1C14A

Crystal structure of e coli enoyl reductase-nad+-triclosan complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
b'GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL REDUCTASE
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Molecular basis for triclosan activity involves a flipping loop in the active site.
pubmed rcsb
total genus 91
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1999-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1c14A00
1J49A 1F8GA 1I33A 2JFHA 1KC1A 4R68A 4XQGA 4NFYA 2DUWA 2HKIA 2A4KA 3V1UA 3F1LA 4ZN6A 5HTOA 5ER9A 1VLLA 3ZI0A 5AXAA 4J4BA 4E2WA 1GEEA 3RU9A 3BXXA 5I7FA 3V2HA 3Q0EA 1Z7EA 2Q1SA 4RLSA 1QV6A 3OJEA 3VOSA 1PU2A 2J3IA 3GMSA 3KYDB 1E3LA 1YKFA 1ZSYA 4YDRA 3DZHA 3WYCA 3A14A 2VHZA 4RLHA 4NH4A 3EZYA 4XEHA 7ADHA 5TX7A 4DLLA 4MINA 1YQDA 3CMMA 1EK6A 3RC1A 4EUEA 4D0RA 2FPPA 2CVOA 3JQAD 3DB2A 4BO2A 5JAIA 1HETA 4I5DA 2HUNA 3JD1A 1XG5A 4CM7A 4LVUA 4JP2A 4BO4A 1X0VA 2FSSA 5F1KA 3CXRA 2IODA 5IXYA 4NZ9A 2EGHA 1WZEA 2P9GA 1ZEMA 5K6AA 1N9GB 1LDMA 4ZICA 3U4IA 1X7DA 4IDGA 2OMEA 1OC2A 4O6VA 5F1OA 2G76A 1ONOA 5AXDA 3QVTA 2OXIA 1QYVA 1YO6A 5TRTA 4XD2A 4E3ZA 4JJIA 4ND1A 5JDCA 1IHXA 2EKQA 1DPGA 3ZNQA 3GK3A 5G0SA 3WYBA 5CEJA 4GVXA 3B20A 3RUIA 2X7HA 4MVJP 2AA3A 2VYND 4IJKA 4BIIA 4RZHA 4MIEA 5ICSA 5DZSA 2HMSA 4W9NA 2DBRA 1KVRA 1Y8QA 1Q2XA 3OEYA 4BGEA 4RQUA 4YJGA 3H9GA 2EW2A 1X1TA 2PNFA 1H6CA 3WDSA 3GH3A 2PZLA 5JMWA 4B4VA 4BQRA 4CM3A 1K0UA 3HFGA 4J91A 1ISFA 4GSKA 3RFTA 1R16A 5A9SB 4IQGA 5BSHA 2VWQA 2X5JO 4UVDA 4WLUA 2BKAA 3R1IA 3OIFA 2P5UA 3VC7A 1PZEA 2W2KA 2A9FA 3AM4A 3JQBC 3AI2A 1VC2A 2VCYA 3WYEA 2HDHA 1AE1A 1U4SA 1IY8A 1Y7TA 4PVCA 4KDEA 3K31A 1A4UA 5JLAA 2C5EA 2VNSA 2QRJA 4PN3A 4GMGA 1ARZA 1U5AA 5A5FA 3VPSA 1QLHA 1BVRA 4AL4A 4EEXA 1FDWA 4CMHA 3D3WB 4BOYA 3ASVA 4ZD6A 3JV7A 1LSSA 4FS3A 4RORA 1B8PA 1NQ5A 1PJLA 3UGKA 4AJLA 3HN2A 1KVUA 2VHYA 3RD5A 5L40A 4J9VA 3F47A 3G17A 4DPKA 4BV9A 4R54A 3LQFA 4NBUA 1GYRA 1YBAA 3AW9A 3KSZO 4PG4A 4EEZA 2VOEA 1UR5A 4R3NA 2EKPA 4FJ2A 4A26A 4EI2A 1HRDA 1M6HA 3M2PA 1GEGA 1BW9A 2HK8A 4KZPA 1IB6A 1PS8A 3Q9UA 3ZWMA 1D7OA 5CPFA 1NFQA 4PZEA 3ROKA 3LT0A 4I5EA 4UVEA 1U4OA 3ONFA 3EY4A 2BH9A 4JLWA 3TFOA 4I9UA 5GY7A 3DR3A 1TA4A 1BGVA 3LK7A 1TT5A 1CEQA 1P1KA 2V6GA 1N7HA 3FD8A 3I1JA 3C8MA 1DIHA 4FFLA 1F14A 1QYXA 2W98A 1CIVA 3M1LA 4DBVO 4YA6A 4O0LA 3F4LA 1PTJA 4PZCA 5DCWA 7MDHA 4E30A 2AE2A 5JSFA 3EVNA 5L7TA 3ZU5A 1DEHA 2QQ5A 3OM9A 1SMKA 3RWBA 1A5ZA 1LDNA 5TC4A 2IRWA 1JAYA 2C59A 3AUUA 1G1AA 4ZRMA 2HMUA 2UUOA 4OOFA 1KVQA 3O8QA 3NV9A 2GASA 3KRTA 2PR2A 4A0SA 1NNUA 1FXSA 3WXBA 4CM1A 1CYDA 3IP3A 4DC1A 4M86A 1XGKA 4WGGA 3UAGA 3V1YA 4LCEA 1LX6A 4ALNA 4DQVA 2OFPA 1FF9A 4R01A 4UEJA 1DIGA 3HUDA 1U9JA 4PGFA 4U7WA 4BO3A 3AWDA 2YHIB 3QVXA 2YHUA 3F6YA 4GWKA 1NX6A 4O59O 4Q3EA 2O23A 3JQEA 4IGEA 2O50A 4YJFB 4BUCA 5CG1A 2EJWA 3ZCXA 1LLDA 2H1SA 1VJ0A 4TRMA 1P31A 2Q2VA 2VTEA 3GN1A 3ROQA 2ZK7A 5K6AC 5IDYA 3BMNA 4HKTA 5EQFA 3Q11A 4NBWA 4XIJA 4M49A 3ZN2A 4P38A 3UKOA 4E2YA 3DBRB 3JQFC 3OHSX 2OZPA 4BNWA 1W0CA 4IY1A 2I9PA 2JHFA 2WDZA 4K1LA 4DC0A 3WGQA 4EGFA 1LEHA 2Y93A 3QWIA 1ZO8A 4FB5A 4B7UA 1ZUD1 3I9JA 1HSOA 3H65A 4CR7A 1ZFNA 1N5DA 4KTVE 3UUWA 3GQVA 1C1XB 2PH5A 3BYZA 4AFNA 3DZBA 3H9JA 4BNZA 2VRCD 3E5MA 3FTNA 3GGGA 3O38A 3QVWA 2C2XA 1AN9A 1MV8A 1DO8A 1U1IA 4RO0A 2Y1CA 4E4YA 4JP3A 5L45A 4N18A 1JLLA 3NDRA 1AGNA 5ER6A 1B16A 5T67A 4PVDA 5BSGA 1JW9B 3RUHA 1HDZA 1WMBA 8ADHA 1DJQA 1TT7A 5T6BA 1VL6A 1ZK3A 1SOVA 4WLEA 1R15A 1Y5RA 3NJ8A 4BNFA 5L4LA 1MGOA 4J16A 3BMQB 3GEGA 5THKA 1P1HA 3DAFA 3KETA 1MG5A 4QO7A 3CKYA 2Q2WA 4L4XA 3IOYA 3KM0A 2NTNA 3WTCA 5BNIA 5L53A 3F9IA 4DIOA 1GZ3A 2OL4A 2C7VA 3RUAA 2FR1A 4G81A 1KS9A 3F1KA 1PJ3A 4GLLA 2X6TA 1BSVA 1IOLA 4OIMA 1WDLA 4YACA 3ST7A 3IIEA 3OF2A 4URFA 5U4QA 3X2EA 2Q46A 5JDCC 5B4VA 2QW8A 5A04A 4R1UA 3FHLA 3JD2A 2F1KA 3OH8A 5A9TA 1R37A 3OICA 2I65A 3GDFA 2O7QA 4P4LA 4RVFA 5EL0A 3DAPA 5TQVA 4GPD1 3UN1A 3VPHA 3ZHXA 1QKIA 2NADA 2NWQA 3A1NA 3DWFA 5KVSA 2BMAA 3O8QB 3BHIA 1Y9AA 1F17A 3DL2A 1GPDG 4KUHA 1AXEA 1BHSA 2ZTMA 3ROPA 4ESOA 3EK2A 1XQ1A 1CERA 5ILGA 4QECA 4OM8A 3WOHA 4DREA 1M76A 1H6DA 4WKGA 1Q7BA 2C82A 5BNTA 4R69A 4L8VA 4PG5A 4PRKA 3H2SA 5KJEA 1PWXA 1ISMA 3U62A 5EIOA 1HSZA 4L74A 4DMLA 4TRJA 2YFQA 3PDUA 1IPEA 4Q3NA 4IPTA 4R4JA 5EERA 4YR9A 2VQ3A 1NHWA 4JBGA 4CMKA 3RKUA 3Q6IA 1G6KA 4CLHA 3F3SA 2JFFA 4E6PA 4D45A 4YAKA 3FN4A 3W8EA 2X9GA 1PJTA 3EVTA 3MCVA 3W4IA 2YY7A 5KVVA 1EEHA 3WGZA 1IE3A 1SEVA 3DZGA 3N7UA 4FIZA 1OOEA 1PQPA 9LDTA 3DTTA 2AEJA 1UDBA 2ZQYA 2Y1FA 4EYEA 1UXGA 1MLDA 2E6UX 5AVOA 5G4LA 4B3JA 5J23A 4J0FA 1SC6A 3I4CA 4B8WA 1AHIA 2TMGA 2PK3A 4CV1A 4NJMB 1DC5A 1LI4A 1ZK1A 1N9GA 3NRCA 3U4DA 3VKVA 2IDZA 3MJ4A 1AHHA 3OQBA 1NBOA 4OGWA 3RAJA 2D8AA 3RKRA 4WCDA 4OSOA 5KJCA 5FWNA 1E1MA 1Y9EA 2C54A 2EXXA 3GEMA 5CPBA 1NAIA 1P77A 4BKQA 3PGJA 5DCYA 4PG8A 1U8XX 1C1DB 1P44A 3SLGA 4GX0A 5I7EA 5L9AA 4DTIA 5KJ6A 4LISA 4CL8A 1DIAA 4MVJG 3DBHA 1HLDA 1FDSA 2HJRA 4FFNA 1PJ4A 4KUEA 3GVHA 3L9XA 5B1YA 3EW7A 2Z95A 4RPLA 3CZMA 3FTPA 4LGVA 3C1AA 1ENOA 3JSAA 4MP6A 4TRNA 1Z82A 4FFRA 1P9LA 1U7HA 3CINA 4XCVA 3WBBA 2EERA 2B69A 2YYYA 3T7EA 3UH1A 2YZ7A 3ANMA 3WWZA 3FRJA 4LW8A 1JN0A 1A27A 1NAHA 3KO8A 3OA2A 5I7VA 1J0XO 4JK3A 3AFNA 4TROA 4DLBA 1ISIA 3PYLA 4R9RA 5MGBA 3ADPA 5T5QA 3T7CA 4UVHA 3QP9A 5C37A 3K5PA 2V6BA 5G0WA 1PS9A 4CMIA 1E7RA 1UZLA 5G0TA 2BLLA 2BGMA 2NVUA 3CSDA 1H0KA 2FPGA 3RU7A 5K0ZA 1UDAA 4BO0A 2EWMA 2RAFA 3IL2A 1Z75A 3PQDA 4NJOA 1ML3A 3VPGA 3AY6A 2VWHA 3LF2A 2O48X 3QSGA 4FFOA 4EZBA 1BDMA 1M75A 2R2GA 2NQ8A 1Y8QB 3ICPA 3UICA 4BO6A 1EFLA 4GKVA 1U3VA 3EAGA 1EE2A 4GAEA 2FR8A 4J7UA 4XZ3A 3GF4A 3D3EA 3WJAA 1PJQA 1Z73A 2X0RA 3I9LA 3AI3A 2NU9A 1YONA 3OJLA 1J4AA 1MFZA 1UXKA 4FFMA 1IUKA 2FN7A 4ZQEA 3MTJA 5JPIA 3FNHA 1QRRA 2ILTA 4K26A 4AJOA 1R66A 3GA0A 2FMUA 3H7AA 2JJYA 1B7GO 1C0IA 1PZHA 1YQXA 2B35A 2ET6A 4YCAA 4RDHA 4WCFC 3BIOA 4PG7A 3Q1LA 4PLHA 5I9MA 1KEPA 4N5NA 4BQPA 3EMKA 4IGFA 4CLRB 1BWSA 2AXQA 4YT5A 3AY3A 4MVJI 3SLKA 3TOXA 3DBLB 3MJTA 2GSDA 1LJ8A 1PGPA 1QSGA 2QRKA 3GG2A 2NQTA 4X54A 5GZ6A 5TT0A 3QW2A 5EMHA 4K6FA 5IZCA 3SVTA 4J3FA 1QV7A 2Y05A 4I5FA 1F8FA 1K2WA 1HE4A 4ZU3A 3GEDA 3VVBA 3DHEA 2I3GA 4DIBA 2W90A 5JO0A 2I5PO 4CQMD 2OBNA 4ZQHA 1HE3A 4J2OA 4JNKA 2Y0CA 4RDIA 3ZWBA 4RPHA 3TNLA 3LT2A 3DZFA 2BFMA 1SNYA 4L4RA 1B15A 1GQQA 1I3LA 3GZNA 3W6ZA 1I32A 2BFAA 1KOLA 3DFZA 4GH5A 1V8BA 3GVIA 3K2BA 3KYCB 3TPCA 4CM6A 2HLPA 3A9WA 4GBJA 2B4RO 3DOJA 1DLIA 1ENYA 2CD9A 3RUDA 3NKLA 4BNVA 3OBBA 4J1NA 1JWBB 3GMDA 4JBIA 2IXBA 1WNTA 4IM7A 4RF2A 4J0EA 4O5OA 5TIIA 1SBYA 1PGJA 1PR3A 4PCVA 1XELA 1JTVA 4NI5A 3RFVA 1YS4A 4O63O 3F4BA 2IEDA 1ZCJA 5IAAA 1GUYA 3L6EA 4LCJA 2GUGA 4MVJA 5JFOA 1WLYA 2RHRA 4JCOA 1U3WA 3CH6A 2YDYA 3HG7A 3ZWVA 2FHSA 4E33A 4WEOA 4WK6A 3JQCA 3I4FA 4K9DA 4R51A 1XIVA 2IEBA 3MZ0A 3OIGA 4DWVA 2X0IA 1JDJA 1FDUA 2J3HA 4U6QA 1HDXA 1YL6A 1T24A 3S55A 3CMCO 4W7HA 4PRLA 5ENDA 1YB5A 3M1AA 3TJRA 2ZIZA 5JY6A 1NYTA 4BKOA 3GR6A 2Y67A 5ES3A 2WSBA 1B8VA 4RVDA 4CQLA 5DF1A 5F1PA 3O9ZA 5LC1A 3ROMA 4LMRA 3U4HA 5KVCA 2NNLD 3RBVA 3ONDA 1GPJA 2XPCA 5A1TA 4C7JA 2DT5A 4A03A 3G1TA 1IZ9A 3FNGA 4EDFA 1ZMTA 3DBVO 4TRRA 2NTJA 4BGIA 1ENPA 1PL7A 1MG0A 1AXGA 3NYWA 3ZNOA 1O9BA 3IMFA 3C85A 4R1TA 1PIWA 3WNQA 4I1IA 4NK4A 1EDOA 2E37A 4H3VA 3OSUA 2CF5A 1HYHA 5BSFA 4Z3KA 4WASA 2XOXA 4J90A 4GLOA 4K28A 1VRWA 1B2LA 3CPSA 4DQUA 3R3SA 1DRUA 3JQ7B 3AUTA 4FOOA 3VVCA 3UVEA 3RI3A 3MWDB 1D3AA 3DMTA 4UUMA 1JKIA 2DBQA 4L9RA 1IPFA 5DULA 3U0BA 4YXFA 5JXWA 3Q2KA 1M67A 4BNYA 1WWKA 5FYDA 4CM5A 4E5MA 2CMDA 2X5OA 2GZ1A 4RVGA 5CDYA 2JD1A 3C7CB 5JO9A 4BNNA 3JD0A 2CZCA 4ND2A 3KEQA 3HZZA 1WMAA 2C5AA 4NBRA 4UEKA 3JCZA 1MC5A 3JQ9C 2DQ4A 2Q1UA 4PLFA 5BNFA 4ZQFA 4AG3A 2Q45A 1GD1O 2LDBA 4YAEA 5GZ3A 3QWHA 1Z74A 3LLSA 4ALJA 4BO5A 4MKZA 4YAJA 3TN7A 1I36A 3RVDA 3VHRA 3KEOA 1LLQA 2WD8A 3JQ8A 4CODB 1GCUA 2PLAA 3QE3A 4FOSA 3FWNA 3ZNPA 1EMDA 1CJCA 3DONA 3SBOA 2I6TA 1VKOA 1LTHR 4OYRA 1SZJG 3OEWA 2CDCA 4TQGA 2PH3A 2ZB7A 5COAA 3VKUA 2O3RA 2JCXA 5L95A 3KSDO 3L07A 1HDOA 2JAPA 4DA9A 2VRCA 4GMFA 1I10A 5K9ZA 5B37A 1DFHA 3COSA 1NPDA 3GAZA 2WE8A 1W8DA 5CDGA 3H5NA 2X0NA 2JCVA 2GN4A 1D4FA 1BMDA 3CUKA 3NGLA 1T4BA 4AJKA 3VH4A 1XWFA 5THQA 2GYYA 2BGKA 1GQ2A 4AJIA 1O89A 4MVJH 4B8ZA 4F6CA 2JD0A 2AQKA 3MOIA 3GPIA 2A35A 1FK8A 3E48A 3EUWA 3KLMX 3GHYA 2E48A 4E0BA 3Q3CA 1GR0A 1R4MA 1XKQA 3SEFA 1ONNA 3LC7O 1E5QA 1DDOA 3ZU2A 5IZ4A 2X0JA 1RKXA 4Z9FA 4ZQGA 3ZNNA 2D2IA 4YT2A 1H94A 2B4TO 2HSDA 4I08A 4NU6A 3VH3A 2V6FA 1GYPA 1N92A 1HEUA 4MKRA 3WBFA 3WIEA 4AJ1A 4YT4A 1HXHA 4IMRA 3ANLA 2Z5LA 4YPOA 3DXFA 1ENZA 1GADO 4NDNE 1XA0A 2B0JA 4UVIA 5ENVA 4W99A 4BKRA 1YL5A 2IZZA 3TFQA 2VYNA 1DAOA 1WDKA 3QQPA 4G5HA 1L7DA 4PLCA 3VDQA 1OZAA 1P45A 1E3SA 3STHA 2ZTVA 1XQ6A 2BRUA 1I2ZA 5FI3A 3C7AA 5L51A 4WLVA 5JE8A 4JBHA 5B12A 2B4QA 4WNIA 4TSKA 5DBIA 3ZGYA 3P19A 2CSUA 4WLOA 4CV3A 3VH2A 2AMFA 3JQAA 4YAIA 3C1TA 1GZ6A 4GQAA 4BO7A 3KUXA 4CM9D 2P5YA 1P0CA 1WPQA 2XAAA 3HDYA 2I67A 1UP7A 4R16A 4UUPA 4OXNA 3ZWWA 2C2YA 1RWBA 4ITUA 4DIFA 2DVMA 4MIYA 3KSUA 1YDEA 2RCYA 3W8DA 5AQ1A 3C3XA 3HN7A 2Q49A 3CZRA 4FGWA 4BB6A 3VPXA 4MP8A 1R4NB 3K96A 4IS3A 3AUAA 3K9QO 2CFCA 6ADHA 1WZIA 2BELA 4NJMA 1BXGB 1NPYA 4FC6A 2AW5A 3G49A 3RUFA 4FJ1A 2O4UX 5A05A 2BI8A 4N7RA 3FI9A 2DC1A 1T25A 2E82A 1UAYA 1GUZA 1HYEA 1U2GA 1LBEA 5HBRA 4E32A 2NU7A 1NM5A 1OMOA 2FWMX 2O2SA 2RH8A 3FF4A 4YVFA 4XRRA 1KVTA 4IJVA 1KVSA 2UVDA 2C0CA 4Z0HO 4J1TA 1E7WA 2P91A 4E12A 3GHHA 3JYNA 2RH4A 5TNXA 1GV1A 1X1EA 3AU9A 3GUYA 3BMQA 1PGOA 1YBMA 5TLSA 1VE9A 3K30A 5DOVA 5G4KB 3WLFA 1H2HA 3CE6A 3V2GA 2ZATA 4HBGA 2GO1A 3I3OA 3BHJA 2IXAA 3V2UA 2VZ9A 3S8MA 1BW9B 3LVFO 4JIGA 2DKNA 5CEFA 4HXYA 4HADA 4WOJA 2G17A 1R0LA 3UCXA 3UHAA 2OP0A 1KY4A 3WJ7A 3ZV4A 1ID1A 2EW8A 2DM6A 5F21A 3U3XA 2V6MA 1BXKA 3T4XA 1HDRA 2CNBA 4CR6A 4MVJE 1EVYA 1MUUA 3E18A 4YEDA 2Q99A 1M66A 4I9HA 1VM6A 3WWYA 3L4BC 2WE7A 3IUSA 1B14A 5EESA 4J6FA 1UH5A 4D43A 2D1YA 4KWIA 5ITWA 1ZXLA 3QHAA 4LRTB 2FR0A 2W2LD 1Q0QA 4NQZA 1QORA 4XWYA 1E1NA 4FPXA 3WS7A 4AJ2A 3M2TA 4TZKA 1O5IA 3H9QA 4FN4A 2NSDA 2PA3A 3FBTA 3I9NA 3QIVA 3WQSB 4JX8A 1UAGA 3IUPA 4UULA 2D5AA 5JY1A 5ITVA 3NT5A 5HS4A 2C7GA 1C0KA 2WYWA 3O03A 2AEFA 4NU5A 3KOUA 3PHHA 3F5QA 3PRJA 3KYDA 4Q3DA 5FI5A 5C5IA 3E9MA 1IYZA 3U49A 1DRVA 3SX2A 4DPLA 4CLXA 3R3JA 4NFHA 4WPGA 1SAYA 4KQWA 4DYVA 2H6EA 4KWHA 4BNKA 1PS0A 3G1UA 3NT4A 5CG2A 5TS3A 2WD7A 3D64A 4GX1A 1YGYA 1YWGO 4GKBA 1I30A 3WGOA 5FF9A 4YWJA 3LT1A 4YT8A 4L0QA 3C24A 4IINA 3ULKA 1DOHA 3JQ9A 1H93A 4Y9DA 1U2DA 1EVIA 3LDHA 4JJGA 1A72A 1HE5A 3LLVA 2AQ8A 4R41A 4F6LA 1T2DA 3HFSA 5G2OA 2XXJA 1F0YA 3NDJA 4AJHA 3H5RA 2J8ZA 4QXMA 3OJFA 4WEQA 4BNIA 2P2SA 3ZU3A 1JA9A 4FQ8A 4OH1A 1SCUA 3GNQA 1NR7A 3A06A 4L76A 1HL3A 1I8TA 2HMTA 4K6CA 4E31A 4BMSA 3ENKA 2Q3EA 3ZDFA 4BO9A 3PXXA 3I6QA 4MJLA 5DOZA 1XCBA 2FPIA 2P9CA 4PIVA 3GFGA 4PZDA 2VRBA 3DQPA 3O4RA 1BG6A 2PD4A 1YQGA 2J3JA 1LSJA 3NTQA 2DLDA 4NHEA 1GDHA 3RROA 1KEWA 3ON5A 4CM8A 3G79A 2PGJA 4QX6A 5H81A 1PSDA 2YUTA 3PYXA 4P22A 1Z45A 3EYWA 4CPDA 1N2SA 1ONPA 4DQXA 5I7SA 1B3RA 4BVAA 1OAAA 4QUKA 3I9OA 1UZNA 1RM3A 1S6YA 3OQ6A 3MWEB 1NPTO 4D0SA 1EUCA 4Z9YA 3KBOA 3DMYA 2H5LA 2UV8A 4OXKA 2Q4EA 3E5RA 1VKNA 2YV2A 3ANNA 3I9MA 2VHXA 1V0JA 1X0XA 2DU8A 3H4VA 2OUIA 1B8UA 1P1IA 3S2GA 3RASA 3BMOA 3TRIA 4P4GA 5IDWA 3JQBA 3VZSA 4Y98A 3H2ZA 3S2EA 4CUJA 1L7EA 2DFDA 3MOGA 4CUKA 3PHIA 2X23A 3ENNA 3WNVA 1X14A 1T2AA 2O2YA 2QYTA 2XXBA 4HUJA 4DBZA 3RSHA 1QYWA 4EJ6A 3FR7A 3HB5X 3W8FA 1EVZA 2CDBA 3DFUA 3IS3A 2OORA 1DC4A 2QZZA 2QX7A 1NVTA 4HFJA 3GGPA 3QWFA 1EQ2A 3GGOA 1EVJA 2EGGA 4PLWA 3RJ9A 1J5PA 1R4MB 4ALKA 1RM0A 1BRMA 1E3JA 3I83A 4O1MA 5F5NA 5JC8A 1I24A 5GZ1A 3DZJA 3NGXA 4DVJA 2WWRA 2DBZA 4MOWA 2NTVA 3GPDG 2JAHA 2G0TA 2D4AA 5JCXA 1MB4A 3A4VA 2P9EA 1NP3A 1EQUA 5COBA 2EJVA 2HO5A 3TZCA 2HK7A 4EBFA 1T2FA 3OECA 1E6UA 3ZW9A 4XB1A 1QYDA 3HJAA 3L9WA 1EDZA 1MC4A 4CMJA 2AEMA 1QG6A 4L73A 5KJ1A 4IDAA 4XYEA 2Y1EA 3FSRA 3HDHA 4JROA 1EBUA 4CR8A 4NG5A 1GQYA 3GY0A 2IYPA 4GX5A 1WW8A 2PD3A 3H9EO 5COQA 4KDFA 1ULSA 2VWGA 5IFLA 4E5PA 4Z0TA 5JYEA 1Y81A 9LDBA 4OO3A 3GNSA 4H16A 4D41A 2J5RA 4HX5A 3VH1A 4E21A 4OAQA 3AK4A 3OQ1A 4XYLA 3NJ4A 2POQX 5JW6A 4CUZA 4Q3CA 1PZFA 1F12A 1Z6ZA 3U5TA 3OA0A 3TDKA 3WB9A 3DTYA 3B6ZA 4NBTA 4B4UA 1CWUA 1JQBA 2PZMA 3QA9A 3QWBA 4Z3DA 1PL8A 2NV6A 3LC2O 3OJOA 5EPOA 1V35A 4PLZA 4D44A 1ZH8A 1PR9A 4WJZA 2G82A 2ZB3A 5KVQA 1Y8RB 1LA2A 3WIDA 3DMTC 2QYSA 3GG9A 5C3MA 4HP8A 4D3FA 3PHJA 4IDEA 1Z7BA 3BMCA 2I66A 1GFSA 4JQCA 1ZKMA 4MO2A 1LRLA 2CDAA 4A5OA 3BMOB 3PP8A 2WD7B 1YB1A 3PQEA 1PL6A 3GOHA 1ZK4A 4IZIA 4WNCA 5EQDA 1WP4A 3SXPA 1CQIA 4FJ0A 1DAPA 1XHLA 3JQFA 2X22A 5JDIA 2EP7A 1GYQA 4QFCA 4XX0A 2X8LA 4LSWA 4HNGA 1ZIDA 3WG9A 1Q0LA 1H9AA 1UXHA 1LLCA 4AJPA 1D1SA 1YXMA 3KLPX 1EUZA 5A4DA 4YJHA 2HRBA 2B5VA 1YDWA 1JU9A 1G0NA 2A94A 3VZRA 5KKAA 2J6IA 5F5LA 1LC0A 2FOIA 3L4SO 4KTTE 3JYPA 5BSEA 2Y68A 2VHVA 1YL7A 1Q0HA 3W1VA 1EE9A 3ZWAA 2B83A 2OBYA 5JYDA 3INGA 2FZWA 1DRWA 4S1VA 1PEDA 1U5CA 4YBZA 1M2WA 1NTOA 1LSUA 4B79A 1MA0A 2IYOA 3WSVA 1T1RA 2Y1DA 3LZ6A 4XDYA 5TSDA 4BNLA 3RUCA 1SPXA 2V65A 1DC6A 1HZJA 1NXQA 3PFFA 2Y0EA 5H82A 3RCBA 3UOGA 5CDUA 2SCUA 2O7SA 3QJ5A 3U4CA 2PWZA 4B4OA 4HNHA 1PJBA 4BGUA 1K3TA 1YB4A 1E0DA 1XEAA 3GRPA 1N1EA 1OBFO 1SOWA 1E3WB 2YFHA 4ND3A 3CEAA 4MKXA 2GERA 1VSVA 4MVJM 5FFFA 2ZB8A 3LYLA 5LDGA 5I9NA 4WUVA 2AQIA 4IS2A 1I2CA 3DBRA 4IIVA 4UVGA 4AJEA 2BF7A 3HWRA 4OQZA 4P8RA 4ALIA 2Z1MA 4BMNA 5B4UA 3L6DA 1HDYA 4IQ0A 1I5RA 2HAEA 2FRDA 1PJSA 1LSOA 3KVOA 4QQRA 1KIFA 4J4TA 1QLJA 2O4CA 4J9UE 1CQJA 1SO8A 1XSEA 3TF5A 5L3ZA 2J5QA 1ZSVA 4M54A 3WMXA 1LRJA 4OXYA 2EEZA 1ZJYA 3EGOA 3S2IA 4G2NA 2ZYDA 3PZBA 1TVEA 4S3MA 1DFIA 2X1HA 3IC5A 3PLRA 3IKTA 2CUKA 2JHGA 5U9CA 3H3JA 3L77A 5L7YA 4Q3AA 5AOVA 1C0PA 1MX3A 2AE1A 4YTEA 1V6AA 1HDGO 2GLXA 3N74A 1K6IA 1YH3A 4Q9NA 2LDXA 4I5GA 1I3MA 4UREA 2DTEA 4L4SA 2VOJA 4QEDA 4DGSA 3E9NA 3ASUA 4M55A 5EINA 1VI2A 5IG2A 3IJPA 4EJMA 2VZ8A 1P1RA 1DHTA 4CMIB 1X15A 3DC2A 1DIBA 4RF3A 1P33A 2VN8A 3O26A 3QV1A 4QFDA 1KY5A 3KTDA 1KC3A 5TF4A 4TZTA 2UUPA 3TZKA 4WCFA 5BR7A 3M6IA 1QP8A 2VYVD 4CQMB 2ZJ1A 4J1QA 1ADCA 4JXKA 1PQWA 4B3HA 2DTDA 3Q2IA 2HU2A 1HDCA 1KYQA 2YQ5A 3OIDA 3BAZA 1IHYA 1LQTA 1ADGA 2QG4A 2FY8A 1ULUA 3G0OA 2CVQA 4RPJA 1NWHA 5EJ2A 5CFZA 1JKFA 4CMAA 3PQFA 5L4NA 4DUPA 1C1DA 5A03A 4E5NA 1YVEI 3D7LA 3NTOA 1I0ZA 5KJFA 4XR9A 1NQAO 4ND4A 3GAFA 1R4NA 1V9LA 2ZTUA 3JYQA 4RVUA 4RCVA 4WCFB 2EV9A 1RYDA 3MTGA 3OP4A 4CM4A 1IZ0A 4LRSB 2Y0DA 3DOOA 2PGLA 4OMUA 5JC1A 3CTMA 1ZNQO 4FCCA 1DXYA 4BNMA 2C29D 5CHEA 1YOVB 4U0JA 3MJSA 4OQYA 1AUPA 3WGGA 3DZKA 1UXJA 4UUOA 2X9VA 2GZ3A 3F46A 2YV3A 3VZPA 4LMPA 1WDMA 3WGTA 1XDWA 3TL2A 3ITDA 2R00A 4RVHA 3RC2A 2JL1A 1NFRA 2GZ2A 4TWRA 5CDTA 4EITA 1PQUA 5MDHA 1EUDA 1KETA 2EF1A 3PTZA 3BTSA 1VL0A 1ZJZA 3DBLA 3ETDA 3GRKA 1C3VA 1XU7A 3JQ8B 1OFGA 1XR3A 4FC7A 1GUFA 3V5NA 3TZHA 5FEUA 4XYBA 5T8KC 4PLPA 4RPKA 4YAGA 3R0IA 3ZV6A 4CV0A 2PKRA 4BNTA 3VAZA 1DLJA 1Y5MA 1HZZA 1YJQA 2BGLA 4A10A 4YYZA 4QTZA 4CMEA 2VWPA 2YW9A 4ONEA 4UAGA 1MXHA 2ZCVA 1EZ4A 3IKVA 3LC1O 4JJFA 3JTMA 4DL9A 4MVJD 1LC3A 4TMFA 1H9BA 4DLAA 3NAQA 3RUEA 4RGBA 1ZZEA 2BFOA 2W4QA 3NX4A 4XQCA 4N5LA 4XB2A 2VYVA 4RQTA 2VUTA 5U1PA 4BHTA 1BXZA 5HWSA 1WXDA 5JAMA 3INTA 2O3QA 3PFWO 1BTOA 3B70A 3D5TA 3GDOA 1R0KA 2GGSA 3V1TC 5L4SA 2OP1A 5AXBA 3VPFA 1ZK0A 1R12A 2RHCA 3PVZA 4TKMA 4GGOA 3LU1A 3U09A 3PGXA 4IXWA 5KOIA 3I9KA 5AXCA 2DTXA 3WQQA 5TJHA 4QT0A 4CLDA 5IN4A 4D79A 3WFJA 3FCOA 5A5EA 4CMBA 4KOAA 3HE3A 3HB4X 2UDPA 5IF3A 4GWGA 4BNXA 1LLUA 1R6DA 3EHEA 1HYGA 2ZYGA 4KQXA 4NNJA 1YE3A 3D1LA 5G4KA 2AG8A 1LU9A 2JKVA 4XGIA 3TOZA 3D4NA 1ZMOA 2YQ4A 3VZQA 3AM3A 4RF4A 3ZU4A 1DC3A 2UYYA 1HF3A 4PLVA 6LDHA 4I8XA 3P2YA 4FBGA 2AQHA 4A7PA 1Y8RA 1OI7A 4XDZA 1XU9A 3MEQA 4ZVVA 4W7IA 2QZ9A 2JCYA 2GF2A 5A9SA 3H5AA 4II3A 1KEUA 2QRLA 4RVSA 1RM5A 1O94A 1U28A 2ZCUA 1NQOA 2BHLA 1ORRA 2OHXA 4H15A 3HDQA 3UW3A 2Q1TA 4LSMA 5TGDA 1VJ1A 4IMPA 5HM8A 3UXYA 4KP7A 3CIFA 2VT2A 2YJZA 3GUCA 5LDHA 4C4OA 3GZNB 4LVCA 1QR6A 4IDDA 3TQHA 4A73A 1ADFA 4J49A 3MJVA 3GLQA 3FBGA 3BHMA 1UUFA 5KWEA 1Q1NA 4FFPA 4HFRA 4HFMA 1H6AA 3C7DB 3AUSA 4CJXA 3WLEA 4YRBA 4OOEA 3JQDA 5DDIP 1T2CA 2D59A 1NFFA 5JDIC 1QYCA 4Q39A 5I8ZA 4OKNA 3AI1A 5DBGA 1A9ZA 3W4KA 3L6OO 3Q9NA 4GGPA 3JQGA 2OO5A 4YRAA 4DMMA 3AJRA 1QXSA 3OJ0A 3V8BA 3ABIA 2H9IA 3F5SA 1DJNA 3GVXA 3PIDA 4F45A 4BNGA 1E5LA 4WE3A 4QSMA 5IXSA 1NVGA 3KYCA 3MJCA 1ISGA 1P1FA 5C7LO 2NU8A 4CQMA 4CM9A 2X4GA 1D8AA 1F06A 4XYGA 4J43A 2FZEA 4UUNA 4ZA2A 4A27A 1U3TA 3DAGA 1IL0A 2D3TA 1E7QA 3ZV3A 5DP1A 3ZWOA 1P0FA 3PYMA 2D5CA 3IAHA 1GCOA 4XIYA 4RJTA 4FR5A 1JVSA 1JAXA 1X13A 1HT0A 3D4PA 3GDGA 1WVGA 3DOCA 1HE2A 5T64A 4CLEA 3PJFA 5KTKA 3HHPA 3PJGA 3E03A 4WLNA 1P74A 3DDNA 1V3VA 2HRZA 3DO5A 3SJUA 2WTBA 2DBVO 2WMDA 3FPCA 2EKLA 4FD3A 4EJ0A 2Y66A 4G65A 3QVOA 4U0KA 4L75A 1Q7GA 1E7YA 2DPGA 1LQUA 5JS6A 3IJRA 4NIMA 4YJGB 2HK9A 5C7IO 1I3NA 4RL6A 2GR9A 3ZZNA 4XYMA 1J6UA 1PGQA 2P4HX 4II2A 3E9QA 3ZWPA 1A4IA 3TZQA 2OOSA 4E5YA 3RC9A 4LN1A 3K6JA 1MP0A 5A06A 3IDSA 3ZW8A 4B7XA 4AJNA 4IBOA 2VUSA 4PG6A 4YJFA 3ITKA 3LF1A 3WTBA 1NVMB 1XYGA 2NU6A 3P7MA 3JD4A 3K2EA 3S1LA 1LUAA 4BS9A 1A7AA 1IULA 3QY9A 2W2LA 4OKIA 4OJNA 5CAEA 5G0UA 2DUUA 1DFGA 4NR0A 2VUUA 3JQ6A 5B4TA 4MP3A 3NTRA 2GN9A 3L0DA 3LSYA 2Q50A 3PPIA 3EZLA 1L1FA 2HMVA 3OFSA 3WSWA 4NK5A 5C7OO 2Q2QA 1WAMA 5LCXA 3K73O 1DHRA 3A28A 4J2HA 5H83A 2J3KA 1CF2O 3TL3A 4B4WA 5IZCC 3DBHB 5G0VA 4M87A 4NPCA 4N5MA 1B26A 3N58A 5DCUA 4CLOA 3HQ4O 4WLFA 4BMVA 1YOVA 3WFIA 1G0OA 4W82A 1T1SA 2O3UA 1S7CA 5JCJA 5CP8A 3H8VA 4Y6PA 2Z1NA 4ROSA 3AOEC 2GRAA 1U7TA 4EUFA 1DB3A 4BL5A 3IQDB 4U8GA 2O3TA 1RJWA 1UP4A 4XQEA 1SEPA 1BDBA 4HY3A 5F3RA 1HTBA 4KUGA 2B36A 4ZRNA 1TEHA 1ZEJA 2AHRA 3H6KA 1K6XA 2IZ0A 4YJHB 2HCTA 3JQGB 1PZGA 3EC7A 2NVUB 1GU7A 3L4BA 3RBZA 1LDBA 2BFPA 2C20A 5T57A 2F00A 3AU8A 2ZYAA 4R5MA 4QO8A 4IIUA 1FJHA 5EN4A 1Y6JA 2VNAA 4CMEC 1H5QA 2O3SA 1RM4A 5BT9A 3WMWA 3RC7A 5HA5A 4R1SA 1MXFA 3PWSA 1JVBA 5KCZA 1P3DA 2I76A 3G3EA 5AYVA 1GTMA 1ZK2A 3PI7A 2YV1A 3I5MA 4BNHA 4XQ9A 5GMOA 3GC6A 5L7WA 5DN9A 3TSCA 3AM5A 4D42A 3BMCB 5DP2A 1NQTA 1N7GA 3NT2A 4GI2A 5CDSA 1P1JA 3IP1A 2HQ1A 3EDMA 1LNQA 2IE0A 4LK3A 1V3UA 2Y1OA 4W6ZA 1NHGA 3ETEA 4TKLA 1E6EA 3WICA 2B37A 3ZH2A 1O95A 2R00C 3B1KA 3VTFA 2A92A 3PIIA 5HS6A 3D4OA 1TLTA 2TMDA 4E13A 4RV9A 4CV2A 4PFJA 4D3SA 3FR8A 5KIAA 1JKJA 3D0OA 1B3BA 2X86A 1A9YA 3I23A 5BQFA 2J5KA 3E1KA 1E77A 1UZMA 4ILKA 1EFKA 4IUYA 3GVCA 1PX0A 4YQZA 4J7XA 1UP6A 4HWKA 5JAQA 3BTUA 2GNAA 3HNPA 2PGDA 4GSLA 4Y8VA 4R5HA 1E7MA 1W4ZA 2PV7A 4DXHA 1ZXBA 3FWZA 2X5KO 2UAGA 3GNTA 1HWYA 1GAEO 1QMGA 4NFSA 1PJ2A 1XLTA 3PHLA 4IZHA 4ZQBA 4ZJUA 4U6SA 3ICCA 2JFGA 3E82A 4Z0PA 3U9LA 2CF6A 2YHIA 3OMLA 3PEFA 4M1QA 3DEYX 2ZJ0A 4XGNA 4PLGA 5TT1A 2CVZA 4B7CA 3ONEA 3RQSA 3I6IA 4RF5A 4FDAA 1FMCA 1FDTA 4EW6A 4KMSA 5I9LA 3DHNA 3ORFA 1U3UA 1H6BA 4ND5A 3RBXA 2GCGA 1E3WA 4XJTA 3KXDA 5TJ9A 5JMPA 4BB5A 3AOEA 2NVWA 4IDFA 4NBVA 4IQ8A 1VSUA 2OGUA 4XA8A 4BNUA 4IDCA 3DHYA 1ZW1A 4W4TA 2GN8A 3ZWXA 4NMHA 1E3IA 4CMCA 3RJ5A 5T8KA 5JCJD 2JD2A 1ADBA 1C0LA 3AOGA 1BXGA 1JWAB 1SB8A 1ZVMA 2NACA 2PFGA 3ADOA 2DFVA 2O3JA 4Z9XA 2PTGA 4YJDA 1N1GA 1PGNA 4BGVA 1NASA 1O8CA 1LRKA 4HFNA 4BKPA 2X9NA 4AJ4A 3B1FA 1ISHA 1LXCA 5IN5A 4OHUA 3UCEA 1H2BA 1Y1PA 1GL3A 4W9NC 1T26A 1TB4A 4F46A 5ILOA 3JQAB 3QWAA 3PJDA 4ID9A 2HJSA 1UJMA 3HADA 1HLPA 3PZRA 1T4DA 3ETGA 3ZV5A 4GVLA 4AICA 2PY6A 2QIOA 4CMGA 3PWKA 4FW8A 4N54A 2NVBA 3WX0A 3R6DA 2EIHA 1LDEA 5DT9A 4PLTA 4OL9A 4Y67A 1ISJA 4CM4B 3X2FA 3KV3O 2Q1WA 2W8ZA 4J7CA 4GX2A 4R9SA 4IXTA 4AVYA 3ZHZA 3ZHYA 1UXIA 2WEKA 3E6AA 3VDRA 5KKCA 3FNEA 4PLYA 3GT0A 3D5QA 2Y1GA 1E1KA 1X7HA 1X7GA 3PHGA 4U5QA 4BO8A 5DBFA 1I01A 1ZSNA 2EP5A 2QHXA 1KBZA 3KZVA 3ZHBA 4XGKA 2W2KB 5A3VA 5IJZA 2CY0A 2BI7A 1DSSG 4TVBA 4CLOB 4INAA 3ZWNA 4E2ZA 3NDIA 2PZKA 3BA1A 3PDJA 1C14A 4IJWA 2G1UA 4OSPA 2Y99A 1RPNA 4WECA 4YB8A 3QRWA 4E2XA 1C1XA 3BTOA 2E4AA 3PJEA 1GZ4A 1YJ8A 3K8ZA 2VTDA 4DPMA 1W73A 2DAPA 1CDOA 1SB9A 1A7KA 2D0IA 4XR4A 3WGYA 2FSVA 4D7AA 1EK5A 1RYEA 2ZB4A 2R6JA 1EBFA 1W6UA 2VZ0A 3C1OA 2IZ1A 2I3AA 4B3IA 3W6UA 1DIRA 3E8XA 1R0SA 2NM0A 1NWCA 3BMNB 3KYBA 3PK0A 3QVSA 4MVJF 1VL8A 1V3TA 2P4QA 1KEVA 2P68A 4YQYA 3VTZA 3P5SA 3SC4A 4A2CA 1D1TA 1GV0A 3TZ6A 4DRYA 4DYDA 3W4JA 2DPHA 1LDYA 4I9NA 3K92A 4HV4A 3PLNA 2NUAA 3RIHA 4UEOA 2PD6A 3I52A 4XRGA 1K89A 4RPGA 3UCFA 3WQRA 4IJUA 2PKQO 4R1NA 4BO1A 2WYVA 1TT5B 1PJCA 4Y6RA 4EUHA 3HSKA 2AG5A 3GVPA 1ZBQA 4JN6B 4BV8A 4R3WA 4Q3BA 4AJJA 2GDZA 1T2EA 4WOKA 4CL3A 3UF0A 4Y6SA 4Z6KA 1GY8A 5HRUA 3QLJA 4BKUA 3AFMA 3HDJA 4CQLB 4E5KA 4F3YA 5DNAA 3SJ7A 5CEEA 3AY7A 4IDBA 3DZIA 3P2OA 3KHUA 1HKUA 1I2BA 3UFXA 2WM3A 1YRLA 1O6ZA 1VJTA 4XJSA 4GL4A 1TXGA 1A71A 1CRWG 1OC4A 2GD1O 1Q7CA 5KNLA 4YRDA 3OETA 3JYLA 3S2FA 3LT4A 2C07A 3INRA 3FPLA 2VT3A 5IDQA 2RIRA 2VHWA 4M8SA 1O0SA 1YBVA 3D3WA 3GZ4A 3WGHA 5IDXA 4TVOA 3KB6A 5JAZA 4ALLA 5A3JA 4CLRA 3JYOA 2V7PA 1MFPA 3BZUA 2H63A 3H9UA 4ALMA 3B1JA 3ZWCA 3FNFA 5I8WA 3MJEA 4XKJA 5ICMA 2WJPA 2X58A 4MDHA 2RBEA 5JBIA 1E92A 5JNLA 1I3KA 1TI7A 5ADHA 1VPDA 2Q4BA 3SC6A 4J1SA 4MPDA 1E6WA 3GFBA 3BTVA 1K6JA 2PZJA 4FSHA 4JGBA 4J4HA 2EG9A 2XF8A 4CM8B 1PWZA 4ZGWA 2EHDA 1NR1A 3RFXA 5A9RA 1DBVO 2I99A 4MIOA 4BNJA 1B0AA 2PKQP 2G5CA 3JD3A 3PWZA 4P4NA 8LDHA 4C7KA 2BD0A 1E7SA 1KERA 4FGSA 1FDVA 4ZHSA 3NEPX 1LDGA 1UDCA 3ZWYA 2NLOA 4RZIA 2HMWA 2YDXA 1M6WA 3NUGA 2ZKLA 4H7PA 3JQ7A 2E49A 1N8KA 3WR5A 3GN2A 4D3DA 1E3EA 1U8FO 1BVUA 3H3FA 3TWOA 4D46A 1CETA 2ZTLA 2GPTA 3WGIA 2ZQZA 4M89A 1E1LA 1K5HA 3T4EA 2B5WA 2GN6A 5A02A 2FP4A 2WYUA
chains in the Genus database with same CATH superfamily
1J49A 2A9PA 1MJNA 2JFHA 4XQGA 3ZCQA 5E6RB 4IHJA 3WBKA 1IZZA 2CXPA 3FMOB 3V1UA 4JUAA 1JEJA 3JZAA 4L95C 3ZJ5A 1D0IA 2XH8A 1C3LA 3FLAA 1J9EA 2BEVB 4J3JA 3CV3A 1D07A 2RKWA 5FX2A 1ZOPA 1GN9A 4V02A 3L4EA 5I7FA 1IN1A 3RFUA 3V7YA 2LV8A 2AT1A 1ZCZA 1NDQA 3C4VA 3DMDA 3FNQA 3SQXA 3KSAC 1RBZA 4TSRA 3TUJC 2YYZA 3OJEA 1Q1QA 2HFKA 3TNJA 4HDOB 1GCAA 4RD2A 2RD2A 4TZ0A 3KVYA 1ZN8A 1FA9A 1ZSYA 2AR9A 1IVNA 3LA8A 2A0KA 4MVYA 5ALRA 4TZ6A 1NOJA 3PNPA 4HLQB 2APJA 2X41A 4M38A 3RNLA 1EFRA 1CUBA 4BJ3A 4NONA 3L4KA 1K7XB 1YQDA 5EUCA 2QSYA 4AMUA 1ULTA 2N3ZA 4CETA 4DLSA 3LXRA 1JQDA 2FUG1 4LFCB 4G4GA 3DHWC 2O5EA 3ABOB 2KBFA 2A0FA 2X42A 3BXFA 5DHQA 3FUUA 3AFGA 2PUEA 3WYFA 2GH1A 4X45A 4LVUA 5SY4A 1JWLA 4JP2A 3QU4A 4DM7A 1X0VA 5F1KA 2OQIA 1C7IA 4LHYA 5IXYA 4GXRA 4NAUA 1QZ3A 4FEGA 4WZAA 5K6AA 1N9GB 1YC5A 4IO0A 2WA2A 1NVFA 4LBYA 3VNQA 3NIWA 1JDPA 4O6VA 2RG7A 1FL9A 1OLOA 2G76A 5K0EA 3GRAA 3KD3A 2GCIA 2P2LA 3QVTA 4IOMA 1FPQA 3HACA 4N5IX 4UJ5A 2WQZA 1VCHA 4HH3C 1N25A 3AVQA 1C9KA 1K5DA 4ND1A 5AI4A 5JDCA 2EKQA 5BWLA 3OOWA 4RA9A 3ZY6A 3GK3A 4ZYZA 1P0MA 3C87A 4UTZA 4EYGA 3WYBA 1AMOA 4MQEA 4EVQA 3OOYA 3RUIA 2KX7A 3B53X 4BFYA 1WBDA 5DGIA 2ZUEA 1D2NA 2VYND 5LJLA 3MELA 4IJKA 4BIIA 1URPA 3DCYA 1YACA 3F6BX 1CEYA 4GR4A 1BS9A 5KNDA 2QQFA 2DBRA 5ANRB 4ZMSA 3H1BA 1U8TA 1N5LA 3A1EA 4UHKA 2V1UA 2XUGA 1AH2A 3ORQA 2IYSA 5GV7A 3H19A 3I9FA 4M6WA 2CXNA 2VXCA 3TO5A 1C30B 2W2TA 1E5DA 4X8MA 3OO1A 4BN0A 1EIWA 1WMSA 3ZGXA 2NIPA 2XTZA 3UMYA 2PZLA 2QUJA 3ISVA 3Q41A 4BQRA 3ZCTA 3HCEA 3WYDA 1EUCB 3JRNA 5TMDA 3R7BA 1WZCA 3KR9A 1TMYA 1OKKD 3UMVA 2BZ1A 5H16A 1PT8A 3ZUGA 5FQOA 4EI7A 4KFSA 3Q8LA 4G0OA 1H2WA 2HI0A 2A58A 1QQTA 2P5UA 1PZEA 4MUJA 4R7ZA 3UK7A 3H2GA 3PNOA 5GP1A 1JDUA 2A9FA 4HDRB 3TKAA 2LKCA 1VC2A 1X9GA 2VCYA 3AI2A 3GDHA 1ADYA 4RE6A 3RLFA 3RARA 1AE1A 1RRPA 3TECE 3QXCA 3UPUA 1QVVA 3OLZA 4TSFA 2HBYA 3WIBA 4KDEA 3BGSA 1A4UA 1B0UA 4NJEB 3CCBA 3E1SA 2VNSA 4GR5A 4WY2A 4B2IA 4GMGA 4BE7B 5DE3A 3VPSA 4BWYA 3LCVB 1ST3A 2B61A 2JHCA 1FDWA 1Q0UA 3I58A 3PICA 1NIPA 1J09A 1XE3A 2WR8A 3NRBA 4ZODA 3M5DA 3JV7A 1EM8B 1F3LA 1LSSA 1KFEB 2VDUE 1M2EA 3BE8A 1NQ5A 4L9WA 1SN7A 2MSEB 1BH2A 4AJLA 3N1UA 4BC1A 4UDYX 3I8XA 3X1ZA 1G41A 3AR4A 1R2QA 1G3QA 3H1AA 2POCA 3EGDB 3G17A 4ACAA 3LUKA 1M7BA 2WHQA 2X19A 3N6XA 1QK5A 4ITRC 2GCNA 4RZQA 4KFCA 1JDBB 4EEZA 3VSDA 2Q8QA 4B6OA 1NSFA 4CG0A 4R3NA 1D6NA 4BYGA 2HU8A 5DTJA 5E4TA 2ST1A 1SHLA 1B4DA 3B13B 4TTJA 3PPVA 5B7QA 5BN4B 4PZEA 3LFTA 4X00A 2W6PA 3ROKA 1P73A 1RXUA 2XQGA 4P5PA 4UUBA 5CYGA 3D8SA 3ONFA 1CQWA 2P6MA 4RWEA 2XDAA 5F51A 2CHQA 4MV4A 4HQFA 4PWYA 5GY7A 4U4AA 1NE7A 3BFPA 1ORIA 2BM0A 4ZPJA 2JJ8A 2V6GA 1MF7A 1QYRA 3C8MA 1DIHA 3I1JA 4KV7A 5LZ7A 2ONJA 1F14A 1I9GA 1W5SA 2GZSA 1GDDA 1X87A 4RV4A 2CLOB 6REQB 1NGSA 3K09C 3U6BA 3KZCA 1CIVA 4AMVA 1L8OA 4DBVO 4MWEA 1X7ZB 4O0LA 1ZZGA 2XKBA 2TYSB 1E94E 5DCWA 2OGZA 3SSNA 4Z7OB 2AE2A 4RUKA 3ZU5A 1DEHA 1DAMA 1KJWA 1S2NA 2CL7X 2JF0A 3OM9A 1RQXA 5G1OA 5I9BA 3IVMA 1QO0A 5TC4A 2IRWA 1JAYA 2DG2A 4B0PA 1JL3A 2OV8A 2HHCA 3PNLA 4XVQA 2ZUTA 2AV6A 2HMUA 1W5TA 4OOFA 3H5WA 3KT8A 1E9RA 3NBUA 5DNEA 1EAMA 2BFWA 4A0SA 2GESA 4E15A 3RYFB 1FP2A 2W71A 2QPOA 4K6KA 2RI0A 2IFTA 3IUBA 4DLUA 4M86A 2BBTA 1RVDA 3V1YA 2CLKB 4WGFA 2QL6A 2YWHA 1COWA 3FZQA 3WK5A 4ALNA 4UEJA 1DMSA 4R01A 4PGFA 1JT9A 1CFJA 2NPOA 4H4DA 2XUZA 4U7WA 1E59A 4BFWA 5EWLB 3QVXA 4I50F 3HMKA 4O59O 4LNUA 1F6BA 4RTKA 2JI4A 4MQBA 1IVYA 1LLDA 1US8A 3QUSA 2HWUA 2R79A 4LOIA 4UCWA 3E8SA 1P31A 2JIPA 3GRRA 4UPEA 1JHVA 2ZK7A 5YASA 5K6AC 1GZSA 2G6TA 2XMQA 1QIMA 1XF1A 3V7NA 1E3DA 5DM0A 4B8YA 1VE5A 2O8CA 1KDPA 1SUCA 3DBRB 4IDNA 4CTOA 3L49A 3VDNB 1TM7E 1JG7A 1W0CA 4IFIA 4DCJA 4C76A 2QDKA 2FMKA 2X8WA 4IY1A 3I3SR 2I9PA 4RPCA 2D0OB 3B2NA 4K1LA 2QRHA 1G1MA 1F9EA 4IKEA 4RM2A 3UANA 3STYA 1WXGA 2Y93A 4ZT2A 4JLVA 4DLTA 4ETIA 3ML1A 4V2IA 4FB5A 1ZUD1 4C29A 4WIAA 4ND8A 1GSAA 3T5TA 1ZFNA 4Q9KA 4W5OA 3KJFA 2EHJA 3QVLA 4PF1A 4DLVA 1HTWA 2N1MA 4QBGB 2X6RA 2X2PA 4D4HA 3SQMA 5J2UF 3U4GA 2QRUA 4NOJA 1A9XA 5EIXA 3P94A 3E5MA 3S2SA 4Q48A 4ZT7A 2ZBQA 3IBTA 2UZAA 1LVHA 4UTNA 1DO8A 1U1IA 1VGRA 1TUIA 4RO0A 1NUSA 3F9CA 1XTBA 3NW9A 3O21A 4M8LA 4N49A 3NDRA 4KIGA 3WAJA 3GV0A 1SQGA 3L8DA 3OPQA 4JWTA 1WMBA 1XZKA 3DYIA 8ABPA 3HI4A 1ZK3A 4GI5A 2V7XA 1R74A 1LF5A 1FOEB 2HWXA 1Y5RA 1WVMA 3MMZA 2LCQA 2XMSA 4BNFA 3W2IA 4B44A 1TUBB 1OWOA 3DWGA 4C0XA 4JBNA 3PGLA 3PQ3A 3KETA 3DEZA 3H86A 4QO7A 3RHTA 2EGUA 2HRDA 1CUYA 2PMBA 2ZR0A 2HOQA 1QTQA 2OAP1 5L53A 3QVMA 2NTNA 3GIDA 4LRUA 5K5EA 4DG5A 2BTQA 2OL4A 5BPHA 4WKOA 2C7VA 3VMFA 3H6HA 1D9XA 1M3SA 3F1KA 3R0ZA 3SZUA 4PZ9A 3AR9A 4JYMA 1BSVA 4B3DA 1NUPA 5IBPA 1Y7LA 2GBLA 3IIEA 2CBXA 4KN6A 3ST7A 3UAXA 3X2EA 2WTMA 1J2TA 4M0KA 4LECA 4PN7A 1NNLA 1RBYA 2ZJBA 4B3XA 2H2AA 1JTEA 3MTAA 3SSAA 1P7ZA 4IVQA 4KAXA 4P4LA 2MT9A 2HJWA 1G20E 1I1OA 3KXPA 4GPD1 1BQ3A 1J70A 1DARA 1PO7A 3IEUA 3QOYA 2BMAA 4WACA 3SHVA 5JNVA 5BV2P 1JEQA 5E7JA 4AO6A 3GLFE 3PQ8A 1KOGA 1U7UA 4YLYA 2WTXA 3DL2A 3B51X 1AXEA 2W2QA 2C8LA 1BHSA 1V4BA 1IM8A 4EYKA 2FEKA 2PG3A 2XNHA 3MRXA 1CERA 1QZZA 3KJNA 2HIHA 4DREA 3QMMA 2G5TA 2WZDA 5K20A 1M34B 2PX6A 5EOVA 2QVGA 1KNQA 4ABTA 3GPBA 4BTEA 1P4SA 3M4JA 4DZZA 1Q7BA 5BNTA 5IM4F 3S3TA 3GBSA 2B8TA 2Q3JA 3KV1A 4KXWA 1PWXA 4Y2HA 1PR0A 5D3ZA 3R76A 3Q8MA 4I3GA 3U62A 3E8MA 5EJ8A 3FH0A 2YFQA 4R2LA 3PDUA 4TV8A 3STWA 4IIHA 1IPEA 1YCGA 3GLKA 4G37A 5EERA 2I2AA 3CEPB 4IUDS 1T6ZA 4BYMA 3K1AA 4TS3A 2P0YA 3FCEA 3RKUA 4KXVA 1RYFA 4CLHA 3C48A 1K75A 2VCHA 5JISA 1Z26A 3FN4A 2H06A 2HPVA 2X9GA 4XDGA 4NE2A 1PL0A 5ED4A 1NYRA 1AV7A 1PJTA 4KN5A 3FWHA 1NJ1A 2YY7A 1Q0RA 4IIJA 3WGZA 5KVVA 1M2HA 2JBAA 1HX7A 3DPSA 4FIZA 4B32A 4EUKA 4EWLA 1J90A 3SF8B 3ZVLA 3UMMA 3L5KA 4B6JA 8OHMA 1LV8A 1RD4A 1LWOA 3IR7A 3OLXA 1ZM3A 1UXGA 2WIJA 4B3JA 2XD4A 2NT4A 3MF4A 2FEPA 3HO8A 1PT6A 4J0FA 5FTJA 3UMJA 1JAZA 4OK6A 2ZM6B 4HDNB 2QT9A 1UANA 3GFRA 4D02A 1PKXA 1YUNA 1E4VA 2MYNA 1APBA 3QHPA 5ILQA 1KYIA 1CVRA 1LI4A 1JDBC 4ZOLF 3SI7A 2CNNA 3SHFA 3TEMA 1QGOA 3QMPA 1SXJA 4M9RA 4REOA 3MJ4A 3O82A 4DWWA 1RQGA 5HCUA 4O4LB 5BW4A 1NBOA 1C2TA 1PEKE 1S3SA 1QFSA 2FMIA 2YHSA 2YV4A 2UVQA 3EE6A 3LY5A 4Q9AA 4WCDA 4OSOA 4RY2A 4F96A 4YRGA 5FWNA 1E1MA 1Y9EA 5CPBA 2I6UA 1P77A 3RAFC 4BKQA 1E3MA 5D7NA 3QYAA 5EE9A 1ODKA 1XKLA 1C1DB 3W5JA 3KZKA 5E2BA 1HZZC 3VJRA 5L9AA 3E3NA 4LISA 5DJ5A 4BMZA 3H2YA 1IY9A 4R7TA 2ZS8A 4ER5A 4G09A 1ZNXA 2HJRA 3CISA 3A6FA 1YE5A 4J0HA 4KUEA 4AY5A 4X6LA 4EA7A 5B30A 1AMUA 1Y98A 2CCJA 2FWAA 2Z95A 4RFVA 3RU3A 3TXYA 1UBUS 3V1KA 2QNRA 1VL1A 1ENOA 3JSAA 3IT1A 3WFZA 4TRNA 2OBFA 1L5SA 2AN1A 3FMGA 3FSJX 3H17A 2HT6A 2F43B 4XCVA 3WBBA 4C1NA 1HK7A 4ECAA 3UJNA 4P33A 4FFBB 5DHRA 4J7AA 4RD4A 5ECGC 3WWZA 1DKOA 4DRXA 3FRJA 2IHYA 1JN0A 1RKQA 2B3DA 3OA2A 2XKJE 4KMMA 2WJVA 3A7EA 4XIIA 1J0XO 3AFNA 4P80A 2VDWB 1NUUA 2FNAA 5BN5A 4INJA 4R9RA 4HNAA 1YHYA 3K4HA 2JI8A 2PGAA 4AF6A 2GN0A 4ROTA 5C37A 2REQA 3T3NA 3TSAA 4EG3A 2PAFA 4HXGA 4ZDJA 3PE3A 3NS7A 1ZAYA 4XFJA 1PS9A 1SCIA 3KQLA 2A0YA 5FOTA 1UZLA 1XZNA 3WRXA 2R2AA 1DI0A 2BLLA 2NVUA 3T1HB 3RU7A 5BN3B 4IV5A 1UDAA 3UJHA 1X8LA 3EQ2A 2RAFA 5LZ4A 2HDOA 2WOOA 1SQ5A 3AY6A 2VWHA 2W7TA 3Q6NA 4KQ6A 1AA6A 1UWLA 2YY5A 4J0DA 4O4JF 2O48X 5ALOA 2VDKB 4OHXA 2VTBA 3BULA 4B0OA 4FFOA 3ZY4A 4RMJA 1L5QA 2FCRA 4HDKA 3O4VA 3U19A 1DBSA 1M75A 5B3KA 4GYYA 3D7SA 5CX1A 9ABPA 1P8JA 4GKAA 3PQCA 3FSEA 4DCOA 2WZCA 2NN3C 4QXAA 5BW6B 2IYAA 4BO6A 4Z54A 2UYHA 4NEHB 3EAGA 4KPEC 2AOUB 3ZDRA 3D3EA 1NUAA 3T61A 1ZJWA 4CGZA 3HRIA 5LA6B 2ORWA 1Z73A 5REQB 4DLPA 1M1YE 1YQEA 1VHJA 2X0RA 1ZITA 4BLRA 5ICFA 1YONA 2I4IA 4OMDA 2BY4A 4DSOA 3H5TA 4IIBA 3FYHA 3KFLA 4TS1A 3X1MA 1UBEA 3CZ5A 4IP0A 2P7IA 5JPIA 4K26A 1QRRA 3JQPA 1B43A 1RYNA 1B73A 1XZHA 2PA0A 2R65A 2VT6A 3GA0A 3QF4B 4LEIA 2HF2A 3H7AA 4C4SA 1P2DA 4U3JA 5CLJA 1WW3A 3NHAA 2EZ9A 2GI4A 4KO2S 4YCAA 4I3HA 4D4GA 1FTQA 4RDHA 4WCFC 5AM5A 5B1HA 3SZMA 3IA2A 3RS4A 2IZOA 1XMSA 4C5BA 4CU2A 3EEOA 1PSZA 1HQKA 3AERB 3OZWA 4BQPA 4IX1A 2CE2X 1AS0A 2WT8A 1TOAA 1BWSA 2BMEA 3SFVA 5IAOA 3AY3A 4MVJI 4R2KA 2EFEB 2QE7A 4GM4A 4RL4A 3MSCA 3ZQ6A 5CDFE 4W5RA 3I53A 5BMVF 2H1LA 1XC7A 4RELA 3T9FA 3Q4GA 1B6TA 1U2ZA 2H1WA 1KZHA 5LUAA 2C4UA 5GZ6A 3QW2A 5EMHA 1FYEA 4EG8A 1GZ7A 1PHPA 1QV7A 3H97A 1L7QA 2C9YA 1F8FA 5HFJA 1ABBA 5DH9A 1T5OA 4FT2A 1R8SA 1E6LA 3N2GA 4ZU6X 2BF4A 4XVUA 5BWOA 4GRAA 4ZU3A 3GEDA 4RESA 2OHJA 2AUNA 1V4VA 4LXTA 4DIBA 1T9GS 3UQZA 1JXMA 1RCTE 2J7PA 2XQVA 3OZDA 4JSTA 4Q37A 2OBNA 4N82A 3TOSA 2ROQA 4J2OA 3UA4A 2Y0CA 1D6JA 1VHWA 4RPHA 1V8ZA 3W2HA 3WKBA 4EG1A 3O83A 2FXVA 3HVRA 3BB4A 1Z0JA 1K3UB 2HA0A 2DLNA 3EIWA 4RJ2A 1XLWA 1GQQA 1IEVA 3GZNA 5KTMA 2BFAA 3HXTA 3TI7A 3E84A 4JI7B 5CCBA 1YDGA 3TCNA 1A4XA 3IHKA 4ZOBA 3AETB 1GGVA 3KAPA 5CAEB 3VYUB 4A0HA 4EFLA 3X44A 1G60A 3A9WA 4FILA 4GBJA 5CMLA 4YUWA 5LSAA 3WK4A 2AF3C 3KQNA 3HCRA 4N3CA 4PAOA 3OBBA 1BWQA 5JSZB 1JNXX 5IM4A 2C77A 1COWD 3GMDA 3NAGA 3UT5B 3EASA 4FONA 1WSDA 5B7PA 1NZFA 4XX0B 5DXJA 3X1DA 3SYLA 4IM7A 1DBQA 4RF2A 4BX0A 4YQFA 3L5OA 1PR3A 2J48A 3IDOA 2AOVA 5T3UA 2R6CA 3RFVA 1QKKA 4CF3A 5INTA 3E9CA 3F4BA 2IEDA 1GUYA 3NIFB 2AKEA 4HB4A 5JFOA 1YRWA 2F1IA 3CH6A 3HG7A 5L8VA 5FORA 4TTSA 4EG0A 2BMVA 5FL7A 2FHSA 4X8LA 4WEOA 4WK6A 5K45A 1Y89A 3CNNA 4LZWA 4HX9A 4NAVA 1S2LA 3A4MA 3ANXA 2OZVA 1TK2A 3TX6A 4DJEC 4UDNA 1TF5A 3E5HA 3P5BA 4R51A 3ZGLA 4ZI7A 3OD1A 3LY8A 3ZPXA 1GPBA 3NPAA 2JLUA 3ZDCA 2B4YA 2X0IA 1XMIA 3AEXA 5BV7A 3K6SB 16PKA 1WMEA 1HDXA 1YL6A 1Z4PX 1BNCA 1P6UA 5K3CA 2C9MA 2QDXA 2HMAA 3LBFA 3M1AA 3AJ9A 4G85A 3ROZA 4RH1A 4MHOA 3MYYA 3B6JA 2X1VA 2CYCA 1BN7A 1L7PA 1PNOA 1G2IA 4O08A 3WNZA 5K0JA 2WSBA 1UBTS 3L02A 5DF1A 6PFKA 2OHHA 1U7WA 2H57A 3PI6A 5LC1A 1NI3A 3NLLA 3U4HA 5A62A 5CGQB 4Y2TA 3QITA 1OXSC 3BE4A 2WJ4A 1H05A 1PFKA 4HLUC 5AKJA 4A03A 5DIFA 4B31A 4F93B 4EDFA 1MEJA 1QGDA 3QTLA 2C5HA 4GQBA 1LH0A 3EWIA 2NTJA 3LYUA 2QTHA 5FUXA 5TB5A 3VJKA 1BKSB 1MG0A 3NYWA 1ZQ9A 2R4UA 3CZ9A 3LDFA 1IAQA 3N7AA 3PF8A 4LOHA 3M5WA 3C85A 4TLMB 4WZBA 2YWCA 3UHJA 4I1IA 3U7FB 4NZNA 4TLEA 4ARCA 1RPAA 4NK4A 5JFTA 4MH0R 4PCAA 2E37A 5T4HA 1N1MA 1E2JA 4AN1A 3M34A 3ESDA 4WT7A 4EHJA 1MH9A 3T9BA 1VLZA 2ZZKA 1YZFA 4BZQA 2C7QA 4J90A 4E2XA 5JRZA 1JTFA 4FZ3A 4WZBE 4G89A 3K70D 5EEGA 1ND6A 1Y7HA 1W4CA 1V11B 1B2LA 1KY3A 5G3YA 1ZVVA 4GI3A 1G9XA 3OWXA 2VHUA 3CPSA 5HGJA 3R3SA 1DRUA 4DQ0A 3LOUA 1J8FA 1PKEA 2I8CA 2NAFA 2R5FA 3K8YA 1IEWA 5ERGB 1JFRA 3MWDB 3KJZA 4WA8A 5SYAA 4PONA 4D2IA 3AR8A 2UYCA 1HNNA 3T06B 1Y33E 3IUEA 3A1CA 1DBWA 3OT5A 2OV2A 4RHCA 2PGNA 4YBRA 4YXFA 4Q4HA 4Q18A 1JXOA 3FRHA 2CMDA 3VU1A 4AZ3B 2GZ1A 4E5MA 5ARBA 2HPAA 4YMUA 1OVGA 5CH8A 3VU9B 4B2PA 1G5IA 3BE6A 5CDYA 1JBEA 4BNNA 4O2BB 1ONSA 2ZWIA 3WLQA 4J2TA 4ND2A 7GPBA 2COEA 2I0FA 2XJ9A 2FPOA 3P71T 1WMAA 4NBRA 1D2CA 4UBNA 2IKSA 3UUEA 1Q5PA 4XUCA 1J0CA 1UBGA 1VB3A 2DULA 5BNFA 4ZQFA 1CZUA 2Q45A 5KS2A 1GD1O 2LDBA 4EKGA 1OBVA 1BMTA 4WUTA 1XPOA 5AHWA 4ALJA 2CXQA 2JFYA 2QTLA 3KEFA 3UYKA 4HL6A 5IPFA 1I36A 2OFWA 3RK1A 4H7FA 4IJMA 2WFMA 1G16A 1GCUA 1WSAA 4UDXX 4A1OA 1FDIA 4OF4A 1J21A 3BXPA 4DM4A 1EMDA 3DONA 3SBOA 4A2WA 2OK8A 3OLQA 2I2XB 4OYRA 1X9HA 4DCNA 2QGZA 3KJHA 2G67A 1IDN1 1N5OX 1U98A 2JZOA 4FFVA 2VF5X 3U7QA 3VKUA 2C96A 2O3RA 2JCXA 4P3XA 5L95A 3KSRA 4K7JA 3F2IA 3L07A 1HDOA 2JAPA 5DBHX 5KTYA 1V5IA 3NO4A 3UFXB 1GRNA 4M8KA 3WL3A 2H2DA 3K6RA 2QYOA 1I7LA 3WK8A 1ZCBA 3N5CA 1W25A 3KQKA 1IMOA 1CK4A 3DH0A 3KNZA 5GPBA 5K9ZA 3GAZA 2P3SA 1U7XA 3BN3A 5GJWC 4K9KA 5ALTA 2Q9UA 4XWAA 1T4BA 2BISA 3CE9A 2OGTA 3NOVA 3QV2A 1SUPA 2V03A 3RG2A 3WHPA 2BGKA 4HC4A 4GZMA 4MVJH 2IYVA 2JD0A 2AQKA 1CY0A 2IUUA 5IRCD 3EUWA 1SKYB 3KLMX 5IVPA 2BC9A 3Q3CA 4UCFA 1D8TA 3GEEA 1KYTA 3HA3A 3KWMA 1ZC4A 1G8JA 2V7UA 5AI5A 3SEFA 1ZGAA 4BAGA 3W1EA 1PD0A 1Y5NA 2VYFA 3INYA 1DDOA 4KLZA 1D4OA 5D5PA 5H9VA 2XUJA 5C18A 3SYNA 1KF0A 4LRWA 2BGTA 3KKZA 5TARA 1BAPA 1R3UA 4ZQGA 2D2IA 2JAUA 2W6JA 4A4DA 5EAIA 4DMRA 4F4JA 4YT2A 2R47A 2BMJA 3SXJA 2QX6A 1IY0A 2B4TO 4MWGA 4L57A 2HBRA 1AUVA 1N92A 1I2MA 2NXNA 4MKRA 1O54A 3WBFA 4YT4A 1U0FA 1FP7A 4EIWA 1GADO 3UBTA 3NONA 2R97A 3RYHB 1WXWA 3HR7A 4N7BA 4RDCA 4W99A 5EJ5A 5FUQA 2A5LA 4C0BA 3VTAA 4RSGA 4WK4B 1LV7A 3E15A 3OC6A 1JQLB 4S0XA 2WM8A 1JI3A 3OQHA 4Y7DA 5TQ0B 1QTRA 1E3SA 1AO3A 1DDGA 2BGNA 4XJXA 4CL0A 1I2AA 1I2ZA 4IV0A 4C0JA 1EDEA 2OYSA 3C7AA 1ESDA 2YOFA 5FADA 5B12A 3TD2A 2B4QA 5C31A 4WNIA 4LQDA 2N46A 2C92A 1JLKA 3ZGYA 4BATA 4CV3A 1N0UA 4UATA 3JQAA 1QRTA 5I7OA 1HFEL 3COZA 4L2IA 3HWX1 4G84A 4TTAA 4D6XA 2XAAA 1MB3A 1QH1A 1U5BB 1RHUA 1LB1B 1PJ8A 1JDVA 1UP7A 2B1RA 2VHJA 3ONVA 4TXHA 3U4MA 3AETA 3VR6H 1Q1ZA 2FWNA 2XMZA 2DVMA 4S04A 1OXBB 5ALKA 1O08A 5KB3A 3W8DA 5JSKA 1G66A 3KWFA 4K9QA 5BVHA 2I91A 1QS0A 1U28C 2UZ4A 2JATA 2GPNA 2GLUA 2HX1A 4IS3A 4BLSA 6ADHA 4AKSA 4RZUA 3FOWA 5EFOA 3OC0A 4Z4IA 4FC6A 2DYKA 3PUIA 1EDBA 1U8YA 4FJ1A 2HN9A 3BGVA 3AL3A 1YRQA 3K16A 3OM1A 1HQCA 2BI8A 3TE6A 2DC1A 4FMCF 5HZMA 5M34A 1LBEA 5HBRA 2XDWA 3PX2A 5FTNA 2KB0A 2XKAA 5J5CA 2ODQA 4YVFA 2WJ3A 2I2DA 2QVXX 1IOWA 4P86A 4IJVA 2I87A 4QTTB 1W4LA 1P2SA 1P91A 2C0CA 4KRGA 3LUGA 1F8XA 1N2ZA 2YWJA 4X20B 4C07A 1T0PA 4BVEA 2PBFA 1Y8ZA 4ICIA 5AVTA 3B48A 5ADUS 1V7CA 4FNOA 1X1EA 4D8TA 3TRHA 1GL7A 1VE9A 1FXUA 3K30A 3GLUA 2VNJA 3C6BA 3SFZA 1Z0KA 1GA1A 2AVNA 2Z9CA 1W4RA 4HBGA 5ALYA 3I3OA 3UENA 1XFDA 5E9QA 1E58A 2VZ9A 3LVFO 4FI3C 1E2FA 4JIGA 4FD2A 3F7MA 5DHAA 4ZV4A 4S12A 3MB8A 4YUAA 2CMGA 1MVLA 2LR0A 3B6KA 4KWCA 1SKQA 1WD5A 1T8RA 2VAVA 1ECGA 1KE1A 2EJCA 3EQ9A 1K4MA 2HTEA 4YMLA 4ARBA 1CUIA 4Q7LA 1SCKA 2XZDA 2I3DA 2AK3A 1UBSB 2V6MA 4K81B 4QHTA 5DNWA 2XQJA 1YJXA 3VU9A 2BBWA 4YEDA 1Q84A 1MTZA 3KKNA 3G0BA 4UAVA 3LP5A 4EB6A 1Z5GA 3EIEA 1C7ZA 2PU5A 3RRMA 2E6KA 3VAYA 4ZGGA 1PG0A 1SQ6A 5BR1A 5ITWA 4KWIA 2WYIA 4LC0A 4X7RA 5B2ZA 1XZDA 3T94A 3QPWA 1GQRA 1RTTA 2Z5FA 4ZTUB 1F48A 4B40A 4XGQA 1UKYA 4I19A 4IXMA 3MJDA 4F72A 1PG5A 1OU0A 3M2TA 1JFVA 2YNMD 3R0JA 2WB2A 3J80A 4Q82A 1HT1E 3LQYA 1DQSA 2WW8A 3B5JA 3FBTA 2ZXEA 2DQZA 3E2MA 3NYQA 3QIVA 5CXSA 1O2DA 5HQTA 2HQSA 3DDUA 4BZXA 4D1YA 2ID4A 3I32A 2FJ0A 5ESXA 1ZNZA 1J56A 3BGIA 3IV9A 5GGYA 3ZX4A 4CKXA 5ITVA 5DM70 3DBOB 3CWCA 1FFHA 2OHIA 2AEFA 3KOUA 3PHHA 4NWIA 4H3SA 1NOKA 3F5QA 4KJXA 4Z2YA 2Q6LA 3K4QA 4FLMA 3SF8A 3TM5A 5C5IA 4KG7A 2J0VA 2MMGA 2VAXA 1DRVA 2Q0SA 2X76A 1P0IA 4C08A 3CR3C 1ECLA 2H6EA 4C78A 1PS0A 1JQJC 5CG2A 1PBTA 3UUGA 3D64A 3AR3A 4G6ZA 4NLLA 1U9IA 5MN6A 5AVJA 4R84A 1M1ZA 4QUEA 3VOAA 1II0A 3MTDA 1T0IA 2WKSA 3R6GA 4I8DA 4LZAA 4YWJA 4YT8A 4J8PA 3C24A 5CITA 2R84A 1O95C 1YDFA 4A36A 5AESA 2NPIA 1Q7TA 4TWBA 5AJZA 3GLSA 2IEGA 2BR4A 3QOXA 4QQNA 5HKKA 2I7XA 1I4EB 1U2DA 1X3SA 2VK8A 3T6KA 4M99A 3CS3A 1LTQA 3T52A 3Q5EA 3SE7A 3OQOA 2ZTSA 1TM5E 4N7MA 3VR4D 1EYZA 3BBLA 4R41A 1E4OA 2CL6X 2B0CA 1F0YA 2XXJA 1VMKA 3IE0A 3NDJA 5DTEA 1Y3BE 3QX3A 2J8ZA 2OAGA 1KFCB 3OJFA 1P2TA 2C97A 4WVFA 2IS4A 4KQKA 4RIFA 1Z2AA 3ZU3A 4OH1A 5M7EA 2FPLA 4YMIA 1KNXA 3GNQA 1NR7A 1Z22A 3A06A 5JD6A 1HL3A 1DKUA 2GHRA 2RHMA 4IX9A 2HLHA 2RHLA 3ENKA 4CZ2A 1WCIB 2MMCA 3LAWA 1KSHA 4FUQA 2OG1A 5G3ZA 4B6EA 5TMEA 1JQKA 4D3YA 4EHFA 4J75A 3JWPA 2FCAA 3GFGA 4PZDA 3BKXA 4QEKA 3O4RA 1DQRA 2QX4A 4OXIA 4C0LA 2J3JA 5K8TA 2DLDA 4GOLD 1GPNA 1POXA 5UKDA 1J0BA 1TZBA 2CHEA 2OSBA 3RROA 1KEWA 5JJIA 3CEJA 1OA0A 1BU5A 1WQ4A 3WAKA 5JQGA 3G79A 2PGJA 5ALZA 4C2BA 3DL4A 1PSDA 4YJ3B 3ZOKA 1H3EA 2JRCA 3PYXA 4MHSA 1Z45A 4BE4A 4CPDA 1ORTA 1RPJA 3ESCA 5IJAA 4EW3A 3DE3X 1M0EA 2IS1A 4EHBA 2ONZA 1RZ3A 3LWBA 3OI7A 4S1OA 1RM3A 5JAUA 5JV5A 1EUCA 4Z9YA 4RZSA 4C6HA 3KBOA 2AG1A 3QGMA 2Q4EA 4I46A 2XVZA 1FJGB 4NABA 5HF6A 1AZLA 2H7XA 1G42A 1O96B 3BZBA 4YQEA 1B8UA 2AXPA 1P61B 1TKBA 1J5EB 3BMOA 3AF0A 3O1IC 4B3MB 4URHA 4P4GA 3M6VA 1V4NA 3FJ1A 3JQBA 3VZSA 3LPDA 4NZOA 3FG9A 5AP9A 3S2EA 4YDQA 5C8YB 1GN8A 2J9RA 3PD7A 3HA2A 1L7EA 2DFDA 1PR5A 2ZAOA 1NE2A 3JASA 4N40A 1T2AA 4F2DA 3NHMA 1AO0A 3D9QX 8MHTA 1QK3A 4CT5A 4ZDIA 1F4LA 4EJ6A 3HB5X 1LS1A 2IY8A 3I5UA 3W8FA 1FEZA 2ZOSA 1DC4A 4IVRA 5GADl 3L7DA 3BL6A 4RSRA 1GPLA 1TJPB 3GGPA 4G1UC 4GPEA 5CLHA 5F2OA 3GGOA 1JSCA 1CNEA 3IQFA 5AOBA 4PAWA 4YUVA 5JS7A 1JT2A 5LQCA 1J5PA 2C88A 1QFYA 4ALKA 1BRMA 4O1MA 3I83A 5F5NA 1EWQA 3L7AA 1I24A 3WADA 3W79A 5KQLA 4XE5A 4DVJA 1Y8AA 4C4XA 2I80A 1QH8A 4RYLA 2NTVA 3LDAA 2G0TA 3G59A 4IWYA 3D1JA 3HLYA 2P9EA 1NP3A 1U0RA 1LTKA 2C8VA 3ZHRA 4EOGA 1OWMA 4OU5A 4FZ5A 2EEPA 3KB1A 3ZW9A 1AZTA 1YR2A 4OUDB 1O58A 1PR6A 3Q0TA 4KQ9A 4RDXA 3TLAA 4AO7A 1XRRA 3D6TB 3A10A 1K8QA 1MC4A 2PZFA 3K53A 3L7IA 3AJDA 4FE7A 2X0FA 3ZDBA 3KP1A 3MK31 4G23A 2XD9A 4OD0A 5KJ1A 4S1TA 3AX6A 3M9XA 2ZS7A 3DB1A 3OT1B 4X1YA 3WLJA 4LDAA 5KSYA 1QCZA 3VNSA 4RZ3A 4NG5A 4C3UA 3GLIA 3LWZA 4ZVKA 1MPTA 3JAKB 1JJAA 4W5QA 3TRDA 5GJBA 5IFLA 2FEMA 2H4FA 3BJEA 3FFTA 3NUQA 4YFVA 4MV8A 4YP6A 3QBTA 4KN9S 3U1BA 4DMHA 2WYOA 2P77A 4ZCRA 4ESVA 3QMWA 4B45A 4BFXA 4UPDA 4JQSA 4CNQA 5KYXA 3AB3A 3PB3A 4OO3A 3GNSA 2IYWA 3LP6A 4H16A 2J5RA 4OY3A 4D41A 1Z47A 7YASA 1DV1A 4HX5A 5KNCA 1SWVA 2GB4A 4E21A 4LFAB 1A2QA 2POQX 2XB2A 1PVVA 3DEJA 1YC2A 1PZFA 1Z6ZA 1YRHA 1ZH2A 2X2FA 3WNDA 3WB9A 1YZYA 1FTNA 1OIVA 5TGZA 5K0BA 2QLLA 3UY4A 1ZHOA 4M9QA 2ZBPA 4UOZA 3HKEB 3CA8A 1KKUA 1JQBA 5J5VA 5IK2D 5IJ0A 3R8FA 1PL8A 3LC2O 3PITA 4HLNA 1V35A 4LKRA 3U48A 1ZH8A 3K1ZA 5AKZA 3LUJA 5K8IA 1ODTC 1C1HA 3PNMA 3FJYA 4MRAA 4W8GA 3GLHE 3C3MA 4CR6A 2WAAA 3IQGX 4WOBA 4UHDA 4XM2A 2O0MA 4HP8A 2F55A 4D3FA 1Z4IA 4MZXA 3GJ7A 4GO1A 5DO9A 5KQGA 1GFSA 2CVHA 3MIZA 2ZJ8A 3CCFA 4QPCA 4F3RA 4DZRA 2XGGA 1QGED 3RR2A 1FRQA 2J0SA 1VL5A 1PL6A 4IZIA 4W1RA 3V1MA 4HTFB 5AVVA 5EQDA 3RREA 4YFYA 3PNBA 3EBLA 4FJ0A 4HYEA 4FZVA 1XHLA 5CNMA 2YVLA 5LNK1 3OUTA 3G0CA 2QBYB 1YSCA 1LI5A 1QBKC 3NC4A 4QFCA 1TK9A 2I71A 2NAPA 3VNAA 2XMDA 1H9AA 4IVNA 1D1SA 4OHZA 2IYYA 1YXMA 2WHRA 3KLPX 3RVJA 1EUZA 4EFKA 4Y0NA 1T4CA 3T95A 3SOPA 5DCLA 2E18A 3OCUA 2H16A 3L7BA 2M6LA 3DNFA 1HA3A 3PWTA 2FOIA 3L4SO 1EFUA 4TL7A 5BSEA 2Y68A 2VHVA 2IU0A 1ZU5A 4HYQA 1Q0HA 3W1VA 5ECWA 3AF5A 1IHOA 2I8LA 4A92A 2ZSEA 4P82A 3RADC 1XMVA 2R3SA 3NBXX 4NCNA 5IKPA 2ZYRA 1UK8A 5CT4A 2FFRA 4PV7A 2HIAA 2ZJYA 2DUNA 2IYOA 4KIJA 4UBMA 4HAZA 1OFTA 1T6XA 3LZ6A 4ENUA 4DTCA 5AK0A 1SPXA 4CIBA 1NXQA 2CKDA 2ZJ3A 1ZN7A 5FNVA 1T8PA 2V7QA 2FZ4A 3OEED 3THWA 2O7SA 3COPA 1JB9A 3EVGA 3HA7A 4FHCA 3U4CA 4B4OA 1G59A 3X2SA 2KBEA 3FWKA 4U7GA 3RVOA 3THOA 1P0QA 2VH2A 3ZU6A 1YB4A 4EFDA 1E0DA 5EP3A 1GZHB 5EJGA 2PLFA 3WB0A 4YMTA 4M0LA 2B4KA 1SOWA 3CW2A 2YFHA 2A9VA 1PK8A 4ND3A 4R9VA 3V8EA 7AT1A 3II6X 3IR5A 4Q24A 2IHUA 5FFFA 4A91A 2CN1A 2Q5FA 2QD4A 1WCYA 2G88A 2HDNB 4LI0A 4QYMA 2H08A 3DFKA 4F3TA 3V34A 4IIVA 4KLRA 1K8RA 4OQZA 1P7CA 3CB2A 1XCPA 3TSWA 4X64B 2A9RA 4OFZA 3TQRA 3IKMB 4MNTA 4YPVA 3E3LA 2CK3D 1I5RA 2QRGA 5EP2A 4E3WA 1OV4A 2AFIB 3I76A 2IWHA 5ETJA 1LSOA 3KVOA 4CIWA 5JBNA 3SQNA 4H1HA 1QLJA 1DAGA 3NOQA 1UC4B 3LX6A 2JFOA 1SO8A 3H11A 4MUYA 3U9SA 3TF5A 3O3CA 1P2BA 3BOSA 3UJ7A 1LCIA 2WZQA 3L1UA 2RARA 4F4CA 2EEZA 4IYJA 2ZYDA 2XEDA 3PZBA 2XCUA 3PLRA 2CUKA 3T35A 1G5RA 1TM3E 2OV4A 3SS9X 4OX9B 4LGYA 3H3JA 2XZLA 4F9EA 2XGOA 5A2GA 4Z3OA 4JJ6A 5AOVA 3AL0C 3HU5A 2ONYA 1XMXA 1QP0A 3Q7QA 4PO8A 5KAMA 4HDCA 4DDKA 2C1XA 1YH3A 3KHKA 4FTWA 5E1DA 4Z1OA 5CFMA 4Q4DA 1WB4A 1OX4A 1YVRA 3ZC3A 4UREA 5C5DA 4O2LA 1OHHA 4OI1A 1TZ2A 1KFBB 4QEDA 3TBHA 4DGSA 4EQ6A 3E9NA 4B6SA 3GLFA 1E4EB 1L5NA 1FX1A 1VI2A 4QDUA 3I72A 2Z8ZA 3DP9A 1R9MA 4GDMA 2IW1A 3HWWA 2P2ZA 1OA1A 3GJRA 4IW3B 4PZ0A 1Q0SA 1HOXA 4RF3A 4MRNA 4R2XA 4A5SA 5FBHA 1P33A 2BTQB 3C8HA 3O26A 3WV4A 2P4SA 1EK1A 3MCWA 4AECA 1SXGA 1QLWA 1OBOA 1W6RA 1IEQA 2VSQA 2NO6A 2Q0HA 2YIDA 3FROA 3K3PA 4MITA 1G8FA 1KC3A