4ZGWA

Short-chain dehydrogenase/reductase from serratia marcescens bcrc 10948
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
245
structure length
245
Chain Sequence
HPLQGKVAFVQGGSRGIGAAIVKRLASEGAAVAFTYAASADRAEAVASAVTTAGGKVLAIKADSADAAALQQAVRQAVSHFGNLDILVNNAGVFTLGGTEELALDDLDRMLAVNVRSVFVASQEAARHMNDGGRIIHIGSTNAERVPFGGAAVYAMSKSALVGLTKGMARDLGPRSITVNNVQPGPVDTEMNPDAGEFADQLKQLMAIGRYGKDEEIAGFVAYLAGPQAGYITGASLSIDGGFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords short-chain dehydrogenase/reductase
publication title Stereoselective synthesis of (R)-phenylephrine using recombinant Escherichia coli cells expressing a novel short-chain dehydrogenase/reductase gene from Serratia marcescens BCRC 10948
rcsb
source organism Serratia marcescens
molecule tags Oxidoreductase
total genus 89
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zgwA00
5BNFA 3E03A 4MDHA 1LBEA 3NV9A 4RVDA 5AXBA 1W73A 3JQGB 5ICMA 4UAGA 4YDRA 1A7AA 3ONEA 1UZNA 5C3MA 5KVQA 1TT7A 4XYEA 2FZWA 3JQAA 4RCVA 5IDWA 1GADO 2EP5A 3BZUA 3KO8A 3GUCA 2YJZA 2EG9A 5I9MA 2FP4A 4GWGA 2DTEA 1HETA 2HK9A 3ZNPA 4Q3DA 3GVXA 4TRMA 4CQMA 4GLLA 2PZJA 2OBYA 3SBOA 3R1IA 4R4JA 1PS0A 3NT4A 4LRTB 5U4QA 2P9GA 4E33A 1ISGA 1P3DA 5LDHA 3WYCA 1P33A 3OF2A 2NWQA 1HL3A 2E6UX 2J5RA 1L1FA 4CMEA 1ZKMA 1ZJZA 3I1JA 4WOKA 4CLHA 1E1KA 1H9BA 3S8MA 3QE3A 2QQ5A 1R4NB 3K9QO 2PD6A 1C0IA 4DQUA 2B4TO 3EVTA 3KVOA 2CVOA 1I0ZA 3KRTA 1PQUA 4OL9A 1UXIA 4S1VA 4W7HA 4YVFA 4U0JA 2OHXA 4XWYA 3IKVA 1JDJA 3ZNOA 1YL6A 4HKTA 1ONOA 4AJNA 4YJHA 4A2CA 3H9GA 2HMWA 2E49A 3OMLA 5L45A 4E5MA 3O03A 2NU9A 3G3EA 1NHGA 1EQ2A 3C7DB 2GPTA 4TVOA 4RZHA 5FI3A 1FK8A 4IBOA 1PQWA 4P4LA 4KQXA 3UCEA 4NK5A 4L4XA 1TLTA 4N5LA 4ND4A 4XCVA 3DBLB 4BL5A 2HJRA 1GPJA 1GYPA 3HE3A 4YQYA 3UCXA 5L4NA 1PJLA 2YW9A 4BB5A 4NFHA 3G1TA 3DZHA 2D4AA 3FNEA 5A9TA 2ZYDA 2DKNA 2YHIA 3HFGA 1OC4A 4PLYA 3JQ9A 3TOXA 1QYDA 2AXQA 3PHLA 1G0NA 2FSSA 3RSHA 4RVUA 3AOEC 3D3WB 3B6ZA 3JQ8B 1VL6A 1N2SA 4NU5A 1CQIA 3DAPA 3R0IA 1QV6A 3PRJA 3U0BA 4R41A 1W4ZA 4E30A 5JCXA 1MUUA 1KIFA 1U3VA 3MJSA 3L6DA 4BMNA 4CM3A 4CMAA 3ZZNA 4Y9DA 4D42A 4JCOA 3ZNNA 4CM1A 1K6IA 4BKQA 2HQ1A 4ZGWA 3OJ0A 4UVIA 1OMOA 1BRMA 3BMOA 4GPD1 3WGOA 5TSDA 4AICA 4CUKA 1HE3A 4DPMA 1XG5A 1NFFA 3GT0A 4BGIA 3JQBC 1PTJA 1IPFA 1RM0A 4FFLA 1F14A 1QKIA 1YJ8A 3EZYA 5A5EA 1K2WA 1E1MA 3GMSA 4U6QA 4ZQFA 4K9DA 3FNGA 4BMVA 2RHRA 4HUJA 5B12A 3H3FA 3PZBA 3Q6IA 3H9QA 3OEYA 2W8ZA 2AA3A 1T1SA 1CDOA 3H9UA 4B8ZA 2CDCA 3SVTA 3G1UA 4B3HA 1YOVB 2UUOA 2W98A 1Z82A 2UYYA 4XX0A 3WIEA 3GPDG 5JXWA 1FJHA 4BO8A 4YR9A 2O3RA 3H7AA 3KV3O 2ZYGA 1H2BA 1UXGA 2X9NA 3PTZA 4GH5A 3FR7A 2I76A 4JX8A 4RZIA 3O26A 5B4UA 4JQCA 4MO2A 2B36A 5CG2A 1U28A 4L8VA 4AJ1A 1HLDA 2D3TA 4K28A 2PZKA 4IXTA 4NPCA 1O8CA 3OSUA 2CF6A 3PVZA 4YJGA 1VLLA 1KETA 3FCOA 3INGA 2AQ8A 3MJEA 5LDGA 3NYWA 4G65A 4YTEA 1HDCA 1DSSG 3FI9A 4CJXA 3ZWXA 5JAZA 3QVOA 3MJTA 3NGLA 4HBGA 1BVUA 1EFKA 1WMBA 1HDXA 4R54A 2X8LA 5K6AC 5COAA 4A7PA 1IZ0A 1P1HA 4NFSA 5CEJA 1K5HA 5G4LA 3F1LA 3FTPA 1LU9A 3WXBA 4DMLA 5CEEA 2I67A 1ENZA 3RFVA 3KYCB 1YBMA 4ZQEA 1XLTA 3WBFA 2IZ0A 1PZHA 5JDIA 1C0KA 1Q2XA 2NVWA 3ENKA 3GFGA 3H3JA 4IUYA 4NBVA 2VHYA 4I5GA 1HDZA 1NVTA 2O4UX 5L95A 3K5PA 2Y1GA 3QRWA 4TZTA 3T4EA 7MDHA 1DC3A 4A03A 4AJPA 3U9LA 4NBRA 2X0RA 4I9UA 1GEEA 3DTYA 3AUTA 1Q0LA 1YQXA 4HX5A 3KXDA 9LDTA 4J49A 4R3NA 2ZQYA 2QRKA 1E6UA 2ZTVA 2G17A 1QSGA 3KSZO 3DOCA 5C7IO 3EY4A 3L4BC 3OICA 4M87A 4B4UA 1T4DA 2FPPA 3LSYA 1NYTA 1KY4A 4ALNA 4NDNE 4BMSA 4D46A 4A5OA 5A05A 1O9BA 4CV3A 1H0KA 4A73A 2ZTMA 3NDJA 4BNGA 2JCYA 5I7EA 5KJFA 2V6BA 1ISMA 1G0OA 2JAHA 2UV8A 1N7GA 1EDZA 5DZSA 4WUVA 2Y0DA 4IQ8A 1BXGB 4WLVA 2EEZA 2DLDA 2P4HX 4HFMA 3VTFA 2ZB8A 4TVBA 4XZ3A 5MGBA 5JAQA 1LQTA 4DIFA 4OMUA 4PN3A 1UJMA 3FPLA 1F06A 4KMSA 2Y1FA 3K31A 1DJNA 2ILTA 4QFCA 2JHFA 1I24A 1B3BA 3ITKA 3OH8A 4FGSA 4JJGA 2B35A 4O5OA 1YL7A 3TZKA 4MP3A 1SZJG 3WQQA 5CDGA 1QLJA 2WYVA 3ZHXA 4OKNA 5IDYA 2GSDA 3ROKA 3CE6A 1ARZA 3HADA 3GG2A 2VTEA 4UUNA 2I5PO 4OOFA 1E0DA 4CLDA 3QJ5A 4IDEA 1BDMA 2GUGA 2O3TA 3G79A 3RUFA 2VZ0A 1N92A 5JFOA 5EIOA 4JK3A 1YJQA 1LDGA 1GTMA 1U8XX 1VSUA 5FFFA 3GZ4A 5U1PA 3D5TA 4WCDA 4NJMB 4KOAA 3VZRA 5L51A 1EE9A 2W90A 2D5AA 4R1SA 1R0KA 4RVFA 5A9RA 1W6UA 3RC7A 2NTVA 1X7HA 2OBNA 4FOSA 5THQA 3DBRB 3NEPX 2VQ3A 1ZK1A 3QVXA 1AUPA 3QSGA 2DBRA 4IMRA 5JS6A 2IYOA 5IXSA 2C54A 3TJRA 1BHSA 1B26A 3E9NA 4MPDA 3VZQA 3BMQA 1X1EA 3ZN2A 1NAHA 4QEDA 5TQVA 1PGOA 5DT9A 2WYUA 1LXCA 3CZRA 3VVBA 2XXJA 3W6ZA 3DAFA 1MLDA 4WLEA 3E1KA 1DFGA 2CF5A 4AJJA 1NP3A 4CLOA 2YFQA 3B1FA 1XQ6A 4CUJA 1V8BA 4K26A 3V1UA 3ONDA 3KSUA 4R1UA 5I7SA 1P1FA 1FDUA 3MZ0A 3D64A 4JJFA 3R6DA 1UAYA 3T7CA 1PR3A 3GK3A 3VZSA 1ZSVA 5JDCA 1A5ZA 1FF9A 3ABIA 4BS9A 4KTTE 4MVJE 4MVJP 4CLRA 4DMMA 2WD7A 2QG4A 4A10A 2A9FA 4G81A 2JCVA 5G4KB 4INAA 3K6JA 1PZEA 4KTVE 1YDEA 4NMHA 4OSOA 2ZQZA 4ZHSA 5KWEA 1BW9A 2FPIA 6LDHA 3LC1O 4XRGA 4CM6A 4FR5A 1B2LA 1S6YA 1K3TA 3BMNA 3IS3A 4CM4B 1I3KA 2YV2A 1JKJA 4XB1A 4YRDA 4PZCA 3TOZA 1OBFO 2HMTA 4TRNA 3GVIA 2H5LA 3NDIA 5EINA 3C1OA 4YT5A 1TXGA 3RJ5A 5ICSA 2NUAA 4WLNA 5I9NA 1DAPA 5K0ZA 4C4OA 2HMSA 1Y81A 3PWSA 3OIGA 3M2PA 4I8XA 4AJ2A 3ZWBA 4BGUA 4BNJA 4OSPA 3CINA 4OJNA 3ZU5A 4R1TA 4WEQA 4XDYA 1KVTA 3DBHA 1DOHA 3PP8A 3DZGA 2X1HA 2IXAA 3V8BA 3VPGA 2VUSA 3PYXA 1YVEI 2GN6A 2P5YA 4D0RA 1ISHA 4J2OA 1E77A 3E6AA 3GR6A 4PVDA 3NJ4A 1KBZA 2Q2WA 1KY5A 2PK3A 3COSA 3GVHA 4J9VA 1UZMA 1AHHA 2YY7A 4U6SA 3M2TA 2WSBA 3PHHA 4WCFA 5GMOA 2Y68A 4QECA 3C24A 3BTVA 4I9NA 3QWBA 4BVAA 1BXKA 4PFJA 4BIIA 4D45A 3U5TA 1UDCA 3DC2A 4R1NA 3EDMA 1SAYA 1O5IA 4LRSB 3ZWYA 2EXXA 1T2AA 4XGNA 3H5RA 1YL5A 4JN6B 4XQCA 1JVBA 4CL3A 2NVUA 4NBUA 2AE2A 3JQBA 3I5MA 4DLAA 2E82A 4WECA 4OAQA 4DC1A 4BNIA 1EDOA 2VOEA 5L7WA 1A7KA 2NV6A 1DC4A 1ZSYA 1GL3A 1FMCA 4TMFA 2BLLA 5IN5A 3WIDA 4D79A 3PWZA 1D8AA 1GEGA 2C7GA 4B7XA 2CZCA 3PPIA 1NTOA 3LC2O 1DJQA 1E92A 3ETDA 3VAZA 5JSFA 5L7YA 3KYDA 3IP3A 5LCXA 1MFPA 1XR3A 2BFMA 4ZICA 1A9ZA 1DLJA 3O4RA 2Y0EA 5KKAA 4WK6A 5TRTA 1KEVA 5A9SB 1GCUA 2DBVO 3EHEA 4GI2A 4IM7A 1U2GA 3F5SA 4L9RA 2EJVA 3GNSA 4IQ0A 2PKQO 4Y67A 2DFDA 4KDFA 4RPJA 4BNTA 1KEPA 2B5VA 4G2NA 3NUGA 1J49A 1Q7BA 5IJZA 3MJCA 3JQ7B 2QIOA 4IDCA 2ZKLA 3GZNA 3JQEA 5EESA 4HFNA 3RASA 4MKZA 4D7AA 3KHUA 3VKUA 5K6AA 3ONFA 4K6FA 4I9HA 3TZ6A 4Q3AA 1W0CA 1H2HA 2R6JA 3FHLA 1Z7EA 4UVHA 1M67A 1UP6A 3W4JA 3ASUA 2FPGA 2LDBA 5FWNA 4R3WA 4ZD6A 3WGZA 4NI5A 1BMDA 3FWNA 4YPOA 4WLOA 3VZPA 3NTRA 2ZJ0A 2Y93A 3PZRA 2BFOA 2PNFA 1CJCA 4W9NA 4E2WA 3WTCA 4X54A 1YB5A 1ZBQA 3U4IA 4ZQGA 2IXBA 4YAGA 4RPHA 2GZ3A 1T2CA 4Y6SA 4DREA 3PJGA 2UAGA 2VT3A 3B20A 4KP7A 3C1TA 5JC8A 4OQYA 3AI2A 3IL2A 5A1TA 4RPKA 5JCJD 1C0LA 1GPDG 3WG9A 1XU9A 2VT2A 5DP2A 3VOSA 3WNQA 2H9IA 4NR0A 1BXZA 1HSOA 3BHJA 4IJWA 3W1VA 4F3YA 3OA0A 2ZIZA 1IHXA 4RO0A 1YBVA 2A4KA 2AW5A 3QLJA 2D8AA 2V6GA 4J91A 2DBZA 4WLUA 3RBZA 4EBFA 4BOYA 2PV7A 5L3ZA 2WYWA 4BO5A 2GYYA 4MVJA 4H7PA 2J5KA 1R4MB 2R00C 5C37A 1EVJA 3EZLA 4Z9FA 1AXEA 5CDSA 2ZTLA 3E5RA 5IG2A 4XYGA 1T4BA 4CLEA 1PEDA 4H16A 3UXYA 3L9WA 3WLEA 1WVGA 3PHJA 3GHYA 1IZ9A 5JCJA 4BO9A 3EMKA 3WSVA 1V9LA 4PLGA 4FBGA 1HYGA 5HS4A 1UDAA 1ZEJA 2EGHA 3ZWOA 4L76A 2EKQA 4DRYA 2OORA 4WEOA 1E1LA 5FYDA 1GQQA 1V6AA 2ZK7A 2X9GA 1I33A 3FRJA 3LLVA 1BDBA 1CF2O 1LLDA 3HUDA 3ST7A 1CWUA 1PL7A 1YXMA 3AY7A 1PZGA 2YQ5A 3AUUA 1E7MA 1E3WA 5JLAA 2EJWA 1WXDA 1ZFNA 3PHGA 4M8SA 4PG7A 4GQAA 2DTXA 4P8RA 3O8QA 1J0XO 1NQAO 4RQTA 2VWPA 1XWFA 4QXMA 2YFHA 2VZ8A 1UUFA 3KTDA 7ADHA 4FSHA 3ADPA 4XGIA 5HRUA 4R5MA 5AVOA 2I99A 3HFSA 3W4IA 2FOIA 2VWQA 3LZ6A 2IYPA 1U1IA 1MV8A 2CVQA 2H6EA 4ND3A 1HYHA 4BB6A 1Y8QB 2X86A 2XAAA 2O3JA 4PGFA 4E2ZA 1QXSA 3ULKA 5IXYA 1SMKA 3VPXA 1T2FA 3BTSA 4OH1A 4D3FA 4IY1A 2LDXA 2JL1A 2UVDA 4CV1A 4FW8A 1ZCJA 3JQDA 4DQVA 4CMBA 2YDXA 1U5CA 3DB2A 4CM5A 1Y7TA 4L74A 1O95A 2Y1DA 4PLCA 4KQWA 4BGEA 4YXFA 2C2XA 1EUZA 1SNYA 1N9GA 3HZZA 1WDMA 4J4TA 3FSRA 2BFAA 1DFHA 3WBBA 1HE5A 2J5QA 4CR6A 1U3WA 4DWVA 3EUWA 2W2KB 4AJEA 2ZCVA 3DTTA 3DFZA 1ONPA 1NR1A 3JYOA 4LVCA 2BMAA 1EEHA 4TSKA 5A4DA 1ISIA 2EGGA 3G49A 3ZV5A 3WOHA 1VJ0A 3BHMA 3VTZA 3TFQA 3AI1A 5B37A 3GRPA 1UP4A 2VHWA 2GASA 3A9WA 1ZMTA 3D0OA 4D3SA 1ZMOA 1GYQA 4IMPA 1P1JA 2CDAA 1ISJA 1LRKA 3DHNA 4Q9NA 2DUUA 3QWHA 3VKVA 4ESOA 2UDPA 5IDQA 2X9VA 1QR6A 3O38A 1GV1A 4RORA 4LSWA 4RVGA 1VJ1A 1ZSNA 1JAXA 3HSKA 3JD1A 5DBFA 4FD3A 3DEYX 1E6WA 3ICCA 1B3RA 3I9OA 4Q3EA 1GYRA 1DC6A 2Q4EA 3FF4A 4TKLA 3BMCA 3FNHA 3T7EA 2F00A 4CM9D 3GAFA 4M49A 3GDFA 2J3HA 3I83A 4NK4A 3ZV6A 4DC0A 4HFRA 2Q49A 1NPDA 1UAGA 5G0VA 2X0JA 4NBWA 3BHIA 2RHCA 3NX4A 1SCUA 4LN1A 1VI2A 4WASA 2BI7A 3RUAA 3E9QA 4GVXA 4MKXA 1YB1A 1C1DA 3RFTA 1ENOA 1JAYA 5ILOA 3JV7A 3NT5A 4BO1A 4LCJA 3TN7A 1CETA 4PLWA 3OFSA 4RV9A 4E32A 3UKOA 1U4OA 4B8WA 1E1NA 3PFWO 4XDZA 1X13A 1UH5A 2QYTA 3DHEA 4GX5A 4BKOA 5COQA 3E18A 4XD2A 2TMGA 4J1SA 3ZU2A 1PL8A 4IDFA 5KNLA 4FQ8A 1NVGA 1HT0A 3PIDA 3RI3A 2PD4A 4U8GA 4B4OA 5IZ4A 5IZCA 4D44A 1IHYA 3LYLA 4H3VA 4IPTA 2RIRA 5JBIA 3HHPA 1SO8A 1QYXA 3P2OA 1FDTA 3M1AA 5KCZA 1ULSA 3H65A 3AW9A 2PY6A 4LCEA 2CDBA 1XQ1A 4ONEA 4HNGA 1XKQA 5ITWA 1VSVA 1PJQA 4J6FA 4WLFA 3RCBA 3U4CA 2C07A 3WNVA 4U0KA 4YWJA 2E4AA 4NH4A 1ID1A 4K1LA 1DBVO 3PHIA 3RUCA 4RGBA 4OXKA 3GPIA 1ML3A 3WGTA 1NASA 2ZB3A 4GMFA 5HWSA 1N7HA 1SB8A 4ALMA 3C3XA 4KUGA 4E5PA 4B79A 2X5KO 4YJFB 2WD8A 3H6KA 1JWAB 1GFSA 1JW9B 1PU2A 1YDWA 2E48A 4UUMA 4OXNA 3DR3A 4E21A 1KERA 1MGOA 1VKOA 3QWIA 2VZ9A 3S2EA 4BNFA 5BQFA 3EK2A 1VRWA 4BNKA 4AJLA 1GY8A 3QQPA 1I01A 4YACA 3OEWA 2V6FA 3CMMA 2SCUA 4FIZA 3KYBA 2OFPA 2JJYA 1LDBA 1KYQA 5ITVA 4O59O 3FN4A 3GOHA 1D1TA 2FHSA 2VWHA 4B3IA 1CRWG 1LDNA 3GEMA 5CDUA 5KVVA 3DHYA 4O1MA 3WQRA 1ZK0A 1XCBA 1EE2A 3F4LA 3R3JA 5DCYA 3VH4A 1T2EA 4CUZA 3WICA 3GA0A 1HDYA 4R69A 3D7LA 2D1YA 3GVPA 1DFIA 3OP4A 2CD9A 3B1KA 1UR5A 3VDQA 1JKIA 4IDGA 1C1XB 2WWRA 3UH1A 1F8FA 1LC0A 3WJ7A 1QRRA 2P91A 3CUKA 3ZNQA 4JXKA 1NNUA 2FSVA 3KLPX 1HXHA 1CYDA 2CFCA 2ET6A 2GR9A 3JQFC 3OIFA 3ANNA 1DC5A 1TT5B 2BRUA 4QQRA 2F1KA 3UCFA 1R16A 4IZIA 1MP0A 5G0WA 3HN7A 3K8ZA 5EQFA 4MVJG 1GU7A 3TSCA 1YBAA 1E3EA 3NTQA 1ZZEA 3OM9A 4XQGA 3D3EA 1E3SA 2IEDA 1EMDA 8LDHA 5T57A 2PGLA 1U3UA 1D3AA 2GNAA 4W7IA 1Y8RA 2GO1A 3SX2A 3ZWWA 4DIBA 3I4FA 1QG6A 2PD3A 4RPGA 1MA0A 5TC4A 1WNTA 4OGWA 4O6VA 1Y6JA 1A4UA 1HEUA 1KVRA 1E7YA 3G0OA 2V65A 2JCXA 3UGKA 1AXGA 3NJ8A 2EW2A 4Q3CA 1UDBA 2OUIA 3NTOA 3RAJA 1F17A 1AN9A 1NBOA 2WMDA 1EUDA 5ILGA 5THKA 1RYDA 2O48X 4ZVVA 2R2GA 2Q4BA 1MXHA 3EAGA 5JC1A 4E6PA 4Z3KA 1HF3A 4IIVA 5EPOA 3JYPA 1XYGA 2GDZA 3WR5A 2X6TA 1JTVA 1Y1PA 2BGMA 3KEOA 3HDHA 1JWBB 3LK7A 4BGVA 3CMCO 1I2BA 4FFMA 3RWBA 1B0AA 1Q7CA 2Q2VA 2VYVD 2QW8A 2NLOA 4CMIB 4EZBA 4PLVA 3MJVA 2ZTUA 5T6BA 1NQTA 4EEXA 1IULA 1JA9A 3C7AA 3NGXA 5KJ1A 4FFPA 1I2CA 3CH6A 1WPQA 4EEZA 2JAPA 1PQPA 1LSUA 4PLTA 1BSVA 2D2IA 1YONA 4XYMA 5DDIP 1OI7A 2E37A 4R9SA 4BV9A 4GKVA 2YV3A 3GNQA 1GUZA 3H4VA 4WE3A 1Z6ZA 3I3OA 4YT2A 1DIAA 4HWKA 2VYVA 4FPXA 4DBZA 1LSSA 3BYZA 4CV2A 1Q0QA 3C1AA 2B4RO 3H2SA 3OA2A 3TL2A 2I3GA 5T5QA 4FJ0A 4MP8A 2O4CA 2VWGA 3CXRA 3IMFA 1HSZA 3DMTC 4Z9XA 3QIVA 3FTNA 1F0YA 3TDKA 4J1TA 2O3SA 2G0TA 2XPCA 3RVDA 4YEDA 1CEQA 2BKAA 5KVSA 3ITDA 4IS2A 3ZDFA 3HQ4O 3DL2A 1XEAA 2BF7A 4BNWA 1TI7A 1IYZA 3L4SO 4PLPA 4EDFA 1GZ6A 2J3JA 3OBBA 4OKIA 3TZQA 1GD1O 4NJOA 3AOGA 1F8GA 3JYNA 3CKYA 3NKLA 4FJ1A 2DU8A 4MVJF 2B83A 1E7RA 3WYEA 4JIGA 3IAHA 1XGKA 2DPHA 3AU9A 4GX2A 4RDIA 3PEFA 3EC7A 4CM8B 3NT2A 1H6DA 4CQLA 5ER6A 3P19A 3E8XA 1D1SA 1NQOA 1C14A 1PJCA 4E4YA 2D0IA 4KZPA 1C0PA 5BR7A 5TJHA 2PA3A 4I5EA 1YE3A 1H6BA 4FN4A 3D5QA 4KUEA 3BXXA 1H94A 3L0DA 3WX0A 2BELA 2EKLA 3GHHA 1NXQA 1BGVA 2OOSA 3MWEB 3AFMA 1JN0A 3ROPA 3RUHA 1LNQA 4R01A 4CODB 5EERA 2Y0CA 3PYMA 1PS8A 5TS3A 2FN7A 3JQGA 1N5DA 5DOZA 1V35A 1ZW1A 4J9UE 4Y98A 2P9CA 3WGGA 4XJSA 1B16A 5G0UA 4MVJH 1DRUA 2Y99A 3MWDB 4PRLA 4IS3A 2BGKA 1IUKA 3GFBA 3JQAB 4ITUA 5L40A 1OC2A 1L7EA 2Q1TA 3GDOA 1U8FO 2A94A 2C59A 4XKJA 3UHAA 3IC5A 3DBVO 4CQMB 1P1KA 1EVYA 3FD8A 5HA5A 4PG8A 1OFGA 4BQRA 4DLBA 2ZB4A 4WPGA 4URFA 3RBVA 4BO6A 3ZCXA 1YKFA 2IDZA 2X5OA 3FPCA 4QX6A 2GGSA 2X23A 4RVSA 5TGDA 1LLQA 4CMGA 3AUSA 3P2YA 5EL0A 4ALKA 1DAOA 1F12A 5F5NA 1P74A 1LRLA 1R4NA 3SLGA 3Q1LA 5DN9A 4M54A 3SJ7A 2DVMA 4QFDA 4CMHA 1XSEA 2GRAA 2HRBA 3GN1A 4PVCA 1Z7BA 2PGJA 4L73A 1VM6A 1NFQA 2HKIA 4XR9A 3GY0A 1M2WA 2NVBA 3MTGA 3WB9A 4N5MA 4CMEC 2FMUA 4NFYA 4XR4A 4YJHB 4F6CA 4Z0HO 5IAAA 1W8DA 1KC3A 3M6IA 2C7VA 4HV4A 2POQX 4YA6A 3RC1A 2XF8A 3RKUA 4DBVO 1E3LA 3GH3A 1DIHA 3IJPA 4GKBA 4HY3A 1ZK2A 2Q2QA 3LQFA 1RWBA 3H8VA 5F3RA 4AFNA 3PQDA 3AUAA 3GLQA 3AOEA 4N18A 2O7SA 3LF1A 3DBLA 1AE1A 5EQDA 1H5QA 2Q46A 4JLWA 3AJRA 4YRAA 1PJ2A 1XDWA 5KIAA 4B7CA 2HK8A 4ALJA 3IQDB 5BT9A 2X4GA 3PQFA 3VDRA 5IFLA 1DRWA 2HUNA 2B69A 1M6WA 1GQYA 3IOYA 5DF1A 3W8EA 3I9NA 5DCUA 2OMEA 1EBFA 2YHIB 4I08A 3D3WA 2OP0A 3JQ8A 5L4SA 2VHZA 3A06A 5A03A 4J7XA 1XU7A 4J7CA 3U09A 1LI4A 3C85A 2VCYA 3IIEA 1CERA 1GDHA 3L9XA 1RYEA 1P45A 1DB3A 4GMGA 4RPLA 1DLIA 2HMUA 4IJUA 1KOLA 3NDRA 4ZQHA 5CPFA 3KETA 3JQ9C 3ETEA 3JSAA 4FFRA 5TF4A 2PH3A 3QA9A 5CDTA 3KOUA 1PGNA 1ZUD1 3BMOB 5KTKA 4Z6KA 1IY8A 5HM8A 1WDLA 4LGVA 4UREA 1FXSA 2OXIA 2NU8A 4R51A 1WZEA 4E0BA 1XHLA 5TIIA 1HE4A 3E5MA 1E5QA 3ZWAA 2ZJ1A 1HYEA 3RJ9A 3ZWCA 2I3AA 3ROQA 1YOVA 3BTUA 2NTNA 2FR0A 5A3JA 1VPDA 3EW7A 1PWXA 2FR8A 3E82A 3I52A 4MVJM 5CHEA 4UEJA 5DP1A 2GN4A 1X14A 1X15A 2AEFA 1RPNA 5G2OA 2HRZA 4ZU3A 5K9ZA 3ASVA 3AI3A 3CSDA 4MP6A 1DIBA 3V1YA 1EQUA 4GWKA 3L6EA 4PG4A 4XIJA 1ENPA 1LSJA 4DIOA 3I9LA 3WYBA 4E5NA 1WW8A 4J7UA 4EJ6A 1LA2A 1P44A 1I10A 4MIEA 1UXHA 4YJGB 3MEQA 4YAEA 5H82A 3RC2A 5B1YA 2J3KA 4JBGA 3JCZA 1DIRA 2XXBA 3LT4A 2P2SA 3RD5A 2YYYA 1YO6A 2RH4A 3PGJA 3WS7A 4PIVA 1R6DA 1A4IA 1GUFA 3VPSA 4R68A 4GGPA 3KYCA 2PWZA 2VYND 4D43A 1IOLA 1EFLA 2VNAA 2AEMA 3AK4A 1VC2A 3F46A 4WOJA 2TMDA 5FEUA 2BHLA 2QRLA 3ICPA 1C3VA 1UXKA 4LMRA 1Y5MA 3UOGA 4BKPA 5IF3A 3L4BA 3QP9A 5KOIA 3F47A 2HO5A 3GF4A 3V2UA 3M1LA 1ZEMA 3D4PA 4R9RA 2NU6A 2FWMX 4GSKA 1G6KA 2WE8A 4AJHA 4GX0A 3PLRA 2QYSA 2VYNA 3DMYA 2A92A 1ENYA 3H5AA 3KSDO 3TPCA 3VPHA 1EK5A 3GGPA 1DIGA 3ZH2A 1H9AA 4DGSA 1X7GA 4EUEA 1KEUA 3LLSA 1HWYA 4Z3DA 1MC5A 3PWKA 4ND1A 4Z9YA 1BXGA 1GR0A 4Q39A 1B8VA 1AGNA 3VVCA 4TZKA 1U7HA 3I9JA 1GZ3A 3CPSA 2WDZA 5GZ1A 1HDGO 1ZO8A 4N54A 2Z1MA 5AXDA 5AQ1A 4XGKA 1I3NA 3U4DA 4J16A 1P31A 5BSHA 3H5NA 4LISA 1ADGA 1B8UA 1JLLA 2W2LD 1LDMA 2G76A 3MTJA 3ZWVA 2DPGA 4F6LA 2BFPA 3A4VA 4P22A 2DBQA 3WWZA 2OZPA 1Z74A 3I9MA 5GZ3A 5U9CA 4FOOA 3TNLA 4KWHA 4E2XA 4BNNA 4EUFA 2X7HA 3FBTA 1YRLA 3I4CA 4HADA 5EJ2A 2EHDA 3DZBA 2QRJA 2Q1SA 1LEHA 3X2EA 4Y6PA 4BKRA 3ZHZA 5C7OO 2DUWA 1QLHA 4DTIA 3DQPA 2QZZA 2W2LA 5JO0A 1J6UA 3SJUA 1R15A 3V2HA 3KLMX 1V3VA 3TZCA 2WTBA 3OJLA 2CMDA 2ZB7A 4GX1A 4ILKA 2AE1A 1J5PA 3BA1A 2CVZA 3Q2IA 1ISFA 4MIOA 4NJMA 5CPBA 1EK6A 3L77A 1ZK3A 3G17A 1V0JA 3PI7A 5ENVA 3EYWA 5COBA 3UUWA 3HB4X 2O23A 2PLAA 4IZHA 3DBRA 4PLZA 1KVSA 2QX7A 3MCVA 4BUCA 4DL9A 4KWIA 5BNTA 4PZEA 4FB5A 3INRA 1WAMA 1X1TA 2Z95A 4B4VA 1EBUA 3GC6A 3JD0A 5F1KA 3SC4A 1JQBA 2Y1CA 1EVIA 1LDEA 2Y67A 1SB9A 1GUYA 5L7TA 1ZIDA 3K2EA 1LRJA 2H63A 4UEKA 4J0EA 2X22A 3BMQB 3U62A 4FJ2A 2HK7A 3DZFA 4BNMA 4S3MA 3LT0A 4RF4A 2G1UA 3WQSB 1KEWA 1LDYA 2CSUA 1HLPA 2DM6A 5H81A 1A71A 2I66A 3IKTA 3PDJA 1NPYA 1WZIA 1GAEO 1YQDA 3JD2A 2HDHA 2NM0A 3OJOA 3P5SA 4HP8A 4W4TA 4ZA2A 4CLOB 1IE3A 2NU7A 4IDAA 2ZYAA 4BHTA 4C7KA 2NQTA 1SOWA 3KEQA 2AQIA 3Q0EA 3F3SA 3ORFA 2Q1UA 1JU9A 3KBOA 5CEFA 3HDJA 4Z0TA 1YB4A 4CLRB 1V3TA 3GUYA 3WFJA 4NIMA 2WD7B 5G4KA 2Q1WA 3HDYA 3IJRA 1HDRA 3AFNA 3W8DA 5AOVA 3DFUA 4UUOA 2B5WA 1H6CA 2GZ2A 4XQEA 5JDCC 3W4KA 1KS9A 1BW9B 2WM3A 4CM4A 2Z5LA 2C2YA 3RQSA 4CM9A 5JE8A 3BMNB 1PJ3A 4EYEA 2OL4A 2ZATA 1N1GA 1ADCA 1I3LA 4J2HA 2PH5A 3UF0A 2CY0A 2BD0A 1SBYA 1Z45A 1NPTO 3RFXA 4XYBA 2O2SA 3PIIA 2BH9A 1GCOA 3DBHB 1D4FA 4JJIA 1HTBA 3LT1A 2YQ4A 5CDYA 4WKGA 4TWRA 3ZHBA 4DLLA 4YRBA 1EZ4A 3X2FA 5BSFA 4XIYA 1K0UA 3RIHA 1DEHA 5G0TA 4P4GA 2IRWA 4OM8A 2PFGA 1K89A 4GAEA 4NQZA 1PGPA 4QUKA 4WCFB 1A27A 3Q11A 2IZ1A 3ZU4A 3GVCA 4J4HA 3RROA 4J43A 1QYVA 4RF2A 5F1OA 1NVMB 4BV8A 4CR7A 2IEBA 1B8PA 1U9JA 1EUCA 1A9YA 2I65A 1QYWA 3GGGA 2X0IA 4Q3NA 4BNLA 3S1LA 4L4RA 1A72A 1X7DA 5GZ6A 1DHRA 4W82A 3PYLA 3EGOA 3JQ6A 4WCFC 2NVUB 3Q9NA 4N5NA 1KVQA 2IE0A 4NU6A 1ZH8A 5T67A 4DYDA 4QSMA 4EITA 4YAKA 3LT2A 4FFNA 4KDEA 1PGJA 4ND2A 1RM4A 2DQ4A 3NRCA 1VE9A 2JFHA 5AYVA 5JYDA 3KYDB 2EP7A 3GDGA 5A9SA 3N7UA 4EJMA 1I32A 4F45A 1FDVA 1WWKA 3Q9UA 5JAMA 2OO5A 3WGYA 2AQKA 4IXWA 3IP1A 1MXFA 3PXXA 3UFXA 1ZNQO 1KC1A 2Q45A 4CMJA 2I9PA 3GGOA 5A04A 3DZIA 1QMGA 2JFGA 3H9JA 3JQ7A 2JD1A 3BTOA 3JQCA 1T1RA 1U7TA 3QVTA 1K6JA 3ROMA 1HZZA 4RDHA 4BQPA 1O94A 5GY7A 1HRDA 2CUKA 4C7JA 3PFFA 3OQ1A 1UP7A 2O3QA 3GZNB 3JD3A 4FCCA 3DZKA 4E31A 1U5AA 3L6OO 4AJIA 2Y05A 4D41A 1E3IA 1YWGO 1QORA 2HJSA 3TL3A 5I8WA 3HG7A 5I7VA 3I23A 4F46A 5KJCA 3GRKA 4WNIA 1XELA 4CMKA 1PS9A 3AM4A 4L0QA 4DPLA 1XIVA 4AL4A 5I8ZA 4M55A 1DO8A 1K6XA 2P4QA 1DPGA 3DAGA 2VNSA 1LUAA 4O0LA 2BGLA 4EUHA 3U49A 1E7SA 2AG8A 4ZJUA 3ON5A 3K92A 4FFOA 5C5IA 3OQ6A 3GN2A 4RF5A 4Y6RA 2CNBA 1SEPA 3SXPA 3RC9A 4AJOA 1X0VA 1UZLA 2YDYA 3INTA 4DVJA 4GSLA 4HXYA 4IGEA 4YYZA 3N58A 2G5CA 4J1QA 1JVSA 1U4SA 3F5QA 3WMXA 4MKRA 3WJAA 2JD0A 5IDXA 2P68A 4JGBA 4YAIA 5L53A 2QHXA 1N1EA 2R00A 5TT0A 3DONA 4LMPA 4O63O 4ALIA 4TQGA 4UVEA 4I1IA 5TNXA 2EF1A 4RL6A 3QV1A 4W9NC 3TZHA 1NX6A 5JY6A 4AG3A 1Y9AA 4UVGA 4U5QA 1NAIA 2JKVA 3MOGA 1P77A 2VN8A 1LSOA 4YCAA 3K96A 1G1AA 1R4MA 1VKNA 3WSWA 1ZXLA 3DOOA 4J1NA 1WMAA 5H83A 1LLUA 1FDSA 1Z73A 2BI8A 1MB4A 5BSGA 3DWFA 5JMWA 4RLSA 4XQ9A 3ZV3A 4PCVA 4FGWA 5J23A 4ZQBA 4CL8A 3C8MA 5T8KC 3Q2KA 1MG5A 4E12A 5CAEA 2JFFA 2AEJA 3A14A 1AHIA 2NACA 4JP2A 5JPIA 3QY9A 4AJKA 2PKRA 4YAJA 1E5LA 4E13A 3PDUA 1BG6A 4ZN6A 4E2YA 2GLXA 3PLNA 4AJ4A 1M6HA 2B4QA 4GL4A 1ADFA 2PTGA 5FF9A 3F6YA 4Y8VA 4B4WA 4BNHA 1RKXA 1B7GO 4ID9A 5ENDA 2NNLD 3GAZA 4Z0PA 4ALLA 3ENNA 1E3WB 4BO3A 3A1NA 4QT0A 2DTDA 1T2DA 2PZMA 3TF5A 3O8QB 1S7CA 2JD2A 1ADBA 1PJTA 4IQGA 4ROSA 5F1PA 3GMDA 3ZWMA 4GLOA 4A0SA 2YUTA 5T64A 1Y8QA 1IPEA 5JY1A 1SC6A 3VHRA 1NHWA 1N8KA 4CLXA 4MOWA 5JNLA 5TT1A 3AM3A 4MVJI 4NG5A 4XA8A 3PJFA 3UAGA 5I9LA 1NFRA 1BWSA 3JD4A 3RU7A 4BNVA 1LTHR 4YT4A 5B4TA 3WTBA 1R37A 2D5CA 5DOVA 4LVUA 3GEDA 4YQZA 1BTOA 4RVHA 3S2GA 2B0JA 1R0SA 3PJEA 4II2A 4BNYA 2YZ7A 8ADHA 3L07A 2DC1A 3H2ZA 4PG6A 2VUTA 5JW6A 1N9GB 2C0CA 4J4BA 3WGQA 4BKUA 5L4LA 2W2KA 4YBZA 2WJPA 4GVLA 4NZ9A 2VOJA 3QVSA 4PLFA 1RM3A 3WGIA 1O0SA 2AQHA 5ER9A 3A28A 4LW8A 4M86A 4UULA 3FNFA 4RLHA 3GNTA 3JYQA 3C7CB 3AY6A 4K6CA 1T26A 5ADHA 2OGUA 4J3FA 1R0LA 3HJAA 2HLPA 1QP8A 3AY3A 3T4XA 1EVZA 1VL8A 3ANLA 4UVDA 1P0CA 4II3A 3UICA 5LC1A 3DXFA 2FR1A 4MINA 2O50A 2EV9A 4IIUA 4BO0A 5A02A 3OIDA 3KM0A 2D59A 1OAAA 2X0NA 5I7FA 1TA4A 3BMCB 3UN1A 4DUPA 4E3ZA 2C20A 4UUPA 4PLHA 1P1IA 1ZK4A 1NQ5A 4OO3A 1CQJA 1SPXA 4IDBA 4OXYA 5IN4A 1NR7A 2Q99A 3TQHA 5EMHA 2RAFA 1MX3A 1O89A 3QVWA 3KUXA 1U3TA 1P9LA 4FS3A 3TRIA 1Y5RA 4PG5A 1LX6A 4QO7A 3QW2A 4WJZA 4AVYA 3PGXA 5JAIA 4CPDA 3IUSA 1C1DB 4ZRMA 2VHVA 3ZW8A 3E48A 1PJBA 4CMCA 4XJTA 1YQGA 3JTMA 4BNZA 5BSEA 1PZFA 1PIWA 3MJ4A 3D4OA 4IINA 1H6AA 4YB8A 3WMWA 4H15A 4U7WA 5TLSA 5EN4A 3MOIA 3U3XA 4TROA 2J8ZA 3ZV4A 4JBIA 2UUPA 4OHUA 4FDAA 3R3SA 3STHA 3ZGYA 3WLFA 2Q50A 2VRBA 3KB6A 4CV0A 1WP4A 3U4HA 5KJ6A 2RBEA 1GV0A 3AU8A 2P9EA 3Q3CA 4J90A 1KVUA 4PZDA 2WEKA 1DHTA 2Y1EA 4IDDA 4W99A 5BNIA 1OOEA 1WLYA 3CTMA 3TWOA 6ADHA 4A27A 4XYLA 4FC7A 1Q1NA 5TJ9A 5TX7A 2J3IA 3D1LA 2GERA 2NSDA 3VPFA 4B7UA 2W4QA 1YS4A 2VUUA 2VHXA 5F21A 5IZCC 2AHRA 3W8FA 4OYRA 1E7WA 5F5LA 4EI2A 2O7QA 4ND5A 3DO5A 3RUIA 4YJFA 1M75A 4HNHA 4E5KA 5A3VA 2YHUA 3ETGA 1NM5A 1HZJA 2Y1OA 1PL6A 2FY8A 5JO9A 1U2DA 4DPKA 5ES3A 5DNAA 3PQEA 3KZVA 1CIVA 3F9IA 1IB6A 4DQXA 3SC6A 5KKCA 3E9MA 3ZW9A 2C5EA 3W6UA 3IDSA 4BO2A 2H1SA 5JMPA 2I6TA 2C5AA 2OP1A 3GEGA 2YV1A 4I5FA 1SEVA 2C82A 3OECA 4TKMA 3ZHYA 2B37A 4IJKA 4DXHA 5MDHA 5HTOA 1MG0A 2DAPA 1TEHA 2Z1NA 3ZI0A 3GG9A 1JKFA 1V3UA 1PX0A 4ZRNA 1ZXBA 1R66A 3I6QA 3BIOA 3S55A 5DBIA 9LDBA 1RJWA 3ZWPA 3JQFA 3N74A 1E6EA 2IZZA 3RBXA 3RKRA 4DYVA 2HU2A 4E5YA 1I3MA 1GQ2A 4L75A 3RUEA 2J6IA 4WGGA 2XOXA 2HCTA 3B1JA 3F4BA 1QV7A 4JBHA 4JP3A 3F1KA 4RF3A 2DFVA 1Q7GA 4TRRA 4BNUA 4G5HA 1C1XA 1LC3A 2EWMA 5B4VA 1NWHA 3P7MA 2AMFA 4WNCA 1P0FA 3FBGA 1DXYA 1J4AA 2PZLA 3CZMA 5AXCA 1LLCA 4YJDA 1TT5A 3HWRA 3LC7O 1I5RA 3K73O 4FC6A 4M89A 5KVCA 1OZAA 1TVEA 5JYEA 3CEAA 1NWCA 3D4NA 4XEHA 2HSDA 4L4SA 3ZWNA 1PSDA 1IL0A 1I8TA 3DOJA 2GF2A 1Y8RB 4P38A 1M76A 3PK0A 4D3DA 3TFOA 2QZ9A 2NTJA 3FWZA 4RJTA 3LDHA 5FI5A 2FRDA 1DRVA 3LU1A 4IGFA 4D0SA 2A35A 3LVFO 4CM7A 3OJEA 5C7LO 2IODA 4RQUA 2P5UA 1E3JA 3GQVA 3K2BA 5JDIC 1PJ4A 4EJ0A 3QWAA 1H93A 3V1TC 1Z75A 4MVJD 5A5FA 2EKPA 2RCYA 3I9KA 4NBTA 4DA9A 3FR8A 4QO8A 1BVRA 4XB2A 1QYCA 2GN8A 4JNKA 4R16A 2RH8A 1R12A 2EW8A 3VH2A 3UVEA 1Y9EA 5A06A 4LSMA 3IUPA 2C29D 5T8KA 3WDSA 4YT8A 3OETA 3EVNA 3HDQA 4CMIA 2EIHA 3RU9A 2FZEA 2O2YA 4OIMA 1RM5A 5HS6A 4LK3A 5DULA 3VC7A 3DZJA 2GN9A 4TRJA 2HAEA 1ORRA 1YH3A 3BAZA 2NQ8A 3H9EO 2PGDA 4A26A 4MJLA 1PJSA 3AWDA 3OJFA 4BNXA 1X0XA 1LJ8A 2GZ1A 3DMTA 5L9AA 2G82A 2HMVA 4J0FA 5CP8A 1T24A 3B70A 4IJVA 2GD1O 2NADA 2VRCD 3SEFA 3JYLA 4W6ZA 2V7PA 5AXAA 2PKQP 1VL0A 1D7OA 3V2GA 4JROA 1PWZA 3V5NA 3ZU3A 1LQUA 1VJTA 3NAQA 2WE7A 4Q3BA 2V6MA 4CR8A 2Q3EA 3UW3A 1E7QA 1HKUA 1HDOA 5CFZA 4EGFA 4PRKA 3AM5A 4N7RA 2Y66A 3OHSX 2JHGA 4P4NA 4NNJA 5HBRA 3QWFA 4R5HA 1FDWA 1B15A 4OQZA 4KUHA 3PJDA 4OOEA 2GCGA 1P1RA 4MIYA 1Q0HA 2VRCA 2DT5A 5KJEA 1XA0A 2X58A 1I36A 5DCWA 4GGOA 1UXJA 3DDNA 1TB4A 5DBGA 1PR9A 1YGYA 4I5DA 4M1QA 4BO4A 3O9ZA 3HB5X 4GBJA 1I30A 1MC4A 1T25A 3RUDA 1O6ZA 4EW6A 2ZCUA 3QHAA 3WFIA 3ADOA 1ZJYA 4QTZA 3CIFA 5G0SA 4CM8A 1PGQA 3SLKA 4B3JA 1L7DA 2AG5A 3LF2A 3WGHA 2VTDA 4CQLB 3VH1A 3HNPA 4HFJA 3JQAD 1GZ4A 1HE2A 3OQBA 4XRRA 2X5JO 1I2ZA 1ONNA 1MFZA 3ANMA 3HN2A 4NHEA 3VH3A 1DDOA 2EERA 2PR2A 1WDKA 1M66A 3S2IA 1ZVMA 3S2FA 4BO7A 1B14A 1ULUA 4CQMD 5CG1A 3K30A 4UEOA 3I6IA 1SOVA 2O3UA 3WWYA
chains in the Genus database with same CATH superfamily
3AETB 5BNFA 1YBHA 3E03A 1LBEA 4RXUA 4KX3A 5HJ2A 1N2CB 4BJ5A 5B53A 1FRVA 2D1QA 3PSAA 4YDRA 4EB8A 3MWDA 3ONEA 3M82A 4YLYA 2GVNA 3L43A 4KJXA 4CZ2A 4RCVA 5ESRA 4UHEA 3GUCA 4FBMA 5I9MA 4RMIA 2FP4A 1Z7YA 2DTEA 4BLRA 1SCAA 3PFKA 5A6SA 3TLZA 2NX2A 3W6NA 4Q3DA 2PUCA 3DPUA 3T5DA 3JWHA 3KPVA 1VRVA 3ER8A 2OBYA 3SBOA 3QEJA 3AFHA 1YIAA 2ZLBA 3MUFA 4EPVA 1ILWA 2X9QA 4LRTB 1X7YA 3KQYA 3LIIA 2GZDA 5U4QA 3HY3A 3NM4A 3T1TA 4FE4A 4CG2A 1ZD2P 1P33A 3QELB 4N82A 4PGGA 5IBQA 2BFEA 1KFBB 5JZMA 3B38A 2H9AA 1L1FA 5EWJB 4CMEA 1DBIA 1ZKMA 3I1JA 1JYEA 5IKPA 4C7OB 3EPRA 2JRLA 4X1YB 1QZ3A 3QE3A 3HGMA 1DTEA 1AZWA 2V9PA 1C0IA 3HJUA 3COJA 2B4TO 3EVTA 3ZBQA 2Q5HA 5MN5A 2HA4A 3I0NA 4RIIA 2XE4A 3CG0A 4DBLC 1PQUA 3GB9A 3WQHA 4H3SA 2PGNA 2ZXEA 3G9TA 1LK0A 1QH9A 4YVFA 2ZIFA 4U0JA 1AU9A 1EX7A 1KI2A 2BEVA 3IKVA 1EXMA 4FHEA 4ZAVA 3T9FA 5JSQA 4OV6B 5JSYA 1IHUA 4H1HA 2YWBA 4MLPA 5F3WB 1WABA 1YL6A 2VSFA 4QWWA 5GP1A 3TVTA 3H9GA 5B3AA 4M6WB 4WKCA 3TRJA 1V7QA 1FCJA 1XZEA 3GJQA 1NXSA 3M4ZA 2E49A 3U17A 4HLQB 2CB0A 3RABA 3RG2A 2JBWA 3O03A 8MHTA 2Q3CA 3FNIA 2NU9A 2PGOA 4X8MA 5LBTA 4IGIA 4RS3A 3EXG2 1U3CA 3K0CC 2H11A 4Q47A 1GA6A 5JS8A 4UNPA 2QVZX 3OY7A 2P65A 3D6JA 4MWEA 2IP2A 5DW0A 3UCEA 2HZ7A 4NK5A 2DULA 2C9MA 3WNZA 1WXQA 1GPJA 3LHKA 5FO1A 3KXIA 4BE9A 3TVYA 2YW9A 3O8NA 1V2HE 3N2GA 2GDJA 1R2QA 3DZHA 2D4AA 1W1IA 4MLCA 3FFTA 5A6VA 1Y1TA 2ZYDA 4ARSA 3EMVA 2Q3FA 1RHUA 4TZ6A 1Q0UA 3K3PA 5LBUA 4MDFA 4JUIA 2VAVA 3PHLA 2DKOA 4BX9A 1TCVA 1XVAA 3AOEC 3CW9A 3U60B 2AT1A 2Q41A 4KGVA 4P54A 4R41A 3H19A 3MUOA 1W4ZA 3CVJA 1REQB 2BL4A 4NY1A 3LY5A 4E30A 1XNQB 1Y1SA 3WNBA 2J6BA 1U3VA 4F7DA 2WM9B 4W7SA 3WGLA 2VJDA 1R0RE 4NZNA 4CM3A 1D0IA 3VU3A 3ZZNA 2WKWA 4ZPJA 1NXPA 3WGOA 1BRMA 2K4MA 3V8PA 3KD3A 4S0ZA 5EXPA 1IBCA 1FLNA 1LTKA 4MWOA 3ZDQA 5FUQA 1DXQA 3GJ8A 2QK4A 4I1VA 4R2MA 3HI4A 4HQLA 4RZQA 3FPKA 2VDWA 1NRIA 4MMXB 3EZYA 5A5EA 3E8MA 1RQGA 3GMSA 4YGYA 4W5OA 2OQIA 4K9DA 2X8WA 3P0FA 4HUJA 1JHMA 2WU8A 3H3FA 5B12A 4A2WA 2OHOA 2AMYA 3H9QA 1VE5A 1J9EA 2W8ZA 3KZOA 3OEYA 3H9UA 4Y9UA 2H1LA 4YK7A 2CDCA 5LA6B 3G1UA 4P33A 3ZIUA 2Y4OA 5F52A 5AHWA 5DRYA 2JBHA 1XE3A 3DUFA 4JYAB 4XX0A 3DM5A 1GZ5A 5BR8B 3MK31 4YR9A 1VCHA 2EX4A 5JH7F 2QD5A 4IJ6A 3COZA 3G02A 1H2BA 3FLBA 1QC5B 2I76A 1UOEA 4WHMA 5B4UA 4NMXB 1FS5A 1M73E 3H5OA 3L06A 4JQCA 3SYMA 3T12A 4GKJB 1YGPA 1MRZA 1U28A 3EX7C 1UINA 3NC4A 4PHFA 5F51A 2HWXA 4K28A 4IXTA 3GJRA 2YJGA 2BVNA 3I92A 1QIMA 1T5OA 1OFHA 4QGHA 4Q4CA 2AQ8A 2AOTB 3A6KA 3NYWA 1XLWA 1TTHA 2UYHA 2DHQA 2BI4A 1DSSG 2EU8A 1U98A 4CJXA 3ZWXA 4K6KA 4Q9DA 1GNPA 4P3YA 4E3WA 1FUYB 1JZTA 1KMMA 4RDXA 3ZTYA 4G84A 4WY8A 5ECGC 1EFKA 2G9QA 2VDJA 2X8LA 1FJ2A 1JDUA 5COAA 1IZ0A 3QKTA 3V9AA 1P1HA 1U9ZA 4BJHB 5CEJA 3F1LA 3D8TA 3VJLA 3F6PA 2PR7A 4FYMA 3Q7QA 5CEEA 2I67A 2A86A 2JFZA 2WW8A 3PSHA 5KYUB 1XLTA 2IZ0A 4RTQA 2C3MA 1GILA 1MOQA 3F3MA 1E9BA 4UDNA 4CKEB 1KGDA 3AFIA 2RGWA 1Z5ZA 4LXGA 3GFGA 3H8WA 5HCIA 1DVRA 3O8OB 3BEOA 4NBVA 3W04A 3E2IA 2VHYA 2XQFA 3T3GA 4CDMA 2JA1A 3LH5A 4BMPB 1NVTA 5LQRA 5C53B 4CEJA 2QTCA 1TQ6A 4TZTA 3SHFA 4A03A 2BKXA 4NBRA 1XMOB 1N6RA 2AC2A 2QRPA 1O0BA 2WYOA 4Q6BA 1UODA 3D2CA 4DADA 4QQ8A 4TKVA 2CNNA 1EFPA 2Z9DA 3IVRA 4B7ZA 1GG5A 1XWIA 3P0RA 5JCZA 2O8CA 2QRKA 3RU3A 5KYGA 3DO6A 2ZTVA 4KR3A 1FYDA 1WD5A 4HYYA 3L41A 2DUNA 5TEWA 5AKEA 3QITA 4IMIB 1TU3A 1OJLA 1DWPA 3D6HA 5BSMA 4M87A 2J5XA 2YW2A 2V4UA 4BWVA 3NP9A 2JKZA 5DBHX 3A4NA 4D46A 4DWJA 5FTMA 1VLHA 5A05A 1IOZA 3S8EA 1H0KA 2FW6A 1UF9A 4GSYA 2ZTMA 4AUNA 1RS0A 2RE8A 3FNQA 2W6IA 2G1KA 4FXOA 1RMYA 4EJSB 1D2EA 1EDZA 4RVOA 1RCUA 1YR3A 1CRLA 3VTFA 5H80A 2NSYA 2JFBA 3JZIA 5LNK1 8OHMA 1CP3A 2PWAA 4OGKA 2XQIA 1NUSA 1L5HA 1LQTA 2OSVA 3KOMA 3CZCA 2BGNA 2EIXA 4B48A 1SHUX 2R8RA 3FPLA 3GLGB 1W49A 2B1IA 2EZ4A 3EPPA 1LD3A 1N3LA 2O1EA 1DJNA 3FSEA 1G9XA 3NASA 2LGJA 4BB9A 3CUUA 5DYIA 4B3TB 2XITA 1KMCA 1I24A 2A5YB 1B3BA 3ITKA 3OH8A 4GI3A 1KIAA 2DH6A 4O5OA 5CB4F 5FO0A 3UT5B 1UBJS 3NKFA 1SZJG 1QPZA 1ADJA 2OAEA 1DTSA 4QPPA 4S1OA 3G82C 1POXA 4O29A 3ROKA 3CE6A 1ARZA 2HCFA 2J9FA 4DR2B 2QMOA 2AFIE 4AN0A 4UUNA 4OOFA 2YWGA 3VHLB 5AI5A 4YV1A 1K3FA 4IDEA 2GKGA 2QMUA 3DLTA 3WLSA 5KU7A 2JPDA 4C29A 1H66A 5JFOA 4FYXA 2NIPA 5EIOA 4O4LB 3DXYA 2IS2A 2X3UA 2CLHB 1EK2A 5KTYA 1TYZA 2F43A 2HOQA 1UBSB 3GEIA 1EESA 1HFJA 4ZYUA 2FEWB 5FFFA 3PHBE 3OLZA 3RBAA 4K03A 5AW3A 2EAUA 3R7WA 1L4BA 4WCDA 5CUQA 4NJMB 1NVVQ 1DGQA 5CGQB 5ERXA 4PXAA 2NV2B 1WMEA 2C0QA 1EE9A 1WY5A 4F3KA 4EG6A 5E2AA 2W90A 2D5AA 1ZMXA 1CUWA 1R0KA 3PFCA 4KO1S 2H1RA 1WJGA 5EXEA 5JSUA 3RC7A 3DMHA 2JVIA 2OBNA 5THQA 3ZLTA 3M6MD 2FEKA 2BFDB 5J4HA 3QVXA 3QEKA 1Y98A 1T0PA 1AUPA 3Q12A 4KQJA 4TYPA 2CXXA 2DBRA 3UK0A 2IQIA 4ZEVA 4X8LA 4WOBA 3MA0A 2VQDA 1B26A 2CJWA 5EJGA 3W5DA 1BOOA 4R40A 1UPBA 3FTDA 5BSTA 2F67A 3VNBA 4EPYA 3TQOA 1PGOA 1EGQA 2B8TA 1ECLA 3N5KA 2WYUA 1WW2A 2C1ZA 2PGIA 3SYTA 1QVVA 2XXJA 2IOQA 4CIDA 2PKYX 2ZROA 3AX6A 1X7XB 3W6ZA 3DAFA 1MLDA 4ZDKA 5E1OA 3FPAA 4XUCA 4QLOA 2XZOA 4NVRA 4BMDA 4AJJA 5DB4A 1NP3A 2MYPA 4OK5A 2J7KA 1WSDA 3B1FA 5IKEA 2J7PD 2QRVA 5L3SB 4U2EA 4QPCA 3QVJA 1P1FA 1FDUA 3IPXA 3D64A 3MZ0A 5TV2A 3TO5A 5K20A 2W2PA 3E7XA 2WM2A 3T7CA 2WU0A 4X7PA 1TM5E 1RYYA 4NE9A 4Z4CA 5AVQA 1EJBA 5EHNA 4KTTE 4KIFA 1G5FA 1OFIA 3F6BX 5AQEA 3P9CA 1KKMA 4HWPA 4Z7JA 4GXTA 3OX3A 1SKYE 2JI8A 2GM4A 5AM3A 2JH8A 2C8JA 1NJFA 1THGA 2UXDB 4G81A 1BJTA 1D2NA 1XAGA 3B51X 4INAA 4MROA 4B85A 5DCLA 3S99A 3EIOA 3QBEA 3RF6A 2PUVA 3DR5A 3Q5DA 4LZZA 2J7PA 1BW9A 1GGNA 3DT9A 4MYUA 3BFKA 1PE0A 4CIVA 5CB6A 4HN9A 1BWQA 3WC4A 1ZQ1A 1K3TA 1MX1A 1TJYA 3A3PA 1JKJA 1OH6A 2OHJA 2HMTA 3PG5A 2H5LA 2PAFA 3DVAB 3ERCA 3AR8A 3ZKWA 1B23P 3C1OA 3OZAA 2X6QA 4YT5A 4U39A 3UT6A 1BMFD 1QO0D 1JZQA 1XZBA 1EX6A 2OQRA 2YVQA 2P6NA 5LLDA 4UXJA 5EHZA 1DAPA 2I7XA 4DLVA 3ILXA 4C4OA 1H4SA 2Z9CA 4AJ2A 1OX4A 3DW1X 4I8XA 3ZWBA 1EPUA 1WQ4A 2XD9A 1GDTA 3CINA 4OJNA 7MDHA 2RHDA 3UG6A 4R1TA 4WEQA 4XDYA 4R7GA 2BBOA 1DOHA 1JBEA 1LFDB 3DZGA 2X1HA 2IXAA 3DB1A 2VUSA 2XXAB 4NFLA 1YVEI 4DM3A 1OA1A 3LRXA 4LG1A 1ISHA 4J2OA 4Q93A 1O03A 1YS7A 1LZLA 3X1YA 1X94A 2W83A 1BQ3A 4ERXA 4YV0A 1PFUA 1PFYA 4BQSA 4PVDA 4FBLA 4DDTA 3QX3A 3ZQ6A 2VPZA 1KBZA 3B3GA 1N4AA 3SN6A 3IQXA 2GVDC 2RK3A 1KY5A 4J9VA 4E08A 2D74A 2YY7A 3HRIA 3TM4A 1BMFA 1X7ZB 1TUIA 2WSBA 2ZBRA 4L50A 3EDQA 4OXQA 3IGFA 3C24A 1JUDA 2YRXA 1N2JA 4GICA 4HJXA 4Q01A 1L5NA 4EIWA 5LDDC 1TQ8A 2BP7A 4OREX 3DC2A 4R1NA 3K0AB 3TDMA 2EXXA 1T2AA 5JTUA 2NG1A 3C6BA 2HA5A 1K4YA 1NNSA 1UOPA 3L8YA 3Q3VA 1EUCB 4J75A 3SC2B 2XUGA 2YJ5A 3JQBA 3FZQA 4JX9A 4WECA 4OAQA 1U2EA 5JJBA 1FJGB 1E1CA 1LNSA 7ABPA 3Q5GA 3VC1A 5BQ3A 5J59A 5AK0A 3TB6A 2BMWA 1ZSYA 3GP3A 4TMFA 1FMCA 3C4VA 2BLLA 3KOXA 4NZZA 5IN5A 3SC3A 3LP5A 1D8AA 4FHCA 2C7GA 3NDBB 1IQPA 2I80A 4Z2YA 3I2KA 3PPIA 3FH0A 4Z4FA 1DJQA 5JSFA 2WQ7A 4TV8A 1LCIA 1SIUA 2QNRA 1XKLA 1A9ZA 4UTZA 3GRZA 4WZ6A 2EC5A 3DDUA 2EKZA 4X8OA 1FRNA 3OTGA 4KPUB 1KEZA 4GI2A 2H31A 3T3DA 1KHHA 1RBMA 2EJVA 2JVKA 4ZCIA 1RI4A 2PKQO 3TKLA 2R4QA 2DFDA 3QMMA 4RPJA 3UB4A 1EAMA 4QNRA 2QAJA 1P2VA 2PJUA 4G2NA 4Y2XA 2XB8A 4M83A 3U39A 1Q7BA 4ZVMA 4JYCA 2QIOA 1VRCA 4IDCA 2IUFA 4TTPA 5DFAA 1G20B 2W6MA 1RQ2A 4QPZA 2H17A 3HABA 1RYBA 4M0KA 5AW6A 4H6XA 4UJ3A 1P81A 3AQIA 2D3WA 4M22A 3D6AA 3EUFA 1P2TA 3OWXA 4ND6A 4OHVA 4RM2A 4FCWA 2YFKA 1W76A 4QRIA 4A3SA 3PNYA 1T8YA 1RHRA 3IHTA 3PC7A 1D5WA 2CCKA 5AUNB 3E4CA 5K6AA 4JXZA 3ONFA 2HSJA 2JGDA 1VG0B 2G04A 5LM3A 4O2LA 2EKBA 2R8XA 3M34A 2W4MA 1XALA 4I9HA 2JATA 2WVJA 3RV4A 4IQFA 1X77A 3QKUA 3DP9A 1J97A 3TM5A 3U6BA 4LQDA 4JEMA 1SCQA 4Q3AA 3HU2A 2I62A 3FHLA 1D2MA 2IOYA 4OYLA 4P81A 3JQPA 1Y3IA 1UP6A 5EIWA 5CJ2A 1WF3A 5FXMA 3AF2A 4DV7B 4IJ5A 4M0EA 1FTSA 2R2AA 4R3WA 5F35A 5FWNA 1EE1A 4NI5A 1Y3BE 4WV3A 1JHRA 4DW8A 4FGUA 5BYAA 1KJJA 3CKKA 3DXZA 1Z4OA 2GEDA 2PSFA 2QN6A 3M7IA 4N03A 4UU1A 5A3RA 5CLFA 2DJIA 3PZRA 3VGJA 3DS8A 1I4TD 3OCCA 4IIEA 4KFSA 3JZAA 1OXSC 4LMBA 3WTCA 2IXBA 2ZSUA 3P2JA 2JZCA 1IXRC 4K9LA 4YAGA 4MI9A 3WYGA 4AG5A 4RPHA 1UBFA 1T2CA 4DREA 2VJBA 1CY6A 2D7DA 3PJGA 1YZTA 2YC4C 3MRXA 2O2XA 5CXQA 5LU9A 2AOWA 2XUOA 1PUXA 3B20A 3HBLA 3C1TA 4KP7A 4CN9A 3PWTA 1EHIA 5KQLA 3VR6D 5KYYA 3LL7A 1PRYA 5BVGA 3IBSA 5C1PA 2QJTA 1O97D 3LUDA 5DP2A 5DXAA 1R0BA 2Q8NA 4MGEA 4LJRA 3CISA 4DTCA 4EFKA 3DE3X 2ZIZA 3EFOA 3L84A 4WFJA 3UAYA 2F1OA 4J91A 2X77A 3NOQA 4N0EA 1O6GA 4UNSA 5L3ZA 3KCQA 4XSVA 4OUKX 1Y3AA 5CIYA 5E9WA 1UBTS 1K97A 1TMKA 4DEXA 3MERA 1P7WA 1B6GA 1DS6A 1R4MB 1XK7A 4HS4A 4MW0A 5KX5B 2IXGA 3HUUA 1AXEA 4CGZA 2O2GA 5IG2A 1MQSA 1ZM2A 3B3AA 4HAIA 3C5WP 4GD3Q 4CLEA 1FP4A 3M5PA 4YMGA 3FYHA 1EM8A 1WVGA 2AOUA 2VZEA 1XZCA 2QTHA 3PHJA 3GHYA 3RS8A 1IZ9A 1OBHA 3VR6A 1S2DA 3V32A 5BMOA 2XCOA 3ZJTA 4EMUA 1Q0ZA 4PYNA 1OVGA 2AOVA 2BGIA 1RLMA 3IA2A 1CJTC 1V9LA 4OGLA 4P4SA 5ALGA 3AUXA 1CNEA 1UDAA 2EGHA 1CUAA 2R4TA 2OD2A 4LSZA 2C5LA 2AK2A 2EKQA 3VYWA 3Q7EA 3TK1A 5CLIA 2OA0A 2G7ZA 3QGMA 2X9GA 5B7PA 1DP4A 2CJFA 1CF2O 1LLDA 2P2NA 2XA2A 2ZUCA 1PR4A 3HBNA 3DO8A 3HCNA 3KXLA 4RM3A 3A9UA 2YQ5A 2JGKA 1MBZA 3JALA 4GOKA 2B1JA 3FPHA 1AHNA 4M8SA 1A8HA 3A2KA 4GQAA 3RJTA 1PK7A 3CE9A 2PXXA 5FYQA 1M2HA 1NXOA 1HA3A 3KTDA 4EW1A 3ADPA 4XGIA 4LZWA 3UMYA 1JJIA 2BWJA 2I99A 1TUBB 2OKCA 3ED1A 1Y63A 2WVHA 3OO1A 1V6SA 2FRXA 3C3AA 3K53A 1XMQB 3WMWA 4QM6A 3KAQA 1MV8A 2CVQA 4ND3A 2WHEA 1HYHA 2ARKA 3QYPA 5HIAA 3DWEX 2OCIA 4CBVA 4KQEA 1QXSA 1SMKA 2RGYA 1NW4A 3MMPA 4IHJB 2WF5A 4LYHA 4OH1A 2GD2A 5SICE 4IY1A 5TQ0B 1NBAA 3PU6A 3PT9A 3PNPA 4NCAA 3B6MA 4CV1A 1G4UR 4K9OA 1GPAA 4OH7A 2EHJA 3JQDA 4OMFG 2ZPTX 4CMBA 5ALPA 1P4AA 2AUTA 4NE2A 3LPAA 4LQ4A 1EP9A 2Y1DA 4K6MA 4KQWA 4KQ1A 4QL3A 1Z2DA 2C2XA 4KR0A 4AYWA 3SX0A 1Y9JA 1YQWA 2BFAA 2QPTA 1DFHA 2C78A 2J33A 4DLNA 5C5CA 1NZJA 4EGCB 1CHDA 3IV9A 4DR7B 5I7UA 4NQRA 2V6JA 5LBIA 1EFTA 5FTWA 5HCNA 1GLVA 1XDGA 1P5FA 1YV9A 2W70A 3UJ7A 4C3OB 1QO9A 2XEDA 1FVOA 5IP5A 1NR1A 2ORIA 2Z0MA 2ADFA 5C4IA 2A2ZA 3G49A 5D5PA 4KX5A 4K9NA 4G5OA 3H0KA 3ZV5A 4MA4A 2KI5A 4OK6A 4UFNA 2AZDA 3BHMA 3DBOB 3O3NB 4G8CA 1S4QA 3AI1A 3BG5A 4I4IA 3JW8A 4ZP1A 4ZEXA 1YACA 2GWHA 2QS9A 1Z13A 3JS5A 4IJQA 4PC6A 4TLDA 3AHGA 4Y9RA 5F12A 3O8DA 1WEHA 1ZMTA 3D0OA 1ZMOA 4LTDA 1V1JA 2IYVA 1OCEA 3CIOA 1P1JA 4IMPA 4D3SA 1N0WA 5A4IS 4N0MA 1LRKA 1PVDA 1SU7A 4B31A 1OKKA 5JNUA 3GLGA 3DHNA 1R9JA 2DUUA 1TYCA 3L49A 1EP3B 1WS6A 3LOQA 4GPZA 2GPBA 3S68A 5IDQA 1QR6A 3O38A 4H7EA 1GV1A 5L3QA 2WAYA 3PFNA 5DK4A 5JLJA 1VJ1A 1QU3A 2WR8A 4JLUA 7AT1A 4D4HA 1JAXA 3LWBA 1KYZA 4JI8B 3I9OA 3NFYA 3Q6MA 2R44A 1DC6A 3GCDA 3P45A 2WQZA 5A7FA 3TRKA 3GQBB 4TKLA 4B75A 3QUAA 3BMCA 5CVVA 3CGGA 3URMA 1J0EA 2QTAA 4ETNA 4CYMA 1U6IA 2OLJA 1MH9A 3GAFA 1G6Q1 1GSHA 3FCEA 1QH1B 3D4BA 3I83A 3OE4A 4GHWA 5EYPB 3ZV6A 5LQUA 1I6MA 3P71T 2AUNA 1IN7A 1NIPA 3ZCQA 1P5JA 3CR3C 2P2ZA 1U8CB 2HA0A 3BHIA 2NSHA 3NX4A 4O8ZA 5EJAA 5BSUA 4LN1A 5K45A 2GYUA 2BI7A 1Y5NA 2N9UA 3LPNA 3E9QA 4TLEA 2C9BA 1EJ6A 4RK4A 1RU3A 2AJBA 3BXEA 5FA5A 2Q5QA 3VU9B 1P61B 3BK7A 1OT5A 3D7KA 5T3YA 1Q21A 4PLWA 5DH9A 5K6RA 1ESCA 2ONZA 4RV9A 1YTLA 3RSLA 5FPQA 1Q0SA 1E1NA 3FDFA 4P2BA 3RJMA 3HXMA 2R3SA 1D9XA 4O4IF 1PD0A 2PWBA 3M5CA 5ALEA 1Z5OA 4PIPA 1Q1ZA 3E18A 4U6NA 1SHZA 3H1TA 4FNMA 1G21E 1QIEA 2CHVA 3WP0A 5LJIA 3G2LA 1HT0A 2JJMA 2JIZD 2JW5A 2COEA 3PIDA 1PTKA 4PCAA 3TNYA 5B3LA 5HJ5A 2YOHA 2PUHA 3OTIA 2A1TS 4YRFA 2IVZA 5HG0A 2VJYA 4BP1A 1CZLA 3LYLA 3U0VA 3CEPB 1FSZA 3HHPA 1SO8A 5CJPA 2IBTA 2B4AA 1ULSA 1MVNA 1QWSA 3AW9A 3OZBA 2PY6A 2RG1A 3KXPA 4YRCA 3LMKA 1ZN2A 1F6WA 2BKVA 2GFQA 4MS1B 2DETA 4WLFA 3N2KB 2QD3A 4X7MA 2XRMA 4P1ZA 3E27A 4U0KA 3ENVA 4YWJA 2SNIE 2E4AA 4KN6A 1ID1A 4NH4A 5G3YA 3HMKA 3LHIA 3PHIA 3ZYZA 3CUVA 1T5HX 3GPIA 2JIZA 2IIVA 3EZ6A 1NASA 3FYDA 4F4IA 5JD4A 2LP4Y 4UM9B 2ZB3A 3I5UA 3DZDA 5HWSA 1N7HA 3GNLA 4P31A 5AI4A 1MA3A 4HVCA 1FS4A 2JCBA 1RCTE 4G0XA 1Z2PX 2ZIAA 5KYWB 4O2AA 3K9NA 1BO6A 2YRWA 3Q6NA 4I46A 3H6KA 4ESVA 4DCCA 2VF8A 1OPRA 2XLCA 4E5PA 2VHUA 2ZSFA 3KB8A 3BDVA 2R6GA 3ELYA 4TTQA 1CE8A 4UUMA 3AI7A 2J30A 3ZD8A 5KHOC 1W5BA 4MR7B 4WXHA 1QAOA 3O3CA 3KJXA 4FFDA 3OQJA 4OHPA 5ESWA 3B6KA 1VRWA 5FNVF 4DZZA 3LW8A 1GY8A 2AJLI 3QQPA 5CDFA 2ODBA 3OQIA 3S28A 1WXFA 4O4HA 2QTNA 4JB2A 2Q5OA 5ED0A 2ZUTA 4PYIA 5EGNA 1R9GA 4FIZA 4UHJA 5AKIA 2OFPA 5CA0B 2F62A 2JJYA 4CG3A 3GAAA 3VZDA 3B7PA 2OV6A 3R7NA 2PX8A 1MJGM 1QVZA 4YJ3A 1FMTA 1Q1BA 2ZOSA 3DHYA 2YVUA 2I4RA 4DDWA 4JJKA 2V1UA 4WNAA 1DIOB 2X9LA 2OYCA 1W5AA 3R3JA 4N3AA 4J8PA 4KXVA 1ATZA 1T2EA 1SHJA 3WICA 2V7TA 1ECCA 4HBZA 3D7LA 5F7OA 3WV5A 3GVPA 4MV6A 1G2PA 3K9LA 3SR0A 1VI5A 1I1NA 3VDQA 1JECA 5LYJF 1D2GA 4JV5B 1RWQA 1YUNA 3OUUA 4ECEA 1BDJA 3UH1A 1WOYA 3EGXB 2QG6A 3IXMA 1QRRA 2J08A 2P91A 3B52X 4EVQA 1NNUA 4JUFA 5JCPA 3M6XA 1CYDA 2W6QA 4ON9A 1AN0A 2XVMA 1TAHA 5EWLB 2ET6A 3JQFC 3CM0A 5DNVA 2K7FA 3KDPA 2Z8YA 1SQ0A 3ANNA 2BRUA 2GI4A 4FN5A 4QQRA 4LJ4A 3UCFA 1WZUA 1MP0A 2YN0A 4F56A 3K8ZA 1ZA1A 3TSCA 5ICGA 2R1TB 4WERA 1ZZEA 4DF3A 2IPXA 2JGLA 4NS1A 1E3SA 3T94A 1R3UA 1EMDA 8LDHA 4URXR 5EQJB 1U3UA 2NTYC 2GNAA 4GL2A 5LQCA 3SS8A 2C77A 2FP3A 1L7AA 1PYDA 1XB2A 4AXBA 1SQ5A 3KQOA 4JP5A 4PHCA 2OCPA 1I2DA 2PMWB 1IXZA 1XJWA 4UHCA 2J3QA 3KD2A 5FBQB 4O6VA 3D7MA 1HEUA 3UGKA 1JR2A 1U1GA 2V65A 2JCXA 3M8KA 1T9DA 4JSRA 2F48A 4UUBA 1C30B 3ESBA 4TXNA 4Y2SA 2CHQA 2QUAA 2WKPA 2ZE8A 5BSKA 2FF7A 1Q1QA 3FDXA 1WUIS 3UPTA 3I2JA 3IRUA 4YPFA 5HE9A 1PDWA 1TVMA 1RWNA 2X5XA 5ILGA 4DCNA 4U02A 5MFPA 4EG8A 3CZQA 4GC9A 2Q4BA 3L0OA 1IZZA 4C05A 4ZHQB 4I4TB 3F78A 1EWKA 2G5GX 2OB1A 4UE6A 3RB8A 5LOVA 3HJFA 2I8CA 3B9PA 4URZR 3M0EA 2FVYA 3CNNA 3OX1A 1G5TA 4B34A 1JEDA 2AHOA 2A9PA 3JYPA 2ZS9A 4TS1A 3R23A 1VI6A 3CLHA 4Z9BA 5AW1A 5BVHA 2DQZA 5A4AA 2CLDX 5H5JA 2RIPA 4C7XA 2YBEA 4PN7A 1C7RA 2H54A 1JF8A 1K7CA 3LK7A 4BFSA 4U2DA 1DAGA 1RQ7A 1I2BA 3C70A 4MDEA 2VHJA 1Q7CA 4GW3A 2Q2VA 4RSMA 5DBOA 4M0LA 2FKAA 4CMIB 1HMYA 3H9BA 1R5OA 4PLVA 1I6WA 2NSJA 3C7AA 1E9EA 4RFSA 1SKYB 4JJ8A 3MYRA 4FFPA 2PS9A 1NI4A 3E70C 3KR0A 4LXUA 4OD0A 4I4CA 1PQPA 1J99A 1COZA 1UKYA 1QZTA 5EXXA 1SY7A 2QLNA 3ZHOA 2Q9UA 5H3CA 3ROGA 3DE2X 4LRQA 1G8GA 3BJIC 1XTRA 3VOBA 1BXRB 3GNQA 1RYMA 2HPZA 1ZX1A 4BTVA 3A10A 1GUZA 1ODJA 2XTNA 3N07A 4RMHA 2QZJA 4BV3A 1FE8A 3QUBA 1FX1A 4HWKA 1VHDA 1ZGGA 4IV0A 3WLPA 1Q0QA 3IR5A 1YU6A 4V0MA 2B4RO 2JJ2D 2JB9A 2XTAA 4YRLA 2F6RA 1FOEB 4MP8A 5CLJA 1U81A 2ZRMA 1HSZA 3L05A 5BP7A 2BUCA 3PD1A 3QIVA 3SOZA 1Z6GA 1JEQA 1MX5A 1JA0A 3P9SA 1EK1A 3LBNA 2J4DA 3AQ4A 2P7HA 4QDTA 2I6SA 1R6UA 4IS2A 4AZ0B 4HLUA 1XEAA 4Z0NA 3FMVA 4J3NA 1V26A 1QBGA 1JI3A 1Y34E 2WIDA 4Q1CA 1Z38A 3BD7A 4UOEA 1N6NA 1GD1O 3DMGA 1L8LA 2VH1A 1LWOA 1WCV1 2XUDA 3TFWA 1GITA 3NKLA 4U5XA 3T3EA 3V7NA 4D8WA 3LTNC 4JT2A 3E9DA 2G4LA 2RB4A 2HYIC 4GBMA 3WYEA 3PJRA 4XGQA 4G8BA 3QX9A 4WQMA 1WUJS 2G8NA 1XGKA 3IAHA 4RDIA 5EA2A 4EDHA 4ENSA 4GI7A 4KO8A 4GXRA 3UQYS 4JBWA 4TL9A 2O0JA 1YDHA 2X14A 3OPVA 4BQEA 1C14A 1PJCA 1UT8A 3JAWA 2Z6UA 2D0IA 1KYTA 2VQSA 4KZPA 4CFSA 3EF0A 5TJHA 2PA3A 2QMQA 4OVKA 4LCBA 4I5EA 4FN4A 1H6BA 4IKOA 2XTJA 5E6RB 3QUSA 5SZKB 2BELA 3AVVA 2EKLA 3DZCA 1KI3A 5ITZA 3D31A 5BMVF 1U3GA 1W6RA 5ALSA 3PVCA 2DXIA 2Q6OA 1E5DA 1WXGA 2FZGA 3T3NA 3EEBA 2WG0A 3NBYC 3R0VA 4WKBA 3HWWA 2ZBUA 1PS8A 3K4QA 3R3VA 4PY2A 2FN7A 2IEZA 4ZOLF 1Y1KE 4KZKA 4O2BA 1QS0A 2IYFA 2ZT6A 1PBNA 2H4FA 3FYTA 3S81A 1RIFA 3WGGA 2CHUA 3BK1A 3GU3A 2CEKA 4MW1A 4S1TA 5TB5A 3UMCA 1B16A 3G7NA 2RAPA 3N87A 3ZIAD 4XVHA 4PRLA 4KRFA 1IBMB 3ADKA 2BGKA 4B3DA 2R87A 1UMBA 2ASVA 2ZJ5A 1A1SA 3GFBA 2UYOA 3RIXA 2IS1A 3SWWA 1WCIB 4H60A 2JVJA 3FJ1A 2B99A 2Q6LA 1AHPA 1Z2NX 2WU1A 3S0JA 1YI8A 3ZZTA 1GHTA 1KZ6A 3G5UA 5LZ8A 1PJRA 2JAUA 2QTTA 3OVMA 3FD8A 4G09A 5FTKA 3HPRA 4BQRA 4L5CA 4DA4A 2ZB4A 3CPHA 4WPGA 1F48A 4XLLA 2EX0A 4OHOA 5BNWA 2IDZA 3FPCA 2PVPA 3BWXA 1RKBA 4QX6A 3ZDZB 2Z9BA 5EY5B 1FFEA 1S01A 5DTQA 1MIOB 2X23A 3KUKA 3NKVA 4HNAB 3ZGLA 1LLQA 3ZIAA 4ZYXA 3AUSA 4KU4A 2AG1A 2O2JA 3JARA 2JZOA 3FWPA 3IXLA 1P74A 3UZUA 4W5TA 3BJRA 1E3TA 4XIFA 2WICA 4D8YA 4CMHA 2GRAA 3BQNB 1Z7BA 3CLRC 4P82A 1URPA 1YQTA 4DHEA 1KI8A 3PDHA 3L4KA 2H06A 2FJ0A 3PC6A 3PRHA 1J23A 1Y82A 2O5VA 4ASUD 1SK9A 1JJBA 2F1HA 3OPYA 4Q34A 2IYYA 2NVBA 3BORA 3CT4A 2XIJA 2HR1A 3WB9A 2H1FA 3GJYA 3WYAA 1YT5A 3I62A 1ZICA 2XBUA 3M6IA 1OB2A 4BRWA 2G1PA 4M8IA 4HV4A 4ZT6A 1ECBA 4MS3B 4UM8B 1E2NA 2QL7A 2R8YA 3TQRA 4ZCPA 4EGQA 2IYRA 3GH3A 1DIHA 3KYIB 5CNIA 5LD2C 1ZK2A 3DTVB 1XDSA 4JLNA 4C6TA 4MQ5A 4AFNA 1SRQA 3D6NB 3AUAA 3GLQA 4IIBA 4M7PA 4JC0A 4MUHA 1RNLA 4JLWA 2XADA 3OOEA 5JMTA 2YRFA 3MUNA 3QPBA 3THXA 1OLXB 3QPCA 4ASUA 3FJOA 3F9RA 4ZARA 2FFRA 4M0FA 3PQFA 5JAOA 4W5RA 5IFLA 3S40A 3G2HA 1M6WA 4HDNA 3BIWA 1GQYA 1HM5A 3W8EA 1ORVA 3F67A 2IUYA 1SC4A 1VHQA 3I9NA 1EBFA 1KY3A 2YHIB 4MR7A 1RR6A 2CZQA 2XE8A 2ZAGA 4I08A 5CLLA 4AM8A 1A2QA 2A5LA 3JQ8A 4RKFA 2ZPAA 5L4SA 4Z4EA 1YDGA 3TLXA 5IHPA 4BEJA 4A8JC 4J7CA 1T0BA 3U09A 4F91B 1LI4A 3C85A 2VCYA 3QU9A 4R7TA 1ACJA 4R84A 3UOAB 1EUYA 4M1MA 4U7DA 2R6R1 4Y1FA 1PVOA 1XNGA 3QBJA 3VV2A 4JD5A 1X3SA 4MW5A 4AMYA 1A9XA 1ESZA 1ONSA 3CLTD 4QICA 5ALNA 1DLIA 4LJ6A 1MH1A 2HMUA 3N2NA 4IJUA 4N0DA 3M81A 5DHPA 5HIJA 1JI0A 4DM4A 1CZUA 3HP1A 4MB6A 1TU0A 1U1CA 5CPFA 3JQ9C 3O21A 4XVCA 1HQCA 3ETEA 3FCCA 3QA9A 3QY0A 3G8DA 1QGZA 5IEJA 2IYNA 5DWDA 1JDBB 5KTKA 1IY8A 2FW7A 3PHCA 1X9GA 1NVFA 3QVUA 1TUGA 4G36A 1SUFA 4UHDA 1ODKA 1WZEA 4R51A 5K8VA 5B30A 1QJ4A 3ZWAA 2ZJ1A 2BTQA 1HYEA 1NP6A 1SUIA 3IULA 3K5IA 4X9XA 4C4TA 5T4HA 1GTSA 1YOVA 2I87A 1JHUA 3KPWA 1T2UA 4TV9A 2M6RA 1N1MA 2XOEA 4IGAA 4YMTA 3ANTA 4WINA 2BTEA 5FBRB 2IK8A 5TMDA 2VZLA 1C9YA 1T3HA 3GFSA 2XMPA 4PGMA 3QEAZ 1M0EA 4ZQCB 4NCHA 5A3SA 1E63A 1HE1C 4YPVA 4B9EA 3BBLA 3HTXA 4JBNA 1M8KA 3M3HA 3KFXA 3DL0A 4GEKA 1GFWA 1X14A 2GN4A 4DSOA 5AI6A 1GTL1 1RPNA 4GM1A 1LNZA 3RSCA 4ZU3A 5K9ZA 2RGDA 1EP2B 2H07A 1NKVA 4MP6A 2L19A 1H1LA 3FPFA 2RCNA 4GWKA 4LQLA 4XIJA 3KKKA 1LSJA 3I9LA 4I14A 1I4EB 2DQKA 3Q72A 4L9AA 4J7UA 4EJ6A 4MIEA 1OX6A 4ISBA 4YJGB 1JR6A 4CRWB 1GQSA 2R6FA 5B1YA 3RC2A 1MB0A 3IEKA 5B55A 4DCGA 4R1MA 4BDTA 1GTVA 2ZBEA 5E7JA 4HDRB 1FMJA 1ST3A 3U4QA 2QAGA 5AM4A 1YO6A 3NAZA 4XWKA 2XRZA 2C9CA 4PIVA 2AOXA 1R6DA 1U90A 1IQ0A 3VPSA 4BVKA 1S3GA 2A58A 4R68A 4MK4A 4RJ2A 2WY2D 3SZMA 4RKEA 2CJYA 3DULA 4UE2A 3AB8A 1SU4A 3DXXA 2VNAA 5DMHA 2Z04A 3SIWA 5FJJA 2HCJB 4BASA 5K3OA 3KS9A 2BHLA 2FZCA 3Q7SA 2XUPA 1Z3IX 2BEWA 2QD2A 4EVIA 1A9RA 1Y5MA 5JQWA 5CBPB 3QP9A 5KOIA 3F47A 4ARVA 1ABBA 4DVGA 3QEBZ 3PR2B 3SFTA 4UNNA 1XX6A 2Z2IA 3GROA 3PQ5A 1LPOA 3D4PA 4R9RA 4V1CB 1Y9DA 2JDID 1SELA 1DC7A 1ZOSA 3LBAA 1QX4A 4II7A 4AJHA 3KU4A 4KPFC 3RS2A 2QYSA 5TQJA 4L85A 2A92A 5LP6B 4PONA 1GR1A 5K2MA 16PKA 3KSDO 5C1IA 2ID8A 3OTWA 1NG9A 4G1BA 1RI5A 3VPHA 1Q11A 3M89A 1DIGA 1NNI1 4LXTA 2YNMD 3BSWA 4B76A 1U2TA 2ZSHA 1WRBA 2VP4A 1DX4A 4LFCB 3AP2A 2GAJA 3MQ4A 1X7GA 3NCHA 1KEUA 2FPPB 2H85A 4Z3DA 1R6BX 4NBKA 3UMGA 4DV6B 1U99A 1TJNA 1MC5A 2Z5VA 2YWDA 4JHLA 1H2ZA 4FDVA 3ADDA 2JDIA 2M2IA 3EZGA 4Q39A 5JZOA 1AGNA 1JJAA 1I51A 4Y18A 3U16A 2IEYA 1XJQA 2QTZA 3FVVA 1XTVA 4F2PA 4QDXA 5EE5B 1IN5A 2GF0A 4B43A 1EI9A 1VXRA 1HDGO 2GBLC 2YNMA 1P19A 4N54A 2XMQA 3GT4A 5AXDA 4YQEA 4WOCA 1I3NA 5JNWA 4M98A 1KAEA 3SY8A 5BSHA 4IV5A 4L2IB 4M7WA 1KWKA 4QPDA 1QFSA 5JG7A 1RHJA 1B8UA 3SBDA 1A9QA 3FVWA 4M0MA 1QONA 2X2EA 2H7VA 1SIOA 3WK6A 3AVUA 1E20A 2OBMA 2YS6A 3F8WA 3USCS 2CNLA 1KE1A 4DBZA 1JHZA 4GRIA 2LCQA 4FOOA 5AVWA 3EFHA 1SKBA 3NHZA 4DLKA 5U9CA 1IMJA 1U7ZA 3RVMA 1RLUA 3O9VA 1NI5A 4U2GA 1RDFA 4ECAA 2DPLA 4IIGA 1EZZA 4BKRA 2R86A 3GBPA 2DUWA 1BGWA 1G21B 1QLHA 2XDYA 3LVBA 2BJHA 1XD8A 4INPA 3KEFA 2GD0A 3H5IA 4QUHA 1W4LA 4BQIA 2QZZA 3DL7A 2XTZA 2JHAA 2ST1A 2JAOA 5FA8A 4FYJA