3AIMA

R267e mutant of a hsl-like carboxylesterase from sulfolobus tokodaii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
283
structure length
283
Chain Sequence
b'ASVEEIRSLFKQFSSLTPREEVGKIEDITIPGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDSAGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTREHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVEFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVFYGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobustokodaii
pubmed doi rcsb
molecule keywords 303aa long hypothetical esterase
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 95
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2010-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aimA00
3DEAA 3IUMA 3G0DA 4KAAA 4WDRA 1YASA 2QJWA 1QO7A 4OU4A 1BROA 2XUQA 4OCZA 4UBIA 2WUDA 1QIGA 1W75A 2OCIA 2ZYSA 1GPNA 4W1QA 5ISMA 4ZI5A 1C7JA 3QPCA 1VXRA 5K3FA 1ZD5A 4YK7A 1CLEA 4C6HA 3RM3A 4B0PA 4DM7A 4BTLA 3QMVA 1BCSA 4CCYA 1XRPA 1P0PA 1R1DA 2Y2VA 2EDCA 4CG2A 2RONA 1XRQA 3R0VA 5FDFA 3DD5A 4IQ4A 5K3DA 1AC5A 1AMNA 4ARBA 3EQ9A 3S8YA 1CUDA 4LHEA 1FFAA 1ZD4A 1BEEA 3V1NA 1XQVA 1OCEA 1BCRA 1ZIYA 3BDVA 5ALIA 5FKJA 1SCKA 4BAGA 2WIGA 1IVYA 3V1MA 3LIPA 1VA4A 1CUCA 2XLCA 1ODTC 3H2IA 1MX9A 1ZI6A 3ESBA 5LZ2A 2CJPA 2PBLA 1HLGA 3AINA 4QWWA 1DT5A 2WIFA 3C8HA 4TGLA 4PSDA 3G9UA 3ANTA 3C6YA 2J3DA 5CBKA 1QZ3A 2BGNA 5FP0A 5YASA 1ISPA 4QDUA 5ALJA 4HS9A 1VE6A 1C7IA 3QPDA 5A71A 4S0XA 4CIBA 1OXMA 3R3WA 5AICA 1EK1A 5AKGA 1YSCA 4U2DA 4XJVA 3IUQA 4X6UA 3WZLA 1EDDA 3I1YA 5A2GA 1XRNA 4ZREA 3FVTA 5DTIA 2YXPX 3V9AA 4MWSA 4RNCA 5AKLA 3X3HA 1X70A 4FWBA 4BTVA 1UK8A 3P2MA 5AI4A 4CCYB 2QM0A 1NU8A 1AUOA 3G0CA 5ALZA 1IMJA 1UOOA 4I19A 4O08A 4LKOA 1E3QA 1BRTA 4BP9A 1XRLA 5KREA 2BCEA 2ZJ6A 1EVQA 4KRXA 5ALKA 4WY5A 1E5TA 5ALWA 4Y2PA 4G5XA 3I2HA 4H77A 3QM1A 4BDSA 1E8MA 4UHFA 5AM4A 2ECFA 1XQWA 5C7YA 4WDQA 1TCBA 5ALGA 2BAGA 1MO2A 1QIIA 3H1AA 1BN7A 2VF2A 3O4HA 4LXIA 1PJAA 4A16A 4ITVA 1WPRA 2C4HA 1EB9A 2XMQA 3FOBA 4F5ZA 1HBJA 3RLIA 1USWA 4G9GA 4Z49A 1CUFA 2RI6A 4GWLA 2GBFA 3H04A 5T4HA 5F4ZA 2XUHA 1EK2A 1BEZA 1JFRA 4KR0A 3VKFA 2XB6A 3F8SA 5KWJA 4Y2UA 4E46A 3DQZA 1CVLA 2JGMA 3Q8WA 4XWGA 1I6WA 3ESAA 4W1SA 1GXSA 3R41A 1GQRA 3CCBA 1PFQA 3R40A 5SYNA 1EH5A 3BF7A 3DJYA 2AJ8A 4CI9A 3OM8A 3WJ1A 5K5EA 2ZYHA 3AZOA 2CEKA 1ZGBA 1QIHA 2H7XA 4LIPD 2DHCA 2VJDA 2CB9A 4FFVA 4BAZA 2VJCA 3N0TA 1ZD2P 4Y2VA 3D7RA 1PV1A 3LIIA 1JU4A 4BDTA 2AJBA 1OILA 5I9IA 3QVMA 4QE3A 2WFZA 2X8BA 4MQMA 2B9VA 4CIAA 1R88A 3I2GA 3H17A 2XQIA 1XZAA 3DYVA 5E2IA 1WHSA 1QTIA 4HXFB 4OUKX 5EIEA 2WHPA 1SCQA 2JIDA 1LPNA 4JH0A 2GBCA 3STVA 5AP9A 2WJ4A 5AKZA 3I28A 1Q83A 3QMWA 1JI3A 1YA8A 5CH3A 1N5RA 5CH5A 1AZWA 2RGUA 4BC0A 2DHDA 2WJ3A 1QO9A 5HFAA 1Q0RA 4NZZA 2ONCA 2XUFA 4BBZA 1GGVA 5JADA 3R3YA 1CIJA 3M82A 2BJHA 4F21A 1R50A 4Y9SA 3FYUA 4FDMA 2XUAA 3BXPA 2WJ6A 3AIMA 3BIWA 1FFEA 4ZV7A 4TPKA 4Y2TA 2OXEA 5BWCA 4CCWA 3M3DA 4AMYA 6YASA 1CUEA 2Z8XA 3V48A 3VJMA 5JZ9A 2DFPA 4EHBA 3I2JA 3WK7A 4NMWA 2HA2A 2VT7A 3DLTA 3UUFA 1Z68A 2AJDA 2EEPA 3B3QA 2HADA 3TGLA 1S8OA 2NW6A 2OPHA 5DNUA 4B82A 2ZSHA 5AK6A 1DU4A 4HRXA 1KU0A 2GBIA 4V2IA 1LPOA 1K8QA 1LLFA 1U4NA 4P08A 5DWDA 2ZSIA 2W22A 1AURA 4U2CA 5CT6A 4H7JA 2BUBA 3IULA 2JGKA 4L0CA 4PNZA 2VAXA 1QONA 2DCMA 4C87A 4YPVA 4DSZA 4EUSA 3WA6A 1ZD3A 3ZLTA 4KAFA 2DSNA 1LPSA 1DX4A 5AM1A 2DHEA 5FOQA 5DLPA 1QIEA 3BJMA 2WHPB 4I4CA 4AO6A 4G4JA 2QXTA 3G02A 1F8UA 3PF9A 5LKRA 4JYPA 4X94A 4G4IA 2PUJA 1XZGA 2W6CX 5AOCA 3SWWA 4QZVA 2GYWA 1P0QA 2XT0A 3L1HA 5AIBA 4WY8A 1QIKA 5FLKA 4K6GA 4J0HA 5JZSA 3AUKA 2GZRA 2Z3WA 2CUTA 3I6YA 5AI5A 4BCDA 4HXEB 4U2FA 3VXKA 4EY7A 2DQZA 5E4YA 3FYUB 4KE8A 3V1LA 4UFPA 5HQ3A 3IUJA 5ALRA 1K4YA 1U65A 2Q0XA 1IZ8A 4FKBA 5DNWA 2WG0A 1MNAA 3SK0A 2HU5A 3FWHA 3VDXA 3FNBA 4BZWA 4KAJA 1THTA 2C58A 4ZGBA 1GPKA 5ALTA 2PL5A 5CXXA 5H3HA 2WTNA 5CTAA 4BAUA 4Q1VA 4K5QA 2BUCA 1WCYA 1LZKA 2X5XA 4H7FA 1Q0ZA 1ORWA 2H7CA 4MEAA 1A88A 3A2LA 2Z8ZA 1UKCA 5ESRA 3ZI7A 2QUAA 1W76A 2VA9A 1CUIA 4UHCA 4CFSA 3CCCA 5JD6A 1R3DA 4B9AA 1R9NA 1ORVA 3PDCA 4M0MA 3DYIA 5LZ9A 4OB8A 5AKIA 5AH0A 1DX6A 3HYSA 3D2BA 1THGA 1EA5A 3QITA 2WU3A 3ESDA 2R8BA 2GYUA 5JD4A 5LKAA 2Y1KA 2HL6A 1TIBA 3FCXA 3W06A 3OURA 4UHEA 4KACA 3FYTA 4UBMA 1L7RA 2H7YA 3ILSA 5ALQA 3A2NA 4LXHA 1TCAA 4DNFA 1CQWA 2OAEA 4W9RA 1MN6A 5HQ3B 1EXWA 1HDEA 2BUAA 2ZVDA 3OOSA 3QH4A 4X3CA 2WILA 3D5EA 3H2JA 4U2GA 3G8YA 2BKLA 3KWFA 3GROA 1XRMA 2JGJA 2O2GA 1XZBA 5BOVA 3LS2A 3O95A 4G8BA 3ZLUA 2FX5A 3WKDA 2Z5GA 4C88A 1XZLA 5EGNA 3WYNA 1G5FA 1CEXA 1WHTA 1YAHA 1L7AA 1LBTA 3ICWA 4QA9A 4X97A 5I8PA 1FFCA 1JMKC 1IZ7A 4WFJA 5JZBA 1XZKA 1XZCA 1QGED 5EIAA 3DDUA 2ES4A 2C0QA 5E4JA 2K2QB 1UK9A 3FYUC 1SOMA 2PX6A 3ANSA 5EI5A 3IB3A 1G42A 1JT2A 1XZHA 3ICVA 1A8SA 1YS1X 4OB6A 3C45A 1Y37A 5AI8A 1J07A 4QDTA 5IKXA 4QDOA 4AX4A 1QIFA 4GW3A 5C8XA 2PSEA 2OCKA 4UBJA 3O9VA 4A23A 1P0IA 4W1PA 4AB1A 4J0DA 3F9CA 3UUEA 4Y2XA 3DCNA 4JYMA 5HKAA 4Q3KA 3JWEA 1CUVA 5DYWA 4MXDA 3STWA 4B81A 4UFOA 3DKKA 2O7RA 2WIDA 3T52A 4TVKA 1ZI9A 2OGZA 4B84A 2LIPA 1EI9A 5JATA 1EDEA 2WHQA 5ALSA 2WG1A 2BGRA 2QR5A 3GZJA 4P92A 3S2ZA 4LYDA 3I1IA 2XQGA 3STTA 4QDXA 2XI4A 4IHAA 5IVKA 4FHZA 3W9UA 4AMZA 4GECA 1SCIA 1XLWA 3YASA 3G0IA 4XX1A 3HI4A 1TCCA 2QTBA 4P9NA 3E3AA 3WK8A 4N5HX 1XKLA 1H22A 1RYYA 4D9JA 1NU6A 5AOAA 1DINA 2B61A 3IBTA 4E11A 3MUNA 1AQLA 4J03A 2WU4A 2ACKA 4X71A 5AM2A 4YASA 5DYYA 4FNMA 4BVJA 2XQKA 1CUZA 3SC2A 4PV7A 4FNGA 3L1JA 3VVMA 1F6WA 2QKYA 2FUKA 2CKMA 4X91A 1J1IA 4OB7A 2QS9A 4H0CA 1H2YA 2AJLI 4Q34A 1ZIXA 2D0DA 5CH8A 3C6XA 3R3ZA 1MX1A 3JYHA 3FSGA 5AIAA 4Y2QA 4OYYA 1LPMA 2ZYIA 1H23A 1FSSA 4BCCA 3AFIA 2QUBA 1EHYA 5FXMA 3A70A 4BCBA 4UFNA 1HKHA 4FLFA 3NOXA 3N2ZB 5HF5A 3I6ZA 5ALNA 3R3VA 3U0VA 1H2ZA 1A7UA 4HAIA 4ROTA 4B7ZA 1CR6A 4PF1A 1D07A 4QDZA 2CZQA 1N8SA 5HCUA 3OG9A 2QMQA 2WLSA 3H19A 1QLWA 4AO7A 4K6KA 3WWEA 2OG1A 5K3BA 5D7BA 5FUMA 4AN1A 3OTQA 4FTWA 3H2GA 4GDMA 4ZV9A 1CUHA 1MAHA 4PQEA 3WWPA 2WHRA 1B6GA 3H18A 5BV7A 2PSDA 5ALDA 4C01A 3DOIA 1UK6A 1GZ7A 3LCRA 4QEKA 4DMKA 5EHZA 3PUHA 4ZWNA 5HF6A 1W52X 4W63A 4UHDA 4X90A 4G9EA 4GI1A 1CPYA 4N8SA 2OLEA 1E8DA 5AKYA 3WWDA 4X85A 1WM1A 2H9YA 5EHNA 1ODCA 4BRSA 3CN9A 3WK4A 2PSHA 5FPPA 3FSGD 1XZEA 1O6GA 3U1TA 2AJCA 2ZYRA 4FBLA 3OC0A 4H18A 2VATA 3WL6A 2XMBA 3G0BA 3O0DA 4M0FA 3MVEA 5A7FA 3C5WP 4B9EA 2PM8A 2XMDA 5AM0A 2ZJ7A 2JEZA 4DGQA 3HACA 1MT3A 2OCLA 5ALMA 3O4JA 2XUJA 3I2IA 3WKEA 3QYJA 4GXNA 3PE6A 2HA5A 1O6FA 4Q3LA 2HRRA 2XE4A 2HRQA 2AXEA 4Y2JA 1LGYA 1WPXA 4BE4A 3E1GA 4WCVA 1YAJA 2RAUA 2WFMA 1VA5A 2C5FA 4UUQA 2WKWA 1LBSA 3ED1A 1K63A 2ORYA 3WL8A 3WK5A 1UXOA 3NWOA 2B4KA 4UPDA 1MU0A 3C43A 3H2KA 2WUFA 1RP1A 4YX9A 4JNCA 5IVIA 5HKBA 4WFKA 5JYCA 2UZ0A 1QJ4A 1KU6A 1DTEA 4KRYA 1QTRA 3H2HA 3O4GA 2R11A 3RARA 1QIMA 4G4GA 3WIOA 2RIPA 2HA3A 3NGMA 4UBLA 3KWJA 2QJRA 4C4XA 4K2AA 1P0MA 4WFIA 4BP8A 3KOOA 5JD5A 4UHBA 3PUIA 4Q82A 4QNNA 3AIOA 3E4DA 1MPXA 3WWOA 4DMCA 4N8EA 2E3JA 2Y6VA 3PF8A 2WQZA 3TEJA 3IURA 1BU8A 1NX9A 3ESCA 2VJAA 4C4ZA 3IIIA 1YB7A 1WB5A 1CQZA 1IUOA 2HA6A 3W2TA 4MWTA 1YA4A 1FJ2A 5T4BA 1YB6A 5CRIA 1ACLA 5AKKA 3L1IA 4L9AA 1WOMA 2GYVA 1HQDA 5IVHA 3DL4A 4G8DA 3BWXA 1JU3A 3M81A 4OSEA 4E15A 5D3ZA 1XZIA 1VLQA 4DTCA 5FRDA 3HRHA 2BFNA 4Q3OA 2XQFA 5AKHA 1JKMA 3SX4A 3PFBA 4XIIA 3D2AA 2WUEA 3NUZA 4L3WA 2QZPA 5ALYA 2G4LA 2XQJA 3WLAA 2V96A 3PICA 3FLAA 3JW8A 2OAGA 4RE6A 1JJIA 5A6VA 5JIBA 4UBOA 5LZ5A 4OD0A 2HA4A 3DL7A 1TQHA 3RK4A 1UOPA 3ZV7A 1VKHA 3KDAA 3WKBA 2OGSA 2DQYA 1E8NA 4EBBA 4ZXFA 5HK8A 4X6XA 2RHTA 4DMFA 2YASA 4IH4A 2HFKA 4MYSA 1ZICA 4G8CA 2I78A 1XZFA 5LLSA 1Y7HA 4B85A 4B6GA 3W9BA 2WIJA 2JBWA 1K6EA 5CURA 1H2XA 3GELA 5DTJA 1UOQA 4X93A 3G9XA 3WYDA 1LPPA 2J4FA 2VT6A 4KYVA 3IVMA 1XKTA 5AHXA 4C4YA 3GA7A 5J3JA 4QLAA 3WK9A 3G9TA 4FLEA 3WWCA 2VSQA 1H2WA 4J7AA 4DLNA 4QWMA 3R3XA 3AJAA 1CFJA 2JEYA 3PFCA 1UT6A 1TRHA 3BIXA 2PPLA 1E89A 1A8UA 3ZLVA 3HXKA 3K2IA 1JMYA 4C89A 1CUSA 1DT3A 2XMSA 4GBGA 2O7VA 4H7EA 2V9ZA 5CW2A 4UHHA 4HTAA 1CUAA 5ALUA 3W04A 4JUIA 2HU8A 4GHWA 4IH1A 3D2CA 3CN7A 5LZ7A 1CRLA 3DS8A 4B83A 1W1IA 1ACJA 1WB4A 4Y7DA 1X2EA 4EZIA 4AO8A 4OPMA 1UKAA 5JAOA 2VJBA 3WKAA 2I03A 4RPCA 3EQ8A 1XZDA 1VJ5A 3R3UA 2C0PA 3O9MA 1MX5A 4DNQA 1MNQA 2PVSA 1QFMA 1VOTA 1FFDA 3QPAA 3M83A 4X92A 3TRDA 1R9MA 1UZAA 2CMFA 3KD2A 2D5LA 3DNMA 4K6HA 3VJKA 2GZSA 3FBWA 4X6YA 3I2KA 1TAHA 3C6ZA 2XUGA 2HIHA 1IUPA 1SFRA 5IH7A 3QBJA 3PI6A 3FCYA 3MGAA 4Y2YA 3B5EA 4ZRDA 2DR0A 4P93A 1EDBA 5LYYA 1J06A 4L72A 3K9BA 4KE9A 4JEIA 3F67A 5IVDA 2JGIA 5DJ5A 4W1RA 5EHXA 2OGTA 3EQ7A 5FV4A 4A5SA 1GPLA 5K3FB 1EX9A 3WIBA 1XLVA 2EDAA 2VEOA 3H0CA 3GBSA 2XUDA 2YYSA 3FLBA 5FPQA 2JF0A 1XLUA 3EIOA 5C8ZA 5EFZA 1QE3A 5JAUA 2OCGA 3EBLA 1AGYA 1GT6A 3WKCA 2O2HA 4LYEA 4H7KA 1JJFA 4QLOA 5ALHA 1W6RA 4U2BA 3HSSA 5AO9A 3IA2A 1CUGA 2Y6UA 3C70A 3K6KA 4IH9A 4H7DA 2V98A 5AK3A 1F0PA 5ALFA 3FAKA 1CUWA 1CUUA 3HJUA 3HABA 1CV2A 3B12A 2C7BA 1Q84A 1N5MA 4E14A 4AZ3A 1MTZA 5AKEA 1CUBA 4PSUA 2WUGA 5ALEA 5CT8A 5AI0A 3D4LA 2OQIA 3BJRA 4CG3A 4BVLA 1ZJ5A 4AZ0A 5ALVA 5AOBA 1EINA 4H7IA 5KBYA 4PO3X 3STUA 2G63A 4FBMA 4EA6A 2PSFA 5A62A 3WL7A 1AKNA 2FJPA 1JJBA 4LXGA 5C8VA 1XRRA 1N1MA 4G1FA 4X00A 2G5TA 3HEAA 4N5IX 2XMZA 4ARAA 1LNSA 3G0GA 2WIKA 1XFDA 3BL8A 1L7QA 5JANA 3ZWQA 1XROA 4J0JA 4KEAA 4J3JA 2XUKA 4DIUA 5LP1A 4RE5A 4BATA 1UFOA 4B0OA 3F97A 1DQYA 1C4XA 4BVKA 3O4IA 4U2EA 3T4UA 3RKSA 1QOZA 2HU7A 4MJ3A 4RGYA 5AM3A 4FMPA 2WG2A 5JAPA 1FFBA 4GEGA 3WMRA 5JARA 2JGEA 3STYA 3BDIA 2ZJFA 2ROQA 1SC9A 3ZPXA 2B20A 4B80A 1UKBA 4BE9A 1QIDA 4EY5A 4ETWA 5JALA 3F98A 3GUUA 5K3AA 4EY6A 5D3KA 4AQDA 1ZJ4A 4BRZA 1YCDA 3QMMA 5HF9A 4M0EA 3HLKA 1HPLA 3E0XA 1DWOA 3CXUA 5CXUA 1LZLA 3MUOA 1W4LA 4HRYA 2IX9A 5ALOA 4PW0A 2ACEA 1ETHA 2H1IA 3LLCA 1BS9A 4AXBA 3WI7A 2XUIA 2I3ZA 3I2FA 3AZQA 7YASA 4KJXA 1AX9A 4HXGA 3IUNA 4EY8A 4F0JA 1VXOA 2RHWA 3V1KA 1DWPA 2QRUA 1LPBB 4XVCA 1IUNA 4J0CA 4DMHA 2VAVA 4INZA 2Y2UA 3VVLA 2YH2A 2PU5A 5JAHA 1G4HA 3H1BA 5KWIA 4MYDA 2V97A 1X2BA 3AIKA 5T4FA 3C8DA 1BE0A 1UK7A 2P8SA 2XMCA 2HM7A 1M33A 2XUPA 1ZGCA 5I7UA 4DNOA 2VQ6A 1ODSA 3A2MA 5LIPA 4KE6A 1CUJA 2PSJA 1CUYA 2XDWA 3D59A 3C6BA 5AKJA 3VISA 3STXA 2WFLA 2XMGA 1VE7A 1J2EA 4J0IA 1WB6A 5AI9A 3WK6A 1BN6A 3DKRA 4BYMA 1TKRA 1XQXA 4IO0A 2IITA 1DWQA 3UMJA 4HZGA 4GLBA 4EY4A 2IIVA 2QOEA 4X95A 3WL5A 4HVTA 5ALXA 5CT4A 2FJ0A 1HL7A 5AJHA 4BC1A 2WTMA 4CG1A 4Y2RA 4MQLA 3I6MA 5LZ8A 3C5VA 3W05A 3OPMA 2JGLA 5AK4A 1GQSA 1KEZA 2CBGA 5DNVA 2XUOA 2I3DA 3AZPA 1F0NA 2HFJA 2QVBA 3HC7A 5HK9A 3BF8A 4N8DA 3WA7A 3F96A 1T2NA 5CT9A 1XQYA 3EF3A 4J0KA 1VZ3A 5K3EA 5ALLA 1E66A 2GBGA 2XLBA 2QXUA 5C81A 5A7GA 3FLEA 5EHQA 4Q05A 1U8EA 4UBKA 3BE8A 2PUHA 3G7NA 1R4ZA 4I3FA 5EIHA 5HZGA 1QIJA 1VZ2A 2VTVA 3FVRA 1LPAB 1YS2X 3IDAA 1U2EA 4FOLA 2J3QA 5CMLA 4DYHA 3G9ZA 5T4EA 2QT9A 1B41A 3D3NA 3Q0TA 5DYTA 2WM2A 4KE7A 2J4CA 1MAAA 3VJLA 4F60A 3A6ZA 1CUXA 1GKKA 1EVEA 5CT5A 4DSAA 2PU7A 2WSLA 1ZI8A 1TK3A 5SYMA 1EB8A 2WFLB 3TJMA 4H35A 3KSRA 1G66A 4WJLA 4UBNA 4BB0A 3HZOA 5ALPA 2OQVA 2JGFA 4H7HA 1DQZA 4J0GA 2HHAA 2PKYX 4FLMA 5AK5A 1UWCA 2HA0A 5E4TA 4Y2SA 4AN0A 1K5PA 5JASA 3QZUA 1XZMA 3DOHA 5AI6A 2Z3ZA 5K3CA 2X76A 3C87A 4EB0A 1Y7IA 2G5PA 4BZZA 4NS4A 2C5GA 5D6OA 4X7BA 3GFFA 1T4MA 1A8QA 5HFNA 1QFSA 1RWQA 1ZOIA 4OYLA 5LZ4A 3AILA 1YR2A 1XZJA 5AKXA 5A7HA 3WQHA 2HA7A 4OU5A 4MEBA 4DNPA 1GKLA 3D0KA 2XMRA 2HDWA 4NVRA 5HF8A 2O2IA 4PSCA 3WJ2A 1MJ5A 3LP5A 3KXPA 3WZMA 5AM5A 4FFWA 5BWBA
chains in the Genus database with same CATH superfamily
1CQJB 3KKOA 1Y6JA 3LQ2A 4PN3A 3M2TA 2RMKA 1K75A 5KSYA 3G0DA 4LJYA 1QRTA 4KAAA 3P9YA 3KKLA 3NHWA 4HX2A 5BORA 2LP4Y 2EHJA 1QO7A 2FPPA 3DM5A 4CGYA 4YRGA 1BROA 4DQUA 3ECSA 3DE2X 5DHTA 1H3EA 5JMOA 5J40A 3P97A 2ODBA 3COVA 3IO3A 3N87A 4GX2A 1X13A 1QIGA 4NEQA 1JYEA 2OCIA 5GONF 1GPNA 1X80A 4W1QA 1FXUA 2JAQA 4EPYA 1G6KA 1UDXA 2WAOA 4ZI5A 1ENZA 3JQAD 4LFCB 3H1GA 3HWX1 2XCQA 1IHOA 2OHHA 1P2FA 1G5TA 3T99A 3S0JA 1QHIA 2P30A 3ET4A 1VYUA 1ZD5A 2O8EB 1T3ZA 4IM7A 4XM2A 4OYHA 3RD5A 1GNQA 4GOKA 1T36A 4B0PA 2WD9A 5TS2A 4ESVA 2PUBA 1KR5A 3D6VA 2VYNA 4CCYA 2G1KA 2C95A 1P0PA 2H0QA 2A0UA 5HBRA 1JPVA 5LBIA 1QRAA 2PWYA 4NBTA 1XRQA 4OV6B 3A1WA 1MMFB 4PZYA 1KFBB 2R1VA 3MIIA 3ZDZB 1FTNA 4NBVA 3SBOA 2I3GA 2GJ4A 2X4DA 3HB4X 1JDBB 1M6YA 2C8VA 3DD5A 1KETA 3MWFA 3RI3A 3TLAA 3ZDEA 4LJRA 1IXSB 1W0CA 2P75A 3CKYA 4K26A 2IF2A 1R74A 1NHWA 1E1CA 2HN9A 2QX4A 4IIBA 1DC3A 4OQ4A 5F1PA 4HEHA 1XKQA 2P2SA 3AU9A 3PXXA 4YT2A 5JH7F 2AHRA 1QX4A 3NIDB 3AHEA 4LECA 3OZVA 4TKUA 1BHQ1 1T25A 3EGDA 5ARBA 4PYRA 4JVSB 1WZ2A 1R66A 4NONA 1M0WA 3RVDA 1TI7A 1Q1EA 4WUTA 3R7FA 2I29A 4IMJB 5DP1A 4GL2A 1I2DA 3HY6A 1YRBA 1Z12A 3HH8A 3TKLA 4MJ7A 1KJNA 3A25A 2IDKA 3SNHA 1ODIA 4CLRA 3OTOB 4BO1A 4RS3A 2H5LA 1KIAA 2FMKA 3AF4A 3IPAA 4Y2HA 3CX4A 1VIDA 3HA2A 3N8NA 2VK8A 4BAGA 2XY4A 2ASEA 3V4ZA 2QQFA 1WUYA 2RCYA 2CHEA 3L8MA 2OUKA 4QC2A 2II6A 3HUFA 2HJGA 4C7XA 2G4VA 3LX4A 3QA3E 5BUSA 1GTJ1 4K8RB 3OT5A 4JLBA 1NY6A 2HLNA 3AG6A 1W4CA 3CH4B 3MBOA 1R0WA 4FOTA 2ZT8A 1DIOB 1NXVA 2AOTA 2EW2A 4DXAA 5BMVA 3DVAB 4IMRA 1ICIA 5LZ2A 5D6NA 2YXBA 4G6ZA 3AUJB 2PBLA 1MR3F 3HUEA 1KDOA 3GPLA 1PQ4A 3BICA 5BSTA 4OMDA 2OBMA 2WIFA 3C8HA 3KOUA 5THXA 4PSDA 1YGPA 1XTTA 4C0WA 4LOHA 2PGDA 5EIWA 1I3KA 3ANTA 3C6YA 2CCKA 5A0TA 2A7XA 2Q6KA 5EXTA 4CQMB 4E5SA 1L3IA 2J3DA 2Q8NA 5C4IA 2B2CA 2GK6A 1P9WA 5DU2A 2AFHA 4WAUA 1ISPA 3BWVA 4QDUA 4Q6WA 5YASA 4C7KA 4MDEA 3ZJTA 3NKLA 1X7XA 2PX2A 4WK0B 3U0BA 4HN4B 4KDCA 1L4UA 5A71A 1BHO1 4YALA 2E4YA 1J00A 2IYLD 3CG0A 2CSUA 4AU1A 3EW9A 2Z5FA 3KKNA 5JXJA 3R3WA 5AICA 4V1CI 2UZ1B 5JCXA 3PDHA 1EK1A 5C1IA 1A8IA 4MIEA 2Q9UA 1I6LA 2VDWB 2VPIA 5D3MB 4GMHA 3EZYA 3LWZA 4MKXA 1X7DA 4MI6A 3DWGA 4ZVLA 4EVRA 5T3UA 4WN9B 1UANA 4KWEA 4RD2A 4ESOA 1YSCA 1R6VA 4U2DA 3PCRB 1YNSA 5K7SA 3DE7X 5IARA 3CZ5A 1KMCA 1A71A 5FUYA 3DVQX 1JQJC 1OBFO 1H0RA 3K4HA 4NU0A 3EY9A 1EDDA 4S1TA 3TIXB 3ZJYA 2JCXA 2PAAA 1FMLA 2I4RA 1V1MB 3RFVA 2IPMA 1G64A 1W1UA 4I08A 1SXJA 4RNCA 4V38A 3TW4A 1R5BA 3ND5A 3NX4A 2AFIB 5AW9A 3UA4A 3DHWC 4XIGS 3P2MA 5AI4A 1HOXA 1PT5A 5DW3A 5B4TA 4FEYA 2QAJA 3ZGZA 2H11A 4YHBA 1UAAA 4JLJA 4MR8B 3SS9X 3GFQA 4BO5A 1C41A 3IVAA 3U4CA 2WPDD 4LY6A 3UH0A 1NU8A 3TTVA 3E8XA 1XAIA 1W36C 2EX1A 3IVGA 2AUTA 4CPDA 3EAGA 3PGJA 3CBGA 4RKFA 1J20A 1RFLA 4HWTA 2GILA 3UHAA 1VMDA 3O2SB 2C1ZA 4FYMA 1TPZA 3A4VA 2R8XA 1RKBA 1FDSA 1W88B 3WO1A 2F1IA 2ZIWB 2BKXA 4YREA 2L69A 3E61A 3HUUA 4LK3A 4PC3A 1NM5C 4MGZR 5J4HA 2QL6A 4LY3A 3WRWA 3L8HA 1ML3A 4FCCA 2RGGA 3IJPA 2I1QA 3ZJ4A 2BCEA 2IDMA 1OGJA 4C0HA 5H0IA 1WLSA 3AETB 3M33A 3LQFA 1V45E 3OEHD 4UREA 3TRIA 2D0IA 1JZQA 1TDJA 3QELB 1EVZA 1GEGA 3O90A 3HKEB 2EZUA 3TTTA 1PL7A 1D1TA 1UZMA 1L5VA 4XXHA 3VHXA 4KSCA 5ALWA 1O03A 1K6XA 1GUYA 3NT4A 3T12A 3O8DA 1P2BA 3I2HA 1C30B 4H77A 4M99A 2QN2A 1NN1A 5FI0B 4KXXA 3GJ4A 1NY5A 1RI5A 3GQBA 2DERA 2Q4RA 2JLCA 3KLMX 4HGOA 3KAPA 4DQVA 1JEYB 5JNLA 3LK7A 3KZCA 3ZYZA 2ECFA 4DDVA 1CQIA 1EKXA 2RJNA 3OCWA 3IQDB 5C7YA 4R5HA 1OFTA 3Q7SA 4P0PB 1FTQA 4D79A 3HCBA 1TCBA 2YMLA 4LPKA 2NO4A 3OZFA 1MO2A 5A06A 1ARZA 1WB9A 1B6SA 3AVXA 1NC3A 4M98A 2G0TA 4UDYX 2B4YA 1BN7A 3BJEA 4A2PA 3ZBQA 5FTJA 4A16A 2XGMA 1VJ1A 5CCEA 1WPRA 2C4HA 1BG6A 4ITVA 4B4DA 2ZJ4A 5JXGA 2FZ5A 1WS6A 2ZBDA 1USWA 3BFJA 3D7KA 3E7WA 3MILA 4KW7A 3T0IA 1N77A 1YCGA 1N8KA 1CUFA 2FSPA 2AFIE 2N46A 1KAHA 3VDNB 4BP3A 1UPXA 3OTWA 2EX4A 3MSCA 5K9ZA 3LY9A 3ZEAA 5E9AA 1U9IC 1XYVA 1FBTA 2FG7C 4MVJI 4CDMA 5T4HA 4LJKA 4PC1A 4V0OA 5F4ZA 4CHTA 3KJXA 2XUHA 1ZINA 5LLTA 5AXDA 1EK2A 3C6QA 3H5VA 1C9KA 3KV1A 3PA6A 2YHAA 4FYXA 5DE3A 3VR3A 1JFRA 3L1VA 4AJNA 2IEGA 1Y8QB 3IP6A 1DRJA 1UM8A 2ZQZA 3HP4A 1Z45A 3LUCA 1BXRA 4LV8B 1SC1A 3CUUA 4GM4A 5DXFA 3VKFA 4HQNA 4CODB 4E46A 2FTKE 3AR6A 4OMUA 4BRWA 1GLVA 1MJFA 2ZTLA 4DUGD 4QU9A 1ZLXA 3RYHB 1G7RA 3RF7A 1IG0A 1PZXA 4L4ZA 4BMDA 4DY4A 3QBVA 3GIDA 5EMLA 4DG5A 121PA 2YVQA 4IDHA 4Q9DA 4R9UC 2KSQA 2XOKD 3HMQA 4WKGA 5JUWA 5H3CA 1EZ4A 2BTQB 1U1CA 2E37A 3ORQA 4DUPA 4DVGA 4W5RA 2ZB4A 1GQRA 3SF0A 4BNIA 4X1OA 3GNQA 3AC0A 3KB6A 1D2RA 5KDOA 1PEAA 4WXYB 1GFIA 4EUHA 4GRDA 1F17A 3R40A 2XCUA 1NBHA 2OVFA 3DJYA 4MCIA 1VRVA 1H4SA 4CI9A 3HBLA 1M66A 2FEKA 1GPDG 4YXFA 1N0WA 4NJEB 4GXTA 4AUMA 3ANMA 3TH5A 4DAEA 3BWYA 5DVZA 2EARA 2IYQA 3QPBA 1DCTA 3PFWO 4YP9A 2CEKA 3VUFA 1ZGBA 3K9LA 3OF5A 4TRMA 2QI9C 4G09A 1QIHA 3HJNA 3CPSA 4RADA 5L45A 1RLIA 4B44A 1HYHA 1PJTA 3NBFA 2CB9A 2ZQ5A 4FFVA 3N0TA 4MIKA 4MUKA 4F6RB 3AEKA 3D7RA 3E5NA 1XMPA 4HFNA 1GADO 3V5NA 3LJKA 2FPIB 4BDTA 3ZWBA 4D9HA 1A9XA 3BQ9A 3N58A 1QVVA 3IDFA 4HGZA 5I8ZA 1E2NA 4B31A 1O94A 2WFZA 1DLJA 3FVQA 2XBMA 3AKEA 2E18A 4BKPA 3GLSA 5E7MA 1GAJA 2CYAA 4C2AA 2ZSAA 3PXCX 3P2IA 3VKUA 3FPJA 1ODJA 4YIKA 4F4CA 2VYFA 1EZ1A 4Y2GA 5JS7A 1FVXA 2B4AA 5E2IA 4ZQBA 5JVDF 2QYTA 3MHTA 1KOGA 4OUKX 4Y6PA 3BXGA 2CYCA 3RE1A 1IOWA 3GNLA 3BRCA 4I3HA 4NF2A 4MKHA 5AP9A 2QM7A 4URWR 2PZEA 2FMIA 4OLJA 4YY3B 5KQSA 2UYHA 4JJ7A 1ISHA 3PHJA 2X8LA 3DWEX 1T5TA 1P3JA 4O3FA 1U7OA 2Q50A 3I28A 3NXSA 2ZIEA 4GKVA 4I9UA 3R7WB 1Q83A 1KO7A 2ZPTX 1YA8A 2YMMA 5A5VA 2O50A 3WNQA 3TW6A 3WHKA 3OZAA 1V1JA 3N7TA 2PS9A 3UMVA 1AZWA 1LDNA 1PUXA 1ZL0A 1Z4OA 2WJ3A 3NTXA 1LK5A 1Q0RA 4K05A 5AW8A 1EHIA 5KOJB 3K09C 4LE1A 1XF1A 2Q5JA 1J0BA 2O0JA 4QYXA 3OQBA 2UXDB 1TM3E 3TAHA 2DJIA 1EE2A 2B1IA 2WHEA 1NP6A 2Y8EA 4OUDB 2BCJQ 3GLQA 5CPFA 1CNFA 1CIJA 3K3PA 1D2MA 3R3YA 2XZLA 1PSDA 3NHUA 1H2EA 1E69A 1OYOA 1TTHA 3D1LA 3FYUA 4FDMA 4YP7A 2GA9A 3BIWA 4GZ5A 4ZV7A 3C24A 2I6FA 1GY8A 5IAEA 2ZYTX 1T2AA 4Y2TA 3IRVA 3UK0A 3ZNOA 4CCWA 4D9MA 3NRCA 4FOPA 3N6RA 5BWCA 3NAGA 4DWOA 4QJ5A 2GASA 2GF2A 5JRZA 3WQQA 3E48A 4DHEA 2X5NA 4CXMA 2ZSEA 2O3TA 2XSZA 1XVLA 2PJDA 3CVOA 4Y0AA 3QVUA 3VC7A 3X43A 2OA0A 3ITKA 4OIFA 5KOIA 1GXSB 2BEUB 3GLKA 3NCTA 4R0NA 1GPAA 1B74A 4IIUA 4PC6A 1TYDE 3I12A 4HDAA 5LMUB 5AK0A 1RWPA 4DTIA 5BSFA 4A6PA 1LVUA 3HGMA 4PHCA 2F7SA 2J0EA 3FPHA 3KV3O 4P6VF 3CPEA 4F92B 1S8OA 4IS3A 4P4LA 2NW6A 3T5TA 5F98A 2VK2A 2ZSHA 3PIRA 1XVAA 3LU1A 3BC1A 4OIMA 4X7MA 4I36A 5AK6A 3UYKA 3TM4A 1THMA 1KVTA 1N5DA 2NNWB 4Y9DA 1Y9EA 4L9RA 1EP9A 3ZDXB 1KNQA 5A6SA 4KC0A 5IEBA 5HW0A 4ARUA 1GKUB 2XWBF 4GKAA 4V2IA 2RE8A 3ZU6A 1LPOA 1II8B 2DC1A 1QGDA 3WS7A 1JU9A 3VZSA 2QE7A 3BB1A 1LLFA 1NDQA 3C0KA 4P08A 1IWPB 1F60A 1GQOA 1WU8A 4CIWA 4FUQA 5FPHA 2FSGA 1DC8A 1NXWA 3VH3A 1B3RA 4M37A 3U3OA 2GOYA 4HAUA 2FFRA 4PVCA 4H7JA 3KHSA 1ODLA 3IULA 3DTVB 2HSJA 2WF7A 3ZIDA 3A06A 3OZBA 4CM3A 3F3KA 1ZK1A 4X1YB 1TU3A 3HKBA 3OPYB 2FOIA 2RD2A 3QKRA 1RQRA 3WA6A 4BNHA 2WSMA 4C2TA 3UPTA 1QBGA 2BFFA 2J59A 1KOFA 3EVEA 4OBXA 3U09A 3FWYA 1Z3CA 1RYDA 4YP6A 2RGNA 2IOFK 1LPSA 2PRIA 2IUYA 1TGVA 5AM1A 1U9CA 1R4NB 4KH0A 3ZGXA 2F1HA 4JQCA 1QTNA 2Q5IA 5IX8A 2BZ1A 4HAXA 3S99A 4RPKA 2DLCX 1QIEA 3EDRA 5DW0A 4ZVKA 2WHPB 1RLUA 3L0SA 1NQTA 3MT0A 4L75A 5FWXB 3UT0A 1WULS 3ITDA 3NPAA 4HNHA 4XVUA 3HV2A 2VF8A 3GBPA 4XFKA 3V2IA 1M2VB 1R00A 3UUGA 3OIGA 5LNK1 3KKZA 5DH9A 4A1FA 3JR3A 2CBZA 5A05A 4TZ0A 1W59A 3FNHA 2PUJA 1XZGA 3WLIA 1SXJC 4N1AA 2VO1A 4BE7B 1QC5B 3DOFA 3RYIA 1M76A 3L2OB 2GYWA 3BRQA 4I5EA 1Y7LA 5EMKA 2X22A 3N9IA 1REQB 2YICA 3B7PA 1MC4A 1R0BA 1WY7A 3D3QA 3G0OA 3IKJA 2XOXA 4U0JA 1ONSA 2OCBA 4ZRNA 3N8HA 1JNXX 4TRNA 4O4JB 2EJCA 4CM1A 3DV0A 4G97A 4KDEA 5ELXA 4BMCA 2A1TS 4HBGA 4ZIRA 2O5RA 4Z9FA 4MW9A 2NU7A 2J3LA 2J6HA 4DLXA 3EPJA 3PEUA 1P8JA 2AR0A 2QK4A 2EKBA 3OPVA 3GAAA 4B46A 3V1LA 4FIDA 3EVZA 5FHRA 3MT9A 3DE0X 1KEKA 3B89A 1KI7A 1MT0A 2VUSA 4QYIA 1IUKA 4C0XA 1AKTA 2Q0XA 3K9WA 4TWJA 5DNWA 4GP9A 2JEOA 3PV0A 4RSHA 1U94A 4RU1A 2O2EA 3EE6A 4DV3B 2RB4A 2ZSUA 5EZQA 3VDXA 3OF2A 3G6KA 4EG7A 2OSBA 2IX3A 2ZE8A 3ROPA 4PANA 5IKMA 2O48X 2XYVA 2FN3A 1CRZA 4S12A 1W8DA 3EHEA 3FGOA 3IDZA 4RMNA 1TJ4A 4KAJA 1KR2A 4NZPA 1CEYA 2P2CA 4IO1A 4PGFA 2O7NA 5J5AA 1G2OA 5TT1A 2Y0PA 4DFDA 1S8NA 2OD2A 4ZGBA 4MV1A 3VPGA 5H3HA 2DR2A 3O1LA 4BAUA 4CMKA 3EZGA 2AX3A 4K5QA 1VSBA 3WIEA 5F1OA 2DYKA 2IQ5A 1WCYA 2X5XA 4XYEA 4YCSA 1C2YA 5FUQA 3HCWA 4H7FA 4G0UA 3BA6A 1V8PA 1KL7A 2VJPA 1QYVA 2AEJA 1ORWA 3TI9A 1BGWA 2FW9A 2ZI3A 4CV0A 3TB6A 2PWAA 4QL3A 1W2GA 5TGDA 2PANA 2SBTA 4PHTA 5IABA 2XRZA 2O8NA 2GJ8A 3M6FA 3ZNPA 2H4YA 2LVBA 2DGDA 3W6OA 4PYJA 1Q1GA 2GFHA 4MHSA 1QM5A 1VG9B 2WOJA 4XI9A 3JAKB 1SUBA 2P77A 4C4RA 2HSGA 3CCCA 3ISVA 5KDLA 2H2HA 3IMGA 2G70A 4PCAA 4ENPA 4CNBA 3PIDA 1VMAA 2CXPA 4JLVA 3FSRA 4JQZA 1YBAA 2AYYA 3L8YA 1E3SA 3W5CA 4B2IA 1ZQ1A 3IPCA 2AVDA 3DYIA 4TWRA 3NC1C 4TYPA 4RMIA 1N6IA 4MJXA 3UC9A 2CV0A 5F2EA 4D0NA 2N47A 3H9QA 4UMVA 2CEAA 5AKIA 3ZDQA 4Z7JA 1GZ3A 3KU1A 3E84A 1DX6A 1F2TA 5EJ7A 4UCXA 5J58A 3U7QA 3RUEA 1IEVA 3P4YA 3G5AA 3EPPA 4EW3A 3QXSA 1MZPA 4TXJA 4J8PA 3B85A 4JJ6A 5GP1A 4UDOA 1YXMA 2H18A 2OP0A 1WOYA 1KK0A 2SNIE 3NEAA 4X64B 4E0BA 3ESDA 4OI2A 4EP1A 1FSFA 4XE5A 2CW5A 2O2SA 4YYZA 9ATCA 5JMTA 2IXAA 3DVAA 3N8IA 4RD4A 3RASA 5LKAA 2OCPA 2HL6A 2DUUA 4HNQA 4MARA 2ATCA 3W06A 4LSZA 1W36D 5I48A 4HQOA 1Z63A 2IYPA 3T3PB 4O2BA 2EBFX 4WZBB 2NO1A 4KUHA 2NMVA 3LWNA 1TUEA 2A35A 5F9MA 2HUNA 2JIQA 1PVDA 3A2NA 4C76A 2ENUA 1S3FA 2VJYA 4QBHA 4BQIA 4DNFA 1KFKB 2IOHA 2FUEA 4A9AA 5K45A 3TTWA 3RCBA 3M6MD 3L9WA 1B6RA 4GNKA 4D9NA 4HR7A 5A4KA 2DFNA 3HN6A 4CTOA 3IA7A 5EXPA 4FPXA 3OOSA 3QH4A 4R68A 2OV2A 1LQ2A 1RKXA 3OMXA 3MW8A 4M36A 2WILA 1NXQA 2GJSA 1ZUD1 1AU9A 4X45A 1NN3A 2WWGA 1SNYA 2UZ1A 4GS5A 5I47A 1CETA 1DAKA 1O94C 4NAUA 3VDQA 5AVYA 1JFVA 2VDWA 3Q3JB 5D3MA 4TTQA 4FR2A 2O2GA 5IW8A 4O59O 3E2IA 2QUKA 4OLAA 4DV1B 1T1EA 2ZOSA 4S1PA 3ZWPA 4J0QA 4NMMA 3W6NA 1O1YA 1WVMA 2NSYA 3O95A 4KOEC 2P40A 2OXIA 3ZLUA 1ZBQA 1ZN7A 3GUYA 3P9NA 2W2NA 2H65A 3C6KA 1K5DA 1N9GB 1T4CA 2FX5A 3WKDA 2AOVA 2I2BA 5DM2A 4DCGA 1E1NA 4DV5B 3OU2A 4MS4A 1I13A 2AIRA 2I8CA 3RC3A 2QN1A 5KEIA 3N53A 3WYNA 1G5FA 1CEXA 4DANA 1RC1A 2QLTA 3R5TA 2ZRQA 3SJ7A 1L7AA 1LBTA 1Q7BA 1RBZA 2R6CA 1P17A 4EI7A 4H2DA 5IUNC 5ED0A 4PPNA 5JZVA 1GVHA 3UXEA 1ULHA 5BWOA 2VBIA 3QX9A 4GOLD 3SY8A 4CBVA 5I8PA 4ZKEA 1FFCA 2F3SA 2HLDD 1JMKC 3KTAA 1XIVA 4DCCA 5CXQA 4MR8A 5IXSA 1IH8A 4P3XA 4XCXA 2HIMA 3LX8A 4CM7A 4RANA 4OATA 3ZHOA 1FNMA 4P53A 4YB8A 3H6KA 3LX5A 2FPUA 3LDHA 3ZU3A 1JQBA 1ZMRA 2BOVA 2D1TA 2JFXA 4YJGB 4QJIA 2GNAA 5DN6A 3ZY4A 1GUZA 3QHPA 3L77A 5G3YA 2PG3A 4FB5A 1T8SA 1M2EA 1C8VB 4ZC8A 3HP7A 3TNDA 3H5TA 1W88A 5G0UA 4YEDA 5BRNA 4BO4A 1A95A 1JA9A 1V1RB 4F9TA 4MWGA 4BJ3A 2ES4A 2NUPB 2ZI9A 3PITA 4D5GA 1I51A 3SXPA 1APBA 3FYUC 3MMZA 4GFDA 4X3OA 3QELA 4WVLA 4M0CA 5AXCA 4B2YA 1Z6ZA 4GWGA 2ZT7A 4BZQA 3RUCA 1G42A 3O8OA 3QOWA 5JROA 1QP7A 4XSVA 3DE3X 2ZUBA 4WXHA 3RKUA 4KQKA 4DXDA 1W85A 3ICVA 1C30A 3OI7A 3UANA 4D41A 3UHPA 1S2LA 4OB6A 2YWDA 4UVEA 1Y37A 1PL6A 3P0JA 3G2JA 4QREA 4ZCSA 3ZQ4A 2GCEA 4YH1A 2PSEA 2OZLB 5IAKA 4JWKA 3AP1A 1XD8A 3TO5A 1D09A 3AI7A 2EAUA 4UBJA 3O9VA 2BGIA 1OU4A 4A23A 1P0IA 1VJDA 2F9MA 4KNVA 2PNFA 4OL9A 4XGIA 3I0MA 3KVOA 2OENG 4WN3A 3K9QO 3RIXA 5KYUA 4DWJA 1FP4B 4NBRA 2FPKA 1F4LA 2J9FA 3GY0A 4NCIA 1X39A 4Q3KA 1PJQA 2KYRA 3AW9A 4FKMA 5DYWA 4DE5A 3UJNA 3FTQA 3F1LA 1VDMA 3COWA 2PZMA 2B5WA 3AR9A 2RAPA 4ODIA 3MCTA 1LSJA 2ZSDA 3BQMB 4ZI7A 2WIDA 2GT1A 1F2UB 4MSUA 3QX8A 1UBGA 3ZXYA 3KYCB 4F9EA 3PJGA 4TVKA 3K05A 3GGCA 1E6UA 1O6BA 3K5IA 4MDFA 4HDSB 3P5SA 1KVSA 1Q92A 3R9KA 1EDEA 3F7NA 4OP1A 3UAGA 3U4AA 4C0QC 4CTKA 3TL6A 8ATCA 4UAGA 1EGHA 3WNCA 4C0JA 3P9ZA 2BGRA 2F8MA 4RWEA 2JZNA 4M53A 3V55A 3D8SA 5BN1A 4NYIQ 4PCUA 2CLDX 1E9EA 4P92A 4LYDA 1G18A 3UFXA 1HFKA 1U4SA 3I72A 2ZJAA 4HDMB 5K0CA 1IVSA 2QSUA 2XW6A 3TTSA 5EIXA 3ADKA 2ATIA 3ZW7A 1C7ZA 1N5OX 4I0WB 2RGNC 3T1HB 4XEUA 1X7GA 2YFKA 5IVKA 1R8SA 3AL3A 3H1PA 3HJRA 2AEMA 1XBTA 3OPXA 3HN2A 4RD6A 3CX3A 4F4HA 3NEJA 3F73A 2D7JA 3GXBA 3OHPA 3S3TA 3EWSA 4R83A 3WRYA 2DFDA 1SCIA 4RZQA 4N3CA 1TD1A 5EWJB 3K70B 1C0PA 2C9DA 1GNLA 2JIPA 3U3ZA 5GAJA 3A26A 2CNWA 3EXAA 1NVWQ 1DJNA 4M6WB 2C3MA 1NLFA 1PEYA 3W8DA 1N3BA 1L6RA 1OTYA 2QTBA 4P0TA 3J7AC 1PHRA 5B64A 3BYZA 1O9BA 4IPTA 5IAAA 1V9LA 4EF4A 2WY2D 4M7RA 5CPBA 4UUPA 2XMPA 2VYND 3ZX4A 1KEWA 2PEYA 3MD0A 2Z08A 3ECAA 2GAJA 5EVCA 1QUFA 3W6PA 3IMEA 4YCCA 2C2YA 4DIOA 3BXEA 2VJKA 1I94B 2B61A 2R1ZA 4NCNA 2ZJ1A 1Z0JA 2WNHA 2VRBA 3MUNA 4R54A 1XTPA 1N9KA 4GX1A 2A84A 1RCUA 2D59A 1QR2A 1NPYA 2B36A 4L9SA 4OHBA 1JDJA 3MPOA 5CLLA 3HDTA 4XDZA 2WU4A 3AVVA 4YASA 3E22A 4ZMBA 4OGWA 3B2EA 4A4DA 4FNMA 1YRHA 3H9JA 1S2OA 3LBNA 3BGSA 1J39A 2Q8PA 4MV7A 5CR9A 4KR6A 3UOWA 4FYHA 3LT5A 4ATNA 2YMQA 4IDEA 2YWBA 2WAXA 4II3A 4F8JA 3LO8A 5DHQA 1QV9A 3L1JA 1NW4A 1B15A 2J41A 4EG8A 1F6WA 4PO9A 5IAJA 1YBFA 1KZ9A 2FUKA 1P31A 1ZIPA 4X91A 4CLXA 1GPYA 3ZVLA 4EQ6A 4OB7A 1DMSA 2UZ3A 2ZKLA 2QS9A 1RVDA 5F4BA 3IDOA 3V1UA 1WUHS 3IQEA 4Q34A 4Q02A 4UJ5A 3LX6A 4B4UA 1EUYA 1T3TA 2ISSD 1X7YB 3L0YA 4RTPA 2W2XA 1L7DA 4H1UA 3I83A 4HO1X 2D0DA 1A98A 4PYQA 1QV7A 5CH8A 3V9PA 1AMUA 2IYXA 3EARA 3FSGA 3JYHA 1B8PA 1EQUA 3W5AA 2P2DA 1FU8A 3K0BA 3R7WA 1SVUA 3OOWA 3PP8A 1Y0BA 1SD2A 2C57A 4ME6A 3Q7QA 3ZWDA 1HE5A 4V0NA 1TQ6A 1G20B 2Z4SA 3RGGA 2X5KO 4F3NA 1DV1A 3S2UA 4GX5A 4WWHA 4ENUA 1I3CA 2Q07A 5LUBA 4BMPB 1SHKA 3IUYA 5A9SB 2PUFA 2SCUA 4DZZA 1MEEA 4PR3A 1SMKA 4A10A 5JPCA 5KOJA 4OHXA 1PW7A 3VNBA 3H5NA 3CNBA 4C4PA 3DMRA 3LOQA 1NVXQ 1DELA 2OTCA 3RSHA 5A5DA 2WTUA 1SUFA 1T1RA 2C7PA 1NYLA 3NT2A 2NSJA 3DDHA 3NOXA 5BSHA 5C1OA 2GGSA 4ZA2A 4OJKA 4YCBA 2NTJA 5JSZB 1HI9A 4RZ2A 1CY0A 3SQWA 1F3OA 2C99A 2X5OA 3JPWA 4QIHA 1DAIA 1G16A 3OCYA 2YC2C 4YV7A 3AF3A 1H2ZA 3DOJA 1LC0A 2I7TA 1CDEA 3B6EA 3O5AA 1WF3A 3D3WB 1CR6A 1IC6A 1GPJA 2QLLA 1Y81A 2BEUA 1H65A 2YJTD 3THYB 3T9FA 1OB5A 2I91A 1N8SA 1K7YA 1NF9A 1BE6A 1NKSA 3OH8A 4Q48A 3V4OA 4ZZ1A 1IN8A 4JIMA 3U44B 1JBKA 4Q47A 3DEJA 3OG9A 1XNHA 1ZW1A 2A5JA 1SXJD 2QMQA 4L6AA 4A7PA 1YS7A 3PSHA 4F4DA 4LE0A 1N4AA 3AUAA 3PQ5A 1AF4A 1KEVA 3AT1A 2Q9AA 1KJYA 1MKYA 1VB3A 3H2ZA 3OMWA 4PYOA 4KN9S 4XQCA 4E22A 2WSSA 4ZJUA 3ETLA 2GO1A 5BNWA 4K9MA 3WWEA 3RDPA 1NI5A 1XR3A 5K3BA 5T6MA 3EXHA 4CLOB 5FUMA 5FUVA 1Z0FA 1ORDA 1AGRA 3NC4A 3B1ZA 5TNXA 3NJ4A 3SEQA 3TBHA 1FK8A 3LFUA 4YLGA 3IAS1 1WZEA 2QRNA 2WWVD 4E33A 4FFNA 2O3RA 1B8VA 3LKZA 2DECA 5FFFA 1MG0A 4EQ6B 4AQYB 3M6LA 5TXGA 2R96A 3R0QA 3X1YA 1KQFA 2QG4A 2RC6A 1DQRA 3OQHA 1EFCA 2C2KA 5GGXA 1G20E 1GT91 2PSDA 4LXQA 2R44A 4NU8X 1XQ9A 3DFUA 2NPFA 1U2ZA 2R6JA 4X1YA 1IM8A 5IZCA 2D0PB 1N7HA 3OU7A 5HQJA 2F9FA 3DF9A 4K87A 1U2GC 2G9RA 3O21A 2SKDA 3TQHA 3OX4A 3JQRA 3OC6A 3ND7A 3EIXA 1E4YA 4IILA 4CM8B 1VB5A 3QE4A 5KTNA 1CY1A 1RFGE 3SC2B 1OHHA 1E2KA 4DWWA 3WMXA 3WLQA 5CA0F 2AK3A 5EHZA 1GYPA 3OD1A 3OTHA 2WB2A 3I42A 1DJPA 1BC5A 3CH7A 3GNTA 4ALLA 3FJ1A 4BNXA 3LTEA 1DBRA 3BGIA 5KJFA 4Q1BA 1RJFA 1CPYA 3BCSA 5KYXB 3LQQA 4ID9A 2OLEA 4KL8S 2Q4BA 3VR6A 3V6MA 5TQ0B 1Q3HA 4PFJA 4X85A 4QUDA 4QGFA 1M2VA 3WBJA 3HJAA 5ICEA 2D2VA 3IR6A 1X9HA 3CE9A 5DTMA 5B6PA 3M1AA 4BRSA 2LBPA 3UZUA 4HAVA 4U7JA 2QT0A 3HJGA 5JY6A 2LNDA 2ZI4A 4L7VA 2FN4A 4NWIA 1U7TA 1O6GA 1KP2A 1S3IA 4FFBA 2A3RA 3JVEA 4O02B 3RBZA 2HW8A 2ZYRA 2AC2A 1FRNA 1REQA 3OIDA 2DFKB 4PZ9A 2PLAA 4Q4CA 3WL6A 3VFDA 1TQ8A 4Z1OA 3PTAA 4M0FA 4TTAA 1Q6ZA 5FFNA 1P9LA 3EG9B 1EYZA 5A7FA 1GA4A 4GQAA 5DLDA 5TLSA 2NP7A 2CSXA 3N8GA 1WDWB 2EQAA 3C5WP 3AHFA 2PM8A 3INYA 1E1LA 5EIBC 3BWDD 4B9EA 5K0EA 1XDGA 2MYNA 1DFHA 2WD8A 4IIVA 5EQTA 2WJJA 4AZ0B 4DRXA 5DSTA 3VR3D 3VX3A 4REQA 2G28A 3ZDDA 1Q74A 4XPZA 2JEZA 2K5UA 4I55F 3ONWA 4KQMA 4OI0A 1J8QA 2AMVA 3USES 1F7VA 4FJ1A 2W6MA 2ZETA 3AJDA 4YRDA 1RWWA 1XCOA 2H1FA 2VZEA 4D5EA 3E0QA 2ZRDA 2ZBPA 5JC8A 2M6RA 1X6VA 2FW8A 2XUJA 1GRQA 3I2IA 5F7ZA 4LWZA 1YKFA 5B58C 3MQFA 4RABA 1FP6A 3Q9UA 1D2HA 1B0AA 1I9CA 2X1VA 4Q3LA 3MMSA 4DSUA 5LMCA 4ZT3A 2W6QA 1DX9A 2HRQA 3BE4A 1FPQA 1MIOB 3DB2A 1S01A 4NFLA 3TGWA 4KVAA 4RF2A 1ZIDA 2NZXA 5FBZA 3GR6A 4FHEA 2GH1A 3NNSA 1R7RA 2OD9A 2OKGA 4JK3A 3W3AA 3U4DA 1Z5ZA 3EEOA 1XG5A 4WCVA 4Z8XA 4URZR 1NDUA 4V2UA 1TF2A 1OLOA 4JGIA 3TZHA 4OXYA 2WFMA 4EI2A 5AYVA 3KVRA 2GI4A 4EPVA 3QKSA 2O0LA 4LRUA 3SYTA 4JBWA 3D6MA 5LXTF 1I33A 4LGCA 1WMDA 1C4OA 4ZAWA 2YBDA 4BVAA 4RTKA 2F62A 5BSGA 5TPWA 7MDHA 1AOXA 3P4XA 3RBXA 4RJ2A 4AKTA 4GPAA 3ZR4B 4FHCA 3HO8A 2BSQA 3J81k 3RYFB 3WGLA 2X6QA 1Z37A 3GFGA 4BIMA 2ZM6B 3NWOA 1RDFA 3ZWNA 2B7LA 2B4KA 4I9HA 4MVJG 5JO9A 1KMHB 4D3DA 4G1BA 2VJOA 1BIFA 5CEEA 4OKSA 1MU0A 2CMGA 1Z7EA 1CDDA 4BZPA 3C43A 4QBGB 1TW2A 1BD4A 1A1SA 1O94D 1R10A 1OXSC 1RP1A 2B94A 2FEPA 3Q6IA 1CY6A 5IVIA 4LSWA 3R8XA 3MCWA 5HKBA 2W0MA 3EA0A 3JVDA 1PX2A 4XWYA 2QTZA 2UZ0A 1KU6A 1QJ4A 3PWKA 3U81A 3Q2IA 2VHVA 4LMRA 1TNDA 4FKZA 1QU2A 1ZKDA 2WWIA 4KRYA 5H9VA 1VBNA 2GRJA 5GJBA 1BMFA 3KZXA 1V9SA 2GM9A 2P5TB 2R11A 1FYVA 3BZUA 3H2HA 3PQ3A 4ZO7A 1ZN8A 3NYQA 1OWNA 3BFPA 3ADCA 1K2VN 1NVMB 1YJ8A 2ECQA 1WJGA 5IM5A 1QIMA 4RSMA 5DK6A 1XMIA 4TQGA 5KTYA 4JGBA 1F8FA 4QG7A 1T8UA 2GYYA 1DEOA 4RA6B 2RIPA 5JS8A 2J3KA 3OOHA 2A7QA 2CXUA 4OMFG 4DABA 1J8VA 4UBLA 4ZDWA 3ZQ6A 2QJRA 4IJVA 1KYIA 3SHFA 4CF3A 4D96A 4NRDA 4K2AA 3QI2A 3MJHA 2ZYWX 3TBKA 1CZKA 2NU6A 5K0GA 1X1BA 2JI8A 2WU8A 3OZWA 1P0MA 3QIAA 4I4TF 1SC3A 4O2AF 4TKVB 1XDSA 1V8ZA 1IJBA 2EATA 3BBPA 3GV0A 1BJTA 4NQZA 3UB3A 1AGXA 5JD5A 1NXTA 5CX4A 2VJLA 3K6JA 1P5RA 1RRPA 3PUIA 1JTEA 1DBVO 2I1WA 2FA9A 3KOMA 1P4AA 3AIOA 5IK2A 1TYAE 1QZUA 3PFNA 1S9HA 1UAYA 3CJRA 2V7QA 4FGUA 4LRTB 4EF5A 2ZK7A 4DLBA 1IZ9A 5CNMA 3CX7A 3FNGA 3HR4A 1IN1A 3KVNA 1A9SA 4G07A 4HDRA 3MLEA 2GERA 4PG4A 4IQGA 1QH8A 1W9HA 2AS0A 2HD4A 2MR5A 1WQ4A 1V25A 2PBFA 3JVIA 4CM4B 3PGA1 5CB4A 3BWCA 4H15A 3ZCXA 1MABB 5LQSA 4MI9A 3P27A 5JPDA 3ANXA 1EFKA 2RSLA 1I1OA 2QTFA 3A9SA 2BH9A 4QOSA 5FULA 4R1LA 3NETA 5CDTA 1GKIA 3AHJA 3NBQA 1OLSB 2XSZD 2BR5A 1NLMA 2VJAA 2J6BA 2Y9MB 3CR8A 3OT4A 5AVRA 3A6DA 3V7YA 1TEXA 3ICOA 2D2IA 4FYJA 2B34A 1XV5A 1Z8FA 1FVHA 3SR3A 5K0JA 3I9MA 1HE3A 1MVOA 1WB5A 1L5MA 3ITNA 4LYAA 1NIJA 3VVCA 5C9ZA 3EMVA 2UV8A 4Y98A 4AKIA 1UDAA 4MP6A 3PVSA 3QFCA 2ZEJA 4M1YA 1E2FA 4U4AA 3SIPA 3ZX5A 5AVWA 4NYJQ 3HYCA 2JIOA 2P4HX 4ZQIA 4BQQA 3DFZA 2H3EA 2AKEA 2O5VA 4UQLA 1QCDA 1GNSA 4CI0B 1VCIA 2AQHA 1ONBA 1N2JA 3AFOA 1YA4A 4J4HA 1WW8A 1Z5NA 2DBRA 3SBXA 3SLRA 1RS0A 1EXVA 2A59A 1KEPA 5AKKA 1RYMA 3G82C 3A3OA 4L9AA 2O2XA 4KXNA 3Q5GA 2QE7D 4GOOD 4TV9B 4ZQFA 4EO9A 1DKNA 3DO6A 9MHTA 5JBIA 1IRIA 4KIWA 5GV7A 4QJ3A 1DEHA 4XQEA 1FUIA 2OXRA 1T1IA 3CH5A 4ZVQA 1YB1A 4FC7A 2AE1A 5AD1A 3PWSA 4ZCLA 1ZGJA 5I8WA 1NGSA 2PT9A 4JZKA 4P31A 2BCGY 1X42A 2DP4E 2EJBA 3LKBA 5BMOA 5LUAA 1G8SA 1VLQA 5HS4A 2W6PA 3UJ8A 4FHGA 5FRDA 5C18A 3B13B 3CF0A 4GU5A 4D42A 2NUPA 2PXCA 4JYBA 1PNRA 1MV5A 1JKMA 1UBSB 3MRVA 4FBGA 4RMJA 3SFVA 1KI3A 2Y1WA 3FFTA 3TLGA 4AJ4A 4XPIB 5FA6A 2QAGC 4NYMQ 1A7KA 1TJYA 4D45A 4NBWA 1YFLA 2WZDA 5ALYA 1O89A 2XQJA 1NKTA 4LMAA 4RHXA 3WLAA 4DMLA 5KNLA 3T5CA 4J49A 5IRCD 1PRYA 2QRPA 4OLHA 2WWYA 2BI8A 2X3FA 3HCFA 3PE4A 1ODFA 2YJ4A 2EW1A 3BSYA 2IY9A 5HKKA 2OZLA 3IBCA 1Q7CA 2HX1A 2OGWA 3UEOA 3E82A 5B4VA 3HVKA 4UBOA 2BI4A 4OD0A 1V5EA 5FA5A 3DBRB 4MV4A 1N2OA 3DL7A 1GZSA 1TQHA 2X86A 3RB8A 5J4LA 3PJDA 2B1JA 3WGOA 4L1KA 3KKEA 1T2VA 1OLUA 3N74A 3KJIA 3IP3A 3EXHC 1IN4A 1H66A 2OGSA 5IMBA 2DUNA 1QQBA 2RBEA 3GW8A 3H7IA 4ZXFA 4PQYA 3KYCA 3I34X 1MB3A 2Q41A 4PLZA 4X6XA 3KEQA 1MHPA 5A3VA 4DMFA 3B1YA 4D0RA 3EOBI 4IH4A 1FBNA 2CXQA 4HDSA 4N01A 1IVNA 3T34A 1USKA 4ZYUA 4MUMA 3EPHA 1ZICA 1F4PA 3TAUA 1JSCA 2F8SA 1P2TA 1YQWA 1Y5IA 5LQRA 5E3HA 3CEMA 4KXWA 3AU8A 1H6DA 3W9BA 3L07A 1NVBA 5HIKA 3B9RA 1ULAA 1RHKA 1Y5LA 4ZOQI 1ST2A 3EHDA 3E5MA 1CY7A 3FOAA 3H4MA 4FINA 4GR5A 4HDMA 2H9AA 5LL6P 1CQPA 2AQIA 2JZCA 1V7PC 4PRKA 3G9XA 3WYDA 4URHA 2J4FA 3UFBA 3A6KA 5HDBB 2FRDC 4KYVA 4YQZA 4DA7A 2XB9A 3GA7A 4TUYF 3F8WA 4MGIR 5LJLA 1ISGA 4ILEA 3QVLA 3L7KA 1SOWA 3Q3HA 1DVRA 2VSQA 3PNOA 3WGMA 1H2WA 4J7AA 3UV3A 4HC4A 5PGMA 2FDRA 1VIYA 5F5NA 1L1FA 4LJ8A 1DHTA 1NMEA 1MJGM 2CL6X 2HPAA 6PFKA 3ORYA 2GRAA 3CRZA 3E9NA 1P91A 4D9CA 5TS3A 3BMCA 5DDIP 4QBKA 3HKDA 5TMDA 1JIJA 4XGNA 1E2EA 1OI2A 1P7ZA 1L8AA 2PO7A 2Y68A 1X8JA 3GJSA 4EHKA 3LHDA 1JJVA 2CHGA 2LXNA 3I9LA 3IHWA 2C4WA 2GSWA 3IPRA 2X7HA 3PYLA 2ODAA 4PNPA 4D0SA 5LMNB 4AMBA 1RAHA 3ZD8A 3BD6A 5DN6D 1QK4A 5FYDA 1RIIA 2AOXA 2R7KA 1ECLA 4ARSA 1IQPA 1F0KA 1L5SA 1O96A 3PBKA 1H8HA 3D0QA 4IICA 1NA5A 4LVCA 1G8KA 1XJ0A 2CNDA 5KQGA 1TRKA 3IL2A 2OT3B 5KVAA 2GF9A 1KXJA 5DGXA 2HRBA 4UAVA 4CKCB 3W7VA 2ST1A 3Q7EA 1IJKA 2V9ZA 3OJEA 4LZOA 1WDKA 3MJSA 3RG8A 4UHHA 1UXIA 3SR4A 1CUAA 1QZTA 2JASA 1SKAA 2OV8A 1MAWA 1SUSA 1T9CA 3EIHA 4LTMA 4TROA 3TVTA 1J5PA 5CLIA 3W04A 4A2CA 3BEDA 4K8OA 2HU8A 4IH1A 1DQPA 3WGKA 1YUBA 1ZD1A 4F86A 5F2OA 5LZ7A 1CRLA 2ABWA 2R5WA 3K20A 4FGKA 5AW3A 4HWRA 1D1QA 1UM9A 5BRJA 1H05A 2O5EA 1IQ0A 3KKPA 2O8CB 2QI9F 1W1IA 3AXSA 1TAQA 5I7RA 2JAUA 1IJFA 1LF0A 4G5YA 5EMHA 2G0NA 4J94A 4GRIA 1Y34E 3TUIC 4EZIA 4AO8A 1Y6GA 1FP1D 3IEKA 4OPMA 1UKAA 4MDYA 3MGKA 5ICMA 3C7DB 4IHJB 1X7YA 2DVMA 3KZKA 5E6SA 1KYWA 1AQUA 3B6IA 5ECDA 1E59A 3LO5A 4RXMA 5KAMA 3PNBA 1U02A 4LDPA 4RVGA 3TNJA 2WKQA 4TV8A 1N2EA 2C2OA 1TUIA 2HH9A 2Z5LA 3VGJA 1YQQA 2FSVA 4WBNA 4XKJA 4RPCA 1G20A 2GEKA 2OBNA 1XZDA 2BL4A 3PNLA 2XF8A 3QBDA 3ZHUA 2G17A 3JAMA 2VPYA 1E4OA 4KQ6A 4LJAA 4RGBA 3ONEA 4GYWA 3OZDA 2FLWA 2VHJA 1CJVC 5B5SA 3AF1A 2MSEB 3C1AA 3G88A 3M9LA 1JKFA 2GEUA 5AUPB 1JDZA 4OEHA 1QFMA 3OF3A 5TGZA 3PRYA 2JLSA 2PQ6A 3DTTA 1PJSA 1GNPA 1W4BA 3DWFA 4I1SA 4JC0A 2XCTB 4G1EB 1O6CA 2J87A 4YJFB 5HTOA 1O77A 1RLJA 2CXHA 3TRDA 5GVRA 1UPFA 2CMFA 1XA0A 4OQXA 1P2UA 2I34A 3NBZC 5JJBA 5ITSA 2PL1A 2XWJI 2Y1XA 5JNTA 2CXOA 3QF4A 4W99A 4IBOA 3S2GA 3DNMA 2UUPA 3FBWA 4JEHA 3KLOA 3AHIA 4YYEA 3C6ZA 3QXXA 2ATXA 4FONA 4ZMSA 2JZOA 2XUGA 2HIHA 4R2MA 2PZFA 4CLHA 1ENPA 2A1TR 3H5WA 3BB3A 3NORA 4OXQA 2JIZA 1SFRA 4OK3A 3EIUA 5IH7A 3AESA 3FWPA 1W5TA 3IR5A 1URPA 2FOLA 4DA4A 4A6XA 3KFVA 4I4LA 4YQYA 2OYCA 3MGAA 3LK6A 2EU8A 3NNNA 2IYNA 3A4YA 1Z4NA 2E4ZA 1Y4SA 2FKNA 6Q21A 2ZANA 3UJ9A 2QTNA 4W5HA 4PVDA 3TD6A 5LYYA 2A8YA 4MVXA 1J06A 3K9BA 4ZDIA 2X6TA 4FMDF 5EIOA 1UXJA 3F67A 2V7VA 5IVDA 3F3SA 3P32A 4Q4AB 1NN0A 4HTFA 1GPBA 1ZU5A 3X1KA 5DJ5A 4LHVA 4C6TB 2VUHB 3EULA 3FUUA 4CLOA 2VYVD 3A0RB 3GEHA 2OGTA 2AN1A 3PKJA 3RJ9A 3T1OA 1QVRA 4A5SA 1D7AA 4KDFA 1GPLA 4JZYA 1KSGA 5JZMA 2V7GA 1ZK4A 2VQFB 4YRKA 1Y1QA 4FDTA 1JLHA 4B3FX 2UXCB 1W9MA 2OB1A 5EIBD 5TIIA 1PL8A 3D6FA 2IU0A 5LP6B 1ZXBA 1K66A 2MDTA 4X1IA 3SYLA 1Q6YA 3MRSA 2JLRA 4LOAA 3ZTWA 2GVZC 2EX0A 5JNUA 4F8EA 3M3PA 4E5MA 1XCPA 2FZLA 4ND6A 5EFZA 3L93A 5C51B 4E3WA 5BUCA 3HSKA 1ZXXA 3PDUA 1E18A 2QN3A 4M9UA 3SEZA 4RBNA 3LCUA 2PL3A 1NF3A 3CCFA 3OM9A 1GT6A 5BMVF 4MZXA 3FGNA 4WUVA 3SZUA 5IEJA 1OBOA 3RAPR 1SA0A 2O2HA 4LYEA 4CTNA 1XEFA 2Z6QA 4YGYA 2PKCA 3FRIA 2B3TA 3I01M 4JEUA 5ALHA 3I23A 4KVGA 2VRNA 1P8AA 1EFVB 2QJOA 4W6ZA 3IA2A 2Y6UA 1EE9A 3NDIA 2J9RA 4KQGA 3MCAA 3GG2A 3AQ4A 3KKQA 5TQ0A 1BCRB 4AZSA 2QUZA 3ZHRA 1BQ3A 4KP7A 2WYUA 4TXLA 3HJUA 4GKJB 1V6CA 2QRHA 3A1CA 1AG9A 1CV2A 2NV0A 3B1FA 1P9OA 3G2PA 3LH5A 4QQNA 1NTRA 5DBOA 5CFMA 3N7UA 1OWLA 5BR7A 1FJXA 2EFDB 4E14A 5IM4A 4JLAA 2BFAA 3IE2A 1I1NA 2VPWA 1O7JA 2HWYA 4LJ9A 3UAXA 3IUEA 2WKRA 3A9TA 4UEJA 1VL6A 5BP7A 3LVRE 3OQIB 5DKFA 4L0QA 4W8HA 4N7MA 4OFBA 4RZIA 5L4LA 1IBRA 1V2HE 2FN7A 3MWLA 4ZAFA 3AWIA 2YW2A 4XSGA 4LWPA 1E96A 3G3EA 5L4SA 3LLSA 2GNOA 1JI0A 5EXEA 4HNSA 3HCNA 1KARA 2UUBB 4EDFA 3ANYB 2WWTA 4S1WA 3II6X 4J43A 2VP0A 4HRVA 3KFXA 4KAXA 3OCJA 3UWKA 4AZ0A 4EWLA 2B98A 2IUEA 4F1WA 2BEKA 1W1WA 2IYAA 4ZKDA 5AOBA 1A4IA 4H16A 3E81A 1EU1A 3QE0A 5FIUA 3RF6A 2IE0A 3PGVA 4FOOA 3WB9A 2W71A 4FU0A 5J59A 3ZWVA 2FDXA 3AI3A 2G63A 4JSRA 4LOKA 5C4MA 1ZX1A 5FHQA 4U9UA 2AVNA 2BIFA 3JYNA 4E07A 4G41A 3WL7A 1O5TA 4TTJA 1XYGA 4OH1A 4LXGA 3QSYA 3WLJA 3MERA 4G1FA 4ESHA 3WOVA 4F7DA 5DX0A 1TO2E 3MWEB 5FBRB 5AVUA 1Z16A 5K0TA 4MHOA 1DAPA 3RANA 5JFOA 2VSYA 5D01A 1HDRA 4E2ZA 2PNJA 1OYWA 1PG5A 4ZT7A 1N8TA 4PCVA 4R16A 4ARAA 4EARA 2CNWD 1BDJA 3G0GA 4RGVA 1RTKA 4NEGA 3BH0A 4ENWA 1Q44A 3B52X 3D1VA 1JP7A 2JARA 1PQPA 3PCTA 4CVNA 5HVNA 5JANA 1NQAO 5DB4A 4KEAA 4LUCA 1Z0IA 5EMJA 3TX6A 5BWLA 3CV3A 5BNFA 5IXJA 1UPAA 3RTDA 2Q5LA 5DEOA 2QV0A 4DIUA 4UUOA 4JXXA 4PX3A 1L4HA 3B3JA 4L76A 4JIGA 4UATA 2ZUSA 5I5GA 3GJTA 5AVSA 5FFMA 3L01A 4OQFA 4WI1A 4B0OA 5C32A 1XPJA 5BQ5A 4U7PB 4DCOA 3SIXA 3GC6A 3O4IA 4HQKA 1I6MA 4S35A 2VP2A 3GLVA 5TMBA 1SWWA 3RYFA 4MQFB 4EL5A 4M8LA 3N3AC 1USUA 1SZDA 2R62A 1DQNA 1OF1A 3EGCA 3THRA 4E30A 3QXGA 1KMHA 4EMSA 3CLVA 3AF6A 2IDJA 3UF0A 1AM4D 3EC7A 4IY1A 3E70C 1KVRA 2G83A 4DYVA 1V35A 4GEGA 2NUTB 4QPNA 5KJEA 3WMRA 3KHUA 4B6EA 1C14A 2J6IA 4V03A 1G3UA 1LEHA 1ESEA 4ZGWA 4X61A 5JLJA 2YKGA 4K9SA 1NAHA 1AKVA 2FMFA 3VYWA 3B6MA 4MWCA 2JRLA 2ZJFA 3GT4A 4QQ8A 9LDTA 3O8RA 3FKSA 1O97C 5U1PA 4B80A 2DUMA 1QB8A 1LKZA 4XM1A 3QNMA 2QDXA 4XGQA 3ULKA 1IMOA 4EY5A 1TA0A 1U7DA 4JELA 4KPUA 4WESB 4NBKA 5AR1A 5J9FA 2CNBA 1YQUA 3KSUA 1Q7EA 2VDVE 3TOZA 1OX4B 4XVHA 2WWWA 3ETCA 2NZ8A 4YFYA 2ADMA 3JS5A 2C5EA 4ZU6X 1J2TA 4AQDA 4N5LA 2ZB2A 2HF7A 1Z15A 2HAEA 1BU5A 3AEYA 5HF9A 4JI7B 4M0EA 4PIPA 1Z2CA 3HLKA 3CWQA 4YUVA 2Z6AA 1K2WA 1CG6A 1FFWA 2EC5A 4I1YA 5CXUA 3TCNA 2QGZA 3LUAA 2WBLC 1YBVA 1EJBA 3F0TA 3KZOA 4JCOA 3RVQA 3VH2A 3VR6H 1CF9A 2W5UA 1GITA 2VWGA 3A9UA 3IT2A 4K0KB 1I0ZA 4WOKA 2PH7A 3RTCA 2H1IA 4EMBA 4KQWA 1K8ZB 3K0SA 2GCGA 1Q2XA 4X54A 4QNRA 3SE0A 2V03A 4AVYA 1ZY2A 4GL4A 1DP4A 1BMTA 1TVMA 1KZ6A 1YZGA 1ZVQA 2FU5C 2P6NA 4HFJA 1Q1NA 1SBYA 1Z0SA 2HK7A 3VKHA 2Q0HA 3JWGA 3DULA 3AZQA 4HATA 5BURA 1PSZA 2ZS9A 4AJ2A 4YP1A 4BGEA 2VSFA 3ZDYB 4FSXA 3IVRA 2H06A 1TAGA 1GQFA 1TFUA 1F14A 1IK6A 3PUKA 3V1KA 2QSJA 1B8OA 3A58B 4RJIA 3VV2A 4PIVA 1LPBB 3D0OA 3BS4A 4BNNA 4XVCA 4J0CA 2BZGA 3QA9A 1ZPDA 4ND2A 4ER3A 3IAHA 3MQ4A 1FLDA 2GUGA 4P33A 4EUSA 2PA3A 2GETA 3VOBA 3DAFA 2MTBA 3ENWA 1QK3A 4JJAA 4MNTA 2IHBA 3L4BA 4MYDA 1SN7A 4BO6A 1L4FA 2Q45A 3WSWA 4BFYA 2WINI 3AIKA 3FHCB 3QUQA 4UULA 5T4FA 1YZNA 2I0FA 3LUHA 5AJXA 5AT1A 4MUYA 1KS2A 1NRXA 1AZLA 3QLVA 2L0XA 4NNJA 2OMEA 8GPBA 4I1IA 3U5ZB 2ZIAA 2WSSD 2XUPA 1WNTA 4DY6A 1UKVY 2GPAA 3FTCA 5HTKA 5I7UA 3L49A 3RSOA 1DUSA 2VQ6A 3HBJA 5G1NA 3TZQA 3WGJA 3A2MA 1EWTA 3PC3A 3W3AH 1X1SA 4KE6A 2REXB 2PGOA 4V0SA 2FSVC 1WL8A 1KKLA 3RSQA 2J85A 4EX7A 1M1NB 1J8MF 1U7ZA 1GN8A 3NALA 4IQ8A 1DJMA 3W1EA 3KXDA 3IP9A 5KQRA 4JI6B 1B00A 3VISA 4RGQA 1XXHB 4H1VA 2QYSA 4I1RA 1IEWA 1EFPB 2BM0A 1U3DA 1WO8A 2Z9DA 2ZREA 4MMYB 2XMGA 1V8BA 1CZNA 4HPXB 1F8XA 4DLUA 4J0IA 5DTEA 2ZVPX 4FCTA 2QD3A 4NESA 4BJHB 4D3YA 4LWOA 4DR5B 4CZ2A 1Z35A 2Z6VA 2NOAA 5AI9A 5I3CA 1BN6A 2GPSA 4AROA 4BYMA 4O4LB 4WW0A 1AE1A 4UM5A 1HRKA 2Q6OA 4YPFA 1L4GA 4ZQGA 1IM2A 1PHPA 2WC1A 4IF6A 5IYZF 4IO0A 5SZKB 4QUEA 4AS3A 3K5HA 2I4NA 1PFKA 3T4EA 3UMJA 1ZMXA 1ZUNB 3KEFA 2FFJA 4DCTA 4DR1B 3I92A 4L8GA 1P1BA 2ZWAA 1YNOA 4RC9A 1MO6A 1O58A 1GPUA 5B3LA 2FMTA 4U9HS 3U4QB 3Q2OA 4X95A 5C52B 3WL5A 5ALXA 4W7SA 2CXTA 3WB1A 2G1JA 3B60A 4G56A 1LFDB 4URUR 2EQ5A 2X1MA 4LRWA 4B6RA 1PNTA 5AJHA 3H11A 1H6CA 3TKAA 4YAKA 1NJ5A 1WHSB 1HNZB 1XDDA 1BH2A 3HFSA 1FA9A 4UXHA 2P2GA 1ZIOA 3PNSA 1FQWA 3QXJA 2AMLA 4MQLA 4QFCA 4EUEA 5ADUS 3C5VA 2YUTA 3N0XA 1PBNA 4LA4A 5F2NA 5H83A 5JT1A 3QLTA 1NXPA 1E4EB 5AK4A 3WX0A 1V26A 1HG0A 1AUXA 3K0CC 3FOZA 1M75A 3AG5A 2KLBA 1PYGA 1YFZA 1H5NA 2DWQA 2ZT5A 3LYHA 2XUOA 2V7EA 3GDFA 3KVYA 4IDOA 3FZGA 3AZPA 2V6FA 5GWXA 3LUBA 1RQPA 3PE3A 1E9DA 1BDMA 5BQXA 3JQ7A 5HK9A 4GC9A 4D82A 4HGRA 4N8DA 1QMGA 4AMVA 2V4UA 4P4SA 4Y9UA 5T3YA 3EF3A 4J0KA 4B32A 4EGJA 1D2AA 5K3EA 5J4KA 2ZCJA 5ALLA 1YDHA 2TMKA 4ZVRA 3ZKAA 5G0VA 2QXUA 3B6ZA 3CISA 5A7GA 2G40A 2XCRB 1ECFA 3SVZA 3NWJA 3ZK8A 3REOA 1LRKA 1GDTA 3G1UA 1A2QA 3DAPA 3GVHA 5CA1B 3DKPA 2M32A 2PMCA 1UFQA 3P45A 3GGJA 3HU1A 4UBKA 1PVOA 2EJUA 2IYEA 3X1ZA 4O4HB 1IWBB 2GA8A 2Z0MA 5J2TB 3OT1A 3TR0A 2CC2A 1IEXA 3G7NA 4L5IA 4LBYA 4R3UC 1R4ZA 2RHJA 3AHCA 2ZDQA 4ID3A 1TMKA 3TJRA 1PWHA 4JENA 2ORWA 2PCJA 3NANA 5L95A 1SCBA 2FSFA 1KZ1A 2BEJA 1WSDA 2CDAA 4R8RA 1U2EA 3A3YA 3N59A 2H31A 3QEBZ 4OF4A 4KR2A 1SQGA 4PXSA 3GCWA 4DYHA 3EPKA 4YROA 1WDMA 4DLVA 4DJEC 1BH6A 3SSAA 1KF0A 5F3WB 3BUSA 4RK6A 4Q93A 3IHKA 3V80A 2IEBA 1JH8A 2RB5A 4JJZA 4YCJA 3ZU2A 5JI2E 3FR7A 4RDHA 3BK7A 3REQB 5C8YB 2J4CA 5I9MA 5FEMA 3HPQA 3B6KA 2P7HA 1G59A 2I6GA 3A6ZA 2FSSA 2X8JA 1CUXA 3DGFC 3UUWA 1TJ3A 3N39C 3DNPA 3T9DA 1GKKA 2BMDA 1P5ZB 3NT5A 3QFTA 3ZXIA 1DTWB 3PPXA 2C3PA 4JJKA 5BW4A 2ZRBA 3JX9A 1Z0AA 2WFLB 2DFTA 3IIEA 1P5FA 4YLEA 4YMVA 2WVAA 3GJZA 4H35A 2H4XA 3LQRA 3BB4A 4CT0A 2HI0A 1PJ4A 5LA6A 3CX8A 4RIEA 3HZOA 3NBYC 3CNOA 1LVGA 3AHDA 2ZRNA 3H2SA 1EQAA 4PZDA 4CIDA 2BFBB 2O06A 1PGQA 4MW4A 2Y0DA 2I62A 3OQVA 2YXDA 5I6DA 1UDRA 1DGQA 1QF6A 1BMFD 4MVWA 4BKUA 4J0GA 3B9QA 4ZOLB 2HHAA 1G7CA 2DFLA 4NPCA 1RSZA 1M72A 1YZHA 2DZDA 3NBAA 4ARVA 4BX0A 4BUCA 1U63A 3WAKA 2O8CA 4WOCA 3C3MA 1G8PA 1L9XA 1YBHA 2EGGA 2I67A 2CT8A 3RYCA 4NZOA 3GT3A 3IOCA 1A9OA 1K5PA 1UJCA 3U4IA 1MUUA 3DOHA 3QZUA 5AI6A 5K3CA 2X76A 3TF5A 1HDIA 3C87A 4C3VA 1VJ0A 3PR3A 3S7ZA 4EB0A 4BZZA 3HUDA 5L40A 2ZJ0A 4RAQA 1BWPA 4ZYTA 4XR4A 1SB9A 2C5GA 3DZJA 5G1PA 3ZQJA 2JHCA 1JR3A 3LC2O 2XX3A 4X7BA 5CM9C 5CCDA 1PZNA 1T4MA 2CE2X 4QARA 5HFNA 1AK1A 4I9GA 1M7GA 1NOKA 4KQ2A 4EPTA 5KYKA 1T8PA 1EFRA 1ZOIA 1WEKA 2PMFA 5L3RA 1VG0B 3UY4A 2DHQA 1SCAA 4OYLA 2ZJBA 3OA2A 5LZ4A 2V7QD 1M34E 1KI2A 3ZZMA 4EI9A 1ZR2A 4WLNA 1HDZA 1U6KA 3GFSA 4BLSA 1EEXB 2HA7A 5IBPA 2FEAA 4BYGA 4DNPA 2JGAA 2CLLB 4WZAB 5F78A 2GPNA 2VOJA 4CIXA 2UXBB 2R97A 4L85A 3KOYA 5BQPA 4C21A 4EKIA 4OQDA 2ZWMA 3F6YA 4BO2A 4L28A 2PVPA 3SQLA 2O0KA 1NW9B 3PDIB 5FNVA 3SF8A 5I7HA 4NVRA 1QV6A 4G5FA 4FW8A 4M2LA 5CP8A 2O0HA 5COQA 2O2IA 3HNOA 4PXAA 3GRFA 1KP9A 3VNSA 5LD2B 3CLSC 4IIJA 3NFYA 2E6KA 4UUMA 3HBNA 2HRDA 3Q8MA 3AUYA 4QTUB 3F5MA 1FS4A 3WZMA 3OLVA 2VFAA 4PWZA 3C3XA 4UUNA 2C83A 5BWBA 4ZI3A 3DEAA 2F48A 1JR2A 1NBOA 2ZUUA 3FCOA