4ZGWA

Short-chain dehydrogenase/reductase from serratia marcescens bcrc 10948
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
245
structure length
245
Chain Sequence
HPLQGKVAFVQGGSRGIGAAIVKRLASEGAAVAFTYAASADRAEAVASAVTTAGGKVLAIKADSADAAALQQAVRQAVSHFGNLDILVNNAGVFTLGGTEELALDDLDRMLAVNVRSVFVASQEAARHMNDGGRIIHIGSTNAERVPFGGAAVYAMSKSALVGLTKGMARDLGPRSITVNNVQPGPVDTEMNPDAGEFADQLKQLMAIGRYGKDEEIAGFVAYLAGPQAGYITGASLSIDGGFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords short-chain dehydrogenase/reductase
publication title Stereoselective synthesis of (R)-phenylephrine using recombinant Escherichia coli cells expressing a novel short-chain dehydrogenase/reductase gene from Serratia marcescens BCRC 10948
rcsb
source organism Serratia marcescens
total genus 89
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zgwA00
2WYWA 5DCWA 2Q2VA 1QYCA 1B14A 4DC0A 3E5MA 1P31A 3RFTA 1ISIA 4UUNA 5IXYA 1ENOA 4YAEA 4IXWA 2X7HA 4W7HA 5CAEA 4BKPA 1T4BA 5KJEA 3WLEA 4FOOA 1QLHA 1D1TA 3FF4A 4GAEA 3U0BA 1ADFA 4BKOA 3WGHA 2VTEA 5AXBA 2NQ8A 3AK4A 1NAHA 3N58A 4DA9A 3OETA 3VPSA 3E8XA 4RVSA 3ZNPA 1QV6A 4U0KA 3VVCA 1P1KA 3QVSA 3G49A 3ADPA 2DQ4A 1R15A 2Y1DA 2V6MA 4I1IA 4FD3A 3PLNA 4BNKA 3MJ4A 5IDXA 3PQEA 3WBBA 1SAYA 5KVVA 4CMBA 1LDEA 1X0VA 3EW7A 3NDRA 1SEPA 3QWBA 4J16A 4XCVA 5I7FA 4ZHSA 1I3NA 2GYYA 2Z5LA 4FR5A 2V6BA 2JD2A 4FFLA 5EL0A 3VZSA 3F9IA 1E3LA 3K92A 4J2HA 1XHLA 4P4NA 3FBGA 1GDHA 2VYNA 4NDNE 4MVJF 5L4SA 2A4KA 4RZHA 1VSUA 2NVWA 4ID9A 4WEOA 4YAJA 4PLFA 1VSVA 3GVCA 2Q99A 4MVJM 2OXIA 4IXTA 2DT5A 4LK3A 1ZK0A 1DHTA 2EGGA 4JP3A 4E5NA 1BXZA 2EKQA 3L77A 2C5EA 1ZIDA 2EF1A 1QYDA 5BSHA 2YV2A 4BNMA 1AHHA 1E7QA 4RVHA 3D0OA 3WGTA 4PCVA 2Y1FA 4CMKA 4LSMA 3S2GA 4RF5A 4KQWA 1I2CA 2Q1TA 3AFMA 5I9NA 5F5LA 3VDQA 3ZV3A 3BMCA 1HE3A 3NT5A 4IZIA 4UVGA 3ANLA 1KY4A 1UP6A 3RUHA 2J5QA 5IN5A 3BHJA 2D3TA 3LF2A 5ER6A 1H6BA 5FYDA 3VC7A 4EJ0A 4ZQBA 2O7QA 3DBLB 4J0FA 2PLAA 4CM4A 4XIJA 5JBIA 2F1KA 3JQ8A 2JHFA 3JQ6A 4R1SA 4D46A 2X5OA 1UXHA 2UUPA 3PK0A 5T8KA 2JFGA 1QSGA 3TRIA 1NVTA 4DMLA 3DAFA 4OXKA 4A7PA 4CM9A 1P1RA 4JBIA 1JKFA 4N5NA 4UVEA 4B4VA 1V0JA 1ZEJA 4CMCA 3L0DA 3WBFA 1IYZA 1IHXA 1I30A 2OBNA 4XQ9A 1O9BA 3SLKA 1E5LA 1ULSA 2QIOA 4PZDA 4TROA 4P4LA 3GNSA 4B4WA 2VOJA 1LSOA 4CQMA 3SBOA 1P74A 3AY7A 4PLGA 1GZ6A 1HDXA 2FOIA 4E12A 5CDUA 3NTOA 1YKFA 2GGSA 3GPDG 2GN4A 2HJSA 4DRYA 1ZSYA 4J49A 5HWSA 3AY3A 3PDJA 1ZCJA 3LLSA 1BTOA 3QW2A 1AXEA 2AEJA 1KVSA 1M67A 2X5KO 3W4KA 2IRWA 3PDUA 1WZIA 3TL3A 3NDJA 4ITUA 5B4UA 2Q45A 3AUAA 5EJ2A 1X7GA 1O5IA 2GN9A 2FRDA 3F4BA 3DOJA 3TZCA 3ZU5A 1DC6A 3V1TC 4BO8A 1ADBA 4YT8A 2H5LA 3WQSB 3AI3A 2P9GA 4R54A 4D7AA 3AI1A 4XYMA 1MA0A 1NNUA 3WTBA 1X1EA 3GDGA 3LQFA 5A3VA 5H81A 1NQOA 3A28A 1M2WA 1DIHA 5DCYA 3A06A 3QSGA 2B69A 1DFHA 4D0RA 1B2LA 4UVIA 6ADHA 2I99A 3KYCB 4IDCA 4RLSA 1O0SA 2CF6A 4CM1A 1Z45A 1DSSG 1HETA 3ZH2A 3H5NA 5JDCC 4KWHA 4TQGA 4AJOA 2XAAA 4ZQGA 3FWNA 3EYWA 2WJPA 1RPNA 1E6UA 2O3RA 1Y8QA 4GMGA 1KEWA 1R37A 3U09A 4RVGA 4UULA 2VT2A 1E3JA 4TRJA 1KVTA 5G2OA 4O59O 1RM4A 4MPDA 4AICA 4NIMA 3GZNB 5A05A 3ZN2A 5DOZA 3JD3A 2EKLA 3CSDA 1U7TA 4QUKA 1Q7GA 1S7CA 1YDWA 2I65A 1GAEO 1M6WA 2QQ5A 2BF7A 2VQ3A 2VHVA 3WICA 2B83A 4BNTA 4WLEA 4F46A 3LT2A 4I5FA 4GI2A 3JQFC 2PGJA 4B4OA 5C3MA 1UZLA 1PJQA 2D2IA 4OYRA 1ENYA 2JFFA 1WLYA 3ZCXA 3PHIA 3VPXA 3GRKA 4II3A 2ZCUA 3EDMA 4FFRA 4PLWA 1YBMA 2OMEA 3R3JA 1D4FA 5HM8A 2AW5A 2WD7B 3AW9A 4FFMA 1C1XA 4J1SA 4PG4A 1E1LA 5TJ9A 3W4IA 4W99A 2HK9A 1DLIA 4OQYA 2C2YA 3FPLA 2QRKA 3D3WA 1DEHA 5LC1A 3UW3A 1LBEA 1GUZA 2Y67A 4NZ9A 1H2HA 3ZWYA 2O3UA 2H63A 1H6CA 4W82A 2HMTA 4QEDA 4Q3EA 4CLXA 5B1YA 3IL2A 1BW9B 1NR7A 3H8VA 3ZWWA 1TA4A 1CERA 3FTNA 4QTZA 2GF2A 4U5QA 4J6FA 5G0VA 2VT3A 5F1OA 4U0JA 2VRCD 4BNHA 2HRBA 3L6EA 1NWCA 1RWBA 3MJTA 2GLXA 3P2YA 4YDRA 1DDOA 5F21A 4YBZA 4PFJA 3VHRA 4R16A 3L4SO 2JD0A 4DGSA 2Q2QA 1YBVA 4CM8B 3UAGA 1OI7A 1FK8A 4UUOA 3ZNQA 5CEJA 5BNTA 4TMFA 4IJUA 2V7PA 1NVMB 2VZ9A 4UEOA 5I7SA 3S8MA 1P1HA 3HG7A 1DIAA 4DIOA 4KOAA 3JQGB 4WECA 3RROA 1L7EA 3WMXA 1K89A 1PS9A 2J3IA 4G2NA 4RPHA 3LU1A 3QWIA 4UUPA 2X1HA 2ZATA 1UH5A 4XGNA 4D41A 3KEOA 5IFLA 3DC2A 4BV9A 1YQGA 1ZZEA 4ZN6A 3DAPA 1EUCA 3BMQA 1V3UA 3SX2A 4IGFA 2W8ZA 3U62A 2DVMA 4CLRA 1RM5A 3KYDB 4I9HA 2BLLA 2ZTLA 4URFA 3WGZA 4XX0A 4CLHA 1LLCA 4IGEA 1DBVO 4IINA 5TIIA 4PRLA 4XWYA 3OJEA 2JD1A 1JA9A 3KO8A 3NT2A 4FFNA 3C1OA 2Q1UA 2FWMX 3A9WA 3Q0EA 4O5OA 4OMUA 4YXFA 4BMNA 1JU9A 4M49A 3PXXA 1FXSA 4NJMA 1MP0A 2BKAA 1D7OA 1CQIA 1B7GO 2ILTA 2Q46A 5IDWA 1LX6A 4GX5A 1B15A 1X7DA 1NAIA 1GY8A 2PH5A 2VWHA 3F1KA 2XXJA 5HS6A 4YJFB 4R3WA 3ONEA 5IG2A 4QFDA 1AN9A 2EXXA 4HADA 4J9VA 3OIDA 1IL0A 4TRNA 4XYGA 1B3BA 3ZNNA 4BNZA 3EAGA 3I3OA 3JQBC 3OJ0A 3I5MA 4EITA 4BNYA 5ILGA 4E5PA 4DYVA 2E82A 1O89A 1PZEA 1Q0LA 3H9UA 3WGYA 2W2LD 4GX1A 1HRDA 1CQJA 1MGOA 4O1MA 4K9DA 3EY4A 4W9NC 1ZMTA 1Y7TA 4E21A 3GGOA 4UUMA 5JYEA 1KY5A 3I9MA 4HNGA 4GGOA 2C20A 2ZK7A 3INGA 1HLDA 4E5KA 1K0UA 1N1EA 3V2GA 1P0FA 2HK8A 2ZKLA 3IQDB 2ZIZA 1EK6A 3HDYA 3HNPA 4BV8A 3H2SA 5KJFA 1H9BA 1IULA 1XYGA 1PR3A 4W7IA 4M55A 3RC9A 1WP4A 4DIBA 1ENPA 4BNVA 1NR1A 1DJQA 3VH4A 2JAHA 5ITVA 1WXDA 3EZYA 2Q1WA 4PN3A 4YAIA 4HFMA 4IZHA 4B7XA 1T24A 1ZVMA 1VE9A 3WXBA 3PIDA 3PTZA 2BD0A 4LMRA 1YWGO 3NGLA 4R51A 1YL6A 3A1NA 1R12A 2EV9A 3EGOA 4N54A 4QT0A 3V5NA 1Y5MA 1F8GA 3TWOA 4YWJA 4K6CA 4RZIA 4WK6A 3QA9A 2FZWA 3VH1A 4ALMA 4AJEA 2WWRA 2VRBA 4IQGA 4O0LA 5TC4A 2YDYA 3IIEA 4BNNA 1HDZA 4BVAA 4LCJA 2J5RA 5TJHA 3WS7A 5JAMA 3FNHA 3WMWA 3ORFA 3WJ7A 3WYEA 2C7GA 2D4AA 3QY9A 4TVBA 4UREA 1DAPA 2HMSA 3FN4A 4Z6KA 1RKXA 3GG2A 3RFVA 3D5TA 3DZIA 4MP3A 4J0EA 3OEWA 4NK4A 1EDOA 5JSFA 1B26A 4MO2A 4CMJA 1I2BA 1W0CA 1LRJA 1M66A 3FR7A 3RJ5A 1CEQA 1B8PA 5G4KA 3CEAA 2Q50A 5F1KA 2NLOA 3UGKA 3KHUA 1EUZA 3P7MA 1ZK1A 3PQDA 3NTRA 3VAZA 3GNTA 1ONOA 3TZKA 3CTMA 5CEFA 4FDAA 1CF2O 2J3KA 4H16A 3DZJA 1Y8RA 4A2CA 1MFPA 4UVHA 1GQQA 2IEBA 1LA2A 1EUDA 3OQ6A 1HE2A 3G3EA 3LT1A 5B12A 3C85A 3KLMX 3R6DA 4MVJP 3RUCA 5KTKA 5TX7A 3RBXA 1P44A 4E3ZA 2P4QA 3E6AA 4QO8A 4KTTE 1YOVA 1XCBA 3UCXA 2OFPA 1PGNA 2NWQA 5KOIA 2J6IA 3KETA 1TT5A 1GV1A 1SZJG 5ITWA 4GKBA 3W1VA 2DM6A 2FR1A 4ESOA 2WMDA 1SEVA 4FB5A 4ZGWA 2W90A 4Z9FA 3GF4A 2JHGA 2IYPA 3F5SA 5A03A 4KTVE 7ADHA 1DIRA 2C59A 4ILKA 3PHJA 4BS9A 3WIDA 1WDKA 1BHSA 5KVQA 2WM3A 3JQ9A 3N7UA 4D3DA 1EQ2A 5IN4A 5JC1A 4UEKA 2Q3EA 4HKTA 2FPPA 4GPD1 1M6HA 1XLTA 3AOGA 1LSJA 3QHAA 4N5MA 1U9JA 5CFZA 1PS8A 5JW6A 4YB8A 1LSSA 4Y98A 2YHIB 3P2OA 2HO5A 3DONA 2JFHA 2EWMA 2V65A 3I9KA 3D3EA 4YJHA 4HY3A 2RHRA 4CV1A 2QZZA 1X14A 2VYVA 4DC1A 4K1LA 1U2DA 2B36A 3UCEA 4JJGA 1K6IA 4BGEA 4D0SA 1VC2A 1XEAA 2CDAA 3DZBA 2VWGA 4R4JA 3E1KA 1DO8A 2PV7A 1JW9B 4ND5A 1ML3A 4L9RA 2FHSA 2AQ8A 4MKZA 1WMBA 3AU9A 4Y9DA 2GCGA 1PGQA 2Q4EA 1DJNA 2H6EA 2R00A 3NUGA 4D3SA 3ICPA 5L51A 2EJVA 1E0DA 3GY0A 1Q7CA 4M89A 2CVOA 1I8TA 1QP8A 3VKUA 5KKCA 3UHAA 1EK5A 2Z1NA 5IJZA 3KYBA 4EZBA 4L73A 2C29D 3OECA 3VZQA 3DTTA 2DBRA 3IC5A 4FIZA 2BI8A 4BQPA 1EE2A 3G0OA 3LVFO 1IUKA 1W4ZA 3PP8A 2IZ0A 1WAMA 3GT0A 4JCOA 1LU9A 4I9NA 5DF1A 3WR5A 3S2IA 1PS0A 1IHYA 5FI5A 2DTEA 3WGGA 3HADA 2HQ1A 1I3KA 1YL5A 2DPGA 3JQDA 3OIGA 4CM7A 1PL8A 3EUWA 1QV7A 1LQUA 1LJ8A 1BVRA 3LF1A 3RUDA 4Q3CA 1E6WA 2BH9A 4NFYA 2PY6A 2Q1SA 4XRGA 1SC6A 3PI7A 4J3FA 1LNQA 2RH4A 1GFSA 4LW8A 3VTFA 3BTOA 1PJCA 1WZEA 4OL9A 1VKNA 1NTOA 2HDHA 5JCXA 1DPGA 1XU9A 3IUSA 4R5MA 4CMEA 2VYND 4OM8A 3DOCA 4B8WA 2CVZA 4YR9A 4PLYA 2O2YA 4XDZA 2RCYA 3W8DA 4F45A 3DO5A 2VNAA 3NGXA 4OIMA 5JPIA 4BQRA 1UP7A 3CZRA 3D4NA 4RVDA 4DBVO 3MZ0A 2GSDA 4E6PA 3DBLA 4GLLA 4BKUA 2XPCA 3JQ9C 1BMDA 2UDPA 4FC7A 1X13A 4BNUA 5JC8A 2NU9A 3DEYX 1PGPA 4GLOA 4LSWA 3TZQA 3R1IA 1HYEA 1GQ2A 2Y0DA 3W4JA 2O3SA 3U4DA 5T67A 2HJRA 1TVEA 1LC3A 4NI5A 4OKIA 1N7HA 3HUDA 2CD9A 3WG9A 4BO6A 1ISFA 1KVQA 4NJOA 4ZD6A 3WJAA 5TLSA 1PU2A 1DB3A 2WTBA 1MUUA 3O26A 4ALJA 1LC0A 1CRWG 3RC2A 5KVCA 3SVTA 2PZMA 1ZFNA 2VOEA 5HTOA 3C7DB 4Z9YA 3RQSA 1R16A 4AG3A 4A0SA 3T7CA 4WLUA 4A73A 4FSHA 4KDFA 3HB5X 4CM9D 4WE3A 3WQRA 1YL7A 3JYOA 1UXIA 3I6QA 1KIFA 1VLLA 4BO1A 1E1KA 3RIHA 3MOGA 4FJ0A 3PQFA 5KJ1A 3CIFA 2P9CA 1QRRA 5FFFA 1Y5RA 1HF3A 3PYMA 1LLQA 1ISJA 1XA0A 2POQX 1ZJZA 3DBVO 4O63O 5THKA 3RUAA 5JNLA 4PG5A 3ZWAA 4CQMD 2XF8A 5CDGA 3KBOA 5F5NA 3AUSA 4RDHA 3A14A 1JKIA 1K5HA 2V6FA 3PLRA 9LDTA 4XYLA 3JQAB 4RLHA 3GN1A 2B4QA 4PIVA 3K73O 5DNAA 5JYDA 4PLPA 1ZKMA 3ZGYA 3A4VA 1P33A 3BXXA 4NHEA 1VL6A 3JQ7A 1W73A 3B1KA 4Z9XA 3H65A 3RD5A 3KYCA 1DC5A 3BZUA 2YV3A 4IQ8A 4NBVA 2JCYA 3DBRB 4TVOA 5C7OO 2FZEA 2BFOA 4JGBA 5JY1A 3CUKA 5BNFA 3RBVA 2ZCVA 2E49A 4F6LA 3ONDA 3ZWXA 3SJ7A 1PJLA 2I9PA 4R1NA 1YXMA 3QVXA 2VUUA 3L07A 4GL4A 4DLBA 3OEYA 3UVEA 3CKYA 3STHA 2D5CA 3WWZA 2NVBA 3GZNA 4P8RA 1D1SA 3TFOA 4JK3A 2P4HX 3SJUA 1GU7A 1E3WB 1MXHA 2ZB8A 2Y1OA 4WCDA 3ZW8A 3S1LA 4FGSA 4JROA 3ETDA 5IZCA 4LMPA 1Y1PA 4JQCA 4DIFA 3PVZA 3OQBA 4IBOA 3UF0A 2YZ7A 4CR6A 1A9ZA 2A94A 5DT9A 4B3HA 2X0RA 1V3TA 1GYQA 1ZK4A 3RI3A 2DTXA 2TMDA 1P9LA 3ZHZA 2FSSA 4D79A 4S3MA 1N8KA 1XKQA 4KUGA 5A9SB 2WD7A 2C0CA 2YQ4A 3KM0A 2P68A 3PPIA 4GSKA 3OF2A 3TFQA 3GH3A 3JQEA 3HDQA 4EUHA 1DXYA 5L53A 2UYYA 2VN8A 2GPTA 1PJTA 4BO7A 5IZ4A 3FSRA 1NM5A 1KVUA 2CMDA 2EW2A 2GR9A 4FQ8A 2VWPA 1W6UA 3AM4A 4I08A 3WOHA 2AE2A 4OH1A 1ZNQO 1GUYA 1IPEA 1SOWA 4IMPA 1BXKA 4G81A 4ZQEA 1IZ9A 2DBZA 4A26A 3ZV4A 2VHWA 1KBZA 4NK5A 2Q4BA 2QRLA 3DDNA 1VL0A 2WSBA 4XB1A 2NU8A 3DXFA 1YE3A 5JXWA 4J4HA 5C7LO 1FJHA 1BDBA 1JLLA 4FGWA 2GERA 4IIVA 2AQIA 2NVUB 3GR6A 3JYLA 1YJ8A 2JCXA 1UUFA 2AEFA 2E6UX 1GUFA 2C7VA 2DC1A 1EVJA 2XXBA 4CLEA 3MJSA 4CM8A 3B1FA 3INTA 3CPSA 1U4SA 4YT2A 2GN6A 3PJEA 4D45A 2BFMA 1Z75A 2A35A 2NM0A 4YACA 3WNVA 1E7MA 2DBQA 2ET6A 1HE5A 1YQXA 1G0OA 3AM5A 3JQCA 3E18A 4U8GA 5DCUA 4NBWA 1Z74A 3JQGA 2X23A 3FCOA 3OJFA 4BO9A 1NPDA 1OAAA 4QXMA 5JO0A 4FJ2A 4GBJA 1U7HA 2UUOA 3QWAA 5CDYA 1KVRA 4ROSA 1GPJA 2R2GA 3MJEA 3JSAA 3LSYA 2DTDA 4NG5A 4EBFA 1FDSA 4IPTA 1PJSA 1XG5A 2LDXA 4LCEA 3K2BA 5IZCC 4CLOA 3KYDA 1PR9A 4CR7A 4KWIA 2CFCA 4AJHA 1D3AA 3MWEB 3RUIA 4BNXA 3NYWA 4XR9A 1OC2A 4DWVA 3L9WA 4MINA 4TKMA 4EYEA 1JQBA 2B4TO 3HSKA 1JDJA 1K3TA 3OQ1A 4CMAA 4MP8A 3MJVA 2JAPA 4IJKA 3BHMA 3PFWO 1I10A 3HQ4O 4WOJA 2GO1A 2I66A 3VZPA 1WVGA 4YJFA 1VRWA 1A4UA 4ZVVA 3UN1A 5A04A 2YW9A 4JJIA 1HEUA 5EINA 5AOVA 1PJ3A 4BO2A 2A92A 3AY6A 1T2EA 1ID1A 3DZGA 1UXJA 4FC6A 3RVDA 3OH8A 4YJGB 3ZWCA 5T8KC 4ND2A 2CUKA 1BRMA 1NXQA 3RU7A 4E5MA 1OBFO 4FN4A 2ZQZA 3D4OA 3UOGA 2X9GA 4YEDA 1LRKA 4DL9A 5L45A 3PHGA 4JBGA 4CODB 1A4IA 2AEMA 1ZSVA 3AJRA 4J1TA 2O23A 4XIYA 4GQAA 2D59A 5KIAA 1X1TA 5T6BA 1GTMA 1N92A 3QQPA 3ROMA 1PZHA 1I01A 3Q9NA 4XA8A 4ND4A 3AWDA 3BMNB 3TDKA 1U3WA 2PWZA 2NACA 4U7WA 3WQQA 1BSVA 4BOYA 2I67A 4NMHA 4WLOA 1LUAA 5IDYA 3EMKA 1QMGA 1QLJA 1V35A 1PJ4A 4L4XA 1XR3A 1E7YA 1ZXLA 2PR2A 1DHRA 1K2WA 4RORA 3GN2A 1U3UA 1CJCA 1Y81A 2FP4A 3PWKA 5JCJA 3UUWA 4DTIA 1LEHA 1UZMA 4L75A 2HMWA 4Q3DA 5A5EA 3GPIA 3OP4A 3ZWPA 4IQ0A 3V2HA 4ZJUA 5I7EA 1E7WA 4NFHA 2RBEA 1JWAB 2V6GA 5GMOA 4NPCA 3GDOA 4IJVA 4NFSA 5FWNA 1IPFA 4XQGA 2DKNA 4YCAA 3WYCA 1ADCA 2D8AA 3FRJA 4WEQA 3MWDB 3TOXA 1VI2A 4CM4B 1VJ0A 4K28A 2HUNA 3JQ8B 3JYQA 4QFCA 4CV0A 4L8VA 1C0KA 5J23A 3UFXA 1PEDA 2Y99A 3DHYA 2P2SA 4ALKA 4BNWA 4HX5A 3FNEA 4EUFA 3WWYA 5IXSA 3ASUA 1EFLA 2HCTA 5EESA 1FF9A 1Q0QA 3D64A 2AG8A 1U28A 4MIOA 2VHZA 3OHSX 1SPXA 3TJRA 1GYPA 3GAFA 4C7KA 4OXNA 5BSEA 1WW8A 2ZB3A 1LTHR 2VUTA 3FNGA 5G4LA 2Y93A 4MVJG 4MIEA 3C7CB 1C1DB 2ZTMA 3KUXA 2QRJA 3GFBA 3F5QA 1PQWA 1C0IA 2ZQYA 3DWFA 4HUJA 8ADHA 2W4QA 1HDYA 2PNFA 3VOSA 4FFPA 2GDZA 1KEUA 1ZEMA 5B37A 5IDQA 4MOWA 5CPFA 4E13A 3PWZA 3HE3A 3KEQA 3UH1A 1T2AA 1N1GA 2HMUA 3IP1A 2O4UX 5C37A 3DMYA 9LDBA 1YB5A 4KUHA 4R01A 2BGKA 4ZA2A 4DBZA 5TRTA 3S55A 4AJKA 3LLVA 3I1JA 4FOSA 1MXFA 1MC5A 4WOKA 3NJ4A 4BGUA 5LDHA 4RDIA 1KC3A 4WNIA 3CINA 4PG8A 1LDGA 3I52A 2VUSA 1GL3A 4INAA 1PL6A 1WNTA 8LDHA 3C24A 5L9AA 5JO9A 1RYDA 1YS4A 2NTJA 2IDZA 3G1TA 4HNHA 4R69A 2BHLA 4MDHA 3I9LA 3DR3A 1KYQA 4R5HA 1Y9EA 2OP0A 1DIBA 2O3TA 4PGFA 5I8WA 3FBTA 4E2XA 2AE1A 2PZJA 2DUWA 4F6CA 1MV8A 4PVDA 2OHXA 5FI3A 1BXGB 1IY8A 1NFRA 1SNYA 4Q3NA 3U49A 2C07A 3O8QB 4BMSA 1TXGA 2G5CA 3NAQA 2GUGA 1E6EA 3QIVA 5CP8A 2G82A 3WSVA 5FF9A 1DFIA 4B3JA 4WCFA 1U8FO 1ZO8A 5AQ1A 2RAFA 3H9EO 3PGJA 2NTVA 3PZBA 5DBFA 1UR5A 5CG2A 3EC7A 3I9NA 3NEPX 1DC4A 5DOVA 5U9CA 1DRVA 1R66A 2VHXA 2O50A 1QG6A 2VYVD 5EMHA 3X2EA 3ROPA 1E92A 3GAZA 5BSFA 3W8EA 3ICCA 2O4CA 2X8LA 4DMMA 4XEHA 3EZLA 1GQYA 1BVUA 2JKVA 5A9TA 1F12A 3IAHA 2P9EA 5HA5A 2PTGA 4EJ6A 1J5PA 3KSUA 3P19A 1DC3A 1ULUA 2BFAA 5CDTA 5I7VA 3BA1A 2NADA 3ETEA 2G76A 3SLGA 3M2PA 3SXPA 4TRMA 5DDIP 5TS3A 2NTNA 1GCOA 3AUUA 4MVJA 3ON5A 4H3VA 4KMSA 1R4MB 1UJMA 1ZSNA 4XD2A 4YQYA 1B8UA 4E30A 3EHEA 1NQ5A 3D3WB 4RF4A 4CV3A 3K2EA 4B3IA 4ZU3A 3ITDA 4XZ3A 3NX4A 4N18A 5DP2A 1S6YA 1A72A 2EIHA 4RPKA 5G0WA 1C14A 2CF5A 3DTYA 3F6YA 4TKLA 4F3YA 3ZI0A 4W6ZA 5JFOA 1NHWA 1ZMOA 4WKGA 4HBGA 2FPGA 2OORA 1E1NA 1UDBA 4B7CA 4FS3A 3UCFA 4ZICA 1JWBB 5C5IA 2HAEA 4FPXA 4RL6A 3GMDA 2X9VA 4PLTA 3NTQA 4ZQHA 2ZTUA 3GVPA 2OGUA 2E48A 3FNFA 5L95A 3U5TA 4Q9NA 2ZB7A 1HLPA 1V6AA 2IEDA 4EJMA 3GLQA 4MVJH 2Q2WA 1AHIA 3D1LA 3DOOA 4AJNA 3HN7A 4EI2A 4EUEA 4BO4A 4HP8A 2AMFA 3GQVA 3RU9A 4AJ4A 4BNJA 3H9GA 4XYBA 1OFGA 2B5WA 2IZZA 2VZ8A 1B16A 3KB6A 4WCFC 3NV9A 4LN1A 4BNIA 1T2FA 4I9UA 3OJLA 4YT4A 1I36A 2C2XA 5JLAA 1F06A 1F17A 2FR8A 1HSZA 4LGVA 5H83A 2E4AA 1QYVA 5IAAA 4D42A 5ENVA 4CUKA 4OSPA 3DFUA 3QP9A 2Y0CA 3HDHA 1H9AA 1A9YA 2DLDA 4L74A 3SC6A 2O7SA 3VPFA 1YQDA 3PGXA 3VPHA 3ZWMA 4WPGA 1R4NB 1ONPA 2P91A 4Y8VA 3B20A 1H6AA 3BTSA 4J7XA 1AUPA 2IE0A 5TSDA 3H4VA 4M86A 2P5UA 4QQRA 4YRDA 5L4LA 3RSHA 3JQAA 1YB1A 1ZH8A 2NU6A 4GWKA 1P3DA 2WEKA 2VTDA 1J0XO 5BNIA 3I4FA 4WJZA 1YH3A 4IMRA 2YHUA 5HRUA 2I3GA 4PG6A 1PIWA 4BNFA 3ZWBA 1NQTA 4KP7A 4NU5A 2ZYDA 1HSOA 4CLDA 5KVSA 1XIVA 1JVBA 4OOFA 4KUEA 3RC7A 5AXCA 3WDSA 4C4OA 2Y1EA 3DBRA 4GH5A 4JX8A 4D3FA 1OZAA 1QORA 4J43A 5G0SA 4WLFA 2NU7A 4OKNA 4RQUA 1I3MA 1TLTA 2FY8A 1UXKA 4KQXA 1UXGA 3ZWOA 2GD1O 4Q39A 4CQLB 1MX3A 1FDUA 4XRRA 1GR0A 3IOYA 4I8XA 3QVOA 4YAKA 3LT4A 4L0QA 2X4GA 4PVCA 4NH4A 2GZ3A 1E3WA 1SCUA 2IZ1A 4XJSA 5B4TA 3OBBA 1P1IA 4Z0TA 1HDRA 4JXKA 4CMGA 3OICA 5KWEA 1P45A 1DLJA 3NT4A 4ND3A 3M1LA 1MC4A 1UDCA 1ZW1A 1I0ZA 5AYVA 4J9UE 4ALLA 2NUAA 2QZ9A 3K31A 5THQA 4M1QA 4A27A 1UDAA 4LISA 3S2FA 4LVUA 3IDSA 3B1JA 4R41A 3WX0A 4EEXA 2Y0EA 4LRTB 3QWFA 3KLPX 4GGPA 4OO3A 4IIUA 4L4RA 2G17A 2OL4A 3K5PA 2CDCA 5DZSA 4E32A 4IS3A 4DQXA 3C1AA 3E82A 1QYXA 4D44A 2YDXA 1NFFA 5CPBA 3F3SA 4KDEA 3JTMA 3TZ6A 3Q2KA 1X7HA 3ZWVA 3ZW9A 1GCUA 4NBRA 3DBHB 1XDWA 5EQFA 1E5QA 3KVOA 4ZRMA 4E2WA 4Q3BA 1NPTO 1PX0A 2HKIA 2QYSA 4CMIB 1J4AA 3OMLA 3WYBA 1B3RA 4EEZA 1O95A 1ADGA 1UP4A 4JNKA 1ZK2A 5ICSA 5JE8A 3MCVA 2NVUA 3B6ZA 1U5CA 3T4XA 1MFZA 3TQHA 3OM9A 2BFPA 1U3VA 2X58A 3Q6IA 3IS3A 2PD6A 5CDSA 1EDZA 2I3AA 4DQUA 2R00C 2E37A 1NYTA 4YA6A 5JDIA 4A03A 5COBA 1E7RA 4CPDA 1EFKA 4WNCA 1ISGA 4Q3AA 2R6JA 2QHXA 1H6DA 2W2KB 2DAPA 3D5QA 1NASA 4ZQFA 2B5VA 4AFNA 4DXHA 1Q1NA 2HSDA 4J4BA 4Z0HO 4R1UA 3VDRA 2OUIA 1EQUA 1VJ1A 3D4PA 3QVWA 4IDGA 3Q2IA 4NU6A 3ZZNA 1ONNA 3OJOA 1TEHA 4HFJA 4B79A 3QLJA 1ZBQA 2AA3A 2RHCA 4XGKA 2B0JA 4BMVA 4J90A 3WTCA 1CWUA 1F0YA 2HMVA 2RIRA 5H82A 3BHIA 1EZ4A 3T7EA 1A5ZA 1LXCA 1I2ZA 3JD1A 3KV3O 4QO7A 2WDZA 3ZHXA 3U4HA 1DFGA 1PGJA 2BGMA 3TL2A 5GZ1A 3OFSA 2VZ0A 2O3QA 5L7TA 1A71A 4CM6A 1KETA 1VL8A 4J4TA 2DBVO 5DBGA 1HYHA 1LDBA 3R3SA 4K26A 3ULKA 4ALIA 5CEEA 1H94A 4CMEC 2BMAA 1ARZA 2JJYA 4RF2A 1R0SA 2P5YA 1RYEA 1YONA 3H3FA 3O4RA 1UAYA 4YT5A 2BGLA 4Y6RA 4QSMA 4YJHB 3ANMA 3GFGA 4XGIA 4DPMA 2B35A 2AHRA 4MIYA 3I4CA 3VVBA 3HB4X 1PZFA 1KEPA 4NBUA 2YQ5A 3ZU2A 1CYDA 3KZVA 1KC1A 4FFOA 1JTVA 1KERA 4YJGA 1XELA 1O8CA 1Y9AA 4YYZA 4XJTA 4B4UA 5EN4A 4S1VA 3RUEA 5K9ZA 5K6AA 4BHTA 3C1TA 3WFIA 1EMDA 4GSLA 1ZK3A 2DU8A 1HYGA 2GZ1A 2JL1A 3HN2A 1TI7A 1N2SA 4J7CA 4FW8A 1C0PA 4Y6SA 2Z1MA 2O48X 2C54A 4J91A 1BWSA 1Z6ZA 1N9GB 3BMNA 1SMKA 3TZHA 5EIOA 5IF3A 4YAGA 5JDIC 4B8ZA 4UAGA 1WMAA 4E4YA 1LRLA 1XGKA 1ZUD1 3LT0A 5FEUA 4TZTA 4R68A 3L4BA 2X86A 5ICMA 1NWHA 3H9QA 3JD4A 3EVNA 3ZU3A 4EW6A 2PZLA 4XYEA 1HDCA 3GG9A 3DZFA 4HFRA 1U4OA 1HT0A 3ADOA 3ETGA 1VM6A 2GZ2A 1C0LA 3WGQA 3BAZA 5TQVA 4YRBA 4OJNA 4GX0A 2FN7A 4A10A 4DQVA 1KOLA 1BW9A 3CXRA 3JV7A 1V3VA 2EW8A 5JMWA 5JDCA 5JMPA 2QYTA 3AFNA 3PRJA 1SB9A 3KOUA 5EQDA 2G0TA 4MKXA 2I76A 4G5HA 1YRLA 5JCJD 3RFXA 3RUFA 2YYYA 2D0IA 3RJ9A 4AJ2A 5A4DA 3BMOB 1LLDA 4ONEA 4E31A 3X2FA 3RKUA 4OHUA 4DPLA 3ZV5A 1ZJYA 3H7AA 2YY7A 4RQTA 1KS9A 1LDMA 1TB4A 3I9JA 4AJIA 3JQFA 3JYPA 1GV0A 2ZJ1A 3IP3A 2H1SA 2SCUA 1JAYA 1HDOA 1Z7EA 1NFQA 4YQZA 3VTZA 2GRAA 5BSGA 3S2EA 1GEGA 4H15A 5G0TA 3LC1O 1HL3A 2PKQO 1C1DA 1SOVA 3RCBA 5ADHA 5K6AC 3PFFA 2X0IA 3DZHA 2X0JA 4OXYA 2NQTA 2AQHA 3ONFA 3D7LA 1LDNA 1BDMA 2X22A 3GZ4A 3ZHBA 6LDHA 5AXAA 4D43A 5LCXA 2W98A 4Z3DA 4N5LA 1D8AA 1Z7BA 3M1AA 1EVYA 2VNSA 1ORRA 3O38A 1SB8A 2FSVA 4IM7A 1AE1A 4OQZA 2Q49A 3L6OO 4A5OA 2B4RO 3GRPA 1E3SA 2DUUA 3AI2A 5F3RA 3U4IA 1HTBA 3DMTA 3L4BC 1EBUA 4CR8A 2FR0A 1T2CA 1WWKA 2J8ZA 1E7SA 1QXSA 3K96A 3NJ8A 4TRRA 4BO3A 2OZPA 2XOXA 3KSZO 3KTDA 4MP6A 1T1RA 1WPQA 1R0LA 1HXHA 2PZKA 2EHDA 3LZ6A 7MDHA 4RPGA 3G17A 3PHLA 1N5DA 3ZU4A 2BRUA 1EVZA 3JQ7B 4CM3A 1FDWA 3AUTA 3FR8A 2QG4A 4J1QA 4JIGA 1NBOA 1MB4A 3LK7A 3PYXA 1OOEA 3QWHA 4WASA 1AGNA 3QV1A 3GVIA 1BXGA 4TZKA 3O8QA 4Y6PA 2NSDA 4BNLA 3F46A 3OIFA 4UVDA 2WE7A 3C3XA 4XQCA 5KCZA 3DZKA 4B7UA 3VPGA 1J6UA 3GDFA 1GEEA 5EPOA 3MJCA 3U3XA 3IKVA 4E5YA 1IB6A 5A9RA 1V9LA 1Q0HA 2HK7A 3CMMA 3IKTA 1ISHA 3Q3CA 5CG1A 3HJAA 4L4SA 3C8MA 3COSA 1RJWA 1IE3A 4IY1A 3PJGA 1AXGA 3F1LA 4PLVA 2O2SA 4NQZA 2QX7A 2J3HA 3JD0A 1H5QA 1KEVA 3FWZA 1PL7A 1UZNA 1FDTA 1TT7A 3GMSA 3TN7A 4PG7A 1CDOA 1B0AA 4RPJA 2GASA 1G0NA 2AG5A 2CNBA 4P38A 2WE8A 4IDBA 2BELA 3BMCB 2JCVA 1XQ1A 3FTPA 2QW8A 1N7GA 3GUYA 1BGVA 1NHGA 3AOEA 4PLZA 3PWSA 3JD2A 1R4MA 5G0UA 1NP3A 4BB5A 4Z3KA 1P77A 1HKUA 1U5AA 3T4EA 1T1SA 5C7IO 3ZHYA 4L76A 1Z73A 3JQBA 3E9NA 5L7YA 3PIIA 4CL3A 4H7PA 5JAZA 3GEMA 3DFZA 1HZZA 4ZRNA 3JYNA 4XKJA 5GZ3A 2PA3A 1W8DA 2VHYA 2X6TA 3DMTC 4CJXA 3RAJA 4W9NA 1H0KA 3TSCA 3RC1A 1P0CA 4I5EA 5DULA 3GGPA 2LDBA 1X15A 2ZYAA 3EK2A 1IZ0A 3TF5A 4MVJD 2PH3A 5F1PA 3RKRA 2AXQA 1YBAA 1QYWA 4XDYA 1R6DA 3I83A 4IJWA 3NKLA 3K30A 3VH2A 4PZCA 1GADO 1VKOA 3BTUA 3AU8A 5DP1A 1T2DA 5I9MA 3HWRA 4RVFA 4CQMB 2I6TA 3L6DA 5ENDA 5K0ZA 3CZMA 3IJPA 3ZDFA 1PJ2A 3PYLA 2YUTA 3WFJA 3GEGA 1WDMA 4RJTA 4YPOA 3BTVA 1U3TA 3RBZA 5ILOA 3U9LA 5KJCA 4G65A 2EJWA 1YJQA 1P1JA 1JKJA 1VPDA 4GMFA 5TT1A 5CHEA 5U1PA 3RWBA 3UKOA 3E9QA 3W6ZA 4DLLA 1GZ3A 4BGIA 1GPDG 3HZZA 5JAQA 3GHYA 3E5RA 4DPKA 2DFDA 4R9RA 2PD3A 4FBGA 1XSEA 4UEJA 1OMOA 1O6ZA 1LQTA 3MTJA 2J5KA 1WDLA 1ENZA 4ND1A 1Q2XA 4AJLA 4CLOB 3KSDO 4JLWA 1OC4A 3OA2A 3FI9A 3E03A 3I23A 4N7RA 2CVQA 5COQA 1MG0A 1R4NA 4GWGA 3DQPA 3MOIA 2O3JA 1RM0A 2ZB4A 3IUPA 2HLPA 5JY6A 1UAGA 3GUCA 2G1UA 2YHIA 2PFGA 4CM5A 3FHLA 3E48A 1PZGA 1RM3A 3LC2O 1VJTA 4AJ1A 4RPLA 3U4CA 3W8FA 3H3JA 3AOEC 4HFNA 4NNJA 1K6XA 2CY0A 1R0KA 1E3EA 4QX6A 1Y8QB 3DHEA 4BNGA 3CE6A 3G1UA 3SEFA 1PGOA 1I3LA 1HDGO 1JAXA 5GZ6A 3FPCA 5TT0A 3HDJA 4R9SA 4BUCA 4IS2A 3ENNA 5I8ZA 3IJRA 4I5GA 4E2YA 2DPHA 5A5FA 2YJZA 1NVGA 1PQUA 3JCZA 4WLVA 1HWYA 1PJBA 4P22A 4WLNA 3ZWNA 4E0BA 4EGFA 3JQAD 4P4GA 5ER9A 3HHPA 2AQKA 4PRKA 4CQLA 1DRWA 4FJ1A 2EGHA 5BR7A 4J1NA 5MGBA 4XQEA 1DAOA 3ZNOA 2BI7A 1X0XA 5EERA 4RCVA 4KZPA 2PD4A 3QJ5A 1I24A 3PHHA 5AVOA 2PGLA 1C1XB 3GOHA 1NX6A 2C5AA 2VRCA 3UICA 3K6JA 5HBRA 3TPCA 3GNQA 3GVHA 5A02A 4DLAA 4NBTA 3DL2A 1H2BA 1EBFA 2OO5A 2EERA 1M75A 4RV9A 3ROKA 3SC4A 5DN9A 5ES3A 4BIIA 1E3IA 1IOLA 4CV2A 1GD1O 4RVUA 3F47A 1XU7A 5U4QA 3QE3A 3ANNA 3GGGA 2TMGA 4CUZA 4I5DA 4BKRA 1I5RA 3I9OA 3LC7O 4E2ZA 2C82A 1HZJA 3DBHA 1XQ6A 3VH3A 2HRZA 1DIGA 2J3JA 3ABIA 4CMIA 3V1UA 5TNXA 3CH6A 4JBHA 3OSUA 3LYLA 3RASA 4DYDA 3VZRA 3C7AA 1QKIA 2UVDA 1YVEI 4GX2A 5T57A 1LI4A 3ROQA 3GA0A 2WYVA 1CIVA 1ZXBA 5KJ6A 1L1FA 3WNQA 4AVYA 5BT9A 2D5AA 3DHNA 1SO8A 3N74A 1H93A 4WGGA 3LDHA 2OBYA 3HFSA 4PZEA 1P1FA 1XWFA 3DAGA 5T5QA 2A9FA 2X9NA 3FD8A 1DRUA 1LSUA 1U2GA 4IUYA 5HS4A 4CMHA 3BMQB 4PLCA 3EVTA 4PLHA 5A1TA 5L40A 4DREA 2IODA 1PQPA 3WLFA 4CLRB 2W2KA 4M8SA 1K6JA 4FCCA 4Y67A 5L3ZA 3ZV6A 2RH8A 2IXAA 2GN8A 2Z95A 1YO6A 1PWZA 2NV6A 5T64A 2CZCA 4BKQA 3QRWA 3M6IA 1A27A 1J49A 4IDEA 2W2LA 4JN6B 3WGIA 3M2TA 1SBYA 1GYRA 1NQAO 3DB2A 3R0IA 4NJMB 5JS6A 4LVCA 2ZYGA 4RGBA 1EE9A 1JVSA 4R1TA 2WD8A 4O6VA 2CDBA 4R3NA 1G1AA 2CSUA 1Z82A 4U6QA 4BL5A 2PKQP 3NDIA 2PK3A 4OSOA 3VKVA 4W4TA 5TGDA 5LDGA 1T26A 4CUJA 3MTGA 3OA0A 4J2OA 4GKVA 1MG5A 1BG6A 1U1IA 3WB9A 3AM3A 4RO0A 3H6KA 3K9QO 3BYZA 4LRSB 4BGVA 4DUPA 2D1YA 4JJFA 4YJDA 1MLDA 5COAA 5A06A 3TNLA 3Q9UA 4IDAA 4WCFB 3PJDA 1V8BA 1E77A 4EDFA 3WGOA 1LDYA 1GZ4A 4JP2A 4MVJI 2VWQA 4OOEA 5AXDA 5MDHA 3MEQA 2EP7A 2EP5A 4M87A 3UXYA 3V8BA 2EEZA 2FMUA 1LLUA 4AL4A 1EVIA 1EEHA 3BIOA 4GVXA 3GK3A 1DOHA 4HXYA 2I5PO 3QVTA 4MJLA 1FDVA 4MVJE 3I6IA 3F4LA 3G79A 2H9IA 3ST7A 2PGDA 2F00A 4TSKA 2NNLD 2DFVA 2ZJ0A 3L9XA 3H5RA 1N9GA 1FMCA 3Q1LA 2Y05A 1CETA 5A9SA 3GEDA 3O9ZA 3V2UA 4BB6A 1Q7BA 3GVXA 3PZRA 4YRAA 5A3JA 1PSDA 2EG9A 2GNAA 3GHHA 2IYOA 2YFQA 2PKRA 1U8XX 3PEFA 1YB4A 2Y68A 2WYUA 5L7WA 1YGYA 3IMFA 5BQFA 4CL8A 4AJJA 1C3VA 4IDDA 1I33A 5KNLA 5L4NA 3HFGA 1ISMA 1QR6A 2FPIA 3WSWA 1I32A 2UAGA 3ASVA 4U6SA 3ITKA 4WUVA 4QECA 1L7DA 4BO0A 4NR0A 4J7UA 4GVLA 1NPYA 3NRCA 5G4KB 5B4VA 1T4DA 3PJFA 3KXDA 2ZTVA 2YFHA 3Q11A 4AJPA 1T25A 4E33A 3ENKA 3V1YA 2YV1A 3INRA 1F8FA 2Y1CA 1E1MA 1F14A 3K8ZA 3GC6A 4DVJA 5DBIA 1YDEA 3BMOA 4MKRA 4Z0PA 4OAQA 2B37A 2X5JO 1Y8RB 3KRTA 4RF3A 1HE4A 4BO5A 5TF4A 2UV8A 4X54A 5I9LA 1O94A 4ALNA 3P5SA 4HV4A 1JN0A 1PWXA 1Y6JA 3B70A 4OGWA 3CMCO 3O03A 3H2ZA 4II2A 1A7KA 1M76A 2EKPA 2Y66A 3WIEA 1A7AA 2OP1A 1YOVB 4C7JA 5KKAA 1B8VA 1TT5B 2Y1GA 4M54A 2OOSA 5GY7A 3H5AA 3TOZA 4K6FA 3W6UA 3E9MA 2VCYA 4IDFA 1G6KA 5JAIA 2IXBA 4YVFA 4XR4A 1PTJA 4YTEA 2HU2A 4XB2A 4TWRA 2X0NA 4HWKA 3H9JA
chains in the Genus database with same CATH superfamily
3TMKA 4CF3A 2C5BA 2HV9A 1SQFA 1ZS9A 2ZJ6A 3E7XA 1C9YA 4Y2YA 2J48A 3RTAA 2RAVA 3C8DA 5DCWA 2Q2VA 3PF9A 4NLLA 1B14A 4G63A 4D3XA 3TK1A 3ZLUA 1HBJA 1BYIA 1ISIA 3N5KA 1KDVA 1QOPB 5IXYA 1ENOA 1W4AA 2VQFB 4J3JA 1S1CA 1ZD2P 2JGNA 4KE8A 2IPOA 2X7HA 5K0BA 5CAEA 4BKPA 4N6NA 2WNIA 4C6TA 3D2CA 3C7KA 4GSYA 3WLEA 1QLHA 2G7ZA 5KUTA 3FYTA 5CTAA 3EA0A 1CNEA 4BXOB 2VTEA 2C78A 5K8UA 3GXBA 4UUQA 2PL9A 4TT3D 3OQMA 1UOEA 1QAQA 3N2GB 3PR1A 3WYGA 1VYUA 3GNLA 3P26A 4EY8A 4UQLA 1K88A 2D1TA 2V7QD 5HUHA 1A8QA 2HU5A 3GJQA 4URYR 4X97A 3GQBB 3MQ4A 3EAQA 5YASA 3VJKA 5DM0A 1Z5NA 3KOZA 4LQDA 3PQEA 1HRKA 3M4JA 3GT3A 1PW7A 3CQ9A 1X0VA 5EP3A 2IPLA 1SEPA 4QXPA 1OXUA 1KY3A 1OWNA 3UK0A 4QSHA 4UZFA 2DH5A 4ZHSA 4ZYLA 2C4NA 3AUFA 1NIJA 1GVHA 2NU7B 2GYYA 1D2EA 2X8WA 2Z5LA 1V8OA 3Q41A 4KQGA 2V6BA 4P7JA 3TRDA 3ZLVA 2HLNA 4JC8A 2PH1A 1QRDA 4J2HA 4Y6QA 3LYHA 4BZZA 1OXXK 3U7FB 4S1TA 1V5FA 3BBLA 3FBGA 2HDWA 1USWA 3OESA 3ZDDA 4XOUA 3FCAA 5BO5A 2FOLA 2FFQA 3IEMA 1F3LA 1NVEA 3GVCA 4NMLA 3LPAA 4M46A 5DSZA 1GTSA 5EIWA 2LGJA 5F33A 5C31A 4REQA 2ZRMA 1WABA 2FKAA 1JHPA 2W2TA 3AJDA 3M83A 1ZIDA 2EF1A 3VC1A 4R2HA 3AHHA 2XOKD 3WK8A 1UC9A 5BSHA 1KI6B 4EQ6B 1E4VA 4QGSA 3WGTA 3D0OA 4DLYA 4YCBA 2AMJA 3N8DA 4LSMA 5I9TA 1T5IA 2YN0A 1IN5A 2BDEA 2NW6A 1GNLA 2Z5VA 1UPCA 4BRSA 1XCLA 1W1UA 4KXYA 2UYHA 3BMCA 5E1OA 3SNKA 2CBZA 1ISSA 5FV4A 2J5QA 5ER6A 1H6BA 2Q7XA 3KZ1E 1U8EA 3OIVA 4EJ0A 4FNOA 1FU4A 2RGUA 2O7QA 3EQ9A 2OXTA 5DK6A 2PLAA 4R6WA 2EG5A 1QQAA 3BK1A 3D2BA 3AB8A 2NU9B 4EK9A 3NJRA 4JH0A 3PK0A 5T8KA 4M8IA 1EXNA 1PX2A 4JVNA 2VJPA 5JWHA 1REQB 3CSUA 3WL8A 4CM9A 3CZQA 2JS7A 3ND8A 3WB2A 4UVEA 3LQKA 4R9NA 4B4VA 1X39A 1X80A 1V0JA 2QLNA 1BS1A 3NBYC 1ZEJA 2Z2JA 2ZIGA 3C3WA 2NN3C 5GVSA 3WBFA 2O2ZA 3CNHA 4Q1VA 1IYZA 1OLSA 4BC0A 2QP3A 3JASB 1FX0B 2F1OA 1QH1A 1TQ6A 1I30A 4MTCA 4EQZA 3QV2A 5JAPA 4XQ9A 1Z06A 2AOXA 4Q01A 5FBZA 5BN1A 3W5DA 2QBYB 3IQEA 4UU0A 3SLKA 2Q5QA 2DFNA 5IJAA 5EWJB 3G89A 2IU0A 1PFYA 1AKYA 4MW6A 1V4VA 1A8UA 3AL0C 1VGRA 4ZXFA 1DAIA 4D5EA 5EJ9A 1LSOA 2G1PA 4KYIB 2C3PA 1JQEA 1SVKA 2YJ6A 4K8OA 5DWDA 4F5DA 1PK7A 4OFBA 2IV7A 3QLUA 2QM8A 3TD2A 4F7DA 2FOIA 4OTZA 4E12A 1YKFA 2GGSA 5JMTA 1CUZA 3B38A 4DRYA 4J49A 4ZKDA 2C2HA 2MSKA 2Q3BA 3USCS 1DJOA 1ZCJA 1JNYA 3ZQ4A 1XFDA 4OGFA 4HB0A 4YIHA 1AXEA 1PEYA 4G0MA 2AEJA 1D2RA 3W4KA 2AYYA 3PUIA 4GQIA 4B2PA 3L18A 1IWPB 2QMEA 3B6KA 4LJLA 5CW1A 5KB3A 2Z8YM 3AUAA 4K9SA 1X7GA 4Z4IA 1IEQA 1XRJA 2IYAA 3N6RA 3DOJA 1DC6A 4E88A 4NCBA 3GLHE 2IUFA 1ADBA 2UZ0A 5C35A 3FKSA 5JH7F 2R8RA 3AI3A 4UHDA 3K70B 1WA5A 1MA0A 1NNUA 1QF7A 3CZ4A 3QH4A 3KZMA 1EK2A 4HX9A 4WFIA 4D8VA 1N36B 2P9TA 4TX1A 3PQ3A 4BX2A 1NQOA 1M2JA 1RR6A 3DD5A 5KNBD 5GVRA 3LUHA 1YRWA 1D04A 1IRXA 4D0RA 1B2LA 2VPIA 1H23A 3LIIA 2XQIA 4RMGA 3NOQA 4BFUA 2EL9A 3KR2A 4RLSA 4XSHA 1XD9A 2UXDB 2DR2A 5FBVB 3A7DA 4WACA 1D2HA 1HETA 3K9LA 4GMDA 1JHMA 5CVDA 4ML3A 5GPBA 5B6IA 4YJ3A 4TQGA 4AJOA 4WIAA 1E94E 1KJNA 1F2VA 1PV1A 1ZG3A 1E6UA 3L4EA 2R6DA 3NB0A 5BN5A 2R7AA 1COWA 1N3LA 2R1VA 3QZUA 3VJRA 4D8WA 2IXDA 4TRJA 5A0FA 2CZGA 3DMHA 2WZQA 3BS4A 3DNFA 2DPLA 1RM4A 3BJZA 3LWBA 4FYIA 4NIMA 3E0XA 5JFTA 4I7EA 4K81B 1Q3KA 5C0OE 1YHZA 3EEBA 1GP2A 1RCUA 3ROXA 2EKLA 2MMCA 1U0OC 3CSDA 1W44A 2G70A 1U7TA 1SH7A 1IU9A 1XTSA 1GAWA 2BZSA 2F6RA 1Q7GA 1S7CA 3GA5A 2I65A 4QUKA 5EQJB 4OHOA 4Z4GA 2BF7A 1J7JA 4HAXA 4X5OA 1S4MA 4BNTA 5AVXA 1O8BA 2WHYA 3LT2A 3RAPR 3AL2A 4F46A 2ZR8A 2GCOA 2PGJA 2XDQA 2QR3A 5DYGA 3BIXA 1J2UA 1L1RA 4RTNA 2WG0A 2HM7A 4TL6A 2G28A 4OQMA 3CF0A 2O2JA 2BTEA 4ZYXA 5JYCA 2YUIA 4I50F 1IM8A 1YBMA 3VJMA 1CUWA 2AW5A 1EXVA 4FK8A 1C1XA 3HRHA 5FWYB 5LMUB 3PKZA 3DULA 1KH1A 5L3QB 1Q1ZA 1HT3A 1YS6A 1E1LA 1NOJA 4G36A 5FTWA 5TJ9A 3RRNA 4B0OA 4HNTA 4RQBA 1FZTA 2JANA 5D7NA 3VR2D 3FPLA 2QRKA 2KW5A 1SOAA 2JW5A 2C8LA 4MGYR 3F6RA 3CUYA 4CQNA 3S1AB 3DC7A 1H5NA 2Y67A 2V7BA 3W7VA 1H2HA 1APBA 1RYHA 3LGSA 2FRDC 5KBYA 2GBCA 3M82A 5AW6A 4QUHA 2HMTA 4NESA 3W2TA 4M8LA 1Y9ZA 3DGEC 5ADUS 4XD7D 3UM9A 1E6MA 4KWTA 5B1YA 1BW9B 3RVMA 4EG3A 1M6NA 2IU3A 3AIMA 3O8BA 4MRVA 1T5SA 3FTNA 2GF2A 3D1JA 2RGNA 4ARVA 4IIJB 2FV8A 1VLJA 2VT3A 5AJZA 1JJAA 2AZ4A 3FNQA 4U0JA 2OLJA 4D5GA 1NWCA 2SNIE 3IP8A 3SKXA 2H5JA 1DDOA 1XZGA 3TRHA 8ATCA 4MB2A 3NU1A 3KS9A 4UM9D 1UOPA 2O1EA 3D1VA 3OTGA 4Q05A 5KS2A 2Q2QA 1BQ3A 2SKDA 1OI7A 4QFBA 4J0KA 4L3WA 2AD1A 2CVHA 5LP6F 1FK8A 1VCHA 3Q3HA 4UUOA 2RG1A 4TMFA 3RT9A 2W6NA 4Q7MB 3V8RA 4X8HA 5J2UA 3ADKA 5I7SA 1KDRA 1JRLA 2R66A 3S8MA 3KJXA 1P1HA 3H2JA 1K92A 1U80A 3HG7A 1A8SA 4KIUA 4Q15A 4PYIA 3RROA 3HSYA 3DEHA 1L7EA 1IZ8A 4FW9A 2D2EA 2LNDA 3AF0A 1KFJB 2ODBA 2J3IA 3MWLA 1ETHA 1NX9A 1P2SA 2FSFA 4I2VA 4KHZA 5H80A 2O8DA 5C2JB 4JEIA 2QTWB 1JU4A 2CLIB 4XGNA 1BDIA 4ZEVA 3SHTA 1C2YA 4RVOA 4EWLA 3AR2A 3DC2A 3N59A 4IOKA 1IVYA 1YQGA 1V7CA 2X4DA 3A11A 3F6SA 3KCQA 3PNVA 3T1HB 3EGXA 2QAGA 2QAIA 4TYWA 4EPVA 4FMPA 1RM5A 2XYRA 3KYDB 4JYPA 2Q4RA 3LMKA 4WINA 5FA6A 4NE7A 7ABPA 3SQLA 5G02A 3QNMA 4XX0A 5MN5A 3GLGE 4JJEA 2BKXA 4RW0A 2XE4A 7REQA 1DBVO 1NY5A 4XWYA 2DQKA 5B3KA 2WAMA 5A1JA 1XROA 2I62A 4QHYA 1JA9A 4NY1A 4FFNA 5HXAA 5LYJF 1XKXA 1RCTE 1A88A 4X20B 5ALJA 1Y3DE 4ZV9A 1UBGA 2ZITA 4MGKR 4PIMA 4D4KA 4DC9A 3PXXA 3GROA 1D7OA 1B7GO 2ILTA 4OUDB 5AJYA 1AHPA 4XOIA 3N8KA 3DW1X 3T1QA 1ZD3A 2CJXA 4X8OA 1KO7A 1YZYA 2ODEA 1VHWA 3FYCA 4G1FA 5HS6A 3TFWA 2VF8A 4TTAA 4QFDA 5CD1A 5B3JA 1RPAA 4C0QC 2WK1A 1TZBA 4BNZA 3EAGA 2Q3HA 2RGCA 3JQBC 3VXKA 3OJ0A 3I5MA 4EITA 2D7CA 4BEVA 5ILGA 1N3IA 2E82A 3C45A 1O89A 1Y63A 1Q0LA 3H9UA 2QDXA 3F7OA 3WGYA 4GX1A 1HRDA 3D0KA 3NHRA 2OAEA 1CUXA 4O1MA 4K9DA 4Q12A 4EY7A 1N5MA 3FYDA 4NEHB 3ZDYB 1Z13A 2PJUA 2RBKA 5EZYA 1YDGA 3INGA 2CHUA 4M3NA 3DEIA 1U6IA 2ZUDA 3L0ZA 2EVWX 4WQMA 1SHJA 1NA5A 3HNPA 2HCJB 1L1QA 2ALJA 4GZ5A 2ZYWX 4QDJA 2DPMA 4ZEMA 4C2TA 3R0VA 3O3CA 4W7IA 5F7JA 3RC9A 4ER5A 1NQVA 3N0XA 4ZMRA 2XGGA 3PCTA 1DJQA 1EFRD 1ZJ6A 4K6MA 3IDQA 3R8CA 1AB5A 2FZGA 5AKZA 1HFKA 3UMBA 3QBTA 3ANTA 1CJBA 2Y1LA 2G1AA 4YAIA 221PA 3MT7A 2O7RA 1ZVMA 1L6IA 4C07A 2P78A 2V8BA 3EF0A 3OLVA 3EH1A 3PTZA 1YWGO 1SBCA 2J9FA 3CR7A 1YL6A 1TM1E 2QN2A 3IDZA 5FI1B 3R7SA 4YV0A 1SKMA 3EGOA 4LF6B 4QT0A 3V5NA 2HQSA 4D9KA 4NKRA 5C8XA 3AT1A 4RZIA 4WK6A 1R50A 4A8PA 2F67A 4KFSA 4WZAE 2WIJA 2XNJA 2OXFA 4YDHB 4ALMA 1TQDA 3MS2A 5A3QA 2AL7A 1DG3A 3QVKA 1GQSA 1O9HA 4H0NA 4BNNA 3DNPA 4V0LA 2J5RA 3DV2A 5KYYB 2J7PD 1H3EA 1R00A 1SZDA 3ADBA 3RS8A 3QY9A 2D4AA 4LRUA 2QSJA 3F3YA 4G8CA 4TVBA 3RT1A 5HKAA 3FN4A 4Z6KA 4LQ4A 3DZIA 2WUGA 5KCMA 1SU4A 3OEWA 4J0EA 3ZH9B 3QU4A 3UFXB 2PRKA 3CCFA 4MO2A 1W0CA 1X1SA 1DKPA 4IP0A 3UHJA 4BMXA 4C2AA 5HRAA 1LRJA 3K71B 1KJJA 3FR7A 1XTJA 2ZPTX 4MV5A 1B8PA 4ATNA 3VOTA 5BWOA 3GLKA 4RU1A 4B09A 3KVVA 5H8WA 4K2HA 5F4BA 3VSEA 5F1KA 4LTMA 4N49A 3RIEA 2A3NA 4MZXA 1MVOA 3KHUA 3UGKA 1EUZA 2TECE 3C15C 2WWYA 1FFHA 2GZRA 1A1VA 3LJKA 3PQDA 3ECAA 1YBHA 3O4FA 3KJGA 3CTMA 1GZ5A 1L7QA 1TUBB 1W94A 2J3KA 2ODPA 4H16A 5DYWA 4JLKA 3PBKA 4RTKA 3W2FA 1Y8RA 4B45A 3K20A 1MFPA 3KSAC 1KFCB 3SSAA 1YC2A 4L57A 4S12A 1HMYA 3OQ6A 5TEWA 4LMAA 4C6HA 4MHTA 4NJEB 1PR4A 3LT1A 5AO9A 1GGJA 4M9QA 4MVJP 1IBSA 1VL2A 1Z7YA 3P32A 2X3YA 1B6SA 3RUCA 5HRCA 4ZJYA 3F6EX 5KI6A 2CNDA 2BFCA 4WTOA 4WDRA 5AT1A 1O4WA 1XCBA 2OFPA 1PGNA 2NWQA 5KOIA 3P0JA 3BWXA 2KLBA 3IULA 1MQ9A 1L7VC 2AEEA 4JB8A 4JI4B 4DSNA 2QQEA 3WMFA 4D97A 4ESOA 2IYNA 2XRMA 2REQA 1P19A 4Z9FA 2JHGA 2B2NA 4ZI5A 1LJLA 1TO6A 2QWXA 2IKQA 4WK2B 1DIRA 2VPPA 4REOA 1PJZA 3G9QA 4BS9A 3ORYA 2HDNB 1MJGM 3RRFA 4G0UA 4D3DA 1X74A 3P5BA 3JQ9A 1YJ5A 3IB6A 4EKIA 1WNFA 2PS0A 4QUAA 5KTMA 4TYPA 3R0QA 4HKTA 4PAQA 1PNRA 4GPD1 1M6HA 1N75A 3PDCA 3ZJTA 2WB4A 2Q29A 3QHAA 3AZOA 1JEQA 3RVOA 3PHCA 5T3YA 1Z12A 4Y98A 2HO5A 2OG2A 3MTDA 1Z4OA 1UBHS 4NV3A 4PX3A 4HY3A 2RHRA 2V5UA 2QZZA 2VYVA 3HDTA 3O47A 5GV8A 4K1LA 2OV1A 1U2DA 1M6VA 2PX6A 4P4SA 2B36A 4XVRA 2XEDA 4DADA 1H2RS 2WUDA 1VC2A 4FE3A 5ERYA 5EWMB 3REFA 1IJKA 4R4JA 4BEJA 1JLRA 3E1KA 3IMCA 3FMOB 4IUDS 5IKPA 2V7VA 5JZ9A 5MFZA 5DPMA 4EMUA 5F2NA 3N05A 5CIWA 3P94A 3KZCA 1Z3CA 1FSZA 1QFJA 2BFWA 4L9RA 2WICA 4WY8A 1AXRA 3MN1A 4OATA 4DG8A 3BL6A 4EF4A 3BDVA 2GWRA 4M0KA 3TPZA 2XUQA 3N0TA 2Z8XA 2Q5LA 3BB4A 5B1DA 4EI7A 3NRBA 3NUGA 1IIBA 4D3SA 2WOJA 5L51A 3FROA 1XL0A 3MLAA 5I7AA 4NBLA 3N2LA 3GY0A 2O8FA 1Q7CA 1R8JA 4M89A 1I8TA 5KKCA 1F51E 3PC4A 4B3CA 1PR1A 5IMSA 1QCDA 3IE2A 3HBJA 2C29D 2ZSJA 2NAFA 3DTTA 4FIZA 5JXJA 4ETWA 2DHEA 3EWIA 4QPPA 4X71A 1FFCA 3G0OA 1BWPA 1EAMA 3LVFO 1IUKA 1HV8A 1NG1A 2IZ0A 1WAMA 3B9BA 3ZE7A 2XB2A 1LU9A 3U3OA 2BGIA 5DF1A 1PS0A 5JCOC 2GHTA 4UHBA 1IHYA 2IXFA 2DTEA 2ZS9A 3STUA 5DWVA 4UFNA 2HQ1A 1I3KA 3LG2A 2DPGA 3JQDA 3QPWA 1QV7A 3G7NA 4DSTA 1LQUA 4UNIA 1LJ8A 4BVLA 2IBTA 4AM8A 3LF1A 1CDZA 3HN6A 3DPSA 3KLBA 3AESB 3OWOA 4FWBA 4GP6A 4XPZA 5DJ5A 4DQKA 5CCEA 4Q3CA 3LW8A 2WJVA 4XRGA 3PI7A 4LW8A 1GFSA 2YW2A 3BTOA 3Q3EA 1FE8A 4WADA 3T9AA 1UJCA 1NTOA 2HDHA 3G5UA 1DPGA 5JCXA 4PQYA 2Q5EA 3RK0A 4R5MA 4IIEA 2O8CB 4QGBA 3LFTA 2LPMA 2EJBA 4YR9A 2YWEA 4JQOA 1VIVA 2RGRA 1OB2A 1M1XB 1CUGA 5C8VA 3FMVA 1ESEA 2DLNA 3GJ8A 5AI4A 3VKHA 2CJYA 4PSCA 1UAAA 2PG3A 3S70A 4BQRA 4DBVO 5HGXA 2B34A 3CZRA 2FPGB 3D4NA 3MZ0A 4RVDA 5K0NA 3WK6A 1ESMA 1FYVA 4UW9A 5IH3A 3DHVA 4G8BA 4LSWA 3GP5A 3DJFA 2P0AA 4V24A 4C7MA 2UUCB 2XSZA 4G5QA 1HYEA 1GQ2A 3OD1A 4G1VA 2O3SA 4AO8A 3HV0A 2OFFA 4M53A 1T6YA 1CG6A 2HJRA 1TVEA 3HVJA 4XWTA 1EG7A 5G1PA 3H1FA 1XDUA 2W43A 5EWLA 3HJUA 3IBTA 3ASZA 2CD9A 4HZGA 4C4PA 4BO6A 5TLSA 4NJOA 2P41A 5BOVA 4FU0A 3RK4A 3EVGA 4M7RA 4DJTA 4G4SP 1P18A 1RAGA 1WHSB 1YQQA 1WXXA 2A1TR 1JPVA 2HWKA 4JT2A 5D2CA 5A4IS 2L42A 3EFOB 1SUFA 4IG9A 4UTZA 3PFIA 3EIEA 4DV5B 2WM9B 1ZFNA 2W2OA 4FS8A 4NNPA 4Z2AA 2QMQA 4Z9YA 4MI3A 2QS9A 5CCXA 3L8ZA 3QF7A 4WLUA 4A73A 3HR7A 4LHWA 1Y34E 4TXMA 4BV2A 2R5NA 4ZZ0A 3I2IA 1KQFA 4QOHA 1FNBA 1SVWA 1VG9B 4CM9D 4FT2A 3U6BA 2ZDHA 4GOMD 3NAGA 2HIMA 3OZGA 1UXIA 4HYEA 5C4IA 1GLVA 4MQ6A 4P93A 1VLLA 3I6YA 2AI2A 3SZGA 2DSNA 1E1KA 4Q1FA 2PUWA 4D1YA 1YNOA 4YQEA 1JFRA 3GJSA 1QZUA 2QP4A 3ZG6A 2QQGA 3WKEA 1WQ1R 4WAUA 1RYNA 1YQUA 2MSNA 3PYMA 1G8YA 4YP7A 4O63O 3L79A 5THKA 2H07A 4H2DA 5BV7A 3G2JA 5BP7A 3MGBA 1ESZA 3ZWAA 1Z47A 3C43A 2ZRPA 5CDGA 1NVBA 1J09A 3KXKA 1K5HA 3PLRA 5H70A 1QU2A 1XAIA 2FX2A 2P5SA 3BKXA 4R31A 2OCGA 4DBLC 2C88A 2Z2XA 3JQAB 3JX9A 3GN1A 3KDSE 5JWOA 2B4QA 2ZUEA 4EHLA 2JKZA 2MJLA 1UKVY 4PSAA 1X7ZB 3EXHB 4UDOA 1SK8A 3SY8A 4XCQA 2I4MA 1AMOA 4ZZ2A 4NCHA 1L5HB 1Z0AA 1EH5A 3IILA 4OQQA 1L4FA 4AZ0A 1WKCA 3JQ7A 5JH7B 4Z9XA 3KYCA 2W0SA 3WL3A 4MLZA 4YJ2A 1D2GA 3ZS8A 2DG2A 1Q0SA 3B2EA 3GL9A 2JCYA 4NBVA 3VHXB 5L3RA 1OD6A 4DA7A 4R84A 1JJIA 1PYOA 2FZEA 2J31A 2QLMA 1DTWA 4NFLA 1HG1A 2XVXA 3FKSD 2Q3JA 4A0GA 4ER6A 2E49A 3U4MA 3ONDA 2OGSA 1KMHA 3HZHA 1PJLA 1K75A 1OA1A 2V97A 3BIFA 3JRXA 4FZVA 4EY5A 2ACEA 3OEYA 4C6RA 1FYDA 5EJMA 3G2QA 4OQPA 2EWWA 3Q98A 3STHA 5J47A 2D5CA 4ZT4A 2QIPA 3TFOA 3FTQA 3K4PA 3Q8KA 1ZCAA 4F60A 4OB6A 2ID4A 3BDAA 4FINA 3E4DA 2W2VA 4FGSA 2XMBA 5CX1B 2O5RA 3GFOA 3M4ZA 3C6BA 2OA0A 3PVZA 2IYLD 4ZEWA 3ZHSA 1A2KC 3H87A 5A3SA 4OP2A 4L4YA 1ODFA 5EUMA 1P0QA 3W6PA 1DDIA 4I9FA 1COWD 4Q4HA 4D96A 4N0DA 2BEJA 3K5WA 4EJSB 3SJAA 1AKVA 5DX1A 4CKCB 1JQKA 2DTXA 2YWBA 3FUVA 5IMBA 1RCFA 4F04A 1FNCA 3DA8A 4D79A 4S3MA 5H1YA 1HFWA 3LP6A 4KUGA 2WD7A 2XT6A 3FPAA 4JJKA 1F3OA 1LF0A 3JQEA 2O52A 4TQAA 4P80A 5LQNA 4G4IA 3FI0A 2HPHA 4HDMA 1DXYA 4WZBB 3SAJA 4EUHA 4ZO7A 4BO7A 1PJTA 4Q1DA 1QLWA 4Q6WA 5PGMA 3RSQA 2G8LA 4A0FA 3HS3A 5J5VA 3M5WA 2D54A 4I50B 2VWPA 1W6UA 1G3UA 2AE2A 4TSFA 3QLVC 4I81A 4MXDA 1C81A 1J8QA 4XVQA 2NO0A 4G81A 1V2GA 4ZQEA 1A8HA 3QKRB 1XTQA 3TMYA 2LIPA 4N3NA 3HL0A 4H3KB 1QYRA 3LLUA 3ZV4A 3DVAA 1BE6A 1KBZA 2ISCA 2X2PA 1UPXA 1ZINA 3DDNA 4NK5A 4OJQA 2WSBA 5K8JB 5LQMA 1AH2A 2Z3ZA 3X1WA 5JXWA 3IVMA 4RANA 3V4VB 4J4HA 5E6RA 1C9KA 1FJHA 1PNTA 2I80A 4FGWA 4IIVA 5AQEA 1I1NA 4TM7A 5BWMA 3Q9LA 4W5RA 2VTBB 1ZCBA 1UUFA 2AEFA 4RSMA 1RQXA 1TO2E 3DE1X 1EVJA 4X1YB 2H4YA 2VBGA 1U9IC 1LPBB 1ISPA 4BKMA 3D0RA 4CM8A 1OH8A 2XVMA 1YK0A 4J75A 5FNVB 2LXNA 4QRDA 4YT2A 5KC9A 2CYCA 2WZBA 4HMPA 1USKA 8ABPA 5HF9A 1S2MA 4ZVQA 2FFAA 2WA1A 1G6HA 2P4EA 3DZ8A 5K3EA 2WINI 4PM4A 5G1NA 3JQGA 3PQ8A 4MR7A 2CFOA 5AJXA 2WQ6A 3VR4A 2HC9A 4EI8A 1U2RA 5JO0A 1U7HA 3PUJA 1KVRA 4V38A 4YMLA 4ROSA 4OJMX 5LLDA 2XGJA 4OV6B 1SBQA 3KC2A 1D09A 3BK2A 2PS1A 3JSAA 3H75A 4JU9A 4LTDA 4BUZA 2E9SA 3DDHA 1FDSA 4NYJQ 2VHJA 1C5KA 1J1IA 4M1SA 1Y6RA 2HBQA 2PAAA 4M2LA 5LUBA 3VV2A 5CA1A 2B6HA 2G6TA 2Q3DA 5IZCC 2XZOA 3GH1A 3RU3A 4DJJA 2C4UA 4AJHA 3MWEB 3UAWA 1P9RA 2P40A 1PF7E 3ANYB 3JALA 4MINA 1CK4A 4F9EA 5EJ6A 1FMJA 2AMVA 4NBSA 4Y7CA 2OV6A 1GG9A 5EY5B 2G1KA 5BYAA 3Q8XB 4MB6A 2YICA 1KDOA 4MP8A 3KTAB 3LVQE 4LDZA 3O95A 4IJKA 4JYAB 3GLHB 3UMRA 3PFWO 1I10A 4JEUA 3IHTA 5FR2A 1XMPA 2QVYX 3VZPA 16PKA 2QRVA 4YJFA 2WQ7A 3BA6A 3IGFA 4ZQFA 4OQDA 4MDEA 4UCQA 2YW9A 1ECCA 1HEUA 3B60A 4JJIA 2Q3MA 2HPAA 4GFDA 4LJ7A 4WA8A 1YS1X 1YB2A 2I6SA 4ZCLA 4DIMA 3AY6A 1U2SA 3K0AA 3EGWA 4BZQA 4YJGB 3BXGA 4IIGA 4L0DA 3C4VA 5KYVA 4B7ZA 5T7BA 2W8BA 3AVPA 1N2EA 2ZBVA 3KE9A 3NIGB 3WLJA 2A6PA 2IFTA 4D8UA 1Q1EA 4YEDA 3U5ZB 5L45A 4N8EA 1EJBA 1TM5E 1XJQA 1HMPA 1YGPA 3TKAA 2AEMA 3AVXA 1NBIA 3WK9A 3MS7A 3VU0A 4AX8A 3WKCA 4EATA 2X41A 1BOOA 2D59A 1OY1A 3G59A 1X1TA 2VO1A 4KXXA 4N5DA 1N92A 1JDSA 3RREA 5HX7A 3QQPA 5FUMA 3UMMA 4AKIA 5LA6A 3Q9NA 4ZIRB 1EFAA 5C9ZA 3WO1A 3TRJA 1U3WA 1QIJA 4D6PA 4GZ6A 5JHGB 1W0JA 1CEYA 3GWGA 2I67A 2IYYA 2VXBA 3LQRA 1GTJ1 4K9NA 4TWIA 4WLOA 4YFYA 5IDYA 4GRAA 3VU8A 3EMKA 1QMGA 4NG4A 2OE2A 4MS3A 2DLCX 3Q3GE 3T5CA 4V0NA 1Q92A 1OZ0A 4IWNA 1YHNA 3ET5A 4GGMX 1T9GR 3TLEA 3WRYC 1DHRA 1K2WA 4RD2A 4BAZA 2HIHA 2F1RA 2D1FA 4JT4A 1UMBB 3G6KA 1JHUA 3P0EA 5JCJA 1RTTA 4DTIA 4JUFA 3G8AA 3TNFA 1H2WA 1YBFA 4DLXA 1L4UA 1ZM2A 2ZFUA 3QX3A 1C30A 2QLTA 4V2IA 3PXBA 3GPIA 4RE5A 1QBGA 1GPBA 2WJYA 4ZJUA 1Z0FA 5I7EA 2BH2A 3S4YA 2IOFK 7GPBA 2IYFA 1VBMA 2HHCA 2V6GA 3GDOA 3F5MA 3KQTA 4IJVA 1KEKA 1QHSA 4HNRA 1CULC 3FOZA 4CKWB 1ADCA 5K01A 3Q85A 3RK1A 3OE4A 2CLMB 4IKOA 4F4FA 2X7XA 3FB1A 5GM1A 5BXQC 4CM4B 3JAWA 5LQKA 1PG5A 4ZTBA 2RHMA 3V4OA 4DABA 1FJXA 4L8VA 3NQ41 2WF8A 3AHJA 4O4LA 1W75A 1PEDA 4PANA 5I9BA 2JPDA 2J6CA 2P9YA 3IO5A 4LZNA 1JG1A 1NW3A 1TEVA 4BNWA 1OJ7A 1IN8A 2W0MA 3O6VA 1XRSB 2HHAA 5FTNA 3AIIA 2HCTA 4G85A 5E2AA 1K98A 2JIDA 1OT3A 1AGYA 2OLKA 2AG8A 1XO1A 1EDEA 1U28A 2I9KA 4YRIA 1ZGGA 3TJRA 1SPXA 4HTFA 1PFWA 4C7KA 4OXNA 1CZKA 5IPFA 1LTHR 3OZDA 1U8ZA 1Y4UA 4X85A 7AT1A 5AJHA 3IPLA 4H1VA 1X42A 1RXEA 4LPKA 4E22A 4KJZA 1NVAA 5AK5A 1KR2A 3AXTA 5JMOA 2ZTMA 3KUXA 3QTLA 4GZLA 4X1IA 2ERXA 3GFBA 8AT1A 3CWZA 4J0QA 1CRLA 3DWFA 2VJKA 3KQMA 1HDYA 2OYCA 3OLYA 4DLRA 4PYMA 5B37A 1CFJA 1C7FA 1K8QA 1HDIA 4LJAA 4E13A 1NP6A 1NXTA 2YMMA 4LZOA 2GTHA 1WULS 3UH1A 4B6GA 4E7OA 3L02A 1N1GA 2GTPA 1DWQA 2IOFA 4AZWA 3MBOA 3D7MA 3OBIA 2JGEA 3WGUA 1WXIA 1KXZA 2YWDA 4CNBA 4IV0A 1P4JA 3I2KA 3ANSA 4R01A 2BGKA 3T7IA 3UBMA 4DBZA 4PSKA 2NZYA 5K8TA 3HJFA 1TJPB 3KALA 1H69A 3DGFC 4QQKA 4R8MA 1MC5A 5IKXA 1FUKA 3IE1A 4MUMA 2MYPA 5HK8A 2YXBA 5LDHA 4DCSA 4PO9A 1TJYA 4TMZA 3WZMA 2QP9X 3F98A 3GLGB 1Y6FA 1LDGA 2Z1DA 3W04A 1KFBB 3OCZA 1WNTA 2VTVA 3WWDA 1EWKA 4B3BA 8LDHA 5L9AA 3CJQA 1QS0A 2FRVA 5JO9A 3WKBA 5K09A 4B6OA 1M1NB 2B0CA 2IDZA 1SQ5A 3KJFA 5DKFA 5GOTA 3T3GA 4AECA 1R27A 1ACJA 4IKEA 4YP1A 1RC8A 4OX9B 4G8JA 4HLDA 1JG3A 3DR3A 1E2HA 4RPCA 2VDMB 3UT5B 5KOHA 2H85A 3NV7A 5I8WA 1ILEA 2BW0A 3OZTA 1SQGA 2C95A 4KVGA 4AKEA 4MWOA 1OROA 2PANA 5FUWA 3HFRA 4EG8A 4EZIA 1BXGB 1NFRA 2IQ5A 5EHQA 1RQPA 4YP9A 3WP1B 2QJOA 1Z5PA 3K1AB 4BMSA 4EG0A 4AUEA 3NAQA 1Q19A 3WSVA 4TXJA 5CHYA 3JWHA 2ZAGA 3MELA 4PU0A 3SQOA 4EPWA 2Q6IA 4B2YA 1SXJC 1UMDB 2QMOA 3P9CA 1ZO8A 2O57A 3MBKA 2F9FA 3H9EO 2OYSA 3PZBA 2XNSA 5TVGA 5A2QA 4PO8A 3WIBA 4K3VA 4CCWA 2R47A 5CG2A 2I8LA 1DC4A 3DPUA 3JQPA 1Z6TA 3LK6A 2HOQA 2VHXA 2PTHA 5BUSA 2VYVD 1M0WA 3DE4X 2AOVA 3TNDA 2A58A 3GAZA 5BSFA 4MHOA 2O4CA 3HCBA 5H5JA 1TW3A 1E0JA 3BFPA 5HTKA 4E46A 1F12A 2BBTA 1ZMBA 3GYGA 4CQJA 1JL3A 1WMEA 5FI0B 1KQOA 3EG5A 1MIOB 4EJ6A 4DNXA 4QRIA 2UXCB 5DHRA 2ES4A 2GFHA 3EA5A 3PTLA 5EKSA 4LYJA 5EKDA 4MR9B 3BA1A 2HO4A 3LRPA 1PDVA 2G76A 3SXPA 2J67A 3AR3A 5LB4A 3TDNA 1YKGA 2I2FA 3P9KA 3HKDA 4JOCA 4NCXA 5TS3A 1MOQA 3U0VA 3AEKB 3RVNA 3EISA 3HU1A 1A9PA 4KEAA 4MYTA 1Q14A 3ON5A 2QK4A 4YQYA 2R8OA 1A2QA 3EHEA 2W4IA 3EEYA 2A5YB 3C5EA 3FPJA 2NZ2A 3QELA 4KQIA 1GA6A 1RIFA 2PXCA 1BE0A 5KMGA 5B5SA 4I0WB 2ZIEA 3L8MA 1NDUA 4QU8A 2NO7A 2H06A 2EIHA 1JHXA 4RPKA 1XYVA 3PEEA 1Y48E 4WZAB 1Q0ZA 3WLQA 2Y3IA 2EFHB 4TN1A 5K8CA 3X1JA 4AX4A 2ACVA 2VLIA 2BMVA 3G7SA 1O0BA 1LPAB 4NYIR 4R81A 5JFOA 1NHWA 3RSZA 2LZ0A 2OORA 1UDBA 4KVZA 4NHOA 3OAAD 5KYUB 1W6RA 3NYRA 2ZSHA 4BVJA 3GDWA 4F4CA 4R0NA 4BECA 2A30A 1QGDA 2QE7D 4AKHA 3EEIA 3KEFA 4AS3A 5FOTA 3H2YA 3HCDA 1EPUA 3QNUA 5F7OA 4Z53A 3K6SB 2OGUA 3FNFA 1SRQA 2F1IA 3U5TA 4Q9NA 1RFLA 2FFHA 3G0CA 5JSQA 4MVJH 4G0XA 3D1LA 5AJVB 4B6PA 2QGFA 4LZJA 2CE2X 4BO4A 1KO5A 1HFJA 5JAHA 1KIMA 3RU9A 4BNJA 2OWDA 4AJ4A 3H9GA 3I45A 2XYVA 4FR2A 4XYBA 3R24A 4QU0A 5GM2A 1XAGA 1M10A 2UYGA 5DSTA 1ZUWA 2HH9A 2AG6A 3OJLA 4JLBA 2V3WA 2C2XA 2XSZD 2BCJQ 3LY7A 4B32A 1KEEA 1ZI9A 3FFTA 1XWWA 3T5DA 1PWYE 3JZIA 4EEKA 2E4AA 1QYVA 2ZUWA 4F4HA 2CXHA 4HDSB 4Z7JA 3IR5A 5CDFA 4CEJB 3CU5A 3OPMA 4MDYA 3MF4A 4OSPA 6REQA 3DFUA 3DWIA 4HAVA 1A9YA 1QHHB 4BWFB 4AY4A 1QIKA 2FF5A 3SQXA 1C9DB 5KAMA 4Z4HA 2ENUA 3LS2A 1W36C 2MOKA 2YIDA 3UZUA 1NDQA 1EVKA 1L7BA 3QF4A 4JGGA 2FXIA 1JIJA 1UC8A 2G0AA 4Q1BA 2EFEB 2WVHA 3B20A 1H6AA 2ZYHA 3ZCQA 3BTSA 1B43A 2IF0A 4B3FX 2ZUSA 5EJGA 3EOBI 4JL6A 3F6BX 3GUUA 4F11A 2P5UA 1X1DA 4QQRA 3UNXA 3J7TA 4ID3A 4L5AA 1ADJA 4TV9B 4DMHA 3SVLA 4FXPA 3E84A 4YRNA 2WEKA 4HRVA 5EC8A 1GZ7A 1UBNA 1RW4A 3T5GA 3Q4GA 1SOUA 4ZT3A 5JHHB 3HTXA 1AQYA 3EJWA 3THWB 1CE8A 2AH5A 1PIWA 5K3FB 3ZWBA 4F4UA 1UWLA 2DQSA 4CLDA 3VRHA 1JVBA 5A4KA 1YC5A 1QPBA 4OOFA 3NTUA 3H5TA 5FHRA 4UUAA 4C1NA 4RE6A 2QUJA 3FYHA 3U3KA 2H7YA 1P91A 2XTNA 3DBRA 1N6PA 3RSOA 3AW8A 3M6XA 5IC5A 4A82A 4DNOA 1BYUA 4JX8A 3D6VA 4D3FA 2WAOA 1OZAA 3OZAA 4J43A 1H3NA 3VSBA 2FZKA 3THOA 1OWMA 1WPRA 2ASEA 5G0SA 4GG1A 3DD1A 3FM9A 4RQUA 4PBSA 4GMHA 4RS3A 3BIWA 4RH1A 2TS1A 2O6LA 4AXXA 5LKAA 1O6GA 2G5TA 1RADA 1MX3A 2OESA 1NU6A 1R10A 2XVAA 3AIOA 1X9IA 4QXOA 3LT4A 1TIBA 1EDBA 3IAUA 4KN8A 2GZ3A 5DI3B 2OHOA 2XXAA 2J4FA 1E3WA 2NYUA 1F60A 3VOAA 2JGDB 3BJEA 3ZBTA 1G3RA 3OBBA 1P1IA 4Z0TA 5NULA 1YCFA 3T41A 4DE5A 3GCWA 4JXKA 3TXAA 4CMGA 4ITRC 3OICA 1T9DA 3CLHA 1NN5A 1DLJA 2RONA 2COEA 2V98A 1O97C 1E64A 4ND3A 4V1CI 5JT1A 3DCIA 1F2UB 3CC8A 5JSZB 1H0RA 4ON9A 4E1BA 5AYVA 4J9UE 4FDLA 4NONA 3U1VA 4YP5A 2NUAA 1T29A 2MSEB 2QZ9A 5THQA 2ZBFA 4KI0A 4DKXA 2PAFA 4UM9B 2E4ZA 3ND7A 3KNZA 3S2FA 2XMGA 3B1JA 1PWEA 3IDSA 2VDPB 4LRTB 2FR8C 3WAKA 2VF2A 3B1YA 1N2IA 1E3DA 4OO3A 1JSLA 3ACDA 4P3XA 3SQNA 1B1CA 4QPNA 3AETA 1YZUA 4W5HA 2BZ0A 5F3DA 5F73A 3L01A 4MRMA 1VBKA 2CDCA 2BEUA 2PZAA 3KZKA 4KCGA 4P3NA 4QDZA 5DYIA 4LNAA 2M2IA 1ONBA 1MC8A 1VCIA 4HUQB 3SYKA 1NKSA 2BTQA 3E82A 1MPTA 2OQVA 1ELOA 1ZM7A 2AI3A 3U48A 3BWCA 4D44A 1ULAA 3IPAA 4ISCA 2V8OA 4EF6A 4PNEA 1TCAA 3TZ6A 2H9AA 3O0TA 1T0JB 4ME6A 4RZSA 1XLTC 4PAWA 3ZW9A 3BXEA 5J2UF 3UT0A 4JB3A 2V7UA 5JTTA 2PUBA 3KVOA 4DG5A 1D5CA 2QYSA 5IW8A 3S27A 2DYKA 5GOZA 3NBUA 1FBTA 4CHGA 3ER8A 2CKMA 2BJHA 1O95A 2H1FA 4EEZA 1ADGA 4OBWA 3INNA 3TG8A 1ACLA 3E27A 3WA6A 3BXHA 4LHSA 5TMEA 5HZGA 4Q7QA 5JZMA 1V8FA 1F38A 3K9GA 5SYAA 3T4XA 3UC5A 1XQXA 3MAJA 3E58A 4M1OA 1E96A 2KQUA 3NVMB 2A5FA 4UBKA 3TQHA 3BC1A 4QC2A 4TSFD 3Q6IA 3IUMA 3IS3A 2AFRA 1SXHA 2QNIA 4FUTA 1QCYA