1C14A

Crystal structure of e coli enoyl reductase-nad+-triclosan complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL REDUCTASE
publication title Molecular basis for triclosan activity involves a flipping loop in the active site.
pubmed rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 91
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1999-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1c14A00
2Q45A 3MJCA 4JGBA 2Q1WA 1VI2A 1YXMA 2I66A 3P5SA 1A27A 3DDNA 2PZLA 1ZH8A 2B5VA 2DTDA 2BELA 3C1AA 1ADBA 1NPYA 3K92A 1UDCA 4BO4A 2ZCVA 2ZYDA 8ADHA 2X1HA 4BNWA 1AXGA 1Q7GA 3ZU4A 3B70A 1BWSA 1MFPA 2G17A 4FD3A 3MOIA 1GR0A 3GC6A 5EL0A 3E48A 3ZWNA 2HUNA 2XOXA 3RBVA 5TNXA 2C82A 1P31A 2PY6A 3WNVA 3KSDO 5F21A 1ZFNA 3SC4A 3RIHA 3QVWA 1OZAA 4XD2A 3WQRA 2ZJ0A 4FFOA 1V8BA 4JJGA 1BVUA 1YDEA 2OBNA 3E03A 3KRTA 4J49A 1N2SA 1GUZA 3T4EA 3EYWA 2E37A 3DO5A 5JMWA 4IINA 2QIOA 5JS6A 5TX7A 3TQHA 2Q1UA 3IDSA 1JAXA 2C5AA 3KO8A 4KQWA 4R1SA 3CINA 1NP3A 1PJ3A 1E7MA 4Q39A 3VOSA 3QE3A 2LDXA 3B1KA 5B1YA 3PDJA 5MGBA 1DFIA 2GRAA 2VN8A 4KDEA 1ML3A 2G82A 4J2HA 5TT0A 3TFQA 4NU5A 3Q9NA 2HK7A 1LLQA 2YFHA 5BNFA 4RQTA 4BO7A 3G17A 2FR1A 4BO5A 5ENDA 2VCYA 3GUCA 2EIHA 1XWFA 4TROA 2I99A 1TEHA 4B4VA 3LLSA 5L7YA 4BMVA 2Y05A 3PYMA 4NR0A 1F12A 5A9SA 2IE0A 4RPLA 3JQCA 4F6LA 4GX1A 3OIDA 1I3LA 1OOEA 3ZHBA 4CM8B 4JBIA 1UAGA 3K8ZA 2OXIA 1H9BA 4IDEA 5L7TA 3DMYA 2DU8A 1GPDG 3DAFA 1W0CA 1LC0A 3TZKA 4E5PA 2FPIA 4DC1A 2OBYA 2GZ2A 5DDIP 1JKFA 5KJFA 1XLTA 3RJ5A 3RC1A 4FDAA 2JCVA 1SMKA 3DBRA 5TJHA 4U0KA 4RZHA 2OO5A 3V1YA 1SAYA 1PL8A 5JAQA 1P0FA 3V1UA 1LXCA 4HP8A 3PDUA 2NVUB 5AQ1A 4WLNA 3NDRA 1FXSA 3INGA 1YL6A 3ADOA 3JQFC 3VKVA 2ZTLA 3K30A 1EZ4A 2WYUA 1L1FA 4DPMA 2O48X 5G0WA 1HEUA 3I52A 4YJHB 3OM9A 2EJVA 1WLYA 1NNUA 4NJMA 2CVQA 1SCUA 3DR3A 4L0QA 4RL6A 2B36A 3GVHA 1BDMA 4RVGA 4LN1A 1C14A 2X5JO 1A7AA 1P1KA 4CLOB 1GL3A 4AJEA 3VPFA 4XIYA 1SEPA 2OOSA 3TL3A 4NBVA 3DC2A 3BHIA 5EERA 4CQMD 2AQ8A 4TRRA 4QTZA 4TKMA 3DOOA 3SVTA 1A4UA 1KEVA 1G0NA 3PQDA 5KVVA 2VWGA 4R54A 3ZW9A 2OHXA 5DF1A 2VUTA 2W90A 4ZVVA 5KJ1A 4L74A 3JQAA 4HX5A 5COQA 3CE6A 4TKLA 3ZV6A 1U2DA 3DZFA 3ZWCA 5L51A 2JAPA 3UH1A 5L9AA 3AOEA 2BGKA 2VWHA 3OJ0A 3Q11A 2Q99A 3K2EA 1M76A 3PHGA 3GR6A 1YONA 2DVMA 3UFXA 1T25A 8LDHA 3VH1A 3DZGA 2OORA 2WWRA 1IZ9A 1X7DA 3UVEA 4AJKA 3VPXA 4L4RA 1NR7A 3H6KA 2AE1A 4GVXA 3MJVA 4E2XA 1ISIA 3B6ZA 1G0OA 1ZKMA 3NKLA 1YH3A 4CR6A 4IJKA 5L40A 3OQ6A 2GN4A 1UUFA 4PLPA 1EVJA 5AXDA 3RUAA 3GUYA 1H94A 2X5KO 4LRSB 1P33A 4OO3A 5U1PA 1VC2A 4OHUA 3P2YA 4E6PA 3WMXA 4IDBA 3FTPA 4MP6A 1YS4A 1QG6A 2RH8A 1BW9A 1IHXA 4CPDA 3ANMA 1XELA 3CTMA 4CLRB 2BI8A 3QA9A 1UXHA 4BQRA 5HS4A 4HKTA 4O6VA 5CG2A 1QKIA 1Z6ZA 1CWUA 2FZWA 5F5LA 2NU8A 5A9TA 3EUWA 3A9WA 5CFZA 2NM0A 1I36A 3HFSA 4J16A 4D46A 2YFQA 2DTEA 2B4RO 3DTYA 4AJNA 3M6IA 4IXTA 2DUWA 2CNBA 3JYLA 3OA0A 3ZHZA 4OQZA 1AHIA 2VOEA 4G65A 2X5OA 1C0PA 4AJ1A 2E49A 4OMUA 4BIIA 4KQXA 1E7WA 4WLOA 4BL5A 4K28A 4MVJP 3VPHA 3E8XA 3NTOA 4PFJA 3RBZA 3W8FA 3QQPA 4AVYA 1MGOA 2C20A 2C54A 4FJ2A 4JXKA 4QT0A 2ZKLA 4W7IA 3S1LA 4ALNA 4W82A 4YT8A 1XGKA 2J5KA 5KKAA 4R41A 1V9LA 4BGIA 4LVCA 3C3XA 1GEGA 4NMHA 1DC4A 4ZQBA 3FF4A 4BKQA 3BHJA 5KVCA 4OKIA 1GUYA 4YCAA 4WCFB 1R4NB 3H2SA 3DBVO 3A1NA 2HK9A 1U28A 4YR9A 1UH5A 1GTMA 3RU7A 2GGSA 3WQQA 3PJFA 2BH9A 4J1SA 4CMAA 3IKVA 1N5DA 3JQEA 4P4NA 2JKVA 3OEWA 3RAJA 1RM5A 1YDWA 4WUVA 1PSDA 4L8VA 2HRZA 3KYCB 2Y1GA 4DLLA 1B3BA 4W4TA 2HQ1A 6LDHA 1TVEA 1KETA 1LLCA 1X1TA 4GKBA 3QVSA 3UW3A 4RF2A 4AICA 1BG6A 4BB5A 4BB6A 1KS9A 2IXAA 5JBIA 2BF7A 3DMTA 1TI7A 1U3WA 2X6TA 2Q49A 3O03A 3P2OA 3L9XA 4YT5A 4Z0TA 3LT4A 3PP8A 5A02A 1ULUA 1CEQA 2Y66A 3OJFA 4RV9A 4YPOA 4G2NA 1I2CA 2AG8A 3ETGA 4I9NA 4LCEA 5GZ3A 4WCDA 1Y8QA 5IAAA 2GN6A 2A94A 3PQEA 5BT9A 5G0SA 1H5QA 2Z5LA 1BTOA 3CZRA 5A1TA 4UVHA 5JE8A 2W8ZA 3W4KA 3RCBA 5BNIA 3GAZA 2D4AA 5L4LA 5IDQA 4BV8A 4D7AA 4ZRMA 2A9FA 4MVJD 1NAHA 3ULKA 5TC4A 4DIOA 1XU9A 4MIOA 1B0AA 3ZV3A 1MXFA 1QYCA 3RKUA 1E3LA 1MA0A 1AE1A 4CV1A 4BNFA 3DBHA 1A9ZA 1ADCA 5EJ2A 4G81A 3KZVA 4CQMA 2B5WA 1LDMA 5FYDA 3TOZA 4RLHA 3ZI0A 3GOHA 2EW2A 1DOHA 1H6BA 3AOGA 1QORA 4TWRA 4IJWA 1FF9A 4MVJH 4CMCA 3AFMA 1PJBA 3X2FA 4KMSA 3CZMA 1SB8A 3H4VA 2P68A 3OETA 5F5NA 1RM3A 2JCYA 4JROA 5TIIA 4R3NA 1EVZA 5DN9A 4NBUA 1QXSA 4YQYA 4QECA 3MJTA 4K1LA 3Q1LA 1GV1A 2DPHA 4B7XA 1HT0A 3NRCA 3TZQA 3ETDA 3NJ8A 4EW6A 2B4QA 2P9GA 4BNTA 1YO6A 2H63A 4RDHA 3D4NA 4F45A 4IMPA 4J7XA 2HAEA 1M75A 1F8FA 1W73A 1YB4A 3EDMA 3F3SA 1K5HA 1BRMA 3ZU2A 1SOWA 1U5AA 4IS3A 1UXIA 4XB2A 2Z95A 2J8ZA 2C7GA 1CRWG 1K2WA 3EHEA 3QLJA 4Y67A 4CMIB 5C3MA 2I3AA 5F1OA 1MFZA 1HWYA 3ST7A 4A10A 3LC1O 5IZ4A 1I5RA 1Z7EA 4FFPA 3TZCA 1ZUD1 2X0RA 4I9HA 4II2A 2DBZA 3O8QB 2YQ4A 3AI3A 3UN1A 1WW8A 2VZ8A 1HYEA 4AJIA 3L4SO 3T7CA 1P0CA 3VVCA 1T26A 1HDCA 4B4WA 1N7HA 3ENNA 1ZIDA 3UKOA 4YJFA 2YZ7A 2EV9A 2PH3A 4AL4A 1E7SA 4D45A 1KVSA 4XYLA 4AJHA 2FPGA 2LDBA 1BXKA 2EG9A 1DC3A 4Q3CA 1B2LA 4B3IA 4B3JA 2X9NA 1X0VA 2X4GA 3TL2A 4KP7A 4CMGA 2C59A 3COSA 3C1OA 1EQUA 3FHLA 4R1UA 1PJTA 3UUWA 4PZDA 5AYVA 3UCEA 3AI1A 2X9GA 3BA1A 1TB4A 4I9UA 1P1RA 4GVLA 4W7HA 4FFNA 3U4DA 2VYND 3VPGA 4NJOA 2HCTA 3WR5A 4F3YA 2D59A 2ZYGA 2QYSA 2AEMA 1G1AA 3DFZA 1EK5A 2QX7A 4HNGA 4CL3A 2FY8A 5JPIA 1ENYA 1ZSNA 1XDWA 1IOLA 4DPKA 2EXXA 3K96A 4OGWA 2JFGA 1CJCA 3KV3O 2V6FA 3RVDA 4QO7A 4Z3KA 2FR8A 2PK3A 1H93A 2PR2A 1JWAB 3S2EA 4DLAA 3PJDA 3IJRA 4WGGA 1NAIA 1R0KA 4UEKA 3KEQA 1WMBA 4A0SA 3RJ9A 3VH2A 3SJUA 4WCFC 1E3WA 1QYVA 3JQ9A 2VT3A 4J9UE 1DC6A 4ZD6A 4R69A 1JVSA 3H5RA 5U4QA 4NBTA 3L77A 3KXDA 1MX3A 4GMGA 4R51A 3FWNA 3JYPA 5L53A 1JAYA 3U49A 5G4KA 1D8AA 4XRRA 4CLDA 3BTSA 3RFTA 2BMAA 2YHIA 1UP7A 3LZ6A 3ABIA 1O89A 3NTQA 4BNUA 1G6KA 4ZQGA 3SLKA 1CIVA 4UUPA 3H9UA 1LQUA 1PQUA 1VJTA 4CM6A 4DQVA 2QG4A 4FBGA 1C1DA 1I10A 2BFPA 2E6UX 4J43A 3I9LA 4OXNA 1DPGA 4BNVA 1EUZA 3VZQA 4FFMA 3TJRA 4FOOA 5KCZA 2CVOA 2XXJA 3WTCA 3EGOA 3JQ8B 4MVJA 4BNLA 3QP9A 3WGGA 1YBMA 1IPFA 4FQ8A 2PZJA 2WTBA 2IEBA 1LBEA 3C7CB 1ZSVA 5FI5A 5L7WA 2P2SA 4EUHA 3PHHA 4NJMB 1RPNA 5GZ1A 1F0YA 1YBVA 1DO8A 1VKNA 3GHYA 4UVEA 3V2UA 1ISMA 4OOFA 1VL6A 3E6AA 1K6IA 3GK3A 3QVOA 3U9LA 5BQFA 2EW8A 1K3TA 5JYEA 1YJ8A 4K26A 1RWBA 1QP8A 4A26A 4IQ8A 2BHLA 5KKCA 1KEUA 1Y6JA 3V2HA 3GQVA 4JN6B 5H82A 3KLPX 3ZWWA 3OJEA 3WFJA 5FFFA 5IXYA 2C7VA 2O3QA 3DBLA 3HDJA 1HDYA 4TSKA 3WLFA 5L3ZA 1NFFA 4R01A 3ZN2A 3IJPA 5A9RA 5DNAA 5IFLA 2GZ1A 3AM5A 3TF5A 1FDWA 4PZCA 4XZ3A 1GY8A 1HXHA 1I3NA 3PGJA 3ONEA 1MC4A 3FBTA 3BAZA 1PZGA 3MEQA 1BMDA 2YV1A 3RUIA 2JAHA 2AXQA 2GCGA 4RPJA 1KEPA 4TZTA 3OIGA 1N92A 2X0NA 5C7OO 2VTEA 5ILOA 3K9QO 5HS6A 1PIWA 1IB6A 4E13A 3F1KA 5BSFA 1E7QA 1ONPA 3EW7A 4Z0HO 2X0IA 3RC7A 1HYGA 2GASA 3LK7A 3RWBA 1ENZA 4CMKA 4RORA 1HSOA 4OH1A 5C7IO 3PYLA 3I5MA 1NBOA 2NU6A 5ITWA 4AJLA 2OP0A 4JP2A 2Q1TA 1D3AA 3IUPA 2HMVA 4J1QA 3OECA 4CLHA 1GYRA 4UREA 3AUAA 3G79A 2Y67A 2JL1A 3D4OA 1ZK1A 3S2GA 3RFXA 1E3IA 3GEGA 1DIRA 1BW9B 5I7EA 1JKIA 1VJ0A 2ZB7A 3TRIA 5JFOA 3MJ4A 1NQ5A 1WWKA 1F8GA 3OMLA 4UUOA 1B8PA 2P4QA 4J2OA 4J3FA 3GZ4A 2I76A 1Q0QA 5JW6A 3HSKA 1HTBA 1V6AA 1DBVO 1ZMOA 1PS0A 1PR3A 3C7AA 3CIFA 3IC5A 3NTRA 1LRJA 5HBRA 4H16A 1NQTA 1X7HA 3F47A 2C29D 1WZIA 1GZ3A 3H8VA 5A03A 1E92A 2F1KA 2VYNA 2Y0DA 3MZ0A 3PIDA 4X54A 1P1FA 1WDKA 4XDYA 4GGPA 3JQ6A 3GH3A 1EFKA 1ULSA 1P44A 4PG8A 7MDHA 3U62A 5JAZA 1PGPA 3VTFA 2E82A 1D1SA 4ZJUA 4OQYA 3F6YA 3WJAA 1K0UA 3U5TA 4BNXA 1GZ6A 3U4IA 1P1HA 4M55A 3F9IA 5IDYA 1GCOA 2PFGA 2YV3A 5L4SA 3O4RA 1FK8A 1OC2A 4M86A 3SX2A 4UUMA 1UAYA 2D5AA 2Q2VA 1ZK3A 1J0XO 3H9GA 1DEHA 4B8ZA 5IZCA 1YB1A 4IUYA 4ND3A 3EK2A 3GGOA 3BYZA 1Z82A 2GERA 3LC7O 4CR8A 1R15A 1CDOA 4MKRA 2DKNA 1B8VA 3A28A 3LC2O 3LVFO 2J6IA 3G1TA 3RSHA 2JHFA 3WS7A 4WKGA 3WNQA 3I9KA 1TLTA 4Q3AA 3V2GA 3RROA 4GSKA 1PR9A 3ZWXA 1SBYA 4UEOA 5JCJD 4PG7A 3P7MA 3VAZA 3KETA 3BIOA 1K89A 1GYPA 5L45A 1GCUA 2GO1A 4HADA 3G1UA 4O1MA 3JQ7A 1KERA 3ZHXA 2GNAA 2E4AA 4WPGA 2O3TA 2DBVO 1T4DA 2X0JA 3Q6IA 4MINA 4E2YA 2VT2A 3DONA 4QFDA 5I8ZA 1R4MB 5KOIA 1Y8QB 3INRA 1Q7BA 3GN2A 2NTNA 4CV0A 2NQTA 4YA6A 3K2BA 1ID1A 1T24A 2AQIA 2O2YA 5L95A 4RF3A 4DGSA 2DAPA 3D4PA 3IOYA 3K5PA 4N18A 5TS3A 2Z1NA 5AXCA 4BO1A 2H5LA 2QRJA 1O9BA 3UICA 1HLDA 3F4BA 3ZNNA 3OP4A 3N7UA 1JTVA 3RUCA 3WSWA 1BXZA 1AHHA 1KEWA 3ROPA 4XKJA 1T4BA 2HDHA 3P19A 2DBRA 2IDZA 3FPCA 4BNIA 2POQX 1HKUA 3MJEA 1Y7TA 4R16A 2HO5A 3ZV4A 4CQMB 1YB5A 3HN7A 4IDCA 4HFJA 5T8KA 5G2OA 1GQ2A 3FD8A 1OC4A 2W98A 1KBZA 2PH5A 3E1KA 3A4VA 4Q3NA 4GH5A 1GV0A 2W4QA 1LI4A 2ZCUA 3PWKA 1LA2A 1E6UA 3WOHA 1EFLA 1MLDA 2VYVD 3M1LA 1EE9A 4DTIA 4IQGA 4WNCA 4CM7A 2FOIA 4BNKA 3WGIA 3RD5A 1V3VA 1LEHA 1UDAA 3WXBA 4FGWA 1UZMA 3B20A 4P22A 4YT2A 4QQRA 3GVXA 2Y1FA 3I23A 1B26A 3IQDB 3LDHA 4P38A 5DBGA 3LQFA 5EIOA 5G0VA 1O5IA 2Y68A 3AOEC 4URFA 3HHPA 4GGOA 3Q3CA 4E5YA 2AW5A 4BO3A 5CEFA 4J4BA 3BTOA 1XU7A 3OICA 4CV3A 4J4HA 4FCCA 4PVCA 4AFNA 2PD4A 1MG0A 3JQGB 3NDJA 4PZEA 4J90A 4RLSA 4YAJA 1E77A 3N74A 5I7SA 2X22A 3AU9A 5THQA 5HWSA 1I0ZA 3HB4X 4DYVA 3LSYA 1KVQA 4TMFA 1EVYA 3PTZA 2IYOA 3RQSA 4B8WA 4BKOA 2AEFA 4FIZA 4C7KA 1QYDA 2QZZA 3H65A 1LJ8A 4NK4A 2PD3A 3MJSA 1YRLA 4IJVA 1L7DA 3CUKA 5A3JA 1M6WA 1JVBA 2RHRA 2I67A 3CMCO 4I8XA 1XIVA 1M2WA 2WM3A 1XA0A 5CEEA 2D5CA 2IZZA 2O3RA 4UUNA 2NV6A 5DOZA 3V1TC 3PJEA 1S7CA 3I1JA 1LU9A 1V3UA 2R2GA 1W4ZA 4DREA 1PZEA 2DM6A 4HBGA 4YJFB 2VRBA 3D3EA 5AXBA 1HE4A 1LDGA 4O59O 2JD1A 4UEJA 3JQDA 2RAFA 2JD2A 3RUEA 2H1SA 3PGXA 2ZB3A 1UP6A 3ON5A 5B4TA 1DC5A 4IIVA 3NT5A 4QEDA 5HM8A 3FNGA 1ONOA 4JP3A 3GG9A 3U3XA 1BGVA 1FDTA 4HFMA 3KYBA 1LNQA 4XQ9A 3GPDG 2QZ9A 5C7LO 1U1IA 1X7GA 3SLGA 2DUUA 3ANLA 1HZJA 3JYOA 4DQUA 3H5AA 3ZNOA 2AE2A 1DIAA 3JD4A 1X0XA 1JN0A 3GFGA 4WLUA 4IBOA 4EEZA 4DYDA 1H2HA 3PYXA 5MDHA 2P5YA 1O0SA 5KNLA 2WD7A 1A7KA 5ICMA 1DHTA 1PJCA 1MV8A 2FN7A 4PLZA 5GMOA 2I6TA 4L4XA 1B8UA 2XXBA 2C0CA 4IIUA 3H5NA 5A06A 4BGUA 1U5CA 3EAGA 1P1JA 2P9EA 5T57A 2EF1A 3TZHA 1P1IA 2EP5A 3Q9UA 4K6FA 1IPEA 4YJGA 3VZRA 1EEHA 3L4BA 5JCJA 1E3WB 1NFQA 5DBFA 2QHXA 2PV7A 4L73A 1U2GA 4I5DA 4YRDA 2EEZA 1ZZEA 2PLAA 5DCYA 1KIFA 5CDTA 1EE2A 3IL2A 4WOKA 5G4KB 1W6UA 1ZK4A 1Z74A 3HUDA 4XB1A 4FFLA 3JQBA 5DULA 3NX4A 4KTTE 2YHIB 5TQVA 2V65A 2ZIZA 3KYDA 4OIMA 3W6UA 2JD0A 3IIEA 4UVIA 3DMTC 1E6EA 4ILKA 4CM4B 3QSGA 4E5NA 1C1DB 2J5RA 2FSVA 4BQPA 3DL2A 4IM7A 1ENOA 4B7UA 4ZRNA 4MDHA 3LF1A 1H6AA 1N1GA 4I5GA 4D0RA 2W2LD 4EEXA 4OSPA 1ZEJA 4JBHA 4PLFA 4ALLA 4EDFA 1ZNQO 2PZKA 1BXGA 4L76A 2P91A 3SEFA 3KOUA 1T2FA 4GBJA 1ARZA 2GDZA 1QLJA 1NVMB 4A27A 4KOAA 1J6UA 4LCJA 4XR9A 3AJRA 3FTNA 4FJ0A 4A03A 4YT4A 4CUKA 5L4NA 2A4KA 3WICA 3I6IA 3WGYA 1FMCA 3QWHA 4F46A 1HDXA 3H3JA 4WJZA 1PL6A 3ZNQA 4CMEA 3ETEA 3SXPA 5DZSA 1HYHA 4GL4A 2H6EA 2YYYA 3QWAA 4S1VA 2VYVA 2DLDA 3JSAA 3DFUA 4M49A 3ZCXA 3UXYA 3V5NA 4TVOA 3DBLB 1NM5A 4WEOA 3WTBA 4PIVA 3PZRA 3FBGA 3ZZNA 1PJLA 3AK4A 2O7QA 2O2SA 4QXMA 4XQEA 1M67A 3MTJA 2IYPA 4JJIA 1U8FO 2GSDA 2P5UA 3IP1A 5I9MA 3TNLA 4RVFA 3OF2A 1PWXA 1TA4A 5JXWA 4MJLA 3PWSA 3IKTA 1N9GA 3R3SA 4PG4A 4MIYA 2G5CA 1T2AA 3O38A 5IDXA 1I33A 2ZJ1A 1B16A 2YUTA 4KUEA 1SZJG 4H3VA 3WBFA 1XCBA 3DHYA 1WDLA 2I9PA 1HDRA 2W2KA 2BFOA 4E4YA 1DFGA 1NPDA 3KVOA 2GF2A 2IZ0A 3IMFA 5KVQA 3JD2A 3FR8A 1YOVA 1DIBA 4XR4A 3VH3A 3BMOA 4BNJA 3AUTA 2AMFA 3D64A 4FSHA 3NT4A 2FR0A 4LMPA 4NBRA 1PU2A 4GLOA 3U4CA 3UGKA 2VHXA 2CDAA 4B3HA 4EZBA 5K0ZA 3AUSA 3ZWAA 4IZIA 5EESA 1DAOA 3ORFA 2OP1A 1R66A 1Q0HA 3NJ4A 4ZU3A 4M1QA 2WEKA 2WYVA 1PGJA 3VH4A 5KJCA 4IZHA 2GZ3A 2HMWA 4XGNA 4MVJM 3EY4A 1C0LA 2O7SA 3GMDA 1L7EA 4PLGA 4K9DA 4IMRA 4MKXA 3OQ1A 3PI7A 3PEFA 4NFHA 4RVHA 2VUUA 4DIFA 2VRCD 1D1TA 1GQYA 4RPHA 5CG1A 5H83A 2P9CA 5LC1A 4CM3A 1C1XA 4MVJF 4H7PA 3TOXA 1R37A 4YACA 1E3JA 5TLSA 4BKPA 1ADGA 3Q2KA 3SJ7A 1H0KA 1ZO8A 4J6FA 4U5QA 5F1KA 3TN7A 4FR5A 4BKUA 3GNSA 5B4UA 4INAA 4AJPA 4DC0A 1HDOA 3M2TA 4BNYA 4WK6A 5AXAA 1EBUA 4DRYA 4WASA 4LMRA 3WDSA 3R0IA 5ER6A 2DPGA 4GX0A 5HTOA 1LDBA 1GYQA 1Y5MA 3TFOA 3VDRA 5A3VA 3TSCA 2PWZA 2DBQA 2X9VA 1O6ZA 2QW8A 4S3MA 3MTGA 1D4FA 1GPJA 4QO8A 2VNSA 4D42A 4M8SA 1ZJZA 1CERA 2NVWA 4OYRA 2VWQA 1QYWA 3L0DA 1YGYA 3HE3A 3JQ9C 2PD6A 1EUDA 3LT2A 4CR7A 4BNMA 2CDCA 3GRPA 2WYWA 5F3RA 1YVEI 1KY4A 4ONEA 5IDWA 4Z9YA 5FI3A 3PLRA 2A35A 1FDVA 3JQ7B 2VHVA 2D0IA 1RM4A 3R3JA 1IYZA 2HJSA 3UF0A 4RDIA 4FGSA 4GX5A 4GWGA 3RUFA 1XG5A 2NWQA 4O0LA 1P45A 1E6WA 3D5QA 4Y6PA 4A7PA 3EMKA 5JAMA 2ZK7A 5A9SB 3JD1A 1EMDA 5KWEA 7ADHA 2HK8A 2W2LA 4II3A 3K73O 4DWVA 2WMDA 2UUOA 3BTUA 4ALIA 1VM6A 1WAMA 2HJRA 2HMUA 1RJWA 1MG5A 3S2FA 1JU9A 3I9OA 3EZYA 4XJTA 5BSEA 1ZMTA 2RBEA 3I3OA 1I32A 3V8BA 1EVIA 1LTHR 4WOJA 2ZQZA 3E9MA 4BMSA 3FN4A 2VHYA 4MVJE 1VRWA 2SCUA 4CQLA 2B35A 3DBRB 3UCFA 2HSDA 1EQ2A 2O4UX 2IEDA 2I3GA 1GUFA 3AU8A 3R1IA 4BO0A 3ZHYA 2YJZA 4M89A 3DAPA 3WG9A 2ZTUA 4HFRA 2C5EA 3CSDA 4LSWA 4D3FA 3RC9A 1I24A 1NX6A 5DCWA 1BHSA 4EITA 5TRTA 4DLBA 3F46A 1GU7A 1WZEA 3K31A 1B3RA 3HADA 3W6ZA 2O50A 4JCOA 4ZQEA 3WMWA 2PTGA 2VTDA 3I9MA 2UYYA 4YWJA 4DQXA 2GR9A 3WYCA 5TJ9A 4AJJA 1XEAA 1K6JA 9LDTA 3DZKA 4CUJA 5J23A 3NDIA 3B1JA 4XIJA 3RFVA 4B7CA 2EKLA 4I1IA 4Q9NA 3C1TA 3W4IA 4W9NA 3VHRA 1Z45A 3F5SA 4QX6A 5ICSA 2AHRA 3UAGA 1E1NA 1WMAA 2PKQP 3VKUA 5CP8A 4J4TA 4K6CA 3QIVA 4I08A 2Y99A 1OAAA 4L75A 3F5QA 1J5PA 2DT5A 4WLFA 2RHCA 2ZYAA 4MPDA 1T1SA 2BRUA 4ND5A 5TT1A 2I65A 3JQAB 1XR3A 2Q4BA 3CKYA 4Z0PA 4YYZA 5IJZA 4MVJI 3U4HA 4BV9A 1ZBQA 3OQBA 5JC1A 4HWKA 2NNLD 4Q3DA 1EDZA 1T1RA 4BO6A 3HWRA 4JLWA 4YAEA 1E3SA 3AW9A 5DP2A 4BO8A 1XKQA 2CFCA 3BMNA 1KOLA 3ZWMA 4RPKA 1ISHA 4ZQFA 3WGQA 4NI5A 3BMQA 4FC7A 1Z75A 1FJHA 2PGLA 1VLLA 2CF5A 2FWMX 3QY9A 4L4SA 2HU2A 2UUPA 5JSFA 3PIIA 4GSLA 3S2IA 3GRKA 1PX0A 2VRCA 5JLAA 2Q2WA 1UXGA 5CPBA 3SBOA 1C0IA 1JQBA 3GVCA 5T64A 3H9EO 3G0OA 3G49A 4BGVA 3OBBA 1N8KA 4LGVA 3AWDA 3DTTA 5TF4A 4E33A 1CYDA 3PWZA 1Q1NA 3ZU3A 9LDBA 3KSZO 3IAHA 2EKPA 1DAPA 1MB4A 3KBOA 2WE7A 3NEPX 4XCVA 2GPTA 2HMTA 3AM3A 5BSGA 4B79A 3WWYA 1ZJYA 1DLIA 1DLJA 1QYXA 1IZ0A 1X13A 2X7HA 3NGLA 1I8TA 1YJQA 2PNFA 4RF4A 3F1LA 3QV1A 2FSSA 4E2ZA 1IULA 1OI7A 1PS9A 4OXYA 1X1EA 1M6HA 3C7DB 3ICCA 5THKA 5LDHA 2CDBA 4DA9A 3GAFA 1P74A 3GNQA 4WLVA 1JLLA 2WD7B 3QWFA 4IDFA 3OJOA 4IDAA 1SOVA 3E9NA 3OEYA 4R9RA 4WEQA 3W8DA 5IZCC 3G3EA 2HKIA 1A9YA 5JY6A 4XWYA 5JDCA 1K6XA 3LLVA 3GDFA 4CMIA 2NLOA 4WNIA 5GZ6A 4YJGB 4Z6KA 4EYEA 2ILTA 3KTDA 3KSUA 2D2IA 5ES3A 4Y98A 2O23A 4YTEA 4RQUA 4TVBA 5EQDA 2C07A 2VHZA 4Y6SA 3C24A 3O8QA 4FC6A 3WGZA 3WFIA 1Y1PA 3ZWBA 3GDGA 1HDZA 2YV2A 4Q3EA 2Y1EA 2BI7A 1I3KA 3O26A 4DVJA 2A92A 4PGFA 1B7GO 4CMHA 2QYTA 3E82A 4EI2A 1A71A 1J49A 3MCVA 1LSSA 1YQGA 3D7LA 3EC7A 1EUCA 1E7YA 2D1YA 3KYDB 3ZU5A 3BMCA 1U4OA 1IUKA 3NYWA 4JIGA 3OSUA 4YRBA 4BNZA 1UXKA 1H2BA 4I5EA 4QUKA 3GFBA 5EINA 4XX0A 4YXFA 5CHEA 5A5FA 4JK3A 3WQSB 4CODB 1OMOA 1P9LA 3GEMA 1CQIA 5BNTA 4JNKA 5TGDA 4NZ9A 1HL3A 5I7FA 4EJ6A 1NHWA 4DBVO 1BXGB 2Y0EA 3H2ZA 2H9IA 3H9JA 4PRKA 5GY7A 1LUAA 3U09A 3UOGA 3OH8A 3ANNA 4GWKA 4H15A 2VNAA 1D7OA 4ZA2A 4J7UA 1O95A 5JMPA 4GKVA 4WLEA 1W8DA 1EBFA 3LT1A 1KVRA 3M2PA 4E30A 5JCXA 1SB9A 1YL7A 3L9WA 4XQGA 3ROQA 1TT5A 1PL7A 2RIRA 2ET6A 4Z9FA 2D8AA 3I4FA 5T8KC 5JNLA 3D1LA 4R9SA 3T7EA 5KTKA 1U8XX 3FPLA 3K6JA 3DZJA 3L6EA 3RI3A 3SC6A 1E5LA 4E3ZA 1VSUA 4MO2A 5A4DA 3DAGA 3EVNA 3NT2A 3FRJA 4GLLA 1Y81A 4ND1A 4C4OA 4CM1A 3ROKA 2JFHA 2RCYA 3HJAA 3AUUA 1ZK0A 3DBHB 1JKJA 1V3TA 1DRVA 2VHWA 3E5RA 1VSVA 4Z9XA 2ZB4A 4OXKA 2X86A 4EJ0A 4P8RA 1E1LA 1N9GB 2OUIA 1OBFO 2QRKA 4NH4A 3DZHA 2AG5A 1DDOA 1Y8RA 5JY1A 1GAEO 4PRLA 1ISGA 2YHUA 3ZWOA 2WD8A 4RGBA 3DHNA 3HZZA 4WE3A 3RUHA 1U7TA 1IY8A 4DXHA 1NWHA 1BVRA 1JA9A 1RM0A 2CUKA 2DFVA 2B83A 2W2KB 1NQAO 1HRDA 3E5MA 1PS8A 2F00A 2UDPA 4FN4A 2UAGA 4A2CA 5FWNA 5T67A 2NACA 1I30A 4BO9A 3B1FA 2NU7A 5COBA 1YOVB 3DB2A 1LC3A 3BMOB 3BTVA 4DBZA 2GN9A 4XYEA 1SO8A 4NU6A 4CUZA 2YY7A 2OFPA 1GADO 1DRWA 4B4UA 3JQ8A 5CPFA 2WJPA 3HDHA 4Z3DA 1H6DA 3ZNPA 3CPSA 1I2ZA 4P4GA 1H6CA 1IL0A 1HE3A 1PJ4A 1SPXA 3DXFA 4RVDA 3ZH2A 4E21A 1IE3A 5JC8A 2EWMA 1YBAA 3HNPA 1GFSA 2NSDA 2BGLA 3JCZA 2TMDA 4PLCA 3CXRA 3PXXA 3NV9A 4QFCA 4ALMA 4DUPA 4U6SA 1HETA 1Z73A 3HDYA 2X23A 4MP3A 4J7CA 4Q3BA 1MP0A 2J3JA 1E7RA 1HF3A 3WYEA 4E5MA 3PLNA 1I01A 3RBXA 1ONNA 1PGQA 5FF9A 3GZNA 2R00C 1QR6A 1UP4A 1VKOA 4MVJG 1AUPA 1C1XB 2FPPA 3VVBA 2HRBA 1IHYA 1ADFA 3JQFA 3PFWO 4WECA 4CLEA 4CV2A 2OMEA 1X14A 4OKNA 1E5QA 3H7AA 4GX2A 1DB3A 5JO9A 3ZV5A 4B4OA 4G5HA 4BS9A 4RO0A 3I9JA 2I5PO 5A5EA 3H3FA 4YDRA 1NFRA 1R12A 2FP4A 3FNEA 3ASVA 1ORRA 4NBWA 1R6DA 3PRJA 1B14A 2NU9A 4JX8A 3TWOA 4TRJA 3UHAA 4DPLA 3I6QA 4IQ0A 1KY5A 3EZLA 3Q2IA 2R00A 4QSMA 4Y9DA 3ITDA 1DFHA 3WYBA 3WB9A 2BD0A 1V35A 1GZ4A 1Y9EA 4MOWA 2G0TA 5IF3A 1GDHA 1V0JA 3MWEB 1U9JA 3DHEA 1MXHA 2Q1SA 1KVUA 1DSSG 1KVTA 4UVDA 2GYYA 5KIAA 2DQ4A 2GN8A 1E0DA 4O63O 4ZGWA 1F17A 4E32A 3L4BC 1I2BA 4PLTA 3U0BA 4RPGA 4ND2A 4ID9A 3ENKA 4A5OA 4BNHA 1JDJA 4IGFA 1PJSA 4RVUA 4AJ2A 1VL0A 1AN9A 2JCXA 1QSGA 4RVSA 3RC2A 3WIDA 1A72A 2NUAA 3PK0A 1XQ6A 1YE3A 3JQBC 5JYDA 3QRWA 5JDIC 3D3WA 1ZCJA 1QMGA 3HG7A 3PQFA 4E31A 3TZ6A 5KVSA 5CDGA 1MC5A 3ZWVA 4ZHSA 5IG2A 2IODA 2J3KA 2WDZA 3BZUA 3EVTA 3INTA 4BMNA 4D79A 2BFAA 2PKQO 1CETA 1XYGA 2YW9A 3DOCA 3JV7A 3OIFA 4LISA 4LVUA 3WX0A 5C37A 4IXWA 1DRUA 4YEDA 5DBIA 5LCXA 3JYQA 2VOJA 1QV7A 4N54A 4R1TA 3ZWYA 1YL5A 4J91A 3W1VA 1I3MA 3OA2A 4XJSA 1LQTA 4LW8A 1TXGA 4GAEA 5T6BA 5JDIA 1YWGO 1U4SA 4TRMA 1PJ2A 3D5TA 1DIGA 4ITUA 3I9NA 4CQLB 1YQXA 1NPTO 2IRWA 3KLMX 1ZEMA 2GLXA 3MWDB 1QLHA 5I8WA 4NIMA 4TRNA 1Q7CA 1UR5A 1U3UA 2Y0CA 1HZZA 1PWZA 4NHEA 2XF8A 4FOSA 4XGKA 3FR7A 3OJLA 2NQ8A 4CMEC 1H9AA 1LSOA 2BKAA 2R6JA 2E48A 4UVGA 3OFSA 2AQKA 1E3EA 3DOJA 5ITVA 3QWBA 3WJ7A 4KTVE 2PKRA 4RCVA 4BHTA 1HLPA 4KWHA 4R68A 3PFFA 1LDEA 1FDSA 2Z1MA 4NFSA 4IGEA 3CEAA 4R5HA 4MIEA 4BNNA 1PZFA 1PZHA 4HNHA 4GPD1 4PG6A 2DTXA 1PGOA 3BHMA 2O3JA 3L6DA 1NVTA 2YDYA 2B0JA 4R4JA 2FHSA 1R0SA 4N5NA 3CH6A 4Y6RA 1EDOA 3QVXA 3JD3A 4RF5A 2YDXA 2AEJA 4PN3A 1VE9A 3DEYX 2VZ9A 2UVDA 3ICPA 4IJUA 4KUGA 4M87A 3GVPA 4DMMA 5CAEA 1XHLA 3DZIA 3H9QA 1VL8A 3KEOA 2Q46A 1R4MA 3QWIA 5JAIA 4NFYA 4PLVA 1FDUA 4CM8A 4E0BA 5I7VA 1U3TA 3NUGA 2Y1OA 2EJWA 3BMNB 3I4CA 2V6BA 1Q2XA 4IY1A 5DP1A 3BMQB 3QHAA 3PPIA 5I9LA 3FSRA 1NTOA 1WXDA 2BLLA 1F14A 4HXYA 3W8EA 4OM8A 4HY3A 5H81A 6ADHA 1A5ZA 1RKXA 3F4LA 2BGMA 1N1EA 2Q50A 2V6GA 4KZPA 3RKRA 4HFNA 2TMGA 2ZB8A 1NXQA 2V7PA 4FFRA 3WWZA 4D3DA 4AJOA 4TQGA 2X58A 3ITKA 1T2EA 2BFMA 1ZVMA 4ZQHA 2NVUA 2EP7A 3DWFA 3AI2A 4TZKA 3VTZA 4XYBA 4YBZA 1OFGA 2AQHA 4CL8A 4DL9A 4UULA 5IXSA 2CMDA 1PEDA 2FRDA 4GMFA 5G4LA 4NPCA 4U8GA 3ROMA 2EHDA 4YJHA 3Q0EA 2NTVA 1C3VA 4E2WA 5COAA 4GI2A 3GDOA 3X2EA 1CF2O 3QJ5A 4W99A 3ONDA 3ADPA 3RASA 2EKQA 2NTJA 2ZTMA 1PJQA 4J9VA 5HA5A 4J0EA 4JQCA 4CMBA 2CVZA 2Q4EA 4CLOA 3M1AA 4DMLA 1NR1A 3E9QA 4E12A 1DJNA 5A05A 4XEHA 3ZGYA 3GG2A 4NK5A 1R16A 3LT0A 4W6ZA 2PA3A 5ILGA 5FEUA 4LSMA 2EGHA 2JHGA 3GEDA 4FB5A 3IP3A 2B4TO 1KYQA 1YKFA 5B37A 4C7JA 3JQGA 4RJTA 3VDQA 4PLYA 1HE2A 2O3SA 1NVGA 5G0TA 1SNYA 1GQQA 3L07A 4N5MA 4J0FA 4U0JA 4MKZA 1R0LA 4YQZA 5B12A 3WLEA 5DOVA 1RYEA 3D0OA 2ZATA 3UCXA 3WIEA 3T4XA 4BUCA 2Y1DA 1HE5A 4DIBA 4EUEA 4YVFA 2FZEA 3W4JA 1HSZA 5DT9A 2ZQYA 3HB5X 3LU1A 3GPIA 2ZTVA 4J1TA 4U6QA 3KUXA 1NQOA 1WNTA 4YJDA 3RUDA 1VPDA 4YAKA 4RZIA 3R6DA 4CM9D 3BMCB 2WE8A 1CQJA 4LK3A 5EPOA 5I9NA 5TSDA 2G76A 4NQZA 4OL9A 1ISFA 1TT7A 5T5QA 4IS2A 4F6CA 1WVGA 1QV6A 1GEEA 1LX6A 4D41A 4FPXA 4E5KA 4BO2A 3AFNA 4XDZA 4OJNA 3GN1A 3N58A 5KJEA 1AGNA 3NAQA 1Y9AA 2D3TA 3AM4A 3QVTA 4A73A 4CLRA 1LDYA 4YB8A 2XAAA 3VZSA 4D0SA 1NYTA 1T2CA 1BDBA 5IN5A 1JWBB 4KUHA 3C85A 2C2XA 4PCVA 3WGOA 3CMMA 4Y8VA 3O9ZA 3L6OO 3HDQA 3ZWPA 1GD1O 2J3HA 4PVDA 3GGPA 1TT5B 2FMUA 2EGGA 3PHLA 3FCOA 5F1PA 4ALKA 4JJFA 4D43A 5AVOA 2YQ5A 4PG5A 3DZBA 4I5FA 5EN4A 1JW9B 4OAQA 3PJGA 1LSJA 2HMSA 5K6AC 4HV4A 2O3UA 2OGUA 4KDFA 3QW2A 2AA3A 4BNGA 1ZXBA 3JTMA 5HRUA 3S55A 2OL4A 4OOEA 2JJYA 1KC3A 1SC6A 4U7WA 3DQPA 1B15A 3JD0A 1HDGO 3STHA 3FWZA 4L9RA 2VUSA 3AY3A 2VQ3A 1NASA 2JFFA 3RU9A 4R1NA 5A04A 2VZ0A 3GNTA 4PLWA 2DC1A 4R3WA 4XA8A 3VC7A 4ZN6A 1Y8RB 3PVZA 2CZCA 4W9NC 5ADHA 2VWPA 3GF4A 3HQ4O 5K6AA 2DFDA 5BR7A 3WGTA 5LDGA 1Z7BA 2IZ1A 4KWIA 4XYMA 4BOYA 1ZW1A 4UAGA 3WSVA 4M54A 4IDDA 4WCFA 5EQFA 2C2YA 1R4NA 4EBFA 5ER9A 2X8LA 1BSVA 2B37A 4CM4A 4XRGA 3TPCA 4ZICA 1WDMA 5K9ZA 1LRLA 1T2DA 5G0UA 4BKRA 3E18A 1PTJA 1Q0LA 1WPQA 2QQ5A 3GGGA 4ND4A 4D3SA 5ENVA 1M66A 4AJ4A 3IS3A 1U7HA 4N7RA 1KC1A 4NG5A 2Q2QA 2UV8A 3KYCA 5KJ6A 3ZW8A 4CLXA 4FW8A 1J4AA 2XPCA 4AG3A 3GVIA 4YAGA 3HFGA 1ENPA 1VJ1A 3GA0A 4CJXA 4IPTA 3WGHA 2PZMA 5C5IA 1UXJA 4ROSA 1PQPA 5DCUA 2Y93A 3AY7A 4CMJA 1QRRA 2NADA 3NGXA 3PHJA 4XQCA 1ZSYA 1C0KA 1UZNA 3LYLA 4EGFA 1O8CA 3KM0A 1PGNA 1F06A 3GZNB 5CDYA 5JO0A 1LRKA 2HLPA 2Q3EA 1X15A 2RH4A 1SEVA 2V6MA 4LRTB 5B4VA 1XSEA 1P3DA 2QRLA 3WBBA 4CM5A 1DXYA 3ZDFA 2CD9A 3ONFA 5BSHA 3A06A 4NDNE 4YRAA 1ZXLA 3HN2A 4D44A 2Y1CA 2G1UA 1Y5RA 5U9CA 3I83A 1LDNA 4EJMA 1UDBA 2CY0A 3KHUA 1XQ1A 4NNJA 3PZBA 1NWCA 3MOGA 3KB6A 3AY6A 5IN4A 1WP4A 2EERA 2J5QA 4FJ1A 4R5MA 2GUGA 1ISJA 3FI9A 3JYNA 4FS3A 2J3IA 2WSBA 5CEJA 4HUJA 3C8MA 3S8MA 4BGEA 1LLDA 3VZPA 3GHHA 3TDKA 1O94A 3OHSX 5CDUA 1EK6A 2OZPA 4XGIA 5JDCC 1DJQA 4GQAA 3LF2A 1PQWA 1AXEA 1E1MA 1YQDA 4XYGA 1DHRA 1LLUA 5EMHA 4J1NA 1E1KA 1LSUA 3JQAD 1P77A 1RYDA 3BXXA 3GLQA 4OSOA 2CSUA 1ZK2A 4N5LA 3A14A 3GT0A 2NVBA 2PGJA 4PLHA 3PHIA 2O4CA 3VPSA 4CM9A 3FNHA 2P4HX 4EUFA 1N7GA 4IDGA 2B69A 3D3WB 3GMSA 3ASUA 4O5OA 4ESOA 2PGDA 5AOVA 2CF6A 3FNFA 4MP8A 1U3VA 4ALJA 1MUUA 1NHGA 1UZLA 1S6YA 2GD1O 2IXBA 4JBGA 1A4IA 1UJMA 1DIHA 4YAIA 3IUSA 4P4LA 4BVAA 5CDSA 3GY0A
chains in the Genus database with same CATH superfamily
2CFTA 2EBFX 2Q45A 3HUTA 4WBSA 2G9NA 2LNDA 2P27A 5AUQA 4E03A 2FG6C 5T3YA 3H87A 3L6UA 5BVGA 1G291 3UTCA 3ZBPA 2PE5A 3P5SA 3NW9A 4A8HA 2B5VA 5AVVA 2F8MA 3CZ5A 3Q5DA 3U7FB 4K9NA 1ADBA 1NVFA 2O06A 1LB1B 1UDCA 3AJ9A 4HNQA 2ZYDA 4RM2A 1U1EA 2A9VA 1UKYA 2IPNA 2IOYA 4BNWA 1EH5A 2O8EB 1GGVA 2TMKA 1GN9A 2AVDA 5CB6A 2ZYUX 1ISSA 1ATZA 4KXYA 5DHPA 4MEJA 1SG0A 2FWPA 4BX2A 4FD3A 4HZGA 3GC6A 4E1VA 1XAHA 3V1NA 3OHMA 3IAS6 3AIOA 1G5QA 3AV3A 2IUFA 3BL6A 1VYUA 3NHAA 5F51A 3TRJA 4YP6A 1YA8A 1L4GA 3H86A 1NNI1 4Q18A 3ZCUA 2ZJZA 3FKQA 3QVWA 3CA8A 4P54A 3WQRA 3R9WA 3N8DA 1KI4A 4FFOA 3WAKA 3ZD8A 3OEEA 5FOWA 2HV8A 1V8BA 2NZUG 3SHOA 1BVUA 2OBNA 3D31A 2DPXA 4EDHA 5JS7A 4GOOD 1ZWLA 4J49A 2QXUA 4B31A 3G0BA 4FCVA 4REOA 4G1VA 4ETIA 4UXHA 1GZHB 2E37A 3NHBA 4D9CA 2QRGA 4IICA 2Q1UA 1JAXA 5BWCA 3EARA 1DOAA 1OA1A 4PZPA 4QOJA 4RV4A 3O1HB 2VHUA 3CINA 4C76A 2XRZA 1E7MA 2RARA 4B6PA 3NBFA 1LBHA 3T7SA 3WL8A 1RP7A 4QBKA 5B1YA 2PWAA 2R6CA 4MI3A 1EI9A 2I7TA 4LBVA 3TFQA 4LF8B 1AUXA 1G20E 1HDIA 3B60A 2PLFA 1U0RA 3Q9NA 2XT9A 2O7VA 3FLAA 3WK5A 4E09A 2X42A 2FR1A 1HR0B 2XRYA 4OGFA 4UQOA 1XWFA 2I99A 1WY7A 3NJRA 1TEHA 5L7YA 2F1HA 3H16A 3VUEA 4HT3B 4EAAA 1Y1SA 2IK8A 3LYAA 4BU1A 2B8EA 2AGVA 4M9ZA 4O2AA 3CV3A 4KN5A 3EDQA 3G0GA 2E1RA 4KQGA 5KTTA 5K3CA 3JQCA 1R00A 3H5OA 1TVMA 3OIDA 4V0SA 5F77A 3VVMA 4CM8B 1JKXA 2JFWA 5C4IA 1UAGA 5DLQC 3FFWA 4CKBA 1H9BA 2G09A 4IDEA 2VBCA 3RE1A 3WISA 3GLGA 3TZKA 1TGYA 3TG8A 2ZSBA 2R7NA 2HSEA 4LFBB 3HH8A 4XVHA 2OBYA 2GZ2A 4BWYA 2HHJA 3BMXA 1JKFA 5KJFA 1XLTA 4U3JA 2QYOA 3NAZA 1TPYA 2M6RA 1BYIA 5FLYA 4TSRA 3P0IA 1RXWA 3L0YA 1FQJA 2NXEA 2WNSA 1FUUA 2HF2A 1E1DA 3I72A 4RZHA 1H1DA 4U0KA 4EB3A 3W5DA 3GLHB 5TEVA 2OO5A 3V1YA 2ZKIA 4HB0A 2HA6A 2HB6A 1ZCBA 2C8LA 2X3FA 1SAYA 4I1SA 5IUKC 5SZHB 1PL8A 1UK6A 3OZVA 2IIPA 3BCUA 3HYCA 4IXNA 5GM2A 1HNWB 3PUYA 1P0FA 4ZT7A 3VR5A 3RAEC 3PDUA 4WLNA 5TMBA 2X0FA 1VG1A 4ZI7A 4AZTA 4MW5A 1YL6A 2AT1A 4CF3A 2WKQA 1Q77A 3W3AA 3K30A 1BFDA 1Z8NA 1SG6A 1L1FA 1JEYA 5HF8A 2XBUA 1HEUA 1NKTA 2FN9A 3D7SA 1I0LA 2QZ4A 3E58A 1Y7IA 4NJMA 4YJHB 2KSQA 4L0QA 4HDMA 3AEZA 1W30A 5DEOA 3PRKE 3KQKA 1FX1A 1TO1E 2P6UA 2YIMA 1E3TA 2YYZA 1FP4B 4NNOA 4YRPA 5LXTF 2LWIA 1J9EA 3AKZA 4LN1A 1C14A 2BFBB 1A7AA 3OURA 4TXHA 2JJ2A 2X19A 1RRCA 3G2PA 1WL8A 5B2ZA 5KTYA 2H1OA 2HT1A 4C3UA 4KPYA 3DC2A 2VJNA 2VH2A 2PQ0A 4TRRA 2PANA 2QD5A 3UQZA 3SVTA 2BTEA 4ZYWA 4L27A 1O5OA 5KVVA 4R54A 1TUIA 4DNQA 1KHHA 3KP1A 1XZLA 2C4VA 4W63A 5DNWA 1CZRA 2VUTA 3ZW9A 3N2LA 4HEA1 4ZVVA 2DQKA 4DLTA 3PNBA 1T0IA 3HWX1 2YIDA 3HZHA 2P4EA 3JQAA 2IBTA 4HX5A 2O0JA 1P80A 1NLUA 1GJRA 3V7FA 3DMHA 3ZLVA 4B3DA 4QPJC 3ZWCA 5L51A 1FXWF 3VGJA 3EOBI 4UCQA 5DISB 3UH1A 1YIAA 1EQAA 4LGYA 3I8SA 1EKXA 2XBLA 1U04A 4HPXB 5E7QA 1O9HA 1GA4A 3AYZB 3JALB 3OJ0A 1DUIA 2NZXA 3H9CA 3ODPA 4WFQA 2RH9B 3QHQA 4QREA 4K6MA 1PYOA 3N76A 1T4CB 2IHVA 1HT2E 4ENQA 1Y6FA 3PHGA 3HDTA 2BF4A 4D8UA 4KMOA 3UFXA 3DZGA 4RK4A 2OORA 1TLFA 4L95C 1Z7WA 3VPXA 2E5LB 3GH1A 4MGIR 1ZC4A 5HK8A 3EVFA 1SCBA 1CY4A 2FEKA 5AVKA 3FUVA 2VK2A 4L3OA 3B6ZA 4E2XA 4HLQB 1X1QA 3TLGB 5AXDA 1UUFA 4XE5A 5JJCA 4J3JA 1OLSA 1YZQA 1WOYA 3KKPA 4G56A 3S8EA 1A4RA 3A58B 4LRSB 4KLZA 4RQAA 3OLZA 4OO3A 2EFYA 5U1PA 3DCJA 1U7DA 5JCOC 1CJUC 2JGAA 1BN7A 2OVFA 2BGWA 2BSQA 3AQ4A 4J16C 1BD4A 2BFFA 2JHPA 3U16A 1YS4A 1G98A 3UGTA 1T3HA 3KJGA 4HSEA 2NZ8A 3H4TA 1W85A 4PIPA 2MTBA 1M6EX 4OGLA 4CU2A 1G2IA 4AUEA 3DO6A 1J9ZA 3KTAB 4YBRA 2JNWA 3TG2A 1L3CA 2IEYA 4KQCA 2R8BA 2ECQA 1J56A 1D2RA 1QKIA 1Z6ZA 3BF8A 1DZIA 4JT8A 3U1TA 4BLPA 1CWUA 2NU8A 1FYDA 5JMOA 3U1VA 1SXPA 2I9KA 3ZY6A 1J7JA 1D9ZA 4WW0A 1HZZC 1KP9A 5CFZA 2V3VA 1XJ0A 5INTA 2R47A 1E9AA 1KS2A 2NM0A 2C0PA 3SSNA 2JLRA 3UIEA 2AB0A 1UCFA 1M73E 2CUNA 3ADBA 2YFQA 2A58A 4CKYA 4HH1A 1M6NA 3QELB 1LK5A 4QODA 4O02B 2FVXA 3K3PA 4BE9A 2XGMA 3IUMA 1UZAA 3KEFA 3NTLA 3M6IA 2RH5A 3P9KA 4MV5A 2YKGA 2GTPA 2ZE5A 3JYLA 3OA0A 2C2GA 5G53C 2GK3A 2Q4RA 4KVGA 4ND8B 1E60A 1RQLA 2HO4A 2M1ZA 3QEAZ 2X5OA 2HSWA 2JW5A 2A9OA 3F9RA 4F8YA 1NXOA 4LCBA 4DWOA 3IEVA 2O8CA 5E7IA 1E7WA 4WLOA 4JXZA 4K28A 5E6UA 1THMA 2QT1A 3W8FA 3RBZA 1FZTA 2ZU0C 1E3MA 4IVQA 1MGOA 4EG0A 1U7UA 3E9RA 2C20A 2C54A 2WA1A 4WXRA 4EI8A 1WVIA 2ZKLA 4KE8A 1DC7A 4WINA 3IUBA 4W82A 2VLIA 4YT8A 2OKGA 3I5AA 5K4AA 2I3ZA 1SIWA 2J5KA 3HDVA 4R41A 1Z13A 3ZHTA 2C99A 4OP3A 2HBZA 2Y1XA 3VA7A 1RPZA 3RVQA 2EQAA 4BGIA 2CXXA 1EX6A 2J3QA 1WZUA 4NMHA 4ZQBA 4ZQCB 1IAQA 1MB2A 3PHCA 4M1OA 3ESBA 5C0OE 5HW0A 2VDRB 4Y0VA 4C6TB 2O59A 2RDMA 4JOCA 5HKKA 3K9LA 2Q0XA 3P2JA 2JAOA 4ZAGA 2PN1A 2XYPA 3A25A 2QVZX 4DW8A 3MQ2A 3T7IA 2AOUA 1UC5B 2MMCA 4R2XA 4V39A 2W2OA 3A4YA 3LS2A 4LWZA 3G1WA 5HKBA 3RU7A 1SCQA 5LZ5A 3PFCA 1OXBB 1SHLA 2V5AA 5J5VA 5K8JB 3KEMA 2AFHB 3JQEA 3KQVA 4B3CA 3KX2A 3H97A 2JKVA 1TK3A 4KNWA 3RAJA 3O8LA 4K86A 4AZSA 5JV5A 1PT6A 1I6WA 3DP7A 1PSDA 3HO6A 4L8VA 3K0BA 4PEVA 5K0NA 2Y1GA 3VKGA 4UJ3A 2ZS7A 3EVGA 4URYR 3KQLA 2C77A 5SY9A 1KETA 2NT4A 1Y4ZA 1KS9A 4AN4A 3O03A 3DMTA 1TI7A 1U3WA 4MUEA 3L9XA 1QPBA 2VKTA 3LT4A 1Z16A 3AHGA 1ULUA 3D8BA 3DULA 1IZYA 3NBYC 1XZFA 3OJFA 3PS9A 4QLAA 1I2CA 1P7CA 2AG8A 1MJFA 3ETGA 3R5SA 4I9NA 4LCEA 2NPOA 4TKVB 4OTZA 5TV2A 5GZ3A 4TQ9A 3HO8A 4XX1A 2C7PA 1O6FA 3SBDA 3I9FA 5H70A 3TVDA 1IHUA 1H5QA 3CZRA 4O2BA 5G0SA 3ZD9A 1B8OA 3DEFA 4OGGA 2ZIGA 4BFXA 4C4YA 2C94A 1PUXA 3IB6A 4P3KA 3AESA 4R05A 2D4AA 1A82A 4EGCB 2BHSA 5L4LA 2O5CA 8MHTA 4NMWA 4FK8A 4R8LA 4CXMA 2QPOA 2GF9A 5FUQA 2A9FA 2XCOA 3BDVA 4MVJD 1NAHA 3CW8X 3QFCA 1XU9A 4L2IB 1FLAA 4WHMA 3X1YA 1HNXB 3QPDA 5ECGC 1F4PA 3L6RA 4YRIA 3OAAA 4ITRC 5I7RA 5JXHA 1MA0A 4CV1A 1MPXA 2XKBA 4HQNA 4BNFA 2O8DA 1GQOA 2B20A 2V98A 4UPEA 3KZVA 1P6XA 4CQMA 5JSZA 3NYRA 4S24A 2HRDA 5H7XA 2B25A 1JJIA 4U63A 5DM0A 2H2GA 2BSXA 2XT0A 3GO4A 5K2OA 3GOHA 3FUWA 3QFSA 3O91A 4QXAA 4YMHA 4UE3S 2DG2A 2ZAIA 1H6BA 2GEVA 1C3OA 1E6CA 1JSZA 4E46A 5I4CA 3NONA 3Q85A 2GYUA 4IJWA 3RBAA 4UU7A 5SZKB 2N1MA 1USUA 4MWDA 1QF6A 2CSXA 1OLUB 3GJXC 1SB8A 4QUIA 1YUNA 4RABA 2GCOA 4UM9B 2CEAA 2OWDA 1X8KA 4RKWA 3IALA 2HT6A 4J0HA 4YQYA 4IFTA 2JHAA 4QASA 1HT0A 4UBOA 3VOTA 4B7XA 3V6LA 1XA4A 2C5BA 2C03A 4LYJA 3QPBA 4Z99A 3RREA 3SQNA 4EW6A 3QUAA 1T5LA 3A1FA 2I1WA 2H63A 2B5OA 5DSZA 1UWCA 4PO1A 2PM8A 5JISA 3CBQA 4OUDB 4H6PA 5AJZA 5IT0A 3DV0B 5AM2A 4CEIB 3TDNA 1K5HA 3ZU2A 4EFNA 3LVRE 3MMSA 4FYVA 4MWOA 1SOWA 4CF4A 1BE8A 2I34A 2OCPA 2Z2KA 3HVHA 3KTOA 4EZEA 3OTHA 1X1CA 1K88A 1ZLYA 1ZQ1A 2OGSA 3E3LA 1T5DX 2MSNA 4MRVA 3ZS9A 1YZFA 1YVRA 4NS4A 3EJWA 2AUMA 2Q3BA 1S3GA 5C3MA 4RDXA 1U0EA 5KX5F 3ST7A 2QMUA 3K1AB 4PCUA 4HLDA 3EZ9A 3E35A 4JB2A 2PSSA 2PMEA 4C88A 5ALWA 3TZCA 2X0RA 4TWZA 4KO4S 3UMJA 3B53X 1IM2A 1II0A 2COEA 3EE6A 3IB3A 2QSZA 2VZ8A 3MCAA 5LP6A 2VBFA 4GC9A 3PCXA 4AJIA 2IH4A 4I4IA 3EWNA 5A6SB 3QEOA 3L0PA 2PUDA 3L4SO 1Z8DA 1WB6A 1N6OA 4UHEA 4WL0A 1HDCA 3L05A 5FLKA 1AKMA 4DBLC 1ZIDA 3UKOA 3LQ1A 2W93A 1N2IA 5I7AA 1EUYA 1Y5LA 1VP9A 4D45A 2W6OA 1KVSA 3WOVA 4AJHA 2EG9A 2PLNA 1B2LA 2P35A 1JVNA 3GU3A 1C7FA 5IW8A 2R4UA 2RGYA 1JR3D 3D7RA 1S01A 3PUWA 1X0VA 3CLUC 4AQDA 3NZEA 1IK4A 1ZL2A 3KQUA 4GI3A 3S6JA 4CMGA 2C59A 5GONA 2CHVA 1ES9A 2ODQA 4KO8A 2NZVG 1AUVA 5K0TA 3PDIB 5DSTA 2XY4A 5A4AA 1GGKA 3HJTA 5AYVA 3BA1A 1M34A 4XVRA 4ER6A 4CMIA 4F9EA 1KEEA 3VJMA 3WB2A 3C15C 3LYUA 1U6IA 2VNHA 4EF5A 2ZIFA 4FS8A 4O4HF 2QYSA 4I7EA 5FFMA 3A05A 3NVDA 1EK5A 2QX7A 3IESA 1EZZA 2RB5A 4IX1A 4BLRA 1DX9A 3K09C 3WC4A 4AP5A 2SKEA 1A8SA 3D4BA 3H5VA 1CQZA 4LY6A 1IOLA 3T0IA 3WR5A 3K96A 3LW8A 3PD7A 2FW7A 2HNKA 4OGWA 3FFTA 1Q95A 3ZX4A 2CCGA 2OK7A 2B2XA 4N0MA 3VO9A 4CEJB 4PYRA 4QOHA 3K0CC 3KB8A 2V6FA 3TLEA 3G0CA 3NQ41 2OXFA 3NWJA 1Q0TA 1G5IA 1DWUA 1H93A 2FR8A 3CRW1 3B3FA 3I9V6 5D6NA 1GAXA 1PD1A 4PAWA 4DLAA 3IQGX 3OE5A 2G6TA 2KMLA 3IJRA 1UMCA 3SX0A 1YUMA 3UK2A 3F4KA 1WSAA 4KH0A 3FOAA 1QG0A 2C9MA 3ZDZB 4PYOA 2YW2A 2BTQA 4WVLA 3ZU6A 3DMGA 1E3WA 3JQRA 2M6KA 3JQ9A 1BQ4A 4J9UE 2VZEA 3JVUA 2RGCA 4LHWA 4R69A 1XOIA 2ORYA 3L0ZA 1CS0A 2WV7A 4G5YA 3VNSA 4B44A 3P9RA 4KXUA 1R9MA 4H7IA 1N3LA 2E89A 5L53A 3HABA 3EEQA 2JARA 1ZD1A 4NZZA 1K7XB 1D2AA 3G5LA 1NXPA 5HEKA 3EA4A 1QO7A 4CLDA 3BTSA 2FPIB 3BWEA 2BMAA 2YHIA 2ZRBA 1PI3A 1UP7A 3LZ6A 2B3TA 2JGDB 3Q3IA 4QATA 1AZWA 3NTQA 3MLBA 1PL0A 1UBTS 3IERA 1G6KA 2ZRQA 3NTXA 4R1OA 5CB4A 5AW6A 4FGKA 1CIVA 2C9CA 1JLHA 1NYQA 3H9UA 1K92A 1K5PA 2BZ1A 3ILHA 4TLCA 1L4EA 5J1TB 4CM6A 3KOWA 5B6JA 5LNK6 3HXQA 2ZYIA 1TTTA 3IAEA 4ML3A 4PONA 2NT3A 2BFPA 1E9CA 3OJXA 1YDMA 2R8PA 1JL3A 1XXHE 1Z2OX 4WX2B 4FOOA 4K8RB 2M2IA 3V9PA 4EOGA 2XXJA 2ANBA 3V6MA 1CJVC 2CLDX 3WGGA 2ZS8A 1IPFA 1YRWA 3BE4A 2Q07A 3K05A 1EG7A 2C9YA 2IEBA 3MJFA 2B78A 4MTLA 3RRMA 2VXOA 5LYJF 5I01A 1W7AA 2I1LA 3C7CB 4G3XA 3U40A 1V6SA 1ZNYA 1CQWA 2F17A 4QHSA 4LXYA 4X3PA 3DUFA 3I45A 5H3HA 3HCEA 4HVLA 2DSNA 1SCUB 3H0CA 4D25A 1I13A 2CUZA 2J3LA 3PV0A 1ISMA 1TO2E 3VC1A 3ZD6A 1VL6A 3HCRA 1K6IA 2AH5A 3QVOA 4GU5A 2RGNA 2H29A 5CH8A 3KD3A 4IIJA 3WP0A 3Q9LA 2C42A 2QMZA 4K26A 4IZ6A 4LBZA 4GE0A 3I37X 4DDHA 4PZUA 1VBFA 5IMSA 2FPRA 3DMDA 4ZV7A 4IR7A 1KQ3A 3NVMB 1G55A 2QTVB 1RKVA 4JB8A 4PC3A 3OFJA 3ZWWA 1XD9A 5HUHA 5FFFA 1YACA 2D0DA 3OD1A 4KV9A 2VSXA 4EQZA 1G21E 1EGQA 1HDYA 4TSKA 3R3ZA 5EXSA 3Q87B 1NFFA 2D2VA 5L3ZA 3IJPA 2YNMD 2GZ1A 3AM5A 2WUWE 2XE8A 2VTBB 1GY8A 1IH8A 2GZSA 1HXHA 1KYZA 3ONEA 1MC4A 5C8YA 4OX9Y 3GBSA 2RHWA 4FZRA 1RFGE 4DIMA 3KLNA 1BMDA 5E1DA 4HL6A 1Q1GA 5C8DA 2L82A 3QX7A 2J0SA 4TZTA 1N92A 2Y9MB 1RTKA 3EUFA 1EWVA 4BRWA 2OTCA 1ZH0A 4R7TA 2WJVA 3U9TA 1PEAA 2Z4RA 5AJTA 4A0HA 3K9QO 5ILOA 1PIWA 1QWOA 1RLOA 2QLMA 1LBQA 1YB2A 3LV8A 4JV5B 1W87A 4KKVA 3A3YA 4MRMA 1G66A 2X0IA 3LO8A 3RWBA 2Z3VA 4MA4A 5D8DA 3TE6A 3ZIAD 4CMKA 4DR2B 4RORA 2GZMA 4O0MA 4OH1A 1SXJC 1V71A 3ZXUB 1CX9B 3GJ3A 4ND7A 4PHTA 5FTWA 2OP0A 3MTIA 4AJLA 3MXTA 1JHYA 2V0GA 1HEYA 1GU0A 1D3AA 3IUPA 2HMVA 4ZT2A 2R87A 3OECA 4N48A 1DU4A 2BR3A 3GUUA 2XE7A 3N0VA 4DVGA 3H18A 3D4OA 5SY6A 4IUDS 3T3GA 3VZBA 2EX1A 2QDKA 2BEVA 3W06A 1DIRA 3BEDA 5KTNA 4G1BA 4G01B 1VJ0A 2ZB7A 2C2WA 1U3GA 3X43A 1NBMD 1NQ5A 4NOKA 1WWKA 5DW0A 2GZRA 4PS0A 2XJ4A 4R9NA 5EFOA 3SSMA 2YZKA 2HA5A 5TMPA 3RF6A 3AKCA 1FUYB 1V48A 3G5AA 3GZ4A 1BWPA 4FMDF 1N1DA 2TS1A 4HWGA 5E1MA 1MF7A 4JLPA 5E0KB 1QP7A 1OAOA 1ZMOA 3NTRA 2GJSA 3BIXA 1F6DA 1XCLA 1LRJA 2CCJA 3IC5A 4H16A 3TVTA 1N2XA 2H2FA 2VDOB 1WZIA 1GZ3A 3UK6A 1QYIA 3FPEA 3H8VA 3KK0A 4M1KA 4CCYB 1R6BX 4E07A 2BFEA 3DTVD 3BWCA 2Y0DA 3PIDA 5F4ZA 4PNHA 1AMNA 1WDKA 4BEVA 2Z2IA 4QPPA 121PA 1JGTA 3A1WA 1EFKA 1RAAA 3H11B 4MYUA 4ZI7F 1P44A 4P80A 7MDHA 1T5BA 2INGX 1Y8AA 3OSZA 4HDCA 3GV0A 4N0EA 3RRYA 3VTFA 2E82A 4JLSA 5KDDA 2IHNA 4FT2A 1K0UA 3IVRA 5J63A 2QPLA 1GZ6A 1JFVA 4CIAA 2H5IA 3LTEA 2QTTA 1GCOA 2YV3A 4KGXA 2ZAGA 2BCEA 4YECA 4M86A 1OC2A 3GAMA 5L4SA 3VX3A 5CFNA 1N8NA 1C9KA 2DRIA 2DH5A 3TSYA 2JAXA 3M1YA 1ZK3A 2KI5A 1YAHA 4ZDIA 4TYNA 1J0XO 1BEEA 2ZROA 3OE4A 4H1VA 5FT9A 4W7SA 1VHJA 3H9GA 1G6OA 2ZRMA 3O3CA 3UWSA 2QY9A 5HOEA 5WRFA 3CNHA 5IZCA 1YB1A 2A84A 2JASA 1OWLA 4ND3A 3IPXA 1S02A 3KR2A 4YONB 5SV2A 1OBVA 3GGOA 1J1IA 3MYYA 3PXDA 4H7JA 4E5VA 1NF8A 2QR5A 4MVCA 4E88A 1R15A 1ZC3A 1JDTA 4GKKB 1X7WA 3ED5A 1OWNA 4UNIA 2ZZMA 3EQ7A 4MKRA 1BGXT 1UKAA 2OGWA 2PRKA 5LQAA 4LIPD 2VCEA 3EW9A 1EHYA 2H17A 4KAJA 1MAHA 2JA1A 3B1VA 1B73A 2V7UA 1OIWA 1R27A 1DQZA 1C9JA 1E2GA 4XWAA 3I5XA 3I9KA 4BVLA 4H4DA 2C3UA 1D6SA 4GC5A 4X1IA 1PR9A 1W5TA 2FK8A 4EGQA 4BP3A 4DUZB 4NOLA 1K89A 4U02A 4DIUA 1H2YA 1A9QA 1QBGA 1EM6A 4FOTA 2UU9B 3DLHA 1XV5A 1P5HA 4LRYA 4D6PA 4HADA 3ZY4A 1PV2A 4O1MA 3JQ7A 1KERA 5JNSA 2IE8A 2ZJOA 2YVUA 1JQKA 2AOTB 1DOZA 1K97A 2DBVO 2PZ8A 4N4AA 3REGA 3M4YA 1KSHA 1CR1A 2YWFA 2VT2A 3A70A 4O4LA 4AT1A 4EUSA 2F1RA 4YRMA 3DONA 2WWWA 4MDYA 4PO8A 1KEZA 4M9SA 1LS1A 3RRJA 4DCTA 2ZBGA 4FFBB 2R6FA 4QFDA 3KKNA 3KS9A 5I8ZA 1SU7A 4QJIA 1Y8QB 2DY1A 5IJ0A 2JFPA 3DLAA 5I9SA 4D56A 1XJ5A 2LCIA 2G9VA 2ZJBA 3G7NA 2FJ0A 5BMVA 2NX2A 4C0WA 3SC2B 3CH7A 2XWJI 3FDIA 2UYCA 2IUYA 1C30A 3IOYA 2PL1A 3AHEA 3SVZA 1A8PA 2IUTA 3DNPA 4PZLA 5AXCA 1XZMA 1SC9A 4BO1A 2H5LA 3R5KA 1H3EA 3UICA 5BPHA 5FR1A 5DLPA 3SDSA 1JTVA 2VDVE 5DGCA 4U7GA 1PT9A 2UZ1A 3QLUC 3UJ7A 1YCDA 3PUJA 4Z2YA 2HIMA 2WWFA 2D1RA 4JR2A 2POQX 2GWRA 3ZV4A 4R16A 1BCRA 4HFJA 3GNLA 4EO4A 4QYTA 4A91A 2X9QA 4PNZA 2X8AA 1KBZA 1YAJA 3N2EA 4PPQA 1KORA 4U8HA 3GARA 5T3UA 4Q3NA 3QBDA 1GV0A 4YI5A 4QICA 1LI4A 1XWIA 4AMUA 5BWNA 3QA3E 4ZTZB 4B3GA 2ASVA 4OQ4A 1UPBA 3FTCA 4YRRA 4EG7A 4OI2A 1E6UA 3IHTA 3WOHA 3EXEB 4JSRA 3QBEA 3ZLUA 2DBYA 1EE9A 1RWOA 2AR7A 3N8IA 1DWQA 4H31A 3FTFA 1VYVA 4B6QA 4LGMA 5ED4A 1ZD3A 3VKWA 3WGIA 1M1YE 2CXNA 3LVBA 1EB8A 3P9QA 1LEHA 4FGWA 3B20A 4I4TF 4P22A 2IWHA 5KYYB 2DQYA 3RSOA 3EGWA 5CXXA 1RAIA 1NVAA 1Y42X 2OCGA 2Y1FA 3D8SA 1B26A 3GVXA 2ATIA 2VCHA 3CGWA 2IOFK 3OCXA 2V8OA 2XKJE 5IK2A 4TLDA 3TCXB 4U7FA 1J09A 1E9FA 4Q9DA 2PAFA 4E5YA 1Y98A 1ORTA 3LQYA 4CIWA 2CXQA 2G67A 4H1UA 1QZTA 3BTOA 2QL5A 4PZYA 3HVIA 2RJOA 3E05A 4PVCA 4AFNA 3L8ZA 1L0BA 1M10A 1MG0A 2VAVA 4B48A 5FLEX 1RHMA 4J90A 1E77A 3L7AA 2C4NA 3N74A 4HRAA 3AU9A 1PT8A 2O52A 3WL7A 1KVQA 1L4LA 1MT3A 1QG2A 1EVYA 2C2HA 3N2KA 3R0QA 4G5FA 4M8IA 1YA4A 2PUHA 4P4UA 1Z4OA 3BE8A 4KN8A 5H1YA 2FEWB 4FE4A 4TM7A 1QYDA 4LE2A 3H65A 2P3OA 4L28A 1N9KA 1XTSA 4AZ3B 3ORQA 4IJVA 1L7DA 5IUNC 4H0NA 1NXSA 3OOHA 4M98A 2RHRA 5EC8A 4I8XA 2WZCA 4AZ0B 4DG8A 1XK6A 3T1NA 2O3RA 4LK2A 1VMKA 4B7ZA 4D9KA 5DOZA 1LU9A 2CXHA 3LUPA 1V3UA 1WEKA 1YE5A 4M4SA 2AXEA 1NOKA 2WHPA 4M9CA 2HR1A 1PZEA 5AW3A 2EVWX 2YS6A 2VRBA 3ZDYB 5HF9A 4M60A 3D3EA 5AXBA 4QGBA 4FYHA 3VO1A 3AKEA 2PUFA 1XMIA 5K8VA 5LD2C 1F48A 1JH9A 4XPIA 5CHYA 3X1JA 5B6PA 3OQMA 5REQA 4C78A 3CCBA 3HCBA 5B4TA 1UP6A 4HAWA 1DC5A 3EUAA 2ZBUA 1RYNA 2ZWAA 5HM8A 2FQWA 4JP3A 3GG9A 5M3BA 3LGSA 1F2TA 1BGVA 4O2BF 5BW8A 1L5QA 1YVDA 1LNQA 2FKNA 3S40A 4MWEA 4I9FA 4QDTA 3KCQA 3ITNA 4A8TA 3PE4A 2WWVD 1X7GA 4LC0A 2IHTA 3RTCA 3ANLA 2A9PA 3RDPA 4DQUA 3GUHA 3H5AA 5K1ZA 2QVCA 4DCPA 2V58A 2F64A 3CRVA 4PINA 1DIAA 5B1EA 1UKZA 5CGQB 2WHEA 4BXOA 1ND6A 1X0XA 3DL4A 1JN0A 2XLCA 1LW6E 3ND6A 4IBOA 4WLUA 3VR4A 3I6MA 4DYDA 3AM1A 1XPOA 1W5AA 3TO5A 1SCKA 2N0SA 2P5YA 1US8A 2DJIA 2X1VA 3DDOA 3ES9A 4GPAA 2IU0A 1IIRA 1INLA 5JRJA 3GFSA 3EFHA 5EEGA 4F06A 4BLSA 1AUQA 2AW3A 1MV8A 2FN7A 1CUUA 3PG5A 2VR1A 3I28A 3EX7C 1NGSA 2OBLA 2XXBA 3H5NA 3I2GA 1RSZA 4NTZA 2VXCA 1UEXC 3GQBB 4JLOA 1U5CA 2PRIA 4JLNA 4S0ZA 6REQB 1U5BA 1EIZA 1P1JA 1YHNA 2AI2A 2DOKA 2P9EA 5T57A 2OZKA 3TPFA 1VKJA 1OR8A 2EP5A 2NAFA 1S2DA 3GGCA 1IPEA 2QNIA 3K20A 4YP1A 2WVAA 1C9MA 2VHQA 3U3OA 1C81A 3DWIA 1EEHA 3PE3A 4YJGA 1I80A 1LH0A 4N5IX 3WMFA 1BKDR 4HQ0A 4MEBA 4I5DA 1W5BA 4S1WA 2GNPA 2EEZA 1IUNA 5ERYA 5LBIA 3RARA 5DCYA 5CDTA 3WDMA 5CVVA 3P9YA 3QLTA 3TAUA 3QUBA 4WOKA 3PNYA 1W6UA 5JBNA 3DYVA 1PFGA 3MUEA 3SF8B 2BKUA 421PA 1XCPA 3I09A 1A9OA 2ZE7A 3L93A 5EIWA 4WK0B 3I01A 5JSQA 2ZIZA 1MU0A 4PU0A 5FPQA 3WA6A 2J08A 2X6QA 4HAXA 5JXGA 3OT1A 5HM6A 2Q3DA 2JD0A 1UJCA 1Z0DA 3DDUA 4WFKA 4ESEA 4B6RA 3VO2A 16PKA 3RO7A 5FHRA 3AMVA 1ZKDA 2J5RA 4HLUA 4ER7A 3Q7TA 2D7JA 1CC1S 4LXTA 5KNBH 4RFVA 1CHNA 2RK3A 4MHTA 1ENOA 2P0EA 4M0EA 1QB8A 2I7XA 4MDHA 2I4LA 4R31A 4Q1VA 4EEXA 1R74A 1W0KD 1WKBA 2YVAA 4D0RA 4OSPA 4JBHA 2Z9BA 3L1VA 4XWWA 2Q1XA 1ZNQO 1BXGA 1CE8B 5DT2A 2HH9A 4PAQA 5FBQB 3OP1A 3Q8XB 4NBSA 4ZXFA 4OD0A 2X8JB 4XVUA 1BKSB 3WYDA 3JWPA 1J6UA 1NULA 1T0HB 1MHPA 1XXHB 2XDQB 3CPEA 4LCJA 4AS3A 4CUKA 5L4NA 1XAGA 2QA5A 3HM9A 1BS9A 1EFDN 4LHYA 1R88A 2HXYA 2R48A 4LY9A 4BV2A 3L1HA 1Y3HA 2ZUBA 4WJZA 1PL6A 1QDLB 2R60A 3ZNQA 1ST3A 2R86A 3ETEA 3MJHA 5GIPE 2HY7A 3SXPA 1HYHA 1JZSA 3AUXA 1IMOA 2YYYA 1J23A 3HYTA 2PYIA 1W88A 2BEKA 2DLDA 1VJDA 3GRUA 3JSAA 1NXXA 2CHEA 3MMXA 4M0DA 1RWVA 2IPXA 3L4JA 4IO1A 5GONF 1UANA 3SLRA 4F92B 4TVOA 1B23P 3JQQA 4N6OA 2PUWA 3DBLB 5HCNA 4CCAA 3T8YA 3H4IA 1MR3F 1N7IA 3HS3A 3AK4A 2O2SA 2YJ3A 1IBRA 1M67A 3DKPA 3MTJA 4QYXA 2XCTB 1U8FO 1RR6A 2IYNA 5AJWA 4JLKA 1TM1E 4R8RA 5I9MA 4DLWA 1XTQA 3UMMA 2JI6A 3COJA 1PWXA 4MJLA 4L7VA 2ZBPA 3IKTA 4YRCA 3WNBA 4P08A 1PO7A 1XYVA 1Z0JA 2D1QA 1EK1A 3L5OA 2PQ2A 3SDBA 1KR2A 1OXUA 5H68A 3TLBA 5AICA 2ETVA 1NP7A 3CVUA 1B16A 3OBIA 5KWJA 5CFPA 2QV0A 1JHMA 4D0LB 1SHJA 1OH7A 5FADA 4QELA 3TLYA 2WT8A 1MV5A 1P8AA 1RKUA 2BFOA 2HJVA 4UOQA 1XZGA 2DUMA 3E2IA 2GF2A 2IZ0A 1ORVA 1OPXA 3A6FA 3CVOA 3IMFA 4WRRA 5EJIA 1V26A 1IQPA 3BMOA 3FCCA 3L8FA 1NVEA 4RY9A 2H4XA 3NT4A 4NBRA 5ETJA 3U4CA 1G8YA 2IEAA 2VHXA 2CDAA 3ETCA 1RBYA 3AIKA 4DZRA 2BN4A 1VJ5A 4GO1A 4C7XA 2KWIA 2C92A 3NHMA 4ZU3A 3IMEA 2G08A 2I6SA 4YRQA 5JFTA 1E9VA 4KPUA 2FOXA 4ZYVA 2CDNA 2GZ3A 4JIMA 5FULA 4CN9A 1PNQA 4PM4A 4ZWNA 1TRKA 3TAXA 3VOBA 2WP8J 4GDMA 4PLGA 2XX3A 4Z1MD 4EW3A 2VO1A 2OUKA 2ZJ5A 3V42A 3MUFA 4HS4A 1IG0A 3KKOA 3PFBA 3OQ1A 3MWGA 4MPRA 4NZYA 1NX9A 3KELA 3IFSA 3LPLA 3FLEA 1VE6A 4LJ9A 5AI5A 1D1TA 4HNTA 2IOHA 5CG1A 4K2HA 4KXVA 3F6EX 2P9CA 3VYSB 1IAVA 1ZOPA 3LE8A 1X7XB 2Y2UA 4JCCA 2B9VA 3FDXA 3NIWA 2VAWA 4NCBA 1E3JA 1RFLA 4PSKA 1W59A 2PRYA 3VKFA 4BKPA 3Q2KA 4HWOA 3W5CA 3MLEA 1L7AA 1ZO8A 2BEJA 1KA9H 2DX7A 1H1LB 4J6FA 4GGMX 4ZXPA 3CYFA 4UUBA 1SBTA 5K3BA 2XUHA 4G0NA 3OIVA 2F2TA 2N46A 3Q7RA 2XQFA 5BMOA 5JH7F 3M2TA 1XZJA 1XMJA 2AWNA 3E4DA 4BNYA 1MN6A 3JSXA 1S96A 1F1JA 4IIJF 4K9KA 3HA3A 4O5AA 4DRYA 2XXAB 2OZLA 3D3JA 3IBCA 5KMGA 1Z18A 1Q3HA 2G71A 1Y3IA 1AQLA 2JCSA 2UZIR 3I8XA 4HC4A 4IOMA 5ER6A 4BVKA 4CGYA 4EEKA 4UD6A 3VC3A 3BH6A 3O1JC 1TFUA 3H2GA 5AKJA 3VDRA 2DHQA 1D4ZA 4IFEA 3TSCA 1WHSB 2PWZA 2ODAA 4AD8A 2OD9A 4PQFA 4Y2RA 2WILA 1PVOA 3F7OA 1GPJA 3JTEA 2ORWA 1TKAA 2VNSA 1K8XB 3TW8A 3NBQA 3MS4A 4MW7A 3VX4A 3WY9A 1GTJ1 2WD9A 1T6ZA 4M8SA 4EA7A 1W5EA 2PT7A 2F62A 2Q5IA 1Q19A 2JDID 4ZT3A 4M8NE 2VWQA 1L4FA 1QYWA 3ACDA 1IBSA 3HE3A 4JC0A 5F2OA 1HNNA 4DLKA 1RQGA 4TV8B 2B34A 4RIHA 1N2ZA 3GRPA 2D4HA 2WYWA 3A2MA 1O2DA 1IRIA 3PHBE 1VPLA 3ZDQA 1I1NA 1NI4B 4RGQA 3HYNA 4UD2A 5FI3A 1YVPA 1RCUA 3L0CA 4RX1A 4X61A 5BV2P 1Z2CA 2A35A 3I92A 3HJFA 1G7TA 2D0IA 3QPWA 3R3JA 1IYZA 2ZPAA 2VUHB 4MYSA 4RDIA 3UF0A 2EFEB 2NNWB 5F2NA 3RUFA 1KMHA 4B46A 3W2IA 1P45A 4GUAA 4B3BA 5KYTA 5LKAA 5A9SB 1Z3IX 3UV6A 2GI4A 3OCVA 2W2LA 4HH3C 2WM2A 4AN1A 3K73O 3OQHA 5CCXA 5FUWA 3RLIA 2ASEA 2YMMA 3J81k 1DS6A 1XD2B 2HJRA 5FAKA 3S2FA 1POWA 1JU9A 2LVBA 3NCHA 3EZYA 3PNSA 3STTA 2WINI 5BSEA 4G0MA 1URPA 2RBEA 1H4SA 1E8DA 3I3OA 1TAGA 3VI4B 1LTHR 1GT6A 1QIEA 3LBYA 2ZQZA 1Z68A 4QRHA 1ZU5A 4W9MC 2IYSA 2SCUA 1TIKA 1VIMA 4M2LA 4FYKA 1RC0A 2FI1A 3DBRB 4XDHA 3UCFA 4EIWA 3BT7A 4XSHA 4JYPA 2IEDA 1MJGA 2ZBFA 4KYIB 1GUFA 3K0EA 5K6RA 5BN3B 1P2SA 2P9HA 3ZHYA 3HBFA 3BVPA 2CHGA 5B1IA 2C5EA 1Z8FA 2F43B 3FF1A 4LSWA 2C8VA 1E5TA 2Q5QA 1RXYA 2DY0A 5F7ZA 3J80A 5KOHB 2BJWA 1NX6A 2XB8A 4JEIA 1TUGA 4XWGA 5DCWA 5IPFA 4DLBA 3B9PA 1C1HA 4X95A 3BK7A 5L3SA 1J97A 1KI7A 3HMKA 3K31A 3L02A 3W6ZA 3ZHSA 2O50A 3TPZA 3OE1A 2YWBA 3EZFA 4ZQEA 2Z09A 2JIBA 4UE6A 4DLXA 1NIJA 3I9MA 1ZU4A 3HFRA 4N3BA 5DHUA 3I2KA 4DQXA 721PA 5E4FA 3WBKA 3MXOA 4LECA 1KJYA 1HOXA 3MWLA 2FDCA 1VG0B 4BQNA 1RXSA 1SQ5A 4OJKA 4Q66C 9LDTA 1QFSA 5D3MA 4CUJA 5J23A 4PCAA 5IDVA 2BBTA 2CLLB 2IP4A 1W4AA 2QVXX 3B1JA 3RFVA 4QD3A 2MYNA 4I1IA 4NOMA 3C1TA 3VHRA 5K8UA 1CXZA 1AF4A 3ZTWA 1Q1ZA 3JXEA 5ICSA 1Q1BA 2PXXA 3VKUA 1B1CA 1G2PA 1PQ4A 4J4TA 5J40A 2FPWA 2AYYA 1ZINA 2Y99A 3ED1A 4M1EA 4L75A 3F5QA 2DT5A 1T6BY 1SRQA 2GN2A 4XI9A 4WLFA 3B9RA 2R25B 5GOTA 5TT1A 4AUKA 5CNIA 4EA9A 4ZPXA 2I4NA 3DV9A 2I65A 5JYCA 2JJ8A 2L2QA 4JOSA 4YJKA 3KZOA 1XEFA 2DB3A 1PLJA 4I1PA 1XJCA 4YYZA 2VJYA 5HCIA 1WABA 4MVJI 2Q9AA 4TMZA 1ZBQA 3HI4A 1IWPB 4HWKA 4Q3DA 4EFKA 4PANA 1EDZA 3R7WB 1TAHA 3BJZA 4TUYA 3HWRA 4MYTA 2C7OA 1E3SA 1VLJA 1CUYA