3L41A

Crystal structure of s. pombe brc1 brct5-brct6 domains in complex with phosphorylated h2a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
KRVYITFTGYDKKPSIDNLKKLDMSITSNPSKCTHLIAPRILRTSKFLCSIPYGPCVVTMDWINSCLKTHEIVDEEPYLLNDPEKELELGCTLESALKRARAQGPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCSTLNVYNKRLARHLEDGNVVLITCNEDSHIWTNFLDNASQNKTIFLQNYDWLIKTVLRQEIDVNDRIADEFARAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords BRCT-containing protein 1
publication title gammaH2A binds Brc1 to maintain genome integrity during S-phase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 75
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l41A01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l41A02
2EP8A 3K0HA 3SZMA 2EBUA 3PXBA 3EF0A 1T2UA 3FA2A 3I0MA 1IN1A 3T7KA 3COJA 4IGKA 3PD7A 2COKA 2ADOA 2LE0A 1Y98A 2JW5A 3PXCX 3QVGB 2K7FA 1T29A 2EBWA 3PXDA 2ETXA 2L42A 1CDZA 1GZHB 3T7JA 4U4AA 2COUA 3K16A 4IFIA 3PC8C 3U3ZA 2E2WA 2AZMA 3K15A 1IMOA 2INGX 4BU1A 3T7IA 3PC6A 3PC7A 3AL2A 1JNXX 4OFBA 3L41A 4ID3A 3L46A 3II6X 4XQ0A 3KTFA 4JLUA 4Y18A 4BU0A 2R1ZA 3UEOA 2HTFA 3EF1A 3UENA 1OQAA 3HUFA 1L0BA 2D8MA 3QVGA 3SHTA 3HUEA 2NTEA 2XNKA 2WT8A 3PA6A 3PXAA 1N5OX 3AL3A 3L40A 2K6GA 4XPZA 2XNHA 3OLCX 1T15A 3PC8A 3I0NA 1WF6A 1L7BA 1T2VA 3JVEA 3SHVA 4N40A 2M2IA 3PXEA 2VXBA 2VXCA 3SQDA 4Y2GA 4BMDA 2COEA 2DUNA 3K05A 3T1NA 5ECGC 1Z56C 1KZYC 3K0KA 4BMCA
chains in the Genus database with same CATH superfamily
4FPXA 2EV9A 2PIDA 1OIWA 2FMXA 2VTVA 1U2TA 2Z09A 3QV1A 4CWAA 2DUUA 5GONA 1GGEA 4AICA 1A8PA 2BEUB 3EXFB 4MV1A 5EQFA 1QE0A 2AK2A 3WSTA 1OCEA 4EECA 2X3YA 3RTBA 1LW7A 1F2UB 1MIOB 5EJAA 4BKOA 1H4TA 1QIGA 3V8BA 5I7WA 3NPAA 4O5OA 4DR6B 1OLOA 4QRHA 2QE7D 4PO8A 3HJAA 2HSGA 4JT2A 5CJ2A 5L4LA 1OA0A 4XQEA 4ZIRB 2KLHA 3IBSA 1G5FA 4YHBA 3Q8MA 5COBA 2LXNA 1U94A 4GU5A 3W3ZB 2BR3A 3WGTA 3Q8LA 1JH8A 2AGVA 4DLZA 1NVFA 3SBEA 1TM5E 4QXOA 4GI1A 4NJMB 2XCQA 3C3DA 4ABYA 4ALNA 2UYCA 3HCWA 3E1SA 3OQIB 3QY9A 1TAGA 4MVJD 1UM9A 1UUFA 1X14A 3VRHA 4BNZA 3HADA 1U28C 4UNQA 3JQDA 1NBEA 4NLLA 3VR2D 2AG5A 3C3JA 2Q7DA 2EP5A 4KSBA 3VZQA 1B8UA 1KHTA 1N3YA 2F4VB 2ZJ5A 5ADVA 3G89A 3LUCA 3QBTA 4KR9A 3BMXA 2QHXA 1J9EA 1N4DA 1EDEA 3GZJA 3ONFA 1O77A 3ZZNA 1DCTA 4RENA 1HBJA 1HF3A 3D3NA 2C59A 4LHZA 1BCSA 1CD5A 3FR7A 2I8LA 1G3QA 2CL6X 4BO9A 2QJOA 4GPTA 4UDOA 4W1RA 1RM3A 4ILEA 4DYVA 2V1XA 3JY6A 3K8QA 1I4TD 1KY2A 1U7XA 2VXOA 1A2OA 3O8QA 4I1YA 1VE6A 5C1OA 3O03A 1C0EA 2YVKA 2F1KA 3FSGA 3VR0A 4TS3A 4AWAA 1WQ1R 1S7CA 3FPGA 4TSFD 3WWOA 2QTHA 3LTNC 3ZVNA 4C6SA 2VSOA 4IW3B 4YAJA 3R5XA 4K0KB 1KVTA 3MJRA 3S2EA 2CV0A 4LPKA 5EXEA 1B0UA 4F1JA 2AJCA 5F7JA 5JAZA 3U3XA 4LFAB 2BM1A 4JFAA 4ENQA 3QSGA 1Y4AE 4AX8A 4MUAA 3LHIA 2HLDA 4W5HA 1WVIA 4CN9A 4M1QA 2UZ3A 3IPCA 4GKJB 5I45A 5AJZA 4Q9IA 3I61A 4LY6A 1XZCA 1VSBA 5CPFA 3ZDCA 2C4HA 3K4QA 2WLSA 4CKEB 4CMAA 2PQ2A 4EAAA 3KKNA 1N1GA 1Y0BA 2Q2OA 4DSOA 2ONCA 1IY8A 1W46A 3UWPA 3S2YA 3OETA 4RV5A 2J5KA 3S7ZA 2C8LA 4L57A 1JE0A 1U2EA 2ZE6A 4O4HB 5ALKA 3RC2A 1NNSA 1SRRA 1CLUA 2ZYSA 2P3QA 1B16A 4K9PA 1Z7BA 2PUBA 3RADC 2VCYA 1K97A 3WHLA 1FLDA 1TCBA 1YZ3A 4P08A 5KTOA 4IWYA 5EQJB 1AZWA 2C04A 2C54A 4BE4A 1HRKA 5DPMA 4ZGGA 2C94A 2CWWA 5JDIA 4CF4A 1DO8A 2O06A 2QZ4A 1WDLA 3HKBA 2FRDA 3HCAA 4GOXA 4HFMA 4UC0A 1BC5A 4NJOA 1G41A 4N8DA 1YNSA 1DCMA 5AD1A 1W88B 2NZJA 3N8IA 2WY2D 5FI3A 4DJJA 4ZMSA 1ZI6A 3RYIB 2AFRA 4DBLC 4ZT3A 1LTHR 2PJUA 5JAOA 4RE6A 4BAGA 1YQTA 1FVFA 1QYIA 4LC9A 5HRUA 1TI7A 2ECPA 4YB8A 3RSLA 4XWKA 2L17A 2HK8A 3LK7A 4BFTA 2J07A 3MLAA 5CX4A 5B2ZA 5BUCA 2FSVC 4UXJA 2BKEA 3P19A 3C43A 3DE1X 4I55A 3ROMA 3ZBTA 4B4WA 4RJJA 1A4XA 4O2BF 4TV8F 1D03A 5BQXA 1ZJJA 4MXDA 5CNJA 2XAUA 5AKZA 3G9ZA 2G88A 3SZUA 2YOGA 4C05A 1JYFA 2HHCA 2WTXA 1XMJA 1D6NA 3BL5A 1J4AA 3JU3A 4GVLA 3ZU3A 4FFRA 2WIAA 4U2CA 1RPZA 5JD4A 3PLNA 4TV9F 3ZDFA 2EWMA 2R7NA 3R75A 3JQ7A 1JDVA 1U8AA 2QJWA 3PKJA 2IHVA 4M87A 3REOA 3SFTA 3B48A 1QH1B 4X3OA 1D9ZA 1H6DA 1NI3A 1UPUA 2C4MA 3LHDA 4Q7KA 1A69A 1I7PA 2HWUA 1PGQA 2O2DA 3OWHA 1T8UA 5EE1A 3R7FA 1ZC4A 2PRKA 5LWQA 4FBLA 5H83A 1E1RA 2P35A 2EYUA 4IX9A 3ROPA 1FDOA 2GUWA 2D74A 3O47A 1T10A 5A9TA 3THWB 2W2QA 3LP8A 4M8NE 2VK8A 2ROQA 5D6OA 5DGDA 3TNDA 3HY4A 1F2DA 1DUIA 1XPUA 1HE4A 3I2JA 2HK6A 3GGGA 3QVJA 5ECYA 1L8QA 4CLDA 2D7CA 3MWKA 4LJSA 4J0DA 3MCWA 4FFBB 3LQKA 1PVVA 1UJ2A 4LDQA 5E4TA 2WUGA 3JQAB 5T5QA 1M1XB 4CKYA 3QOXA 2MSWA 1OU0A 1ZK4A 5EERA 1QIJA 4XWTA 2ACVA 5HDQA 1NKTA 2O1XA 2VDQB 1Z15A 3ZKAA 3A4YA 3L7BA 5EKXA 3RVMA 2FR1A 3LBFA 3OJEA 2J6BA 5JD5A 2ID9A 4D56A 2A92A 4FTWA 4RSRA 5U1PA 3JW8A 3WC4A 1BXKA 1CF9A 5KX5F 3BJMA 2JEOA 3AUUA 4MGZR 1YULA 4PC2A 1S9HA 4D98A 4GMFA 4DSUA 1PGPA 1B0AA 3LK6A 5KVAA 1FX1A 2V7XA 2XGGA 1GFSA 3FRHA 4M0EA 1XD9A 2QVYX 4HLDA 1YZVA 2HYIC 1A96A 2I54A 4HAYA 2JJ1A 3MQ2A 1I7QB 4NHOA 2BGTA 2J3KA 5KIAA 2Z2YA 3I37X 4X6YA 4MUKA 4PSAA 5THKA 3LRPA 3X1JA 3BIXA 1P7ZA 4RPLA 1N6OA 4EPVA 5AW0A 5JSZB 4OI0A 1GGVA 3RQSA 2ORIA 2HU7A 5DLQC 4XRGA 4YS6A 3T5AA 5J4LA 4B75A 4G4JA 2P62A 2QQFA 3LCRA 4JI6B 2GFQA 2NPOA 2PA3A 3K8OE 5HTKA 1KOGA 4UEQA 2J4CA 3UQZA 3BEOA 3COZA 4PHHA 1YZHA 3MUFA 3E4CA 2JFYA 1CB7A 2H2AA 2QVZX 2A1TR 2OZKA 4BCBA 3HUTA 1ULSA 5KKAA 4QDKA 5KYYB 4DV2B 5CX1B 2ATEA 3V7YA 2FE4A 3EQ7A 3U37A 1OHHA 3DBHB 5KNCD 3WYDA 1GCIA 1H2EA 4TMWA 2PLNA 2WFLA 3CLTC 3SLRA 4OCZA 3ZU6A 1MENA 4BGUA 4KJZA 1YS2X 1D2EA 2FA9A 4KDCA 4ITVA 2GZ1A 3DCNA 2GCOB 3VHRA 5J2TF 4EJ6A 1PFWA 4F96A 5EWLA 4GBED 5DOZA 5HGJA 2DHCA 2XE7A 3EZGA 4URVR 4LOLA 1KJNA 3OX3A 5BQOA 2I67A 5LQMA 4C4RA 3ILXA 1U3DA 3E5HA 3WFZA 3EUWA 3UZUA 4DHWA 4M0LA 1NUTA 2BD0A 1FUUA 2HSJA 2BI4A 3NDPA 4NJEA 4C7JA 1OJ7A 1T29A 2XTNA 4U7GA 4FGSA 1WCXA 4ZQFA 3MCUA 4U7WA 3TUIC 5JRJA 5E8RA 3NRJA 4YP6A 3KT0A 1IN5A 3X3HA 1SKAA 2X1HA 3FCSB 1Y4DE 3H9GA 1PV4A 2GK6A 1YRYE 2VJAA 4M8KA 4RPKA 5AJTA 4ZAXA 2MHCA 3KIPA 5A7GA 1A76A 4FB4A 3O8NA 1L4YA 1UMKA 2C9OA 3AERA 1A1SA 4FDVA 3P1JA 4BMNA 4GMHA 3LOPA 2GAIA 2J5BA 2QW8A 4NESA 4MRNA 3ZWQA 3DOJA 3GWZA 1PQYA 3PGMA 5JNUA 2BTQB 1T5SA 3L7JA 3VDXA 3JYLA 3EMKA 4Q18A 3RJMA 3OD1A 2HJHA 2GAFA 2Q4DA 4MQEA 10MHA 3CF0A 3P9CA 5BVGB 2R86A 4PZDA 1EFPA 4D6YA 5EZQA 4JYZA 4O08A 4H6PA 5ETJA 4GQAA 1M66A 3DBOB 1U5BA 5CA1F 1TECE 3OSZA 2IWRA 1XLWA 4R2IA 3RYFA 1H0SA 2A0WA 4JDPA 3INGA 3KR9A 1K8ZB 4GS5A 5I8ZA 2EZ4A 3EZFA 3TH5A 4DA9A 4AMBA 3H2ZA 1T0HB 1VE5A 2CXXA 3AFMA 3CJQA 1NN3A 3GPCA 3LSYA 1CJCA 4Q4AB 3K6SA 3H2JA 3LYAA 4KN5A 3MFYA 4UEKA 1LXCA 3ZU4A 2ZYUX 2W83A 4NP6A 3GLGE 1OE0A 2PGXA 1W6RA 1BDJA 1HURA 2VJCA 1NXVA 1I3CA 4W1QA 3LQFA 4CR8A 4DV3B 3HFJA 5HM8A 4GR9A 4YGYA 4AQYB 2GI4A 2P7IA 5ERGB 3T5MA 5IKXA 4TN5A 3W4IA 2K6GA 1L4KA 2QZ9A 4G23A 5E0OA 3P0RA 4F4HA 2Z43A 4M1MA 4WCDA 1U8YA 4XB1A 5D84A 4PNPA 3TW8B 1G4HA 2PEYA 3KEMA 3ZTYA 3JRNA 1OLSB 3CRMA 2O14A 3GGSA 4M1KA 2WP8J 3JCZA 4OL9A 5HF8A 5BRJA 5C51B 1ZIOA 3IEPA 3RU2A 1J1UA 1XWFA 2VF2A 2ZS8A 3KSDO 2DQ4A 3RCBA 2KQUA 3YASA 2R6JA 1AKTA 2OV4A 1QYWA 1M76A 1Y4UA 2DQZA 2HNBA 2DRIA 2V74B 3QBEA 2BAGA 2E3JA 4PQYA 3THOA 5JYBA 2ZETA 1KI6B 1SBZA 3HZHA 1DC3A 3D8TA 3ZKWB 4K6HA 5BSTA 2VNKA 2XRYA 5H3CA 3UMGA 2CW5A 1HKHA 3OEED 4OVKA 5K3EA 2PH3A 3N86A 3PJGA 4ETWA 2PX8A 3FWKA 1FVHA 2G9ZA 3F97A 4OGFA 1XMIA 1JEQB 1N1MA 2QI9F 3HZZA 4FZRA 5FD8A 4P7KA 1VL2A 4U7FA 1JB1A 3DZCA 1CUYA 5L95A 3H75A 4GLLA 3X1XA 1AU9A 1WXXA 3K2BA 2A7QA 2N1MA 2RGNC 2YIVX 1YZLA 1FFSA 1R5NA 3KKMA 5IBRA 3BD6A 4PM4A 3OZXA 1ES9A 1I80A 3OZEA 3VJKA 3HE3A 4DVJA 4DEYA 1XLVA 4PTYA 5CA0A 3RREA 3ZV3A 2ERXA 2O23A 1MEEA 3PICA 4WOKA 4ZYVA 4I46A 4E2YA 4QYMA 4EW2A 5EZYF 2TMGA 5LXTB 4UMDA 4D02A 2X40A 2ZZMA 1LDNA 4R9NA 4Y1EA 3TTXA 2GVDC 4Z7QB 2I03A 1JILA 1TLLA 4HWPA 1V8OA 2AHRA 1EK1A 1CZUA 1OKKA 2VUUA 4UVGA 3WZMA 4B3DA 1XTVA 1O94A 4L0DA 3W5VA 1YI8A 3NIWA 1KO4A 1Y5RA 2P9EA 1A4UA 1KYWA 3BCUA 4MJXA 4YBRA 1RHUA 3KXLA 3H83A 1FNBA 4XM1A 5BNZA 5DOVA 5KTYA 3PQ2A 1K0UA 1EUDA 1QGAA 1WM1A 4ZQIA 5THQA 3RUIA 3H0CA 4IY1A 4LGMA 4RYDA 1FMCA 4XVHA 4E6EA 4E5KA 1X7WA 1YC2A 2WILA 1GKYA 1UJNA 3OLXA 2XWPA 3W04A 1Q84A 1KNQA 2QTCA 1QR2A 5DULA 4DIUA 1CQXA 1G1AA 1AHIA 1RHMA 2JZNA 2NAPA 3G49A 3R0XA 5TXGA 2CCKA 5CYOA 1J2JA 5H9WA 3DFZA 1P62B 4CHTA 1W4RA 3FZQA 1OYVA 4G56A 5LA6B 3AK4A 1ECLA 1MJNA 1J56A 1XD2B 2BGKA 1W6UA 1BMFD 1YDWA 1RWOA 2H2DA 2CD7A 2X1LA 4KFUA 2VRNA 4XGQA 4D79A 3BMNA 5LQCA 2D2IA 2Q3HA 5GIPE 1I14A 2CE2X 2R5FA 5JFTA 1EXVA 1IDOA 2ZQYA 3K70B 3W90A 1GZUA 2C7RA 3EUAA 2K87A 4JUIA 4LXHA 1E18A 2FY8A 5IZ4A 3JQBA 1CUBA 2C99A 3KU4A 2PXHA 2AQHA 2NUPA 4S1VA 4A1FA 3ZCTA 3PCRB 1TX4B 2ZIWB 4OK3A 3WJ2A 1Z34A 1JAYA 2FB9A 1EJBA 4MQ5A 1LLFA 1CR1A 4LY0A 4ZHQF 2Q5LA 2BHLA 2D59A 2Q5JA 1JNYA 5A2QA 4FZVA 1FU7A 4F12A 2Q6KA 2ZWIA 1SCIA 1T3HA 1ZMXA 2IYXA 1C8BA 2NV6A 4IJQA 4Y2JA 1NMYA 2QT9A 4XPZA 5CYPA 5AICA 4B84A 4F6CA 2PYIA 1CR6A 3WLJA 4CTNA 3WBBA 1VHWA 4Z0TA 4ZJPA 1A2KC 1WY7A 2JA1A 5CNMA 4OQFA 1NPDA 2FZGA 2ZJ6A 5I9SA 5KYNA 1RPTA 2VBIA 1RYNA 2RDMA 1EPUA 2CUNA 3QP9A 3DDWA 2Q0QA 2NACA 1ZHHA 2P6MA 3HCFA 5TX7A 4AJ2A 2ZU0C 1FU4A 1PFKA 2P3LA 2XE6A 2Q8PA 4HLCA 5AI4A 5ER9A 5D7NA 3NV7A 2AEJA 2IUFA 2DVMA 3IBTA 3QYAA 1NAHA 1P0QA 2VXBA 1GQOA 2P5YA 2WRZA 4QEZA 4CM3A 1IBKB 2V4ZA 1OFUA 2RH4A 3TLMA 1NF9A 5AVKA 4BWFB 1WE2A 1PJQA 2AJBA 4NMMA 5LB4A 1XSEA 4QX6A 1CQWA 4E5VA 5EZ5A 3RSZA 5AH0A 5C4GB 2X8LA 2QRPA 1E2IA 3FDZB 5DYYA 4N7RA 5IF3A 1CX9B 1MR3F 1NSFA 1N7JA 2HBRA 1X77A 3AV0B 4RX1A 2X9QA 3ZCRA 1AURA 3DOCA 5M34A 1MZPA 4DMHA 2FU5C 1BA3A 1GNSA 3FZNA 4L8LA 3RV3A 2KBEA 2ONKA 5LLTA 5TPZD 1Q5PA 3VZRA 5AW2A 3INNA 1U3CA 1JEJA 4MYDA 3X44A 4EMSA 4HNVA 2I7VA 3DFKA 5J2UF 1EGHA 4P5PA 1YQEA 2P9JA 4JD5A 3LPAA 4PLZA 4EATA 1IEQA 5E0KB 2WIKA 1WQ3A 2VQFB 2GHRA 4L50A 2OCPA 2DEUA 4WZBB 4DMKA 3ER8A 4MVJF 4X1IB 2FWNA 1MMFB 3I4FA 5DLEA 4IIJA 1SBIA 3QOFA 2YVUA 1V35A 1QV9A 1SA0A 3FOBA 4X20B 5U4QA 3TLGA 3L01A 1YB2A 1W2HA 5HUHA 5ITZB 4K9NA 1L7DA 4Q21A 1MJFA 1V5EA 5LJLA 4YCNA 3KWLA 4XA8A 3D4PA 3NRCA 5DH9A 3UWOA 1JT2A 4DMUB 1JHPA 4ZV9A 1LF0A 2ATXA 1W85B 2VSFA 3DVQX 4NSNA 5A3QA 2EZUA 2YWBA 1RZUA 3QV2A 3IDAA 4R2MA 1L4EA 1XB2A 1UODA 1PZGA 1VHLA 2QYSA 4AVYA 1XEXB 1JEYB 3BB3A 4ZU3A 3FBTA 4FMCF 4UM9D 3HRHA 5EMKA 3TTWA 3Q3VA 3QE9Y 5TT1A 1Q1ZA 4QM7A 4DEVA 2MT9A 3LYUA 4E09A 1K6XA 4NPCA 1SB9A 1UFVA 1DGQA 1F8FA 3GLVA 1PQUA 1YT5A 4WUVA 2QUAA 1F0YA 3MSXA 1SRQA 2GPWA 4Q3OA 3CC8A 3CO5A 4U7HA 3O1JC 5C7YA 1KEWA 3L8CA 3NOQA 3ED5A 1ATIA 1G17A 2VDWA 2IYPA 4LFCB 3PWZA 4HZGA 1K6IA 4TLMB 3WQQA 2X19A 4NU8X 4Y6SA 3GLUA 4ASUD 1TGYA 4F3TA 2V03A 3AY7A 1O8BA 1C9DB 4WXMA 2NT4A 2NTYC 2DX7A 3R3ZA 3JWPA 4IAOA 4R3UC 2PRIA 2W9XA 5J58A 1W25A 5C34B 2QYTA 5I7HA 2IUUA 1TUIA 4H3VA 4Q4JA 4LHWA 2UV8A 4EI8A 1RXVA 2OENG 3GEIA 2YXEA 4LOIA 1PUIA 1CP3A 3R23A 2G77B 3IV7A 2LIPA 3R4VA 4Q1AA 4UULA 4GZLA 4X66B 3FJYA 1JI3A 2Z08A 1W9HA 4YT8A 3NBYC 2FSVA 3AEYA 3ECSA 3J7TA 3K32A 2A9PA 3NH9A 4YJDA 1NP6A 4WESB 1JHUA 4KV9A 3KJHA 5J43A 2EIXA 3H9UA 5AUPB 3TRKA 3KXDA 4JYMA 4K8OA 2QTTA 1RZ3A 3FUUA 3TZHA 5B3KA 8ABPA 1ODFA 3DHYA 1J25A 5CBPA 4GEKA 5IRCD 1Z0KA 1C80A 2WNSA 1RCUA 4DM4A 2H7XA 3QOWA 2XW6A 1NC1A 1VJCA 4FU0A 4EDFA 3EN0A 2QN8A 3B5JA 2RKBA 1T24A 4BLSA 3VTKA 4I0WB 1DAPA 4M1ZA 4Y2VA 3FPCA 3FHCB 3HCEA 3L5KA 3TNFA 1X8XA 1QPZA 3Q40A 4I9HA 3ZLBA 1KZHA 2ZRBA 3OEHD 3DZBA 3WLQA 2ZCJA 2GWHA 3HB9A 2M6LA 1CHDA 4JXZA 1I6MA 4H77A 1YZUA 2H2HA 3KSUA 4KXWA 5CU7A 1FIUA 4OBBA 3G88A 2ZSIA 3HDVA 1EUCB 1OUMA 5H70A 4D6XA 5EVJA 2WB4A 2P2LA 2DPGA 5DLDA 2M6RA 4TQGA 1RQXA 1X0XA 2ZBRA 1R4ZA 3D7NA 3FR8A 3H9BA 1PNRA 3QWFA 3ANMA 3ZCPA 1V11A 5DNCA 1RHQA 1B6RA 4YMHA 3JARA 1TKAA 3ZY4A 4PZ9A 4ZEXA 2CYAA 2GILA 3AB7A 4ZI3A 2QUHA 1PL0A 1A4RA 4Z4FA 1NBWB 4I4LA 3OVMA 1RKQA 3CZQA 4HP8A 4P4NA 3MC1A 5E6UB 4BV9A 2HCRA 2O8CA 2QL6A 3ZWMA 4R7ZA 1Y1QA 3KE9A 4J0JA 1KFKB 3EXG1 1KKMA 3T9EA 2CNLA 3ENWA 3CONA 1H5NA 2A1IA 3D6UA 3NDIA 4RMNA 5FNVA 3S4YA 3WIUA 4C06A 4RULA 1DU4A 3B1FA 4W1PA 5LP1A 1A5ZA 5C8YB 2O8FB 4R54A 4JVLA 1WXFA 3SXUA 4EW3A 3QUBA 3O3MB 4JJ6A 3G1TA 4MITA 3WTCA 2G72A 1TCVA 1UKBA 2V97A 3IEXA 4K88A 4PRLA 2ALJA 2W6NA 4CIYA 2NYVA 3CUVA 5JQGA 4G9GA 4WJLA 5C53B 4GYJA 1Y34E 1UJ5A 2DPLA 4KR2A 1GNQA 2V59A 3KQPA 4QGBA 4BAUA 1EZ4A 2XPCA 4PHFA 2BDTA 3LV8A 4AX4A 4C0AC 1S8AA 1NT4A 3SBOA 2PKYX 3KX2A 4PONA 1O87A 4S24A 2QBYA 1UJ4A 4G37A 4M1EA 1UBKS 1XO1A 2JB9A 4DMLA 3V1UA 5JZMA 1YA6A 4QAQA 5B4VA 1VZ3A 2ZWMA 3G9UA 4G0PA 1P0CA 1TVCA 4Z99A 1E3EA 3WNBA 3EFBA 3I9KA 1EK2A 4MDYA 4QHTA 3ELBA 4G0MA 4DIBA 1B14A 1L4NA 5C7IO 3L0OA 1LK0A 1Z4NA 1XE3A 3G5MA 1P7VA 3ZXSA 5YASA 3L92A 2RI0A 1NLMA 1RI2A 4IGEA 2LP4Y 2DJIA 2W2OA 2XF8A 4N3AA 1MC5A 3K9GA 4C6TA 1U7WA 5ER6A 1NW9B 1E5TA 5ALTA 5B7GA 1VGRA 4FHCA 1UMDA 2N75A 3AR9A 3DZIA 2DKFA 3ONVA 2W93A 4KAFA 3DJFA 4PC6A 4D57A 1FFAA 2P5SA 3AHJA 1GZ6A 4ROSA 4BX3A 5AXCA 4F4UA 1YKSA 3CH6A 3G2HA 4ZI2A 2UYHA 4I6JA 2FSSA 1E2MA 2IZ0A 4Q37A 4HEJA 5I7EA 4DCNA 1ZUNA 2QAGB 4HPWA 1EGMB 3PDJA 3AZQA 1NW3A 3NUQA 1DKMA 2R1TA 4A82A 2I3AA 2G9QA 4NBLA 3I28A 1ECBA 3IDZA 1LPOA 1G0OA 1UXIA 3H5AA 3AF3A 4AIIA 3ENNA 2PZEA 1ZJZA 1AZLA 4DRXA 3MERA 4PPQA 4X63A 2DLCX 3MWJA 1GRCA 4QU9A 2XQJA 1UDXA 2PZAA 4IDEA 1QSGA 5SZIA 4K6GA 1E7SA 3SF0A 1G2OA 1NW4A 3FTDA 1FVXA 4RJKA 4WBNF 3MUNA 4JV5B 3PV0A 1WULS 4LXIA 3BMQA 1FNMA 2H4JA 1TQDA 3F8TA 2WPNA 3WYBA 4JZYA 4JI2B 4GAEA 4R01A 1R5JA 1TLFA 2E1PA 3E15A 4KXUA 1J5XA 4FT2A 4MV6A 2PD3A 3TZQA 3HHEA 1JKJB 3AFGA 1KK3A 2BFNA 4JB3A 2FMKA 1LSOA 4OSOA 2DY0A 3FGNA 3JZAA 4C0KA 4CLRB 5K0NA 2VK1A 4E32A 4Y7CA 1ZN2A 4UVEA 3M6AA 3U0BA 3KJXA 5EKUA 3DDZX 2XA9A 3VOBA 3NIFB 5DTQA 3T3OA 2RHMA 3CRW1 2FVYA 3DAPA 5LCXA 4COOA 2I78A 1Q77A 2BBWA 2QGZA 3LNCA 3TOSA 5ICSA 2Q3JA 4EABA 3IGFA 1ISMA 1P3DA 3I9MA 2WSMA 2FMIA 3NNSA 4JJ4A 3GFRA 2BBOA 2IU0A 1XZKA 3GRZA 1MOZA 4QDTA 5AHWA 1RKUA 2DSTA 4MRMA 1H85A 4BJHB 5C5DA 4JBHA 3OQVA 1VL0A 2EFHB 4HDOB 1OW3B 5FO1A 1VXOA 4BLWA 3H6GA 2C8JA 3Q72A 1JJ7A 2GS9A 1JNXX 4LDPA 4KDEA 4K9KA 1D5CA 3Q1KA 2Z57A 4HDAA 4AKEA 2A35A 4EA8A 3RBAA 4C0BA 2RB5A 5AW3A 2BIFA 4DCOA 3OLQA 5EJFA 2O2CA 5LP6F 3MUOA 2OZLA 3AY0A 1F06A 4Y18A 4QHSA 2HXGA 4UOQA 5FA5A 1AMNA 1IEWA 3IYLW 4YXFA 2JD1A 1E0DA 2HTFA 3H0EA 3RC9A 1GGFA 5BO5A 4KNYA 2JFGA 4R81A 5L9AA 4KQ2A 1GGJA 3MB8A 1OYYA 2VZ0A 2IHUA 1JU3A 2X9LA 1Z63A 5DHQA 3NVDA 1NFQA 3Q0EA 1P2SA 3H0KA 4MR9A 2FETA 2HMTA 2WT4A 4KO4S 2QG4A 2RGNA 2X5OA 2RCNA 1ESEA 3GEDA 3MPOA 4US0R 3BFJA 1W76A 1A8QA 4A6PA 4AZ3A 4E7PA 3ZVKA 2JGDA 2DHDA 3BULA 3QUTA 2V3VA 3ENQA 4ZCRA 2R79A 1KQFA 2AJLI 4INJA 4OGGA 2OYCA 3VKHA 2X5JO 4XUGB 4M1YA 1T36B 4G0UA 4CM7A 1QG2A 2HH9A 2X8AA 2IYTA 4XASA 1N5DA 3EQ6A 1NVUQ 4EX7A 5EJ9A 5NLLA 1L7BA 4EJSB 5JXWA 4WZAB 3GLHA 2ZJZA 1QIDA 2DYKA 4O0MA 4NYIQ 1TU4A 2JJ2A 2CEKA 1W0KA 3DPIA 1EEXB 5L6LB 2ZPUA 4BY9E 4EZIA 3N75A 1NONA 3EIOA 1QHNA 4HXFB 1A4IA 4FZJA 3A3NA 2QXYA 3ZUGA 2VBGA 5K9ZA 2VYQA 2C5LA 4M8LA 4TUYF 4UM7A 3OURA 4QPJC 4JLAA 5CM8B 5K6RA 1WVMA 1R9NA 2AI3A 3Q8WA 5A4FS 4I8DA 2ORVA 1DPFA 3J80A 3FFBA 3L4JA 2WWGA 1RAAA 4URUR 2IH5A 3C4QA 5HQJA 5L3ZA 1V4NA 3TSAA 4IG9A 2YY5A 4O2AA 1W2WB 3O38A 1AV6A 3OE7A 3MQ4A 2QTAA 1RKVA 3FG9A 3I09A 1RPJA 4LCBA 4I9NA 2PR7A 4PGHA 3PFWO 1ZHFA 2E89A 4OPMA 1LTQA 1IZ9A 4O4LB 1Y7LA 2XIQA 4JI5B 2V9CA 3DLIA 1L5YA 2OPHA 3FVQA 3B9RA 4RD3A 4JYPA 4EHLA 1NXTA 1TCUA 1QKIA 1QZ3A 2D5CA 5L45A 3WHIA 2P27A 1CYDA 1Z0FA 3A2MA 1IY9A 4CLOB 9GPBA 2OEPA 3TR6A 4C20A 2I2BA 2R8XA 5IVIA 1KTIA 3W7BA 5CCBA 4Y98A 3CSSA 3R2JA 3RSCA 1LS1A 1E66A 4IRUB 3VSAA 1IBCA 3Q7EA 2EFYA 1TQ4A 5ENDA 1F12A 4J0FA 4OL0A 5F77A 5FKJA 2B1GA 5KI6A 4F2DA 3BIJA 2GCIA 3T1HB 4LF5B 4FOSA 2C31A 5H02A 4J9VA 4KQGA 2ZRQA 4DWJA 2YIJA 1ZM9A 2Q28A 1YRLA 2I6QA 5TQ0A 3D5TA 5AKKA 1IH8A 4PZYA 2RH5A 1JLHA 1OLUB 3CLRC 1GUAA 5LC1A 5HGXA 1E2BA 3PC6A 1AQ6A 3OM0A 1UPCA 5EJEA 3EQ8A 4ZO8A 1V7ZA 2PGLA 1W0JD 1J09A 1Q22A 3CR7A 3NC4A 2FWBA 1B74A 3I52A 3Q9UA 4NARA 4PLPA 4XRRA 1BDHA 4MKIA 1NVWQ 3TMKA 4HRYA 5K45A 2G06A 2B98A 4DR4B 1H4QA 5HG0A 3HN7A 4HTFA 3UXHA 3CKYA 5DIZA 4A27A 2QSJA 3TFQA 1G2QA 4GUAA 1C0PA 2AMJA 1AB5A 2XF2A 3PNMA 4YDSA 3AH8A 1AKRA 1VKOA 3KUUA 3TLBA 4D9JA 4ZOLA 5JV5A 1B93A 5TV2A 1YZQA 4U63A 2P2CA 3TL2A 1CY0A 1HFKA 2KW5A 3UG6A 3AM1A 5JJLA 1P9LA 5FI1B 1PYOA 3DE2X 5A6VA 4S05A 1W5FA 2I2CA 4NMHA 3AIMA 2CF5A 1WTAA 4HL6A 1T9DA 4QUEA 5DHTA 5CT6A 1M6EX 2L2QA 4L9SA 1L5NA 1V43A 4U2FA 2IPNA 1OI2A 2OBFA 4IVRA 1Z28A 4YRDA 2WWXA 2LTAA 4Q9JA 5AM0A 4PO1A 1KMMA 1COWA 1H0RA 1WF6A 1XCPA 5JZSA 1JALA 2VAXA 2Q49A 3RVSA 2QN3A 3E5RA 3T9CA 2L69A 3G2KA 4II3A 1VFPA 2VPPA 4HDNA 3SIXA 3NONA 1TZMA 2PPLA 3CV3A 1A9OA 2JAQA 5JWRA 1K3UB 4JEMA 4DGQA 1QONA 2PAAA 4M22A 3WXBA 4IDDA 1J6UA 2FQWA 1OTXA 3ZV5A 3BXPA 1C7RA 1QRTA 1H9AA 1OX4A 4Y0VA 1DOZA 1N5JA 1N5MA 2C2OA 1O95D 2O4CA 1DAGA 2OKGA 3FJOA 3ZE2B 1HEIA 3PHJA 3GRYA 1PZFA 1AUXA 1C3VA 4JLPA 3G13A 4DB4A 3F49S 1RR6A 5AHXA 5HQ3A 3DAOA 3BAFA 1NJ8A 1PSWA 1L5QA 5CVCA 1F7UA 1ADYA 2LDXA 3GLTA 5F9MA 1L4MA 3TECE 1DKPA 3BWBA 1VA4A 3W3AH 3WNZA 4F4JA 2DETA 1AKVA 1O7JA 4LG1A 3T7KA 1N36B 4N54A 1XZLA 3M6IA 4YJ3B 2DC1A 3BREA 3DZDA 1D2MA 3ZHBA 2ANBA 2JK1A 5TGZA 1KVUA 4BNXA 1CU1A 4KXNA 4NRDA 3WTBA 2JFPA 2XD9A 2CV2A 4WT7A 3F6RA 3EEFA 4RFLA 4TL8A 1CS0B 5JS8A 3FOFC 2A86A 1KY5A 2HSEA 5ESDA 5C37A 4HD8A 2HHJA 4ZGWA 3L0PA 4WZZA 4RA9B 1XTQA 2IJGX 2RGAA 1Y7PA 1D0VA 4IQ8A 4OY3A 1KYIA 3WZ2A 3WL6A 5AM5A 2J32A 3GRPA 1E7RA 4CIAA 1KKUA 5I8WA 1DMSA 2IT1A 3PRJA 4HYYA 1R9GA 4K1LA 4MINA 1JSXA 1CNMA 4AZWA 2I65A 2W2NA 3LPLA 2AE1A 3U3ZA 1YS7A 3NAGA 1GU0A 2GPYA 4ITUA 4Q39A 4RABA 1H65A 5K3SA 3RC1A 1POXA 2I9PA 4GKAA 2PV0A 1P2FA 2PX3A 3C5CA 4HZUA 1MC4A 2QN9A 3DMDA 1Z17A 4RETA 5B6PA 4MI6A 1MO3A 2F3QA 3O2QB 4U2KA 3NGXA 4CDGA 3MNFA 3ZWDA 1ZJ4A 3GJZA 1K9SA 4B3IA 4QPZA 4C78A 1LRJA 2CKMA 3DFFA 1H93A 3K96A 3BWDD 3QA3E 4ZO7A 5T4FA 2GK7A 2XOKA 2Z8YM 3GMIA 1PZMA 3QUSA 1LNSA 4JLUA 5DJ5A 3WGIA 1O5TA 2HL6A 2QVCA 4L73A 1NY5A 3QVOA 3LKVA 1Z22A 1EE9A 3HUFA 1GUFA 4NVRA 5A7FA 1JXAA 5AUOB 4LPSA 4DV0B 3ROXA 2UVQA 1NVVR 2YOFA 4NCNA 4TZTA 4PF1A 1ADCA 1N5KA 1P3Y1 3DW3X 3E2PA 3ODPA 1DZ3A 1CQPA 1J22A 1V45E 4D9KA 2EBFX 1PK8A 2P1DA 4WN9B 1N0WA 4L4YA 5HSGA 4NE7A 2WDZA 1XLUA 5K8CA 3ANNA 3I45A 1FL9A 3E9CA 1ZCAA 4X1YA 4XQGA 1N6HA 3WNQA 1S2IA 3CH4B 4LDZA 2XQVA 2JI4A 4GWKA 4DN6A 3DLHA 3A6HA 3G0BA 4MB2A 2E4XA 1E9EA 3OH8A 6ABPA 1EUQA 2E85A 3BK7A 3PGXA 4U3JB 3I9V6 2CVFA 2C03A 3RWMB 4YX9A 4FLFA 4XJXA 2G1UA 3AR3A 1BNCA 2CFOA 1H0KA 2QLLA 1FDSA 2M2IA 3I92A 4ND2A 5K4AA 5FV4A 3NORA 5CB8A 4ZCSA 3GI1A 1EGQA 1XJWA 2G8LA 3V1YA 2PANA 4MYCA 1SVOA 1W52X 2D2EA 2R1UA 5CBKA 3C4VA 1NRJB 4XGRA 4AO6A 2I3DA 2OQIA 2MMCA 2CVOA 4G5GA 4LQ4A 1RJDA 1E5QA 1G5PA 2JEYA 4RZHA 2VHXA 1NY6A 3HLYA 3T1NA 5I7VA 1J7JA 3WIOA 3NHAA 2KHZA 4YIKA 1GIAA 2SKDA 4JP2A 1EBBA 4PXAA 4NL4H 2TYSB 5BQ3A 1N5RA 1S1CA 3W2HA 5EG5A 4B6RA 1T9AA 4CNQA 2DR2A 4PAWA 1YACA 3ZK9A 1T6NA 4XDZA 3K2IA 2X58A 2VWQA 4DMCA 2A5YB 3OLYA 4NCXA 1T6BY 2O7NA 1GPKA 1SQGA 1L5KA 4AJIA 4MJLA 1JDPA 1U04A 2IDZA 3H2IA 3IC5A 3QW2A 5EIAA 2J31A 4D7AA 4DJFC 4EENA 1NKSA 3PFGA 4F8JA 3R8FA 4ZI7B 2YICA 3O3NB 4RNCA 5LUBA 3SDSA 1EUZA 5EJ8A 3V34A 4JQSA 4V1CB 1I7SB 5CLHA 4BP9A 4GFDA 1IMJA 3L7YA 4BVLA 2GBCA 2QD3A 3GP5A 3IIMA 3HU5A 4GI2A 4KI0A 5IBPA 3JQ8B 4OF4A 3UJ3X 2FKAA 1PT9A 2Q50A 6NULA 1KWKA 4WKGA 2A0UA 5I48A 2QL7A 3TLXA 4OKNA 4ZVVA 4RPJA 4D4LA 3K2QA 3ABSB 3SICE 2YWHA 1G5RA 2XBLA 2AJDA 3A31A 3EJ6A 3N8DA 3PG5A 3ROTA 4UTPA 2CLSA 2RIRA 3FMOB 3FWPA 4OU5A 3WIVA 4E46A 1PX2A 2G83A 3U4HA 1A7JA 3ACBA 3H5VA 1T1GA 4Y2SA 2WM3A 3OM8A 1IM2A 5E1OA 3ZNPA 1C8VB 2JKVA 3IAXA 1D3AA 3IURA 2Z0MA 3LUJA 2J9FB 1HFJA 1IFXA 1Q1QA 2QVLA 1ULBA 3OZDA 4V2UA 1MF7A 3QJYA 1JMVA 3T9FA 4RTJA 3HA5A 3QLJA 2VUHB 3IAM6 4X24A 3ZV6A 4KZKA 5DMHA 1CWUA 1VLLA 3DC2A 3EPKA 3NB0A 4C29A 2PCJA 2ZJFA 4CT0A 1E4VA 2FFBA 5L7TA 1F1JA 3BTSA 3JZMA 4L6IA 1UOPA 2BHRA 4OSPA 1SO8A 3A14A 5KYUA 1BD4A 2DTEA 4P83A 2Z9DA 4M6WB 5AJVB 5DEOA 4KYUA 4G4IA 2QX6A 4MVXA 3SJBA 4YWHA 3UAYA 4BO5A 1GRQA 4ON9A 5DVZA 2GEJA 4YN3A 4D92A 1DZIA 2OR3A 4AS3A 1VRWA 4C7XA 1JN0A 4H1HA 2TRSB 5KHOC 1U3WA 2A9FA 3GCWA 1X0VA 3EVAA 3FF1A 2OBYA 1L7AA 3WWZA 2ZVPX 1NJFA 1T15A 1WSAA 1WHTA 1W73A 2NXEA 3EXHB 4CCYB 4F84A 4WK2B 4X65B 4DUZB 3OX1A 9ABPA 2QJTA 4RORA 2ZLBA 1QO9A 1H42A 1MO2A 3CMCO 2I7XA 5BURA 4R2WA 1H6BA 2L18A 3VBEA 3MAAC 3GEPA 3MTEA 4ENVA 4C3ZA 2WAOA 1LX6A 4GHWA 1NF3A 3W3AD 3ZI7A 3KQNA 3IL2A 3OO0A 3GJXC 3NH6A 4GMXA 3B6JA 1WG8A 3IEUA 3G2PA 1JPUA 5ALFA 4AF8A 1V39A 5DW3A 2Z4TA 3UICA 3KPYA 1F5NA 2PH5A 4PBSA 2FPLA 3I39X 5IJXA 3A2LA 1KIFA 2PZMA 1ILEA 1K6JA 2IKQA 3ORFA 2FP4B 4WJZA 4OBXA 3RVLA 3IODA 2XE4A 1HT1E 3AW9A 2FOIA 4R6WA 3QLVC 1Z56C 3LCVB 1Q74A 1IN4A 3FFXA 4LZLA 3DZ8A 4DKJA 1XDSA 5L3SB 4GKKB 5I7FA 1SHJA 3HL4A 4FCTA 4KWTA 1C41A 1QTRA 2CE7A 3E2IA 1TKBA 1SVUA 2Y77A 4X41A 1GFIA 2ZIEA 3BHIA 2OHJA 3O93A 3VTAA 2IW3A 2HU2A 1DIOB 1Q14A 2BE7A 4FN5A 3V33A 1TGVA 2D5IA 3V4ZA 3DG9A 1YI1A 4G1FA 5TGDA 3O21A 5KTRA 4EHNA 1U0NA 4TL9A 4YRGA 4BWGA 1GEGA 1FTWA 5EJGA 1EA5A 3WLRA 2HA0A 2D1RA 3PNQA 2B21A 1NULA 5IAAA 4M9UA 3QKSB 4BMXA 3JD0A 1E58A 1QQ6A 2O2IA 3B5EA 3DR5A 4CPDA 1ZISA 4ZAFA 4AQDA 2A4MA 2ON6A 1TAHA 1YRQA 1FP1D 2DPHA 1NQOA 1YVEI 4MHTA 1LRLA 3JAWB 2RGCA 2J3JA 5FHRA 3DB1A 5AUNB 3R0VA 2W6IA 4D4KA 1QIMA 2AD5A 4MCAA 2IIPA 1RBYA 2GZ3A 3DZHA 2WWRA 4MWBA 4A8JA 1ORVA 2VJKA 5CB4F 5GJCA 1MUUA 3VU3A 1SUEA 2DZDA 3NTRA 4EBFA 4J1TC 1X7ZB 1MABA 3M5CA 1F60A 2QJRA 1OH5A 1E3LA 1YJAA 4A2CA 4HS4A 3E8XA 2XJ9A 1HWYA 3Q9SA 3T3HA 3U44B 3RYHA 4J7AA 1EP9A 4QFCA 2YRFA 1TOAA 1FQKA 4QGHA 1JHQA 3M8KA 3D81A 3KTOA 3QFHA 4G9BA 3RFVA 1E2DA 3B9BA 4L8YA 3OCUA 4V02A 3L8DA 3CINA 1QRRA 1SCBA 4LC0A 2H5IA 3L7CA 2GHQA 4RJTA 1OI3A 3BTVA 4HSEA 3S99A 3KOZA 1KFJB 2PLRA 3QVXA 4Q12A 3I5YA 2PX6A 2VTKA 3BRWD 4CUKA 1WZ2A 5IK2A 1N6RA 2VYCA 1KU0A 1VMEA 3RODA 2Z2JA 5MN6A 4N8EA 3RLFA 1YVPA 4JGIA 3S5UA 4KO2S 1EGAA 1ZS9A 2KSQA 3K5WA 2DOKA 3QVSA 4PRZA 5AR1A 3WA6A 2EKBA 4M46A 3RFXA 1GWNA 1R7RA 3T35A 4LYGA 3U7FB 4MQ4A 5IKOA 3LFUA 3R5FA 1CZNA 2FN8A 3MS2A 4IILA 3BQ9A 1EX7A 1SCQA 1F2TB 3KOUA 4IDAA 4QU8A 3HY3A 4EO7A 2B9EA 1ZWKA 1EWVA 1XZDA 1YU6A 2EBHX 3K1ZA 3QJ5A 4KVFA 2Q1YA 4MS4B 4P4GA 1RM5A 5ANRB 3UOGA 4CF7A 1JHXA 1Q92A 2Q7XA 4K6FA 2QY9A 2X4GA 3GD5A 4G0WA 3PJDA 1DTWB 3SKYA 2PVSA 5CFRA 4V0OA 3L4BA 2O6LA 3TZCA 2DWUA 3KYCB 1GG5A 3HNPA 4KIGA 3WIEA 2W6JA 1EX9A 3I5UA 2PGIA 4MKXA 1XCLA 2AXNA 4FGUA 3D1VA 2C9ZA 2GYUA 4FEYA 2I2XB 3I2GA 4DY6A 4JY7A 4IDQA 1YCDA 2GN8A 2WMNB 2XY4A 4BO3A 5C80A 4KMRA 1HY3A 2H8KA 3BL6A 5AHRA 3RRNA 3FOCA 1RHRA 4QDOA 1Z8HA 4QYIA 3U56A 2W2LD 4L9WA 3A6EA 4G5YA 4DLLA 5DYTA 4ZJZA 2AN3A 5FUVA 4PX3A 2IH4A 2PIAA 4CLHA 2BJVA 4UCXA 3VPGA 1UC5B 3IJRA 4LX0A 4TMXA 3EFOA 4YRFA 5AVWA 5EIBC 1G8GA 4B6SA 4HRXA 1L7EA 4POAA 4RM3A 5I9NA 3LVRE 3GOQA 3CUWA 1UKEA 4TS1A 2WJIA 4HDRB 1KYYA 4WGFA 2X7JA 4EO9A 4F06A 3VYRB 1S5PA 4F3NA 3AF4A 2PLAA 5AP9A 4Q4CA 1RXWA 4HVLA 1J2RA 3GRAA 3FUTA 3CPHA 3L8FA 3OFND 3NHLA 1QF9A 1HLPA 4YJGA 4EARA 4MYUA 1RAGA 1IJBA 3EH1A 4K3VA 4EUSA 2OSVA 1E1CA 5AQ1A 1ADFA 4XOIA 2XMDA 1V41E 4YTEA 4DLXA 1ZD2P 2CLIB 1I6WA 1Y3HA 1SZPA 1ZBQA 1GPUA 1DEKA 5EPEA 3ER6A 2VFAA 2A88A 4KV7A 3UW3A 5JZ9A 1OPRA 1AGXA 4RVCA 3AZPA 1LUAA 2FGKA 2DCUA 3GUCA 3KB8A 3U80A 3ZJ4A 1TUBA 5DHAA 3B6MA 2XNDD 3T41A 3NHSA 4DQXA 2AFIE 5B1DA 5KWVA 2YQ5A 1GZ5A 1NJSA 1YS6A 4E07A 4P81A 5CFQA 1YJQA 2A78A 4HB4A 3IIEA 2CLFB 4LRUA 3WNVA 3U39A 4LVOA 4Z3OA 1RZRD 1WBBA 2FW1A 5CCDA 5JJ5A 3AVOA 2I5PO 2EXXA 2JVIA 2SECE 3LGXA 3MYYA 3HB0A 3DL4A 2AMVA 2HDWA 3ESAA 3VU1A 3FPHA 3LIPA 4FYWA 5KDDA 5F2EA 3EGXA 2WJ3A 1O1YA 4GP7A 3KV1A 2QY6A 3BSFA 4PHTA 5DIFA 3UGKA 2VJDA 4Q34A 1M6NA 4ENUA 4MDEA 4UBOA 3PK0A 1SCNE 3WV4A 7ABPA 5JY6A 1ELOA 5AMXA 3HPQA 1C7ZA 3U9TA 5FWYA 1HETA 2XQFA 1FNDA 3EA5A 2Q1TA 3ZVMA 2IV2X 3L6OO 2Q0XA 2QTVB 4JA0A 1G8PA 1Y8ZA 4PPGA 3HJGA 4V0ME 5I9BA 1A04A 3BD7A 3PUHA 2IYLD 3IDQA 3RAJA 4AN0A 2AMLA 3FNFA 4GLFA 4HB0A 1P5ZB 3JWEA 2IGBA 2BKAA 3EUFA 1I0ZA 2G0TA 2XNHA 3UCEA 3VU8A 2G9UA 3JASB 2D4AA 3CXUA 3B7WA 4GNKA 3SY8A 1BYUA 3MGBA 4MDHA 5JC8A 5K3FA 2CWDA 2ZXFA 2P9ZA 4PLYA 2ASVA 1DG1G 2R8BA 3ADPA 2QTZA 3NPMA 4W5RA 1B00A 4F6RB 1PDOA 1OPXA 4JSYA 2WHPB 2YJGA 5EL0A 5FOXA 1CK4A 3LT5A 4IDBA 1M2FA 1WPRA 3Q87B 3FLBA 1UMCA 1DBIA 1RJEA 4KFRA 1CVLA 4Q6BA 3W6UA 1Z07A 3DXZA 4BMDA 1KAHA 1RBQA 3MJCA 2O2EA 5JASA 1MAVA 3E9ZA 3PUVA 4X84A 5HJ2A 3WRWA 1W1UA 3QMWA 4W7HA 3ETGA 3REQA 2PSJA 1Y80A 4DPMA 3PI6A 4EY5A 3OE1A 5L7YA 3PR3A 4RQUA 5MF6A 4BZZA 1YRWA 1N25A 5ESRA 4RWEA 1BCRB 1ZINA 3FN4A 2WEKA 3CG4A 2XUQA 3CW8X 3SZMA 1GSAA 4E1VA 4OLAA 3DFUA 1OWMA 2DFNA 2HCJB 2OBXA 1H4VB 1FMFA 4N03A 2Q5EA 1VHJA 1RLUA 1WBDA 4DM3A 2YJTD 2P4EA 2RBKA 3A2NA 3FCXA 1YJBA 4LUCA 2ADOA 2AWNA 4LZPA 3U7QA 5DBHX 2XB4A 3LUDA 4PZEA 4WN3A 3DV9A 3SF8A 3DTVB 1Z16A 1SUWA 2EVWX 4N82A 1QMPA 3TQTA 3CRNA 4BBJA 2QUJA 1NMZA 3BH7A 4D3FA 2IYYA 2ID4A 2D0IA 2FYTA 2IYUA 3I0ZA 4EQ6B 3PEVA 4UNRA 5J23A 3D7SA 1G4AE 4CZ2A 1WZUA 3V6LA 3RJZA 1F5SA 2XBMA 2WD8A 1NR1A 2XHZA 3KLMX 4ZALA 1FBTA 1XTRA 3B1YA 1M2JA 2GTIA 1MG0A 3EB9A 2HK9A 4WNCA 4M4SA 4GI7A 1LTKA 4WXYB 2JFBA 1GQYA 3K16A 5DGXA 5ALQA 1WB9A 3EE6A 2VTDA 3KSBC 3HS3A 1B15A 1ISJA 1S2GA 2JC3A 1J06A 1GZDA 1P2DA 2O7SA 2I4MA 2OAGA 2IELA 3KOMA 3ORRA 4QFBA 2C2WA 2OPBA 3ZWAA 2GDJA 4KLCA 3V2IA 3LLCA 2P78A 3P8ZA 3AEQA 4FFVA 3FVTA 2J3IA 3RVRA 3KRTA 4MR8A 1OSNA 4HO1X 4Y9SA 1FFCA 3DBLB 2YWJA 5CT4A 3QVUA 1R0CA 3VNBA 2VRCA 5LKAA 3SQXA 4NEGA 1EHIA 2P3SA 3KLNA 4KIWA 4MEJA 2BL4A 2IRWA 4ARVA 3A9CA 3MBKA 2AUMA 1JQ3A 1YDMA 1MT3A 2BEVA 3KQMA 3O4IA 3VNQA 2WJYA 2XXJA 5LSAA 1XP8A 2O8EA 1M2KA 1FTYA 2ZT8A 3ZHVA 1DJNA 1EVJA 1R6TA 1B8PA 1T4CA 3SQOA 4ZJUA 3JQ6A 1NLZA 1GPBA 2F43B 3LTEA 4JT8A 1ORIA 4I3HA 4XX0A 3HGMA 1BWQA 4O8ZA 1M1YE 3QVGA 1UFKA 4P86A 1RYEA 2OLKA 3HXKA 3D3JA 3HPRA 5AQEA 4KR3A 2BC9A 4XVQA 4G6ZA 2LIVA 4CKZA 3OA0A 3TTUA 2EZ8A 3I76A 3P9KA 1XZMA 2O1EA 4IHJB 1AGYA 1KYQA 2QRVB 4CYMA 4ZEVA 2QS9A 4UDNA 5JWOA 2FPMA 3ABIA 4S3MA 1SD5A 2GDZA 2JK0A 1ECFA 4B6OA 1A9PA 4MS1B 2CXTA 2XH8A 4CL3A 1QTIA 1N6KA 1E94E 3IUSA 3JZFA 3N53A 3QKIA 4PC1A 5LZ5A 2NU8B 4C4ZA 1LB1B 1H2BA 1A5TA 1RXSA 2MWMA 2D3WA 4KJXA 4MA4A 1CUCA 3C7CB 3NVAA 3WWDA 2RBGA 3K1TA 5ALZA 3ZHUA 3GLIE 2QMHA 4CM6A 5C31A 3JYNA 4CXMA 3HDHA 1WUYA 3IAHA 3L1UA 3FPSA 3EGDB 4HAIA 4PLGA 2WAXA 4CV0A 4F8EA 3UAZA 5KC8A 2J3MA 2BYTA 4FKZA 5HKKD 2VJBA 4HWTA 3SD7A 4ESEA 4MP6A 1R0BA 4DIOA 3CQ9A 3IUBA 5EJ5A 1IY0A 3PEWA 4P4UA 3H2BA 3FOZA 1N1DA 1PZHA 2O8BB 1V6SA 4P53A 3T0FA 4E03A 1T3SA 2ZDQA 1RKXA 5FCDA 3ZIUA 5KTPA 1T2UA 1E9BA 1IE3A 2BF7A 1YOVA 3AHDA 3OBBA 5SYMA 3R7WA 1P9OA 2ECFA 3E1GA 4W1SA 1WPGA 3KEGA 3T5TA 2REQB 4DLUA 3MT8A 3IJEB 1MORA 1RLMA 1XCMA 1ZM3A 3ABRB 1VLJA 3EZ6A 1O97D 1L7PA 4DMMA 5L4SA 3EJWA 3PZBA 4PPNA 4H15A 1LPBB 2PT5A 1LQ2A 1W0CA 4BXOA 1RNLA 1YR1A 4B3HA 3F4KA 1WUTA 4ITRC 1DFHA 1EE2A 3GVPA 3AR6A 1FFBA 2VN8A 4B9AA 2C8VA 4RC9A 4PY2A 2G76A 3BDAA 3C3CA 1C1HA 1MX3A 4XWGA 1VLQA 1XALA 2WJWA 3SIPA 3B52X 4NAHA 4RF2A 5JAUA 1STOA 4ZFNA 5JROA 3OMLA 1QHHA 1QBKC 1UADA 3DULA 3EZYA 3HYNA 2VZ8A 4Q4HB 2KLBA 3BZWA 1R4MA 5JSQA 1Y63A 5HIMA 4RHCA 3RTAA 3TG8A 3PA8A 4B4VA 1B6SA 1ZUWA 2OCAA 2LKDA 4RKFA 4O6VA 3N1UA 3T7CA 2AZMA 4JC5A 1YZGA 2WQZA 1E0AA 2L0XA 3MILA 2O2XA 3WWCA 4K40A 4UPEA 2BFWA 2IHKA 4X9XA 1I30A 1Z6GA 3HNOA 1TLTA 5HQTA 3RAFC 1JHMA 1A9TA 2VDNB 2X41A 3W4KA 1ONOA 1J1IA 3KUDA 3X1WA 2HIMA 1TMOA 3JD2A 4FUTA 1XAGA 3OZTA 2JFVA 3R5TA 1ZGBA 1GAXA 4X7MA 1RU3A 2WHYA 2BEKA 1EP2B 3GZTB 4BKMA 2GRUA 1CNFA 2IS1A 1NA5A 2IODA 2J67A 2Z1DA 4WXPA 3K9WA 3IIKA 1ZIPA 4D26A 1D0SA 1SY7A 1ZSYA 4P36A 4EL0A 3T4UA 3OQJA 3V1TC 2E5WA 2ZUTA 1E4OA 1P4JA 1HMPA 3QBJA 4QD3A 3TLYA 4CN8A 5JVDA 4GE0A 5DM0A 5JH7A 1A2QA 1L5HA 3TB6A 1XK6A 2A33A 2WKQA 4E88A 4MQEB 1GCAA 3UJ8A 3VO9A 4CF3A 5JHGB 1U1GA 1CVIA 4DDTA 2I1QA 5JJKA 1CDOA 2VH1A 4KN8A 3RS8A 1FDWA 1M2GA 4JMPA 4RKWA 1Y8CA 4ZTBA 4E5DA 4ERXA 4CEIB 3F47A 1R5BA 4YMLA 3OTOB 1K66A 5I9MA 4CLEA 4CGZA 4P0TA 1A5SB 3SHVA 4OGWA 4RH3A 4H9GA 2DSNA 1CT9A 2R6CA 5KNLA 2YWRA 2C9YA 4GC9A 4KVGA 3JWHA 2FKNA 1D5WA 3UB2A 4B5LA 4EMBA 3D3WA 4EZBA 1Y1KE 2OK8A 1MD9A 2HCFA 4IKOA 5DYGA 1PFGA 3GCDA 1PR5A 4GO1A 4Q48A 5F2KA 5BNIA 3KQUA 3FNBA 2VHJA 2HLHA 3K6JA 2GSWA 1WXIA 2Q6IA 3GAMA 4IV5A 1DC6A 4N6NA 1BMTA 1U81A 3P0HA 3SI7A 3VPFA 1W96A 4UVHA 1FSFA 4TYMA 1NE7A 2ZVDA 4PGMA 5CDUA 3KDSE 2H1HA 1I94B 4Z2YA 4WNYA 4WXEA 2EW2A 5B2FA 4K9SA 2NU9A 5D5HA 4E5NA 1KMNA 4J1TA 4HDCA 4LXTA 5K3CA 4KPYA 2QRHA 1FFHA 2QQ5A 2X2OA 4AW9A 1NFRA 4XX1A 3BCSA 1ZM4A 3Q6IA 4FNOA 2OFWA 1SEVA 1PO7A 4PS1A 5T8KA 1DRJA 4EG7A 4JIGA 2BGJA 1V9LA 2R60A 2ZSAA 1D1SA 2C0QA 2R4UA 1Z5PA 4PNZA 2V6IA 4KXFB 3RPEA 1DL5A 3EZ9A 3EG9A 3GELA 4BX8A 4KR7A 3L79A 1KI9A 3DCIA 1GILA 4EFNA 3WGHA 1APBA 3TQQA 2WWYA 2IYEA 3EARA 1XFDA 2F1JA 2NUTB 2PU5A 4WY8A 5CXSA 2YCLA 5G02A 3V4OA 3ZI4A 5AOAA 2XT9A 3KPWA 2B3TA 4BLVA 5GOTA 2H85A 5EGNA 4LVCA 1X1RA 4QXQA 3AUKA 2AHOA 2NZUG 3H1TA 3TVTA 3AETA 1GITA 1PR0A 3N0TA 3OEYA 2WFMA 3ETEA 5LWHA 2PRYA 1KO1A 1QWOA 1BKSB 3FX2A 4U2GA 2DY1A 3VNSA 4CMHA 1CFJA 1V8ZA 1FFWA 2GQ0A 1XU7A 1VKRA 3HCRA 4HDKB 3N2GB 4LISA 4M8SA 3K15A 4BGEA 4IFBA 5ARCA 5A3RA 1RXIA 3G59A 3QHAA 4AJNA 2ZIUB 2BZGA 4CG0A 5MHTA 1NW6A 1G5IA 4J8PA 2IITA 3ED1A 4ES6A 1SPXA 2G04A 1SN7A 2G80A 4IM7A 5BN5B 2V7GA 1A95A 1LC0A 4G89A 1RI5A 2GJ8A 4B43A 2WJAA 2CHEA 2JHCA 2OP0A 3E05A 3GW8A 4R1UA 2PTHA 3RU7A 3SVZA 4YJ2A 3UMRA 2K7ZA 2BGUA 4XSVA 1MN6A 4KXQA 5JNTA 1VPDA 4RK6A 5KKCA 1HL7A 1PJRA 4B71A 2IBSA 4F9TA 5A1JA 3E2MA 3P26A 5IYZF 1PT5A 2Q0SA 2VDJA 3HJHA 2CVHA 3LLVA 4KLZA 1DAIA 1VPWA 3L7MA 2XZOA 4HQOA 4NAVA 4Y2QA 5TPWB 4BZXA 4D9EA 5KSOA 2XGMA 2YMPA 1WY5A 4QULA 1DKRA 2E5FA 3RLIA 1E8NA 3OSUA 4YRRA 1KYXA 1D6JA 1AUVA 3AXTA 5HCUA 3TIFA 4XEUA 4CJXA 1KOFA 2D0OB 3VA7A 1CJMA 3H8SA 3AIKA 3PFKA 1RQGA 2GFHA 4BVGA 3JSAA 3AR8A 1D2CA 2DFKB 3S1LA 5FPKA 2QU7A 2X8WA 1TYBE 3E5NA 4J75A 1MW9X 1RDFA 1F4LA 4YRTA 1E2UA 2F2TA 4JI8B 1RLJA 3L6RA 5EFZA 1TQHA 3UK6A 5C35A 2BVNA 4ZC1A 4D99A 2QTFA 4F38A 4WI1A 2W6OA 2RGDA 2P9TA 4MLDA 4I4TA 2FW0A 1PJZA 1H05A 4C7OB 1PFUA 2HA7A 1GP2A 1RXYA 3EMVA 1QK3A 4QEKA 3VPDA 3A1WA 4QWMA 1CUIA 3K05A 4I50A 5FTLA 3OPYA 4WEOA 2OYRA 2HZBA 3HYRA 2JHAA 1N5LA 3KZNA 1FXSA 1L8AA 1Y7TA 5F5LA 3OOJA 3TSYA 2RGBA 5DHRA 2TMDA 4EAQA 1RKBA 2REOA 4WOBA 5H0IA 1QJCA 3AR5A 4LS3A 4UM8B 1B23P 2JKYA 2FGJA 2O3UA 4R8SA 4ZARA 4U2BA 4ZEOA 1T9KA 1CUVA 5F12A 5FR1A 4P92A 3RSHA 1EKXA 1ZOIA 2C92A 2JIPA 4DCTA 3LLUA 2OUKA 4FDUA 1U2ZA 3UT0A 2GO7A 1HQKA 4P22A 3R9WA 1WDWB 1YB7A 2JIQA 3FFWA 5AKJA 4DJEC 3A7EA 3X2EA 4BEVA 5ILOA 4B8WA 3ANSA 3TPFA 4LCJA 2D5LA 1K8YB 1Z68A 1PHPA 3M6VA 4D6PA 4ZAYA 3H05A 4R9UC 2Q0HA 1GA4A 5EJIA 4Z54A 1N2JA 1UXOA 3LHFA 3HLTA 2ZATA 4FOLA 2ZKIA 3GUVA 1R0ZA 3AEKB 4UD6A 2CN1A 4FR5A 1ZNWA 1FYDA 1GTL1 2M6SA 5C18A 5KQMA 1BE1A 4XJTA 1VL5A 4WOJA 2QJFA 4R2XA 4HDMA 3GJQA 3IOYA 1X94A 3P2MA 2X4LA 1VCOA 4MLZA 1M7BA 1V5IA 4UOEA 1GAEO 2OFFA 2NTJA 3K09A 4F1KA 5BOSA 4E51A 6REQA 4NCBA 3VZCA 1XTUA 2SCUB 3HABA 3F8WA 4N01A 4PU0A 3O7WA 1PZEA 3A1FA 3LP6A 4IZIA 4ZYWA 3QU4A 3N76A 3GJ0A 4HNGA 3L8EA 1XHEA 3WBJA 4FMDF 4C4TA 3BPSA 3CFYA 4DLTA 1QP4A 1AC5A 2ZVQX 3RF7A 3VR4D 3AY6A 4RCVA 5BW5A 5FAKA 3QYFA 4GLOA 2R65A 4G0ZA 3NKFA 3B6KA 2BEUA 3EXFA 3EC1A 1NE2A 5CVUA 3HBJA 3QPVA 4C0WA 2PKCA 1F2UA 1MIOA 2HEGA 4IUBS 3TLGB 4E08A 3FFAA 3O91A 4EYOA 5A1TA 2FSUA 1ZIYA 2V6FA 1PV2A 4NFHA 1C7FA 1RBMA 1VG0B 4QICA 4FHDA 5JBIA 1QOQB 2G7MC 4HX5A 4MKHA 1KJIA 2CSUA 2D8MA 1V16B 3OQ6A 4OH7A 4QGAA 3QNUA 3EQZA 3Q11A 5DCLA 4ZIRA 3D0KA 2P1RA 4R9VA 1VPEA 5K1ZA 1U3VA 2YFKA 1G55A 1DTEA 4RTPA 4EHDA 3IP8A 2JGJA 3MWYW 2J45A 4UD2A 3L1HA 1HDEA 2J4DA 2BGRA 1U9ZA 2G5PA 2QTMA 3NETA 3R0ZA 4YALA 3UAWA 4NJMA 4DDVA 2GM4A 1Y6JA 3I34X 1ZH6A 2C5FA 1T9ZA 3FFTA 1ZK1A 2C96A 3OQIA 1FA9A 1WUJS 4OKSA 3TSWA 4J6FA 1BHSA 1TQ8A 3NHJA 4RVDA 4N7MA 2DLNA 1OAOC 3PNVA 2VSYA 4XUEA 3DDCA 4UFOA 4KRFA 4GQBA 4LN1A 4MLCA 3D7KA 1RWBA 3SDBA 4ISCA 1T6YA 3AW8A 3ZCVA 1E1YA 3P27A 1RCFA 2W4IA 4UUMA 4GSLA 4UASA 2DWPA 2PS3A 3GNSA 4XJSA 3RRBA 3STWA 1JA9A 4M89A 2VDWB 1W35A 4JLDA 1JYSA 3WKDA 3KCNA 4RKRA 2VXCA 5GGXA 1R4AA 2HU8A 1SVKA 2YFYA 2D00A 2JF0A 3H8WA 3JD3A 2BBTA 2ZRNA 3HVJA 3DONA 1N6PA 3MCAA 4NDZA 1UBLS 4Q1CA 4UHFA 4A6DA 4BMZA 1Y3CE 1XXHA 3LDFA 3N8NA 1TZBA 1GCGA 3JYOA 1Z62A 1UR5A 3LGSA 4OMCA 1KI4A 1Q2UA 2QXUA 3GJRA 3WADA 1WD5A 1J23A 1ETHA 1U0BB 4Y67A 1KAEA 2ZQ5A 2DJ5A 1ESZA 3I53A 4D81A 2G1AA 4M49A 4AMZA 2B94A 5IKMA 4AJHA 4G01B 1ZD1A 1K2WA 1TZJA 2HF2A 4Q66C 1XZGA 3FROA 3KQVA 1XC7A 4IDFA 3GPBA 1SCUB 3LCUA 1GPNA 1Z47A 4K46A 2C3MA 1VPVA 2LE0A 3G82C 1Z37A 2XQGA 3U44A 3B3AA 2R751 1JDTA 2ONZA 1EA7A 4K03A 2OV8A 4NZNA 1JDSA 5CW2A 1LWOA 3JVIA 4R0MA 4CKEA 4HX2A 2IHNA 2P1ZA 1V48A 3G8AA 1GL7A 3GC6A 3LAWA 1CV2A 4HJXA 2AX3A 4MJ3A 3Q3CA 2PUGA 1YL5A 4P54A 4OQYA 4UCFA 1JG4A 2OLEA 3QENA 3AUYA 2I0FA 4FQ8A 4O4HA 5JCZA 2I2AA 3FCCA 3RB8A 1A88A 2FSIA 4NOLA 1U9JA 5TMPA 3LBIA 4OHKA 3WK4A 1YJXA 1J9ZA 3GWGA 1UEXC 4AB1A 4K05A 5HRAA 4DSZA 3BSYA 1AB6A 4FFPA 1KMCA 1H3FA 2GMWA 3FOEC 4P4LA 2IF0A 2XAAA 4JVNA 3V8VA 4CI9A 4ZDJA 4RL6A 3HVRA 1OI4A 4J0EA 3RS7A 4L4SA 4LCEA 1H66A 2I33A 1W88A 2FPSA 4KODA 4TRNA 1IOZA 5D2CA 5FLEX 2DFTA 3RYIA 1Z8NA 1ZRSA 1BX0A 2NO4A 4D1YA 1V47A 2MTBA 2WAMA 1WLYA 4QODA 2R7KA 5LLSA 2JFOA 1QORA 2XB6A 2VNAA 4TGLA 4XPIB 2RKOA 2X0KA 4FZ5A 4BFUA 4DTIA 2JLZA 3GBVA 3D8SA 2EJUA 3ICVA 3TLEA 2OXRA 4NATA 4GVPA 3W6NA 2CK3A 2ZI5A 3ZIDA 1AHPA 1AT1A 2F55A 1C3OB 3H99A 3UCXA 1EFAA 3FB4A 1AGNA 2BHTA 5EY5B 1XV5A 3N05A 4FIZA 3IESA 1OZAA 5SZJA 4W7SA 3ZY3A 2TS1A 4EPWA 4Z4EA 3ZHCA 1GQ2A 1FRZA 2Q1XA 5HKAA 3NKLA 1QFYA 3LKBA 5B1YA 3PC8A 3IAAA 4PBTA 1PG5A 1QH1A 3TB4A 3H5NA 3GPLA 1QHGA 1QDLB 1ZCFA 3IT2A 1GPH1 2NV2B 4ZO4A 3GV0A 5AJUA 3FTFA 2ZT5A 1DLJA 3AONB 3UH0A 2SKEA 2O20A 1P7YA 1YF3A 1VE3A 5ALOA 3ICOA 4CF6A 2BUAA 4XR9A 5EGSA 3EOAI 1N78A 1K86A 1SC9A 1ZKDA 2IEAA 4EYGA 5I4BA 5JSYA 4H6WA 3THWA 4QQ8A 6AT1A 1MJGM 3COPA 4BFWA 1P7WA 2O7RA 5FUMA 2C4NA 2R68A 1TF5A 4PO3X 4MW0A 3EQ2A 1P5RA 4L6AA 2OCGA 2UUCB 3C41J 3W9YA 4FFBA 3BIOA 4LWZA 2HUPA 2OGTA 2VG8A 3ZE1B 3UMJA 5I01A 4C30A 1QFXA 3JQAA 2IEYA 3SPXA 3VKVA 2PU7A 3IKTA 4YRKA 1FP2A 2R2AA 4F04A 2ZB3A 4FGWA 3UXMA 5IF9A 1CJBA 3R0IA 2WZCA 1N7GA 1ECGA 1DHTA 4FD3A 3D8HA 3T5PA 3UWDA 1RBZA 4L0MA 3SYLA 5COQA 5JMTA 2UYGA 2X9NA 1ISSA 2C3YA 1W36D 2NZYA 3OCJA 3DEIA 3G0GA 3EIWA 4IUYA 1DUSA 2PUWA 3AJDA 4IL5A 1C8KA 3P96A 5B37A 1POWA 1OV6A 1K5GA 4J0QA 1DKUA 1EG2A 1J39A 2NU6B 3WK5A 5IT0A 2GETA 1U5AA 2QM3A 2FUNB 3OM9A 3LF2A 2JLVA 3GMTA 5A4KA 2NSJA 2ZYVX 3F6PA 4I36A 2PXAA 4CGYA 4F2WA 3EYWA 3U60B 3FWNA 1TIBA 3IO5A 4LOJA 5JSZA 3BF7A 4YO8A 2X2PA 3GDWA 5IFKA 5IKPA 1JIVA 1KERA 1X8LA 2R2GA 2B69A 1NBMA 2Q5CA 1GKKA 1J2EA 4PG7A 3SYNA 1BEUB 4MUBA 3IXMA 2AR7A 3M82A 2BDEA 4E2ZA 1QYVA 2QW1A 2FV8A 5JECA 2BGNA 3A6DA 4PXSA 3BN3A 2H59A 3HWWA 4M38A 2YZNA 2YV4A 4QOJA 4C08A 2CXUA 4AXXA 2WYVA 4NCJA 1QH9A 1W93A 4U1RA 4XFJA 4F85A 3L0DA 1TD1A 5CX1A 5ERYA 5EMJA 2ZP1A 3LY8A 4PAGA 3GX1A 3DBHA 3M33A 3THSA 1NMXA 2ZJ3A 3U3MA 2FSPA 2JDID 3D6JA 5E9JA 1E1MA 4TMFA 5ALIA 3LRTA 1UDAA 2HJRA 3FCUB 2D4HA 1XDUA 3KTFA 1OX5A 3MTAA 1Q0TA 1MV8A 2NZWA 4OUDB 4XM2A 2GCOA 5BP7A 4KK4A 1HUQA 2NZ8A 2BZ1A 2NXCA 3VNVA 1U0GA 3L0ZA 1S4MA 2R11A 2P2YA 3BGOS 3DTTA 5CTJA 1IDN1 1NXWA 1F17A 4AYTA 1ZIXA 1CNEA 4R0VA 5JZOA 1ISPA 2AG1A 2ZJ8A 1N7HA 2VH2A 2HWXA 4AJEA 1CBUA 1G7CA 1K5PA 2O9JA 4KXXA 3BIWA 4Y2UA 2QAGC 3NFRA 2H06A 2PGDA 5BQ5A 5K8LA 1JS1X 1K3TA 4FJ2A 3VU0A 1IY2A 3V32A 3D59A 5EUBA 4KN6A 3AL3A 5EAIA 5A6SB 2C9BA 3UO8B 4DMGA 3V00A 3RWBA 1KETA 1U0LA 1XROA 3O8BA 4ZK2A 3WKCA 2IP4A 4KAXA 3M1AA 4GL2A 5FBRB 2IWHA 2ABWA 2GLXA 2NSDA 5FNZA 1VPTA 2FSHA 2FLVA 1IULA 1KO8A 3UXEA 2O2GA 4CKWB 5B64A 5CD9A 2ZTMA 3LZDA 1T8PA 2OXTA 5IT5A 3HXLA 2PFGA 1JIUA 3C2QA 1VB5A 2DH5A 3H2HA 2BTQA 4I5IA 3UQYS 5FQNA 3WLLA 3DF9A 4B6JA 4L7VA 4ER7A 5FFMA 1EZZA 4B87A 2GHIA 3QQ5A 5BVGA 1UKYA 2EF1A 2VBFA 3FJ1A 1IHUA 2LCFA 3L6CA 5DNUA 2HO4A 4AL4A 4CM4B 2Z2ZA 4N1AA 3PS9A 2CHFA 3TZ6A 1G3MA 5TT0A 3BTUA 4I5FA 3JQQA 1MJHA 1MVNA 3NWPA 4YY3B 2EX1A 2JGDB 4QXMA 4RE5A 1XCBA 3ZWVA 3HEMA 4HWOA 4BVFA 1CIVA 1LVHA 2P2SA 1CVRA 1S6YA 2VIIA 3B7GA 1RMQA 3LC0A 4Q4AA 2W11A 2W98A 3LMKA 2PYZA 2ZYWX 4OI4A 4B3BA 1E7MA 4HAOA 4UHBA 2ACWA 3EF0A 3PRHA 2GEKA 3UA4A 1T3TA 1EM8A 3GLHB 3NM6B 4NZZA 4AKIA 4P34A 1PWYE 3WLMA 4D3XA 3FNRA 4G2TA 3ANLA 3G5AA 3ZDZB 3MB5A 4AP6A 3L6BA 1GM5A 1HYGA 5HKOA 2PZGA 2IX3A 1EK0A 5H9VA 4D9BA 2NSYA 5CP8A 5KPDA 4D8WA 3PXCX 1VE9A 4Q1BA 1MVOA 3SNKA 3HVIA 1EHYA 1TL7C 3ZDRA 3TW8A 4IMPA 1M10A 3AGQA 3PQFA 1ZMTA 1YAJA 3QG1A 1F14A 1E2KA 1TYAE 4ZCLA 4D3YA 1KEZA 2NZ2A 2XGSA 3VNAA 1RJFA 4BRZA 2W4QA 4ZQBA 2REXB 2X6RA 1IN7A 4O2AB 3GR6A 4FYKA 2IEZA 4Q4LA 3OF3A 3ILYA 4LNHA 4EG1A 3FTCA 4INOA 3PUJA 4QLBA 3ZKWA 1KI6A 5JXIA 3DTYA 2BFFB 1Y33E 1ZAKA 4W9NC 2CXQA 2C3PA 1M6VB 3COVA 3TEMA 2XMCA 3K9NA 2I55A 1IXZA 4P7GA 2GEDA 4DV1B 1Z2AA 3C5HA 4YXWD 3LA8A 3CZMA 4Q9AA 2XRFA 1JEQA 3RROA 3PHHA 1YQQA 1NXXA 2NGRA 3UHFA 2JBWA 4DREA 2IKSA 1YR8A 4JJIA 3PLAE 3E35A 5CMLA 2OBNA 1E2FA 1H8ED 1TJ3A 1CQZA 1XZBA 3CTPA 3M3HA 4FGKA 5HIJA 4JLKA 4U0JA 3ZHQA 1GDDA 5EI5A 3TRIA 4MW5A 4B4DA 4OKIA 4KRXA 4Z4HA 4B6FA 1FYXA 4X7RA 2EZTA 1L4FA 4PNHA 3HYTA 1MAHA 3O8RA 2Q2VA 4B8ZA 5ED4A 2HWKA 5CLFA 1A2BA 4MO9A 2FR8C 1RXCA 3C1AA 3Q8XB 4BU0A 1KH1A 1T1SA 5LXTA 3CLUC 4LK2A 3RF6A 4FFNA 3TFWA 4J49A 4EJSC 4G25A 2C4TA 1QYDA 2CHQA 4CM1A 1K7YA 2V58A 5FEUA 3VX4A 3W6OA 4BJ3A 3DLBA 2CFRA 3L84A 1GARA 3PXXA 5BR8B 3AIOA 3OZ7A 1L4UA 2X4DA 3TLCA 4J3JA 5WRFA 1ANKA 4OYRA 2SKCA 4RVOA 4YC7A 2FR0A 1VCHA 4JP3A 2KBFA 3MTJA 4L7QA 3RGGA 4R71A 3B12A 3GRVA 1IB0A 2AFHB 2RI1A 1Y5LA 2OWEA 4FQ5A 4FZ3A 4IX1A 4N5DA 2HLNA 4FFLA 3HKEB 3OBIA 3A6KA 4JHXA 5EHQA 3WWEA 4HXEB 4H17A 1DRWA 4TTAA 1E96A 3RVJA 3WS7A 4D9FA 4EI2A 4IUDS 5GAJA 4IEEA 5IM4A 4ZXFA 3SYKA 1RAEA 2X6TA 3LS2A 3DD5A 4URYR 3VJMA 5LA6A 5ALVA 1NI4B 3O9ZA 3D7RA 1XD2A 1NJGA 1WXWA 4DNPA 3KEQA 4RTNA 2WWWA 3C3YA 3NBXX 4TM7A 3DR3A 2VF8A 4JJ8A 4JC8A 3FYUB 2ARKA 2N0SA 3HN2A 3FTNA 4AF7A 4DILA 2ZYGA 1NOIA 3KUXA 2W2XA 4HUQB 5FOWA 3KZOA 4RZQA 1S96A 4MQ6A 1Q1GA 4A5SA 1VJGA 3HA2A 3QU2A 4PINA 4WKCA 5SY6A 3E58A 4M9ZA 4OOEA 5GVRA 2GM9A 1E63A 2QP9X 2ZM5A 1XQVA 3UYLA 3NATA 4ETIA 3H6HA 1TB4A 1P4RA 3B1VA 3A4IA 1V6CA 1XAJA 1QKKA 2HRRA 3GF4A 4MWEA 2E1RA 2VDRB 4FQ7A 3VR6H 2ZZNA 2OO5A 2ZR9A 5DTMA 1J42A 2X3FA 5IN5A 2VTBB 3RYCB 1QRUA 2BKUA 3LDHA 5H16A 1CIPA 3ZY5A 1K6EA 1NN5A 4B6EA 1UMBB 2AOTB 3R74A 2O8BA 3LLMA 1NUUA 1U7UA 3FYCA 2CL0X 4FYPA 1E3WB 1JZQA 4JEUA 3ZHOA 4B17A 5LBUA 2BW0A 1KO7A 4NNJA 5GJVC 5IARA 3WSWA 4JZKA 4LQCA 5AVQA 3OX4A 2WUFA 4J0HA 4KE9A 4IS2A 4BNIA 3D31A 3EASA 4BRUA 3UT5B 1JECA 3F98A 2IA5A 2Y1FA 3GDHA 1P4SA 2VT3A 1B0PA 1R0SA 1SUIA 4EY8A 2G4VA 3VH4A 2X23A 3CHYA 3PUKA 3AFIA 4I08A 3V48A 3OQOA 2Q3EA 2IIBA 4UTOA 2EG5A 2O0JA 3ZUPA 1JP7A 1UBGA 3BBPA 1Z25A 4HDSB 3NWBA 4MUHA 3CEPB 2A1UB 3ONWA 3FDZA 4O33A 4DUYB 1SXJD 1RC0A 4KC0A 1T5TA 1AD2A 4RGQA 4OQMA 1E4EB 2FDXA 4NICA 1KAMA 4NDAA 4UQPA 5FO0A 3MJDA 1WV1A 3H8VA 5TMBA 1TT7A 2Z58A 1Z82A 4B35A 5LM3A 2QL5A 5KYKA 4FFDA 4AFNA 1EB9A 4O4IB 4FYXA 1TYZA 2WVHA 3LQYA 2BSXA 4IEFB 5GP1A 1IXSB 4BBPA 3TLZA 4H7EA 1VCMA 2C4WA 3T0IA 1I4DD 4MMYB 2JKZA 2CNWD 5JSUA 3R3SA 3NHBA 1DC5A 1G8AA 1TQ6A 4GKVA 5CEFA 4DJAA 1N32B 4RIGA 4WZBA 4X1IA 1LKZA 2ZAOA 4DFDA 2HRCA 4HZUB 3LKDA 4UE6A 2ZJYA 5F3WB 4M2LA 1NDQA 2YYYA 2GKOA 4HEA1 3HR7A 4X20A 2WPDD 2QSUA 3AC0A 3E3OA 2HSWA 4U5QA 3SC2B 5ITZA 1UBOS 5CYGA 4EX6A 1NG1A 4NBWA 1K3FA 5ARDA 1PUJA 3TD2A 4MVJM 3NBUA 5ICFA 3TPCA 3BB4A 3WGQA 3PD1A 4CEIA 1W85A 1WNFA 2BH9A 3WK8A 2AXQA 3EGOA 3GEBA 3N58A 2QV0A 4FXOA 3CF2A 3LUKA 1KJQA 1XR3A 2JCYA 4IUCS 1XEXA 5ISMA 5LDGA 1IONA 1AKUA 1V8FA 1JXQA 2H1WA 2YDYA 1JEYA 2YXLA 1J0XO 2QUBA 1ILWA 1E6LA 1NSTA 1ODJA 4F2HA 2I29A 3FNEA 4K3UA 4KSYA 2J9ZB 3EGWA 4PEVA 1F38A 3KEFA 2P69A 3KSMA 2ORYA 2ES4A 1Q83A 1ZRMA 2X77A 2YWFA 3IQDB 3C70A 5JNVA 1SHLA 3ORSA 3EPHA 4Z0NA 2IZOA 1LU9A 1YO6A 1JJAA 2EGUA 3DMNA 1YR6A 2HOQA 3I6YA 4KKXB 4NG4A 3R9KA 2ZUVA 4WHMA 1VHDA 4A5OA 2CBZA 4I8IA 1A9XB 2E6UX 3GZNB 1C7QA 1U4OA 4ZOAA 4ZVUA 2J6IA 3CEMA 4O63O 4RMGA 2IUYA 4TS4A 4R68A 1N33B 4V0NA 2YV5A 3OZSA 1BHJA 2R8YA 1EX1A 1ENYA 2H4YA 3F3SA 1JQBA 1D9XA 3IALA 3QXSA 2HADA 5BSKA 2BELA 4O4JF 5IM5A 3BCRA 4EYQA 4LI0A 2DXIA 3ETJA 4R5MA 1A9QA 1QO7A 3KHTA 4KH0A 1CZLA 3VGJA 5GZ3A 1BIFA 2B37A 4CM9A 1A8SA 4XWAA 1AK1A 1M9NA 3QVLA 4QBHA 3T8YA 3D4OA 3MLEA 4J0KA 5A5DA 3PXDA 2A5DA 3IAS6 3CRVA 1YQDA 4YQYA 4RMIA 4DDUA 3D6HA 3SEFA 3NLLA 1WXQA 4WESA 4A6XA 3KL4A 5B2EA 4TROA 3UTDA 4C43A 4EITA 1Q0UA 1WCV1 2R4TA 3O4HA 4ZYZA 1V25A 2I6SA 3UMMA 3VO1A 5JDCA 1MKYA 1UEIA 3KT3A 5I5GA 1NYLA 3EDQA 4MUXA 4PQGA 4IJ5A 2BCGY 3RNLA 1PGNA 2HBQA 3LU1A 4LRXA 3LXMA 4V24A 1O5IA 4DNQA 1YHNA 2ZT6A 4TVOA 2XYQA 4QYSA 5BT9A 5TE9A 3CT4A 2ADFA 4HZIA 4K6KA 3PFBA 1GXSB 2RK3A 3A58B 2XB8A 3EBOA 1Z83A 3JWJA 4BOYA 3WOHA 1KNXA 1U63A 4HNSA 4TKVB 3OIWA 1QP0A 5JCJD 4I3FA 4ZKEA 1C5KA 1X80B 1EUCA 2PXCA 4WRRA 4ZOCA 4YV0A 1J99A 1XTIA 3ITKA 3NHRA 2Q41A 1JWAB 4PYKA 1COZA 4HUTA 3A3PA 3PENA 3G6WA 3OZBA 4KPGA 1AIPA 4XEHA 2AN1A 3W5JA 4FEAA 4J16C 1FQOA 1A5BB 5AI9A 2FVXA 3UJ9A 4LGYA 4E13A 5I51A 5D1HA 3HUEA 2GBFA 3IVGA 3OIDA 1IQUA 2WIFA 4LHXA 3CX4A 1IJEA 2P40A 3BWCA 3NO4A 2PGAA 3I62A 3QH4A 2WOJA 1L2TA 1UZNA 5E6UA 4PZLA 1BXZA 5FBVB 3EAQA 4LOKA 4KQ6A 2IYVA 4YR9A 1VPLA 1U2QA 4D4IA 2OM6A 4BQPA 5KC9A 5C2JB 2REBA 3CW9A 5IBQA 1I2BA 4OMDA 1IQPA 2ZW9A 3JVVA 5C8YA 1R00A 4KQEA 4LJYA 1RFGE 2O8FA 4N40A 2OECA 5D8DA 1IPHA 1L7OA 2CJXA 4MUJA 3DZGA 5DT2A 3KSRA 5ALEA 2AW3A 5F1KA 3VUFA 4MWGA 1ZZGA 5CDFE 3ZR4B 1ZGJA 4W5WA 5IZCA 2Z4RA 1PX0A 3RTGA 2COEA 5KEIA 1UBTS 2A0YA 2GGSA 2VL7A 1KWGA 3UFXB 4YT2A 3PE4A 2F3SA 1VCNA 4E4YA 3F4LA 1T1IA 2C3UA 5IJ9B 3HDQA 3GEMA 1NRWA 3B20A 5DGCA 5EXSA 4PSDA 2H8GA 3AP3A 4K9OA 3WRYC