4YV0A

Crystal structure of trypanosoma cruzi spermidine synthase in complex with (2s)-n-methyl-n-phenyl-2,3-dihydro-1,4-benzodioxine- 2-carboxamid
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
269
Chain Sequence
b'GWFREEPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
pubmed doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
total genus 92
structure length 269
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yv0A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yv0A02
3I53A 4EVIA 4PGHA 2O07A 1B42A 5P8WA 5LR6A 3OE4A 4DM3A 2ZIGA 2GA9A 2P3QA 5GIOE 3FPGA 1VQ1A 2Z6UA 4BY9E 2QE6A 2IBTA 2AVDA 2EJUA 1X19A 3DUWA 2OB2A 3DMFA 3OZRA 3GIWA 1L3BA 2HTEA 5E1MA 1MHTA 5CUQA 2ZWVA 4E30A 5K8VA 2ZCJA 3GRVA 3PX3A 3PVCA 1BKYA 4QTUB 1Y8CA 3P9CA 1M6EX 4R8RA 4Y30A 4FP9A 1WXXA 5LQKA 3GRZA 4X61A 4RTSA 4FSXA 4YMHA 3TOSA 3I5UA 1DUSA 3OFKA 5DT2A 3CC8A 2PY6A 3G7UA 1SUSA 2BZGA 5GM2A 4ER7A 4PONA 3GU3A 2NXJA 5DTMA 2PX2A 4HGZA 1YB2A 1RJEA 2ZLBA 5FHRA 2OB1A 1NV9A 4HSGA 5E1BA 1AQJA 1BHJA 3FYDA 1KR5A 2NP6A 2P41A 3P2IA 2FPOA 4OX9Y 1ORIA 3T7RA 2G71A 1QAQA 5K0FA 1L1EA 3NJRA 4C06A 3TKYA 2ESRA 2P35A 2OPBA 5DSTA 3SR4A 5DPMA 4YUVA 2HMYB 5ICCA 5ICFA 3LCUA 3KQSA 5EQJB 2C7OA 3UJAA 4C4AA 4NECA 2H1RA 4PCLA 1AV6A 1NKVA 2N47A 4GBED 3ELWA 3DXZA 4FGZA 3TM5A 4RTLA 3EGEA 3KPUA 1N7IA 3NWEA 2DULA 2QM3A 3Q7EA 2YQZA 4KDRA 2AOVA 4RX1A 3I58A 1VPTA 3A27A 3BWMA 2HV9A 4C05A 3DXXA 5KQSA 2GH1A 3E8SA 2UYHA 1PRYA 1G8SA 3M6XA 4EMSA 4CXMA 4PYNA 3LKDA 3P97A 1KHHA 3BGDA 3GRYA 5EEHA 1AQIA 1O54A 3BWYA 4RTQA 4DA4A 4LWOA 1Z3CA 4V0QA 4AZWA 3MGGA 3VC1A 2IH4A 2IDJA 2PBFA 3T7SA 2OXTA 4Y2HA 3OU6A 5DLYA 2AOUA 4BP1A 3KKZA 4E33A 3SMQA 2VDWA 2JHPA 4AUKA 5DTQA 3FTCA 2GAFA 5CD1A 1U2ZA 4O29A 2K4MA 2C7RA 5CM2Z 5K0JA 1P91A 5ICEA 3MCTA 4GF5A 5GWXA 3O4FA 3CVOA 5EMLA 5T6BA 2O06A 4RVHA 4EK9A 3FRHA 4DCGA 4QDKA 2O0LA 5CIYA 3KQPA 1XDUA 3ELDA 3EVFA 4RTRA 3IV6A 3EVCA 4MWZA 1ORHA 3GDHA 5FULA 5C0OE 3LKZA 3T7TA 5T67A 3ER8A 1DCTA 3EVGA 1ZQ9A 3JWGA 1QAMA 2P1DA 2AZTA 2ONZA 3EEYA 1UWVA 4GUAA 3GWZA 3DLIA 3G2QA 2PJDA 3BGVA 1EJ6A 1KPGA 4FS8A 2WA2A 5K09A 4WXHA 3HCEA 1SQGA 2P7HA 1R00A 3IYLW 3EVZA 3HM2A 2GLUA 4XCXA 2NXNA 2A14A 5EOVA 3IHTA 1RI5A 1FP1D 3REOA 1BC5A 2E5WA 3A7DA 3IEIA 5K0EA 5K05A 3HEMA 3TKAA 1NV8A 4E31A 1XDSA 5T64A 5E9JA 2AR0A 3K6RA 5EHIA 4DQ0A 5DWQA 2I6GA 2ZW9A 4R6WA 3GNLA 4AZSA 9MHTA 1FPQA 5FADA 2FK7A 5DXAA 3KQVA 1NW3A 3BWBA 1HMYA 3THRA 2OO3A 2YTZA 2DPMA 4LECA 2ZVJA 3G8BA 4OA5A 3HA7A 5KVAA 2JH8A 4HGYA 5FTWA 3FUUA 2WK1A 3PS9A 3GJYA 3GRUA 3D2LA 2HNKA 3FUTA 3HVIA 3P71T 4IKPA 1VP3A 4HH4A 3Q87B 3PFHA 5EZSA 2HR1A 1IY9A 4CWAA 4C07A 2JJQA 4EQZA 4RTOA 3CGGA 1NW5A 5FQNA 4A6EA 4KRGA 4KIFA 4RWZA 2O57A 3UA4A 1KPHA 5EC8A 1I1NA 1KP9A 2VDUE 3OZTA 2XYQA 4FSDA 4R6XA 2IP2A 3ID6C 3EGVA 2PWYA 1F38A 3BUSA 1G60A 3K0BA 4PGGA 1NT2A 2FHPA 2GB4A 1KIAA 1M6YA 3G5LA 5K0NA 2ZTHA 4YUYA 2NXEA 4H0NA 5LQJA 1RJGA 5K0BA 2AOWA 4AX8A 1Q0TA 5HIIA 4CTJA 5G02A 2ZFUA 4F86A 2Y1WA 3FYCA 4ZTBA 3A25A 3TPZA 4DKJA 5EMMA 4BLWA 2V74B 4RTMA 3OU7A 4DCMA 2AS0A 1SUIA 3CJRA 1D2HA 2ORED 2ZWAA 3SM3A 1QYRA 4YV2A 2G70A 2PSSA 2PLWA 2VP3A 2EX4A 1VIDA 3MQ2A 3B3GA 4RV9A 5H02A 4L7VA 4E2ZA 3MHTA 1UIRA 1TW2A 3RW9A 5DX1A 3ORHA 3S68A 3JWJA 2VS1A 4YUWA 1D2CA 2IFTA 4YV0A 2PX8A 1QANA 1SQFA 2H11A 1JSZA 1KYWA 3LDUA 3AY0A 1ZKDA 3LX6A 3C3YA 5FA5A 3KQOA 2YVLA 3UA3A 2AOTA 3GCZA 1N2XA 1SVUA 4BP3A 1WS6A 2NXCA 3EGIA 3M33A 4FT4A 4PYIA 4R05A 3MB5A 5FWAA 5HFJA 3UJ6A 2PKWA 3BGIA 4E70A 5E2BA 2CKDA 2BR4A 3HVJA 1V39A 3KR9A 3EMDA 3MERA 2ZIFA 3KR0A 1NW8A 3R24A 4E32A 4M37A 3V8VA 4CKCA 4P7GA 3A4TA 4RSRA 2Z6QA 3TLJA 1X1AA 3UJ8A 2CL5A 3WSTA 2IPXA 1P39A 2ZBQA 3QV2A 4PIMA 2R3SA 5FQOA 1NBIA 1YZ3A 3M4XA 3FTEA 5HZMA 4WVLA 3HCBA 3QOWA 5EMKA 3V97A 3R0QA 5GP1A 3A7EA 4DMGA 1XJ5A 2AOTB 5CVEA 3TQSA 3NWBA 3G2PA 4P7KA 3NW9A 1DL5A 5LQAA 4GOND 3UZUA 2I7CA 3EVDA 5EG5A 1NBHA 1JG1A 5E8RA 1QZZA 2NYUA 1X1DA 3GXOA 4M36A 2G1PA 4JXJA 2ZSUA 4PIPA 4PYJA 5JUWA 2P3OA 2JH9A 4X1OA 4YUXA 4KW7A 2JHCA 1QAOA 4OQDA 10MHA 1FBNA 3FTFA 1WY7A 5D1NA 1RI3A 3OU2A 3SX0A 2OZVA 2AOXA 5E8JA 1XTPA 4YUZA 2NNWB 4KIGA 5EEGA 2FRXA 1JG4A 2IH5A 3M70A 1JQEA 2Q41A 1XCJA 2AVNA 1HNNA 1L3CA 2AN4A 1ZGAA 2XYVA 3KQYA 2YXLA 3R6TA 2ADMA 5EGSA 5M5BA 3EVBA 1JSXA 3KR1A 3BKWA 2IIPA 3AWIA 1SKMA 2ZBRA 3HP7A 3M6VA 5K0LA 4PYOA 3FPHA 4POOA 3RIEA 3B5IA 3GO4A 4DF3A 4PCAA 1R8YA 3DR5A 2PT6A 3LCCA 3O31A 3LGAA 4QQNA 4A6DA 3KPYA 4EKIA 3TFWA 5KS2A 5FA8A 3MTEA 4P58A 3B3JA 1N7JA 3LECA 1KPIA 3HCDA 3KHKA 3MTIA 5DM4A 3EEOA 2UYOA 3TMAA 1INLA 3ME5A 2OKCA 2EJTA 2XYRA 5IKMA 3G2OA 3PX2A 3P2EA 2IH2A 3NMUF 3I64A 4LWPA 3B7PA 4QTTB 3MAGA 5F2KA 4QPPA 3ANXA 2OYRA 3AXSA 3JWHA 5E1DA 1YF3A 3O7WA 5K01A 4M38A 3VYWA 1P1CA 4KDCA 4PWYA 3PT9A 3M6WA 1EQAA 3DMHA 3OCJA 3TR6A 3GRRA 3PLAE 1X1CA 3G89A 4V0RA 1KXZA 1NW7A 3I9FA 4IWNA 5E9QA 1RI4A 5C9ZA 1L9KA 2EFJA 2R6ZA 3G5TA 5EKUA 1YZHA 4IV8A 3UFBA 3FZGA 1AF7A 3HA5A 4GEKA 5U4XA 3LCVB 2PXCA 1TW3A 2FK8A 1R74A 1ZGJA 2P3LA 3EVAA 3G2MA 3LDGA 1R18A 4PYLA 1FJXA 2VDVE 3NDIA 4P7JA 3MCZA 5E1OA 2I9KA 4UOEA 3KQQA 5F2OA 2YXEA 4C08A 1EJ0A 4C03A 1P1BA 5HIKA 4E2YA 3CKKA 3FUWA 3C6KA 4F85A 2VZ9A 5LQRA 1RI2A 2QRVB 4ISCA 3DULA 3FUXA 4FT2A 5B1SA 3SXJA 1VL5A 2BR3A 4FZVA 1OR8A 3VSEA 5CVUA 3P9NA 4CKEA 5FUBA 5HEKA 4HTFB 3TM4A 2FYTA 3AXTA 4OBWA 3UBTA 2KW5A 2CMHA 3OFJA 3R9XB 3KPWA 4KVZA 2H00A 4HG2A 3SSMA 3UJ9A 4QDJA 5EIWA 4QPNA 1L3IA 5DRYA 3ER9A 2YXDA 2JG3A 3NDJA 2O05A 2PGXA 2CWWA 2P40A 2PXAA 3LDFA 4MIKA 2V7EA 4B17A 4ER0A 1VP9A 4HRAA 1BOOA 4X63A 4E2WA 2LD4A 1G6Q1 1Q0SA 5CVVA 4ER5A 4XUCA 5IH3A 3UJDA 1XXLA 4RVFA 4CTKA 3ELUA 3KU1A 3THSA 4BLUA 3SSNA 3T0IA 2NP7A 2YR0A 1VBFA 3AJDA 3E7PA 3H2BA 3HA3A 1D2GA 2EG5A 4KWCA 3X0DA 2YX1A 5DSXA 5EVJA 3NVMB 1EIZA 2PX5A 5DTRA 5EKXA 2ZZMA 3E05A 1KYZA 3P2KA 2BM9A 2OBFA 1EAMA 4RTNA 4U7PB 3FPFA 1RI1A 3LSTA 3U81A 3UJBA 2FCAA 4E2XA 4YMGA 5E9WA 3HCAA 5HIJA 2P8JA 2JHAA 3FUVA 5JR3A 5DM2A 1O9GA 2UYQA 2XVMA 3OE5A 4R8SA 5LQCA 2G8NA 3TRKA 2GPYA 4MHTA 2ZZNA 1G8AA 2PT9A 4RVGA 1M0EA 1XVAA 5KYGA 3KQMA 1JR4A 2G72A 3L8DA 2HWKA 1R8XA 2C7QA 4C04A 2IDKA 4Z2YA 2ONYA 3JWIA 1X1BA 1IM8A 5GOZA 2C7PA 5K0GA 7MHTA 1PJZA 3DOUA 4MQ4A 3G88A 3OZSA 3ELYA 5HIMA 3UJ7A 3NVKI 4X60A 4AZVA 1JTFA 3KPVA 4PYQA 4X41A 5BP7A 1JG3A 3M6UA 2B9EA 1XDZA 3HNRA 2BR5A 3OPNA 5DM0A 5GM1A 1YFLA 1VLMA 4F84A 1R6AA 4FR0A 2PXXA 1NW6A 3FRIA 2WA1A 4YV1A 2UYCA 2BM8A 4IV0A 2B78A 4OBXA 4K6MA 1MJFA 3BKXA 2GS9A 5EIFA 4XUDA 3SVZA 3KR2A 3BT7A 4RTKA 3DTNA 1IXKA 5EHGA 3KQWA 3VC2A 3SSOA 4P7FA 2UZ4A 3FTDA 1ZG3A 2Z6AA 4G56A 3CBGA 2IBSA 2B2CA 2PV0A 2PX4A 3PFGA 4RTPA 3B89A 4CKBA 1I9GA 1TPYA 3LBFA 4GOLD 4QQKA 3DXYA 5CCBA 2PVCA 3G8AA 1H1DA 2YUIA 2B25A 3DH0A 4RVDA 4OQEA 1I4WA 5DX8A 1ZHFA 2AN3A 3HCCA 3KQTA 5CCXA 3QOXA 1RJFA 4PYKA 5CVJA 2I62A 4ER3A 2P7IA 5HOQA 3RODA 3HTXA 3UWPA 5F2NA 4RTJA 1RJDA 5EPEA 3ERCA 8MHTA 3LHDA 3EPPA 2IGTA 5DX0A 5EZQA 5FWDA 2B3TA 3F4KA 1WXWA 1XCLA 5ERGB 4GQBA 2AOUB 5GINE 1JTEA 2Y1XA 1WZNA 1FP2A 3DMGA 3HCFA 1YFJA 4GOMD 3NTVA 1T43A 4BLVA 4OA8A 3C0KA 3DP7A 3SGLA 5ICGA 5LSAA 3PTAA 1VE3A 3EVEA 3A26A 4GC9A 3P9IA 4GOOD 2QRVA 3HVKA 4MTLA 3LBYA 4RYLA 1O9HA 4AZTA 5K03A 2AN5A 2OY0A 1G55A 3EMBA 3LL7A 4HC4A 5CVDA 5HILA 5E2AA 5MHTA 3C6MA 5BW4A 4HTFA 5FHQA 2ZIEA 1F3LA 3LPMA 4PINA 3PB3A 2ZULA 2XVAA 5LQNA 1JQDA 5BXYA 2ERCA 5K0CA 4U7TB 3FPEA 5GIPE 2XBMA 4PYMA 4GC5A 5KQRA 1YUBA 3CCFA 5LQUA 1NE2A 1UFKA 3BZBA 4QVKA 1WG8A 4M7RA 5C1IA 1EG2A 3DLCA 3B3FA 4XUEA 2PWPA 3CJTA 2ZZKA 3CJQA 2QY6A 5DM1A 4LG1A 5FCDA 1SG9A 4ATNA 5DXJA 1JG2A 2ZBPA 4DZRA 2BH2A 1JQ3A 5D1HA 2F8LA 3FPJA 3BWCA 3R3HA 4QVGA 5DRTA 4EKGA 3BXOA 5BW5A 3C3PA 3E23A 3KPJA 3P9KA 4ER6A 3UJCA 3GGDA 3HVHA 1G38A 5EMJA 3P8ZA 2CMGA 4PNEA 2QYOA
chains in the Genus database with same CATH superfamily
1N7HA 4LSMA 1GPUA 1T0UA 2OENG 3DC2A 2AJBA 2OUKA 1ZI6A 2RGGA 3BWEA 3OE4A 4KAAA 5JADA 5JAIA 4OFZA 4A0FA 3H6KA 1MQ9A 4RD2A 2BJVA 2H7VA 3E9QA 4YRMA 2QW8A 3L6BA 4TQGA 4YT8A 4O4JB 1X19A 2G17A 4QBTA 1XA3A 1YB7A 1JHYA 1T6BY 2FSSA 4LVUA 4QM6A 4ZO4A 1NBME 2WYOA 4A36A 2HWUA 1XK6A 3E8MA 3LS2A 4MGYR 4JN6B 2HT6A 4C29A 3ZY6A 1BKYA 5CB0A 2EWMA 5TX7A 1Y6GA 2Y2UA 2A59A 3QPCA 3CLHA 4FP9A 3ZIDA 3BDVA 2OP1A 2GCPA 2HMTA 3D7RA 3O3OB 2QNIA 4RELA 4PG8A 3IIIA 4HX5A 3PDJA 5IULC 2H1IA 3H2GA 4E1VA 3IDOA 4FZ3A 3DNPA 1PJ2A 2FWPA 1SXJA 4NZMA 4GE3A 1W36B 3OTIA 2OGUA 4MVWA 2OILA 2RHLA 1T6YA 5HMMA 3O93A 1LVUA 1FJGB 4YJKA 4WINA 2NP6A 4K81B 2IY8A 2JZNA 3ESQA 3CM0A 3L18A 4OX9Y 4AZ0B 5G02A 2G71A 2H59A 3AUSA 3WIVA 3A1DA 2IP4A 1U99A 2H06A 1OB5A 1MFZA 3ON5A 1B2RA 3EFOB 2CHUA 4UPVA 1L0BA 421PA 4F0JA 3HZZA 4IIJB 1PFQA 2OAGA 1IZZA 4LF7B 1GTMA 2NVBA 3LHKA 4JLMA 3QMPA 5FR2A 2VUSA 4JLUA 2PX0A 4QG7A 2H8KA 3JX9A 3NTRA 3VNRA 5A04A 4LFBB 3PQ2A 2C94A 1V11B 2UZ3A 2XWPA 4HNAB 4BFZA 2XKKA 4FUQA 5CB4B 4QG3A 1N5DA 2Q5CA 3K70B 5DMXA 6Q21A 5JCPA 3LL4A 3PXBA 4QEDA 3TRHA 3EXEB 1XYYA 2C9MA 4LDAA 1QLHA 2Z43A 1K4KA 3NBQA 5EUCA 3DWFA 1CQZA 2CNWD 4AVYA 2VCYA 4INZA 2XGMA 4RL6A 2K87A 3TW6A 4RKQA 3FZQA 4BNNA 3NHYA 1OHHD 4DYDA 3C7CB 4JUBA 4YMTA 3QQPA 5AKJA 2VAPA 2XXJA 4YI3A 3KM0A 1NN3A 3MGGA 4XGIA 5DI3B 1PR9A 3E18A 3P52A 5AKZA 1KA9H 2MU1A 4BC1A 4CMBA 2I03A 1P8AA 3WI7A 2H5EA 3AB8A 4G5RA 4EZIA 3NX4A 4X8MA 4E12A 4P2BA 1R6TA 5EXSA 4AUKA 1UBFA 2Y93A 5DDIP 1U04A 4DGSA 4RA6B 3L8MA 4J0GA 5H4HA 4TV9F 1GTSA 3AL2A 4LHZA 4LSZA 1N5RA 5CM2Z 5AK0A 1IEVA 2KWIA 3K1TA 3IUYA 3WGTA 5DEOA 2Q5HA 3WK7A 3ZX4A 3JVDA 2QAGB 2BFCA 5HQJA 1JSRA 2HSZA 4RTRA 3ELDA 3EXHC 3IS3A 1R66A 3K1JA 3UGTA 3E1GA 3LZCA 5C51B 2AJTA 3EVCA 4NCNA 3VJMA 1TA9A 1Z4PX 2X0KA 4LNHA 2C20A 1X7YA 1GG9A 2ODQA 3PJGA 3GA7A 5DASA 3SOZA 4FSHA 4S04A 1A96A 2YHBA 2DFDA 2G88A 4PE5B 4C0HA 3V4VB 5LM3A 1X42A 4KYVA 2DBYA 2YJ4A 4A3SA 1IMOA 5EN4A 5B2EA 3C8ZA 4X65B 3W5CA 3IYLW 4XASA 2YJTD 3EFHA 1K06A 2IPOA 1G66A 3IHTA 2P4EA 3H2HA 2VSFA 1FZTA 1KRWA 1Y1TA 2V9ZA 3V7NA 3E70C 2IYOA 4MMXB 4FHEA 5AVXA 4TTIA 5T64A 2IS1A 3WKBA 4Q1VA 1VMAA 3KYIB 5FNVA 4P08A 5KTRA 1VE5A 4HDAA 2CXNA 3K9HA 4L4RA 4CM4B 2XJ4A 2JKZA 6CHYA 5FADA 4DA9A 2K6GA 3AETB 3A9SA 4B48A 1EVYA 2XEDA 2QJOA 3UHFA 1KI6A 4JBLA 4MI9A 3TECE 4U9IS 1CFJA 4XDZA 2F3TA 1GFSA 1M34E 2RGDA 3CB2A 4IKPA 3WDKA 5K3OA 3DS8A 3CR3C 1CY7A 4DLZA 2J07A 2HR1A 3AHGA 2JJQA 5FBWB 1XI2A 1DV1A 4DW8A 5L53A 1R0RE 1R9GA 2NO0A 3KKKA 1DTSA 4KRGA 4BVLA 4QTYA 2WVAA 3IUNA 3L0BA 3SK0A 1M1NB 1W29A 2OVBA 1YIOA 3V4LA 1Z75A 4Z2AA 1K75A 3Q72A 4N9WA 2EWVA 3IB3A 2O2GA 2DP4E 2ZYUX 2PWYA 3KXDA 5AJUA 2OWDA 3M0EA 1CB0A 4RYDA 2ZTHA 3SNHA 1ONNA 1XMJA 5T7BA 3Q5DA 2AEJA 4K6CA 3BMQA 2W0MA 1R6VA 1RJGA 1KSGA 5K0BA 4NBTA 3GJZA 1Q0TA 1UC9A 1FJ2A 2JGLA 3LLSA 1TM4E 2FW8A 4YHBA 3TPZA 1RAIA 3IEKA 4RA9A 5JZVA 1IVNA 2V74B 4YWJA 1NBAA 2P6OA 2X2OA 3PJEA 3IXLA 4M99A 1WUKS 3HACA 3LWDA 2BD0A 1D2HA 3SM3A 3AR4A 2J4DA 3MUFA 2PSSA 2ZR9A 3L0DA 4HZGA 4WTOA 1T1IA 1UIRA 1AT1A 2FE1A 1EP3B 1IN5A 3KJHA 3JQAA 4HF7A 3DVAB 2PX8A 3ETLA 4RV4A 5DM2A 3SZUA 3AVWA 4CKEB 1Y3AA 4JJAA 3VRHA 1M34B 5AIAA 5HDBB 3ZDBA 2YVLA 1WUYA 4CG3A 3AFMA 5I51A 4F1KA 1NRIA 1QNFA 4DLKA 4IIBA 2XD9A 1W0JD 4HWGA 3TI9A 3TTYA 1ADFA 4E5NA 4RS4A 3IP9A 4R31A 4TWAA 2YWJA 5EZYB 2W4IA 3L93A 4I5DA 1WZUA 1GSIA 1GZHB 4M37A 3RKSA 1XTVA 2BCJQ 1I3KA 1I2BA 3AUXA 4O3FA 1VI5A 4ZYXA 5F1YA 2QJWA 3R7WB 3AL0C 1M8JA 2R3SA 3LAWA 4YP9A 4F2HA 4C3ZA 2FMHA 4DIEA 4MDHA 5DVZA 1O94D 2HIMA 1REQB 3O3MB 4QBIA 4G8BA 2BRUA 5ALFA 1XJ5A 2AOTB 3L4EA 3PUHA 5LC1A 3WLHA 1C4OA 1E1LA 1HFWA 1FNSA 3IVCA 3NW9A 4LYJA 1NQUA 4Q4AA 1VB5A 2XZTA 3OX2A 2QTBA 3MUNA 2XPCA 1E2DA 3OZ7A 4B87A 1H4SA 3DD5A 4LZOA 1J9ZA 1C3LA 1TZCA 3QVSA 1FTYA 2ZUWA 3F6CA 4CMEC 3U5ZB 2CDBA 1THGA 3E3NA 4OAQA 1V3QE 4FZRA 3L4SO 4JXJA 3H6HA 1R6BX 5DYWA 3ZD7A 4RDCA 4MVJA 4A10A 1YA6A 2JH9A 1DUVG 4X3CA 2JD1A 1ZFNA 3FFBA 3F47A 3N5CA 4OQDA 4LHEA 1V1RA 1XZHA 4PFSA 5LJIA 5K1ZA 2OZVA 1A97A 2AW3A 1WB4A 2I67A 2O1EA 3GGOA 2WJGA 5E8JA 3LD9A 1JG4A 3SXUB 4Y1GA 2ZIVB 1GWNA 3NM4A 4ENUA 2VHYA 1QG2A 3T9FA 4PNHA 2F1RA 1FYWA 3N74A 2R7KA 3TZBA 2W83A 7ABPA 3KVYA 3ADBA 4HD8A 3EVBA 5HQTA 4DE5A 1JKJB 4G1CA 4F1JA 4RJKA 1UM9B 3M9LA 4HUTA 3A4NA 1BE6A 3IPLA 3F8WA 1YV9A 2SICE 4ZVNA 1PZXA 3ACDA 3PQ5A 4DVGA 1AK2A 1MNAA 7REQB 2RHMA 3M49A 3P0EA 1T9HA 3R0XA 4MWDA 5CNKA 5CTAA 1HE1C 2HCRA 1NASA 4PCAA 4X66B 1K3UB 4B6OA 1O94C 2DQZA 3Q12A 5KQMA 1CLEA 4RPLA 5CNIA 2PMCA 1JFTA 3RFFA 5K8UA 5IHPA 1MGOA 2J1LA 3BREA 3OD5A 5PNTA 2A9QA 4QRDA 4EW6A 3B60A 4UHKA 3JD2A 1I5OA 5IKMA 2JFNA 2WPNA 3EAFA 2VUTA 1QRDA 1MDFA 2V5VA 1UIMA 2VP6A 4HLUC 3ZHBA 3L4BA 3AXSA 4GI7A 1SAYA 3FVRA 3JQFA 4Y1EA 3ANMA 4ZQEA 4RENA 1EWQA 3M89A 1YTLA 2QM8A 4DVJA 1I2AA 3GGCA 2R47A 2QROA 1QFMA 3KKNA 4NV3A 3LA6A 4G0XA 4HXEB 3QLVA 2R6ZA 2C3MA 2YN4A 4URVR 4KQ9A 3HH8A 4QYIB 3LCVB 4NYIR 4DWOA 2G6BA 2FK8A 2R1TB 3VMMA 5J23A 1PYGA 2D0PB 4JP5A 5DGTA 4ENQA 5CD9A 4KQ6A 3B51X 2J0QA 3TZKA 3V3KA 1M6VB 2X8AA 1NVTA 3CLVA 3ILYA 4R5MA 1YFZA 1PDVA 3S8EA 1XTUA 5TF4A 2VHUA 3EXG2 3CLUC 4L4SA 4F3YA 4F85A 3RVLA 2W00A 1X1QA 3A06A 3BQMB 2JLSA 5IWAB 1PGJA 1WL8A 4YIHA 1RLMA 1GNVA 2FQWA 3BL8A 3PXEA 4CI9A 4BNIA 1J7JA 4HG2A 2J5XA 1GRVA 4B31A 4D74A 3SY8A 3C7DB 4Z51A 4H59A 2C2GA 3QVJA 4DCPA 1CX9B 1II8A 3VZBA 1DFHA 3LXUX 2AWNA 2A0XA 3CWZA 3WFIA 2EGGA 3AM1A 1NNLA 4ARZA 3I8SA 2Y0DA 3LFHA 4BTLA 5KMGB 5CVVA 1MZPA 4KREA 2HF7A 1NXPA 4I66A 3G1WA 1VBMA 3ELUA 8ATCA 1DBIA 1RM4A 2AZXA 2UYYA 1Z8HA 1RYEA 4H7KA 4HZUB 3DEAA 3TQOA 3VR2A 2QTLA 4JHXA 1HRKA 1RYNA 1YZVA 4H15A 4LEIA 3X1KA 2RBEA 2ZRFA 1W48A 2PX5A 4R7TA 3AUFA 1DLJA 2SKCA 2AR9A 2H2IA 5H1YA 3BFJA 2XXBA 2WKRA 3ZZ1A 4F92B 3QA3E 2H31A 2L42A 2J7PA 1E0SA 4AW9A 1F5NA 3HN7A 4TL6A 5EJFA 1MXFA 4E2XA 1QQBA 1JH8A 5DGIA 4RKWA 1ECBA 3BIFA 4IDAA 2GESA 3IPAA 2CL7X 4BB5A 1U0RA 1H42A 5JXWA 3M3PA 1F48A 1DCMA 2ZSBA 1QIHA 2E5FA 1M72A 1SCAA 2I1QA 4U6SA 2C7QA 1EWYA 2IE0A 2IDKA 3D6UA 2WU3A 3CLSD 3ELBA 1ZZGA 1MORA 4LDQA 4TL8A 5GOZA 3RF6A 3DQZA 4X8HA 2X0FA 2RGUA 3ZVRA 4IDGA 2CT8A 4DRXA 4R9UC 1XXHA 1C3OB 2AYZA 2W71A 1GEGA 3JR3A 1L8AA 2H4YA 3BYZA 3ASUA 2CYCA 3DF7A 3HNRA 3IJPA 5KNBH 3B48A 4HAZA 4IR7A 4OUDB 4TMVA 3T9DA 2POQX 1ESZA 3SFZA 4L5YA 4P9NA 5DM0A 5AKIA 4X6XA 4R0MA 5KJFA 3H16A 3EMKA 1KGSA 4FR0A 4NARA 3U3JA 2FXVA 4RF2A 1JR3A 1XCBA 4G36A 2BF4A 1KFEB 4HJRA 1QP4A 1BQ4A 4Y9DA 2XF8A 2VYQA 3OH8A 2FSIA 4KDFA 4NFYA 5HUHA 4MB6A 4S2UA 1ZXXA 4MKZA 4CT0A 3R5SA 4MQFA 4XUDA 1V1MB 1MABA 1Y80A 1A4UA 2YV4A 3A1UA 1IXKA 3BB1A 3IIEA 3QRWA 3RV3A 2CJYA 4RFVA 2A0WA 1OOEA 2UVDA 1IONA 1EFRA 2EGHA 2V4UA 5FWYA 3PVZA 3LIIA 4H4EA 3HJTA 1UMBB 1K8ZB 3NDRA 4OB8A 4ZVUA 5AVSA 3EXHB 3G2NA 3IP7A 2PX4A 3NAGA 4MRAA 1NSYA 1U02A 3HYLA 2VHXA 3WQSB 5CFZA 2HCJB 3UYLA 3DE1X 3V8NA 3LQ1A 3DLAA 2OAQ1 2GRUA 1JJFA 1DC7A 3A1VA 5EFZA 3V8EA 3CUUA 4F38A 2RB5A 1TZBA 3AG5A 3H7AA 5JDCC 3WWZA 2HUNA 4E51A 4XD2A 3I6MA 1VCMA 4F2PA 3RG2A 1GTZA 5AD1A 4KL8S 1MV8A 1GLVA 1S3SA 3N9IA 1L4EA 3QY9A 2OV1A 2W11A 3VR3A 3PQDA 3RPEA 3W4JA 3KXLA 4XW2A 3WL5A 3R5JA 2RI0A 3WRYA 3ZVLA 4AP9A 2PXHA 3DT8A 4QKQA 5EHZA 5KJ6A 1BGXT 3JXEA 4OKSA 4MUFA 5DHUA 3VBEA 1ISGA 1WZNA 2Q8NA 1JXOA 3E58A 3ND8A 3FDIA 4TMXA 3I1FA 3OPXA 4BLVA 2GUGA 2CF6A 3IUBA 1T2UA 2ZATA 1V8DA 1N3BA 2V55B 3ABOB 3EVEA 2GAIA 3B1KA 1ATIA 3UF0A 3WLAA 1KRXA 3VV3A 5GADl 3A36A 5EE3A 1Z26A 4MA4A 4B71A 4DFDA 1DBQA 2FSVA 3H9BA 3HY3A 4FEAA 4QATA 2M2IA 5AKXA 9ATCA 1Q7TA 1JB9A 4RLSA 2FMFA 1W5SA 2X9LA 3QUSA 1F3LA 3ZCPA 2NOAA 1G5PA 4D9CA 3TB4A 1QKIA 3WGMA 3R6LA 4QU5A 2KQUA 4MUKA 1J0EA 2FETA 2JIOA 2WTUA 1IN7A 2XWBF 3R1IA 1QV9A 2OCKA 4BO8A 4R40A 3TZEA 1PN3A 2ZYDA 4QD3A 3B3FA 4FZJA 3DZHA 4WWHA 2OHGA 2PBZA 2PZLA 2CXHA 2O2ZA 2YW9A 4E6PA 5FCDA 4ZMSA 2A1TR 1U65A 2X19A 3W2HA 4G24A 5EXPA 3F1LA 2VDPB 2F8LA 3EPRA 4F11A 1JKXA 5HRCA 2JK0A 3TR0A 3MWEB 3RROA 1AUPA 2I8CA 4M8SA 5IKEA 4XFKA 1E8NA 3JAKA 2W6CX 2Z0MA 1XK7A 4HGQA 1G38A 2CMGA 3H5WA 3OY2A 4DWJA 1QS0A 3WLLA 5C37A 4RZIA 3A6PC 3QEMA 1CQJB 5A4FS 5LZ5A 1MDBA 1DQYA 3EASA 2RGCA 1KQFA 1SH7A 3RJMA 1GUAA 1CULC 1KJNA 1P7VA 1PG2A 2B92A 2RG1A 3PTLA 4RU1A 4WA8A 5CT5A 1KP3A 1U9JA 5TQ2B 1NJ8A 4MQMA 1C0KA 2VAXA 3ZYCA 4EL0A 5A4AA 4D8UA 2D7JA 1WEHA 2ZCJA 3ZVNA 1ZWLA 4D4KA 4JFAA 1Z9BA 1F9EA 2QUZA 4NE2A 2O2EA 1E3IA 1EZZA 3GGJA 2CZGA 4GX2A 4LWZA 3CN9A 3GRZA 5C7YA 3I8OA 4AWAA 3AI1A 3TOSA 1DUSA 2XGGA 3FY4A 4YRQA 4BLQA 3MJTA 4H7EA 4ER7A 4FMCB 3TPCA 2I6UA 2PJUA 3EBPA 1DDGA 3JS5A 1KU6A 1EUDA 1W1WA 2WP0A 3TRIA 3WK8A 1I3MA 4GDMA 3PXAA 2Q1SA 3K8OE 3QXSA 3I28A 4OYHA 5EZ6B 3T5DA 3WB1A 5L7WA 2K7FA 2ZR7A 4QSHA 3T5PA 4D0LB 1D0SA 2OFXA 2JBWA 1G4UR 4K28A 4UTOA 3SAJA 3VHXB 2YNMA 4JBGA 1ZITA 2O3RA 2P35A 1A5SB 3CNBA 1L5WA 2C4KA 4KE8A 3DMDA 2ZB7A 5DSZA 2PZEA 2QP3A 4Z8XA 4JDUA 5EQJB 2W8ZA 1F8FA 3N8HA 2G07A 3VNBA 4NECA 4C3OB 3GFTA 3D4NA 1U9YA 4KQXA 3FNEA 5J2TB 3DL0A 1VKNA 3N2KA 3RT1A 4D4MA 4D9HA 4RQAA 4HWKA 5DLQC 4TS4A 4P31A 4MIEA 4C05A 3TW0A 2A0UA 2R9VA 1AA9A 5U4QA 2Z5VA 2BC9A 3MINB 2PSJA 2C2ZA 1WXHA 2PR7A 4OK3A 3BXEA 5I7VA 1KHHA 3MJCA 3CVUA 3FM9A 3WLSA 4RTQA 1FOEB 4R0NA 3R41A 4PPQA 1R16A 1QGUB 4DG5A 2XAUA 1SXJC 4TWJA 2OT3B 4HH3C 5SYAA 4OGWA 3AEKA 1GL6A 5WRFA 4J1TA 1N1DA 3L41A 4PX5A 3B52X 5KU7A 4JI0B 3LC2O 1T2VA 4NPAA 2I29A 5IMBA 2ENUA 2Q7OE 1KEPA 1E0AA 2EW1A 5CD1A 2G9RA 1M7GA 3HKBA 2QTWB 3F67A 3L6RA 1ZINA 1JJ7A 2ZJ7A 2UXBB 2BFOA 4TLDA 3C3BA 2DECA 4MKIA 3W5UA 4UFPA 3AW9A 1NXVA 3GDFA 1U8FO 5T6BA 3W05A 4LYAA 1X1EA 3F7MA 3JQQA 2VIIA 4C0BA 4CEHA 3O2SB 3H5TA 4D99A 3VJRA 5A5FA 4W5NA 1S8FA 4I9UA 1HG1A 3ZFNA 4OJNA 2VWGA 5TNXA 1GGMA 2MMGA 3ZH9B 3R5KA 4PBRA 3DYIA 4ILEA 5HKOA 3FROA 2GYYA 4EA7A 3T7TA 1P3JA 2QVGA 2PGNA 1C41A 3RYFB 1CRZA 1LW7A 2ACEA 3ZLUA 4EW3A 5CA0B 2OKGA 2QI9F 1ZUHA 2LV8A 1CCWA 3GCDA 5ESXA 2WKQA 5FD8A 1TVKB 3ICWA 5C8YF 5EWLB 4Y2XA 5J9FA 1YRLA 2WPDD 3EVZA 2GLUA 3KD3A 3VR5H 4BFTA 3F78A 3NASA 4R1TA 1ODTC 4YP0A 2VSQA 1GPNA 4A6XA 4OQQA 1T91A 5ED0A 1KRHA 4XE5A 1GSHA 3TFQA 4E31A 2HFJA 2F1OA 2Z08A 4M9XA 3F46A 2VKQA 4O2BA 1DTEA 2AUNA 3C7KA 4HH0A 2JAUA 4BUCA 4F8YA 1NVEA 1LC3A 4ANFA 3PD0A 1FDRA 3EA5A 1LEHA 4ZMRA 4BJ1A 5BVGA 2GSDA 1NFFA 3OFND 2CSXA 3GCWA 3CNHA 3THRA 2YTZA 2WIGA 1B1CA 2E49A 1JNXX 1H2FA 5GJBA 4AULA 1L4BA 3CCBA 3MWFA 4QVGA 4B6SA 2HNKA 5EZSA 4EJ2A 2EKLA 1II9A 2EFDB 5EHQA 4QHSA 4HWSA 4M9UA 1N2EA 2NZYA 1CUSA 1XUOA 3DOIA 1C9NA 5BN5B 2HF9A 4B35A 3K15A 5ARDA 2I6XA 1L4MA 1TUIA 1IFXA 1XTKA 3E3MA 1AZLA 1H2EA 3NBKA 5KNCH 1FFEA 4KR7A 3HO6A 5H4GA 3OT1B 1T5IA 4N40A 4HQKA 4HRVA 2WWWA 1BKSB 1QCYA 2FRDA 1NLMA 1JA9A 1EH5A 2XDYA 1CF2O 2QJFA 3AF2A 3G5LA 3MD9A 3L9XA 3QVTA 4V38A 1K0UA 3PHJA 1A7AA 3U7JA 1QRUA 2ZJBA 4WK2B 3ZXXA 2G67A 3B9PA 3QEJA 5CFLA 1KS2A 5P21A 2Z5GA 4DSNA 5LU8A 1N3YA 4GI1A 1OB2A 2XB4A 3W5BA 3AUKA 1APBA 2XSZD 3H11A 4U2EA 1R0LA 4E21A 1ZRMA 1H2BA 3AFIA 3BF7A 3CZRA 3PYLA 4MKXA 2F3UA 3QE0A 4E2ZA 4X1YB 5A3QA 1CIPA 1CR6A 2OHOA 3CRZA 1TVMA 2WZDA 4DANA 3DPIA 3UWMA 1Y3DE 2WDPA 1O96B 1AQLA 2OV8A 3WLTA 3GQVA 3ZUPA 2UUBB 1KYWA 1WP4A 3DYVA 3JYPA 3QF4B 5D3MA 3LX6A 2A9OA 2IX9A 1OW3B 3TTTA 3U9SA 4CMIB 4YX9A 1G8PA 3UT5A 2O8NA 2MYTA 4JEMA 1E5TA 3HNOA 3WGJA 4F4JA 1RE1A 2GHRA 3PQ6A 5BO5A 3DQPA 3V46A 4CIDA 3GEBA 3KR9A 1N5KA 1TU4A 5JLAA 1FSGA 2G1KA 3MT9A 3QMMA 3R24A 1NW4A 1AGNA 1YKGA 4F71A 1VRCA 4ZCSA 2A5GA 4I8IA 1MB4A 3LT1A 3QI2A 3DE7X 2ZBQA 3QKWA 4JBHA 1KJJA 1JBKA 3PI7A 2AD1A 5ISMA 4IIFA 2XUHA 1XPRA 3R0QA 2N0SA 3TWOA 3VTZA 4M55A 2GYUA 2QRJA 2VK8A 1LX7A 4Q3NA 2G1UA 1YBAA 3EYWA 1J0BA 1E32A 5CDFA 2WJVA 4D80A 4Y1RB 5LQAA 2VF4X 3K16A 4OM8A 3KTAA 2WAXA 1QDLB 5C1OA 3THXB 1U8TA 4OHXA 2Q50A 3CRMA 1ZVJA 2BEUB 2WYWA 3CNNA 3O84A 4JZKA 1S4MA 1UDXA 4QREA 4EHAA 1A2OA 1QHSA 3BQ9A 3VUEA 4H9JA 3CO5A 7ADHA 4AYWA 2AMLA 2P3OA 2J3JA 4EJSA 4JI7B 4IRXA 4HQLA 5KSOA 2N75A 3K5IA 4OY3A 3FVQA 4HSEA 3OE7D 4XVRA 1ZD2P 2IHZA 3ZFUA 4ZTUB 1PR4A 1T0BA 3CZPA 3WMEA 1U7WA 2AR7A 4MV9A 1FXWF 4M8IA 4QDUA 3U3XA 2FN3A 4DOMA 1OXKB 4BX3A 1ODIA 2ZSIA 4O63O 2ZTLA 3OLCX 2Y66A 5M5BA 3FR7A 3CH6A 4LFCB 1E0JA 4KR0A 1PR3A 2IH2A 3G82C 3SEFA 5KHOC 5HHTA 2QX4A 1GNRA 2BRUC 4KHZA 4D3FA 1AF4A 1HFKA 5ADUS 2O19A 3PKZA 4OJYA 2QN2A 1AN0A 2PO5A 5BYJA 3RC1A 2PT6A 2WU1A 1WQ4A 2E5LB 5BOVA 1Z0KA 3MTEA 4R1SA 4G65A 2DGDA 4JB8A 4CL8A 1T6NA 3CH7A 3ZR4B 2YZKA 621PA 1FLNA 2XRYA 2O2SA 2O7RA 4BVEA 3JALA 2BHLA 3GLIA 1N5MA 4BVFA 5LYJB 4KV7A 1M5RA 2NUPA 3VYWA 1DC5A 2E82A 2W37A 4KDCA 4RCVA 3PC2A 4Y6LA 3DLBA 4G26A 3NHKA 2J9GA 1N9GA 1CQXA 2QL7A 3DMHA 4FMDF 2CHVA 3N87A 4BLOA 4D45A 5JYBA 3ESRA 1GYPA 3DCJA 3O8QA 1KJQA 1OLXB 2FLWA 2PD4A 4YH1A 5ALKA 3DTVB 5E7IA 1OI3A 1WMAA 2EFJA 3JD1A 4MA5A 1YZHA 1E2HA 4ZT6A 1XR3A 4EITA 5C5CA 3R0IA 4X8LA 4KQCA 1YI0A 3G2MA 3EVAA 3HE3A 1ODSA 1UBHS 4PFJA 4U1RA 3AV3A 2A0YA 4A92A 1FVOA 1MN6A 4G3XA 3KQQA 1YACA 5F2OA 3T99A 4ZI5A 5IJWA 2IS4A 1P4RA 1C2YA 4YPOA 4G1EB 4KH0A 1DJPA 1GO2A 1V5FA 4OQNA 4BKQA 4C4RA 1NVXQ 4DMCA 1MKYA 3T61A 3PICA 3RHTA 4DLLA 4HL6A 5EWMA 2EFGA 2X4LA 2C0PA 2QN7A 1WDWB 3IDFA 4FXPA 3UBTA 2PX3A 2REQA 4GICA 3C85A 1M75A 2OCAA 4U2KA 1L3IA 2C59A 2DT5A 3L1HA 3E81A 2WIKA 3L4BC 3JQFC 3N2GA 4QYSA 1LS6A 4MIOA 4IDOA 5HK9A 2RHWA 2Q4DA 2XA1A 2VHZA 1D6JA 5CT6A 1SXJE 3RC9A 4CLOA 3MTDA 1YA8A 1M2OA 1T15A 2ID8A 5A4JA 5IAAA 2CUKA 1RHRA 3Q88A 3QLVC 4X54A 3IOEA 3SSNA 4KE9A 1AKVA 1KYVA 3PHHA 1MAUA 3KWMA 3SKVA 4TM8A 7GPBA 2JBAA 1QJCA 2J5KA 2X1MA 4JU9A 1BXZA 1GRCA 1L4UA 1IXZA 2QTGA 1JHPA 1TKAA 2GAOA 5EZ5A 3N6VA 1F12A 1KFJB 2W9XA 3FCOA 1NX6A 3RRMA 2D8AA 2OHJA 1AKRA 3FWYA 3STTA 1KAGA 2BFBB 1Q77A 2O7NA 5LJLA 4MPTA 2JHAA 1NJ1A 3FUVA 4Q5IA 3TLGB 1CG6A 4IG9A 4CDRA 4EKNB 4URUR 4ZHQF 2GLXA 3Q2OA 1NFRA 4QBKA 4XOUA 3ZZ0A 3HJRA 4CKWA 2HC9A 3LHSA 2C8VA 4RK5A 3OX4A 4X1KA 2Y0CA 1W2WB 4DMMA 3ANNA 1I3LA 2EKPA 1NR1A 4GLOA 4EHDA 5ED4A 3UCEA 2GK3A 3UJ7A 3IO3A 2Q0XA 2CB9A 4Y8VA 4YAJA 2GXAA 3IULA 5IFLA 3ZWDA 5AI8A 2H92A 2I76A 2DBQA 1LA2A 2X4DA 4JBYA 4Y6OA 5U9CA 4U8GA 4L2IB 3SQNA 4BFWA 3DLHA 4KIJA 3VPHA 1MJGA 1JIQA 4PZDA 1ESCA 2VC2B 3TZCA 1UOEA 1CQWA 1GGEA 3QPWA 4RFSA 4IV0A 1MO5A 2OECA 2CUNA 2P9EA 4RH1A 2UYCA 1EA7A 4AG5A 3BKXA 4BO5A 4QTZA 2HH9A 1PNRA 4YCMA 1BSVA 2XDWA 3VC2A 2ZRHA 4ARBA 3GUHA 3HDGA 4Y2QA 4I14A 4TUYF 3D2AA 2GN2A 3FTDA 3TLKA 1AG9A 1JVBA 3CEMA 5K3CA 4ZOCA 5CCEA 3PR3A 3NOOA 2WF8A 3LF1A 4J91A 1I9GA 1TPYA 4OHFA 3ZDXB 4AJLA 2GUWA 1Z15A 4W8GA 4ZJZA 3D1LA 1AGXA 5KVQA 4KAJA 2HHAA 2YUIA 4DV6B 2B25A 3IR6A 1ZD1A 2BGMA 1Y4AE 1I4WA 4LX8A 5ALUA 3WGKA 5KWJA 3LLUA 1BU5A 1G9TA 3EEQA 4KXUA 1DPGA 1RJFA 4RLQA 3SDSA 4CG1A 4WL0A 6PFKA 4DDMA 5M7EA 3C70A 1LF0A 1EUYA 3ENZA 4LOKA 3ERCA 8MHTA 2V6GA 1Z5ZA 1H6DA 3C3KA 3ZV3A 2AE2A 1I51A 3FJ1A 1A8HA 4UAVA 2ZS9A 4GU5A 2Y1FA 2QY9A 5D00A 5IBPA 2ZRDA 4IIUA 1YMVA 1LKZA 4RVCA 5A9RA 4I0WB 4GC9A 3P9IA 3UEOA 2W2PA 3LUBA 3BWXA 2BPOA 3U2QA 1O9HA 4I5IA 4M83A 3VAAA 1PZMA 2A5JA 4D9FA 1RBQA 1TYCA 3D8SA 1QFSA 3X1MA 2BFCB 4AK9A 3U4IA 2E4XA 4NBLA 1K6IA 2JAOA 3BM5A 4EY4A 3DDOA 1ITZA 5LB4A 3NU1A 2QMEA 3RK1A 4JSYA 1A7KA 1EVIA 1GPWB 1KSFX 1NUAA 1X7YB 2CLMB 2WHEA 1MQ8B 1GPDG 2YXPX 3BDIA 3DFIA 4IFEA 2WTMA 4IVRA 5FWXA 3RTDA 3MJRA 3O4GA 3R7BA 1UFKA 1JRLA 4ESHA 5C1IA 5G0WA 3KLOA 4LDPA 3S29A 1QU2A 5DHAA 4MR9A 2P2YA 3SYRA 4LG1A 1UP4A 5DK6A 4K86A 1QPGA 1SHJA 3UKDA 1LSSA 4DXHA 1HY3A 3IAM6 4ZAVA 3WRYC 2RHDA 4JIMA 5BMVA 5BW5A 3K92A 5FNVB 1I3OA 3B6IA 3IBSA 1KAMA 5L7YA 4JI2B 1VCOA 2RGRA 2WHQA 2E48A 2NQ2C 4KU4A 5U1PA 5CBPB 4NQRA 5JZBA 3UHJA 1H66A 4AJKA 3I52A 3RS0A 2H2WA 1VSBA 4NBWA 2QUHA 2YWCA 2ZIGA 3ZUGA 1YVPA 1KI6B 4HAIA 4QUIA 3O8RA 2X86A 2WT4A 1SKAA 4RXUA 2FSVC 3U5TA 4BY9E 2C4UA 5JXIA 4X44A 3DMFA 1XFDA 2XB9A 3K8ZA 3DDHA 5EP1A 4IP0A 4YT2A 4EG5A 4F60A 2GJ8A 1B23P 2A9KA 2DSNA 1JU3A 1XZMA 4RHEA 1Y6QA 4HRYA 5JSHA 4JI4B 1GQSA 1FDWA 3LT5A 3OM8A 3MCAA 1ZN7A 3SEQA 4NR0A 3CKYA 5GTDA 2YIMA 5CBKA 4CEIB 1LNQA 4FHZA 3LC7O 5HZHA 2W4MA 4FKZA 5H83A 4JT8A 2PX2A 4Y3UA 4TL7A 1IOVA 1NXXA 4TN1A 4U7GA 5EJ2A 5BY2A 2OB1A 4KWHA 2YNMD 3KJZA 3KX2A 4TWIA 5JEDA 3FRJA 3O1JC 1W94A 3GFFA 4NWIA 2ZWPA 3QKRA 4FYHA 4RA9B 1L5QA 4YASA 3ZE2B 3OQIA 4AJOA 5A3JA 1QAQA 4CETA 4F6LA 1RWXA 3K6SA 1OE0A 2GZRA 2IZ1A 2X7JA 5EJIA 3ST7A 1EGHA 2M6SA 1VCHA 4XRGA 2DUMA 1RLJA 1XLUA 5AKLA 4EYQA 2WOOA 4EI7A 4DQLA 2C7OA 3BORA 3W7AA 3JQ9A 1CZLA 3T54A 3JARA 4KFUA 1VMDA 3JQAB 4LW8A 1H8EA 4MNTA 1R15A 4MVJE 4DN6A 3SS7X 3AEXA 2V7PA 3KPUA 1XE3A 3VPCA 4HV4A 2ZVDA 3S6JA 2Q9UA 2QX6A 3EIEA 1GPH1 1MO2A 2BGKA 2Q3CA 4J0CA 2MSWA 2GSWA 3E8SA 4ARVA 1S3FA 3C3EA 3UOGA 4QGSA 1CUYA 1NY5A 1OYVA 3CVWA 3CX8A 5HK8A 3TTSA 2DQ4A 3AM3A 2NZ8A 2L69A 4K0KB 4ETNA 3WICA 5LIRA 2VJDA 2AJ8A 1SVIA 1VRWA 2D1SA 4IILA 1Y9ZA 3BC1A 3BCSA 4LHVA 4NU8X 2CUZA 3WO0A 4CM7A 3KHTA 3GMSA 1X8LA 3ORFA 2C7BA 4L5AA 1ZY2A 1GQYA 1KZ6A 4E33A 2VRCA 1HQKA 1NQXA 4OYRA 3R8CA 1LDGA 1NVVR 1QM5A 2JHPA 3HXLA 3D4LA 3RR2A 3VKUA 3MT0A 5DN6D 1UP6A 1VXOA 4QULA 4DA7A 1QZ3A 3CYFA 2YNMC 4A5OA 3F5SA 1C1DA 1P91A 1WPQA 2IF2A 3H8VA 1NTOA 3PNBA 1P5RA 4GF5A 3K1AA 2DTXA 4MQ5A 1O4VA 5GWXA 4D81A 4CM8A 5I7OA 2GD6A 1E62A 3UFXB 5F9HA 2NNLD 2EYUA 1L4YA 2E1PA 5H8WA 2YBDA 1E3QA 3HABA 4TSFA 2I4IA 2PEZA 2IVZA 1H1LA 2P0AA 4P5PA 4WACA 4B3BA 4ZN6A 1LSJA 3W78A 2X8WA 4A26A 1GIAA 1JUDA 3HUEA 4S24A 3V1MA 1WPXA 1W1UA 2Y1EA 4NEGA 3LKBA 3T1NA 5C8YA 3UVEA 4RZUA 4O8CA 4UU8A 4XCXA 3HM2A 1SU7A 1ESNA 3ICCA 3QKUA 2IOFK 3CT4A 4O4HA 3GC6A 4D8VA 2FZKA 3O8BA 1RWWA 4DIBA 3NXSA 2GPAA 1UPXA 1DX4A 1Z88A 1EVKA 4N1AA 4J1TC 4F7WA 1T13A 5CCDA 1C9KA 1C3XA 2OO5C 3HS3A 2PGDA 4CLXA 2DX7A 2XZPA 1YA4A 4PAMA 2EF0A 2FK7A 2IXGA 3FHOA 2JJ2D 4WZ6A 4BL5A 1L7DA 3PIIA 1FX1A 2IV2X 3ZDAA 4ZIRA 1XLVA 1BS9A 1KI8A 1KP2A 3T3IA 5C8VA 1EI9A 1L7EA 3FUUA 4CCSA 5FO1A 2ZT8A 1J2EA 3GJYA 4W1SA 5E9AA 4C2UA 2ZRGA 4ZT2A 4AMBA 4ND1A 5JYCA 3FX2A 3K09A 3NTLA 4C07A 1HLPA 1JX6A 2W58A 1DXQA 5C8DA 3C6ZA 3VU9A 1RZVA 4A82A 4QT4A 3B1WA 5EXTA 2G9NA 1E3MA 5JD4A 2NU8A 4A6EA 1MVLA 4K6FA 2YWFA 4KIFA 5LL6P 2CJPA 4QICA 4JMPA 3U3ZA 4XFDA 1MVNA 2VDUE 3I4CA 2GEKA 1G8FA 1XTJA 3JPYA 4WBNA 4MP3A 2AEEA 3DVSX 3RIMA 2PZKA 4K6KA 4D92A 2GB4A 4EG6A 4L51A 1CEQA 1WAMA 1XN1A 2X2FA 2YHAA 4NDAA 4BU1A 3GH3A 2O8FA 4IQ8A 1PZFA 5LWHA 1PR1A 1QVRA 3Q8MA 1YR2A 4C0JA 2GO1A 2IOHA 4LBYA 3MLBA 4OP1A 5IUNC 4L3OA 1B26A 4PLCA 4FD2A 4HMOA 2E18A 4PBSA 1KHTA 1TVFA 3TOZA 1OIXA 4WVFA 3L0YA 4BIMA 4YXWD 2GCGA 2ZTMA 4TYNA 4XTCS 4AKHA 1HUQA 3H87A 4Z8YA 1HE3A 4NYJR 5H80A 3CJRA 2VJAA 3T0FA 2PM8A 3DOFA 2WIDA 4K5QA 3DEYX 4D3ZA 3QVXA 4Q4HA 3MQ2A 1IDN1 4Q9DA 4D4JA 1SC9A 4PZLA 3DBHA 4ETWA 1UKCA 3KOXA 1DOHA 2IFTA 3LY9A 1Z45A 4QRIA 2IIVA 3Q15C 4JOCA 3CUYA 3OTGA 4YJFA 3VO1A 3WGYA 5CFNA 2Q45A 2W6QA 4KLNA 4U2CA 3OZWA 1E1RD 1Z5VA 5AHKA 3S2FA 5A05A 3UA3A 4CMCA 1K2WA 1XXHE 3H5OA 1H2RS 3MJFA 2ZRBA 5LKAA 2A88A 3UUWA 5GPBA 1ILWA 5CG2A 2QHXA 3CVVA 1SBHA 4GGOA 4XSHA 1MAWA 3SVLA 1ZUD1 1V39A 3QMVA 3U37A 1Y1SA 4REQA 4E6EA 2FRDC 2EWWA 1PT7A 1U7ZA 4XTRA 3RTAA 4M98A 4ARZB 4JCCA 2WRZA 2ZJ0A 1JR3E 3KFXA 4HB0A 1NNSA 1L5NA 4DEVA 1DIOB 1N9ZA 5M04A 1RTKA 3F6YA 3FTEA 5F51A 1HE4A 3A2MA 3N3AC 3MA0A 1WIWA 3TW8B 1DL5A 2WWVD 1UDWA 3ZLTA 4TKUA 4W5WA 5DISB 3HDHA 2GBGA 4URYR 3ZGLA 4A23A 5BNWA 1EKXA 2G3YA 3AERA 3I6YA 5AI5A 4W5RA 1FQWA 3P5SA 3NVDA 4DCSA 3CZAA 3DL4A 4NL4H 3R7NA 1AA6A 4B76A 5K8TA 1XAJA 4BMZA 1U28A 4LZJA 3SMVA 1QE0A 2Q46A 2QK4A 1IHYA 2HKIA 2PMKA 4FLMA 4GAEA 4ZQBA 1HEYA 4R7ZA 5FKJA 4DQDA 5BOSA 2PUFA 1BHQ1 4NKRA 5KCMA 4D4GA 2XNDD 3K2BA 4TT3A 3N76A 1XDWA 3GLHA 2RHOA 2VP4A 2JHFA 4XGQA 3UK6A 3VZDA 1JXMA 3ZU4A 4CM5A 1XXHB 3VSBA 3JQGA 2BV3A 4LYYA 2ISCA 3MMXA 4F45A 3OAAA 2AHOA 3U1VA 2Q41A 1YZFA 2A2ZA 1Z0UA 2AVNA 3E9NA 3IAS1 3L8EA 3Q2KA 4HK4A 4LDNA 4XZ3A 3FPSA 3WWDA 1SG0A 4D3YA 4DPKA 1IWOA 3DZGA 1D2AA 2GZDA 5DGHA 3LWNA 3UAVA 4MICA 5DNDA 4PSCA 3TCKA 2ROQA 5KOJA 3WHLA 1HQDA 2NU7A 2QX7A 1A9ZA 3IVXA 4GNRA 5JO9A 1IVYA 2QM7A 2RKOA 1YJQA 4OQPA 4JD5A 3LUPA 4FPXA 4IKEA 2JFZA 1MABB 3P45A 3VFDA 5JVDB 3D1VA 3DCIA 2ZRMA 4RH3A 3COZA 4ZT5A 1YQQA 3COPA 3DZKA 5KVCA 2UYOA 3TMAA 2YXNA 2IZ6A 4XJSA 1WXDA 4RZ3A 2J45A 5I9TA 3A9CA 5CLLA 2WYIA 4BZZA 4LWPA 4U5XA 5D6OA 3VKVA 4EJSC 1YBMA 3AKCA 4OHOA 4OHMA 4GMXA 4R4JA 1Y7LA 1Y9EA 5ER6A 2R1ZA 6REQA 2IYTA 3KZOA 3ZDYB 2QAIA 2P11A 4FGWA 5K6AA 5A02A 2CXRA 3A10A 2L19A 3BJMA 1I14A 1V3TA 1B14A 2O50A 5A5EA 3KHUA 3NAZA 4ZVTA 3F4LA 4RPGA 3LIPA 4O0MA 2HYDA 4XH9B 4IMJB 5BWCA 4WERA 1D5WA 2J9ZB 4OIMA 3KU4A 3RU9A 3EX7C 2FPRA 1RTTA 1Z29A 2ABWA 5DHFA 4BX9A 5IJZA 2VT2A 3TLCA 2AMFA 3U1BA 3CQ9A 1AHNA 2I9KA 1ZGGA 2WD7A 4IEFB 4G84A 1YQGA 1QG4A 1ECLA 4WEOA 5AVUA 2EARA 3KQKA 3LY7A 4DSOA 4IWXA 1JHOA 2OD7A 3FUWA 4QARA 3C6KA 1DAPA 4YVFA 1ECGA 3ZCUA 2OCGA 4PLTA 4I1VA 4EPXA 1QIIA 2C1EA 3AQ4A 3A3PA 4HMQA 2OMKA 5KX5B 4LJYA 3FTQA 4YR9A 5IX8A 1U4SA 5FPSA 1RHMA 3OFJA 4GT1A 4RVSA 4X7PA 4EG1A 5CFOA 3W06A 4R2WA 2C31A 3GOHA 3LBNA 4MIKA 3FGPA 1CIVA 4JGIA 2JGKA 2VH2A 2YBEA 2FG6C 2BBTA 2VDLB 4BMXA 5JS7A 1T8WA 1PK8A 1UWKA 4F4DA 2B0JA 2XNSA 3C6YA 5E0KB 3W79A 5F12A 1L5FA 3FZYA 4QC2A 5BPHA 4V0NA 2BI4A 2AQHA 2VP0A 1B73A 2QYSA 2ZRPA 1IRIA 5KDOA 1RKQA 1T2DA 4Y2PA 4HCJA 4DJJA 4NOJA 1F2TA 1J8FA 4G01B 3GHYA 3JAKB 4NENA 4UVEA 5E7MA 3WHPA 2X0RA 5FUYA 4O8ZA 3NANA 1R88A 2M32A 2XTAA 1QS0B 3CX7A 1QHHA 1YB5A 2GYWA 3KAKA 4YQZA 2ZIZA 1P4GA 4YFVA 3RSQA 3UAZA 3QEMB 3WA6A 1LW6E 1MJGM 1BROA 3IOCA 2Y1LA 3OE5A 1HR0B 2Q7XA 3T3PB 1UBNA 2VSOA 4HVAA 3NRJA 5B5SA 1IAVA 4KNVA 4NFSA 3E61A 521PA 3RBAA 3OX1A 4MB2A 4NOKA 1PZNA 1R8QA 3C15C 1CKEA 3VU3A 4KZKA 1T8TA 1M1XB 2XMPA 2K5UA 3ZK9A 3LT0A 4MQ4A 5I01A 2PUCA 1ULSA 3F2IA 3ZHXA 1D9XA 2NT3A 4TS9A 4BAGA 1RMYA 4DLBA 3BK7A 1YR8A 3GR6A 1JTFA 3R7LA 3TOCA 3H5AA 3WIDA 1JG3A 1C50A 2B9EA 1XTBA 4EHLA 4H31A 4JB0A 2DF8A 4LKOA 2E4UA 4QNMA 4L3WA 5THQA 2GK7A 5CW1A 3FFTA 1SOWA 1NW6A 1TZJA 1VLLA 5HS4A 4XOIA 5MF6A 3GD7A 4ZK2A 2YHUA 3MGCA 1NONA 2O3SA 3AUJB 4V03A 4WBXC 1NFQA 3RQIA 1C9JA 3H2JA 4MUGA 4DUZB 3HHPA 2AD5A 1AKWA 3F9RA 3MAAC 1AQUA 3BFXA 3VA7A 3NC1C 1K6MA 3WWPA 4BBZA 3HBMA 3PG5A 3BFPA 1ZNZA 1CZHA 4MYSA 4OFXA 4ZCRA 1TYBE 3B6EA 3D8HA 4TUYA 5E3HA 9ABPA 3AUTA 3QXCA 4L8YA 5A9TA 5JMWA 3T41A 2ZRQA 3CZ9A 1E94E 3N2KB 3LBFA 2ONKA 2Z8YA 4GWGA 5I4KA 1BX0A 1VL0A 2CVPA 2FKAA 1JYFA 1PGPA 1G4AE 2RH4A 1DHTA 3BFVA 3G8AA 2YIVX 3IKVA 3QP9A 4G4IA 4XSVA 5CLIA 3IJEB 4NXMB 2ZVPX 4R9VA 4OQEA 5DX8A 1ZHFA 3QBEA 2AN3A 4AZ3A 3O3NB 4P3KA 3QOXA 2VCHA 4ZI3A 2RGYA 2HA0A 4ZYLA 5TGZA 1KO1A 4ZYVA 1A82A 2H1FA 4D56A 1RJDA 3T15A 4PHCA 3U61B 3CSUA 5KSWB 5ADVA 3AEKB 3NFYA 4IX9A 1ZNWA 1EDBA 3CE9A 1GRNA 3NNNA 4C4ZA 2GFIA 1G42A 5HOEA 2FPPA 3DE6X 4I1SA 5KCZA 2W2KA 4BKPA 4BV2A 3HKBB 4PHGA 3RUHA 4N6NA 2R85A 3G3EA 5GQSA 1E6LA 1NVWQ 1F7VA 1DC6A 4M1QA 1GTVA 1KI1A 1Z06A 4YRZA 4B1FA 4Q0MA 3WNBA 4KXXA 5IRCD 1QRTA 3RV4A 1A95A 2W7TA 1JG7A 3RC8A 3JRNA 4HLNA 3JAWA 1S9HA 1A9YA 1GLGA 4KP7A 4QOGA 2WMDA 1DE0A 1K7YA 3GNQA 1UK8A 3WQBA 1YBVA 4MUJA 4BEJA 1WG8A 4ND7A 4XARA 4LTMA 3AR8A 1CTQA 1YCHA 2ES4A 3Q40A 4FGKA 4YCBA 5DNUA 1K89A 1JIKA 4KE7A 1WD5A 3ZD9A 3WQRA 1J9EA 3OJWA 1R10A 4LXTA 2NVWA 2YC4C 4R1LA 2QV7A 4XYBA 4HVLA 5K3EA 2VP2A 2XRFA 5J47A 4O2BB 3C3PA 4A73A 4DV2B 5F98A 2DTDA 1JQAA 1HV8A 2JD0A 3GBPA 3KTDA 2QTZA 4Z0HO 3AF6A 1OROA 3Q3VA 4JLPA 5DCUA 4ENWA 2ZU0C 2VPIA 4IIDA 5BVGB 1HQYE 5KJEA 4OF4A 5E38A 4AKSA 3AR9A 5BSMA 3RYCA 3B6JA 2EEZA 4DPLA 1CQIA 1ZVKA 3RRFA 1XNJA 4EEXA 2ILTA 3T3NA 3MM4A 2DQYA 3D43A 4QGAA 4EYGA 2HT1A 1M7HA 4YDQA 3BXXA 2NO5A 2GTIA 4C14A 2A9VA 1EX9A 1XT6A 2I7DA 5LWQA 1FL9A 1I7LA 1WUTA 3HR7A 4PCVA 3SU8A 2HAEA 9LDTA 4NFHA 2AI3A 5KKCA 1M6EX 3ZVMA 1JEYA 1BDJA 1ZXLA 3ADOA 3DEKA 1E96A 2CF5A 1ZSNA 3ET4A 4FSXA 3OEHD 4KI7A 3T3EA 1SC1A 4WW0A 4H9KA 2ZSKA 1K9SA 2WIAA 4ZZ1A 2YZNA 4LNUA 5GM2A 5B4UA 3WGQA 3BSFA 3NT2A 4JT4A 3VV2A 2PUGA 4GMHA 2AA3A 1KBOA 3U7RA 1MX1A 4R8KA 4BNJA 5CDFE 2BKEA 4IQFA 4WADA 3BICA 2EG9A 3L79A 3GQBA 4UHDA 3FOAA 3NEJA 3T7RA 4MINA 5BW6B 2N42A 5K0FA 1L1EA 1R50A 2Q29A 3H11B 1OUMA 4F91B 2W6IA 1H8ED 3QJGA 3AJRA 3R9XB 2WIFA 3HL0A 1NUPA 1UKYA 3N8KA 4F4HA 3A2LA 3LVRE 8LDHA 3O1HB 4MUYA 3KE8A 2F4NA 1R0BA 4NE9A 4Q9JA 1UZUA 3ANTA 3RUFA 1GLNA 3IHWA 4BQIA 3ELWA 4PGMA 1C7EA 4RPHA 1T2AA 2ARKA 2C77A 3NYWA 4B81A 1NC1A 1SQ0A 3B9QA 4DUGD 4IEEA 3FCAA 2YQZA 4M7WA 3D8UA 5D3MB 1Z3IX 3RKRA 4Q3AA 5ALGA 5IARA 3RIXA 4LC9A 1FNCA 1RFLA 3STXA 4ZI7F 1F14A 3UT5B 4C4TA 3MRTA 4FFLA 3RC3A 1SQ5A 4YN3A 1L5SA 2DBZA 2QD3A 5FJJA 3UC9A 1BFDA 1KJ8A 1QTIA 1HBJA 2DKOA 2WSSD 4NBUA 3S5JA 2VRCD 3CUTA 3V5NA 1NDQA 4HLQB 4DA4A 1J56A 1QU3A 2IKSA 4LWOA 4PAGA 1D8AA 1GTL1 4EHFA 1RS0A 2ZXEA 4CMJA 1ICEA 3MRXA 4Y2HA 4D4IA 2WP8J 1TQ4A 3JR7A 1OXUA 2B9VA 2NLOA 3JZMA 2IQIA 3K53A 4I1OA 2ZPTX 1JMVA 4P98A 1LVGA 4XWGA 2VBIA 2VLBA 2VT7A 1VPEA 5E95A 2C1XA 3GG2A 4JGGA 2SCUB 1G3UA 2C3PA 5KC9A 2QYHA 2TMDA 4B5LA 3P4YA 1IEQA 3S1AB 1PG0A 4Z4EA 5EINA 1OA0A 2O06A 3ZDRA 1M2FA 3SSAA 1SCBA 1OH6A 3JQ9C 4B40A 1Z38A 5H16A 3WQQA 2E55A 3GFPA 2N1MA 2WUFA 3B70A 2DWQA 2A5LA 3DJFA 3IDQA 3O74A 3GLIE 1JAIA 1A9RA 4WBSA 2PIDA 1H0KA 3RDPA 3I32A 2IYVA 3MTJA 3I39X 3V1TC 4EJSB 8AT1A 3RD5A 2XGOA 2Q7DA 3NZEA 1W0KA 1JHVA 1SUEA 4ENRA 4MK4A 4ETMA 3FYSA 1U0HC 3OD1A 2WLTA 4UU7A 3ZTTA 1Q50A 5EMHA 4UQLA 1ZC4A 1HFJA 3E4DA 3E5NA 1U3VA 2G09A 3ZG6A 5HKKD 2HQ1A 3GP5A 1V8PA 3UAWA 3D2BA 3LLCA 3OQJA 4O33A 4RY9A 4KXNA 5E9JA 3UUGA 3UWKA 5AW5A 2ACVA 2AC4A 2HCFA 2WBLC 2AE1A 3K0KA 4JI8B 1CXZA 5J1TB 1Q19A 1Y3FE 1OGIA 2OFWA 3JCZA 2V9CA 4YBRA 3LX5A 4DXDA 3HEBA 1U7UA 1PLLA 3EAGA 3RSCA 1TCCA 4NCHA 2DPMA 3VTFA 1QUFA 2EKBA 4ZEVA 2VQ6A 3HCWA 3R3YA 3DDWA 2QPTA 4PSVA 1NJGA 1X13A 2YMQA 3D7LA 1YH3A 5AK6A 3CXUA 4YY3B 4CWAA 1AO0A 4HEHA 3WNZA 3FZEA 5CX1A 3OF2A 5BQXA 4CLRA 2QLBA 4RWZA 4D0GA 4MQLA 2O14A 4CNBA 3JALB 2FSUA 3OZTA 5JTTA 3DZJA 3F2VA 3H1FA 2IYRA 1FQKA 4IOKA 1X9GA 1QIJA 2HPHA 3NETA 2OV2A 3KFVA 1N9GB 3MMNA 4M8KA 5HJ2A 2CMKA 4RAQA 3WYCA 1USUA 2JJ1D 3O8QB 2UAGA 2C82A 3B7GA 4MJLA 4Q1AA 2Q1TA 1NWCA 5JZ9A 4BAZA 1WUHS 5K99A 3T95A 3BSWA 3TSZA 3GBSA 3WNVA 4BLWA 3WDSA 3VAYA 2CLDX 2Q1UA 3OU7A 2DXIA 1JILA 3PR1A 2Z95A 3IMEA 4XX1A 3UHAA 3TINA 4TLAA 2LDXA 3OBIA 3L8CA 1CS4C 1HE8B 1K8XB 3FH0A 4UTXA 4DUPA 5F23A 4E13A 1N2HA 1BEZA 2HLHA 2IYAA 4K2HA 3TAXA 3HA2A 2YMPA 2ZOSA 3N0WA 4M22A 4M9RA 3IHLA 2WJPA 1VL2A 2Q9AA 1IJFA 3ORYA 5EWMB 4F5YA 3K09C 1X7HA 1KI9A 3JD4A 4MV7A 3J80A 1RCUA 2ENWA 3DNMA 5FA5A 1LBQA 2PKCA 3REQA 3ZXIA 2REQB 1AHPA 2LPMA 2ZTSA 1WS6A 4W9RA 2QTCA 3PWZA 1LPPA 5HFJA 4K6OA 1KC1A 3QTLA 3TJZA 2CNNA 3N2GB 1HE5A 3U4AA 1GZ6A 5JAOA 2ZIFA 2V7XA 4Q6WA 2AMJA 5F35A 2FMUA 2W2LA 2XT9A 4CLOB 4XWWA 3I61A 1M2OB 1NF9A 3T5TA 1UKEA 3LT4A 1K6JA 1YJ5A 4PX3A 2IEGA 3U16A 3DBOB 4FMPA 1YZ3A 5JRZA 2EX1A 5ES4B 3K5WA 3QOWA 1DX6A 4B09A 2AHRA 4MVCA 4YDHB 2OYSA 3FPKA 2JBAB 1ZWKA 2XIQA 4TMFA 3ZHCA 4CCYA 2VPYA 3MBIA 3AUYA 2Q28A 3R09A 3KJIA 4ZVLA 1N1EA 4DAEA 3EZLA 3HBAA 3QYFA 4WOKA 5KYVA 2E3JA 3KXIA 4BNVA 2G9UA 4BFXA 1Y9JA 2XI4A 5JQGF 2P69A 5CVTA 4JR1A 3QG1A 3NPAA 3NHRA 1JWAB 3EARA 3BIOA 3OI7A 1D7AA 4UUAA 2FRVA 4PYJA 4D9BA 2WZQA 1PK9A 4KBYA 3ITNA 2J85A 4CKWB 4X1KB 2LKCA 1L5KA 3CLTC 3ZS8A 1Y82A 5F3DA 1QRRA 2AOXA 4ISBA 2AXQA 3TRFA 3L6UA 4YR7A 1OU4A 2I2AA 2Q49A 1LTQA 2VBGA 3HKDA 5IU6A 4RIHA 1M33A 1V7CA 1JEJA 2ADMA 2CL6X 4IGAA 2TS1A 3PHGA 3OT5A 1YS1X 4L6IA 2CV2A 3H1TA 5TPZA 5KINB 3NRCA 4UVGA 2UYGA 1RC1A 3HP7A 3GRKA 3U56A 2FSGA 1YU9A 4RFSB 1KVUA 2CWDA 4PYOA 4X20A 1L5OA 2FEOA 4RF5A 4B7CA 1TUBA 2PHZA 3AFHA 2HHLA 3UAXA 2QZ9A 1R9NA 1MRNA 3DR5A 2WR8A 3LCCA 3AIKA 4S1OA 3JYOA 5DHSA 3FKJA 2XJ9A 3H3JA 3BCHA 4QRHA 1GCIA 3V6LA 2Y77A 1ZM3A 2HSDA 3KHKA 3I4FA 2G5TA 2F67A 1P2GA 3W6PA 3AYZB 2WV7A 5KNLA 3NGLA 1DLIA 1T3SA 1U28C 1WKCA 3LRPA 3RB8A 3O7WA 2HZ7A 1KXJA 4I7EA 4DRZA 5I7WA 1M8GA 3JTMA 3KJXA 4IW3B 4LI3X 3KETA 3M6WA 1J22A 3Q41A 2HWXA 4XM2A 2ZYIA 4ZO9A 1D04A 4JASB 5C32A 1JEEA 1X1CA 2J33A 2QRMA 4N0DA 3CWCA 3FFWA 4IWNA 2GN4A 2Z4RA 1EFPA 4EAAA 3UPTA 2IE8A 3KEGA 1P7WA 2BKAA 1CZUA 2Z09A 4BNKA 5KU1A 5HIAA 2I6QA 2LP4Y 2QT9A 4LDZA 821PA 3EIFA 5J4KA 3O38A 2B4KA 3PPWA 1OZAA 2ZI7A 3O90A 4YRJA 1F1JA 5IN4A 3SZGA 2X5XA 1HE2A 2X8JA 3AR7A 4IDNA 2Q4OA 2XQJA 1UBOS 1VL5A 2IHKA 2PWBA 1XCGB 1Q95A 1LPBB 1KYTA 1QJ4A 2JIPA 2PS9A 3COWA 3P94A 1YDMA 4J07A 3N7UA 5C4GB 3ZBPA 2PUHA 2RK3A 4NEQA 4Y67A 3SIWA 1HDCA 5FDFA 2JEZA 1WJGA 1XQYA 3TD9A 2H00A 2R5NA 3ESZA 1G3QA 4ND8A 4QPNA 3ZY2A 4OHZA 4EFDA 4WXPA 5FWXB 1JLMA 4XCVA 3PNPA 1CFZA 1E3TA 4HRAA 4IUDS 1B6TA 4FFNA 2VJYA 2D3TA 1PZHA 2OR3A 4WLNA 4DJEC 5K6AC 1D6SA 2B1IA 2EU8A 1NDUA 3ZZNA 1MOZA 1DJNA 1ZJ4A 1F8GA 2J46A 3CH4B 3DE5X 4BWFB 3UT6A 1GAXA 4MR9B 2AGVA 5JT1A 1NR7A 2IC5A 2XTMA 4IINA 3L40A 3FLBA 2DZDA 3E7PA 1U31A 3DEHA 3NP7A 4OQZA 4QQ8A 5EIEA 4GL2A 2GERA 1ABBA 3KB8A 3ZKAA 5DNVA 5BMVB 4IJVA 4TYYA 4WN3A 2BHSA 2FPGA 2WYUA 3G8CA 2OD2A 5IF9A 2BYTA 2F8SA 3PFBA 1LCIA 1ZVMA 2JGEA 5INTA 1GKLA 1NKTA 5E9WA 4OLFA 2BGWA 4J6EA 1KJIA 1ZEMA 3OQ6A 5AJVB 3COJA 1TJ4A 4EGFA 5EE5B 1PYOA 5ALMA 4PTLA 4BRSA 2XY4A 3SQXA 1O6BA 2YMLA 1XVAA 5JWOA 4HAXA 3U3KA 4Q16A 1QONA 4KUHA 3AJAA 4B7UA 2I65A 1H2ZA 4TKVA 1KDRA 7MHTA 2GHTA 3ZU5A 1UANA 1PFYA 3IUEA 1T1JA 1V3UA 4WK4B 3TBKA 4C7MA 4R8VA 2ECFA 2ECQA 2WVJA 2V8OA 4PRZA 4ROSA 4N82A 4ZGBA 3OG9A 3RBZA 2Z8YM 2HLPA 2P1RA 3L1IA 3NRBA 4PRYA 5ARBA 4BVJA 2D7DA 3L4KA 4EO7A 1AUXA 1RWOA 1VIMA 2GBIA 3WZ2A 3FOFC 5K3BA 2WA1A 1V41E 4YV1A 1GAWA 3JZDA 1AXRA 1ZD9A 3B5EA 3NDPA 4OGKA 4PZ0A 1PR0A 3GNSA 4PICA 3OTHA 4YLEA 2PA3A 5L51A 2GJKA 3OQIB 4BECA 1TD1A 5HVNA 3DTNA 1TTPB 3SSOA 2FPWA 1M7BA 3LBHA 4W7HA 1XEWY 1BE0A 1ZNYA 2CFTA 4P7FA 1CIJA 5FR1A 3TVYA 4ADSG 3D64A 5AM1A 1YQUA 1P17A 3K9LA 3UW1A 3ITDA 3ZNQA 4AJIA 4EF6A 1M2HA 3JARB 1G1MA 3A1SA 2HFKA 1HYBA 4NJMB 4QUGA 1XLTA 3VI3B 2WM2A 3C48A 1F4LA 1JMKC 1OFIA 3VPAA 4IDEA 1U2TA 1I30A 3M7IA 4LRUA 3ZIUA 5BSVA 3L5OA 2ORIA 3BTUA 3D5EA 4DLPA 2FWAA 6LDHA 3O4VA 1SC6A 4ZVRA 1I4OA 2FOIA 5GJVC 1SWWA 5KTKA 4HDRB 3JVVA 1XZ8A 4JL8A 4AJEA 5KYWA 2DMRA 2QL9A 1BXGA 4TVBA 1SY7A 2WWTA 1QZUA 1SQSA 3LQRA 4CMAA 2TMYA 2IPNA 1TKCA 1JJVA 4NHEA 4Y0NA 3WDLA 3BS4A 1G291 1WKBA 2PQ0A 1ZA1A 2Y1XA 1E9CA 2A1TS 3K9GA 4TS1A 3UB4A 2IUFA 3OQVA 3CPHA 4GEGA 2ISQA 4LOJA 5ICGA 1ZONA 4I6EA 4RHYA 2JFFA 4EA9A 4MVJH 3GPLA 3A3KA 1QF7A 1E9BA 2Z2YA 2UKDA 1YAHA 3LQKA 4WJZA 3IRUA 3KLNA 5GV8A 4E14A 5ALVA 2IHVA 3BL5A 3LL7A 1BS2A 2YZ7A 5K03A 3D6MA 4PZEA 3K1AB 3V1YA 3VNAA 3C6MA 1PKEA 5FH9A 1NNUA 4GXQA 4FJ0A 3RIYA 4P2GA 1OILA 4DB4A 4MR7B 2FW0A 5CFRA 3ZWYA 4UFNA 1T3HA 4Q1DA 3CA8A 1JDBC 3AB3A 3P20A 2XQGA 3LNTA 1SZDA 2BLLA 4B6GA 4PYMA 1DAFA 4IGEA 2Y27A 4H9GA 4WOJA 4Q93A 2GETA 4BMNA 5CDHA 3PE4A 1G5IA 3BZBA 4RF4A 2XOKA 2WUVA 4Z3DA 2Q1XA 5IS2A 3PUXA 4EYKA 4EY5A 1FXUA 1WP9A 3WP1B 1H94A 2UVPA 4DIMA 4O4JF 1G41A 4KQFA 4RANA 5DOZA 4EWLA 4O4HB 2JI4A 4PPYA 2JAHA 4YC7A 2P5SA 1ATZA 2DM6A 3PK0A 4JSTA 4KQ2A 4CM9A 1QYCA 3STWA 1P5FA 2P5TB 4XWYA 1N6PA 5CH8A 3D8RA 5IJ9A 1KYYA 3K9CA 2QMUA 3WLJA 3RREA 4Z4FA 4NLLA 4C01A 3HDTA 2ZRCA 3AC0A 2A9FA 1TZ2A 4GWKA 4PGHA 1RP7A 1W75A 1CEXA 1PV2A 4IXTA 1QQ7A 3G59A 4C6HA 3T1TA 4DM3A 1LLCA 2NQ8A 3P4UA 4EGAA 1I2CA 4R81A 3EY9A 2MYPA 4AN4A 5CB8A 3F1KA 4MDEA 1MT0A 2CLSA 3R3ZA 1P9OA 1JWBB 2B8TA 5IT5A 2IBTA 3ZCTA 1CUUA 2ZR0A 5KDLA 1Q84A 1ZUIA 3ZOKA 3AKEA 2IXFA 1JDTA 3ORSA 1NVBA 1IZYA 1PS0A 2RH9B 2VH1A 5CDTA 1J42A 1K7CA 3VU9B 1DKQA 3PVCA 1KY3A 2QPOA 2NU8B 2AZDA 3SBOA 4R8RA 1E4VA 1VG9B 1P6UA 2YICA 4IIJF 5TT1A 4B2YA 1GGFA 4QHTA 3KEMA 3O9MA 4E09A 3I5UA 3LSYA 4BCDA 4DARA 4WBNB 1FSFA 2PY6A 3MT8A 4HNVA 2C4MA 4GX0A 4M1SA 2GKGA 3V42A 3T7EA 4XLLA 5CB4F 3N39C 2LCIA 2R79A 4XA8A 2W6ID 4TXNA 1JAHA 2B4RO 3T4PA 1SWVA 1IOZA 5JNSA 3BE6A 3PQ4A 3QELA 2FPOA 1QNLA 2GPTA 2PU5A 1ORIA 2VSYA 1KH2A 1IG0A 5IUKC 1XPOA 2PV7A 2DHRA 4EI2A 2Q1YA 3M82A 4WIAA 4CEJA 3OTWA 4O4IA 3FMOB 1V8OA 4CIWA 3L7CA 3DDSA 1H3FA 3D5TA 3DBHB 4MMYB 4GBED 3W5IA 1AV6A 3Q9SA 3DXZA 1O95A 1H2HA 4Y2JA 2A35A 2I71A 2V6BA 1JDSA 1IH8A 1ZGCA 3BVPA 3H1AA 3Q7EA 4IDFA 1IHDA 2ATVA 4YJFB 4YMIA 5AQEA 5YASA 3WV5A 4I5FA 3AP1A 4EO9A 1AKQA 1TCUA 3GLHE 4M88A 2X3UA 2UYHA 1FRNA 1VE1A 3TLYA 4ZI7A 1IWPB 4G8DA 1G8SA 4NEHB 3TNYA 4EMSA 1JXAA 4P3NA 3WLIA 1X14A 4EG8A 1TZMA 3BOSA 2AG6A 2CVQA 4IVPA 5IXSA 1K2VN 2B5WA 1Q1GA 1Z08A 1UPBA 2F17A 1L7MA 3DGFC 2JAWA 4O2AF 2PUEA 2IDJA 3HUMA 1E98A 1CNMA 1KSHA 3PTZA 2VRBA 3I9LA 4NC9A 3FMVA 2QVXX 4KPUA 4U0JA 2Q4EA 4MPPA 4BE4A 1Q5PA 4HRXA 4IL5A 4U2DA 1XNRB 4DV4B 2BFAA 2IXBA 1NSTA 1ZM7A 4U2GA 2FY8A 2O5CA 5I9BA 5AKHA 3PC6A 2ATEA 1A5ZA 1JDZA 4MWEA 2HJ9A 4MARA 2JZCA 4NF2A 4Y2VA 1SMKA 5ICEA 2RKBA 2WJZB 4KQIA 4I3FA 4LDRA 4NOLA 4OLHA 5IJAA 4ZEWA 1KDYA 4TKUB 2GBFA 5AI4A 4BLRA 1FU7A 2DWOA 4EB6A 3AERB 3I5MA 1HDIA 5LYYA 4D97A 3CPSA 3W2EA 4II2A 3HDJA 2AN9A 1OBCA 5C4IA 3G7SA 4MS4A 3R4VA 5KEIA 4NXNB 1U8XX 2DY1A 3QXHA 1ZUWA 2EZ8A 3COSA 1PT9A 2NG1A 1P0QA 5J5AA 5BN4B 4FS8A 4MA0A 3PXUA 2QXTA 2OAEA 4R2HA 4YREA 2Y6UA 2A14A 3MMSA 4LKRA 3OLXA 1U0JA 4Y0AA 1FP1D 3CG4A 3HJAA 2V0GA 4J3FA 1EQUA 2PSEA 1I2DA 3SC2A 1SCDA 4NCXA 5HZKA 3UPDA 4RKYA 3JYQA 3K6RA 3N5KA 1U1CA 5K9ZA 3EF0A 1JKMA 2O8VA 3H05A 1YVDA 2ZW9A 3I04M 3VDNB 3T6KA 3WB0A 3TUZC 3TLMA 1AD2A 5ALRA 3EEIA 1FMJA 4YIKA 3S1LA 3ZNPA 5KOJB 5KWSA 1UFQA 3G85A 3OIDA 2NU7B 4FW9A 3UJ3X 5BR1A 4RZ2A 3L4JA 1DIGA 1SULA 4KX3A 4Q39A 5KHLB 5BVHA 2ZXUA 1QLJA 3HA7A 4GXTA 4TLEA 1GQ2A 2WK1A 3ZD6A 3RAEC 1WMFA 4B46A 1Z5WA 3QYJA 2PCJA 3Q87B 3G49A 5HP4A 2ZYVX 2IDMA 1MRSA 4FGSA 5CVCA 5DMHA 4Q66C 2YFKA 2VJMA 4QJ4A 1QHIA 1X92A 3HU1A 5EI5A 1G3MA 4K9QA 1SVNA 1ZNQO 1OAKA 3J81k 1E79A 4FSDA 3G6WA 5ALLA 1N7GA 4KGDA 1GGHA 1V5GA 3CRW1 1NT2A 3LUDA 3TSWA