4YV0A

Crystal structure of trypanosoma cruzi spermidine synthase in complex with (2s)-n-methyl-n-phenyl-2,3-dihydro-1,4-benzodioxine- 2-carboxamid
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
269
Chain Sequence
GWFREEPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
pubmed doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
molecule keywords Spermidine synthase, putative
total genus 92
structure length 269
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yv0A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yv0A02
3PX2A 3I9FA 3V8VA 3E7PA 3DMFA 1NV9A 3ER8A 3GRRA 5EPEA 1EJ6A 3EVFA 1G8SA 4X1OA 1QANA 5DXAA 3M33A 3EVGA 5MHTA 1XCLA 1D2HA 2FK7A 5T67A 1QAMA 1XTPA 2AOWA 2HNKA 4L7VA 3QV2A 2GS9A 4OQEA 5ICEA 1G38A 5DM2A 2FHPA 3C0KA 1AF7A 4OA5A 3ME5A 3PT9A 2JG3A 3LSTA 2P7HA 5EKUA 5GM1A 4C07A 3NMUF 3BKXA 4ATNA 4DM3A 5DX1A 3LDFA 4XUCA 1JR4A 3G2MA 3OZRA 3FYDA 4FT4A 1FP2A 2JH9A 1KYWA 2PBFA 5E1DA 5FHRA 4RTOA 3FPHA 5LQCA 4QTUB 1HMYA 5DSXA 2B25A 5HILA 4P7KA 4IV0A 1YB2A 4E2WA 3ORHA 2OY0A 2JHCA 5E2BA 1VBFA 5CUQA 5GWXA 3GIWA 3FTEA 5E1MA 4E2XA 4PNEA 4AZSA 2NP7A 1UIRA 5LQAA 1XDZA 3NDJA 5F2KA 3ANXA 2BH2A 4GQBA 2BM8A 2ZBQA 3GRZA 1NW5A 2CWWA 7MHTA 4PYIA 4A6EA 3GGDA 4WXHA 1BKYA 5EVJA 1SUSA 1QZZA 1WZNA 3C3YA 1EAMA 1O9GA 3BZBA 4PCLA 4LWOA 4WVLA 4QVGA 2ONZA 2AR0A 3RW9A 2YX1A 4PIMA 3TKYA 5HZMA 1YFJA 3TLJA 3KR9A 2QY6A 2P1DA 3ELUA 3HP7A 1IXKA 3HCDA 1SUIA 3X0DA 3QOXA 1R74A 3DLIA 1O9HA 2KW5A 3PB3A 3QOWA 5CM2Z 5DXJA 2C7PA 3F4KA 3JWHA 3UJBA 3KR0A 3M6XA 3GRVA 1ZHFA 3FUTA 2OB1A 3LPMA 4BP1A 3LBYA 3UJ9A 5M5BA 3ERCA 1NW8A 3BGDA 3BUSA 3OU6A 3G2QA 2DPMA 4ER5A 1MHTA 2AN3A 5F2OA 3HCAA 1L3CA 3RIEA 3GU3A 2XYVA 2Y1WA 3HVHA 5EHGA 5HIIA 1NE2A 3TPZA 1YFLA 3FUXA 5EMLA 3MGGA 5D1HA 2ZIEA 1JG2A 2B3TA 3LCCA 4QQNA 4YUYA 3G7UA 5HIJA 2CL5A 2XYRA 2GA9A 3HVKA 3LECA 2ZULA 2ZBPA 4FZVA 4RTRA 2PX8A 5DTRA 4K6MA 5H02A 2PJDA 2PWYA 1WXWA 3PS9A 5EQJB 3P9KA 4CKBA 2NYUA 5HFJA 5IKMA 1P91A 2JHPA 1I1NA 2AOUB 3ID6C 3TM4A 3PLAE 3A27A 5T64A 3P97A 2QE6A 2OXTA 2C7QA 2O07A 2XVAA 3NWEA 3G5TA 2C7RA 2ZFUA 5C1IA 4OX9Y 4MTLA 4EMSA 4MHTA 2CMHA 2Q41A 5CVJA 2GAFA 4RX1A 2EJUA 4GC5A 2CKDA 1JQEA 5CVVA 2BZGA 3P2EA 3FRHA 3T0IA 2PXAA 5DX0A 4BP3A 3U81A 3KPJA 1UWVA 4RV9A 5FULA 3DXYA 1YUBA 2ORED 4ISCA 2AOTB 3FPJA 4KW7A 2YTZA 3KQPA 1XCJA 5FTWA 1I9GA 2Z6QA 3OFJA 3TFWA 4EVIA 3BGIA 1M6EX 5FWDA 5DTQA 2P8JA 2ZWAA 10MHA 4GUAA 3OZSA 4JXJA 3CJTA 3LCUA 4H0NA 1JG4A 1NBHA 5LQNA 2O0LA 1G60A 2IDKA 2O57A 4U7PB 5EEHA 4AUKA 5BXYA 2ZLBA 4RTSA 5DLYA 4QPNA 4GBED 5F2NA 3EMDA 3FTDA 3UZUA 4DCMA 1WG8A 4HTFB 4A6DA 3B3JA 3C3PA 3TM5A 5CVUA 3GO4A 4YV0A 2PGXA 2A14A 1BHJA 4YV1A 2QM3A 3G89A 3HA3A 2G8NA 3SSNA 4C04A 3LHDA 3MQ2A 3B3GA 2Z6UA 4IKPA 4PGGA 1XDUA 4GOOD 5K0JA 5KYGA 3EMBA 2AOUA 2JHAA 3S68A 2OO3A 1WY7A 2WA2A 2IFTA 3UJDA 4G56A 4P58A 3FZGA 4R05A 1SKMA 3LGAA 2OB2A 2YXDA 3C6MA 4MIKA 1P1CA 3UJAA 4U7TB 2IH4A 2IIPA 2PSSA 1HNNA 3P9IA 1SQFA 1YZHA 5EGSA 1DCTA 5HOQA 1JG3A 3ER9A 3DH0A 2B2CA 5EZQA 2PV0A 2BR5A 3M4XA 1VP9A 2PX4A 3EVEA 5EG5A 2HMYB 4GOLD 3E8SA 3A7EA 3VC1A 4ER0A 3TMAA 3KQVA 3CBGA 3DP7A 5E2AA 3BKWA 5FQOA 3I5UA 3LL7A 1L1EA 4HGZA 1IY9A 1KYZA 3BWMA 3DULA 2IDJA 2PXCA 3KQTA 3OU2A 3R3HA 3FPFA 4BLVA 4E2ZA 2ZW9A 3LX6A 5K0NA 4OBWA 4RVGA 1M0EA 3DXZA 2QRVA 4PYQA 2IP2A 2WK1A 2ZZKA 3EGVA 2HV9A 5EKXA 3SMQA 5DM1A 3UWPA 2C7OA 2UYHA 2ADMA 2V74B 3ELDA 3FYCA 3A4TA 1T43A 2P35A 4X61A 4FS8A 4RTMA 4HG2A 5KVAA 1JQDA 2ZBRA 1FBNA 5HEKA 1JTFA 3MCTA 2GPYA 4CXMA 3NVMB 2I6GA 1BOOA 5KQRA 4POOA 5CIYA 4EKGA 2PX2A 1ORHA 4R6WA 4EQZA 2F8LA 2K4MA 4RYLA 2QRVB 5GIOE 3EEOA 3OU7A 4HTFA 5P8WA 5BW5A 2ZSUA 1KPHA 1RI4A 2LD4A 3KPVA 2JH8A 3MTEA 3DXXA 4YUVA 4RVHA 4XCXA 5GP1A 4DKJA 5LQKA 4HRAA 1V39A 3V97A 4KRGA 5K0FA 3C6KA 3B7PA 4X60A 3EVBA 5K0CA 3FPGA 3G88A 1Q0SA 3G8BA 3P9CA 4NECA 4Z2YA 2I62A 1ZGAA 2ERCA 3EVAA 3I64A 2G72A 1EIZA 2YR0A 1YF3A 1BC5A 3UJCA 4MQ4A 3P9NA 3TRKA 4CKEA 4M7RA 3SGLA 1P39A 3A25A 5K0GA 4V0RA 2ZZMA 3OE5A 1MJFA 2AOTA 4R8RA 5FA5A 3EGEA 3HNRA 3SR4A 5KQSA 3HM2A 4OBXA 3VC2A 3KR2A 3WSTA 1RI1A 1ZQ9A 3HCEA 1PJZA 1X1CA 2GB4A 5HIMA 1QAOA 5GINE 2G1PA 3EVCA 1X1BA 3ELWA 3IHTA 2OBFA 2UYQA 3O7WA 2AVNA 5EMMA 5FCDA 4QVKA 3P2IA 2IBTA 5B1SA 3AJDA 3L8DA 3LKZA 4R6XA 3GDHA 4RVFA 3BWBA 4C05A 3O31A 3T7RA 4DZRA 1AV6A 1VP3A 2EG5A 4GOND 3M6WA 3B5IA 3OCJA 1SG9A 1NW3A 5G02A 2UYOA 2EFJA 3MTIA 3IYLW 4R8SA 3I53A 4HGYA 3GRYA 1Y8CA 4RVDA 1NT2A 4E31A 2NNWB 4YUXA 3R0QA 1AQJA 1JQ3A 5K03A 1G55A 1RI2A 4FR0A 5EEGA 2FRXA 1D2CA 5GM2A 4Y2HA 3FUWA 4UOEA 5DM0A 2VP3A 3CVOA 3OFKA 5DTMA 3NW9A 3PFGA 3UA3A 3HCFA 3H2BA 5DRYA 4M36A 3CCFA 3PTAA 2XBMA 4CKCA 4EK9A 4GEKA 2VZ9A 1TW2A 4LG1A 2N47A 5K8VA 3FPEA 5HIKA 4RTPA 4AZVA 2B78A 2AN4A 3SX0A 1YZ3A 1ZKDA 4P7JA 2G71A 2VDWA 4KVZA 5DRTA 4EKIA 5K0BA 2HR1A 5E1BA 2IBSA 2AS0A 1EG2A 2FK8A 5C9ZA 4FGZA 5EMJA 5K01A 1I4WA 1R6AA 1U2ZA 4OA8A 2AVDA 1ZG3A 5CVDA 5LQRA 2NP6A 3EEYA 3M70A 3OZTA 5C0OE 4C03A 3HTXA 5E9WA 1QYRA 3KQSA 2NXJA 3GJYA 2PKWA 1KR5A 1KPIA 1KHHA 1VL5A 2NXCA 2XYQA 2O06A 2G70A 4QQKA 4BY9E 3G2PA 3CKKA 4RTJA 3LDGA 3EPPA 3A7DA 1XJ5A 4AZTA 3CJRA 2ZCJA 3DMHA 5ICFA 5U4XA 1NV8A 3G2OA 3CJQA 2IH5A 3K0BA 2OKCA 2GLUA 4LWPA 5EIFA 3RODA 1N7IA 1X1DA 4E33A 4FP9A 4KDCA 3R6TA 4QDKA 5FHQA 3KR1A 5K09A 1SVUA 2BR3A 1L3IA 5D1NA 1RI5A 2IPXA 3AWIA 1VPTA 4ER6A 3PVCA 4ER3A 5K05A 2PY6A 2YXEA 1FJXA 5JUWA 5CCBA 1DUSA 1FPQA 3M6VA 4GF5A 3PFHA 4DMGA 3MERA 4AX8A 3I58A 5BW4A 2H1RA 3AXSA 3UFBA 1Z3CA 1B42A 4PGHA 3MCZA 1TPYA 4PYNA 5FUBA 3VSEA 2YXLA 4F86A 1XVAA 4FT2A 1WXXA 3E23A 2UYCA 2P40A 1PRYA 3KQYA 3LCVB 3P8ZA 3FTCA 4FSDA 1H1DA 2PLWA 2OPBA 4GOMD 3O4FA 4QDJA 5DSTA 1XXLA 1EQAA 1D2GA 3D2LA 5IH3A 1KIAA 3HA5A 3SSOA 3JWGA 3OE4A 3GRUA 3KPUA 1M6YA 1OR8A 2ONYA 3BWYA 3K6RA 2FPOA 3B89A 3MB5A 4HH4A 5LSAA 2ZWVA 3ELYA 5ICCA 3IEIA 1R8YA 4IWNA 4PYJA 3BGVA 3NTVA 1UFKA 1XDSA 3MAGA 3HCBA 3SM3A 4DF3A 1Q0TA 2GH1A 5EHIA 2B9EA 2VDVE 4RSRA 3KQMA 4P7FA 3UJ8A 3BWCA 3IV6A 1L3BA 2Y1XA 1R8XA 1JSZA 1NKVA 2VS1A 2ZTHA 4PINA 4PIPA 4KIFA 1NW7A 4HSGA 5GOZA 1O54A 1VQ1A 4XUDA 2NXNA 2HTEA 1INLA 2ZVJA 3PX3A 2ZZNA 1EJ0A 4C4AA 3G5LA 4BLUA 3NWBA 4M38A 3TKAA 4KIGA 2PXXA 4KDRA 5ERGB 2ZIGA 3EVDA 2FCAA 3NDIA 2DULA 4V0QA 4FSXA 4RTNA 2ESRA 2PT9A 5E8JA 5CCXA 2WA1A 5E1OA 5EC8A 4CTKA 2PX5A 2BM9A 1RI3A 1F3LA 1G8AA 4PYOA 3HA7A 1IM8A 5GIPE 3KQQA 3TR6A 5KS2A 1NBIA 1R00A 3Q7EA 5E8RA 3VYWA 2EJTA 2O05A 2HWKA 2YUIA 3DR5A 4DCGA 4RWZA 1X19A 4ER7A 5ICGA 4RTKA 2AOXA 3TQSA 1SQGA 3SSMA 4P7GA 3T7SA 1N7JA 3R24A 5E9QA 2E5WA 3DUWA 3LBFA 3SVZA 3P2KA 4PCAA 3THSA 2EX4A 2AOVA 3E05A 4RTLA 2I9KA 3B3FA 4HC4A 1P1BA 4PYKA 1VE3A 5DWQA 3THRA 2ZIFA 3GWZA 5T6BA 3SXJA 2IH2A 1JSXA 3EGIA 1N2XA 1KP9A 5FA8A 1NW6A 2H00A 3FUVA 3HEMA 4F85A 5LQJA 5CVEA 3MHTA 3KKZA 2P3QA 1FP1D 3DTNA 3DMGA 3KQWA 3DOUA 3HVJA 1AQIA 5DX8A 4LECA 1RJFA 2CMGA 3KQOA 4M37A 4RTQA 1L9KA 4Y30A 2YVLA 3OPNA 3CGGA 2BR4A 3KHKA 5EOVA 2IGTA 2PT6A 3Q87B 4CTJA 1R18A 4C08A 5LR6A 2R6ZA 5BP7A 2OYRA 2H11A 1DL5A 3GNLA 2NXEA 1ZGJA 3LDUA 4X63A 1ORIA 4C06A 3GCZA 2P3LA 2P41A 4E2YA 3REOA 2AZTA 4QPPA 5EMKA 5JR3A 2FYTA 3EVZA 2I7CA 2UZ4A 4KWCA 4QTTB 8MHTA 5E9JA 3FTFA 3BT7A 1KXZA 5K0LA 4O29A 5DM4A 1F38A 9MHTA 3KU1A 5EIWA 4E30A 2QYOA 1VIDA 3T7TA 4YMGA 4OQDA 4GC9A 4DA4A 5K0EA 3AXTA 3NVKI 4MWZA 2Z6AA 1RJGA 4YV2A 4F84A 3HVIA 4PYLA 4B17A 2XVMA 1QAQA 3TOSA 2V7EA 3UBTA 2JJQA 2R3SA 2VDUE 3DLCA 5DPMA 3NJRA 4AZWA 4DQ0A 1RJDA 3P71T 3AY0A 3KPYA 5DT2A 1JTEA 2OZVA 1KPGA 4X41A 5FQNA 4ZTBA 3KPWA 5FADA 3FRIA 3JWIA 2PVCA 4PONA 3G8AA 3GXOA 1JG1A 4YUWA 5EZSA 3CC8A 2YQZA 5FWAA 1G6Q1 1WS6A 3LKDA 3UA4A 3UJ6A 3R9XB 1VLMA 4E32A 4YMHA 4PYMA 4YUZA 1X1AA 3HCCA 3JWJA 3A26A 4IV8A 4PWYA 4E70A 4BLWA 4CWAA 2P7IA 4XUEA 3FUUA 5LQUA 1TW3A 2PWPA 3UJ7A 2AN5A 3M6UA 3BXOA 2P3OA 1RJEA 5CD1A
chains in the Genus database with same CATH superfamily
4BB6A 3TLAA 3I9FA 4BVKA 4QOSA 4ZEWA 4LAFA 4WCDA 2ZAGA 4KNYA 4IKEA 2AQIA 5F64A 1Q44A 3BULA 3E61A 2ZSAA 3EVGA 5L3QA 4KUGA 3ZJ5A 1LDMA 1L8AA 3OH8A 3LQKA 4K9RA 4MQFB 5T4FA 1E2UA 1RTTA 3BQMB 3VU9A 4YRZA 1G38A 5DNEA 2FGJA 2VPWA 1T35A 3EGCA 4JT9A 3QMWA 4EYSA 2C3UA 3WGGA 2H1VA 1QRRA 4ZYLA 3AL0C 2HRZA 3L0OA 1RR6A 2H2GA 1DC3A 1OXTA 3FYDA 2JH9A 3EEFA 5FHRA 4ZDIA 2PBLA 1J9EA 2ZWOA 5FFMA 2JIZA 3VAYA 3RUDA 5FNZA 5LQCA 1JLHA 3L4SO 1R6VA 5DSXA 1UJ5A 3U49A 4DFDA 4AF6A 1EX6A 4FDTA 5BQ5A 1DE0A 1YDFA 1AK2A 2NYRA 2NZUG 3D2AA 3JQBC 1WU7A 1MG0A 3IPRA 4L50A 3BCSA 5ADUS 4JLUA 1Q0RA 1W0KA 3RSGA 4F2PA 1QH1B 2G40A 2R1TA 2PWBA 4H31A 3SHOA 4XWYA 1AQYA 1RHJA 3SCZA 2GFQA 3LOUA 2ZBQA 3QUAA 1DGQA 1CHDA 2BEKA 5HZHA 3WYFA 4U2EA 3VH1A 5KWSA 1O9GA 3BZBA 1NTRA 4TMYA 3UQYS 4YAUA 1LH0A 2CDCA 3CNEA 4ZGGA 1NXQA 1QFSA 2C7VA 2L2QA 2XRFA 4EGFA 4FYIA 5AKGA 1KAGA 2PFSA 1M74A 1NVVR 3O83A 5EJFA 3WLJA 4O4IA 1IQRA 3LHIA 3V7YA 3AF6A 2XF2A 5CNKA 1YBVA 6LDHA 1K6MA 3JVVA 3W2HA 5EE0A 3OU6A 1PX0A 4MGZR 2Q2QA 4W5JA 3FOZA 4G1BA 2GZ1A 2XCLA 4S1VA 4IYRA 3O91A 4Z8XA 1SC4A 3T9AA 5LLTA 1UDCA 5G1PA 3DBIA 4KWIA 3JZDA 1FTWA 4NIMA 4Y9DA 5EMLA 4FNAA 1SCBA 3QY0A 3GRAA 4P0TA 5H9VA 1NJ6A 2G5CA 2QMQA 5FA6A 3KLMX 4BO7A 5AJHA 1UEIA 4R9SA 4B8YA 4QU9A 3ZD7A 2XKAA 3TQHA 3T4XA 3VR4D 3A0RB 2EYQA 4HAVA 3R0ZA 4R1MA 3WLMA 1KY5A 4IDCA 4ZHSA 3BWXA 3ZNNA 4DDUA 1U65A 1XOIA 1T3LA 4RIEA 1EGAA 5FFFA 3S5UA 1TAUA 3AG5A 2EJUA 2X1VA 3NONA 5LZ8A 4F12A 3KOZA 4RKFA 2V7UA 4UHDA 3KJGA 1ZI8A 3K9CA 2JLXA 1NBMA 4HAYA 4GM4A 4KTVE 1B6GA 2WWHA 2E4WA 1NVGA 4C2BA 5J58A 3U61B 3TLXA 4OUDB 2YWHA 4NLLA 5CT6A 5BQXA 3KJEA 4ISCA 1Z56C 3HJHA 1R2QA 4I1RA 4R9RA 5D3KA 1GCAA 1GEGA 1MAWA 3DL2A 5HSGA 4WSOA 1GARA 1Y42X 2AEMA 4EJ6A 3O0DA 1WR8A 3KXKA 3ROFA 1WXHA 3THXB 1UC9A 3K0FA 2P4HX 4MYRA 3FYSA 2C5FA 3E5HA 4LRUA 1WXIA 5ALWA 1U2DA 1XTJA 3I5YA 2CZGA 3IE0A 4J1SA 1SBZA 3HQ4O 4JITA 4RESA 1YQQA 2IYVA 4AO6A 4C87A 2FPGA 2KHZA 3JQRA 3UZUA 4ESVA 3WMFA 4R1PA 1CZNA 3TM5A 1DEAA 1WMFA 2HA0A 3M4NA 2ZRQA 5HOEA 4DUGD 1PAUA 1SOMA 2FZEA 3ICOA 1XZ8A 2G8NA 4B3BA 4K2HA 1A76A 4D9GA 4GOOD 3UWMA 3A6FA 2RGXA 4MLDA 5DFAA 4KRYA 2HQOA 3ZDRA 1E3MA 1NULA 2VC2B 3DNPA 3OZ7A 1W1IA 3CW9A 3PUVA 4NFHA 2RGWA 4EY5A 4OYYA 3RCBA 1VJRA 1VKZA 1IRIA 1YDHA 1SVOA 2BUBA 2DECA 2JFXA 3AH8A 3LXUX 5AM5A 5K3DA 2QZJA 3V8MA 1QFJA 3PXAA 5HK8A 2GMWA 2A1UA 2XUDA 1MTOA 1NLMA 3L6DA 4JR0A 3G1WA 1JDUA 3EFOB 3Q2OA 1WX1A 5EXEA 4WINA 2W9XA 3ZW7A 5I4KA 3A37A 2FP3A 4LE0A 3AUAA 3IP5A 1JAIA 5AP9A 1FDUA 3C6XA 5B2EA 4RQAA 3DUFA 2ZB2A 1IPHA 3O8QA 1VMAA 3ND5A 1KYZA 4G86A 4LE1A 2WNSA 1ZLXA 4OL9A 4EG4A 4TV9F 4IILA 1OLUA 2ZTMA 3HY3A 5AW7A 2WP0A 3QKSB 1PZEA 5A02A 1XUOA 3IR7A 5EJIA 3PNKA 4RD1A 3KZVA 5J40A 1PR4A 1OB2A 4C7OA 5LBIA 1CP3A 5JZMA 4DIDA 3D31A 1CG6A 1XQYA 3A4TA 3JRXA 4LJ8A 4ZOCA 4X61A 5DK6A 3TOCA 5HR5A 1EWRA 3FVRA 4FDUA 3VDRA 2HF8A 2VPXA 5IF9A 3HPQA 1FP6A 1T10A 2HMAA 2ZYTX 1XMOB 4M86A 1EVJA 3JY6A 4LHEA 3UMFA 3EZNA 3KZKA 1OX5A 1OVGA 3TK1A 2PX2A 3CW8X 1U6KA 3LLSA 4KPUA 5LA6B 1K6XA 2JFQA 3L49A 4WN9A 3ZCVA 3EEOA 1W36D 1I0IA 2CL6X 3GMTA 4A1FA 3H9GA 2Q8QA 2ZTLA 4Q4AB 1KOJA 5DHTA 1G0NA 2VF5X 4LY0A 3V97A 3N7UA 1B73A 2XNJA 2XY4A 4U2DA 2P6NA 1AOXA 2BVNA 3ETDA 3ZIUA 5C7YA 1E2DA 4NQRA 2XXAA 3MWKA 3U3JA 2PKQO 3OEEA 4L57A 3DVRX 1B8NA 4MP3A 1GQYA 1AT1A 3IJRA 3C3WA 4CKEA 4ZYVA 4TTRA 5LL6P 3VO9A 2JK1A 2UUOA 3T5DA 5BWMA 4H60A 2PPLA 1N4DA 3WI7A 1DFHA 3RAJA 3QUBA 2XCIA 1KS9A 2OBLA 2RDMA 4F6CA 3OP1A 5I5EA 3L40A 3WSTA 3V1YA 2JA1A 4O4LA 3BMXA 4S12A 1GNSA 3LYAA 3EVCA 2IE0A 1DLJA 2IYWA 3MMNA 2UYQA 1YC2A 3KT6A 2QJWA 3G68A 2DR3A 2FZKA 3DOIA 2JI7A 1KEUA 2JAUA 1VPWA 4HZIA 1WA5A 2M2IA 1G2PA 1P2DA 1RRGA 4AQ7A 1AV6A 4A73A 2HMUA 4KWHA 3D6TB 1BS2A 3QVUA 1QGDA 1ODIA 1A4XA 1D4FA 1K6EA 4F06A 3PTLA 4CM9A 2AEFA 1WKVA 3LQ4A 4ND1A 2P9JA 2VH1A 4A82A 4GZMA 1KDPA 3ZHUA 1U2TA 4V3BA 3K8QA 4UE2A 5H5JA 3UGQA 4YAWA 3VYUB 1JT2A 2BP7B 4O1MA 4UCFA 2Z08A 1OC2A 3SN6A 2AUMA 1DV2A 5THKA 4CMIA 3PFGA 4O5OA 1LVHA 4Y18A 1A5TA 2P65A 3BBPA 4X94A 3ZDXB 1CY8A 2GYVA 2O2SA 1UJCA 1GQRA 4GEKA 4LMPA 5IMSA 3HUUA 3RRYA 4RJIA 2ZJBA 3OFSA 4UEJA 4BLSA 3FPCA 1E9VA 1P6UA 4JSYA 4X20A 5JVDA 1DQRA 2PL5A 4WGFA 1C9DB 1HFKA 4OHBA 3E82A 1QHYA 4FGZA 4ESHA 1F14A 2IXEA 4OA8A 3H8WA 5DW0A 5FWXB 1Z35A 3H11A 4KFSA 1GG8A 3CR7A 3BPSA 2JKYA 3L05A 4J07A 3QE4A 4E08A 1ZD3A 3BIOA 1TQDA 1ZC4A 1YE5A 4X3PA 3FDJA 2J4DA 4YQFA 3NETA 1GDHA 3W05A 5JI3E 4RD0A 4BY9E 5JSUA 3S44A 2WIFA 3CG4A 2NM0A 3RDPA 4RJTA 1MW8X 4UNNA 1M6NA 1ZMTA 5K8UA 2CNWD 1UQRA 2HXSA 1L1FA 3VR4A 1EFCA 3SZGA 3EJ6A 1HL7A 1BYUA 1K3FA 4LKOA 3ZCUA 1A97A 2VAPA 3LPLA 3Q6MA 4KL8S 1T5OA 5JNLA 3SI7A 3V3TA 3FYTA 1BE1A 2PV7A 2W43A 5DEIA 1T6ZA 1NU8A 1G9TA 1CSEE 2VYVD 5MN4A 2BGRA 5HXAA 4X1YA 3D3JA 1HFEL 4ND5A 3PWSA 5JUWA 3M6VA 3GG9A 4LMAA 4B8ZA 1EFTA 2GCIA 2C3YA 3KJNA 3PFHA 2P9CA 3PC3A 2VDPB 1I10A 4CKZA 2IOQA 3SXUA 1L5LA 1F17A 5IC4A 2QIOA 1S9DA 3AXSA 4LZOA 3HRHA 4IJQA 1ADJA 1IWBB 2O2GA 3RYTC 1VB5A 4UEKA 1Z5VA 1XD9A 1VCHA 1MC4A 4E12A 5I01A 3AVVA 3VU9B 1PZMA 4LBZA 5JOQA 2CFOA 4I4NA 4OJTA 1LSUA 1NHGA 2I78A 2HDOA 1USIA 4I5GA 2R1ZA 1PYDA 3GVIA 3L04A 3QKRB 3RRXA 4U7FA 3L9WA 5BN4B 1RHKA 3MGBA 4EG6A 2FXIA 5KZMB 2QUBA 3WL6A 3PYXA 2Q2WA 3W9SA 3D2LA 4ZFNA 1GGMA 2H8GA 5KWIA 3PDUA 1Y1QA 1YHZA 2ONYA 1B16A 3DHVA 2C8LA 3IKVA 3BZUA 3OM0A 3NOQA 3ELYA 1UJBA 4IWNA 1GUDA 1UFKA 2YV2A 3OMLA 2ZRHA 3WKDA 2F1IA 1Q1NA 1PE0A 1NWCA 1NP6A 4CHTA 5ARBA 1RIFA 3WIBA 4AS2A 1IEXA 4IR7A 4Z49A 4W5RA 3VC3A 1U99A 2ZTHA 4GSLA 1S96A 1IDN1 4KIFA 1NW7A 3CXRA 4MINA 1I4DD 5DNWA 3RYCB 1M66A 4R1QA 1I4LD 1USVA 4MRRA 3C3AA 4YJHB 3RT1A 4MS1B 4GKJB 2Y9MB 1QS0B 4XDGA 1RHQA 2NO5A 4CG1A 4JC5A 4XIIA 1E60A 4D3DA 1M6HA 3EZ6A 1YU9A 1GEEA 4HF7A 5IRCD 3K0AA 2XH8A 1ZC3A 3ULKA 4CEHA 1PR3A 2PT7A 2Q9CA 1R4MB 2JAXA 4MRPA 1E0DA 1SR8A 4J75A 1Y6JA 2VYND 4J91A 2BFBB 4ZT6A 1ZNXA 2VF8A 4P82A 4AY3A 1J42A 1FX0A 1HV8A 3JQEA 4PYOA 3SF8A 5KS2A 1VHWA 7MDHA 1R00A 5BV7A 2F1RA 1YB5A 3I6YA 4MNTA 2NQ8A 1VLLA 2O2EA 3AWDA 3VNSA 5BN3B 4ETMA 5ICGA 1PFKA 4HVLA 5LD2C 2F00A 3A6GA 1OGJA 1STOA 1T2NA 3MT0A 2REBA 1VLHA 3E35A 3OCWA 4V0OA 2Q4OA 2IGBA 3UWOA 4UBIA 3ENVA 3GJRA 4EYKA 1PJRA 2DT5A 3HB9A 5DWQA 3WLOA 3KSZO 2I4OA 2TS1A 4EY7A 2ZBDA 2PJUA 3HEMA 4CPDA 4P4TA 4ZQHA 3ZCQA 1Z73A 3DTNA 3N2KA 3H8JA 1AQIA 2BM0A 2HCFA 2R47A 5C5CA 1CF9A 4Y1GA 1G3QA 4ZO6A 4KITB 1Q0QA 1VJGA 1T15A 5AI0A 4NL4H 1UBLS 2IGTA 2ZRAA 4R54A 4C08A 1OHHD 1HLDA 1NU6A 2B34A 2O0HA 2WWWA 2GCPA 3DF7A 4IG4A 4TL8A 1RABA 3GYGA 1RXSA 3NRJA 1NUUA 4GI3A 1SCAA 4JC4A 5EWLB 4D57A 1VSTA 3V8EA 1I6WA 3F4LA 4CI9A 3JQCA 3UMBA 2H5JA 2QLJA 4XGIA 2G7MC 4ARBA 2UZ4A 3K70C 4TL7A 1SC6A 1EVLA 5CX4A 3OUZA 5DM4A 1F38A 1ODCA 4O4HF 3E9YA 2X0FA 4N41A 5KQMA 2P0AA 4F38A 2I3AA 3TGWA 2JFPA 1MF7A 1JEYA 1U9YA 3HFGA 4HWSA 4L5CA 1MEJA 3KFXA 3B2EA 4CF5A 3R5KA 4ZCSA 1WMDA 1QC5B 4E88A 4NICA 1IL0A 5KVCA 4NPCA 5AESA 3FMPB 3BTUA 1J0CA 3FKSA 3R3XA 4BNHA 3NHZA 1TOAA 2HJHA 3Q1KA 3R3VA 4M6WB 2I03A 5CDUA 2CBGA 2A0YA 1U3GA 4J29A 3G6KA 5C51B 3IEVA 2FOXA 4AZ3B 3BJMA 1YZKA 4PZPA 5BRNA 5JJ5A 1GLVA 4ZHQA 5H0IA 3THWA 4HQLA 4MVCA 3NV7A 3V42A 5IKEA 4XVCA 3RWMB 3WOVA 1JL3A 5IYZB 4FB5A 2OHVA 1UP4A 1KHTA 3R9XB 4NZMA 2IEBA 2B36A 2HM7A 5ITZA 3FUUA 2ERYA 1U7TA 4CLDA 3BRCA 4YAIA 5IT9A 2GF9A 3MCUA 4HNHA 2C9DA 2GSWA 3V8VA 2DLCX 4UVIA 2XBUA 4M7OA 4KNWA 1RIIA 4LWQA 4RKRA 5GTDA 1Q7TA 4EHBA 4LZZA 1QANA 4FGWA 3VR1A 4KR6A 3NRBA 2WU3A 1WNFA 1CIPA 1BDMA 5FB3A 4MS1A 5F77A 2ALJA 4HDNA 3VAAA 1Y8ZA 2OG1A 5MGBA 2NPFA 9LDTA 3DDZX 1KI7A 4RZIA 3P4XA 5EKUA 5CA1F 3G8CA 1GL9B 3QW2A 4YRFA 1NHWA 3S28A 1QZ3A 3WLLA 2R68A 3RGWS 1WSBA 3UTDA 3VFDA 4HQRA 1OBFO 1WD7A 4JD5A 4AYXA 2GJAA 5AHKA 2F4VB 1JPUA 3TL6A 1DS6A 1MAUA 4JLBA 4WBXC 5GONF 3QLJA 2X1MA 4NBUA 2PQ6A 2DLNA 4IV0A 1DAFA 2OO5A 2JHCA 2Q3EA 1XXHE 3V9AA 2Q4RA 1SUCA 1NDHA 1ETUA 2EFCB 1UXGA 1EWTA 3RUAA 1ESCA 3SHWA 3DLTA 4X97A 4PNEA 2NP7A 2JPDA 1D09A 1QHNA 1R4AA 3ML1A 3VPHA 2O23A 1YMVA 2GJKA 3QLTA 3HMQA 4LOLA 4MV9A 4TGLA 4XIFA 4BU0A 4QUBA 4C4SA 5C1BA 4IHJB 1XD2B 3GGJA 3GGDA 4NBVA 4WJZA 3GH3A 2VJBA 3GRKA 3QWAA 4XQEA 4YC7A 4B5LA 3PHIA 3UXHA 1QVZA 1NBWB 5J2UB 4MWOA 1J8VA 2AR0A 2LCFA 4GWKA 4TV8A 1JA1A 3CEMA 2CSXA 2MYNA 3EXEB 4D4KA 2O8CA 3B12A 3MJ4A 3VTZA 3R3JA 1JV2B 2I2AA 4IY1A 5BN3A 3LTNC 3RBVA 4KH0A 3LC0A 4KFRA 1RQ2A 1XZCA 2JAPA 1C80A 1SXJC 1XNJA 2I99A 1TMKA 2J3HA 2WJIA 2EBWA 3NCTA 3W2IA 3ZIAD 3LPMA 2BMVA 3GEBA 3N07A 4KK3A 3D4BA 1OFUA 1FXWA 3I8XA 1MHTA 3F97A 4TS4A 5IM4A 4RHUA 3KWMA 2VJQA 2J67A 2ZB8A 2IEDA 1X7XB 1DT5A 3IQXA 3EIFA 3OFND 2XWPA 4KBYA 4G9BA 3NH9A 4M0PA 4DLBA 2QLBA 4ZI7A 4YUYA 2WPNA 4JBHA 1A5ZA 1MC1A 2ZULA 3NHFA 4PXYA 2WUGA 5COAA 5J5CA 1CNFA 2H3EA 2H48A 1D4AA 1ESZA 1S5PA 2FJPA 2YC2C 1WXWA 4FMCF 2AKAB 2FWNA 1NYRA 2VP4A 2XB8A 4R16A 5BWBA 3EH2A 4E4TA 2DH5A 1ZOIA 3TM4A 3VZBA 5B7GA 4YMWA 4L8FA 3ZE9A 3QEJA 5HBGA 1S0UA 4ZOEA 2C4UA 2B0CA 1AHNA 2O2CA 4GSKA 4H59A 4OM7A 4YGXB 4O4LF 2AG5A 2Q99A 2X0IA 3FIJA 4J1NA 3TLBA 3UPTA 4OJYA 4BRWA 3KWLA 3KT0A 2DQ4A 4C4TA 5LYJF 4GC5A 3D3EA 1CRWG 1Y8AA 4Q3KA 3AT1A 5M04A 4KR0A 2EHJA 2ZATA 3QI7A 4NK4A 4QDUA 3PG5A 2WWVD 3KPJA 4RY8A 3TDNA 3U81A 3ZQJA 2I3ZA 4WNCA 5L4SA 2O8DA 1OCEA 3KG2A 2JIQA 4FCVA 2P90A 4FC7A 2IOHA 2Q3CA 3BGIA 3FM9A 1EZZA 3PDWA 2XUZA 3EXG1 2JASA 4TXHA 3GAFA 2DE0X 4FDMA 1PGQA 2Q3DA 5AMXA 3T3OA 2REQB 3U44B 4G5HA 1F2UB 2JLSA 4RD6A 2DAPA 3CX4A 3KTOA 2YHUA 1G60A 2KBEA 3IV7A 2O57A 3ACDA 4ALMA 1AS0A 4FZ5A 4QPNA 3DZ8A 1AXRA 3KXDA 2HH9A 1QRDA 5LMNB 4LBWA 1NQ5A 4L51A 1PFGA 2IQ5A 3VC7A 3ZLUA 1NVUQ 2X7JA 1UWLA 3OJEA 1JECA 4K2AA 4MGEA 4MPPA 4OGGA 3W6PA 4WI1A 4PAGA 1SCDA 1F1JA 1XJCA 1XKQA 4FKZA 1S3SA 4HAIA 4MKZA 4NKRA 4AXXA 5DYWA 1ZSYA 2XNDA 1HZJA 1T1EA 2UXDB 5LB2A 1GGHA 3QI2A 4MEBA 3M89A 3RD5A 1RXCA 1THGA 2FSVA 2WEKA 2WT9A 3S68A 2Q0SA 2ZRBA 5IABA 1MORA 1PU2A 1F60A 3KX2A 4M9QA 2OB2A 2JFUA 3ZI7A 3AR4A 1M67A 1S2DA 1P1CA 2J3MA 2PKXA 4INZA 4YRAA 1EK5A 4GYWA 3F73A 1E1MA 5HRCA 2IUFA 4O25A 1XZAA 3AJ9A 5F12A 4B9AA 3H04A 2PVSA 3KYCA 1HO3A 1N1GA 4HYQA 3EZ9A 1A9TA 1BXRA 2XMSA 1QVRA 2HFKA 1JP7A 1LB1B 2AT1A 5TEWA 3TXAA 5E2AA 4K9SA 1VHTA 3F0TA 3AR7A 4V1CA 1G7TA 3GLSA 3BDIA 2Q6VA 3DULA 1J2RA 4IH4A 4Y2UA 4O4IB 1VYUA 4R7GA 4LNUB 4DBLE 4GMDA 1YJXA 4CI0B 2FCRA 2P11A 4IXTA 2HHHB 2VPYA 2IT1A 2IS6A 2IZ7A 3OURA 3WYNA 4EGAA 1TK9A 3PFFA 5JO9A 1RC8A 4MHSA 4DMKA 2VXCA 1PS8A 1EGHA 1Z6QA 1BA3A 4KH1A 5AJWA 2BM1A 2WAOA 4TS9A 3S4YA 4BKUA 5DNVA 4ZYZA 4Z9FA 4RTMA 3QE9Y 5KYXA 3PUXA 5EFZA 4LW8A 3IO5A 2AXQA 1GTG1 2FR8A 3DDNA 3K2EA 3T95A 4GP7A 3WICA 4MR9A 2UAGA 4P4SB 5K3FB 5FPSA 1CFJA 4MAAA 3IT0A 2FFHA 2XD9A 3HSYA 1DQSA 4I3GA 3PDJA 2YOGA 5D7BA 1QGUB 1KEPA 3B2QA 3SZMA 3EXEA 4B84A 3T5GA 1NONA 2FPLA 4YI3A 1YV9A 1XZPA 1FDIA 2EAUA 3NGMA 3ND9A 4IMIB 1KDZA 3OLYA 3V6MA 4I2VA 4PSVA 1UJNA 2EVWX 3B8EA 2FF7A 4ENSA 3T1YB 2FA9A 4HSEA 4IP0A 4R8KA 3WLAA 3GLIA 1ODKA 3NEYA 3ZDBA 1RAHA 2VZ0A 5B3AA 2NO7A 4LV6A 5EP4A 1N9GB 1YQUA 2WDPA 4JOQA 2KJQA 4TPKA 5AM1A 5H59A 3SE7A 1APBA 1DCKA 2R85A 4CGYA 5DEOA 3HUEA 2IXTA 2BKUA 3I52A 3PZRA 5TQ0B 3PGMA 4R1OA 4OSOA 3L7LA 3Q85A 2WKQA 4L4ZA 1PJTA 1U1EA 4PHTA 3PE3A 3S2SA 3IDSA 5C8VA 3IHWA 2RG7A 2CV2A 5KQSA 1X92A 3T5PA 2O8NA 3VA7A 3D4PA 1T2UA 4CM1A 4MR8B 3G1TA 3TXXA 3KB6A 1TM1E 1X1BA 2DFPA 3RE1A 2OBFA 1UJMA 5B7QA 3LY9A 2XMQA 4R0NA 1WP9A 1SU6A 4FLMA 3BXXA 1Z6XA 5DGIA 3JRNA 2FFBA 5B1SA 2BTQB 4E3ZA 1ANKA 1KEEA 7GPBA 4J4TA 4MW4A 4XPIB 4B76A 5KSPA 3U17A 4PU0A 4CDNA 2JIOA 1OYVA 3T61A 4AJ2A 4RVDA 7YASA 5FYDA 3H3FA 4CMEC 4NYJR 1KI2A 3E2MA 4Q9KA 5JSHA 3RVBA 3G79A 2XQFA 1PR6A 3EG9B 3EQ6A 3GA5A 1ZJWA 3CZQA 5DM0A 5LOVF 2AYXA 2VJDA 2C5BA 4BBZA 4I8XA 4X7PA 1A5SB 3ANLA 2NZVG 4BVHA 4N76A 3PTAA 3GOHA 4QUAA 1PR2A 2PD6A 2VDRB 1CJCA 2VZ9A 4GBGA 2PMEA 2IV2X 2GVDC 3M1YA 4AZVA 4B4OA 3KAKA 1QK3A 4QRIA 5D7NA 4RGYA 4Q1BA 2V97A 3UJ3X 1CRLA 1V8FA 2YBEA 2YJ5A 2ZSJA 3E3MA 4ZODA 3UUWA 4TSKA 3ECAA 1G21E 3RVDA 3IUYA 3WRYA 2GARA 5K01A 4OHXA 4DW8A 3T3NA 3LYLA 1FY2A 3B6JA 5C37A 1ZW1A 2BUCA 1WEKA 5ESRA 1SPXA 3EFOA 1N4AA 2V6IA 4MLZA 4OY3A 2ZYWX 2HQBA 3IIKA 3ZY5A 4B3XA 1NW4A 4P53A 2CDRA 3FH0A 4WFKA 2YMQA 3KLBA 3F5FA 2QN7A 2W6PA 3G85A 4QQRA 4Q7QA 1N3LA 1YR9A 4ARSA 2TMKA 3R7FA 3S8EA 2VBCA 2ZCJA 1M2VB 4YUAA 3TQQA 5KU1A 1W6UA 5EJ2A 3D6AA 3ADDA 3BRWD 1DEOA 1BQEA 4HDSB 3RNOA 3ACBA 3FSJX 4PG6A 3FROA 1O6ZA 2C0QA 4WXYB 5G4LA 3UXYA 1RWPA 4EYGA 4XWWA 1N77A 1N6OA 1BEEA 1PQYA 2GFHA 1LV8A 4QLBA 2WVHA 1JSCA 5L6MB 5LQSA 3WGMA 1N3BA 1SPBS 4Z9XA 3U2QA 2YXEA 4E5MA 3PRYA 1S4MA 1FPQA 1BX0A 2JGMA 3B9BA 1L7MA 3L6UA 3F6BX 5AQ1A 1R6UA 5KI6A 1Y9EA 3ILYA 5LYYA 2JIBA 1S6YA 4FXPA 2XB6A 4OXIA 1TTQB 4MPTA 2WZQA 3K9BA 3OEED 4Q9AA 1SG0A 2KPOA 1VL2A 1L5RA 4HL6A 1Y6RA 2O2IA 4DLVA 3IIJA 2I76A 4YX9A 2JH3A 4NWIA 2BGLA 4QVIA 3U16A 1F2DA 4N82A 3I05A 3KQYA 1D9XA 5KCMA 3NHLA 2I54A 2VT7A 3DLPX 4F96A 4WBNA 2PLWA 4MS4A 1K4YA 2D7CA 2IIVA 3COZA 4PX3A 3KKNA 1SY7A 3PEVA 4ND4A 4ENVA 2EOAA 3NYQA 3OE4A 3SSAA 2QLTA 4ROTA 4XLTA 3T4EA 2ZSIA 2FVXA 3BWYA 3EGWA 3K6RA 4NOMA 1JHDA 1LLCA 2J7PD 4BFTA 2EQAA 2VK2A 4C78A 5EJEA 2ZWVA 3OQJA 3ZX5A 1L7VC 1E62A 1WB5A 4AQDA 1NVKA 3AW8A 3E9EA 4J9UE 1OI4A 1W4BA 2P91A 4IXWA 1NRXA 4IYJA 3GNSA 2YZ2A 2MU1A 2YJZA 4IMRA 1E6MA 4JK3A 2OXRA 3M6IA 1G64A 3QFSA 2O2XA 4D9HA 5IF3A 3NYWA 4EHDA 1UQTA 5B58C 4LBYA 2EKDA 4G36A 5E7QA 1INLA 1AF4A 2PUHA 2ZVJA 3D59A 3PGVA 3TFQA 4WBNB 1THZA 1SXQA 4K40A 2BFAA 1QVWA 3NWBA 4C3UA 4Z4CA 2C58A 4BUCA 3ZWDA 2YMLA 1KEWA 3B51X 1IAVA 1IJBA 4ISBA 4WK4B 2H2HA 1J56A 4PO8A 5THQA 2JHGA 3ZVRA 4YCBA 4L6AA 2WJ6A 1IATA 1SHJA 1UJ2A 4X8OA 4ZGWA 5AW3A 3QK7A 5EZYA 3JAMA 4C4YA 5C5DA 2AN9A 3PD1A 1G8AA 4DNFA 1E4EA 1NMYA 1YS1X 2WM9B 4I5EA 4MS3B 3AEQA 5BSGA 1NRWA 1E98A 1NBIA 3ORYA 4NPHA 1HZZA 1Y3DE 4HVAA 3BFJA 3DMRA 2VHCA 4DCGA 4YCLA 2OQIA 2SKEA 4ER7A 1CS4C 1NJ8A 3FCAA 3AI7A 4XWGA 1S7GA 4LXHA 3IEPA 3DOEA 4BC1A 2FUEA 2E5WA 3QVGA 4V24A 4LYHA 4XLLA 1C0KA 3GQVA 4DCCA 4PO1A 1AKVA 3KKOA 4PYKA 3NWJA 4PLZA 5T6BA 1TLLA 3RSZA 4DA6A 1T5SA 1E9BA 1THTA 4NHEA 5F9MA 2WE8A 5JT1A 1KP9A 1ODJA 4F85A 4DIOA 5KSZA 3GLGE 4WUTA 4M53A 3NEAA 5JD4A 1WWKA 3KETA 1U1IA 3IP6A 1L5KA 1RJFA 3AHJA 5L40A 4BLPA 4GX1A 1SC3A 3REGA 2O5CA 2WF5A 1LA2A 3CGGA 5KPDA 4YRBA 4YJKA 3S1SA 1CVIA 3QPDA 2QM8A 3HCWA 3JQBA 1K68A 1VL0A 3LLVA 3OZDA 3HV0A 1AGPA 2HEGA 2V9CA 1P81A 2JKVA 2QGZA 4C06A 3ONVA 4ZICA 2EYUA 1LS6A 2SKDA 5TGZA 1J5EB 9GPBA 5HNKA 2O8EB 1P60A 4JLMA 5EN4A 4XH9B 3RAEC 3BIJA 3JWEA 5DLDA 2DQYA 1J4AA 2FZWA 2QWXA 2Z9BA 1U8XX 4QTTB 1E5QA 3ANYB 1WD5A 1M33A 3RFVA 9MHTA 2YIVX 2BGUA 4H9GA 4UNSA 3VTFA 1PFQA 4JYZA 2PGAA 3PIRA 1KRHA 2WF9A 4PBTA 1JI0A 4CF7A 1N2SA 5LMUB 5EHXA 2JFZA 3TDKA 1RJGA 2OHGA 5BN4A 1QDLB 4Q34A 3LQ2A 2R66A 2ZJZA 3QKRA 2ZS7A 2BRUA 4JIGA 1JB1A 4MA4A 5GOTA 3VR2A 4BKRA 5BWNA 2FSIA 3DHEA 3RU7A 4AZWA 4UASA 2A9KA 3S2IA 3P71T 1VA4A 3AP2A 5BMOA 2PL3A 1X7GA 3IUSA 4HBZA 1HX7A 1KAEA 2OZVA 3GFOA 5FADA 1X7WB 2GPWA 4WDRA 1ACMA 1LBQA 4BQSA 4IM7A 5EJMA 5BXQC 2XQVA 3CSDA 3D4NA 4DXAA 5CDHA 3LKDA 1JILA 4YRQA 4EAQA 1E7SA 2NUAB 2AFVA 3FY4A 3G2HA 4C7BA 1C0PA 1SO8A 2EQBA 4GOJA 4NCJA 4HN4B 4BC0A 1BHQ1 4IDEA 3CCBA 3STYA 5I48A 5F7JA 3FNGA 5DMXA 3WTCA 1E7RA 5DH9A 1XD2A 3DEFA 2AN5A 3I9MA 3M6UA 3GLGB 3RF6A 3PWTA 3AUUA 4AFNA 3DMFA 2YRFA 1XJWA 3HCPA 2AX4A 5FL3A 1XPUA 2HRRA 2EGHA 2C42A 1GGVA 3RB8A 2ETVA 2JZNA 1G8SA 2FWAA 1FRQA 1K7CA 3B85A 2FDCA 5A4DA 3N0TA 5IARA 3OQPA 2R751 2FX2A 3ZY4A 1Q7EA 1Q6ZA 1C3OA 3ZYZA 1ONOA 2Y2VA 3WV4A 3SEZA 4CIBA 1MEEA 2P7HA 1CX9B 1SG6A 2ZREA 2H1IA 1VFNA 1MVNA 4QXAA 2C78A 1HDEA 3DZDA 4J3JA 3BK1A 4QASA 4HRVA 5EZ5A 2PBFA 3FMFA 1CUFA 3GGCA 4D02A 3DOCA 2H8KA 3FTQA 1VZ2A 2VXBA 4FJ0A 3TSZA 5C18A 3AR2A 3DGFC 3CVVA 1YO6A 1TVKB 2NQ2C 1YA8A 1QE3A 3IELA 4NV0A 5DI9A 2FFJA 3TQCA 2FMKA 1L7EA 1QGUA 4US1R 1TK3A 3I8SA 5AJUA 5EMNA 5E1MA 4XYMA 1GPH1 5A1TA 5DV9A 3IQGX 1U2EA 2E48A 1U2GC 1UIRA 2IEIA 2V7TA 3PGLA 3FZQA 5DULA 4PZLA 4PN7A 5FAKA 2RGGA 1EXDA 1AKYA 4H2DA 4BMNA 4RA9A 1BKYA 4UZEA 3UB2A 2C29D 1NMQA 4E1AA 2YFHA 3K92A 4XJTA 3ZH2A 1XZJA 1TLTA 1X0VA 1U2SA 1W73A 2I4RA 4ZO7A 1OXSC 2J9ZB 3LY7A 2IQIA 4AKGA 2C95A 4N18A 1VDZA 4CLEA 2P1DA 3GPBA 2FPIB 1IXKA 2G88A 2PZKA 3AVQA 5FI5A 3Q6IA 4GE0A 4QPJC 5KJEA 2JGRA 2UKDA 3OWOA 4Z2AA 4ALIA 3EVNA 4JOSA 3ZDZB 4QDOA 1IZ8A 4Q4JA 4YT4A 5HJ7A 3DE2X 3JATA 3GRVA 1L1QA 3ERCA 5K0ZA 2WZDA 1UF9A 4ALKA 2WU4A 1ILEA 1SJ9A 3G2QA 1XVIA 5H16A 3PDIA 4P8RA 3D5TA 4PV7A 5JSZA 2C99A 4PLPA 2G4CA 2F6RA 2QY9A 3QTLA 4JP3A 2EKBA 3AY3A 3FVQA 4O0MA 5KOYA 3FUXA 5AKXA 5E38A 5HIJA 3HNPA 2EU8A 1XI2A 3QXHA 4M0EA 1T2CA 5BO5A 2IHUA 4Q7EA 2PRKA 3F46A 3QTBA 2I1WA 4HNQA 2QW1A 1OXBB 3BFVA 1YMUA 4KHZA 4MDYA 2X9NA 4LS3A 2WIAA 2QRNA 2FKAA 5K99A 3F9CA 4CODB 3I62A 1CD5A 2CHEA 4UHFA 5E6RA 2OXTA 3ROXA 5JWOA 3G5TA 1KYQA 3DCJA 2H7YA 3V4VB 1UDAA 3JD0A 4ZQBA 1SOAA 4DSAA 2I80A 3AO0B 3LT2A 1QRAA 2PYIA 4M2LA 3QSYA 4TMVA 1YNOA 4X1IB 5CYFA 3TCKA 3DVSX 3ZWMA 1L4HA 4AMUA 5FBWB 2RHTA 4D80A 3E1SA 3L01A 4OHZA 1TU4A 2OC9A 2VCEA 1NYLA 4G5FA 1ORTA 5AOVA 1T2AA 1XCJA 5EJ6A 4TZKA 3D6JA 3MUNA 1KJYA 1L5NA 1LWNA 1JFVA 3WC4A 1GIAA 2HGZA 1GY8A 1RPJA 3QY9A 4PFSA 3CVWA 2B4QA 3DMDA 1AY0A 2XXAB 1E3SA 1XMPA 3NHJA 3OF3A 4WNAA 3KE9A 3O1LA 4U9UA 3MT9A 3PI6A 1F12A 4DCNA 2GTPA 3TPFA 3M34A 4K8RB 2WIGA 5AUPB 4MCIA 1X86B 4HTFB 1W25A 3TNJA 1ULSA 3C3PA 3FI0A 3ICWA 4KVAA 1YC5A 1XMVA 2C61A 3H0CA 4NJOA 5BRAA 1AH2A 2F4NA 5JS2A 4UVEA 2W4QA 3ZDFA 1DAEA 1II9A 4YRRA 3ZY2A 4ODIA 5AI6A 2VUTA 3LHDA 1TO2E 3P9XA 2HO4A 5A03A 2RJ3A 4J9VA 4KACA 3TW0A 3UAOA 5KYGA 4ZPXA 3UCEA 1IXYA 3HKDA 5F73A 1WMSA 3FGPA 1X2BA 4MUNA 3W4KA 4A0GA 4QBGB 5ILQA 5I7HA 4FWTA 2VFAA 4OUKX 3BF7A 3ORQA 2QQ0A 4YDSA 3C6YA 4OJNA 1GYQA 1ZRHA 3NTRA 2WHPA 1ZONA 4M0MA 2FQQA 1I4OA 1DC7A 1BE6A 4H17A 4RLFA 3UG7A 3GMSA 1E5LA 2FW6A 3MWEB 2B2CA 2AL7A 4TVKA 5ALRA 1KWKA 5A04A 1VP9A 3LP8A 3AP3A 2VKTA 3K9LA 3LPAA 3O95A 2PX4A 1F2VA 3NJ8A 4DBZA 5J2UA 1A27A 2C3MA 1G20B 2ACVA 5JS7A 1XA3A 4WKOA 5JAQA 3WGKA 4C4RA 2Z6VA 4JHLA 3G0OA 3C7TA 2PMWB 1RYMA 1WHSA 3DKVA 1JG7A 3FCXA 5BT8A 1GADO 2QRVA 5AKHA 5TX7A 1T9DA 4AUMA 5TC4A 3O26A 4Y1FA 5DM1A 4KPYA 4FJ1A 4URUR 2R8RA 1LNQA 1Y5MA 2DHDA 1AS2A 1DIOB 3TTWA 3LF2A 5CFRA 2GAIA 1J22A 1VKRA 4MUJA 4R2WA 2O2DA 3H3JA 1B7GO 3AOGA 4HLNA 1P0MA 5IKPA 4KXFB 4PBSA 1JTFA 1N2IA 1Q12A 5BNTA 3P52A 4IFTA 4PZ0A 1BOOA 5T4EA 1A95A 5KQRA 2CJWA 2IZ0A 3S99A 2H1CA 5AVZA 5CIYA 2I3DA 3KQKA 1ORHA 3C6ZA 3O75A 3ZEAA 2F8SA 3Q3IA 2PSFA 5AXCA 5GIOE 2JI4A 1RQNA 4YRLA 2FPIA 3Q88A 2A0WA 5G3YA 5JMTA 4D9NA 1MB3A 3HHEA 1WB6A 2HFJA 3LPDA 1P3DA 2HLPA 1BZYA 4DKJA 3JZAA 1CZUA 4PF1A 1RPTA 2P0EA 2NU9A 1XROA 2GBIA 3M5PA 3ONFA 4HHEA 4KRGA 3UCFA 4LHZA 2WD9A 3CVJA 2NO9A 1UDXA 2FSPA 3LSYA 1C7JA 2WPDD 2XTAA 3C43A 1QKJA 2G04A 1N6IA 4KE9A 4EUEA 4Z0NA 3JQAD 1EFDN 3K6SA 3QPCA 2EFEB 4KUEA 1SQSA 4UXHA 2ZZMA 4LK2A 2PAFA 1DIGA 5KWVA 1COWA 1J33A 3DB1A 3EIOA 1PLJA 5CAEA 2X2FA 4LGMA 4OBXA 5JNWA 5HW0A 1USWA 1RI1A 3HCEA 3N39C 5CBPA 5JH7A 4L73A 3V00A 3QKIA 5D84A 3RSCA 2NUTA 1MO5A 1QCDA 2V7QA 4L6CA 1FYVA 3O7WA 2FG7C 3VJLA 4OMDA 1KFBB 2E87A 1DQPA 1YNSA 3ROPA 4R6XA 3ABQB 3DGEC 1PBNA 4A15A 3ZC3A 1IXZA 1XX6A 2XKBA 4B3HA 1JGTA 1H2RS 4P5DA 1E3DA 4FFDA 4OQXA 1TYCA 1Z7YA 4MVJA 1RQXA 2CL0X 3B6EA 4LSGA 4ZO4A 4BO8A 4PWZA 1PFYA 1XJQA 4W5HA 2NNWB 2EJCA 2GLTA 4RVSA 1NBMD 4TKVA 3KJXA 4BXOA 2QRZA 2OAGA 1GGFA 2GEJA 4ZCRA 5A62A 3H1BA 1KJQA 2H1WA 4A27A 1J20A 1Q1EA 4OQYA 4L7QA 4DLUA 3IERA 4AO7A 3LT5A 2BFDB 2UZ1A 3F8SA 2HKIA 2P5TB 2JCGA 2WILA 1X8JA 1XHLA 3RYIB 5KHOC 2FWBA 4RK0A 1VSQA 1Y9DA 3AK4A 2WSMA 1YZ3A 1V35A 1ZKDA 4DLAA 1GO2A 4MW9A 3WYBA 4U00A 4CCAA 5DTJA 2JLYA 1SXHA 2FR8C 4XR9A 2FK8A 4XASA 5TQ2A 1GWNA 3P0JA 4G1MB 1BVHA 3M81A 1ZG3A 3BQNB 1QH0A 2HMVA 4FGUA 5C34B 2ZRJA 4KSYA 4HH0A 1DO0A 3KQSA 1KJIA 3ZNQA 1RE1A 2DJIA 4Q93A 4EHHA 4D0NA 4EAAA 5LJLA 1KJWA 2G70A 4KX3A 5KKAA 3O8CA 1K9VF 3G2PA 5TT1A 2QN8A 5AM3A 1SQ5A 1T0HB 4RZ2A 4JI2B 3KEMA 1QOZA 4F5WA 1V95A 4UEWA 1I4EB 1E4OA 1QG6A 1KBZA 1N78A 2K7FA 3B6MA 2GFIA 5A4AA 5CFNA 4FHEA 3V4OA 5IZCA 1UFVA 5I6DA 4BJ5A 3DVLA 1WW8A 3R6TA 5LFAA 2QLFA 4TRRA 4ZYWA 2OFFA 3J81A 4K9NA 2QOEA 5GAJA 3AWIA 3ZKWB 4QFMA 3H86A 4AUNA 1IDOA 2HA2A 3SJAA 5KBYA 3E7FA 4D6PA 3O8DA 2LZ0A 2AK3A 3MCAA 1NOKA 2H4XA 4BBAA 4F6RB 3VRHA 1D4ZA 1PL0A 1JHRA 1OFHA 1VIYA 1QR2A 4WW0A 5LUBA 3X2SA 3VVMA 1TZBA 1W36B 2W6NA 1YKSA 1IWOA 2IUEA 3F71A 4GI5A 4GPTA 1PCXA 5UKDA 2YXLA 5K20A 1ZM9A 1U9IC 3SXPA 3TQFA 1WBBA 1OH8A 4FT2A 1WXXA 3R75A 5JHGB 2X8BA 4BQEA 3U56A 3PJEA 1GAWA 3U9TA 1PWYE 1ILWA 1QS0A 5A4FS 2EWWA 3LRTA 1HI9A 1M5TA 3LOPA 5C5EA 1JG6A 1F8FA 2NZWA 1VPLA 4FFSA 1ZCZA 2GPNA 1B0UA 5BR7A 1EBUA 1NFQA 4N8EA 3JWGA 1I7LA 4KPGA 4ZOQI 1TQHA 3RS5A 4OM8A 2BGWA 5F3RA 2J30A 3GUYA 4FZ3A 4Z4GA 1EM8A 3S29A 3JYOA 2XLBA 1HUQA 1O77A 3HCBA 3L5KA 1ZFNA 1AD2A 1GD1O 2QX4A 2RHJA 1GKLA 2X4GA 3MFYA 1Z5ZA 3MTDA 4FXOA 1KEEB 4KQ6A 2O8EA 3BXEA 4A6XA 2FV8A 2KQUA 1A1SA 1NAHA 4J16A 2ZRCA 1GXSA 2EFYA 4MICA 4PINA 3OPYA 2GESA 5FPTA 1TCVA 4GLOA 1KYXA 3H9BA 2OORA 2R2GA 3Q7TA 1QFXA 3G0GA 4DQUA 1BMQA 3W6NA 1UAAA 2Q5IA 3PR1A 5KNDA 3M82A 3TBKA 4KIGA 1NXTA 1B76A 4KDRA 4TUYA 4W9NC 5A9SA 1NF3A 1U0NA 4J7UA 3L92A 5ALOA 4NI5A 2QMUA 5HPYB 5KTYA 4I8DA 2Y67A 2VK8A 1F51E 1NXPA 1OI3A 4DA8A 4D96A 1K89A 3LY5A 4C01A 1U7DA 4IIDA 2O8VA 3VDQA 1SK9A 1X7ZB 2JJMA 5GIPE 3D4OA 1MJ5A 3H9UA 3TR6A 3RBXA 4A8JA 3SC2B 5ESWA 4DUZB 3A6LA 4YWJA 4WJLA 5IEBA 1PUJA 1BDHA 4ZJZA 2N46A 2GRJA 3RU3A 2AG0A 1PJ8A 3KFVA 4A8JC 2R7MA 3LXRA 2G9UA 1D2NA 2Q0QA 3DBVO 3OQHA 1QIIA 3WK4A 2UUCB 3ETEA 1RRFA 4GYKA 2FE4A 4XIYA 1O0SA 4ZK6A 2W2QA 1HE4A 4OKIA 4A3SA 4TZ6A 4X1YB 4FJ2A 2YYZA 4PFJA 4KXMA 3WL3A 3VV2A 3GV0A 2YH2A 3INGA 1RAFA 5CEEA 1FP1D 4V2IA 1C9KA 4O2AA 2QL5A 3HVJA 4CL0A 1VLQA 4B3FX 4CFZA 4L4UA 1NUTA 3CEJA 1N2CA 1WUKS 2NZ2A 3KOUA 1IXRC 2B1JA 5EOVA 2PT6A 2PYDA 4ARZB 5B4VA 5LR6A 2IZ6A 3K6JA 1H0RA 4QEZA 1Q95A 1WSDA 4NULA 3GDFA 3ZE7A 1O8BA 4BAGA 2NU8A 3K0SA 2P41A 5FTJA 1NIPA 3WGOA 2AJBA 5JDCC 1ADGA 4PTYA 5JV5A 1B1AA 1NZDA 2WPDA 1X87A 3NYRA 3TZLA 3VR4H 4CEIB 3OIVA 4EPRA 4RXTA 1UKAA 5B3KA 5C4IA 2BKXA 3BMOB 3IKJA 3DEAA 5EIWA 5C1OA 5JDCA 1GCIA 4OQFA 3VHXB 4L02A 3T7TA 2IDMA 3ZE2B 3CXUA 4YMGA 1DG1G 5BY2A 3ANNA 4MV3A 2A4MA 5J3JA 1UPFA 4NK5A 4EKDA 4WKNA 3AXTA 3G1UA 3GFVA 3GWGA 1J5XA 3HYTA 4N8DA 3ROKA 3HVIA 3AI1A 4MS4B 4BFYA 2V59A 3LUJA 3MCVA 3TOSA 4ZKEA 3TX6A 5ITVA 2D1RA 4OHUA 3IOCA 3K9HA 8GPBA 1K8ZB 3LIPA 3BG5A 4MPDA 1RBQA 4DRYA 1ECPA 1BJTA 4RDCA 4X41A 5A3VA 3K4HA 3KPWA 4E11A 1JNYA 1R10A 2PVCA 4C0LA 1MH9A 3EEBA 1Q77A 4P3YA 2CLIB 2MSNA 5H3HA 5LWHA 1DMSA 4ZAZA 1ENYA 2BFOA 1L5VA 2YVKA 4WZZA 5CURA 3UIEA 1E96A 5HM6A 1HZZC 2CJXA 2Q3BA 3DYVA 3TW6A 5JASA 4ARUA 4ZT5A 1E1CA 4LNHA 4QDZA 2YQ4A 4D41A 1RJEA 2UZIR 4HAXA 4RE5A 5ENZA 1L6IA 1U4NA 4L8WB 3DBLA 3GRRA 3HI6A 4QL3A 1B26A 3FCSB 1RJ9B 4F93B 4H3HB 4CG2A 4EP1A 3GN1A 1AKMA 2P4QA 3QV2A 2XF8A 3GLTA 2M6LA 2WMNB 3GP5A 3IUNA 1CR0A 2A58A 3Q8WA 2XKKA 4HDKB 5DASA 1DFGA 1YTUA 2NZJA 4Q9DA 3L8CA 3UWSA 1Q92A 4R2KA 2XGSA 4C07A 4U2FA 4L0MA 2ODNA 1QOQB 2OBYA 3AEQB 4MRMA 3JS5A 4RQTA 1NXSA 3DVQX 4EH1A 1HF3A 3ZGZA 4ILKA 4NRDA 1NBOA 2O1XA 2VJNA 3FPHA 3F2VA 4OU5A 2M9MA 3OUTA 1BQ4A 3TLGB 2VWHA 2Q3JA 4LHXA 2OV1A 4QWMA 3CYFA 3F9RA 3L02A 4W6QA 3RFXA 1U7PA 3RR2A 4E5NA 4Z5XA 4ALJA 4V1CI 1P19A 5BVHB 2FJ0A 2VJMA 1SVWA 4X84A 4XYBA 1EX9A 3GIWA 3AGQA 4QHYA 4BTEA 5A9RA 5M7EA 3PPWA 2C4NA 3FTEA 1U4OA 4P4NA 1SHTX 4Q3NA 1PK9A 3HN6A 1ZL2A 3RVJA 2F55A 3O8QB 4XVRA 3DV9A 5CGZA 4C4PA 1CEQA 2QI9C 1EDBA 2EL9A 3EBLA 1SUSA 2FSVC 3OMXA 3VH2A 4O4JA 4PLTA 3SBDA 3EF0A 3HDHA 4BVEA 5B7NA 3ILXA 4NU0A 1E77A 1Q2XA 1Q7GA 2CLFB 2IPMA 4O2BB 5T3YA 3OE1A 2VOJA 4GI7A 4QREA 2FSGA 1ZD1A 2X0DA 5C7LO 1E6CA 3HCDA 2X5OA 4HB4A 4Q3CA 3VNAA 4HUQB 1C7FA 1MB2A 2H7CA 1NN3A 4QOEA 2PMBA 3TQIA 1XZKA 4F9TA 1N5IA 1X1RA 1Z4MA 1YBHA 2JAQA 1MQ8B 1VBMA 3K05A 4BP1A 2VHTA 4YIKA 3S27A 1XLTC 2WFAA 3IUPA 3SNHA 5DF1A 1WJGA 3OTQA 2OYCA 3ROZA 3TUZC 5IM4F 1A98A 4Q1CA 3HCAA 4JGGA 4BO4A 2VN8A 1H69A 1SOWA 4H35A 2ZK7A 4A10A 1C1XA 1XN4A 2B3TA 2QTVB 3DFZA 3IAUA 3W8NA 2I1VB 3NBAA 4YJ2B 5CRIA 1YB6A 4L5YA 4Q48A 2E4AA 4P83A 3LC1O 3JVEA 1HYEA 2CE2X 5DHQA 2AG6A 4KCGA 1CB0A 4XSHA 4HQKA 3WKEA 3ZCXA 3L6BA 3O0TA 2CXNA 3A4NA 1CYEA 1OBOA 2GN9A 2DFVA 1RLUA 4DG9A 1KI9A 4RIFA 1HK7A 2PUWA 1OWMA 3WQSB 4NZOA 1GTMA 1X8KA 2VTKA 4O02B 3TL2A 5KWEA 5IC5A 5T3UA 3KWFA 2BFMA 4OLFA 3W1VA 4D4HA 1JJVA 5DISB 5CVJA 2PH3A 2GBLA 3C14C 1QQ7A 4S1WA 4UZSA 4X9XA 1UKBA 3ANSA 4HDNB 1T9KA 3LHKA 5A0VA 1C1HA 3PX7A 4L5IA 2O3RA 3D8NA 1PNTA 4Q3BA 4XE5A 4EB6A 3R41A 3NT2A 4CT0A 2VPIA 5CCDA 4YJ2A 3W6OA 3CKLA 4FLEA 4AX4A 4CCYA 3C45A 5FTWA 3VISA 4JHXA 3FKSD 3SOZA 1M6EX 3QMVA 3NALA 5J59A 3U6BA 2WF6A 5ELXA 3OVMA 1D1PA 5I7AA 1KZ7B 3ACCA 3CJTA 3IDZA 1KEKA 3CRRA 1I3NA 1ISFA 1SXJE 4YRJA 3WJAA 4BQOA 2ZE7A 4G97A 4CU2A 1KK2A 5LQNA 1FLDA 3SC4A 4P1ZA 2OHXA 3BTSA 2WUFA 2H07A 4Q9HA 2PMDA 1KIFA 1U8TA 4KQ9A 3VYVA 2Y6VA 3OQMA 4YHHB 4N3GA 3TD6A 2X42A 3OZWA 5CVUA 3NQ41 2BBSA 4QD3A 4FHCA 4YV0A 2QM3A 5IP5A 5DM60 4YV1A 3HA3A 4DWWA 2Q2NA 2QG4A 3FYUB 1BCRA 3HB5X 4JUCA 4NYIR 3RUCA 1J8QA 1YOBA 4IKOA 5EUQB 2GTIA 3W6UA 1AS3A 2AC4A 4CQMB 3MQ2A 2Z6UA 3WGQA 2BP7A 4FONA 3W2TA 4N0QA 4LZWA 4Q4DA 2EDCA 4YPFA 1SOVA 4HQ0A 3LO5A 5BQOA 2Z43A 3TN7A 3LIIA 5CTJA 2J85A 2VBGA 1SGWA 1K6JA 1IB0A 1PDWA 1ZL0A 1QC5A 2GZSA 3BRSA 3LDAA 3PR3A 1DQYA 4H1VA 4PLVA 2V96A 4QXRA 5FXMA 1H1TA 2Z4TA 3L8YA 3MJTA 2TMYA 4JJIA 4KYIB 2P6RA 1E3WA 1ZHOA 2VSOA 1PD0A 3R4CA 4P33A 3QSGA 4JI7B 1LPPA 3HFJA 3L6OO 2OKGA 4MI3A 4Q1FA 2O3SA 5DXFA 1IULA 2YICA 1NJ2A 5KVQA 4J2HA 2BR5A 3EG9A 1VC2A 4II7A 2OQ2A 3DL4A 3AVYA 1SOUA 3WHKA 1NXVA 3ZY3A 3I0NA 4V0NA 3I2YX 2OENG 3AGPA 1ZOOA 1DEHA 1VHDA 4TYPA 3S2YA 1JT9A 2BGGA 3IA2A 5FQOA 4FILA 4ZCPA 2G1AA 3OU2A 4RZ3A 3ZVKA 1J1UA 1CLUA 1RLJA 3OQBA 3KKQA 4TSFD 3IP8A 4YAJA 4ERNA 1JIQA 2X14A 2JI6A 2Q4EA 4FHZA 4GMXA 4YJDA 3UK6A 2QBYA 1B1CA 3GMIA 2RI1A 3K9GA 4PQYA 3QBTA 1LV7A 1QF6A 2V74B 4K6GA 4PX2A 1J23A 5HS6A 2IDZA 2XDQB 4CRWB 5IHPA 3ADKA 4HQFA 2ZRFA 2Z5VA 3O2NA 3UPUA 4OB8A 5JCPA 4LF5B 4PSUA 4Q1AA 3C8DA 3IUBA 4MGIR 3QXXA 2XYPA 3MCTA 1ISRA 4R69A 2I6GA 4B3CA 4IHQA 1E7YA 1HSOA 4YLGA 4POOA 1VG0B 1ZD5A 2FW1A 2ZAIA 4EKGA 4FFRA 1B6RA 3DE1X 2QB5A 4ED9A 3AL2A 1P1JA 4RK4A 5M34A 3SXUB 5JSKA 4RQBA 4YXWA 5KTRA 1JQJC 3CRVA 1NVWQ 1O57A 2JH8A 4RVHA 1KOGA 3EQ7A 2O7SA 4Y6PA 1W47A 2PTHA 3DUFB 3KB2A 5L3QB 4LMBA 3C6KA 1DEXA 1ONSA 3G7NA 3LCRA 1ZU5A 4IUYA 1B3RA 4L9RA 5HFAA 3CLSC 3SS9X 3COJA 3EOBI 5L7WA 2YFKA 1G6KA 2PS9A 3I64A 2P5SA 1ESNA 3QA9A 4R9NA 1LXCA 1IBLB 1U7OA 1RMYA 1XVVA 2Q45A 4JT8A 4UM7A 1C2TA 5AKKA 4EY6A 5K0TA 4IF6A 3OTOB 2Z2XA 3GZ4A 4V0RA 1BRTA 3P19A 4H7IA 1IOZA 5FA5A 1QV6A 1QM5A 1XTRA 5BNWA 2AEEA 3QOYA 1NX9A 3CZMA 2L18A 2OGZA 1VYHA 4GECA 1AKRA 3RYCA 2Q2OA 1R0SA 2C98A 3EOZA 1IY8A 3LD9A 3NWOA 4FD3A 2OP1A 3T6KA 1RYFA 3CA8A 1EFRD 2C94A 3P2IA 4DR7B 3AW9A 3TB6A 2VJYA 3T5BA 1EEXB 3ZHVA 1U8ZA 2Q8NA 2ZWPA 4FCCA 2YIJA 4FHGA 3PNQA 1TQ2A 3R3YA 3B5IA 1PTJC 3OCJA 5JLJA 1RMTA 2PJRA 3RAPR 4A16A 4QYSA 1N1MA 2RONA 4NCNA 1MRSA 1GFZA 3OX4A 4I9UA 5FR1A 1VLJA 2JJ2D 5DHUA 4YUXA 2ZSFA 3ZXUB 2VOEA 3TVDA 1QV9A 2GUGA 3FB4A 1ICEA 1ZMOA 3EY4A 4K9OA 3MJHA 1UBHS 1BFKA 1YDGA 2AN1A 5EYPA 1SFRA 2V7VA 2YZGA 3RRMA 1VKJA 2GDJA 1AUQA 3WXBA 3DCNA 1D2RA 3MD0A 2JDID 2VRCD 3KBBA 4WA8A 1OAAA 1OT3A 4KR7A 5B55A 1TF5A 1VB3A 1BIFA 1NWHA 1PYOA 3FYUA 5I9SA 3CMMA 1LC3A 4B0OA 1UAYA 2N47A 3S8MA 3TR5A 1PV4A 1ISJA 2P9QA 4DQVA 5FF9A 3HL0A 5DYGA 3HDQA 2W0MA 1H8EA 3IPLA 5AJTA 1V1JA 1GNQA 1E8NA 1V41E 2Q1YA 4Z54A 1AHPA 3ENKA 2R1UA 5C9ZA 2RJOA 1NQWA 1F6DA 5CVDA 3QELB 5IJZA 3UT6A 1NUPA 5AIBA 5KWJA 2W7TA 2VTBA 4B3GA 3NNSA 1MA0A 2G4LA 4FHDA 4KLCA 3VR3D 3EX7C 4HATA 1ZYUA 3NP7A 4IF4A 1ZVKA 4IOJA 1E4EB 3UN1A 1XLWA 3RJTA 1Y4UA 3I2GA 5FTNA 4UHHA 6GPBA 2HN9A 2C2GA 1DHRA 2PZFA 2UZ0A 3IDAA 3VNRA 1EVYA 3H2JA 2QL7A 4BIMA 2JZOA 2J87A 5C5IA 1YB4A 2H7VA 2HSDA 1IRXA 3PVSA 5CPFA 1B93A 1XHFA 1HLPA 1UM8A 3AKYA 1NQAO 2I2WA 3ZU3A 1RBMA 5FHQA 4WESB 1PSZA 1KI1A 3N76A 1ZMRA 1GUAA 1JR3A 1EFPB 4Y6OA 4OMFG 1SB9A 3OPYB 3UXMA 4ER3A 5K6TA 3C8MA 2GEDA 4YACA 4M1MA 1UDBA 1ZD2P 3L8ZA 4LJ5A 1HYGA 4UJ3A 1QIJA 5EA2A 1FNMA 4ADSG 4EYOA 2F48A 1K9SA 1MNQA 3C6BA 2ZUBA 1M2HA 5TVKA 5JRDS 4CEJB 1RXYA 1BX1A 1E2IA 3BFXA 4B3IA 4JUAA 1ZESA 3HL4A 1KZHA 1TA0A 4GMHA 4B4WA 3ZFOA 2XBMA 2DMRA 1I0LA 2WJAA 3N2KB 4OMUA 4GOMD 2R48A 4DGSA 1L5HA 1XVTA 1LPNA 2I2DA 1YS4A 2VAVA 3GPIA 5J4LA 2G5PA 2HYIC 4FCTA 3V4FA 4QBKA 3DL7A 1U1GA 3W7VA 1HRKA 3ZJYA 3WR5A 5DE3A 3MB5A 1QHSA 3B89A 2ZIXA 2V1XA 1IHYA 2GK6A 3G6WA 4MRSA 3W0LB 3D81A 4L5JA 1QGED 4RH0A 4AJEA 1F0YA 4D8XA 1U3UA 1H6DA 4H3VA 2AF3C 4UM5A 4BKQA 5IAKA 3F5DA 4R8MA 5GZ3A 1YQXA 1T36B 1A9XB 1XAIA 1G8HA 3O4JA 1RBYA 5AK4A 4CMKA 1JE0A 1UXHA 3DNMA 4Q7MB 3OTGA 1L4YA 4C4AA 1A0OA 1CP2A 3D7LA 3EBOA 1EP1B 3G2LA 4FGJA 721PA 2XCUA 1Z4KA 2PXXA 5ERGB 2E5FA 2FCAA 4UHBA 4V0QA 4KI0A 4B6OA 3H2HA 3GUCA 1DARA 4ZYYA 5BSKA 5AVYA 4YASA 2PGOA 1P7WA 3IBSA 1TM4E 4ACBA 2G28A 2YVAA 1F3LA 1M8KA 2J48A 3NDRA 4UAVA 5KOHA 2ZYAA 4S1NA 4YFVA 4L78A 4IVRA 3I92A 3IBTA 2YIDA 1NJFA 3DA8A 1JBQA 2G9NA 3PCRB 3S7ZA 2POCA 4MEAA 2AFRA 1ZIPA 1O97D 2GRAA 2EERA 5BW6B 1TJYA 4ZCLA 4RTKA 2VVTA 4PSDA 2ZSKA 4LJKA 3ENNA 2VI5A 3DT9A 3HGTA 3NVDA 3KJFA 4P7GA 2LIVA 4PY2A 2Y2UA 4KN6A 5DW3A 3TF5A 2EX4A 1T2FA 1K08A 3DE5X 3OOEA 1IONA 5AXDA 2YWBA 5J4VA 1RYYA 2F1JA 2VQ6A 3GWZA 4JU8A 2X1HA 5A4KA 3SAJA 5HKAA 1GT6A 5B1HA 5KTPA 1N2XA 1NXXA 1W35A 1TEHA 2H00A 2CD7A 2F3QA 3GFFA 3K1AA 3KKZA 4M7WA 2C0PA 2FX5A 3OIYA 2KLHA 1V6CA 1JZTA 4RFSA 3R7DA 1M2GA 3QVJA 2VYVA 3HMKA 3BB4A 5D5HA 2YHAA 2Q0XA 4EJ0A 4YJHA 1X1EA 1X1TA 2WTMA 5JCXA 4KIWA 5BT9A 4NS1A 3HDVA 1TEVA 2OVBA 1SVSA 4I1SA 1UL1X 3KOWA 3FJOA 1EGMB 1T6NA 1ZQ1A 2ONKA 4JL5A 2WIJA 3DJFA 4TWBA 1PYGA 4TLMB 4YXFA 3II6X 1D0SA 1S8OA 4V0KA 3KKLA 1B14A 1XZGA 3CE6A 2ODPA 3REOA 2CLCX 1DAGA 2H31A 3IBYA 1K0FA 3Q41A 4R51A 2H2FA 5TT0A 3DCYA 4ZARA 3UJHA 3A1SA 1KXZA 1MVOA 3FNHA 1J2YA 3JYPA 3L4KA 3LFTA 1ZK3A 4RSGA 1ISPA 3EXFB 4G5YA 4HDRB 3WP1B 4XOIA 2C1XA 2XA1A 4E30A 3CVYA 2X5KO 4GC9A 4NYMR 5CLJA 5AHOA 1CVLA 1T1JA 2HADA 3AKCA 1YJ5A 3EWSA 2AZXA 3JZFA 4BFVA 1S4QA 4ZZ3A 2GCNA 5DNCA 1Y8QA 1U3TA 1OKKA 1QG0A 1I6LA 1XTKA 2DC1A 2P2LA 1G3RA 3FF4A 4JUIA 2R3SA 4AAYA 4CQJA 3EUAA 3W8EA 1FYFA 3G9TA 3RWOA 4P35A 4X62B 4TTTS 2LKDA 3TSOA 4EUFA 2I6QA 1LZLA 1ML3A 3NEJA 1GAXA 2D7JA 3G8AA 4D56A 1RDFA 4TKVB 3SYKA 1YJAA 4BXOB 5F1YA 4KXUA 1AZTA 4ETWA 4WEOA 3C41J 4DWVA 1FTGA 1Y8RB 2F3UA 1OTYA 4WDQA 4NY1A 4C6SA 4FMCB 2ZIXB 4YMUA 3PHHA 2AJTA 3VO2A 1Z6ZA 2P7IA 2EX1A 2ISCA 3BXOA 4HUTA 2JJ1D 1JA0A 3R40A 2KM1A 5JQGF 4P7BA 2I4NA 3D1LA 1TC2A 4R8VA 1NURA 3LKVA 1YONA 4HD8A 4F9EA 3VSBA 3VR5H 5TS3A 4G8BA 2YDYA 4F72A 1EXNA 1O1YA 4QHTA 1SCKA 4B44A 3EPHA 1ZGCA 1DG3A 2YNMA 2XDWA 1DBQA 4PYRA 1D2HA 2AOWA 3Q5EA 1GPUA 4HUQA 1JEYB 4OV6B 3M9WA 2CNLA 4IVQA 1IFXA 1OLOA 2FHPA 3EZ7A 3UHFA 4RDIA 3TEJA 1TUBB 2FOIA 2ZAMA 3MVEA 4WL0A 2QQGA 2B30A 1G8KA 3UB3A 2BMAA 4ICIA 1UKCA 4NV3A 1WCIA 3RRNA 3TIVA 5B30A 1OWNA 4W7HA 4AMVA 2QAGA 4IUCS 4U7WA 5ADHA 3IVAA 4QUKA 2IEGA 4W5WA 1B23P 3GDOA 2I7TA 4UUAA 4QTUB 2J9YB 4QT0A 1HMYA 1NKTA 2RFLA 3C5EA 3DAYA 1JN0A 3ZWAA 2HHCA 3W5IA 5HJ5A 5IVHA 2W2LA 1Y4DE 2EW2A 2V0CA 1E2QA 2E9SA 2TRSB 4M8LA 5LBTA 3I61A 3OCVA 3ZFNA 2BYTA 5ILOA 2ZT8A 3F1KA 2AG1A 2VAMA 5E0OA 2I9PA 1RQGA 1NQTA 5JTUA 3SVLA 8ADHA 2HF9A 3N2ZB 3RT7A 3E9QA 3QG5A 4A6EA 4EWLA 3VOTA 3TKYA 2WJPA 8ABPA 4EA8A 4LYEA 3M7IA 4EFKA 4RMIA 1KY2A 4WOBA 2C4VA 4HEA6 3BXZA 1SKBA 2G9QA 4GXNA 3KR9A 1N0UA 1TMGE 3TLJA 2XUKA 5BNZA 5JCOC 1IZ7A 4B7UA 3TYXA 3IP7A 4A36A 1VXRA 4AZ0A 2GXQA 1Y33E 1DWQA 2QPTA 2EWVA 5JCOA 1UAGA 2XMBA 3OIWA 5E6UA 1R66A 1D0IA 4M7PA 3UMCA 2GO1A 5HHTA 3GJZA 1L3CA 3RIEA 4KAJA 5EP2A 2IHKA 4ARCA 2ZJ8A 4G4IA 2BDTA 3KV1A 4GHWA 4BGEA 3UMYA 4L22A 4JT2A 4RENA 1CQWA 4QEKA 4K1LA 1DTSA 1QQ5A 2GN0A 2GQ0A 1LSSA 2ADOA 3OJXA 2BEVB 1F5SA 1SBHA 1WHSB 3I9KA 4URYR 4DR4B 1EGVB 2ZTVA 3EWNA 3LKBA 3P9KA 2NYUA 4GD3Q 5ADVA 4G5OA 4HDMB 4F9GA 5LP1A 3GLGA 3AUSA 2CGEA 4D9IA 2ZKIA 3KQHA 2PU7A 4LCJA 3B6KA 2XE6A 3CT4A 4MUGA 5E6SA 4LHSA 2VPQA 3ASVA 5D86A 4QNRA 3D54D 4IIJF 4TMXA 4XCVA 2ONCA 3FRHA 4DV4B 2DY0A 3DBOB 4QC2A 4DM4A 1OF1A 1W7AA 4RV9A 3VSAA 3PUWA 5AW0A 3IVRA 2OOKA 5FYQA 2GM4A 1GNRA 1LI5A 3LT0A 5E4JA 3K16A 4U7DA 3IPCA 1AIPA 1QORA 2JVKA 3N70A 3WS7A 1OFUX 1PGJA 3I72A 3QBEA 3ZGOA 3ZS9A 5JSYA 1ZOSA 4EPYA 2CXUA 1CETA 3LHSA 4PO3X 4AWXA 5JATA 3OZSA 3U3KA 1P75A 4DWOA 1SVNA 3AERA 3D6UA 4NMHA 4BWFB 1C7IA 4MKFA 5AKIA 3N3AC 3OCXA 4AUKA 5KTOA 3CEAA 1HE2A 2EQ5A 2ID9A 4G0WA 1SUBA 2IKSA 4QOHA 4YT5A 4QT4A 1DQNA 5D3ZA 3B3JA 3ZHXA 2PL1A 4G0OA 1TZ2A 5SZHB 3WX0A 1EM6A 4GPEA 1ZWLA 2FPXA 4B34A 4RAQA 4CR7A 5ALVA 2XT6A 3NHBA 1TM7E 4RPKA 2DFDA 2X9LA 1XDUA 4AN0A 4W5QA 2Z4RA 2ZJAA 4N5MA 4CL3A 2FLVA 2Z2ZA 4AY4A 4D3XA 4EM6A 5LZ2A 3QUQA 5A7FA 1GHTA 4MVJG 1UWCA 4XIGS 2FXVA 2VLIA 4EO9A 2I2FA 3MLBA 4NTZA 1Z5OA 3LGAA 2J0EA 2IX9A 3LMKA 1G20E 1H0HA 5LLDA 3FGNA 3LRPA 3AR6A 4JZYA 4MITA 1A7AA 1Z5UA 1K8QA 4DQXA 1WRBA 4ZRDA 5A0TA 4R1NA 4JP1A 1TQ6A 1KDYA 5FDFA 1FLAA 2JEYA 4OHOA 4GBJA 5LOVB 1BMFA 4JYCA 3R7LA 5JSZB 5H3LA 3FD8A 1EFVB 4YRGA 4X45A 2XE8A 3HKEB 3ZQ6A 4EG5A 2G25A 1QIEA 2J6HA 4C30A 3WIDA 4EITA 2YRXA 2UYGA 3SZRA 2HT6A 1TRKA 3CZCA 3DP7A 1YRAA 2BC9A 4FWBA 4AN4A 2E4UA 5ALSA 1T8YA 3AU9A 3NUQA 4N7RA 4ZCQA 2EBHX 4NU8X 1A4UA 3VDNB 3FPFA 5C8DA 2NU7B 1HFWA 1LNSA 5ALFA 4TKUA 2PSEA 2N42A 1U5BA 4EA6A 1ULUA 2PG3A 4IEEA 1L7AA 4FEYA 3UGKA 5FEMA 1SAYA