4YV0A

Crystal structure of trypanosoma cruzi spermidine synthase in complex with (2s)-n-methyl-n-phenyl-2,3-dihydro-1,4-benzodioxine- 2-carboxamid
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
269
Chain Sequence
GWFREEPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
pubmed doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
total genus 92
structure length 269
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yv0A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yv0A02
1R8XA 3G89A 4CWAA 4YV0A 1EJ0A 5CVUA 3PX2A 4GOND 5HILA 2AZTA 1RI4A 3UJ6A 5FWAA 5E1BA 3VSEA 4X60A 1JG2A 3S68A 4RV9A 5K0EA 4FSXA 1R8YA 3NJRA 2VP3A 3EEYA 2HV9A 3C0KA 5GM1A 4RTSA 3TQSA 3KR9A 3FZGA 3ER9A 2G70A 3FTDA 1SG9A 4OA8A 5K01A 1JTEA 5FQOA 2YXEA 4UOEA 5FHQA 3V8VA 3LDGA 4C04A 5LR6A 2P41A 2XYQA 3MCZA 1G8AA 3THRA 2P3QA 1YZ3A 3LBFA 2ZBQA 1EJ6A 3G5TA 3E7PA 3O31A 4HTFB 4FZVA 4PYQA 5EVJA 5LQNA 5HIMA 5LQRA 4OA5A 3BKWA 5ERGB 3P8ZA 2UYQA 3SSMA 3G88A 3NW9A 1NE2A 2FCAA 1YZHA 5C9ZA 1RJEA 2ZTHA 5FTWA 3ORHA 3EVCA 1H1DA 2ESRA 3UA4A 5T64A 5HFJA 3Q87B 3DMFA 10MHA 3OZTA 5C1IA 4E31A 4BP1A 3GXOA 1P91A 2NXCA 3M6XA 1B42A 3FYDA 1QAQA 5CUQA 5EEGA 4JXJA 4POOA 3LDUA 1YUBA 3CCFA 3F4KA 3LBYA 2P40A 2I62A 3UJBA 5LQUA 3FUUA 5E2BA 4GOMD 3OFKA 1BKYA 2EFJA 1JSXA 2ONYA 4PGGA 3KQVA 3O7WA 3PS9A 3G2OA 3M6UA 3OU7A 1UWVA 5HIJA 1NT2A 4IWNA 3FUTA 3G8BA 2P7HA 3FTEA 4DF3A 3IYLW 2JHAA 3CBGA 1FP1D 3KHKA 5B1SA 2PX8A 4AZTA 1YF3A 2IDKA 2ZWAA 3HCDA 4QQNA 3BWCA 3E8SA 4IV0A 3HM2A 3LCVB 5DX0A 4G56A 3RODA 4C4AA 4ER6A 3NTVA 4CXMA 4P7GA 5DTRA 1IXKA 4E2WA 3KU1A 3HTXA 4EMSA 4YV2A 2ZIGA 2AOUB 5LQKA 2GS9A 3FUVA 3ELDA 3REOA 3GRRA 2JJQA 2PXCA 2WK1A 3R0QA 5CVJA 1PJZA 1KPHA 3PLAE 3CGGA 5F2NA 4FR0A 4AX8A 5ICGA 3DMHA 2UYCA 5CVEA 5CCXA 5ICEA 2N47A 2AOXA 3T0IA 3EGIA 3B5IA 3MTIA 2PWYA 3SXJA 3ERCA 5LQJA 2QY6A 3EEOA 2NXJA 2YR0A 3FPEA 2CWWA 2ZLBA 3QV2A 2NP6A 1G38A 2PLWA 1D2HA 1R74A 3DUWA 3OU2A 4XCXA 4C03A 2BR3A 4EQZA 5IKMA 3HEMA 4YV1A 3GRYA 2HR1A 3KQOA 3TKAA 2G8NA 5JR3A 4BP3A 3AY0A 4R05A 1RJFA 1HMYA 2ZVJA 4EK9A 2ERCA 4MHTA 3BT7A 2EJTA 4MWZA 2NNWB 2AVDA 3CJTA 3G2PA 2G71A 3HCEA 3KR0A 4P7JA 4HC4A 1OR8A 4XUDA 3CJQA 3UJCA 1Q0SA 2XBMA 2IGTA 3BWMA 4PYIA 4X1OA 2VS1A 3LX6A 2G72A 3AJDA 3HVKA 4BY9E 3GRZA 3UJ9A 4LWOA 3DXZA 2VZ9A 2GLUA 4OBXA 1EG2A 4BLUA 2QYOA 3BWYA 2ZULA 3JWHA 2CMHA 2AOTA 5D1HA 2HWKA 2P7IA 3HA7A 5E2AA 5E9JA 2EG5A 3TM5A 5K0NA 4KDRA 2P35A 5DX1A 2QRVA 3DXYA 5EZQA 5U4XA 5DSXA 3TFWA 2Y1WA 2GA9A 5GIOE 2QM3A 4H0NA 4C08A 1R6AA 3LCUA 2PY6A 3A26A 4FT2A 3TR6A 3P9CA 4M37A 1EIZA 5CVVA 3OZRA 3LECA 3LKZA 1F38A 1XTPA 3DLCA 4RWZA 4V0RA 5DX8A 4ZTBA 3LGAA 3SVZA 1FP2A 3IEIA 3DP7A 1M6EX 2BH2A 1KHHA 2VDWA 4KDCA 2AN4A 1L3IA 1YB2A 2JHCA 3VC1A 4AUKA 4QTTB 3GNLA 3A7DA 3LSTA 3RW9A 2B9EA 3PX3A 3KPJA 5K03A 2GPYA 2GB4A 4C05A 2OB1A 1JR4A 3GRUA 5EQJB 4HSGA 4BLVA 3KPYA 3B3JA 2VDUE 3DMGA 1UFKA 3MERA 4KW7A 4R6XA 3E05A 2H11A 4CTJA 4RTRA 4MTLA 5EKUA 5H02A 1QAOA 4PNEA 3BGIA 4RTMA 1KPGA 3H2BA 1G8SA 4ISCA 5G02A 2BM9A 2A14A 2XVAA 2IPXA 1L1EA 2AN3A 2B78A 2O07A 2QE6A 1NW8A 3EPPA 3FPJA 1N2XA 3FPFA 1VLMA 3A27A 5EHGA 5EMMA 5K05A 2ZCJA 2PKWA 1U2ZA 5MHTA 4PCLA 5K0JA 2AOVA 4BLWA 1RI5A 2FK8A 4GC9A 3NWEA 1BOOA 3CJRA 1KR5A 3MAGA 5LSAA 3UJAA 4U7PB 2IP2A 5GM2A 5CIYA 3DH0A 2FPOA 1X1BA 3M6WA 4PGHA 3BUSA 1XDZA 2ZZNA 4R6WA 3BWBA 5ICFA 1UIRA 2GH1A 3E23A 3AXTA 3EVFA 1SVUA 3G5LA 1NW5A 2B2CA 2YQZA 2F8LA 3OE5A 4IKPA 4U7TB 5EHIA 5BW5A 3FRIA 3JWJA 2R3SA 4DCMA 3EGVA 1JQEA 2PJDA 4RVFA 1RI1A 1TPYA 1ZHFA 4RVDA 3C3YA 4ER5A 4QVGA 2IDJA 2C7QA 3T7RA 4FSDA 4PIPA 2EJUA 4YMGA 1Y8CA 3ELUA 1AV6A 5EC8A 1NBHA 2AR0A 2IFTA 1WXXA 1KIAA 1P1BA 5E9QA 3UA3A 1VIDA 4AZWA 4KVZA 5FCDA 5BXYA 3JWIA 5DM0A 2P3OA 3EVBA 2O0LA 4RVGA 5DLYA 2JH8A 2ZBPA 3M6VA 5LQCA 1HNNA 4XUEA 3P2EA 3ELYA 1IY9A 5LQAA 2JG3A 3DOUA 2ZIEA 2OY0A 2FYTA 2PBFA 4KIFA 4GBED 2YTZA 3G2QA 3SM3A 4EVIA 3KPWA 3LL7A 2OPBA 4PYNA 3C6KA 3P9KA 1X1AA 3KR1A 5EPEA 1VBFA 5DM4A 2PWPA 5EKXA 2PX5A 1ORIA 2JHPA 3CC8A 1NV8A 4X61A 4GF5A 1JTFA 3OE4A 5CM2Z 5K0BA 2Z6UA 5E8RA 4YUWA 5K8VA 4YUYA 1FBNA 3DLIA 1FJXA 4RTOA 1KYWA 3C3PA 2AS0A 4GC5A 5E1MA 3I64A 2PT9A 3M70A 4OQEA 3WSTA 3B3GA 3FUWA 3FUXA 1WY7A 4EKIA 3MCTA 3PT9A 4KIGA 4A6EA 2Z6AA 3B3FA 3NMUF 2UYOA 1QZZA 1RI2A 1NV9A 3HA5A 4FP9A 5FQNA 4L7VA 5C0OE 4LECA 2ZWVA 4E32A 2E5WA 3A25A 4QDKA 4AZVA 2PT6A 1DUSA 2Y1XA 3DXXA 3PFHA 2AN5A 2AVNA 2AOTB 3P71T 2OKCA 1F3LA 3G8AA 4M38A 4PINA 3SSOA 2G1PA 4YMHA 4Y30A 1O9GA 2QRVB 1Z3CA 5DTQA 1JG1A 1DCTA 1G60A 3T7TA 1BHJA 3HP7A 2PX4A 2CMGA 4WVLA 3MTEA 4QPPA 4E2ZA 5K0CA 3UJ7A 1JG4A 5FHRA 1T43A 5K0FA 2O57A 2IH5A 2UZ4A 1NBIA 3SGLA 1JQDA 2XVMA 3EVGA 1X19A 3HCBA 4P7KA 3KKZA 1EAMA 4XUCA 2P8JA 3EVEA 3M33A 4HRAA 4P7FA 1I1NA 1RJDA 4GOOD 2XYRA 3KQSA 3PTAA 4PCAA 4CTKA 5DXJA 5EEHA 3LKDA 3OU6A 4Z2YA 3TLJA 2NP7A 1R18A 3EGEA 3LDFA 3OCJA 5EZSA 1G55A 4PYKA 3GGDA 1ZGJA 2B25A 3OPNA 1SUSA 3JWGA 5DXAA 3AXSA 3EMBA 3TKYA 1XDSA 4C06A 3R3HA 3UZUA 3VYWA 4RYLA 4RSRA 3UFBA 4YUVA 2PGXA 3NVKI 3FYCA 3BGVA 4X41A 2PSSA 3FPGA 5E1DA 5BW4A 3KPVA 3P9IA 1AQJA 1ZQ9A 1VP3A 3SX0A 3KQMA 4GUAA 3I58A 4E33A 3THSA 4ER7A 4A6DA 3R24A 4V0QA 5BP7A 1RI3A 7MHTA 2I6GA 2FHPA 3M4XA 2ZW9A 3RIEA 4PWYA 5GINE 1NW7A 4HGZA 3GDHA 5CD1A 1BC5A 1ZKDA 5HEKA 4C07A 2EX4A 2LD4A 2PXXA 1INLA 3MGGA 4QQKA 4ATNA 3A7EA 2ONZA 1M0EA 2HNKA 5KS2A 4R8RA 2ORED 1WS6A 1FPQA 2R6ZA 5DRYA 3GU3A 2B3TA 4K6MA 5DSTA 3TM4A 2ZBRA 3IHTA 2ZZKA 3UJ8A 3UJDA 1SUIA 5K09A 5GWXA 4O29A 5DM1A 1D2GA 2PV0A 2BR4A 4MQ4A 5FULA 3A4TA 3ER8A 1X1CA 5FWDA 3X0DA 3FPHA 3GRVA 2UYHA 3HVHA 3ANXA 3KQQA 2C7OA 3IV6A 3MHTA 3B7PA 1MJFA 2ADMA 3TOSA 4PYMA 3MQ2A 1NW3A 3NVMB 3OFJA 5K0LA 4DQ0A 1D2CA 3VC2A 3G7UA 2NYUA 2GAFA 3I5UA 2I9KA 2ZZMA 2H00A 5EMKA 1XDUA 2P1DA 3R9XB 1VL5A 3BGDA 2OXTA 4B17A 4X63A 5EMLA 5E9WA 4EKGA 2HMYB 3NDIA 3U81A 4RTLA 4QVKA 1G6Q1 5DWQA 1SQGA 3HCAA 3I9FA 5F2OA 1AQIA 3PFGA 4YUZA 2PX2A 3CKKA 3ME5A 3PVCA 3Q7EA 2IBSA 5DPMA 2YX1A 1L3BA 5T6BA 5GOZA 1V39A 4QPNA 3P9NA 3KQPA 4HGYA 3FTCA 5KQRA 1XXLA 1TW3A 5HIKA 2O06A 1Q0TA 5EOVA 3UBTA 3GWZA 3MB5A 3T7SA 2KW5A 1KYZA 5DTMA 1IM8A 3EVAA 3KQWA 2K4MA 4M7RA 3OZSA 3UWPA 4DCGA 5HOQA 5FUBA 3ELWA 3HA3A 2I7CA 2BZGA 5IH3A 3EVDA 4OBWA 1XCJA 5CVDA 5EIWA 1PRYA 1O54A 1NW6A 4DM3A 1YFJA 4P58A 3HCFA 3HNRA 5DT2A 4ER3A 1KXZA 2YVLA 2V7EA 1DL5A 3P2IA 5FADA 4KWCA 3GIWA 2XYVA 1VP9A 2CL5A 1VPTA 1ZG3A 3BXOA 4PYOA 3NWBA 2WA1A 5E1OA 1KP9A 1M6YA 5EIFA 2IBTA 3HVIA 4QDJA 2C7PA 4PYLA 3B89A 2DULA 2ZIFA 4OX9Y 1P1CA 4PIMA 4FT4A 2CKDA 1ZGAA 3P2KA 2NXNA 5JUWA 1XVAA 3I53A 5DRTA 5GIPE 2V74B 1JG3A 3NDJA 1N7IA 3K6RA 3KQYA 2IH2A 4HTFA 3DR5A 2YUIA 2ZFUA 4FS8A 1JSZA 4Y2HA 4M36A 3KR2A 5T67A 1QANA 3TRKA 2VDVE 3KQTA 4HH4A 4RTKA 8MHTA 2OB2A 3SSNA 4GEKA 3ID6C 4GOLD 3PB3A 2BR5A 2DPMA 3FRHA 2FRXA 4E30A 2IH4A 3AWIA 3CVOA 3BKXA 4NECA 5EMJA 4FGZA 3D2LA 5P8WA 4DMGA 4DZRA 5M5BA 3QOWA 4IV8A 5EG5A 2ZSUA 4DKJA 1P39A 3HCCA 4E2YA 4RTJA 2YXDA 2AOWA 5FA8A 1XJ5A 2OBFA 3SR4A 3V97A 4KRGA 2YXLA 3TMAA 4PYJA 5FA5A 1WG8A 3GCZA 4MIKA 3FTFA 5F2KA 5KQSA 4E70A 3R6TA 4R8SA 2FK7A 2NXEA 3GJYA 2PXAA 1I9GA 3HVJA 2P3LA 3C6MA 1JQ3A 1RJGA 1SQFA 2AOUA 3EMDA 1R00A 3O4FA 1N7JA 5HIIA 4RX1A 1XCLA 2OYRA 2OO3A 3K0BA 4AZSA 5EGSA 5CCBA 1MHTA 1VQ1A 4RTNA 2JH9A 2IIPA 1WZNA 2PVCA 4LWPA 2HTEA 4CKBA 2Q41A 4F86A 3L8DA 5ICCA 3DTNA 2O05A 2WA2A 1TW2A 5HZMA 3G2MA 4GQBA 4YUXA 4F84A 3BZBA 1KPIA 4LG1A 4CKCA 5KYGA 5KVAA 1I4WA 1SKMA 1X1DA 3TPZA 3EVZA 5K0GA 4DA4A 4RVHA 4E2XA 3KPUA 5D1NA 5E8JA 2OZVA 3GO4A 4WXHA 4ER0A 2H1RA 1AF7A 1EQAA 1QYRA 1ORHA 1QAMA 1L9KA 3LHDA 4QTUB 3SMQA 1YFLA 2Z6QA 4CKEA 9MHTA 5GP1A 1VE3A 4F85A 3LCCA 3DULA 3P97A 4OQDA 3QOXA 2BM8A 4RTQA 5DM2A 4PONA 1NKVA 2C7RA 4RTPA 1O9HA 1L3CA 1WXWA 3LPMA 4HG2A
chains in the Genus database with same CATH superfamily
2FSVC 3U1VA 1NYTA 1RVV1 1GR0A 2BGTA 1C1XB 4YV0A 1EJ0A 1WMDA 4IIHA 5A3QA 5JT1A 1DGQA 3HB1A 2P30A 4KPUB 1NJ2A 1S3FA 1AGYA 1C80A 5DISB 4MW0A 4UEKA 5DGXA 4V03A 1YMQA 2V6JA 1JVBA 1YHZA 1OXXK 2GHIA 3JYHA 4PAMA 5DSZA 5DNYB 4D42A 1FMCA 4GLOA 1KHTA 3CN9A 3RSOA 4CU2A 2O8CB 1UBEA 4LMAA 3CRVA 2DHCA 3DCNA 5JWOA 3A9RA 1Q95A 2Q7OE 2G9ZA 2XF8A 2LKCA 2E4ZA 4ZOAA 1K7EB 4RQBA 3A6KA 3THRA 3H5AA 2Q6OA 2YWHA 1CUDA 4JEHA 3H5IA 3NTOA 3U3XA 2AL7A 1H2BA 1KRHA 2BGNA 3DDZX 4J4HA 1V7PC 4LZPA 6GPBA 5DH9A 1RC0A 4DV2B 5ERGB 5KHAA 1P1IA 5E2IA 3KQNA 4LOHA 1KFBB 5IKEA 3O7MA 3A3YA 1QS0A 1Y3HA 1I5OA 4FR2A 5ALYA 1DLJA 1EQUA 1GFZA 2H31A 1AZTA 3FMFA 3HC7A 1CF4A 2A4KA 2RI1A 2YXNA 1NQWA 3OI7A 2PE5A 1GQQA 2G6BA 1CWUA 1NJ8A 3H2ZA 4F3RA 4DCJA 2I87A 3KKOA 1N0VC 3C5CA 4OHMA 4JC0A 2GR9A 2P11A 4Q48A 4HMQA 3L18A 2QGZA 1MC5A 1UJCA 5EWMA 5IDWA 1E5XA 1ICIA 3VR5A 2Z09A 1NVWQ 3BD7A 4FXPA 4DRXB 4OHRA 3Q1LA 4PGGA 5GZ6A 3U56A 5D84A 1GL7A 3PS9A 5FTJA 5JYDA 2J6HA 2YWJA 3B13B 1LD3A 1NOJA 2JFHA 5BN1A 1WY5A 1R0WA 3IYLW 5BYBA 3R6GA 3HE3A 3DR3A 1YE8A 1KAHA 2XYHA 4YASA 3S81A 4G07A 3HCDA 2A5FA 3FWKA 1EKXA 1O5IA 1E1DA 3K1ZA 2GXUA 1YZUA 4NIMA 4Z0HO 1W49A 1EDDA 4E0BA 3CVWA 2FW0A 3ZX4A 3E9RA 4BXOA 2IS1A 5JJLA 4L4XA 1JMKC 1YE5A 2DE0X 5ALQA 4UUMA 3ORQA 3D3WA 2ZE8A 1I6LA 2E2WA 3P0FA 3SJ7A 1YSCA 4EYEA 1VYTA 6CHYA 1V8DA 3I3OA 3L7KA 4FOTA 4FR0A 1E1CB 4XJSA 2JCVA 4YA6A 2QPOA 4OIMA 4QHYA 4N0EA 1KY4A 1N8KA 4BMXA 4FLFA 4P4GA 3QPAA 5H4HA 4QBTA 3SXJA 3TSYA 3TZKA 3ZH9B 4EKDA 2WTBA 2B5VA 2GN0A 1O0BA 2P79A 1JE0A 2BL4A 3K94A 1SIOA 4CMAA 1Y80A 4MZXA 1LI5A 4EQZA 3I42A 1RNLA 3VKVA 4CR6A 5ALZA 5LLSA 1R0CA 3KQOA 2Q0SA 3QM1A 4N5NA 4B2IA 4BNUA 5JNRA 4AKTA 3KOWA 1PT5A 5G41A 2W0MA 3LCRA 1QP0A 5JMTA 2XLBA 1YASA 4CNQA 1NSYA 3S55A 1E3JA 4RHTA 1XWFA 3ESQA 4EJ2A 1N0WA 2AMYA 1T5TA 3UHAA 3TQIA 3OX1A 1TMGE 2BGKA 2GOYA 3KXIA 4D9GA 5C1DA 3VJRA 4K05A 2ZJ2A 2ZUDA 4NVRA 2LTAA 1RM5A 1XHFA 4W5OA 2IHKA 3H5TA 3A6JA 2X0NA 3TSWA 3LF1A 2HHLA 1U3DA 3TW4A 5IDVA 2NO5A 3P9SA 3BGOS 1YHYA 4JY7A 4E5PA 4Y2TA 4NJMA 4DNQA 1QGED 1E2IA 2DAPA 4RENA 3CXRA 1XU9A 1RPAA 2QRGA 2GSWA 2IYYA 2UUOA 1KZ1A 4BWVA 1IHUA 4KXVA 1AMOA 3DV0A 3SVTA 2H2WA 2QM7A 1VLJA 4P3XA 3V4RA 1F14A 3TLYA 2Q29A 5HQTA 4GQAA 4M37A 1QHYA 3O8NA 1R0ZA 3LKZA 4Y2RA 2P69A 4KOEC 4F7WA 4R41A 3CTMA 4XB2A 2J33A 3CU5A 3BAFA 4NTZA 1GJRA 2BH2A 1Y1KE 3RAJA 1W4RA 1NWHA 2ZJBA 4B4KA 1YB2A 2P0YA 2XMCA 3WRYA 2PO5A 3PDIB 3ZHUA 3RW9A 3DEAA 1B14A 4AJIA 2XUAA 5REQB 1ESDA 2FRDC 1IMJA 3FN4A 3H04A 1XZFA 1PDOA 1PN3A 1UFKA 3DWFA 2D0DA 3QIAA 4LK2A 5JAZA 4UW9A 1TQDA 1JHZA 4TTQA 4AMBA 4ZU1X 5ILOA 2JEOA 2ZRJA 4D4LA 1G8SA 1I7PA 3E58A 3FDFA 1SZDA 3O4HA 4ZRMA 2SCUB 3TLZA 1PR1A 5MFZA 2AN3A 4DMGA 2XWPA 4P3KA 1J0AA 3EPPA 1N3IA 4XM1A 2ZBVA 1T1IA 4CTKA 1WAMA 2NUPA 2ERYA 3B53X 3E15A 3VHRA 2PKWA 4NZNA 2X8JB 3VU3A 2Y76A 3YASA 4ANFA 4FYKA 1G17A 1UPBA 3DCIA 3FYHA 3HN2A 1YR9A 3L1IA 2UZ0A 2X0FA 3ZXUB 4C7BA 1YVUA 4DNOA 2OORC 4TYQA 1YR1A 3E0QA 5TB5A 5D6NA 4Q1DA 4RGBA 4UARA 1JKFA 1ZIOA 4AJ9A 4RHEA 5CIYA 1C9KA 5DGDA 1Y9EA 5ICFA 3BE5A 5CDGA 3GWGA 3VR5H 1KMMA 3EVFA 3MJTA 1NW5A 1QHXA 4HZUA 1RCTE 3K4PA 4QD3A 3OE5A 5ERYA 1ZI6A 1DZIA 3F7MA 3PQEA 3IUYA 3K3PA 8AT1A 1G7CA 4NBSA 3PX7A 2EF0A 2ES4A 1RI1A 1DQYA 5AMXA 1H0SA 1E1KA 1RABA 1K97A 4QVGA 3UV3A 3ZN2A 4EZEA 4H35A 3GCWA 1GPNA 4RD0A 4BUZA 2NIPA 2QAGB 1VJRA 2NO6A 3EA5A 4OU4A 3O8QA 2XWJI 3DTVB 4HS4A 4R1UA 4MGHA 5IBPA 4G67A 2I8LA 3WJ2A 1B43A 5CAEA 4MPRA 4E08A 3JWIA 1LPSA 4S05A 4RULA 3QIVA 1DT5A 3D8HA 5LQCA 5D85A 3WMXA 3SDZA 4MQEA 2ZIEA 3CB4A 2FYTA 3FYTA 4J0DA 2X3UA 4M8SA 4MUYA 4IDHA 5FI3A 4PGMA 2ZAIA 4R8MA 1N0UA 4XVRA 4MW6A 2DQZA 2ZRDA 1NXOA 4I99A 4QJBA 4A73A 2WR8A 4U5XA 4Z53A 3W3AA 1P1JA 3REFA 4PV7A 3P9RA 1BWQA 2LDBA 4N0DA 4ZOLF 1W581 1RHMA 2XNHA 4O4IA 1KWGA 4IDAA 3QVGA 3CWQA 2WAOA 2BDTA 5JC1A 1NJ6A 4KCGA 3B3FA 5JFOA 2UYOA 1Z2PX 3E8XA 3SU8A 1FFXA 3RGGA 4DABA 5FQNA 1WDKA 4AZ0A 2ZWVA 4UATA 4CL3A 2JAXA 1S0UA 1J09A 1N7HA 2BEJA 2AN5A 2IHUA 2FNAA 2VJKA 2YZMA 1VG9B 4P36A 4LSGA 3KEGA 1RWXA 1F3LA 1FW8A 1TEXA 3MWKA 1Y8AA 4UASA 4Y30A 1Z8HA 3TNLA 1Z3CA 4D9MA 5BORA 1JG1A 3EVNA 1S9HA 3HP7A 2UUAB 4GVPA 4IBOA 1ECFA 4EO7A 1QB8A 1L4YA 3W05A 4J0FA 4REMA 1T43A 4Q9IA 3G0OA 2XUZA 5TDHA 2J07A 4BWFB 4KQJA 3CINA 5IEJA 4CEJB 3RSQA 1M75A 5KHOC 5K4GA 1RIIA 3AIOA 4PZAA 5FWXA 4E2ZA 1Y82A 4EY6A 4KR7A 4Q01A 3ZYCA 2F64A 4PZZA 3G8CA 2Q9BA 1U63A 4L07A 1U0EA 4G4GA 4FBMA 3DM9B 3PXBA 1AKTA 3AVPA 4GDFA 4FDAA 1RE0A 1JMYA 2OAQ1 2AG6A 3H8WA 4YEDA 1NNI1 4TTRA 3ZFOA 2AFHE 3OPNA 1VCOA 2ZR8A 2WD7B 4GYWA 1DAEA 1ZIPA 3KJIA 4KYTA 1PJCA 1GCGA 4YUVA 1J8DA 2DC1A 1TAUA 4JYBA 3QJYA 1P5HA 4X41A 3TPCA 2PSSA 4IUBS 3Q6MA 3KPVA 2PQ0A 3V8PA 1VP3A 4YRAA 4GUAA 2HK7A 1BE6A 2H2IA 2WV9A 1QOZA 3FAZA 1V3UA 1NC1A 3KAQA 3RYTC 4YJ3F 5C8XA 4KFRA 1YVPA 4E7PA 1E1NA 3HUEA 5IHXA 5K8JB 2DECA 2QL5A 3NBXX 4GZ5A 2PUEA 1P17A 1XTBA 2D2FA 5KNBA 1NLUA 5CFPA 1N5DA 3KT8A 1QMGA 1Z2AA 2FSUA 2ONZA 3MXTA 1I2ZA 4WK4B 3U3JA 2FGJA 2ORED 2A1UB 4XWGA 2ZSKA 5DJ5A 1JE1A 4RD1A 1OFTA 1DAFA 3I4LA 3IHTA 4AKEA 1S3GA 3LP6A 4J29A 4JC8A 2HTFA 1NQOA 1NUAA 4PU0A 4DJEC 2BR4A 1Z33A 5TE9A 1QGAA 1UJNA 5K2OA 2G3YA 5J4VA 2WJ6A 3VYTB 3BWVA 2VT3A 3DKIA 4R9NA 4AI6A 1GYPA 2FZCA 2C92A 1UWLA 1JH9A 1NRWA 4NE2A 2XWBF 4PYMA 1LRJA 3FNRA 2KI5A 1YO6A 2V7TA 3FVTA 4HDQB 4M54A 5AI5A 3G7UA 2KB0A 3WNZA 1R9NA 2XOKA 4DQ0A 4BZWA 1IOLA 1W7AA 2GUWA 3ROFA 3OCUA 5BR7A 4OGLA 5JIBA 5CX1B 2NAPA 1N2IA 4U39A 1N3LA 5KKNB 3U4MA 3LUPA 2HO4A 5B55A 1DRVA 2V7UA 1LTQA 2WM9B 3NNSA 2JI9A 2ZU6A 1F0NA 3T9DA 3U5TA 4BCCA 1TL7C 1L8XA 4MTCA 4WESB 4ZCLA 1ZD3A 4QBIA 3RAPR 1TMYA 2BY4A 2QV0A 1T9BA 4I5EA 1TW3A 3W8DA 1WHSA 5IF9A 3Q7QA 2J32A 2VUSA 4H0CA 4AO7A 1JHXA 2Q1WA 1KYZA 3KV1A 4ND4A 4O2BF 3KB6A 2B8TA 1G9SA 2VTBB 3L9XA 5ALHA 1EQ2A 3HBNA 3NIGB 1XCJA 4A8HA 1EDBA 3FFXA 2CCGA 3O91A 5CYFA 4QASA 5DT2A 1G19A 1UM9B 2YVLA 221PA 1G3QA 3MM4A 4LE2A 1WTCA 4JODA 1ZG3A 4LNUA 1QWOA 3ISTA 2R66A 1BVRA 1KP9A 4K87A 1HLFA 5FPSA 3W3AH 5H9VA 1BGWA 1LB1B 4G09A 4PHTA 4EL5A 1P4SA 4IIYA 2DWOA 3NZEA 4LHVA 2D7CA 4LKRA 4JT4A 2WW8A 3RTBA 5EE0A 1CS0B 2P9YA 4E1AA 3EZ2A 3IX7A 3PUKA 3SZMA 3HYTA 3MGAA 4AYWA 2DFVA 1WX1A 1RKQA 3K96A 1K5GA 1JSZA 3Q7TA 5DHFA 1CYEA 3I23A 4QDZA 1Q77A 4EH1A 4FMDB 4W9MC 2C57A 4C0HA 3CUWA 5FFFA 1Z45A 1BYUA 2IOYA 2PO7A 4TV9F 3SOZA 1M6VB 3SHOA 4YIHA 1VRVA 2ZJZA 3DE1X 2ZAGA 1T9GR 3OT4A 2GZRA 4C78A 3EDOA 2J3MA 3HU1A 1P0CA 4PHHA 1M2VB 3BKXA 3HNPA 3ZU3A 2RH4A 5KNDD 5JCXA 1BH6A 4MUBA 5AJZA 3AU8A 3COVA 4XPIA 3FF1A 4IXNA 2JANA 3F90A 3Q9SA 3EXFB 4RSMA 5TJHA 3EK2A 3ZDYB 7REQB 2YZGA 2AOWA 4JJGA 4IDGA 1QHHB 3E27A 3KOUA 3OHSX 4BJ6A 4CN9A 3OZ7A 1WG8A 2I7XA 2B83A 1JQ5A 2PRJA 2OXEA 1SU8A 3NANA 4S1NA 1TLFA 3C5WP 5I5GA 1JT9A 2H29A 4LX8A 1C1YA 4ZYLA 2ZPTX 2PHZA 4TMVA 4PPNA 2ORWA 3N2KA 5LYJA 1M1YE 1V96A 4RX1A 1XCLA 4JIMA 3C6XA 3BMCA 4DADA 2DQYA 2VHVA 4I1OA 4P3YA 4R1PA 5BOSA 2CVOA 3MWLA 2X76A 4LMRA 2M1ZA 3B2QA 4KE7A 2K7ZA 4IIFA 1CJVC 1BU8A 2W2QA 5KNBH 3HKBB 5EESA 1EHYA 2YXBA 3LP8A 1PUJA 3OAAD 3C4VA 1RQGA 3PHHA 4WLFA 1VL8A 1V26A 2VK4A 3G2MA 1FSZA 2C9MA 1MFZA 4GQBA 3ZHTA 4BFLA 4F84A 1U31A 4XPZA 1SXQA 1P5JA 1ZISA 4F93B 1HDCA 1NMQA 1OI7A 5C34B 3MA0A 3TPZA 4DA4A 4TTJA 1FXWF 4LFBB 2OZVA 2QMZA 5J4LA 5BSVA 3K1YA 1QAMA 3T3OA 1EK1A 4DXHA 3OLWA 1G64A 5DK4A 4CODB 1H4TA 2WHQA 4CCWA 5HS4A 3K2IA 1IAQA 3INYA 2BM8A 4BBZA 1V2HE 5BWLA 1NVUQ 1L7QA 2J4CA 5EHNA 1NKVA 2ENWA 4PPYA 3EZNA 3T3GA 1R5OA 1BMQA 4F4CA 4AUEA 5LXTA 2FWIA 3N8DA 2JD1A 2NVWA 4F4HA 1L7BA 4K3VA 1REQA 4PRYA 4BKUA 3U49A 3RVPA 3NYQA 2CB0A 5FIUA 2PBRA 3JAWA 5F5LA 4D9HA 2V3WA 2RI6A 1ESEA 2YDXA 4P93A 3U3KA 4WXEA 1DAPA 4A2CA 4JP3A 4IRUB 4CTMA 4Z1OA 2E9SA 2GEUA 1QNLA 3LX4A 2OCDA 2VP3A 1EFRD 4YP6A 3OEEA 4GKJB 1KI7A 3RF7A 4OKSA 3O4GA 3PV0A 3MUOA 3KQUA 3T5DA 4A0RA 1G18A 2HB6A 5JD5A 4XKJA 4OOFA 4HDRA 1GZ3A 3I45A 4L5BA 3TLGB 2B36A 5A3JA 2VJLA 5CB8A 1TJ3A 3QX3A 3QJGA 4K86A 3AF4A 4PZYA 3ICEA 1AUOA 3DEFA 4UMVA 1E7YA 3JAKB 3QUSA 1VLQA 1L5HB 4O6VA 5J2UA 2F7SA 2B8EA 4O2AF 3V3KA 5LQRA 3PF9A 2AXEA 3THWB 2NU6A 5JARA 1OILA 4NBKA 1R66A 3QX9A 3LX5A 4P2BA 4RBNA 3UGJA 4F06A 3EVCA 4URZR 4AJPA 1MRNA 1LS1A 3VUFA 4JJKA 1EPUA 2JI7A 3LD9A 5T64A 2PMEA 4F92B 2XB8A 2C4KA 1EX1A 4BP1A 1MORA 3DVLA 4EYSA 2PYZA 3FB1A 4J1SA 3U7RA 1F3OA 3HFGA 4RA6A 3PQ5A 3G0DA 1E5LA 1KK3A 1BKYA 2DH5A 3AVQA 3HU5A 5JJBA 2HMVA 4XOIA 1UQTA 2BKXA 3FLBA 1B0UA 6AT1A 2O7RA 4MI3A 3R0XA 3GT4A 1DX6A 1NT2A 4JBWA 2VAXA 1H2XA 4ENTA 4OHXA 3CBGA 3B78A 3K32A 3W8EA 3K16A 5BN3B 1GRVA 3DONA 5G1OA 5AI8A 1HX7A 1J20A 1YS6A 1QONA 2A0FA 4P7GA 5COQA 5BV8A 4CQLB 2M32A 3KNZA 5KOHB 3DPSA 4JKIA 5TQ0A 2W2MA 3C15C 3RI3A 1XFDA 4XA8A 1U4NA 2G06A 2ZB8A 1DDOA 5EJIA 5HDBB 2N75A 2DMRA 1ZH0A 2B98A 2O5VA 3GQVA 3Q2KA 3TEJA 1B1CA 1PFUA 1KVQA 5CFQA 1FJHA 2V5UA 2WJJA 4NFHA 4CV3A 1VPVA 1EM8A 1G4HA 4DUGD 3JTEA 3W5CA 4ALJA 3BMOA 3D31A 4F8JA 2FQWA 4FYPA 4DEVA 4ZPJA 4D4HA 3A05A 3EJWA 3R3YA 3R9WA 4ASUD 5L45A 5FORA 4E21A 4R9VA 3OT1A 2BFPA 1MH9A 2QTCA 4Y1RA 4BP3A 2OOSA 2PMCA 3BTSA 3QMPA 1K3UB 3TIIA 3BT7A 2GN2A 3OPYA 4EF5A 2FR1A 4CG0A 4JFRA 2RHLA 4I6JA 2YNMC 1E1LA 2HH9A 4I3GA 5E7MA 2IDZA 2DFPA 1P2SA 2Y77A 2NO1A 1YC5A 5E4JA 1Q6YA 3D6AA 1COWD 4YDSA 3PIDA 4JLDA 1OD6A 1CD5A 1VLZA 3IJRA 4FHCA 3VPFA 4D0NA 4YX9A 3EG9A 3UJ9A 5KNDH 3PQCA 5BN5B 1JJBA 5EHXA 4R7TA 2V8BA 1HDIA 2GD0A 3Q5GA 1T9ZA 2CMFA 4FLMA 1JI0A 4ITUA 4KODA 2QYOA 2HU8A 3VGPA 1ECJA 1GG2A 3T9EA 2QJWA 1LV8A 2JIZA 5EP1A 3HA7A 5H80A 1TECE 3VRHA 1U1EA 4MVYA 4HWGA 5KPJA 1DRUA 3GGPA 5EJ4A 3GMDA 3I04A 1NONA 4MV0A 5C1BA 5HFNA 4GGOA 4M53A 3H5WA 3F78A 3NAZA 4H0NA 4Y2XA 1TB4A 1YRYE 3P9CA 2XSZA 4X1IB 3OZRA 2PUDA 1U8XX 4AMYA 2C9DA 4B82A 1OI2A 1TO2E 2ECKA 1FUKA 1MJ5A 3Q8XB 5ALLA 3W0LB 4FFLA 4ZYZA 4TMKA 1Z9BA 3CIFA 1O5TA 1PFWA 4OQQA 4C0WA 1B8PA 1H6AA 3E7XA 5GGYA 5KNCA 4PVDA 5AKJA 2FW9A 3BBPA 5IVIA 4G65A 3THYB 2WPNA 1CY0A 1WRBA 4II7A 2GCOA 1M1NA 3GRUA 4JBYA 1KEEA 4HLDA 3AVWA 1RLIA 3DMGA 1YR2A 4PNHA 4GI3A 2I4TA 3WHLA 2BT4A 5EKUA 3KDAA 4YPOA 4L74A 1U0SY 1RRFA 4XFKA 4IS2A 2Q1YA 4PNEA 5H8WA 3T7DA 4CMGA 1QRTA 5G02A 4XXHA 3FKJA 4ID3A 1TMOA 3FYUC 4Y0AA 2J5BA 4RETA 4F5ZA 2PSEA 2O4UX 2OZLA 4GR9A 4M0MA 3ZGYA 1P0PA 2WU4A 2WUEA 3UATA 1FLNA 1XLTC 1AN0A 2J7PD 2B34A 1KRWA 5PNTA 5EJ8A 5MHTA 2JRCA 2C7VA 2R1TB 4L51A 4MW9A 1D9XA 2Z95A 1E2HA 5C4GB 3D7SA 1I0ZA 2WWGA 3ICCA 1A9QA 1JDZA 3QEKA 2Z2ZA 2YXPX 3GR6A 3WYGA 3BUSA 1U5BB 1Q44A 3KC2A 1QGUA 1EE2A 1QQTA 4PE5B 1SXGA 4L3OA 3SF8A 3W8FA 1EE1A 5B6JA 5G3ZA 3EY9A 5E38A 2EJCA 3G5LA 4ZVTA 2ZUFA 4JVLA 1OLSB 2ZJAA 1KDYA 3FMOB 2CNOA 1ZS9A 2P2GA 3LX8A 2H54A 1CF2O 2W2TA 4MARA 4FC6A 3COSA 2TMYA 2WWXA 1RYZA 4JP5A 2Q6KA 2WWHA 2AYZA 2O1XA 2BMAA 4KXNA 1AV6A 1N2CE 2VJCA 1NBHA 1VYUA 3MG9A 2DWQA 5E9QA 5IU6A 3L4JA 1CU1A 5HWSA 2DTDA 1AB6A 1CFZA 3QK7A 1FDRA 1PT6A 1KK2A 1VJ0A 5FOVA 3TMKA 3BQMB 1THTA 2WP0A 2Q07A 3PITA 4K28A 1QLWA 1U0BB 1H66A 3B51X 4UNNA 4V2UA 3ZWNA 2QAIA 1E9BA 2Q3CA 3PNYA 1E3LA 2B2XA 2YTZA 3LHKA 3NEPX 4NZ9A 1FRNA 4LXXA 1LZLA 5KJCA 5DM4A 1KWKA 1RLJA 4LJ9A 1GUAA 1YOBA 4K0RA 4IVNA 2BFDA 4N9QA 1SCQA 5AW1A 4GR4A 4KVAA 3VX4A 1XYVA 1H2EA 1G2OA 1P9LA 4RL4A 3PEWA 1MA3A 1ZWKA 1JGTA 1XA4A 2QLFA 3I64A 3RVOA 4ADSG 4D9BA 3B3GA 3AJEA 3RQSA 1V3QE 1LSUA 1Z5UA 1K8YB 1U5AA 4XDZA 1ZFNA 3M5CA 3ESAA 2JCSA 3HEBA 1QZZA 1AX9A 2X9QA 1XEAA 3I34X 1T1GA 2E5WA 2AB0A 2VJAA 3GDOA 4C7XA 1JXMA 1L5KA 1F9AA 5AOAA 1TYEB 2UYGA 3W2IA 1LC0A 1Z4NA 3GJXC 1C50A 1LLCA 2CY0A 2R8RA 1YJAA 4HWKA 1E6CA 1OBFO 3CLKA 4PAWA 5AM3A 5FTMA 1F5NA 3IJ5A 3RRBA 2JFYA 2Q1XA 4MPTA 1FDVA 2YHIB 2YJNA 4G1BA 4X84A 1OVGA 5BRNA 2ACEA 4WWHA 4DLWA 4I81A 1X7YA 4GPTA 3OTOB 4WV3A 2CUKA 3G7SA 2RHRA 3TTXA 5DOZA 1DXYA 3NBMA 5JALA 3OZFA 3LLSA 2I66A 3LPDA 3D8NA 3QITA 1RWBA 4P38A 3LKDA 3EZLA 4WLVA 2C2OA 1YHNA 4ML3A 4CM7A 3CO5A 3N2EA 2NP7A 1NY6A 1C3OA 2GPAA 4A10A 4EELA 4CIWA 1X14A 3DEYX 3ZCUA 4Z9BA 1J5XA 1E7WA 4BRZA 4QNMA 1MT3A 2B25A 2MMGA 5DYYA 4ESEA 2F62A 3JALA 1JKJB 5ITSA 1YZVA 4EGSA 5B7GA 1D9ZA 5DHAA 2WTMA 2FW1A 3DZBA 4TXLA 3GVCA 5ITVA 2L18A 3H11B 3DQQA 5K7SA 3WC4A 1N4DA 4GECA 6NULA 1TU3A 4YJGA 3ZR4B 4CM5A 3L6CA 2PPVA 3ORSA 1JQLB 3C8HA 2I6GA 1GNRA 2PQ6A 1KSHA 2HBYA 3LC1O 5DIZA 4D80A 1GU0A 2BFCB 3ZGXA 3BL6A 4ZOLB 2VXYA 3ZCQA 1QGZA 1XCPA 3A1CA 4KQCA 4FCCA 1M72A 2IW3A 3KZMA 2Q5OA 2GZSA 1EFVA 1MAHA 2REQA 4M76B 5AVZA 5K09A 1QVZA 1IHPA 4YXWD 1KF0A 1JHVA 3OJXA 3HSSA 4FNOA 2JGDB 1C9YA 2BFOA 5FWDA 3S1LA 4C7OA 2VA9A 3ZC3A 5B2FA 3TG8A 3ANXA 1E3TA 3FGZA 4J8PA 5HZGA 5ES3A 2XQKA 2Z6VA 3J81A 3INGA 3ZI4A 1IM2A 3LT4A 1PTJA 4Q34A 2D54A 4FCWA 3MAAC 4CFSA 1C7JA 2ZOSA 3LQRA 4DA8A 2DPXA 3GBSA 5DNAA 1UMDA 3AHGA 1Z74A 2HQRA 2KM1A 3O2NA 2V6BA 4L85A 4RDCA 2ILTA 1RKXA 2K87A 4X6UA 3RB8A 4AXXA 4C7VA 2B82A 3PVCA 1C7IA 5KYTA 2GT1A 2F90A 3OOYA 4EYGA 4ZIRA 3UF0A 2HREA 2JAUA 2QU8A 4G1FA 4N54A 3C24A 4M1WA 4W9RA 2QX8A 2O0MA 1XQWA 3I32A 4RLFA 1OLXB 2YCLA 5JCJA 1E6EA 3NAQA 1PZNA 2A1TS 4B74A 1BXKA 1V8OA 3K0AB 3JPWA 2W90A 1YZLA 1NVBA 2YY5A 3JQ6A 4FYHA 3F3YA 3HGMA 4LZJA 4ZAYA 2WZCA 3W2TA 1G20A 4DIUA 1YDHA 3J80A 1DKRA 4Q19A 1CY8A 2V7EA 3P0JA 1NBAA 2AZ4A 2BFEB 3FMVA 4O2LA 4H3SA 1JHYA 2GXSA 2WQZA 1MAAA 4K9MA 1I32A 2PTGA 1UWCA 3JVDA 4YJ3B 3H19A 1A2QA 5CM8B 5BN4B 3WDLA 3HS3A 4I4CA 4AJNA 3HDJA 2W83A 3VNUA 3EOZA 5KHLB 1V11B 3U80A 1F6DA 1FYWA 2C97A 2IY9A 1JQBA 2IUYA 5KX5A 3PDHA 5JUWA 1XVAA 1ORWA 2FWRA 1YRAA 2O7NA 1J22A 1T2NA 3I53A 4RHUA 4S1TA 1UT5A 2GK3A 4EFNA 2ZUEA 3URKA 3AEQA 3LUFA 5IK2A 4RMGA 2E1RA 4DLBA 5FEMA 1IBLB 3OPYI 3ECSA 1BW9B 1B4DA 4RCZA 3IXMA 4UBLA 5D3MA 1KOGA 1ECLA 4OL9A 1NP3A 4S35A 4ERXA 4ZYYA 4FK8A 4YCJA 4B76A 4DTIA 1ZRNA 1HT0A 4BNXA 5B1DA 4R51A 3DBHA 1KARA 5JHGB 4INPA 1FJGB 3IPCA 4BFTA 5M5BA 3D81A 121PA 3G2KA 3QUTA 4RKWA 5A1TA 1U2RA 3OKFA 3MRTA 2FW8A 3CZ9A 4I2NA 4WKOA 3FVWA 4W9NA 1Q7CA 3MINB 3GPCA 3M89A 1OLUB 2RAFA 1VLLA 1NN3A 3IP9A 4Z8YA 5TQJA 4JI7B 4P3OA 4EVRA 3TMAA 5AXAA 3UWDA 4X9XA 3ZV7A 2GK6A 1MAUA 1AS2A 5F4BA 3NB0A 4A92A 5IDXA 1Q84A 2XQJA 1HSZA 4K9SA 5LP1A 2RGEA 3KOMA 4ND6A 1KJ8A 2IZZA 4O2BB 4XE5A 1VMDA 2DJIA 3C3CA 4EB0A 2J6BA 2VJPA 1OGIA 1SQFA 4IEFB 4KK3A 3PEFA 3OD5A 4NNOA 4I50A 2TYSB 4C0LA 4DUGA 2XXAB 1ODSA 2OD2A 2VNIA 4NE9A 4YCSA 2F2TA 2JJ1D 2R65A 4JYZA 1Z5NA 2DR3A 4KSBA 1ADBA 1VE7A 2AJ8A 4BNKA 2PH1A 4AQDA 1E6LA 3ZHOA 1YQGA 5EXTA 1U8FO 3KUXA 3PGJA 4FHDA 4WE3A 2FUG6 1MO6A 3U2QA 1DC8A 1D4FA 1GSAA 1FTQA 2WD8A 4FILA 4GI1A 4ZK6A 1KPIA 1WR8A 3OLYA 1VIAA 1QNFA 1ZH6A 1DBIA 1I4WA 4Q03A 5K0GA 4M1ZA 3A6HA 2IF2A 1U11A 4UD2A 4NCNA 3FGNA 4G0QA 1M76A 1MV8A 1QYRA 4WEOA 1YFLA 1XF1A 3BQNB 1E32A 3O90A 3ILXA 1WD5A 1EBBA 3H3FA 4G5GA 1VE3A 3GHYA 4F85A 1ISGA 4CI9A 2P2ZA 5KI6A 1BWRA 2DB3A 3PKIA 2HWWA 1I6WA 4EQ6B 4TV9B 3GLSA 1SRRA 4PONA 3T99A 2NMVA 1G291 1GKYA 1J9GA 2QVZX 1TK3A 3GLTA 3Q72A 2WWYA 1ZVQA 3HKEB 3HJCA 4JLAA 5CVUA 2V7XA 5IC5A 5IARA 2GJAA 2FMHA 2Q5HA 1DBVO 1FUEA 3SK0A 2R00A 2VZEA 4D0GA 1BN6A 1XZPA 2FWAA 3OZAA 1P77A 4DDUA 1CUXA 3BXFA 5FPTA 5KVCA 2AMFA 3D3JA 4L4ZA 3WBBA 1UKYA 1IUKA 3N8IA 2AE1A 1SK8A 3IS3A 3PHJA 1O03A 1RFGE 1ZNZA 3C0KA 4ILKA 1NQAO 2ADOA 4KMSA 5TXGA 3TQSA 4RLSA 2GBLA 3K9GA 1QFMA 1BU5A 4WSOA 1SBYA 2FMXA 5DWVA 3FJ1A 4PGAA 3LDGA 3WV5A 1EFLA 1OX4A 3I0NA 3MS2A 2ATEA 1Z25A 1K86A 4GXTA 1XCOA 4NCIA 4MXDA 3X1XA 1QHIA 3ZY2A 1OIWA 2WVAA 3GJ3A 4IQ8A 3LBFA 4JBIA 1EM6A 5IASA 5IC6A 1GRCA 1JECA 3O31A 1VZ2A 3COZA 2RHCA 5HIMA 3PDUA 4H3VA 1Q2XA 1CW2B 1BOFA 1Z6TA 1P1KA 2FMIA 3LPLA 1XAJA 1KYYA 3IXQA 4KU4A 5J4KA 2XTMA 1OA1A 4OOEA 1DQNA 1UZNA 3HXOA 3N2LA 4G63A 4JUAA 3A9WA 3SHWA 3B85A 3P4UA 1Z7YA 2BAGA 4LOAA 3T3PB 1EX6A 4E09A 2HYIC 4RMNA 4DLPA 3L7NA 2WT8A 3ITNA 2OMKA 1HE4A 3K9CA 4YH1A 4EITA 1NQTA 3TTVA 2Y6VA 5JADA 3RIHA 2J0UA 3H17A 3REQB 1KJQA 5BYKA 5AJWA 3BAZA 2A5JA 1JQAA 3K05A 1ZHOA 2F4VB 3H1FA 4X00A 3ETCA 3GZNA 1BHQ1 1XZDA 5L3VA 3AF6A 3ZHSA 2OCPA 1B8UA 1NHGA 5FBWB 2W6QA 5B7NA 2R79A 5AVYA 2FXIA 4QYIA 3ZY3A 1IG3A 2IHJA 4NEGA 5FLEX 4M7OA 3KHKA 4UHDA 1GT91 3NDBB 5L51A 3LHFA 3K9WA 3S27A 2XDWA 1KI9A 2IRWA 2QN1A 4HR7A 1E0DA 1KEZA 1PS9A 4FGUA 5DTRA 5LZ9A 2NUBA 1PJ2A 4CMEA 1NYQA 1KK0A 3WYAA 1RHRA 1EUDA 1G5IA 1UPAA 2Q6TA 2RGGA 2ZM6B 4TROA 2OOKA 1WABA 4JI6B 1TLTA 4KN9S 3RSGA 3PLAE 4JJAA 4PQFA 4CM9A 1CUVA 3VDQA 3W78A 4O63O 4ZT6A 4FUTA 3WJAA 1A7UA 1CJKC 3QYPA 4RKFA 5FPHA 1Y1QA 5LA6A 5AVWA 1JALA 3V7NA 3D43A 2VQEB 3JZIA 3WIVA 3CE6A 1OMOA 1R3UA 4IDDA 5C2JB 4QARA 4PEVA 3A0RB 2H4HA 3W5HA 4JS0A 2IE0A 4EHHA 3K6SA 2R7AA 3D8UA 2H7CA 5MGNA 2GI4A 3BN3A 4EI7A 1EI9A 2B0CA 2XVYA 4O0LA 5AK0A 3WLHA 3G49A 3MXOA 1VFNA 1RWVA 3CX7A 1XJWA 4TSFA 4YO7A 4KQFA 4O2AB 3EULA 4Z0PA 1U8UA 2W6ID 1XVTA 2ZBFA 4NMLA 3NHWA 3WHKA 1M2KA 5JR3A 3RYHB 4CUJA 3OWHA 3A1FA 5GJWC 4UEOA 1WBJB 3A9VA 3C14C 3SF0A 4EHBA 3PUVA 3KR0A 4UVEA 2F1KA 2C83A 3C3DA 1N6RA 1ZUNB 5A5EA 3FZYA 4MW5A 4WFJA 1GPDG 2YASA 1OAAA 1MTZA 3CHYA 3ACBA 1K7FB 2IGTA 4J3JA 2O3SA 1D4OA 2VS1A 4YMSA 1J8MF 3AJAA 3LX6A 3RABA 2J45A 5C5CA 3LKVA 2VZ9A 3HPRA 4KI0A 4P4UA 3CPSA 2FOXA 3VR1A 3TOZA 3D8TA 1UMCA 2Z83A 2CMKA 4WCVA 2AD1A 3MWJA 5JEDA 5KWSA 4M21A 1DEKA 2C2HA 2AOTA 3ASYA 2HWKA 1T2DA 1JNYA 1RAEA 3L6OO 2PEZA 3P7MA 4EY8A 2P35A 5B12A 1RQ2A 2GPSA 2OCYC 4I5IA 3L0CA 4BWGA 721PA 4DV7B 4CV2A 3BSYA 3TFOA 4OHKA 5ERXA 2D1SA 1OXMA 3KLBA 3QXSA 4FE7A 4FGWA 4RWZA 2VZ0A 3RSHA 3SPXA 3TQFA 3VU0A 4CL8A 1RT9A 3LGAA 1BCSA 3O4IA 4Q9NA 1OPXA 3ND7A 4HL6A 5MGBA 3A6GA 2CNWA 4QXMA 3HO8A 1ZH2A 1SBCA 3L43A 2XJ4A 4TL8A 4EB8A 1FA9A 2YWXA 3W5IA 4DGSA 4XZ3A 3KYJB 3AO0B 1AZLA 4QDXA 1LBQA 3DT8A 4JX8A 4WCFA 5FOSA 4F38A 1ONOA 3MGKA 4BLVA 2Z2IA 2P4UA 1CF9A 1SOUA 1NFQA 2OAGA 3B6KA 4KSCA 4CL0A 5L7TA 1Y9ZA 2ONJA 1O94C 3F9CA 3FIUA 4OXQA 4FN5A 1X86B 4WJZA 2HM7A 1X70A 4LJRA 2OBBA 2F59A 4IILA 4OMCA 1L1EA 3KTAA 3HJNA 4TM8A 3ONEA 3FNFA 3B6MA 2ZCJA 1FFWA 3EFOB 5FL7A 2G9RA 1HNXB 4DRZA 4LNAA 2C07A 2OUIA 3I9V6 4GZ3A 1OHHD 1RI5A 4K6KA 3U4HA 3X1ZA 2NACA 1IRXA 3MAGA 1Q91A 2IUEA 4IJQA 4KAJA 4BNIA 1WCIB 2V7GA 2JI6A 2OGZA 4P9NA 4XD7A 2CN1A 4FW8A 2NG1A 2OCKA 2P9HA 1F8FA 2VP4A 2ZKLA 3DH0A 4LZLA 4YRQA 4MUEA 4EPYA 3N6XA 3IKVA 2W48A 2VJBA 3AUTA 1V41E 1G21B 1JLSA 3HACA 3M9LA 4I9NA 4IG9A 2ZCVA 1ND5A 3Q6NA 4JBXA 3UH0A 4AW9A 3KZVA 3LZ6A 4DV1B 3KB1A 1UZMA 2OYCA 5HJ5A 1ZPDA 2R3SA 5IVKA 1L4UA 1JPUA 1UBSB 2FDRA 3G1UA 5FFMA 3JQQA 1Z4MA 3EXG2 3C3YA 2P9FA 1G8YA 1T1RA 3E1GA 4Q15A 2R751 1G42A 2FG7C 1K6XA 1LLQA 2QTZA 2WF7A 5FPPA 2AR0A 3O4VA 1WXXA 1Z68A 5ED4A 4OM7A 5I01A 3FA2A 1CNEA 2ZJ0A 2CLOB 3GROA 2P3OA 1HPLA 1YIAA 4D44A 3C8DA 2TECE 1CUGA 4OJMX 5DLYA 1WCV1 3ZIAA 4BNDA 3SY8A 4M9XA 1FYXA 1HL3A 3LIIA 4HJXA 1DKMA 3UM9A 1W4LA 2JARA 3LXXA 1SBQA 3UMJA 5BWCA 1YA8A 2OPBA 4N0PA 5BYAA 3BULA 2Q21A 1MO2A 3PJEA 1A9XA 4UVHA 4C76A 2VAPA 3LAWA 2P9QA 2XH8A 2VNKA 3LI2A 1SIWA 2K5UA 3WOVA 2J6IA 4H1WA 3T1OA 1XCGB 3TNDA 4YYEA 2P3SA 1WULS 1JB9A 2AS0A 2EL7A 1SVKA 2CDRA 3A9SA 1E5TA 2DERA 5DLPA 3RYCA 2XB4A 4KIGA 4LC1A 2GA8A 3FPCA 4I9FA 4U2EA 4WOPA 4F97A 5HW0A 1OX6A 4FP9A 2WT4A 4NPAA 5ECDA 5C0OE 1DO0A 2QM8A 3OQIB 2Z4SA 4G86A 1G66A 5ARDA 3COJA 5ALXA 1TM3E 1AE1A 3RIXA 1Y1SA 2YIMA 1W36C 1ZRSA 3GOQA 4LX0A 4PINA 1X80B 4OBBA 2JCGA 5TGZA 3OZUA 1YBAA 2H85A 5DTQA 2VDPB 3A1VA 1BEEA 3WQSB 1BQEA 3SLKA 1AGRA 1U8AA 5K0CA 2DT5A 1UKVY 2AGVA 3U60B 4JJ4A 3A0UA 1JQDA 2JJ2A 2DEUA 1SOVA 4WCDA 5HBGA 4IIEA 1Z2OX 1T8PA 2C8LA 2O2EA 4P7KA 2KPOA 4JXKA 3PNPA 4WACA 3ILYA 1E5DA 1MF7A 3KEQA 5K8UA 3EXIA 3HI6A 5YASA 3V8NA 4C4TA 3T7KA 4QRIA 1I4TD 2CFSA 4OXYA 1MD9A 1DFIA 2HCFA 4RMIA 2FFJA 4EKNB 1RHKA 3UCXA 4KLNA 5H83A 4TX1A 2OQVA 4PYKA 2RGNA 5ITZB 3R8XA 2BLNA 3JY6A 3AXSA 2TMGA 1HT1E 5C8YF 4WADA 4C20A 3O03A 4D92A 2HSGA 4LQLA 4D8VA 1JIIA 4CMHA 2HRQA 5GV7A 4Y0VA 1TM5E 4JU9A 1N57A 1K5HA 4IM7A 4CFZA 2F55A 3DOEA 2QA5A 5AVJA 1DBPA 3GT0A 4OREX 4TVKA 3R24A 2W98A 2QNIA 1M34A 3WI7A 3EAQA 3ADDA 3TJMA 1YQXA 4PSKA 1NLYA 3C2QA 4XUGB 1WXFA 5EJEA 3E9YA 4GU5A 3OC6A 3IV7A 4HLUC 1GPH1 2FF7A 2BZ0A 3MGGA 1EDEA 1UAGA 2VYVA 3RSFA 4AS1A 1KEKA 2WFAA 2OR3A 3TKLA 5DRYA 1K4KA 1QK5A 1T35A 1QKKA 1WV1A 2B3TA 2MINA 4IVRA 1R0RE 3R7FA 1BGXT 1SUIA 2GCPA 5F2EA 5JY1A 4XLTA 3VZCA 1M6HA 2RMKA 4X8LA 5FULA 3UAXA 3I6QA 4ZI7F 3EXG1 1BO6A 3ER8A 2A7QA 1FF9A 5KQGA 4B6EA 3O6VA 4GX0A 4F3KA 3CR8A 4Q9LA 4IINA 2Y68A 3FR8A 3RKSA 2F1OA 1OFUX 3IAM6 3MHTA 5JXWA 1ULZA 2B9VA 1BA3A 3BYZA 5K0LA 1TAHA 1B8VA 4PC3A 4Y9SA 2FQXA 2X0RA 3ZS8A 1ZH4A 2I9KA 3OIDA 3CEJA 4AB1A 2H16A 1XNHA 1BDBA 1T0PA 3AF0A 3DMRA 3KVVA 3ZLUA 3GIDA 2JIQA 1D6SA 1ZZGA 4EF6A 3IC5A 4LDJA 3OA2A 2I2XB 1U9CA 2HA7A 3G17A 3JVVA 4HDSA 5DWQA 3PD7A 5C1PA 3OJEA 1II9A 1RRMA 3ZU2A 5C8ZA 2YX1A 2C29D 3A2KA 4QQ8A 3NBKA 3ZK8A 1HG0A 3KQPA 1XKXA 3FTCA 1Y9JA 4FMCF 4J7XA 1AQ6A 5L3ZA 1XEXB 3UHFA 1Q0TA 5DASA 2PKQP 1TM4E 4GP6A 1ZMBA 1C30A 2IX9A 1NG1A 3T5GA 5KREA 3EVAA 1XJQA 3MF4A 3OZSA 1JLLA 2V5VA 4X1YA 2YS6A 5CVDA 5EIWA 2YS7A 3PT5A 4PZEA 4QX6A 2WJWA 1D6NA 2QQ0A 1HE3A 2F43B 1QIHA 1T0BA 3N0TA 5AKZA 1T13A 3ZDFA 1T2EA 1GL9B 3QBDA 1JSRA 1SC9A 4ZVNA 1A82A 4H4CA 3TQQA 1T10A 2VUIB 3OHMA 1NQ5A 1Z73A 3MD0A 4WOCA 1GZ4A 3UMCA 3GJTA 1QU2A 2Q9CA 4I9HA 2OV1A 3D3EA 2BMDA 3UMBA 3BE8A 2YW2A 1IN4A 1X8JA 5JU6A 4A6PA 2A3NA 1NSFA 1RM3A 2DWPA 3P94A 5T8KA 5JSYA 1JJAA 1R15A 5JFGA 2BISA 3ZWCA 3WO1A 4G0VA 4UHHA 1I6MA 1G4UR 5DYNA 2OGUA 3R3SA 5JD4A 2E89A 4QYSA 5F1PA 2AWOA 3OFVA 3KO8A 3RUDA 2I0FA 2PKRA 3BRWA 2QSJA 3C4QA 3RYFB 3O47A 1IWOA 3IEXA 3OMXA 1DCKA 1R8SA 1NUHA 2QUJA 3OJOA 3OZCA 4JR2A 5C7OO 2WICA 4QXPA 1QV9A 2IYFA 4KXMA 4QT0A 2OXCA 2X6RA 1X7DA 5DCLA 1KJYA 5CHEA 5EL0A 5CDHA 3Q0EA 5P8WA 3UB2A 4TVSA 3J7TA 1T4BA 4N01A 1EUQA 3TLXA 2BUCA 1V4BA 3AI2A 4QFCA 4DKJA 1SXJE 1C1HA 3R7BA 3TL2A 1WZ2A 3JVUA 2CHGA 4QFDA 4JLOA 4P7BA 2C03A 2DLCX 2ZT6A 4A3SA 2PKXA 3KEFA 1DX9A 4CM8B 4LYEA 2Y1OA 4K9OA 4ZAVA 3HGTA 1LDYA 1D4ZA 1T9AA 4M89A 4X95A 1QQ6A 3EZ9A 4PXYA 3STHA 3R6TA 1DBSA 4FJ1A 3H2HA 1I9GA 4PFKA 1VGVA 2LCFA 3DXFA 2GK7A 2P3LA 4PTZA 3AM3A 2DKOA 3D1JA 1RZRD 1FB5A 2JLZA 3A4YA 3RSZA 3FPAA 2GHQA 4FN4A 5CYPA 5K3OA 7GPBA 4UPDA 1S8OA 1R4AA 3PJDA 4RD4A 1CR4A 3IELA 3QXCA 3CZRA 2RH5A 4JROA 5CW1A 5CA0F 4YIKA 1NUSA 3Q5EA 3GCXA 1U7ZA 3EOAI 2Q41A 2MSLA 4KPGA 4NYJR 4O5OA 4YNBA 5KSPA 4BNNA 4D1YA 4XI9A 3D3NA 1V1MA 4B46A 4Z1MD 5L3QB 1AVTA 4IIJA 3JQGA 2CZQA 5E6RB 5JBNA 3FOAA 4C29A 3O21A 3N6VA 2VYND 5KVAA 2XRZA 4MLPA 3GJZA 4FHGA 3TLKA 2QTWB 1AF7A 1T25A 4EBFA 3SC2B 2YV3A 3FB4A 3A2LA 2BBWA 4OIFA 1CZHA 4KWEA 1TRHA 4J3FA 4NFSA 2VHYA 2BHTA 2I2BA 1HDZA 5DM2A 2ZQZA 1YJXA 4XCVA 2DR0A 5HX7A 4Z4FA 1O9HA 1N9GA 1YTLA 5BVHB 2HEGA 5JZVA 1CIJA 3C45A 4CMIB 1LJLA 1UXIA 3W2EA 3EQZA 3BDAA 3FCXA 3FSJX 4TQUS 3AEXA 3SP1A 3W9UA 4GX1A 1JZTA 1UDRA 3PX2A 1ZK0A 3LBHA 2HQSA 3QU5A 5HILA 2PNJA 1FTNA 1R0LA 3E61A 3HKDB 3I1IA 4LE0A 3OQOA 2WQ7A 2GCEA 1R8YA 4AWBA 1N2SA 1Z4LA 1KP3A 4RK0A 3U3ZA 4OHUA 4EX6A 3W79A 1E4EA 1TM7E 1SG9A 3IUJA 1XD8A 4RXTA 4WK6A 2E48A 1PQUA 3I1FA 4LOIA 4B4WA 1IY8A 1A5AB 2A30A 3AB3A 4YWJA 3ZE1B 4CEHB 4NOMA 1APBA 2IHYA 1T8WA 1G8AA 3MCZA 3S2GA 3W9BA 4EVSA 1RC8A 4LTNA 3R09A 3NR2A 1AD2A 1L5ZA 4TMFA 1ZONA 5LQNA 4FZVA 3DVAB 3LO5A 4OA5A 4OG2A 3FOWA 4ZXPA 3T1VA 1KR2A 4B7AA 1WLYA 1XLWA 1PL8A 3TSOA 4AZ3B 5AK4A 1OB2A 1NE2A 1YS9A 2IKSA 4MQMA 1TUBA 4UAJA 1TEZA 2H65A 3B1JA 5JEEA 1BDJA 5EE9A 2ESRA 2C7BA 4ZEMA 1UKAA 1UP7A 2Z30A 3K73O 2BFBA 3G0GA 4E31A 1DV1A 4GPAA 4RIHA 3RDPA 3FYDA 1LVHA 4NK4A 1UXGA 2GVZC 3SC3A 5H7XA 4AY5A 1EK5A 4KO8A 2Q27A 3I5YA 2UXBB 4PC6A 5HGXA 5ENZA 2AYYA 2IEIA 1U9IC 4YROA 4LSWA 1WDTA 1TPZA 4BV2A 1U2PA 2HSZA 3E5MA 2W7TA 2YVQA 5FAKA 4Y98A 2OTCA 3JV7A 1IY0A 4TVBA 4D4JA 4ZU3A 3FFBA 1RR6A 3ETLA 5D00A 4Q1BA 1L5HA 3RC7A 5JI3E 3RVRA 2AUTA 2P7HA 2GQ0A 3HDQA 2QRNA 4Z6KA 4KMMA 2H06A 1MB9A 2BSXA 3I39X 4ZZ3A 3KEMA 4NK5A 3FMPB 4BMZA 4ZODA 4DR2B 2F3SA 1CUAA 2XRYA 2YHSA 1V3TA 2E7ZA 2L42A 3HR7A 1GAEO 1QTQA 1XROA 4WNIA 1E9SA 3A4VA 3K2QA 3T41A 4DSUA 3ODPA 1ZOIA 1UF9A 2Y1GA 4BLRA 4OD0A 2Q50A 3IMEA 3R0QA 1M10A 4NU5A 4S0XA 4TTAA 1LQUA 4EG4A 2Q8QA 2CJWB 3FROA 3FNEA 4OHOA 5NULA 1MG0A 4C22A 3ITKA 3KAKA 5CJJA 3PXCX 3OQBA 4O1MA 2HU7A 4XWYA 3BQ9A 2ZR0A 1GSOA 2P4HX 1D07A 4JASB 1PO7A 1MDFA 4WUVA 2QY6A 2A88A 4EG6A 1SO8A 4GMHA 3VTKA 1UAYA 2Z3VA 3JQDA 3NT4A 3GEIA 1G9TA 3BRCA 4CKCB 1IN6A 1HLPA 1U7WA 4JX9A 3ZWPA 1I0IA 3NTLA 1V8PA 2OMEA 5AD1A 1Y0BA 4NS4A 1OKKD 2A1TR 4EBBA 1JVSA 1X7GA 3RC8A 3H18A 3E3AA 1UK6A 3WRXA 4KAXA 4QO7A 4WZBE 4MWZA 3ZKWA 3DS8A 3O92A 3CJTA 2Q9UA 3OZDA 2Y9PB 2J6CA 3O8LA 3L1JA 3FW1A 4MVJF 4YR7A 2Q5JA 3QBTA 4M87A 2UDPA 2G04A 2QL7A 3PVZA 1R6UA 2GSDA 3TTTA 4E1VA 2HGSA 3NBZC 5FOXA 3UKJA 3VAZA 3T3NA 5F78A 2G0NA 1IN7A 3VMMA 3X2FA 5HE9A 4I7EA 3CBQA 1P7PA 3PPXA 1A69A 4CM4B 5I7FA 1EG7A 2XE6A 1ZCBA 1N6NA 4HWPA 1CUHA 4DR4B 1DIHA 4N7RA 5BMVF 2EG5A 2XWQA 4MLDA 1T36A 1B2RA 1NJ1A 2QRVA 3ADOA 3HMKA 3IUQA 2RGYA 3KS9A 4U3JA 5B1IA 3ICQB 2FN7A 3C7KA 4FE3A 2PX0A 4BECA 4GKKB 3G9ZA 3B8HA 3TOVA 5BR4A 5MFPA 4GH5A 2AJCA 2FE4A 2J9RA 4N3NA 1POXA 3WLLA 1BMFA 3IBGA 5IUNC 3RC3A 4H1VA 2CV2A 4JD5A 3K0CA 3LH5A 5KEIA 2GYYA 3CRMA 3OTIA 2PEYA 5FP0A 5CNKA 3OZBA 4KTVE 1NPYA 3SS7X 1C9DB 2N3ZA 4HF7A 5FI1B 1T5SA 3RG2A 1V3VA 1O3YA 3D8BA 2QTGA 4NEHB 3V4FA 4EKYA 1FYEA 3DGEC 2OZPA 5LP6C 4E46A 5KC8A 1TCUA 3QMMA 4PBTA 5L6MB 3GNLA 3GLGE 3UHOA 4EFMA 4TS1A 3EGXA 3OE7D 2GPYA 3P96A 1ND6A 2VWHA 2X23A 1NYLA 2XQGA 3F49S 3I2JA 3QOFA 2NU9B 1N6HA 5I8PA 4CTJA 5CXXA 8MHTA 1ZUWA 1WQ1R 3OP1A 3V2HA 2H11A 5FPKA 1WETA 1H6DA 3DBRA 4A8TA 3TE6A 1UBTS 3TWOA 4CG1A 3ZU4A 1L4NA 2XEDA 3PYMA 3S7ZA 5HUJA 1Y6ZA 2OV2A 1DIOB 1GKKA 5F7ZA 4QTZA 5KQPA 1AUXA 1CEYA 2BMJA 1PT9A 3WLKX 3R6LA 4XIFA 2H2GA 3PFNA 3QFHA 1NW8A 4IGAA 4WD3A 5J9FA 1YNSA 3ZDDA 1PEAA 4RSHA 3EPKA 2HUNA 5FXMA 5EXXA 2IU3A 3KT3A 3COPA 5KTMA 2RH9B 1Q17A 4WZAB 1CEEA 5LM3A 1CQIB 1BOOA 3CJRA 1AF4A 3DF9A 3U4AA 1EXDA 1Y5RA 3DMYA 4IQFA 4NONA 1QVVA 4TLMB 1C9NA 1A9OA 2EVWX 2ZRMA 5GVSA 4DV3B 1E9EA 1H69A 1AB5A 3JQEA 3LS2A 2M98A 2K7FA 4PG5A 4I19A 4DDTA 1BFKA 1CG6A 2ZYSA 1YRQA 4ZN6A 3ABRB 3RS5A 2MWMA 4XJTA 2HEIA 4MZDA 4ZGWA 3LU1A 1DPGA 4XIIA 3V4ZA 2O4CA 3E0XA 3QNUA 1KI6A 5HKKA 4EPWA 1ICEA 3DFIA 1Z0DA 4KBYA 4RVDA 1Y9DA 4LDPA 2HMSA 2WJHA 1Y3IA 3DEHA 2IK8A 4PZUA 3EBPA 4R31A 3AG5A 3MFQA 1BXRA 5F64A 5AUOB 5ENVA 4EATA 4XVCA 2BJVA 4MRMB 1U7DA 4N1AA 3B2EA 4X7PA 2J41A 4ZEVA 4Q4AB 3THXA 4JDPA 4U2KA 2K2QB 1H5QA 1F60A 2HJRA 2FWJA 3OM8A 3QUBA 4D4KA 1DXOA 2CK3A 1RLOA 3UWOA 2WF6A 4IXTA 1PX0A 4ED9A 1BDHA 4HBZA 3O93A 1KNQA 2JG3A 1O6FA 3PIIA 2W43A 4ZOEA 4MP3A 1CBUA 1I24A 3LL7A 1OLSA 4PYNA 4KIJA 4ZMSA 1C0IA 2B61A 2Z3ZA 3D6UA 5ADHA 2R8BA 1WO8A 1UMBB 5A9TA 4EAAA 4XQ0A 3B9BA 4X61A 2IH5A 1Q7GA 3NQ41 5K0BA 3IBYA 2ASVA 4PQYA 5EIBC 2H5JA 1FEZA 4PNZA 2YNMD 3C3PA 3DLTA 3T9CA 4HKTA 1HQYE 1HY3A 2VPTA 2WZBA 1JV2B 3QYFA 3HY3A 2QTLA 3MCTA 4HEA1 2AZMA 3WL8A 1NV9A 4I1SA 1E3QA 5FPQA 3B3QA 3UYKA 2C2MA 2ZPAA 4AXBA 4O33A 1II0A 3M83A 4MQBA 1N92A 3QP9A 4LXYA 3CEAA 421PA 3B5JA 2HPAA 4A03A 3AFNA 1XL1A 3IB6A 3CISA 3UUGA 3JAMA 1ECBA 3NTQA 4M0LA 4TLCA 4KE8A 1E8MA 2IJGX 3D2AA 5ALKA 5AW3A 1OWOA 1SR8A 3DFMA 2ZM5A 1K88A 3SGLA 3VU9B 1O95A 4OUKX 2KMLA 2ANCA 3TXYA 1V9CA 4IG4A 4CCSA 3GRPA 4WIAA 3ETHA 3PC8C 2UUPA 1OAOC 4B9AA 4WH0A 3ZHZA 4HAXA 5DT9A 1MC8A 3OEWA 5AHKA 4WXMA 2ZUSA 3PZBA 3O0DA 3QWBA 4UDOA 5IJ9A 4N3CA 4P86A 3INNA 5TGDA 4BO9A 3V1KA 3BEOA 2WJAA 2F1RA 4NFLA 3RCBA 2G80A 1E3IA 5EKTA 2WFLA 2ETXA 2YHIA 4L4RA 2IKQA 2IS2A 3JQ9A 2YWCA 1JAIA 3CA8A 2Z2XA 1XD2B 4YJFA 4BVBA 2ZRAA 5KJEA 4YP0A 5BW4A 2VQFB 5CFLA 1GSIA 2P0EA 3O8BA 1U7TA 1X87A 2WKQA 1N1EA 5DN9A 3SJAA 5I7HA 1AKYA 1QIMA 2EBUA 2I76A 4LDQA 4PWYA 5G3YA 5KKAA 4EJSC 4F4DA 4Z4QA 4OK3A 2IOFA 3N39C 1BC5A 1ZKDA 2ONCA 2VT7A 3LPNA 3E22B 3P2YA 2YN2A 3CNQS 3DOCA 2DT8A 4XVQA 1JEDA 3QUAA 4LFAB 2AK3A 1Y81A 1C7ZA 2Y0BA 3EF0A 1G2IA 3OOSA 4KSYA 2CJPA 1UZUA 3LNCA 4R0VA 1HYQA 3UFXA 2GXAA 4LQDA 1XNRB 1L5LA 4ZJUA 3MWEB 1W35A 1RQRA 2DU8A 4ZQEA 3ND5A 2QDKA 3GRVA 2UYHA 1KU6A 3CVJA 3FUCA 5FD8A 5KYYB 1T3LA 3O3NB 4U2GA 3DTYA 4KQ6A 5FR2A 3UB4A 3U7EB 3VR0A 3G1WA 4OGKA 1SUFA 4MGZR 3GVHA 3AIIA 1W8IA 3OFJA 5B3JC 3HV2A 2POQX 5HK9A 4MAAA 4Z49A 4ZZ0A 4EYKA 5IANA 5EMKA 1CUUA 2W8BA 1NMXA 4C6TB 4PLFA 3C3XA 3RK0A 3F47A 1Z4IA 1QM5A 3W1VA 4V02A 2C82A 4PPFA 2PYDA 4MVJD 2EKLA 1SQ5A 2H1IA 1CR0A 1Z4OA 2F3UA 3GLFA 3I9FA 5K6AC 3QW2A 5F7OA 2CE7A 5C80A 5FWYB 2X8AA 4OI2A 2QLNA 1ISRA 3C85A 1G6KA 4G0XA 2VP0A 3CUTA 1EINA 2XNKA 1SVSA 3MJFA 5IYZA 2WD9A 1XTSA 2BGIA 4CT0A 5TLSA 1T3SA 1KDVA 2NAFA 4ZALA 1T2FA 4JK3A 1YONA 3FRJA 1Q11A 3L8MA 2DCMA 1UINA 2YJ5A 4QPCA 4ZO8A 5C8YB 5G4KB 3EVDA 1QP7A 4J4BA 1PVDA 1PRYA 2GDJA 2FN8A 4EJMA 1SKAA 1LNZA 1JHRA 1PQPA 4KV7A 1N6LA 2X9LA 4IHJA 5JI2E 5EMNA 5AVOA 4RM3A 2DFDA 1RIFA 3AF1A 3P2IA 4PG4A 4DTCA 4X90A 3G2HA 1C14A 3G68A 3PNVA 1JJFA 1C4XA 1ULSA 5IJWA 2FPGA 4GP9A 5JQWA 2X2PA 3X2SA 3WWCA 4DJFC 2WRZA 3GW8A 4ZANA 5BV2P 4OVKA 3CF4G 4BUJA 1I51A 2Y4NA 3KE9A 1H0RA 5JDCC 4OFWA 4P34A 4HATA 1L5MA 2SNIE 4PIMA 4LHEA 2BONA 4PPQA 3DHWC 1C81A 3K6JA 4Y1FA 2GWRA 2ZYVX 3JZMA 1K1EA 3NCTA 3EN0A 4BB9A 1AS0A 5KVVA 5DRTA 1SU4A 1F6WA 13PKA 1IJEA 1XKQA 4BB6A 4ZI7B 2QHXA 1ZU5A 4GWGA 5AM1A 4EG0A 5A4AA 4G26A 5T67A 5CT8A 1R64A 3BL8A 4IDQA 4RFLA 4JZKA 1Y7LA 2BFEA 3EUFA 4FFBB 2GBPA 4HH4A 4LY9A 4TRNA 4ZVUA 3P9YA 2AMJA 2MSEB 2IYXA 4FEEA 4WZ6A 3SKVA 1FRFS 1KC1A 2PG3A 2Z2JA 2VTEA 2NSYA 4X5OA 4GOLD 4G0PA 4O5AA 3PB3A 5BQ3A 2WUWE 4BWYA 2FUG1 2JCBA 3NHLA 4R1TA 2O6HA 2CVPA 4LJ7A 1Y1RA 5JASA 2IL1A 2GKGA 4E94A 4RZ3A 5HRCA 3ZLBA 4JENA 4Z3OA 3QOWA 2WB4A 1BKSB 2ZSUA 3LQYA 3BE6A 3JATA 2YXDA 3L1UA 4B32A 2A0YA 5I9MA 4PBRA 2QP3A 3H8JA 3WTCA 5HCIA 2YXLA 4KO2S 4JFAA 1J33A 4FMCB 1Z37A 1T2AA 4KFTA 5EZYA 2Z1MA 2Q0HA 5E6SA 2IS6A 2JFNA 2QX9A 1H3FA 4MR7B 4TKVB 1E89A 3FKSD 1VECA 3QQ5A 2Z8YM 2A5LA 1RJGA 1UDXA 2HRZA 4ZDKA 4R69A 4MQ5A 3O2QB 5C7IO 3RNLA 2X0DA 4OMFG 3ORYA 4PQGA 5ITWA 1T4DA 3ZK7A 1VL2A 4L2IA 4PO9A 3HMQA 1W2WB 2GEJA 1UJBA 1G2PA 5ALSA 3SLRA 3H4IA 1VJDA 2DTEA 5TQVA 2OCXA 3HCRA 4O08A 1XTKA 4F86A 5BUSA 4QA9A 1C9JA 1U9ZA 2J8ZA 3FCCA 3H2JA 3CNBA 2OCLA 1QIGA 1GZDA 1WW3A 3PEEA 3BZBA 3KKEA 5IPFA 3RLIA 4B71A 1ZCFA 5KYGA 3L1KA 1PEKE 3MLBA 3MIIA 2GM9A 3STWA 1YZTA 3I4FA 4MV9A 3QKRB 1T6XA 4RGYA 1CY2A 1CLUA 1F8YA 1L9KA 3IUSA 4CRWB 1AN9A 1U28A 4DQXA 1DTWB 1D4AA 4IVPA 5F9FA 4FIZA 4QZVA 5F3RA 1DBRA 2A9PA 3JYPA 3HPQA 1ZXLA 3HUUA 1JYSA 2LIVA 4TKZA 1U3CA 1THMA 1SURA 2O19A 2OZKA 2DWUA 2PX3A 2XE8A 5UKDA 2NN3C 1L5OA 1VKRA 1Q1NA 4K6CA 4O4JA 3STXA 5B36A 3AVVA 3IVXA 2R4QA 1GPYA 2QZSA 2BELA 3B5EA 1UC5B 4HQ6A 4GBJA 2AXQA 1OXKB 4X54A 3UJ6A 3TZLA 1OTYA 3FY4A 5JOQA 2I1QA 5U4QA 3NIBA 2AFVA 3USZA 3TSCA 2WP8J 2VP5A 1BJKA 4LXGA 1G4AE 2H7XA 3RC1A 4R8VA 4BO8A 4E15A 2OC9A 1N25A 1YOVB 2OQRA 2WAAA 3CPJB 4LV8B 4GR5A 2I2WA 2BKEA 3OY7A 3VMFA 1CY7A 2XMGA 1T0HB 3H1TA 4OYRA 4DVJA 4YT2A 2ECPA 2H6EA 1OOEA 1TNDA 1ORRA 2B6HA 1C3EA 4KQIA 5LC1A 4ACAA 5H9WA 3P26A 1Q7RA 2MSKA 3HKEA 4PR3A 4QQFA 3B38A 1F8XA 4RD2A 4F60A 1OFVA 4YBRA 4YT8A 1IC6A 2D5BA 2RHMA 1WMFA 5AHRA 2VSQA 4MA5A 1PFVA 2PAAA 5CA0B 4H7JA 4NZOA 4UNIA 1RJEA 4YQFA 3RRYA 4DR7B 1VMEA 1J8FA 3CY6A 4TWBA 4G37A 3GLHE 4G4SO 2XITA 1NBME 1U7PA 3D6MA 5K6TA 4Z9AA 4DM4A 5HYVA 4CF7A 3CCFA 2XMQA 3W4JA 1XTIA 2LWIA 2I62A 1SHZA 1UMKA 1RJWA 2P40A 2PUWA 4RKRA 5LZ8A 1A04A 5E2BA 4KUEA 3IPLA 5CB4F 3KRTA 3IAAA 5TPZA 1DO8A 4QKQA 3FBTA 4BU1A 4Z4HA 1UEXC 3R6DA 5IH7A 1HLGA 2FPMA 4Z9XA 3FTEA 4EP1A 1L4LA 4N9WA 1AKQA 3UVEA 4NJOA 4EENA 2FXVA 2PX8A 1WE2A 2EBHX 4QGAA 5TPWB 1PV1A 1YZYA 2IDKA 4EY5A 1WA5A 3OMLA 5DP2A 1JEYB 2XGSA 4CXMA 3DDNA 1SCKA 2WBLC 5HBRA 1FCJA 5JXIA 3KU1A 3ZLJA 1ZW6A 1DAOA 3ELDA 5F73A 4X8MA 2O2SA 5LZ7A 1PR9A 4FDMA 3ZE9A 3CW9A 3EOBI 3KYDA 2G63A 4M8NE 5HHTA 1KI8A 2QRJA 3G13A 5CNJA 2IWRA 1H4QA 2YMMA 1PK7A 1JNXX 3OEHA 4I4LA 2N47A 2AOXA 5FLXA 5JJ5A 1W73A 2AXNA 1HFWA 1I8TA 1ZIYA 2OVFA 3DBIA 4JQCA 3ZBQA 2O8DA 5LNK6 3JQ8B 3O8CA 5AWFC 2GN8A 3P9QA 4FJ2A 2Z1NA 3RC2A 1LBSA 1YS1X 2CWWA 4MIOA 3RYIB 2PLWA 2GEKA 3W5SA 4F6LA 4P08A 3GFVA 1VHJA 3IP7A 2HR1A 1EUCA 1T5DX 3BJRA 3SR0A 2IP1A 3QRWA 2IEZA 3HG7A 3IOEA 4LY6A 3LO8A 5EJ2A 3HCEA 1FSSA 3B7WA 4OMDA 4UE2A 1OR8A 4DLSA 1DB3A 3DOFA 4QGHA 5KUTA 3CKLA 3O82A 4XFJA 1T9HA 2QE7A 3NUGA 3DPIA 1AZWA 3SS8A 4FFDA 4NXMB 4GS5A 1KTIA 3ZE6A 1Z7GA 2VHZA 4OQNA 2XUJA 4CR8A 2TMDA 2EEZA 3DE3X 3U09A 4G9GA 2ZE5A 3U5ZB 2H5EA 3AF2A 4YCNA 4QUHA 3WIDA 5DHRA 1PEDA 5TEWA 3VR4D 4WKCA 3DW3X 2FN4A 2Y4OA 2ZULA 3NRBA 5F1KA 1NJGA 1E3WB 2A2ZA 1CIPA 4IH9A 4E14A 1RRCA 4JT2A 5K0NA 2OO5A 4KDRA 3H5LA 4G84A 2YV1A 1ATIA 1N1DA 4TM7A 3S1AB 3N59A 4C87A 1F2UB 5C31A 1U9JA 1BRMA 4QLAA 1V71A 1P61B 2ZIVB 3T3DA 1B23P 3TR6A 2J3DA 3U4IA 4ENUA 1GU7A 4G5SA 4LRSB 3K4HA 2PAFA 4CT5A 4DBZA 1EHIA 3MCWA 2AEEA 1QCYA 3FYUB 3CNNA 4I55F 3RF6A 4L78A 4J0QA 3H9EO 4B8WA 2CV0A 5CH5A 3GLIE 2ZBEA 1EX7A 4RVUA 3UIEA 1KHHA 2QTAA 2Y0EA 3GLRA 4FQ8A 4P1ZA 1XX6A 2RB4A 4QBGB 5JAQA 4BQRA 5BSFA 5BR1A 2OBNA 2ZRCA 3L8FA 2OZEA 2AFHA 1NA5A 1SQ0A 1T4CA 4K1XA 4Y67A 1Z5PA 3FF4A 5F5NA 1MPXA 4NP6A 3CN7A 1IPEA 4HUJA 1P9OA 1ZITA 1EFDN 3MWGA 4L6AA 4NE7A 3TLMA 4A8JA 4BBPA 2YJGA 2FHSA 1VRWA 5FJJA 1SM4A 4KW7A 1J0XO 3I28A 4J7AA 4ZTZB 4GOJA 1E63A 2IYNA 2IZ1A 2JKVA 4FGLA 4GKAA 4LYJA 3CLRC 1AKWA 3DNFA 4QLOA 1DEAA 2N1MA 4BX9A 4R68A 3KELA 4KACA 3CH4B 8GPBA 2D8MA 4RTPA 1XP5A 4OAPA 3IUNA 4IGEA 4NAUA 4KYIB 4NNPA 2FSGA 3D6NB 1QC5A 1XZKA 3AEUA 2IYWA 1FZQA 2HU2A 4YONB 1T1JA 5KYUB 2PZLA 5JS2A 1KR5A 1X92A 1P0QA 4ETMA 3NGLA 2PZ8A 1HE5A 1W46A 4U7PB 5EI5A 2J31A 3ETGA 5A62A 1TFUA 1PYGA 4AMGA 1DIBA 2HIHA 3R7NA 2A57A 3KOXA 1FVFA 2QB5A 5IT0A 4LRTB 4IJKA 4G3XA 4QAQA