1C14A

Crystal structure of e coli enoyl reductase-nad+-triclosan complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ENOYL REDUCTASE
publication title Molecular basis for triclosan activity involves a flipping loop in the active site.
pubmed rcsb
source organism Escherichia coli
total genus 91
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1999-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1c14A00
1TEHA 2B4TO 4IPTA 3VTZA 2BF7A 3DBVO 1YOVA 5LC1A 2E48A 4OQZA 2AA3A 1M75A 4OXNA 4NBUA 1NWHA 1IPFA 4GVXA 1RM3A 4F3YA 1OC2A 3QE3A 4TRRA 3K8ZA 1WLYA 3B6ZA 5FYDA 4BNGA 4XEHA 4YYZA 3IDSA 1E3SA 4RVSA 3RKUA 4Z3KA 1D1SA 4IY1A 4D46A 3E18A 4BOYA 3PYMA 4WGGA 4PLCA 3WGTA 4D0RA 3QW2A 1YBVA 4X54A 1VKNA 1EFLA 1P3DA 4H3VA 1I5RA 1GCUA 1J49A 1A4IA 1EVYA 4KQXA 2HCTA 3E03A 3RC2A 3RUCA 1BHSA 1HSOA 4FN4A 1Q7BA 3ETGA 3HDYA 4NFYA 4MIEA 1V9LA 3LSYA 4GX0A 4K26A 4E0BA 1WMBA 4O1MA 3L6DA 1HTBA 3QSGA 2WM3A 5LDGA 3NEPX 3IMFA 3OIDA 4O0LA 2G0TA 1P45A 3MJEA 3Q9NA 3RUIA 1Y81A 3FWNA 2FHSA 3KM0A 3EW7A 3L9XA 1MUUA 4Y98A 4YAEA 4ZVVA 3LU1A 3HDJA 3GG9A 5GMOA 3GZNB 4Z0TA 1U3UA 1BWSA 1FF9A 4NBTA 2X5JO 4ND2A 1LBEA 4ITUA 4CQMA 1HZJA 2D59A 3BMNA 4N5MA 3JYPA 4FW8A 4IDBA 2BGMA 4JGBA 5CDUA 1TVEA 3I52A 3ONEA 2GZ1A 1A9YA 1QV6A 4CM7A 5ILOA 2OGUA 4RDHA 4E13A 1QYXA 2WWRA 4J16A 4B3IA 1DOHA 2EHDA 3BHIA 2NU8A 3U4HA 1LNQA 5F5NA 4DL9A 1KC1A 1KC3A 2VWHA 1UXHA 1LRLA 4EUEA 1R4MB 3QIVA 4UVEA 5A5FA 2QRJA 3GAZA 5G0UA 4CLRB 1DRUA 1U8FO 5L45A 1GZ3A 2ZCVA 5HBRA 3RJ9A 2OBYA 1N8KA 3E8XA 4XIYA 3JV7A 3K6JA 4XQGA 1L7EA 3FR7A 4JIGA 1JWAB 1V0JA 3AUUA 5I7FA 5TF4A 2X1HA 4MPDA 5HS6A 3LC7O 3KYDA 3O4RA 2R2GA 3VDRA 1O89A 1CERA 1SO8A 1GYQA 2IE0A 4C7KA 1W8DA 1G6KA 1B26A 1XU9A 3HG7A 4WLVA 2BH9A 3CH6A 2Q1WA 4YJFB 1ENPA 3ZWYA 3HADA 2WD8A 1ONNA 4I9HA 2IZZA 5KNLA 5IJZA 1KEPA 2JCYA 3ICCA 4JP2A 4K1LA 3F3SA 2VCYA 3EHEA 4Q3CA 4E12A 4YR9A 4JNKA 1SB8A 1QRRA 3JQBA 4S1VA 4CL8A 3I9KA 4XWYA 2ZQZA 1V8BA 3GGPA 4NHEA 4MVJP 4WOKA 4CMHA 3EZYA 3VKUA 1EEHA 2AQKA 2ZTUA 3KXDA 2O3JA 3PEFA 2RHRA 4CMEC 4UREA 3GDGA 4J43A 2VYVA 4R9RA 2QRKA 3E82A 4JLWA 3GN2A 3LZ6A 2RCYA 4O59O 3ZWOA 3CMMA 2PZKA 3R0IA 4H7PA 1N5DA 5DF1A 1U2DA 4BNZA 4J1NA 5B4UA 3IJRA 1FJHA 1MX3A 4OXKA 2ZKLA 4J4HA 4R41A 4CM6A 3ZWMA 2Y0EA 4PRLA 2XF8A 4MP3A 5IDWA 1DEHA 1XCBA 1E7QA 1IHYA 1O94A 3IP3A 4NU6A 3U0BA 5CDTA 4M49A 1ZSNA 2Q2VA 1GDHA 4BS9A 2AEMA 1YJQA 4J6FA 3JQAB 3RUEA 1KIFA 1LI4A 2TMDA 1JN0A 4TRNA 3DR3A 3NDIA 3Q6IA 1OOEA 2DVMA 3SLGA 1T2DA 3K5PA 4EJMA 5TS3A 5EJ2A 2HK9A 4ESOA 4OKIA 3LQFA 2YHIB 4MKXA 3V8BA 3ZV3A 2VT2A 4HP8A 4BNWA 4FB5A 3E48A 2HAEA 1G0OA 2VZ8A 2JAHA 5TLSA 1FMCA 4RPKA 4IDEA 2PLAA 3VPXA 2B4RO 5FWNA 3D0OA 2X9VA 3NDJA 4PG6A 3TZ6A 1O9BA 3FD8A 2GN8A 3IS3A 4NU5A 2G1UA 4DVJA 2VN8A 1UR5A 3FTNA 1MA0A 4XQ9A 2WSBA 4OSPA 5EINA 2HMUA 3AJRA 3OH8A 5I7SA 2SCUA 1UP4A 4ZGWA 2YUTA 1PWZA 3GUCA 4I08A 4LRSB 1NFFA 2B36A 1HWYA 4D79A 2FZWA 3F5SA 2WMDA 4IUYA 3OQ6A 2J5RA 5AQ1A 2GSDA 4MVJA 2VWQA 1ISGA 3WNQA 2R00C 4G5HA 3EAGA 3K2BA 4IS2A 1QLJA 3GZ4A 3TSCA 4TZKA 4AJNA 4LISA 2FRDA 4AVYA 4DLLA 1I0ZA 2Y99A 4XDZA 3IQDB 1KS9A 2B83A 3H5RA 1GPDG 4R9SA 1WZEA 4R1UA 4XRGA 3HDHA 1IB6A 4QFCA 1JKFA 3L4BA 2BFPA 5K0ZA 5IXYA 2HSDA 1I33A 1Z74A 3PLRA 1SCUA 2IYPA 4R3WA 1Q0LA 2FSVA 1NPTO 4A0SA 5JDIA 3B70A 1I01A 5EERA 2D0IA 1G0NA 4MDHA 2C7GA 4IM7A 5C7IO 2NVUB 1YBMA 1ZJYA 1U5AA 3ANMA 4AJJA 4QO8A 1NQTA 3DONA 1HETA 2I65A 3F5QA 3DFZA 3QWFA 1SNYA 2GCGA 1NR7A 3BTVA 2IYOA 1D3AA 3BMCB 4ND3A 1PJTA 3NT4A 4C4OA 1NBOA 4A5OA 4ROSA 1U3VA 3B1FA 3DQPA 2D2IA 4OXYA 4WASA 1F8GA 3GZNA 4GMFA 3UOGA 5IDQA 5BR7A 2HJSA 4M1QA 2FR1A 4M86A 1ADGA 3TOXA 1RM5A 3ADPA 2AXQA 3RU7A 1MFZA 2CDCA 2O7SA 3A14A 1XQ6A 1B7GO 3E1KA 3DOOA 3GG2A 3P2YA 2EP5A 1SOVA 4GSLA 4IQ0A 5JC1A 3DZIA 5JDCC 2RH4A 3QA9A 4AJIA 3S2FA 4CMGA 2P2SA 3DZJA 2NVWA 4RV9A 2PA3A 1HDCA 2X9GA 2ZYDA 2D5AA 4KDFA 3JQEA 3JQ7B 4D42A 4FFLA 5EESA 3RKRA 4MVJH 4ZICA 2C29D 4IJVA 1PZFA 3O8QA 4FCCA 1GU7A 1LTHR 1HYGA 3RC9A 1R4MA 1ISIA 2Z5LA 3IC5A 1V6AA 3PTZA 3ZHBA 4NG5A 1LEHA 4PLTA 3E5RA 4CLRA 3ZHZA 4AG3A 2DPHA 3QWIA 2AG8A 4YJHB 3KOUA 1NTOA 2VNAA 1WNTA 1C1XB 4HADA 1F17A 3WJ7A 3V2HA 4HNGA 2O4UX 3UKOA 1DHRA 1TT5B 1YB1A 1B2LA 4IJUA 1OI7A 4JQCA 2PK3A 4ALLA 3GVXA 1Y5RA 1I3MA 1YDWA 3VKVA 4YQYA 5BSHA 3PGXA 4E30A 1M2WA 2HK7A 4YJFA 3WGIA 3GFBA 3RUFA 2WTBA 4UVGA 3WICA 1X7DA 2LDBA 3DL2A 1XIVA 1ZMTA 5KJ6A 2P68A 1KVUA 3I9OA 1K2WA 1TB4A 5F1OA 1B16A 3SVTA 3BYZA 4W6ZA 5GZ6A 3RJ5A 1YB4A 2B35A 4GX5A 5I7VA 1EE2A 1XR3A 2ZTVA 1V35A 1VPDA 2UYYA 4YDRA 2C0CA 4J7CA 2IEBA 3GPIA 4BNFA 1ZBQA 3LT2A 5JXWA 3QVXA 1BTOA 1EQ2A 1ZZEA 3PFWO 4RF5A 4F45A 2PWZA 2YZ7A 1K0UA 2DM6A 4L4RA 4BNKA 4DPLA 1VE9A 2DBVO 4ZN6A 2VTEA 3IKVA 4LVCA 4FIZA 3QP9A 2VHXA 1R0SA 1XYGA 4WLEA 4BO9A 1YVEI 3GDFA 3HHPA 1A5ZA 1GADO 4DPMA 1BG6A 4L0QA 1TI7A 3QVTA 4MIYA 2D3TA 5F1KA 4FC6A 3JYQA 4BQPA 2Y93A 4GGPA 2E49A 2HMWA 1P33A 4NI5A 2Q50A 3WGOA 3DAFA 1P9LA 5AXDA 4J1SA 4Y6RA 1YQGA 3JQ9C 3QVOA 5EQDA 4I9NA 2DUWA 1U1IA 1E3WB 2DQ4A 3EC7A 2VRBA 3MJVA 2GRAA 2VRCA 3MOIA 3WGZA 1Y9AA 1PZEA 3WGYA 4OYRA 1Z7EA 2PGLA 2YHIA 1E6UA 1KYQA 2EKQA 3KRTA 3W4JA 1DDOA 3OA0A 1YOVB 1HSZA 3PP8A 3EY4A 3LT1A 4RLHA 1YKFA 3H3JA 2NUAA 4BO4A 2I6TA 4BKUA 1CYDA 5JCXA 2Q45A 3U49A 4BNYA 3ZV5A 3KSZO 1UJMA 1PJBA 2GR9A 3DBLB 1VL0A 1XHLA 1TLTA 2IXBA 4K6FA 5HM8A 1ZW1A 4M87A 5CFZA 3U62A 2GLXA 1I3LA 4BV9A 3DOCA 1Y7TA 1SPXA 3F6YA 3JD3A 4GL4A 2GZ3A 1JW9B 2AE1A 2UV8A 4IJWA 4PCVA 1ZVMA 4B79A 1Y1PA 3H5AA 4PN3A 2W90A 2NTVA 2V6GA 3PQEA 1L1FA 4XR4A 1QXSA 1KVQA 4QUKA 1LSSA 3UCXA 3T4XA 2AEFA 4CM5A 3KBOA 5G0TA 1GV1A 2GERA 4L4XA 2H9IA 4QECA 1T1SA 3QHAA 3JSAA 2VHVA 4HFJA 4CR7A 1PR9A 3PWKA 4D41A 4B3HA 1EMDA 1NHGA 3I4FA 2C82A 4YWJA 3ROMA 2FPPA 3OJ0A 1XSEA 4WLNA 2EXXA 1O0SA 5DCYA 5K6AA 2NV6A 1LUAA 1BGVA 1Z6ZA 2O3UA 5DN9A 1U4OA 5G0WA 5C3MA 1GUYA 4CQMB 1T2EA 1EDZA 3C8MA 4Z9FA 2NVUA 1E3EA 1N1GA 1I8TA 2Y1OA 3GMDA 4IZIA 4S3MA 3ZU5A 4RPJA 1PJ3A 5JFOA 4J2HA 4BNUA 4NPCA 4MVJF 2Y1DA 5A3JA 1ZIDA 2W98A 4FFRA 1W4ZA 1ZCJA 2NVBA 4MINA 3BMCA 4XJTA 3H5NA 3KEOA 4GPD1 1QG6A 5T5QA 3VZPA 3ABIA 3DAPA 4A10A 4R01A 4WEOA 1KOLA 3DHEA 3ZDFA 2WYVA 1PQWA 2D1YA 1YXMA 3R1IA 1T25A 2CSUA 2PZMA 2EV9A 3Q0EA 1CF2O 4DIOA 3HB5X 1C0KA 3CMCO 1B3RA 1GR0A 3FPLA 1LSOA 5JW6A 5COBA 3X2EA 2YDYA 3H9UA 4ALNA 1CEQA 4PIVA 3ADOA 1HE2A 1PU2A 3KYDB 5COAA 5BSGA 2PD6A 4BO7A 1O6ZA 4YEDA 1V3UA 2GO1A 1OBFO 3JQ7A 3LC1O 4YAIA 5EN4A 4RZIA 1FK8A 1ARZA 1H0KA 2EJVA 3W4IA 3TOZA 4XA8A 3WSWA 2E82A 4LW8A 2JD1A 4JX8A 3TZHA 3ANLA 2I76A 3ROQA 1H5QA 1DRWA 4CMIA 5AXCA 2YQ5A 3ZWCA 1AHHA 5CP8A 2DFDA 1C1XA 1GAEO 5I9MA 3AUSA 1K3TA 3KTDA 1E7WA 4EJ6A 2D8AA 4KWHA 3C24A 3WQRA 3WYBA 4DPKA 4ZHSA 1P1HA 3TL3A 1F12A 1XG5A 4DC1A 4BL5A 2NQ8A 1V3VA 4B4VA 2J3HA 2TMGA 2P9EA 3TFQA 4RDIA 4BNXA 2AQ8A 3ONDA 5TT0A 4DYDA 4D44A 4XKJA 2O3SA 2Q3EA 4EZBA 5KJCA 4E5MA 2NU6A 4G2NA 4MVJM 1R37A 5DOZA 1P1RA 1S6YA 2CMDA 3BZUA 4Q3DA 1EZ4A 4TVBA 4XCVA 4J0FA 2Y66A 3BTSA 5T57A 4F6LA 5L4NA 4PVDA 5A3VA 3FNHA 1M67A 2B69A 4BNIA 2VNSA 1YGYA 5AVOA 1FDTA 1RYEA 1GUFA 5JLAA 5A4DA 1Q7GA 4RF3A 1Q2XA 5THKA 1Z75A 1HEUA 2VHZA 1LDMA 1R12A 2CF5A 1IUKA 3L07A 4RPHA 2AW5A 2C54A 5EMHA 1PZHA 1PSDA 1I2BA 2CF6A 2GN6A 1K6XA 1ZEJA 3Q2KA 3UF0A 1GD1O 3VVCA 2VWGA 5A06A 1P31A 1R6DA 3C7AA 2VYNA 3ZWWA 5IXSA 2OL4A 1UAGA 4J0EA 3H9QA 4TMFA 4Z0PA 3C3XA 1UH5A 3SEFA 4FC7A 3C1AA 5CEEA 2EJWA 1T24A 1YONA 3WWZA 1ENZA 1E3IA 2EG9A 4II2A 3OSUA 1WMAA 4GWKA 5J23A 5ICMA 3TZCA 1E3WA 1MP0A 2JCVA 2JFFA 1JWBB 3KSDO 4BGIA 3VZRA 4P4GA 3AOEA 3DFUA 4KUHA 4WCFA 3TWOA 1BSVA 1Z45A 4J49A 3ULKA 1DBVO 1PTJA 3F4LA 3FHLA 5CEFA 3PYLA 3W4KA 1JVBA 4QO7A 4OGWA 2PH3A 4TZTA 4KTVE 3OICA 1LA2A 3DBLA 3KYBA 4CV0A 1NFRA 3PHIA 2RBEA 2V65A 4E6PA 4RQTA 4Y9DA 3NGLA 4QX6A 1YS4A 3I9NA 1UP6A 4FSHA 1E77A 1UAYA 4H15A 3SX2A 3OJOA 1DIRA 4PG7A 3DAGA 4EJ0A 3OP4A 2W2KB 5F1PA 5JC8A 2AQHA 1DIGA 1ZO8A 4XQCA 2CFCA 4NH4A 3VZSA 4E32A 2Q46A 1PX0A 3OJEA 4XB2A 4XRRA 4ALMA 4BO8A 2O7QA 1CRWG 5IG2A 3SJUA 3DTYA 3O38A 4MJLA 3JD2A 1H9AA 4XJSA 1ADCA 2IDZA 4GSKA 1HYHA 4OJNA 3W8FA 3LC2O 4CJXA 3PFFA 1IZ9A 1ZK0A 3NYWA 3PQDA 2C7VA 1Q0QA 3ENKA 3JYOA 2NM0A 5L3ZA 4BGVA 3RROA 5IF3A 1Z7BA 3HDQA 1B15A 2YYYA 4YQZA 4LMPA 3I5MA 1NVMB 1W73A 4J91A 3VH3A 4CM9A 2JD2A 5L4SA 3AUAA 4TKLA 4XR9A 1KETA 1Y6JA 1U3WA 3WTBA 3MJTA 1R0KA 4W9NA 2GN9A 2H5LA 3WWYA 5DDIP 3CTMA 1LX6A 1LXCA 3K2EA 3JCZA 1RPNA 2YFQA 3NJ8A 1F06A 4XQEA 4DXHA 3U4IA 3WMXA 4DYVA 1PR3A 2BRUA 4Q9NA 3E9QA 3GR6A 4B4UA 3JQFA 3BIOA 2VT3A 3JYNA 1I36A 4P8RA 3O8QB 1LU9A 5CPBA 4UUOA 2EEZA 3UUWA 4CM3A 4RCVA 3ZNPA 4RLSA 1MB4A 1GZ4A 4BKOA 2QIOA 5L7TA 4D45A 1KY4A 2Q4EA 1B8PA 2VZ0A 4BO1A 3I6QA 4CMBA 4PLVA 4CMKA 5KJFA 4RGBA 3H9GA 3PK0A 4YJGB 3GRKA 1P77A 1PL6A 1VLLA 1EUDA 5B12A 1NQ5A 4FJ0A 1A4UA 3NT2A 3WYEA 5KVCA 2AQIA 4ID9A 4BNVA 1DO8A 3O03A 3PWSA 1WDMA 2DBZA 4J1TA 5DULA 4JXKA 1DIHA 3FI9A 4M89A 4LSMA 2X7HA 2P5YA 3PHGA 1AXEA 1SC6A 4RO0A 3RIHA 4GAEA 2LDXA 1LDNA 1DC5A 2Q49A 4Z9XA 4EEXA 3JQAD 6LDHA 3CEAA 1T4BA 4P38A 3AI2A 1EVIA 3KEQA 1ORRA 3E6AA 5KCZA 3KSUA 3M6IA 4D0SA 1RWBA 4EDFA 5HTOA 2ZIZA 4BQRA 2O3RA 2P4QA 5CDSA 5GZ3A 1P1IA 4JJIA 4FPXA 1QSGA 3V1YA 2FPIA 1Y5MA 2FR8A 3WTCA 4DMLA 1UUFA 4MP8A 2YJZA 2Y0CA 3RUHA 3TZKA 2NSDA 1YH3A 3VHRA 2X8LA 4MVJG 1JQBA 1ONPA 4E5KA 1EE9A 4J1QA 2FN7A 5EQFA 1MG5A 4HKTA 4E5PA 5H82A 1U5CA 4BB6A 4I1IA 4YAGA 2HQ1A 4ZA2A 4FQ8A 3PJEA 4EW6A 4N18A 5B4TA 4IMPA 3PDUA 1IULA 4CV3A 4G81A 4N5LA 2EW8A 4FGSA 1JU9A 2FSSA 3UHAA 4L73A 1H6CA 4YRBA 1RYDA 1NVGA 4FFMA 2Q4BA 3LDHA 1EVJA 3KB6A 5BSFA 5KJ1A 4YB8A 3GVIA 4J7UA 4U7WA 3WS7A 3ZWVA 4UEKA 3VZQA 4GX1A 1PL8A 4KTTE 1YDEA 1DIAA 1DJQA 1NAHA 4DUPA 2XXBA 3P19A 4J4BA 5I7EA 1BVRA 1P74A 4PLPA 1C3VA 3AI3A 1EBUA 1BXKA 4GWGA 1LDYA 1SB9A 1LDGA 1OZAA 4I5EA 1NNUA 4JROA 4OQYA 1AUPA 3UXYA 2B0JA 4EITA 4DQXA 2JL1A 2CZCA 2DPGA 2NLOA 3I9LA 1U2GA 2ET6A 3FNGA 1ENOA 3F9IA 3H6KA 4JP3A 5JMPA 3NT5A 3JQBC 2QQ5A 3AFNA 3U3XA 1X14A 1K6JA 3DHYA 1DJNA 4HWKA 1H6DA 1EFKA 3VTFA 3DMTA 1BW9B 1ZK4A 1TT7A 2GPTA 4QQRA 8LDHA 4R16A 4KP7A 2O4CA 4ZRMA 5CDGA 2Q2WA 4ZRNA 2DC1A 3ZW9A 4NK4A 1MG0A 4WECA 3WSVA 1DC6A 2XPCA 2HLPA 2QG4A 1T2CA 3PI7A 4AJEA 3BHMA 2IZ0A 2O3QA 3ASVA 4AJ4A 1HZZA 4BGEA 2JHFA 3ZNOA 1BXGA 5ER6A 1A9ZA 4QEDA 4BNHA 3ZWXA 4J7XA 3GY0A 4E5YA 2W2KA 1EK5A 4M54A 3G0OA 2PGJA 5CG2A 5JY1A 2IODA 4YRDA 4ZJUA 4XYEA 1AE1A 1PS0A 2J3IA 4GLLA 2Y68A 1CIVA 5DBIA 1GEEA 3B1JA 3HB4X 3I1JA 1RJWA 3V2UA 3JD1A 1PQPA 3GNQA 4KDEA 4OH1A 2B4QA 4CODB 5IDYA 1LJ8A 2QX7A 4Q3BA 4DIBA 4YBZA 5T8KA 3PXXA 3C1OA 1KEUA 1M6HA 1LRJA 1BMDA 3FBGA 2E4AA 3JTMA 4UEOA 1X7HA 3JD4A 4H16A 1XKQA 5CPFA 3ZWNA 1NPYA 1NWCA 3DZBA 5CAEA 1PJCA 1DIBA 4NBWA 4NIMA 4YA6A 2BHLA 2BKAA 4W7HA 3DZKA 5HWSA 3N7UA 5ILGA 4I5DA 1VSUA 4LSWA 5IAAA 2BFMA 3C85A 4QT0A 1WW8A 2A4KA 4XGNA 3QLJA 5CG1A 4AL4A 3WLEA 1VRWA 2BGKA 1UXIA 4Q3AA 1PGNA 1LDEA 3H9JA 3K9QO 1FDWA 3PJGA 1HDGO 5JE8A 3GUYA 4UVHA 4KMSA 4EEZA 3VAZA 3QVSA 4HY3A 4KZPA 2X0RA 4CMIB 4E4YA 1UZMA 3VOSA 1A71A 5A03A 2P5UA 4MO2A 3TRIA 1PQUA 4EYEA 3WNVA 4CLHA 5JYDA 5C7LO 4INAA 4YJGA 3ZI0A 2BFOA 1Y8QA 5BNTA 3TQHA 1FDVA 4PZCA 5F5LA 3EMKA 1NQAO 5MGBA 2ZTLA 2PH5A 3FNEA 1DFHA 4RORA 1ULUA 4WCDA 1UDBA 1GL3A 3A1NA 1GTMA 1HDYA 3L4BC 1GYRA 4B3JA 2VYND 2FZEA 4RVGA 4BMNA 5JDIC 1H2HA 1H94A 2P91A 3FSRA 2JAPA 2W2LD 1ZFNA 2G17A 3GHHA 2XOXA 3MJ4A 4CR6A 2EF1A 3HN7A 3S55A 2B5VA 3KZVA 5BSEA 3GQVA 4II3A 3D7LA 3Q2IA 1R66A 3GVHA 5ADHA 4YTEA 1QORA 2PTGA 1R4NA 3GH3A 3N58A 1N92A 3UGKA 1B0AA 2NACA 4DIFA 2WD7B 3KVOA 4JJGA 3K96A 1TXGA 5LDHA 3STHA 3S8MA 1EK6A 1E7SA 4O5OA 1ZMOA 5JY6A 4W99A 1C1DB 3UW3A 2O2YA 3LLSA 3QWAA 4ND1A 3ZU4A 2G76A 4B7XA 3K31A 5BNFA 4NBVA 4A7PA 1LC0A 1VSVA 4UUNA 4WNIA 2I3AA 4YVFA 3BTOA 4NK5A 1ENYA 3RCBA 3K30A 1GQYA 4MIOA 2PKQO 4N7RA 4BNJA 3PQFA 4P22A 2GASA 5G0SA 4Y8VA 5K9ZA 1UDAA 1ZKMA 4C7JA 1YQDA 1X1EA 3D4NA 4P4LA 4R1NA 5A9RA 3GRPA 2HU2A 4OL9A 4OOFA 5GY7A 4LGVA 4HFRA 1HL3A 5U1PA 2GYYA 3L77A 4U6SA 3WDSA 1LLDA 4TSKA 4WCFB 2OO5A 2BD0A 2QYTA 1D1TA 3P7MA 5L95A 3PHHA 1E5QA 3KETA 1BXZA 3ON5A 5FEUA 3OIGA 2O50A 1PGJA 4PFJA 1T26A 4GQAA 3WIEA 3M2PA 5I8WA 5H81A 3H8VA 2O23A 2IZ1A 4CM9D 1WPQA 4XDYA 2BI7A 4UULA 5THQA 3BAZA 4CQMD 2GD1O 3WGGA 3HN2A 1I30A 3WOHA 1C0IA 3AUTA 2IEDA 3HZZA 3RAJA 3NTOA 2E37A 4GKBA 5MDHA 2E6UX 3T7CA 3WX0A 9LDBA 3D4OA 3OFSA 1TA4A 3SJ7A 1CETA 3LK7A 3ASUA 3PRJA 1VL8A 1PJSA 3C7DB 3R3SA 1MXFA 2DT5A 4PLHA 5ENDA 2ZB4A 1BW9A 2NADA 3LT0A 4OAQA 3F1LA 5L7WA 4MP6A 1WXDA 1NR1A 5DBGA 5ER9A 1GUZA 2QZZA 4ND5A 4BO3A 5TC4A 2PKQP 5IDXA 1BDBA 2HRBA 2HKIA 2PZJA 3H9EO 1DLJA 5L40A 3GAFA 3HUDA 1WWKA 3LF2A 1NPDA 1EUCA 3GEGA 4E21A 1HF3A 3ITKA 3A06A 1LLUA 3C7CB 3OMLA 2DTDA 4GVLA 3FNFA 2CUKA 3AY3A 4RVHA 1I2CA 4IXTA 3PGJA 3P5SA 3ZU3A 3HWRA 2VUTA 3HSKA 1J6UA 3ZW8A 4FR5A 5TJ9A 4XIJA 1VJ0A 3AM3A 3S2GA 4Z6KA 5A04A 3BA1A 2A94A 4IDGA 2P9GA 3W8DA 1FDUA 2B5WA 3PJFA 1V3TA 2PR2A 3WLFA 1NYTA 5JO9A 2O48X 4F6CA 2EKPA 1B8VA 5JSFA 1SMKA 2FMUA 4R3NA 1MXHA 1PL7A 5G4KA 2WDZA 4OSOA 2C5EA 4UUMA 3CKYA 4B7CA 1DFIA 1DXYA 3F46A 1HT0A 4Q3NA 4BGUA 1YWGO 3DC2A 1FXSA 1NP3A 4ALJA 2RIRA 2QRLA 3INGA 5JNLA 1ONOA 1F0YA 3ICPA 3MEQA 2X6TA 2VYVD 3JQ8A 2F00A 3I6IA 4BB5A 2EWMA 6ADHA 4L9RA 3OIFA 8ADHA 3DBRA 1QYDA 3E9NA 4WLUA 5IFLA 1EBFA 2EW2A 2JCXA 3GVPA 3S1LA 1PGOA 3MZ0A 4CMAA 2B37A 2X5KO 1XDWA 2YDXA 4MKZA 4DMMA 3NUGA 1MC5A 3WFIA 1C0PA 3VPFA 4OHUA 4UVDA 4YPOA 3I9MA 5IZCA 4O63O 1SOWA 1JAXA 1X7GA 2Q1SA 1NQOA 2FP4A 4AJOA 1SEVA 2FOIA 3MJCA 3OHSX 3ROPA 3F47A 5HRUA 5BNIA 2D5CA 2ILTA 3IOYA 2X58A 5KVQA 4FGWA 4OIMA 3GEDA 3GNTA 5DCUA 1VI2A 4DBZA 2VHWA 3TNLA 2O2SA 3WXBA 5K6AC 4CLEA 5I9NA 3NKLA 4IGFA 3CUKA 1CQIA 4J9UE 4QXMA 4ZQFA 4AJKA 3P2OA 3L6EA 1BRMA 2C07A 2JD0A 3GGOA 4TKMA 1T4DA 3WJAA 3WBFA 2P4HX 2VOJA 1U28A 4AJ2A 1JKJA 5L53A 1CQJA 5EIOA 2Q1UA 3WGQA 4A2CA 1UXGA 1I24A 1VJTA 1ZK3A 1E3JA 2EKLA 2PZLA 2UUOA 2X86A 5JO0A 5L7YA 4L76A 2WD7A 2FPGA 4R1TA 1O5IA 2X22A 1ISHA 1J0XO 1DSSG 1QYCA 2Z95A 4AJPA 4MVJD 4BKPA 4HFMA 3ZZNA 1C1DA 3L4SO 1U7TA 3JD0A 2ZB7A 3DBHA 5CEJA 2ZYGA 3LVFO 2VUUA 4F46A 1NAIA 4WPGA 5TX7A 5JBIA 5TIIA 1ZSVA 3AFMA 3OEWA 3COSA 4R51A 5B37A 1HRDA 1QP8A 4O6VA 4TQGA 1RM0A 3U4CA 4DA9A 1ZJZA 2UUPA 4MVJE 3F4BA 1U4SA 4B8ZA 1H9BA 5F3RA 1GYPA 5COQA 1JKIA 5AXBA 4NJMB 5KKAA 5IN4A 5L4LA 2H63A 1H6AA 1SBYA 2VUSA 3RVDA 1DLIA 1P1FA 1NX6A 2VOEA 2I67A 1PIWA 2NWQA 4YT8A 3ZN2A 3RBVA 2AG5A 2Q1TA 3WIDA 4XB1A 2QYSA 2HMVA 1ISJA 1PJQA 3OQBA 3IAHA 1DHTA 3CINA 5TGDA 2OP1A 4D3DA 4WUVA 4IS3A 1T2AA 1H2BA 5JMWA 5KVSA 4B8WA 2JKVA 4FJ1A 1PEDA 3H65A 4I5FA 2GZ2A 3R6DA 1I3KA 2HRZA 4PLZA 1NASA 3W8EA 5B1YA 3WMWA 4HNHA 2AMFA 1H6BA 3AM5A 3F1KA 2AE2A 2JFHA 2CDBA 3IUSA 4J90A 5H83A 4R1SA 4AFNA 4HXYA 1LSUA 2X9NA 4CM4B 4Y67A 2WYUA 2VQ3A 1A27A 3GNSA 4YCAA 1BXGB 3IUPA 5FF9A 4NDNE 4BHTA 2C20A 3G1UA 2BGLA 4DGSA 4U5QA 1NFQA 1N2SA 1EQUA 3DB2A 3DWFA 3MJSA 4XYLA 3M1LA 1UXJA 5ITVA 1D7OA 2X5OA 1MFPA 1X0XA 2YY7A 4CLXA 3DEYX 3EDMA 1WZIA 1M76A 1P1KA 4KQWA 2PFGA 1MC4A 1BDMA 3BMOB 5A05A 3ZV6A 4B4WA 5DCWA 5AYVA 1HDXA 4K28A 4RL6A 2I66A 1LQUA 2FR0A 4IDDA 1W6UA 3NV9A 4TROA 4WLOA 5ICSA 3G3EA 4NJOA 1YE3A 4DWVA 4U6QA 3UH1A 9LDTA 3DZGA 1GY8A 3X2FA 4DTIA 2HMSA 3D64A 3HFGA 3ZHXA 2ZTMA 2Y1CA 4Q3EA 4NFSA 5C7OO 5GZ1A 4E2ZA 1WP4A 3AOGA 5KJEA 1R15A 3QJ5A 4BO5A 1LRKA 4CQLA 4RJTA 2AHRA 1QYVA 2EP7A 4QFDA 3AOEC 4CMEA 4WCFC 4YJDA 3ST7A 4R5MA 3PIIA 4A26A 5DP2A 5TT1A 5KKCA 1HE3A 1Q7CA 4YT4A 1JDJA 5L51A 4CR8A 1F14A 1UZLA 1IOLA 2EIHA 5HS4A 4R5HA 1Y8RA 5JCJA 1PGQA 4CUZA 5CHEA 3A28A 4XX0A 1E1KA 1H93A 1Y8QB 2YHUA 3PHJA 1ULSA 3DHNA 4L8VA 4LCJA 1U8XX 1GEGA 1WDLA 4IDAA 3JYLA 1M66A 3VDQA 3D3WB 3MTJA 1OAAA 1X1TA 3U09A 3EUWA 4I5GA 4GH5A 3N74A 2ZB8A 3WGHA 1LLQA 2X0JA 4BKQA 2J8ZA 4A73A 3TF5A 1QYWA 1T2FA 4U0JA 1XLTA 4UVIA 3WQQA 3Q11A 4PRKA 3DZHA 3V2GA 4PLYA 5TQVA 1ISMA 2Q99A 5EL0A 3ROKA 1HXHA 2EGGA 3RUAA 2J6IA 1ZNQO 1P44A 1R4NB 3RWBA 3GGGA 1B3BA 1E3LA 5EPOA 1EUZA 2OUIA 2VRCD 4CV2A 2DLDA 1OFGA 4M8SA 4RVUA 3PDJA 4ZQHA 3RUDA 4RQUA 1ADFA 2XXJA 3ENNA 1X13A 4RZHA 4U0KA 4IDCA 1OC4A 1WDKA 1GQQA 2X23A 4G65A 3TJRA 2QW8A 3NX4A 4DLBA 3ZWPA 4BVAA 2BELA 1GQ2A 4Y6PA 1DFGA 2DUUA 4W9NC 1KERA 2H6EA 4FDAA 4E5NA 3IP1A 4RF2A 3D5TA 4UAGA 4XZ3A 4ZQBA 2HMTA 5JPIA 2JFGA 4PZEA 1E7YA 1DRVA 2R00A 3KO8A 3O26A 2YV3A 1YJ8A 4LN1A 2BLLA 1PS8A 3VC7A 4CLOB 5JAMA 1PJLA 4OO3A 2ZATA 3DTTA 2IRWA 3JQFC 4CLDA 3ORFA 3GK3A 2OZPA 4IIVA 3L6OO 3OM9A 1Y9EA 2X4GA 3PVZA 1UXKA 4LMRA 1LLCA 4WNCA 2XAAA 4BIIA 4WKGA 3H4VA 1FDSA 2CD9A 1SZJG 1ID1A 3ETDA 1JAYA 1AN9A 1N9GA 3CSDA 3V1UA 3VPSA 4JK3A 5C5IA 3DMYA 1K5HA 3QWBA 2NQTA 1U3TA 1P1JA 1ZSYA 3W6ZA 4GLOA 3D4PA 3KHUA 1ZEMA 3CZMA 7MDHA 1DAPA 4D3FA 1ML3A 2ZYAA 4NJMA 3EYWA 1YBAA 3L0DA 2Y1GA 4IJKA 2F1KA 3T4EA 2EGHA 4IDFA 1QMGA 1XU7A 4E2WA 4CM8B 3DOJA 5U9CA 2WJPA 1E6EA 3V1TC 3D5QA 3KYCB 4HX5A 5JYEA 4DC0A 4NR0A 2G82A 3GN1A 3LF1A 1EDOA 2NU7A 3GDOA 4J3FA 3MTGA 4ZU3A 4NNJA 1NXQA 5TRTA 3EZLA 1YL6A 2PD3A 3GHYA 2YV2A 3EK2A 3V5NA 4KUEA 3INTA 5JAZA 3PWZA 4RVDA 3UCFA 3JQCA 2R6JA 4AJHA 1JTVA 3SC6A 3BXXA 5JDCA 3G17A 1R0LA 4NBRA 1IL0A 4OM8A 3MCVA 1I32A 1VM6A 2A35A 3OETA 1D8AA 4CM4A 2YFHA 2PV7A 2DU8A 1DPGA 1XELA 3ITDA 4YT2A 1U9JA 4Z9YA 3RD5A 1A7KA 3C1TA 4IQGA 1DB3A 4AJ1A 1G1AA 4K9DA 1E1NA 3HFSA 3IJPA 4PG4A 4FOOA 2CDAA 3I83A 2C59A 4UUPA 1HDOA 3ZV4A 4DLAA 5G0VA 2D4AA 5A9TA 3PZRA 4WOJA 1LDBA 2OXIA 4KWIA 5DBFA 2PD4A 3M1AA 2DTEA 3EGOA 4IMRA 5AXAA 3HNPA 3BMOA 1T1RA 3GVCA 1IYZA 2V6MA 4IZHA 4WLFA 3CZRA 4XD2A 4IIUA 5I8ZA 7ADHA 3AWDA 3GF4A 5G4KB 1KBZA 4M55A 3I4CA 3FTPA 1R16A 2NU9A 4J9VA 4E2YA 2V6FA 4CL3A 4JN6B 3D3EA 3DDNA 4E3ZA 4R54A 2YV1A 4IQ8A 5KTKA 1BVUA 1P0CA 3QV1A 4WEQA 5TJHA 1B14A 1HYEA 3JQ8B 3ZCXA 2ZB3A 2PNFA 4YAKA 3DBRB 4N5NA 1Z82A 2BMAA 2O3TA 4FOSA 3ZWAA 1A7AA 1ISFA 3IKTA 1F8FA 4IGEA 4XYMA 4BKRA 4FS3A 3PHLA 2Y05A 2ZK7A 4FJ2A 3VH1A 3D1LA 2WE8A 3BMQB 2UVDA 5A9SB 3DMTC 2BI8A 2I5PO 2FY8A 2RHCA 3JQGB 3OF2A 5LCXA 3RQSA 3S2EA 2HUNA 1W0CA 1E1LA 4W7IA 3UAGA 5A02A 4BV8A 5IZ4A 3RFXA 1AHIA 1KVRA 3K73O 3OA2A 2J5KA 3EVNA 1PWXA 3RFVA 2POQX 1L7DA 4DRYA 3GT0A 4XGIA 5ENVA 4BNMA 3PPIA 4EBFA 3OJLA 1DC4A 3GPDG 2J5QA 2A9FA 2C2XA 3D3WA 2VZ9A 4RPLA 5DT9A 3GFGA 4BO6A 1P0FA 1GV0A 3AY7A 4PVCA 3JQ9A 4R69A 4D43A 3B1KA 3ONFA 4Y6SA 5T64A 3Q3CA 2CY0A 4JBHA 1SAYA 3RC7A 3VH4A 3IL2A 2DAPA 3CIFA 4OKNA 3SC4A 4GI2A 2Y1FA 4AICA 4L74A 4QSMA 3UFXA 3M2TA 1JVSA 3NAQA 4NFHA 2WYWA 5T8KC 1E1MA 1K89A 3UICA 3WG9A 1ZH8A 4PLWA 1JLLA 4NMHA 4TRJA 3WR5A 4ALIA 1Q0HA 3OJFA 2P9CA 4FFNA 2YQ4A 1QR6A 3ZH2A 1YO6A 2ZJ0A 1ZXLA 3DBHB 3NJ4A 4LVUA 1GFSA 2VHYA 4E33A 2J3JA 4OMUA 1E5LA 2GNAA 2NNLD 4DQVA 3FWZA 1HE5A 4ZQGA 4BO2A 2DTXA 1HKUA 2DBQA 1C14A 1XWFA 3K92A 2OP0A 1I10A 1IPEA 1VC2A 1ZK1A 4KUGA 1XGKA 4CLOA 4WJZA 1HLDA 3I3OA 4EGFA 1S7CA 5KWEA 2PY6A 4BMSA 4YAJA 1WAMA 4BNTA 4D7AA 3AK4A 1N1EA 3TN7A 4YACA 1E6WA 1X15A 3FCOA 5IN5A 4I8XA 1RM4A 3QRWA 2HDHA 4NZ9A 1JA9A 4B7UA 2WEKA 3GLQA 5DZSA 4URFA 3QQPA 3KLPX 1K6IA 1X0VA 2UAGA 3RBZA 3CPSA 3I9JA 4JBGA 4TWRA 1KVSA 1RKXA 2W8ZA 1UZNA 3JQAA 5TNXA 2ZJ1A 3E9MA 1MLDA 1AGNA 1QKIA 1IZ0A 3MOGA 2X0IA 5BT9A 4CM8A 1KVTA 3KYCA 3AM4A 1E7MA 4YXFA 1PS9A 2CVZA 2I9PA 3ANNA 5ITWA 1QV7A 3ZNNA 5FI5A 3NRCA 4HBGA 5ES3A 4N54A 1MV8A 2Z1MA 1LQTA 3SBOA 2QZ9A 4BNLA 4JCOA 4UEJA 5FI3A 4AJLA 1J4AA 3DXFA 3FF4A 3KLMX 2DFVA 5DNAA 5KIAA 4A03A 3NTRA 4FFPA 3H3FA 4YT5A 3ZGYA 5DP1A 2OHXA 4JBIA 2OOSA 3ZHYA 2Q2QA 1D4FA 1XA0A 4YRAA 4KOAA 3AW9A 3MWDB 4FFOA 4IXWA 1ADBA 4XYBA 5JCJD 4WK6A 3GMSA 1PZGA 1CWUA 2GUGA 3H2ZA 3UVEA 1PGPA 1YRLA 5BQFA 3DZFA 3HE3A 2WE7A 4PZDA 5HA5A 4IINA 3RC1A 4PGFA 1YL7A 3B20A 1A72A 4EUFA 5G2OA 5AOVA 2JHGA 1E92A 3WFJA 4EI2A 2RAFA 4HUJA 1J5PA 1O8CA 1SEPA 1VJ1A 1NVTA 3CE6A 3Q9UA 2UDPA 1NM5A 4CMCA 3I23A 1M6WA 3UN1A 3ZNQA 2FWMX 3OECA 4CQLB 2GGSA 5F21A 2BFAA 2G5CA 3IIEA 4OOEA 4Z3DA 4DBVO 1Q1NA 3ETEA 3INRA 4ND4A 3FPCA 3R3JA 5FFFA 4RF4A 3BMNB 4J2OA 3U9LA 2Y0DA 1KEVA 3RFTA 1HE4A 3TL2A 3PJDA 1Y8RB 3A9WA 1AXGA 1HLPA 3QY9A 2VTDA 4PLGA 4R68A 4TVOA 3VPHA 4CV1A 1NHWA 3OEYA 5T67A 3A4VA 1DC3A 5JAQA 3RBXA 1YL5A 2CVQA 4EUHA 3DO5A 4MVJI 3NTQA 4FD3A 4K6CA 3G49A 3TDKA 1UDCA 1MGOA 2C5AA 3PYXA 3QVWA 4BMVA 1IHXA 4LRTB 2VWPA 4MKRA 4CM1A 5A5EA 3WQSB 2H1SA 3LLVA 2Z1NA 2PGDA 1OMOA 2OORA 4JJFA 1IY8A 5T6BA 3BMQA 3EVTA 4PG5A 2OFPA 3UCEA 5A9SA 5G4LA 4D3SA 3JQGA 4A27A 2A92A 3SLKA 1PJ2A 3VPGA 1I3NA 3WYCA 3AU8A 3PIDA 3QWHA 4DREA 1ZXBA 3OQ1A 3GEMA 4LK3A 1I2ZA 2OMEA 3O9ZA 4ONEA 4R4JA 5I9LA 3PLNA 4L4SA 4PG8A 4FBGA 2EERA 2OBNA 3W6UA 4U8GA 5U4QA 3ZWBA 2GDZA 3KUXA 3VH2A 5DOVA 2JJYA 4HV4A 4RVFA 4CUJA 3FBTA 4W82A 4YJHA 4B4OA 5KVVA 3GA0A 2QHXA 1N7GA 3TFOA 1B8UA 4CMJA 3NGXA 3W1VA 3GOHA 4W4TA 1KEWA 2HO5A 3RASA 1XEAA 1TT5A 2Y67A 3OBBA 3RI3A 1WVGA 4BO0A 1Z73A 3AI1A 4I9UA 3AU9A 3KV3O 3L9WA 3WB9A 4QTZA 2GN4A 1XQ1A 2HJRA 4ALKA 4GBJA 4HFNA 2ZCUA 4GMGA 2YW9A 4ILKA 3PZBA 4IBOA 3RU9A 2DKNA 4CUKA 2CVOA 2ZQYA 3BTUA 4RPGA 1VKOA 3JQDA 3JQ6A 4MOWA 1VL6A 5C37A 4Q39A 3BHJA 1E0DA 2HK8A 3CXRA 2PKRA 3ZU2A 5KOIA 3FR8A 1C0LA 1GPJA 1N9GB 4BNNA 1LC3A 2I99A 1IE3A 2V6BA 4WE3A 5B4VA 1HDZA 3TPCA 1KY5A 3G79A 1ZK2A 1YB5A 2RH8A 5TSDA 3MWEB 2V7PA 1CJCA 2I3GA 2Y1EA 1HDRA 3S2IA 4BUCA 1DAOA 1QLHA 3LT4A 1GCOA 1EVZA 1PJ4A 4E31A 3U5TA 3G1TA 1N7HA 1GZ6A 4ZQEA 4Z0HO 4NQZA 3SXPA 5JAIA 1LSJA 4L75A 4CPDA 4GKVA 4ZD6A 1ZUD1 4PLFA 3TZQA 2CNBA 3WBBA 4DQUA 2W4QA 1YQXA 5JS6A 3U4DA 2NTJA 3E5MA 4E2XA 5IZCC 4XYGA 3LYLA 4LCEA 1UP7A 2GF2A 5L9AA 4J4TA 2J3KA 2DBRA 1O95A 2X0NA 2NTNA 3VVBA 2W2LA 3GC6A 3H2SA 2IXAA 2C2YA 1E7RA 3HJAA 3RSHA 3HQ4O 4P4NA 3AY6A 5A1TA 4GGOA 5CDYA 3Q1LA 1CDOA 4XGKA 4GX2A 3NDRA 4TRMA 2AEJA 3T7EA 3FRJA 3FN4A 1U7HA 3H7AA
chains in the Genus database with same CATH superfamily
1XYVA 3KZNA 4KXMA 4MLPA 3URMA 3TM5A 5DT2A 1XKXA 1RJFA 4M8NE 1SC9A 1R4ZA 2YFYA 3WWOA 2PMDA 1A9PA 3AXSA 4FMDB 4MGHA 3IAM6 1B00A 1VB3A 3DT9A 1J33A 4FGUA 1J25A 4Z51A 2ZRHA 2HADA 1FUKA 1M75A 2RC5A 4LOJA 4NBUA 4OXNA 1T5DX 3PVSA 2HBRA 3TGLA 2BW0A 3C0KA 2CZGA 4X63A 3FWHA 1PEKE 4TGLA 5K09A 2D0DA 1N5JA 4BMYA 2OOKA 1A97A 1A4XA 5BV7A 1IY0A 3IULA 3I3SR 3DFFA 3IDSA 3K6KA 1J21A 1NF8A 4JOBA 3REQB 1VCIA 4EHDA 4IY1A 1PW5A 3FMOB 2ZRPA 2E4XA 2ZWIA 1NVWQ 3GRVA 4BOYA 4KAJA 1DKPA 1PCXA 3A8TA 3N28A 4IH4A 1VKNA 2VPQA 1G3IA 1C9KA 1QFZA 3ZK7A 2X9LA 4A82A 1XFAA 4C4TA 1E2UA 2BTQB 1WABA 1T8YA 1BHSA 4GOND 4NFYA 1NN1A 3K2IA 4P86A 2I22A 2DJIA 1MZPA 3Q9SA 4B3TB 2KMLA 2XTAA 4K26A 4E0BA 2P3LA 4O1MA 1WMDA 4BCDA 4I36A 3IAS6 2XT0A 3QSGA 4L8LA 5LDGA 4ARAA 3OIDA 3Q9LA 2H9YA 4Y6QA 4YBRA 4IFTA 3FNRA 4NZPA 1U3DA 1P45A 2HSGA 4O25A 4PQEA 1SXJA 5E3JA 4I6EA 3DSRA 4PZ0A 3ZD8A 2WC1A 3ADKA 3MOSA 1YVRA 3L9XA 4W6QA 2WICA 4RJ2A 5AK3A 4ZVVA 2BR5A 4H7IA 3IO3A 4KXXA 4EB6A 4RTLA 5GMOA 2WSIA 1U3UA 3C2QA 3EZGA 3Q12A 4IVQA 5JAPA 1DJPA 4NBTA 5HE8A 1I0IA 2DQZA 4X24A 3F6SA 4ND2A 5BSMA 1X42A 1LBEA 4GPAA 3VDNB 3AFIA 4MMZB 1UFKA 5FT9A 13PKA 4C4YA 2D59A 2WVJA 4V0SA 3K0SA 3UJ7A 1F9AA 2BGMA 4JGBA 6AT1A 1TVEA 4DC9A 1GQOA 1U3GA 4JELA 1E4EA 1OBOA 1G4AE 1JDUA 2J9YB 2DFLA 2CKMA 4XGQA 1ADYA 2OGUA 3N9IA 4E13A 1POXA 2JFQA 2VKQA 4MQFA 2WUDA 3WOVA 3BHIA 1GL9B 3VPDA 3EOAI 5FL7A 4Z7QB 3JSXA 3SEQA 3IBYA 4Q9LA 3T9CA 3C14C 3UHOA 4BTEA 2MMCA 3KB2A 3RTDA 1CJMA 3FKJA 1T0UA 3STTA 4EHKA 1I4EB 1KC3A 4DHWA 2EFDB 3QIVA 2OCDA 3RVOA 2QRJA 1NBHA 1GZ3A 1DRJA 3MTEA 2VP6A 2HLNA 3REOA 1FYFA 1N8KA 1OA1A 2V97A 4XIYA 1DG1G 1LV8A 1J0CA 2UZ3A 3FDJA 3JV7A 3K6JA 2FZKA 4XQGA 4GDFA 2B1JA 4RGVA 2R5NA 4D0GA 5KNBH 1V0JA 2ODBA 3STVA 5I7FA 4DV4B 4MRNA 5C8ZA 2O8EA 3A2MA 1MIOB 1P2DA 3O4RA 1XVVA 4PM4A 1O89A 1WKBA 5ALRA 3IUMA 2V3WA 1V1RA 3T5CA 1OT5A 4C7KA 1W8DA 1XU9A 3HG7A 3KQOA 3TMYA 4JI4B 1T1JA 1WW3A 2VP0A 4WLVA 1TAQA 1EFVB 2VQEB 3QYAA 1DWUA 3H2KA 5C52B 3UIEA 2X13A 5CA0B 2WD8A 1FRNA 3KKQA 4G0NA 1ONNA 4I9HA 4BTVA 3NHKA 2E55A 2JCYA 4IHJF 3RH0A 4C03A 5HEKA 2VCYA 3FROA 4X93A 3UGTA 2QNIA 1K2VN 2YIJA 5F33A 3SVLA 1PT8A 2B98A 1SB8A 4S1VA 5AI4A 4ZT5A 3IGFA 2VO1A 2OPBA 2ZQZA 1V8BA 1AQIA 3G1WA 3O8NA 5ARCA 3GGPA 1E6KA 1WHSA 2UYQA 4DLZA 5J4YA 5EYPB 3VKUA 3IPCA 3TW0A 4YHHB 2AQKA 2ZTUA 1Q83A 2F3UA 2O3JA 2RHWA 4UASA 2RHBA 4QGGA 3ZCSA 1G19A 3GDGA 2VYVA 1A9SA 4RIGA 2G36A 4JLWA 2GYUA 3CLUD 5SY9A 3UT5A 4B87A 1X1AA 3KSBC 3VHLB 1CXZA 3I12A 2WQ7A 3OEHD 4L0DA 4O59O 1G59A 1XNGA 1GRNA 2PZKA 1OAKA 3C70A 3L18A 3R0IA 2GTPA 1N5DA 3DGFC 2W93A 3V4VB 3ZEIA 5B4UA 1PK8A 4P0TA 1X87A 4WKBA 4PRLA 1SHLA 3I8SA 1XXLA 1WUHS 1V25A 5H70A 4DDUA 3E61A 3RLIA 5IDWA 4YCCA 4FCWA 4AY6A 1XCBA 2E4YA 1IHYA 1C3LA 2EQAA 2HDWA 2HEIA 3GLHA 3IP3A 3KL4A 4N0PA 2GK3A 5EXTA 3GFSA 1XP8A 2PSDA 3P97A 1AVTA 3OLXA 3SMQA 1Y82A 1HFWA 4BS9A 4Q9IA 1GITA 4CF4A 3RUEA 4F85A 1OLUB 2TMDA 3ENQA 1CZUA 1JN0A 1TEXA 2FLWA 3A4TA 4TRNA 1WUIS 5LB4A 1S2MA 3DR3A 3EBOA 3RS3A 3ZTYA 1YA8A 3U4QA 3HLKA 1Z7WA 3DM9B 3WLQA 2ACVA 2XMSA 2CNLA 4LJ4A 1DBQA 1Q3TA 3GPCA 4NABA 4XVQA 4U7FA 2ZE6A 4UBIA 1YA4A 2Z83A 4D02A 1ZKDA 3AR4A 4ESOA 1MNAA 3LQFA 3LLUA 4RV5A 2OCBA 2B2CA 5E1BA 3T3DA 4W8HA 2WWIA 2AJ8A 3E9ZA 4BNWA 4ENQA 2WMYA 5HQ3B 4EQ6B 3DE7X 5TLSA 4JQYA 2BJWA 1WF3A 5T6MA 1UPUA 3L93A 4RTMA 3AL2A 2GO7A 4PG6A 4QG7A 4Q4HA 3RKSA 3VNUA 4DVJA 3BL6A 2CHUA 3MPUA 3FTNA 4WK2B 2IV3A 1IHUA 1MX5A 2AF3C 2WSBA 3GJRA 3LT5A 1I14A 3PUVA 4JEMA 4XQ9A 3SZLA 5I7SA 1N77A 3LO5A 3CX4A 3PFHA 2N1BA 1K7CA 1PWZA 4HYTA 3N86A 2W48A 2BGIA 1JEQA 3E9EA 4H27A 2FZWA 4L5JA 3F5SA 4TKUB 1W19A 5FCDA 3SSMA 4DEXA 3V48A 7ABPA 4OXIA 5DGDA 4AK9A 2MU1A 2PSFA 2O1XA 1IATA 3EXIB 4FGJA 3UJHA 5AQ1A 4PBSA 421PA 1U11A 4MVJA 3RVPA 1YZKA 2HUPA 4LQCA 5KYVA 2ADMA 2R00C 3VVMA 4HF7A 1Z56C 4LIPD 4PO8A 4DRXB 3EAGA 4BWVA 4ZEVA 5BWBA 4K3VA 3K2BA 5B36A 2CYCA 3OFVA 4ZOCA 5CD1A 4J3JA 3OF3A 1T4GA 4AVYA 4EI9A 2AKAB 3QBEA 1GN8A 4L7VA 3CZ9A 1I0ZA 3OAAD 4YJ2B 1UDRA 3IQDB 3G0HA 1KS9A 3P2EA 1XJWA 5EHNA 3REQA 1G2QA 3P9CA 4QFBA 2QIPA 1Y1SA 2CNWA 3LTNC 2I33A 4XRGA 1L6IA 3MM4A 4MA0A 2R11A 3L4BA 6REQB 2HF2A 5D6OA 2R6R1 1YI1A 1GFWA 5FB3A 3B2NA 4GNRA 1I33A 2GCOB 5HGJA 2IYPA 4L0CA 4N12A 1TK2A 3NW9A 1NRIA 3LM8A 1NPTO 4A0SA 4BLTA 3EVGA 4FHFA 2D0IA 1KF0A 3UGJA 2R6HA 3L7BA 1G66A 1ZD9A 3ANMA 1ZJYA 4AJJA 3DONA 4ASUA 4QU9A 2H2FA 2I65A 4HG2A 4ZARA 4EGCB 3QWFA 3OMWA 1DEAA 1SNYA 4F5ZA 2VI5A 2RJNA 3UWDA 4MYCA 4BPRA 4CVNA 1P5RA 3BMCB 4EG7A 4FZRA 2O2EA 3WKEA 4BFUA 1G5FA 4HATA 3B1FA 4BKMA 1TGYA 1F8GA 4TT3A 1GLVA 5DYNA 5BR7A 2XCLA 3KYJB 2BHTA 2ZU0C 4PZZA 2XODA 1BRTA 5IWAB 1O9GA 3SXUB 3PXCX 4RKRA 1CSEE 1P81A 3RU7A 1OT3A 2CDCA 3HABA 4RFSB 3A14A 3BA6A 3E1KA 3L0PA 2G5TA 2FG7C 3FMFA 1V16B 3GG2A 4NCNA 2CC2A 1ZD3A 1NY5A 1Z39A 2C0PA 2Y8EA 3DZIA 3GCZA 3IOBA 3QPVA 4ZODA 5JDCC 4DV6B 3IAFA 3DZJA 3DLBA 1J0BA 2NO9A 1HDCA 2X9GA 4BC0A 1TKAA 4RE6A 1R0WA 2ZJZA 4F5YA 1IBMB 4JVLA 1KKUA 1QGAA 3T5AA 4MV1A 4FFLA 1NVKA 2YN2A 4QXRA 4RMHA 1TM3E 1NKVA 2BCJQ 3CWQA 3E2IA 3QTLA 4KBFA 3O8QA 4FCCA 1QP7A 3NMUF 2A9PA 1OJ7A 2Z5LA 3PTZA 1V6AA 4HX2A 4JJ6A 4NG5A 5JJIA 1OFHA 1BN6A 2TECE 2I8AA 2R7MA 3QWIA 2XR1A 4JCCA 3ROZA 1JSZA 2F9FA 1L4FA 1NTOA 2GD6A 3TLZA 2PJZA 3VTAA 4HADA 1QPBA 3AY0A 3WJ7A 5GOZA 4JSTA 4XARA 5FNZA 1Q7RA 1WOYA 2PUWA 3C39A 1Z4QA 3DEZA 2I2AA 2O2HA 4AROA 1UCFA 1MIOA 1B2LA 4G24A 1VP9A 5JSQA 3E3AA 5C5DA 2PK3A 1AHNA 1RE0A 3HCOA 3R3VA 4UBLA 4YX9A 2H06A 1YDWA 2D74A 3VKVA 2HA0A 4KYIB 3P27A 4YQYA 2W4IA 3MIZA 1RBYA 3PGXA 3URKA 4E30A 4QA9A 5CXQA 5FX2A 2LIVA 3AHIA 1KMQA 3EVZA 5CFQA 3WICA 1FFSA 1YMUA 3TRDA 3DL2A 2W2NA 3EISA 1M0WA 1ML4A 4NCHA 1DARA 1KVUA 4Q6BA 2PUCA 4LE0A 4JD5A 3UMSA 4EJFA 3M6MD 2HHAA 4KVAA 1VCMA 3RJMA 3SVTA 3SKXA 3C3AA 3IVXA 3UA4A 1QFMA 2X7XA 4GEGA 1L8AA 4GX5A 3WHPA 5BN3B 2H2WA 3QHPA 4KGZA 2FZVA 2ZTVA 4QOHA 1V35A 1I6MA 3C8ZA 3C8HA 1XZ8A 1Z6XA 4KRXA 3QVVA 3IPLA 3GPIA 3SYRA 5JXWA 1UBLS 1QGUB 4H2DA 1PLJA 1HYQA 4XIGS 1BTOA 2IE8A 1DAFA 2IPMA 5GWXA 4I4IA 3SHVA 3BPSA 4F45A 2GF0A 1VGVA 2B8JA 2SECE 4Q12A 1K0UA 3IBFA 4JAVC 3C15C 2VP2A 4JVNA 5IAOA 4LXGA 3CR3C 3OQMA 3GJZA 3W5JA 3IKVA 4LVCA 4FIZA 2FTKE 1GP2A 2JLYA 2V0CA 1V8FA 4QUEA 2WTUA 2JG3A 4BO9A 1NRWA 4ZCIA 3HHPA 1KNQA 3RAGA 3I6YA 4NU6A 3T3OA 1YKGA 2YCLA 3AIOA 2GRUA 5KNDD 3PEUA 1ND5A 1TI7A 3QVTA 1TF2A 1Z5NA 1L4NA 2X7JA 5JASA 4YWHA 2VPIA 3A6HA 4Z53A 2BI4A 4UBOA 4BBJA 2QTAA 1Z16A 5AUQA 7REQB 2OCLA 1H3FA 1YGPA 4NI5A 5ABPA 4C0HA 1C9YA 2OCYC 2QLLA 3L02A 4M1WA 3L8HA 3MB5A 2IHKA 2XYPA 3N53A 3V7FA 3RR2A 3OZEA 2YOFA 5BPFA 5I51A 4NVRA 1R9NA 1E3WB 1ZIPA 3EC7A 3ENZA 1I3CA 1YQEA 3MJVA 5TPWB 5J2UA 4NCBA 1KO7A 4B3BA 5JSYA 1PZEA 1IHDA 4OYRA 4X91A 5LZ4A 4DS3A 3U48A 4I4CA 5DVZA 3ESXA 3L8GA 4LC0A 1DDOA 2JI8A 1A82A 3OPQA 3PB3A 3EY4A 2Q5QA 1ZGJA 3PP8A 1SXJD 2NUAA 4TYQA 3SQOA 3VNQA 3U39A 4BKUA 1CYDA 3V55A 5HF5A 4MQEA 2IYEA 3U49A 4KE9A 2LZ0A 4MJXA 1PJBA 2MR6A 2BBTA 2OCXA 2QY6A 3B2EA 4LRYA 4QUHA 1GDDA 1RWWA 2GPWA 3VNBA 3KTFA 4JT2A 1KEKA 1DWQA 4DRZA 1ZW1A 3WLMA 5CFZA 5C4IA 4C4XA 3TCKA 2NZYA 521PA 1FP4B 1PDWA 3JZIA 5K05A 3F6YA 2FN4A 3ORHA 4XEUA 4C88A 1HNNA 1EVQA 3L7AA 5DM0A 2ECQA 4YI5A 4HSGA 2VJNA 3MF4A 1JW9B 2UV8A 1ZVMA 2R6DA 4Q9JA 1JHUA 3H5AA 4K6HA 2W90A 2NTVA 4RKFA 3T8YA 2X8AA 1IRIA 3E27A 4YV0A 3RTEA 4KQ9A 6PFKA 5BYAA 1TM1E 1D0VA 4GYWA 4Z1MA 5I7HA 2AEFA 1EDBA 1OI4A 4JB3A 2QRNA 3G2IA 1YC5A 4KXYA 1FMTA 4S1OA 2C61A 3A9VA 1A5SB 1JH8A 1KAMA 2WK1A 2D7CA 5CD9A 1THGA 2VA8A 1IIRA 4XM1A 5G0TA 2GERA 3ZCUA 4PE5B 1VQ1A 3JSAA 1JS1X 4CR7A 3QF7A 4H18A 1WXHA 1MORA 4UNNA 2IY8A 3KPWA 1IWBB 1U3CA 3I4FA 1YRWA 2C82A 4YONB 4YWJA 2I2WA 2RAVA 3DNFA 4YMWA 2FPPA 1J2TA 3ZQUA 4DIDA 6REQA 4MQMA 1L1RA 5DCYA 2GCOA 2O2IA 1LUAA 1BGVA 3UK1A 3O2SB 4JMPA 3VA7A 1E79D 4DF3A 1U4OA 3QE0A 1XF9A 2I9KA 2ZJ4A 1PLLA 4KN9S 1IEWA 1VTKA 3FFAA 1PT5A 4GI3A 2HNBA 3GMDA 4MAAA 1E9FA 4HAVA 1L8XA 1DV2A 1OVGA 2NT3A 3G7SA 4OHFA 5JFOA 4BNUA 4FEEA 4MVJF 4DCUA 1FTGA 1MPXA 1ZCJA 2NVBA 1AQNA 2CNOA 3BMCA 3WDMA 2I4OA 5CCDA 5HQJA 3H5NA 3Q3HA 1HGXA 3O7WA 2R7AA 1YIAA 3CEJA 4HH0A 1L5ZA 5EXXA 3ZZUA 1P2BA 1Z0JA 1HE1C 2GJSA 5HOEA 1WKCA 4G0UA 1Z2OX 2PMCA 2J30A 1M1UA 2ZBPA 3K8OE 3R1IA 4LI3X 4TLLB 2VXCA 2CSUA 2ZT6A 4R6XA 4MW9A 1IIBA 2EV9A 2INGX 3K09C 2WZDA 4LTNA 1RQGA 4RFSA 7GPBA 1B3RA 3B8HA 1DTEA 3E2MA 3I2JA 1HT1E 4U2BA 1FMJA 2OBXA 5COBA 5ECWA 1MN6A 4EYSA 5FOQA 4ND8A 4ALNA 4NMWA 4PIVA 1DO2A 1AKQA 1PU2A 2KM1A 3KYDB 5COAA 4FILA 1V1JA 2PD6A 4DB4A 4ZVPA 3NWJA 4ENTA 3KXLA 5EN4A 4NYJR 1FK8A 3W4IA 2PL9A 4W5HA 4N3NA 3T0FA 3EIHA 3QW4B 3TQOA 5AI8A 5J2TA 3LX5A 1E1QA 2Q4TA 3ANLA 1GCAA 3KD3A 1DDGA 2I76A 4O2AA 1H5QA 5L6LB 3ZDBA 1FXUA 4WV3A 4CMIA 5EZQA 3WE7A 4ZOQI 4MGIR 3AVQA 1ZN7A 4Q9AA 1I7SB 3VUFA 4I81A 1ZL0A 4M8IA 3HVHA 3AB7A 5CNIA 3W1WA 3AUSA 1Z63A 1U8TA 1AKRA 3PQ4A 1K3TA 3WJ2A 1TYBE 1SU6A 5CYFA 3RSQA 4EA7A 2WOOA 1E7WA 3KTDA 4EJ6A 5F7XA 1JX6A 2YHSA 3C24A 1MV5A 3HO8A 3CNNA 3WQRA 3WYBA 1P1HA 1CJBA 1TAGA 3AP3A 1F12A 3MTDA 5FI0B 4BL5A 2I29A 1V3VA 1YCHA 1F3OA 2B5OA 1NW8A 4H35A 4KFRA 5SYAA 3SYTA 2TMGA 3BEOA 3QA3E 4M46A 4BASA 5LQKA 4R2JA 3C41J 3GJ4A 4GBGA 3TFQA 3FB1A 3DLIA 3ONDA 1BFDA 1RIIA 4OGGA 2ZJAA 3CLSD 4KVGA 4FDTA 2JEOA 2ECKA 2R8XA 2V7WA 3OZTA 5AK0A 1I7DA 3CRRA 2O3SA 1COWD 3N07A 2N0SA 4W5WA 4G2NA 4MVJM 1P1RA 2QSZA 2O9JA 2PX4A 4P35A 3BZUA 4ER6A 2A9KA 2XTZA 4Z8YA 1LF0A 1OHHA 3V46A 3HJNA 5BN3A 5ES4B 4NXMB 1Q50A 2Y66A 5JG7A 3E7PA 2ONKA 4G5OA 4GEKA 1B6GA 1RWNA 1AU9A 1N9ZA 2A1TS 4H3HB 3SN6A 2XGMA 1HI9A 3PL1A 1QGUA 3COYA 3EMVA 1G8HA 4ZOLB 1FDTA 4V1CA 3VUEA 5LYJB 1AB5A 1GUFA 2V6JA 3QOXA 4PSUA 4B46A 3TRFA 2O6LA 1K4MA 5THKA 2L0XA 2WPNA 2OORC 4KYUA 4MGEA 1LDMA 4N0EA 3BUSA 5AJYA 2XHZA 1IOVA 3L07A 2QRUA 2AW5A 2C54A 3OCCA 1PSDA 1I2BA 1D4OA 2CF6A 1H2EA 1K6XA 1NXOA 2X0FA 2KBFA 4WXMA 4I4TB 3HCWA 1RXEA 4YFVA 4CGZA 5K8VA 2CMHA 1VFNA 5CB4B 1N2CB 3OQNA 3M9WA 1UAGA 1RS0A 3QBTA 4HZUB 4J0EA 1C3XA 2I0FA 4TMFA 4M0UA 3C3XA 2ZFUA 3M0EA 4ZO6A 4ZEWA 3AUFA 2CNWD 3N5CA 7REQA 3BGVA 1EJ0A 3KPUA 3I5AA 3EH2A 2CYAA 3SQLA 5K8TA 2IK8A 4NEHB 5LZ2A 1H8EA 4GUDA 4HCJA 4ZZ0A 4N39A 1WMAA 2SCUB 1G17A 1S8AA 4K6MA 1JXOA 4FNAA 4XSHA 3TZCA 1E3WA 3SS7X 1GNQA 2JCVA 1FRVA 2JFFA 4JUAA 4ASUD 4Q21A 4BGIA 1XKTA 3L4EA 3VZRA 4EZIA 4Z5XA 2HSWA 2BDTA 3AOEA 2OAEA 1SCJA 1S9HA 3D3NA 4PNHA 1BSVA 1KMHA 4JQZA 3GQBB 3RRZA 3MTIA 4MEAA 1I6KA 3F4LA 1M34E 3FHLA 2XCQA 3I42A 2H2AA 4QJ5A 4N40A 2V6IA 3FETA 3R2JA 1HEIA 1RYBA 1LA2A 5KBYA 3T1TA 1X7XB 2FX2A 4QKQA 1NUUA 4L5YA 3HYRA 2E4ZA 3A0RB 2VDWA 1A95A 4MHOA 1J8YF 4E6PA 3NGLA 3CVWA 1OVMA 3VR0A 4NMLA 3I9NA 4HH1A 2QQ0A 1CJVC 4M1OA 1ATZA 3LSTA 4C0AC 1IG0A 1RKQA 3F8SA 4X95A 4MV4A 4EG6A 4QYTA 5FR1A 4OPMA 4OTZA 4XFKA 4EJ0A 1KJYA 3OP4A 4OQEA 4JC8A 5JC8A 1LNSA 1NUHA 1O0BA 2BSXA 1ZWKA 2CFCA 4IJ6A 4NH4A 3QKSB 4E32A 1KJIA 3D8UA 4DJDC 2ANCA 4JA0A 3ZE0B 4BO8A 5J2UF 1TIPA 2GSWA 2Q0XA 3O38A 4YXWA 1TUIA 3KHTA 3OIYA 4NRDA 2QBYB 2FPSA 2QMOA 2PSSA 4RENA 4TSFD 4J7AA 1IY1A 1WTAA 2E18A 1TM7E 1DTSA 4GXRA 2Q5IA 3R76A 2DSTA 4E5VA 4FVTA 1H1LA 5JXGA 2WM9B 1IZ9A 3NYWA 5BRNA 5TMDA 5EJ8A 5JXJA 4AECA 5CM9C 3V42A 4BGVA 5IF3A 4OQ4A 1XCMA 2HM7A 3HDQA 1B15A 3H5TA 3U3DA 1G8JA 4YJ2A 1S01A 4LMPA 3BL8A 4F1JA 1X1RA 1O96B 3N76A 3QMMA 5K8CA 2BEJA 4HRVA 3O3CA 2Q3DA 5AVQA 3VH3A 5EGNA 4CM9A 1GPKA 2ZYVX 3VKHA 2VCHA 1QHIA 5CAEB 1CY2A 1X7YB 2IP2A 1FTWA 4XR9A 3O4FA 3MJTA 3KJNA 3CRW1 2G0AA 2FMFA 1J00A 2GN9A 2ZE5A 3KV1A 4MEBA 5AIBA 1OV6A 5K0BA 1A1VA 1F8XA 1XEWX 4XQEA 3AJDA 3JCZA 3WYNA 4RTJA 1F06A 2J0QA 3EVDA 3J7TA 2J9XB 3RQIA 4LNUB 4FI3F 3KR9A 5DISB 1NY6A 1I7PA 4UUAA 3LLMA 3TCXB 3E9QA 3WNDA 3G8AA 4B4UA 5K4HA 2ZIWB 3GH1A 3PNMA 3BIOA 4P33A 4C2TA 4L6CA 3T7IA 4KL8S 5CPBA 1HMPA 5J5VA 1ICIA 2VJMB 1HTWA 4PPGA 4RCVA 4MYDA 3ZNPA 1DUVG 1GZ4A 3OZBA 3UQYS 4C0JA 4HTFB 5E0KB 1BJKA 2JBAA 4A8PA 1LS6A 4Z4CA 1S2IA 4BO1A 5HKAA 3STWA 1WCWA 1HORA 5KJFA 4AIIA 1QHNA 3CNQS 1L7BA 3MCAA 5JD4A 1EVEA 2YJNA 2O8BA 2IELA 3GRUA 4FJ0A 4GXTA 2HWXA 2Z6VA 2H5JA 5DIZA 4F86A 5JSHA 4BMPB 3IAUA 2WQ6A 1M5UA 4GI5A 1AZTA 2A0XA 1W4AA 2VSNA 3MERA 1DBRA 4MMXB 5D01A 3WL4A 2YJTD 1A88A 1P60A 4UTVA 1ZP6A 4LJYA 5HZMA 4L6IA 2A1IA 2YXPX 1J24A 4IW3B 3R5SA 2P5YA 2J7PA 1BYIA 1LX7A 2KB0A 5C8YA 3N5KA 1M2FA 4PF1A 4N41A 1LDNA 2B3DA 1D2MA 2Q49A 2PJRA 2JLWA 1RPJA 3BWEA 4QBIA 5TQJA 3CEAA 1NMZA 3E05A 4OB8A 1GG2A 2C1EA 1LBSA 2BFCB 2XSZA 4U9UA 4XD7D 1VSQA 5KCZA 1G20E 3AESB 3E4CA 4HAXA 4LY0A 4D0SA 1SXJC 1G3RA 2QQFA 1NJFA 3G9UA 2C5BA 3L49A 1FS4A 2EARA 1ZOPA 2XIQA 2ZIZA 5FTLA 1TQDA 1Y3IA 5GZ3A 1QHHA 3SF8B 4EYQA 1KFCB 4AP9A 4IMIB 2YMPA 2YIDA 1H2FA 3KTAB 2H08A 3O84A 2AJTA 4I50B 3KQQA 4IUBS 3EZ9A 1UUFA 4DMLA 2P9JA 4P92A 1ONSA 5C1IA 2X9QA 4KQFA 2R6CA 1G98A 2NSDA 1R8XA 4HYQA 3T7KA 4OQXA 2ZYWX 2WJIA 3VHRA 2X8LA 4IDNA 1JQBA 4MVJG 4W63A 1FP7A 1JT9A 1A9TA 2GHQA 2RG1A 3AHEA 3CUSA 3GLTA 1EE9A 4TM8A 4LX0A 1QJCA 4E5PA 1DAGA 2E3JA 1U5CA 3G2MA 4BB6A 4I1IA 1QF9A 4ABYA 4JP8A 3QSYA 4ZA2A 1Z38A 2JNWA 2LPMA 4EW6A 4N18A 1DGQA 3NO4A 2CXQA 3HP4A 4N5LA 4CETA 2EW8A 4HDAA 2XKJE 1JU9A 2FSSA 2OXEA 3T95A 2D54A 1YRHA 2PNJA 3UHAA 3FYCA 4L73A 4WAUA 3ZJ5A 2G6BA 2WIAA 4W1RA 3W0LB 1NVGA 3NIBA 4BU1A 3EFBA 2QA5A 2D1QA 3CZPA 1ZGGA 3LDHA 4I3FA 5BSFA 1FX0A 4YB8A 1CR0A 3GVIA 1X3SA 4U7WA 5PNTA 4OK5A 1Q2UA 2QSJA 2XCUA 3WS7A 4EKDA 4I4TA 4BVHA 3ABOB 1BD3A 4GX1A 3WHKA 4NTZA 4NG4A 2Q9BA 5CB4A 2CEAA 3PXBA 3F98A 1YDEA 2IUYA 4HZUA 4XFDA 4FE7A 3E53A 1NAHA 1G5TA 3GARA 3VYTB 4YMUA 5BYKA 4MYUA 1KJNA 4ZK2A 2ZJ6A 4L4ZA 4C9BA 4ZYVA 2WOJA 1C3VA 2WB2A 3ZIUA 3K0AB 4TMXA 1O4VA 2J9FA 1C0EA 1BXKA 1E94E 1SB9A 5TMEA 1NNUA 3UV7A 1AUPA 4FXOA 1SGWA 4DKXA 1NJ1A 1V41E 2YZ2A 2W6NA 4FYKA 2JL1A 1BAPA 5G1PA 1OX4B 3I9LA 3ONVA 5P8WA 3D5EA 1D2NA 3W5IA 4PC2A 2IC5A 1NXWA 3BK7A 4C3VA 1BFUA 3Q5GA 1KAHA 1P6XA 1G9TA 4J29A 3DDSA 2DR0A 4WKCA 2G8LA 3D3JA 4U7TB 4ZOBA 4YCDA 3GQBA 2PUJA 4F1WA 3KNZA 4D6YA 4C06A 3CQ9A 3L5KA 3THRA 3VTFA 2ERYA 3PDCA 2BGRA 2FEMA 1ZK4A 1A8QA 1DQNA 1P7WA 4Z4EA 2V7TA 2BKXA 4QQRA 3VZBA 1O54A 3UG7A 4AY3A 1FVXA 4GFDA 3A1DA 3G9TA 2RGNA 2PWAA 2Q2WA 2XIJA 5FFMA 3ZW9A 3NOVA 1UT8A 1MG0A 4WECA 1I4WA 1W93A 1AKUA 1I1QB 2XPCA 4YGXB 2HLPA 4PRYA 2FDCA 5AKXA 1O7JA 2QZJA 3FJYA 2O3QA 2GPJA 3FLBA 5B7NA 2IT1A 1EUCB 4AJ4A 1HZZA 2JHFA 5GOTA 4G23A 4MV7A 1MJNA 2VPXA 4QEDA 3R3UA 1RMTA 2ADFA 2F55A 4OYYA 4TX1A 5K5EA 3I32A 4AMVA 4ZJUA 1XCPA 4TKZA 3THOA 2C8LA 5IAEA 4FB4A 5M7EA 2Y68A 5KOYA 2QBYA 3HB4X 5DX1A 3U3MA 1MO2A 1YI0A 4NYIR 3HXTA 3H0EA 2XZOA 3GNQA 2IYAA 4KDEA 3ED5A 4II7A 5FUMA 4MPJA 4CODB 1T0PA 2YICA 1TKRA 4M1EA 3I64A 4DG5A 1RXYA 1LJ8A 1R0CA 3U4MA 4Q3BA 3COZA 1DC8A 1UQUA 5BW6B 1UKEA 5T8KA 3C1OA 3ILSA 1HPLA 4ZXFA 3N0WA 4DLRA 1KEUA 3K5IA 1LRJA 2WTAA 1BMDA 1XL1A 2PT5A 3JTMA 1E4YA 1O96A 1KZ1A 3C97A 4AW9A 2IPNA 4JR1A 3RU3A 5A7FA 2I1LA 5CAEA 2MINB 1X7YA 4NBWA 2YZGA 4FKMA 5I9BA 4CG3A 2BKAA 1OIXA 4W7HA 4CGYA 3DZKA 4B4DA 3O8LA 3HKEA 3N7UA 3CUYA 3GMIA 1VSUA 1QVWA 4QT0A 4RMJA 4BDTA 2JLBA 5DH9A 4E4RA 4FFVA 2WHQA 4LNUA 5CG1A 3HB0A 4AL4A 3WLEA 5E2BA 5IARA 1VRWA 3I61A 1GTSA 5C4MA 1UXIA 4UUQA 3AGPA 1RWVA 2WIJA 4TQUS 3EODA 2QT1A 2R6ZA 2UYGA 2RH5A 5JE8A 3CLHA 3TBHA 5A7HA 4CT0A 2Q0SA 1OXMA 1OJLA 4G8CA 3DM5A 2VJMA 3QVSA 2CFOA 4WMLA 4HOYA 1QH8B 4Q16A 2EGUA 4PHFA 4P3OA 4PGMA 5FA8A 4HTFA 2NV2B 4AYXA 4D2IA 1A71A 2P5UA 1ZJJA 2OK8A 2ZBFA 3TRIA 3H5IA 4P4UA 1PQUA 4Y2PA 4UTNA 3B3JA 4EYEA 2F90A 4FD2A 4CLHA 5JYDA 3GJ5A 3EPHA 4DV1B 5KVAA 3COWA 1U0BB 2BFOA 2PDAA 1Y8QA 1FUEA 5BNTA 5GJCA 5KDOA 8MHTA 3GELA 4AULA 4G9BA 1SRQA 4RA9B 4UXHA 5DJ5A 2IV2X 5ADWA 4NOMA 1TYDE 4KQMA 1I1HA 4G25A 4HR7A 5JPDA 4GS5A 2JGRA 1HDYA 3L4BC 3GGJA 4DABA 2HW8A 4B3JA 2ZBUA 2FZEA 3IP5A 5TDHA 5P21A 1T5LA 2Y1KA 4LHXA 4ACAA 1H2HA 2P91A 3MJ4A 2W2LD 1NSYA 5IANA 4EFNA 1MABB 3OZGA 1DTWB 2ZRQA 3OFJA 4HYYA 2G1PA 4FMCB 3S55A 2B5VA 2V4ZA 1GGMA 2MCFA 4WVFA 5CH8A 1MAHA 1ZN2A 2CL7X 3TO5A 5LLTA 3Q2IA 1SBNE 3M82A 1KO5A 1V7QA 1H8ED 2FW8A 4Q1EA 4RK4A 1QVAA 2G70A 3GVHA 2BFCA 1GTL1 3LHFA 3BBPA 4X8MA 2AZDA 3KFLA 2OGTA 4KG7A 1G8AA 2OCKA 1NW6A 3NEJA 4H6PA 3O82A 4IGAA 3VV3A 3OG9A 2NACA 4DIFA 2GWRA 4U2GA 3BXGA 1R0ZA 1TXGA 3SF8A 4YQFA 2CCJA 1WSBA 3MNFA 2R25B 3AHHA 3FWYA 4ZWNA 5JDCA 2WM2A 1CW2B 4BC1A 2P62A 4BLOA 3LLSA 5JS1A 3TW8B 3DDOA 1T2UA 3NNDA 3DWIA 3I1FA 3ZXYA 4NBVA 1RWQA 1DQRA 1P5ZB 4A6XA 2EU8A 3DFMA 4UUNA 4A7PA 1DKLA 1V6CA 4CIYA 1CJKC 1XO1A 3A25A 4YVFA 2ZZMA 3RE1A 3GPLA 3FAZA 3B51X 2QP4A 4O2AB 1ENYA 1B0UA 4MIOA 4YO7A 5KNBD 2PKQO 2XNCA 4N7RA 3ZQ4A 4P22A 3NOQA 2KW5A 2WV7A 1I2AA 1W5FA 5KSZA 4Y8VA 1US8A 5C8YF 1JDPA 5IJAA 2Z3WA 2WNSA 3MJDA 4C7JA 1YQDA 2EWVA 3D4NA 2PSJA 3FPJA 1YIOA 3GRPA 4CG0A 5GY7A 3G5AA 1I1OA 5BXQC 3CH7A 4YXWD 2JI4A 2B92A 1S1CA 5CT5A 1JR6A 2I6UA 3EHDA 4X7RA 4KXNA 3L77A 3ZX5A 4DA4A 1QPZA 5LZ7A 4P3PA 3D0QA 3OM1A 1QK3A 1LLDA 2EP8A 4XUDA 5K3CA 3DHVA 2BD0A 1D6JA 2QTLA 4NYMR 3TUJC 3PHHA 3ABQB 1BXZA 3ON5A 2DLNA 2O50A 5INTA 1BMQA 3LNTA 4FFSA 1PK9A 3N05A 5FOTA 3ESBA 3IVMA 1XZBA 1X70A 3K0AA 4H08A 4S1WA 2M1XA 1FYWA 3DZDA 3M2PA 3SY8A 1T0BA 3B1YA 1JKXA 4PC7A 1DPFA 1WZNA 3ZBPA 4C07A 3VSCA 2IZ1A 4KLNA 4CM9D 4EVSA 2NO6A 3UHJA 1MJFA 2BI7A 1LB1B 1QIDA 2PLNA 2GD1O 2X8BA 2XT9A 3HNOA 1OCEA 1OX4A 1W35A 4MRAA 2JFNA 1C0IA 2SNIE 4ESHA 2B30A 3IOEA 2WVHA 3VAAA 2E6UX 3WK8A 4QL3A 1R7RA 2EJBA 4XTCS 2Q3HA 1FSSA 3RJZA 1WV0A 3T7CA 3D4OA 9LDBA 3K1AB 1ZUHA 2A7XA 2IHVA 3U0VA 3ASUA 4PGGA 1PJSA 2FWBA 1CZOA 1TPYA 1CRPA 4PHTA 4PLHA 4Z7OB 5A5DA 2OO7A 1ZJ4A 5ENDA 4C4PA 4OBXA 3TJZA 1KMIY 3F1LA 4MP6A 4CKCA 5L7WA 3AEKB 1NATA 1YQWA 3PSAA 5DBGA 4BO3A 1MB0A 4KN8A 5TC4A 2PKQP 3OTHA 1NT2A 1H85A 4L6AA 4FYXA 2PZJA 1QCZA 1VI5A 5L40A 3BK1A 3T1OA 2VK2A 3LF2A 2V98A 3ZQKA 1NPDA 1SUDA 3P96A 1AZSC 1EUCA 1ECJA 2IH2A 3ITKA 4OD0A 3PU6A 4D4MA 5B7QA 1LLUA 2RHDA 5F7ZA 4DNPA 3AY3A 3NHZA 4E08A 3V1MA 2NZWA 4C7OA 1DOAA 3ZU3A 1T8RA 2VUTA 2ZITA 3CXUA 1NRJB 1XKLA 5TJ9A 2A14A 3S6JA 4AMGA 4RDCA 4MUJA 1Z0KA 5FI1B 5GVSA 1D8TA 3UKDA 1ZAYA 2YMQA 4OMDA 5JFTA 1USIA 4FQ5A 5JBQA 3RAFC 1BDHA 1DINA 4H60A 2J0SA 1Z15A 2Q0HA 3G6WA 3W8DA 4N7MA 1FDUA 3LUPA 4YROA 2YV5A 1V3TA 2J7PD 4M0EA 5AHKA 3UO8B 3ZLVA 2W6PA 2FKAA 4FP9A 1Z0IA 1NYTA 2ZG6A 1Q0PA 1XK6A 2HH9A 2WAXA 3BRQA 2EKPA 1GAWA 4ZPJA 5IKEA 1UBFA 2JDIA 4KQGA 5CIYA 3AFOA 3EUFA 1PL7A 4OSOA 3ESYA 4MQ4A 2HJHA 3CKYA 1DFIA 1OF1A 1NGSA 2JVKA 1DXYA 4IZOA 4BV3A 4FGKA 4BGUA 1I0LA 1ODSA 1PUJA 3EQ8A 4FWBA 4G67A 2PQ2A 5I3ZA 1NP3A 5CLHA 2RIRA 4F7DA 2QRLA 2QD4A 4HRAA 4M9ZA 1R0XA 1L9KA 2DWUA 3D6HA 5F5XA 3ICPA 3ZDQA 3ACDA 5J1TB 2C3UA 3JQ8A 4KNVA 5EWLB 2EWMA 3UJDA 3DULA 4KO2S 2WA1A 3OIFA 1KR2A 4KO8A 1AD2A 3DBRA 3TMAA 4LEIA 3UXEA 4C3OB 3R7DA 1CKEA 5IFLA 5C51B 4ZHQB 2EW2A 1QGDA 3LOQA 4HJRA 3WMRA 1KO1A 3GCWA 1P0PA 3PE4A 4P32A 5DIFA 1PGOA 4PNEA 2Q4DA 3MZ0A 4CMAA 4FI3C 5FOVA 2B37A 1XDWA 2R6GA 1HQKA 1KS2A 1RAEA 1V8OA 2H11A 1QUEA 1QH8A 4RJJA 3TZEA 2BGWA 3NUGA 3LFTA 1YRQA 3DVLA 4ETNA 5CX4A 1JLHA 3PNSA 2C1XA 2P9YA 4L07A 4RH3A 4GPEA 1M6YA 5DGTA 1X7GA 4AJOA 1KP3A 1N3IA 2FP4A 2X4DA 1OH8A 1PV4A 1VLVA 2GILA 4LXIA 3FB4A 2D5CA 2QTBA 3IOYA 4RK5A 4D5GA 1O57A 5CBPB 5LMZA 4G1MB 4QBHA 3GEDA 3HV0A 3Q0IA 4MSUA 5DCUA 3UYLA 4DBZA 2VHWA 1T91A 3TNLA 4F56A 2N75A 1K63A 2O2SA 2FPIB 3K9FC 5I9NA 4MWGA 4F4DA 3NBKA 2I03A 3I04A 4HN9A 3CUKA 3FCEA 4AJKA 1RNLA 5JROA 4IGIA 1E5VA 5AK6A 1NONA 3GGOA 3LUHA 4L7QA 3WJAA 3WBFA 1SBCA 2VOJA 1MHPA 1P9NA 1PD0A 2ORED 3ZDEA 5JXHA 4GLFA 4OI4A 5HF9A 1YQ9A 1KAGA 2I4IA 5EIBD 4KCGA 2EKLA 2PZLA 2Q3LA 3KP1A 3HP7A 2BPOA 4TN1A 5BP7A 4Y9TA 3EC1A 5IBQA 4L76A 2IL1A 3HO1A 2X0KA 1RI2A 3CR8A 2Z2YA 2X22A 3K4QA 1J0XO 2GKSA 4PIMA 2QENA 5AWFC