3AIMA

R267e mutant of a hsl-like carboxylesterase from sulfolobus tokodaii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
283
structure length
283
Chain Sequence
b'ASVEEIRSLFKQFSSLTPREEVGKIEDITIPGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDSAGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTREHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVEFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVFYGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 303aa long hypothetical esterase
molecule tags Hydrolase
source organism Sulfolobus tokodaii
publication title Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobustokodaii
pubmed doi rcsb
total genus 95
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2010-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aimA00
3KWFA 4JH0A 1DTEA 3BIWA 1EDDA 5LZ4A 3FVTA 3SC2A 5LP1A 5J3JA 1VOTA 2X8BA 3C5WP 3I2GA 1EVEA 1NU6A 4FFVA 3I6ZA 2JGEA 5JALA 1R3DA 1QIMA 4BTVA 3C70A 4G9GA 4RE6A 4ZREA 3C6ZA 1JJFA 3ESCA 2FJ0A 2QS9A 4XJVA 4H18A 2VT7A 4DNOA 2XUDA 2PBLA 1LBTA 4DMFA 4MEBA 3W05A 2IX9A 1CUSA 1CUCA 3I28A 1N8SA 4BAGA 4UFOA 4G4IA 1T4MA 2XUOA 4BRZA 3DYVA 1CFJA 4Y2PA 4FBLA 4AMZA 4EY8A 4PW0A 5E2IA 3OG9A 3WQHA 5T4BA 3I2FA 5ALKA 2C58A 2J4FA 4X3CA 4UFNA 1HPLA 3F96A 1WHTA 1XRNA 1LPSA 2D0DA 5T4EA 4X7BA 2Z8XA 2BCEA 2WFLA 1QIHA 2B61A 4NS4A 2XUJA 1J1IA 3FCXA 1JU4A 5ALWA 1QIEA 4RE5A 2OPHA 4YASA 1X2EA 5EGNA 4AQDA 3WK7A 4D9JA 1MTZA 3EBLA 2V97A 1UXOA 1O6GA 4X85A 1TK3A 5A62A 3VJMA 3LCRA 3HABA 1SCQA 2W22A 2O2HA 4BCDA 1AC5A 3FLBA 1JI3A 4ZGBA 5JADA 5K3FB 4UHHA 4P9NA 3BF7A 4X71A 2WUEA 4H0CA 5HKBA 1LPPA 3PICA 5DWDA 4UBOA 2XB6A 1I6WA 1K5PA 4KAFA 2Y1KA 2XUIA 4EBBA 2XUHA 3WKDA 4LXHA 1TCBA 2PVSA 4EUSA 5LLSA 1GKKA 4X6XA 1O6FA 1CQZA 1DX4A 2H7CA 3HI4A 1CUDA 1DU4A 3SX4A 2V98A 5AP9A 1QOZA 4H7HA 4K6KA 1MN6A 1GKLA 4DNQA 1XRRA 1WPRA 3DOIA 2OG1A 5HQ3A 2XI4A 5ALDA 2DR0A 1QONA 1HLGA 2QUAA 5T4FA 1K63A 2AJ8A 1EB9A 2CEKA 2HL6A 5D6OA 4UUQA 5AOAA 3G0CA 1LZLA 2H1IA 1UK7A 1IUNA 2DCMA 3ZPXA 4Q3LA 4DSZA 1EK1A 2WU4A 2HU5A 3WKBA 1ISPA 1VKHA 1A7UA 1U4NA 2VF2A 4B9EA 4EY6A 1E5TA 3R3WA 3O4HA 1H2XA 4Y2RA 5DNWA 1AMNA 3H1AA 2WILA 4PSCA 4DLNA 3MGAA 1SC9A 1CUEA 5HQ3B 2EEPA 3WZMA 4Y7DA 3D7RA 1P0PA 2OGTA 3AZOA 1AURA 3IB3A 2O2IA 3TRDA 2CZQA 4W9RA 1UK6A 4JNCA 4J3JA 2YXPX 3GFFA 4J7AA 1FJ2A 4FKBA 5AKEA 5DYTA 1MNQA 4INZA 1TIBA 1JJBA 3ZLUA 3VDXA 2HM7A 2WJ6A 1X2BA 4AZ0A 1WB5A 2PKYX 3QZUA 5BWCA 4AMYA 1UT6A 3G7NA 1BE0A 2HFJA 5AO9A 5EHXA 4GI1A 5FV4A 3F98A 1CUJA 5AM3A 3VVMA 2RHTA 3CXUA 3BL8A 4BE4A 4L9AA 2HA2A 4IH4A 2BFNA 1CVLA 1XZJA 5ALSA 4O08A 1GPNA 2OGZA 5ESRA 5JAPA 5YASA 1W76A 4IO0A 2VTVA 2ZJ7A 4A5SA 3RARA 3DDUA 4H7IA 4KRYA 3ZWQA 5EHQA 1XLUA 3DJYA 4Y2SA 3DL4A 2CJPA 3RM3A 4XX1A 4DMHA 5FUMA 2DQYA 2BUAA 2AJLI 2QUBA 3SK0A 3R3YA 1L7AA 2QM0A 1XLWA 1IUPA 3V1MA 1U8EA 1NX9A 5T4HA 1THTA 5AM0A 1ZI9A 3VKFA 1F6WA 4AB1A 5CH8A 3P2MA 5ALEA 4B0PA 3FYTA 5BWBA 2GYVA 1USWA 2WKWA 1VE7A 4OPMA 2QR5A 4Q1VA 5ALYA 4EY5A 3I2KA 1EK2A 4B7ZA 2AJBA 4QZVA 3G9UA 5I7UA 1MPXA 4G9EA 2YYSA 1A88A 4UHFA 1H2ZA 3OM8A 3K6KA 2BAGA 3NWOA 1CUWA 3I1IA 2XUFA 2CBGA 3QMMA 6YASA 1W4LA 5DNVA 5KWIA 3A6ZA 2V96A 4E14A 1QLWA 3V9AA 4FNMA 3QM1A 3STXA 3QBJA 4QEKA 4MJ3A 2VATA 1JKMA 5DYYA 4NMWA 1YASA 5LKRA 2OAGA 2WUFA 1AUOA 4OD0A 1CUUA 1ZGBA 1N5MA 3FNBA 5KREA 2WJ3A 3LP5A 4L72A 1YAJA 1QTIA 4QLOA 3G8YA 2ACKA 1XFDA 3AILA 4X00A 3FBWA 2XT0A 3H2HA 3BJMA 3E3AA 1QIGA 2XQJA 2JGIA 3IBTA 4BB0A 1R1DA 5I9IA 4BAUA 1R9NA 3B12A 1ZGCA 5JZBA 3H04A 2Z8ZA 1RWQA 5JIBA 2WTNA 4BTLA 4AO8A 2VSQA 5CTAA 2XQKA 2PSJA 3T52A 1UOQA 3QPCA 3E0XA 1SFRA 2RONA 4ZV7A 5AI5A 4UPDA 2XDWA 1G66A 3NUZA 4LIPD 1IMJA 3HEAA 1Q83A 1UFOA 2PUHA 2XUGA 4H7EA 3VVLA 5AICA 2XQFA 3VISA 3CCCA 1BEEA 4MEAA 4BAZA 3B3QA 4NZZA 5AKZA 2AJCA 2WTMA 5H3HA 4B80A 5HF9A 4OU5A 5CT6A 1CQWA 2PM8A 3B5EA 5FRDA 3HYSA 3HACA 5ALZA 3BIXA 3ESBA 3FVRA 2H7YA 2QXTA 4Y2VA 2HA0A 4CG3A 5A2GA 2VJDA 3L1HA 2YASA 2B4KA 4Y9SA 5IKXA 1XZMA 4J0GA 4U2CA 3FWHA 1JMYA 5AM2A 1XZEA 2ZJ6A 1XZKA 2O7VA 3STTA 5CBKA 3STVA 1BU8A 4Q82A 5CRIA 2Y6UA 3AINA 4EY7A 5DNUA 5HF8A 4X92A 3G0BA 2Y6VA 4ZWNA 1CUAA 3RLIA 1XRMA 2BUCA 4JUIA 1EB8A 4QE3A 1MAAA 2HDWA 5AKHA 2XMGA 1SCKA 1WCYA 3K2IA 5LZ8A 5IVIA 4W1QA 4B6GA 3WZLA 2PU7A 4FFWA 2DHCA 3WLAA 2H7XA 1PFQA 2G4LA 1MT3A 4F21A 1BCSA 5JD4A 3DS8A 3C5VA 4V2IA 3DCNA 4HAIA 4DMKA 4MYSA 5AI0A 1RP1A 3WL7A 3PUHA 2OLEA 5ISMA 3PFBA 2VJBA 2JGLA 5JATA 3WWDA 3C6XA 3K9BA 4XIIA 5EIEA 5C81A 4WFKA 1CUBA 4C87A 1GGVA 4MQMA 4QWWA 1J06A 1EX9A 2HA6A 3M83A 1DWQA 1Q0RA 4DYHA 4CG1A 2XLCA 4C6HA 3UMJA 3D2CA 3DOHA 4UBLA 2OQVA 3CCBA 3WWEA 1HBJA 4Y2TA 2HU7A 1ZICA 2PX6A 4X94A 2AXEA 3FYUA 5FXMA 5C8VA 4U2DA 2GBIA 2O7RA 4M0EA 4UBJA 4BVLA 5E4JA 1ZI6A 1TCCA 2CKMA 2PSFA 2XQGA 5K3CA 4ZV9A 3BXPA 1UOOA 2B20A 1C7JA 1CUIA 3VXKA 4WY8A 4BATA 3IUMA 3WJ1A 1C7IA 3FCYA 3H18A 2ES4A 2WU3A 4BP9A 4QDXA 1VLQA 2Y2UA 1BRTA 4BCCA 1CUFA 2WQZA 2ROQA 1TKRA 3R0VA 2GYUA 1QGED 1DWOA 3JWEA 1XZDA 3C6YA 1YSCA 5AJHA 5D3KA 5ALNA 4L0CA 1XQYA 5CT5A 2XLBA 1F0NA 2BGNA 2BKLA 1YA4A 5AM5A 5I8PA 1LPBB 1MJ5A 2C4HA 4J0DA 4PV7A 3HJUA 1XRLA 3H19A 4IH1A 2HA3A 2PUJA 4G5XA 2WJ4A 2JGMA 4N8SA 5AI8A 5HF5A 4C4YA 4JYPA 2WUGA 3OOSA 1IZ7A 1CUGA 5EFZA 4MXDA 3BE8A 5AKGA 1BROA 3R3VA 3G9TA 3G9XA 3D2BA 2RGUA 5KBYA 4CG2A 4PSUA 1E66A 1Q0ZA 2UZ0A 4FMPA 2QMQA 4DMCA 1LBSA 4N8EA 2WIFA 4DIUA 1XZAA 4BYMA 1ODTC 4KE8A 1LPNA 1YAHA 4HRXA 2QZPA 4K5QA 1OCEA 2G5PA 1Q84A 3BJRA 1YA8A 3I2IA 4FBMA 2OQIA 2ZYHA 3C45A 4H7FA 3G02A 4UBMA 3WMRA 4KRXA 2PL5A 4U2FA 4X97A 4K2AA 3Q8WA 5AK6A 3M81A 1WB4A 1R88A 2VT6A 3HSSA 4PO3X 4BC1A 4AN1A 1XQVA 4QDZA 1A8UA 1HKHA 4FHZA 4L3WA 4H7KA 4KAJA 1R50A 5F4ZA 4IHAA 3AZQA 3DD5A 4B82A 4A23A 2ORYA 2Q0XA 1ETHA 3GA7A 1QIIA 1LLFA 3H1BA 5AOCA 5A7FA 2OGSA 5AM1A 3RK4A 3H0CA 2IITA 5A71A 4X91A 1LNSA 2GBGA 2ONCA 3E1GA 4AX4A 3ANTA 4Q05A 4U2BA 2OCKA 4DNPA 5JZ9A 4Q3KA 2DSNA 1X70A 3D5EA 2WFLB 1QO7A 3EQ8A 3LIIA 5ALMA 5A7HA 5JYCA 2X76A 5IVKA 3AJAA 4E15A 2WFMA 4TVKA 2ZJFA 5IVDA 5ALVA 3U0VA 2WIJA 5FPQA 1QFMA 1AGYA 1CUXA 4QA9A 3HLKA 2CB9A 1N5RA 4OSEA 1P0IA 1ZD2P 3UUFA 1EA5A 2VAVA 3WIOA 5DLPA 1YB6A 1QZ3A 1E3QA 3V1NA 1XZBA 3PE6A 2JBWA 2XUPA 4E11A 5AI9A 2PU5A 4OB6A 3L1IA 4LXIA 4OCZA 4N8DA 4J0HA 4C4XA 2IIVA 5FDFA 3PFCA 1SCIA 3WL5A 3V48A 1ZD3A 5JASA 1E8DA 5JARA 1EDEA 1C4XA 5BOVA 4UHCA 2K2QB 5AK4A 2C5GA 5C8XA 3HRHA 1EXWA 3IUQA 2C5FA 4BBZA 4Y2YA 1U65A 2WHQA 5SYNA 5K3DA 1GPLA 3IUJA 4G4JA 1CV2A 4GDMA 4S0XA 5ALGA 1ZIXA 1CR6A 3DNMA 2RHWA 1JFRA 1P0QA 4FTWA 3FYUB 2HA4A 3W2TA 1LPMA 1YB7A 4BP8A 3WYDA 1H2YA 3PDCA 3OPMA 1U2EA 2G63A 2HA5A 3IURA 1CEXA 5CURA 3F8SA 5CMLA 1PJAA 2I3ZA 1M33A 1F8UA 1R4ZA 3MUNA 2EDAA 4PSDA 3H17A 5ALUA 1CUZA 2FX5A 4DSAA 5K3BA 2I78A 2WIGA 4W1SA 1MAHA 3EF3A 5JAUA 2HU8A 3G0GA 1ZD5A 1KEZA 5JD6A 3EQ7A 4HZGA 1K6EA 3RKSA 4GLBA 3SWWA 1KU0A 3O9MA 4QNNA 1EI9A 3I6MA 4KR0A 5ALQA 2QJRA 4J0JA 4W1PA 5HKAA 4KACA 2B9VA 1GZ7A 3A2NA 1XZFA 2C0QA 3E4DA 1ZD4A 2WG0A 4GECA 1FFBA 2XE4A 1EINA 5AIAA 1MX5A 1WOMA 4JYMA 4UBNA 3ESAA 1CRLA 5EIAA 3QMVA 3TJMA 2WHRA 3A2MA 1QIDA 3DLTA 1TCAA 3W04A 5DJ5A 4Q34A 3IVMA 3QPDA 3QITA 4UBKA 2V9ZA 4BE9A 7YASA 1LPOA 4GHWA 3QVMA 2XMRA 5D3ZA 1XQXA 3WKCA 2PSEA 3WK6A 3TGLA 1AKNA 4E46A 3LIPA 3R3ZA 3QH4A 3QPAA 3FLAA 1UKBA 2BUBA 3DKRA 4XWGA 5AK5A 3AZPA 3HC7A 4AN0A 4J0CA 4B84A 4QDUA 3KDAA 4C4ZA 3WI7A 1QTRA 4J0IA 3AUKA 1DQYA 5FLKA 1ZI8A 4ITVA 2R8BA 3FLEA 4CI9A 4HXGA 1DT5A 2WLSA 3WK4A 3MVEA 3C6BA 4B83A 4PNZA 4TPKA 5CT9A 1TRHA 2VJCA 1AQLA 4M0MA 5BV7A 4KYVA 5E4YA 5K5EA 5LYYA 4HS9A 1MU0A 1MX9A 1LPAB 1NU8A 2WG2A 4F60A 1SOMA 2J4CA 2NW6A 4KEAA 3FYUC 4Q3OA 1GXSA 3Q0TA 3STYA 3OC0A 5ALRA 1XZCA 1DT3A 4KJXA 1ZJ5A 4A16A 3I6YA 5LZ5A 5ALIA 5IH7A 2HA7A 3QMWA 3WWPA 5ALOA 4BVKA 1L7QA 4LKOA 1E8MA 5CW2A 3BF8A 3KWJA 5EIHA 3O4JA 4WFJA 4FNGA 4UBIA 4H7DA 3C87A 3ZLTA 2VJAA 2OCGA 4H35A 4HXEB 1RYYA 4AO7A 4CCWA 2XUKA 2RIPA 2QT9A 2HRQA 3H2GA 5KWJA 3V1LA 1JT2A 5C7YA 1D07A 1UKAA 3JW8A 1ORVA 3FAKA 4G8CA 1XZIA 2XMSA 2CMFA 3VJKA 3ICVA 3ED1A 4P92A 2R11A 2QKYA 1W6RA 4FLFA 1UOPA 1CIJA 5ALJA 4N5IX 3WK9A 2I03A 3GROA 3M82A 1BCRA 3TEJA 3O4GA 2ZYIA 4LHEA 4Y2UA 2GBCA 4CCYA 5DTJA 3PF8A 4TGLA 4X90A 4ARAA 3O0DA 3WK8A 4RGYA 1W1IA 5LIPA 4OB8A 3W9BA 1HDEA 4MWTA 1N1MA 1P0MA 3S8YA 3WKAA 5CH5A 2Y2VA 1ZOIA 2VA9A 2PPLA 3DQZA 3H2JA 4P93A 4DNFA 4BCBA 2XMQA 4BDTA 3WA6A 1CUHA 5AKLA 3GELA 2RAUA 3YASA 1UWCA 2OCLA 5FKJA 4BRSA 3ICWA 4EY4A 4AO6A 2DFPA 4NVRA 1HQDA 3G9ZA 4BC0A 2Z3WA 2PSDA 4W63A 2OAEA 1UKCA 1GPKA 1ZJ4A 3JYHA 4KAAA 4CIBA 5LZ7A 3WWOA 4EB0A 4BZZA 1CUVA 1ORWA 4KE7A 3R3XA 1FSSA 5HCUA 3BDVA 3O9VA 4X6YA 4OYYA 3PUIA 3LLCA 4C89A 1BN7A 4J03A 2OCIA 3C8HA 1AZWA 5ALPA 3OTQA 5AKJA 2QOEA 4Y2QA 3WA7A 1B6GA 3GBSA 2ECFA 3WJ2A 5CXUA 1L7RA 5HK9A 1CPYA 4GBGA 4ZRDA 4M0FA 1IUOA 1XRQA 1G5FA 1H2WA 5CXXA 5K3FA 1XZGA 1JMKC 4BVJA 3M3DA 2EDCA 3NOXA 4CCYB 3AFIA 1G42A 5EHNA 3AIMA 4H7JA 1BN6A 1IZ8A 4X95A 5AKYA 3EQ9A 2DHDA 3ANSA 4PF1A 1K8QA 1HL7A 2QJWA 2ZSHA 3STUA 4KE9A 4WCVA 1MNAA 4HVTA 1QE3A 4LYDA 1VA5A 3FSGA 5ALXA 3X3HA 1QIKA 3VJLA 1CUYA 2VQ6A 1WPXA 4K6GA 3WIBA 4MQLA 4GWLA 5JAOA 1QFSA 2GBFA 4F5ZA 4ARBA 3ZV7A 2JGJA 3FOBA 1OILA 2HFKA 1J2EA 5AK3A 1EH5A 3GZJA 4QDTA 1XROA 2ZSIA 1GT6A 5K3EA 3QYJA 5AKKA 3ZI7A 5HK8A 5CT8A 3R3UA 1ACJA 2BJHA 4ZI5A 3DKKA 3BWXA 3L1JA 4G8DA 4AXBA 1ODSA 4EHBA 2WIDA 2WHPB 3LS2A 3ZLVA 1FFEA 3R40A 4YX9A 2P8SA 2X5XA 3KOOA 4RNCA 2JF0A 5JANA 3KD2A 2ACEA 4XVCA 3EIOA 4B0OA 1EVQA 3N2ZB 2VEOA 3D3NA 1VZ3A 1IVYA 4WDQA 3WL6A 4AZ3A 3D0KA 1TQHA 3I2HA 1YCDA 3STWA 1YR2A 3PF9A 1Y37A 4FLMA 1TAHA 2J3DA 1YS1X 2FUKA 5CT4A 5AOBA 3A70A 3I2JA 2QRUA 3C8DA 4U2EA 4QLAA 4U2GA 1XRPA 3T4UA 5DTIA 4UFPA 4I3FA 4LYEA 4YPVA 5HZGA 2GZSA 5ALFA 2DHEA 5HFNA 4FDMA 4GW3A 3V1KA 2LIPA 1QIJA 1FFAA 3W06A 4OU4A 2WHPA 3HXKA 1MO2A 4UHDA 1BEZA 2C0PA 2J3QA 1VE6A 3WK5A 3GUUA 5LZ9A 3G0DA 1J07A 3G0IA 1UK9A 3WYNA 3CN9A 3O4IA 3CN7A 4LXGA 1XLVA 3H2IA 4RPCA 2JGFA 4WY5A 4FLEA 5A6VA 5AKIA 4EA6A 2DQZA 5FOQA 3PI6A 4GXNA 5ALTA 2HADA 4B85A 2BGRA 4I19A 1EHYA 1VXRA 4JEIA 3S2ZA 1JU3A 1E89A 4FOLA 2WFZA 2VAXA 3IUNA 3I1YA 2XUAA 3BDIA 5AHXA 4OB7A 2WIKA 2Z5GA 2ZYSA 3R41A 3F9CA 1DX6A 1MX1A 3IA2A 4HXFB 2ZYRA 5SYMA 2YH2A 3H2KA 2HRRA 4K6HA 1LZKA 1QO9A 4EZIA 1F0PA 2WSLA 1QIFA 4IQ4A 4KE6A 1DINA 2Z3ZA 4UHBA 2ZVDA 1GQRA 5ALHA 1BS9A 5D7BA 4B9AA 5AH0A 1XKTA 2WM2A 4W1RA 5AI6A 4B81A 3AIKA 1ACLA 1FFCA 1A8SA 3DEAA 4BDSA 2CUTA 2HHAA 3WWCA 2XMCA 3MUOA 4Y2JA 4G1FA 4OYLA 2AJDA 4WFIA 3WKEA 5HFAA 3KXPA 2RI6A 3DYIA 2E3JA 2WUDA 4PQEA 1G4HA 1XQWA 2C7BA 5IVHA 2I3DA 2G5TA 4DGQA 1FFDA 1CLEA 5HF6A 2XQIA 2QXUA 2GZRA 3ESDA 2H9YA 4QWMA 3D4LA 1K4YA 1ZIYA 4P08A 1AX9A 4YK7A 1PV1A 1S8OA 1VXOA 3F67A 4ROTA 2JEZA 5ALLA 5AM4A 1Z68A 2JEYA 2XMBA 3DL7A 4Y2XA 4HRYA 1DQZA 3F97A 1W75A 4X93A 4G8BA 1E8NA 5JZSA 1WB6A 4QDOA 3D2AA 1DWPA 4Z49A 3WL8A 4BZWA 4IH9A 3A2LA 2XMZA 5AKXA 3AIOA 1R9MA 3C43A 5EHZA 1JJIA 3HZOA 2PSHA 1VZ2A 3U1TA 5FPPA 4MWSA 2JIDA 1UK8A 1XKLA 3NGMA 4CFSA 1LGYA 1UZAA 1A8QA 1KU6A 4I4CA 1VA4A 1H22A 4DM7A 5EI5A 5E4TA 3IDAA 5AIBA 2FJPA 1YS2X 2XUQA 1H23A 5JD5A 2WG1A 4ETWA 1QJ4A 2QTBA 2HIHA 1B41A 3IIIA 3D59A 4WJLA 2O2GA 4J0KA 1XZHA 4F0JA 5DYWA 4FWBA 2D5LA 5FP0A 1EDBA 1GQSA 1VJ5A 4N5HX 5LZ2A 2JGKA 4C01A 3KSRA 2QVBA 1XZLA 4H77A 2OXEA 4CIAA 4ZXFA 2W6CX 4HTAA 4MYDA 2GYWA 4C88A 1WHSA 1OXMA 5CH3A 4OUKX 2XMDA 3W9UA 1W52X 1ODCA 1WM1A 3N0TA 4X6UA 4WDRA 1Y7HA 5JAHA 1THGA 3OURA 1T2NA 3O95A 4G4GA 5C8ZA 3ILSA 3FSGD 5A7GA 4DTCA 3IULA 4GEGA 3UUEA 5AI4A 5LKAA 4UHEA 5K3AA 1Y7IA
chains in the Genus database with same CATH superfamily
1L5SA 3TX2A 3MILA 1KYTA 2OCBA 4JH0A 4QUEA 5EMHA 1VJTA 3U62A 4IXDA 1V8OA 1KI1A 1PHPA 1DTEA 3PQ5A 2EJBA 2FU5C 4GNRA 1U9CA 3GA5A 4HGRA 4MW4A 1KSGA 3W6ZA 3I0MA 2QLJA 4OI0A 1RWMA 1G98A 2V7BA 5LZ4A 1JR6A 5BPHA 2DT8A 1EVYA 3K5PA 1DKRA 1X7YA 1WQ3A 2V6JA 3H6KA 1HE2A 3TSZA 4ZZ2A 3LQRA 1V8FA 4FZRA 1A5AB 2KQUA 3L8CA 1ZUHA 2GF2A 4Z3DA 5F12A 2DPHA 4BO0A 1X9HA 1GKUB 1Z5OA 1LEHA 4D92A 2XRZA 1SVIA 1UMCA 1Z74A 3WL3A 1XEAA 2XMPA 3KB1A 4HB2A 5BSKA 4HGOA 2X8BA 1MB9A 3I2GA 4L51A 3QW2A 3F2VA 4J9VA 1JLLB 3FW1A 3KV3O 4RUKA 3H4TA 4A9AA 5JALA 1S2IA 1YT5A 2JGAA 3TSWA 1AQYA 1QIMA 4OHPA 4G9GA 2OZEA 2VTKA 2OFXA 1SWWA 3IXLA 2BHTA 3WQSB 4BFTA 4ENPA 1XQ9A 3TJZA 1Y3IA 5TQ2A 4Y2HA 3PHBE 4TXMA 2P27A 2W2TA 2GCNA 2M6SA 4Z4GA 4CQJA 1MAWA 2VF7A 4CPDA 3E9MA 4A0QA 2I7VA 4B2YA 2K7FA 2C3PA 1P2FA 2QS9A 2XB4A 3RUPA 1LBQA 1P61B 3A4LA 3BRSA 5CGQB 2JZNA 3LQ4A 1S96A 1NLUA 2V7QA 3EXAA 4R9SA 3DG9A 4F46A 4NBWA 1H2EA 3FCEA 3ENQA 2EZUA 3THYB 4PCVA 3UTDA 4YY3B 2YV3A 4G81A 1OREA 3FPGA 2AVNA 4J0EA 4B3BA 1JDVA 2VPYA 3ABSB 4TZ6A 2PBLA 1PSZA 3C8MA 3JQGB 1VI5A 3NRBA 1ABBA 4Z4EA 2R62A 2Y4OA 3T3DA 4DMFA 4MWDA 3N8GA 1ZONA 3RS3A 2I33A 1FCJA 1WX1A 3V7FA 1CVIA 1G7CA 3KZNA 3RFUA 4BV9A 4XRGA 5FWNA 1IRIA 2ZJ4A 4G63A 1I3KA 1HG1A 2QNBA 3USZA 3NBQA 4FYIA 4DJ5X 1ZL0A 5I7HA 2NPOA 4WXMA 221PA 1PTJC 5J2UA 1W25A 2CGEA 3FNFA 3I28A 2K4MA 3K5HA 5E9QA 3N0RA 2UZ4A 2FUG1 4YJGB 4BAGA 4RIFA 1UDXA 4GPAA 4G4IA 4JLJA 5FUBA 2XHEA 4N47A 3WYCA 3EIQA 3S0JA 5CLHA 2AR7A 1SH7A 1U0JA 2IE8A 3AEQA 4WKOA 5EE5B 2V7VA 1U99A 3ROEA 3SSNA 1QRTA 1JB1A 1T8WA 1CFJA 4AW9A 4KR7A 1E5DA 4FBLA 2XB2A 3DMGA 2FUCA 2JI9A 2Q5EA 3IAFA 4HLQB 1OA1A 4F3NA 3QX8A 3H9BA 4RSHA 1D0IA 4HV4A 4YQYA 1H1LA 3WLKX 1KEVA 3TF5A 4CF4A 2VDQB 3EUEA 4CR6A 5AVVA 4IIJA 3RAGA 3OG9A 2A67A 1VCIA 2OM6A 3DEJA 4QIHA 1QHXA 4OM7A 4QASA 1JLHA 1QVVA 1RWKA 3PHJA 5AQ1A 3U44B 2FW9A 3TLCA 3ZOKA 1N8TA 4B46A 1K27A 2CMGA 4MK4A 5KTKA 1Z63A 3K0CC 1XQ6A 5DSTA 2VIIA 5A4KA 3F96A 3GBPA 4GPZA 2JLSA 4KN5A 1XDZA 2BKEA 2EF1A 1S2GA 2R4UA 3KEOA 3QMPA 4FDUA 3WDSA 3VYUB 4B44A 4YAJA 5CA1A 1WDMA 4JLVA 1FNSA 4X54A 2X14A 1X92A 5JSFA 2Z8XA 3PLAE 4G4SO 1IZ9A 5AXAA 4DE5A 5IULC 2FF5A 4FGJA 2HJHA 2B61A 4NSNA 2FHPA 2ZCUA 1ZDMA 1W4BA 4LC1A 1XA4A 2VDWA 3SP1A 3ZEAA 1JU4A 3T3EA 3W5BA 3WMFA 1OXSC 4RTNA 4URVR 3ENNA 2IOQA 3BE5A 5CJPA 4JI0B 3EWSA 4JP1A 4RK5A 1DO2A 3H3XA 3N2IA 3FR7A 2XKJE 2QTHA 4AQDA 3KNZA 1B6SA 1ZGHA 1N0IA 3UMGA 3KFVA 1YDWA 2O8VA 1NSYA 2JBAA 4B8YA 3CEPB 4DWWA 3EBLA 1A72A 1TUBA 3OZCA 1RYNA 1UXOA 1GUBA 3QI7A 5E4FA 3L7NA 2BEWB 4Y6PA 1GNTA 1CY8A 3A32A 5BUZA 3OZAA 2Y68A 3IEPA 2YNMD 5HS6A 1USVA 3HABA 1SCQA 4DTIA 1OXXK 1V8DA 4CODB 1GY8A 3ABOB 3RC9A 3DEHA 1W36D 2C98A 2JDIA 5GP1A 1AC5A 3P20A 1LW7A 3FLBA 1NFRA 3K73O 4M22A 5IEBA 4ZGBA 1ZSNA 4UHHA 1B15A 5KTSA 4KNYA 3BF7A 5DVZA 3KL4A 4Z1MD 1L9KA 3EPLA 1BWQA 2QROA 1IN5A 3C7TA 2HZ7A 5KYYB 3CZAA 1PZGA 1K5PA 2RKWA 5FJIA 5U4QA 2Y1KA 1F4VA 4KWHA 2XUIA 2M6KA 1NUPA 2OB1A 3QF4A 3D6MA 3ROKA 3CRNA 4CEHB 4MWBA 2PQMA 1MQ8B 3DF9A 3AI1A 3KTOA 1U0OC 2LGJA 2QM7A 3HCCA 1QC5A 4OQMA 3KQKA 4WA7A 4JEUA 1VSVA 2I2CA 4L5YA 2ONZA 2XXAA 3HXPA 4GI2A 1YCHA 2SNIE 3AXTA 3IERA 4OHXA 3RRMA 4R54A 3RS4A 3UM9A 2GZ3A 1HNNA 2JHPA 3UHOA 1P17A 3BAFA 4F9FA 3HEBA 3AL2A 4INPA 1WEKA 3IIMA 3WIEA 1US8A 1PR5A 4N18A 1HI9A 4RVHA 5LUAA 1K8YB 5LA6F 2V98A 1QOZA 1PNVA 4N4AA 2BGIA 1D1QA 5CM9C 2FWPA 4NZPA 2Q3MA 4TKUA 2P5SA 1JQJC 5EZYF 4MW0A 3ZU5A 1SKUA 4K6KA 3UMMA 5CCXA 5KVSA 1MN6A 1V45E 2PMDA 2JLWA 1F4LA 1OLSB 1O5OA 3BILA 3TOSA 2YWGA 1CF4A 4DNQA 4L73A 2D7JA 3U9SA 3PNPA 5EE0A 1UEIA 4YJ3F 2OG1A 3C6QA 3LKVA 4PZYA 5TMDA 4K46A 3A9SA 3U4CA 3FBGA 4FEYA 3PYXA 2BTEA 2GD0A 4IINA 3HJAA 2QUAA 3B60A 5T4FA 1NOKA 3EZ9A 1R0YA 2KLHA 4IIUA 4J1QA 3AB7A 4K87A 5FI3A 3WLIA 5TQ2B 3DXYA 4DYVA 4KI7A 4ZALA 4ESOA 2BRUA 1HLFA 1FBNA 5D6OA 2XWBF 3G0CA 4UM5A 5AOAA 3QEMA 3IJEB 4UM9D 4Y1RB 1RM4A 3S3TA 1UK7A 4AQ7A 3AFGA 1IUNA 3IDOA 2QNRA 2RCYA 4N7MA 2A5JA 3JR7A 4Y98A 1DSSG 5THKA 3KJNA 2RI0A 3OQ1A 1PJ8A 3F5QA 2B7BA 2HU5A 4R2HA 3WBBA 3VOAA 1QFYA 1CNEA 1UXKA 2J9ZB 1EE9A 1G16A 3OZDA 2CL6X 2X4DA 3CMMA 3LPMA 2A92A 2GHRA 4Q21A 5A06A 2O05A 4A2PA 3DTVD 2QVZX 5L3QA 4N0DA 3K1TA 1IM2A 2B8EA 2KMLA 1M2NA 3AOEC 3LBYA 3N6VA 4UKDA 5BYAA 1U4NA 1V9SA 4NZYA 5HIJA 1KTIA 1QMGA 2D00A 3EDCA 4ZEXA 1H9AA 4CMCA 4JDPA 2GPAA 1FQJA 1K5GA 1B14A 1DZ3A 1KC3A 1O8BA 3GRUA 2VI5A 1ISMA 4DL9A 2QRLA 1M7BA 4WUVA 5BO5A 5C35A 2ZIZA 2PBRA 1I0IA 1QH9A 3N8KA 4ENVA 4J43A 4LAFA 1L8OA 3A11A 5I9LA 4ZQEA 2Q1TA 5J4LA 1MIOA 1FJXA 4RELA 3WGOA 2WILA 3T1OA 4PSCA 5K99A 4M9UA 1D6JA 1SC9A 3HYCA 1QO0A 4TMFA 5D5PA 4B43A 4J1SA 4B3GA 1JG3A 3UVEA 1U3WA 3WZMA 4C1BA 4Y7DA 3D7RA 3UPTA 2MSLA 5FHQA 5J2TF 3LUFA 1IAVA 1LCIA 3EFOB 3VKGA 1JAXA 1J0DA 1UJBA 4KX5A 4CQLB 1ZAYA 1U0NA 3Q9LA 4HEJA 3EJWA 4ZOCA 4TYWA 2K87A 1QRDA 2I4TA 3CJQA 2GZHA 2P7IA 2Z08A 4DIKA 4EVSA 4P38A 2D5IA 4UD6A 1YDGA 1WW8A 4JNCA 5BR8B 3UMRA 2UXCB 2BEJA 3NU1A 1LW6E 5LBTA 1TQ6A 3W8FA 1ADCA 2H92A 3IQDB 4J7AA 4CIXA 1Q1GA 2HDNB 1Z45A 2RHJA 2IUEA 3PUXA 4UMDA 1H6BA 1S89A 2A59A 3S99A 1C9MA 2WHEA 2EZ9A 2CJXA 5HFJA 3VYRB 1TIBA 3VZDA 3R6WA 1ZN8A 3GNQA 3S40A 1KMCA 2FH5B 3D0RA 1JH9A 2NGRA 4KZKA 2O8CB 1J6UA 1E99A 5E1DA 3OT1B 5CVCA 1V6SA 1ZW6A 1TJYA 4XQGA 1H65A 1DEOA 3OECA 4HB3A 3X1MA 1RT9A 2HFJA 2OGWA 2WF9A 1COWD 2M32A 3C74A 2RDMA 2NXJA 2BFBB 4GI1A 1RKUA 1P9NA 1AO3A 2D1QA 2DBRA 4TT3D 2QGNA 1JLRA 1I7SB 3L43A 3R77A 1AZLA 2W2QA 4MS1B 5C3UA 5AM3A 1YUMA 4OHMA 1PFGA 2XOXA 2HA2A 4JJGA 2ZT6A 4IQ0A 4RNDB 4KITB 1WF3A 2IUFA 4W8OA 5CVUA 4DVGA 4HZUB 4FWTA 2AN3A 3C7DB 3DFKA 4MPJA 1GEEA 3EXIA 2KBEA 4MRSA 4MDFA 5F3WB 1TAUA 1BQ3A 3FOAA 2BFNA 2E18A 1P1JA 1IQPA 2HOQA 3M1YA 4RH0A 1PNRA 1XZJA 1XC7A 1JX6A 2EL7A 1X15A 1POXA 4TMTA 2RJOA 4O08A 5LWHA 3DEZA 5I48A 4PBSA 5ERXA 2DUNA 2LDBA 1NVVQ 16PKA 3B6MA 4JFRA 4RY2A 5YASA 1JWLA 4JGIA 2H06A 2WDZA 3LCMA 3DT6A 3ASUA 5K8JB 1PQ4A 5AW7A 1B73A 1HZZA 1N57A 3AHDA 1OXTA 2ERCA 2RHDA 4I8IA 3RARA 4A5SA 4H7IA 1FUYB 4AECA 2HREA 2JGDA 3A26A 5L53A 4RM3A 1XL1A 1NT2A 1QS0B 4MV7A 3GWZA 1XLUA 1EFRA 4N39A 3FI9A 3ZU3A 3D4OA 1OUMA 1MBZA 4O5OA 4AX8A 4W5NA 3PXUA 1JR3E 2WSMA 2IYLD 1CU1A 2ZROA 4DLRA 5AW3A 3ZWYA 1YV9A 2DQYA 2BUAA 2Q4OA 3IKMB 2HMYB 1O95A 4G0OA 4PIVA 4RQAA 4W9NC 1VCMA 3VR5D 5J5AA 1GNPA 1E62A 1K68A 4OA8A 2ZYTX 5LXTF 4LF7B 3R3YA 1VMKA 5T67A 1QX3A 1IDN1 4XYMA 1GOTA 1NBMD 4YIHA 1VIDA 3ZZUA 2IPNA 1CXZA 3ZWCA 2LXNA 4GR5A 4CU2A 3VC1A 1TEHA 1QU2A 4M87A 1QKJA 3NRCA 1J1ZA 1M34A 3NWJA 3VYSB 5FUWA 2FPOA 3HWX1 1YB4A 1AXGA 1GZSA 1J49A 2IPXA 3RVJA 1KQOA 1Q7GA 4XH9B 5C51B 1ONBA 1ZVQA 1MZVA 3IBSA 1GLVA 4E33A 3PEWA 2JEOA 5CXSA 3FFBA 3NBZC 4B2LA 1ZI9A 2YS6A 3LLSA 3NI2A 1Q0TA 2BISA 3RF7A 3A58B 3I3OA 1SVLA 4BKOA 3P2MA 1UJ4A 1BQ4A 2NMVA 5ICCA 1I4WA 4AC9A 1HRKA 2CKDA 5EY5B 4EL5A 3OEED 3GD5A 3HKBB 4H9GA 4HF7A 3R3JA 1IIBA 4PU0A 4YHBA 5BWBA 1C7FA 1HZZC 3BMXA 4PGFA 3MIIA 5DX8A 1RZ3A 1ZW1A 4QUJA 621PA 3F3SA 3P2OA 2DUJA 5D00A 2WKWA 3IMCA 2WAXA 4K9LA 1VE7A 1IHYA 4RSGA 3FOEC 4WRRA 1LNZA 2HKIA 4OHBA 5ALYA 4EY5A 4KXLA 5JNTA 5FOXA 2G0AA 4C9BA 3BVPA 4IMJB 3RC3A 1Z39A 3SHVA 1M2EA 1X94A 1AE1A 4Q4JA 5FUXA 1GTMA 2G9QA 3MTEA 4YQFA 4QFDA 1F8YA 1X7YB 4XLZA 1JJAA 4UCWA 4GYYA 5DT9A 3V8BA 2ODBA 1XMIA 1TK9A 4KQ6A 3MTBA 3JYPA 4Q9LA 2H1WA 4F6LA 2XKAA 1X0XA 2AMYA 3NWOA 4U6NA 2P41A 2DWCA 1L2TA 2NVOA 2VJMA 3I1IA 1VG9B 3QMMA 3F7OA 3LW7A 5FUVA 6YASA 2I9PA 5KI6A 1R6XA 3T7AA 4TUYF 4NBRA 5T6MA 3MT8A 3V5NA 3A6ZA 5KWIA 5CB4B 5JXJA 2FMKA 4ZZ0A 1X1RA 2V96A 5CEJA 2FB9A 1RQ2A 4QQKA 2DWPA 1QLWA 3Q2OA 3I3SR 2KWIA 1E2QA 3QBJA 4QEKA 2P2ZA 2ZOSA 3IQGX 3N2EA 1W88A 4Q18A 1F2VA 4H6WA 2I8CA 4KBYA 1A97A 2P35A 2I2XB 2FQYA 3D7MA 4UULA 5KHLB 1OIWA 1L1RA 3ZQKA 1HTWA 3ZR4B 5DYYA 4L8WB 1YASA 1PW5A 2PS9A 5LKRA 1KRXA 2PJDA 2ZJ1A 2WUFA 3BOSA 3E8MA 3DMYA 1Y9EA 4NMXB 1XEWY 3H7IA 4I55A 4YDSA 4ZT4A 1KPGA 1REQA 2HWUA 2H16A 1ZGBA 2IW1A 3ZBPA 3I76A 4KV7A 1N5MA 4H3VA 3VU1A 4D3SA 2BFFA 3EVNA 1LDEA 4F8EA 4S35A 2XVZA 1E2BA 3BUSA 2XXBA 3NALA 1JTFA 4BO7A 2WF6A 3PGVA 2MTBA 4FCWA 2W70A 3SHTA 1Z4MA 3OIUA 2I99A 3LY5A 5JEDA 2NYUA 9ABPA 2M9MA 1L5NA 4CN8A 1TMKA 1LJLA 2BHSA 1RIIA 4P82A 4S2EA 2J6BA 5LFAA 1CIPA 5CDUA 5I4KA 2ACKA 2P3QA 1XTTA 3FROA 1P6QA 1TU0A 2EG5A 5EUQB 2DUUA 1JIJA 3FBWA 3FZYA 5FBKA 4LFAB 2EL9A 3H2HA 4GI7A 3BJMA 3FHJA 1YI1A 4F8YA 4IVRA 4JSTA 2X58A 1QIGA 1TM7E 2G9UA 3KYCA 3WHPA 1QNFA 4RD3A 4MCAA 2C5EA 1L8AA 4Z86A 5DCYA 1M34E 5HJEA 1EFAA 5BQ3A 4GOLD 4AG3A 2F1RA 3B7GA 3LK7A 4UNPA 1MR3F 4BB0A 3LQFA 3J80A 3L4KA 5EQTA 5K05A 4EQ6A 1R9NA 1QM5A 1XGKA 2V7QD 3B12A 3QUAA 1S8NA 4FZ3A 2NPIA 4WCFC 4DT1B 3W2EA 3BQNB 4NIMA 4AJLA 3O47A 4I6JA 3GXOA 3T5PA 5GJBA 5D8DA 2UYYA 1N0VC 3H04A 3VDQA 3GLFB 4Z3OA 3CLUC 2FDXA 1OI4A 3K0BA 4ZOLF 3T3OA 1JR3A 5JDIC 1OLUA 2WTNA 3AUFA 3F9IA 2Z58A 3GLKA 4JR2A 4NHEA 5TXGA 1VMDA 5KPJA 3VJRA 1E9DA 2I7TA 4L50A 4R9RA 3MTQA 2XQVA 5CX4A 2P78A 3CM0A 3BB1A 3AF0A 2ZSJA 1T9KA 2XQKA 4PAWA 2ZZKA 2PSJA 3T9DA 3AM5A 3TECE 3QPCA 2R6DA 3E0XA 4K9PA 1AM4D 3PPIA 3DHYA 4WLNA 3MELA 1IWPB 3MW8A 4MVJH 1PLKA 1KQNA 1SFRA 5CA1B 4DV4B 2NVWA 3B6EA 2FPIA 1UWVA 4UPDA 5C1DA 1XXHE 1NT4A 2CMHA 5FPKA 1G66A 1V9CA 4BUJA 4P7KA 1WUTA 4EQ6B 5HG0A 4IIXA 1NTOA 1WMFA 1UFOA 1Y6RA 2XKKA 1OXVA 3ZY6A 2XUGA 2PKRA 2FEKA 4K9MA 1JE1A 3VYTB 1NLYA 1IRXA 3KC2A 4H7EA 1HE5A 3MB8A 2EJUA 1WAMA 2O0JA 4Q9JA 3L0DA 1G8PA 3RJ5A 5JHHB 3QXXA 2DVMA 3GLGB 3EZ2A 3DO6A 2XQFA 4FR2A 3ZQ4A 1CVRA 2DBZA 4D42A 2HV8A 2UYHA 4IFTA 4UDNA 4PLGA 3M4YA 2GZMA 1CLUA 3B3QA 3NXKA 4IUCS 4LHVA 4BMVA 2VTEA 4CTMA 1D7OA 4K9OA 2OVBA 1VLVA 4ZT3A 1MO5A 2WTMA 4KPYA 4ASUA 2HZBA 2JFPA 4QEZA 5FNVA 1CG6A 5CFQA 4EPRA 5BWMA 4GYWA 5CT6A 3FPEA 2D62A 1SZPA 2HYDA 3IQIX 1JZSA 4I1RA 4I36A 2VHYA 5CEFA 3HYSA 2WTXA 3LLUA 3HACA 1T1RA 1Z62A 2DBVO 2XNSA 4BQSA 5J2UB 1QF6A 1TYZA 3AB3A 3BIXA 3KCQA 5JAZA 1S6YA 3DA8A 4IHKA 4WZBA 3FVRA 2IYNA 3C3XA 1BOFA 3P1JA 1ZXBA 3RU7A 1WQ4A 3P9RA 4YBRA 4DLBA 1KH1A 4R69A 3BE4A 3FI0A 4DLTA 3OBBA 4C6TA 1KTVA 2HA0A 3CF6R 3BTUA 4JQOA 5DLEA 1JPVA 4D8XA 3HKDB 2SECE 1A9ZA 3Q3EA 3RFCA 1NQAO 4ZYZA 2HTEA 5IKXA 2RHLA 2W2LA 4KFUA 3OKAA 3NCHA 1T5DX 3ONVA 1PFKA 1CD5A 2O8EB 4U2CA 1CP3A 2O3JA 1PUIA 5KNDD 4D98A 4O4LF 1KJYA 2XIQA 2GAJA 3QE9Y 3G0HA 1H2AS 1TT7A 4QOSA 1YRLA 2ZJ6A 3ZU4A 2RH8A 1XZKA 2BP7B 3DGEC 3U6KA 5CBKA 3STVA 2ZSBA 3BT7A 1BU8A 2X3YA 4ZGGA 5CRIA 5IHPA 2DXIA 2LCIA 4P5EA 1IZZA 4BMSA 4MUIA 1IWOA 5HVNA 4FCTA 5CFRA 2Y6UA 3GN2A 1N6HA 5DBIA 3AINA 2CV1A 3RSGA 4EY7A 4MMXB 5DNUA 1NWCA 1EGVB 1WLYA 1WUIS 4LI0A 4WVFA 4ZOLB 1M6VB 5ES3A 2A78A 5HF8A 4A2CA 5C1IA 4B09A 5E6SB 1NE7A 2O57A 1VLJA 3DBRB 2PX4A 3O1LA 2BUCA 3L6UA 3LT0A 2BEUB 4JUIA 3P5BA 2HIGA 1V4BA 2HDWA 2XMGA 3QXHA 4E4TA 2GPSA 4X1KB 5LZ8A 1T9GR 4XVRA 3KTAA 4OQZA 5JFTA 2O6LA 3B9QA 5DNEA 1DRKA 3KDPA 2C4UA 5E3JA 3GPCA 2Q1UA 3IAXA 1WMBA 3GHYA 4KLNA 1D2AA 2I22A 2PX2A 4UCXA 5JBIA 4CKYA 2H7XA 1LC3A 4MVJG 5DX0A 4L0MA 4F21A 1BCSA 1NR1A 2R6JA 3O8QB 3DS8A 4CVNA 2UVDA 4Q00A 1LDBA 2RK6A 3A6HA 1J0CA 4QU9A 2OECA 3G2MA 3LMKA 3DCNA 4KFSA 4O2AB 3AJEA 1CYDA 4I46A 4JLMA 2EBHX 2B3TA 1HYBA 4DMKA 3AF3A 4E5PA 2J7PA 4RA6A 1ZIPA 4YRBA 2NZXA 1VCHA 3PC6A 5LM3A 1DCTA 2JG3A 3ZD6A 3ADPA 1N6PA 3ZWNA 4GMGA 2IJGX 4FSDA 4CYMA 3WL7A 3C1AA 5CFNA 3PITA 4ZO8A 3Q0IA 3WB2A 1Z5ZA 3PFBA 2QTZA 2VJBA 5JQGF 2O9JA 1Z4IA 2JK1A 4JA2A 4EABA 1SOUA 4U39A 3REQB 4HVLA 1BH6A 1SHJA 3FDFA 4UPEA 4NNOA 1YK0A 4PS1A 4ZP1A 1QJCA 1DQRA 3DL0A 3V2IA 1OASA 2EBUA 4YCAA 5C81A 2DYKA 2NO7A 3P0JA 4WFKA 1CUBA 4KX3A 1EM6A 1W5EA 3ABZA 4M8IA 1K7SN 1T3SA 3QF4B 1W581 5CR9A 3OSZA 1A0OA 4QWWA 4PSAA 2ZRCA 3GBVA 5IXSA 1MMFB 3E5HA 3SX0A 3O31A 1WW3A 2A0KA 5JVDA 2ZKLA 5EKXA 2ZTLA 1ISIA 4OHVA 5ABPA 2J0SA 4NV0A 4OBBA 4C1NA 1KYVA 2H4JA 3A1NA 3LSTA 4P5DA 4RBNA 1ECPA 4CUJA 1DWQA 4HY3A 4N41A 2IOFK 3THWB 2HSZA 2NU7A 5L4NA 1TDJA 2ATEA 4HCJA 2I1VB 3KEFA 1T5OA 3ND5A 4HAXA 1NXPA 4QBTA 5DI9A 2ZREA 5BMVA 2W2PA 1N0HA 3L4BA 4ZVLA 3I5YA 5IAKA 4WJKB 3C0KA 3KOUA 4PCAA 4XEHA 3RNOA 1EFTA 3SZ3A 1XPOA 5J4KA 1AF4A 2SCUB 4DA8A 4Y2TA 3OU6A 2C61A 2VZ0A 3NPAA 5EP3A 3RCBA 1R10A 1J5XA 2FN9A 1ZICA 1QWSA 2PX6A 2AC7A 3CX6A 2UUOA 4L3OA 1R4MA 4PX2A 4EGQA 3IIEA 1PJ4A 1JAZA 4G5YA 5BVGA 3DMRA 4WLEA 4BVLA 5K2OA 1ZI6A 5AJUA 1BE1A 1YCFA 4Q1EA 4EZEA 4GBJA 2BBWA 3DZIA 4MVCA 2B78A 2VQSA 3V8RA 1GR1A 5GIPE 3IJRA 4ARZA 5BOSB 3N2LA 4QBGB 1C7JA 1C0KA 1Z4KA 1CUIA 2MSKA 4JBHA 4ZANA 3RUEA 4EG8A 4BLUA 2R9VA 3LT4A 5ICFA 4BATA 4Q02A 5EIFA 5CJ2A 3OLVA 1UQTA 3GW8A 1VL6A 1UBSB 3IMFA 5E6SA 1FY2A 1YTUA 1KGSA 3G1WA 3WYBA 3GR6A 2OV2A 1VYVA 4FEEA 1SU8A 1Q95A 4GI3A 2IZ1A 3I72A 4IHJA 4AZSA 1FRNA 4ZK6A 5KQRA 1A71A 1XMQB 2BSQA 1Q1EA 1QRRA 1L7VC 3IDSA 3L06A 4I9UA 2C54A 1U7TA 4GM1A 4FYWA 3R8CA 3LQ2A 2Q4DA 4QDXA 4V0LA 4EUEA 2NXEA 3PFNA 3PKJA 2Q8QA 4Q12A 4A26A 2HJGA 5JZVA 2HSDA 2OBYA 4C4SA 5FLXA 3FJ1A 1DDIA 1JXMA 4L5IA 3GC6A 3LDFA 4Q7LA 1M0TA 3OICA 5JW6A 3CVVA 3IQXA 1WPQA 2QQEA 2R86A 4YACA 2G5CA 2A0WA 4PZDA 4UCQA 2CLFB 3R0VA 3F3KA 3DTNA 1W4AA 1DWOA 4LF5B 4RPHA 1Q16A 1SBTA 4PXSA 5I5GA 3RDPA 3GLTA 4ZN6A 3P9SA 2AMJA 4K7JA 2MSWA 1WABA 5TQ0B 2E82A 4JI4B 5D3KA 4R3NA 2WOOA 5ALNA 1TK2A 2XLBA 4FR0A 3PNLA 1F0NA 3NONA 5IJXA 2HX1A 3MCAA 2QJTA 3BFXA 2XHZA 3NO4A 2OXTA 1HFEL 1O5TA 1I7NA 1AXRA 2E49A 3EDYA 3JQ7A 4YMHA 5AUOB 2BKLA 2VP0A 4B6QA 1K1EA 4LVCA 3KPVA 5H1YA 1JPUA 3JY6A 3KFXA 3NBXX 3GIDA 4RTMA 2X40A 1H2BA 1ZMXA 2A9OA 2IRWA 2H1FA 2OFOA 2QP9X 3O92A 4GKBA 4MB2A 2JASA 2PGXA 1SVKA 2NT4A 4C76A 4EKIA 1RZRD 3TLAA 1M7HA 3QW4B 3IVXA 2V4MA 3P2EA 3PHIA 2FW0A 3EAGA 3H83A 4N8SA 5AI8A 4X1YB 2WP8J 4Q93A 2J87A 2WT4A 4YBZA 1HE1C 4WVLA 4CUKA 4QQ8A 3I0ZA 4XFKA 1XA3A 2A0UA 3SAJA 4UEQA 3DH0A 2WR8A 5JXIA 1BROA 2P3LA 3NBFA 5AW6A 1P2BA 1AUXA 1P4GA 3G8AA 3Q12A 3Q7SA 1N2JA 1T13A 3R3VA 2VP5A 3AC0A 4UVEA 3G2IA 1E2KA 3I8OA 4FCVA 1UFRA 4KHZA 1ENYA 2AA3A 3H11A 1E66A 3U4DA 4Q4HB 4BNGA 1IFXA 1Q0ZA 1XMXA 3R9IA 3TL6A 4FMPA 3EY9A 2HJWA 1ZMBA 3IPXA 5EPEA 2P9JA 4M4SA 4P3KA 4PGMA 4PPYA 5BQ5A 4DMCA 2CL5A 3GN1A 4OIMA 3ECAA 3UBTA 1ESCA 2Q6VA 3ZI4A 2ZVQX 1NF2A 2WUVA 2RGAA 1JSLA 1DEHA 2C4TA 4N9QA 4KE8A 4LE0A 4W7IA 1J23A 1I24A 1H2FA 2O8FB 4HRXA 1OCEA 1OZHA 3DB2A 3MFQA 1YA8A 4DSUA 4LF9B 1OC4A 3U7RA 3H8JA 4UBMA 3U3DA 2AZDA 3A3PA 3JAWB 2G9NA 3L02A 4EPWA 1GPMA 2YVAA 1UP7A 3CZ5A 3IP5A 4BU1A 3I05A 3IRVA 4K2AA 3URMA 2PUVA 4NOMA 5FTNA 2BR4A 4PO9A 3SU8A 1W34A 3C7AA 3M81A 1FFGA 1WB4A 3ZY3A 1NMQA 4JK3A 5ADVA 1U7OA 1RBZA 2JLAA 2NSHA 4PAMA 3N58A 1J22A 4X63A 4BQQA 5HIKA 4BC1A 4FX2A 3IV6A 4QDZA 2WZCA 1TGVA 2C3MA 2VH5R 4A8TA 3TI9A 3CTPA 1X1BA 4GBED 1HKHA 3KZVA 2ZAIA 2BFMA 4DCNA 4DV5B 4DR1B 1RWBA 2DGDA 2GSDA 3KTFA 5AVUA 3U4QB 1NQVA 2I66A 1OH8A 1JS1X 2H1HA 3QA3E 4NBNA 4HTFB 3ZNOA 2ORYA 1C1XA 1ZM7A 1CY1A 1W19A 2VOEA 4LQDA 4I8XA 5LYJF 4M9SA 2BMEA 3O94A 1QIIA 1SCJA 1YBVA 3GGSA 3NORA 3OX2A 1OY1A 4IOMA 5BN4B 1XZQA 5JJBA 2V4ZA 5A7FA 1HXHA 1NQ5A 3DQPA 3H0CA 4MUXA 2A84A 3PQ4A 4CXMA 1JQLB 3A4MA 2IEZA 4IEFB 4RIIA 3V4ZA 3E1GA 3LLVA 1GNVA 2H1RA 2B2NA 1RAAA 1U80A 2C7GA 4M8KA 4Q01A 2PTHA 5IZ4A 4H0FA 1TTTA 1EA7A 2Q07A 3SVTA 3RS5A 2XECA 1G9TA 4JEHA 3V6MA 1T91A 4XJTA 3EX7C 5LLTA 3FYDA 2JLZA 2BEVB 2HUPA 3CZRA 4E5KA 3ZCTA 4OGFA 1U3UA 5I3ZA 2XCRB 4AJ1A 4MJLA 4CMAA 4ZHQA 2D8AA 5CDTA 2J6IA 3FNRA 3SQXA 2HNAA 3HNOA 3MWDB 3K0FA 3EQ8A 3NJRA 3UNXA 2VJMB 5JYCA 2X76A 3CH4B 4LISA 3SF8A 3H65A 2WFMA 5HUHA 1OBFO 3RQIA 3UHJA 4D4KA 5GMOA 1DTWB 1E1RA 1WVMA 1XVVA 3B6JA 5FWXA 3U0VA 2WIJA 1A69A 1AGYA 4IHJB 5CD1A 3ZVNA 4QJIA 5DM60 4BMYA 4HAZA 3ER8A 4QA9A 4KO1S 1R12A 4RSMA 3AKEA 3U4AA 1F7VA 1KVSA 2YJ6A 5SZIA 2VK1A 4Z1OA 4HEQA 3RSQA 4KBGA 3B3AA 4A82A 3VR2A 3HLYA 1E77A 3NASA 4IIEA 4N48A 3MSXA 1Y8RB 2WP0A 1RABA 3H8SA 3G59A 4R2LA 5B30A 3GNSA 3L7MA 1EA5A 3ZZTA 1Y5LA 2ZJYA 3EMVA 5JYDA 2YJTD 2VAVA 2G6TA 4MIKA 4PFKA 3WIOA 5TT0A 9GPBA 1SM4A 1V47A 2JI7A 4FDLA 1YB6A 1E96A 3VR3A 2HO5A 5CAEB 2GA8A 3IFSA 1BD4A 3Q15C 5EQJB 2R3SA 3HJBA 1PR1A 4DM4A 1EUDB 2WE8A 3N5CA 4ZC1A 1F2TA 2XUPA 2XZDA 1TQ2A 4ND8B 4E11A 2IPOA 5AI9A 1F8GA 5A03A 4XUGB 1GSOA 4D4MA 2CDRA 3W6PA 1NP6A 3CUEF 4CKEA 2Q50A 4OCZA 1ZISA 4YONB 4DBLE 2Q3LA 4PO8A 4RK4A 4J0HA 4PBRA 1KI9A 2I6FA 2I2WA 2DOKA 3BFPA 2OO5C 1E92A 1ONPA 3Q7PA 3UN1A 1GGJA 1Y98A 3IQWA 2PR7A 3IEXA 4C4XA 1VSBA 3R8FA 1NX6A 5H3CA 3LC1O 1Q12A 3V48A 2ZAMA 5CDGA 2HCFA 3KQTA 5KCZA 1C9KA 1E8DA 1TYDE 2HJSA 2NVBA 2GN8A 4H3HB 4ARZB 2ZYDA 4LJ4A 1PLLA 2W6MA 4P4SB 3ELBA 5BOVA 4OHZA 1R0WA 2ZULA 2WWVD 5ICGA 2I87A 2GSWA 2K2QB 3OX1A 3EGVA 4KR9A 2C5GA 2X8JB 2YQZA 4D9CA 3PNSA 1MB3A 2Q21A 4HH1A 4ND4A 3JQAA 4EGAA 5KYYA 1HNZB 4NENB 1T8RA 3DPIA 4DIMA 3HGTA 1EXWA 3LYHA 4O4LB 4YXWD 1VBMA 2Z2ZA 2ZJAA 4CFZA 3G89A 4DW8A 2PA3A 2C5FA 4GMDA 2PUFA 4HPJB 3WLQA 3ZQ6A 3BXZA 1U65A 3LWNA 3B8EA 5SYNA 5K3DA 4HWPA 4L07A 4ZOAA 1ZLXA 1CZUA 3COVA 5B3JA 5AUPB 4TX1A 1BVYF 1SEPA 3SR0A 1NN3A 4BRWA 4DCJA 3PVSA 5G4KB 3UENA 2JANA 1ODIA 1OBCA 2WSSA 4JXJA 1OA0A 3GQBB 1SD1A 4L8VA 3PDIA 4QQFA 1ZC3A 1LBEA 3ZU2A 5DB4A 1P0QA 2VAWA 4L4XA 2RMKA 3FYUB 1DQNA 1YZUA 2RB4A 5JTTA 4RK7A 5JC1A 3EK2A 1LPMA 1YB7A 4BP8A 3T1YB 4JJ7A 3PDCA 4U0KA 4NULA 4DMLA 3OPMA 1U2EA 2XF2A 1DXOA 3WIVA 4ZYXA 4F12A 1E1QD 2FX3A 2HA5A 2DQSA 3W3ZB 3TQRA 3KK0A 3IURA 1W4CA 3EW7A 4CT0A 1Q2UA 5ELXA 4J16C 3ZNPA 4CDMA 5JJIA 2OCXA 1HE8B 1JHPA 3ODPA 3F8SA 2QLFA 2QLBA 1G8SA 5DF1A 4NFHA 3TR0A 3BAZA 4XLLA 3ASZA 1KZ1A 4QUBA 4A03A 4CLOB 3JPWA 4IJUA 3Q9UA 1MXFA 3KB6A 2ACVA 3CR7A 1GYPA 3OQPA 4PICA 4HMQA 2FLKA 1MG5A 2VHJA 3K9GA 1NVXQ 3KLBA 1KYYA 1O57A 2ISQA 2K6GA 2OHVA 3H17A 3PDIB 4IG4A 1CWUA 2QR2A 1N7GA 1UR5A 3Q0EA 1KEEB 3R7WB 2M1ZA 1Z17A 2QK4A 3KYJB 3L7JA 5K3BA 1AV6A 2UXDB 4E12A 1N2GA 4GXTA 5JAUA 4L2IA 2E1PA 4YO7A 4YJ2A 3G0GA 1OKKA 4ZT7A 1F1BA 1I1HA 1KEZA 1U7UA 2ZBQA 3E2PA 3LFHA 4R05A 2J3LA 3I42A 4XQEA 4HZGA 1K6EA 1RQGA 5REQA 4F9TA 2D74A 5JAIA 2GJ9A 2WTUA 4BXOA 2HF9A 2G0TA 1P9OA 1SC3A 4OFWA 3O9MA 4QNNA 5HTKA 2B8WA 5CVTA 5AVOA 2XVXA 1EI9A 3ET5A 1WULS 3OX4A 2BF4A 3I6MA 3P0FA 2ONJA 4A3SA 1FXUA 2WV9A 3HHEA 1M3SA 2HH9A 3N2GB 5ALQA 4XDZA 3PVZA 4KIFA 4J0JA 2CXPA 2XYRA 4ZAYA 4BV2A 1NVEA 4BWYA 3M2TA 1VI2A 4QRIA 5HKAA 3UO8B 2FG6C 1JSCA 3ONEA 3AV0B 3P0RA 2B94A 1KO5A 4KMSA 2FAXA 4ZO7A 1OJLA 4KQGA 4CI0B 1QCYA 4KPUB 5DM4A 4NEGA 2PZGA 3NYRA 1XZFA 1EJ6A 1VE5A 4JQZA 5INTA 5KYUA 3P9QA 1UBRS 2OSVA 1Y4AE 2H17A 3K94A 1NRWA 3PP8A 2C4KA 3IALA 3II6X 4KXNA 2NYRA 3ST7A 3AR7A 2AW5A 1LDNA 1MX5A 1OV4A 4JYMA 4KKXB 4ED9A 1KSFX 4HN4B 2HBYA 2P6RA 1V16A 3A9RA 3I9NA 5K0NA 1CRLA 2UU9B 5B2EA 4RJLA 1JIXA 5CUQA 3EVDA 4KQCA 1WE2A 4WNIA 3WAKA 4RKWA 2NNLD 1Q77A 1YB2A 5EIAA 5LB4A 4HBZA 3AYXB 3O7MA 1X1TA 4Q3BA 1UKZA 3ZC3A 1JF8A 1D2CA 2B34A 2P62A 1L1QA 3LGXA 1FB5A 1QWOA 4P83A 5H5JA 3QLUA 1QIDA 3UH1A 2JW5A 3FFWA 5HOEA 3ZGXA 5F1KA 1EGMB 3GFRA 1UMKA 5DJ5A 3CEJA 1KJZA 1CNFA 3TI7A 5CB4A 4XSGA 3EVGA 3KR1A 2JAQA 1NNSA 5D2CA 3C2QA 2C2MA 3DZCA 4WCDA 3ETEA 3URKA 2W6NA 1RKQA 2ZRNA 3ZX4A 1J25A 3KTAB 4WI1A 4YP0A 2VDNB 3NJ8A 5GV8A 2FI1A 1RLUA 5A3SA 4GLJA 3PCXA 3ZCQA 3ACDA 4GOOD 3R3HA 3AFMA 1ZXLA 1GRQA 1ZVKA 2C94A 2XMRA 2BDTA 3MOSA 4KQKA 4WZ6A 3VR4H 2PSEA 3SDZA 3L8FA 1II9A 1NMSA 4FYXA 4R1TA 5IXYA 3ICPA 3LIPA 4Q3DA 4DV6B 3BG5A 3IESA 1QOPB 3FLAA 2QT1A 3EMDA 3DKRA 3BICA 4HB4A 1T9BA 2WWXA 1I2DA 3KRTA 3NT2A 4XWGA 2P4HX 2GK4A 3T1HB 2QU8A 3RYTC 3OWXA 3SSOA 1Y3CE 2FPLA 5FBRB 3GJ3A 1XD2B 1CJSA 3MJ4A 3TQFA 3G49A 4B84A 4J0CA 5E0KB 3SEAA 4D1YA 5EXXA 4QDUA 2XNDA 3VTZA 3F73A 3KDAA 1Y8QA 1NJ1A 3FJYA 1XPUA 1AKTA 1R5OA 2EP8A 2GESA 1NQOA 2H4ZA 3EDMA 3GJ7A 4M8LA 4R84A 4EB3A 5FHRA 5IDQA 1RC8A 2XX3A 1U7HA 1U5AA 5GADl 3K1AA 1PJ3A 1OD6A 5FLKA 4KMOA 1VDZA 4N65A 5BQOA 1AY0A 1SZDA 1HM5A 4NBUA 3FLEA 2IYAA 5E95A 5C8YA 1WUKS 3NAMA 1XCGB 1L7MA 2DX7A 3ND8A 3RJZA 5J2TB 3K1YA 3AEYA 3MVEA 2ZRFA 3GDHA 3C6BA 3FGNA 3FTPA 1A9YA 3HH8A 1R0RE 2GBLC 5CLQA 1PVDA 4B31A 1P29A 3AY0A 3OIYA 3IVRA 2PNFA 4TPKA 4FDAA 2QUKA 2XW6A 3M6AA 2OVFA 5CT9A 3THXA 1SMKA 1W1UA 4QGFA 3L2OB 1F5NA 4LZJA 2Y1CA 4KYVA 2FEWB 5IT9A 2YDXA 7GPBA 5K5EA 2ZANA 1EWRA 4GKVA 4HS9A 1XMJA 1Z08A 1MU0A 4E7OA 3HNPA 2O1WA 3IT1A 4MV9A 1NU8A 1J2YA 2J09A 2W90A 4OFXA 1EMDA 4XGKA 1P74A 4Q0MA 1LDGA 3MJHA 4R8KA 4UTZA 3FYUC 4IG9A 4MB0A 1T5LA 3Q0TA 2WD9A 1F2DA 1KFKB 3STYA 3SQNA 3H9JA 3AP2A 2OKCA 3LWBA 3C39A 1XZCA 5FLYA 1L5RA 3GQBA 1VIVA 4PLVA 5IM5A 3WQQA 4DILA 3E18A 3QBDA 4GMKA 5E6RA 5EYPA 3COPA 3OMXA 4IV5A 3THWA 3VPHA 5ALIA 4CGZA 3QMWA 4KQFA 4D6XA 2CNNA 4NF2A 4HLNA 1VKRA 3MPUA 5ALOA 2R6FA 5F5LA 4DLAA 1XRSB 2HXSA 3WV5A 3H2YA 4QOIA 1PK9A 1TIPA 2NOAA 2OWDA 5L3RA 1LY1A 4FGLA 3UANA 2IDKA 3QVJA 2J0EA 5EE1A 3HVIA 4P7GA 4UBIA 4AMVA 1D1PA 4AURA 1VFNA 2VRBA 3O8QA 2ZQ5A 2GBLA 3MCWA 4MQ6A 1NV8A 2WD8A 1AHIA 1U3FA 3DE0X 3EXIB 4N0PA 1W4RA 2CDAA 2HPVA 4YRLA 2X7HA 3UQYS 3VPFA 4P33A 3QXGA 3ZIAA 1AHNA 3PRKE 1KP9A 2F62A 2GI4A 4Z51A 1ESMA 2ATCA 2IEAA 2W7TA 2ZRQA 3NYIA 1NUAA 2QJFA 3OQIB 4Z9BA 3VDNB 3VAYA 2RIPA 4K03A 1MVNA 1V96A 1YR1A 3IMEA 4Y3UA 5BW6B 2QT9A 3VVBA 4HHEA 3WYFA 2P6OA 3K8OE 1EK0A 3GJYA 2QPAA 4MR8A 1EHIA 3P9IA 4PYKA 4BEJA 2IS1A 1FDRA 2C9OA 1Q6YA 4AJ4A 4PGAA 3U26A 1KXJA 1GCGA 1JJ7A 3JW8A 3SXJA 1A95A 4C29A 4YFVA 4BNZA 4IDOA 1HO3A 1ZA1A 3FAKA 4B4VA 1Q74A 2QN3A 2WWGA 3HVHA 4LG1A 1PVOA 1Z0SA 2NTNA 1BHQ1 2YDYA 1TRKA 3H1FA 2P4SA 3WL4A 1S3IA 1Q57A 1STOA 1Y4DE 2ZWMA 3LVFO 5TMPA 3VR6A 1N75A 1U9ZA 2H07A 1W9HA 3HZZA 1XIVA 2ZS7A 4F8JA 2QY9A 2Q6IA 3EGCA 3LL4A 3ICVA 3FXAA 1DADA 2Q5JA 1UOPA 3BL5A 3MGGA 5SV2A 4EWLA 4PYRA 1WNTA 2OBMA 1C41A 3ETNA 4WOJA 2I03A 4JJZA 5T6BA 2YIDA 1U8ZA 2D3TA 1HF3A 3DTTA 3NHPA 1EDOA 2WHXA 2FUG6 3PWZA 1G8FA 3CZQA 3S8MA 1JGTA 4IJ5A 4N9WA 5C34B 1KDZA 4B8ZA 1PJTA 1UEXC 3D3WB 3R7DA 5KOJA 2OESA 1YOBA 3OMWA 3O4GA 2ZYIA 3M5WA 4TWJA 4AMUA 4NPAA 1APBA 3NGLA 4ZA2A 2DBQA 1EX1A 1JFVA 2XNDD 3ILYA 5HNKA 4CCYA 1DJPA 2KI5A 5DTJA 3HDVA 4LX0A 3PF8A 1WDKA 5F1OA 5DYNA 3U56A 3DO5A 1PHRA 4HGPA 2OPBA 3HM2A 5EAIA 5A05A 3TPCA 3U2QA 2P9YA 4BWFB 4DHWA 4ZHQF 5K6AA 1COZA 1RIFA 3ANLA 3E15A 4EJ0A 1U31A 4OB8A 3TZLA 1QUFA 1HC7A 4LXXA 1FLAA 2A0XA 4M7RA 2YV4A 5G3YA 3PJDA 2C5LA 1CE8A 2HDOA 4MWTA 1Z0AA 2R0QC 4FFSA 2VH2A 1VL2A 3OLCX 4FD2A 2JCBA 1P0MA 5FOWA 3UK2A 3DD1A 3LQYA 2JIZD 4WN9B 2JZCA 3AU8A 4GOMD 1FZTA 1K7CA 1SUDA 2FSSA 3E27A 4IL5A 1EWTA 1Q19A 2AI1A 2C8JA 1RMQA 3GRFA 5EZYB 2PT7A 2I80A 2A1UB 1BFUA 3CUKA 3I12A 4MMYB 4UQPA 3RS0A 4RACA 3VHXA 2Y2VA 1QYWA 1WKCA 1ZOIA 2BM8A 2I1LA 2PPLA 1YS7A 2R8PA 3V4OA 2FFAA 4FONA 3NAGA 1F1JA 1HEIA 2DJIA 4BCBA 3V6LA 1M5UA 2XMQA 3CMCO 4MSUA 4U9HS 3RKRA 5J63A 2CWWA 2R4QA 2XPCA 1CUHA 2COKA 2F8LA 2R48A 3GDFA 4K88A 5AKLA 1EP9A 1CY0A 3LD9A 4CMGA 3JALA 1ZYUA 3UJCA 1Q7EA 3EVEA 4G25A 1M1YB 3W5CA 4QHTA 3T3NA 2C29D 2ZBUA 3K05A 5E9AA 1OOEA 2OCLA 2P0AA 3Q5DA 2H9AA 3U3RA 4AO6A 4BRSA 3MS2A 1OTHA 3TJRA 5GTDA 1FS6A 5BV1A 1CERA 1NKSA 2F3SA 2Z3WA 2C84A 3QNWA 1VSQA 4MV8A 1XEXB 4EKEA 3K9CA 3IOMA 1AK9A 1YVEI 4MRVA 2YW9A 2G9RA 3WWOA 1ZMRA 2DLDA 2O1XA 4FZ5A 2R8RA 5I9TA 1CUVA 4GZ5A 3DBOB 2Y0DA 1LK7A 3X43A 3NT5A 3ZIAD 4Y9DA 5HCUA 3QY0A 4ENRA 4ZKDA 1QCDA 4BJHB 3UJ8A 1TEXA 3GQVA 1BIFA 3LLCA 4RJJA 1BW9B 1C9JA 2VBCA 4XPZA 3GGOA 1QE5A 3EG5A 2WAAA 5CYFA 3U49A 4YMIA 5BVGB 4J03A 4L3VA 2W6JD 3L1VA 3QEBZ 1NN0A 2OCIA 4TXJA 4BTEA 3EXG1 4OK5A 2FZLA 2BF7A 2FF7A 4X44A 5CBPA 1Y6GA 1H4SA 2XXAB 1MO6A 3DAFA 3Q88A 3ANXA 3GZ4A 1KY2A 3QWAA 5DIZA 2F48A 3OU2A 1RHRA 1YS6A 3SQDA 4Y2QA 4M54A 4FYKA 2AN5A 2JD0A 2VHTA 4KN8A 1B6GA 3RADC 1WLSA 2OZLA 5T8KA 2VNHA 1K9VF 1QV6A 3SYRA 1H1TA 3PHGA 4OH1A 5FTKA 3DE4X 3MTGA 2JVIA 5CXUA 4M88A 1CEQA 1L7RA 3LSYA 4XCQA 5IAJA 1E2HA 3FSJX 4E03A 3B9PA 3CNNA 4EX6A 2G8LA 3IT2A 4M1TA 3PC4A 1IUOA 3A36A 2ID8A 3FOWA 2PDAA 3LCVB 4PTZA 3TBFA 3TVYA 2X9QA 1XZGA 2JJ1D 3HRKA 3P71T 3LCCA 4OQ4A 2PWPA 4L22A 2EDCA 4EHNA 2J6HA 2O8NA 3NFRA 4EM6A 5D6NA 4NARA 7REQB 1XVAA 2PIAA 3AFIA 5HQJA 1CF2O 4ZAGA 3AIMA 4A1FA 3PZRA 4W82A 2H08A 4NJMB 2QL7A 3GB9A 3P9ZA 5IAEA 3EAQA 4MGYR 1D9XA 4YMUA 4F4IA 2Z6AA 1P19A 1FVXA 2R68A 2P1DA 1J1UA 4RVOA 4E3WA 1P6UA 3ANSA 1MOZA 3TFQA 1E2PA 4CM6A 7ABPA 1Q6ZA 2ATVA 1LWNA 3WLNA 1A9OA 4F96A 2Q9CA 5DTQA 2ZSHA 1J8MF 1M2JA 2FWJA 3STUA 2JFHA 2BGUA 1IY9A 2IV7A 4TTVA 4WCVA 3D6AA 4HVTA 5CLLA 4PRKA 4BGUA 4EVRA 2VXOA 3A9UA 3GGDA 2ZRIA 2JVJA 3A14A 3QLVC 4QGGA 3MA0A 4XDHA 4YCBA 1EUZA 3HU1A 5ALXA 3VNBA 4K1LA 4W7SA 4UVIA 3RTDA 1KMNA 4R7ZA 1O95D 2VQ6A 4DR6B 3PQDA 2PXXA 1T26A 1GN8A 4K6GA 4GKAA 5CPBA 3WIBA 1Z37A 2EJTA 4BNLA 1QBKC 3ZD8A 2BEUA 3NJ4A 4UUBA 4F93B 3JQAD 4Q4LA 4WX2B 3TQSA 4F5ZA 1JIUA 3PVCA 3TW0A 3VTKA 2VS1A 4MUJA 3G2LA 3ZWOA 4MI9A 1EUDA 2L0XA 1TZBA 3ICOA 3SSMA 1W0KD 5EIOA 3HP1A 2GKGA 1W5FA 2FQWA 1KFBB 2ZB3A 2VBGA 3NTXA 3FMGA 4J8PA 1QP8A 1RTKA 4H1HA 2B1QA 1AD2A 4WN3A 5K3EA 4L27A 4LDNA 3F6EX 1FP4B 4U63A 5AKKA 1T9CA 2QRNA 3ZI7A 5B6JA 2F8MA 2RHMA 1IN4A 4ZI5A 4RHUA 2OEPA 3IDFA 1K7FB 1KXZA 2X19A 3PYMA 5D85A 3L1JA 4II7A 3AHCA 4HT3B 1NYQA 1UKEA 3DKVA 1ODSA 5DDIP 3T9FA 4RMIA 5BQFA 2A2ZA 1QGOA 4F11A 2G83A 1NWHA 3G2KA 3RYFB 1GN9A 3GOHA 3F8TA 4KIWA 3KVVA 2EFCB 3EIHA 3LS2A 3ZI0A 2C3YA 3VTAA 1C3VA 1OV6A 1T5BA 2VNJA 1X7ZA 1SHKA 2Y66A 1I7QB 2V6GA 3HZHA 3F5MA 3WV4A 1QYVA 4MVJE 1FFEA 4JIMA 1QR6A 1MC5A 3QWBA 3RAFC 4DGSA 4RESA 3KOOA 2MJLA 2RCNA 4MLPA 4RNCA 3MPOA 4WZAA 5JANA 2ACEA 4XVCA 3BWBA 4R40A 2B4QA 2NG1A 1Z2OX 1TTHA 4IXTA 3TOXA 5IVPA 1MHPA 2VEOA 3SXPA 1OGIA 2QDXA 2XNKA 3OE7D 4G37A 3ZE8A 2WJPA 3WLSA 4ECAA 4UXJA 4WDQA 3FUXA 3KKQA 1MB0A 4W5QA 1G4AE 3D0KA 4D8YA 3ZXSA 4JLWA 5B7NA 2Q5QA 2C96A 2WYVA 3IDQA 4J2HA 5TGTA 1L5HB 3I2HA 5EKDA 5BUQA 4LVUA 1L5OA 3HR8A 3IHTA 3K1ZA 2GPTA 4TN5A 1CP2A 1JKIA 1LI7A 2PNJA 1RPAA 1S2LA 1CZKA 3W7BA 4ZI3A 1TAHA 3NWEA 1A2QA 7REQA 4Z53A 1Z26A 2IP4A 5IYZF 1ZRHA 2M2IA 3Q87B 4LFCB 2O2CA 4RD6A 4EW2A 2A1IA 1ECLA 2BI7A 1Z34A 2H2IA 2ODAA 3A70A 2NQTA 3FPSA 2PJRA 4ETNA 2Q2NA 3U4QA 2NACA 3QX7A 1G8YA 4QDKA 1RI5A 4ETIA 4JQCA 4LKRA 1M5TA 1T0PA 1TO6A 4N76A 3OJWA 4BV3A 3CLSC 1RWNA 3RTEA 4X1IB 2ZI4A 2O5VA 2BD0A 1PO7A 3T3PB 4R8LA 5F1YA 3KR2A 3BH0A 3M33A 5DTIA 5JCJD 3AFNA 5IANA 4KP7A 1R0CA 2NZVG 1XD9A 2G6BA 1P4AA 2PBFA 2GM5A 4LSZA 5I45A 2HF7A 1PJSA 1BVRA 3UK7A 3D4BA 1T2UA 1Z0JA 3KQOA 3SIPA 3HJHA 1NMYA 3H5TA 2GZSA 2NO5A 2WIBA 1GSHA 1TADA 2IYFA 2JCVA 3P45A 4DLUA 2RG1A 2YFHA 2ZSDA 4Z8XA 5ALFA 4DMRA 4Z5XA 5IT0A 3UJPA 5JFGA 4EHFA 3CPSA 3G7UA 4QDJA 2AFHB 2OILA 4BNFA 5ILQA 4F1JA 4HDRB 5KEIA 3DE7X 3OZXA 4GW3A 1JFFB 4Q9HA 3MCZA 5DBHX 4EBFA 3DV0B 1NVTA 2AUTA 1GCOA 2P4QA 3TVTA 1SCNE 2R6ZA 4X1IA 2QE6A 4C7XA 2XRMA 3HB1A 1ZH0A 1B4DA 3KQHA 2FZ5A 2VA8A 1JR4A 3W06A 1KERA 2B8TA 2WHPA 3HXKA 3CVWA 2IV2X 4IEEA 1B26A 3PKIA 4CIYA 1XT6A 1IZYA 2O7QA 1YDFA 1I1QB 3AF2A 3CF4A 3F74A 4LCBA 4JLAA 4QGBA 1QANA 5HIIA 4KQ1A 4ND1A 3MF4A 1G18A 1OLOA 4S3MA 4N7JA 3G0DA 3TZ6A 5C4MA 1EVIA 4DUGA 1UK9A 2VJLA 1R15A 5KAMA 3S4YA 2QN7A 4JJIA 3EODA 1MDFA 4U9IS 4LXGA 4AP9A 4JB8A 2JGFA 3AB8A 4QUAA 4RQUA 3H97A 4FLEA 1VM6A 2GDZA 2PGAA 1HK7A 3PI6A 3FOCA 4JN6B 1N2ZA 2BFCA 2IYZA 5ALTA 3TRIA 4P58A 4L28A 3MS4A 2W6JA 2ZGVA 4MWOA 3HNRA 2YY7A 4HLCA 4UEOA 3UXEA 3W2IA 5IF3A 4RH3A 2BGRA 4AK9A 1UIRA 4HQOA 3I9V1 4TLCA 3S2ZA 1SPXA 1B6TA 4WV3A 2D4AA 4XFJA 4HG2A 3R09A 2F3TA 3HJGA 1GL9B 3ONDA 3UKJA 1BYIA 3ZYZA 1NC3A 1T5HX 4FOLA 4OMDA 2DLNA 1C0PA 1TEVA 2KX7A 2WFZA 2VAXA 3A4VA 1GAWA 5EGSA 2I6GA 1PEAA 2IUTA 1GDTA 2V7WA 4C3UA 4LHXA 4WOCA 2EGHA 2XUAA 5DXFA 3BDIA 5AHXA 3KOWA 3UK1A 2D3WA 1W2WB 1QYCA 1NVMB 2WIKA 2R1VA 4RPLA 2Z5GA 1UXIA 3HP7A 2PUAA 2ZM5A 3OE7A 3SZLA 1RYEA 3UJHA 4R2XA 1C5KA 2YHUA 2HEIA 1FYVA 4N3AA 4EJSB 4DWJA 1HLPA 3IA2A 3LPDA 5JJLA 4HXFB 2ILVA 5BMVB 1X77A 2YJ5A 4JVMA 2JKVA 5DW0A 2BKVA 2I71A 2PJZA 2Y1FA 2Y0BA 2YH2A 5DPMA 2RHHA 3TDMA 3WOVA 4DAEA 4LSMA 1S1MA 5K09A 4X64B 4BXOB 5DBEX 2GN0A 3EPHA 3SD7A 1K4MA 2VJKA 3OCCA 3E9YA 1RYBA 3NT4A 3K4QA 2ZCJA 1QO9A 1TCUA 2OV1A 2ZRPA 3Q3HA 3D8UA 5CJJA 4EZIA 4F4CA 3ZGYA 4GVXA 4QPZA 3O84A 1VBFA 1YB5A 1S9HA 2FKAA 3LV8A 4IQ4A 4PRYA 4UHBA 3RWMB 3WQRA 1JFTA 4REOA 2VWPA 1TVKB 2AZMA 3QV1A 4QQNA 4ZT5A 4B7CA 4PC2A 4PCLA 5EA2A 4BB9A 1IOVA 1M6YA 1B74A 1DAIA 1WUYA 2HJRA 2I1QA 2ZTVA 3ZBQA 1KOGA 3IXQA 1NKTA 2FLWA 3PNYA 2Q5LA 2WM2A 3EC1A 2IXTA 2VP6A 3AR6A 4W1RA 3INNA 4TLDA 5IJZA 2K7ZA 1P8AA 5DSZA 4ZOQI 2GM9A 4ZCTA 1HFJA 2R5FA 4LW8A 3AKCA 5TIIA 5CIYA 3L1UA 1XVTA 3HDQA 3DZKA 3K53A 3MLAA 4HI0E 5ECDA 1K5HA 1MJGM 1OPXA 2H0QA 3JWIA 3N86A 3OLWA 2CUTA 1SXGA 1YZTA 1QBGA 3OSUA 2ZB7A 2ZUWA 1Q44A 5TPZA 2CDCA 2XMCA 3RIHA 2JHCA 4J1TA 4D8UA 4Y2JA 1EVZA 2UVPB 4G1FA 4OYLA 3K9HA 4CL0A 5C18A 2DR2A 3FH0A 1XHEA 3S2GA 3K6RA 2QLMA 4Y67A 3VYVA 3KXPA 5K45A 2RI6A 4GOXA 4BY9E 1Z6YA 4ZO4A 1AKMA 2GAAA 2VT3A 4F04A 2E3JA 4ACAA 3TL3A 3VZPA 1RZUA 2C7BA 5IVHA 4XIFA 3ZHYA 4D5EA 4G5HA 1FFDA 2LPMA 3GJXC 4RXUA 5A3JA 4RTLA 1QV7A 3NH9A 3ZZMA 3FYCA 5HF6A 1HZJA 1BX3A 1XTVA 2PXAA 2XQIA 1IBLB 1IB0A 2GZRA 2YQ5A 4TRRA 2QLLA 3VOSA 3BXHA 2ZJ2A 3GHHA 2BN4A 2H9YA 5DN6D 3UCFA 2A88A 2HHLA 1FP1D 1P3JA 1PQWA 1VGRA 1U8AA 3CKLA 3IBYA 3Q3GE 4G1BA 2KJQA 3EDQA 3T54A 3LUGA 4P08A 2IY7A 5CDSA 1ZJWA 1I5OA 4YK7A 3KZMA 2YR0A 1VXOA 4QXQA 2JFNA 2H5LA 3KS9A 3QVSA 4L4RA 4DB2A 2P9QA 3CUWA 3FF4A 5ALLA 4IFEA 3QE4A 4I3HA 2DHRA 1XTKA 2QRJA 3O3MB 1V1MA 4ZYLA 2YY6A 2AC4A 3B1ZA 5DBFA 4U4AA 1KVUA 1Z68A 2JJ1A 1PRYA 2QG9A 4M6WB 5F7JA 4AAYA 2L69A 2XMBA 3HPRA 2QLNA 2H8GA 1A9PA 3MSCA 3F97A 4CF6A 3ORYA 1W75A 2VDRB 4EATA 3A04A 3JAMA 3DP7A 1OWMA 1KDRA 3UWKA 2XVMA 3IB6A 2BZ0A 3OEYA 4G8BA 5E6UB 4DBVO 3LYLA 5L3QB 3L18A 1QP0A 5AVTA 4HWRA 5EOVA 3PQCA 4MV3A 4HWGA 5KSZA 4Z49A 2DY0A 2I2DA 5THXA 4YDQA 3GRVA 5EEGA 1H8EA 3FRJA 1XCLA 2P75A 3FTDA 3RYHB 1N78A 4EECA 3VVCA 3U4IA 1HNXB 5AKXA 4BQOA 4NOLA 2WTBA 4LGYA 4W5HA 2O0MA 5GZ1A 4F2WA 3O4RA 5EHZA 2Y1DA 4JJAA 3AVQA 1IN8A 4JROA 5LP6A 4QICA 3L79A 2ORWA 4AU1A 3CW8X 3ASVA 4D6PA 4LOJA 2EP7A 1TD1A 1LJUA 2A86A 2A9VA 3A9VA 3NEPX 4MWSA 4F4JA 1UM8A 1JEOA 2PGOA 4HJXA 4L8YA 2LKCA 2GLXA 2ZIGA 4MKZA 3THSA 2CFCA 1G2QA 3FTNA 4LDZA 3T3HA 2R5WA 5M3BA 3P5SA 4EK9A 4M3NA 3FVQA 1OGJA 1VMIA 3RJTA 3UG7A 4KYTA 4RD1A 2OOSA 5CFLA 3B1WA 4OYHA 2BZSA 1XWIA 3UHFA 5H4HA 1H22A 2XF8A 2ZUVA 2QZ4A 4O8CA 5C8YF 4DM7A 5I7OA 5LBUA 2DPYA 1ZCFA 4UAVA 4NAVA