4ZGWA

Short-chain dehydrogenase/reductase from serratia marcescens bcrc 10948
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
245
structure length
245
Chain Sequence
HPLQGKVAFVQGGSRGIGAAIVKRLASEGAAVAFTYAASADRAEAVASAVTTAGGKVLAIKADSADAAALQQAVRQAVSHFGNLDILVNNAGVFTLGGTEELALDDLDRMLAVNVRSVFVASQEAARHMNDGGRIIHIGSTNAERVPFGGAAVYAMSKSALVGLTKGMARDLGPRSITVNNVQPGPVDTEMNPDAGEFADQLKQLMAIGRYGKDEEIAGFVAYLAGPQAGYITGASLSIDGGFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords short-chain dehydrogenase/reductase
publication title Stereoselective synthesis of (R)-phenylephrine using recombinant Escherichia coli cells expressing a novel short-chain dehydrogenase/reductase gene from Serratia marcescens BCRC 10948
rcsb
source organism Serratia marcescens
molecule tags Oxidoreductase
total genus 89
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zgwA00
1E3LA 4CV3A 4D3DA 2NTJA 1Z6ZA 1ZJZA 4FOSA 2AQIA 3KLPX 3H9GA 4PIVA 4WOKA 2ZJ0A 4B3JA 1EQ2A 3VH2A 1Y9AA 3QLJA 1WDKA 2EJVA 1VRWA 3GLQA 1HLDA 3PDJA 3WLEA 3QHAA 3L4BA 1ENYA 1VSUA 2YFQA 3UW3A 4RVDA 3TDKA 1RM4A 2O4UX 1OAAA 4RLSA 1LBEA 2I99A 4C4OA 4IINA 1PEDA 4EZBA 4CLHA 3ORFA 1BG6A 2O23A 4RQUA 2B4RO 1EDZA 4ZHSA 1YB4A 4NJMB 3GY0A 1CWUA 3HFSA 5CG2A 4JLWA 3ABIA 3GDOA 4OKIA 5KWEA 2GN8A 4PG5A 3HQ4O 3GHHA 4PG6A 4J2HA 1YBAA 5CFZA 5AXDA 1F8GA 2GLXA 2HCTA 5DCYA 1NFFA 2NNLD 2W2LA 3E18A 2PY6A 4XQEA 4BMNA 1Q0HA 2Q50A 4B8WA 1G0OA 4MVJM 1R0KA 4PVDA 2CUKA 2J3IA 1JA9A 1E6EA 1S7CA 2X4GA 2VWQA 3K9QO 3R1IA 3U4IA 4M55A 3FWNA 1GQYA 4MVJE 3ZU3A 4DGSA 2J3HA 1EFLA 3RUCA 1T1RA 1PS0A 4QECA 2UVDA 4UVHA 5CDUA 4CV2A 4YT5A 4K26A 4ND5A 1ISHA 1P77A 5HBRA 5AXBA 3WYBA 4R4JA 4BL5A 1Y8QA 4CLXA 5L4LA 1LDMA 2EIHA 3BMQA 1B14A 2I3AA 4YJGA 2ZIZA 1FDUA 4TVOA 5U4QA 3RC9A 3Q9NA 4WPGA 5IFLA 2Y0CA 3EMKA 1WAMA 4YA6A 1VJTA 4BNFA 4Q3AA 2B36A 5ITWA 2IYOA 2Q3EA 1AUPA 2Y1GA 2WD8A 1Y81A 3DFUA 5A5EA 5A04A 3ITDA 1QYXA 4O0LA 3GNTA 1DLJA 4AJOA 3PTZA 1MXFA 3EVNA 3OJLA 5JCXA 5EIOA 1P0CA 1VL8A 2QRJA 1E92A 3S2FA 1O89A 1XSEA 3UCEA 3ZV5A 3WGOA 3JD1A 2GN9A 1DAPA 2G17A 4YAIA 5HWSA 2C5AA 2Q4BA 1V3TA 2X6TA 3VZQA 3PJDA 3FPLA 5LCXA 4CV1A 4XYBA 4RF5A 2EGHA 2PWZA 4NH4A 2HU2A 1M6HA 2WE8A 2R6JA 3PVZA 4KUHA 2VZ9A 5JDIC 1KY4A 2ZTLA 3JYQA 2F00A 3KOUA 1M75A 4KUGA 5L3ZA 3WIDA 3VZRA 3W6ZA 2NU7A 1BXGA 1YQGA 2UDPA 2G76A 5TX7A 3QWFA 2E49A 4H16A 1VLLA 1R0LA 3I9NA 4HNGA 1IZ0A 4NFSA 3AM3A 3G17A 3HDQA 2Y68A 1U5CA 2DUUA 3K96A 2VWGA 3KSUA 1PJBA 3KYBA 1NWHA 2Y1OA 5JDIA 3RJ5A 4BNGA 3ZWMA 1DC6A 2AQHA 3M6IA 1N2SA 1UZNA 1Z74A 4U5QA 4C7KA 2PZJA 2FRDA 4XYLA 1SZJG 3ZDFA 2OOSA 1ZIDA 3WNVA 1HDOA 3EGOA 3NJ8A 4XGIA 3MJTA 3ZNNA 1MXHA 2UUPA 3KHUA 4PCVA 5G0WA 2JD1A 5BT9A 1PX0A 1ZJYA 1YDWA 1R0SA 5JW6A 2A94A 3FNGA 3BMNB 1HDGO 4GH5A 5IAAA 1YVEI 4TZKA 1DIAA 4CM7A 2HUNA 4L74A 5COQA 3OA2A 4LSMA 4WLVA 1XYGA 3DBHB 4OKNA 2JAPA 2VHXA 2VCYA 2GZ3A 2GF2A 2QZZA 4GSKA 2POQX 4MIOA 3CINA 5CDGA 4FOOA 4PVCA 4CLEA 1R16A 1WZIA 5B4VA 4BUCA 3VTZA 3KSZO 1ORRA 3H9JA 2EW2A 4J9VA 1YBVA 3AY7A 4ESOA 1HWYA 2B35A 1NQTA 2CMDA 3FSRA 1VJ1A 3ZNPA 4D0SA 3BMCA 3TOZA 4EW6A 1WMBA 1XGKA 1GCUA 2BGLA 2RHCA 3GMDA 5GZ1A 1ULUA 4HWKA 4CMGA 1ONNA 2WTBA 2Q1SA 7ADHA 2C2YA 4B4WA 1P1HA 1P1KA 4WCFB 4WUVA 5EESA 3LQFA 4J3FA 1H6DA 4RZIA 1LDEA 4MOWA 2QW8A 2J6IA 2D5AA 2DKNA 1E5LA 3WGZA 1HXHA 2CZCA 5ILGA 2X5JO 1LLCA 1ISGA 3X2FA 3E03A 1NQOA 4R9RA 5ILOA 2PTGA 2PGJA 2Z1MA 3M2PA 4NK4A 4RPHA 2Q1TA 2YFHA 3LT0A 5A9TA 4X54A 1JWBB 4GI2A 4ZQFA 4WLOA 1WDMA 4CQMB 1O6ZA 3RBZA 4TRJA 3E82A 1JVSA 5I9LA 4N54A 5COAA 3N74A 3WJ7A 1MB4A 3B70A 3IUSA 1IE3A 4HFNA 1HSOA 4B7UA 1T4DA 1GY8A 1P3DA 4UVIA 5ER9A 5JS6A 1U2DA 2HK9A 4JP3A 2JCVA 3WGYA 3ZV4A 5H83A 4Y6SA 4QO8A 4FFMA 5ICSA 3PGJA 4YWJA 3ASVA 2OP1A 4AJHA 3TPCA 3LDHA 4CQLB 4RF2A 1E7MA 1X7HA 3ST7A 3ICPA 3F6YA 1VPDA 4N5LA 3H5RA 3AM4A 3RUDA 2O3SA 5GMOA 2J3KA 2YYYA 1T2AA 2VTDA 1ZW1A 2BF7A 2HKIA 3LK7A 3I9MA 4BNIA 5EL0A 3OEWA 2X7HA 4OSPA 1KBZA 1P31A 1GCOA 2RCYA 4I9NA 5U9CA 3KUXA 3GK3A 3H9UA 2PD3A 4BNLA 3GAFA 1UAGA 4D44A 5TIIA 4OH1A 2NQTA 1W4ZA 3C1TA 4B79A 1V0JA 4YRAA 1H9AA 3DFZA 3ROQA 3WR5A 1HYGA 3P19A 2ZJ1A 5G0TA 3N7UA 1JKJA 1C3VA 2BKAA 1YKFA 3GDGA 5TS3A 1O95A 2HJSA 4CL3A 1BWSA 4RDHA 3ETGA 3GGOA 1A4UA 1IL0A 3FPCA 2FSSA 5KIAA 1LRJA 4QEDA 4NI5A 3H3JA 2Y1DA 1HRDA 1C0LA 4WLFA 4B4VA 4MVJP 3U9LA 3JQAA 2XOXA 4N18A 3ANLA 1LC0A 1IUKA 4UREA 3F9IA 4AJNA 3KLMX 1SEPA 2NM0A 3PQEA 3GAZA 3VPXA 1DSSG 3WNQA 1O8CA 2IE0A 1O0SA 5G4LA 4XJTA 4CUZA 4EUHA 1AGNA 4QQRA 1HF3A 3MJSA 2UUOA 2VOJA 3UAGA 5DZSA 3ZWCA 1PJLA 2WM3A 1ZK4A 1KVRA 3KRTA 3JQGA 2VRCA 3WTBA 3GF4A 4IDDA 3S55A 3E1KA 4DMLA 1U8FO 1YL6A 4YAEA 5ADHA 4ALMA 1FK8A 3NTQA 4IJUA 4NHEA 1XU9A 4QXMA 4I9HA 1PZFA 5BSHA 2HSDA 3BMOA 4L76A 1V6AA 3QVOA 3WQRA 1QG6A 1ZUD1 3I1JA 1A4IA 3W6UA 4EBFA 4Q3BA 2O2YA 1H9BA 1DFHA 2Y66A 3FTPA 1Q7GA 2QZ9A 4CR6A 4L4RA 3H2ZA 5CPFA 2I9PA 1G1AA 4EJMA 4B3HA 1LXCA 4CLOA 3INGA 1T1SA 4BNJA 4E30A 4FD3A 3NT4A 4ZQEA 5G0VA 3AOGA 5JO0A 4YXFA 3KEOA 4Y98A 4Z9XA 1E3EA 4A10A 1TVEA 2VRCD 3WMWA 4CM1A 4IMRA 3DOJA 4BB6A 1ID1A 4CLOB 1PS9A 4JJIA 1QLHA 4KZPA 4FC7A 3DQPA 3NTOA 2IZZA 4BNYA 1ISFA 1X7DA 3OJ0A 4Z9FA 2UV8A 4B7CA 4IQGA 3QV1A 2DM6A 3TZ6A 3S2EA 4G2NA 1EZ4A 3PIIA 1Q0LA 3DTTA 4BNMA 4R41A 5CPBA 4ITUA 1DHRA 3WQQA 4YDRA 3E9MA 1M76A 2RBEA 3DZFA 2I66A 4W9NC 1KOLA 4KP7A 4HUJA 3LLSA 2WYVA 1IZ9A 1DHTA 3VPGA 3MTJA 1GTMA 1DC5A 3UFXA 3QSGA 3CTMA 4UVDA 5CDYA 3DTYA 1RPNA 1DIRA 5CP8A 1Y7TA 2DBQA 3L0DA 2A9FA 2YW9A 2X9VA 4TQGA 5G0UA 3FHLA 5MDHA 2OP0A 4W9NA 3HZZA 2PKQP 1YQDA 1Q2XA 4RPKA 2BFMA 3KB6A 3RIHA 1MV8A 5AXCA 3TZHA 1GFSA 4BNZA 1TT5A 5G4KB 5C7IO 2EP5A 2YY7A 1EBUA 1XEAA 4YJHA 4DL9A 3JQCA 3IOYA 3KO8A 4RQTA 3PQDA 5JNLA 4FC6A 3GA0A 3DEYX 1Z73A 4JJFA 4M49A 1ZFNA 1A9ZA 3HB4X 2IEDA 4JBHA 2ZB3A 1FF9A 2Q45A 4CM8A 3LZ6A 1HE4A 2Q99A 1KVUA 4XQGA 4IS3A 2YQ5A 3TL2A 3TZQA 1XELA 1SMKA 3RAJA 4MPDA 1QKIA 3W8FA 3E9NA 2AE1A 1OOEA 1YRLA 4BO0A 3V1TC 5KVSA 3M2TA 1Q7CA 5FWNA 4DBZA 2C0CA 3Q3CA 3GEDA 2Z5LA 1F14A 4E4YA 1VL0A 3E9QA 2DTDA 3NV9A 4CL8A 2NV6A 4YT2A 3B1KA 1U3UA 2C2XA 5T64A 5IDQA 3AFNA 2A92A 2AEMA 3OQ6A 4CPDA 2QYSA 3PHJA 2O3RA 1N5DA 1ADCA 1NR7A 1QLJA 1XQ1A 3C24A 1LLQA 4W99A 4BMSA 3DWFA 2ZKLA 3GN2A 1OI7A 3VH1A 2CVQA 2Q49A 3GEMA 2FOIA 1QP8A 5JMPA 3WXBA 3DBRB 4I9UA 3V2GA 4BO1A 1Y5MA 1PGJA 2V6MA 5JFOA 3IP1A 3GRKA 2I65A 3WG9A 3FNFA 5A9SA 4OXNA 4F3YA 1O9BA 2J5QA 5JY6A 5BR7A 3IS3A 2VQ3A 1WZEA 3RVDA 3OHSX 5KVVA 4IGEA 3FBTA 1K6JA 2DLDA 2W98A 1N9GB 5JCJA 3RC7A 1PZEA 4FFLA 3FF4A 3KEQA 1JN0A 2FPGA 1LQTA 4D0RA 1E7SA 1PJCA 3CUKA 1J0XO 3LT1A 2RH8A 5LDGA 2GRAA 1Z82A 3EVTA 4WECA 1D3AA 5TSDA 1X15A 1A71A 1E1LA 4XWYA 3FWZA 4P4LA 4RVFA 1CJCA 3H5NA 3ROKA 1LJ8A 3WLFA 3ZV3A 4WEQA 4AG3A 4W7IA 3RSHA 4PRLA 2GN6A 1EMDA 1YB5A 5CAEA 3TFQA 1HE2A 1A9YA 2CF6A 2GNAA 3UKOA 4BGVA 3PEFA 1NP3A 4LRTB 4U7WA 4DA9A 4FJ0A 2BRUA 5FEUA 1PQWA 1KS9A 3GR6A 4MKZA 3I4FA 4PLHA 3MOIA 1Y8RB 3PJFA 3Q0EA 3IMFA 3PLNA 4NDNE 2PGLA 3NT5A 2H5LA 1BTOA 3CPSA 4JQCA 4RO0A 2DPHA 4U0JA 2P5UA 2W4QA 4B8ZA 2CVZA 3D3WB 3EAGA 2X22A 4E13A 4UEKA 2PKRA 3WIEA 3DC2A 4P22A 3P7MA 3OF2A 5CEFA 4J0EA 5ITVA 1QYWA 1SNYA 2Z1NA 3NRCA 4YAKA 1LLUA 3S8MA 4RPGA 1HYEA 3V1UA 4XYGA 2VWHA 5DNAA 4RLHA 3I6IA 4RZHA 5KVCA 4AJ2A 3JQ7B 2VTEA 1Y6JA 2NSDA 3WGGA 5F1PA 2VUSA 3O38A 3D1LA 3GZNB 3RUIA 5EN4A 3KXDA 4K9DA 1WPQA 2AMFA 4JJGA 1ARZA 2VZ8A 2RIRA 2PH3A 3ZV6A 1I24A 1V35A 2HRBA 2EKQA 1UAYA 3MJCA 2GCGA 3PHGA 5FYDA 4GL4A 1ISIA 1N7GA 1U7HA 3EYWA 4LGVA 4WKGA 3TF5A 3D5QA 4WK6A 2CNBA 4MVJG 4R3NA 1LUAA 3ON5A 3LLVA 4PG4A 1GL3A 1XLTA 3HG7A 3OIGA 1UR5A 1E1KA 2DT5A 2YV2A 3WB9A 1VJ0A 1I8TA 4CODB 4D43A 3FD8A 1ADFA 5JSFA 3ONDA 4FB5A 4ZRNA 1SEVA 2CD9A 5IXYA 3NJ4A 1WLYA 5IF3A 1ULSA 4W7HA 3LSYA 3F47A 3ZWVA 3KM0A 4YB8A 1PJTA 1BW9A 3VAZA 3HJAA 3VVCA 1WDLA 4HADA 2AE2A 2YHUA 4ID9A 4WLEA 3INTA 4IDAA 1YE3A 1PTJA 2PLAA 3FTNA 4LVUA 1CETA 3TZKA 4Q3NA 4DBVO 1BRMA 5L4NA 1DC3A 2J3JA 3ZW8A 4FCCA 4OXKA 1AN9A 2YDXA 3STHA 3HNPA 4DVJA 2EHDA 4AVYA 5HTOA 3LYLA 2E48A 4BOYA 2C59A 1VE9A 3VPSA 1YB1A 5L40A 4KMSA 4DLBA 3E6AA 4CMHA 5TRTA 4TRNA 2D59A 3DAGA 3DDNA 3JQ9C 2V7PA 2IXAA 1MG0A 3AUAA 3L4SO 3PK0A 5FF9A 5JC1A 2ZTMA 5T8KC 3ZN2A 1QYVA 3JQDA 3ZZNA 3RQSA 4RCVA 4HNHA 3BHIA 1PQPA 1NHWA 1Y9EA 1RYDA 2NWQA 3CMMA 2DFDA 4MVJI 2D3TA 3VC7A 4BKUA 2DBRA 4QSMA 3LC1O 1YQXA 4K1LA 4BO5A 1PZGA 4PG8A 2GZ1A 4IDFA 4Y8VA 4IDBA 4BHTA 3HSKA 3JQ9A 1PGOA 1F0YA 4UUPA 3UH1A 1UUFA 2ILTA 3AUSA 3L6DA 5AYVA 5T8KA 1XA0A 1ZK3A 3I9OA 4Y67A 1OMOA 1ZXBA 3GMSA 5HM8A 1Y8QB 4L4XA 4CMKA 1XDWA 2IDZA 5K0ZA 3OBBA 2E82A 2HMSA 3PJGA 2R2GA 4Y6RA 3BMQB 2ZCVA 4KUEA 2HMTA 1ZKMA 4YJGB 4DIBA 5F1OA 5DF1A 2ZATA 5C7OO 5K6AC 2NQ8A 1PS8A 3O03A 5IZCC 1DBVO 3R0IA 1SPXA 3RBXA 3TRIA 4BKQA 3S2IA 1XG5A 4DC0A 3BXXA 3D4OA 2BFAA 1Q7BA 3GFBA 3W8EA 1UDBA 1JKFA 1ZNQO 4GQAA 2FR0A 3ZHBA 1IY8A 4ND4A 1YDEA 1DDOA 3RU9A 1IHXA 1AXGA 2OUIA 4J7CA 1ZSNA 3E5MA 1KVSA 2J8ZA 2XXBA 1AE1A 3QWAA 4ND3A 5K6AA 1M66A 4FW8A 1DIBA 5CDSA 4RVHA 5IZCA 3RJ9A 1EBFA 3FBGA 3JQEA 5GZ6A 1K3TA 4AJ1A 4CMCA 3EDMA 2HJRA 1NVMB 3VDRA 2B69A 3QVXA 3BIOA 4H15A 4IBOA 4YBZA 4IQ0A 3PI7A 1GUZA 3A1NA 4FDAA 3MJEA 2DBZA 1UXGA 4UEOA 3WGTA 1D8AA 1W6UA 2EGGA 3TQHA 1BXGB 1T24A 4HKTA 5A06A 1JU9A 4ZICA 3ASUA 1TLTA 4IXWA 3H8VA 2NU9A 4A73A 3DHYA 4PLGA 4L4SA 1B0AA 4TKLA 5B4UA 2UAGA 1BHSA 1N1EA 2PFGA 2BMAA 2TMGA 4UULA 5ENVA 5JBIA 1HYHA 1XHLA 1E0DA 2VYND 4BNUA 4LW8A 3MTGA 2H63A 3DAPA 4KTTE 3NUGA 2E4AA 4XJSA 2EP7A 2FSVA 2PD4A 3HDHA 4FFNA 5EPOA 3W4IA 4YCAA 1UXHA 4ZRMA 1EK5A 3C1AA 2CF5A 2RAFA 6ADHA 5DCWA 4FPXA 5KJ6A 2OL4A 3LF2A 1I3LA 3U09A 3V1YA 2GZ2A 2IEBA 3WFJA 1P1JA 3I52A 1OC4A 4N5NA 3A4VA 4L9RA 4NR0A 3UGKA 3WTCA 4YYZA 4U6SA 2PGDA 1LSOA 5JAIA 3PJEA 1KC1A 2NVUA 2JJYA 2ZTUA 4WNCA 4BV9A 4F6CA 1JWAB 4CLRA 1JAXA 2DTXA 4HFMA 4CR8A 4UUOA 3DHEA 4XYEA 1J4AA 4BGIA 2YHIA 3IQDB 1P1FA 2CVOA 3LF1A 2Q2WA 4YJDA 8ADHA 3PLRA 5L45A 1KEUA 4UEJA 4B3IA 4ZQHA 4R01A 2SCUA 3O26A 2PZMA 1P1IA 1W73A 3DZJA 2VUTA 1UXKA 4BNTA 1V8BA 5CHEA 5ES3A 2IYPA 1DRWA 4ZN6A 2GUGA 3RC1A 4R1SA 4RVGA 3DOOA 1VSVA 5ICMA 1LC3A 3Q11A 1I30A 3NT2A 3PZBA 3QJ5A 2HAEA 3I23A 5JAQA 4CM4A 3K5PA 4D3FA 1MC5A 5KCZA 2HK8A 3IP3A 4PLPA 1V3VA 2YV1A 3BMCB 3PXXA 2C29D 1R4NA 1EUZA 1VC2A 4MVJH 4J4BA 1UDAA 2VWPA 1W0CA 2B37A 2PR2A 3M1AA 5A5FA 2DUWA 3I5MA 5DT9A 4GBJA 2HO5A 1QYCA 4J1SA 4KDFA 4RL6A 3VPHA 4E33A 1C1DA 2DVMA 3ZH2A 1B3BA 5ENDA 2OBNA 5A03A 3PHIA 5COBA 2B4QA 2FMUA 3DAFA 5HRUA 4R68A 5C5IA 2Y0EA 3COSA 5A02A 3ANMA 3PFFA 3OQ1A 5DOZA 3PDUA 4R5MA 4E2YA 1U3WA 1BDBA 3B6ZA 3CMCO 1IULA 1C1DB 3GPDG 1ONOA 3CZRA 4IIVA 4XZ3A 1F06A 4E5PA 1M67A 3TNLA 5EINA 3EY4A 1B16A 1I33A 3HUDA 1EUCA 2WD7A 3WWZA 2PZLA 4I5DA 3RFVA 4FJ1A 2X58A 1E3WA 1FMCA 3ZNQA 3DBLA 4JIGA 6LDHA 1T26A 3JD3A 3GNSA 2B5WA 4Q39A 5ER6A 1CYDA 4DUPA 4Z0PA 3DB2A 4YT8A 1XKQA 3JQFC 4M87A 5A4DA 5C3MA 2DBVO 3RD5A 4WJZA 3D7LA 1NPYA 1I2ZA 4BV8A 4JNKA 3CSDA 5BNIA 4OL9A 3MZ0A 4RVSA 2CDAA 3RWBA 4A03A 1NBOA 1D1SA 1GZ3A 2Q2VA 3IJRA 4EEXA 1NHGA 2P2SA 4CQMD 4RORA 3FR7A 3ZNOA 5U1PA 4WNIA 5EMHA 1QYDA 3QP9A 4KTVE 3FI9A 3JQFA 4HP8A 4K28A 5LC1A 3ZU5A 3F5SA 3VTFA 1SC6A 4CMIA 1DB3A 4E12A 1PIWA 3BAZA 3F4LA 4XR9A 2X0NA 1PL8A 3I9LA 3FR8A 4U0KA 4BMVA 1QV6A 3PQFA 1YJ8A 3WSVA 2FY8A 4OM8A 1SAYA 3AU8A 4BO6A 3DZGA 4LMPA 4AJ4A 1WWKA 3FRJA 4R69A 2D0IA 3DOCA 1DRVA 1WW8A 1IPFA 1RKXA 2Q4EA 3WYEA 4DMMA 3AFMA 4MP6A 4OYRA 1EE2A 2Q46A 3DZBA 1CERA 2WYUA 1J49A 4B4OA 3ADOA 2X8LA 4EITA 3JQAB 1CDOA 1LQUA 1WXDA 4GGPA 5DBIA 3DZHA 3GDFA 3ETDA 3RKRA 3AK4A 4YJFA 2LDBA 3RASA 1DIGA 1GV1A 1UP4A 2PK3A 4U8GA 3VKUA 1ZK1A 4HX5A 1RM0A 2ZQYA 1QV7A 4JBIA 1PWZA 3QWIA 3PWKA 3ZWBA 1R6DA 2NACA 1WMAA 2A35A 2BHLA 3F46A 4JK3A 3WOHA 4MIEA 5IG2A 1HTBA 5JDCC 1PJ4A 1U8XX 2VHYA 1ENZA 3JQGB 3F3SA 4R1UA 1NYTA 4IIUA 1YO6A 1GDHA 3K73O 2HMWA 4IS2A 5JXWA 1LLDA 2UYYA 2W2KA 3QVSA 3K8ZA 4RV9A 1T2FA 1NAHA 1SB8A 3KYCA 4OGWA 4W82A 1HKUA 4IDEA 3WYCA 1E3SA 4RPJA 1ZH8A 4Z0HO 4D79A 3BMOB 4ZA2A 3G3EA 5JDCA 5BQFA 4WASA 2G82A 2W2KB 2XAAA 1HLPA 3IIEA 1DRUA 3AU9A 2C7GA 4Z3DA 4M89A 1X0XA 3K2BA 4WLUA 4WOJA 1C1XA 1JQBA 2DAPA 3KYCB 5TNXA 1ZXLA 3ZWWA 2XF8A 1BMDA 4R54A 1U3VA 1PJSA 1U5AA 1DAOA 4IMPA 3GG9A 5F5NA 3RFTA 4NIMA 2CDBA 5I9MA 1LSSA 2YJZA 3JQ8A 2J5KA 2PA3A 2QX7A 3W4JA 2NU8A 2BGMA 1B8UA 3OECA 4PLCA 3SEFA 4C7JA 4II3A 1LSJA 4H3VA 1I01A 3V2HA 1PR9A 4E2XA 1O5IA 3JTMA 2WJPA 3FNHA 3AI3A 1H2BA 4IM7A 1IHYA 4DPKA 3BTUA 1ML3A 3GZ4A 1KYQA 4NK5A 1U9JA 1NM5A 5MGBA 3PWSA 4YRBA 2ZB4A 1YXMA 3HFGA 2OMEA 1IB6A 4YR9A 3O8QA 1U2GA 2PZKA 4BVAA 4FN4A 2WYWA 4LCEA 4PFJA 4PN3A 4E2WA 4TRMA 3GN1A 4QTZA 3GVHA 1MG5A 3AOEC 1KEVA 4J1NA 4DQXA 1Y1PA 2P5YA 3O8QB 1DJNA 3CH6A 2ZK7A 4GWGA 2AEJA 4FJ2A 4RF4A 5CDTA 5BNFA 1BXKA 3NGXA 5DP2A 4N5MA 2VYVA 4J43A 5TGDA 2ZCUA 2BI8A 4IGFA 3HDYA 1P45A 3JV7A 4IUYA 4KWHA 2BFPA 1FDWA 1BGVA 1E7WA 3SLGA 4ZJUA 3D5TA 2QRKA 1GPDG 2FWMX 4YACA 2VZ0A 4BO7A 2Y1FA 1TT5B 4KWIA 5TQVA 1HSZA 1PL6A 1UDCA 3AOEA 4O59O 4YJHB 3OH8A 4XGKA 1DIHA 4JX8A 2FN7A 3PGXA 1H93A 3G0OA 3GG2A 5C7LO 5JLAA 2JCYA 3ITKA 4CM8B 2NTNA 1HDXA 3L77A 3RROA 2Y93A 2GYYA 3C8MA 3PYLA 1V9LA 4FS3A 3GNQA 2NVWA 4TWRA 2QYTA 3INRA 1X14A 1E3IA 4NU6A 3I4CA 1U4SA 4XCVA 1I5RA 1ENPA 2VYVD 3JYNA 4WE3A 4A0SA 5L95A 1GQ2A 3L9WA 2F1KA 7MDHA 1DO8A 3BHMA 2G5CA 3K31A 3ONFA 4DLLA 3DZIA 4ALKA 1PGPA 1ZEMA 1R12A 1E7RA 2P91A 3PHHA 4P4GA 3RBVA 3GUYA 4WGGA 1NFRA 3V5NA 4NBTA 3MJ4A 3A9WA 1LNQA 4FGWA 2Z95A 3H9EO 3OETA 2O48X 3PFWO 3OFSA 3R3SA 4MVJA 1E1MA 3IKTA 1R15A 3WGIA 4I5GA 1EEHA 4ND2A 2QRLA 2I3GA 1MLDA 2C7VA 4CLDA 4HFRA 4TKMA 4GAEA 2QQ5A 1R4MA 1NX6A 5JAZA 1KVTA 1YBMA 4OOFA 4MJLA 2C5EA 5A9SB 1T2EA 2NLOA 2OO5A 1TEHA 3OMLA 4GVLA 4URFA 3GQVA 4PLYA 3RKUA 5TLSA 2IODA 3H2SA 3M1LA 4W6ZA 5L7TA 5FI3A 5JYEA 4J2OA 1EE9A 3MWEB 4YVFA 2GERA 3HN2A 3UN1A 5BSGA 1PGNA 3P2OA 3JQ6A 1OZAA 4FFOA 4DQUA 5GY7A 1MA0A 5JAMA 4DWVA 4E5YA 1X1EA 3CIFA 5JMWA 1LDYA 4HXYA 2Y67A 1IPEA 5EQDA 1KVQA 4MVJD 3H3FA 2OHXA 3MOGA 4J0FA 3A28A 3KYDA 1S6YA 2FZWA 3D4PA 3SC6A 4AL4A 3QY9A 3PHLA 4L0QA 3SXPA 3FN4A 2IXBA 4NG5A 3ZWOA 1AXEA 3WQSB 1YOVA 1GYPA 2IZ0A 5AQ1A 3KVOA 3NTRA 4IZIA 5KKCA 3LVFO 3JQBC 4MINA 1FDTA 1XCBA 1UP6A 3U62A 4XRGA 2PD6A 5B12A 3AWDA 3K2EA 2Y05A 3EW7A 3RUAA 3VZPA 1C0PA 5F3RA 4CMEC 4BO2A 2BGKA 2P9EA 1GUYA 1T25A 3ENNA 2EF1A 1DXYA 2WDZA 2D5CA 3L07A 2WE7A 3SBOA 4P4NA 4XQCA 2BLLA 3ROPA 2O3JA 2JFHA 3C7AA 2JD2A 3BHJA 2JCXA 1H6AA 3H9QA 2EKLA 5I7EA 1E3JA 5AVOA 1NXQA 2O2SA 2OBYA 2D2IA 3GVCA 4R9SA 4A5OA 5FI5A 3IJPA 4CMEA 4UUMA 2VNAA 2VUUA 3GC6A 3JD4A 4E5NA 2I76A 1HL3A 2Q1WA 4Q9NA 3AM5A 3HWRA 4Z6KA 4BQRA 2CDCA 4EJ0A 3ZHYA 1UP7A 2O3TA 1LRKA 5DP1A 4EGFA 5GZ3A 4O5OA 4G65A 1XU7A 1C0KA 1B8PA 5T67A 1R66A 4ALJA 4L75A 3ZU4A 4YT4A 4CM9D 3U0BA 1NVGA 3SX2A 3OIDA 1NNUA 4BO8A 8LDHA 4XB2A 2YDYA 3OP4A 2D4AA 1E7YA 3WGQA 1GD1O 3NDRA 3W4KA 4PZEA 4ZD6A 4IXTA 1EVIA 4DQVA 3U4HA 3ZWYA 3ZWAA 2YV3A 1F12A 1FJHA 2V6BA 3AUUA 3PWZA 2BH9A 1PJ3A 1MFPA 2X0RA 5KNLA 2AXQA 1LEHA 2AG8A 3NDJA 1MGOA 4B7XA 4Y9DA 4TSKA 4GGOA 3L4BC 1P9LA 2ZYGA 2P4QA 3VZSA 3H4VA 3K30A 4D3SA 3Q9UA 4GWKA 4YEDA 1Z7EA 4CJXA 5K9ZA 1JTVA 3EUWA 3OJOA 3OSUA 1BXZA 3GGGA 3CE6A 5IDWA 4O6VA 1A7AA 1BW9B 1ZK0A 2CY0A 1BVRA 4OIMA 5CEJA 3UVEA 4YAGA 4F46A 4ZU3A 3AUTA 3B1JA 3H7AA 4NJMA 3MJVA 5JC8A 1TB4A 5I8ZA 1U4OA 1LX6A 2XPCA 1EVJA 1N1GA 2ZB8A 3QRWA 5L9AA 2HMVA 3DONA 2FZEA 3NGLA 4Q3CA 2ZYAA 1PL7A 3AW9A 4R5HA 1OBFO 1GUFA 1H6CA 1TXGA 1D4FA 1E77A 5F5LA 3HE3A 1TA4A 2EEZA 2IRWA 4LISA 3MEQA 1WP4A 1DJQA 2C20A 3UCXA 4AJIA 2I6TA 3C3XA 3PYMA 1I0ZA 2C82A 5A05A 1EDOA 1QSGA 3HB5X 3LU1A 4DC1A 1EVZA 1LSUA 3DR3A 1RM3A 1Z45A 2DTEA 2P9GA 1LRLA 4RDIA 2V65A 1U28A 1W8DA 5G2OA 4IJWA 5EQFA 5A9RA 3H65A 3ADPA 4HBGA 4GX5A 5THKA 1B15A 4EYEA 1BDMA 2GO1A 1H2HA 1BVUA 2NADA 4R3WA 4BS9A 1JVBA 4J49A 3TZCA 3UOGA 1A7KA 3GUCA 3MCVA 2AQ8A 5HA5A 1T2CA 1T2DA 1C14A 3F5QA 3TJRA 1Z7BA 1RYEA 1K0UA 3QA9A 1HDZA 4XDYA 4GX1A 4PZCA 3U4CA 3ICCA 1PWXA 4ILKA 3ZWPA 3IUPA 4E32A 2GSDA 2TMDA 3LT2A 2AQKA 4I1IA 4P8RA 1I3NA 2P9CA 2JHGA 4EJ6A 1YJQA 4BKOA 5THQA 3RCBA 2VYNA 3SJUA 4BNHA 3GVPA 5I7FA 3Q1LA 3WBBA 4BO3A 5J23A 2W2LD 3ONEA 1WNTA 2DFVA 3WICA 1Q1NA 1DPGA 4PLVA 5T57A 1HZJA 3GEGA 5B1YA 3Q2IA 3T4EA 4D46A 4MP3A 5DN9A 3P2YA 2DPGA 5G0SA 4UVEA 4BNVA 2YZ7A 1PU2A 4W4TA 4A2CA 3T7EA 3OJFA 4QUKA 1XQ6A 1SB9A 5TF4A 3GT0A 4ZQGA 4TZTA 4R1NA 4EEZA 1KC3A 2I5PO 3BTSA 1H94A 1NQAO 1JDJA 2V6FA 3D4NA 3RUHA 1LDNA 4J7XA 4Z0TA 4UAGA 1DLIA 1ZZEA 2G0TA 4DPLA 4IDCA 4CM3A 4LMRA 1GAEO 1HZZA 4CUJA 9LDBA 3UUWA 2VT3A 1HDYA 3UXYA 1K89A 1L7EA 4II2A 3E5RA 1K6XA 4HV4A 3HADA 3WX0A 1E7QA 2JD0A 1LTHR 3QWBA 3ETEA 3QE3A 4XB1A 1GPJA 4QO7A 3CXRA 1J6UA 1YWGO 2Y0DA 3ANNA 2ZYDA 3WMXA 1M2WA 4IPTA 2OXIA 1JKIA 4OQYA 1UZMA 3QQPA 5I7VA 2FR8A 3LT4A 4JCOA 2V6GA 3G49A 3DXFA 1P74A 4AICA 1TI7A 3EC7A 4PLWA 4GLOA 1A5ZA 4DREA 4OQZA 3JCZA 3BMNA 4D42A 1SOVA 4M86A 4TRRA 2NU6A 4IQ8A 2JFGA 4XYMA 3GH3A 3RFXA 3QVWA 5IN5A 1GU7A 3G79A 4DIFA 4F45A 2CFCA 3GVXA 4XX0A 3ZGYA 3DBHA 4CV0A 2NVUB 5BNTA 4MO2A 1NPDA 4CLRB 3Q2KA 1VKOA 4OOEA 4BO9A 1ENOA 1ZVMA 4I5FA 3RUFA 2YHIB 1UH5A 2VOEA 4I8XA 2X9GA 5I8WA 1LU9A 4WCFC 2O4CA 3EZLA 1ISJA 2NUAA 4YAJA 2PNFA 3TOXA 3EHEA 5FFFA 3KV3O 1E6UA 3PPIA 4MIYA 3FNEA 1CQJA 4PZDA 4UUNA 5IJZA 3HDJA 2DQ4A 3I6QA 4PLFA 4ALIA 2EG9A 1K6IA 3T4XA 1U3TA 4P38A 2JKVA 1JAYA 4GSLA 2VHZA 1R37A 1GYQA 4GX2A 2HDHA 4YTEA 4WCFA 3W8DA 3WGHA 1H6BA 4CM4B 1ZSVA 4J16A 4OHUA 2VNSA 3SC4A 4HFJA 4E5KA 1DFIA 5JO9A 3O9ZA 4EUFA 1HETA 1R4NB 2FP4A 4CM6A 2B83A 4G81A 4LVCA 4M1QA 2HQ1A 2BFOA 2VHWA 3I9KA 4PRKA 2C54A 1B8VA 5DBGA 3WWYA 1GEGA 4XA8A 4BO4A 3LC2O 4XRRA 1G0NA 1D1TA 3DO5A 2R00C 4DTIA 3L6EA 3DZKA 1Z75A 3I83A 4CQMA 4XEHA 1X13A 3C85A 4J7UA 4K6CA 2HRZA 2B0JA 3B1FA 4G5HA 2D8AA 1H0KA 4IDGA 4AJEA 2X23A 4KQXA 4OO3A 1PZHA 1J5PA 4QFCA 2HMUA 2A4KA 2Y1EA 1F17A 2O3UA 2Q1UA 4U6QA 1I2BA 3VHRA 1NASA 1YL7A 2PH5A 3H6KA 2R00A 2VHVA 4BNWA 2WSBA 3RU7A 2WD7B 5DULA 4CQLA 3P5SA 3W1VA 1E3WB 2GN4A 3G1TA 4XGNA 3AY3A 3DBLB 2GR9A 1F8FA 1U7TA 1Y5RA 1IOLA 1P0FA 1SCUA 1YS4A 4MKXA 2PV7A 2WEKA 5C37A 1I32A 4LK3A 3TL3A 5I7SA 4FSHA 1HE5A 2G1UA 3D0OA 4TMFA 3DMTC 3G1UA 3OICA 1CIVA 1YGYA 2VT2A 4KDEA 1SBYA 4JN6B 5JPIA 4K6FA 4AJKA 1FDSA 2Q2QA 2O7QA 4WEOA 2AA3A 5L7YA 4E6PA 1N7HA 1RJWA 4OJNA 3NYWA 4E0BA 4JXKA 5JE8A 4M54A 3OJEA 4Z9YA 1I2CA 3HHPA 5A1TA 3DMTA 4NPCA 1NFQA 1MX3A 4CMJA 2B4TO 3CZMA 3ZI0A 3AI1A 4OAQA 1OFGA 1K2WA 2JHFA 4GPD1 4FQ8A 4CMIB 5L53A 1OC2A 3RUEA 2EXXA 2E6UX 1QXSA 2I67A 2O7SA 1LDBA 1BSVA 2J5RA 4J9UE 4GLLA 3OIFA 3ZHXA 3KZVA 1C0IA 1HE3A 4GKBA 1DFGA 1P44A 1B26A 4NFYA 4L8VA 1WVGA 4J6FA 3ZCXA 4B4UA 1FXSA 1L7DA 1P33A 2HK7A 3QW2A 4YQZA 5AOVA 3GFGA 2CSUA 4NU5A 4Q3DA 4BIIA 2DU8A 5DDIP 1LA2A 1KETA 2EV9A 4BKRA 3I3OA 3IKVA 4J90A 1B3RA 4ONEA 3QIVA 4XIJA 3O4RA 3KBOA 1AHIA 4MP8A 1P1RA 4AJJA 4AFNA 4PLZA 4OSOA 3EK2A 4OMUA 4YJFB 3ZWNA 4NZ9A 1HEUA 3CKYA 5IDYA 4EDFA 1T4BA 4XD2A 4DPMA 1KEPA 2BELA 1KY5A 5L51A 1X0VA 4FR5A 4RJTA 4R51A 5KJCA 2RHRA 1PJQA 1V3UA 4CR7A 2X5KO 3D64A 3OM9A 3DMYA 2OZPA 2WMDA 2Y1CA 4LN1A 2VRBA 5KTKA 3JYLA 1D7OA 2JAHA 5TJHA 5HS6A 3I9JA 2BI7A 1NAIA 4PGFA 1AHHA 1VL6A 4BKPA 1HDCA 3UF0A 1GADO 1EUDA 3TFOA 3PZRA 1QMGA 3A14A 3E48A 1PQUA 1YL5A 4NQZA 4O63O 3L9XA 2X0JA 3NDIA 1RWBA 3JQAD 3ROMA 4FFRA 3MWDB 5IN4A 3FCOA 2RH4A 9LDTA 3QVTA 1CRWG 3WS7A 3F4BA 1NWCA 1MP0A 5F1KA 3U5TA 2FR1A 3QWHA 4ALNA 4PLTA 3ZWXA 5TJ9A 1C1XB 1GYRA 1GQQA 2H1SA 4XR4A 3KTDA 4N7RA 4ZQBA 3DL2A 2GGSA 1VKNA 2QIOA 4RVUA 3L6OO 3ENKA 3VVBA 2AW5A 4BNXA 4I08A 3VOSA 1GZ6A 4IZHA 1E5QA 1E6WA 2OORA 2X0IA 3Q6IA 3NKLA 1UXJA 3UICA 1QR6A 3WFIA 3JQ8B 4J1QA 3E8XA 3U4DA 1GZ4A 3DHNA 3WJAA 4PG7A 1CEQA 1MFZA 4XDZA 2DC1A 2YQ4A 4J1TA 2JL1A 4BGUA 3JYPA 1B2LA 4ZGWA 5H82A 3ZW9A 1NTOA 4FGSA 4OXYA 3ULKA 1ZSYA 4MVJF 2Y99A 4FIZA 2AHRA 3VH4A 4S1VA 4O1MA 3SLKA 4FBGA 3H5AA 2AEFA 1QRRA 2NVBA 3RI3A 1XWFA 3U3XA 1JW9B 3EZYA 3WDSA 3C1OA 4INAA 4DLAA 3VH3A 2FHSA 4AJPA 3ZHZA 5L7WA 1PSDA 4GMFA 5CG1A 1PR3A 5I9NA 3NEPX 3C7CB 3JSAA 2O3QA 4KOAA 1I36A 1JLLA 3WSWA 5G4KA 3JD2A 1CQIA 4RPLA 4IJVA 3IDSA 5EERA 3K6JA 5DOVA 1X1TA 3SVTA 2H6EA 1ADBA 1EFKA 1I3KA 2FPPA 4R1TA 4XQ9A 4NBWA 3VKVA 4E31A 2EWMA 4GVXA 4QT0A 2D1YA 2B5VA 2W8ZA 5L4SA 1KERA 1ONPA 4JP2A 4NNJA 3TSCA 1Q0QA 4BB5A 1U1IA 5TT1A 4A27A 4D45A 3ZU2A 1GR0A 5KKAA 3IAHA 3GHYA 3GOHA 1I10A 2ZTVA 4CMAA 3R6DA 4E2ZA 4QFDA 2ZB7A 2HLPA 5KVQA 1MUUA 2JFFA 5KJFA 1CF2O 5B4TA 2XXJA 1X7GA 4GX0A 3TWOA 2OFPA 4XIYA 2QHXA 2GDZA 3SJ7A 3D3EA 1ZBQA 3X2EA 3V2UA 1EVYA 3NX4A 1UXIA 4YRDA 4LSWA 4DIOA 2LDXA 3AY6A 3NAQA 2ZQZA 3U49A 4A7PA 1EQUA 4CUKA 4MKRA 2YUTA 3RC2A 3AJRA 4IJKA 4AJLA 1UJMA 4LCJA 3N58A 3AI2A 4CM5A 4A26A 4EI2A 3DBRA 4I5EA 5BSEA 4EUEA 3K92A 1NPTO 1YONA 1K5HA 4E3ZA 5BSFA 4HY3A 1SOWA 2QG4A 1FDVA 3BZUA 3OEYA 4ALLA 3KETA 5A3JA 4J91A 2EERA 4XKJA 5JY1A 5HS4A 1QORA 1N9GA 5KJEA 4D41A 4TVBA 1YH3A 1VI2A 5LDHA 1R4MB 3VDQA 3UCFA 3B20A 4RGBA 4D7AA 3C7DB 2H9IA 4ZVVA 5AXAA 5DCUA 4M8SA 3LC7O 3F1LA 1A27A 2X9NA 3BTOA 3GVIA 3GPIA 1UZLA 3S1LA 5IDXA 4GMGA 4NFHA 2EW8A 1XIVA 3KSDO 1GV0A 2NTVA 2GD1O 2E37A 1ZO8A 3BTVA 5IXSA 1LDGA 4BGEA 1RM5A 1LI4A 4WLNA 2W90A 4GKVA 1XR3A 3PP8A 2ET6A 3R3JA 1O94A 2OGUA 1ISMA 1NQ5A 4FFPA 1M6WA 4TROA 4RF3A 3S2GA 1Y8RA 4NMHA 4DYVA 4ND1A 3KYDB 3A06A 3BA1A 1ZMTA 4J4TA 4UVGA 4R16A 4QX6A 5EJ2A 4NBUA 3VPFA 1SO8A 1IYZA 1YOVB 2GASA 3D3WA 5T6BA 4CM9A 1NVTA 3CEAA 5DBFA 5H81A 5B37A 1N92A 4KQWA 1MC4A 4LRSB 4NBVA 4JROA 3OA0A 4MDHA 5JCJD 4JGBA 2P68A 1HT0A 3JQBA 4E5MA 3HN7A 2BD0A 1H5QA 1DC4A 3JQ7A 1E1NA 5T5QA 2IZ1A 3BYZA 1PJ2A 3PRJA 1ZCJA 4DYDA 4ROSA 3GZNA 1N8KA 2GPTA 3WBFA 2AG5A 3DBVO 2X1HA 1DOHA 4NBRA 4IY1A 3UHAA 4BQPA 4DRYA 1DEHA 2EJWA 4BNNA 3JD0A 3GRPA 2EKPA 4J4HA 5TC4A 4F6LA 1A72A 1B7GO 4NJOA 4WCDA 3PIDA 2P4HX 4E21A 5F21A 5JYDA 4CMBA 3F1KA 4Y6PA 5A3VA 1HDRA 1TT7A 1ZK2A 2FPIA 1PGQA 3PYXA 2C07A 1GEEA 1I3MA 1NR1A 3IL2A 3V8BA 4S3MA 5TT0A 5CEEA 2X5OA 4YQYA 1G6KA 1KEWA 2O50A 2PKQO 2VN8A 4L73A 1ZEJA 3IC5A 2X86A 4JBGA 4BNKA 1VM6A 3GGPA 1ADGA 5KJ1A 3OQBA 1EK6A 4Q3EA 3T7CA 2WWRA 4H7PA 3JYOA 4YPOA 1L1FA 1KIFA 3TN7A 4Z3KA 5IZ4A 5KOIA 4DXHA 1ZMOA
chains in the Genus database with same CATH superfamily
4CV3A 4N9QA 2R8EA 4D4KA 1ZJZA 4BWFB 2BBSA 4PIVA 4DR6B 4N5DA 3TSZA 4DCOA 2ZRGA 3ACDA 3HY3A 4Y1EA 1EX9A 1WDKA 2EJVA 3B52X 1VRWA 3FDJA 4HVAA 4IHQA 3PX3A 3KZ1E 1ZDMA 3LS2A 2KS6A 5HQ3B 1HLDA 1TQ4A 4MV4A 3WLEA 1CZRA 4OYLA 5BOSA 5JBQA 1UINA 4MIKA 1ENYA 1VSUA 1CDZA 2A1IA 3RVOA 2C4MA 3SD7A 2HUPA 3ZUGA 4RVDA 3TDKA 2O06A 4CG3A 1W47A 4QPPA 4JUAA 4RLSA 1FX0B 2GZRA 2I99A 1V7ZA 4IINA 1GZDA 4TWBA 3F74A 1PEDA 3JASA 3SHTA 3V8MA 3QELB 1Z68A 5CFLA 1YB4A 2J87A 4HUQB 4WSOA 1I1HA 4UEWA 2HV8A 3WKCA 4LOAA 4A8JC 3B9RA 1YE5A 2O0HA 1O08A 2W6ZA 4N0MA 1Y3AA 4YS6A 3CX6A 3UAZA 1IPHA 4EENA 4OKIA 4EP1A 2B1RA 2GN8A 4IOMA 3CX3A 3IBTA 5JD3A 4PG6A 4JI2B 1YBAA 5AXDA 1F8GA 4QDXA 1EH5A 1MOPA 1RHUA 3OCYA 2HCTA 4MAAA 4Q37A 1OXTA 1NFFA 2H00A 1Z6TA 5ECGC 2PY6A 5H68A 1J2YA 3D0KA 3EASA 4BV2A 4DQLA 4AI6A 4B8WA 4HNVA 1CJMA 1G0OA 4Z9BA 2ZRMA 4CCSA 3QVGA 2XF2A 3QUQA 1GOTA 3FVVA 2Q6LA 4KAJA 2Z30A 4PVDA 2X4GA 1MRNA 2P6OA 2QV7A 3D6HA 1R88A 1B0PA 3K9QO 3PNSA 4K86A 1M5RA 3ZU3A 3BWYA 4D5GA 4YDHB 1QQAA 3I6YA 3U3MA 3AO0B 2UVDA 4UVHA 3TTSA 3DF9A 4BLSA 4DG8A 1ZM9A 4BVGA 1N77A 2Z6VA 4PO3X 4ZAXA 4O4HF 2PMFA 2VHQA 5HBRA 4F5DA 3IJ5A 1G3UA 3PC6A 5AXBA 1Y8QA 3ZHSA 4AYTA 1UT6A 3HXKA 1JDVA 3FJOA 3ED1A 3I2IA 1LDMA 1S3FA 2UYQA 2WSSA 4O2BA 3EQ6A 5BMVA 3GB9A 4IGKA 3KUUA 4TVOA 1TVCA 4KKVA 3NTUA 5LUAA 1NLMA 2WQ7A 1AZLA 1S8FA 2RB4A 1GKKA 4JWKA 3EMKA 5IFLA 4YA6A 5CB8A 1Y1SA 4P0TA 1R0WA 4TV8F 5CLJA 1E2KA 1DMSA 3CTPA 4YCNA 2IYOA 4E15A 2Y1GA 3DQZA 5CFOA 2VJMA 4L6IA 2J3EA 1I2MA 1R0BA 5IK2A 5A5EA 1E94E 1Z4LA 1QYXA 1VYUA 4O29A 3OUZA 4G24A 2QQEA 2AWNA 4KSYA 2W6CX 3EVNA 4H6XA 1N5MA 1FQOA 1PT7A 4ETNA 3TAXA 1JLKA 3TLCA 5EIOA 4ZU6X 1W19A 2QRJA 2V7QD 1XSEA 1F2VA 2OECA 2DWQA 3WGOA 3CSSA 1MMFB 4P31A 2XUIA 4PPQA 5BN4B 1DAPA 2G17A 4B82A 1GTRA 4QFMA 1VBMA 2J85A 4F84A 2Q4BA 4YHHB 3M49A 3VU0A 3N0XA 4MRRA 4B6QA 2HLDA 3FPLA 4XYBA 2AC4A 1ZRNA 3FCUB 4Q4AB 2PWZA 2H4JA 2WE8A 1HT1E 2A7XA 3QF4B 1KY4A 1VG0B 2F00A 1M75A 3R7WA 1K97A 3EZ7A 3RE1A 1X1BA 5DB4A 2ONYA 2NU7A 3W6ZA 4O4JB 4TYQA 3EQ9A 3UWDA 2CJPA 1NRJB 2C77A 3EGIA 1VLLA 1FYFA 2FRDC 2NTYC 4P3NA 2NZ2A 3E8MA 4MH0R 3SIXA 1KIAA 3AM3A 2IZ6A 4WKNA 3QG1A 5B2ZA 5AVRA 4OHBA 2NXCA 1U5CA 4DR2B 2H0QA 5AM2A 1QQTA 3NBKA 4H7JA 2BMEA 1PJBA 4OQLA 5HW0A 2QQFA 4M2LA 2Y1OA 3NB0A 4R83A 2QTRA 1TE2A 1DC6A 2ZLBA 1X1DA 3SFVA 3DXZA 3IA7A 4UHDA 4V2UA 1UZNA 2JFOA 4X1KA 4Y2JA 4U5QA 2F9FA 4C7KA 3PEWA 2FRDA 2AF3C 3CVUA 1GP2A 5F9HA 5REQB 1QHFA 3ZDFA 4J8PA 4RIIA 2JGDA 3VO2A 1NIPA 2OOSA 3HJBA 1XEXB 3WNVA 4ED9A 4PF1A 3HKDB 4AN4A 4OFXA 3M4YA 5KSZA 4ZI7B 3U6BA 1MXHA 3A3NA 1RCUA 2FK7A 5CYOA 3SCZA 4MS1B 8ABPA 2GBLC 2JD1A 2OK7A 1VCIA 2GF0A 2ZJ4A 3QFSA 1CRPA 1ZI9A 5A3RA 1M8FA 1W93A 4GSYA 5HYVA 1M1XB 2R44A 1UIMA 1JEQB 2ADMA 2OQIA 2XBUA 4MUJA 4WT7A 1Q1GA 1T8WA 2B9VA 3DE2X 5CX4A 4TMTA 4F3TA 1N5KA 2HUNA 2G83A 2N0SA 4X1YB 5ESRA 1A9OA 4ARVA 3D6MA 3K6RA 1QIFA 3ZTYA 3G59A 4DSOA 2GZ3A 1J0CA 1EFHA 2XADA 5DPMA 3GJ0A 1K63A 3QKTA 5T4FA 3AB7A 4QPCA 1TM4E 3TTUA 4CNBA 3R7NA 5CDGA 1C3OA 5K3OA 1G21A 2WG1A 2GBLA 3RRJA 1E20A 4D1YA 1IM8A 1WZIA 1HFJA 5DX0A 5H80A 4E08A 4KZKA 1ORRA 1BE1A 4HUTA 3BAFA 2CXNA 1WXGA 1YBVA 3AY7A 4GQBA 3MB8A 4IOLA 4WXHA 4RTPA 3ETLA 2HC9A 3FSRA 4D0SA 3ZNPA 4X97A 4R2LA 1SHZA 3FLBA 3Q7QA 3STVA 2QR5A 2XGGA 1GCUA 4Y6GB 4P9NA 2NSLA 2PS3A 4MW6A 5J1SB 2Z9CA 4RK4A 2C9ZA 3D0RA 1N5RA 4JSRA 4WCFB 5EESA 2GRUA 4JU8A 4RHTA 5JIBA 2HHCA 1KIMA 4QUBA 4I6EA 2I2AA 4MOWA 5FI0B 2AXPA 2BY4A 1GN9A 2OC9A 5CYGA 2H7CA 2X5JO 1MX1A 3A1FA 2I1LA 1LLCA 1ISGA 4D82A 4YY3B 3THWA 3E03A 2FW7A 4IV0A 4ETMA 5ILOA 2XUFA 1QIGA 1IK6A 2BKEA 2QLJA 4UDXX 5D51S 2WV7A 3QV2A 1QFMA 4Q12A 4RPHA 2YXEA 2JIBA 2F8TA 1A8SA 3I2GA 1U2EA 2OZLB 4JC4A 3T7IA 3T3HA 2VT7A 1JV2B 3DKVA 4J0HA 4DCGA 3AL0C 3TNDA 2QP4A 3FSEA 4AMYA 1QCCA 4CQMB 4NJEA 3RBZA 1ZGHA 3SIPA 4XLLA 1OWLA 3E82A 2HK6A 5CW2A 4P0PB 1KQFA 2OO3A 2GQ0A 2WJ6A 4BFXA 2PM8A 1NRIA 3THOA 4ZT5A 1C7EA 2XCRB 3QEMA 4OJMX 2BGWA 4J29A 2CNLA 4D26A 3C41J 3NRBA 1U2DA 4P3OA 2DUJA 3MRVA 4KX5A 1TTTA 2HU8A 2R7AA 3WGYA 1P0PA 2FW0A 4JYAB 2MMGA 1QIJA 2F3UA 4TS1A 4CF5A 4F91B 1HQCA 3VJMA 1ECCA 1DAMA 4CKBA 4AJHA 3SVZA 3H1GA 3U9SA 4FFWA 2PGAA 2R65A 2RKBA 4JUCA 3A05A 1PYOA 3WSTA 1E7MA 4QQFA 5GOZA 4OMFG 1BJKA 1VG1A 4LY3A 2ZSHA 5GQSA 1DWQA 1CUXA 3ICPA 1RPZA 1Z4MA 1OXXK 1VPDA 2OM2A 1SOMA 1W46A 2WDPA 4IX9A 3AM4A 4AZTA 3J7AC 2YYYA 3D6TB 3MJDA 1CF4A 1V7CA 2PGNA 5LU8A 1RZVA 3EGCA 5LQNA 4QASA 3NHPA 4BQEA 2B8TA 1SHJA 3LK7A 4I1YA 4OQNA 4P86A 3NFRA 3FOZA 5EL0A 1A7JA 3OEWA 1U0BB 2X7HA 2HIGA 3RHZA 1OLOA 4JIMA 5MFZA 2P2GA 3JWIA 4L5JA 4FHZA 2V3CC 3WAJA 3TVDA 4I9NA 3ZDAA 5B6JA 1RXUA 1KY2A 5JSKA 4Q1DA 3SXJA 3GAFA 1UAGA 5MF6A 1CIPA 1GAJA 3MS2A 1KFJB 3HY4A 2HRDA 5TIIA 3OCCA 4OH1A 4JYCA 4M1ZA 1Z4PX 4YP7A 1M2VA 4LC0A 4UMEA 2ETVA 4RACA 4F2WA 2BEVB 1R64A 4IDHA 3DFZA 4V38A 2AMYA 4I1OA 4ZI2A 3NOOA 3KKZA 4MKFA 1I0IA 1M7HA 3N7UA 4YJ3F 1WETA 2BKAA 4E22A 3E05A 1WU8A 3ZXYA 1IEXA 5BRAA 3OZFA 1UK9A 2XEXA 1ZA2A 1JNYA 3PQ6A 4IVRA 4MUYA 3WQHA 5EHXA 3KT8A 4OATA 5LD2C 1JEYB 3HKEB 3LDGA 2FWJA 1WSWA 4RNDB 1R8XA 3VKHA 1C3LA 1VJRA 3ZD9A 3RHTA 1T8RA 1TUBA 1IWOA 2BGIA 3HYSA 1SEPA 3OQIA 3SQLA 4CTJA 2VA9A 2B7LA 4DLKA 3VPXA 2KJQA 3GGCA 1TMGE 3VZSA 3DMFA 4CUZA 3T1YB 3G8DA 5ELXA 1AGNA 3QMMA 2BZSA 4XFKA 2G72A 2G9UA 2UUOA 4H0NA 4PW0A 5TQ2A 3U40A 1HBJA 4P5DA 3UAGA 4ZVRA 5CB4F 3MMSA 1PJLA 4PGGA 2VJCA 2WM3A 3T15A 3EF3A 1T3ZA 3KRTA 1FUKA 5CCBA 1PBNA 3AONB 1RMTA 4YN3A 3DEIA 2ZANA 3PIRA 3TQOA 4QC2A 4MICA 2F48A 1RTKA 3L7NA 3E1KA 3EBLA 3F3YA 4Q4HB 1U8FO 4TQAA 4YRIA 1K8XB 4MI6A 4ALMA 3GD7A 4NHEA 1UMBA 2GETA 1XU9A 1OBVA 1BO6A 4DLZA 5ADVA 1PD0A 2I55A 3ICQB 3MXTA 2WU0A 5BSHA 2VBFA 3N8GA 4G56A 4AS1A 1I6KA 2CXUA 5T41A 4BFWA 1G59A 1M2EA 3W8NA 4EBFA 3A6ZA 3EPJA 1H9BA 1GLNA 1DFHA 2V3VA 5HFAA 2Z2KA 3FTPA 5FCDA 4MRMA 1J1IA 4PYNA 1PWYE 1NKTA 3H2ZA 4GXNA 2I9PA 1G1AA 2GTIA 2Z3VA 1TQ6A 3UPUA 1LXCA 3AEZA 3M33A 4HDAA 2P6MA 3IVGA 4TS4A 3INGA 4V39A 1T1SA 2CCKA 3KC2A 4W5HA 5AJYA 3V8PA 2WHRA 3NT4A 1GCIA 2AS0A 3WMRA 4P7FA 1M2JA 3KEOA 3P2IA 4Y98A 4Z9XA 4B6EA 4C01A 1N1DA 2PT6A 4QEKA 2VRCD 4S2UA 3F2VA 3WMWA 5AVXA 2C3OA 4IMRA 2POCA 5JSZA 1Z34A 4INPA 4ROTA 1W5TA 3W5HA 1T5HX 2IV7A 4HL6A 1U3CA 1PS9A 3PD0A 2IEAA 3GJ3A 1GARA 4JJIA 3TQSA 1LK5A 2IZZA 1U65A 3G9QA 2N42A 3TOVA 1KO5A 3ZGOA 4RTMA 3RS2A 1OB2A 1R74A 1KH1A 2HBYA 3DE0X 4IQGA 4JB8A 4URYR 2DM6A 4GXRA 4B7CA 5C46F 3Q9SA 2Z1DA 1EZ4A 3PIIA 1EFAA 3CISA 4JC8A 4E5UA 3DTTA 2MT9A 2HT1A 2OFFA 4ZXFA 4TZ6A 3BGDA 4BNMA 3NHZA 5T3YA 4OXRA 1S1MA 3ITNA 2PSFA 3LFTA 4YDRA 2IYRA 2PPVA 3MUNA 2RBEA 4UHCA 1NC3A 1PT8A 2I66A 2YN2A 4MUBA 4KP7A 1UWKA 3LLSA 3FUXA 4HUJA 2ZM6B 1PLLA 3QSYA 3QF7A 2LXNA 1VMEA 3U1TA 1QRDA 1GTMA 3KR9A 4TUYB 1U02A 2V5UA 1N9ZA 4JLJA 1VIVA 4UVDA 3PS9A 2PX3A 3R0QA 1OXBB 4MVCA 1U31A 5JSYA 3UIEA 2X9VA 1UQRA 2ZR8A 2I7VA 3GPCA 3UMMA 3OLCX 3LL4A 4BIMA 5L3VA 5G0UA 4RGYA 3RWOA 3L6BA 1LTKA 1NW6A 2DR3A 3QBDA 5WRFA 2LCQA 4BRSA 2OP0A 2GA8A 5AT1A 4YX9A 5MDHA 2PKQP 4HB4A 3RIHA 3CWCA 3EAQA 2BFMA 2R751 1OCEA 2O2EA 2VHJA 3KB6A 4PHTA 4DLVA 3BT7A 1JLLB 1QAQA 2NSHA 3TZHA 4BASA 1U8UA 3BRSA 5TPZD 1PG0A 1C1YA 1XEAA 2WVJA 4YJHA 3IOYA 4YUVA 1HURA 3PQDA 4RQTA 1RRCA 3DEYX 4JJFA 4M49A 2R2AA 1KI4A 1A9ZA 4TXJA 4LRYA 4ZOAA 3SYTA 4EX6A 4OJKA 1Q15A 2I34A 3HB4X 1UZUA 1RAFA 3IBCA 2QW1A 1FF9A 4JBHA 1NA5A 4ZARA 4I46A 2XVXA 1ZL0A 3LUCA 3ESBA 3FGOA 1KVUA 1G6Q1 4XQGA 2QTZA 2ATVA 1IAVA 4JT2A 4WBNF 1XTKA 3EF0A 5J4VA 5F51A 3TZQA 1ACJA 2A9KA 2GEBA 5IASA 2ZIVB 1LPOA 4C30A 2JAXA 4RLFA 2QDXA 1KTIA 2XMRA 4Z53A 2R8YA 2A5YB 1Y7HA 4FLFA 1B43A 4HQRA 1UKZA 3PFNA 2I91A 5FADA 5AI4A 2CE2X 1K7SN 1POWA 1KKMA 3HYNA 3O3OB 3UAWA 1N2HA 1THGA 4UPDA 3M2TA 1E59A 1MORA 4DBZA 2C0CA 3Q3CA 3BIFA 1TQ2A 3GEDA 2Z5LA 4AP6A 3LCVB 3HVRA 2XZLA 1E64A 2XAUA 2ZXUA 4M8KA 3P0HA 3MGKA 2OB2A 1X70A 1VL0A 3E9QA 2DJ5A 2PJRA 4D0LB 4ZCSA 2NV6A 2IITA 1M5UA 4P92A 4EG7A 2Z5FA 5IDQA 2EIXA 2VXYA 1PNVA 1L4KA 5E7JA 2A33A 3EW9A 3MLAA 3VJKA 1TZCA 1RABA 2AEMA 3JARB 4B45A 1HH4A 2QVGA 5FH9A 3IOEA 3OQ6A 4CPDA 5KQSA 2CV1A 3MCAA 3X1DA 2QYSA 4EYSA 1W5FA 1ADCA 3HA3A 1QLJA 2C03A 2ZSFA 2ZKLA 4HRYA 3LZCA 1NBMA 1SWVA 2O2HA 3GCWA 4NAVA 2WHXA 4H60A 1JPNA 1P2VA 1YULA 2CLLB 3A10A 4LDNA 1II9A 2XZTA 2OHVA 1ULAA 3DBRB 3DDSA 4I9UA 5FO0A 3V2GA 1PUJA 1USGA 3PWTA 3SC2A 5FUYA 5C8VA 4KAAA 3IP1A 2HQSA 3VYWA 1NJSA 3HEAA 3WG9A 4CEHB 2FTKE 4OXNA 4F3YA 4Y2TA 1RJFA 3COVA 1O9BA 1JFFA 3WYFA 3DGEC 3RVKA 3FHOA 2C9OA 1IN7A 3IS3A 5IC4A 4PQEA 2R5FA 1SU7A 4IGEA 2RHTA 1W1UA 3PXBA 4ZDJA 5JCJA 4MNTA 4D9BA 2A3NA 5JJIA 3BD7A 1JN0A 2CLDX 5JSQA 3IQXA 3WA6A 2WLTA 4O08A 1PJCA 1H23A 3SYRA 1KEEA 1ZJ4A 4UARA 5TSDA 1A71A 4G09A 3FWZA 3ROKA 1CJCA 3PITA 4WEQA 4AG3A 5AVUA 4DUZB 1LNSA 4JYBA 4QEZA 1PNRA 2GN6A 3DOFA 5BOVA 5CAEA 4EMSA 3VC2A 4OQQA 1R9MA 4QVIA 2RHOA 1ZD9A 1NR5A 1TL7C 2JIDA 1F2TA 1DX4A 5IBCA 4G63A 2NO1A 1ODSA 2AMJA 5IKOA 5C1PA 2BWJA 2CK3D 2IWRA 3L6RA 3N7AA 3WJ1A 4LNUA 2BE9A 4CU2A 5AVYA 3DNMA 4JHXA 3KKPA 4HMOA 4MWBA 3NCHA 4OD0A 1PQ4A 4HPJB 4PPGA 3TQQA 2Y4OA 2H29A 2Z9BA 3Q3IA 3IMFA 1D1QA 3PLNA 3H6HA 4RDXA 5D87A 3GA5A 5BW8A 1G18A 4YMUA 2NXWA 1BTOA 3JVUA 4LHEA 3KQHA 2DPHA 2W4QA 4G0YA 1GWNA 4CEIA 3DUWA 2F3SA 1E61A 2PKEA 1VMKA 3H4TA 1D07A 1RZUA 4IEIA 3WIEA 4EKEA 3A6KA 3EZ9A 3HXQA 2WWTA 5BYKA 3IRVA 3NRCA 3D8TA 4MWEA 1LLUA 1XAIA 4JVNA 5M04A 4HQLA 4RPGA 1HYEA 3NALA 3VC1A 1KPIA 1FXWA 1S9DA 2ZJ8A 2C58A 3E35A 1LVUA 2X40A 3V1UA 1PSZA 2VWHA 2NV0A 5DNAA 1YS2X 4OJQA 1PT5A 4AJ2A 2ZIXB 5F2OA 3O83A 1Y42X 2PGOA 3JQ7B 3LX8A 5LBTA 4MWGA 1H5NA 4FKMA 4I9FA 2OBFA 4JI1B 3VAYA 5EJEA 5LXTA 1Q0TA 4F2GA 4HEA1 3DNPA 4QRHA 5F1PA 4F56A 2J5BA 2O2XA 1TYBE 3O38A 3RUIA 4UEQA 3IAS1 4FP9A 1MV5A 1B2RA 4MQLA 1TRHA 4NNPA 3LUHA 1J0DA 4QLAA 3BXPA 3L04A 2Q07A 1YDMA 1L8QA 2VZ8A 3L02A 3Q0IA 4JJGA 5JJBA 4DAEA 3ZV6A 2O8BB 5FLKA 4X91A 5J2UA 3FIUA 4CKCA 1QVZA 3HMQA 2GX6A 5D8DA 4EF6A 2RC6A 3ASYA 1CW2B 5FYDA 1NVVQ 4MDFA 2Z5GA 5F78A 1N7GA 3FUCA 1G38A 1U7HA 2FFAA 5HVNA 2NN3C 2AYYA 4I81A 4KBFA 2C2WA 4MVJG 5E3JA 1WV0A 1OV6A 4O2BF 1GL3A 1PF7E 2FPIB 3P0FA 4F96A 5BMVF 1TKRA 1EFVA 2ZQ5A 4O4LA 3ZK9A 4D9EA 1FFYA 1MJFA 3UO8B 1TO6A 5BWMA 1DX6A 4XTCS 1HQYE 2YV2A 2MMCA 4D43A 3FD8A 3WYAA 5JSFA 1PTJC 2WMNB 4FT2A 4ECAA 4FB5A 5KTRA 3P9RA 4RV5A 3USZA 4ARIA 2FUG1 2GBPA 4IQFA 1E1QA 1V5IA 3CNBA 3DCIA 3JZDA 3NJ4A 1ULSA 3OZIA 2MSEB 3DFFA 3LSYA 1GUDA 3IELA 4B2IA 2XB4A 3KM0A 3O1HB 1PV2A 4IJ5A 3OQMA 2PCJA 2I1VB 1EVEA 2H92A 4QRIA 1GJRA 3TW0A 4HRVA 3PE6A 2VDNB 4AKTA 4L5AA 4P2GA 3OEHA 4NESA 4XWAA 5CH8A 2XZDA 4EYQA 3L05A 3N2KA 4KPUB 3ZGNA 1WSAA 3QW4B 4K6MA 1PTJA 3L7AA 3PTAA 5AK5A 2HU7A 1DBQA 1S2LA 4Q3NA 4LYFA 4XEUA 1BRMA 4DBVO 5JCZA 5L4NA 1QNLA 2GZHA 4MQEA 1HKHA 5DKFA 3FMIA 4FCCA 1ELOA 3WK4A 3STHA 4AX4A 1VJDA 4HDQB 5TEWA 2QSYA 3SXUB 2X3YA 2AN9A 2X8WA 4K9OA 2WWYA 2VH1A 1TQDA 1ZN7A 4PNHA 4AO7A 3LUBA 2Q3MA 2ZDHA 1QQ5A 5TRTA 4EQ6A 3FWHA 5KOJA 2DLCX 3KPYA 2H16A 3JQ9C 1EQAA 2IDJA 2IXAA 5CB0A 1O03A 1BFDA 2FW1A 3L4SO 3PK0A 5FF9A 3BZWA 3ZZNA 4AX8A 3KQYA 4RCVA 1GFZA 5LIRA 3KKLA 3HCBA 4C0XA 1Y9EA 1RYDA 3ABQB 4ZDWA 4U63A 3CMMA 2EVWX 3N2IA 1QGAA 2DFDA 2YNMD 4LBZA 2H52A 4G85A 3M6VA 3VC7A 3ZX4A 4C7MA 3EB9A 3U19A 2EJBA 4JA0A 4QSMA 1JVNA 3PT9A 2FFJA 4BO5A 3G5AA 4Y8VA 3H5VA 1JA1A 4NV3A 4BHTA 3JQ9A 2E1PA 5CHYA 3D3JA 3PCXA 1QC5B 3LWZA 5I45A 3B6IA 1NT2A 1ZK3A 3MMNA 3QGMA 4YRKA 2H5EA 1IHOA 2YS6A 3I2FA 5HM8A 2C0PA 1MAUA 2DPYA 1NP6A 2CXSA 1JTEA 2HJ9A 3GJRA 4CMKA 1K3FA 3OBBA 5FA8A 3FNBA 4MVWA 2LZ0A 4G4GA 2HMTA 4YJGB 2FPWA 1RT9A 1WTAA 2V9ZA 2VAMA 4XOIA 1XPUA 3O03A 2D2EA 4JMPA 4WBXC 4BX0A 1DBVO 3T38A 3RBXA 1NJ8A 3JQQA 1OVGA 4QDTA 4XSHA 4BKQA 3AHDA 1XG5A 2AR9A 1A0OA 3D4OA 1E6KA 3IYLW 2KX7A 3DLTA 2OV2A 4IFBA 3LPDA 1MNAA 3VYUB 4BVHA 4PSDA 3ECCA 1PR6A 3P8ZA 4GQAA 2QTGA 3GYGA 2M6RA 4B76A 4OHZA 3ORYA 3AUJB 4EM6A 4QARA 4CT4B 2QN9A 1YHZA 1E63A 1RWNA 2XUQA 3HCCA 2ZJYA 5JCOA 1KVSA 4K0KB 2WJJA 4EUKA 4PZYA 5DNCA 2ZSDA 4FW8A 5IZCA 1Z5NA 4G1EB 1DBIA 4CL2A 1RWWA 3JQEA 3FBGA 3L7YA 4AJ1A 2GWHA 5JJKA 2HJRA 1NVMB 4TSFD 3VDRA 2VR1A 3QVXA 5CXSA 4DHWA 5JARA 1R8SA 1P61B 2H1CA 4UBMA 3UJHA 3FZYA 4EY5A 3ROXA 4HQ6A 2J3LA 4FDAA 5LP6A 3ML1A 1OB5A 2K7ZA 3LHSA 5KYGA 3C3EA 2VAXA 1TJYA 1UXGA 3LUJA 3FYUB 2VP3A 4Y7DA 3UGTA 1JHPA 2J32A 4AZ0A 5A0TA 1BXGB 1KDZA 2IELA 4HKTA 3I2HA 5DI3A 4KNWA 1F2UB 2NU9A 2KW5A 2GK3A 2Q5FA 3F6BX 2YFKA 5HG0A 1DADA 4PLGA 1B0AA 2JLBA 3HMKA 4TMKA 1JHZA 3KFLA 1BHSA 1N1EA 2OM6A 2BMAA 1AM4D 3O6VA 4KPGA 3HJFA 1HYHA 2QN7A 4M0FA 1OFUX 2R8RA 4LW8A 3MTGA 1HDEA 3Q85A 2ZDGA 2Q3LA 2E4AA 4IIGA 1ZUHA 3B1VA 1M2OB 3ORQA 2EP7A 3V4LA 4UTRA 4Z7QB 2X6RA 5C35A 3G8AA 3Q3JB 4QUJA 3H1TA 2GPBA 2W42A 3HDHA 2BEJA 4D3ZA 4AQYB 4UTPA 1TFRA 2HCJB 3I28A 1UXHA 5FD8A 2E87A 1H9CA 4MQ4A 1K4KA 4YCDA 2OZKA 3C1AA 3MS7A 2XUDA 2IQIA 2FMTA 5DCWA 4FPXA 5KJ6A 3R44A 3V1YA 3NIWA 4R84A 5FTJA 1US8B 1P1JA 3I52A 5KHAA 3V7WA 1OC4A 2OC4A 3BX1A 3ZGVA 4NYIR 2FJUA 1T3LA 3T61A 4MYUA 3AR5A 4FILA 4IVPA 5JAIA 1MNQA 2NVUA 3VUFA 6GPBA 3V48A 1JR6A 4JUBA 1JWAB 4CLRA 2DTXA 1LQ2A 3TLYA 4ICIA 5LB2A 1JSLA 2F4VB 5T7BA 3DHEA 3F6PA 1N2GA 1TD1A 1P1FA 1WUKS 1DXQA 4EPVA 2FDCA 3LLMA 2Y2VA 3D6UA 1UMCB 4NS1A 4YJDA 3JSXA 2B9EA 3NKVA 4EA6A 8ADHA 1PJ8A 1XYYA 4B3IA 1VYVA 1KGDA 4LUCA 3O26A 5C3UA 2I7TA 5AVZA 1U98A 1P1IA 1P2DA 4KYIB 4RETA 3S27A 3WNZA 5SZKB 2OEPA 1ZG3A 4TXLA 3UV6A 5CUQA 2GJ8A 4AMBA 4CU5A 2K5UA 2Q4TA 5DXAA 3A2MA 4Z8XA 5B7NA 5DN6D 4QREA 2GXAA 4HDCA 2VPQA 1DRWA 5B7QA 2Z56A 4PPFA 3UJPA 1UFRA 2SCUB 1LC3A 3IOMA 1SA0B 3NM6B 5FP0A 3BXOA 3NT2A 5JAQA 2HAEA 1M2GA 2NT4A 3K5PA 4L72A 4PLPA 1K6EA 1V3VA 1SVMA 2HCRA 3BMCB 3PXXA 3WGKA 1ZOIA 3SIWA 4EUNA 4ZAZA 3U26A 2VWPA 3Q3EA 2ZSBA 3M1AA 5FPHA 2P62A 1E2BA 3AEQB 2XE7A 4WN9B 3O4FA 4DM7A 1C1DA 4X3CA 4KSCA 1I1NA 2NUPB 3ZH2A 2QE7D 3CO0S 3K53A 5ENDA 2XWPA 3IQEA 5BXQC 1B8NA 2OBNA 4IHJA 3TIXB 1IXKA 5A03A 3IPXA 3T7AA 3PHIA 3T3GA 3DE1X 2FMUA 2E4WA 4GT1A 2CLOB 2GVNA 5C5IA 5BV7A 5CITA 3PDUA 1IMJA 1CF9A 5BPFA 2G09A 2ID8A 1UBFA 1TEVA 4IIVA 2QQ0A 4XZ3A 1N2OA 1ST2A 1M67A 1K7FB 1GT6A 1EDEA 1T0BA 5E4FA 3ECAA 2GYWA 4XVUA 2W2XA 5HE9A 2BUCA 2C9CA 1I33A 1L8XA 2OGZA 5JXGA 5K6RA 4MUFA 1DI0A 1MW8X 4FJ1A 2CL0X 2GKSA 2P3SA 2CUTA 2QYOA 5KX5F 2J07A 4D4GA 1NG9A 2XUKA 4JIGA 1IN5A 6LDHA 4MA4A 5ALYA 5B1SA 3PQ4A 1JE0A 5I9TA 2B5WA 1VP9A 4LVOA 3R2JA 3WWCA 5HZGA 1CYDA 2VKTA 1A97A 4PC6A 3DB2A 3NAZA 2W22A 1KDRA 5ERYA 4YRJA 5A4DA 3I04M 4HTFA 2XDAA 5AWFC 1HK7A 1RFLA 3MD0A 3SE0A 4EHLA 5A4MS 5JISA 1LW6E 3E7WA 1D8TA 1NPYA 6AT1A 1I2ZA 2FX2A 2NZ8A 3AF1A 4LJLA 4M36A 5BRNA 5IJ0A 2IHNA 1QVRA 3RWBA 2CDAA 1Z17A 3OY7A 3AP2A 2V96A 2Q2VA 1D1SA 1O58A 3KFVA 3H2YA 1A2OA 2OGSA 5CYPA 1UBEA 2P2SA 3SR4A 1VDMA 4RORA 2IZ7A 5U1PA 3ADBA 1YR6A 2AX4A 3TKYA 1XN4A 4IIFA 4BMXA 3IGFA 3E9ZA 3P52A 5KU1A 1U0OC 1DKUA 3R5KA 1FNMA 3F5SA 3VTFA 1SC6A 2QP3A 1ZC3A 4NMXB 4Q1AA 4CMIA 4QVGA 3WIBA 2R8OA 2ADOA 3BDAA 1QYRA 3BAZA 3EGXA 5EWLB 2IYNA 3TG8A 1TEZA 4Z4FA 2R1VA 3C14C 4XR9A 2X0NA 2PYDA 4BMVA 2ZBUA 1QV6A 3E1SA 1YJ8A 2XHEA 3KEMA 3N2GB 1E9EA 4BFTA 3A2LA 2JIOA 4I50A 4OM8A 5CFQA 1OH8A 3QH4A 4OGKA 3DP9A 5IW8A 1IHUA 3UBTA 3C8UA 2B34A 5C81A 5FBKA 5K6TA 3PXCX 4C7VA 2C8JA 5FDFA 1WWKA 4YXWA 2D0IA 4BVJA 1BGXT 1DRVA 1GG8A 3DOCA 3FPJA 3OMXA 1LWOA 4FQ7A 4GF5A 3BWCA 3VZBA 3S5UA 3WLQA 5ICEA 2NP7A 2B25A 4MP6A 4OYRA 5HIKA 4KL8S 4N12A 4POAA 1EE2A 1FYXA 1BQ4A 1G5QA 2H3EA 1CERA 2LBPA 1J49A 1E2QA 1PDOA 3R6GA 2X8LA 5CURA 3JQAB 1WF6A 5DHPA 3D8BA 1HM5A 1LQUA 1IUPA 3UMCA 2WU4A 4UUAA 3DZHA 5DBIA 1I4TD 3RARA 4NICA 1D2HA 2D5LA 1CJKC 2ZAGA 3QX9A 2OKCA 2EZ9A 3DM5A 1JHQA 1UP4A 4K9SA 1ZK1A 4HX5A 3LIPA 2ZQYA 2VF4X 3NC4A 4RENA 4FKZA 4P4SA 3WLMA 1R6DA 2IU0A 3PXDA 3T1NA 3F46A 3HDTA 5CNIA 1PKEA 4MIEA 5F2NA 2HTFA 5IG2A 5JDCC 1PJ4A 4B3DA 2XJ9A 1G55A 2QRMA 3S6JA 3TZLA 5JZMA 1FYDA 4HZUA 3PNYA 1NYTA 1DO2A 5LPNA 4FW9A 3PNLA 3HCRA 2HMWA 3KPUA 2CHVA 3N05A 2DY0A 5JXWA 1W581 1FSZA 1NVDA 2UYYA 4UE6A 4XTRA 2NO4A 5TS2A 1CK4A 2W4MA 3K8ZA 3R40A 4QBKA 1T2FA 2O8NA 4NC9A 4BEVA 1RI2A 4GD3Q 1SB8A 2FFHA 3TOSA 1TAHA 1T9KA 3KYCA 1ZR2A 1I5OA 1N9KA 1CG6A 3WYCA 1TAUA 5L3SB 4NSNA 3WYNA 1U7OA 3ZTTA 3G3EA 3ZS9A 5JDCA 4C0LA 2J33A 2XH8A 4NZNA 4WASA 4OHYA 3VR3A 2XAAA 1HLPA 1BU8A 2H4XA 3IIEA 1DRUA 1FTSA 1N6KA 3WLHA 4EYOA 4GI7A 2C7GA 1DT3A 4WOJA 3R7LA 1C1XA 2QTMA 3OTHA 5LA6F 5C8YB 4LMBA 3ZWWA 2XF8A 3MMZA 5CDHA 5IMBA 4B47A 2GCPA 3IVCA 4M6WB 1XZGA 1ZJWA 2FMFA 3F6CA 4TTVA 1PJAA 3G0BA 1M2FA 1DAOA 1R5OA 1C9EA 2IU4A 3NHFA 2HB6A 3S0JA 2OBBA 3T9BA 3GG9A 3VVLA 2PN1A 4FN5A 4HO1X 3IILA 4LJ6A 1SCKA 1GPYA 2W2OA 3H2HA 2YJZA 3JQ8A 1JG3A 1P91A 1ZL2A 3AKDA 4J1TC 2R8ZA 4WVFA 3W4JA 2QX7A 1NMQA 3FPBA 1U2GC 2H1RA 3JVDA 4QNMA 3WIUA 4DLWA 1J07A 4F04A 1B8UA 2V0CA 4PLCA 3IUNA 4MQMA 3OD5A 1MB2A 3BULA 2P8SA 4PS0A 1ESZA 5D85A 4FWBA 2C5LA 3DO6A 2GXUA 3IBYA 3JTMA 4ZOLF 2XDQB 1IHYA 1T10A 3N6XA 3WLIA 3BTUA 4DPKA 4UFPA 2K7FA 2XYQA 2FETA 4X65B 4R6XA 5MGBA 2HCBA 3V4ZA 5GJBA 3RNLA 3D9QX 2ZB4A 1SOUA 1B42A 1X8JA 2DWCA 3HFGA 3NVAA 3MTEA 4S1NA 1V39A 2JJ1D 2PG3A 1U2GA 2PZKA 1Y6ZA 5CFPA 2XVYA 4AY4A 4PFJA 4BVAA 4EX7A 4GS5A 3HR4A 3DMNA 3AUFA 3GN1A 4M7RA 4CTOA 3NG1A 1NDHA 2ZBRA 3F6SA 3TM4A 4BFYA 4ND8B 3KJFA 3NVKI 4PSVA 2QT9A 2ZYIA 5DTMA 1PL0A 5HSGA 4EW2A 2PXCA 4HR7A 2MR6A 4HVCA 1KWGA 4LC1A 4FYKA 1CRZA 1KH3A 4FJ2A 4H1WA 4YCMA 3ZVLA 1BXKA 4N47A 3MXOA 5DP2A 5EHGA 1AKQA 5BSFA 4KLZA 3QE4A 1ZIPA 2BF4A 4IGFA 2WFLB 3FMOB 4FLMA 4DA8A 3RT1A 4H2DA 2XGOA 3AVUA 1BGVA 3R3YA 2DFKB 4AF8A 5DIFA 2QRKA 1GPDG 3FFAA 3R9XA 3OZWA 2IIVA 2FFBA 3QITA 3PDHA 2Y1FA 4KWIA 2JGFA 4CF3A 1FSSA 1WEKA 1HSZA 1PL6A 1UDCA 2HFKA 2P77A 3JRWA 2IH4A 4X61A 3OH8A 4TMVA 4KLRA 4AY2A 3CNQS 5DYYA 3MYRA 3PGXA 5I51A 1GRQA 3GG2A 4EG0A 2JCYA 2ECOA 4CM8B 3L77A 4TLDA 4OLJA 1T9GS 3C2QA 3LUPA 1ZGBA 1M1YB 4FS3A 2JDIA 3GNQA 1AUQA 5SY4A 5K51A 3QBTA 4H18A 3BGWA 3L5OA 3DB1A 2C5SA 3L0OA 5BWLA 4RESA 1H85A 1TVKA 3F2IA 2WWFA 1U2RA 4DY6A 4K9RA 4ESHA 1UKEA 1I5RA 2VYVD 2ZRHA 3QEOA 3QNUA 4RABA 5GOTA 1GQ2A 2G9VA 3L9WA 3V7FA 2HTEA 2QSUA 1E4EA 2QMYA 3CZ4A 4U00A 2HQRA 7MDHA 1Z16A 4EVIA 2EX0A 1YACA 3WI7A 3DZIA 2IUSA 2Z2JA 2RHWA 1WPXA 2P40A 2IV3A 1O0BA 1VKRA 1CEYA 1DO0A 1XZEA 2P91A 3ONWA 1O97C 1YA4A 4G0UA 1T8PA 5ALPA 1WKCA 1J20A 3HBNA 3MJ4A 5LXTF 2Z95A 3NHLA 4MW5A 2WM2A 1UC8A 2O48X 3OETA 3PUIA 3OFSA 4NE9A 4P83A 4QDUA 3UJDA 5E0KB 4AZVA 1NT4A 3P26A 4OXXA 2I8AA 1EEHA 521PA 4OVKA 3WK8A 2IU3A 2PQ2A 3EGVA 1E4OA 1O77A 4HFRA 5BQOA 4JOQA 1A2KC 3H4IA 1DZIA 2QD3A 4OOFA 3S29A 5J2UF 3R20A 3P2EA 1FIUA 2QR3A 2HF2A 1RAAA 4FT4A 1OX4B 4A0HA 3FB4A 2A4MA 1BN6A 3OMLA 3ZLUA 4MLPA 5DV9A 2C83A 4KO3S 4URFA 4PLYA 1R9GA 3RKUA 4DDMA 3ZJVA 1SIOA 2IS6A 1M6VA 3T0FA 1E2NA 3MJHA 1XZMA 5FI3A 2W9XA 5JYEA 3UJ8A 2GVDC 3HN2A 2Q5IA 8GPBA 5DH9A 4PXYA 4YRTA 3G0DA 4XPZA 4DILA 2BMJA 4TV9B 3P2OA 3ZS8A 3MINA 4AUEA 4I4NA 1CRLA 3CIOA 4DQUA 1S4MA 4AUKA 5IM4A 2PUCA 5HP4A 1DGQA 4P7KA 5JAMA 3DV9A 3IBFA 2ATIA 1A9PA 1M54A 1THTA 2ZGVA 1WHSB 4GZMA 4DA6A 2WHQA 2H4FA 5JXJA 1IPEA 1KVQA 4MVJD 2VIIA 5H7XA 4GE3A 4AL4A 4ENSA 2GPYA 5M29A 1MKYA 3SXPA 2ZSKA 4FBMA 1AXEA 1YOVA 3WADA 1JHVA 2X2FA 5TR9A 4O33A 5DHRA 1A50B 2VP5A 5GONA 1FDOA 3LVFO 3IB6A 1ADJA 3S8YA 2W6MA 3K0CA 4IDNA 2NAFA 1X92A 2JATA 3EW7A 3HNOA 1CU1A 1S02A 1Z22A 4RH1A 2O54A 2H5JA 3SZMA 1FFBA 1T25A 3KJXA 4LS3A 3M3PA 4FKBA 2FOXA 1O54A 3BWDD 3L07A 1W34A 2VPWA 4K6OA 5MHTA 3UT6A 4XQCA 1XNQB 5TMEA 3HZHA 3ROPA 2JFHA 3C7AA 2G25A 3G5UA 2JD2A 2Q6OA 1KE2A 4KVAA 4C76A 2BMVA 2FN9A 4F38A 1VDZA 1B6TA 5CX1B 4WIAA 5FB3A 5A0FA 1CS0B 1P80A 1SXJD 3CJRA 3FFWA 3Q40A 4QYIB 5JSHA 2P6NA 4MJ7A 2VNAA 2VQSA 3DOIA 5GIOE 3DL4A 1C9KA