3AIMA

R267e mutant of a hsl-like carboxylesterase from sulfolobus tokodaii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
283
structure length
283
Chain Sequence
ASVEEIRSLFKQFSSLTPREEVGKIEDITIPGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDSAGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTREHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVEFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 303aa long hypothetical esterase
publication title Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobustokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 95
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2010-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aimA00
4J0KA 4FBLA 1K5PA 4CCWA 3WZMA 4J03A 1HLGA 4X93A 4EA6A 4AN0A 1NX9A 5DYYA 4Y2TA 4OB6A 4QWWA 5E2IA 5FLKA 3B3QA 2D5LA 1YCDA 1CQWA 2JGMA 2GZRA 3H2GA 1WOMA 3WKCA 2XLCA 1LZKA 1ZIYA 3M81A 5JAOA 1W75A 3STVA 1OCEA 3L1HA 4Q34A 2QT9A 4O08A 2ZJ6A 4H18A 2X76A 2V98A 4QA9A 5AO9A 3E4DA 5AI9A 3DKKA 5AI5A 3S8YA 2WG2A 5FOQA 5AIAA 4UFPA 3WMRA 1FFEA 1QJ4A 2I03A 1UOPA 1E3QA 1H23A 3YASA 3AIMA 5JZBA 5ALOA 1LPMA 5HFAA 2H7YA 1B41A 5LZ9A 3ILSA 2C5FA 3W9UA 2HA3A 4AO8A 4QLOA 3O4GA 1A88A 1O6FA 3R40A 4U2DA 3FYUA 4BYMA 5AM4A 5DNWA 4WFJA 4WY8A 4GLBA 3GROA 3WJ2A 5ALTA 2DHDA 3E1GA 1R9MA 2WIFA 5KWJA 1ZIXA 4N8SA 1Y7HA 4X6XA 3FOBA 2HU7A 3D3NA 4KACA 4NS4A 1YAJA 4PQEA 1Q83A 3HC7A 5F4ZA 2R8BA 5LIPA 2FX5A 2BFNA 4DIUA 4AMYA 5AKJA 1JI3A 1XZLA 2HA0A 5I9IA 3BJMA 1AUOA 3IA2A 2J4FA 1R3DA 2QXTA 3GZJA 2Z3ZA 3QMMA 4F0JA 4Z49A 4ZV7A 1N5RA 1X70A 4H7HA 4BAUA 2GZSA 3ANSA 1CUBA 1BCSA 3H0CA 3L1IA 3QMWA 5JAUA 2GYWA 3M3DA 2OLEA 2Z8XA 5AOAA 1WPRA 3I2JA 2PBLA 2XMDA 3FCYA 4PSUA 4X91A 1XQWA 4AN1A 2OPHA 3NOXA 4LYDA 4K6GA 1W6RA 3EQ8A 2B9VA 3W9BA 3ESDA 2O2HA 1CIJA 1CUYA 3AINA 1FFCA 4GWLA 3R3UA 4BP9A 2PSJA 5JAHA 3LS2A 2Y2UA 4BBZA 1F6WA 3A2LA 1UKBA 3LIIA 5AM1A 1E5TA 2WIJA 4QE3A 2HIHA 4DNOA 1EX9A 5ALGA 5CH3A 1E89A 2XUPA 5AKLA 1ZJ4A 4DM7A 3SK0A 1QTRA 5FP0A 5LZ7A 4WJLA 1TKRA 1EDEA 1DINA 1EVQA 2WHPB 1AX9A 2I3DA 4XIIA 1THTA 1XRQA 1XLVA 2XUOA 3WKAA 4OU5A 4UBOA 4BB0A 1QO9A 4H7JA 3EF3A 3WWDA 3UUFA 4CFSA 1ZD2P 1YB7A 1TCBA 3AILA 4FFWA 1JU4A 4UPDA 3CCCA 4Y7DA 1R4ZA 5AOBA 2DR0A 4YASA 3STTA 2XUFA 1MNAA 3D2BA 4AZ3A 5I8PA 1H2WA 5FRDA 2BGNA 2XQIA 1AGYA 3DOIA 3NGMA 4KJXA 2B61A 2HA4A 5LZ4A 4DNPA 3F96A 2Y6UA 4HTAA 3DD5A 4HVTA 2EEPA 5ALQA 5ESRA 6YASA 2AJ8A 1UK7A 5T4FA 1JU3A 2W22A 1IUPA 1ZGCA 4DMFA 1UOQA 1MU0A 3DYVA 3UUEA 4HRXA 5EHQA 1QGED 1CEXA 4Y2YA 1A8UA 2JEZA 5E4TA 4FLFA 2CMFA 1P0IA 4FNMA 4U2EA 4G8BA 2QKYA 4AQDA 1UK8A 1MT3A 3GELA 3C87A 1X2BA 3RLIA 1JJFA 1J1IA 3VJMA 2DQYA 5AKIA 4ARBA 5AI4A 4JUIA 3E3AA 3EBLA 3KSRA 4Q3LA 1ODSA 5JATA 3OOSA 5LZ8A 2O2IA 3RKSA 2PUHA 2V9ZA 3BIXA 3I2KA 3MGAA 1FFDA 2VJDA 1EK1A 2Z3WA 3DS8A 4H77A 4H7IA 2O7VA 2GYVA 2XUAA 2ZYSA 5A62A 2R11A 4XWGA 4DMCA 2AXEA 1F8UA 2GBIA 2OGSA 4EY8A 5AICA 3C5VA 1VKHA 2HU5A 1UKCA 1GZ7A 2VAXA 4CG3A 1FJ2A 2QS9A 4MYSA 2BGRA 2WM2A 1J06A 2B20A 1H22A 5CT8A 2RONA 2QJWA 3WL5A 2WLSA 4BP8A 1HKHA 2LIPA 3OC0A 1CUCA 3OPMA 4M0MA 3STUA 3FYUC 5FPPA 2JGJA 2AJDA 2XQKA 2VTVA 2C4HA 3W2TA 3WK7A 4C89A 2HADA 4QEKA 1ODCA 2CUTA 5CT4A 3O4JA 2YASA 4WY5A 4BCDA 4G1FA 2WIDA 4XJVA 4BCCA 3FLEA 4GXNA 1VJ5A 2AJBA 3AUKA 3C43A 2WJ6A 3EQ9A 3TEJA 2OAEA 4FNGA 2WUDA 5CH5A 3I28A 2ZYIA 1UKAA 2HA2A 4K6HA 1ODTC 2P8SA 2E3JA 1W4LA 3G7NA 3G0GA 4XX1A 2ORYA 1OILA 2OGZA 4IH1A 1LPNA 2RIPA 4AXBA 4GBGA 1XRNA 5LLSA 3FSGA 4G4JA 1TCAA 2C0PA 4DMKA 2ZJ7A 1WB4A 1CUUA 3I6ZA 3WL7A 3ZLVA 1EH5A 3A2MA 1LPOA 1XKTA 5K3CA 3C6XA 4DNFA 3QZUA 1MPXA 4KE8A 5C8VA 1L7RA 3ZPXA 1O6GA 1JFRA 3IURA 1ZI8A 1ORVA 3PE6A 3CN9A 3D59A 3FCXA 2DHEA 4LHEA 1DT5A 3PUHA 1AQLA 4B9EA 3IB3A 1CLEA 1XZEA 3C70A 1LBTA 4B7ZA 2GYUA 4U2BA 1XQVA 5AM0A 5BWBA 5AM2A 3PFBA 1EDDA 3H19A 2DCMA 2H9YA 5CXUA 2VATA 1CUXA 1G5FA 1I6WA 4G8CA 3KD2A 3DKRA 5EGNA 1RYYA 1VE7A 4G4GA 5I7UA 4B85A 5YASA 3B12A 4ZI5A 2DFPA 2OXEA 4LKOA 4ZXFA 5CMLA 5T4BA 1SOMA 2WHRA 3DL7A 5AKXA 2RAUA 2OGTA 3A70A 5JADA 2CZQA 3V1KA 4Y2PA 2VQ6A 4QZVA 1HDEA 1M33A 2RHWA 3K9BA 3FLBA 1KU0A 3EQ7A 5BV7A 1E8NA 4LIPD 1VZ3A 4OCZA 1NU6A 4Y2QA 2WJ4A 3WIBA 5JANA 4HAIA 2HRQA 2HA6A 1E8DA 1IMJA 2Q0XA 1HQDA 5JARA 5JALA 1CQZA 4UFNA 1QOZA 4EY7A 1C7JA 2OAGA 5ALKA 3U0VA 1XZAA 5ALHA 4DLNA 3ED1A 5HKBA 2G63A 3WI7A 4BZZA 3HYSA 3KOOA 1RWQA 3C6ZA 1B6GA 3QPDA 4UHDA 1CUHA 5AK6A 2HA5A 1MAAA 2XMBA 4V2IA 3STYA 2OCIA 4BVLA 3T4UA 3ICVA 2JGLA 4J7AA 5DYTA 3RARA 3O9VA 3JYHA 4MWSA 4I4CA 3EIOA 4QDTA 2PX6A 1UFOA 2JF0A 3DYIA 3STWA 1W52X 2G5TA 2CEKA 3C45A 5AHXA 1L7AA 5T4EA 2VEOA 4MEBA 1QIJA 5D7BA 3L1JA 3Q0TA 1XZHA 4BDSA 2UZ0A 1A8QA 4EZIA 2VF2A 4DNQA 5JIBA 4B84A 1TCCA 2WG1A 2PSDA 1GQRA 4PSDA 4TPKA 1MNQA 4E11A 5A71A 1G42A 1N8SA 1CUVA 5HQ3B 1CUIA 3IUNA 4G5XA 5IKXA 4F60A 1BRTA 4J0GA 4EBBA 4K6KA 3H2JA 4TGLA 4B81A 1T4MA 4L72A 4FMPA 4MWTA 3N2ZB 2QMQA 3H1AA 1U2EA 4AO6A 1P0PA 4J0CA 3WYDA 5K5EA 1AURA 3F9CA 4YK7A 2H1IA 1PJAA 3IULA 5EIEA 4FKBA 4GHWA 4U2GA 5ALRA 3IVMA 4CG1A 4BDTA 4AMZA 4KAAA 2VT7A 1ZGBA 4Y2XA 3R3YA 4QDUA 2ROQA 2PKYX 2WIKA 3H1BA 3PICA 4HRYA 3WLAA 4L0CA 2J4CA 4BAZA 1VOTA 4RE6A 2HRRA 3HLKA 1WB5A 2JGKA 2QJRA 4OYYA 4FHZA 4X85A 2YH2A 4D9JA 3WA7A 2RGUA 3M82A 4CCYA 2WTMA 3WYNA 4X95A 5LYYA 2ZVDA 1CUGA 1SFRA 4DTCA 2XQGA 4MEAA 4KEAA 3G9ZA 1MN6A 5DNVA 3PDCA 2HHAA 1IVYA 2C7BA 1EINA 1EDBA 4Q1VA 3GA7A 1BE0A 5JD5A 3ESAA 4UBNA 1CUFA 1GXSA 2WG0A 3DL4A 2ECFA 3O9MA 2I3ZA 3SX4A 4H7FA 3WKBA 4PW0A 4E15A 2Y1KA 2AJLI 4L3WA 1Y7IA 1LZLA 2CB9A 2ZSIA 5CBKA 4X6UA 4KRXA 5ALIA 1K6EA 1CUWA 4ZV9A 2OCGA 5JAPA 3AIKA 3C8DA 3D5EA 4ROTA 1SCKA 2OCKA 4A23A 5D3ZA 1UOOA 2XB6A 5ALPA 2CKMA 3HSSA 4FFVA 1BEEA 2XUHA 3UMJA 5FKJA 5T4HA 1XFDA 4BRZA 1P0QA 3ZWQA 3PFCA 5D3KA 2WU4A 1UT6A 3FYUB 3BDVA 4G4IA 1EA5A 1DX4A 5SYNA 5EIHA 2DHCA 5A7FA 3LLCA 2QM0A 4I19A 5ALYA 3HXKA 1AKNA 3MUNA 3RK4A 2DSNA 2PU5A 2WTNA 4BAGA 2JBWA 2WFLA 3QPAA 5IVIA 1THGA 4UHCA 2Y2VA 4EY4A 4E14A 1LLFA 4QDOA 1YS1X 1MJ5A 3W04A 1XQYA 3WL8A 1CUSA 3ANTA 1CUEA 4BC0A 1XLUA 4C01A 2XUKA 5JD4A 2VJCA 5ALUA 4PO3X 1UWCA 3DEAA 2HFKA 2QXUA 3BL8A 4KAFA 1TIBA 3BF8A 4X00A 1GKKA 1Q84A 4WCVA 4X90A 3KWJA 3WL6A 2ES4A 4HZGA 4W1SA 5KWIA 4B82A 2XDWA 4BTLA 4WDRA 2WKWA 5JASA 2PSHA 2BKLA 4CIAA 5AKZA 1QE3A 2Z8ZA 4PSCA 5DTJA 5H3HA 3E0XA 2WSLA 3OTQA 5HKAA 1YS2X 4AZ0A 4B83A 2ACKA 1FFBA 4K2AA 4GW3A 1CRLA 1G4HA 1USWA 3BE8A 2IIVA 2OQVA 5DLPA 2C0QA 4CG2A 1PV1A 4GI1A 4KYVA 3U1TA 4X94A 4KAJA 1QIGA 4QDXA 3ZI7A 1K63A 1ZD5A 4X92A 3D7RA 4HXFB 4WDQA 5BWCA 1AMNA 1BEZA 3AIOA 4J0HA 4C6HA 3C6YA 4YPVA 5BOVA 4TVKA 5HCUA 1AZWA 1N5MA 1QONA 2PSFA 1Y37A 4LXHA 1R50A 2XQFA 3ICWA 4G9GA 1XRMA 3WA6A 2WU3A 4C4XA 2D0DA 1C4XA 3AZQA 4J0DA 2BCEA 4DSZA 1QO7A 1VZ2A 1ZI9A 2PSEA 4BRSA 5EFZA 5ALFA 4CI9A 1JJIA 1CV2A 4E46A 3I6MA 5EHXA 1YB6A 1T2NA 1LGYA 5AKKA 1YA4A 4FOLA 3RM3A 4QNNA 4BE4A 1XQXA 3LIPA 4EUSA 3IUQA 4DYHA 2QRUA 2V96A 1H2XA 2ZYRA 1CR6A 1WM1A 5LZ5A 3I1YA 1YR2A 4MQLA 2HA7A 2W6CX 3KWFA 4EY6A 4UBLA 5ALNA 5CURA 3V9AA 1HPLA 2HU8A 1QIMA 1XRLA 2C58A 3FWHA 2WQZA 4S0XA 4B0PA 3WWOA 1DTEA 2C5GA 3R41A 5ALVA 5ISMA 5JYCA 1LPAB 3DOHA 5ALLA 1E66A 1HBJA 4Q05A 1DU4A 2VAVA 3H04A 7YASA 5LKAA 1UZAA 4ZREA 3AZOA 1GQSA 4H7DA 5ALEA 3PF8A 3WK6A 4KR0A 1DT3A 3DJYA 4UHEA 4WFIA 3D0KA 2BUCA 1YASA 4B80A 3D2AA 5DJ5A 2V97A 3BJRA 3WKEA 2VT6A 1RP1A 4BATA 5LZ2A 2K2QB 4UBJA 4G9EA 3HJUA 2FJ0A 5DTIA 1EI9A 3G0BA 3V48A 4B0OA 5HF9A 2WHQA 4B6GA 2G4LA 5EIAA 4AB1A 4F21A 2WUEA 3D2CA 4UHFA 5AKEA 4AO7A 1CVLA 1ZI6A 1CUAA 4MJ3A 5AI8A 3F98A 1CPYA 2H7CA 3T52A 1VE6A 5IH7A 4QDZA 5K3EA 3V1LA 5HZGA 5C8ZA 3I6YA 3H2KA 1QIDA 2ZYHA 3C8HA 3DLTA 3HRHA 2GBFA 3LP5A 1R88A 3I2FA 1BN6A 5AKHA 3WQHA 4IH9A 1QFSA 3K6KA 1XZFA 1H2YA 3STXA 1LBSA 1ORWA 1QTIA 2HL6A 5C81A 4Q82A 5HF8A 4UHBA 5KREA 3N0TA 3WK4A 4GECA 4W1PA 5KBYA 5D6OA 3G0DA 1HL7A 4H0CA 4JH0A 5IVDA 3I1IA 1F0PA 3GFFA 4C4ZA 3QMVA 1U4NA 4DMHA 4YX9A 3GBSA 2WJ3A 3OG9A 3V1NA 5EHNA 4H35A 5C7YA 3QITA 4X97A 3JWEA 3Q8WA 5FV4A 5CW2A 3BXPA 2QZPA 1H2ZA 5HFNA 2QR5A 2OG1A 5LKRA 5CT6A 1MO2A 4CIBA 1XZGA 2J3DA 3FVTA 5K3DA 2WHPA 3SC2A 4HXGA 4BZWA 1IZ8A 3KDAA 4UBKA 4RPCA 5A7GA 1XZKA 1Q0ZA 4A5SA 4Y9SA 4MYDA 1WB6A 2XUDA 3R3WA 4GEGA 1JMYA 2GBGA 4NVRA 2VA9A 5A2GA 2HDWA 4OYLA 3FNBA 5AH0A 2BJHA 4Y2RA 2PL5A 2Z5GA 4IHAA 1QZ3A 1X2EA 4G8DA 1GKLA 1EXWA 1XZIA 1CUDA 5A7HA 4P08A 3G02A 3OM8A 2VJAA 3VDXA 2XMSA 3HACA 1XRPA 2XQJA 4N8EA 1EVEA 4P9NA 3QBJA 1PFQA 1MX5A 3S2ZA 4FLMA 1D07A 3PF9A 2XMQA 4KE7A 2YYSA 3ZV7A 3G9TA 2AJCA 4P93A 2XI4A 3VJKA 4F5ZA 3A2NA 3WWCA 2XUQA 1U8EA 1MX1A 3VXKA 3B5EA 3BIWA 5ALWA 4FTWA 3ZLTA 5HK8A 3SWWA 3DCNA 3OURA 4BE9A 2I78A 2JGFA 4ZRDA 4ETWA 1LNSA 1SC9A 4ARAA 2RHTA 4UBIA 1DQYA 5AOCA 3V1MA 4NMWA 5EHZA 3KXPA 5EI5A 1K4YA 5HF5A 2JGEA 2O2GA 5ALZA 3TJMA 3I2IA 3QVMA 2DQZA 3BDIA 4JYMA 2IITA 5FUMA 1E8MA 3WKDA 4Q3KA 4MXDA 2X8BA 1SCIA 4OU4A 2ONCA 1FFAA 4FWBA 4W63A 3IIIA 4C4YA 1XRRA 2Y6VA 5LP1A 3A6ZA 1WHTA 2IX9A 1GPLA 3NWOA 4B9AA 2PPLA 2QUAA 5JD6A 4XVCA 5CXXA 5K3BA 1XZCA 1UXOA 1DWQA 4QLAA 4AX4A 4KE9A 1ISPA 2H7XA 4OSEA 5AKYA 3O4IA 3GUUA 4ZWNA 3IDAA 2WFZA 1EK2A 2QTBA 1ETHA 2ZSHA 4KRYA 5K3AA 2XUJA 3G8YA 4LXIA 4PNZA 1SCQA 1ACLA 2XMZA 5DYWA 1TK3A 1A7UA 2WILA 4OD0A 5IVHA 4KE6A 1Z68A 2XUIA 3F8SA 3ESCA 1CUJA 4IO0A 4UHHA 3FAKA 3C5WP 5AK5A 4W9RA 5CT9A 1QLWA 4N8DA 1LPPA 3FLAA 2RI6A 2XT0A 3X3HA 1MAHA 2EDAA 4J0IA 1ZICA 5AI0A 1KEZA 2B4KA 1S8OA 2QUBA 2CBGA 4K5QA 5ALXA 4OPMA 1C7IA 1JJBA 4L9AA 3WK5A 3HEAA 1EHYA 5FDFA 4Y2VA 3F67A 3VKFA 2GBCA 4X71A 2OQIA 1U65A 4OUKX 5FXMA 2JGIA 4BC1A 2NW6A 4I3FA 1DX6A 1DWOA 1DQZA 4P92A 5HF6A 4RE5A 4X7BA 5ALMA 1L7QA 4Y2UA 1JKMA 4X6YA 3I2HA 4M0EA 3IBTA 2PUJA 2QVBA 1QIFA 1R1DA 5CTAA 2BUAA 5FPQA 1XROA 4UUQA 4WFKA 4OB8A 4HS9A 4NZZA 5SYMA 2WUGA 4DGQA 2WFMA 3AJAA 3JW8A 3W06A 4W1QA 5AI6A 2O7RA 4Q3OA 4FDMA 3R3ZA 5K3FA 3QM1A 1GPKA 5AP9A 1VA5A 3FYTA 4LYEA 4CCYB 1BCRA 1BS9A 3AZPA 5CRIA 1LPSA 4BCBA 5DWDA 2VJBA 2PU7A 5AM3A 4H7KA 3F97A 1A8SA 3VVMA 1YA8A 1QIHA 1NU8A 3I2GA 1CUZA 3DDUA 4RNCA 3HZOA 4PV7A 4FLEA 3G9UA 3P2MA 2XLBA 1XZJA 1BU8A 5AJHA 1OXMA 1XKLA 3MVEA 3WJ1A 4FBMA 3WWPA 3CCBA 1UK6A 5JZSA 1XZDA 1IZ7A 4INZA 3G0CA 3ESBA 3BF7A 5AK4A 4BVKA 3BWXA 1J2EA 2VSQA 2G5PA 2PM8A 4EB0A 1N1MA 4ZGBA 5HK9A 4EY5A 1ACJA 2QOEA 1YAHA 3H2IA 1WCYA 4DSAA 3H17A 3R0VA 4N5HX 2PVSA 4IQ4A 3CN7A 1CFJA 5ALDA 4JEIA 1P0MA 1QIKA 2YXPX 3AFIA 5AKGA 3O0DA 3IUJA 2ACEA 1G66A 4J3JA 3G9XA 4U2CA 1GPNA 5CH8A 2FJPA 1KU6A 1WPXA 1K8QA 4X3CA 1MTZA 3O95A 3R3VA 2WFLB 2WIGA 2XUGA 4QWMA 3VJLA 4MQMA 3QH4A 2BUBA 3HABA 4IH4A 3FSGD 5A6VA 1VXRA 1XLWA 4N5IX 2EDCA 3WK9A 1IUNA 3PI6A 3TRDA 2FUKA 4Y2JA 1YSCA 1EB9A 4BVJA 2WUFA 1JMKC 3W05A 4UBMA 4PF1A 2JIDA 3K2IA 2OCLA 5CT5A 1VA4A 5J3JA 1TQHA 2J3QA 3D4LA 5HQ3A 2JEYA 2ZJFA 3O4HA 3PUIA 4OB7A 4HXEB 1J07A 3WZLA 3H18A 4RGYA 1ZOIA 3TGLA 3FBWA 1R9NA 2CJPA 5IVKA 1Q0RA 5K3FB 5ALJA 3R3XA 2BAGA 2XE4A 1TAHA 4C87A 4GDMA 4H7EA 4C88A 4JNCA 1QIIA 1VLQA 1BROA 1EB8A 1ZJ5A 3FVRA 1XZBA 3DQZA 3QPCA 1AC5A 4J0JA 1VXOA 4Y2SA 3ZLUA 4W1RA 2XMRA 2X5XA 1GT6A 1MX9A 2HM7A 1W76A 5AK3A 2XMGA 5C8XA 4LXGA 1UK9A 3WK8A 5ALSA 1TRHA 4EHBA 5AM5A 3WWEA 3H2HA 3WIOA 5E4JA 4BTVA 3MUOA 3NUZA 1QIEA 1JT2A 1BN7A 2HFJA 1GGVA 1DWPA 3HI4A 1XZMA 4A16A 3G0IA 3M83A 3C6BA 4ITVA 4UFOA 1ZD4A 3DNMA 1F0NA 1WHSA 2XMCA 1IUOA 4M0FA 4JYPA 3CXUA 5JZ9A 5AIBA 5E4YA 4U2FA 3VVLA 1LPBB 3IUMA 1QFMA 3LCRA 5DNUA 1ZD3A 3QYJA 3VISA 1W1IA 1FSSA
chains in the Genus database with same CATH superfamily
3KJEA 4RTOA 1JS1X 4FBLA 1GTL1 1K5PA 3MOGA 4LXXA 2GZ2A 1KWGA 3WY9A 4J03A 1Z7GA 2VDWB 1M2HA 3Q7RA 4JLBA 3EIQA 2O07A 1Z6QA 2NXCA 3L0OA 4PFQA 4RH1A 3U3RA 4X93A 1NX9A 3LK6A 4PSAA 3DDNA 5LPNA 4TS9A 4M0DA 1T5IA 2XZLA 4QWWA 3ZU4A 5T3YA 4ZALA 5E2IA 3GRPA 2K7FA 4ZVMA 4BVFA 1KR5A 3B3QA 3AR7A 2YXEA 4YCLA 4P34A 4A7PA 5JQGF 3ITDA 2H1LA 2EFEB 3OBIA 2QL7A 3RJTA 2FRDA 2H3HA 3HUUA 2N9UA 1ULUA 1UBGA 2HJ9A 2JGMA 2GZRA 3COJA 1WOMA 3RVOA 2HHHB 5JRZA 2A9PA 3CZ9A 3O3NB 2XLCA 1X19A 4MUEA 4F8JA 2H0RA 1GL9B 4RU1A 1Q15A 3GGCA 1HRKA 5EQTA 5HKOA 1PFGA 1YONA 5DX0A 1OIVA 5CDGA 1EFVA 3N2KA 3WTBA 2QT9A 2I22A 1M0EA 2KHZA 1BDJA 2EFCB 3TZHA 3GAMA 3OFKA 4EZBA 1IYZA 5DBGA 3PHBE 4A91A 3FDXA 2X76A 2V98A 2IF2A 4F1KA 4F4HA 4Q4AB 4DG8A 5JQGB 1AD2A 1RZ3A 1DBWA 2NTYC 3DKKA 5BRNA 4R31A 3S8YA 5F73A 2BZ1A 1CJBA 4J9VA 4NQRA 5BWMA 4XYLA 4E12A 3DMGA 1QGOA 2GZ1A 2QAGA 1Z4MA 2ZSBA 5C5IA 1KTIA 4UFPA 4ITRC 1QJ4A 3GV0A 4F2HA 3MWEB 1CQJB 3AESB 3OHSX 4KPUB 2ORVA 1U2PA 2ZIFA 3QEMA 1H23A 2O5RA 1T4GA 3SBOA 2XCRB 2I91A 3AIMA 4OBXA 5JNTA 4MZXA 5JZBA 2LCIA 4L2IB 4BS9A 4K9RA 1VPEA 1DAOA 3UJNA 3EWIA 3ILSA 4XDGA 1FL9A 4YJHB 3TW6A 2I1WA 1JN0A 3A6HA 2ZEJA 2CXPA 3K5HA 1DQRA 4AMUA 1DHRA 1MAUA 4UU0A 4E5DA 3E5NA 1A88A 3IB6A 3F3KA 2O1EA 3DBRA 1MVLA 1MB0A 4EKNB 2XKKA 5KYVA 3B60A 1E2DA 3GRRA 3HPQA 3W5IA 4LRXA 5U9CA 5CJPA 4AT1A 1T8RA 3NGXA 3QOXA 4HDSA 4WY8A 3M9XA 4GLBA 4GYKA 1NPYA 2DHDA 4KWCA 3TNFA 4DC0A 5EJ4A 3CPHA 1XDWA 5FNVA 3VU0A 2F48A 4R68A 2WAOA 2PAAA 4TKUA 1S89A 4L51A 2X6QA 4B35A 2Z4RA 4C4PA 4DC9A 1ECPA 1JR2A 1NULA 1M8FA 4D02A 2HU7A 1CU1A 1N2XA 2FSVC 4NS4A 5AJUA 4YR7A 1YAJA 1Z13A 4PQEA 3ZCQA 1Q83A 1WABA 3HC7A 4L7VA 3ZJYA 4JP8A 1RAGA 3IEXA 1JIVA 2FX5A 3MRSA 3HR7A 2WWTA 3H86A 1OVMA 5JZVA 4BNVA 3UBTA 3ZVKA 4C08A 1RQLA 2ZE5A 4IRXA 4YO8A 1EFAA 3JQQA 5E6RB 2TYSB 4L85A 5AKJA 2JIBA 5M7EA 1LJLA 1V3VA 1YZUA 2J3HA 4MUJA 2BWJA 1R3DA 2Q5JA 1L4NA 2IPNA 2LW7A 1H3FA 3OOHA 4OX9Y 2V9CA 1KOJA 1K1EA 2ZIEA 2EJTA 3Q8MA 3O94A 3NXSA 3QMMA 4Q9HA 5C3UA 2I6XA 1NN3A 2GN6A 1NVWQ 3A1DA 3GMDA 3L8ZA 4DDMA 1CYEA 1IHDA 4H7HA 4HMPA 2E4VA 3PENA 3DBOB 4NU8X 4L0DA 1VSBA 4G0YA 3ANSA 5F1YA 3TTTA 1N5DA 2WVAA 1DO2A 3ND6A 1P75A 3NAQA 3OOEA 4TKLA 4EGCB 3H0CA 3VSEA 1DJMA 5KOHA 1S1CA 2DR3A 5JAUA 2FZCA 2Z8XA 3EZ6A 1P80A 4JODA 2QE7A 1T10A 4K7JA 2X0FA 4H1WA 1JXMA 1E4VA 3K9CA 4L16A 5L7TA 5JDIA 2HWYA 5LP6F 1ECLA 3S55A 4RADA 1IIRA 3FVVA 5ECGC 3A06A 2RH8A 3L40A 3PXAA 1XQWA 4GMHA 2WQ7A 5COQA 1RI3A 4NCNA 1P4AA 4Q3EA 4L5JA 4ZOQI 3DBHA 1PT5A 2EJUA 3NOXA 3L07A 1IEQA 3HYLA 3PKJA 4HADA 5COAA 3V8RA 4NYJR 3WNVA 4BY9E 1D4ZA 1OAOC 4CNQA 5LQKA 4B43A 3H4TA 5EKTA 3FM9A 3EVCA 4PC1A 3UHPA 5KYTA 1HYHA 1LJ8A 2JFZA 3ESDA 4M9XA 4MIEA 2QZZA 1CUYA 4WK4B 3SOZA 3U9LA 5JBIA 1DC3A 2D8MA 2X9QA 4LGMA 4M1KA 4ZO4A 3RC8A 4G0UA 3R3UA 4G1BA 4UEKA 1HURA 3G8AA 5ARDA 3DE4X 4F7WA 1GV0A 3NX4A 3DE2X 2FPSA 4P84A 3PC4A 4EM6A 3BMXA 4IHJF 3BWCA 4ZKEA 4X84A 2B30A 5LP6B 1DRJA 1Z0ZA 4MVJH 2Y2UA 4PM4A 1W19A 3P32A 4NENA 2IH4A 1SC4A 3OFVA 3A4YA 4MRNA 4DILA 1F8FA 1EXDA 4K9MA 2RAFA 1G7TA 3A2LA 1ZLYA 1XMVA 2CHGA 3DVRX 3NEAA 1T3TA 4UZSA 2OE2A 4ISCA 1PK7A 3TJRA 5K0FA 2AFIA 4G5HA 2HIHA 2ZXFA 2HJSA 5F5LA 1QQBA 1NI4A 2ZAYA 5TDHA 2VZ8A 3CR7A 4H59A 4NPAA 2P4HX 3ZU6A 4DNOA 1EG7A 5JAZA 4EGSA 5L95A 1CEYA 2YXNA 5EWJA 4CKYA 1EXVA 2ZI5A 4I6JA 1X1AA 1Z4JA 2VUSA 1WW8A 1FFXB 2XUPA 3O4RA 4XUEA 1X7WB 3H99A 2OFXA 2CJYA 4DM7A 1K06A 5JW6A 1SIOA 3SK0A 1Z88A 2Z9DA 1LA2A 1QTRA 1TM5E 3ID6C 4UULA 5DXAA 5F21A 5GPBA 2OFFA 3BCUA 2WP8J 1JDBB 1PL6A 2PMDA 3QHAA 4WJLA 2WHPB 1N7HA 1QYVA 1UP4A 2YR0A 3HGQA 2NM0A 1JYEA 3RVMA 3W2EA 5FR1A 4PS1A 4XIIA 1PBNA 1QFXA 4AJLA 4C20A 5TY0A 2W2OA 4JI7B 5DXJA 3QE0A 3ZXSA 1PLKA 3A8TA 4H3SA 3O90A 3CE9A 2QSZA 4HX9A 3OIDA 4S12A 1QO9A 5CCBA 1D9XA 3JAWA 1CB7A 2H08A 1XMQB 4TKVA 3V32A 1M73E 2GFIA 2XW6A 5SICE 4KK4A 3AILA 5FUBA 3RRZA 4DDWA 1NNUA 2P2LA 4BP1A 4BYGA 3EZ7A 1RQXA 1ZJJA 2ANBA 2BDTA 2I6TA 1Q0LA 2NV0A 5JVDF 1Z6YA 5KHOC 1ZH0A 4V0OA 3CZQA 5D8DA 1AUXA 2K6GA 3LQKA 1LTHR 2XUFA 4RVGA 1F8XA 3HM2A 1VB3A 2VF5X 2HRBA 3T3EA 2IYLD 4AZ3A 2WKRA 3FPGA 3ROKA 3W3AH 1FMJA 3D9QX 1IB6A 3IQEA 4KOAA 4YAJA 4YP7A 4URUR 4QX6A 2BGNA 4PZUA 2PAFA 3TIFA 2GPTA 4GVPA 4C0XA 5C7OO 4IF6A 2PT5A 3AB3A 3GAZA 2PUBA 4LISA 2O4CA 2YZNA 1HQCA 5LZ4A 2LP4Y 4P82A 4XDZA 3ONEA 1N6NA 1SBCA 2ZSAA 3H42B 4K9SA 3F96A 3T9EA 5EJ5A 3JSAA 4RVOA 4CG0A 2IA5A 3KCNA 1PQ4A 2EG9A 2NZ8A 3H5OA 1OXUA 1N6PA 2KSQA 1QM5A 3M1YA 2FPWA 4NBUA 2W2VA 1JR4A 1M2VA 2R6CA 4QASA 5SY9A 5F12A 3EYAA 5HTKA 1X6VA 1UK7A 3VR4H 2M6LA 3LX8A 1GAWA 1N2SA 1JU3A 2C03A 2P35A 3KFXA 4KWIA 3TLGB 1UOQA 2Q3MA 5M04A 4L6AA 1E0SA 3DYVA 5I7EA 4MO9A 3E7WA 2O23A 2JI9A 2JHFA 2RHOA 1S3IA 3TBHA 5EHQA 4WNIA 1EFPA 3OX1A 2ECQA 3UICA 3ON5A 4A73A 1OKKD 3MRVA 2JEZA 3ISTA 4I50A 2CLMB 1E1RD 1OBCA 5I3CA 1OXBB 2L2QA 3QVUA 4MWCA 5JU6A 4FLFA 1NNEA 1EFHA 1GOTA 2JHPA 4YC7A 3CUTA 3AB8A 3ZW8A 5LP6C 2PXAA 5EERA 4EHLA 3KQVA 1XCJA 4W5WA 4C7MA 1JWBB 2C9CA 3JQFC 2RBKA 1RZRD 2BH2A 1XA3A 4U2EA 3OIWA 4HYQA 4B2YA 5A03A 3FRJA 2PY6A 1NG9A 3PRYA 3LQYA 4JOBA 4RS3A 3WLRA 1D2NA 3OT5A 1AK1A 3UA3A 2EVWX 4ND3A 4B6JA 1E4EA 2VF8A 4Q4HA 3UENA 2EXXA 4EI2A 4NV1A 2Y67A 3ZXYA 2H9IA 1QO0D 2NXEA 3GFRA 1KK1A 5ICEA 5DPMA 3TI7A 1FRQA 2DQYA 5AKIA 4FZVA 1XXHA 4PAWA 5AI4A 4JUIA 1J22A 1KSHA 1YMVA 1NJFA 3DBVO 2W5UA 4PLYA 4MKZA 5E1OA 3DAHA 2DECA 2ZBPA 4HLQB 4X6LA 3TRJA 2WYWA 4BFSA 5IT5A 4JENA 1LJUA 1A98A 1UXGA 1B0UA 3OZFA 1XD8A 3VKVA 4FB5A 3ZC3A 3C39A 1RJGA 4KLNA 3FVWA 4NEHB 3TQIA 2KPOA 1P5RA 2DKNA 1UBEA 1KEPA 3AM4A 4L76A 1RWPA 3BIXA 1M8KA 3FI9A 2QDKA 2QTNA 1EK1A 1Y8ZA 1L5RA 2BGMA 2Z3WA 1RZVA 4HUQA 1OD6A 4JD5A 4B2LA 5BURA 4G5YA 2GRJA 3IBCA 5KWEA 1T5BA 3CS3A 4KQ9A 2HF2A 2PKWA 2VPIA 5B3JC 4CQNA 4DA8A 4J16A 1B6TA 3O0TA 4H7IA 1GZ3A 5G0WA 3QUAA 3M7IA 4DCJA 5AW6A 5EMMA 3SJUA 1GZ6A 2ZJZA 2X9GA 2AXEA 3QELB 4F71A 1F8UA 2J45A 4RGVA 4AS3A 5JXJA 5BSVA 3O2NA 4GOJA 4YCAA 4PZ9A 4P98A 2XRMA 3C5VA 1VYVA 2BMAA 2MHCA 2PLNA 4WOJA 5C5CA 4QULA 4URVR 5CVJA 1Y1TA 1SB8A 4LPKA 1H1DA 4REMA 2HV8A 1Y9JA 2H63A 2IHBA 1EFCA 1QHSA 5KYUA 2OY0A 3HVUA 1FJ2A 4ERXA 4OAPA 2WM2A 1TF2A 5G1OA 3HADA 1RABA 2X41A 3JXEA 3J7TA 5HJ5A 2RONA 1OPRA 1WJGA 2JLSA 4BNYA 4QLBA 2QJWA 5T6BA 1HO3A 4EJSB 1J21A 4COOA 2CGEA 4UTNA 2WLSA 4BP8A 3N8HA 1USUA 1WQ1R 1HKHA 3I76A 3ZVRA 3OC0A 3DEKA 1NVBA 1E5XA 1JB1A 2QTFA 2HHJA 3MEQA 1RHUA 4K1LA 4NESA 4PQYA 2FFHA 3QE2A 3STUA 1YOVB 4ZARA 3FYUC 1VKNA 2XB9A 3O21A 2F4VB 3U17A 2BT4A 3BKWA 2QGFA 2H57A 4BTEA 5I01A 2AJDA 1IIBA 2V6IA 4QOEA 5BYBA 4TS3A 1H5UA 4HL6A 3UWOA 3HO8A 2TECE 3MXTA 2Q28A 3RHSA 3AF3A 4Q3NA 3IP3A 3ET5A 3KT6A 1BQ4A 2PXHA 1D8TA 1JG2A 1ZOPA 3OTWA 3LMKA 3B70A 5A1JA 2X86A 3ED5A 2NU8B 5BMVA 5C3MA 5ADWA 8LDHA 1V1MB 1QF7A 3OETA 1E9DA 1DADA 5DTRA 4HDKB 4S3MA 4DZRA 5C8DA 3Q8LA 2Z2ZA 1UMBB 4D6XA 4ZEOA 4PYRA 5FBVB 3C24A 4JI8B 1J0EA 1RXEA 3L4BC 4G1FA 3SPXA 3WB0A 5IX8A 5J4VA 3N59A 1OREA 1UDCA 4XJVA 5ECYA 4M9SA 3BTUA 1HTTA 1D6MA 3FB4A 2RJ3A 3ME5A 2G7ZA 4RMJA 2ST1A 4TTIA 4MGIR 2WJ6A 4P54A 3TEJA 2OAEA 3NBFA 4QGHA 4E94A 4FBGA 4FNGA 1OOEA 2WBLC 3ZKWA 5AXBA 2BFPA 3ENKA 1MXHA 2JIQA 4TV9A 1YBAA 3FFWA 3I28A 4UDXX 5TGDA 3V8QA 4B3XA 5B58C 1P5HA 3G2KA 5TMPA 2J9FB 2WSSA 5IP5A 4P0QB 4N40A 4ZYWA 1MIHA 2E3JA 2V4ZA 1W4LA 4YVFA 3G7NA 3MS4A 4PBTA 1OLXA 4A6PA 5AUNB 3NFRA 3SXUB 4KQ1A 2OGZA 4IFIA 3ETCA 1VLHA 4X7RA 1ADYA 1BGWA 1YVRA 4O4LA 4E1AA 3IQWA 3N74A 4AXBA 3IE1A 3FUTA 4CLHA 4DDTA 4DG5A 2VUIB 3AF5A 1XRNA 1VG0B 5T8KA 3FSGA 1ARZA 3JD1A 4G4JA 2V6JA 2C0PA 1DKQA 2NU7B 4G5FA 5NLLA 2R1VB 4HGPA 3WHLA 1L9KA 3TEMA 5DLEA 3AJDA 4D4JA 4DMKA 2ZCJA 3GFSA 3LQ1A 1VI6A 4N4AA 2OO5C 1T5DX 5TARA 1CUUA 2FF7A 1BFUA 1J09A 2OHJA 3WFIA 3GLFE 4X1OA 5ADHA 5IULC 4MQEA 3WL7A 3KSDO 3L46A 4M53A 3O3MB 3QEKA 1TLLA 2XSZA 1FK8A 4OQ4A 2R1TB 1NXWA 1CS4C 1DNPA 1UEJA 4QBHA 3A9VA 3M6AA 2R6GA 4CMAA 1ZMRA 2V7PA 4MULA 4NSNA 1HI9A 3T15A 3SSNA 4U2BA 2H2FA 3Q7PA 1ZK2A 4OQFA 4WAUA 1NA5A 3OI7A 4PZDA 4WN9B 4DNXA 2YJ5A 3C6XA 3QZUA 2JKZA 3HB1A 2I4MA 1LKZA 1OGYA 5DYGA 5FTNA 4F2GA 1KC3A 3ZPXA 2YN0A 3D8SA 4ZD6A 3VYRB 1QFZA 1Q7BA 1JFRA 3A1VA 3VYTB 1ORVA 3AF0A 4C5BA 3B48A 3ZNNA 4NJEA 2Q3CA 3PE6A 4HG2A 3E1KA 1IXKA 4LZZA 3SF8A 3FCXA 3PNSA 2DHEA 4TLLB 1A7KA 2TMYA 4LHEA 1Z15A 3MG9A 3D8TA 3VR0A 2HNKA 2P9FA 4RZXA 3PUHA 1N0HA 4B9EA 3CEMA 4KPFC 1H65A 4RHEA 4Z7QB 3SEZA 3IB3A 3LRTA 3QU9A 3H2ZA 4NPCA 1X0VA 1J0DA 3V80A 1I13A 3I04M 2C2GA 3GJ0A 4RMHA 4S2EA 4LJSA 3HKDB 4U3JA 4EGQA 1LBTA 1CG6A 4KCGA 1E2GA 4Q7MB 4RIHA 5DN6A 3JQ9A 1OFIA 5AW3A 1B1CA 4LQ4A 5LYJF 3GZNB 2DQKA 3AY3A 1P7VA 2FKAA 3WDMA 5EGSA 4GZ5A 2FQ1A 3OX3A 3WGHA 3FOEC 4A0FA 4TYPA 4BB9A 5ILOA 1EDDA 1XKXA 4JL8A 3RHTA 3HKCB 3BMQB 3G2OA 4RSGA 3PC8C 3DR3A 1I6WA 3KD2A 5FWAA 3DKRA 3H7IA 4BPRA 4NOLA 4RF4A 4BO6A 1L5HB 5CPFA 1EWTA 2ORWA 4CF7A 3AWDA 1GTMA 1MDFA 1Z0JA 3EVGA 3NHLA 4H17A 4WTOA 3OOYA 3ROZA 2PRJA 1XPJA 3KKMA 1DBIA 4I4TF 2YNMC 4KYTA 4EDHA 3AVXA 4GPEA 2WD7B 4UVDA 4DYVA 1EKXA 1DC5A 2R66A 5HG0A 1Z5NA 2HZBA 2NU6A 4D8YA 4F5DA 5LYJB 5BN1A 3R9WA 1IPHA 2WJIA 5HKKD 4G1MB 1W0KA 2AG5A 2X8LA 3QBTA 5AKXA 1P81A 1T0HB 3PL5A 5EIWA 2A1UB 4EWLA 3D6UA 3VR5H 1TADA 3TNLA 1ZKDA 1NATA 3B2NA 2AR0A 1JVBA 2XGMA 2WSYB 4HWKA 2OORA 4R0NA 1BD3A 2P0YA 3L04A 5CVEA 3SS8A 2C5AA 1R5JA 5FOSA 4GF5A 3TLYA 5JH7B 1KFEB 4Y2PA 4G01B 2PR7A 1GTRA 1RRPA 4Z51A 3HYTA 5CBPB 4HBZA 4I4TB 1GU1A 1HDEA 1XZPA 2R3SA 4J7CA 1ZR2A 1ODJA 1U5CA 5D51S 1KU0A 4BFVA 2AI1A 2PUGA 4BNJA 3MGBA 4MQFB 2IYNA 4LIPD 1NYRA 1VZ3A 3UXMA 1ZK1A 2P9TA 4JUFA 2QLTA 2B8WA 3ZK8A 4PXAA 1QWSA 1ZH4A 5JANA 1N2IA 4HOYA 4BASA 1SMKA 4PCAA 1KYZA 5BVHA 1TAGA 2P6MA 3EA4A 4DUYB 1OFVA 3L0BA 3ZHXA 3ROEA 4DDVA 3NC4A 1IMJA 3K8QA 4A0QA 4DDUA 4YB8A 4E70A 1KNXA 3FHLA 1NXPA 4YT2A 1HE1C 2GNOA 1WXXA 3QVXA 3EVFA 5L4LA 1TOAA 2V0GA 1MW9X 1Y8CA 4CLOB 4M1QA 4OXYA 3PCXA 2WHXA 3TQCA 2VDMB 3U0VA 1C9MA 1W48A 1YZQA 2FZ5A 3X44A 3K6SB 4R3NA 3BJEA 4KUHA 5ALHA 5HKBA 3KE8A 3IT0A 2ZYWX 4RA6B 3WI7A 1U0RA 4JLAA 5DISB 3LO8A 1AKVA 1FTQA 1B6GA 3L6DA 3SQOA 3G2QA 1ACMA 3DP9A 4UHDA 3ZD8A 1SA0B 2D1QA 1ADBA 4DLAA 5DEIA 4BKPA 2VUTA 2VK8A 5IBQA 1QRDA 3TOXA 1CF2O 1MAAA 3PYMA 3NTUA 2NX2A 2Q9AA 4CIXA 1EVLA 2OCIA 4KN6A 2Z1NA 3BYZA 3RFVA 2ZJ8A 4V02A 3DZBA 3KZNA 4WZAB 1FW8A 2GTPA 3TSYA 4MGZR 3WXMA 1Y6QA 4XB6B 5JI2E 1CEEA 1RM5A 1T4BA 3DZHA 3O9VA 4HK4A 4MWSA 4EYKA 1F51E 3OPNA 1R10A 1B26A 1RI2A 4P5DA 3THXB 4PX9A 1FTYA 2D7DA 5AW4A 3MTDA 5B37A 4QDTA 3OJCA 2PX6A 3OVMA 1YZFA 1F3OA 4H0FA 4YRTA 3RANA 1T9KA 1QC5A 1WMAA 4QRDA 3TLKA 1XMSA 2JF0A 4IGFA 4POAA 3BB1A 3KPJA 2D74A 2GJ8A 4KQ2A 3V4PB 3STWA 3ZY4A 2G5TA 4XYEA 3WLEA 4BJ5A 2Q7XA 2PMCA 2PUDA 3QIVA 2GOYA 1L7AA 3T9AA 3ELDA 3I9V6 2GXAA 4MUHA 2GHTA 2V6FA 3RKUA 3MTIA 1SXQA 3ITEA 3C6QA 4BNDA 2PKCA 1AZTA 1VCOA 2CVPA 2HB6A 2IU0A 5A3QA 3DLBA 1X9IA 4RELA 2UZ0A 4NXNB 5K0SA 4KQFA 1PZHA 1N7IA 1V3TA 3GVXA 2OBBA 3KYCB 4P58A 3ZZ0A 4EZIA 5KHLB 1N77A 3BPSA 4DNQA 4JT4A 5EKSA 1TCCA 4PIPA 2YKGA 2WG1A 2UXDB 4G89A 1EVYA 3KUUA 3AY0A 2X9VA 3RTBA 1SU7A 1OZHA 4G23A 5F1OA 3DF7A 2OZKA 4ZC8A 3WBKA 3V7YA 1MNQA 5CDSA 2CV2A 3GVIA 4X60A 2RHLA 5CX1A 3C16C 1PWXA 2M2IA 1NYQA 3KWLA 1CUVA 2YXBA 4GM0A 4L8FA 4TMXA 3RE1A 3UB4A 1YR3A 1CUIA 3KG2A 3JQ7B 5IKXA 4YMUA 2ZBFA 4LDAA 2VRCA 4WE3A 1JKJA 1BRTA 9MHTA 5E3IA 4B7AA 1M5UA 3W5DA 2I0FA 3ODGA 4IX9A 1JLHA 1KFKB 1N32B 2WQ6A 3HMKA 1S7GA 5B53A 2DCUA 2ET6A 3K96A 3H2JA 1CY0A 2JLQA 2ZJ5A 4MWOA 2IT1A 5JD3A 2EIXA 3U13A 3V8MA 1W46A 4FYIA 4GPZA 4C04A 5B3KA 5CCXA 1T4MA 4EVSA 4FIDA 2AFHB 4FW8A 2Q2WA 3OKPA 4FMPA 4PQFA 1B16A 4P4TA 1J8QA 1PJ2A 2IJGX 4IQGA 3E9QA 4QHYA 4IZIA 5AVKA 2CF6A 1KGSA 1CJCA 2QMQA 1JAYA 2D3TA 3FDFA 3NZEA 5C34B 4D6PA 1MABB 5IDXA 1MQ9A 5IZCC 5IT9A 2JBAA 4K87A 1RJDA 4DLYA 4TYNA 1KP3A 1ZJ6A 1SRRA 4H3KB 3K9QO 1P0PA 1SUWA 1QQ5A 3O84A 3EASA 2Q0HA 2XNDD 3I8SA 3NIGB 4J0CA 3VZPA 1R0SA 1KXZA 2VT2A 4I9UA 3VTKA 2VT3A 5K5EA 3F9CA 4PG7A 4U7WA 2H1IA 1ZXLA 1PJAA 4D9BA 5JAMA 1T6YA 5LLTA 1E9CA 2DEUA 4EI7A 4HN4B 2V5UA 2V7EA 4AIRA 2CL5A 3KL2A 1C9EA 4CLXA 5BN3B 1NXQA 1EFKA 3MT8A 1KAOA 3GP5A 1E0DA 4Y9TA 4Q37A 5K0LA 5KOJA 4DV1B 4U2GA 1FS5A 4HEQA 4JJEA 5JHHB 2AZDA 4G1UC 4OXIA 1RXVA 1P73A 2A88A 4C76A 3FTDA 4OM7A 1K7FB 1KBZA 4ZI7A 5JCZA 3GFGA 5BQ5A 1G59A 5IM4F 2VT7A 1ZGBA 2RAVA 3LBNA 1RTKA 3R3YA 3B2EA 4JXXA 1HZZA 2YJTD 2EOAA 4FFSA 3B52X 3SCZA 1E6EA 4XYMA 2WIKA 3WMGA 1R64A 1AKMA 2Q8QA 2RI0A 3KQWA 4OGKA 2O52A 3PICA 3W0LB 1ZGAA 4HRYA 4RCZA 4NCAA 1IPEA 4X3CA 4YNBA 4E5MA 5ER6A 4F8EA 5EKDA 3VFDA 1OJLA 4KFCA 1QRRA 8ADHA 3KXLA 4JI1B 1HKUA 1JHAA 3A6KA 1NRJB 1PSWA 1R8XA 1VOTA 3BGDA 3MIIA 4RMNA 4KH0A 4X1KB 2WKSA 4RDXA 3EX7C 3DWFA 3VGPA 1NY6A 5K0BA 3O4VA 5LDGA 4QVIA 3ACBA 2A2ZA 2XUZA 4H6XA 4LFBB 1PJBA 3NBZC 2VWHA 2Y1LA 1KORA 5FYDA 4JXZA 1YTUA 2V7UA 4JS0A 1A9RA 1P4HA 3CEHA 3D6FA 3P97A 4G37A 4DLLA 2YWXA 1EQAA 1WHSB 1A2OA 3DLPX 3LF2A 4FHZA 2X8WA 4DZTA 3QX9A 4TV8F 1M5TA 3IX7A 5MF6A 1P2GA 4FX2A 3U7JA 3ZCRA 4JJAA 4CCYA 3BHMA 1C7QA 3TMYA 4ZT7A 3NUQA 5LQCA 4AN4A 3UWPA 4PYOA 3RSGA 3WAGA 1MORA 2JA1A 4QAJA 1IBCA 1NFFA 3ASVA 2ISQA 2FWPA 2PANA 2VPXA 3DTYA 1BQEA 2IXBA 2R4QA 3L0DA 5EKXA 4D0RA 2X8AA 4U6NA 4PNEA 3J80A 1UCFA 4MCHA 4Z8YA 4DQXA 4EJ0A 5JY6A 3G9ZA 3Q98A 4IBOA 3FMOB 1JB9A 1M1YA 1MN6A 1C14A 1PNVA 4IOKA 3V7FA 3I61A 1QP7A 1LS1A 3CMCO 3K4PA 4HAWA 4L4SA 4NPHA 1O3YA 1V7PC 2YJ3A 2FWMX 4FCVA 1R2QA 4TV8B 3SQNA 4TMFA 3CHYA 4FGJA 1Z12A 1J42A 3GA7A 3O8OA 2CFIA 1MAVA 3G8CA 1UJCA 2ZSDA 3ESAA 3VKUA 4YJFB 5LSAA 5ED0A 2FZEA 4FGUA 3Q88A 1DDOA 1CUFA 4H4EA 4O29A 1KETA 1YNSA 3H5RA 5KAPA 2JIMA 3R23A 3DL4A 2ZBUA 1E2LA 1CCWA 1PJRA 3LCUA 2AC7A 4NU5A 1FSGA 2YDYA 2JVJA 2AZMA 4QELA 1JIJA 5M29A 3T41A 5CK4A 5BUQA 2AJLI 3A25A 3S2YA 1Y7IA 4OEHA 1ZNQO 3AHFA 3CNBA 1LZLA 2CB9A 2ZSIA 5G2OA 4X6UA 5JCJD 2FG7C 3FYCA 5A4IS 5ALIA 5HEKA 1K6EA 1U90A 5CVCA 2VPYA 2OZEA 2XODA 4ZV9A 2BKAA 4XCVA 3R9IA 5AW5A 2OCGA 3EH1A 5JAPA 1A9SA 1WUYA 1E1CB 2AH5A 4OATA 5HHTA 5B6JA 1DAHA 4S04A 1W4BA 2ENUA 3A6GA 5BSMA 4F3YA 3P2YA 1WXHA 1EJ6A 2Y0BA 2G06A 4RKQA 3RSFA 2JI6A 5J43A 1VGVA 1FQJA 5AT1A 5AXAA 4M8LA 3D4PA 2XA2A 3QFCA 5ALPA 1UBNA 2A9JA 4EGAA 2CFSA 1OC4A 1PKEA 3LQRA 2PX4A 4ZJPA 1G5RA 4I1YA 4DY6A 1AN9A 4LOJA 1RYNA 5KNLA 1U5BB 1YRAA 4ESEA 2EG5A 2E37A 3DDHA 4EPVA 1Y8AA 2MSCB 3DVAB 3EWNA 7GPBA 3BERA 3UMJA 2EKDA 3IVXA 3L84A 5EJMA 4E2YA 1JVNA 3IUYA 1L4MA 4IIJF 2IGTA 3F5MA 5ARBA 5BSTA 1E2IA 3ZZMA 2MINA 1HT1E 3D5QA 1W5SA 2BEVA 5DTQA 2RK4A 1C5KA 4WESA 4HNVA 3GT4A 1PG2A 3PFCA 3UJHA 4CFYA 3KB2A 1KO7A 1R0KA 5D3KA 1UT6A 5IKEA 3RLFA 4C14A 5HYVA 4U5XA 1EA5A 5A4AA 4Q9DA 1E1MA 1GA6A 3MT9A 4GZ3A 1MJGA 2D2FA 2Q9BA 4XWAA 5SYNA 3QJGA 4OIFA 1OH8A 1QCYA 4EPWA 5IDQA 1OKKA 1JLKA 2GMWA 4MQBA 1E1RA 6GPBA 1P7CA 3ND7A 5DM60 2QDXA 1C7ZA 3LLCA 2QM0A 2CNKA 3CLRC 3GUCA 1DO0A 4P7JA 4OFBA 2FR8C 4LZJA 4TOIA 5ALYA 1WEHA 4AX8A 1AQJA 4LWQA 4IIJB 1GFZA 4YREA 1AKNA 3NJRA 3A37A 3RK4A 1DMRA 2YYYA 4D8UA 3UGTA 2YY6A 3EPHA 5LBTA 2COUA 2NQ2C 3KSUA 1EESA 3GAFA 3AB7A 1O4WA 5DGTA 1A5AB 3UHFA 1IEVA 2OZLB 2CLDX 2WUVA 4DXAA 1G8FA 1DRVA 3KQPA 1YFZA 4MR7A 5KWVA 3V46A 3TR0A 3DHNA 4P5EA 1KZ9A 4Y6LA 4TYQA 3TLMA 3SICE 1V9SA 1QO0A 3GJYA 3KOXA 2RGNC 3QWIA 1F38A 1YHNA 3A27A 4X8HA 1M54A 1I1HA 2O0JA 2RKBA 3LGXA 5ALEA 5AD1A 4KHZA 5J2UA 1GVNB 4Z1MD 3H11A 3VNUA 2G1AA 4YACA 1GPH1 2VNIA 2GBLA 5TQJA 1UJ5A 2VCHA 5KIAA 3IC5A 2PT6A 2ZSUA 2ERCA 1ZISA 4DMLA 2XTZA 1VTKA 3OSZA 4E2XA 3F6EX 2BDEA 2Z5LA 3PT5A 2HMSA 3BOSA 2YZ2A 1UADA 1UWCA 2HF8A 1DSSG 1QRTA 3QG5A 3B9RA 3SX0A 3LLVA 2FF5A 2LD4A 1BAPA 1D1PA 3B38A 4NYMQ 1XDZA 4R1LA 2XRYA 2QGNA 2CJFA 3BL8A 4N9QA 2Q6LA 4E7OA 1O95A 3HA2A 4DKXA 2RE8A 2IYUA 5AVWA 4K0KB 5I4BA 1GKKA 2RHJA 1HG1A 1PGNA 1D2AA 3EXG1 1PZMA 1IZYA 2PL9A 4IDDA 1JFFB 3RD5A 4P0TA 4PRYA 4WBSA 4HLUA 5FBZA 3VBCA 2R6AA 3PKIA 4XWTA 4CUZA 1EMDA 1W85A 4IQ0A 4UD2A 2JCYA 3WL6A 5B3LA 2FSHA 3N53A 5JE8A 3O8RA 1OU4A 1SH7A 4OLFA 3SKXA 3A6PC 3F4KA 4WDRA 1YVDA 2IYEA 3HWSA 3IL2A 2WKWA 3HUFA 5CA0F 2PUWA 4PG5A 4B4DA 1JG4A 2PSHA 3HN7A 4YV2A 1Q74A 4G26A 1ND6A 4PSCA 3L4SO 2J0UB 1DBVO 2ZRJA 1BWRA 4CODB 1SUPA 1L7NA 1XTQA 1IXZA 4JB8A 1C3EA 3OQIA 4WLUA 1BE1A 2WJPA 4B83A 1DVRA 3DO6A 4DJAA 1DTWA 1U1CA 3G9QA 4CM9D 2C92A 4BVAA 2EKPA 3F7TA 3N8KA 2V55B 3DFFA 1TJPB 2ACWA 1SCJA 1CRLA 2C2KA 3H9BA 1E2JA 1G4HA 3IBGA 3NXKA 5BUZA 4ERNA 3QV1A 3P26A 4EJ6A 5CFMA 4UCWA 2XYVA 4YCBA 3QF4B 3DONA 3M3PA 3RABA 4ZEMA 4D6YA 1R0XA 1JLLB 3BE8A 3WDKA 5CA0B 3X0DA 1KI6B 4EG1A 1YZGA 2PE5A 4LTMA 4J6FA 2Q3FA 4OJYA 3FIJA 3A14A 1JQKA 2AKYA 2OHHA 1VG1A 3WLFA 4UMFA 4O5OA 2WT4A 3LH5A 3TLEA 1RJ9B 3V8EA 4H16A 1UPFA 3RVDA 1JEQA 1XHFA 3CUSA 2O5CA 1P61B 4KYVA 4PNPA 5DI3B 1JAZA 1HE5A 1RWNA 1WEKA 2J6CA 4KAJA 4KXFB 4I99A 3ZR4B 5J4KA 2XYHA 1XN4A 5CNMA 1BHQ1 1Y0BA 1MD9A 5IEJA 4HAYA 3GLGA 3D7RA 3GJRA 4RWEA 3FR7A 3LUHA 3GGDA 1L8LA 4FGLA 4L3OA 5BWCA 1AMNA 3C3MA 2JRLA 3AUXA 4YT4A 2ZT5A 5ES3A 5F76A 3O92A 4M88A 1JZSA 2PRZA 4DCCA 4A0SA 4CIWA 3FJYA 3T3NA 2BP7B 1KP9A 3L43A 2C95A 1VBKA 3IJ5A 4MRSA 3UJ3X 4TVKA 3DL2A 1AZWA 1YRLA 1Z8NA 3BGIA 4LXHA 1NVDA 1R50A 4UJ3A 1GYPA 2VF4X 1QP4A 1VL6A 1VI5A 1N2GA 4N5DA 1F4LA 4NY1A 2G9NA 2B3DA 1DIRA 4RYDA 4JU9A 3RJMA 1C4XA 5CPBA 3AZQA 4MTCA 2JHGA 3WTCA 2JAWA 1G3MA 3PRKE 2MR5A 4RIFA 2WVJA 1XLTC 4W5JA 1E2KA 3UPTA 1EGMB 1K8XB 2JJYA 4MKXA 1QO7A 3TOCA 4DSZA 2XRFA 1ZI9A 2P6RA 1B76A 1ZUIA 3COZA 3P9NA 3OQOA 4UCQA 1MJFA 1NT2A 4P7GA 5IZ4A 4C7OA 2O05A 4CI9A 2MYTA 1WU7A 4Z99A 2AXNA 1C3OA 1HV8A 1JJIA 4RFLA 5TS3A 3OPYA 2E6KA 1CVRA 1NXTA 4EEZA 1G21B 1TTQB 4QOHA 5EWMA 5A9SB 2OCBA 4JUAA 4TXNA 4KLZA 3K05A 3JPYA 4G4SP 4IIBA 2F59A 1O8CA 2FWNA 4QNNA 5JPDA 1T1JA 2IVZA 2L42A 3IRUA 1DIHA 2PQ0A 1U5AA 3DE1X 3IUQA 1RVDA 3KVNA 1E9FA 4F1JA 1VG9B 3RGWS 4QUIA 1JBKA 1O87A 5MHTA 3MTGA 4ETIA 2WU1A 3C48A 4YECA 1CZUA 4QPCA 2YV2A 4LX8A 1ZK4A 1AHPA 1UZUA 2ZATA 3EFOA 2ICAA 5AW0A 1CR6A 3QEBZ 1R6VA 3VDQA 3PFGA 1LVUA 4JEMA 4LWPA 3S27A 3MWYW 2HA7A 3HKBA 1J1UA 2GAAA 5CLHA 3L0SA 2X1MA 4P4SB 2W6CX 5ILQA 2BMDA 4U5QA 3VR2A 3EXHA 2IXEA 1I0ZA 2ZTHA 1Z2DA 4EY6A 1IOZA 5CA1F 1FYFA 4IJQA 3F71A 1ZU5A 1GZ5A 1ZONA 2CHVA 1C0EA 4EX6A 4EA8A 4PIVA 2CHEA 3DE7X 1SKUA 3F6CA 1Q5PA 4QO8A 1NWCA 3MTQA 3P9QA 4LY6A 2X1HA 1U1GA 3BRSA 4RTJA 2YRFA 4TTPA 2P9EA 3FWHA 1GRNA 3KOMA 3VR6H 1Y4UA 2C5GA 1EX1A 1BJRE 4FOTA 3UQZA 2JL1A 3ZBPA 3TQRA 1UKZA 4JY7A 4DA6A 3I5XA 4AQYB 3GRFA 1USIA 3CRMA 3IDQA 1LPAB 3L18A 1RLTA 4JVNA 4D42A 3ER6A 3DAPA 1SQ6A 4ENPA 1PU2A 2PGJA 2OBMA 4QGGA 1S3SA 2FW7A 3MOSA 4WLVA 3D81A 3DLAA 4LYHA 2VAVA 1PGJA 2CD9A 3NJ4A 2Z57A 1F2VA 2EAUA 1WXQA 2IYFA 1CW2B 4Q3BA 3EXAA 1NLFA 1NTOA 1WV1A 3JRXA 1E77A 3HP1A 2NACA 1AQIA 3TKLA 4DSOA 3RTDA 4FJ2A 4BJ6A 5K09A 2D2IA 4KR0A 4MVJF 5D6NA 4PICA 4O3MA 5EE0A 3GVCA 3SC4A 4WVLA 3ND5A 1GGNA 1BHO1 5L4NA 2QAIA 3GCZA 2XVMA 3F5FA 2OUIA 4LF4B 1E5QA 3OF5A 1JVSA 2IEYA 3IP7A 1AB5A 1F0KA 3LKZA 4HPXB 4KQKA 5FLYA 4B2PA 1H66A 1MV5A 2C9OA 5H16A 2E89A 3D2AA 5DJ5A 3LZCA 3J81k 4RLFA 1UINA 3CGWA 4JLMA 3EIEA 4J4TA 3Q7TA 1FP4A 1TVKA 1X8XA 2MSLA 3LC7O 5A3RA 4BGDA 1RXYA 4KIUA 1PJTA 4FEAA 3W7BA 1GCOA 1H4TA 4PLFA 3V7NA 2P2GA 3DOJA 3GC6A 3RIYA 3HJUA 3K0HA 2IYAA 4MR8B 5DTIA 4LQLA 1EI9A 3S3TA 3KQSA 1RXSA 2OL4A 2XXJA 3FLMA 4TT3A 4MTLA 4ZJZA 2WHQA 1AB6A 3EYWA 3PWTA 3WICA 1Z34A 2PN1A 1MOSA 4D8TA 5KYNA 3OEED 4REQB 1K0FA 5AKEA 2FP4B 5FPYA 3SBXA 5ES4B 1YBMA 1R6XA 2E82A 2FKNA 4MJ3A 5AI8A 2O5VA 1CPYA 4LJ7A 1TB4A 3KOUA 4BNKA 4OKIA 5P8WA 4HNAB 4CTKA 3OZBA 1YS4A 5IH7A 4RJKA 4LJRA 4QDZA 5K3EA 5KVQA 3V1LA 3PHLA 4BGEA 1PZXA 2IP2A 4I9GA 4M1ZA 4QICA 4M9ZA 4RD4A 5JI3E 5BR8B 5IXJA 4D9EA 2ZYHA 2HK8A 2HMTA 1EBBA 2V65A 1RPJA 3AKDA 3WLLA 4MYRA 1BN6A 3WQHA 1BHJA 1GAQA 2BV3A 2WIBA 3Q0IA 1XNHA 1YFLA 4KPEC 3OM0A 3FTPA 1QFSA 3FGNA 4YAGA 1YCFA 3DDOA 1XEXB 3K9FC 1KY3A 2PUAA 1THMA 4I1RA 1DQSA 3K7EA 5GIPE 3IHTA 5AQEA 2NTEA 4UC0A 1X8JA 1JMVA 3I0NA 2FPOA 3ZCXA 5C81A 4Q82A 3K1AA 2ZTLA 3D8NA 1V1RB 2GR9A 3F2IA 3KUXA 4LJ4A 4RAOA 1FBTA 4UHBA 4R1TA 4W1PA 4BX8A 5IT0A 4Y1RA 1BXZA 3PQ8A 4PSVA 4JMPA 3GH1A 1M8PA 1B0ZA 1KO4A 1RS0A 4X45A 3TSAA 1HL7A 1YJCA 1UJBA 2P9CA 1TJNA 4MV5A 2O8BB 3UY4A 1Y3IA 4FX5A 3JAMA 1RLJA 2I55A 2ZXEA 1FA9A 1LXCA 2OEPA 2V7TA 3VMFA 3LUPA 4CN9A 3GFFA 1V7CA 1EYZA 2JDID 2HCFA 4C4ZA 4M60A 1Y3DE 4XB2A 3I32A 2Z95A 2WM3A 1DEKA 2AN5A 3S44A 3GBSA 4KGVA 4PR3A 3ZWWA 1LBEA 1O58A 1RYBA 4FDAA 1NI3A 2QPLA 3FH0A 4XUGB 2GWHA 4O1MA 4UNNA 3OJXA 1SXJA 4MS1B 1GCIA 2FN8A 5EHNA 2UVPB 5B2ZA 1LK0A 4C2UA 1E69A 3HB9A 1KVRA 3ZEAA 3AERA 1MIOA 4ASUA 3DXYA 3JWEA 2IBSA 1VFPA 3H9GA 4INJA 3RYIB 1GNTA 3B1ZA 2XNSA 3ESRA 2QZPA 3SZMA 4D9IA 3CINA 4PQGA 1SU6A 7ADHA 2OHIA 1RPZA 1Y48E 5THXA 5EJFA 2QR5A 4XJSA 3U44B 1ZA2A 2OG1A 3RF7A 5LKRA 4A0HA 1PQWA 3HFRA 2QTLA 2BFCB 3DXFA 3GUHA 1X1EA 4OBBA 1JDTA 3BH7A 5CT6A 4CIBA 3H7AA 2UXCB 3M5DA 4L5CA 4P6VF 5K3DA 2XCLA 4HXGA 7REQA 3R9KA 4ARIA 2OV6A 1CJTC 4UUPA 2AKAB 1BXGA 1WSAA 2WD8A 2OBNA 3SZUA 2HCTA 2ZLBA 4RPCA 4Y9RA 5TMEA 1NJ8A 4ROSA 4EJ2A 3GY0A 3EGIA 4BFWA 1XZKA 2XZDA 4CMEC 3RV4A 4MS4B 5TPZA 1Q0ZA 2DBRA 4M83A 1IATA 2D59A 3TAXA 4QUKA 4JYBA 3KYDA 3KAKA 4LDPA 1D3AA 5B4TA 2XUDA 3CG4A 3PJDA 3RRXA 4DW8A 3R3WA 4YJKA 1CK4A 4HLNA 4QU5A 2Y92A 4Q1FA 1KI3A 4U02A 2IIQA 5A2GA 5DM2A 5JLJA 3B9PA 3FNBA 4KRFA 3UK7A 4DPKA 1EWKA 2QORA 4D74A 3ZQJA 1FTWA 2YYZA 1R66A 3Q7EA 1H9AA 1JAIA 3IGFA 1RMTA 3TBFA 1KVSA 2VAPA 4Y2RA 3ZD7A 2MYPA 1RHQA 2HMAA 5FTLA 2PL5A 1WX1A 4BQRA 1CNMA 3NNSA 2AXPA 4GG1A 1QZ3A 4MW0A 3WSWA 1Y6JA 1G18A 4G8DA 4KUGA 4L74A 4XOUA 5LNK6 4K8RB 1TTHA 3CLUD 5SZIA 4ZRMA 2FEOA 3M49A 2WI8A 2OHOA 4KXLA 4UTRA 1Y3CE 1ZY2A 4JSYA 1DXQA 2Y3IA 1B93A 1CDOA 3ZCPA 4P36A 2F17A 5I7OA 3R7FA 1MP0A 5CLJA 2FZKA 1M8JA 3HACA 5GV7A 2PUTA 1X80B 5CB0A 2ANCA 2QT1A 2XQJA 4GM4A 4WN3A 1BSVA 2CNBA 1GZUA 1A4UA 2LE0A 3RTCA 4M9RA 5LMZA 1E2BA 3ZEIA 4RJTA 3PXEA 2QQGA 1C9DB 3HR8A 1YZYA 4MS3A 3GYGA 3PGJA 3AUSA 1IVSA 1NMQA 3DQQA 2A8YA 1V7QA 4FLMA 4FFMA 4F2WA 1Q2XA 3FHOA 3P96A 1NC3A 2Z2YA 4DANA 5B3AA 1A95A 3G1UA 4FUTA 3KEFA 4HBGA 2HC9A 3AFGA 4LMBA 4ZCPA 4DIFA 3GJ8A 1WMEA 2VK1A 4RF5A 3ZV7A 3P0HA 3O3OB 3P0EA 2IWHA 4BNIA 2HQRA 4MEJA 4TMZA 2XI4A 1E9AA 4RGQA 3ROFA 2BFWA 1DRKA 1XTVA 1MX1A 3QIAA 5HIMA 4DN6A 3VXKA 3JCZA 1C3LA 3N2YA 4RTKA 1ABFA 2QN7A 4ZI3A 2EZUA 3QP9A 4JBHA 1YUNA 2XHEA 3WGUA 5KVCA 3SWWA 3DDZX 4X66B 1KMIY 1W5BA 3OURA 3RF6A 4CU2A 4RVNA 3PXBA 4MV4A 1OIXA 2DFDA 2EHDA 4N82A 3AL3A 3FCEA 2R44A 3HKEB 2PGDA 5D3MA 3UJDA 1GFSA 1RI1A 2FPGA 2GD2A 4QQKA 1PEKE 1LNSA 5FI0B 1P9WA 4YRKA 5JNRA 3WYFA 2GKOA 4ARAA 4CETA 4HFMA 3AUYA 1T5HX 3K15A 2MWMA 3O03A 2GJSA 4KRGA 4Q39A 2RHTA 4LFCB 2YHAA 1ZPDA 3ZY6A 3LDFA 3PPVA 1R74A 4I1IA 4RHUA 4GLLA 3V1MA 4RM2A 4JIGA 5EJ7A 1S2LA 2QX8A 3PQCA 3K9GA 5EHZA 2J7PD 2D1TA 2YWRA 2XYRA 5JSZA 3E8XA 4A92A 2C2HA 3OOWA 5A4JA 2JGEA 1OX6A 2BHLA 3C3XA 4ND6A 1KI2A 1M9NA 2IZOA 2F8SA 1LRJA 1QB8A 1SRQA 1ZD9A 3GT7A 4NOJA 4FYPA 1X86B 3LG2A 3UMYA 1MRNA 5L3RA 2G82A 5FUMA 2VNKA 3IBSA 4YCMA 4GQAA 1EIWA 3AHEA 3RFFA 4S1TA 3K0SA 3QXGA 4B75A 3RK0A 4MXDA 2JJ2A 4FYVA 3JQGB 1S2GA 4MW7A 4IS3A 1KDRA 4FWBA 1H0SA 4ZRNA 3P5BA 4AYWA 1O8BA 1AVTA 3R5XA 4GYYA 4QEZA 4JLWA 3KQQA 1JE0A 4KMSA 3A6ZA 3WMWA 3HB4X 1WHTA 2H1RA 1GPLA 2IX9A 2R00C 3L6OO 2AD1A 5C8YA 1VIAA 4B9AA 2EFHB 4YIKA 2FHSA 2AVNA 4JBXA 4D99A 2PPLA 1P2SA 2FWAA 1P9RA 2O7QA 1GGEA 3U60B 2Q4DA 3A9UA 4I8IA 3UCFA 1UPCA 1U2GA 1E32A 1H94A 2EFJA 2G36A 2Y0DA 3EGWA 4R1OA 1L5LA 5C5DA 5THQA 1SO8A 5CXXA 5K3BA 3LV8A 4Q9LA 4FFBB 3VPXA 1UXOA 1JHPA 1P4GA 2P2SA 3EIXA 2QVZX 3IEVA 3M5WA 5I7AA 2QSJA 3IH5A 2YS7A 5ELLA 4DIOA 2WJAA 1XB2A 4PVCA 1V35A 1I6KA 4HHEA 2I9KA 1V48A 2ZT7A 4MHOA 5K0GA 3RYCB 1ISPA 1O9HA 2AX4A 4YY3B 4YJ3A 1DLIA 2RGRA 4JLVA 2H7XA 3ZD9A 4C1BA 1DRWA 2Q2QA 5FPTA 4YIHA 1I4LD 2NTNA 4O02B 4AY3A 5CDFE 1PHRA 1YCGA 2P7IA 3TQTA 3WS7A 1QHXA 4H4CA 1RQGA 5DSZA 1VCMA 3CEPB 1D1SA 5G0UA 4ZC1A 5CYPA 1YFJA 2H5JA 4P31A 3VC2A 4DL9A 4W5OA 3WFJA 2QTBA 1VKOA 2VP6A 5H0IA 5IC4A 3D0OA 1Z9BA 5AR1A 1NVKA 4IWXA 3REQB 3I42A 2FOXA 4EUEA 3IUBA 3MSXA 5IMBA 4BFXA 3HG7A 2WWXA 4PNZA 2FHPA 2WD9A 1AXGA 2GNPA 2I2XB 1ETUA 4HN9A 3SIPA 1N4AA 4ZEXA 4QBGB 2GEFA 4RV5A 2XMZA 4KXVA 4CV1A 4RQAA 3ZS9A 2YJNA 3OZWA 4HGRA 4JN6B 2SKDA 2A3NA 2WILA 1WUKS 3KAJA 1Z62A 4IQ8A 4DMGA 1S9DA 1O96A 1Z68A 4LMAA 3UWKA 4D9HA 2ZYDA 4YRBA 4TSRA 5AVOA 2B1JA 4JT2A 1RPNA 4L07A 1IXYA 4LK3A 1CUJA 1Y89A 2QD1A 3HCBA 3PGLA 4W9NC 3SM9A 3ZWAA 4DR2B 1L6IA 3U16A 2TMKA 4IO0A 1T0JB 1MV8A 3C0KA 2DSTA 4YRJA 1MVNA 3F6BX 3UV3A 1O94A 3DE6X 3W34A 2J33A 1DG1G 2JAPA 2I7CA 4ZOLA 5HXAA 1Q1QA 2IDMA 1NOIA 4BWFB 3IOMA 1W93A 4E07A 5A02A 2IFTA 3FLAA 3IAS6 3AP3A 3PZBA 2H4WA 4MB6A 2OBYA 3JZAA 6AT1A 2JS7A 2XCUA 2OHXA 2BCGY 3L1VA 4J0IA 1GNQA 4Z8XA 2W8BB 5GOTA 4MI3A 5HZMA 2LIVA 2PJDA 2WJZB 1LEHA 3D3JA 3G89A 3NHPA 1AMUA 3CVUA 3KQKA 1C7IA 2K7ZA 1JJBA 1WLSA 4J8PA 2EKBA 4QL3A 1AHIA 3EF0A 4Y1FA 5L7YA 2W58A 3L6CA 4TS4A 3A26A 3D6AA 1RQPA 2O2CA 4BU0A 4C4SA 4Y2VA 1W35A 2YMQA 3ITKA 1K08A 5FUYA 1HT0A 1YQ9A 2G88A 2X2EA 2JJMA 2ZDGA 3BMOA 3R09A 2JANA 4OUKX 4NIMA 3K0AB 3CNNA 4EB8A 5CB4F 4BC1A 5IH3A 3FE2A 2CVOA 4G09A 1DWOA 2PKRA 4OO3A 4MVWA 3MTJA 5HF6A 4E7PA 3C7KA 2QTCA 3KQYA 3LPLA 2BF4A 2FOIA 2N42A 3KXKA 4XKJA 5ALMA 1U0GA 1J9EA 4HWRA 3WGMA 5GADl 2VTBB 4Y2UA 1TYZA 2GPSA 3AVQA 5GZ3A 1TDJA 2PZLA 2HDHA 2JFPA 2WSBA 1SU4A 3OM9A 3P4YA 5FWDA 2PH1A 3BD8A 1OIWA 1VIMA 1VYUA 4ZK2A 3SR4A 1Q95A 3CF4A 3RVNA 2YVKA 2OCDA 5DHSA 1OFTA 5CW1A 1PCXA 4Z3KA 1DXHA 3ZGYA 1MT0A 3Q72A 1NQWA 3RAPR 5CB4B 2QENA 5CTAA 2Z6UA 1ST3A 1B8OA 2OMKA 2XTAA 1E7SA 3TZLA 2K5UA 1NYTA 2R85A 2ZIAA 3LBHA 2H8KA 2HN9A 1A04A 2Z0MA 1AF7A 1VI2A 1JZTA 2MSEB 4G81A 4QUJA 5K2MA 1CEQA 1W1UA 4OB8A 2PUEA 1F2UB 1C41A 2WUGA 5ITWA 1M0SA 2P0EA 1GVHA 1PN3A 2WFMA 4K05A 3RFXA 3O82A 2Q4RA 3SGLA 4RTPA 2IQIA 2EW8A 3DC7A 2GAOA 3LDHA 5KZMB 1CZOA 2FEMA 2AW5A 3KJIA 5I9MA 4B6EA 4L9WA 1Y1SA 4MKHA 4TTSA 3OLYA 1J0AA 2AG1A 3UT5A 2IPLA 4YUXA 4UM7A 3IELA 1U9JA 1UAAA 2VR1A 3ISVA 4N47A 1QV7A 2X15A 3L0PA 3L8DA 1Z82A 3IMEA 4PFJA 4C6TB 3S7TA 3JQ8A 4II2A 4FT4A 1OV6A 1X94A 1EUZA 1FMLA 3HO6A 5AP9A 3I04A 1XL0A 4POOA 4JP3A 4ZIRB 5CNIA 3GARA 3F4BA 4JLPA 2FPUA 5TVGA 3BB4A 4LYEA 3O8BA 3H4MA 2IP4A 1YQWA 4LBWA 3ZDEA 4GXRA 5DWDA 2J32A 1FDVA 3PGA1 3Q9SA 4UNQA 2ZANA 5D2CA 3L06A 4ADSG 5GGXA 2EGGA 7ABPA 2B34A 3KZOA 1GG8A 4BNGA 3LD9A 1NVFA 5EZ5A 2JFHA 1E94E 3LECA 1DAPA 1QIHA 2QRQA 1M10A 3QVKA 6CHYA 4KPYA 1EP2B 1M66A 3DMRA 3ONDA 3ILHA 2HTFA 4A27A 1F2TA 4PR0A 3HXMA 1L4UA 2EWWA 4FE3A 5ANRB 1WVGA 3V2HA 4BV9A 1JEOA 4HGOA 4OOFA 4PV7A 5HS6A 1ZUD1 3AX6A 3SJBA 4EITA 2P2CA 3HJTA 1XTUA 4E6PA 4UCXA 3CBGA 4YRZA 3PFIA 1PF7E 3ORHA 2NTJA 1R8YA 1UMCB 1JJ7A 1QFYA 1VMIA 4HDMB 5LLDA 1Z5WA 4P33A 1R0YA 4ZYYA 1TMOA 3UAWA 4DEXA 1LU9A 3HV2A 4S1NA 2P9ZA 4DT1B 4FE7A 3FUXA 4I55F 1RAFA 5IHXA 4MPJA 5CCDA 3K5WA 3SY8A 4ES6A 4OI0A 1P2UA 1CD5A 2HW8A 2J08A 3NTVA 5H1YA 2NVUB 3QKSA 2ZYUX 3WJ1A 4YMHA 3WWPA 1II8B 1M2NA 3UJAA 5THKA 1GRVA 1ML4A 1D2MA 5SZJA 5JZSA 3LRPA 1OLSB 4RYLA 1U8YA 3PSAA 1LY1A 1JTFA 4PTYA 2O7SA 1FP6A 4DMRA 1T36A 1XC7A 4FFOA 3G0CA 2R65A 4CMIA 3EEIA 3EUAA 5KSYA 3ESBA 4MDEA 3BF7A 2BR4A 2J09A 2P0AA 3PDJA 3PFHA 3PUVA 3BG5A 4GRIA 4M0UA 5HIIA 1ADJA 3BWXA 2JIRA 1HE3A 1W9HA 4RPIA 2PCLA 4QTYA 4NYMR 2Q3JA 3U19A 5GINE 3GA5A 2G5PA 4MV6A 3HCRA 4I55B 3SFZA 1ZHOA 2PJRA 4CTOA 5CLLA 4I6EA 5HK9A 3U3ZA 1LTQA 3TX2A 4EF4A 4QVGA 3LGAA 1DAMA 3ONVA 1GA1A 1ACJA 3F7MA 5HKLA 3CW2A 2FSVA 4LXUA 3DGEC 2Q5QA 3F9IA 4AG5A 4WCFB 2IGBA 4DYDA 2WMOB 3ZY2A 1YZLA 1GZHB 1NZDA 2QI9F 2YMLA 5K0ZA 3R0VA 4JOSA 1U1DA 4EB3A 1AUQA 5EFOA 1OA1A 1MBZA 1RT9A 2PVSA 4IQ4A 4MRRA 5JHGB 4HB0A 2OP1A 4GKAA 1QHEA 1WD5A 3H8JA 4KXMA 3HJHA 2OP0A 2DVMA 4G0QA 4HWPA 3CLTD 3TNYA 4CF5A 3EPJA 3N6XA 2PJUA 1XV5A 1H0HA 2YXPX 4C30A 4LYGA 3ODPA 5AKGA 2A5YB 2GD0A 2UYCA 3IUJA 4F9GA 1V39A 1KDPA 4L6CA 1G66A 4J3JA 1HE8B 3C3YA 5C7IO 1KAEA 1CKEA 5JBQA 2R4UA 3ROGA 5LOVF 1XVUA 2HXGA 2FFJA 3MM4A 3OCCA 3BAZA 2P9YA 4QAQA 4JJ6A 4JJZA 3ZE9A 3UZUA 4XVQA 1F4PA 4FDLA 1R12A 1VLLA 1G5PA 2E48A 5JSKA 2ZUTA 3KKKA 3WFZA 4LJAA 3MCVA 1NFRA 4HO1X 1JWAB 4RH0A 3VPCA 2EJWA 3ZTYA 2EX1A 1YB5A 4XD7A 3QPUA 2D0IA 4PQRA 4N3GA 1U9IC 2PLFA 1K8QA 5K1ZA 4JGGA 1MTZA 3CX6A 1USGA 2PA0A 4DQDA 1PJZA 1CQIA 1NSTA 2VQ3A 4YAWA 3R3VA 6ABPA 3IERA 2WFLB 4WH0A 5IAEA 2GGSA 5DN9A 3NM4A 2IUFA 4CKEB 4KGDA 3OJFA 3OZDA 4V0RA 5LOVB 4UMVA 2QD4A 4ME6A 1ZD8A 4L9SA 1C7FA 1OAOA 4L8VA 5FADA 4NL4H 4EUHA 4YXFA 3AUAA 2B8NA 3HY4A 4XR9A 1W36C 1KYYA 1G63A 2F6RA 4Q4AA 4QGSA 5JQGA 1Z5GA 4PGGA 1GUBA 3LU1A 4DQLA 3HN6A 1X7ZA 3BXZA 2P78A 3Q7SA 4EHIA 1MA0A 3GBPA 5EXTA 1PDWA 2RHHA 5E1BA 1ULSA 1NQVA 1VRWA 2ECPA 4ZDKA 3PGXA 4KXYA 2ZRDA 1SQ0A 2OENG 3PPWA 4D8WA 1R8SA 4HTFA 4JJIA 3EBPA 3N8DA 4N0EA 1E1DA 1H9BA 3E5MA 1DV1A 2Z6VA 4UBMA 4BE7B 3KQTA 1P44A 4XIJA 4I9FA 3UANA 3PVCA 3JWJA 4ND1A 3PFFA 4CIVA 4D97A 4KO4S 3EZ2A 3JV7A 3RGGA 1KPIA 4G6ZA 5EAIA 2J3QA 3D4LA 2GZDA 1VPDA 4YJHA 4XFKA 2XWBF 4GNKA 2H2IA 4QPDA 2OB1A 2RK6A 3M1LA 3RS4A 1JDPA 4Y1GA 2Y9MB 3GPDG 3K70B 1ENYA 3IQZA 3O4HA 3R4CA 4XGQA 3SC6A 4L75A 3W5UA 5G40A 3I9V1 1C0KA 1NUUA 4YP1A 1KDTA 1YL5A 3H18A 1ZOIA 1WG8A 3U26A 3WBJA 2W6QA 3TGLA 4M1EA 1FFYA 4B6PA 5KAMA 1RM4A 5IJ9A 1O0CA 5K3FB 4AY2A 2VHZA 3BTOA 4IIHA 4MYUA 2ZSEA 5ALJA 4DS3A 1RCTE 1WZ2A 2BKVA 4O2BF 1JQLB 1KVUA 5IYZF 4MP6A 1ZNYA 4MW9A 5F98A 5TQ0B 2XE4A 2E55A 1TAHA 3EF1A 4HZUA 3U5ZB 4GDMA 2B5VA 4H7EA 1SCDA 4RK4A 5EQDA 1QIIA 3OF2A 1BCRB 1BROA 1VRVA 2X4DA 4WCFC 3PGVA 3COVA 4WINA 2I67A 3GLFA 3GCDA 3K94A 4IPTA 4J1QA 2IUUA 2R8RA 3ZX5A 5KKNB 2JZNA 4EYGA 2JFGA 3KLPX 4JZKA 3KPUA 5IEBA 1BXKA 3PHGA 3QPCA 4C0SA 2LV8A 4V2UA 4S1VA 2E21A 1JDZA 3KLNA 1XMPA 4NE2A 1UBHS 1VXOA 5CVDA 3NTLA 2H92A 2EZ4A 5GV8A 5GIOE 3O1JC 3QA3E 5EPOA 2DY1A 1VE5A 4UW9A 4JJ8A 3VNRA 1PJ4A 3G0OA 3ZWPA 4WI1A 5L51A 1U7OA 2XMRA 1U81A 1E0JA 4FGSA 4YAOA 3VHXA 4MDHA 3BTSA 4Q4LA 5IYZB 3BE6A 3P7MA 2BBSA 1N1GA 3IAM6 4AJIA 4CL8A 2CDBA 1OBHA 2M32A 1ZC3A 1GRRA 2XMGA 1BOFA 3DBLA 3L7OA 4PYLA 3WOVA 4WCDA 5KQMA 5EOVA 3ER9A 4KQGA 3WK8A 1TRHA 1XZQA 1EWRA 1QH8B 2QI9C 5JH7F 1XHEA 1QRUA 1CY8A 1T24A 3C3BA 4YI3A 3HXQA 4BNMA 2VDOB 4KTVE 5KYKA 4DCTA 3RAFC 4LGCA