3AIMA

R267e mutant of a hsl-like carboxylesterase from sulfolobus tokodaii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
283
structure length
283
Chain Sequence
ASVEEIRSLFKQFSSLTPREEVGKIEDITIPGSETNIKARVYYPKTQGPYGVLVYYHGGGFVLGDIESYDPLCRAITNSCQCVTISVDYRLAPENKFPAAVVDSFDALKWVYNNSEKFNGKYGIAVGGDSAGGNLAAVTAILSKKENIKLKYQVLIYPAVSFDLITKSLYDNGEGFFLTREHIDWFGQQYLRSFADLLDFRFSPILADLNDLPPALIITAEHDPLRDQGEAYANKLLQSGVQVTSVEFNNVIHGFVSFFPFIEQGRDAIGLIGYVLRKVFYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability of a thermostable carboxylesterase from the thermoacidophilic archaeon Sulfolobustokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
molecule keywords 303aa long hypothetical esterase
total genus 95
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2010-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3aimA00
1YR2A 1YA8A 3I6YA 4IHAA 4YPVA 3SWWA 3FWHA 5AKYA 4FBLA 1B41A 5AK3A 4C4ZA 5IVDA 2B9VA 1ZIXA 5T4FA 2C7BA 1JJFA 3DLTA 5F4ZA 7YASA 1UOQA 4E15A 1OILA 3HI4A 5ALYA 4LXIA 1XZHA 4NMWA 1JU4A 1VE6A 1F6WA 3WKAA 4W1PA 5JZ9A 1JMYA 5LKRA 1XRLA 4OUKX 2RGUA 1LBSA 1XFDA 5AO9A 4W1SA 2IX9A 1MNAA 1SFRA 4X3CA 4TGLA 2HIHA 2PKYX 2O2HA 4KE7A 5A6VA 4HTAA 1EA5A 4RE6A 2WU4A 4GHWA 4BAUA 4S0XA 2FUKA 5JANA 5AIAA 3H2KA 1HQDA 4XVCA 4LXGA 1QIJA 3C6BA 3PUHA 1Y7IA 2Y2UA 2JGLA 2HA5A 4HXGA 5CW2A 2WIFA 1A88A 3C8DA 5FLKA 3NGMA 3I1YA 5CT6A 4BVKA 3EQ9A 3H0CA 3LIPA 3IBTA 3Q8WA 4I3FA 3C45A 3RK4A 3YASA 1W4LA 4DSZA 2XMQA 2XE4A 4M0MA 4UBKA 2GBCA 3I1IA 4X97A 4OB7A 5ALUA 1H2ZA 5K3BA 1NU6A 5BOVA 2ZYIA 1BE0A 5CTAA 4QWMA 1AKNA 1CFJA 4EY8A 4QZVA 3I2HA 1XZEA 1ZIYA 2QMQA 2RIPA 4WY5A 2VT6A 5FDFA 1EXWA 1XQWA 3G02A 1X2EA 2XUPA 5AKGA 4RNCA 3P2MA 1AQLA 3ESCA 4OCZA 3C70A 3X3HA 5AKLA 1QE3A 1R88A 5HQ3A 1VKHA 1GGVA 3IUMA 3W9BA 3S8YA 1SCIA 4Y2PA 1ZI8A 4Q3OA 3BL8A 1C4XA 2WFLB 3WWPA 1UKAA 4CIAA 4UHFA 4DM7A 1Y7HA 4OU5A 3E4DA 3PFCA 2WUDA 5CXUA 2G4LA 1QONA 2V9ZA 1VA5A 4X00A 2Z8ZA 1H22A 1GQSA 1XZJA 3KD2A 4CG2A 2BAGA 1ZJ4A 5AP9A 4X6YA 3M83A 1K63A 1CUCA 4KEAA 2Y6UA 1DT3A 3HC7A 3C6YA 1LPOA 2GYVA 1VE7A 2VEOA 4G1FA 4N5IX 1G5FA 4W9RA 1ZGCA 5EHQA 1O6FA 3FSGD 1EDBA 1H2XA 5FXMA 3SK0A 3G0BA 2ACEA 5CXXA 4ZREA 3PICA 3GFFA 2GYWA 1HDEA 2XMZA 1PJAA 4GDMA 4K5QA 1CQZA 4GXNA 1L7QA 4ZV7A 1AMNA 2IIVA 2V97A 5E4JA 4WFJA 1CPYA 3D3NA 1F8UA 3SC2A 1X70A 3IULA 1LPMA 1QIHA 5C8XA 4H7KA 1WM1A 4JYMA 3V1MA 1MN6A 2O2IA 5AH0A 2YH2A 1UXOA 4YX9A 3T4UA 4JYPA 3BF7A 1A8QA 1YSCA 4G8BA 1JFRA 3N2ZB 3VKFA 3I2IA 1Y37A 4UBJA 4MYDA 5EIAA 2QZPA 3H2IA 4B83A 3FYUA 4ZRDA 1XZFA 1W52X 3H18A 4LXHA 1EB9A 4FNMA 1TCBA 1ODCA 1TCCA 5KREA 3D2CA 5AM2A 4INZA 2WIDA 2VAXA 2VJDA 4KE6A 4BB0A 5K3CA 1OCEA 1DX6A 4DMCA 1XKTA 1THTA 5ALLA 5T4EA 2DR0A 4ARBA 1YS2X 3H1BA 2XUQA 3G7NA 1GPKA 2HDWA 4IH1A 5I8PA 1VZ3A 3TGLA 1GKKA 3I2KA 5ALVA 1E8MA 2W22A 4WFKA 2H7CA 5IVHA 1ORWA 4U2CA 3UMJA 1R4ZA 4AMZA 5FPPA 5HF5A 3VVLA 1TRHA 2PSHA 2XMSA 4UBMA 4QLOA 5CRIA 4W63A 4DYHA 2XDWA 5CT8A 3I2JA 4FHZA 2JBWA 2XT0A 5DYWA 1GT6A 3EF3A 1W76A 3Q0TA 1VZ2A 5AM0A 2WKWA 1MX5A 3OM8A 2WLSA 4WJLA 3STWA 3I28A 2JGKA 5LYYA 1ACJA 4O08A 3QBJA 4HS9A 1K8QA 2HFJA 1IZ8A 1K4YA 1HPLA 2WUGA 4B0PA 4H18A 4BAGA 2NW6A 2XLBA 1WPRA 3H1AA 2CJPA 2ZSHA 3GROA 2QM0A 1C7JA 4J03A 3OG9A 4YK7A 4MEAA 2ZYSA 1ETHA 1AX9A 1TQHA 3QPDA 2PU5A 3WWDA 4BTVA 3WK6A 4FLMA 3A2LA 1JU3A 3QMMA 4G4JA 3RARA 1DINA 4BDTA 4JUIA 2I03A 2CZQA 3FVRA 3I6ZA 4Q1VA 5FRDA 5AKXA 3O9VA 4DLNA 5JARA 3MUNA 3BWXA 1W75A 4B6GA 5A7GA 5FP0A 2OAEA 3FLBA 4CCYA 4M0EA 4Y2TA 3W06A 2OQVA 3DOHA 1P0PA 1XRRA 4UUQA 2WFZA 5ALNA 1QIDA 3B12A 3HLKA 2DHDA 5FKJA 4FDMA 1A8SA 3DD5A 3VVMA 2PUJA 1J06A 3F8SA 1P0IA 4OPMA 4Y2JA 3ZLTA 3WK8A 3NOXA 5CH3A 4UHCA 1CLEA 1TK3A 2C0QA 1QFMA 4K2AA 4EY5A 1FFBA 2ORYA 4AN0A 5AOCA 4L9AA 1G4HA 2HRRA 4DGQA 4X85A 5JD6A 4QDUA 4CI9A 2IITA 3I2FA 3ZWQA 4P9NA 3B3QA 3IIIA 3LLCA 2X8BA 1DWOA 2QJRA 1IMJA 1MNQA 2GBFA 5CH8A 4XX1A 4XJVA 2C0PA 4IQ4A 2VJBA 2HM7A 5BV7A 1QFSA 1BS9A 1E66A 4DMKA 2VSQA 2AJ8A 1ZD2P 5HKBA 4Y2SA 1N5MA 1ZOIA 4PV7A 3IDAA 4OYYA 2WJ3A 4U2FA 4B7ZA 1E3QA 1HLGA 1CUVA 1PV1A 2H7YA 2O7VA 2E3JA 2XUKA 2B20A 4G5XA 2GBIA 4HRYA 4XIIA 4U2DA 5C8ZA 1UKBA 4H35A 1BN7A 1CR6A 5K3DA 3ICWA 3WWEA 5DJ5A 1CUUA 1LPSA 4K6GA 1KU0A 4CG1A 2BGRA 3EIOA 3UUFA 4GBGA 1H2YA 1LPAB 4C01A 1CVLA 2YXPX 3BDIA 2VATA 3A6ZA 3MVEA 4X90A 1DWQA 3HXKA 1J1IA 4QLAA 1C7IA 3QH4A 3TEJA 5C8VA 2YASA 3DQZA 4OD0A 3W05A 3IURA 1IUNA 2FJ0A 3F96A 4A16A 4ARAA 5I9IA 4AO6A 1JKMA 2G5PA 3KOOA 1F0PA 1HL7A 3K6KA 2PSDA 4HXFB 1TIBA 5LZ2A 1J2EA 1DT5A 1CUYA 1BEZA 4DNQA 5EHNA 4Z49A 4KAJA 4H7JA 1LGYA 4BZZA 5AOAA 3FYUB 1J07A 1QLWA 1YB6A 3VJMA 3BE8A 5DTJA 1CUXA 1UWCA 3ESBA 3GUUA 5SYNA 4JEIA 4KAAA 4DTCA 1MAHA 5ALRA 4Y2UA 1U4NA 1DTEA 4BE4A 2OCIA 5ALTA 1WPXA 5ALHA 2CKMA 2BCEA 4EB0A 4OB6A 1USWA 1R3DA 3D2BA 5JZBA 1QO9A 1QTIA 1FFCA 3QMWA 3DYVA 3DCNA 3G9TA 3STTA 1TAHA 5CH5A 3PFBA 1E8NA 4J0HA 4Y2QA 1ISPA 2J4FA 3AJAA 3WK4A 1CV2A 1LLFA 5D3ZA 3WWOA 1XRQA 5ALKA 1XRPA 5KBYA 5A62A 5JAHA 1CUWA 1XLVA 2FJPA 4EY7A 2HFKA 4BE9A 3FYUC 3WI7A 2ZYRA 1EDEA 4BATA 3AZQA 3G8YA 3AFIA 3WKCA 3VDXA 2RONA 2XMRA 3ESAA 4BP9A 4IH4A 2PU7A 3B5EA 2DSNA 1EH5A 4QWWA 1WHSA 1JMKC 5HCUA 3FBWA 4NZZA 4FKBA 2BGNA 4G8CA 2Q0XA 2JEZA 2QUAA 3SX4A 3T52A 1UK6A 3H04A 4Y2XA 4GWLA 1UK8A 6YASA 1XKLA 2JGMA 1N1MA 1F0NA 4AX4A 4N8SA 5K3FB 4RGYA 4N5HX 4MQMA 3AUKA 4B85A 2BUCA 3O4IA 1UOPA 4X92A 1R9NA 2HA4A 3K2IA 2D5LA 1YASA 1B6GA 2GYUA 5HFAA 3F98A 4UFOA 1MO2A 2XQFA 5EGNA 1H23A 5DNVA 3K9BA 5HF8A 3PI6A 4B9AA 5AKZA 1ZI6A 3D0KA 4Y2YA 1DX4A 1UKCA 4UBOA 5A7HA 3STXA 4QDXA 3DS8A 2VTVA 2RHWA 3BIXA 3KXPA 1IUPA 4WDQA 4Y2VA 1BU8A 3HABA 2BJHA 2Z5GA 3QVMA 1XLUA 3RM3A 3KWJA 1DWPA 5CBKA 2ONCA 3G9XA 5DLPA 1WB5A 2I78A 4BZWA 4U2GA 2RAUA 3JW8A 1WB4A 4BCDA 4BRSA 1E89A 2XMDA 2Z3WA 2HA3A 5IVKA 2JGEA 5DNUA 2DHEA 4AO7A 5LIPA 5LZ9A 3HACA 4U2BA 4G9GA 2PL5A 2R8BA 4MQLA 4EA6A 5ALEA 3BJMA 2CEKA 3IA2A 3STUA 1MPXA 4BCBA 1AC5A 4H7EA 2WIJA 2OLEA 3AINA 1GKLA 2DFPA 3IUNA 3KDAA 3ZV7A 3M3DA 1N5RA 5AI0A 4BC0A 2CB9A 3U1TA 2XMGA 5AM3A 4RPCA 1QIIA 2QXUA 4RE5A 2JGFA 3STVA 4X6UA 1HBJA 3G9UA 1VXRA 2ZSIA 3LIIA 5HQ3B 2PBLA 2C5GA 5AI8A 3QMVA 5EHZA 3D5EA 4DIUA 2BUBA 5AI6A 1VXOA 3WK7A 4I19A 4FFVA 1T2NA 2OCLA 4P92A 4J0DA 2HU8A 3VISA 1XRNA 3W04A 5C81A 2ROQA 4DSAA 3FSGA 5JASA 3WIBA 2EDCA 1I6WA 3S2ZA 4BBZA 2OXEA 4BYMA 2WFLA 3O0DA 1EVEA 1LZLA 4BVJA 2WIKA 3CCCA 1QIKA 2HA7A 2QTBA 3H17A 5EIHA 2Z8XA 4PSDA 5JAUA 2HA2A 4MXDA 4PF1A 5AI4A 5JATA 3R0VA 4DNOA 3VJLA 3E1GA 3QPAA 5ALZA 3PUIA 3L1JA 4WDRA 2OQIA 2VAVA 3BDVA 2G63A 1EHYA 2CUTA 4X94A 4DMFA 2YYSA 1BN6A 5ALPA 1UOOA 2PSFA 1YB7A 2QXTA 2XUIA 2AJBA 2WUEA 4ZXFA 1FFDA 1N8SA 2JF0A 4G4IA 4FLFA 1CQWA 3L1IA 5K3AA 4E46A 3CN9A 2HL6A 2ZJ6A 4AMYA 5EHXA 1ZI9A 4F0JA 2QOEA 1R9MA 5ALXA 3LS2A 1ZJ5A 4JNCA 4UPDA 1E8DA 1EX9A 2DQYA 5LZ7A 2O7RA 5T4HA 3E0XA 1CUHA 3ZLUA 2QT9A 1P0QA 5A7FA 4G4GA 5JYCA 5K3FA 2EEPA 4HVTA 3HEAA 1AGYA 1P0MA 1Q84A 5HKAA 1MTZA 1MJ5A 1FFAA 2I3DA 2O2GA 1KEZA 4D9JA 3JWEA 3QM1A 4ZWNA 3L1HA 4U2EA 2ZYHA 2QJWA 1ODSA 4AN1A 2VA9A 1QO7A 5AM1A 1GZ7A 1EB8A 4C4YA 3R3WA 5K3EA 5JALA 2ES4A 4FOLA 4CCWA 1ZD5A 4H7FA 3DL7A 1RP1A 4C89A 1D07A 4X71A 3ICVA 4B82A 1EK1A 1LPNA 5DTIA 5HZGA 2AJDA 5AI5A 2ZJ7A 4GEGA 4EUSA 4FNGA 1QIEA 4EBBA 3C6XA 2PSJA 3BJRA 3O4HA 4OSEA 5ALFA 3HRHA 4C4XA 3GZJA 5EI5A 1LPPA 2C4HA 2HU7A 5AKHA 2WQZA 3BXPA 4QNNA 3FAKA 3G0IA 4WFIA 4B0OA 1LZKA 1WHTA 3HJUA 3DDUA 2XUAA 4J7AA 4X91A 4M0FA 1VA4A 3HSSA 1E5TA 5ALMA 1OXMA 3DOIA 1U8EA 1EI9A 3WKEA 3CN7A 1A8UA 3R3ZA 4GECA 3EBLA 3EQ7A 3F67A 3WK5A 4KJXA 5ALSA 1YAHA 4UBLA 5A71A 4EY6A 2XUHA 4FBMA 3QZUA 5D7BA 2BFNA 1QZ3A 2WU3A 4N8DA 4DMHA 3AILA 3ZI7A 2CBGA 3C43A 4NVRA 5AK4A 4X6XA 3OTQA 1S8OA 5ALJA 2WJ6A 2P8SA 4ZV9A 4NS4A 3AZPA 2PX6A 4B80A 3O4JA 3WKBA 5AHXA 1GPLA 5IH7A 3F9CA 4PNZA 4J0KA 1ZICA 5AI9A 5FUMA 1CUGA 2HADA 1M33A 3WKDA 3ANSA 5AJHA 3C5VA 4ZGBA 2J3DA 4QE3A 5FOQA 4EHBA 3H2JA 1CUJA 3JYHA 1ODTC 3FCXA 3PF8A 4V2IA 1SCQA 2XI4A 5EIEA 1FFEA 5IVIA 5JZSA 3W9UA 1THGA 1ZD4A 5AK5A 4EY4A 4BDSA 3I6MA 5C7YA 2AJCA 3D4LA 2PVSA 1TKRA 4KRXA 1XLWA 4PQEA 5ISMA 2XQJA 1JJIA 1FJ2A 4KR0A 3DNMA 1LPBB 4A5SA 3WIOA 2WG1A 3D59A 3OC0A 3PE6A 5E2IA 5E4TA 5ESRA 2VJCA 5CURA 3D7RA 5A2GA 1ZD3A 4LYDA 5AK6A 1TCAA 1WB6A 3ED1A 1L7AA 1AUOA 2ZJFA 5AIBA 2VQ6A 1EK2A 4H0CA 2EDAA 3DJYA 5LZ8A 3V9AA 5T4BA 4AXBA 4DNPA 1CUFA 5AOBA 2Y2VA 4Y2RA 1LNSA 2AJLI 5JD4A 1L7RA 2WFMA 3WL6A 4J3JA 2QR5A 4E14A 2OCKA 3VXKA 1CEXA 2G5TA 1R1DA 1VJ5A 4BCCA 2WHRA 4PSUA 4Q82A 3IUQA 2H1IA 4H77A 4H7HA 2VJAA 5ALIA 4MWSA 2D0DA 4WCVA 2ACKA 3FLAA 1XZLA 5ALDA 1CIJA 2GZRA 3DKRA 3W2TA 2Y1KA 2V96A 4UFNA 3FOBA 4AZ3A 1ACLA 1AURA 4Q3LA 4KE8A 5AKKA 3OURA 4H7DA 1QTRA 1W6RA 4Y7DA 1QJ4A 2K2QB 2JIDA 2DQZA 2PPLA 5FV4A 3PDCA 4BRZA 5DYYA 2WILA 2QVBA 1MX9A 4FTWA 4XWGA 5ALQA 1X2BA 4BP8A 2WHPB 5AM5A 2ZVDA 5HFNA 3G0CA 4ETWA 2JGJA 1DQZA 3FLEA 2Y6VA 1K6EA 3R3UA 1WOMA 1XZGA 1KU6A 4MYSA 2I3ZA 4FMPA 4KRYA 4G9EA 3IVMA 1T4MA 1ORVA 3WZLA 3NWOA 3HZOA 1Q83A 3R41A 4HRXA 1O6GA 2OCGA 4UBIA 3C6ZA 2X5XA 1NX9A 3G0DA 2FX5A 2RI6A 2H7XA 3R3XA 2GBGA 1XQVA 1U65A 2WG2A 5LZ5A 5ALGA 1YCDA 4X93A 4GI1A 4AQDA 3WA7A 1ZGBA 3R40A 3WK9A 2J4CA 1H2WA 4B84A 2XQGA 2HA0A 1CRLA 1IVYA 1BCRA 2WTNA 3M82A 1YS1X 1RWQA 4Q3KA 3GELA 3N0TA 1UT6A 4QDZA 3DYIA 2UZ0A 3H2HA 3UUEA 5CT4A 3BIWA 4W1QA 2GZSA 4Q05A 2QRUA 3AIOA 3AZOA 3DEAA 3QITA 3ZLVA 4TPKA 2J3QA 1MX1A 5CMLA 3WLAA 1QIMA 2XB6A 1EVQA 2VT7A 4K6KA 5JAPA 3O9MA 4CG3A 1XZDA 2QKYA 2DCMA 2PSEA 5KWJA 3WJ1A 4FLEA 2WHPA 1EINA 4E11A 1UFOA 3EQ8A 5D6OA 4LHEA 4QDOA 4G8DA 2XUJA 4PSCA 1RYYA 2WM2A 1UZAA 1A7UA 1IUOA 3FCYA 4LKOA 5AKEA 4UFPA 2Z3ZA 4OU4A 3NUZA 5SYMA 3WYDA 1UK9A 4GW3A 5DNWA 4UBNA 1GXSA 1CUAA 1XZMA 3MGAA 2BUAA 3VJKA 3WZMA 3R3VA 4DNFA 1LBTA 2OG1A 3ANTA 4ZI5A 4J0IA 2XUGA 4JH0A 1BEEA 4ITVA 4QA9A 1CUZA 1FSSA 2OGZA 4CIBA 5D3KA 5E4YA 3A70A 3HYSA 3I2GA 1XROA 5JADA 2ECFA 4AO8A 5LKAA 1W1IA 2PM8A 2XMCA 5AM4A 3OPMA 5JIBA 3G0GA 4P08A 1QIFA 2W6CX 5CT9A 1GQRA 1XZIA 4LIPD 1G66A 1XZCA 5J3JA 4K6HA 1MU0A 2XUOA 4IH9A 3FVTA 1HKHA 4KAFA 3ZPXA 4LYEA 2QUBA 2CMFA 4UHHA 3V1LA 5I7UA 2XUDA 5HK8A 5BWCA 2OGSA 3CCBA 3ESDA 2WHQA 3DL4A 3G9ZA 3C5WP 3V1NA 2HA6A 4UHBA 4ROTA 1CUBA 2WIGA 3WYNA 4L0CA 5ALWA 1EDDA 2H9YA 4J0JA 4PO3X 2JEYA 2HU5A 1BROA 2WSLA 4X7BA 5IKXA 3WA6A 5AICA 2B61A 4UHDA 4N8EA 5JD5A 5YASA 1VOTA 4C88A 2AXEA 2XUFA 3TRDA 3WL7A 4EZIA 2XLCA 4Q34A 2QS9A 4KE9A 3KWFA 3CXUA 3A2MA 3IB3A 1U2EA 1MAAA 5H3HA 4C6HA 4BAZA 3RKSA 2C58A 3WMRA 1K5PA 2LIPA 2XQKA 4TVKA 3WL5A 4I4CA 4HZGA 5HF6A 5AKIA 3E3AA 4J0GA 5ALOA 4P93A 4AB1A 5FPQA 1BRTA 1DQYA 4F21A 3WWCA 2C5FA 1WCYA 3O4GA 5JAOA 2WG0A 3C87A 5HF9A 3FNBA 3V48A 3C8HA 5CT5A 4B9EA 1QIGA 1UK7A 4MWTA 1DU4A 5KWIA 1YA4A 4OB8A 3PF9A 4OYLA 3U0VA 1SCKA 4BVLA 4L72A 1R50A 2WTMA 4FWBA 1CUSA 4BC1A 2WUFA 4BTLA 5DWDA 3D2AA 3TJMA 1XZAA 4GLBA 5BWBA 4HXEB 3WJ2A 1XQYA 1G42A 2HRQA 4YASA 1PFQA 1QOZA 4J0CA 1VLQA 4A23A 1CUEA 4HAIA 5K5EA 1BCSA 3WL8A 4KACA 4F60A 4FFWA 4Y9SA 2DHCA 3LCRA 1GPNA 4C87A 2WJ4A 4QDTA 3V1KA 3H19A 3QYJA 1CUDA 1XRMA 2XQIA 2XMBA 3GA7A 3O95A 1XQXA 2HHAA 3LP5A 1JT2A 3F97A 1JI3A 3A2NA 4CCYB 2V98A 4L3WA 4X95A 2RHTA 3GBSA 4F5ZA 2X76A 4WY8A 5LP1A 4CFSA 3STYA 3QPCA 3AIMA 3ILSA 2OAGA 5EFZA 4PW0A 5AKJA 3OOSA 3KSRA 4MJ3A 4UHEA 1Z68A 5LLSA 5LZ4A 4QEKA 4IO0A 1QGED 3RLIA 3MUOA 1SOMA 1CUIA 3IUJA 1AZWA 2R11A 3H2GA 1YAJA 3DKKA 5HK9A 2JGIA 1SC9A 2OPHA 3BF8A 2OGTA 1XZBA 1XZKA 1Q0ZA 1IZ7A 3M81A 5DYTA 3AIKA 4AZ0A 4H7IA 3WQHA 4MEBA 1MT3A 1Q0RA 4KYVA 3FYTA 1JJBA 2VF2A 2PUHA 4B81A 2BKLA 1NU8A 3R3YA 2B4KA 4W1RA
chains in the Genus database with same CATH superfamily
1IDOA 3ZCPA 4P4GA 2RH9B 1XI2A 3I6YA 4XQCA 5IJWA 2CLOB 1RFGE 1Z47A 3LQ1A 1HWYA 5LM3A 3SWWA 2P7IA 1NBME 1O96A 5CA0F 1PKEA 5IG2A 2GCNA 1SH7A 3NDJA 3BZUA 3M1AA 3NVDA 4IHJF 3L7BA 2GO1A 3DA8A 3GYGA 4ZRNA 4LE0A 2W2TA 4RY0A 4C4ZA 1Z7WA 1UMKA 2RK4A 5IVDA 2P7HA 3CGWA 5K1ZA 1GZVA 3FMOB 4QT0A 5T4FA 3NDBB 2C7BA 2B7CA 2BFEB 2V0CA 4I6EA 1A77A 3B82A 1QUEA 4HUJA 3G17A 2QV0A 1PD0A 2ASVA 5I45A 4BO0A 3OQOA 1G6HA 3OCJA 3WS7A 1ZSYA 1TC2A 7YASA 1UOQA 5EZYA 2X40A 1U1FA 2GDJA 3GFBA 4XJXA 5AXBA 4LXIA 1WV1A 3R7FA 4CLEA 5KVCA 1DLIA 1OBVA 5ITZB 3WY9A 5LKRA 3LECA 5FWDA 3C3MA 2FFAA 2VP0A 3X1JA 3QKWA 1T15A 1UBEA 4FHGA 1WPGA 4Q3EA 1JDUA 1N36B 1E5LA 3QLUA 5K6AA 1L7EA 1H93A 4K81B 1RCTE 2XBMA 1I6LA 1UBCA 4X3CA 3P71T 4TGLA 1L5OA 3VNVA 1GDDA 2J3IA 2SCUA 1UFQA 2HIHA 3PUKA 4ILKA 1RRMA 2D1YA 2PKYX 4WZZA 4AJNA 3TCNA 4MRVA 1W4BA 5C2JB 1VRCA 3OZAA 5E7JA 4TS4A 1G5HA 1D2MA 1XB2A 4DA9A 1KVTA 1OZHA 2RHCA 1FQOA 4NBSA 4AP9A 1EA5A 1OX5A 3PUVA 5IABA 1NVAA 3CTPA 4XOUA 2JG3A 1YJ8A 1J9GA 3HY3A 1NRXA 2CNLA 3I64A 4JVLA 2QYHA 1L4HA 1EXNA 3B9QA 4GHWA 2OFPA 3WGUA 2Z8YA 4S0XA 3SF0A 1IULA 4CQMD 1J8DA 4F1KA 1NIPA 2YBDA 3A1VA 5AIAA 1DOAA 1UFRA 1UZNA 4C4OA 2Q8PA 2KM1A 1IXKA 3OQBA 1NJ8A 1W2WB 3QXHA 3S81A 3AR5A 1AF4A 2JAUA 3DE0X 2SNIE 3L7KA 1FPMA 2F1IA 5BQOA 3TPZA 1EZZA 1JHUA 1Z0KA 4DWWA 1Y7IA 2Y2UA 2BI8A 2C5HA 2VBIA 2ZIXB 4IIYA 4ER5A 3WLJA 1POXA 4MLDA 3QX8A 2W8BB 2ZTMA 5IC6A 5TARA 4NH0A 1BEUB 1Z73A 2VG8A 3BVPA 3UMVA 1P4GA 3DTNA 1F6BA 1ODJA 3K0AB 4I55A 4UQLA 2FDCA 4TRNA 5CW2A 2ZBFA 5LUAA 2BE9A 1BVYF 3F47A 3C2QA 4KGVA 4L85A 5IAJA 4ZMSA 4LF9B 2EW1A 4U7TB 1T9HA 1LXCA 1T6BY 3EVCA 4GMXA 3WOVA 4J2TA 4CCSA 5LQNA 2AKEA 1F8XA 5E4FA 2PD4A 3T5PA 1VBFA 2HV8A 2NZWA 2VC2B 3IODA 3KP1A 3KSAC 2QR2A 2D74A 4OJQA 2V9CA 3I1YA 3M6FA 5CT6A 3GJSA 1O9GA 1WDKA 2ODQA 5D2CA 1BHJA 3H0CA 3NIFB 1MCZA 4MA5A 5T41A 4MYRA 3AT1A 3RK4A 1N6NA 4I3FA 3TLGA 3ANLA 4MO9A 4LDZA 1PR1A 4MW9A 1BGXT 3ISVA 2RB4A 1M1YB 2C98A 2H52A 1KBOA 1MRZA 3G2OA 1P5JA 2AFIB 5K8VA 3UM9A 4LFCB 4YNBA 1Z0UA 1MGOA 3L7AA 4ZANA 2P6NA 2OHVA 5SV2A 1BMTA 5ILQA 4DYVA 5IDWA 3Q8KA 4MPRA 1OBCA 4EB6B 1W4RA 3I1IA 4WZAE 2IPXA 4OB7A 3GFGA 2YWBA 5KTOA 1H2ZA 4BQEA 4PPQA 2ZIVB 4G86A 1E99A 4XIYA 3SMVA 1J2TA 1P3Y1 1T9BA 4AG5A 3I34X 4K9KA 2BFDB 3DBLB 1ZXXA 4DCPA 3UJ8A 1KZ7B 4DLTA 3QVGA 4RXTA 3CX7A 3PPWA 1PJTA 2WD7B 3QHQA 1Z3IX 3GLHA 3B3FA 2YIMA 1I3NA 1EFLA 1K3TA 3O8RA 2JI6A 3RDPA 5JLJA 1CFJA 1WDLA 3MT8A 4MVJG 1CSEE 4LKRA 3I2HA 1V8ZA 2IPMA 4A92A 5JPDA 1JVSA 2FY8A 2KBEA 3COPA 4ONEA 2UUOA 2V58A 4IZ6A 1GA6A 3QA3E 4KO1S 4G84A 2ZCJA 2VDRB 2VT6A 1T3GA 1JSZA 1PWXA 3D4IA 1DBWA 3EIWA 4GS5A 2Q46A 3FNHA 1V8OA 1XQWA 1I01A 4MV4A 1VHWA 3EIUA 3CH7A 1X2EA 2XUPA 4LX0A 3GARA 4FMCF 3GRZA 3QKUA 4LJ8A 1EUDB 3K71B 2MHCA 3N28A 2P5YA 3E1KA 2FV8A 2WOJA 1AQLA 4HX5A 1X1DA 5HRCA 2LWIA 4RA9B 4UD6A 5ECGC 5JCXA 3B13B 5AKLA 1D8TA 1OQAA 1EM8B 1QE3A 2QRKA 3ETGA 3OZWA 1R88A 4OGWA 4XQ0A 4BXOA 1SHZA 1JIIA 4EHAA 3G5TA 1GGVA 1NNI1 3JRXA 3KJFA 3OQIB 3CE6A 4D96A 2H63A 2A88A 3X43A 4ZOCA 1P7VA 1EA7A 2ETXA 2ZBEA 2FFBA 3HYCA 3ORYA 3NJRA 4O02B 4TMFA 3S0JA 3TWOA 3U7RA 4CG0A 1QVAA 2C4TA 2JEOA 1ISIA 3A37A 5C46F 1YZVA 3ILHA 1R18A 1DQNA 1PFKA 3UB3A 1SRQA 3DXXA 3D1LA 4V0MA 2IU0A 1Y7HA 5LYJB 1ZD9A 3QUBA 3T1QA 3VI3B 5E3HA 4I8DA 3ZV5A 5I8WA 1FF9A 3U16A 4GF5A 1SO8A 1GL7A 2QRVB 2YNMA 3V4FA 3GRVA 3IQXA 5BN1A 1N6OA 1H2RS 4YP9A 2EBFX 4AMBA 1ECLA 3M1YA 4NQRA 2O0HA 3PK0A 5BT9A 4AJ2A 1MVOA 1IQRA 4R81A 1QC5A 3C3XA 1X6VA 1PJLA 3D8UA 4RENA 1T2EA 1DI0A 3A4LA 4B2PA 1DE0A 4Z9BA 4FBGA 2EX1A 4Z6KA 5KMGB 5LLTA 3TVTA 5L7TA 3TZCA 4L7QA 3KD2A 3NW9A 3P0IA 5JSYA 1U0EA 1MF7A 1OOEA 2YC4C 3N2YA 1XTPA 4FC7A 1FDTA 2FZEA 4TTPA 4U39A 3LLSA 3ENQA 4CEHB 4CE6A 2V7GA 4MMXB 3L0CA 4X6YA 4BQQA 1Y4SA 2J0UB 3CR3C 4XEHA 3T3MB 2CUNA 3TECE 4B1FA 2PBZA 1KSJA 2AD1A 5HFJA 4B3TB 1IN4A 2XIJA 3C6YA 1N2SA 3DFFA 3FPJA 2XZPA 3UOGA 3ZCXA 1VE7A 2YWFA 1G19A 1GQQA 2ZSKA 3FBTA 1U3WA 3MTGA 3EFOA 1G5PA 1P1RA 4QQ8A 2G9NA 3U4DA 3M4ZA 2C2BA 2J85A 5TMPA 4M9ZA 1CEYA 2KS6A 2V5UA 3OPVA 4I4NA 4LCBA 1ZGCA 3MEQA 2QTNA 2YIDA 1C9KA 1QNLA 1EDBA 2HD4A 4ZYVA 4GNKA 5DI9A 3EULA 3PWZA 1W4AA 4PG5A 2G0TA 2G5GX 3LNTA 5GAJA 1KYWA 1N3IA 1NA5A 1NR7A 4FK8A 2QYOA 1ZOOA 2WT4A 3PRHA 3G0BA 4AF7A 5B3AA 1BA3A 1QRAA 3P0EA 5BNIA 2JAQA 2CE7A 1N5JA 2N3ZA 4KVGA 3WLLA 3PICA 3GFFA 1E6MA 2GYWA 2J6HA 1BCSB 1X7ZB 2V6JA 4M54A 2FUCA 3U9SA 3EXFB 2XMZA 2Z2XA 2OBLA 4QUKA 4C1BA 4YT4A 3K20A 4BGIA 1M5RA 3AEQB 1CQZA 1FP2A 3MRTA 3ANXA 4ENUA 5EKSA 3FHJA 4D7AA 4EUKA 2VJKA 1AT1A 1YDGA 1QH9A 3P9YA 3RVOA 4ZV7A 3EXEA 4MS1A 1HEIA 3IVCA 2RBGA 3KLMX 3NAGA 4WFJA 2GN8A 4PLTA 4K6MA 4DKXA 1QGDA 3WAKA 1P9NA 1YONA 4ETMA 2F1HA 1X7HA 4KI0A 1OI4A 4DLAA 4CNBA 4WWHA 1N5LA 4IDGA 2I2XB 3EB9A 1TM4E 4LZOA 4LOHA 2VSYA 3FCOA 5FTLA 1HNXB 5CLGA 1MTOA 1PFWA 3VSBA 1Y1PA 1Y8RB 1QIHA 2RSLA 4RHEA 2Q9AA 3HYNA 4G0YA 4GPZA 5C8XA 3O92A 1WM1A 2V8OA 1W4ZA 4OXQA 4XASA 4PBTA 3BGVA 1T3SA 3NOVA 1MN6A 3UTCA 1JHZA 2O2IA 2E85A 4ZI7B 1E98A 1NAHA 1N2BA 5GONA 4ZI2A 1EFCA 3VAYA 1C80A 4LSMA 3FI9A 4BMOB 1NN5A 5K0LA 2PZEA 2W7TA 5HXAA 4FEGA 1S3FA 1CJUC 1XLTA 4Q4CA 1A8QA 2YY5A 2EU8A 3TLXA 1JJVA 4G8BA 3F6CA 3F5MA 5DHFA 3GNQA 3EZNA 4G5YA 3E6AA 5A0FA 1EEXB 4NE9A 3IE0A 3Q8XB 3D4NA 4BOYA 5FA8A 1N75A 1RNLA 4O1HA 3OQIA 4MYDA 1B3RA 3BWVA 5EIAA 5KHAA 1J42A 1Z35A 4GQIA 5DM4A 3H2IA 4MPTA 3RYCA 3MZ0A 1CZRA 3FYUA 1U7ZA 3HA2A 1OC2A 1W52X 2I2WA 1YQXA 3O8LA 4KH1A 4L76A 3MWLA 2KW5A 5FHRA 3G82C 1EB9A 5HA5A 2R5FA 1B74A 2WHXA 3GJYA 4AZTA 1L9KA 3JWIA 4BRWA 5KTKA 1P1IA 2VYND 2Y1WA 3NXSA 1P19A 1IK6A 4UU0A 4KKXB 1P4RA 5JDCA 2XKKA 1O87A 2R66A 3T99A 2E2WA 2NV2B 4DXDA 2WIDA 4KVAA 1GTSA 4HOYA 1OY1A 3SNKA 1NPTO 4IUDS 4F3YA 1KDZA 3BH7A 1NXXA 3BS4A 3FVVA 3GF4A 3KO8A 3FCUB 1PHPA 4HB2A 3UWOA 3SEAA 4TV8F 1OCEA 4JEUA 4Q47A 4E1VA 2JAOA 1P4AA 1W34A 5KOIA 1X92A 3SMQA 1A5ZA 1THTA 2A5JA 3ER6A 3F6PA 3ONDA 4OM8A 4QODA 5JH7B 3DDCA 1KIAA 1NOKA 1P4SA 5CFQA 4KVFA 1NW3A 4KREA 3ZW8A 4QM7A 5EQJB 1FYWA 1ZQ1A 2LCFA 3A11A 4GICA 3LWDA 5AXAA 5L3SA 2OFOA 5KDOA 3KLPX 3NWPA 1GR0A 1KK3A 1QH1A 2NTJA 4U3JB 3ZQ6A 1DUIA 2WWHA 2ZRKA 2PKQP 3GVXA 4HDMB 1MDFA 2FH5B 3COSA 3WNQA 2NP7A 1Q1AA 1V7QA 4G6ZA 1TVEA 4A0SA 4JB3A 1RJGA 4JJGA 9LDTA 5KVAA 1ZNQO 1E8MA 4HNUA 1S6YA 3T5CA 3K5IA 3Q7TA 5KQSA 1DQSA 2BHLA 4V3CA 1M2KA 1WHTB 2AG8A 3D6TB 5LJIA 1T3ZA 2OZVA 2FTKE 1M1NA 3UMJA 1A8IA 3LX8A 4D4JA 3QE2A 3C7CB 5AJXA 2WK1A 1HSZA 4LJRA 3HTXA 3VVLA 1AMOA 4KVZA 2H9IA 2QTWB 4EKYA 4YV2A 1TRHA 4C21A 2XMSA 1ADGA 3ASYA 3H5WA 1SD5A 3MGGA 1RRPA 2VQEB 1M8PA 3H5RA 4ZCRA 2LBPA 4WXPA 2YQ4A 1USKA 1DOZA 3PSAA 2NSJA 3L04A 1GCOA 3UG6A 3WLSA 2XDWA 5DN9A 1L8XA 1IXRC 2GD1O 2OFXA 2ZLBA 4LBVA 4GI3A 3FKQA 4PLHA 3S2EA 4CQNA 4YUXA 4PN3A 4FZVA 3HU1A 2GLUA 3LKBA 5FD8A 5I48A 5CITA 1UOEA 2VPIA 4MS1B 1IG3A 5DYWA 3ZCVA 4HBGA 5M2QA 4FW8A 3FVWA 4D4HA 4LI0A 2VF4X 4QYMA 2L17A 3K1TA 2VOJA 4L4YA 2C8LA 3NUGA 3DMTA 3PDHA 3VU3A 3PLNA 1U11A 1HKUA 2PEYA 3AF4A 3E15A 4MWBA 2QMYA 1NYTA 2X9VA 4B40A 4PNEA 5G0WA 7REQB 2P6MA 4DDWA 1QZTA 1QLJA 4QHYA 1G3MA 4QYXA 4DQ0A 1MX5A 4P8RA 1QKKA 1YJCA 4HY3A 4TLLB 3C3JA 4WJLA 2BGWA 5LL6P 2HYDA 3D4OA 3STWA 1JILA 4NK5A 3RSCA 2JGKA 2FZWA 5AJWA 3R75A 4FHEA 4F11A 1SVWA 3JD2A 5THXA 5EUBA 1D09A 3UH0A 4TKMA 3OUZA 2HF8A 2BEVB 3OIVA 1E9AA 2PWYA 4E08A 4HLDA 1NATA 4B0PA 3DMYA 3S7ZA 1WPRA 4BP1A 4R0NA 4RVCA 1M6YA 4RFVA 2UUBB 2CJPA 4KXXA 2QY6A 2F9FA 1JH8A 2ZBVA 3D3EA 4OHWA 1P9RA 1L8OA 1XRSB 3GROA 3K9HA 1X19A 3AEUA 3U3OA 4YCSA 3J80A 5BQ3A 3ADBA 1RXIA 4KR2A 2CNOA 4XKJA 3OG9A 5K3SA 3O75A 2CLFB 2IXDA 2PXHA 4YK7A 2CD7A 4ND5A 2G3YA 2ZUBA 1BXKA 4W8GA 3EGCA 4MARA 1M2HA 1TAGA 2A1IA 3FB1A 2EP7A 4MNTA 4YRCA 3TUZC 7ABPA 3OLYA 1QGYA 1M8GA 1IY2A 2W4IA 1FS5A 2ODBA 1ETHA 3AW8A 3C98A 3MFYA 2PQ6A 1A5TA 3AIIA 3MJRA 2DBRA 3BORA 4P35A 3HCAA 4NHEA 3ITKA 4YJHA 4L0MA 1YRYE 2VHQA 3KVRA 1RBMA 3V4LA 3DWEX 2PU5A 2XAUA 2YV2A 5GIOE 3CSSA 4BTVA 2QMUA 1PTJC 1TLTA 2ZAGA 5DM60 1DEAA 2WD8A 2X1LA 4I1SA 4RPIA 1G9XA 2J3KA 4OMCA 4HWGA 2FK8A 3CX6A 3QMMA 6Q21A 1AM4D 2PT5A 4Z1MD 1I32A 3LDAA 3SP1A 1PSDA 4AMVA 5F4BA 4BDTA 1U2DC 3C4QA 1C9YA 2WVJA 2ZQYA 4D56A 2CZQA 2Q3MA 3OZGA 4G0PA 3EXHB 4KZPA 5G53C 4Q1VA 2VDJA 5ETJA 3E70C 3WWYA 2ZUCA 1NLYA 4OO3A 1F12A 1ZMRA 2IHUA 4YCBA 5GJWC 3IO5A 1Q2XA 2K6GA 4KIGA 5A7GA 3TH5A 3A27A 4XE5A 2PBRA 4EFDA 1VI2A 4WHMA 5FP0A 2OAEA 4DR5B 5FUWA 1OLSA 2Y77A 2X4LA 4PYLA 2O54A 2JI4A 4Y2TA 2G8LA 3CRZA 4PSKA 5HMMA 2QU8A 2JAPA 2FEKA 1MOSA 2D6FA 4L15A 2CVQA 5I9LA 3IV9A 4HP8A 5KS2A 3DOHA 1HEUA 5F5LA 3UHPA 2YYZA 3AVPA 1UFVA 3HFSA 4MR8A 1BE6A 4XYEA 1Z0ZA 4QAQA 1AGPA 3RFVA 1P0PA 5HIJA 3RHFA 1XJQA 4LBZA 4CIDA 1IJBA 4Y9TA 4B8YA 2D06A 2DHDA 1G16A 4KIWA 5FKJA 2J33A 3F6RA 3QJGA 3CLKA 4K3VA 2O2YA 1A8SA 3DD5A 3S1LA 1K8XB 4HWTA 1J06A 3U2QA 2P65A 3A6HA 1P0IA 2GAAA 2OD9A 4HWKA 3GV0A 2JB9A 2GPTA 4OPMA 3ZLTA 1RKUA 1C8BA 3G8CA 3LCJA 1S1CA 3NOXA 1DXYA 2YV5A 3A4TA 2MDTA 3ADOA 3HA7A 3CRW1 2JFUA 4UHCA 3UMCA 1THZA 4AY3A 1CLEA 3SDZA 4CQLA 3PKZA 3G68A 4DBLE 1TNDA 2GM4A 2H16A 1X7ZA 2P40A 3QJ5A 4BX8A 1RWXA 2JHFA 5EOVA 3EEYA 5E2BA 5JEEA 5H70A 4AT1A 2JLAA 1GEEA 1BMFA 3Q3HA 1KY5A 2DPGA 1PFUA 2WSYB 1V45E 3K73O 4HYEA 2QRLA 3RODA 1V8PA 3A9UA 4EDHA 5BPFA 2WTXA 4L9AA 4JLNA 3ABZA 4I1YA 2HRRA 4UATA 5C37A 1II8A 2VAWA 3JQDA 4LHWA 3Q6IA 1E62A 4QDUA 4DG9A 5JD6A 1ZH2A 5L9AA 1L5VA 4A8JC 4CI9A 3LXRA 3BCUA 3O8OB 2CVOA 2A9RA 4ZT5A 3ERCA 3ZCRA 2V7VA 4LF5B 3GA0A 1C3EA 3D5TA 4LQLA 2NO7A 2IZ5A 4YP0A 3V2GA 3V7UA 3ASUA 3HCOA 1WL8A 1CF2O 4BECA 2XCRB 4Q19A 1P77A 4LOKA 4QXOA 3KDSE 1VKJA 4RZUA 3LLCA 4UCXA 1LWNA 2FZKA 4BO4A 1EE9A 2H0QA 1DUSA 5KOYA 1EWYA 1VMKA 3J81k 3HK2A 3THWB 4OSPA 5IKMA 3WGOA 2CFTA 2XNDD 2CNDA 3ANYB 2YZ7A 4M22A 5D7NA 1NBAA 5C0OE 2W11A 4IQ4A 3TTSA 2LW7A 2ZI9A 3GMIA 1P6XA 4A10A 2FPIB 2VJBA 4WLNA 2IKQA 4E5SA 3EDCA 4EGQA 3L0BA 3DBHB 3BCSA 4KXVA 5DBFA 4AY4A 1BS9A 1T5OA 1MZPA 4LYYA 4YO7A 1RQ7A 2O2EA 4GAEA 4OXNA 5DK6A 3RSGA 4DUYB 3GFPA 5EKXA 3TRHA 4XDZA 4DWOA 4ZI7F 1A71A 1V6SA 4YMHA 3IBGA 1B16A 1J8VA 3HZHA 3LK6A 4Q00A 3LW7A 2QAJA 1PWEA 3RVRA 1P9LA 4D80A 3IDAA 3UJ6A 4ENRA 5J4HA 5K01A 1G1AA 2B4YA 5BSMA 2JH3A 3RFUA 4O29A 1JLSA 5HTKA 5KDLA 4U6SA 3Q2IA 4LRTB 3VR4H 3PUYA 1E6WA 1Z12A 2BE7A 4IUCS 1E3QA 2ZE5A 2MJLA 1EKXA 4ZCIA 3S2SA 4S35A 3W5BA 4CIYA 5E0KB 4MVJM 1HRDA 3F3YA 2KLBA 4PZPA 5LBIA 5TJ9A 5J23A 2Q62A 2EBHX 2R8YA 4PSAA 3T61A 1YC5A 2JFPA 4X63A 3RV4A 5I5GA 4J1TA 3T5AA 4G5XA 2X22A 4U2DA 4DG5A 1Y4ZA 5G4LA 1BKSB 1VP3A 2MSDB 2WWTA 4LWOA 4DLZA 5C80A 5C8ZA 5CCXA 3MN1A 1UKBA 1BXRA 3RS8A 1KZGB 1DJLA 2J08A 2ZTUA 2X8WA 3BM5A 3HWX1 4JJ7A 3V8EA 2IDKA 4B35A 4I5GA 3DCJA 2W6OA 1H8ED 1TAQA 3I9V6 3R5XA 4LHSA 3WWEA 4BO9A 5SZJA 521PA 3AKEA 5C5IA 1Q1BA 5C7LO 1OH8A 221PA 1GZ3A 4RPKA 2WRZA 4PZUA 2ZYDA 2BGRA 5AVTA 3G5AA 3EIOA 4XJTA 2WNHA 4R54A 1DBIA 1Z83A 1SJ9A 2I3AA 3JV7A 4UZEA 2PZAA 4CTMA 4PWYA 1A98A 1HETA 2QUHA 3BMXA 3A06A 1D0VA 5JO9A 4PLCA 2CCJA 1Q7CA 4ZOQI 5AT1A 1LLCA 4LDJA 5DBEX 1TAUA 1ENZA 3CZMA 1CVLA 1A9YA 3MWKA 4GFDA 1WQ3A 3V8VA 3BDIA 3KEMA 1U90A 1T0JB 4JVMA 1T1EA 3FX2A 3A6ZA 3MXTA 4B6PA 5KNCA 1AGNA 1U7XA 1WMDA 1X42A 3HXKA 5BNWA 1RAAA 5TE9A 3TTXA 1WXHA 1I9CA 1J1IA 2H9AA 3EIXA 5K45A 5K6RA 3RO7A 2IELA 2FOLA 4KMRA 1FBTA 2HREA 1CB7A 2FQXA 1I1QB 2HU2A 4WT7A 2J30A 4URVR 1W0JD 4I1RA 3F74A 2WV7A 3WFIA 4YAIA 3DQZA 1U5BA 2H1FA 3GQVA 4PZZA 3DAFA 3W05A 3IURA 4ZYZA 1XP8A 1ZA1A 2HRZA 4Z7JA 3MBKA 1OJLA 1OD6A 3VR3A 1AQUA 5F5XA 4QIHA 4OHMA 2Q8QA 2DCUA 3AB7A 1DQPA 3OCUA 5FBQB 4UZSA 4Z51A 3ZJ4A 2WYUA 3SE0A 1Q91A 4ARAA 3I3OA 1URPA 2PKQO 3KSZO 5I9IA 1L7DA 1QHXA 3DNFA 5H3LA 1O8BA 1XZPA 4BNLA 4U7PB 1F0PA 2X7HA 1XX6A 2IHNA 5BUZA 3TZQA 1B8VA 1WABA 3G7UA 2V45A 3PITA 1GQOA 1JQDA 1HDZA 2GD6A 3R6WA 4CHTA 3IQDB 1RIFA 4PXYA 4WK2B 1TIBA 2WD9A 2PN1A 3F0TA 3EMBA 4O4HB 3G49A 4P80A 1CZOA 4E94A 5LZ2A 5C5CA 3DBIA 1T4BA 2DFTA 2XTZA 2GVZC 4KWHA 4Q03A 3R20A 4BP3A 1S5PA 1HE3A 4YI3A 5B57C 1ZN7A 4U0JA 4X8HA 4B5KA 3SZUA 1YQ9A 4KAJA 4A82A 1EYZA 4BQPA 4BZZA 1Z5ZA 1E7QA 4YRFA 4A26A 3QKSA 2CZCA 4MVJP 2JLSA 2EL9A 3VC7A 3VJMA 4RJ2A 3B1KA 3X1WA 1UWCA 1G4UR 1VYVA 3ESBA 4FYPA 4HQFA 5SYNA 3H8WA 5B6IA 1YL7A 2QN1A 1I80A 3NBMA 5C1IA 4CUJA 1B1CA 3LL7A 3GDWA 1OWMA 3ESQA 1N0IA 1VHLA 5BMVF 4RZ3A 2FN3A 4W99A 3M5WA 1OI3A 3DF9A 2HAEA 3JR3A 4BX2A 3L7MA 1GGJA 1UDAA 1PG0A 1Q5PA 4CIXA 4BE4A 2OCIA 4IGEA 1ZNWA 3PQDA 4ZICA 1DBPA 3M9WA 3ROMA 1WPXA 2FMTA 4X8MA 2YV4A 1OYVA 8GPBA 3KIPA 2RKWA 2YR0A 3ABOB 1SXJA 3X1MA 5EXPA 4DIKA 3UXHA 1E94E 1DG9A 3EGWA 2ZPTX 4EB0A 3T35A 3AUJB 3D2BA 4PC3A 3MOGA 3N2EA 3OOWA 1DB3A 5LQSA 5DI3B 1LRKA 4X1IA 3GHHA 3TKLA 2BELA 3BG5A 3JD3A 3ZVLA 1UBOS 2O5EA 1G18A 1R0SA 2JFBA 3K1JA 4N7BA 4R9VA 4URHA 4HDRA 4AZVA 4URXR 4KFCA 4EGJA 3DCNA 4NBTA 3UJ9A 1NXTA 4QFDA 1XDUA 1BDHA 1T8TA 3ZH2A 1D8AA 5LA6B 3STTA 4TVOA 3USES 2JW5A 2Q3JA 5TC4A 3GB9A 4GR5A 2QX7A 3NAQA 1Y82A 3NTQA 1ZNZA 2O8BA 2V6MA 4F4UA 4A8JB 3ZHYA 4FHFA 2NVUB 2PT9A 2B78A 1CY4A 1CV2A 3IEMA 2HMAA 3SM9A 3I61A 1P2UA 1Q7GA 4D02A 2J3EA 3KOYA 1LLFA 5D3ZA 1OAOC 4KYTA 5JUWA 4UEQA 3TVDA 4O4IA 2VR1A 5ALKA 5A6SB 1QHEA 4PLFA 4HN4B 5KBYA 5A62A 2YC2C 3MMPA 1KZHA 1CUWA 5IZCA 5BVGB 3AHHA 1ADBA 4LCEA 2FJPA 2AC7A 1JIQA 5IAEA 3WICA 5DWVA 4M21A 4BE9A 2VXCA 5LQMA 4RO0A 5CIWA 4YEDA 5GY7A 2K5UA 3QMPA 1J0EA 3WRYA 1SBTA 4I08A 2HB6A 4OXKA 5DI3A 3V7NA 3MJDA 3IVXA 3WKCA 4R71A 3OOYA 1FUIA 2GJAA 2W37A 4PG7A 4HJXA 2C97A 2QMEA 1ESCA 2AFHA 3GAMA 3ZD9A 4KPUB 4BP9A 3NM6B 1ZUNB 2NZ2A 3ZHVA 1AUPA 1ZH6A 3CWCA 4QWWA 2BM9A 5DVZA 2XJ9A 3VI4B 1N8KA 4CLOA 5HCUA 2QY9A 1FZTA 4YRGA 1N25A 4FKBA 5AVVA 4G8CA 1V48A 1BD3A 1YDMA 3A2KA 1DFIA 2YWXA 3QF4B 3OEWA 4DXHA 3ZKAA 1JQ5A 2GVDC 4WCFC 3SY8A 3QBEA 3H04A 5LR6A 2X13A 1P80A 4JYZA 3PQEA 3RSLA 4GWLA 4ADSG 2PUBA 4LTDA 2OSVA 2VJYA 4BUCA 4E5MA 4M7RA 5ARBA 5GTDA 5JAUA 4NAUA 3LPDA 1KNQA 2HMSA 2JGMA 2YYAA 1D0SA 4LFBB 1JMVA 2HQRA 3N7UA 4DV1B 3CLVA 1SM4A 4LVNA 1V3QE 3FPCA 4JLVA 1OKKD 4MB2A 4WECA 4Y2HA 5GV7A 3RTCA 5K3FB 4I1UA 3R1IA 3WGTA 1JT9A 2BMJA 4H3VA 3FM9A 2UV8A 3SJAA 2MINA 4L5BA 3UMFA 1UOPA 4RL6A 2XWQA 2R60A 4J3FA 4Q01A 3DULA 1FQWA 1B6TA 2VHWA 1K4MA 5EEHA 4YMLA 1Z22A 4P36A 3RF7A 3ZLJA 2A5GA 4POOA 2D5LA 1N9ZA 1QOQB 4IFTA 2GBPA 3I6BA 1S96A 1F1JA 1KEKA 2G36A 2B8TA 4N49A 2C5SA 3GGDA 1PVVA 4KOAA 4QYIA 5DNVA 1JG4A 2LXNA 4FFPA 4NJEB 2H1HA 1A9QA 5F2KA 2C57A 4LHYA 4XH9B 3U19A 2VDWA 4BMXA 1U3CA 1QG6A 3RC3A 4OI2A 5ITZA 4ZXPA 1ML3A 5AKZA 1Z74A 3GOHA 1QQ6A 4IIFA 3ZX5A 1TGYA 1ZW6A 2I4IA 5I5EA 4Y2YA 1I5OA 1DX4A 2OZPA 1T0UA 3BZBA 2DBVO 1CY0A 1W59A 4WBSA 1E3DA 2PH3A 2Y1CA 4QUHA 2R8PA 1IUPA 4F71A 1DJMA 3F1LA 1V43A 2I4MA 3KQWA 3WNBA 2FR8C 1DELA 2N1MA 3AKYA 4W5JA 3UH1A 1MABA 2FI1A 2ZBUA 1QYIA 1G3QA 1GPYA 2QRMA 2X1VA 2ZIXA 5LP6A 2CK3D 2BJHA 2Z5GA 3O91A 3PC2A 4X8LA 3UK7A 2I22A 2C29D 5DLPA 3NCHA 3K31A 3LC7O 3ZU3A 3H7IA 1U8AA 2RE8A 4RSGA 1I5EA 3GDGA 4BJ1A 2NAPA 2DKNA 1FBNA 2PLWA 1CQJB 4BCDA 4GOMD 3ESXA 1MV5A 1YZKA 3RS5A 3A0RB 3EDMA 2XMDA 1RIIA 4CDMA 3FIJA 2Q6TA 4WY2A 2UU9B 1S02A 1Y3CE 1U9ZA 2VXBA 1N0VC 1Z5WA 2FRDA 1M10A 3MG9A 4A8PA 2WKQA 4M9QA 4DDTA 5K4GA 4PO9A 3NBYC 1X1TA 3H9BA 4XLTA 5B58C 4JLOA 5CFZA 4CEHA 2PSSA 1RE1A 4U2BA 4RADA 3D64A 2PL5A 3UJAA 1RJEA 2W8BA 4IIVA 1UAYA 3BTUA 1YHNA 2OXIA 3VYTB 3NKVA 2R7LA 3N0XA 5KYKA 1A4XA 1S1MA 3G2KA 4HGZA 4YLGA 2FZ5A 2XSZA 2IEZA 4ZEXA 3W6NA 1IDN1 1MXFA 3B2QA 3EISA 4RZQA 2JAXA 3RRZA 4CETA 1H2EA 1V16A 1X8LA 3STUA 4Z3OA 1VE9A 2Y1OA 4EYEA 5J2TA 4BCBA 5L7YA 3L7DA 1QG4A 4QPDA 2W6MA 4MRNA 2HPAA 2QD5A 4G5RA 1XQ1A 5JSZB 1AHNA 2Z30A 2WIJA 1AXGA 1QZZA 3MTAA 5CAEA 4E88A 4TZ0A 4I0WB 1NN3A 4WTOA 3ZHZA 4LHZA 3UHAA 4TTTS 2DFPA 3KDAA 1R0KA 2NVBA 5KC9A 3NLLA 2GWHA 1JG2A 3M3DA 1N5RA 3L9XA 1J4AA 2ZREA 2XTNA 5B5SA 1FIUA 1UBJS 3LLUA 3VJRA 1SAYA 1S8FA 4NENA 3AEQA 5CNKA 1RM4A 1GITA 3TPCA 3I3SR 3NDIA 3O4FA 3O8QB 5IBRA 1QR6A 1THMA 4HNAA 4EAQA 3JWGA 1GEGA 5ITWA 1C9JA 2M1ZA 2XMGA 3VPAA 2FQWA 1IC6A 3H1EA 4RF3A 3GFRA 1L1EA 1LK5A 4MP6A 4F4HA 5A5EA 3P4YA 4BNFA 2QJFA 2WNIA 4RPCA 1J09A 3U1VA 1HA3A 5BR4A 2D5CA 2Q2WA 2A5DA 2UVQA 4P3PA 1SKBA 4B3JA 5DH9A 2O14A 2WI8A 5TQJA 2Y93A 4KPGA 3N7TA 1IWBB 2VLIA 1BXGB 1T5DX 4EW6A 1VXRA 4KITB 3Q3EA 1EVYA 3ORSA 2REOA 4BWFB 2PK3A 5AI8A 2HR1A 5AVJA 4M99A 3OLVA 3IA7A 3TFQA 4PQGA 5BSGA 3QKSB 4CL3A 1E6LA 1NONA 5IK2D 4W9NA 1K7SN 5BN5B 2QN7A 4LCJA 2WVHA 2GHRA 3D5EA 2Q5FA 3A7DA 3HS3A 3ONEA 4GP9A 1XA3A 5J5VA 3VSEA 3FMIA 1ARZA 1DDOA 2BY4A 2CFSA 3GRKA 4I19A 1IY1A 1FSGA 4FFVA 3VH3A 4AJHA 4R9UC 4B3RB 1ZZEA 1T2NA 1XHLA 3O3CA 2OCLA 2VZ9A 4F56A 2M6KA 4EPXA 4F4FA 3K70B 1D04A 4KQ2A 1OV6A 3W3AH 3UFXB 1SG6A 2Q49A 4HB3A 1DBRA 1PX2A 2Q3BA 1IOLA 2XGSA 2O2ZA 2Q5EA 2A5YB 4K88A 1NFRA 4BNDB 2JFVA 2C04A 3ABIA 3FSGA 1WZUA 4FSXA 3ROKA 4EFLA 4P1ZA 3ZK7A 1DAHA 1XJCA 1HZJA 3JTEA 4YAJA 1Y9JA 3U44B 3O0DA 4FNAA 4FSHA 1ZHFA 2BT4A 2FLVA 4YQZA 1LZLA 3TIGA 4BVJA 5FUBA 4MK4A 4B6FA 3UYLA 3BH0A 4HDRB 2O8DA 5EIHA 2Z8XA 1U0JA 1HY3A 3FNEA 2JKZA 1SUEA 3DTVD 3PXBA 1ESZA 1NVDA 2POCA 4EA7A 2AJTA 1CJTC 4PF1A 3QFHA 3JRNA 2X6QA 3D3QA 3PNYA 4R7TA 1ISFA 3RS2A 2W42A 4C7OA 1MC5A 3NCTA 4DNOA 4BEWA 3E9QA 3KZXA 2A9KA 2NP6A 4B71A 2NV0A 3ZGYA 4Q1CA 5ALZA 3RSOA 4WDRA 1JZSA 1UEJA 2EYUA 3AXTA 3P94A 3AHCA 4M1KA 2EATA 1U9YA 2X58A 5IYZF 1HQCA 4NH4A 3GRAA 3T3PB 4AUKA 3NFRA 4X94A 4OHCA 3BWYA 4DMFA 4MHTA 4U02A 2AYYA 1OLUA 1ISGA 2JBAB 4FCWA 3EAFA 3RRFA 4YXFA 3WLNA 4JHXA 1GAEO 4UHKA 5DLDA 1FFDA 4G4IA 2JF0A 4OFZA 4ZXFA 2JJ2A 2X0FA 1R4MB 4MVJD 2D1RA 4GRAA 4FLFA 3W2FA 2VBGA 1B0PA 4P7GA 3SDBA 2V0GA 1JH9A 4RACA 3RC8A 1R8YA 3MT7A 1RPAA 4UQOA 3ZTYA 4MUBA 1KKLA 1IBSA 1WVGA 2HL6A 4NESA 4RHXA 4D9EA 3DQPA 1QFXA 3D6UA 1UMCB 2XHZA 1Y1QA 2W2VA 1SB9A 1Y3IA 3H75A 4DNQA 4G23A 2P9QA 1EQAA 4N4AA 2HEGA 3T6KA 4MA0A 5EHXA 1E2LA 3THXA 3IR7A 4A2WA 1FUEA 1NVEA 3WIVA 1KH3A 1V4NA 2V7EA 3SVLA 1KI3A 1VLMA 2JFYA 4C4SA 2QXYA 2V4UA 2BHSA 2PMEA 3R74A 3LS2A 2V6GA 1QF6A 1QH0A 5ERXA 1TZMA 4MITA 4RGVA 1GTJ1 1G2IA 1QBKC 3QX7A 1MX3A 1XVVA 4X45A 4G1UC 2ETVA 4CLXA 5IU6A 3HKCB 4LF6B 2FSVC 4ZK6A 1PJ2A 2DY0A 4OHVA 3ZIAD 4NLLA 2D4HA 4RCZA 5E3JA 3TL2A 3F6EX 3L07A 1CT9A 4JGIA 2PQMA 2QN9A 4HI0E 1D2RA 1DXQA 1VE5A 2EG9A 2JL1A 2P69A 1I2DA 2R6DA 1GFWA 2CXTA 4PGGA 4DBLC 5DM1A 1UADA 1V2GA 4HKTA 1RXCA 2C2GA 2YN2A 4HVTA 3K9CA 4QU5A 4X44A 2Q5LA 2XDQA 5HKAA 2I8AA 1H0SA 4OQEA 1CY1A 1MJ5A 2ZRHA 1FFAA 3LDFA 2CLSA 3ADDA 1UBKS 3K7EA 4M36A 4M87A 2X0RA 1IQ0A 3JZDA 4LSZA 4M8IA 4W9NC 4BN4A 4DBZA 2YMQA 4ZWNA 1XAJA 4G1EB 1KC1A 4ZPXA 4KPYA 1Y8QA 4QYWA 4HF7A 4KIUA 3I9KA 3HL4A 3NHMA 4A0RA 2ZYHA 2W6JA 3IP3A 1Q15A 3AM1A 5G41A 3V32A 3WAJA 4AJ9A 3RIYA 1ODSA 2P0YA 4FU0A 1SKYB 1HDRA 2JKVA 2PXXA 2PRIA 4FOSA 4KTVE 2C2ZA 4Q7JB 3R9KA 4E2WA 1KO4A 4Y1EA 5JAMA 4C4YA 5K0CA 3ZJUA 1OH6A 1NQVA 4OBBA 5K3EA 2IYOA 5GQSA 2FJUA 4TKUA 3PX3A 3PXDA 2JIBA 5MFPA 2OT3B 2BGTA 1IJEA 4AWAA 4BNMA 5FEMA 1II8B 3IPXA 1F38A 1KOJA 5IZ4A 2IH5A 1O1YA 2VZ0A 4N48A 3LBAA 5ILGA 2Q7DA 1D2GA 3N86A 1XVTA 3AG6A 2GCGA 1PLJA 3LPLA 4FILA 4TTJA 5JR3A 1MDBA 1ZMTA 4IIDA 1D07A 4N7RA 3A1CA 4H1UA 1BQEA 1CWUA 2CLHB 1DO8A 2YQZA 4MKGA 4MUYA 4Q16A 4Y67A 2H5IA 3G2PA 2PDAA 3ICVA 3OWHA 5FB3A 3GEGA 4B82A 4BNJA 3L4EA 1RS0A 2UDPA 2GN4A 2N9UA 1LPNA 1O4WA 1P62B 4V02A 4II3A 4B43A 1GTZA 5DTIA 2AJDA 2O1SA 3GPCA 4MGIR 5EHIA 2VEDA 1FFGA 4EARA 4GEGA 1PE0A 1V1MB 4EG3A 1KWGA 3H83A 2COKA 2RH4A 3C6XA 3P32A 5HUJA 2BD0A 3JQRA 5LOVB 4HDQB 2PLNA 2VXOA 4WOBA 1U3TA 2EZUA 1A9PA 3WYEA 2R87A 1ETUA 2PSJA 2OQ2A 3G2LA 2QHXA 1ECFA 3LYUA 2IZ0A 3ZU2A 3ZWWA 4YMTA 4OSEA 4TWAA 4PCUA 4HLUA 4C4XA 1JNYA 3B38A 2V1XA 1EUZA 4R2XA 3SIRA 3QE9Y 1LPPA 4XQ9A 4E22A 4JC8A 4QT4A 3KOUA 5AKHA 4UTPA 2G1KA 1AHIA 2H3EA 2WQZA 3KZCA 4V39A 3FCAA 4D8TA 5BQXA 2Q4EA 3FAKA 1GAWA 1ZVMA 4WFIA 2ZB4A 3L01A 2D00A 3ZKWB 4Y0AA 3HJUA 5LQKA 1P0CA 2PCJA 4KIJA 3PGKA 3TB4A 3TRFA 5GZ1A 1F9EA 2DZDA 3DPUA 2NUAA 4J7AA 4WXRA 1HZZC 1RQNA 3W34A 1K8YB 3L7NA 5HOQA 1K7FB 2ZZKA 3BHNA 4HUQA 3WB0A 4DCNA 4DIBA 1V3TA 4DLWA 2W4MA 3JVDA 1L5QA 1OXMA 2WTBA 4IXNA 4U7JA 4DCMA 2PGXA 2PPVA 3VHRA 3D6MA 3EC1A 2C9BA 2QQGA 2G8NA 3PHBE 3EBLA 1IHDA 1UJBA 3AH8A 4GECA 1OYWA 1TIKA 1UKYA 3OKCA 4HNTA 3GJRA 3WK5A 4JHLA 5TS3A 1WUJS 4NOMA 4PYRA 3IGFA 4AWBA 3MBOA 4GI5A 4UBLA 2O48X 3OPXA 1SCNE 1E58A 1CS4C 2RI0A 2WMDA 3PVZA 5CR9A 5TVGA 3DKPA 5D7BA 5ADUS 4HV4A 1ZEMA 2ZRDA 5EMNA 4DRYA 5B2EA 3ZTWA 1A9XA 4QXPA 3V2UA 3UO8B 4L4ZA 4DMHA 1ZISA 1NX6A 3Q12A 3C43A 1DQRA 4YAWA 4BBPA 1Z6XA 3WNDA 4HNSA 2GEBA 5FBHA 1WMEA 4H16A 2HZBA 2VHTA 4OQDA 1MFPA 1L4YA 1E7SA 1QQ5A 1S8OA 4UUPA 2QT1A 2FSHA 3RFTA 3WE7A 2DC1A 1G8FA 3QKRA 4C2AA 1X9IA 2GHIA 4ZV9A 3KQSA 1JV2B 2G04A 2IY8A 4NY1A 1NVFA 5FX2A 5FAKA 3AZPA 3Q8MA 1ECJA 1IHPA 2DUNA 3N2IA 4TMZA 3WQBA 1NBMD 1FSFA 3O6VA 1M2EA 1RRVA 3AC0A 2XRFA 2HJ9A 1JUDA 5AHXA 1RC8A 4DARA 2VK1A 2TMDA 1FSPA 4J0KA 1ZICA 1D2AA 2SBTA 3IAUA 4EP1A 2BTEA 4BNKA 2R4UA 2H1CA 2IV2X 4QO8A 1P8JA 2DR2A 1WUYA 2JLQA 3AI3A 5CM2Z 2G5CA 2NXNA 3L0OA 4KXWA 3SSMA 4ZQIA 4TKVA 3IT0A 1ZRNA 4WEOA 3PNQA 4UNRA 2CNWA 4NFSA 3A04A 1FNCA 3K1AA 3BXEA 3LT5A 4C0XA 1M7GA 4EHBA 1R12A 2E49A 4P2BA 1A3CA 3U6BA 5BWOA 3GQBA 1T6XA 2V7XA 1BWRA 4IDBA 4LDAA 2NN3C 4BYGA 2PX8A 3GEBA 2E4ZA 1ONBA 1LSJA 2FMIA 4E5PA 1RHUA 3D0QA 1SY7A 1O0CA 2IPOA 5IVIA 1PG5A 4KCGA 1PZNA 4WOJA 2PG3A 5EERA 3W9UA 1SXQA 1ZD4A 3MJFA 1W85A 4FZJA 2RHOA 2AJCA 3CLHA 2JI7A 5TEWA 3R09A 1M54A 1ZQ9A 1XLWA 3M33A 2N47A 1RYFA 1FJ2A 2Q5HA 3D81A 4D8YA 2JLYA 2IXEA 2JVIA 4FOTA 4JU9A 1JE0A 4BNTA 3ADKA 4QQKA 2EZ9A 1KEVA 5LOVA 1KQ3A 3AERA 2JPDA 2H1RA 3ICQB 2QP9X 3L7CA 3PE6A 2A94A 3JSXA 1NBWB 2Q50A 3COVA 2P78A 2QRQA 4LAFA 4MCAA 4RD1A 3BC1A 3LO8A 2VJCA 2B1RA 4K8OA 3UJCA 2X1MA 2PMKA 5A2GA 1ZD3A 1J1UA 1SVOA 1TCAA 3J7TA 4LSWA 4BLPA 4BQOA 1GADO 3PVSA 2Q5IA 1PYGA 4ZT2A 1GUBA 1HLPA 4D6XA 1P2FA 4PZLA 5L3QA 3BSYA 3CW2A 3UMRA 4CMEA 4DZZA 5AIBA 4X8OA 2OEPA 2VQ6A 1XIVA 4EUNA 2I4RA 2NQ2C 4P4UA 4H0CA 4BRUA 1GA4A 4O33A 3UVEA 2VRCA 2CYCA 3CLUD 3PCXA 3PIRA 4D3YA 5AK0A 2GN0A 5KYWA 3OCCA 1NQTA 3OE7A 5T4BA 2XTJA 2VNAA 4DNPA 1D5WA 2Q1TA 4O2AB 4YRIA 1E4EB 1TW2A 2HWWA 1KQPA 2AQIA 5SZHB 3ILYA 5CEJA 3W7BA 4Y2RA 5B7NA 2VJPA 2ZT6A 4GMGA 4LTMA 2AJLI 4REQB 3ZJVA 1J22A 4HQ0A 1PX0A 1JYSA 1L7RA 3KTOA 3EUFA 5F21A 4DQVA 1P91A 3QG5A 3FTNA 1PW7A 1KF0A 3KHKA 2XGGA 4QUBA 2QR5A 5MGBA 2UYHA 4OP2A 4P98A 5DF1A 5BMOA 1ELOA 4AKSA 1FUUA 2WQ6A 4NCHA 2Q1SA 4ND8B 3RIHA 4W5TA 4AY6A 3DV0B 1R1DA 4AJPA 4XYGA 2Q28A 1I6MA 5ITVA 1NJ1A 2VSOA 1Q17A 3LUFA 4HAUA 4U63A 3S8MA 4DHWA 4JSRA 1EZ1A 3IBSA 4NC9A 2H1IA 4H77A 4FP9A 1SEPA 1YVRA 4AY5A 1WX1A 5ITSA 2F1KA 3DB1A 3LUCA 5ALIA 1O7JA 2FZVA 2JIMA 4QGAA 1XYVA 2AQ8A 4P22A 3IQWA 4WCVA 3O8OA 4UNSA 3RYTC 2AZTA 3GCXA 3Q2KA 2ZB8A 4MSUA 3ZY5A 4CEJA 1I3MA 4D41A 1T0BA 2QSZA 3GMTA 4M4SA 3W2TA 1WPQA 2Y1KA 3CZPA 3CRRA 2OD2A 2V96A 2B2CA 5G0VA 4ZDWA 3BAFA 2JCVA 3B5JA 3FNGA 3SGLA 1CVRA 2R25B 1WNFA 4Q3LA 3TW4A 1X1AA 2XOEA 1I4TD 1XLTC 4RQBA 4KQWA 3IPAA 3KQVA 4DT1A 2Z6AA 2A8YA 3OURA 1P2BA 2XA2A 5AUOB 4D1YA 4IJUA 1TZKA 4RQUA 3G6KA 4XLLA 2W2KA 4ZALA 3GMSA 2EHDA 4RAOA 5DASA 1QJ4A 2JIDA 3KJNA 3EAQA 1YUNA 3NV7A 2DQZA 3BCRA 4KDEA 4OHRA 4XM0A 2PL1A 5BV0A 2H2FA 3U48A 1C2YA 3B1VA 3PDCA 3ZNOA 3HLYA 1J0BA 4Y1RB 3JTMA 4IIXA 4GYWA 2OD7A 1RMYA 3R76A 4E6EA 2JJMA 3PYXA 2FXVA 2QVBA 4C3UA 4C78A 1MX9A 1O57A 1GGNA 1Q2UA 2YFHA 3IJEB 4YH1A 1IHXA 2EJTA 2FETA 3VTFA 1HG0A 1B6SA 1R6BX 2LE0A 1RBZA 2J32A 2J4DA 2VUUA 2GLXA 4NATA 4BP8A 5ADVA 1J2YA 2X3FA 2X8JB 1QPGA 3PHIA 4IDFA 4JVOA 5AM5A 3ETEA 2XB4A 4GZLA 4HGOA 4ER3A 5AJTA 3U4GA 2UZIR 3G0CA 4PZDA 3AM4A 1RXEA 1YU9A 2BZGA 4JJKA 2EKBA 2P4HX 3DEJA 4YC7A 3RREA 1IAVA 1DCFA 1K6EA 2HZ7A 1XV5A 2PAFA 2R00C 3DTYA 4IXMA 2GTPA 3WBJA 2WF6A 4QGBA 3KLBA 4DWVA 3HCPA 1YFZA 3OTHA 1KU6A 1OFIA 3OX3A 3RRMA 2JLXA 2PY6A 2RAPA 5KJCA 4FMPA 1GNTA 3LGSA 3UGKA 3KQUA 3F5SA 3GXBA 4URZR 4CU2A 1U6KA 3QEBZ 4RXMA 1B42A 4Y8VA 4AXXA 3AUAA 1XHFA 4G2NA 2I6SA 3Q5GA 4ZAGA 1NDHA 2H54A 4UTZA 1ORVA 1JAHA 2SHKA 3WZLA 1FXWF 2XNCA 5GJBA 2EF0A 4PC1A 4MJ7A 4UW9A 2A4KA 1HLFA 2R6GA 2PFSA 1GR1A 3R41A 3H11B 1O6GA 2OCGA 3MOSA 5IHXA 5JZOA 1XC7A 2ODTX 4XQGA 2P75A 6CHYA 1Q92A 5C51B 2X5XA 1NX9A 1P17A 3G0DA 5EWJA 1RHKA 1RRKA 2ALJA 4CYMA 5DBGA 2XWBF 2HCTA 4LZNA 3R3XA 4XVHA 3AU8A 5BV1A 3IEVA 3ZBUA 2GBGA 5I4CA 4Y18A 1NF3A 1C3JA 1MRNA 1OTHA 3AEZA 3HJBA 1U65A 5DHRA 3I9V1 4JUCA 3JQAA 5BSEA 2A58A 1JSLA 3JQBC 4HNQA 4GI1A 4PG4A 3LX5A 4DQLA 1E18A 4AQDA 3I42A 1W0CA 1BSVA 3WA7A 3ZHQA 2CLCX 3LT0A 1KYQA 3AXSA 3HJAA 5ESXA 5CA0A 3SHWA 4ESEA 3MM4A 2P91A 2X9QA 3EG9B 2YXNA 4JI6B 1WIWA 1JA0A 2QTVA 2AG6A 2C4KA 3F7MA 3WK9A 4DTIA 5DGHA 4QOJA 2ATIA 4P4SB 3T9FA 3O7WA 1KXJA 2XIQA 4JELA 4KN6A 3K70C 1D6SA 3A58B 4ZDIA 3QUCA 4DM3A 1RYDA 4DLSA 3HRIA 2MINB 1CW2B 4FEEA 5JOQA 3M82A 3OPYI 3WTCA 1Q50A 3EW9A 2VUHB 3K05A 4W8HA 2X5JO 1JXQA 1ZK1A 1Q1NA 4KQCA 2XWSA 1E3EA 2IEYA 1TYEB 5LWHA 3DYIA 2IOHA 2Y0PA 4ACBA 4P4NA 2MMCA 2QL5A 3VR3D 5DNEA 5A5VA 4O2BF 1W581 4WNIA 3UUEA 1JPUA 4NOJA 3GLFB 1NPYA 1RQGA 4TXNA 3BIWA 4W1QA 3UUWA 4GOXA 4BFSA 1NXQA 1K6MA 4BKQA 4Q05A 4WCDA 1CQXA 1BKYA 2ORIA 3JQGB 4OIFA 2CHVA 2MIIA 3QITA 2ZE7A 3E03A 5T67A 1KKMA 1E3WA 2QROA 5TMBA 1SXPA 5KHLB 2O6LA 4R51A 4GVPA 2F1RA 1QIMA 2SECE 3DFKA 4MGEA 5EE3A 5HIMA 1WZNA 2ZBDA 3K6SB 4PFJA 2J9XB 1XCPA 3LBIA 3ONNA 4FJ2A 1SVNA 3PP8A 4YJ2A 1UXGA 3I04A 3W5IA 5JAPA 3VUEA 3UGJA 2ZULA 3CPSA 3HM2A 1KO8A 2A78A 3QLEA 4LYJA 5EIFA 4CG3A 4ED9A 4WBNF 3L46A 3WRWA 3M70A 2PSEA 5KWJA 4QUJA 3UJ7A 3ZD7A 3U3KA 3ROFA 2JASA 2ZRCA 1EM6A 1Y6QA 1FNDA 1M34E 4J90A 5JCOA 1QO0A 5FBRB 5TVKA 4PIVA 2ZSUA 3P26A 1UFOA 1GV0A 1P4JA 4GSLA 1C1HA 3EWIA 3CF0A 1F8GA 3H3XA 4TN1A 4GUDA 4P7KA 4U6QA 2FDXA 2WA1A 5F78A 2D1FA 3MT0A 4AMGA 1XKQA 2YVLA 4TUYA 4KTTE 1A76A 3L92A 4PXSA 3RTAA 2G7ZA 2G71A 3AFOA 3OU7A 3RC7A 4CLRB 3AUXA 2QPTA 4UASA 2DB3A 5AK3A 2P2YA 1PJ4A 4D9IA 1N32B 1L5HB 2AMFA 2AT1A 1XMPA 3Q6MA 3OCXA 4GQAA 4D9KA 1N2JA 5LXTB 2QTRA 2AA3A 4I3GA 5CDGA 4UFPA 2EKDA 3R3HA 4E5DA 4MRPA 4RKYA 5DNWA 1ST3A 1WF6A 4NBKA 4JWTA 1EAMA 4XPZA 1P2GA 1GXSA 2VP9A 5KYNA 4ARZB 1N5OX 3IQZA 4ARCA 3QGMA 1XKXA 2HBYA 1XZMA 1U9CA 1YVEI 3MGAA 4ASUA 4D8UA 2UUAB 1GCIA 4MQ6A 2BUAA 4KR3A 2FZLA 3VJKA 3JQFC 1JPNA 4L95C 1Z6GA 3KT8A 1HE1C 4UE3S 3SQXA 3NHUA 3V1UA 1LBTA 3IC5A 4TLDA 1OIXA 4YMWA 5FI1B 2E1PA 3K0CA 2XUGA 3OOEA 4IVPA 4J0IA 3K4PA 1SZJG 1D4AA 2J5QA 4JBXA 4QRIA 4DLXA 4GIBA 4QA9A 1M1ZA 2YW9A 3HWRA 1FSSA 4RY8A 4YAKA 4ZHQB 4F8EA 3WRYC 2PBFA 3K30A 2QPOA 3ENNA 4FX5A 1S8NA 6REQB 4CMGA 3HYSA 2Z8YM 1NP7A 4HEA1 2P11A 2XF2A 2XXAA 5JADA 2ECFA 1LBIA 3HDGA 1T2VA 4RHUA 1D3AA 4AO8A 2XEDA 1IZ0A 4G36A 4JQCA 5DP1A 2IS4A 2FN9A 1P61B 4PO8A 2H08A 2FQYA 4MS3A 5ES3A 2C7GA 4FGLA 2GJ8A 1C8VB 1M2WA 4YONB 3KTDA 1TJNA 5DN6D 4XWYA 4D97A 3G0GA 2X5OA 3UAYA 4F8JA 3ZU6A 3TR0A 1QK3A 2W6CX 4RS4A 1LI5A 2R8EA 4ID9A 2FMHA 1LKZA 5F9MA 1XZCA 3KKZA 3LOPA 2NVWA 2EKLA 2B9EA 3NBFA 4K6HA 4O4LB 3E0QA 4F9EA 1GFIA 1MQSA 2FG6C 1Y8CA 1MU0A 4IDCA 4ZQEA 1GARA 1B8NA 3C4JA 1QGOA 4GH5A 4TS3A 1QDUA 5KYTA 4M88A 1E4YA 1L4BA 5H7XA 3HRKA 2ZQZA 1H2HA 4DC1A 5MF6A 1KPHA 4RKEA 2M6LA 4EVRA 2CMFA 5TF0A 1Q3TA 5LBUA 3V1LA 4B4KA 4XUEA 4NCJA 1UT5A 1NMXA 5I7UA 1ZITA 4U6NA 2OYSA 2Y1LA 2DUJA 4JZKA 1YHYA 2AKAB 2PMDA 3H1FA 3PGVA 1GZUA 1B43A 3V1NA 5JYBA 2Q3LA 4KR6A 4GXRA 2HA6A 4UHBA 4ERXA 4ROTA 4DIOA 2WIGA 5ELMA 4L0CA 4IIHA 5ALWA 3ZY6A 1FNMA 4A6DA 4Y6PA 2FEWB 3DMFA 2O4CA 4RWEA 4OJNA 2PKCA 2ZJ3A 4CDGA 5JY6A 2F3RA 4OUDB 2QM8A 2I2CA 4F4JA 2JEYA 1VFPA 2XD9A 3L0SA 6LDHA 1CJCA 1REQA 3DEFA 2DPYA 3UMBA 2EL7A 1CLUA 5CCEA 4X7BA 4UDYX 1CG6A 3HVHA 3NP7A 5FOXA 3LLMA 3SOZA 3UGTA 3STHA 4UHDA 5BSWA 3ZWMA 5ER9A 2ZKLA 1US8B 4TXHA 4Z1OA 5IDVA 2AMYA 1Z6QA 5DNYB 1DS6A 4KUHA 4D0LB 4EKIA 3WL7A 2XUFA 3CR8A 4FS8A 1GA1A 1ZW1A 3QENA 3EZ9A 4KE9A 3SS8A 4J4BA 1JF8A 3KV1A 1SD1A 2QAGC 2GRUA 2ZCVA 3FGNA 4WRRA 5DTMA 1BDMA 3WDLA 5I7RA 2P9TA 1N33B 1WD7A 1YJXA 4B3XA 3A1WA 3AF5A 5DN6A 4F72A 5HRUA 4ZYXA 2WOOA 4MVJE 2IYYA 3IT3A 2ZITA 2QN2A 1KERA 5EKTA 3PLAE 3NYQA 1GTRA 4RA9A 3I9LA 1M74A 2OV2A 4DUGA 1DV2A 2J9ZB 4BVEA 3WGIA 2C58A 3BJEA 3EVFA 4TWBA 2A3RA 1K5PA 3PIDA 4KP7A 3U39A 3WL5A 1DKPA 5CLJA 4C7VA 4RTQA 1YZTA 2WR8A 2P0AA 4XARA 4BX3A 4L0QA 1AO0A 2I7CA 4J49A 4HZGA 4Q9HA 1AN0A 3TDKA 2GN6A 4BWVA 4V1CI 3O2SB 1MA3A 2ZUTA 4CV0A 4B7XA 1KMNA 1STOA 5BSHA 1PR4A 2QM3A 2GF2A 3TTVA 5DEOA 1G7SA 4MDYA 3GLUA 3A3KA 1ATIA 4AB1A 1YRAA 2VRCD 4JWKA 5DMHA 2AWNA 5H1YA 3OJCA 1DQYA 2JFNA 2VHEA 3B5IA 5KTMA 3ZN2A 3N0VA 1JN0A 1RE0A 3RLFA 3H3JA 2C5FA 3IUBA 4L16A 4X3PA 1WCYA 2WG0A 2YXEA 2QYTA 4EPWA 2Q1XA 3FWKA 3JYQA 3T3DA 1IRXA 3HYTA 1EFTA 4B33A 1KBQA 1VSVA 1ZO8A 4WKCA 1N77A 1B73A 2JANA 4HH0A 1QIGA 3BA1A 1XD2A 1KARA 2UYOA 1K7CA 5HPYB 1USVA 1E2MA 3L02A 2VA8A 4FMDF 4WN9B 3WZ2A 2FMXA 3K2EA 4BBJA 2FUNB 4EF5A 4DV6B 3D6VA 3Q1LA 1SCKA 1E0JA 4HFJA 5DWQA 3O7MA 4F12A 1R74A 2DMRA 3IDQA 3OTGA 3O3NB 3EGXB 4YJ3F 2J3JA 2GERA 5CDFA 2FSPA 4V0LA 1JEJA 1XHEA 2H4ZA 1NXOA 3DGEC 3JQCA 3KALA 2W2XA 2WUFA 4J1TC 3A1EA 4N7JA 4BC1A 4I81A 4BKMA 1KAMA 3INRA 2ZI7A 4HNGA 1JP7A 4ARUA 3OLQA 3PB3A 2OORC 5C7IO 1XMIA 3WJ2A 1GGFA 4RZSA 4G5OA 3FUCA 4XGIA 3U4MA 4H3HB 3OZEA 4F7DA 1X0VA 3WNZA 1OASA 1UMBB 2BGUA 3F5DA 5L45A 3KXLA 3ZIUA 2B99A 5DNUA 2R2AA 5K5EA 5L51A 1SN7A 3SHTA 4K6CA 1BCSA 2R44A 4UEOA 3WL8A 1TVKB 3ZEAA 3RTEA 4KACA 2X2FA 4RKFA 3WQSB 4E30A 1SPXA 4O4JB 5LYJF 4P83A 4DMGA 2AEFA 3FDJA 1ZGJA 1OX4B 4DB2A 4JJIA 2AN3A 3E7PA 4YROA 3LC1O 5DBHX 2R8OA 2PX2A 1J5PA 3ELUA 4C87A 4F85A 2AQHA 4FUTA 3L5OA 1EX6A 1Z28A 3CPJB 1X1QA 3H19A 4RJTA 3GJ5A 2NGRA 1DC6A 1XRMA 3B70A 3FFBA 2YVKA 3RS7A 3VU1A 1ND5A 4BFTA 4EAAA 2PVCA 2XQIA 1FOEB 1LTHR 2XMBA 4M1OA 4AW9A 3A4NA 1KDTA 2QTCA 1HORA 2C0CA 3RFFA 5CDTA 2R7MA 3AR9A 2HDOA 2PD6A 1KVUA 3ENZA 4M1ZA 4UM5A 3CLTC 2G88A 3CZ4A 5ARDA 2CL7X 1EHCA 1FK8A 3GRYA 3LZCA 2IUSA 2PGOA 1EFRA 1NJGA 2OUKA 3HA5A 1N7HA 3U44A 1KJNA 5HILA 3OESA 3U7HB 1C29B 1OI7A 4L3WA 2J3MA 2GEDA 3ZW9A 2GRJA 3A6LA 1DEOA 3GBSA 4IAOA 2EV9A 2IOQA 3UFBA 2OC9A 4HNRA 1TIPA 5F3RA 4CFSA 1FMTA 3DW3X 1EXMA 3EFHA 2OV3A 1L7NA 4FD3A 2IZOA 2QB5A 4CFYA 5INTA 2PX5A 3D6HA 3KZOA 5G0UA 1GUFA 2OAGA 3BTOA 3DHEA 3HHPA 3L05A