4YV0A

Crystal structure of trypanosoma cruzi spermidine synthase in complex with (2s)-n-methyl-n-phenyl-2,3-dihydro-1,4-benzodioxine- 2-carboxamid
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
269
Chain Sequence
GWFREEPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
pubmed doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
total genus 92
structure length 269
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yv0A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yv0A02
3O4FA 2OB2A 3PS9A 2GB4A 4Y30A 3MB5A 3FPEA 4CTJA 3ER8A 3I5UA 1VLMA 4E32A 4YV1A 1UFKA 2CWWA 3KPUA 3LDGA 5EKXA 5T67A 4GOLD 3T7RA 3ANXA 3R24A 4X61A 4NECA 4ER0A 2ZTHA 5IH3A 4DM3A 4FP9A 4C07A 4RTRA 2PWPA 3KR1A 1FP1D 3NVKI 1B42A 1AQIA 2P35A 4PWYA 4FT4A 2PX2A 2IDKA 2UYOA 5GINE 3O7WA 3GU3A 1SQGA 4EVIA 3FRHA 3HCFA 4KIGA 5EPEA 4AZSA 1TW2A 2OZVA 3DOUA 3M33A 5K0EA 4M38A 1L3BA 1WS6A 1VL5A 4GUAA 5EOVA 3EGVA 1BKYA 2QRVA 2H11A 4C08A 3MCZA 2PXAA 3DLIA 3I58A 4PONA 3FUUA 4BP3A 3CJTA 3TM4A 3I64A 1FBNA 4PYMA 3TRKA 4DMGA 2XYRA 2ZW9A 2AOVA 3FUXA 1JG4A 4CTKA 5F2KA 3BXOA 4FR0A 1RJFA 2GA9A 2PJDA 2LD4A 4QTTB 4RWZA 3UBTA 4C03A 4EKIA 5FULA 1T43A 3ERCA 3NMUF 3I9FA 3A26A 1XVAA 3C0KA 4ISCA 3VC1A 1KHHA 2P40A 5EHGA 3HA5A 4GQBA 4RX1A 1RI4A 3TPZA 4RTSA 2Z6AA 3CVOA 4FSXA 3RIEA 1ZHFA 5EMMA 1BOOA 3A7DA 3HVIA 4V0QA 5EZSA 3DMFA 2GPYA 3FUTA 4WVLA 2IH5A 2P3OA 1HMYA 2AOUA 2EFJA 3NVMB 1KR5A 4PYLA 4GC9A 4GF5A 5CVVA 3GCZA 5K0NA 3I53A 5C1IA 3GRVA 5E1MA 5D1HA 5EHIA 3V8VA 3L8DA 1JG1A 5DWQA 2V7EA 3MQ2A 3KHKA 3NWEA 4HC4A 1UIRA 3V97A 5BW4A 5DLYA 4PYQA 2AVNA 4XUEA 1INLA 2AS0A 4R6WA 3E23A 4RTOA 4R8RA 1DL5A 3SMQA 2P41A 4OX9Y 3DP7A 3M6UA 2QYOA 3ORHA 1AF7A 1JQDA 4DF3A 4MTLA 4DKJA 3G5LA 1WG8A 4R8SA 1VBFA 3MGGA 1H1DA 5LQUA 4PYIA 4L7VA 4WXHA 1Q0SA 4HH4A 2VS1A 3B5IA 1HNNA 1P39A 5LQRA 2PX5A 2IBTA 2IIPA 3AXTA 1ZQ9A 2B9EA 3FTCA 3M70A 4P58A 3LCCA 2N47A 4QQKA 4QQNA 5C0OE 5ICGA 5K0BA 2PSSA 1KPHA 2ZWAA 3HCDA 5E1DA 5GM2A 1KYWA 5FHQA 3DXYA 2GH1A 3Q7EA 4AUKA 1JSZA 4EMSA 1U2ZA 5K0FA 5CVDA 3UWPA 4K6MA 3T7SA 1YZHA 2NXCA 5FADA 2OKCA 3KQVA 4E2XA 4RTPA 3OU7A 2OXTA 3B3GA 4PGHA 3PTAA 3THSA 4KRGA 2ONYA 3LCVB 2PKWA 5EC8A 4E2YA 3EGIA 3EEYA 1XDUA 3GDHA 4KVZA 2IFTA 2AVDA 1RJGA 2YQZA 3GRYA 3KPJA 3MAGA 4EQZA 1JQEA 3EVFA 1G6Q1 3O31A 5JR3A 5EG5A 4YMHA 5FWAA 2VZ9A 3UZUA 3BZBA 4BLUA 3GRUA 5EKUA 2AOTB 3HNRA 4E31A 3GWZA 1L3CA 2OB1A 4PCLA 3OE4A 4YUZA 1WXWA 1R6AA 3KKZA 4M36A 5DTQA 4E30A 5M5BA 3TKYA 2ZZMA 4GOMD 3G2OA 1NW3A 3B7PA 2P7HA 1VP9A 2UYQA 4RVDA 4ER3A 4RTMA 3EMBA 4AX8A 1X1AA 5LQKA 3KU1A 2Q41A 2OPBA 5FA5A 1XDZA 5E9WA 3FZGA 3LBYA 5DXAA 3LKDA 2XVAA 3FPFA 2I62A 3F4KA 5EVJA 4HGYA 3PB3A 3QOWA 1O54A 1XJ5A 1M6EX 3OFKA 4GOOD 4KWCA 2IH4A 3HCEA 3DXXA 5CUQA 3TQSA 2WA1A 1YFJA 5BW5A 1KXZA 4BLVA 5DT2A 2NP6A 3VYWA 1YZ3A 2BM8A 3B89A 2ORED 2HV9A 1VE3A 3G7UA 4KDCA 3THRA 1NW7A 4GEKA 4U7PB 3EVGA 3OZRA 3FTEA 4LECA 3OU6A 3BWYA 1P1CA 4KIFA 4XCXA 5HILA 1D2CA 5KVAA 10MHA 4YUXA 2ZZNA 3KQSA 3G2PA 2P3LA 2ZSUA 1R8YA 4GBED 4DCMA 2NNWB 4PNEA 4C06A 4OBXA 3B3JA 1SKMA 2I6GA 3DULA 5H02A 3C3YA 3EVZA 2R3SA 2Y1WA 4YUVA 3MERA 4BY9E 9MHTA 3PVCA 5E9JA 2FYTA 4EK9A 4X1OA 5DPMA 1I1NA 5K0LA 5FUBA 1R74A 4R6XA 4P7KA 1KIAA 5JUWA 4PIPA 5P8WA 2WA2A 5LQNA 5EMLA 4RTLA 3DUWA 1EJ0A 1O9HA 1ORIA 3G89A 3UJ8A 2Z6QA 3NTVA 1KYZA 2FK7A 5K05A 4C04A 2PXXA 4V0RA 5F2NA 5LQAA 3HA3A 1SVUA 3BWMA 1FPQA 3KQYA 2BZGA 2JHAA 1BC5A 3K0BA 5E9QA 1P1BA 1BHJA 3KQWA 5E1OA 5DM2A 3UJ6A 3A7EA 3LPMA 2EX4A 2VDUE 5HFJA 4QVKA 5K0JA 4GOND 4C05A 2AOXA 3AWIA 2JHPA 5EEHA 4E2WA 3P97A 1NW5A 1ZGJA 4QPNA 4RTNA 3GRRA 3S68A 2XYVA 2C7RA 4M37A 2C7OA 3LGAA 3OCJA 2IGTA 1NV9A 4KDRA 3EEOA 1VP3A 2DULA 2O57A 3KQMA 5HZMA 4P7GA 2Z6UA 5KYGA 5K09A 2ZIGA 2C7PA 4DA4A 2C7QA 5EQJB 3MCTA 4A6EA 2PGXA 4DZRA 2VDWA 4JXJA 2AN3A 3FTDA 3OPNA 4B17A 5FHRA 4RTJA 2ZBQA 2UYCA 1EG2A 1OR8A 5CVEA 4R05A 2GAFA 3G88A 5FTWA 4YUWA 3KQOA 3PX3A 4PYNA 1RI3A 3BGDA 1I9GA 5HIMA 5DX1A 2B78A 3DR5A 3MTIA 1WXXA 2EG5A 2FHPA 1PRYA 2A14A 4XUCA 2YTZA 3KQPA 5GOZA 4RV9A 5DTRA 1JTFA 3BGIA 3G8AA 5LSAA 2OBFA 1JG2A 2IP2A 1NT2A 1VQ1A 3B3FA 1EQAA 1SQFA 3UJBA 1NV8A 1O9GA 1XCJA 4PYJA 4RYLA 5KQRA 2YUIA 2GS9A 3R9XB 4FGZA 2AR0A 1D2GA 3E8SA 3NDIA 3VSEA 3UJCA 4QVGA 3E7PA 3AY0A 2I7CA 4PIMA 3LSTA 3UJDA 1QAOA 5DTMA 4HGZA 2PV0A 3FYDA 4QDKA 4F85A 1M0EA 2PT9A 3UJ9A 2PT6A 2P3QA 2G71A 2IDJA 4HG2A 2GLUA 3AXSA 3BUSA 5CVJA 4RVHA 5ICFA 1TPYA 3SSNA 2PXCA 2FPOA 4OBWA 5DX8A 3EGEA 5E2AA 1Z3CA 3EVCA 2AOTA 4ZTBA 1X1BA 3QOXA 3EVDA 4RTKA 5CCBA 2BR4A 4BP1A 2EJTA 3HVKA 4MWZA 1Y8CA 5T6BA 3SSOA 4E33A 1YFLA 5ERGB 4YV2A 2VP3A 5EEGA 2P8JA 2PBFA 3ER9A 2JH8A 3ELUA 2G70A 1M6YA 5DM0A 3BGVA 4PYKA 3SX0A 4QPPA 2O05A 2ZBRA 1UWVA 3A25A 2IPXA 2ZZKA 1SUSA 3H2BA 3LDUA 5DX0A 3SM3A 1KPIA 4MHTA 1DCTA 3UFBA 2QE6A 3EVAA 1G8AA 3T0IA 2YXLA 4CWAA 3IV6A 4QDJA 2YXDA 1DUSA 2H00A 2G8NA 2ERCA 3OFJA 2BM9A 4HSGA 1QANA 3TLJA 3X0DA 4LWOA 3P8ZA 5GP1A 4PCAA 2O06A 4FS8A 3KR9A 3TKAA 3TR6A 4U7TB 2ZVJA 1WY7A 2B3TA 4P7FA 5FCDA 3GJYA 3NWBA 5MHTA 3IHTA 4BLWA 3ELYA 3LDFA 5K01A 5KQSA 1QYRA 3OU2A 4KW7A 1PJZA 1XDSA 5CVUA 3FPHA 1ZG3A 1YF3A 2NXNA 4HTFB 4YMGA 1RJEA 3JWHA 2JJQA 3PX2A 5DM4A 2O0LA 3C3PA 3CJRA 3FUVA 5E2BA 3A27A 1IXKA 3M4XA 2B2CA 5EIFA 2PX8A 1SUIA 2ZWVA 3IEIA 3Q87B 1RI5A 3CKKA 5G02A 5GWXA 3CGGA 3UA4A 1JQ3A 1IY9A 5BXYA 2BH2A 1IM8A 2XBMA 5D1NA 2EJUA 5CD1A 1SG9A 3FPGA 1EJ6A 3GRZA 2H1RA 3LHDA 2ZIEA 3SSMA 3BT7A 1AQJA 1JSXA 3D2LA 3G5TA 3ELDA 1KP9A 4CKEA 1EIZA 3DTNA 2OYRA 2ESRA 1QZZA 1G8SA 1D2HA 4X41A 2QY6A 1R18A 3TOSA 2PX4A 4UOEA 5FQOA 5ICCA 4HRAA 3KR2A 3DMHA 4X63A 3HVHA 2XVMA 4OQDA 2QM3A 2NXEA 3K6RA 4F84A 5HIIA 4CKCA 2ADMA 3LX6A 5B1SA 3P2KA 7MHTA 5BP7A 3ID6C 5HEKA 5GIPE 3HA7A 2YXEA 4FSDA 1NBHA 4MQ4A 4ER6A 3C6KA 4DCGA 1RI1A 2ZULA 3GNLA 2P1DA 3FRIA 1ZGAA 3OZTA 4OA5A 3M6VA 2PWYA 2R6ZA 3EVEA 5E8JA 5DRYA 4IKPA 2ONZA 2CKDA 4Y2HA 3HP7A 4YUYA 3VC2A 1NW6A 2B25A 3JWIA 2AZTA 3G8BA 5U4XA 4RSRA 3KQTA 1XXLA 3LKZA 2PLWA 4X60A 2V74B 5LR6A 2P7IA 3R0QA 3U81A 2ZIFA 3UJ7A 3G2MA 2NP7A 1X19A 3P9IA 3HVJA 3BWBA 2PVCA 4OQEA 2NYUA 3C6MA 3RODA 4OA8A 1WZNA 5E8RA 3M6XA 4IV8A 5CM2Z 3GGDA 5DM1A 2ZBPA 2VDVE 3BKWA 5GM1A 3LECA 3DLCA 4EKGA 1NE2A 5LQCA 2QRVB 4E2ZA 3KQQA 3TFWA 3EVBA 3OZSA 4RTQA 2IBSA 3JWJA 3PT9A 4LG1A 1AV6A 3P9CA 1N7JA 3KPVA 3HM2A 4FT2A 1QAQA 1G60A 3ME5A 5C9ZA 2UZ4A 2FRXA 2CMHA 3TMAA 2JHCA 3MHTA 5E1BA 1VIDA 3LCUA 3FPJA 5EMKA 1P91A 1F38A 3KR0A 2BR5A 3RW9A 2JH9A 1ZKDA 2BR3A 3P71T 5K0GA 5LQJA 1FJXA 3LL7A 3HTXA 4GC5A 1RJDA 8MHTA 5F2OA 3CJQA 3T7TA 3OE5A 3CCFA 2ZLBA 5HIKA 3HCBA 1X1DA 5EGSA 2YVLA 3R3HA 2G1PA 1I4WA 4G56A 5FQNA 4XUDA 2HNKA 5K0CA 4A6DA 1NBIA 1G55A 2AOUB 3DMGA 4H0NA 2WK1A 3DXZA 3CC8A 4RVFA 3FTFA 5KS2A 5K8VA 3BWCA 4LWPA 1KPGA 4E70A 1L3IA 5FA8A 5ICEA 2PY6A 2ZCJA 3NDJA 4CKBA 2AOWA 3PLAE 1JR4A 4FZVA 2O07A 2HWKA 3BKXA 1JTEA 2YX1A 3NW9A 3R6TA 4IV0A 4AZVA 1TW3A 5DSXA 4O29A 3KPYA 2HMYB 3WSTA 1QAMA 3SVZA 1L1EA 1FP2A 1MHTA 2F8LA 3P2EA 3GO4A 4M7RA 1NKVA 4P7JA 4AZWA 4HTFA 5DSTA 2DPMA 5EIWA 4POOA 2CMGA 1NW8A 3SR4A 1XCLA 2E5WA 4CXMA 3PFGA 5K03A 3UA3A 2G72A 4RVGA 3FYCA 1R8XA 3IYLW 3REOA 2HR1A 2YR0A 1EAMA 5HOQA 2HTEA 3GIWA 1F3LA 3SXJA 4PYOA 3JWGA 5CIYA 2I9KA 2AN4A 4F86A 5DXJA 1JG3A 3HCAA 5T64A 2CL5A 2OO3A 2XYQA 3P9KA 1YB2A 5EMJA 4DQ0A 2FCAA 3M6WA 3PFHA 1R00A 2IH2A 3MTEA 1YUBA 2K4MA 4PINA 4Z2YA 4ER5A 3AJDA 2JG3A 1N2XA 3QV2A 4C4AA 1MJFA 1L9KA 1V39A 1ORHA 2FK8A 3E05A 3HEMA 3NJRA 5CCXA 4MIKA 3CBGA 3A4TA 4YV0A 2AN5A 5EZQA 1XTPA 5GIOE 2ZFUA 1N7IA 5IKMA 3EPPA 3HCCA 3P9NA 4AZTA 3G2QA 3FUWA 1G38A 5FWDA 4ER7A 3EMDA 2Y1XA 3P2IA 2KW5A 3DH0A 4ATNA 1X1CA 4IWNA 3KPWA 4QTUB 2UYHA 3SGLA 4PGGA 3TM5A 3GXOA 5HIJA 1VPTA 2OY0A 3LBFA 2NXJA 5DRTA 3UJAA 1RI2A 3ELWA 1Q0TA
chains in the Genus database with same CATH superfamily
4QECA 5ILGA 4B3JA 5IKPA 3HO1A 3G0OA 4LOLA 2VHJA 4HQKA 2CWWA 1MH9A 2FMFA 3RBAA 2PMBA 5I4CA 3EPKA 2IHTA 2CUNA 4K1XA 5HOEA 4UUQA 1YSCA 4OP2A 1M7BA 1W47A 1H5QA 2CLLB 2J9ZB 2WJAA 1QOPB 2PX2A 2JGFA 2GLTA 4WERA 5L4NA 2FN9A 5FWYA 3BMNA 4PC7A 4B7XA 4V0KA 3HWRA 4KIGA 4IIXA 4PLFA 3HBJA 3FDZA 3HJUA 1YDMA 2W2VA 3M33A 1JBKA 1J8VA 2PNFA 4J16C 4NQRA 4FFSA 4TXJA 4CM4B 1KKMA 4NBKA 5CA1A 5LP6A 3MT0A 1DIAA 3ZK8A 2NO7A 2UUOA 4WY8A 4U7DA 4NYMQ 2ATXA 1L9XA 4I99A 3TM4A 2FF5A 4II3A 1FBNA 3AP1A 1DAFA 3ICVA 4CQLA 1JG4A 3WIOA 1A8HA 1LQTA 2HLHA 2AFHE 3CUTA 1NATA 4ESHA 2A8YA 3I1IA 4OY3A 1XNQB 4EKIA 3NMUF 3IP7A 5FO0A 3ORYA 4UMFA 3A1WA 1P6QA 3HBNA 2VXYA 4RVSA 4MW2A 1QH9A 2K6GA 3R0IA 1TU0A 4OIMA 1U7WA 3MWGA 3CVXA 3BD6A 4TZ6A 5BN5B 4OM7A 4KLNA 1QU2A 4P32A 1HTTA 1V8OA 3H9JA 3UOAB 3VSCA 3LFTA 3HXQA 5DGIA 2XMBA 8GPBA 1ZK3A 3I9NA 1SH7A 4PFKA 3HDJA 1DARA 3FWZA 1L7VC 1XB2A 3KALA 1H6AA 5AOCA 1HG1A 2WUFA 2XCTB 1Q1GA 3V97A 4GYKA 1GKKA 3CKYA 3L7AA 1SUAA 2V7UA 2JLCA 3O1IC 4NEGA 4Q3AA 4US0R 3HB9A 1VSUA 2P41A 3L01A 4KJXA 4LISA 1TYEB 3ZZNA 4P5EA 4RY0A 2LWIA 4EHHA 3MG9A 4Q3OA 2JCBA 3CH4B 1ST3A 3FLAA 3W5CA 4KQIA 4N03A 4MI3A 2EDCA 3H11A 5KJCA 1TUIA 3N74A 3OIUA 4ZOLA 2VPTA 3QE0A 3JQBA 4ZZ3A 4ZODA 3JAKB 2JPDA 5I01A 1IEQA 3CSDA 3O8NA 2GPBA 1Z56C 1YJBA 2WJ6A 1CUEA 2ZWAA 4M53A 4PO3X 5HJEA 1DKLA 3T3EA 4E4TA 4BXOA 3DXYA 3Q7EA 3EZ6A 1H2HA 2JI6A 4RFVA 1ZGHA 1X7DA 1SVKA 2G88A 4JEHA 3DZGA 5FD8A 1WLYA 4P0PB 3NT2A 4JR1A 5FADA 2OKCA 4Q03A 1G3UA 1F17A 2YVAA 3P0FA 3SEQA 3OIWA 1DINA 4HEQA 3B3GA 3JTEA 4J91A 2IUYA 1YUNA 3F67A 4EDFA 1O0SA 2MR5A 3KZVA 5EC8A 3WRXA 1JHAA 1XDUA 3MWYW 3GRYA 4XASA 4PANA 5A6VA 3O4IA 4Q3DA 2YXBA 1H0HA 1WE2A 1NC3A 2EVWX 2XE7A 3ZQUA 3HVRA 1F9AA 3AZQA 4U63A 2CCKA 3VQTA 2EF1A 3BZBA 3O91A 3VH3A 2AKYA 4PCLA 1EVZA 4IDHA 4LHEA 1P74A 3GUVA 4Y8VA 5KQLA 7ABPA 2R6GA 1VA5A 1U1DA 2VAVA 4GOMD 1UZMA 1REQA 5KCMA 4DCPA 1U65A 1ZDMA 1DAMA 1B8NA 1L8XA 1UQTA 4AX8A 2ZJ7A 2Q3CA 3WXMA 5JY6A 1Q1ZA 3ZZ0A 3D6TB 2W6CX 1V0JA 2V7GA 3JQ8B 2ZUUA 3OVMA 1EP2B 1YD7A 3B52X 3EQ6A 3L8MA 4HNAB 4U00A 1NN0A 4WZBA 2WG1A 3OFKA 3UAYA 5BMVB 4D2IA 4BTLA 2Y6VA 3TO5A 3UGJA 1Z6TA 3KKNA 4ND5A 3TB4A 5BUZA 1IRIA 1EBUA 2JVJA 4DLBA 5JCOC 3FOFC 3MS2A 5HBGA 2PMEA 4FYPA 1YFJA 2GBLC 5FPKA 3IQHX 2I6FA 1YULA 5DYWA 2AEMA 4IDQA 3OFVA 4IF4A 3KVRA 4PG4A 3RCBA 4BGVA 2VIIA 4ON9A 3B89A 5AKZA 2IOQA 4G1EB 4KDCA 4TS4A 4MW1A 4X3PA 4A4DA 4AWAA 1QPZA 1JFRA 3HN2A 2YRWA 3R0VA 2FMUA 2PJUA 1D2CA 4P2BA 2HSJA 4QD3A 1Z74A 1TIPA 3CX4A 2LGJA 1FZTA 3O1HB 1QONA 2CHVA 2AXQA 3TRDA 1S8NA 3IR7A 5I3CA 2YWEA 3LRTA 4Y2GA 1SKMA 1E5DA 2FW6A 3EVZA 2COKA 3G2NA 3OOSA 4KV7A 4OP1A 4NCIA 1OX4B 3SQLA 1YQDA 4TZ0A 1IQRA 2CSUA 1NFQA 2WJHA 4RL4A 1KAQA 1IMJA 3TLXA 1HTWA 2YW9A 5BOSA 4R6XA 1ZC4A 3FWHA 3SPXA 3IALA 4BVFA 4MSUA 1K75A 3H1TA 2ONCA 4YDHB 3ILYA 4W99A 4TTQA 4Y1EA 4R1NA 3OPYI 1E6UA 1G63A 2ZJ2A 5ALKA 4EJFA 2R1VA 2JFQA 3DAFA 3IOMA 5F4ZA 5CA1F 4CL2A 1R6BX 2EGHA 2XV1A 4M8NE 4PRYA 2R1ZA 4V0NA 4BO9A 1FVOA 1Q3TA 1SPXA 1OA1A 5E1OA 4IVPA 2B36A 3R9KA 4L5CA 2DWQA 3K35A 3AF5A 2CXXA 3DZBA 4L2IB 4ACAA 5K0JA 2B0JA 2I80A 1VKOA 2JHPA 3ZX5A 4P6VF 4UHKA 4E4RA 3BIWA 1UMCB 5A5EA 1HT3A 3RJTA 1RQPA 2FP3A 1KK0A 1MW9X 3OD1A 1A7AA 2YMLA 2ZYVX 1K8ZB 1DU4A 1GU1A 3P4YA 2X1LA 1Q1NA 1Y4AE 1JHPA 2AKAB 2PKCA 2F43A 1LWOA 2O57A 3PDHA 4LE0A 4UCQA 4XKJA 2X15A 2B34A 4HRXA 4QQFA 3ZIDA 5K09A 1UT8A 2VYFA 2C7PA 2C7QA 1RQ7A 4RHCA 2VUUA 1HTBA 4UE3S 4IEIA 4NK5A 4TTJA 1RU3A 4DMKA 1NTRA 1N3IA 3MOSA 1TVKA 3GFGA 5I8WA 3G88A 4PE5B 1XELA 3E7WA 5ALQA 1MJGA 4EHNA 4DHEA 3SR3A 3URKA 1DO8A 3AIMA 1C0PA 3D81A 3MB8A 1JWBB 3GLUA 3J7AC 1DTSA 2R48A 4V0LA 1YWGO 4BECA 2XVXA 3C97A 1Q0ZA 3FSEA 4NDNE 2IP2A 2PQ2A 2EIXA 1US8A 3DE1X 1DBRA 1FLDA 4J76A 3REQA 1TCBA 2A9JA 3FLMA 1XCJA 2ZJ6A 3MSXA 3W2EA 4EY7A 3L7MA 1I33A 5CNJA 3R9XB 4JVLA 3HEAA 4B3IA 1W30A 1K0FA 1ODLA 1D1SA 1SXHA 4J0FA 1NN3A 4H4CA 1QG6A 2YYYA 1X7YB 3JPWA 4YCBA 4IF6A 3U7FB 4ZOLF 5DNUA 1OXUA 1WHSB 2IDJA 5CH8A 4TTAA 2I66A 2I9PA 3L1JA 4CV1A 5DX8A 4A23A 4KBGA 4WESB 3SICE 1GPMA 2GZ1A 2P27A 5HF6A 4EA7A 2HW8A 2IITA 5CJPA 4PZPA 3OMXA 2QTFA 1AHNA 2VJBA 1QG2A 3EVDA 4FOTA 4PG7A 5ENVA 5JMPA 2CCJA 3M82A 4BP1A 1FDTA 1POXA 2GRUA 5LA6A 3SN6A 3QBEA 4AM8A 3O74A 5JANA 1WDLA 2BGJA 5EPOA 2RCNA 5IJZA 4N3AA 2VP3A 5AK6A 3W8RA 2UYGA 1Z39A 1GAQA 2PUEA 3M3HA 3PUKA 4RD2A 1ESNA 1C7IA 4DV1B 1PT5A 2F64A 5DU2A 2O05A 2HRZA 2ZR7A 4AMYA 1YONA 2H2AA 3AEXA 1I7SB 1JZTA 1J5EB 4V38A 1JH8A 1DCTA 3GQBA 3MCAA 4MWOA 1UQRA 2XMPA 4DR1B 1AKMA 3FWKA 1GPWB 4XIJA 3D02A 3PJGA 1LZKA 1RACA 2A9OA 1L7OA 2W00A 3TLJA 2BM9A 3E3AA 4B82A 5BNTA 3SVLA 1G5HA 1XLWA 2J5QA 1ZM4A 4G41A 1XQ1A 2GN9A 2OE2A 1XDWA 2LZ0A 2QRHA 1Z83A 2Q9CA 2XNJA 1X74A 3B85A 3PRHA 4C14A 2VF2A 4BLWA 2R97A 2C20A 4F96A 1KY3A 2GEUA 1HE8B 5B5SA 1OAAA 1XO1A 4TXNA 5K0SA 1F2UB 4MR8B 1XDSA 4TSFA 3ZXXA 4M0DA 3MNFA 2Y1OA 5HKLA 2ZETA 3T9FA 5DM4A 3E1KA 5DH9A 2HD4A 5DYGA 2O1XA 2WD7B 2SKEA 4X93A 3L05A 1H4SA 2D5BA 1U9ZA 3IL2A 1SUIA 2A30A 4MUJA 2WFZA 4RL6A 1JQ3A 3T15A 3H8VA 5BXYA 5I9BA 2GX6A 1ABBA 1SG9A 4HWRA 4JUIA 4YCJA 5D3ZA 1C1DA 2FUNB 3MGKA 4NPHA 1EUCB 1FYVA 1OI7A 4KPFC 2M6LA 3GLFE 1ZRNA 3K5HA 2Q4EA 1EIZA 5DKFA 3UEOA 4WNYA 2GKSA 3M6LA 1K3TA 4G0OA 5DGXA 1Y3FE 3ROMA 2OVBA 1DT3A 5T4BA 2RGCA 1WZEA 3NI2A 3ZHRA 3LTNC 2AL7A 2VNAA 2XSZA 1P4HA 1AJEA 1DLIA 1MQ9A 2ZTUA 3PD1A 5GADl 3FYUB 2NGRA 3H6KA 3CH7A 3G2IA 3N28A 4WY5A 2Q29A 4YAFA 2O0HA 4YAIA 5GIPE 2O8EA 3FAZA 3M83A 3E53A 4MKFA 1GR0A 2CB0A 1LSJA 3MILA 1Q50A 1K7CA 1L4FA 2VT6A 1JB1A 3EA0A 1HRDA 3KYBA 3WP1B 2QQ5A 4XQGA 2H54A 1QRSA 4Q4HB 4G25A 5E8JA 2LVBA 3RBVA 4IKPA 1DQSA 2ONZA 1Y98A 2CKDA 3T61A 2BHRA 2CZQA 3HP7A 2VEOA 3RTCA 4HYYA 2K87A 3FF1A 3FW1A 4FD3A 2DFNA 1WRBA 2AZTA 3KV1A 5JJ5A 1U3VA 4DAEA 3MS4A 2PGLA 2PLNA 3VZBA 3GEIA 1UF9A 2NT3A 3TEJA 3ZU2A 3U49A 1AQYA 4BZPA 4ZGGA 4GXTA 1G8HA 4QUEA 4OQEA 1SCQA 2VH1A 5IT0A 1Y3IA 1SC9A 1KI3A 1WUIS 2V4MA 1E9BA 1YJQA 2EATA 2QU7A 4O4LB 1KO5A 2R4QA 1EX1A 5HMMA 2PRJA 4AWXA 3W04A 3EISA 3QQPA 4PG6A 2FWMX 4CI9A 4TUYB 1MH1A 2ZSKA 1UOEA 4JENA 4KR7A 4LY9A 1D2RA 1FQJA 1RZVA 4KH1A 5F5LA 4CRWB 5KOHA 2QB5A 1KU0A 2DXIA 4MUAA 1KZHA 3ROTA 3O4VA 1NJ6A 3TMAA 3RWOA 2JGAA 1XNHA 2JLZA 2GCGA 4PQFA 4M22A 4NCHA 1RJDA 5F2OA 3Q88A 4MYCA 2Q6KA 3R6LA 4XOIA 3ROFA 2FB9A 4Z4IA 1H1LA 1U9JA 5EGSA 2X8LA 3CXRA 2YVLA 3DOHA 2P0YA 3JYOA 1ID8A 4ZT3A 1QCZA 4QAJA 5FQNA 5I51A 1ZR2A 1FMTA 2ZR0A 1FX1A 3LYHA 2C2HA 4CM6A 3GFSA 2NTEA 4UXIA 1VJ5A 1NVTA 3B6EA 3FM9A 3LTEA 1CLEA 4M0LA 3S1AB 4KQJA 1Y7IA 5DOVA 2SECE 1KAHA 4BNLA 4K9OA 3BWCA 1YU6A 1MRZA 2X3FA 3HUMA 2X6RA 4LWPA 3TQCA 3D0OA 5I7SA 1K7EB 5IWCA 1EUYA 3NIDB 5B7QA 2AOWA 2ERXA 1SKYB 1U3WA 2BSAA 2G5GX 3GMDA 1N2JA 5GJCA 2Q21A 4D9FA 3DEHA 3WSTA 2B99A 4FUQA 1STOA 5LA6F 4OHVA 1OFIA 4P7JA 2WAYA 5DMXA 1R0BA 5EA2A 3M1AA 4OHXA 1CS0B 4HAOA 1VI5A 2QN2A 3GLGA 3DHEA 1WA5A 4RKFA 3GH1A 4BNVA 2DWOA 1NUHA 4LRWA 4M1TA 3WGUA 1I5EA 4DLRA 4LCJA 3KOYA 3AOEC 1Y1TA 4XA8A 2HR1A 1RHJA 1JDSA 2HTEA 3DKKA 3GIWA 2A84A 1QUFA 1N6PA 3AFNA 3DL7A 3R3VA 4FC6A 1TVCA 2I9KA 4F86A 4RPCA 2PWZA 4X7BA 4PPGA 2CNNA 1N2BA 3W77A 2XYQA 2WP8J 4RESA 1YZNA 5JQGA 8LDHA 1R5JA 3KV3O 2B8WA 1NU8A 2DUJA 3DOCA 3DHVA 1Z5ZA 2PMCA 3Q7IA 4OHUA 2C29D 1F0PA 2E5FA 4PNPA 1JAZA 1JV2B 3NYIA 1JA1A 3QV2A 4RS4A 4JDPA 2DJ5A 1PEKE 2ECPA 3QMPA 4C3OB 4NF2A 2QBYB 1C80A 3FMPB 1BMQA 3FF4A 4A8TA 1SBYA 3VAZA 1KJJA 3AVOA 5T8KC 4C7MA 1HDYA 2N46A 1PR5A 2FSVA 3EMDA 2IS1A 1XZCA 1UP6A 3A6GA 3ZHSA 2JS7A 1SOUA 3T54A 3RU7A 1BWRA 4CG1A 4PGFA 2HMUA 1BQEA 4TTSA 1UFKA 5EKXA 1QFMA 2OGWA 2O7SA 4L15A 5HF5A 5T67A 3B53X 1AS0A 3SQXA 4O2BF 3ZHCA 2IPLA 1E2EA 1TT7A 2Z3VA 4P4GA 2QV7A 1E3TA 4Q93A 4UC0A 5JT1A 5M29A 3FYHA 2WHXA 2VQSA 3TG8A 1QHIA 1H4TA 1WD7A 4I0WB 3OO1A 1E9EA 4RHTA 1DUVG 3DEAA 5E6RB 3E4CA 2IHVA 3TRFA 1DLJA 2ISSD 2C00A 5F23A 5HBRA 4LE1A 2ZSDA 3HR7A 3NXSA 3VV2A 1ACMA 1Z7BA 4E88A 3V4LA 3ZWDA 4KQWA 5MGNA 3D7SA 3OZEA 2APJA 2H11A 4ERXA 3QVTA 2QMYA 2A9KA 2WHPB 4PRKA 4JJ4A 1JVSA 1ZA1A 1UZAA 3FY4A 2GUGA 3D31A 1TJYA 2NN3C 3LM8A 4GD3Q 5HRCA 3DT6A 1PLKA 4KEAA 4KQFA 3KWLA 4K9MA 4RCZA 5F2KA 4Z1MA 3SDZA 2I3ZA 3B9BA 2KLBA 1V9SA 3RRNA 4BMCA 1Q17A 4XJSA 2P40A 3IE0A 3TTYA 1SD1A 1UPFA 3PC8C 3OMLA 1I14A 4ONEA 4MUBA 4RGVA 5A3RA 1EFRD 1ILEA 3U39A 4BHTA 3NHMA 3QH4A 4UM9D 3PPXA 4FGWA 4RORA 4V0QA 4E5DA 4EEXA 3D6UA 1OWLA 5FTKA 4PW0A 3E2IA 3OIVA 1OBFO 2J6CA 4PPQA 4ZWNA 1W93A 1VHWA 1RAHA 2EKQA 1R6XA 3GJ0A 5CXXA 4OPMA 4QQ8A 3UB2A 1FP6A 4N47A 3UHJA 1NP3A 4LV5B 3VVBA 3PJRA 4DYVA 1D9ZA 1CJUC 1CZHA 1Y3AA 2BP7B 4QYSA 4LNUA 1E66A 5LKRA 2QM0A 2RK4A 1S6YA 3TEMA 3A36A 1UK8A 2G0NA 2CLCX 3ANYB 4R71A 1NUSA 4GWLA 3E7XA 4M8IA 1DFGA 2WINI 4OQPA 1UPCA 2X8AA 3DW1X 4KO3S 4GMKA 2X0JA 2YIDA 4KH0A 2HPAA 2OCIA 4PYIA 1NVVR 1SZPA 2W2TA 3VYSB 5JCXA 4IDGA 4JQOA 1Z29A 2H7VA 1LBSA 3QU7A 4M1WA 1TC1A 3RYFA 3WYEA 4F1WA 1FNDA 1IAQA 5HWSA 3NKVA 1P80A 4OU5A 1FQKA 1NXWA 1WMFA 2PANA 4MJXA 3WL4A 2WSBA 1PTKA 3UB4A 4B3HA 1KR2A 2I2CA 3ENNA 5GM2A 4E0BA 5EXSA 4DLKA 1JGTA 2ZPTX 1JSZA 2DT5A 3IT1A 1TEHA 2NSJA 2ZU0C 1ZL0A 4R41A 4UHHA 3F9RA 5DGTA 5LB4A 3HCNA 2GK6A 4R2HA 3ZXSA 1V4VA 5K3FA 1HUQA 3LPCA 3M4YA 1JFFB 1XTKA 2IIQA 4X8LA 5FWYB 5MDHA 2W6MA 1K5GA 4PTYA 1Z63A 4ZVKA 2CV0A 1T8YA 2ZRCA 2RMKA 1NOIA 3D3QA 4BWFB 5FNVB 3AY6A 3MJVA 1ATZA 3N86A 3T5AA 1WABA 4TYPA 4XSGA 2B21A 5CCEA 1EXVA 1L6IA 4BOYA 3W0LB 3VDMA 3H84A 1UOOA 1XPJA 3I2HA 1G6Q1 4A8HA 3LH5A 2ZDGA 4DNFA 2FUG1 3RK1A 3F5DA 3PGLA 4F8JA 5KNBD 3RSFA 4EZBA 4D98A 4TVKA 2Y0DA 4ALLA 1WXWA 2JFGA 3C3EA 4PC1A 4QHSA 2HFJA 2JLQA 4KQ6A 1D5CA 5JQGF 2AH5A 3KETA 1B00A 3AJ9A 5AM0A 2ID4A 3HYTA 1R0KA 1RAGA 3GUCA 4WCVA 1KWGA 2PXHA 3B2QA 2GN1A 3MT8A 3OUUA 1ZSNA 3K1YA 2VG8A 3R0JA 4I4IA 3F9CA 3WWOA 1A9SA 3HJHA 5HKAA 3F4KA 1U2SA 2OV3A 4HGYA 1HY3A 1CFJA 2CXTA 3PB3A 4H7HA 2ISCA 2I6QA 3HKEB 4QJ5A 3LY5A 2GD2A 3LUGA 3K8YA 3O47A 4DDKA 4QODA 2XZTA 4A15A 5AJXA 2IEBA 3I6YA 1NNI1 1Y4UA 5JU6A 3TCNA 2BCJQ 5KTTA 4CM4A 3BEDA 2ZJ3A 1D07A 1R8SA 1EBBA 2XOKA 3PBKA 3CINA 3JQPA 4OK3A 1CNEA 1SULA 2IP4A 3UT5B 2P2LA 2QRLA 3HYSA 4QUBA 2YFQA 5DT2A 1ZWKA 5REQB 5CBPA 5HP4A 1P4SA 1Z45A 3DFZA 3DOFA 2XA1A 4P3KA 4P8RA 3WRYA 4CFZA 2RH4A 3HJCA 4GEKA 4DOMA 1M2JA 1GVHA 2VP4A 2ZUCA 1ZEMA 4XCXA 2F17A 4FLEA 5L6MB 3FTEA 2YMQA 4POAA 4DBVO 3ETJA 4HAUA 1U80A 4ZTZB 2ZSUA 3B7GA 1G5TA 5B4VA 2PBZA 2PX0A 2W48A 1W36C 4HD8A 1FEZA 2Q8PA 1D2AA 3KD3A 4GOJA 4A0FA 2Z57A 1XCGB 4KYUA 2B1IA 4RHFA 4ECAA 1IATA 3SI7A 5BN5A 1SOVA 3RANA 3PE3A 2CHQA 4RTLA 2FDCA 2AWNA 1ORIA 1R16A 2FUG6 1KEKA 1WUTA 2QRKA 4GZ5A 4JV5B 4BO5A 2Y92A 2CJFA 4II7A 1UJNA 3DVAB 2YL2A 2P77A 421PA 1M72A 2ZJ8A 3FWPA 2QW8A 4IPTA 2G63A 3RV4A 4NYMR 4RK1A 1NXQA 2HF8A 2J6HA 3O4HA 4J0IA 2GVDC 4QLOA 2R6FA 3AWIA 4HNSA 5BWCA 1ENOA 1S4MA 3ZV3A 3C3CA 2YRXA 4YAGA 2IUSA 3NTQA 4KLAA 1GGKA 1GPLA 2Z6VA 1CUGA 3N2KA 4JB2A 3OZDA 5FUMA 2J32A 3DYIA 4RV4A 4P34A 4IX9A 4D4HA 3Q3VA 1RM5A 3QA9A 4REOA 4CKYA 3D8SA 4F21A 2P91A 4IO1A 3SIRA 4OTZA 3T3GA 4B73A 2BGWA 2Z6UA 4P0QB 2JDIA 5MN6A 1RAEA 1K4KA 2Y0CA 4N5NA 4R9SA 3GP3A 4OJQA 1DFHA 3JAKA 5GV8A 4MV6A 3JQEA 3TNFA 4D9JA 2HMAA 4LJRA 3T1OA 2MSWA 1AUVA 5CTAA 1I3CA 1UXJA 4RZUA 4NMXB 1NF3A 3LX5A 1ND6A 1OWNA 2GTPA 3QE4A 4C4YA 2IYOA 3Q6MA 5BRJA 4ALJA 1WP4A 1E18A 3QZUA 4LQLA 5TR9A 4BFXA 1GP2A 3KBOA 2WM2A 1CUUA 3I2IA 2C83A 2PUDA 4FPXA 3ZWCA 3H0CA 1NT2A 2EU8A 1A3CA 1Z37A 3DVSX 1L7MA 3I45A 2FMKA 3SJUA 1CETA 2YUIA 3DO5A 3RHFA 4ZZIA 4QLBA 4FZRA 4K6KA 1UK9A 2EERA 3WLAA 3HGQA 2VT3A 4XAQA 1NI4B 5IT4A 4R9VA 5LMCA 2O8CB 3KAKA 1M83A 1QNLA 2GLUA 2ODBA 3BFPA 4OQ4A 4ZMSA 3GDGA 3QEMB 1LSUA 2UVPB 3GLVA 3KO8A 4IHQA 4OJMX 2WKQA 2R4UA 2D1FA 3ABIA 4MGEA 5KNBH 2ODQA 1BJKA 1O3YA 4HWKA 1K1EA 1ZM9A 2C9DA 1U7OA 3BE4A 1QDUA 2DUNA 4IL5A 4EJSC 4XRGA 5IANA 3JQ9C 4NV3A 4YV2A 4LOHA 2CUTA 3N8HA 4LQ4A 3RT9A 2XTMA 4CIBA 5DM0A 2D2XA 4E5KA 5KPDA 4QDUA 1CEXA 4ZZ2A 1DC3A 4OSEA 2ZBRA 1MAAA 1N3LA 3JQ8A 4FUTA 4Q1CA 4TT3D 2QU8A 1MIHA 1FVHA 4WZBE 2UZ3A 3AU9A 1CZKA 3QTTA 4HNAA 4H1UA 3RK0A 4MTCA 3O3OB 2AV6A 3R1IA 2EL9A 4OREX 4A7PA 3HBLA 3PNSA 4NX2A 4TSKA 3FOBA 4D9MA 1YJ8A 4NOJA 2ORWA 2H8GA 2Q5CA 2JIZD 4G5YA 5F77A 4DMLA 3T7CA 3DCJA 3EFOB 3TI9A 1KO7A 4H3SA 5AXCA 3N7TA 3EPHA 1TQ6A 4RA6B 3AB3A 2JAUA 4GKAA 1EJBA 4G0YA 1XYGA 1PJZA 4A8JC 3ODPA 4N48A 1LLDA 1Q7TA 2BKAA 2BF7A 1PBTA 4D8UA 1Z5UA 2ZTMA 2CXUA 4GP7A 4J3JA 1XRPA 4NCKA 5LQSA 1OX4A 3RS7A 4CCYB 3W5AA 5GWXA 1NMZA 3ETDA 3H3JA 4I1RA 1JHMA 2Q3JA 3DZJA 1COZA 1IY9A 2FEXA 2I3DA 2X5KO 2VHWA 3AKDA 2GKOA 4Q4DA 4LN1A 3DQZA 1QMPA 3LV8A 3BTSA 1KS2A 1P5HA 1AQLA 3C4JA 3Q5GA 4F2HA 2DJIA 5BV8A 5CFOA 2J1LA 3SHTA 4CMCA 5BT8A 1S3SA 4L28A 4JC5A 2H9YA 3P96A 1Y5MA 2REOA 1E5XA 2K7ZA 4KDEA 4UMDA 1D2HA 1NPYA 1Z18A 2P4HX 3TNYA 3TLCA 1BEUB 2VF4X 3VR3A 2R79A 1N92A 3EZXA 4L2IA 5DHFA 4LGYA 2HU8A 4RSHA 3OTHA 4U5QA 1UMCA 2YNMD 3V1TC 1U8YA 3P0IA 2J7KA 1JJFA 2AI2A 3HUNA 3AQ4A 4GSYA 1H8HD 1QORA 3H8WA 3AY7A 3PHBE 3PJDA 2AJCA 2VQEB 1KSHA 5M2QA 1Z15A 3NAQA 3E03A 1TX4B 2JIMA 3BD8A 4G89A 4OXIA 1XK6A 1E59A 1MV5A 3C6KA 4DCGA 2OEPA 2W43A 1W5EA 1NG9A 2I2AA 2CJXA 1E2FA 1XAHA 2X9QA 3DB1A 2BFFA 3DDNA 3FRIA 4XR4A 1G5PA 3AM5A 3RKSA 5KB3A 2RJ3A 2MCFA 1IG0A 1RYHA 4WJZA 4XJVA 1DC4A 4TWJA 4XTRA 2XLBA 4HBZA 4X6XA 2JIPA 3WKEA 3WP0A 4EUHA 9ABPA 1OFGA 2FZCA 3AL3A 3KJQA 4W5NA 3WVNA 2WWRA 2DTXA 4MQMA 1U1GA 1GAWA 5D3QA 2FFJA 4HLQB 4EY5A 1PR1A 2Z2XA 1OIXA 4HX2A 5B6JA 5ALZA 4QT0A 3R0QA 4EH1A 4UD6A 5ALTA 1KHTA 5AW9A 2H6EA 3ND7A 3HVJA 4XYMA 4B43A 4YMIA 4CEIB 1O5TA 2W42A 3R9XA 2XF8A 1UPBA 4WBSA 4HKTA 3RYHB 3WO0A 4ZO8A 1K08A 4NZMA 5FOWA 1L2TA 1QNFA 1W1WA 4K9QA 1N8KA 1QLWA 4RIEA 1S7CA 2W2NA 1X7YA 3DLCA 1PCXA 4KXYA 5AI8A 4HDQB 4RIHA 1ANKA 1E7YA 2Z2ZA 4JUCA 4N7RA 3TL2A 3YASA 5KVQA 4X54A 1CU1A 2WJWA 2V6BA 3OKAA 1WHSA 3NDRA 3QBDA 2AYYA 4JXZA 2OQ2A 2NSLA 1G60A 3CE9A 4DM4A 1DGQA 2R8ZA 4WESA 3K70D 2WOOA 3MHTA 4NMMA 2BL4A 5TX7A 1L6RA 1ZCBA 2BR5A 3RW9A 1J0CA 2OD9A 2WTAA 4B3DA 1OHHA 2JK0A 4PLHA 3CR7A 4C4PA 2B9VA 2LXNA 3C8MA 1K98A 5FOTA 4ZARA 4OM8A 4YJHA 5CDGA 4R2MA 3GIDA 4NV0A 5IS2A 4FOLA 4F1JA 4R40A 1UWLA 4I3GA 3GEBA 1SVLA 4MUHA 5IVPA 3ZGNA 2BJWA 1BWQA 2P0EA 2AT1A 1OGIA 1YZYA 2QSZA 1NXOA 2QRZA 3NHKA 2GM3A 3Q9NA 4D9CA 3TZQA 2OCXA 4HAVA 3WLOA 3SE7A 3UMRA 2XQJA 2A1IA 4BO4A 1GFZA 5KS2A 4PEVA 2V03A 2IOYA 4B75A 2I87A 2P6OA 3ECCA 3WDKA 3I12A 1YOVB 2OC9A 3SU8A 3ZWKA 3HCWA 2WSSA 4LK3A 4B3MB 5LOVB 1JTEA 1TO1E 1WPQA 3BJIC 3ZE9A 4PO9A 1SOAA 1KFJB 1KNQA 2DM6A 4MS1B 2ZJAA 3CPJB 4QOFA 3ZBUA 5B3KA 1F2UA 4MR8A 2J0EA 4V2UA 5FBHA 4EO7A 3FOZA 3JD0A 2GTIA 4M0UA 4BCCA 2RAVA 3KHSA 3BK7A 2A2ZA 4AT1A 2WD7A 5KYYB 1KJ9A 3QKWA 3UA3A 4EPWA 3LNCA 2NVWA 5ELLA 3BMOB 3FJOA 2EJVA 2VWGA 3IBGA 4RK7A 5BSEA 2YYZA 2V9ZA 1Z26A 2FPLA 3BF8A 3U6BA 1RSZA 2IZOA 4PYOA 4X65B 1YA4A 1YNOA 3ZWXA 1N6IA 2MYNA 4L4ZA 4YA6A 4HP8A 3FOCA 3MFYA 5JS6A 3ND8A 3QMVA 4NARA 1KL7A 1X87A 2Q46A 3M6WA 4LJSA 4K8RB 4QNRA 1K97A 2OGZA 3JQQA 2BEUB 5FOUA 1P9WA 3RSHA 2JC3A 4DIBA 3NR2A 2WV7A 1LBTA 1SIOA 1HLGA 3E05A 3IBTA 4B71A 5TB5A 5JH7B 4EFLA 4MGHA 2WR8A 5F9FA 4KE9A 5GIOE 5C1BA 2J9FB 2OKGA 3SZ3A 4DUPA 1X1RA 2OBLA 3QVKA 3FXAA 2A1TS 1XN4A 2R6R1 3KPWA 1VE7A 4ALNA 4DPLA 4DV0B 3RYIB 3HH8A 1OJLA 4A6PA 5DVZA 3HXMA 1QS0B 1XA4A 2CHEA 1LVGA 4K9DA 3LE8A 4LZNA 4Q4HA 5HE8A 5TVKA 3UJAA 1Q0TA 5A5GA 3ZTYA 4Y30A 4NNOA 4ZKEA 1ZVKA 3VR4A 1D1TA 2IXDA 4Y1GA 3BB1A 3U9LA 1KFBB 1NVUQ 1GZDA 3N8IA 3UNXA 1TQ2A 2JJYA 3NHZA 4NECA 5TQ2B 3E5RA 2QUIA 2XLCA 3SIXA 4K2HA 3T6KA 2E6UX 1YS7A 1OI3A 1SUWA 5D84A 3OJOA 1QGDA 4AWBA 4DIFA 2F55A 3F8TA 2UXBB 4LQCA 1SQ0A 3DNFA 3X1XA 4PNHA 1U5CA 2IUUA 4L50A 1TKCA 2HDHA 4WQMA 4YCDA 2C9BA 2Q45A 1BCSB 3DOUA 3Q0IA 4O4LA 3WJ1A 4NXMB 1NVGA 3KJIA 4JYZA 3LAWA 3ESYA 4WOCA 3VH2A 1A2KC 3EZ2A 1FW6A 4B7UA 3K7EA 3L2OB 2PXAA 1L5GB 3K5WA 3WA6A 1R6UA 1YBMA 4BP3A 3G2JA 3EWNA 3CH6A 4AP5A 4FOOA 3IXMA 2AJ8A 3GA7A 4D3YA 3PC7A 4GLJA 4FMCB 3BXOA 1QQAA 1XRNA 2P9YA 3GN2A 3NS7A 1WM1A 4QTTB 3ROKA 1I30A 3GVCA 4JBNA 4LJYA 5FULA 2JL1A 4A1FA 3FH0A 3C0KA 3GT3A 4MAFA 2DKOA 4LA4A 1KE1A 2Z6AA 5L3RA 3H9QA 4UDNA 2WKRA 4B8YA 2XB2A 3MD9A 1ZK0A 2IKQA 3I30X 3PICA 4AMGA 5EZYB 1H3EA 1D5WA 4UD2A 4WAUA 2V1XA 1GA4A 1Z4MA 3SYTA 2QGZA 2FQYA 3ZNPA 2BV3A 4LCBA 3CB2A 1UBHS 5HS4A 4LQDA 2AGVA 2MOKA 3GPBA 4UXHA 2VOEA 4KXQA 4LRXA 4AZ3B 1O95A 5LFAA 4C7XA 5TDHA 4HB4A 3MQ2A 4R1QA 3HMKA 3PC4A 1KEWA 1YJXA 4Y67A 1UZUA 2AVNA 2WWIA 4IINA 4XUEA 3ZPXA 4QM7A 3P26A 2I6SA 4C7VA 4RTOA 3E5MA 1MOPA 1RBZA 4R83A 3SMQA 2PS3A 2GEBA 2NZUG 3FHJA 1I32A 3B1ZA 3RS4A 3VKUA 4BMVA 3FMVA 2HEIA 2PWBA 3D3NA 3G5LA 2JI8A 4KFSA 5EUMA 3K4QA 4AKEA 2GN6A 2VOJA 2PDAA 4TGLA 5JAPA 4AF8A 4AYWA 2RHMA 1CS0A 2P9CA 1IN7A 3LRPA 2Q3HA 4NY1A 3GLGE 2YFKA 3GJ8A 3LQ4A 1AKWA 2Z4SA 3ZJUA 5D8DA 1RKQA 4V0OA 1EP3B 1Y5NA 3G6WA 5BUCA 3UB3A 2FR8A 5C7OO 1GQSA 3M70A 3FTCA 1UPUA 3A4MA 4P58A 4YMUA 1KZGB 3EULA 4RK6A 1G0OA 1OTYA 3E6AA 4EI8A 1NDQA 1BVHA 5A71A 5BYJA 1T8PA 3IV9A 4I19A 4TYMA 5FR1A 4WFQA 3K72B 3M5WA 5K0FA 3F1LA 3B36A 3IEPA 4CIVA 2CBXA 1NXPA 2A9RA 5DYIA 2GCEA 2VT7A 2F9MA 5TPWB 1AUQA 1N2GA 3F6SA 3S2FA 2VP9A 2NADA 3ONWA 3OU7A 3QLVA 2R7MA 3KWJA 4RW0A 3K8OE 1QFYA 5AKJA 4C1BA 3QF7A 2R25B 2NOAA 3R6GA 1T0BA 1HEYA 3P5SA 4V3BA 3FYTA 2VSOA 2QBYA 2JIOA 4R3WA 2FJPA 1RWVA 2VPWA 3AH8A 1AU9A 4KREA 1UDRA 2AYXA 4O8ZA 5EHNA 1RJGA 2IY9A 5F1PA 3MAGA 2PUWA 4MVJA 1EEXB 2C5HA 3O31A 1QQ7A 3P9QA 4Y2YA 4F5ZA 4JI7B 4I1OA 5AXBA 4JKIA 1IBKB 4PM4A 1A9YA 1I4LD 3BB3A 2DFLA 3IDAA 2EYUA 4FYIA 3OCCA 4H1VA 4TLCA 4OLJA 5DGCA 3SJBA 4F93B 1R5NA 1TO2E 3AMVA 5K3OA 3S2UA 2W6PA 4OI2A 1MT0A 5GY7A 1TA0A 1QR2A 3GY0A 4QFMA 4RH0A 3V7NA 1IJEA 1B2RA 3A4VA 2CK3D 5LQKA 1J42A 3GFQA 1OCEA 2PYIA 3L7IA 4IDEA 4MULA 4B33A 5LJLA 4M8KA 2BUCA 3ZXUB 3X1ZA 2J4DA 3A6JA 1H1TA 2FKAA 3LPAA 5E6RA 4BV9A 4DQDA 2QVCA 4RJLA 4UCWA 1X70A 1BKDR 2Q3DA 1A88A 4D4IA 4UEKA 1AXRA 3AHJA 3AVXA 5C4GB 1NU6A 5JC1A 4BEBA 3WGJA 2CYCA 3AYXB 1Z82A 4OL9A 5BWLA 2O8FB 1R4AA 1JDVA 2VTBB 5JXGA 5ERYA 1BDHA 1FS6A 3PEVA 4WNAA 1VE3A 3PEWA 3U44A 2VKQA 4MKHA 4YRGA 4MVJM 4J0QA 3PLNA 4KIFA 1PKEA 2HQSA 4RA9B 4RELA 3T4PA 2J67A 4ANFA 4DCTA 1QO7A 1UXOA 2H2HA 1JQ5A 3K09C 4I08A 4DA9A 2GJ9A 2OCKA 1E5LA 4P4LA 2I6GA 4QYMA 1SBNE 3EIFA 2GKGA 5LDDC 4GKKB 2GDZA 5CHEA 4BY9E 2VJLA 4M9XA 1SXGA 1E5QA 3L8GA 5IMSA 2XWSA 3RYCA 5CGZA 2RGRA 2CYBA 3JRNA 4K6OA 4OI4A 3DF7A 1PNTA 4RD1A 1SXJD 2WA2A 1F1JA 3HXPA 1Z22A 4WWHA 1EUQA 4O4LF 5LLSA 2P5TB 5A2QA 3JYHA 5IAKA 1VSQA 3GA5A 5DNAA 5GMOA 3UT6A 4BBAA 1DPFA 5ENDA 4L85A 1KZ7B 1MX9A 1OYOA 5H68A 5IHPA 1WOYA 4Z4CA 2ZGVA 2IS4A 1TDJA 2YV4A 4KKXB 1FLNA 1BJRE 4QBFA 2BP7A 4LMRA 1GTL1 5DM2A 4E13A 2QZPA 5JASA 3BIOA 5JMOA 2X3UA 3DGFC 2VUSA 3AZOA 4EG1A 1VI2A 3HDTA 1ZGJA 2Y1EA 4MV7A 3GRRA 2GBGA 5B36A 4D8XA 2HADA 1U1IA 1UC5B 2Q6LA 1MX1A 2C1XA 2HJWA 2QTMA 2C92A 1IXZA 2I7VA 4CMGA 3BCSA 3CQ9A 3CX3A 2DULA 2OQIA 2YVUA 3IA7A 3W7BA 3GDFA 3KQMA 4BCDA 4BIMA 3L46A 1KFEB 3HKCA 3IRUA 3QKRA 2Y1KA 2BI8A 2BW0A 3K1AB 5J59A 5INTA 5KYGA 4G9BA 3THYB 4BV8A 5IM4A 2DKFA 4Y6QA 3FTDA 4MS4B 4LUCA 1WL8A 3ZG6A 3V1NA 1KJQA 2X2EA 2OFFA 2CL6X 4CI0B 5KUTA 3CNEA 4EYKA 2CLSA 2W37A 1PT8A 2ZVDA 3H0KA 1ISPA 1WPGA 2QUKA 5HIMA 2B78A 1S01A 3ACBA 3K15A 5FWNA 3K94A 1COWD 1T8RA 1RIFA 4KLRA 2OK8A 4XLLA 4MW5A 3KQPA 4CW7A 2B8EA 1VJCA 3ZI7A 1XZAA 3ORRA 4JX8A 3UCXA 3AZPA 1JFFA 2Z8YA 3CNNA 1OFUX 4H0FA 1KEPA 1O9GA 4ZHSA 4K3UA 3R3WA 1EZZA 3AF1A 4TKLA 3RABA 2AR0A 3BD7A 4YQYA 1CUDA 3VSBA 3TR5A 1HL7A 5FNVA 5K6AC 1NSFA 1ZJ5A 3MMNA 4M1ZA 1LA2A 1RPJA 3ZV4A 4AKTA 1YS1X 1DAHA 1N0WA 3O2SB 4F2PA 4BC0A 5AVTA 1IONA 3WHIA 1ORTA 4BUZA 4LJ6A 1TPYA 4BLQA 5JALA 1CYEA 3JVEA 2AI3A 4X00A 3OWOA 4B48A 3IOEA 2HWWA 3CUVA 3PD0A 3WR5A 4J0HA 1KYVA 1XTUA 1AOXA 4E5SA 4D0LB 2UU9B 1V43A 5IXYA 5CNKA 5ERGB 1ZLYA 2HBZA 3E9ZA 3DEFA 1JMYA 1GUAA 4GG1A 4K9LA 2WIFA 3ZE0B 4C22A 1DKQA 1K2WA 3L0IB 4IX1A 4R1SA 3BCUA 3H2SA 5IT9A 3SFVA 1PR0A 4C4ZA 4QFCA 5C51B 1DEAA 4KODA 4LDQA 3W5BA 4P3XA 5B3JC 3ZVNA 3HKEA 1L4MA 2QE6A 4LXXA 4EEZA 3JY6A 2YJNA 4OH7A 2NTNA 3FVVA 3OCYA 4INZA 3HV0A 4MVJF 2GZAA 1S2MA 1NLUA 2YWXA 3O3CA 3IERA 5DHAA 3A6DA 1NQXA 4KK3A 3UT5A 3R5TA 5REQA 1GZHB 4EUKA 1A76A 3G8DA 4QBIA 1HNXB 1PLJA 1IUOA 2Y1DA 2NXWA 4U7TB 3C6QA 2HSEA 3NWBA 4Q1EA 3S0JA 3L0YA 3LDFA 3FZQA 4IGKA 3RBZA 3X1WA 5JRJA 1BFDA 2R8OA 3DE5X 4JIGA 4ZC1A 1QK4A 2YIMA 1NVKA 2YC4C 1G41A 3ZCRA 3WAGA 4G1VA 3JWHA 1O6BA 4MV0A 2CUKA 4UOZA 5T5QA 2VZ8A 1QDLB 3OTGA 1JEYA 1OZ0A 2FFQA 4JOCA 1ZMOA 2W9XA 1QBGA 2B1JA 4YBRA 4G1MB 2XMSA 3WGGA 2EQ5A 1CUFA 3KB8A 1TQ8A 1OC2A 5AM4A 5EJ6A 1C8VB 1J56A 1CS4C 3VPGA 4KUEA 1ZZEA 5LYJB 4GXNA 3UWMA 2KQUA 1AUXA 2CVHA 1F20A 2H1RA 3ABSB 2ZIEA 1P17A 2QX8A 4K0RA 4RLHA 5TGTA 1Z5OA 3C8DA 3DVAA 3U0BA 3EODA 4C0HA 1N8TA 2NIPA 3PF9A 2MYUA 4IDDA 4QGAA 2YZNA 3QY9A 4HT3B 3JQGB 1QFJA 1T6YA 1LC0A 2PMKA 4P7BA 1GTVA 2FSUA 2GT1A 1N5MA 3JALB 4TS1A 5AI4A 1EWTA 2FSIA 1XSEA 1FJ2A 1XJQA 2X7XA 3DWIA 2WF7A 3KR2A 3HVHA 4OQDA 1PIWA 1T13A 3RKUA 4YXFA 4QXRA 1ZJ4A 3QKTA 3CUKA 2OCYC 2ZWPA 4HMPA 7YASA 3WKAA 2ZS9A 1PD1A 5FI3A 4EL5A 1E3EA 5HUHA 5HF8A 4BIIA 2VDPB 1FOEB 1VYTA 3AR9A 5DXFA 5ALMA 3KELA 3BK2A 3VPHA 3QA3E 4LDZA 4C6RA 1RXIA 1UBLS 2P3SA 2EG9A 4UJ5A 3DM5A 1HFKA 1P2TA 3BG5A 3KZXA 3M89A 4Y6RA 2QSYA 4E3WA 1V45E 4NU5A 2ZM5A 1WETA 2VUIB 1VDZA 1LGYA 1GTG1 4LNHA 1HZZA 1ZCZA 1GNQA 4OHWA 3ZTTA 4MCJA 1PEDA 1YAJA 1EZ4A 1XMJA 2JAHA 5F2EA 3CCBA 2C82A 1CY6A 3G8BA 1P1FA 2BCEA 4EHLA 5DI3A 4L95C 4M0PA 3KT6A 4X60A 4EGFA 4WXYB 4Y6PA 3IAHA 2ZIFA 5HZGA 3V6MA 1CYDA 2YASA 2I55A 5BNWA 1P61B 1C30B 3I6BA 3FFTA 5JJCA 3K2IA 2BDTA 3MXTA 3M6XA 4H7JA 3AV0B 3CEJA 3U3OA 1VYHA 1ZM3A 4LGVA 5EKSA 1OH5A 4BO2A 221PA 4LHYA 5HX7A 2ZRGA 2HMTA 4LDJA 1QGED 2E1RA 5IM4F 4LXTA 3W06A 1JWLA 4H9KA 2N3ZA 4GAEA 3ZX4A 2COUA 4PQGA 4N7JA 4MPJA 2UVPA 4PAOA 3BC1A 4URZR 2ZG6A 2L82A 3GLHA 4ILEA 4OQZA 3B70A 3FVTA 3G7NA 2H2FA 4ZO4A 5AM2A 4YS6A 3GX1A 5DK4A 3EBLA 4LY6A 3HCBA 3INRA 4R84A 2ZBFA 1LTKA 2X2OA 4URUR 2C2ZA 5BQ5A 1RM3A 2WILA 1YDGA 4YCNA 2FN8A 1G55A 1NUQA 2AOUB 3CNHA 4GKBA 4XM0A 4AQDA 1ONNA 4YDQA 1LU9A 2UUPA 5FNVF 1RRMA 5TRTA 4P54A 1XI2A 2YC2C 2CLFB 1G16A 5DASA 1JG6A 2HHHB 4PG8A 5CD9A 4GBMA 5LVAA 1AS3A 1JE1A 3QLUA 3ZGZA 1B8VA 5EQTA 4WN9B 3C3MA 3LX4A 4PPNA 2QW1A 2JBAB 1JR4A 1N9ZA 4QO7A 2AWOA 2HWKA 2YV2A 3I2YX 1YZTA 3EFOA 1J8DA 1Z2AA 2BI4A 2I4TA 2ZSBA 5SYNA 3TTTA 3WISA 4A10A 2HNBA 4L5YA 4AC9A 2QL7A 2TMGA 3DMTA 5A4AA 1Y6RA 1JALA 3EIUA 4QA9A 4DNPA 4QUDA 1E60A 4Z0PA 4CEJA 1E77A 1RZUA 2EW8A 1L5KA 1UDCA 2X7HA 2C8KA 1P2UA 1PHRA 4PBTA 3U3DA 3E9EA 1DJQA 1XCLA 2G40A 4UQOA 2JZCA 4LVCA 1KORA 3FNBA 2FP4B 4QOIA 4CCYA 3G0IA 3GT4A 1P7VA 1IJKA 4CUZA 3MGAA 3MFDA 1I1HA 2X4IA 2QNBA 3B1KA 3B1JA 3O95A 2Y1LA 3B2EA 3N2NA 3SXJA 3WZ2A 3VVMA 3GPLA 2NSYA 3NHFA 4AUMA 2G3YA 3A31A 4ZVUA 1YB2A 4PQEA 1FU7A 1P0CA 1YDHA 3PFHA 4WSOA 1YUMA 3LYUA 1VMEA 3LUPA 3MLEA 1A8SA 5CLHA 2NZJA 3IVGA 1JBEA 2O5RA 2JFOA 1XZEA 4ZHQB 4LOKA 1T9DA 4RNCA 2XQIA 4AY4A 1PL0A 1SAYA 3G0DA 2FSPA 3A4NA 3ROZA 1NUTA 2AN1A 1GTRA 1RNLA 1ZH0A 3P45A 4K86A 3PUYA 5IKMA 1J07A 4BLPA 4MYUA 1KI7A 3KUXA 4ID3A 1MDFA 4MYSA 4ZJYA 2KW5A 3AVQA 3TGPA 2WNSA 1FVXA 1ZS9A 2ID9A 2DHDA 2WYWA 4NE7A 4KUHA 5EIAA 2Q5OA 3VR5A 1G5QA 4ECEA 1Y1LA 2XY4A 2WZQA 3PS9A 4ZI3A 2EC5A 1L7DA 2JKVA 1XZMA 4N41A 4HZUB 1Z5PA 4B35A 4BTVA 1JQAA 1E4EA 4WK6A 4MQ5A 5ABPA 1WDMA 1GEEA 2JFFA 2BE7A 3V1MA 2ARKA 4ZU6X 1ZHHA 2A58A 1GNLA 2ODAA 2VJKA 5LXTB 1E69A 4CV3A 1QLJA 3UAOA 4JP1A 1HR0B 2QLBA 2HF9A 3OLVA 2NQ2C 2AUNA 4YJGB 1JJAA 1PWHA 2ABWA 2X6QA 4CEIA 1FUKA 1TW2A 2P9TA 3EK2A 1EESA 1G4UR 5B2FA 4CLDA 3OTOB 4P82A 3FNQA 3ZK7A 5JAOA 3N0RA 1EX6A 3NX4A 4HATA 2BGUA 4B7AA 1Z4LA 3CEMA 5H4HA 2DYKA 1E96A 1BVUA 4I2NA 5D6OA 1YIDA 3U31A 4JBLA 4IUCS 3GJ3A 4NNPA 1P0IA 3WGKA 4DCJA 4EYOA 2AOVA 3JQ7B 4KL8S 3JQRA 1VMAA 4JI4B 4US2R 3I8SA 4FX5A 3RSGA 3SX4A 3WIEA 2FFRA 2POCA 2W6ID 3ZDZB 5EJFA 4MKZA 1T43A 1C7QA 4I9HA 4DVGA 2ZIAA 1HE5A 4RJJA 1N5LA 3ICCA 1HE3A 1H2BA 4J4TA 2I6XA 1VLJA 5IK2D 1VIYA 2E1PA 4M88A 1RRGA 1LFDB 1DFIA 3PNOA 5JVDB 4FDUA 5FTNA 1FNNA 1PX0A 5EMMA 4U8HA 1C9KA 1I0IA 4LRSB 5FR2A 5FTJA 1J0DA 4B2YA 4BBJA 3VNUA 5DHUA 4C3UA 2BGMA 3DAOA 3EW7A 4E5PA 4XYLA 5FJJA 1FYXA 2CVFA 2ZB7A 5BYBA 3VPDA 2FLWA 3ETHA 1LH0A 1OX5A 3PKIA 5E7QA 4B40A 1I3LA 2QSUA 5EHIA 1R0YA 3V8VA 4BO0A 4ZQCB 2VPIA 13PKA 3PUWA 5A04A 1VZ2A 1GYQA 3GB9A 3CLKA 1TVEA 5E4JA 2J6IA 4FB4A 4JSYA 1YOVA 1U0JA 4YY3B 5LOVA 4R8RA 2WWWA 1DL5A 4OX9Y 1G8PA 3QOFA 4KOEC 2ZRHA 2FWRA 3R44A 4MS1A 4BN5A 1U9IA 3WHLA 1TLLA 2PUJA 4K81B 5LDGA 1EIWA 3MTJA 4B6SA 2JGNA 5DGHA 4F7DA 4FEEA 4I8DA 1GN9A 2OFOA 2VSQA 3SG0A 4EUNA 3I28A 1MV8A 3A1TA 3NTLA 4EPYA 3DYBA 1OXMA 5KYYA 4YRDA 1V6SA 2VS1A 2OG1A 1NQUA 2Z5LA 3KAPA 3PNYA 4IFEA 5HFNA 1K88A 4I4CA 3WHPA 3BMOA 4G9GA 3U0VA 3LCCA 3UWSA 4CPDA 8ABPA 3G59A 3CHYA 1SIWA 1G18A 3L0PA 5IC4A 2OHHA 1Z0AA 2OHJA 3KZ1E 4Z7QB 4DANA 4ZDJA 1C9JA 3FJYA 3QPDA 5KSWB 2GPNA 2WU3A 2WG2A 4PAWA 4ZDIA 5CVDA 5HPYB 5IUJC 4K6MA 2E4WA 1EFHA 2QIPA 4HH1A 5KYXB 1IIBA 3TE7A 4B3CA 5DJ5A 4LJ5A 3DMRA 4V0SA 1GV1A 2BEUA 1KKLA 2BKEA 3LJKA 3IVXA 4UE2A 2KS6A 4EUEA 2PRIA 4KFTA 5IBPA 3C6BA 1U7ZA 3I73A 5JH7A 1Q20A 2CF6A 2V54A 1N5KA 1QIMA 4V2IA 4YC7A 3JRXA 4E2YA 3LCVB 3MTDA 1Z2NX 4OIFA 2J9FA 3SXUA 3CF2A 4I50B 2E0IA 3ESAA 3U7RA 3P7MA 1HH4A 1Y1QA 3IT3A 5I4BA 2G9ZA 3TD9A 3QWFA 5C3MA 1ZUIA 2WU0A 5AVXA 1R1DA 3RYIA 4BLUA 2QL9A 4EA8A 2DB3A 2Y05A 1L3CA 2C2WA 1FIUA 2R4TA 1E2NA 4U3JB 2CMKA 3RRMA 1EA7A 2WWGA 1OF1A 3V5NA 4MVJP 4TQAA 5HIAA 1CZRA 3K6JA 1NY5A 3KLBA 5TQ2A 3RTAA 3A4IA 4KSBA 5AXAA 2OPBA 2VJDA 5BW8A 2GCNA 3PIDA 1XDZA 4ZEWA 1O1YA 1RKVA 2ZQZA 2Y8EA 3RSOA 5EVJA 3IOBA 4CDGA 2GBPA 1SCJA 2WIAA 1U7PA 2O2XA 1H3FA 3AUJB 1M6EX 1SHKA 4KWCA 5DTEA 1BCSA 1NBMD 2VJCA 3KNZA 4GYJA 1QK3A 4YMSA 4JC8A 4AMVA 1YXMA 2J30A 1BU8A 3KOMA 3M1YA 1CZOA 4BUCA 5MGBA 5HA5A 3AI1A 4I1YA 3MJEA 5CFMA 1AT1A 1KXZA 1M0TA 1P2DA 4R4JA 3LWZA 2CNDA 4BLVA 5KNDA 2YQ4A 3K4HA 3OOYA 3U17A 3VSAA 4BFYA 1AO0A 1U3GA 4BU0A 4Z5XA 3QGMA 5DF1A 2AXPA 1Y7PA 2Z2IA 3KBBA 5HKKD 1A4UA 2NNLD 1GO2A 2BJHA 3PXDA 1PSZA 2ID7A 3LK6A 3VTFA 5IP5A 3OOEA 3RVMA 1XMXA 1FFYA 3OTQA 2PLAA 5JD5A 5H02A 3GOQA 4GT1A 1XQ6A 1G5IA 2ZJBA 5E9JA 1BEZA 1Q74A 1V41E 4G1UC 3I62A 5EJGA 3LQFA 4MKGA 1U2GA 1OXSC 1TADA 5EZYA 5FUBA 3BFXA 1CVIA 3F90A 5EJEA 3UANA 3HO8A 2ORVA 3C24A 4RHXA 1C9EA 1BW9B 2AN9A 2EZ4A 5IAOA 1SXQA 3BZWA 1GGJA 5HYVA 2VNHA 1A71A 3FA2A 1PG5A 3MLAA 4IJUA 1SNYA 5ARCA 4AZ3A 3IE1A 2FW9A 4EJ0A 4QO8A 1D9XA 1M2NA 1Z0SA 5E6SB 4D02A 1B6TA 5F21A 1M7HA 1SKYE 1NW9B 2WIDA 4PC2A 3U9TA 5A2GA 2FPKA 4S04A 1PK9A 2YQ5A 2Z5VA 3S68A 4S05A 4XFJA 2E4VA 1U6JA 4Z4QA 1RC8A 2V0GA 3KJGA 4ZOBA 3UG7A 1UT6A 4AW9A 1NR1A 3DQQA 5HZMA 3NH9A 2P30A 1U28A 1CUVA 1MB4A 4EAQA 4A6EA 3WDLA 3OZGA 1GITA 5J4YA 2J3DA 3B1WA 3T3HA 1TAQA 5IDQA 1OLSA 1TECE 3KEQA 4L75A 2W6IA 2HPZA 2C2KA 1TZCA 4XQCA 1YB6A 4ETIA 3DB2A 5SZIA 4MKIA 4PYNA 4Q3BA 2DFVA 1I9GA 1XMQB 3TQOA 4FWTA 5AWFC 3GLIB 1M8GA 5JTUA 2EWWA 3R3SA 3P94A 1GCIA 4I1VA 4FMPA 1T15A 4XUCA 1VLHA 3SOZA 5EQFA 3N39C 3G8AA 2MT9A 4K40A 4GBGA 5TPWA 2J5KA 1A69A 1MO5A 1ZCFA 5LOVF 3TGWA 1U1CA 3GNSA 3NUZA 3N2ZB 4OFZA 5AHKA 3VH4A 3M2PA 4DJFC 3NNSA 4FIDA 1PJQA 4JJAA 3KJNA 5E2IA 3UJDA 4P31A 4XVUA 3T35A 1M0EA 1QIFA 2NUPB 5DN6A 1EDDA 4MVJE 3TZEA 3K31A 4RTPA 3BUSA 1EZ1A 1R9MA 3AC0A 2XODA 3CBQA 3OP1A 2IXFA 2X0RA 1BQ3A 5C5EA 5E7MA 1C7EA 3BWVA 3EVCA 3MWLA 1E3WB 1O94D 2FHSA 1SK9A 3L9WA 4GHWA 2IODA 4XYGA 5I7OA 2EJTA 4G8DA 1XTJA 3WJ2A 3K0SA 2QLJA 3HE3A 3IUBA 5C53B 5AJHA 3CG0A 4NU8X 1N8SA 2HN9A 1DRKA 3MJ4A 2PUVA 4UZFA 3P0JA 4ZRDA 2CNWD 4EGAA 1YBVA 4L8VA 2PZKA 3WWZA 2F3SA 4B17A 4RSGA 3EQ2A 4N5HX 3SM3A 3A14A 2ZBEA 3AWDA 4S35A 3S8MA 1FDWA 3EOAI 1F3OA 3TTXA 4HLUA 5JH7F 4MHTA 3ZHTA 4UUNA 3T0IA 3N8KA 4PZLA 4TTPA 2ILTA 3Q6IA 1S96A 4PHGA 3R8CA 4OHFA 4Y6OA 1LPPA 1NPTO 2G8NA 5DNWA 4CQMB 2MWMA 1QANA 3G0GA 3P8ZA 1TT5B 2VZLA 3HWWA 4PCAA 1J7JA 2Y77A 4X1YB 2O8FA 2I3AA 1ZGGA 2BJVA 2JHGA 3QKUA 5ARDA 2WVGA 3HFSA 5AUOB 4MRPA 1HYHA 3E9DA 1RWOA 3ENQA 3JXEA 3OZUA 4Q1BA 3OJXA 4RA9A 3S2IA 4C87A 3UCFA 4D96A 4DVJA 1X39A 1BA3A 4L0DA 1RP7A 3O75A 4HNTA 1YF3A 3II6X 3WMXA 4L22A 5JXJA 2WHYA 3EY4A 1FNBA 5B1DA 3A27A 4WN3A 2BLNA 4MLZA 4BQRA 3M4XA 4WLFA 3NANA 4X44A 1H69A 4AJ1A 2WQ7A 4WGFA 2SICE 3GEDA 3CVWA 3CGGA 2VJMB 2XBMA 1TPZA 4U6SA 4CV2A 5C7LO 1C0EA 1XKXA 2OWEA 1QGYA 3FPGA 3IMCA 1LC3A 4JK3A 3RRBA 4OLAA 1NF2A 1QJCA 1RDFA 4M9UA 1JSXA 2H52A 3OC0A 1KP9A 3K92A 4CKZA 2ZVQX 3K9GA 5PGMA 2AZMA 2VHCA 1UM9B 5I47A 2REBA 4XWAA 5BSRA 4NI5A 5TMDA 2WIBA 4UU0A 3QJ5A 3AESB 4FMCF 1ZOIA 4FN4A 3VYUB 4MRSA 4BO6A 1Z5GA 1T9CA 2HIHA 4N18A 5IC6A 3ZQ4A 3IJPA 3BOSA 4I9NA 3RSCA 7MHTA 4KQCA 5KWIA 1SUFA 4L5IA 3A6KA 5F7XA 1NBHA 2FE4A 4M99A 3GL9A 5H3HA 3E0QA 4MAMA 3VDXA 1UDAA 2ZIWB 3B6JA 2ZULA 2YWDA 1MAUA 3EXIB 3K1AA 3LLUA 3N75A 1JFSA 1CERA 1C1XB 2XMRA 1T26A 1OBCA 4LVOA 1I7NA 1KEVA 2R6ZA 4MS4A 5EZYF 2O0KA 4Q9IA 4B3TB 1IULA 4Q47A 3W5JA 4OAQA 2YKGA 4YUYA 3LY8A 2M1XA 1D7OA 1PF7E 3BE5A 1XWIA 2I4MA 4R0MA 2ZP1A 5ALNA 3KCNA 4KPGA 1ZJYA 4FB5A 1KAEA 1V5FA 3UJNA 3W05A 3DVLA 3O5AA 3RC7A 4EG8A 1N1DA 1G4AE 2C61A 1AXEA 2UV8A 4OMDA 2V8OA 2R00C 4DLYA 4M87A 3DQPA 3VVCA 4D79A 2JFZA 5BNIA 3NV7A 1USUA 2QTAA 3DKRA 3EFEA 3OSUA 3JZAA 2OD2A 3H9UA 1C7FA 1T2CA 2VDVE 3NIBA 4UREA 1D4OA 1VB5A 3GJ5A 5JQWA 1CY7A 1USKA 3CO5A 4QGSA 1Z4JA 2DERA 2RG7A 4MB0A 5JNWA 1KZ1A 4D9BA 1NNUA 1T9GR 3NWOA 1WD5A 4D0NA 4ND8B 1CQZA 1RCTE 2EKPA 1PR4A 2QXUA 5EMKA 1E89A 1ESEA 1I0LA 3ABOB 2QT9A 4ZV9A 3R74A 4EDHA 5KREA 3HJAA 3A6ZA 1B6SA 1RPTA 3PRKE 1Z06A 4G0MA 2VP6A 3VYVA 1FZQA 1KYQA 2C5FA 2JK1A 5C5IA 3X1KA 4QYIB 3KYDB 4CLRB 4Z4FA 1QF9A 1MC4A 4GX5A 2GHRA 3I4FA 1A04A 1KMNA 1J1IA 2CDCA 3AJRA 3N8NA 3WRVA 4DADA 1ZHOA 1ZONA 4BYGA 2V0NA 4N5DA 2VLIA 5HE9A 3ZE2B 2A57A 3CC8A 4Y7CA 1GCUA 2BMVA 2O0JA 3KXPA 4MWCA 5EESA 1RWMA 2DKNA 4IKEA 4K6CA 5COAA 5T3UA 4HUTA 1T4CB 1GLVA 2H1WA 2PY6A 1UAGA 2WWTA 4FIZA 1TAGA 4E1AA 5JJIA 1FTQA 3ML1A 2O07A 1SVIA 4DRZA 1DB3A 3OQVA 4GR5A 5NULA 2F3TA 1E2IA 2AMJA 2Q9BA 3F8SA 2GASA 2MYPA 4FBGA 4U9HS 3FHCB 3GH3A 4GX1A 3KSMA 4O29A 3I5YA 3FI9A 4JU9A 3G7SA 1Q95A 1V3TA 2IEZA 3LQ1A 1VG1A 2B8TA 3INYA 5CT4A 2P9ZA 5EUQB 4C5CA 4ZALA 3R7BA 3TLYA 2DPMA 4JH0A 2HLDD 4ZVPA 3KL4A 4YGYA 4M76B 1O94A 3PFGA 3B51X 4D9GA 1G7CA 2W0MA 2G72A 1EWRA 1DOZA 2XUGA 3KJEA 2HL6A 3S28A 5BSWA 2CBZA 4NH4A 4Q7EA 2A0FA 4GZ6A 3A3KA 1VGVA 5LYJA 1Z6XA 2Z43A 2J5RA 2BEVB 4D3XA 1OPXA 1ZSVA 3HCAA 5ALYA 1J6UA 1E0JA 1IHPA 1VIVA 1XR3A 2AB0A 2UDPA 5FFFA 1OJ7A 3ZE7A 2Q6TA 3OCVA 4J0KA 3LVRE 2K4MA 1FMCA 4PINA 5UKDA 4RNDB 3JQGA 2CNLA 3VDQA 3JALA 2C96A 4PQYA 5JCJD 1XCMA 1Q1AA 4MIKA 1SOWA 5DSZA 4ZEMA 3OLWA 2C97A 1N7IA 2ZBGA 2FEPA 3ICOA 3IHKA 4XM1A 2QE7A 2BEWB 3FRJA 5AKEA 1JIJA 1Y34E 4NAVA 3MOIA 3KCQA 2HH9A 5EMHA 5FA6A 4QTUB 4FCCA 3L7NA 4WLVA 3ZEAA 2FLVA 2WDPA 3OG9A 1W25A 4UE6A 3GD7A 4RZSA 3SGLA 1M8KA 2ATEA 3QUAA 3QX7A 4ADSG 4K9RA 4L78A 1AKYA 2VAXA 4HDSB 2FEOA 4IRMA 4G4IA 2WQ6A 4IZ6A 2V65A 5AW4A 4HZIA 2CKMA 4B7CA 5JMWA 3KPUA 3ZXIA 1ETUA 2CY0A 2WFMA 2DPXA 4ZGWA 3HDGA 3F7MA 2J9YB 1WB9A 4FW8A 4GI5A 1CF9A 3L7KA 2QTTA 1CUJA 2C07A 3PCXA 3QITA 1SQ5A 3LT0A 1AQIA 3D6VA 4PWYA 5KO2A 3GBPA 2QI9C 3I9MA 1C30A 1XCBA 4P22A 1G17A 3AHEA 1T8UA 4E5MA 1Y3DE 4W9NA 4EKYA 2C2BA 4PLGA 3GXBA 3NU1A 1DUIA 1T9KA 3AI3A 3QEBZ 4LRTB 4CMKA 2RHGB 3KSDO 5I7VA 5K0EA 1SHJA 1GKYA 4LF4B 1WS6A 3CY6A 3FSGA 4GUAA 3A28A 4BO1A 6PFKA 4RAOA 2YZKA 1XVVA 1FU4A 4IIJB 5IF3A 1LW7A 3KU4A 3WDSA 1ZUHA 4TXHA 5IDXA 3FUXA 2GOYA 4TMZA 2GCOA 1RJFA 3BXPA 3GLHE 4JA0A 1RQXA 2UAGA 2QORA 2VAMA 4G1FA 4DA8A 4DKXA 1RLIA 1NQVA 1T3TA 4A0QA 2ZITA 4IFIA 1CJTC 2C9CA 5TARA 1BJTA 1W4RA 3I0NA 1C8LA 5ICSA 1B0UA 5IG2A 4QRIA 5ESRA 2GPYA 1DKOA 2PX3A 3VOSA 3CIFA 2AOUA 2BFOA 4P33A 4IIGA 3WGOA 1U6KA 1M6HA 1Z33A 4DB4A 2BVNA 4Q4AB 5G1PA 5C1IA 1ZFNA 3IR5A 4NFHA 5D1HA 1ECBA 2QN3A 3K70C 1X7ZA 1K4YA 3R3XA 2FWBA 4MV5A 1E32A 4WN9A 2FMIA 5E9AA 4O1MA 3VJLA 4E03A 2YZ7A 2JBAA 3LIPA 1SURA 2XZOA 1SOMA 1UR5A 4AL4A 2QYOA 5AVOA 3JR7A 4BU1A 1JYEA 3ZW8A 4U2KA 5I7HA 1JZSA 3LWBA 3OQ6A 1IHUA 4A1OA 3R0ZA 3ZBQA 2QN1A 4EARA 4O59O 4ZDKA 5AI0A 3SYNA 3KT3A 1CK4A 4I36A 3MJCA 2A7QA 2QX7A 4OLFA 2WU4A 3LHIA 1NW4A 4WXHA 2IV3A 3SE0A 1GPKA 4HH4A 1U3DA 4QOHA 2IXBA 1NPDA 2FP4A 3D4OA 5JD6A 4ZGBA 4DJDC 2B9EA 2UZAA 1ETHA 5IYZB 4EABA 3PHCA 5BN4A 2PSSA 3HP1A 1N9GA 3MPOA 5EZ6B 1P18A 1V5WA 8OHMA 3GAFA 2I0FA 3T7EA 3FROA 3LUAA 4AUKA 1DC5A 5BV1A 1G6OA 1PJ3A 3AJAA 3RSLA 3WDMA 4KQKA 1YBAA 3IPXA 5L4LA 1IB0A 1SU4A 4URHA 1XRJA 2BBTA 4N3NA 3GJ6A 5EN4A 3SXPA 4JBHA 3VNQA 4F91B 4ZHQA 4Y9TA 4JI3B 3THSA 3P9PA 4EY4A 1E9DA 5B58T 4EW1A 4IMPA 2QUAA 5H7XA 3PCRB 1M8JA 3EIEA 1CR6A 1DO2A 3DFKA 2QYHA 5BSKA 1XZJA 2GM9A 1NAIA 3ZHXA 2UUBB 3T06B 3NHSA 3CH5A 4MPDA 2AOTB 2C03A 4NENB 1N9KA 5F7ZA 2XYGA 5LYJF 1KS9A 2QVYX 4CMEA 4X7PA 5TT0A 4HZUA 2CD9A 4UUPA 4Y2TA 4KXFB 2QP3A 2ZCUA 1DCFA 1H93A 1M2HA 3VZCA 3GF4A 3KU1A 2J3IA 2P65A 4HVAA 4JUFA 1AKTA 4C20A 1Q1BA 2H92A 2OCLA 4FR2A 5E9WA 5LXTA 4DLNA 4NFYA 4G0UA 3O7MA 2EP8A 2VPYA 4P1ZA 4YJGA 5ALDA 1O54A 4FKBA 1XJ5A 4GI1A 4ALMA 4Q39A 1AS2A 1CVLA 1NIJA 2O7QA 2OORA 1QVZA 1Y6JA 5CUQA 2Z4RA 3UAXA 2CLDX 1JHYA 4DMUB 2VR1A 4WKBA 2AUTA 3H4VA 2F4NA 4NEHB 5AVYA 4B6QA 5KNLA 3COVA 4M3NA 4ZCQA 1ODFA 1W9MA 3SQOA 1R10A 1I5RA 4FNAA 1I2MA 1KMIY 1ZGBA 1FP4B 1E1CB 1W8IA 2YHUA 1V7CA 3IHLA 3OAAD 4HQ6A 4OGGA 2PTHA 3THRA 4ENVA 5JSHA 1XMPA 3JQ7A 3LUFA 4LECA 4O63O 4DR5B 3WKCA 2I6UA 3F74A 5EE9A 1K5DA 1VCOA 1R8YA 3E3NA 4PNEA 1LTHR 1IBSA 3GZ4A 5B7PA 4N54A 4DYDA 5FLYA 4JYAB 1FNSA