 3MS2A 2FOLA 3PG5A 5AVWA 3VTKA 1AQLA 4FB4A 3DZHA 3E18A 1Q22A 5C46F 1Z6QA 1IY2A 4PW0A 5I01A 4JA2A 2BKAA 4GBGA 4ZMBA 1XXLA 4BQFA 1VQ1A 3SJZA 1PCXA 1GSAA 1RQ2A 4LV6A 4QU5A 2YY5A 2HFJA 2P6PA 1FTGA 1NQWA 2PKQP 3SXJA 3ONEA 1JXMA 3UAXA 3MC1A 2LV8A 2VZ8A 3H4TA 1Z74A 4CLRA 3KL4A 4CMCA 4YJ3F 4NCXA 1LH0A 5T6BA 4M8LA 2GZSA 2PS1A 5HXAA 4NHOA 4XR4A 3CNHA 3U1VA 3IXMA 1T8TA 3TMAA 1NI4B 2OC4A 2B4AA 5GOTA 5DNEA 1CJMA 3VH4A 3X1MA 5SYAA 2ONKA 1RBMA 1OIVA 4XDYA 4TTJA 4ATNA 4ZFNA 4FR2A 1O0BA 5LA6F 3H3XA 1OYVA 1P2TA 2RH5A 2VTKA 4PBSA 2HZ7A 1V1MA 1LS6A 3NHUA 1N8SA 3CLTD 1E3MA 3TCKA 1YS6A 2Q5HA 5EC8A 4S24A 1UZAA 4LTDA 2BLLA 2VN8A 2ORVA 2QUBA 4Q4HB 1ISRA 1YZHA 2IT1A 4RSGA 1NJ6A 3IHKA 3R8FA 4J3FA 1A4IA 1SU7A 2QE7D 3RK1A 3O91A 1EHCA 2ZIVB 4H31A 1INLA 2HC9A 2VDRB 5DYIA 2AIRA 1L5NA 4QT4A 1P0PA 5M29A 3F98A 2CCGA 5IZ4A 2PUAA 2JANA 1NLZA 2V6IA 3IDSA 3FVQA 1QHIA 5EFZA 4ROTA 1ND5A 1OR8A 2LKDA 3C6MA 4URYR 2CSXA 4O59O 3JD1A 1I7PA 4MJ7A 4DE5A 4YRFA 1ZJJA 3CNBA 3DMYA 5AVXA 2X3YA 1Z0FA 4AQ7A 3IJPA 3D0RA 5AVJA 1C9KA 1JBEA 3CBQA 4DMGA 1OYOA 4JY7A 4IJMA 3A1WA 3ME5A 3HUTA 2FDXA 3V8NA 2AC7A 3BJIC 2LPMA 1FNCA 1TIBA 3D02A 1VGRA 1RRVA 4MQLA 1QGED 2FCRA 3RS0A 1P72A 3ZU4A 4PO8A 3BSFA 2KLHA 2J9ZB 1B16A 3DVAA 4D81A 5K6RA 3VPCA 1DIRA 4UHBA 3VJKA 5H80A 4RJJA 2GSWA 3BRQA 5FO1A 4ZEOA 2A5YB 4ZO7A 4YAUA 5K0CA 1G41A 3D5EA 1Y8RA 3EVFA 4MMZB 4PWYA 5BQ3A 3J7TA 2WP0A 3L0YA 2NZYA 4HV4A 3IQDB 1A3CA 3LOPA 5FR1A 1JSLA 2LD4A 1MN6A 5D6OA 3RT7A 1SJ9A 1ISJA 2VDNB 3F6PA 1PLJA 2W8ZA 1MEEA 3GELA 1A9XB 1YI0A 3EFEA 3PUWA 4HJRA 3EFOB 4QX6A 3RSFA 1IQ0A 2O1SA 1CDOA 1CJCA 2RI1A 1E8MA 2CL7X 2V9PA 3TUIC 1Z8FA 2CNOA 2VDOB 2OLEA 3G8AA 4PC6A 3SHWA 1JS1X 2NO4A 1H1TA 1WUIS 2P9ZA 3GQBA 3JZDA 1DIBA 3Q7SA 2I33A 1XQ1A 3IVRA 5CH8A 1JBQA 4IEFB 4EB6A 4RPGA 1KETA 4Z8YA 3WLJA 1JSRA 2QSUA 1YL6A 3BFJA 3C3MA 4WXYB 1QHGA 2ZYTX 4X94A 3SD7A 3H18A 4AROA 1Z2DA 4QNMA 2AJTA 5HRAA 1I80A 3AFIA 3GNTA 5K0GA 3NH9A 3WL8A 5E2IA 1RWMA 2NG1A 1CQJB 1PEKE 2QEQA 4HFNA 3O8RA 3M6XA 3ZCTA 5IULC 3GWGA 5ALJA 3I2GA 4YLYA 3HP4A 4WN9B 3FE2A 2ZITA 5JYDA 4DPKA 4NCBA 4ZTZB 1ZUIA 3OURA 3NWBA 3NM6B 4L57A 4MR9B 1CVLA 3T9DA 1Z5WA 3PD7A 2Z5GA 1DKOA 1JQAA 1MT0A 1AKMA 1VMEA 2D1QA 4TXLA 1J5PA 2ZPAA 4IMPA 2ZJ8A 5IKMA 3IMFA 4XGKA 4Y2TA 2C5LA 3L8DA 4O2BF 5CM2Z 1XJ0A 2C4VA 2QL9A 5EP3A 1SA0B 4WZ6A 3KYDA 1EYZA 3PGJA 2P6UA 4WL0A 1OH8A 3V3KA 2OKCA 1PW7A 4UXJA 1TOAA 1WKVA 3WC4A 3T7DA 2KB0A 4BQIA 4GC9A 1BFKA 4MXDA 3U2QA 3EZLA 2WKPA 3H5NA 4ZCLA 1ILEA 1JPUA 1UK9A 2FEPA 3WI7A 3P32A 2DT5A 4UBIA 1BJTA 4KFRA 2V7WA 5D3MB 1BEUB 4FFBA 5KKCA 1SUCA 4FFSA 1HEYA 3WLEA 3S8YA 4UHDA 2R48A 4F45A 3F97A 3LVQE 2X2EA 3X2SA 4TYYA 4YDHB 4Z4GA 4H7KA 5KKNB 1U2RA 1UJ2A 1PL6A 5JDCC 3VX3A 4B6SA 3SVTA 4DV2B 2E49A 5F98A 3ZIUA 4UU0A 1UJBA 1UINA 2CHFA 2WSSD 2HSDA 3QLVA 3H16A 2BKVA 2RFLA 4HUQA 1A98A 4I1IA 5JYBA 1Y1TA 3L8CA 4G63A 4IQ8A 1UBUS 2DFKB 3EUFA 3SS7X 2I2XB 4DN6A 5CM9C 2EKDA 3R3YA 2C2WA 4CT5A 5A6VA 3BIFA 3THWA 5A02A 1C0PA 1G1MA 3IKMB 3VPDA 3JV7A 2ZE8A 3PP8A 3THOA 2HJ9A 1SN7A 1PYDA 4YJFB 2E2WA 4C0AC 4GVPA 2H2FA 4JEIA 3UMGA 4AW9A 3DXXA 5F23A 1MP0A 4TTIA 5T4EA 3NALA 3U1TA 1T9BA 3V1NA 2DR2A 3RHZA 1CQPA 4BAUA 4TTRA 2XNHA 3VNSA 3AVUA 2WF7A 1E5XA 3QXXA 1KKMA 4YI5A 1JNYA 1G2IA 3GEPA 2QVXX 3ASUA 1I3OA 3V7WA 1G291 1KY4A 4I4TF 4LYDA 3PFKA 5EI5A 4UBMA 2FN8A 4MRMB 5L45A 4X6UA 2A0YA 2ATCA 4FCCA 2HU8A 3K9WA 3LWBA 3IHLA 5IKOA 3BHMA 2FW9A 1W5FA 4QAJA 2ZBDA 3HZOA 4Q3CA 5EEGA 4LXTA 1WM1A 2KHZA 3OLYA 3R74A 2PXHA 1V8DA 3B6IA 4BB9A 3TOSA 5CT6A 1QP7A 2LDBA 3EXEA 2O7SA 5FBQB 4BNZA 4D9FA 3K30A 3ROTA 3AEQA 3KRTA 1S7GA 2UZ3A 3NHLA 3IEPA 4EUFA 5IF9A 1A5AB 1ONBA 1WCYA 3HKDB 4OKSA 4D82A 4KWIA 1HM5A 1FXWF 1KYZA 4PHTA 2PGAA 1C7IA 1YMQA 2HWKA 2ZKIA 1Z15A 4G5QA 4IV5A 5E1DA 3T7EA 5ALWA 3WYGA 1ODIA 2JKVA 3MJ4A 4I50F 3ZWXA 3PCRB 5LLDA 3TNDA 2DHCA 1DBIA 1WD5A 5DLPA 3CE6A 3KSZO 4IR7A 3JQDA 4QRDA 1P1IA 2DQ4A 5I7HA 3V7NA 3PQ3A 4P80A 2DPGA 2Q1XA 4A4DA 4NZOA 5GJVC 2BKLA 3FHOA 1RQLA 1OFIA 1W88A 1W4LA 2YMMA 3E9RA 3HCEA 1GPNA 3OZDA 4BNXA 5B6JA 1DG1G 3ZNNA 2J9YB 4B3HA 1YNOA 2J3EA 4ROSA 4DNQA 3DDOA 3OF5A 3TINA 1QHEA 4QG7A 4ALKA 3BE6A 5F3WB 5DW3A 1M66A 1H5UA 1M6WA 4V0OA 4CODB 3BFKA 3KYJB 2VWHA 4KQXA 4M1TA 1R8JA 5F7OA 3Q7RA 5GTDA 2YJZA 2I4OA 1MQ9A 4HAYA 5FIUA 2X86A 1J2TA 2QRVB 1I4OA 3AKYA 3DZ8A 3M6VA 4RTOA 2OV2A 5LYJA 1K4KA 2CVHA 3PDHA 4P3YA 4PNZA 4XQ0A 1E89A 1EFTA 3MJTA 4JB8A 4OH1A 4U3JA 2RKWA 3H04A 2WR8A 1ZC3A 2JC3A 3VBEA 4CGYA 2FAXA 5CVCA 1JZQA 2C3OA 4IIDA 5FLKA 5A0TA 3PRJA 3GPCA 2H07A 5H5JA 1E7YA 1P6QA 4N48A 3VR6A 3V7FA 2X9NA 3P71T 1G7SA 2GERA 3IBSA 1S9DA 5C1BA 1NR1A 4TZ0A 1N2ZA 1GGVA 4TT3D 1CUJA 2GPSA 3TQFA 3U26A 4RPCA 2ICAA 4F2GA 2HFKA 1NN1A 1YWGO 2GEJA 4H2DA 5JXHA 3RNLA 1ZK3A 3RS3A 4RLSA 7AT1A 4PN7A 4R1OA 2NVBA 3ZDZB 2IU6A 4FDAA 4HOYA 2NYUA 1XZJA 3GDHA 1JQBA 4QHYA 3DL4A 5CEJA 4K6MA 1SQFA 1CFJA 1JQLB 3MRTA 5D7BA 4YRDA 2R6CA 4NIMA 4N6OA 4DCOA 1E9AA 1LBIA 1PNOA 2I2BA 3S2SA 2CDRA 2BFFA 2WBLC 3KTAB 1JHUA 1SD1A 4WCDA 4YUZA 3K2EA 4LE2A 3ZY3A 5C8XA 1E94E 1F2UA 4XPIA 2C00A 3SQDA 3TX2A 2BHRA 1XAJA 2RBGA 5EJ9A 2V7PA 1UC4B 3P96A 3DOCA 4R5MA 2PYZA 1FLDA 1V9CA 1J0DA 2QMYA 3QX8A 3IT2A 3MUFA 1C0EA 4OIMA 5CJJA 3COPA 5J40A 4BFTA 3ILXA 4E2XA 2IUUA 3QPUA 2QDXA 1FS4A 1N4DA 3AILA 3K7EA 4OMFG 5KNDA 1YZFA 2FH5B 2EYQA 1FZQA 1NU8A 2WA2A 3OT5A 4EHNA 4EG8A 5B1SA 1NBAA 3I05A 4O33A 5CYFA 4HGOA 1OT3A 1XRRA 1ZW1A 1T2EA 3FNBA 3JQ7A 3MSXA 4FGSA 4PR0A 5DM70 3PPIA 3BXFA 1U7OA 3C2QA 3AGQA 4PRYA 5BSGA 2IS2A 3ZU6A 2QUJA 3NIDB 1MB3A 1IQPA 3FR8A 3U13A 3LXRA 1E9BA 5DSTA 3WYFA 4E46A 1KJNA 3PX7A 5AK3A 4EEXA 5F9HA 5J59A 2ZATA 2Y2UA 3KD2A 3OESA 3COYA 4RAOA 1MAUA 2O0KA 4M1EA 2P2GA 1NLFA 2ATVA 4L08A 4QYSA 4HMPA 2YQZA 3WOHA 3PEUA 3DH0A 4MUIA 4MWCA 2PU7A 3ZYZA 5HUJA 1FDSA 5IKPA 1JZTA 2IHVA 4LDZA 2EBHX 2VWQA 3EIEA 4RVGA 4DCPA 3RYFB 5HE9A 3A8TA 5BV8A 3RSCA 2GD2A 3LS2A 2XKKA 4OV6B 4CCYA 1T1GA 1PQPA 3NRJA 5AW0A 1U0JA 2XMQA 2VYVA 3N2KA 4Q9JA 5HS6A 4UMVA 5FPQA 4JJEA 2QZ9A 1ZD1A 1I2ZA 3U61B 5HPYB 3TSAA 1S2MA 2F43A 2A33A 3HBAA 2HMUA 2P91A 4MW5A 2Q5JA 3WR5A 1NW4A 2EFDB 1ZJ6A 3UMJA 4KO8A 4DDTA 2GAAA 2VPTA 1NDHA 1XRJA 2XBUA 4O1IA 2YJNA 2NSYA 4ISBA 5F9FA 3BRCA 1GILA 5EHZA 1W4ZA 4PS1A 4FFOA 4TV9B 1Y7LA 4XB6B 3RADC 1M0SA 1O6GA 4C06A 1Q0LA 1W6UA 1H0RA 1LSOA 1Y5IA 2IIQA 4TVKA 1CXZA 4CLOA 2GLXA 2PRKA 4ZYLA 2JJMA 3W5BA 4K9RA 1I5RA 1EGHA 5LB4A 1G2PA 5CM8B 3ENKA 4KXLA 1L4EA 5HCUA 4YP6A 5IF3A 1LTQA 3ZWMA 3F9IA 1DJPA 1DTWB 2RHRA 3ORYA 4M53A 3WK5A 2B4RO 1QTNA 2BVNA 4FILA 1TU0A 4WLEA 2W6MA 1KO1A 1U6KA 4L1KA 4D9JA 1YBVA 3C5CA 4S1WA 3DVSX 3EVNA 2VQ6A 1F3LA 3DAOA 1FLNA 2FZWA 2D1RA 5HQ3B 5K2OA 1XMPA 3IV7A 3QVMA 4YQYA 2XR1A 1ZHFA 1M1ZA 1G5FA 1PZGA 3D8BA 2H1OA 3A1EA 4MV9A 1NR5A 1XP8A 1CB0A 1EDOA 1FRQA 2ZIAA 3QFSA 4K3UA 1UFVA 2RHCA 2E4YA 5CYGA 1YS7A 1YVRA 1Y6FA 4F7WA 2H1SA 4UMEA 1L3IA 1WU7A 3ISVA 4YJHB 3REQB 3V6MA 1W29A 5JSQA 3UANA 1AA9A 1KERA 4OX9Y 4HFRA 1OILA 3RVQA 1YB5A 4BPBA 2PGJA 3K70D 3EF3A 4L75A 1CFZA 1KRXA 4LX0A 3N8NA 1K0FA 4UC0A 5FWXB 1Z6YA 1LBSA 1U9YA 3L92A 5AI4A 3IAUA 4INOA 2A9FA 1PGQA 2WWXA 3TRIA 2AH5A 4WGFA 2P77A 2Z3ZA 4ZYZA 3IOBA 4HLCA 1UAYA 4EWLA 2ZREA 1NJ8A 3B6ZA 3PDJA 3M5WA 4HH0A 4C0HA 1I1OA 1TMGE 1ZHOA 3BL6A 1YVEI 3A0RB 3L0BA 3ZHYA 3CC8A 3OCZA 3B9QA 2GN2A 2HIMA 4JLVA 4R1PA 4ZI3A 4MW4A 4M0FA 4XWGA 3FYCA 4D8XA 4GGMX 1U6IA 4CKEB 4XQ9A 1RC8A 3E3LA 3S55A 2B34A 2PMKA 4IEEA 5EXDA 4B35A 5EHXA 1IBMB 1XPUA 3FTCA 5K1ZA 2ZJ3A 3CVVA 1PT8A 1TRKA 2ESRA 3E3OA 3RAEC 1SVWA 1B2RA 2O2GA 4BVKA 1OLUA 4PCLA 3W8DA 4MQMA 4PLHA 2DT8A 3AZOA 1W35A 5DHSA 2FVYA 2CNWA 1Z6GA 1LDYA 1FP1D 1NBWB 1PJSA 1F1JA 4P5EA 4PS0A 4RF2A 5D6NA 3VR4H 4HLDA 3RFCA 3DDZX 2M32A 3VC7A 1L6IA 1ISFA 1NAIA 1SBHA 1E4VA 1KS9A 2BDUA 1P4HA 2NU9A 2O7RA 4X1IA 4QDZA 4AJ2A 1W46A 2P4UA 2B2NA 2C82A 2ID7A 4L5CA 5ICMA 2OFWA 3BYZA 4A6XA 4ZJYA 1GY8A 1P29A 1YACA 2O2ZA 3JQAA 3SBXA 1PWZA 2NYRA 3L4EA 1A4XA 3RAJA 1ZGHA 1Z0DA 3W90A 1UOEA 4HQ0A 2D5LA 2Z98A 4IJ5A 4CQMA 4QG3A 3STWA 1YGPA