3L41A

Crystal structure of s. pombe brc1 brct5-brct6 domains in complex with phosphorylated h2a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
b'KRVYITFTGYDKKPSIDNLKKLDMSITSNPSKCTHLIAPRILRTSKFLCSIPYGPCVVTMDWINSCLKTHEIVDEEPYLLNDPEKELELGCTLESALKRARAQGPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCSTLNVYNKRLARHLEDGNVVLITCNEDSHIWTNFLDNASQNKTIFLQNYDWLIKTVLRQEIDVNDRIADEFARAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BRCT-containing protein 1
molecule tags Cell cycle
source organism Schizosaccharomyces pombe
publication title gammaH2A binds Brc1 to maintain genome integrity during S-phase.
pubmed doi rcsb
total genus 75
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l41A01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l41A02
3K15A 4Y18A 3T7KA 3SQDA 4ID3A 3II6X 3L40A 3QVGB 3PC6A 1L0BA 4IFIA 4BMCA 1Z56C 2WT8A 2HTFA 3AL3A 3JVEA 1N5OX 2XNKA 1T2VA 2COEA 3QVGA 3EF0A 2VXCA 3FA2A 1KZYC 3EF1A 1JNXX 4N40A 2EP8A 2DUNA 3T7IA 1GZHB 4OFBA 3UEOA 1T29A 1L7BA 3I0NA 3PXEA 1Y98A 3KTFA 3PC7A 3U3ZA 3PD7A 3K0HA 4BU0A 3HUEA 3L41A 2NTEA 5ECGC 4IGKA 1OQAA 1CDZA 4XQ0A 2EBUA 1T15A 2EBWA 2ADOA 2XNHA 1IN1A 2K7FA 3K16A 2K6GA 3OLCX 2AZMA 2R1ZA 2ETXA 1WF6A 3PXAA 1T2UA 3SZMA 2INGX 3K0KA 3UENA 3PA6A 3T7JA 3L46A 3I0MA 2E2WA 4U4AA 3PXDA 4BU1A 3COJA 3T1NA 3PXCX 2COUA 4BMDA 2M2IA 4Y2GA 2D8MA 3PC8A 2COKA 3PXBA 4JLUA 2L42A 4XPZA 3SHTA 2VXBA 3HUFA 2JW5A 3PC8C 1IMOA 3AL2A 3SHVA 2LE0A 3K05A
chains in the Genus database with same CATH superfamily
1TL7C 1XQ1A 5DNAA 3NGLA 2M6SA 1E1RD 3W8RA 3VAYA 4MV5A 1M6VB 3ITEA 2YZGA 1VKZA 1DT5A 2FJUA 5KCMA 2JEOA 1PAUA 5C7OO 1XTVA 2C0QA 2P0AA 2P9HA 5EFZA 3PD1A 2PFSA 3HB0A 3OIUA 3F3MA 1XA4A 3K8QA 1WUIS 3LHFA 1GPLA 4OYHA 1XPUA 2EOAA 2WM9B 4Q1AA 2JIRA 3SXUA 1E1QA 2VF4X 3H5IA 2B99A 4WZBA 4MR8B 4GLJA 1D2AA 2YWDA 1HT3A 1XU7A 4ND8A 5TE9A 4GM4A 3TI7A 1QO9A 2BMJA 4CTKA 5JDIC 1PNVA 3NIDB 3TX2A 2Y6UA 1DKOA 5BRNA 4S1NA 1D04A 1MORA 3SFTA 4L9SA 1RAGA 1PCXA 2WYWA 4BO8A 2VF2A 1K5GA 3BF7A 3GAFA 1O5OA 3NOQA 1SWWA 4ZVRA 3U2QA 4GS5A 4ZWNA 2RGRA 4RK0A 1XALA 4L15A 1U9YA 2WSSA 3VTAA 1BVHA 4IDCA 3U3ZA 1QIGA 4QLAA 4DLKA 1J33A 2X8AA 1IK6A 3OEWA 1E2JA 2EJUA 2QHXA 3KYBA 2CL7X 1V41E 3ZD8A 4OL9A 4DJEC 2EFJA 3NEJA 3RC1A 2QD1A 3PVSA 4IIJA 3INGA 4TYPA 4BP9A 2O2ZA 3NDRA 3AP2A 5K45A 2HMSA 3LDUA 3GQBB 1TF5A 2EC5A 1Z38A 3HJBA 3NQ41 4M1KA 4X0EA 1GNPA 2VRNA 1DFHA 2H2HA 3DE4X 2IZZA 3A2LA 3NFRA 3KHTA 2BZGA 2PLAA 2OK8A 1TLLA 4OI4A 1KK0A 5KTKA 4LF7B 2C2BA 1A04A 4O4IB 3LCVB 1QU3A 2VLBA 1NF8A 1JHPA 1SVUA 3HZRA 4G4GA 4KAJA 1CJBA 3Q3GE 5IAOA 5KJFA 5LDDC 1VFNA 2GH1A 3BH0A 3M6XA 3RB8A 3D5TA 2QR3A 2QS9A 2V74B 3E82A 3UXYA 4BLPA 5IM4F 1UC5B 1QKJA 2Y66A 5H3HA 3F6SA 2WV7A 3MEQA 4ZGBA 4LNUA 4XUEA 1E61A 2LNDA 3B6KA 3AEYA 3S55A 4PPYA 1RI2A 2ZTSA 3ZW8A 1KMHB 1EQAA 3SR4A 5MN6A 4ZV4A 4RIEA 4WINA 3D3QA 4YB8A 7MDHA 3GDGA 2F3SA 3IEPA 3O90A 4L0QA 3ZDQA 4LBWA 1TEHA 4LYJA 1EZZA 3W4KA 4R3WA 4B4UA 4C6HA 5L53A 2IEZA 1YZVA 4FGWA 2PQMA 3NM4A 4B6RA 5CU7A 1SCQA 4IWXA 1I7LA 2AH5A 4BMDA 5HM8A 1RP7A 1I4WA 4YRDA 4AKSA 2UZ4A 4IV0A 4Q1CA 1SK8A 4UUAA 4CL2A 1VJDA 2FSIA 3A11A 3AEUB 4L78A 1U0TA 1I5RA 5EE3A 2COKA 4DBVO 4O4IF 2ZDQA 4W6QA 3VFDA 3ETGA 4YIKA 3QUTA 1Y0BA 2OLJA 3BMCA 2ZR8A 3EVEA 1CLEA 3GLGA 3WK9A 1V8BA 4MWBA 4R1NA 1RRCA 2JAQA 4FCTA 5KTOA 4I1UA 1T9HA 4H1TA 3GN2A 4EVQA 3AG6A 5KWEA 3RAFC 3O0DA 2PUCA 1OTXA 3OEHA 3GDWA 1YJXA 2A7XA 3DEAA 3DB1A 1SHTX 5H80A 3ITKA 5BSKA 4DVJA 2IBSA 4G8BA 3GBPA 4JX8A 4LI3X 4DJDC 3KFXA 2A78A 1Z12A 1IH8A 4DCMA 4V0NA 2X0EA 4Z3OA 1T3LA 4EB8A 5IASA 3K3PA 4DRZA 2QTNA 1ATIA 2Y1EA 3MJHA 2HHAA 4MYCA 3AB3A 4RIFA 4JYPA 1L5OA 1XA3A 2PLFA 2WIJA 3DAPA 2VDNB 3IVCA 2IH4A 3WKEA 1RMTA 1VM6A 4YXWA 4ER7A 2VDQB 2C5LA 1JNXX 3AK4A 4NY1A 5BR4A 4MCHA 5BY2A 3WZLA 5AJWA 1U3VA 2VRBA 5EINA 5C5CA 2BH2A 2R79A 1H66A 2V6JA 4J1SA 3ZU5A 1YZTA 1O5TA 4J16A 3T7TA 1AZSC 1GRNA 3DTYA 5KVSA 1XLTC 4NMWA 1E77A 2OTCA 3RVSA 2IE0A 4DHWA 4H9GA 5JD3A 3WKBA 3A6EA 5LVAA 2GUWA 1QE0A 1PX2A 4NAVA 5BNIA 4H35A 2HLDD 2AZDA 2VTVA 2YNMD 1NMEA 1U7OA 4LJ4A 4I3HA 4MW5A 1DJOA 2OP0A 4MVJA 2NTNA 3L84A 3A7EA 1T5TA 4WI1A 2JIZA 3FZYA 4G56A 4XOIA 5ALLA 4X8MA 4ZYVA 3PYMA 4MRRA 3RUFA 2WHYA 5J5CA 5TPZA 4XUCA 1QVWA 1XNRB 2XA1A 3IEIA 2WAMA 1JXMA 1U04A 1BVYF 2Q2OA 1T4GA 3JD0A 1ZL0A 2J9YB 3LBAA 4EW1A 2GN0A 5EUBA 1Y5LA 4JB2A 2FVYA 3KJGA 4KITB 5AXAA 2XCUA 2H0AA 3I8XA 1P9OA 2H7VA 1DQYA 4W5NA 1L4EA 4UOQA 3G9TA 4NZOA 3KZ1E 5JAMA 1EFVB 3A6DA 1QBGA 1A97A 3UWPA 1A5AB 1QHGA 1YACA 1C9MA 4XDYA 2DUJA 3EEFA 3FYHA 1XKXA 1JDBB 3GD7A 4GNKA 3GN1A 2H9YA 1TTQB 3TG2A 1N0WA 3QLVC 1AOXA 1Y7IA 3E9MA 5JSZB 5DM2A 5F35A 3PGXA 4LYAA 1JZSA 3H18A 2ZB4A 4JJAA 2DRIA 4U7TB 1MA3A 1VA5A 4WFIA 2QSJA 3EVDA 2ZYWX 2WU0A 4E6EA 3T5MA 2ZKIA 1DRWA 2QQFA 3KZXA 4PPQA 5CB4B 3GA0A 1SBCA 4DWWA 3D4OA 2IS6A 1W5SA 1QQTA 2R1TA 1FNMA 4Z0PA 1JSXA 3WKAA 4ZI7A 1WE2A 3Q7EA 1Y6JA 2H07A 3DOFA 3ORSA 5IS2A 3U44A 1P5RA 1W5AA 2X1VA 2O05A 4QRIA 4QQ8A 3WJ1A 4DDKA 1IXYA 2QQGA 3HP1A 3CX7A 4HG2A 5E1MA 3KEMA 4OP1A 1EINA 3EXHA 2ZQZA 1CERA 1G5FA 1MC4A 5J4YA 4UHEA 4ZEVA 3ADPA 2IHZA 3KQSA 3G2IA 2IHTA 3ECCA 3MJVA 4XIYA 1R9MA 4OHMA 1NUHA 4ON9A 3TRKA 1ZVQA 3ASUA 3O03A 1IE3A 2EYUA 5CURA 1MPXA 3EUAA 3FMIA 4EPRA 5EMLA 3X43A 4FOOA 2FPSA 1S96A 1FQKA 2P1ZA 3N2KB 3H1EA 3TAXA 5B7QA 1QRTA 1DAKA 3ZR4B 3GRFA 3B1WA 1PLKA 4M55A 3BKWA 3Q3EA 3R44A 3FPSA 1DC7A 3GARA 4PNEA 1CF4A 1XRMA 1AUVA 1U2GA 2DHRA 2AF4C 2VAVA 3H1TA 3L40A 3IKLA 4N8DA 4CL0A 1F60A 3IQWA 2ZSUA 3LKBA 2HDWA 3HWX1 3F7TA 1PR0A 2JCYA 1CCWA 3N74A 3C15C 1IUPA 1G21A 4PM4A 3EZ7A 5I4CA 4CF3A 1OFUA 3LLMA 5I9TA 3VZQA 4QX6A 3R9IA 4ZT4A 1VL6A 1KMIY 4F3RA 3QXXA 3DM9B 4HDMB 1XZLA 5AKGA 1CX9B 4JQSA 1V37A 2GRUA 2IDZA 1GRVA 3LUFA 1KDZA 3AOEC 4YV2A 1KORA 5DI9A 1RQPA 5FT9A 3WGZA 2A67A 4UVHA 1L7VC 4DR7B 2R6AA 1EP1B 3N0RA 1ZI6A 2V7VA 4XWKA 2Q5EA 2JEZA 3NU1A 5JNTA 5JJ5A 2JARA 2E82A 2LW7A 2V7EA 4POAA 3D81A 1Q3KA 3FRIA 4TS4A 2OPHA 3H6HA 1H42A 1EFVA 2C98A 4JBNA 1NJ8A 4WOJA 3WWZA 2ZYTX 2VP2A 3NHBA 3KXDA 3PD0A 3QPAA 5AOBA 4ED9A 3PUZA 1G5RA 1ZVVA 1VCMA 1Y4AE 2GSWA 3CG4A 3F6EX 2HXGA 3ACBA 2RFLA 3QBDA 1WD5A 2FJPA 5EAIA 1JKJB 5LD2B 3CRW1 3HWRA 1A8IA 5CNIA 1B8NA 4FHEA 5JALA 4ZAWA 3ZHVA 4RENA 5T64A 3ROKA 1H85A 3BB1A 2VYNA 4YMSA 2C88A 1T9BA 3GJTA 4OUDB 3GFSA 4O29A 1UT5A 2ZVDA 4QWMA 4RVGA 1X8XA 3DVAA 5DLYA 4AL4A 2Y93A 5DK4A 2XUFA 4A0QA 1D5WA 4V3BA 1ABEA 3MXOA 1G3MA 4OIMA 1NW8A 3DXXA 3GEDA 1ZM3A 3QLVA 2DPYA 4KU4A 3UAZA 1IXZA 4OYLA 1U1IA 3QF4B 3AM3A 5BXQC 5CDSA 4B71A 3LZDA 5JS8A 13PKA 3JR3A 1S01A 3LUKA 3DV2A 4JLPA 3T9BA 3HCPA 3QWBA 4OATA 3Q5EA 2QJWA 2O06A 1DG9A 1QVAA 3MTDA 4GKBA 1CUUA 4X90A 1YQDA 1PFKA 3DDUA 1C0IA 4L75A 4QHTA 1NQOA 3IJPA 4O2BB 2PUAA 1P4HA 4G26A 3BUSA 3ISJA 4N7BA 4MDFA 1DRUA 4UTNA 3QQ5A 5HJ5A 1GSOA 8MHTA 2IW3A 3O93A 4CZ2A 1XAHA 1AMOA 4RIIA 2NU6B 2WFAA 5K2MA 2FPPA 1PWHA 1G2OA 1QYXA 3SQOA 3AHFA 1F2VA 1D8TA 1P45A 1VB5A 1KOJA 5L7YA 4M99A 4CNQA 1KJ9A 2I3AA 3UB3A 1N9GB 4EF4A 1GPUA 3QPDA 3B3FA 3WJAA 4L7VA 5B55A 1KU6A 4YK7A 121PA 4YC7A 1VSQA 1CUVA 4QL3A 3C7TA 1VPEA 2HU8A 2XB6A 5HKKD 1XK6A 4M0EA 4XUDA 4JT2A 1QCCA 3OZ7A 1QV7A 3FYSA 3MB8A 1ENZA 3DZGA 3O92A 4MKHA 1O89A 1OTHA 1RAEA 4JH0A 4KOEC 1E0AA 5AP9A 1AS2A 4G67A 4Y18A 1CVRA 5GMOA 3RS7A 3ESDA 2CLCX 2N75A 1Z4QA 1L1QA 3LQRA 3OPYI 1Y3HA 2AJTA 3LA6A 2B36A 1TTPB 1ISMA 3LK7A 4B3IA 3OZVA 5JBQA 4ANFA 4DBLC 2PD4A 1NT2A 4ITUA 4DCGA 1RSZA 3PQ3A 5AMXA 4MIKA 4CODB 4GPEA 5CJ2A 1Z16A 5L7WA 3HV0A 4RPJA 5LOVF 3ABQB 1QHIA 5LNK1 2GT1A 3D6FA 3MJDA 4B45A 4WH0A 3EMDA 4D4HA 2ZIFA 1WSWA 5YASA 2R7LA 4LOAA 1CUEA 4TSRA 4X9XA 5CT8A 3L7BA 2PUGA 4KXUA 1S9DA 1R88A 3PUIA 5ALFA 1OPRA 1R9NA 2FY8A 3LZ6A 3NOXA 2VL7A 3E0XA 2HA6A 2K5UA 3OIYA 3GYBA 4L0MA 4LXXA 1P75A 4DMRA 2I67A 1GYPA 4Q16A 1QLWA 3A3NA 1IZ0A 2CFOA 4HN9A 1T1GA 2SKDA 3KZVA 1EFRD 2EW8A 4UULA 2YTZA 1MZPA 1TOAA 2GSDA 1E2IA 1NDQA 3KQMA 2CN1A 4G4IA 4MUBA 3EC7A 3R3SA 4PFKA 4AZSA 3G0BA 3WBBA 2JZNA 4AJHA 1FLAA 2O14A 4M9ZA 1TT5A 4P3XA 2GJ4A 5EQJB 1WA5A 1Y3AA 2VWHA 4DMLA 2A35A 3N8NA 1E3TA 2ZEJA 4UBLA 4PYLA 2VYVA 1G8AA 2OCKA 1PK9A 4O8CA 4YTEA 3REQA 3RTEA 1SUDA 3MOSA 2Z1MA 3CYFA 4OO3A 1C9EA 1KH3A 1G6HA 3ZPXA 4K87A 3NM5A 3FHCB 2JGNA 4IIHA 3O8CA 1FUYB 1AD2A 4P98A 2HF7A 3AU9A 3C7AA 3GJ5A 3IBFA 4HLQB 1NE2A 4JQZA 4RF3A 5JXWA 1IN1A 4MQMA 1Y8RB 3FIJA 4ARAA 3IMEA 5L3VA 1CUDA 5DLQC 1DHTA 5B6PA 4QDJA 3VNUA 3OOEA 1SG0A 2C2XA 2ZWOA 1L5QA 3PHBE 5JATA 1ZONA 3OTHA 1YDGA 4NYIQ 4QAJA 2ZW9A 4YP7A 4XYMA 4C76A 4FYMA 1PR4A 3UENA 1U1DA 1XL0A 2AN3A 4RD2A 4FGZA 3UG7A 1Y8QB 4TROA 2Q1WA 2DFVA 3E1SA 1Y7HA 5AI9A 2ORWA 3PI7A 4O2BF 1KFCB 3KQPA 1GGHA 2QIPA 1TZCA 5IJ0B 3D8BA 3E6AA 3E53A 3GBVA 3TQOA 3IT1A 5REQA 1CRQA 3QLJA 1JKFA 4RVHA 2J5RA 4X6UA 2RK6A 2ZE8A 2B37A 4LUCA 4IH1A 2OXEA 4M98A 2JJ2D 4BO5A 2DBRA 5JTTA 4NKRA 2ERYA 1A7JA 3L04A 1NKSA 4MV4A 2W8BA 1FQOA 1W1UA 2Y0BA 5CK5A 3VC3A 3W5BA 1HDRA 4LYYA 4CXMA 1W6UA 3U6BA 3SXPA 1E2KA 1OU0A 5BSMA 2I9KA 3ACDA 3KSZO 1FOEB 4P9NA 1RKQA 2GKSA 1OAKA 2FSVA 2Y2VA 2ZJ0A 1D6JA 5CP8A 1Z7BA 1Y7TA 4MVJI 1EAMA 1A3CA 3V7FA 4D5EA 1D0IA 1J8VA 2JH9A 1FQJA 4RV9A 4RXTA 1VRCA 1SVIA 1UBGA 3D6JA 1VJ0A 4N03A 1OWNA 3O84A 3I9JA 1UZAA 2HJHA 1XZPA 3LF1A 4RYDA 3UOGA 2XZDA 1O9BA 2PS3A 4NULA 1COZA 2OB2A 1PSZA 2NNLD 1R5NA 3DWFA 3FMGA 4INAA 5E8JA 1O8CA 2HXSA 5FA5A 1Z74A 5H1YA 4D46A 2O3JA 3EFOB 5ED4A 2Z4SA 4QOGA 4HI0E 2H4FA 3T7KA 2X42A 3S2UA 4Y1RB 1A2KC 4NARA 4P1ZA 1YZNA 4KR9A 4FX5A 2Q3MA 1N1GA 2ZUEA 3SC2B 1Z2NX 3GDOA 4HAWA 4I4IA 3QOXA 3R5TA 2BH9A 1X1EA 2IHVA 1EU1A 2YS7A 4MUXA 1FIUA 2AIRA 4XVCA 3QVSA 1DIGA 1K6MA 1T0BA 3D1JA 1TKAA 3ES9A 8ATCA 2PS0A 3NI2A 3R3UA 4K5QA 5TQ2A 4Y2RA 3HRIA 2VRWA 2VSNA 4CIXA 3TAUA 1JSRA 1Z4LA 2IYEA 2YJGA 3F8SA 1HH4A 3K0AA 3MCVA 2AFHB 3MRVA 3RVQA 2WYHA 4EZIA 2I7VA 4RD4A 1L7AA 2LIVA 5ALKA 3R5HA 3QW4B 4RIHA 3V7NA 4MTLA 4INJA 4DT1A 5DMHA 1JKJA 4LXTA 4UDNA 3FCOA 4TYNA 5D1HA 4E09A 3BD8A 2RBKA 1YZLA 2D8AA 3MWDB 3ZWAA 3KD2A 1FXUA 2NSHA 3VSDA 3X1JA 2IGTA 1WKCA 2YJ4A 3HKCB 2JATA 4LGMA 4MOWA 4CV3A 2APJA 3BWYA 3PRYA 5CW2A 3TLMA 4EJMA 2EYQA 3W3AA 5I7SA 4AS3A 2NIPA 3ZZNA 3AETA 4RXUA 2C4HA 3LY8A 1UPXA 5I9BA 3CLUC 5JSZA 3BSWA 3I9KA 3WB1A 1F38A 4DADA 3MJCA 4EHAA 1E3WB 1JDBC 1JKXA 1P2DA 1RM3A 1RT9A 1EM6A 1XTZA 2IEGA 2WHRA 2ZI7A 3AX6A 3ZJTA 2XRMA 1EKXA 3TUZC 2DFTA 4QE3A 3HVRA 5FTMA 4GL2A 1Q0QA 4TZTA 2HWKA 3R3YA 1P17A 2GYVA 4WUVA 3FROA 4AECA 1T9AA 3OC0A 4TUYF 4M1QA 1BXGB 3WS7A 1KJNA 2YQZA 1T35A 1SCKA 4QUIA 1UJNA 4TN5A 2C03A 4MYRA 4JNKA 1MVNA 1P5JA 5IVDA 3IQXA 1J8FA 1XEXB 3I5AA 1YVRA 1MC5A 1YQUA 2ZOSA 3K0KA 3T7AA 3LT4A 1IDN1 3RUIA 2XMCA 1JG3A 4WNAA 3RWBA 2WJVA 5FIUA 1NTRA 4XX0A 3UGJA 2QTAA 3ELWA 3OT5A 4QWWA 4RFSA 3BZBA 5L95A 5ALPA 1XZNA 2XUJA 3I2KA 3DMRA 3QVWA 4IM7A 2IX9A 1VECA 4UHKA 4TUYB 1T13A 1W44A 2GXUA 2H3HA 2KJQA 3GEGA 3KR9A 4LMBA 4P82A 5T4BA 1W36D 3CZQA 3QV1A 2HGSA 4RDHA 2YIMA 3P4UA 3TN7A 2Y1WA 2R5FA 2ODQA 1HT2E 3LYUA 1HQCA 4WMLA 1ZCFA 3IEVA 4N76A 4D9GA 3TQFA 2YMQA 5T6MA 5AKZA 1DCTA 4OHVA 4IIFA 5IUNC 3NASA 3ZS9A 5AD1A 1GQQA 3AF5A 5HIJA 1SQ0A 4ACBA 1I2DA 2GEKA 1RACA 3AW9A 4OJMX 2CEKA 3W6NA 3RADC 4R9SA 3VR3A 2FRVA 5LL6P 3DHYA 3PC8C 5DISB 4DIUA 9ABPA 3HTXA 3IUSA 3NAQA 4RA9A 1WUTA 5FAKA 4WXEA 5HILA 2PX2A 1TKBA 1RKXA 2GAOA 2QUJA 1TCBA 2ATXA 5KQRA 4EI7A 4I36A 1W19A 1VZ2A 1R27A 3MUFA 3TGWA 3QOWA 1DINA 4QVGA 4YRNA 2J85A 3DE3X 2WOJA 1RVDA 4YR9A 2H1OA 1A50B 4CEIB 1P4AA 2PX8A 3C87A 3NUGA 3W3AH 3E8XA 4GT1A 4N4AA 1EFKA 3ZOKA 1OPXA 1VYTA 3QYJA 3T7SA 2GXAA 2Z2KA 2C96A 3JD2A 4OHRA 2P6OA 3GUYA 3FWHA 4OH1A 1QFSA 3ZHBA 5J4KA 5EWJB 5KNLA 4KWHA 1NWCA 4RETA 4QYMA 1RTKA 2EKBA 4V02A 3VSCA 4TL6A 1E2MA 4KIWA 2TS1A 5KSOA 4L5AA 5C8DA 4WT7A 1VE3A 1FNBA 4PLYA 2HRQA 2QYHA 2FEOA 3LUGA 4C06A 1RBZA 3LDFA 4EKYA 3U3JA 2ZB3A 1TZJA 3A9UA 2HPZA 4BRWA 1RC8A 2JJ1A 2EIHA 3BRSA 4HAYA 1GZ7A 1Z0AA 4AN1A 1YAHA 5H4HA 3L77A 4IOKA 3M3HA 2J8ZA 2HXYA 3OOYA 4M8IA 1TM3E 3OFNA 4FYVA 1EA5A 1SBYA 1XCPA 3WGLA 2X3YA 2O8BB 4DTCA 3LWDA 2H2DA 4FKBA 3WC4A 4MUAA 2D0DA 1LX7A 1VHLA 3NYQA 3VC1A 1WMEA 1HYBA 3GGJA 4JLJA 2AG8A 4NCNA 3N58A 4FZ3A 2G5CA 5CXXA 1K92A 3DONA 4JZYA 4IHJB 5AESA 2E9SA 1MT3A 5F4BA 4A36A 3BVPA 2GETA 2XMGA 5CBKA 4HXYA 2AG5A 2IP4A 3O4JA 4QBKA 4TKVB 5LZ7A 1NQWA 2NN3C 5TPZD 5B37A 3VNSA 3AUJB 1KI9A 4JQCA 4EHNA 1GUFA 3VR0A 3K2BA 2QXYA 4WN9A 1JTFA 2NSJA 5JXGA 3T52A 1DWOA 1E2EA 1GCUA 2RCYA 2X19A 3HCDA 1HNNA 3MGBA 3NV9A 2QRMA 4KSYA 4AFNA 4L08A 2WHXA 1YJBA 3MNFA 1NW7A 4JR2A 4ZEXA 1ZJWA 4TTAA 2YINC 4IEEA 2IHYA 1QGDA 3NBMA 2GFIA 3PLRA 1AKTA 1M2OB 3BICA 4H27A 1T3ZA 2IYWA 1I4TD 4HTFA 4N5HX 1TZ2A 4R2IA 4R7GA 5IAEA 5C7YA 2PT6A 3M5CA 4EJFA 2OCLA 4QJ4A 2IH2A 4IHQA 2BGTA 4R2KA 3TPFA 3U3RA 1SC6A 2FZVA 4RHUA 3NHAA 3DWEX 4LZJA 5DM1A 4D57A 3DDWA 4IDAA 1XVLA 5E3JA 4DLVA 3KT8A 5CVVA 4BE4A 3IKTA 4ZT5A 3ICWA 4XVQA 1POWA 1XT6A 1JAIA 2IA5A 2Q8NA 1YRLA 2DJ5A 5AJVB 5DI3A 3WGJA 4HWRA 1OZAA 2OV4A 2IOYA 3IC5A 5C46F 2NZ8A 1WB4A 5EVJA 1EHYA 1N33B 3CPJB 4X8LA 2EFYA 3SDZA 4AZ0A 1PR2A 1HWYA 3T5BA 3UQYS 4IHAA 4BLRA 3GGGA 3ZU4A 4NJEB 4A91A 2ZWMA 4Q05A 1T4CB 3B85A 3OFKA 1H6BA 4KMRA 1LX6A 2PVCA 1FFSA 2FHPA 4O2LA 4Y1EA 1OLSB 3RARA 4YHBA 4F3YA 4O2BA 5A71A 5IULC 3AHGA 3QY9A 2OGSA 2ZSEA 2C8VA 1Y89A 3EY9A 4I46A 1COWD 5F9HA 1EFLA 2XJ4A 3THXB 3RAEC 1NVFA 2G06A 5EMJA 4AUMA 1E0JA 4YRTA 1FE8A 3WQBA 1YR8A 3O9MA 1HFJA 3KUUA 1R9GA 2EFHB 3PEFA 5B4TA 1EM8A 1GCIA 2Q7DA 2EV9A 3DMTC 1QOQB 3I9NA 4RF5A 2I4RA 2Z5FA 2J0UA 3K09A 2H57A 4KGZA 2J46A 1ZSNA 3D8RA 3ZXIA 4EELA 5ERXA 5JSFA 4N01A 4RL6A 3NKLA 4J2HA 3N75A 1N2XA 4LZLA 3RTDA 2GHRA 4J43A 4ZT7A 1S3FA 4OBWA 4LWOA 1VLMA 3F1LA 1BS9A 1JALA 1M6WA 1N2HA 1F3LA 1N7IA 2KWIA 2QENA 2D1QA 4OFBA 4YDSA 5DSTA 5BR7A 4NLLA 5TVKA 4U7WA 3U17A 1IIBA 3TM5A 5DX8A 3EBPA 3PP8A 5KX5A 4YP6A 1PFGA 1Z29A 5D7BA 2HYIC 4AMBA 4MVJH 1A71A 1VI6A 3W3ZB 1MTZA 5MGBA 5DGDA 1R8YA 4G1CA 5BOSB 5IKOA 1N2CB 4D9EA 1X0XA 2QGZA 4JJ7A 4LVOA 3MAGA 2ZAYA 2RHTA 5HOQA 3RRZA 3BQ9A 4GZ6A 4JUDX 3FPEA 1JPNA 4B3FX 3QKRB 3K6JA 1Z63A 2R7MA 5L3ZA 2WB4A 2WDZA 4ID9A 3ESXA 3Q41A 1Y4ZA 4C0XA 5BMOA 3KU4A 2DUUA 1RAIA 1SHUX 1XNHA 2CNWD 5AHWA 2VCHA 4L51A 4TOIA 1L4NA 5A6VA 3ZY5A 4EB6B 4TRJA 4ETMA 5B5SA 2WD8A 3T3OA 721PA 2X5XA 1R2QA 1P1KA 2F1KA 3BK7A 1OIVA 2Q1TA 1CDEA 3EULA 3G6WA 4K26A 5HMLA 2NADA 5BSGA 2WWWA 1QUEA 3RYCA 2ADOA 2HF9A 1DRVA 2ZP1A 3GNSA 2XNHA 3MS2A 5F77A 5U4XA 3WZ2A 4CCYB 3S1LA 2QPTA 2X4IA 2AMVA 4MUEA 5C3UA 2AKAB 1UXJA 4EHDA 5IM4A 3OJXA 1QVVA 5LMCA 3PGKA 1EX1A 4CM3A 2HHLA 4US0R 3RAPR 2Q9CA 3EFEA 5CFOA 4TKUB 3EVTA 3AZOA 5AVJA 3G8YA 3ICEA 2HEGA 2UYQA 2I33A 1MA0A 4D81A 4DM3A 4Q4DA 5MDHA 4MK4A 1K7YA 1H1TA 3CE9A 1V16B 5GGXA 1L5MA 4FDVA 4WRRA 4WWHA 4X71A 5AK4A 4LOLA 3STUA 2QW0X 1HYHA 1TI7A 2ES4A 4GX0A 3SQXA 4D6YA 1QMGA 5G02A 4EIWA 5K8UA 3D2BA 3SDSA 5T41A 1K88A 3K94A 3H4TA 4QO8A 3IEUA 4D9CA 4MICA 2HMWA 3HJNA 3LQFA 3PQ4A 3VV3A 2EJBA 2YWJA 1U90A 2ZXEA 4J0KA 3OSUA 2MIIA 4WJLA 4LQ4A 4CLOA 3MN1A 1F4VA 1XU4A 2OG1A 2WJAA 2ZUCA 3DOHA 4X91A 4RV5A 3TPZA 4F9FA 2FP4B 2DWCA 5JPIA 4S2UA 1EK1A 4TV8F 2ETVA 2Q8QA 1DJMA 4B31A 1N7HA 5JNLA 1VMKA 1I4OA 4L0CA 4NNOA 5AKHA 3IUQA 4HNRA 1I80A 4IDBA 3IQFA 4DUGD 1NIPA 4RE5A 5TARA 1RI1A 3QE0A 3L8ZA 1GAQA 3X1WA 5EWJA 4B6QA 3SY8A 1UWCA 1TYBE 1ADFA 2ACWA 3FPJA 4LS3A 4KXFB 3M9XA 3C3EA 1VMEA 3P45A 4I1VA 1EWRA 3HDTA 3QMPA 5ALEA 1JXQA 4OBBA 3MIZA 2BF7A 3C14C 4QU5A 3SQDA 3GLFB 2IPXA 3CR8A 4R1UA 3PJGA 1LPOA 2VQFB 4R7TA 1ODJA 2DLNA 3MWDA 1LDEA 1IU9A 3VYVA 2ZIXB 1E4EB 3DP9A 1YFJA 3GLGE 4FR0A 3H5LA 2ZJ6A 4Y9SA 2JLUA 3UV6A 1ISJA 3BXXA 3MZ0A 4YROA 4QJ3A 2HKIA 1JHXA 4UU1A 1VHWA 1ORWA 4PQFA 3AP1A 3FDJA 3KJEA 4PEVA 4WOPA 2WF8A 3CG0A 3CGGA 1Y6ZA 4RELA 3SQLA 3I0ZA 2AX4A 4R8SA 2VQSA 3A0UA 3M5PA 2UZ1B 3DV0B 4J2OA 1E1LA 4KRYA 2P6MA 4J07A 4JI2B 2VJOA 3VUEA 4EDFA 3COWA 2FTKE 4MV8A 2O2CA 2Z6QA 1WDLA 3K0SA 4JI1B 1O8BA 4HZIA 3CA8A 5A5GA 4OKNA 1KR5A 2MMGA 2ZTVA 3F9CA 1K0UA 4AMYA 1JXOA 1RZRD 5GP1A 1WQ3A 1HZZA 1XRRA 3TM4A 3B6MA 1IZ9A 3LX5A 2C7QA 1VOTA 1N2SA 4K0KB 5AYVA 4KDEA 3WYAA 5ECGC 3IAFA 5E95A 3UK0A 4X92A 1IHPA 1X14A 2NQ2C 2QRPA 4KPUA 2G88A 1E32A 1JH8A 3CO5A 4I5GA 3LU1A 3RWOA 1TTHA 3VKVA 3WMEA 1JR2A 5T4FA 4GUAA 1J0DA 2Z3ZA 3PIIA 1J70A 2I3ZA 2YC2C 4YMLA 1AHHA 3NWOA 3T61A 4DUYB 1JVNA 4BHTA 5CHYA 1SOVA 1SWVA 2EDCA 4R6XA 5FWXA 4EITA 4AJ9A 2O8NA 5E7MA 2QQEA 4LE0A 2WNHA 3DL7A 3PSAA 3LTNC 2RHHA 3ZU6A 1V7ZA 3GEIA 4A8HA 4EMTA 1T0IA 2ZUUA 1T26A 2WSSD 2HPVA 4UHDA 5IBRA 3TRHA 5H02A 2W43A 1KRXA 1Q7RA 3I52A 4IMIB 4B84A 2HWXA 4PX9A 3PDIA 1Y3CE 2C2KA 3GZNA 4X85A 4I6GA 2HUNA 2HBYA 4OSPA 2PSEA 1DZIA 3IP6A 3P97A 3CR3C 3GRCA 4CLRA 2BAGA 4AQYB 2NSDA 2Q2QA 3EMBA 4C6RA 4EX6A 4F5YA 5CXQA 3PQ8A 4DLBA 1YOVB 3PDIB 4N6OA 4IDNA 3B8HA 1Z6XA 2Y99A 1A82A 1MRSA 4N6NA 5FWYB 1IAQA 2EARA 3CW8X 4CMGA 2O57A 4L27A 3E23A 3GCGA 3CLSD 4JLAA 1U2ZA 1UK8A 3UFXA 4E46A 4QQKA 4YWJA 3M6UA 3GLHB 3OQVA 1RWPA 1NNEA 2ZIZA 3IDQA 1U8UA 4Y3UA 1R0YA 1NR7A 1BFUA 3QLTA 2C78A 1QH8A 3KQYA 4JD5A 1FRZA 2JIMA 3W9BA 5GINE 4YRGA 1E5TA 2GNPA 3GMDA 1F8UA 1PDWA 1YIAA 2GJKA 2X41A 2IUFA 4N5MA 4LRUA 2Q4OA 2JW5A 1GZ5A 4GG1A 1DAPA 4HPJB 2Z5VA 2E87A 2ZJ5A 3H42B 4G09A 1QGED 1GPWB 1PUIA 1AGRA 3CE6A 5ALTA 4B83A 1D2CA 4DNFA 2EF0A 1ONPA 4MRAA 3QUCA 3GA5A 5AR1A 4HRYA 1AKWA 1W8DA 2FZEA 4TV8B 5CLIA 5FR2A 4EH1A 2XBMA 5GZ6A 1R0XA 5LBIA 4B3JA 1UWLA 5IHPA 2H1WA 1NGSA 3DLCA 3JZFA 4KVGA 2FX3A 1AKYA 2FE1A 2WWIA 3HUUA 3KK0A 4IUCS 5HG0A 4ERXA 1NZFA 5FFMA 1LTQA 2LTAA 5ALUA 3T3PB 1VJGA 4HGZA 3QENA 4IINA 3VU8A 1CRPA 1JQ3A 3GG2A 1DOZA 1NVTA 1XD8A 2E37A 1J00A 3NNNA 5ELXA 2IOFA 5ITSA 3HGMA 3PCXA 4RU1A 1L8AA 2IFTA 2O7SA 3LBFA 4EFKA 1VB3A 1DEKA 1EFHA 2B4QA 1UJCA 1BQ3A 2OBYA 1QGAA 2CD7A 1YTLA 4KQCA 5DKFA 3ZK9A 1UCFA 2FPGA 3MTAA 5LN1A 1X8KA 3Q8KA 5ANRB 1P33A 2P5TB 4LJYA 5JU6A 1X1TA 1U8FO 2OGUA 4D92A 3WLQA 2I1WA 3Q5GA 3HCAA 1BE6A 2PTGA 2ZI6A 3D54D 4NOLA 2X0RA 4R2MA 1IIRA 1YHZA 5GQSA 2YV5A 4CL3A 5J2TF 4EJSC 1FW6A 4MUJA 4WXRA 4AP9A 3WBJA 2IS2A 3OF5A 3W34A 1JHUA 2CNWA 3ZTWA 4RK7A 4WLUA 1EK5A 3UIEA 5EEHA 1OZFA 3BA1A 3LUHA 1I3NA 3LY9A 4OLHA 4TT3D 3RRJA 1NONA 4CT4B 5IT4A 2FR0A 1KO5A 2SICE 2NYVA 3OZIA 1LDBA 4NDNE 4CHTA 1NDUA 5GJVC 1LPPA 3C1TA 1QHSA 2ZTLA 5DCYA 3DNPA 2YW9A 4L6AA 1BJRE 4RCYA 1T15A 3OWXA 3G59A 1EVIA 4EI2A 1GG9A 4EG4A 1SXIA 2AQ8A 3NHKA 3W3AD 4IL5A 4EMUA 2PANA 1KDOA 5CBPB 4RABA 1Q7BA 1P4RA 3NNDA 2JS7A 2GCIA 1KYQA 3ROZA 4NXMB 1WPQA 4L74A 2FWJA 4NJOA 4R71A 1LDYA 3GLIA 1EVEA 1W7AA 3KXLA 4A6XA 1RS0A 5K3CA 3L0SA 3EIWA 4LIPD 3WNCA 4F6RB 1QRUA 4JDUA 2X1HA 3BWXA 1JYFA 1GKIA 2O20A 3QFSA 4BE9A 2C92A 4BVKA 3MSCA 1T1RA 3N2GB 4DIKA 3ZE8A 4G4SP 1L5HA 1HURA 1EYZA 2PH5A 3Q72A 1UUFA 4JGIA 4J7XA 1Q16A 4MWOA 3M49A 3MQ4A 2A58A 4Q66C 4BN0A 5DRYA 2VHXA 2E2WA 2OE2A 5JTUA 2BKUA 1WIWA 2IK8A 2JKVA 2XMDA 1KQPA 4YMWA 3CLKA 1JJVA 3UAYA 3OX4A 2BFBA 2WZQA 5CFLA 1U2EA 4KVZA 4D3DA 4O0LA 2CYAA 2QLBA 2QX6A 3QELB 4UU7A 5HIIA 1UZNA 1T2FA 3HI4A 1YNOA 1QHFA 1THMA 1MAHA 3O1LA 3GK3A 4B3MB 2HRCA 4FE7A 4TXJA 4CU5A 2Y68A 5IAKA 4C30A 2EG9A 3GUHA 5EXSA 4BJ1A 4KNWA 3S1SA 2G8LA 1AZTA 2TSYB 3VO8A 1WW8A 4LKRA 1SPXA 1GUZA 4OQEA 1T0UA 4OGGA 4MJXA 4P7FA 5E9QA 4FLEA 4I5FA 4YRIA 4XCVA 1TD1A 4Z0HO 4PN7A 1Z7YA 3WAJA 3EWNA 1NYQA 1C3OB 2W2PA 3P2OA 5DTEA 5D3MB 3AVUA 2FPIB 4KXWA 1OFTA 2VHZA 4MAMA 3LNCA 1U94A 2QE6A 4DCUA 2RH9B 2OO5C 3GD5A 2P6RA 2W00A 3NRBA 1GT91 3WLTA 4BQEA 3RVPA 2UVPA 1YR7A 3DJYA 3W2FA 4EF5A 2BONA 2DFKB 1J0AA 3NCTA 4OI0A 1AH2A 3O2SB 5H16A 3QLUA 2Z3VA 2JGMA 2XAUA 3OX3A 5DX1A 3ADOA 3IR7A 1JQAA 1DUSA 4NU8X 3Q0IA 3QNWA 1SC9A 1V9CA 2QMEA 3RJ5A 2GBCA 821PA 1Z0FA 1N2JA 1ID1A 1TQHA 3ID6C 1BQ4A 3G0IA 4IVQA 4ZYZA 1DO8A 5IT9A 2D62A 2XWQA 4G9EA 1D9ZA 5KYWB 1NQXA 2XLBA 4C43A 1ZQ9A 1C1HA 3EDYA 1MCZA 2FMFA 3GVXA 3LBHA 3QYFA 3V8EA 3O47A 3QV2A 3R6LA 4MYDA 4BYMA 2ZCJA 2ZT5A 4Q7QA 3ETJA 1K8YB 1L4YA 2CXPA 2BRUA 1T1SA 2DCMA 1A9ZA 1JDSA 1W4ZA 4JC5A 4LOKA 1DTWB 4PZAA 2ZBGA 1RQNA 2HW8A 1ZNQO 4D8WA 3WLNA 4ZALA 2IUUA 3SI7A 3NNSA 2X9VA 2ZIVB 1IG0A 1LD3A 3K4QA 1P1HA 4XJSA 4EVSA 2A3NA 1L7OA 3K2IA 2OENG 1Z6ZA 4G86A 1SA0A 4KP7A 3V7UA 3FHTA 1H0RA 3AV0B 3WSVA 1A9PA 4NABA 3Q8MA 1YD7A 3O0TA 1SB9A 4C2TA 3N2KA 5JCZA 4IPTA 4RTSA 4TKLA 4XOUA 4ODIA 1JA9A 3QBVA 2PUDA 3PWKA 3G5AA 4KFUA 3PITA 4QTTB 5C8XA 5L8VA 4KV9A 5IFLA 1KS9A 5LQNA 1BWQA 1DJLA 1R6TA 5C1IA 2E5FA 1NF9A 2HMYB 1VPVA 4JLVA 4MR9B 1AXRA 2PT7A 1R18A 5JJIA 3KLBA 3K16A 2AN1A 5IUJC 1U2PA 3RRMA 4IIUA 2VK4A 1H3EA 1I2MA 2GFHA 2W2KB 1TJ4A 4CM9A 3SBDA 4F6LA 1E2BA 2AK2A 3CWQA 5FLYA 1HYEA 1EJ2A 1TJPB 3PFKA 1N0UA 4G0MA 3VPDA 1N2CA 2IY7A 3S29A 1KI6A 4C7XA 1RCTE 1XKQA 5E6RA 2R1TB 3L4EA 1Z6AA 3C6QA 1PT6A 4RGBA 1UC4B 1PLJA 1WMBA 1Y42X 3JQDA 3QJYA 4FWBA 1E8DA 1QQ7A 2VPIA 5F7OA 4RV4A 2PUJA 1GPNA 5HM6A 3A1WA 5KDLA 3TIVA 3L5OA 2GTHA 1NPDA 1UMBA 2X2FA 4G0ZA 3ZK7A 1KR2A 2QEQA 1UJBA 1OVGA 2PO5A 3HY4A 4MIEA 1EGQA 2FSPA 5KHAA 3L5KA 2JFYA 1OAOA 3ORFA 3HZOA 2RH8A 4JODA 1UBOS 3P9IA 2GKOA 3OKCA 4IJQA 3NEYA 4ZZ3A 4OX9Y 5F4ZA 2LD4A 3SF8B 3WBKA 2V9ZA 1R6XA 2IYRA 4B4VA 4JUIA 3OCVA 1USWA 4C2BA 1YNSA 4O2AF 4CR8A 1IMJA 2ST1A 3FBWA 1ZHOA 4BO1A 2BFFB 3H9GA 2SHKA 2V6GA 4Z7NB 4UVDA 5DFAA 3KYJB 1AZLA 2HCJB 3TW8A 1EDDA 4I9HA 1CFJA 2VP9A 3FYDA 3RJ9A 4WA8A 4DJJA 1JEOA 3FRHA 4GZLA 2JASA 3S44A 1OB2A 4LF9B 1N3BA 1EUCB 4PC1A 3PIRA 4F4IA 4ISCA 1OYYA 3TRJA 1SGWA 2FLWA 4M1ZA 2PGAA 4WSOA 2BR3A 5H7XA 3SYTA 3EIUA 5CH5A 2G9VA 4TLCA 3FOZA 3PK0A 4JKYA 3FTFA 3EPRA 5ALNA 3P27A 3ZWPA 5BN5A 4JL6A 5HK9A 3NAMA 3BGIA 4JBLA 3BERA 4WASA 1YB7A 2ORIA 2F67A 4D4KA 1M8PA 5CLQA 1UBTS 2RGEA 1ZU5A 1MQ8B 3NIBA 4G9GA 4PBTA 3U37A 4CIBA 1NW9B 1CQJB 3HO6A 1Z75A 5E6SA 5JYDA 4TWIA 1BQEA 3H8SA 1ZGGA 2HJVA 1ZM7A 4R2JA 2H4ZA 2YFYA 4B2LA 1H2XA 1Y98A 4RA6B 4BFTA 1T5DX 4IEFB 2LDBA 4NFLA 4FOLA 2PAAA 5JADA 1Q0HA 1IWBB 4QOSA 5TJ9A 1P18A 1GJRA 1SQGA 2J9XB 3IPYA 2NVUA 5DP1A 4EM6A 2IF0A 4MQ5A 2ONCA 4WZ6A 5LUBA 1V25A 3HUEA 3IVAA 2NU6A 3R3XA 2B8NA 3DC2A 3PQCA 3ZE0B 3EFHA 4YCJA 2J5BA 5FLXA 3AVYA 1L4GA 2AN4A 5JE8A 3S28A 4TMXA 4QICA 3QPUA 1X13A 5LQAA 3CVXA 5KAPA 4MVJF 3G02A 1ND6A 1PVOA 3L4SO 1V4BA 4OUKX 5EIOA 4DE5A 1X7YA 2PUBA 4KTVE 5COBA 1PQ4A 4Q3BA 4XVHA 3M70A 4JOSA 1E8MA 4ZVUA 1R12A 3WLAA 3X2SA 4U2GA 4DC0A 2LR0A 1ZVMA 1ZM9A 4P58A 5E38A 3ROEA 2YFKA 4OK6A 3PSHA 1MJGA 4KQWA 2QA5A 3EZGA 3U4QA 4UVIA 5I01A 5KYTA 2PUEA 2VJQA 3FUXA 3OZBA 2ETXA 2YY7A 5LUAA 1L5LA 3WP1B 3PXAA 1NVAA 2Q3BA 2XDYA 2ZRHA 4TMWA 2B4TO 3RWMB 4CM8B 2EKQA 3SX0A 5BVGB 3DULA 2QTHA 4IWNA 4R8VA 2Y76A 1KH1A 4HWTA 2VDUE 2HTEA 1NVMB 1QB8A 4AKIA 1J49A 2ZUBA 1CUHA 2QAIA 4DMHA 1AQ6A 1J20A 2I1QA 4PTZA 4Q12A 1XQWA 4AB1A 1Z2PX 4MO2A 3UYLA 3CPHA 2WHQA 2GTPA 3ZIAA 2BEUA 3ND5A 4JC8A 5TMPA 2H1IA 1FSSA 2VFAA 3B2QA 3HBAA 2P2NA 3G8AA 1J9ZA 2P4QA 4YP9A 4B6GA 1MDFA 3I2HA 1W5TA 1GTZA 2FF5A 4S3MA 5BSEA 4CM5A 5FJJA 4H7IA 1WDMA 2I8AA 2IGBA 2QQ5A 4OH7A 2FYTA 4EW6A 4PQEA 5AOAA 5I47A 4AKGA 1XJWA 1FYFA 2P7HA 2I34A 4BJ3A 4H3HB 1SEVA 4G37A 2YWEA 1Z7GA 1HEUA 3LE8A 1NMSA 1XVIA 3A1CA 2VZ8A 4AMGA 2HHCA 4AICA 1YVUA 3BE4A 1QXSA 5H70A 4KR0A 4WL0A 3WWDA 4N49A 4CKBB 2SCUA 4ZGWA 3EASA 1A96A 2ZIEA 1FFXB 3C24A 1Q2UA 2R65A 3CH4B 1UBEA 2Z57A 5DT2A 4C0QC 1KJQA 2OHVA 5EMKA 4RTPA 4F06A 1XVUA 1MO4A 2SCUB 1YZGA 1YTUA 3RHSA 1NG1A 2Q7XA 4DDWA 4MV1A 4MX8A 4EG8A 4NWIA 1OXTA 3ZV7A 4R1LA 2XMPA 3AB7A 1KKLA 3D8UA 2CMFA 3VSEA 1SUIA 3DYVA 1Q7CA 1NBWB 2OFWA 4AN0A 5LC1A 3FCUB 4TGLA 1UMCA 3DZBA 4HFNA 4HWOA 4TQUS 1J22A 2Q0HA 1DTEA 3OQJA 5ARCA 3ZE9A 3L05A 2AZTA 3Q9SA 4YRPA 1HM5A 5BW8A 2VDRB 1DIOB 2F62A 3D8NA 1BU5A 3QA9A 3UG6A 2IX3A 2Y77A 4CG3A 4B8WA 1L4LA 3ZDAA 1KMCA 3G79A 1HSZA 3G5LA 3PB3A 3ZWWA 1JWAB 4YJHB 3FUVA 4BPRA 1X80B 2FPRA 1U9IC 3LPCA 1S2OA 1RQXA 4Q34A 1FNCA 4JBXA 4EY4A 1CULC 2H1CA 2UDPA 5DK6A 1FMFA 1Y34E 2XUIA 1XAGA 2QN1A 3CSSA 3LLSA 5K3AA 4DQKA 5IBCA 2A9KA 1K4KA 2HU5A 4RM2A 1Y8ZA 4BC1A 4K9QA 1X6VA 3DPIA 3C70A 4GLLA 5ESWA 1OAOC 3VQTA 2VP6A 5BYBA 3VR4D 3GLGB 1FMLA 2HSGA 2C1EA 2DP4E 5FYDA 2YOFA 1GSIA 2WYVA 4RQBA 3UY4A 1WSBA 1ADBA 4BFUA 4QKQA 1HL7A 1NZDA 5KQGA 3IPCA 5LCXA 5AHKA 5JHGB 4W6ZA 2YVQA 1DKPA 3H9EO 1BN6A 3DF7A 1PJAA 4L07A 4RZUA 2PKQP 4TXMA 4A2PA 3DMDA 4NMXB 2EFEB 4TMYA 3OUZA 1PFWA 3DKRA 4TTSA 3RYIB 5KEIA 1C30A 2DTXA 1FLDA 3NB0A 1QP7A 2XMSA 3B1XA 3CEPB 3VNBA 4GYKA 3LRPA 3T12A 3LM8A 5FPTA 1NNSA 2VPQA 3CC8A 1HX7A 2W2LD 2IEIA 1JAYA 2X5NA 2EW2A 1XCOA 3CVOA 3PA6A 2JLXA 5JRDS 4LJRA 3UJNA 1L5ZA 4G41A 3Q11A 2B7LA 3ETCA 3N0WA 5CIYA 4OHUA 2PUHA 4H7PA 4IH9A 3D6AA 2CDBA 5AM2A 3HKDA 4ZDIA 1O3YA 3LUBA 3S2SA 4NI5A 4YEDA 4MHOA 5FEUA 2FHSA 1JBKA 3VHLB 4PG7A 3K0AB 2DJIA 5TJHA 1TQ8A 1VPTA 3KJIA 4QDKA 5KYUA 1FS4A 2YZMA 3DVQX 2Z58A 5C80A 3GLHE 4KWIA 4GPBA 5JO9A 5A5DA 1I7SB 1P1CA 2FCAA 2FK7A 1JG7A 1F6BA 1GL3A 3GG9A 3GGOA 5HIAA 5JZVA 4RQUA 2ZWIA 4JY7A 3WGYA 3ZX4A 1FFGA 3BHMA 1OTYA 2YMPA 3KKEA 3N0TA 1X8JA 3M6LA 4EGAA 5CLJA 1XA0A 1BMTA 5FOSA 4RAQA 1U0RA 4Q9LA 3TF5A 1L8QA 4NZZA 3EFOA 2BEWA 3DL2A 4YCLA 1A27A 3CURA 4BVFA 1TT5B 3HXOA 4J29A 3A1VA 4IVPA 4DA4A 1GUBA 5C1BA 1NMYA 2QLFA 4M4SA 2EFDB 3DKVA 4WZBB 3SEFA 4DWOA 1UKAA 4L1KA 4MVJP 1Y6GA 2G07A 3UWMA 4ZA2A 1SCUA 2RGDA 3L18A 2IYYA 2AOVA 4LC0A 3S2GA 4B3GA 1CJCA 2QD2A 1JEJA 4C0LA 3T3DA 5JAZA 1H6CA 1RAHA 1G20B 1KVQA 4RVSA 2EERA 1J0CA 1B2RA 4HKTA 2C20A 4HXGA 2W4IA 3TJMA 4NCAA 1W2GA 2ZJ3A 1DBWA 2HDOA 1E99A 2NSLA 1P0CA 2XGSA 3G2MA 3QVTA 4OI2A 2XD4A 4IDQA 5FI3A 4FP9A 3O73A 4DBZA 1QIKA 2HN9A 2OORA 5JD6A 4V39A 3WL6A 1QORA 1G1MA 1S02A 2DUNA 3KT0A 3O4RA 3PC2A 4L8FA 5FJIA 3ZWCA 4F0JA 2JFNA 2GN6A 5KQPA 4BXOA 1HMPA 4IJVA 3RU3A 1REQA 3DBLA 3X1XA 4ECEA 5H81A 4D3ZA 3EGDB 2R1UA 1KJIA 4K2AA 1P44A 3IO5A 3PGLA 5ETJA 2JAWA 1DAOA 1GFSA 1NF3A 1WX1A 4YUVA 3ITNA 2Z6VA 2F1IA 3F71A 1HT0A 4P36A 4M1EA 3T9CA 3G8BA 4E5DA 5CB0A 2FDCA 2PZ8A 2UVPB 2WSBA 5GONF 2R25B 5E3IA 2NVOA 4E03A 3L41A 4KNVA 3MUEA 3P26A 1RYHA 3SM9A 3PTZA 3UHPA 1BKDR 1TF7A 3PUHA 2GJ9A 4WLVA 3SXJA 4AJ4A 2EHJA 3RR2A 2PRSA 1YZKA 3I58A 3JQCA 4CUKA 3USZA 3IA7A 4RA9B 1DC3A 5DSZA 3D5QA 3TZKA 4E30A 4DW8A 4ZI7F 4F3CA 4JJ4A 3HCBA 2HV8A 1TJ3A 1NVUQ 3K9WA 2G4VA 2NZYA 3BRWD 2EFCB 3CIFA 1WG8A 4ZZIA 3AVXA 2WKQA 4CNBA 1RYZA 1QFYA 3I9LA 4Q1EA 1GNSA 2FLVA 5HUQA 3VPFA 4LXUA 1ZJ6A 4TX1A 2VTBA 5J5AA 4ARUA 5JHHB 5FPPA 3BFXA 3TOVA 1WXIA 2OECA 1FSFA 2W2NA 2X13A 5ALJA 5IU6A 5CPFA 1GR0A 5J23A 2X40A 3ENWA 1GHTA 1XZGA 3PEYA 3ZLBA 2NPIA 2R8ZA 3WIDA 3RASA 1YI1A 5AJYA 3NV7A 3UAXA 4FYWA 3D2CA 1FTSA 2C57A 4YO8A 3TYXA 3QPBA 3T6KA 1LQ2A 2QLLA 3FYUA 4FYIA 3TW4A 1LVGA 5ES3A 3Q7PA 3PC4A 5B4UA 2D3TA 2R6CA 1JPJA 3FLEA 3JVIA 4NQZA 2AFHE 3AZPA 4TN1A 2BT4A 2B6NA 2GVNA 1BFDA 1XEWY 2V6IA 1XTSA 5K3EA 1YO6A 4XARA 1PJCA 4FGUA 3ZVLA 2Z43A 3JAWB 4Z6KA 1M2FA 4EJSA 2GZ3A 1Z8DA 2AA3A 3P4XA 1EVQA 1DLJA 2J3QA 4L50A 4RK1A 5TQJA 3SF0A 3TNYA 4RY0A 4HVLA 2V5AA 3QFFA 2O3QA 3CN9A 3RD5A 5KS2A 3WTCA 3FOEC 1GIAA 2UZIR 2HJSA 1K97A 1JEDA 3MF4A 1QIMA 4BKUA 2VDJA 5EJ9A 5ITZA 4ZQEA 1O0CA 2FB9A 2P2LA 4S05A 2O50A 3GNQA 3KPUA 1T6YA 4H18A 4XX1A 2ZYSA 5JUWA 2OQRA 4K88A 2OB1A 3FDFA 3OCWA 4NPAA 4WZZA 1SZJG 4IHJA 2D1YA 2G6BA 4AWXA 1PF7E 1QQ6A 1UXKA 3LUJA 2VQDA 1A4IA 3CKYA 4JGGA 4CKEB 3AF6A 1UP6A 1RM4A 3WKDA 4BQQA 4LVNA 4X6LA 3SFZA 4HNUA 3WLRA 1IB0A 3NR2A 4H4EA 5FI5A 4ZJYA 2D13A 4M7OA 4U7GA 4O0MA 2VXOA 4DM7A 2FNAA 3TZEA 3F6PA 4OQZA 2WAAA 5BN3A 4TTRA 3CX4A 3ZHYA 4AK9A 4A0HA 2C84A 2FN9A 3ER9A 5IJ9A 3SBOA 2E5LB 3U4AA 4KKVA 3T7IA 2C59A 2X14A 3GRUA 4XR4A 3ZS8A 2F4NA 2KX7A 1KTIA 2PGOA 5JG7A 5JS1A 1JR3E 3IVGA 1ZMBA 3UICA 2C5HA 3ZZMA 5CG2A 4ZEOA 2H4XA 1SHJA 1Y9AA 1PJRA 2Q45A 3IAS1 6LDHA 2YRWA 4E51A 4LYHA 2OV1A 2WTXA 1ODFA 3G9QA 3MFQA 1GPKA 4HPXB 4LHVA 3ZWOA 5B2FA 4NJEA 4KO3S 2Q3CA 3OOHA 1NHWA 3IQIX 4QGFA 4CTMA 3PUVA 1Y3BE 2H1SA 4ND7A 3UB4A 2ECQA 3NTUA 4RVFA 1WZEA 4K6KA 3DMYA 5ICSA 3GDHA 1BMFD 2AFIB 1BWPA 3K8YA 4M3NA 3S2EA 1VBMA 4M0UA 3RHFA 2MDTA 3ZZ0A 4MJ3A 1X38A 2JIDA 3Q7QA 4JGBA 5LZ2A 2FMHA 4PVCA 5CLFA 3T1TA 1Z73A 1ZIDA 3QTTA 1CYDA 4O4HA 4X63A 1R1DA 2P3LA 1A2BA 4NDZA 1VKRA 4WZAB 1V6SA 5ER6A 3ZXYA 1E6CA 3OCZA 3TQQA 1Q0ZA 5EGSA 2NTJA 4NE9A 4NH0A 1YUNA 3VPXA 4AULA 1L4BA 1NN0A 3CUYA 1DS6A 3H2JA 3KFLA 2D5AA 4J76A 1K06A 2B61A 4KYTA 5DE3A 3T4UA 2LZ0A 1D4OA 1WZCA 1J2RA 1ZMTA 3FMFA 3BJZA 3PFHA 4Q3DA 4WY5A 2O3SA 3RIGA 4N0QA 4B40A 3I6IA 2X6RA 1QFXA 4G65A 4F2WA 1ZRHA 1EM8B 1G9XA 1MX5A 2H0RA 2QAGB 4IIYA 1P8JA 2OZKA 1T9CA 1DEAA 2UYGA 3PEWA 1BW9A 3HDGA 3V2HA 1E5QA 2Q8PA 5B3AA 3UOWA 2KPOA 3N0VA 2GYYA 3HCCA 4GOJA 2QTCA 4P33A 4RQTA 4QBHA 4H77A 5H0IA 5FPSA 5JNVA 1PTJA 3OHPA 1OCEA 3A27A 4EKNB 3F7OA 3THSA 3O9ZA 5EE0A 3GLTA 4OXYA 4RY9A 2CZCA 4RXMA 3HWWA 3LY5A 4TTJA 1SCDA 2ZVJA 2I6TA 3DZKA 2OFFA 1ADGA 4V1CI 3TLYA 3UK7A 2AXEA 3LDGA 2GNOA 1UP7A 1WMAA 3A4MA 4QFBA 4M8KA 2WTMA 2YS6A 3N0XA 4UNNA 4FIZA 4ZRDA 3SYRA 3UQZA 1BRTA 3H16A 4IIJF 1SKBA 3KB6A 1OIXA 4E3ZA 2GZMA 3MB5A 3L6OO 1YONA 5TMEA 4PYIA 4BFXA 2P79A 4U2CA 4ENWA 2BC9A 3AVVA 2CVFA 3N07A 3PE4A 2XUPA 1YBVA 1WKVA 3DBHB 3IBGA 3TLJA 2FKNA 3GDFA 3U4CA 4AO7A 4KH0A 4OGKA 4HWSA 3I30X 3IE0A 4O33A 1QH1B 4P4SB 4W8GA 2VHQA 5CJPA 1UPTA 3RFVA 2BMAA 4ZVVA 1WB9A 1JQEA 2VYVD 4MXDA 4KIGA 2V45A 5BWLA 4UM9D 4F46A 1PEDA 2O0JA 1Z4NA 4IJWA 2PZFA 3S99A 2ZR9A 1PGOA 1L5YA 2ZLBA 4KR2A 2QLMA 4MRMB 3DH0A 1Y4UA 4G1UC 4JI6B 3S4YA 1XHEA 4LX8A 3RVDA 5JYBA 2I87A 2QZJA 2XOKA 1UOOA 2FWPA 2QLNA 3BEDA 3Q3CA 3JPYA 5I9NA 3SSAA 3RBZA 3AHDA 4J03A 2CCGA 4DABA 1XF1A 2DX7A 3Q3VA 1ECPA 3Q5DA 1ZXXA 1G38A 3MBOA 4F86A 4GKAA 4XXHA 1RZUA 4G5SA 1AS3A 3FFTA 1JL3A 1P7PA 3GCXA 1B42A 3AVOA 3ROPA 2P3SA 2Y0DA 1H5UA 3K6SA 1F8FA 2IODA 3MRSA 3R9XB 1XWFA 4S1TA 2Y1GA 5E9WA 5LB4A 3V7YA 3CX8A 1JIJA 2FP4A 2GEUA 1BA3A 1MGPA 3B5IA 3W7BA 1KJYA 1XRJA 2W6OA 2VT7A 1BD3A 2M1XA 1YI8A 2Z2JA 2ZE6A 3QUSA 3UJPA 4BMVA 4YAGA 1G59A 4INOA 3SX4A 1M2JA 3IJRA 3L8CA 3IAHA 3DPUA 2F43A 4PZLA 3DYIA 4TMFA 1RXWA 3G5TA 3GVCA 3VZBA 2X76A 1RWKA 1ZNZA 1U7DA 1K9SA 3MPUA 2EAUA 2IHBA 4PXYA 4A10A 2P2DA 4EYQA 1M1NA 3NWJA 2WIFA 2PYZA 3BILA 2PLWA 4JLSA 4YACA 1E6KA 5BQ5A 4EJ0A 1IB6A 3E35A 4CMIB 4EHHA 2P9FA 4O5OA 1Z7EA 3DTVA 3H05A 4PGGA 2WJPA 5BYJA 1U81A 3MC1A 4FPXA 2O8FB 1RJ9A 1DXOA 2MYUA 2OP1A 3JWGA 4KN8A 2HMVA 1HFEL 2XUAA 4OHOA 1N5RA 4G0VA 4EBBA 3HJFA 3IJEB 2NU9B 4I50A 5ESDA 2P35A 4OOFA 3NORA 3C7CB 4Y9DA 3HS3A 4TLMB 4ZJUA 4RVDA 2PL9A 2X22A 3NXKA 4U4AA 2GR9A 4EKDA 1C1DA 2RBGA 3AFMA 4KXMA 2IV2X 4NICA 2Y1XA 4UM7A 1CE8A 4US1R 2RH5A 1P0FA 4WLOA 4ZQHA 3SJBA 3WDSA 4AUEA 2W8ZA 1EVZA 4X84A 2M2IA 2ZG6A 2Z8ZA 4JEUA 4C20A 5AI6A 5AM0A 1GL9B 2GN8A 5CLGA 5A9SA 3M3DA 1T5LA 2X8JB 2G76A 3LH5A 4R8KA 4W7HA 4F60A 3RU9A 1JMYA 4AJLA 4AY5A 1F6WA 4WBNA 3TOSA 5ELMA 2WMOB 5I7RA 1J97A 1X7WB 2AK3A 2FFBA 3KX2A 3U7RA 2G04A 4BE7B 1TW3A 1XJQA 2ZYRA 2AEMA 1R0WA 3LQQA 4IMPA 4DMKA 3KAPA 4Z4EA 1F14A 2VH1A 1MABB 3A2MA 4PG8A 5KYUB 2H3EA 1NAHA 1GAWA 4UNQA 4YRBA 1RZRA 3UGKA 1XMQB 4Y7DA 4X6YA 2MU1A 3CLTD 1XQVA 4PSAA 5LXTA 1J07A 2GBPA 2OZPA 2QTLA 5FORA 3U7QA 2N1BA 3DZDA 3G1TA 5E4JA 1JDTA 3WV5A 1D2RA 4N39A 1CQXA 5H68A 2BLNA 5DGXA 2FPOA 3NBQA 4PO9A 4OB8A 3KO8A 1PK7A 1A9QA 1AUPA 1RZVA 3PX3A 3M3PA 3UMRA 4F9TA 1OLUA 2WFLB 4GWKA 1PQWA 1ZITA 3ZBUA 5JAOA 1D03A 2CF5A 2VT3A 3LBIA 3ZBPA 2CD9A 1Y3IA 2Q0SA 2Z98A 4NS4A 4CMEC 1ECBA 2R7NA 4E5SA 4AJ1A 5JCXA 3H1GA 1Z22A 2PGNA 4A6PA 4AQDA 3PJDA 5AKLA 3CLVA 4EO4A 5J2UA 1X39A 4ENTA 2EJTA 4DJAA 3IEXA 5SZKB 4BAZA 3TXAA 3GRKA 2VDWB 5E7JA 4A6EA 4GYWA 2CNKA 4MKFA 1MU0A 4X24A 3QPWA 1TU4A 2PS9A 2AG6A 2DPHA 5D01A 4PYJA 3L0IB 3NVKI 4I2VA 3L06A 5HGJA 2BCGY 4P3KA 4HRAA 5DNVA 1RIIA 3NT2A 3WYDA 4HDOB 5KNBD 5KVQA 2ZZMA 1ULSA 1S3IA 2P75A 5K3DA 4YBRA 2GAFA 1R5OA 3OBIA 3KSUA 2P7IA 3C3PA 4BB5A 4DGSA 3DVAB 2C4KA 2SNIE 3E22A 5GM1A 5HNKA 1TM7E 1KFBB 3JW8A 2BR5A 1Y8QA 4OA5A 4I14A 1IYZA 3ZG6A 5C1PA 4M6WB 4S35A 1DPFA 1HO3A 2B21A 1D1SA 3KLOA 1CZUA 2E5WA 5FLEX 5GVSA 5KKCA 2BFNA 2VI5A 5E6UA 5DYYA 3GJXC 1XQ9A 3CCCA 2YIJA 3M6IA 1YB2A 5BOVA 3J80A 2QWXA 3GF4A 1QG4A 2RAFA 3BIWA 5ADHA 1G20A 3CY6A 3MCZA 2OGWA 3TLAA 4QOJA 5AW0A 1U3FA 1B1AA 1C9YA 1V7CA 2NWQA 1ILWA 1NM5A 3N6RA 3PQFA 3UMFA 5B1DA 3AJ8A 3VX3A 4YH1A 2V7BA 2GDZA 4NK4A 4KPFC 5L51A 1TEXA 4CYMA 1PJSA 1U6IA 4FK8A 2C9OA 3HYSA 3TJRA 1GT6A 2R4UA 3I01M 1FP7A 5CCDA 4R98A 4XD7D 3COJA 2ZBDA 4K0RA 1X7GA 4EKIA 2PRKA 2ANCA 2COUA 5ALMA 4B6PA 1RWOA 1E2LA 3LC2O 1TIPA 5CT4A 5JC1A 3UWDA 1Z08A 1XZ8A 1E0SA 3BIJA 1R8SA 1ZMXA 4M7RA 4M9XA 2FZWA 2VHCA 3JYHA 4XWTA 5KTYA 4MQUA 5BYAA 4PRKA 2F55A 4QTZA 2Q4BA 1VG8A 2K7ZA 4NOMA 4AT1A 2HRRA 2ZREA 4BYGA 3B6EA 3AF4A 4R05A 4KWEA 1QFMA 3TQIA 3TEFA 4TS3A 2GN1A 3LECA 1F1JA 1KK2A 1TUGA 1W75A 4L3WA 5D3MA 3OVMA 2FUEA 2NZ2A 3PZBA 4X1KA 1U2TA 3FSJX 2BFCB 2GA8A 2B8WA 1RBMA 4LBVA 4DLPA 4KLRA 5JDIA 1RXIA 1RJWA 3MYYA 5FV7A 4A2WA 4EUSA 2GVZC 4UDOA 3E7FA 3EXHB 1QAMA 2XCOA 3L8DA 2XGJA 4X1KB 6REQA 2CSUA 2W0SA 2EZ8A 3C0KA 3CNNA 4HLUC 3GWGA 3OD1A 1IUNA 5DYWA 3EIFA 1SKYB 4D5GA 2C9ZA 3FCXA 4V1CA 1DKNA 3AJ9A 1YA8A 1M2NA 2A9RA 2VDWA 1D2EA 3ZC3A 3EQ2A 1Z25A 4WNCA 5HP4A 1GZVA 2GOYA 2JI9A 3L7MA 8GPBA 5LBUA 1I1QB 4YUYA 1KS2A 3NWBA 3D0OA 3W04A 3TO5A 3BK2A 1CS0B 5KIAA 1RRPA 3T1QA 1N6HA 4Z4CA 3VISA 2WSYB 1U98A 6ABPA 3CH6A 1LW6E 1KVSA 3MBIA 4LDNA 2C5SA 1U8AA 5FUQA 1IBCA 2IUTA 1U0EA 4F1WA 3PD7A 4LNUB 3RVOA 4KYVA 2C5GA 5KSPA 2R47A 2AOTA 2X0JA 3MG9A 1ZX1A 3OLVA 4DQXA 5EJ8A 1XQYA 2A4MA 3G85A 1XK7A 4NC9A 4O4JF 1V35A 1DADA 2NTEA 4EX7A 5FX2A 3CJRA 1C7ZA 2BFPA 1I3KA 2ZPAA 3AI7A 4QRHA 4GI7A 3CISA 2D2XA 3OJEA 3CUTA 3ER6A 1PO7A 2X2PA 1RYEA 5DM60 5D85A 5CX4A 4MPTA 2B30A 1BHJA 3MAJA 1J06A 4QYIB 1TNDA 1YMUA 1JB9A 2AUMA 3NZEA 4QPDA 4Z7OB 1FC0A 4WNYA 4ER6A 1XRLA 2BF4A 2GHIA 4YMHA 1Z5OA 4ZODA 4DRYA 1ZFNA 1NJ6A 4CG1A 1CUAA 3GFFA 1XZCA 2X8BA 3WDKA 1LI7A 3BGVA 1NI3A 2UZ3A 3EQ8A 1NPTO 1NSFA 5EPEA 1BWRA 3BMCB 4CLXA 4OP2A 3RQIA 2GRAA 1QM5A 3HY3A 4QBFA 5GM2A 4ZI5A 4LK2A 4R9NA 1XZQA 3D7RA 4BNJA 3NRJA 2INGX 4WKGA 1AZWA 4RTRA 1W94A 5BNWA 1UFKA 4WD3A 4P86A 5A0FA 4D7AA 1JR3D 2HA2A 4Y2VA 1JJAA 2EKPA 3IVMA 2R60A 2VAWA 1B6GA 5CX1A 4OMDA 2V0NA 4KDFA 1X92A 1Q74A 2JA1A 4U9UA 1S6YA 2H31A 4H15A 4ZI7B 3EPKA 2GO7A 3I64A 2PGDA 1A9OA 3KYDB 3PFCA 1LPMA 1ML4A 3ENKA 5JYCA 3PHJA 2YWHA 4N7RA 4TXNA 1BMDA 3D3WB 3QA3E 3ODGA 3ILHA 3R7BA 1WUKS 4FE3A 4I1RA 2DSNA 5TT0A 5F33A 3ZCQA 5ADWA 1I2BA 2PEZA 1OFUX 2OFXA 4PTLA 4Q3EA 2R9VA 1PK8A 4P3OA 1BVUA 4UUNA 1OIWA 1SU6A 3K0CA 4BNVA 1RYBA 1VC2A 4KNYA 2FZ5A 1K0FA 3F5MA 2XT9A 4YAKA 4WXMA 3H3FA 4Q7JB 3ENNA 3O7MA 3WLSA 1DLIA 1R3DA 1LDGA 3EXFB 3WBFA 5C4MA 3R5XA 3WLLA 1NFQA 4R9RA 3F49S 5KZMB 1QHEA 3B7WA 4DQVA 4XGIA 2AC7A 1H1LA 3HXPA 1J0EA 1TMOA 3L79A 2M32A 2OCGA 2RB5A 3TIGA 5JXIA 3B13B 2Q49A 5ALZA 3EQZA 3RO7A 2DM6A 4RGQA 3VU1A 2P1RA 4DDUA 5ALDA 3IMFA 3ANLA 1N5KA 1XZMA 3L1UA 4E70A 3H83A 3BFVA 4R2HA 1R6VA 1C3XA 4OGWA 2XUHA 1DKLA 4QFMA 4GW3A 4J4TA 3DUFA 1EDZA 1XWIA 3IAUA 5IDVA 2CDRA 3PEUA 5LQCA 2RARA 3MLAA 5FBZA 1IHDA 1LJLA 1V0JA 2OSBA 2FETA 2UZ0A 2YZKA 2V7QA 1K6IA 2D5BA 3MD9A 1YKGA 3TR0A 1S2LA 3GVPA 1Q95A 2BR4A 1JIVA 2O07A 3EZXA 2NUTA 2OSVA 1QGUA 4F9EA 3K9CA 3R5SA 1C3OA 1XU9A 2FE4A 3HEBA 3KXKA 4G0NA 2CKMA 3FCEA 3WRXC 1WBDA 1W5EA 1SMKA 3TW0A 2X4LA 4LPSA 1W48A 1E9DA 1B8UA 2V0GA 1GL7A 1OZ0A 3ABZA 3KV1A 1VFPA 3SC3A 2F1JA 4WKNA 3CKKA 4IQ0A 4M1WA 2Q28A 3HCWA 4UEOA 1L3IA 2NYUA 3BMXA 2FX5A 5AKXA 2QUKA 4C29A 1N9KA 4ENQA 4WN9B 5C8ZA 1EEXB 2IL1A 1RJ9B 3IP7A 5KNDH 3KP1A 4MJLA 1CZLA 2I2WA 1HQDA 1FJ2A 4OHFA 2WQ6A 2C7OA 3DEFA 4YHHB 1TMKA 1NUSA 1YFKA 3CSUA 3JPWA 1NP6A 3RUPA 3AI2A 1J6UA 1JSCA 1M7BA 1H8HA 1II0A 3LYAA 5I3CA 3EE6A 4PNPA 4ZVLA 3WDLA 1FP4A 1RKBA 3QVLA 3I1JA 3A1NA 2YVLA 4KK3A 4ZQFA 4ER0A 4OJTA 5MGNA 4AKTA 1T2CA 3CFYA 3F8TA 3PI6A 1UJ4A 5JCOC 1N8TA 3OP4A 5HVNA 1GGFA 3WAKA 1T2UA 3IDAA 3TTSA 2WMYA 2QUZA 2X9LA 1Q7GA 2HX1A 2XCIA 4YAFA 2FR1A 4WCFA 2Q2NA 3DDHA 1L1EA 1LVUA 2V98A 1UBNA 2PG3A 3LT5A 2VP0A 4OFZA 3EZFA 4R81A 5EWLB 2VG8A 3T0IA 5IX8A 1NI5A 4GSLA 1B41A 1IM8A 3WLMA 4A4DA 4D4JA 5KKNB 1W47A 5ILGA 3NP9A 4MEJA 1BU8A 2VJBA 4RHTA 2HK9A 4MUNA 3EXIA 3IA2A 4ONEA 1W34A 4M8SA 3WLFA 1FW8A 5DM70 4FKMA 4QGBA 2XB2A 3H4VA 3ITDA 2OMKA 3R0IA 1H4VB 2CVQA 5H4GA 4YXWD 1FDTA 4GX5A 5EZSA 3REFA 2BHRA 1OFGA 2H48A 1JRLA 3QFTA 2PL5A 2P4EA 1U7HA 2VPPA 1MT0A 4F92B 5JCPA 4ZVQA 3KFVA 3HHEA 3ABIA 3U7HB 2VRCD 1ETHA 2FZ4A 3GLVA 3W2EA 2QVCA 4G25A 3HYNA 2C8JA 3QKIA 3ZUGA 4EYKA 1K3TA 4D80A 3IDSA 5B53A 1WW3A 1OGIA 1U80A 4OSEA 2DT5A 2BHLA 2C9CA 3FGPA 3CWCA 3TK1A 4ZZ1A 5LOVB 1XAJA 4UM9B 1C1DB 1ZRNA 2BMFA 1T25A 4IFTA 4C0KA 2WV9A 3EC1A 2GK6A 5BN5B 3FUCA 5JPCA 2WWRA 3FNEA 3R3HA 4FB4A 5AJHA 3WL5A 5L3RA 2G1AA 2G67A 2Q3EA 3LVRE 5ES4B 2R8EA 3RGWS 5I45A 4HDNB 2ZRCA 4QTUB 1CVIA 1JIXA 1U2GC 5FWAA 5JMTA 4KJZA 3T5DA 2B78A 1BN7A 1PG5A 4HHEA 2QU8A 3F5SA 1J99A 1GTJ1 2HO4A 4ZHSA 3SYKA 3D3NA 1Z0IA 3PRKE 1Y1QA 3MLBA 4J7CA 5ALGA 2R2GA 2Z2IA 3G0DA 4TT8A 1KEWA 4ZANA 1KEZA 3CRNA 5EE9A 2O2YA 2FEXA 3BDAA 2XOKD 4AUNA 1SD5A 5A03A 3IT3A 3I34X 4U8GA 1U3TA 1D2MA 3PC7A 4Q7MB 4BTEA 4HNAB 4Q4HB 1ZZEA 3IQZA 4RHXA 3FGZA 5BSTA 2H51A 4QGAA 1C0PA 1OT5A 3ICOA 3JYQA 5E7QA 5KJ1A 4FT4A 3LW7A 2E18A 1LKZA 4BGVA 4DUPA 3UMJA 3K4PA 4R8RA 3HJHA 1XRNA 4URUR 5CLLA 1I6LA 2PRZA 4H7EA 4RKWA 3SIRA 1HA3A 3QUQA 2JHCA 1DL5A 4ZAFA 4H0NA 4DV4B 1VBFA 1OAAA 4E4YA 5DEIA 1OUMA 5IXYA 3CWZA 2V7XA 3DSRA 3LLVA 1JFRA 3M34A 3NDBB 3I83A 4R1OA 2A5GA 4S1WA 1XYYA 2LGJA 3K8ZA 1IRIA 1FEZA 1OHHA 1VRVA 5FPHA 1JHAA 5A2GA 2H4HA 2XNCA 4M0DA 4DJTA 5CA1A 3MWJA 2PR7A 2ZXFA 3G8CA 1ISFA 4I08A 1Q3HA 2W83A 2UAGA 4RUKA 4IDHA 1H05A 5JI3E 3SDBA 4CUZA 3HA5A 1VE9A 5AOCA 3F74A 4M21A 1BRMA 1FDUA 2P9CA 2D59A 2AYZA 2FRDC 1K68A 4GSKA 4N18A 1RCUA 3DDOA 1UC8A 1SUPA 2AEJA 2QYOA 2Q41A 3FY4A 3EGWA 3AXTA 1O1YA 1DAEA 4MUGA 5AKIA 1ULBA 3V00A 3A4TA 5ABPA 4KO2S 3QSYA 3WB0A 3BN3A 4BWFB 3KKNA 3VOBA 2C9MA 1JEYB 2XXBA 3BG5A 2C94A 1BJKA 2EX1A 2XKJE 3FDZB 3I2YX 3TLGA 4WBNB 5LLDA 2PX3A 2DECA 3OJ0A 3WKCA 4D9FA 3WNVA 1DDGA 5CIQA 3UA4A 3NJ4A 4ZHQA 3PDHA 4NDAA 1XDSA 2Q0QA 3LWZA 4S1PA 4DV1B 1SY7A 1PQPA 4G5OA 1PS0A 4XTRA 2WQ7A 5BQXA 5KQMA 3WG9A 3HFSA 3JV7A 4JQOA 1H5QA 1KAHA 1KP9A 1V39A 3M33A 2GX6A 1GUDA 2FPLA 1AQUA 1GQFA 1XXHA 4UFNA 2QL5A 1L7PA 1XB2A 3MFYA 4QREA 1HDEA 1Z18A 3LLUA 4IV8A 2NV6A 3BIOA 2GCPA 1QDEA 1VIMA 1TK3A 3L07A 4JL8A 4MHSA 4JYCA 1A0OA 1QH0A 1XP8A 2WFZA 3L8EA 1LV8A 3L9XA 1OH8A 4DSZA 4UJ3A 2JGJA 4ZT3A 2XGMA 4CMAA 2ORYA 1EUDA 2XB9A 1VI5A 4P4GA 3WNDA 4RF2A 3AYXB 4CIDA 1N9GA 3VJKA 4HQFA 1BDHA 3O4GA 3U4DA 1VBKA 4F4JA 3KVNA 2DY1A 4U6NA 4JZKA 3JD4A 1LSUA 1Z5PA 3ELYA 1LLUA 1IJKA 3IUBA 3NYRA 4EYSA 3GEMA 4ZARA 3H4MA 4X44A 3U1VA 4XGQA 1C1YA 1X80A 1BWSA 4RDCA 2QJTA 2V7GA 1GZHB 1XVVA 3C8ZA 4HLDA 3AJEA 5AI4A 2JJ1D 5A1JA 1R9JA 3L2OB 2JVJA 1V9SA 3OT4A 5HCIA 5A02A 1ULAA 4MMZB 2C4WA 1ECLA 3JQGB 4J91A 4HAVA 4H59A 5C53B 3G49A 3OCXA 3K1JA 1LV7A 4V0MA 3MWGA 4L8WB 1E4VA 4OLFA 2JLQA 4TWAA 5FL3A 4EK9A 1N6IA 4CU2A 4WKOA 4YRCA 1UIRA 3DBIA 3FJYA 5FL7A 2C5AA 2H65A 5JSKA 1WZUA 3QEJA 3DDCA 3FUWA 3I8SA 2RD2A 1O6ZA 3VHXB 3DAFA 5EIWA 1M10A 3WRWA 5A0VA 1FCJA 3ZH2A 1F2UA 3BTOA 4ZOEA 4RZ2A 3EZ2A 1E96A 2IPNA 4C4XA 4BLTA 1NT4A 2WA2A 3I39X 4L3OA 3CX3A 1OMOA 3RSLA 5B3KA 1NVXQ 1FFXA 1W0KA 2VZLA 3QHAA 4QQNA 2MSCB 4NMMA 3ZHUA 1ZQ1A 1BOOA 1H6DA 4QULA 5TF0A 1JF8A 1GUAA 4TLAA 2YICA 3G7UA 1UK6A 2NQ8A 3FR7A 2WD7A 4QSMA 3N8IA 1JMVA 3D59A 1FJXA 2CV2A 4A03A 2FFJA 4YUAA 2CUKA 3FNBA 1ODSA 1C8VB 5DHSA 1QKIA 2WILA 3SZMA 1PUJA 1KO1A 2E85A 3RVJA 3FUUA 3QM1A 1C81A 2D4HA 1KJJA 1A4XA 2V8BA 5JNWA 5DYGA 3IOCA 2CT8A 1B2LA 3HXLA 1WM1A 1B0ZA 2W6ID 3M7IA 4X95A 4GKKB 1ZC3A 4Q24A 1X1AA 1I7NA 3QLEA 4KREA 4BLVA 4GYJA 5AK0A 3H19A 4BFVA 4BVJA 1SZDA 4K40A 1AKEA 1O6FA 1WD7A 1UXOA 2TMDA 1G3IA 3AM4A 4Q21A 4RAOA 3H97A 3LSTA 4IOLA 2JK0A 4BXOB 3D8TA 3T5AA 3BRCA 2BE9A 2VF8A 2XRYA 3EVGA 1BDIA 4M60A 4MW4A 2WTEA 4GBJA 3E7PA 1XF9A 1TADA 3FPFA 1TA0A 2GM9A 1IPFA 2ID9A 1EE1A 2W6ZA 4Q4AB 1TPZA 4AM8A 5GIOE 1N7GA 1T6ZA 4QNMA 3GMSA 4H7FA 1XQXA 3OLQA 2VKTA 3GW8A 3A4IA 1M73E 3C6YA 2QLJA 3KDAA 4QO7A 4B1FA 2IUSA 3QWIA 4O1IA 1FU7A 2HU7A 1NR5A 2OCIA 5KAMA 4HZUA 5DNWA 3B2NA 3AEQA 3EW9A 3KUXA 2MSDB 2PNFA 2X1LA 4RZQA 2OD9A 2XNJA 2ZANA 5LWHA 2NXWA 1BEUB 1OYWA 2X1MA 4PHHA 4Q82A 1UFOA 5CH8A 1EQUA 1KH2A 2R7AA 4CGYA 1M8KA 1P1FA 5CR9A 1JTEA 3VYWA 5B57C 4UTVA 1YL5A 3P9YA 2QRUA 3Q6MA 3M6VA 3C8DA 3THYB 3UW3A 1MQ9A 3B6ZA 1ZOPA 2FUCA 2RG7A 3II6X 3FPBA 1C3EA 4KMSA 3I62A 3ZD9A 1U31A 1ZA1A 4GC5A 4CKWB 4FI3F 5IWAB 2O6HA 2V4ZA 5TNXA 1XAIA 1R8XA 2IVFA 2I22A 3BB3A 2HUPA 2Q6KA 4B3TB 2V3CC 2PSFA 2FUG6 2J9FB 1Q57A 2P9ZA 1V71A 3PLNA 2XECA 3VZCA 1QHXA 4U9IS 3ZV3A 2ADMA 4BRSA 4DSAA 5AVYA 4KWTA 1V3VA 4RZ3A 1G9TA 4JKIA 5EPOA 1ZGHA 3BJRA 4PGMA 5JY1A 3STXA 2CHUA 4Z51A 3QEMA 1BHQ1 2W6PA 2O8DB 1HBJA 2R44A 2FSGA 1UOQA 3E3LA 2OAQ1 3PGVA 4RVUA 1EJBA 1F2UB 5DZSA 4ZVKA 3EHEA 3L49A 4ARVA 2IYSA 3PRHA 1E9RA 1D4AA 2FPXA 3PXUA 3N2YA 1NVVR 4LTDA 3ZNPA 4O2AA 4ZOLF 3PPXA 4LCEA 4LSZA 4Z8YA 1UBUS 3ESZA 3LGXA 3CMMA 4RF4A 3WGNA 2W11A 2GAAA 2JVKA 3HP7A 2FMIA 2Q5OA 5DV9A 4FYPA 1S3GA 5GOZA 4TYWA 1Y63A 3AEUA 1W4RA 3K53A 2OORC 4CRWB 1BC5A 3ONFA 3IE2A 4K9SA 5K0JA 2ACEA 1BHSA 5COQA 5C8YA 4CTNA 5AW4A 2X3UA 3EAFA 3BDVA 4PYKA 1GN9A 3M1IA 4PHCA 3CVVA 4V1CB 2PY6A 4BO7A 4OG2A 1CJTC 3KXPA 3U7QB 2VHUA 3V33A 4CUJA 5CXUA 2H8GA 1GPJA 1FSGA 3EBOA 3ZJVA 3PX2A 2ZZKA 4G4JA 4YRJA 1AKUA 1XX6A 3OZXA 3E9EA 4F21A 2A0WA 4G81A 1IUOA 4HK4A 1WNTA 4LXHA 2MMCA 2BKAA 2DAPA 1OC2A 1H9CA 1ZW6A 1PJTA 3LUCA 3K1AB 4UAJA 2ZROA 4PONA 3RC2A 4BO3A 2C29D 1T0HB 1BXGA 5JC8A 1P2SA 1TVMA 2DU8A 3I42A 5DH9A 1SK9A 1G20E 3EVCA 5JNSA 3R75A 2BBOA 3IYLW 4DCVA 2I6QA 2AV6A 4R8MA 4X8OA 2SKCA 4OMCA 4RY8A 4QSHA 1YXMA 4HDMA 4J0EA 5EG5A 3VPAA 4HLUA 3CRVA 1TCCA 1SZPA 3LKZA 4Q7LA 4WAUA 5JRJA 3PQ2A 1K8ZB 2Z1NA 1ZZGA 1J5EB 3PXCX 2F59A 2YXLA 3PICA 4GZMA 5EP4A 1QP0A 4UTPA 5KHLB 3AYZB 4RS4A 4BFYA 1QU2A 2BV3A 4JJGA 3G6KA