3L41A

Crystal structure of s. pombe brc1 brct5-brct6 domains in complex with phosphorylated h2a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
KRVYITFTGYDKKPSIDNLKKLDMSITSNPSKCTHLIAPRILRTSKFLCSIPYGPCVVTMDWINSCLKTHEIVDEEPYLLNDPEKELELGCTLESALKRARAQGPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCSTLNVYNKRLARHLEDGNVVLITCNEDSHIWTNFLDNASQNKTIFLQNYDWLIKTVLRQEIDVNDRIADEFARAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BRCT-containing protein 1
publication title gammaH2A binds Brc1 to maintain genome integrity during S-phase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 75
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l41A01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l41A02
3KTFA 2COKA 2ETXA 4XQ0A 3PC7A 2EP8A 1L7BA 3T7IA 1T29A 3T7JA 3PXEA 2WT8A 4IGKA 3SQDA 2JW5A 3SZMA 3K05A 3AL3A 1OQAA 2XNKA 3I0MA 2VXCA 3L40A 4BU1A 4BMCA 1T15A 1GZHB 4XPZA 1Z56C 3II6X 2K6GA 3HUEA 2AZMA 3K0KA 3FA2A 1JNXX 2ADOA 2K7FA 1KZYC 4Y2GA 1N5OX 3SHTA 3UEOA 3QVGB 1WF6A 4OFBA 3JVEA 2NTEA 3OLCX 3EF1A 2HTFA 3T1NA 3UENA 3PD7A 2EBUA 3PA6A 3K16A 4N40A 4IFIA 1IN1A 3PXBA 4BMDA 1Y98A 3U3ZA 2LE0A 2D8MA 4JLUA 3HUFA 3PXCX 3EF0A 3PC8C 3PC6A 4BU0A 3QVGA 3PC8A 3PXDA 4Y18A 3AL2A 3COJA 2E2WA 3K15A 2DUNA 2L42A 3K0HA 3L41A 1IMOA 2INGX 2VXBA 2COEA 2EBWA 2M2IA 3SHVA 4ID3A 3L46A 2XNHA 2COUA 1T2UA 3I0NA 4U4AA 5ECGC 1T2VA 2R1ZA 3T7KA 1CDZA 1L0BA 3PXAA
chains in the Genus database with same CATH superfamily
1GLGA 1XPUA 1XQ6A 1HFJA 1E2KA 3FUCA 3I53A 4HPXB 1YJAA 3DF9A 1IVYA 2Q2OA 4OGKA 4BOYA 4CL2A 2CVZA 4PYMA 3MMPA 3OOHA 1R15A 2RIPA 4PYKA 3F3YA 5GZ3A 1C7ZA 4Y2RA 4E70A 4F9FA 1D4OA 2Q2QA 4JLPA 1JXOA 1SVWA 4XSVA 5AQEA 1ISSA 2BEUB 3EPKA 2D0PB 4OOEA 2BHLA 3SJAA 1NY6A 3TRKA 1JEYB 2JANA 2C8KA 4OJQA 2FEKA 2DY1A 3Q9LA 5B1HA 5K8VA 2C0QA 4Q4DA 5LJIA 2Q0HA 2XQFA 4MP3A 1OFHA 2YZ7A 4E1BA 1B23P 1W2HA 3UK7A 2CCJA 1XTZA 5I9IA 5DLYA 1XNRB 3G1UA 4LDQA 3WNVA 4YAWA 4LZOA 2H54A 3L7KA 5KDDA 1OXMA 5DGCA 4XWKA 3HV2A 2Y9PB 4NMXB 2GN6A 2XTAA 4BLSA 4EAQA 2WVAA 5CH5A 4AP5A 3DUFA 4AQ7A 4CTMA 2JDIA 5E1DA 4HDSB 1CWUA 3Q15C 4EHFA 5INTA 1EUCB 1NI4A 1WUTA 3EFOB 2QN2A 2HJWA 3QTBA 4HCJA 4OKIA 5G1OA 5H3CA 2RK4A 4KH1A 2I8AA 5BSHA 3OO1A 3Q10A 4PAQA 3N7UA 5JZMA 3K5IA 2RHDA 3EH2A 3EK2A 4D9FA 1FP6A 3KZCA 4Z49A 7ADHA 5L3ZA 5I01A 1BMQA 1DS6A 1X0XA 2VNAA 4RAOA 4WBSA 2WFMA 3D7LA 4B7ZA 3R0JA 1M76A 2GILA 3CISA 1M8PA 5GONB 3A4IA 2XVXA 3BCHA 4XRRA 4CG1A 5I6DA 4HMQA 2HA3A 3ZE1B 1PDWA 2W4IA 4QA9A 1W85B 5AK6A 1IHOA 1NF2A 1ZD9A 3G1TA 4IGFA 4WCVA 3E22B 4JLVA 5CLHA 5M3BA 3UAWA 1HDYA 2DCUA 3MAGA 1ONPA 4FBGA 5TS2A 2ECPA 4S2EA 1VJDA 2POCA 2VNKA 3RF6A 1XQYA 2VHWA 4KYIB 1L8LA 4CLRB 5JJCA 4C4YA 3KLOA 4LQLA 4MUAA 2VPQA 4MVXA 2AN1A 3DZDA 2O52A 4G0PA 1OZHA 1X74A 1QBKC 2CKDA 4CIXA 5CCXA 5IZCC 3FUXA 3UA4A 3AL2A 4Q3CA 1UFOA 3ETGA 3S2FA 3A8TA 1W96A 2E2WA 3W8FA 2NNWB 4NBRA 4KPEC 4RYLA 4WK4B 1OMOA 3ZWDA 2YZ2A 4Q3NA 3PPXA 4DC9A 3SQXA 4PCLA 4X1YA 3V7WA 3VVBA 4Q3OA 4UM8B 1MVNA 2G5CA 1SG9A 3CUEF 3DVQX 1WP4A 2QTRA 2IYQA 3GJXC 2XQKA 3BMCA 1H4SA 3KQSA 3WKBA 1JR3A 2NZYA 1DC8A 4RGVA 5DHRA 1Q2XA 1D5WA 4BAUA 2VHYA 5JFGA 2R1UA 3U7FB 1QV6A 5I8ZA 3ESYA 3NTQA 1JE1A 1IQPA 1P61B 3R9XB 1PZGA 4JLAA 3GQBB 1Q7GA 1P4JA 3CNQS 4BATA 4HADA 5CLQA 3EHEA 5FBVB 3I2HA 3Q6MA 1VIVA 3G6WA 3C3CA 5AM2A 1D2CA 4NMHA 2G67A 4NZOA 1QDLB 2BFFB 4OI4A 3WG9A 1LNSA 2AR9A 2RONA 4BKUA 4LOAA 4INJA 1TMYA 1P0PA 5K9ZA 1SUWA 2VDLB 4DV1B 3AQIA 4I55B 3X0DA 3P8ZA 4REMA 4EI8A 3O91A 2DLCX 5KINB 2BTOA 4DAEA 4GKKB 1HEUA 3QH4A 2XYGA 1LDNA 4ASUA 3OZAA 3DEIA 4L57A 1RFLA 2R85A 4RGQA 2C0CA 3BSYA 5AOAA 3K0FB 5AK5A 4ZQIA 1A9OA 2IP2A 3L7MA 1XU4A 3OH8A 1UC5B 2XT0A 3JY6A 1FXWF 4XCXA 4LG1A 5HS6A 1Q0SA 1E5LA 1KDVA 1XLWA 3KQLA 1DJNA 2PXCA 4UCXA 1JMKC 3LX8A 1DHRA 1SVOA 3A6ZA 1F51E 2X4IA 2IGBA 3GGPA 2FVXA 1N0WA 3HXKA 3M3DA 3BXXA 3PFGA 1TUEA 2FCAA 3A1CA 3M1YA 2ZYUX 4H6XA 3SM3A 4W6ZA 3T41A 3AR9A 4B35A 2H4ZA 3W5HA 4Q4HA 3K3PA 5JRJA 3HJAA 1PP4A 4X9XA 1NC3A 2MMGA 1RU3A 2PJDA 1B76A 1LI4A 3BXGA 4FU0A 4K86A 4WNAA 1A7JA 2Z83A 3PVCA 4XOUA 2XNDA 3RU3A 3RVPA 3U5TA 3AF6A 1LRKA 3ELWA 4JX9A 5ELLA 3EASA 2ZSAA 1RZRA 1GV0A 1RYNA 4U7WA 1SY7A 1UJ4A 2XCSB 2ADMA 1RQ7A 4JKOA 2B4RO 2B0JA 2K2WA 4BBAA 3NH9A 1XZKA 1HE4A 1OCEA 2QD5A 3ADOA 4C3ZA 2AX4A 2G1JA 4BBPA 2Q0XA 2ODAA 3T1NA 3HCAA 1M3SA 3V33A 1UK9A 4L4UA 4YMIA 4YK7A 3X1DA 4ZGGA 4WNYA 1KZ7B 3LKVA 2IYFA 1Y98A 4D96A 3FD8A 5IP5A 5BW8A 5ALJA 1JFVA 3L1UA 1CQPA 3ADPA 3BMNA 1NATA 2LNDA 1WKBA 4PPNA 3IKVA 1G2OA 5FTWA 1UAYA 1K5PA 2A3NA 1GVNB 5LIRA 2J0VA 3T9CA 1Z0AA 4M98A 4P1ZA 4P4TA 2E0IA 4UFNA 3V9AA 2I8CA 4G0NA 1DKMA 3GP5A 3RYFA 3WX0A 5I5EA 2G04A 2ZSUA 5CMLA 4AJKA 4A6PA 1Q0ZA 2WZDA 1S3SA 2F64A 1OXBB 4L7VA 3K0BA 2H07A 4EHLA 4KC0A 3ZE8A 4NBSA 1OVMA 5REQA 2NTYC 3GL9A 3WYBA 2YVLA 3VPHA 1O6CA 2FKNA 3I05A 2VXBA 2VQDA 2XZDA 3M6FA 4MRMB 4N7BA 4LSMA 3SICE 3TD9A 1OZAA 1NKSA 5JCOC 1QZTA 4FMDF 3IRUA 2FSVC 3KAKA 1MB3A 1OFVA 4DCPA 5A9RA 2X3YA 4BVLA 4UM9D 1QDUA 2EIXA 1J09A 4JBGA 5K2MA 1JNYA 2D7CA 3CGWA 3NNSA 2ZCUA 5IF9A 1CTQA 3DOCA 3KE9A 1QTNA 3AEZA 2ZCJA 2GHIA 1FMFA 4BMOB 3K2QA 3UG7A 1E2QA 3VYTB 1FFBA 2V45A 5KTRA 3I45A 4I50A 2KJQA 3NJ8A 4LXTA 1C14A 3KTAB 4M36A 4DC0A 1JDTA 3FTPA 1GQYA 1E5QA 1FLDA 3HVRA 3C3DA 2OYRA 4KXNA 2QVZX 4FSDA 4HXYA 4AWXA 5L3RA 2R6JA 3A4TA 3KTFA 1MO5A 2VK1A 3RNOA 4BKPA 1R74A 2WTAA 4MR8A 1EBBA 4UNQA 4YRMA 1J00A 2N0SA 2H5LA 2XUGA 3KB6A 2OQ2A 2P0AA 4D0GA 4WHMA 4PSDA 3MMZA 4CM5A 3QVMA 1M34A 2O50A 2WNIA 3JALA 4BQOA 5DU2A 4IEIA 1C2YA 2ORWA 1OYOA 1ECBA 3SZMA 1SVUA 3DOFA 4AZSA 4D0NA 1DAEA 1A9YA 4LXXA 3EZ2A 4WGGA 4TOIA 3SX4A 3ZLJA 4FFRA 4FBLA 1EFPB 5J43A 3U56A 2J3MA 3A1EA 2B1IA 2VPPA 1NNLA 2W6JA 2XMRA 2HA6A 2ZIFA 3NDIA 4NJEA 4BU1A 2X5OA 4GWKA 1LVUA 4PX3A 3Q3EA 4NIMA 3OQJA 5F78A 3VJKA 5IMBA 4DDWA 5IAGA 2QN7A 5H5JA 1DAGA 3FUVA 2WIJA 3QE2A 2PKCA 1M2VB 4YJFB 3CURA 2V59A 3UG6A 5KTOA 1YQTA 5H9WA 5ER6A 3AUTA 2DQ4A 3DBHA 2R8XA 3STWA 3KJHA 2Q8QA 2XQVA 4TRJA 1M6YA 2AFIB 3TDKA 2K7FA 4DSTA 3BFKA 5GMOA 3K9CA 2PWPA 4UHDA 4EZBA 2AQ8A 2MR6A 4XR9A 5EA2A 3MFQA 1HNNA 1T2FA 5ALTA 2SKEA 4M21A 1FNSA 5FUWA 1A69A 2G71A 3LGXA 3OHMA 2HN9A 3T0FA 3NAZA 2V3CC 2RHCA 2X8AA 2XRFA 1U3GA 2WT4A 4TYQA 3M3HA 4ECEA 3CY6A 4BNYA 2XB6A 10MHA 2CUZA 2VNJA 2WIFA 4MDYA 3DQZA 3SD7A 4EF4A 5D6NA 1T9HA 2NVWA 4R4JA 1NXVA 4A16A 4AY6A 3DZ8A 3WQRA 2X8WA 4ND1A 4Q3AA 5LLTA 4NS4A 1U3TA 5CDSA 4GSKA 4B8YA 4B3JA 1B74A 3BKXA 2R5NA 2I78A 3EEBA 2Q5HA 1EVQA 3DXXA 3KEMA 2REBA 3Q2KA 1YL7A 3QVJA 2ZUVA 1W46A 3IPRA 3AP1A 5KOHA 4ECAA 3ZE7A 3UGJA 1UP6A 5E4YA 4G1MB 4HEJA 4V2IA 5FB3A 3V6MA 4Q7QA 2IHVA 2NO0A 3LT5A 3I0ZA 1E92A 5KDLA 4BDTA 5CXUA 4NCJA 3TVTA 2H1SA 5EYPA 2WQ6A 2G1UA 3PXUA 2A9OA 1DARA 2AYZA 2PZBA 2Q21A 3N70A 2CLEB 5HGJA 1U8UA 1H69A 4XLTA 4DQVA 4NCAA 4F85A 2I6GA 3V3TA 1FVFA 1PR3A 3OPQA 3AF2A 2QE7A 3PX3A 3D7MA 3IJPA 1DMSA 3DP7A 5HJEA 1NQXA 4R3UC 1SVNA 2V03A 5LQSA 1XZAA 1FP2A 7YASA 2BTQB 4YHHB 4H4DA 1NBIA 4MIKA 4H3VA 3HBJA 4A10A 5KWIA 1NBME 1OD6A 2QRUA 4X8OA 1INLA 1JDSA 2B5OA 1ZK0A 5TMEA 3S2EA 4B46A 3HXQA 2ZRFA 5L51A 2AL7A 3C7CB 1G7SA 1N75A 1XF1A 3C3JA 4IJWA 4RA6B 2G4LA 4PX5A 3BCRA 3IDAA 1S7GA 1Z74A 3FVWA 2QQGA 1CRQA 3O7MA 5BVHA 2DUJA 4KQWA 2QW1A 4P58A 4QDKA 2CFCA 2VZ8A 5U9CA 1QFJA 4HG2A 3DC7A 1EFVA 4FYHA 1GU0A 3C5EA 5A2QA 5BV1A 5KVVA 5JZBA 5J1SB 3ZV6A 3FPEA 2FPUA 2JIBA 2QQ0A 3ND7A 1WA5A 2IWHA 3WGKA 3DOUA 1KI2A 5A5FA 5BV7A 2RHWA 4DRZA 1VMAA 1H22A 1EK5A 1L5RA 3KLPX 3NTLA 3W5SA 5I7RA 4LY3A 3NB0A 2CNOA 5EJ8A 4O0LA 5G3ZA 2NV6A 4PYQA 3JQGA 2H1FA 3VTAA 4GMGA 2BD0A 3DBIA 4O5AA 2VT2A 4CG3A 2GBGA 2OHVA 1GOTA 2HX1A 4XX0B 3DZIA 3F8TA 3VC3A 4CMAA 1QK5A 2JL1A 3OIGA 2XWQA 3DSRA 1LDBA 4C7KA 4Q6WA 2IZ7A 1NT4A 4O25A 3NATA 3SBXA 5F9HA 3P0JA 2O05A 2AFRA 3LQ1A 4KR2A 1XG5A 3ITKA 3ETNA 1RQXA 1TM4E 1UZAA 5JS2A 5JXJA 4N7RA 4A7PA 1KAMA 1KYYA 1SKUA 1XTBA 2D1TA 2O2YA 4EFNA 3JQ8A 4JK3A 1JDVA 4Q19A 1MO2A 3AFOA 1F20A 4UTRA 3EIUA 4GPIB 2GZ3A 4XIYA 4ZCTA 1U98A 1EFCA 1VSUA 1GRVA 1O08A 5BN3A 5F5XA 2AD5A 1DEXA 5GM2A 2DQYA 1CDEA 1ODKA 2QL5A 3HY4A 4HYQA 1O9BA 2B82A 2WSLA 4MP6A 4EUEA 2R25B 4UHFA 5A7GA 2EKPA 3NS7A 1X87A 3U1TA 3CJRA 3LHIA 1ZU4A 4C3OB 1F12A 4NYJR 2QZSA 4FDAA 5K8CA 3UENA 4HNUA 4GM4A 3ZIUA 3LXUX 2RGAA 4QODA 5J4LA 3PE4A 4H0CA 4C88A 3QFCA 4RVGA 2HK7A 3AETA 3H11B 1XDBA 2P3LA 2VPXA 4UNIA 3C2QA 1PD1A 3NT4A 2CSUA 3AHGA 4M9SA 3G2KA 4EMTA 3RARA 2Y1GA 4XEUA 4CLOB 2V96A 2ZB8A 5G02A 4NZPA 1CB0A 5JV5A 1JSXA 5BWNA 1E98A 2GEVA 4RZIA 3CO5A 3KKEA 3ENKA 2WPDD 2ZE7A 3DZFA 3HRIA 4LDRA 4ZT4A 4EO4A 4ZEMA 5IT5A 1JIXA 3LUBA 2ZXUA 2QXYA 2HLDA 4MNTA 2WSBA 3JAMA 1CE8A 2GM3A 1ECFA 2EOAA 3QYFA 1XALA 4B74A 4KQGA 3C85A 4ZEVA 2OV2A 5FIUA 5FI1B 4C43A 2ZTVA 5DM1A 5IU6A 3F5SA 1R4AA 3R8CA 1T8PA 1DG9A 1FMTA 1G60A 3QTTA 1J2JA 1YQWA 3W8NA 1AK2A 3K70D 1B93A 2QAJA 2BGWA 4EG5A 1XZCA 1NKTA 1MDFA 1P2FA 3GPCA 2BFCA 1UM9A 3GRYA 1WW2A 4HAXA 1KVQA 5F76A 3ZJUA 1O95A 3EXHB 3DO6A 1VLQA 1SK8A 3FFAA 2J87A 1R0LA 3DT9A 4PTLA 4JGIA 2W70A 4EHDA 1Q3KA 1GILA 4QGBA 5DM60 5LWQA 4O4LF 1UMDA 4QHSA 4DZTA 3G0CA 3I2JA 1CUIA 3QUCA 5DLQC 3RRNA 3ER8A 1XTQA 1Y8RA 1ZOSA 4XVHA 1HQKA 5JDCC 1XYGA 4DYHA 3TEMA 1T9BA 221PA 3P2JA 4J0JA 3L01A 2PT9A 3NWOA 3PWZA 3QHQA 5KNBH 3EZXA 2Y27A 3B1FA 3FPLA 1VBKA 1QGAA 3L8DA 4TS4A 5JMPA 1PEYA 1A8QA 1X8XA 2NPIA 4WKCA 2G82A 3PR2B 4UE3S 5GOTA 1UAAA 1IN6A 4ZI7F 4EW6A 2VJDA 3M0EA 4II2A 2H4XA 3WGVA 1P1BA 4MVJD 1OIWA 3AINA 3KJEA 4PS0A 4A15A 3WA6A 5LC1A 2ENWA 5T4EA 5A9SB 2BZ1A 1JFFA 3KM0A 3PNOA 2WDPA 3CUKA 1SWVA 1ZA1A 2H2HA 2XYRA 5CYPA 3ZJTA 4JOBA 3M9WA 5EE0A 1PHPA 1MO3A 1NVXQ 2H11A 1M1NB 3BZWA 4HVLA 5I7OA 1CYDA 1EVEA 1ADCA 3KU4A 3BB1A 3SNHA 4DLWA 1CC1S 1UINA 5AXAA 2JJ2D 4MS1A 4Z9YA 1TD1A 2W8BA 5JMWA 1I94B 1E59A 1WAMA 3QX7A 4FNAA 5JNTA 1P7CA 3LJKA 4JLNA 4DR3B 3FTFA 2I4NA 3TSAA 2GSWA 3T34A 4DILA 3WRXA 5IS2A 2JFOA 3UZUA 4K5QA 5B4TA 5A05A 4FGUA 3DPSA 2GPTA 4FGJA 4UTVA 4Z7NB 5EMNA 1DAHA 3QELA 3VV2A 1UWKA 1ZD3A 2CMFA 4FC7A 3UWPA 2UYOA 3CW9A 4R71A 5ELMA 1T5TA 4WLEA 1OAKA 4IWXA 3H2IA 1AUQA 4MEBA 3AIKA 3R8FA 1KJQA 4DMCA 1JHXA 1Z29A 2IHKA 3G88A 3H6GA 4Q3EA 4ZOBA 2ZIZA 1REQB 2VP9A 4WDQA 3K6SB 3BGDA 1AA6A 5IVHA 4K0KB 2F43A 2IL1A 2YZGA 1USKA 2Z5FA 1H4TA 5CB4F 1B6SA 1HDCA 1USUA 4D25A 3DAOA 2F55A 2QUJA 2CHGA 4DLRA 1GLNA 1WE2A 3PNSA 1CIJA 3UT5A 3CEMA 2B94A 3ZWKA 3WGIA 1RYZA 2C8JA 3ESAA 4Q3LA 1OHHA 3WP1B 5JNLA 4PNZA 3FWPA 3K9LA 3RUAA 4UEWA 3UQZA 1OVGA 4Q1DA 3ZE6A 3K15A 3VKWA 5JD4A 4LTNA 2AJTA 1W94A 2X1LA 1L3IA 3WE7A 4W5WA 2VDUE 4TTTS 3OOJA 3HO8A 1BCRB 5K3CA 2VVTA 2ZI5A 4WXPA 4D4LA 5T7BA 3HP1A 3OX4A 1JU4A 3GNQA 1XKQA 1JKXA 3GJYA 1NP6A 3OQIA 4IH4A 2MSLA 5EE9A 2A8YA 4ZDWA 2VS1A 3O92A 1F2DA 1T0PA 2VO1A 4U7GA 4DCNA 1EH5A 1X19A 1WZEA 2QXTA 2Z2YA 3PDHA 4J0EA 2O06A 5KNLA 1E6MA 1VZ3A 1U4OA 1QIMA 2EX1A 3R5HA 5K0SA 3VXKA 3K09C 3E7WA 5L4SA 1Y7IA 5TVKA 2AMVA 4QGGA 1OX5A 3SDZA 3JQFC 3LBYA 4MV3A 3D5QA 4FW9A 5AVJA 5TPWB 3BMOA 3TQHA 5ALMA 1YZQA 2P9TA 4TV8B 2NUTA 1ZIOA 2XD9A 1TAUA 5FWDA 2OLKA 3A9WA 3HVHA 1S2IA 1EFTA 3HZOA 1T5BA 1X2EA 3CKYA 3KCNA 4LE2A 3ZXSA 5ADWA 5E6RA 4RPJA 3NU1A 4C14A 3QLTA 4FOPA 4EX6A 3KKLA 3TQCA 2O3RA 1IJEA 1MG5A 4CKEB 3R77A 4JLWA 4YP5A 1Q7RA 4YMTA 1ORDA 3FZYA 2YVUA 1LH0A 1JHYA 1IBCA 3AI2A 1P4RA 3JCZA 2PH3A 4KBFA 1JG6A 3H1TA 4ZT7A 1CXZA 1PRYA 2YQZA 3QJ5A 2GZHA 3SSAA 3WO0A 3NW9A 1AS2A 4ZEXA 4BFTA 2O7QA 2R47A 5CDFE 4RHXA 4LK2A 3WMXA 4DT1B 1S3IA 1OH7A 3EGXA 2O8BB 4OO3A 2WHPB 5TE9A 3UC9A 4GOOD 3ZJVA 5BT8A 4U2GA 1YF3A 4DXHA 5KB3A 4KU4A 1T5LA 5LQNA 4PWZA 4UE2A 3GYGA 1ZFNA 1UQTA 2XX3A 3WGHA 3DULA 3EZGA 1FYDA 2B4KA 4IHJF 4C87A 3IEMA 1IZ9A 5AKGA 3RABA 1RJEA 2YC4C 1CU1A 1PJBA 2E21A 3OFKA 4IV0A 2RKWA 1GUAA 1P39A 2YWCA 4KIGA 4RMHA 1JMYA 3N58A 1L6RA 1WXFA 4E4YA 4U7JA 1CJVC 2Q5JA 4F9GA 5L3SA 2J5KA 2EZ9A 5E9JA 4W5QA 3DT6A 3O4HA 1U8AA 1ZOLA 2CJPA 2EF0A 1I4EB 3IDOA 4DL9A 3X2EA 3AR5A 2V7XA 4EHKA 2HXYA 2RHBA 3IQIX 1TIBA 3M5PA 3CBGA 3REQB 2I4LA 4GUAA 2QZPA 4YQZA 4HB2A 2BZGA 4FFOA 4BJHB 3ZW8A 2WINI 5HILA 1QFMA 2PQMA 4U7DA 1HX7A 2C95A 1IEQA 1OLOA 4H4CA 4KO4S 4RFSB 4WPGA 2IOFK 3A28A 3LPAA 4MP8A 1ZRSA 2WNSA 1ZK1A 1HOTA 4HDMB 3H8SA 1NVMB 4LC9A 1P73A 1G6OA 1SZDA 3GFPA 3UANA 2IS6A 5IDWA 4URWR 3TRFA 4JOCA 4IDEA 3FZNA 3PXXA 1KVTA 1XHLA 2FOIA 2FRDA 2ZYVX 2JAHA 3TZ6A 2QXUA 4DUGD 1ONNA 3T1TA 2C31A 1MX9A 3E8XA 4CM7A 1PLLA 1Q22A 3D3NA 4D3YA 3VKGA 3LF1A 4IOLA 4OHFA 3LW8A 3BE5A 2HU7A 4BXOA 1XHFA 3E9DA 1VLLA 4FWBA 4H59A 4K9QA 4MLPA 1MBZA 1TI7A 5EE5B 1V95A 1SUDA 3OICA 1KI6B 1PT5A 3KQVA 4CL8A 1P1CA 3NCTA 3ADDA 3AF0A 1Z15A 3P5BA 1P2BA 2JJ1D 3PC4A 1DHTA 3RTEA 4BX3A 2FZ4A 3LK6A 4UM7A 3MUEA 1OU4A 5TNXA 4C08A 1QUFA 3KDPA 4REOA 4YRRA 5JAUA 5LDHA 3UF0A 1T3ZA 1EINA 2JAQA 3AQ4A 2VAMA 2IWRA 1GTSA 4DMHA 2ZROA 3VDQA 2G6TA 3EZ9A 4WBNB 1SHLA 4XD7D 1JWLA 1FBNA 2VH2A 3ND5A 2F9MA 3R7AA 2BM1A 4KQEA 3K0SA 1RRFA 3DOJA 4YUWA 3QA9A 2G17A 4WY5A 4HX5A 2QR2A 1WHTB 4RW0A 4GZ3A 1RQNA 3CCCA 3DHYA 2V7GA 3HUDA 4MCAA 1JXQA 1OKKD 1W4RA 3O8NA 1ETUA 1Z4KA 1M9NA 3DCIA 4PTZA 4AZTA 4ENVA 1TVEA 5E0OA 1FXSA 3HHEA 4UM9B 5IKMA 1W73A 2GPBA 1EUYA 1ND5A 4J94A 4B31A 1RSZA 1CJTC 2ZPTX 2HL6A 3PRYA 1DTEA 4D9HA 2YOFA 3EA5A 3AHDA 1X1BA 2VSFA 4L1KA 4QPCA 1X7YB 2V7QD 5FRDA 3UCXA 4ZIRA 5KYGA 1G3MA 1RKVA 1TA9A 4AG6A 4D9BA 1LBQA 2YWRA 2FKAA 1PFKA 5ITSA 4NK4A 4RWEA 1CR0A 2D3WA 4TL6A 1EWQA 3SN6A 3C8UA 5F77A 1JIIA 5LDDC 1EQUA 1TEXA 1YMQA 3P9IA 4DLZA 3Q3HA 2PWZA 1XCBA 1YRBA 4NENA 1QANA 3SMQA 1NQ5A 2YWFA 4PNHA 4ZU6X 1T8YA 3WIVA 4QJ3A 5JZVA 2NW6A 1M54A 3JQAD 4AXXA 3K1ZA 1R5OA 3STVA 4PLVA 1D03A 1XWFA 4B80A 3G0DA 1RVV1 3UEOA 1RLTA 5IK2A 2IYVA 1FA9A 5IHXA 1NOJA 2LV8A 2QNIA 3K0AB 4H7HA 4OLAA 1Z7BA 4G1VA 4NZZA 4M54A 2NXNA 3NOVA 1NRJB 1TA4A 2HTFA 3V55A 1NONA 4DDHA 1OLSA 2CL6X 3A6LA 3IUJA 3Q7PA 3FW1A 5BNTA 3PD0A 4MW4A 3Q8MA 4YMWA 3RG2A 3QVTA 2MMCA 2HJVA 1MOPA 2P8JA 3BQMB 2DLNA 2DPGA 3OIUA 4OL0A 4G8CA 1JAIA 3E82A 4OQ4A 5FWAA 1JAYA 1Q11A 2QTWB 3S4YA 1L4EA 4NABA 4UE6A 1I4DD 4P98A 5B64A 4UHHA 2FUEA 3V1LA 4CFSA 5BN1A 3AUFA 3C1TA 3DDZX 3FWZA 3KELA 1WD5A 2IJGX 3W5BA 1JIQA 1NIJA 2R7AA 2VUUA 1U94A 3GLKA 1CS0B 1VI5A 1X1RA 4JUFA 1UPFA 2WNHA 3NANA 4CDMA 3DO5A 2XI4A 3D8SA 3E6AA 3QXCA 3N8HA 3WS7A 4LGMA 1VLHA 3C6YA 3EJWA 3GBPA 4XM1A 2BHTA 1IZYA 2GXSA 5LBTA 2W37A 1HR0B 4XTRA 2EWMA 2C9DA 4QLBA 1NUSA 4JJFA 1NLMA 5EZYF 2FPMA 2EFEB 4G5SA 4IM7A 4ZALA 2XQGA 1EXDA 1J2TA 1TIKA 1X94A 4RF5A 3GJZA 4HLUA 3GLQA 3QG1A 2XQIA 3WNQA 3SLRA 2F1KA 4K46A 4P4UA 4CF5A 3FMGA 1HRDA 1T1EA 1U0LA 2Z2XA 1ZR2A 1BX1A 2ZYDA 3LT4A 1G2QA 2RG7A 3OF3A 1QP4A 4NEGA 4ENSA 2WAAA 3H5VA 1UBUS 2PLWA 3DEZA 3KR2A 3T4UA 5ICSA 5TARA 2OE2A 1GR0A 4B0OA 2V4ZA 1U9IC 3U9LA 4Q82A 1XL1A 4LDAA 3KETA 1TU4A 1NJ8A 4YCLA 1PS0A 2ILTA 2BFDA 4IMPA 2CNKA 2L17A 3SF0A 1E1CB 2XMZA 3LX5A 4P32A 1GARA 1CVLA 4ITUA 4ZYUA 5JI2E 4UAUA 4BX9A 2ACKA 4HEHA 4I19A 4CODB 2NQ8A 1NTOA 2JHFA 2ZRCA 1CUBA 2O5RA 4UULA 3A1TA 3AB3A 1BMTA 3TE6A 3EVNA 3F8SA 3OURA 4MPJA 3F49S 4RIFA 1RYEA 2HWXA 3K0EA 2HF8A 3DBLA 2VOJA 3C7DB 1J9GA 1TQ6A 2Y76A 4QARA 4FFBB 3ZTYA 1F48A 4LKRA 4E2YA 2NYAA 1XAJA 4HQFA 4QUHA 2VK2A 4F1JA 2CYCA 4NV0A 3SR3A 4FFPA 3T7AA 3S2UA 5AUNB 3DPIA 1OB2A 2A5FA 1LC3A 2FZGA 3IVGA 4DCGA 4C7OA 1QNFA 3RFTA 2XITA 1H1LA 1IHDA 1KYWA 3LOPA 4FS3A 1II8B 2FJ0A 4B3IA 2BE7A 1HM5A 2GVNA 2QPTA 1MJ5A 4IJKA 1JDZA 1WMFA 4X1KA 3TQRA 4AYWA 2LUOA 4FEGA 2Y71A 3OOWA 1Z56C 5EMHA 5IN4A 3L1JA 4X92A 3II6X 2V5VA 3O2SB 1JJVA 1XK6A 4GXTA 1NW5A 4C6SA 1VKRA 1ZBQA 4M55A 2Y4NA 2ADOA 2G8NA 3OTIA 4P4SB 4TQUS 5AH0A 5AQ1A 1RBYA 1WLYA 2A30A 4FFLA 4LJ4A 4YJ3B 4LRTB 3W5JA 2CXNA 3BE6A 4JD5A 2QZJA 5DWDA 5C3UA 4AKIA 4CKBA 4M1OA 4BPRA 4FR0A 2R4UA 3SQLA 5BSGA 3T5PA 4TGLA 5KVAA 3HTXA 2IIVA 1VL1A 2X8BA 3G79A 4CWAA 3E3NA 4RQAA 1BJKA 4D4KA 1TECE 1YO6A 4YONB 1O87A 4CIAA 1VRVA 3FPKA 2HFJA 2VYVA 4IJQA 3H7IA 5I9SA 4OHCA 4XTCS 1I2DA 3RHFA 2BGIA 1SBCA 2X58A 3O8QB 4EDHA 2TMYA 4JLUA 4HT3B 2QN9A 3OZFA 3UMBA 4E14A 2FP4A 1G8MA 1NQAO 1FS5A 1Z17A 2J59A 4EUHA 2W5UA 3GLIE 4AQYB 1VLMA 5J2UA 1NP7A 1MJGA 4UPEA 1B42A 1RS0A 1WVMA 3KHUA 3ZNPA 1CUHA 4X20B 1JZTA 4FEEA 2YW2A 4Y6PA 2GNAA 1UFRA 4K05A 4XYBA 3ZHUA 4EBBA 5BUZA 3LO5A 1ZPDA 2XB2A 2OXTA 1H2AS 2BGLA 2QI9C 4MV1A 1QHHA 5H4HA 2LD4A 3H2YA 1RLUA 3A27A 4J16A 3GZNA 4KVGA 5E3HA 5I51A 3EIFA 5DI3A 4WX2B 3Q40A 4P7KA 5IBRA 3W6NA 1QP7A 3U7JA 1EZ1A 1B16A 1WPGA 2DUUA 4PSVA 2PYIA 3S2YA 2G4VA 5B55A 2AFHB 1SZJG 1BKSB 1GZ3A 4RD3A 1D04A 2ZBGA 4H0FA 1EZZA 5FR1A 4EUFA 4RPHA 1KYQA 4BP8A 2XCIA 1MR3F 3KR1A 4MH0R 1YVPA 3T3MB 2JH8A 1EU1A 1XXHE 1HL7A 1O94A 1W5FA 1G9SA 4GZ6A 1GTZA 5TGDA 4MS3A 2V6BA 3O9MA 3FGOA 3HSYA 3T7KA 1AT1A 3N0WA 4KVFA 2JKYA 3O90A 5T64A 3CLTC 1YCDA 4Z51A 4CM9D 2VYCA 5D1HA 1JSLA 2E7ZA 3I42A 5E0KB 2OA0A 4A2WA 4O1MA 3HL4A 3HG7A 4KLCA 4N6NA 4B9EA 1RD4A 1W0KA 3IOEA 3LE8A 1U8XX 3KXPA 1E1RA 1GZ5A 3LOUA 4QOGA 3WGOA 4IICA 2GUGA 3L1IA 4IIJB 4OQZA 3FNIA 3VJLA 3OPVA 3DTYA 1T1GA 4KH0A 2P7IA 3TCKA 1CQJA 3PDWA 5CX1A 4GZMA 3U09A 1F7UA 5JY6A 2X86A 3FYDA 3RGWS 5JE8A 3V5NA 1B26A 1Y7TA 2QU8A 3MN1A 3KUKA 4M0PA 3D4LA 2PEZA 4LMPA 3T3HA 3ZNNA 2CL7X 3MD9A 3ZS8A 4AECA 4BJ3A 4ILEA 4YREA 1UDCA 1XQ1A 3IAM6 3UXEA 1KMMA 1RAGA 1W88A 4OYHA 4CM4A 2AI1A 4D0RA 4E5NA 3A1VA 4M8KA 1EVJA 4OVKA 4YCJA 5DOZA 4PSKA 4ZYZA 4V1CB 3NFRA 5IWCA 2VZ9A 4DEYA 3MBKA 3C87A 3GOQA 4KB5A 4UDXX 4MW0A 4B33A 2QX8A 3X1KA 2VTDA 4RPCA 4CHGA 2OUIA 1SXJA 3L06A 3J7AC 3SMVA 4F71A 2JEYA 2ZETA 3A3PA 2IXTA 2X8JB 3D2LA 4MAAA 4HZUA 4HNGA 4S3MA 3ZY4A 5JZOA 1B8NA 1UR5A 5DJ5A 3QU7A 4N6GA 3L4JA 4BIIA 5C1PA 4CEJB 2QJWA 4YY3B 3QU5A 5HMLA 3JASB 5KHAA 1CETA 3PUZA 3WRVA 2JI4A 3A26A 1I6KA 3TTWA 1CQWA 1DOHA 2RAFA 3IVCA 3W9UA 3WYGA 3AHCA 4BECA 1ZC4A 4AJJA 4MYSA 4B71A 4C4AA 1H4QA 1HE5A 2VK4A 3B51X 3KHKA 2ZAIA 2ORYA 1R4MA 5ALSA 3IHLA 2WHEA 1RRPA 4OSEA 4DWJA 3R0ZA 2RJOA 4GYWA 4NSNA 1LEHA 3NONA 2ZJFA 3PZRA 1H2EA 1MC4A 1GKUB 1Z8HA 4ME6A 2X40A 2XGMA 2O8NA 1SVSA 1SU4A 3O21A 4FYWA 1ESCA 4G3XA 4GI5A 4PYJA 3CVVA 2BSQA 4NAVA 3M6AA 4PAGA 1ZX1A 3ZGXA 3KXLA 2YICA 1JLSA 2RDMA 5FO1A 3WWZA 5HK9A 1H93A 2XMCA 4LHSA 3J80A 4PPYA 2WSMA 1Z9BA 1M5TA 4BNTA 4BVKA 4I9UA 3M5DA 4RKQA 2F17A 4G89A 5J4KA 2HYDA 2GCOA 2XF2A 2ZBRA 4ZO4A 1GQSA 5JTUA 2NYUA 4F8JA 4YCBA 4DG9A 3CLTD 3CUUA 4AZWA 2NG1A 4LGCA 1CDDA 1M6VA 1WB6A 1G7CA 4V0RA 5DDIP 3VMMA 1Y34E 5C35A 2PLFA 3JU3A 3MCUA 4MGEA 2Z8XA 3UAGA 1YT5A 1E58A 3ZJ4A 5CFLA 1UKYA 4Q12A 4OAPA 2C4VA 3ANTA 3FBTA 4F8EA 2PH5A 3BMQA 3HBLA 2FJPA 1FU8A 2P6MA 4HNAA 2HRZA 4JVOA 2PSDA 3UJPA 1X1CA 2NP6A 3D5EA 3CRRA 3I1JA 3IIJA 2GZRA 2HV8A 4LJRA 4MQLA 1YA4A 3OKFA 3V8EA 1RIFA 2J9RA 2O8CB 3D7KA 2PL3A 4ZMSA 1H2YA 2H1RA 4LYHA 2JBAB 1NMSA 1VPDA 3E9NA 2FVYA 3NHAA 2GO7A 1FDSA 3FE2A 1Y89A 3QW4B 4HAYA 4Q4AB 1SZCA 1J07A 1G8JA 2IHZA 1BKYA 3WLHA 4F91B 4OU5A 3LTNC 2GERA 1WVGA 1ZP6A 2ANBA 1R0WA 2FUG6 3NBZC 3QVOA 3T38A 3M34A 4Y3UA 3WK8A 5JIBA 3TECE 4YCNA 5HCNA 3THXB 4B6QA 4I1SA 1KY4A 2J0SA 2V98A 4X6UA 5KREA 1DTSA 2ZRIA 3F6CA 3FETA 1C0IA 1DRKA 3GIDA 3MJFA 4LIPD 1MG0A 2JAPA 1QQTA 4H7DA 1JBKA 5EHZA 1E2GA 5BSMA 3DDHA 5E7MA 4HEQA 1TU3A 4D6YA 2QY6A 2JJQA 2XE6A 4L8FA 4OLHA 1P9NA 2DB3A 2Z9DA 3N2IA 3OLZA 5K0JA 1CZHA 1Z4MA 5TGZA 3T5BA 3FDFA 1LBIA 2JRCA 3UWSA 4PZLA 1Z4OA 2J4DA 2HQSA 3MZ0A 1OFGA 3NHYA 3FZGA 3PF8A 4MRSA 1JGTA 3F1KA 5EWLA 1RWNA 1KIMA 4BQRA 1M5UA 4F5ZA 1HT2E 1E0JA 4MJ3A 2UUBB 1SG6A 3OFNA 3Q1LA 4FFSA 1VLZA 1Z63A 1U9JA 3NBFA 3L7BA 1KMNA 3EQZA 3IKLA 3LPNA 4WKNA 2EYQA 3I23A 2ZWOA 4HL6A 5AM3A 4A5SA 3B6MA 3HN2A 4B3XA 3KIPA 1XKLA 4BB5A 2WT9A 5HFJA 3BE4A 3FFXA 4E08A 3NMUF 2VYNA 3FLAA 4KPYA 1NW4A 4EP1A 2IV7A 2YYAA 3ZCUA 4PLTA 1E94E 2J0UA 4R54A 4RH0A 1DIAA 1ICIA 2X2PA 3C45A 4L8YA 1YQ9A 4R8KA 4ZAYA 3JQEA 3SX2A 4YYEA 3W9BA 1MT0A 5BOVA 4EPWA 4Q1BA 4S1WA 4NZMA 1E62A 2AKYA 5TDHA 3ROGA 1VFPA 3DBVO 1VL6A 4OQYA 2IEZA 5CVUA 3AM5A 3DL7A 4D45A 1P8AA 4NE7A 3CX3A 3C6KA 3DBOB 3OX3A 1EHIA 5KTSA 2QTVB 1BCSB 1OXSC 1VM6A 3HEBA 1SXGA 3UV7A 3VKFA 3WL3A 4ETIA 4F4DA 1Z2CA 4ZZ0A 2CFRA 1IN8A 4M9RA 1GNLA 3PHCA 3ZDDA 3FCUB 3K96A 2OAEA 1XZMA 2G40A 5LOVB 4PFQA 5GY7A 4DARA 1KBZA 5LFAA 1J2UA 2JZOA 1N9GB 3AFHA 2ATVA 2ZS9A 4DQKA 4DY6A 3ZV4A 5LJLA 4DR2B 5SZIA 4TWJA 3VPCA 2G5PA 1ADFA 3TR5A 3O1LA 3LLCA 4G09A 1QV9A 4MCJA 4TKLA 4H08A 1BHQ1 4PC7A 1DKNA 1OE0A 1YZLA 2ZWAA 4ZO6A 1UWLA 1V6AA 4HDNA 3HVJA 1YB2A 1OGYA 3JAWB 3L0CA 2GPNA 2MSCB 4KUGA 5TQ0A 4RTKA 1W36C 4GKJB 3JV7A 4NAHA 1EWVA 3TFWA 2ZYIA 4X00A 5IM4A 1NLUA 1AXGA 2R96A 3HPRA 4ZVOA 3NVDA 2OY0A 1BDJA 1SIBE 4LX8A 5CU7A 4B7AA 1ZVKA 5I4KA 4XB1A 1TPYA 2CLMB 1T1IA 2IC5A 3VU0A 3FI0A 4N3AA 3ITEA 5JVDB 2BGUA 3JQPA 4KJZA 4UPDA 2HREA 4TMVA 3ASUA 1JIKA 2GRUA 3P96A 1P0FA 4BKRA 4OMDA 3QUAA 3GEEA 5IYZA 1GYRA 2QJTA 3EN0A 1AQNA 1OI3A 5M7EA 2HHHB 3URKA 4BWVA 2HU5A 3O4IA 3BMXA 4LYDA 3U4DA 4J76A 5EIAA 1Y1KE 3IEXA 3ZXIA 1NJ6A 1NM5A 2CDCA 4IIFA 4XWWA 2OGWA 3QBTA 5AM0A 2FSIA 2G1AA 2GQ0A 4O1HA 2N1BA 3LY9A 3HCPA 1XTKA 4OI2A 3OQHA 5IF3A 4YCSA 5JJBA 3H84A 4C5AA 2R6FA 2JDID 3ET5A 4ZDKA 3WGJA 2ZB2A 1F3LA 1GG8A 1XVVA 2GARA 2VYQA 2WILA 3NKVA 1WV0A 3TNDA 3Q8WA 3FB1A 1JU9A 3CX7A 4PQRA 2PX3A 5LP6F 2HBYA 1EZ4A 2I1VB 1ZRHA 2R11A 4M86A 3SS9X 4MYDA 3NVMB 3Q6IA 4QYXA 1CJCA 1GAWA 4PQGA 4G1CA 1YQDA 3FB4A 4I1YA 3VO1A 2W6ID 2IYTA 1GAXA 1H23A 2HBRA 3PD1A 1PI3A 1BE8A 4K1LA 2NZ8A 4CZ2A 3P0EA 2JLVA 2PSSA 2X4GA 2HJGA 2NXWA 4EWLA 4QPPA 2I2WA 2J31A 4BRSA 1XRPA 1N1EA 3K0CA 3O0DA 4M9CA 3RNLA 1JHDA 2QD3A 1LGYA 4I4TB 4OGFA 3UJCA 1N33B 1MO4A 1IL0A 3AY7A 2ZXFA 1JEQB 5A5EA 1EJ0A 3I2KA 2G5TA 3IEIA 3LT0A 3L7YA 4MWGA 4BMNA 1N6HA 2NU9A 3QX8A 4BLQA 3JATA 5KNBA 1WABA 4BNNA 1E96A 1XVIA 1T34A 1KVUA 2JPDA 1YB6A 4ND6A 4WOCA 4ZA2A 4L5YA 4F0JA 4E32A 3M70A 3E8SA 4X45A 4MO2A 4AO6A 5JRZA 5JSHA 4A4DA 3ZHCA 3FKSA 2DPHA 1IBMB 4NK5A 3ZE0B 3EIHA 2LVBA 4X84A 2XLBA 3MBOA 1T0IA 2XMGA 1XQVA 1F6DA 4GBED 1UK6A 3MUNA 5IKXA 3PICA 3KQYA 5J1TB 3RT1A 3U31A 1JR3D 1DEOA 1Y1RA 3GMSA 5LZ5A 2W2MA 2G9QA 3MNFA 3JQAB 3OZUA 4ZKEA 3IOYA 3RASA 1N6KA 4YT2A 3C15C 5I8WA 1O7JA 4WJKB 3AVYA 2VUHB 1S5PA 3LFHA 2ZJ4A 3RAJA 3RRBA 3UKOA 4XUEA 3VOBA 1LDEA 1Z2DA 3U7RA 3VU3A 2XY4A 1RAEA 1UT6A 3ZDYB 4RIEA 4E4TA 2FZKA 3KOWA 2UYQA 1N7HA 1O9GA 2AYYA 2CUTA 3IE2A 3K0HA 4C78A 3HA7A 3L1HA 1ST2A 2XUZA 5FBRB 1SGWA 1NTRA 5ERGB 1RQLA 1CUVA 3KWLA 1C2TA 4XVRA 4WY8A 1IMOA 1KSGA 1ILEA 1USWA 5DHPA 2EBWA 3A4LA 4PHCA 4Q48A 5A4FS 4UHKA 1W52X 1YZUA 5K7SA 1PNOA 2H3HA 4QO7A 2PYDA 3D59A 4HRVA 5COBA 5KNCH 5FPSA 3RDPA 1DAPA 4MJLA 5ITVA 2F4NA 5AW5A 1DGQA 2GAOA 1QNLA 2J6HA 4MV0A 3VTFA 1L5OA 4LECA 4NNOA 1T9AA 2A9VA 4HNRA 3V3KA 4B3BA 1CQIA 2YRWA 4AY4A 1O58A 1RWKA 2ZVPX 4ZRDA 5B58C 2WTUA 4ARVA 1TYBE 2H6EA 5J5CA 2OYSA 3UHAA 1NKVA 3B8EA 3F6EX 5FJIA 4CMKA 5IZ4A 1MB9A 5SZHB 1Y1TA 2COKA 2VBCA 3KSMA 1DUIA 3TLGA 3FGNA 4XYLA 1J0EA 2X6QA 4RYDA 1WP9A 2BLNA 3O83A 1R0RE 2GN2A 4X44A 1V1MB 2OV4A 2QYHA 3LDUA 1K06A 5P21A 4DV6B 4JXZA 2XNDD 3RE1A 2XRZA 4WESA 1RZRD 1MDBA 4MKRA 4TMWA 1SCQA 3JPWA 4QT4A 5LQUA 4I5IA 3HDQA 4YJ2A 1DELA 1SU6A 3H04A 2ZBQA 4Q37A 3I04A 4PC2A 3QHAA 1KKLA 4Z4FA 3ZQ4A 3LI2A 3WLRA 3ESXA 2PUCA 1NVBA 3BRSA 1SG0A 3SZUA 2PX2A 1CRLA 3L04A 2CBZA 4TWIA 2FE4A 2BONA 5DX1A 3HP7A 4JBYA 4ETNA 3LP5A 5LU8A 2CV1A 2XUPA 3OOSA 1PR5A 1TM1E 1K98A 1PGOA 1ZSYA 3VSBA 1TUBA 1GT91 1FW6A 2KE5A 4MWOA 2I22A 3SEZA 1CY1A 3KAQA 2BGGA 3IX7A 3GFTA 2ZI6A 1FFXB 3EVBA 4H4EA 3WWPA 2AG5A 2NXCA 4DJTA 2I7CA 3DMFA 3EULA 1Q16A 3QQ5A 1X8JA 1J5PA 1XSEA 4M88A 4WY2A 1N5LA 2D5LA 2GCEA 4PZPA 2Y1XA 5GONF 4R2IA 2G07A 2NVOA 3RUDA 5KVCA 1RJ9B 4C0LA 3OPYA 5CT6A 2J3JA 4IUYA 3JQDA 5F7OA 1O1YA 2G3YA 4N40A 3UGQA 2W2KB 1XEFA 2PU5A 4LBYA 4U2EA 3GLFE 1ONBA 3ZWAA 4E15A 5LYJA 4R31A 2O4CA 2ZR8A 4I5FA 3V97A 3U44A 1AD2A 2EX4A 4YLYA 3BFVA 4FDUA 3CPSA 1SHZA 2QVXX 2F1OA 3DGEC 5AI5A 4P84A 3UMJA 4F9EA 4ZOQI 3K70B 4O29A 3H13A 2QAIA 3PDUA 3C7AA 3BWEA 2QSUA 4MUJA 2HGZA 4Y6QA 3CVYA 2QMOA 1M8GA 2WFAA 3EBOA 5IJ0B 3I5YA 2RE8A 1H8HD 1MF7A 2FEWB 3U7QA 3FVTA 3CMMA 1UPAA 3E81A 1DBWA 1W4LA 5K45A 1Z6TA 2SKDA 3P2OA 2AS0A 3PYLA 1JSRA 4NJOA 2DJ5A 3V32A 3VYWA 1QC5B 1E1DA 3PGLA 5HQJA 4C0HA 1V16A 3D0KA 4HZIA 3P9CA 1C0LA 2I6XA 3AH8A 2ZIUB 1XROA 3IE0A 4RESA 3PRJA 1S2LA 4W5TA 2ZTSA 3VPFA 4KRGA 3TAHA 3WQBA 4ZK2A 1M1ZA 4YRFA 2PA3A 4BFYA 1A04A 2JA1A 5CDHA 4MI6A 1NRIA 5DX0A 3ABQB 5I5GA 1MAVA 1MN6A 2VF7A 2ZUUA 3AM4A 4JN6B 2CFSA 5J3JA 3C5CA 3ZWVA 4EPXA 4RTPA 2O7RA 5DSXA 4GBGA 4M9XA 2WWHA 3HSKA 3NDRA 1RXYA 2I9PA 3OIYA 1GPBA 1YCFA 3NYRA 2W6JD 3PNLA 4RELA 3M8KA 4BWFB 3AHEA 1L7MA 2C5FA 3M4NA 5CXXA 5DSTA 2BKLA 1YZGA 2H92A 5IKPA 1IOLA 3FYUA 3KYDB 1J1IA 3PC7A 3OTOB 1FTQA 3UAZA 1QBGA 4FMCB 2WYWA 2C97A 4IINA 4R1UA 1WV1A 3ZHBA 4URZR 5BR7A 4BZXA 1SR8A 4K87A 1E2DA 2OILA 3E3LA 3PUKA 4K9PA 4TWBA 2R6R1 1RQPA 1E7WA 4Q9LA 4YRTA 3VJRA 3ZK7A 1LQTA 5JASA 1GPAA 2DULA 3JZFA 5KS2A 4A0QA 4PPGA 4Z54A 4XPZA 1PQUA 1ZJ6A 1DAIA 3GT0A 2QLTA 4P0TA 3MB8A 5ALFA 2ZUTA 5M5BA 4OHUA 4OLBA 1C3LA 1V1RA 5TEVA 4FNGA 2JI6A 4MSUA 4B3CA 3BTUA 5KJFA 4UBKA 3VH3A 2C8LA 4A1OA 2G7ZA 4Y9TA 3A10A 3N0XA 3TDMA 4X63A 3ZD7A 2VK8A 5EMLA 1N5OX 5CBPB 2QAGB 2AUNA 4NICA 4UHEA 4RJTA 2DSTA 3CH5A 3LPCA 2G0NA 5LMNB 4MMZB 4DCTA 5HQ3B 4TTQA 2O8FB 4FZ3A 3H83A 4KX3A 1NASA 3Q11A 1SOUA 3QBVA 4RSRA 2OCLA 1CY6A 4AKGA 1C81A 1E2FA 5H82A 3ICEA 1QYIA 3I8OA 3E18A 1D2RA 1TCCA 3OCZA 4R1QA 4CN8A 3UW3A 1PFVA 2QE7D 3TGWA 5G0UA 5IFKA 4LHVA 3ZBTA 1OTXA 1ZCAA 3F6PA 1UEXC 1RWBA 3H5OA 1Z0IA 4OB7A 1VMIA 2J3HA 1N2JA 3F7OA 4OHBA 2GJKA 1U02A 3PXCX 3V4OA 2HSZA 4L76A 2Q7OE 4BQSA 1YFJA 2VJKA 4BN0A 2R1VA 2Y66A 3GUZA 3SP1A 1ZJ4A 1MV8A 4QVGA 2YV5A 1THZA 4B3SB 3KPWA 5HHTA 4EJFA 2Q5LA 4J0DA 3AVOA 3K53A 5IDQA 4NJMA 2V6FA 4IWYA 1B0ZA 2XTZA 4MR7B 4NH0A 2BKUA 3UMGA 1XMPA 3QSYA 1GPH1 4IUDS 1P33A 4JB2A 3SC6A 1C1YA 1JB9A 5JYDA 3ZEIA 4G01B 3WGLA 4AROA 1NSYA 4JBIA 3VR2D 1YBFA 1QQ7A 2G70A 1Q20A 1O95C 3E35A 4G2TA 4EA9A 2M2IA 3PZBA 1CY8A 4DBVO 3I6YA 1EBFA 3VHXA 3GFOA 4IF6A 2HY7A 1DJQA 2I1QA 2IEAA 1M0EA 3U7EB 1I10A 1E3WA 2BEWB 3FF1A 1CD5A 3H4VA 3QUSA 4TKVA 2Z09A 2FG7C 3FWHA 4LE1A 1C8LA 1THMA 3JZMA 5A62A 1B8OA 2REQA 5EAIA 1QIGA 1SC1A 2QS9A 2Y92A 4R5HA 2ZWMA 4DBLE 5ALUA 1BMFA 5KYYA 3M4JA 3MTBA 4KYVA 3O0TA 4M6WB 5C4MA 4HC4A 2X13A 5G53C 3OFJA 4JEIA 2IUEA 4I1PA 4MPPA 4R2XA 5B2ZA 2ZR9A 3RIHA 3ZD8A 2ZSKA 1OBHA 3PWKA 3VBEA 2CUNA 1ZEMA 2FPPB 2YVQA 3WLMA 2J8ZA 1AS3A 3VKUA 5BMVA 1UXKA 4R9NA 2B7LA 4TKMA 4C21A 2PWAA 3T7RA 2FW7A 4IRUB 2X0DA 3PQ2A 2HADA 1FFEA 2VJQA 4TMXA 4DHWA 3BT7A 4HRYA 2MCFA 4HWKA 5EIFA 2QE6A 3WL7A 1E9DA 1YR6A 4TRRA 4G36A 3OTGA 5E7QA 4ZZ1A 1SC9A 2R68A 4C04A 1BTOA 1LDYA 3ZS9A 1SKBA 4KFTA 4JT2A 1VE5A 1NSFA 2AEEA 4ZCIA 4N5MA 2IFTA 3PNKA 3RJ5A 1FC0A 2XNKA 5HK8A 2F3TA 3F6RA 1ODIA 5CLLA 2IA5A 1RVDA 2R5WA 1THGA 3G5AA 3R1IA 4FLMA 1I7NA 4OGWA 4G85A 3PJGA 5E95A 5IDYA 5KNDH 4QU5A 3L4BA 2IYOA 2CYAA 1GT6A 2PVPA 4CYMA 4BQIA 5GJBA 2H1IA 4XARA 2RHHA 1A9SA 5AI0A 3G5LA 5DHAA 4N5HX 1V6CA 3NBMA 4AJEA 4MQEA 1CY4A 1DWUA 4BGVA 4DV0B 3WRXC 3FOAA 1QH1A 2FW9A 1JLLB 2E89A 4YX9A 1Z35A 2JGJA 4AZ3A 4BB6A 1SQ5A 2NU8B 1XPRA 1UBKS 3GDGA 1PG0A 5FOSA 4E5SA 4IDFA 2D5CA 1V8OA 2IOQA 3L9WA 1HLFA 3ZYCA 4U7PB 1FS6A 1Q84A 1GPKA 2GK7A 2NQTA 2WC1A 4RBNA 4WOBA 3UMYA 3C4QA 3PQ7A 5WRFA 3S3TA 5CBKA 1LK7A 2HLDD 4KP7A 4OJNA 4J0CA 4YN3A 4YT8A 1NPYA 3PA6A 3OLYA 3IP3A 4JLOA 4U39A 1AK9A 2J3QA 1NW6A 5JO9A 1W9HA 4LISA 1JSZA 4RH1A 3DTNA 1KEPA 4R1OA 1QORA 1ZN8A 4RY8A 4BCBA 1P2UA 4BQFA 1OX4B 5JALA 1W35A 1PR4A 4XGRA 3MAJA 3H9EO 2YTZA 2ATEA 4ALJA 4ZDIA 1IFXA 3GLGA 1O95D 1HG0A 4KXUA 4MUKA 4P35A 1YOVA 5U4QA 2UYHA 1DAFA 3I01M 1U7TA 1UP4A 3IDFA 1LW6E 1J06A 4NEQA 4Q15A 3RS9A 5KPJA 1R4NA 4DV3B 4QNRA 4OX9Y 2RHJA 1DC6A 4I08A 1I6MA 1UZMA 3SFTA 4EY3A 3NVKI 3EVZA 5CCDA 2Q7DA 3ZLVA 1EJBA 1YR1A 1NPTO 4EVSA 1DJLA 5F51A 4CU2A 1H0SA 5BSWA 2G25A 1G5QA 2J41A 3F7MA 5FKJA 2HMSA 2I99A 2AC4A 4Z9BA 3W5DA 5SYAA 3QXGA 4DABA 5KWSA 2PR2A 3DMHA 1UPBA 3KXDA 1E6KA 5L53A 4R84A 1J2YA 3L6DA 3EXFA 3KD3A 4BFCA 5KYWB 2YZMA 4CFZA 3E84A 1KYIA 2A57A 3TRJA 1DTWB 1VI2A 1AHIA 1KEWA 2XHEA 4PCUA 5D87A 4ZAGA 5LBIA 3RIYA 4DLXA 3OBIA 5I8PA 1OW3B 1LCIA 3A04A 4GOJA 1X1DA 4U9UA 5H9VA 2FH5B 1CG6A 3U81A 4CMEA 2NVUB 1M75A 3ZX4A 4E7OA 5JHHB 1T2VA 1K7EB 5KYTA 1Z6QA 4NH4A 1RDFA 2P6PA 2P6NA 2D2IA 2HSDA 4JBNA 5BNFA 1SOAA 3BTOA 3BD6A 4FEYA 1JW9B 2FN4A 3GHYA 1CUYA 2OO7A 2QLJA 4JITA 5F3WB 1Y80A 3UMCA 4BLPA 2GD1O 5J2TA 4HQ0A 4ZVQA 3KQHA 2VYFA 3C8HA 4G1BA 1PWZA 4A8PA 4BMXA 1I0LA 3X1ZA 4B8ZA 3T7IA 4RQTA 2H5IA 2Z0MA 1WDLA 2CXSA 2GD2A 1K0FA 1VMKA 2O5VA 3OKAA 4OUDA 1HUQA 4ND3A 5IKOA 3RODA 3V8RA 4HQ6A 1F2VA 2CD9A 1XXHB 2WJ6A 3NHLA 3VHQA 2PL9A 2GMWA 3IDZA 4O2LA 1FX0A 3D6AA 2XECA 4WZBE 4F06A 3OCWA 3N2GB 1CIPA 2R3SA 5BT9A 4ACAA 4TTSA 5ITZB 3LVRE 2Q1WA 1Y7LA 1B73A 3DQQA 2G83A 4N3GA 2EWVA 3DZBA 4Z3KA 3ZU3A 2ROQA 3MERA 4WERA 3ITNA 4YRBA 4XGQA 3ZI7A 3DE2X 3STTA 4L72A 1ULTA 5EG5A 3NHMA 3TFOA 4Z0HO 4KPUA 2ZI9A 1WNTA 2LTAA 4I3HA 2HIAA 1QMGA 4BQNA 3DUFB 4DV4B 4DIMA 2HAEA 1G8GA 2EFCB 2WOJA 3LECA 2FSGA 3H9GA 3MJCA 3N7TA 1G64A 2YS7A 3T99A 3CUTA 4I9FA 5KWEA 1R16A 1E1LA 4DDTA 6NULA 1BS2A 1A95A 1G1AA 4L2IB 1HZJA 3CR7A 4PYLA 1BDBA 2OHGA 4GO1A 4B76A 1NW3A 3ZGNA 1OHHD 1Q7TA 2WWGA 1ZN7A 1EVKA 4M0EA 1LU9A 1QHNA 4GX2A 4Q3KA 3RIMA 3USES 4D3XA 5IAJA 5IJZA 1DFHA 2R4TA 3HKCA 1KI9A 4UUBA 1RM3A 5L4NA 3LDGA 4UU1A 5JSYA 1KYTA 4V0MA 2VJPA 4DMLA 4JC4A 1K97A 3MTEA 2GBPA 3B9PA 3X2FA 1GKKA 3HDYA 4TYNA 2J09A 5DNAA 1GQFA 1UKZA 4GPEA 4MI9A 2PAAA 3PJDA 1PNVA 1Q1GA 5L3VA 4UFOA 3L79A 1ETHA 5H59A 3IERA 4BO2A 1EB9A 2ZGVA 4XGIA 1JJBA 1XK7A 5DULA 2IH2A 3G2OA 3VOAA 3QEAZ 3AEUA 3RW9A 4DREA 4W8GA 3SDBA 1TCVA 5F9MA 4N0PA 4EQZA 4XKJA 5THKA 3VKVA 3QVGA 4D7AA 1GRCA 4GOND 4PGAA 3H19A 2FRDC 4B5LA 4IFEA 3TB4A 1FFCA 1L8XA 1YJBA 4CW7A 1S01A 2GJ4A 1EDBA 1QG0A 1U7HA 2JI7A 4JL8A 4AM8A 1DV2A 1NYTA 1Z0UA 2H5JA 2VZEA 721PA 3UJ7A 4MV8A 5HPYB 3NPAA 1T8UA 1NBEA 2P40A 2GAIA 4OI1A 1DPGA 5GGYA 4YA6A 3T7DA 4BQQA 1U8CB 4X1YB 1VRWA 4IIHA 4PAOA 5AIAA 4X6XA 5KU1A 4BYGA 1ACJA 1P1FA 2VH1A 3ZDAA 3BMCB 5CJJA 1C9EA 3W3AH 5EWMA 3BWVA 5F2OA 1ILWA 1ZCJA 1Q95A 4C0WA 1XD2A 2UAGA 4G81A 1DWPA 1IY1A 2J7KA 1A9RA 1VLVA 4GOMD 2D1RA 2C9CA 1UF9A 4CCSA 3B70A 4S35A 2B8JA 3B52X 3EMDA 4DM3A 3K72B 4FMBB 2XV1A 1NV8A 4EGQA 4PFSA 2BF4A 1X80B 5FQNA 5HNKA 4BLTA 2C3OA 4WCDA 2RGBA 3TE7A 2B4TO 2XWSA 2PSHA 1S2NA 3O8OA 4KW7A 4LYGA 2WQ7A 1L0BA 3EGDA 2HPAA 2GWRA 1G8HA 1UOOA 3CC8A 3NDJA 1E0DA 3L1VA 1EVYA 3CRQA 4JP2A 1RYFA 4W6QA 1P7ZA 1KNQA 2DAPA 5EESA 3U4HA 5AW9A 3RUFA 2WWFA 4JGBA 1WXDA 3H4MA 1YAHA 1BS1A 3D3WA 3HKEB 3QPDA 3IO3A 4MW2A 3TKAA 4EKYA 2ES4A 1XZ8A 3PTZA 4HDCA 1V7QA 3OCCA 4N8DA 4E22A 2RARA 3QU4A 2GF0A 2OFWA 2R2AA 4J2TA 5K20A 4DUZB 2J9ZB 3NALA 4GX1A 5ANRB 3HJTA 1OQAA 5K99A 8GPBA 4BMPB 5GZ1A 1CBUA 1PGNA 1E5TA 1QQ6A 3UQYS 2JGLA 2HK6A 3Q6NA 2X22A 4I99A 4QPJC 4UHJA 3TLXA 3ROQA 2HSWA 2P3QA 3W9SA 1OZFA 2C59A 5DP2A 2I4TA 5B30A 1TK9A 4QOJA 5K8TA 1RQ2A 1WZCA 2QKYA 3Q7QA 1MFZA 4J43A 3U37A 4AKTA 3B1VA 1US8A 1K1EA 2CJFA 4S05A 1A77A 4DM7A 1NXOA 3LOQA 2XGSA 3MMXA 4JBXA 2ODTX 2OXEA 4MOWA 1YR9A 3VPGA 2NYVA 1CK4A 1XDZA 2QU7A 3EFBA 2V9PA 4C6TA 1CLEA 4N9WA 4XPIA 2GN9A 2WTBA 4TLMB 1CUWA 4BJ1A 4EY6A 1A0OA 5FX2A 5EIXA 1C3OA 1G21E 1GPLA 2Q2WA 4HDAA 4I4CA 4CM1A 1YS1X 4B6FA 1NDQA 5IJ9A 5JSZA 2NU6B 4DSNA 2GF2A 2A88A 1UT8A 2IXEA 2JJYA 3UHPA 1GG5A 3WDLA 1KEKA 5TGTA 1T0HB 3R3HA 4MWZA 4V38A 2JVKA 2BH2A 1E9RA 1ZVQA 2Y6UA 4MTCA 1HNWB 1QGOA 1T6NA 1UEIA 2Y2UA 2R5FA 2ZRAA 3A6JA 5EVJA 3ZHZA 4C5BA 3AV3A 4F97A 4RVDA 4XGKA 5EE1A 3BH6A 3HMQA 4G1EB 4J1TA 3GG2A 4NHEA 1I4LD 1KJWA 1ZW1A 2L0XA 3EAFA 3IPLA 5EIBC 3T6KA 4YC7A 4FYVA 1MHPA 2HA0A 2WJHA 4GOKA 4KCGA 5HDQA 5I4IA 4JJ8A 1NJ5A 3PC6A 1KR2A 4B3DA 4YCCA 1WU8A 5CB0A 1K2WA 3WJ1A 4BUJA 1RHQA 4F2HA 4ZHQB 3K35A 3RC3A 2PX0A 1JIJA 1UZNA 1VHWA 3FJOA 4E6PA 3HXOA 2OBMA 4MUNA 5TJ9A 1BN6A 3RS2A 1GXSA 3EISA 2Z3WA 4OMCA 4NBVA 3WGTA 2Y0CA 1YE5A 2FSUA 2MJLA 2W48A 3S99A 4AZ0B 5BOSB 3AM1A 4HI0E 4IZOA 1W6UA 1OI7A 4WKGA 1JI3A 4CIYA 3BD7A 3ENZA 4HLUC 3WTBA 3GFQA 4FMPA 4BDSA 5JWHA 4H7IA 4M1YA 3GI1A 1AVTA 1JQBA 3L8GA 4GLFA 5A5VA 4PNEA 3OF5A 3NRBA 1BW9A 1PJRA 4I8IA 3KQKA 3JYHA 3CTPA 2DLDA 2Z58A 4LJ7A 4O4HA 1EK0A 2XNHA 2ID8A 1WUKS 1ENYA 1IN5A 2JGMA 4JOSA 4OA8A 2X19A 3MGKA 1TW2A 1BE1A 1G9XA 1N3YA 1NJFA 2P3SA 3PFNA 3Q12A 1CZUA 2ZRNA 1F5NA 1ZO8A 4MDHA 1ESZA 5IJWA 4WXHA 1AQIA 3KSRA 4WUVA 4AVYA 2FWNA 3D6HA 3ENNA 3NQ41 4I50B 4FX2A 4TV8F 4JJ4A 4ZYWA 5KOJB 3GRAA 4MKHA 3BQNB 4W9NA 2IYSA 5H3LA 4F6CA 2CHVA 2PS0A 3L0DA 3QU2A 5TXGA 1UQUA 1GFWA 2FN3A 4UMVA 1SM4A 2HJHA 4F04A 4OU4A 4UBLA 3Q9UA 2AV6A 3K32A 3RC9A 1T2AA 4M37A 4TV9A 5H02A 3RVOA 4BNDA 3UMMA 4XI9A 3AKZA 3FDIA 2Q2NA 4AN1A 3LQYA 3Q2OA 1XI2A 1MA0A 3CNBA 2C7GA 4U00A 4ZQGA 1EQ2A 2W2NA 3HGMA 4PN3A 2NO6A 4WXEA 1T6YA 4ZV9A 4LMAA 5K05A 3G13A 5FAXA 4CKZA 1H8EA 1KERA 5IK2D 4RTOA 3A3KA 1LDGA 1Q0UA 3MCVA 4FGZA 4D8YA 4LKOA 3TSYA 5LU9A 1UFKA 4MQ6A 4LF7B 1CHDA 1E2MA 3AJRA 1X14A 4NJEB 3RVLA 4OHYA 1T4MA 1T9GR 2YYYA 4MGYR 3GUCA 2TSYB 2QK4A 2ZSIA 2DFLA 3QY9A 1KDRA 1UC9A 4QUJA 4RM2A 1GAEO 3CU5A 3B82A 3D64A 4QEZA 1Z06A 2PS1A 2W4QA 5EIBD 2FFBA 1GUZA 2AD1A 4QHTA 1E3IA 1SCUB 3AJEA 4R2KA 5JYEA 4LF9B 4BRUA 5C1DA 2VDMB 1PQPA 1H05A 4HQNA 1Y6RA 1SCKA 2RBKA 5DBGA 5T57A 4RUKA 1WBDA 2HKIA 4QEKA 3D7RA 4D44A 1PJTA 2RGRA 3OZGA 1X3LA 2GF9A 3ZDRA 3NAQA 1CKEA 2Z1MA 4HYTA 4BRWA 5CFMA 2BSXA 2WVJA 4LJ8A 7ABPA 4RDHA 4E11A 3TPFA 2LDBA 3B7GA 3FPJA 3W79A 1JPVA 4BMDA 3ZR4B 1BVHA 3KC2A 2XA2A 3DVSX 4LZLA 4JI1B 4ABTA 3QKSA 4BEBA 2DTXA 2O8EB 5IVIA 3RRJA 4C07A 2AG8A 2WEKA 5FWNA 1P80A 2Z43A 4HGNA 3BJIC 4KITB 3ZV7A 3T5DA 1U81A 1K3UB 1I6LA 3KT6A 2ZJ7A 1KVSA 4UBJA 1M1UA 2FGKA 2Y99A 1VCMA 1W76A 1JI0A 3AVPA 2ZI4A 4IL5A 4N01A 3W2EA 4P36A 3LL7A 1K5DA 1NV9A 1KAOA 4CU5A 1JAHA 2Y1OA 2QDKA 1VL5A 1KMHB 3CIFA 3HDGA 5IEJA 2Q1TA 4WXRA 1GGJA 1R4ZA 4LRQA 4HYEA 3ZWOA 4LVOA 3I2IA 1C3JA 2P0EA 3DL0A 3QNUA 4S04A 4OP3A 5CB4A 4HXFB 4CI9A 4MUMA 5IVDA 3ZWCA 1LSUA 2I55A 3EC2A 1FTSA 1MX3A 2H1WA 3GJSA 3AFIA 1Q14A 3EF3A 3JSXA 2GPAA 1K8ZB 1O94C 1ZXBA 4U5XA 2GLXA 3PNQA 2HDOA 2RGCA 3S0JA 3AVWA 4KRFA 1ADJA 4RK1A 4FCVA 4WBNF 2LWIA 1Z7WA 4PHGA 3FNGA 5BVHB 2H1LA 3BUSA 2P2YA 2G1PA 1A3CA 1GFZA 2QX9A 4OATA 4CNQA 1QYVA 5E6UB 4DG8A 2HQRA 3JWIA 3UHJA 4YWJA 4CIBA 1FFYA 4OHRA 4CE6A 5B3JA 4EB3A 2B99A 2D2VA 2JGKA 2EW2A 3N9IA 1IM5A 3R44A 1WXEA 4D46A 4XWOA 2FV8A 4P53A 1BU5A 1O8CA 2ZSEA 1T4CA 2IK8A 4HSEA 4RACA 4HWSA 4BZZA 4D9JA 4FVTA 2G76A 3MILA 1EHYA 4M38A 3DXFA 4JLKA 2ZLBA 3SEAA 4BASA 3RFVA 4YMLA 3TQOA 1X7XA 1Q17A 3HPQA 4K6KA 4CKWB 2VP2A 3SSOA 3VNUA 4DIKA 1IH8A 2OMKA 2RHGB 4L6CA 4RHTA 3W77A 2PUJA 3LX6A 4PC3A 2DFNA 2VPWA 3KZNA 1HE8B 1XEXA 5KNCA 1DG3A 2XVYA 1DAMA 3PFBA 3V1UA 1P4GA 1XF9A 1NXQA 3ZBQA 4J1QA 5HTKA 3RU9A 1N4AA 2W0SA 1OAOA 2VYVD 2W58A 3A4VA 5AI8A 4LRUA 2PU7A 1YHZA 1NUTA 2OBLA 4TKUA 3AKEA 2YOGA 2CMGA 1WUIS 3CKMA 1M2FA 3ETJA 4OEHA 2X0EA 1SRQA 4FINA 3RF7A 5K51A 1VL8A 2NIPA 3BHNA 1CY0A 1KMIY 1WXQA 4JLBA 1SXJC 3IKJA 4R01A 5CIWA 4B47A 1JRLA 1MXFA 3LM8A 4UJ3A 4B81A 5TT0A 3L93A 1L4GA 2E4AA 1GYQA 4Y1EA 4IIBA 3AT1A 5HKOA 2LZ0A 2IV3A 4AF8A 3SHWA 1FQWA 1PBNA 3OBBA 4BKQA 4BBJA 4X95A 3QLUC 8AT1A 521PA 2P65A 3B1YA 1P1IA 2WW8A 1RWOA 2W98A 1AUVA 4KWIA 4LDNA 5FI0B 2VN8A 3D7SA 3ONNA 3P27A 3M1LA 4KQKA 4E5UA 4JQYA 3FWNA 5DXJA 4N41A 4FDTA 4IHJA 4F56A 1QHIA 2IPXA 2BCJQ 2VZLA 4FMDB 3HBMA 4G41A 3FAZA 5CNMA 5C5CA 4ZHSA 5CFNA 1V8FA 1C0KA 3FNBA 4YPFA 1FZTA 4WTOA 1YIAA 4GOLD 4EMBA 1X7ZB 2WD9A 1W93A 3L7DA 4AQDA 5HIKA 3BFPA 4K9OA 3Q2IA 4X0EA 1CUUA 3TTTA 1AO0A 2NUPA 2Y9MB 1R0XA 1O94D 1QO0A 2FDCA 1TXGA 3HKDB 3INGA 1CPYA 1UBLS 3DBRA 4P3PA 3R9IA 3SYKA 1DDOA 4UAVA 3N0RA 2CJYA 2K4MA 2R48A 3VDMA 5KQPA 1CEYA 3GLFB 1RBQA 3F6YA 3JTEA 4LPSA 2VHQA 2QJRA 4JVSB 1ESNA 5DM70 2N3ZA 4INZA 1NLYA 2BI8A 3RREA 3AJ8A 2BFCB 4KHZA 2VWGA 2BM8A 4YRNA 2YWXA 3L7CA 4IEEA 5I9NA 2A9KA 4LWPA 1PL8A 3PVSA 2VEOA 4PVDA 1QHYA 5CB6A 2OSBA 1J2RA 4J4TA 1EI9A 1N3LA 1NMZA 1O57A 3BG5A 1C29B 3K8OE 5F7XA 1M6WA 4J90A 4MR9B 4W4TA 1V25A 1CUAA 3N5KA 3DYVA 1KE2A 1E2LA 3T7TA 1Y8RB 2QD4A 2QVYX 5BPFA 5J5AA 4PO8A 1QDEA 1QIHA 4XUGB 3FUWA 3SGLA 1NVFA 1ZGGA 4O2BA 2ZSBA 3R5FA 1C4WA 1TRKA 4DVJA 1A82A 4EEKA 4UXHA 5A4KA 4BMYA 4LRXA 3C3KA 1QCYA 3QF4B 5BWMA 3VH2A 4P93A 2JATA 3WADA 2GYWA 3O2JA 2GJAA 4OD0A 1G5HA 2WVGA 2H4WA 1G21A 4JP1A 1S8AA 4YECA 3KS9A 3ZGLA 4KUHA 3ZTWA 1ADGA 1SXJD 5JFTA 3ZK9A 4XE5A 4O59O 1C7JA 3HEAA 3M3PA 3NBAA 4LZZA 2FPIA 4YBRA 2EDAA 2W4MA 4G8DA 3V9PA 2IXGA 2FHPA 3LS2A 3N2EA 2IS2A 1KYZA 3CXUA 1YS2X 1E7QA 4C0QC 1FLVA 3ZDFA 1RXEA 3ENQA 1C1XA 2AEMA 5DASA 2Q9AA 1XKXA 3TAXA 2SBTA 3VR1A 4ZGWA 5JECA 2FSFA 4PZAA 4MS1B 1WHSA 4TM7A 4RKEA 2W8BB 2PV0A 2Z95A 1MIOA 4NCNA 3C5WP 4G8BA 4TL8A 1CUZA 1YQEA 4V0LA 4OM7A 4YJ3F 1U2PA 3MVEA 4F5WA 5L95A 3ABSB 3RH0A 1S7CA 2YNMA 4GG1A 2P5TB 5FOQA 3HS3A 4QU0A 1HEYA 2QTMA 4HWPA 5ALOA 1XDGA 4EMSA 3K1AA 1KGDA 1NNUA 3A1FA 4U9HS 5AOVA 2VG8A 2I3DA 3EXEA 4FXPA 1DP4A 3V7NA 4AULA 4JJAA 2G9RA 4NOKA 1YR8A 1N5MA 3R74A 3KP1A 4MKZA 2VATA 2CCGA 3PRKE 2ORED 2C57A 1UDRA 2X6TA 3FMOB 4MRNA 2FWJA 4UTNA 3EVGA 1KK1A 3AEKA 3LSTA 3UUWA 3IPAA 2QRVA 1SD2A 1I3CA 1Z8DA 1YS4A 3F9CA 3H5WA 4Z3DA 3WWDA 3MJTA 5K0NA 2O20A 2GT1A 1D6MA 5DB4A 2BR4A 3BXZA 4NFLA 1QCDA 4JDUA 3PU6A 4B6EA 4Z0TA 1M72A 1TC1A 2B25A 3NJRA 2JRLA 4GNRA 4X97A 3TJRA 4B6SA 3U6KA 3C8MA 1H2WA 3I3SR 1OWMA 5EIHA 2A5LA 1BEEA 3OLWA 4L5JA 2JVJA 3HCEA 1Q0PA 3RK4A 1K7SN 1RHJA 4XVQA 2C9BA 4TLLB 1M83A 3QIAA 1KHHA 3WLJA 1KKUA 1DBQA 2G09A 2VDRB 3AVVA 3O9VA 4Q47A 1S6YA 4LZWA 1YSCA 4A6EA 1ZYUA 2OV6A 2INGX 3JZAA 4ZVUA 3JAKA 5E1OA 4Y0NA 5IBQA 3MXOA 1Z4NA 3P52A 4OY3A 1TT5A 3K2IA 1PHRA 4EG8A 2VTEA 3SF8A 1A76A 3TZQA 4FE3A 1VJ0A 1NJ2A 2JEZA 4E0BA 1CRPA 3DMTA 1MB0A 1UIMA 5ESRA 3LHFA 3LC1O 1NXTA 4FOSA 4DWOA 2FCRA 2E4XA 3HVUA 3MF4A 5FOUA 5LZ7A 1W19A 3WLOA 4B4UA 4URVR 4Q5IA 4TT3A 2MYPA 2L18A 3QUBA 4O5OA 5I4BA 1CUEA 5A4IS 4BAZA 1OWOA 1XYYA 2VAXA 3CRZA 1BFDA 1ZAKA 1ZMBA 3LP6A 4MDFA 3A11A 4EB6B 1NM5C 4IVQA 3DWGA 3L84A 5AJXA 5C5EA 3TI9A 1Z2NX 2EZUA 2IPAB 1PL7A 4K2HA 1A8SA 2O2SA 4UZEA 3PQ5A 3P19A 2XCTB 3TKYA 5DGXA 5E6RB 4B4OA 4MIEA 1ZM9A 1UMKA 3I9OA 3OJWA 1JP7A 4D8VA 3TQFA 1GEGA 3KKPA 3MQFA 4LCBA 3HLYA 3T7JA 1ZUIA 4IIJF 4IDCA 4YFYA 2OL4A 2ZK7A 2MSKA 1YKSA 5JADA 2I7DA 1IU9A 2VT3A 2OD7A 1GPMA 4HKTA 4YP0A 5BN5B 1WSAA 2OGSA 4FGLA 1JXMA 3F4KA 3GFRA 3HVIA 1J9EA 2QP4A 4YBZA 3UO8B 1KO1A 2PYZA 3BB4A 3D8NA 3ILVA 3JVUA 1DBRA 3EVDA 4M60A 4EF5A 2HF7A 3GV0A 1DDIA 3E05A 2VBFA 3LQ4A 1I7PA 4FILA 2NYRA 3SQOA 2VYND 2HU2A 5LA6F 3IJEB 3VISA 2Y0EA 1FTGA 1G9TA 3S5UA 1UDXA 2PUTA 4AICA 4E13A 5EFZA 3RU7A 4UTZA 4EKNB 4M89A 1FS4A 2I3ZA 2OKGA 5TQ2A 3OU6A 5C18A 2AWOA 3OJ0A 5DCLA 5B3KA 1SCAA 3DEYX 2NX2A 1E1KA 1JJ7A 1MH1A 1ORRA 1RAIA 2XNJA 2Z8YM 3HR7A 3I5MA 3P2EA 4J9UE 1GPJA 1T0UA 3BK1A 4HGYA 1E6CA 2BHNA 4MVJF 4RV9A 3ZI4A 2CFIA 5B1SA 4DTCA 1O54A 1ZCBA 4HN2A 5G4KB 1YFZA 2CHQA 2C5EA 1Z6AA 2PZFA 2QTZA 2VLBA 2Z5GA 1DXYA 2JF0A 2QRMA 4BVEA 5AW3A 3WLAA 4R1MA 1VP9A 2LKCA 4Y2HA 4HVCA 5FTKA 2G0AA 1NBWB 2R86A 1UJ2A 2V7EA 2QYSA 1H2XA 3IAM1 4J3FA 1Q1NA 4R0VA 2CMHA 3GGSA 4FEAA 5KMGA 1LVHA 4PRZA 5IAOA 1ZIXA 1RR6A 3ZWYA 4ZI2A 4HFJA 1YU9A 4E21A 2XE7A 4EATA 3SI7A 2B2XA 2WG1A 4WT7A 5E3IA 2C7PA 3GU3A 2I4MA 4O2AA 3BSWA 3KTDA 3NRJA 5KNDA 5CPFA 2XDAA 2YMMA 3PHIA 4IYRA 3VO9A 4WFKA 5AVVA 1E3SA 4WJZA 5LQDA 1I4TD 1E8MA 1K89A 3GX1A 3Q0TA 5FORA 4XRGA 4FWTA 5DHQA 1GQOA 2C9MA 3E4DA 4GSLA 5HS4A 4ZCRA 1U7WA 2VDNB 3WLKX 3IFSA 4MITA 1RMTA 2JFYA 5TEWA 3B2NA 3TW8A 1C9JA 3NEAA 3NORA 4DR6B 2QQ5A 5D51S 2XAUA 2YCLA 5LZ4A 2QM7A 1GGNA 4BXOB 1XZHA 3Q9SA 1RWXA 2C4HA 3CNNA 4DN6A 4RA9A 5JRDS 2OENG 4DF3A 4DJ5X 2XUAA 3SXUA 1BH6A 1X1SA 5KAMA 3MWKA 1U28A 4AS2A 3G9XA 3GFFA 3R5XA 1KOJA 1ZUNB 1C3XA 4B7CA 1XCPA 3OUTA 3GGDA 3WWOA 4DHEA 3M83A 3NT2A 1MP0A 1NIPA 1K3TA 2HRQA 3NWEA 1OR8A 4JT8A 5JH7A 2QQFA 1MQSA 5FAKA 5TLSA 1LX7A 4YXWD 3EVFA 5K0CA 5KDOA 1E2IA 2LDXA 4WK0B 2R8BA 5DXFA 4QFCA 4FYIA 3EIQA 1EUDA 1VCHA 2B20A 1PV4A 2D5IA 2NO4A 2PGNA 3FCYA 3BFXA 2GAAA 3MLEA 5CW1A 4C7BA 3QFHA 2CXTA 2F00A 2FG5A 1RI4A 2PL5A 2QTGA 1NHWA 2LRHA 4YLEA 4LRYA 4QT0A 4FHZA 2ZJ2A 1U04A 5LMCA 3OZDA 1FZQA 1SO8A 3NM5A 3AUXA 2IOYA 3E9QA 1GFIA 1AQUA 2UVPA 5JHGB 3LQQA 1AKQA 2Y1CA 3I62A 4C3VA 3OCXA 2ZE8A 2QIOA 3KKKA 3WLTA 1I9GA 5KNBD 4ZIRB 3AKYA 4TTAA 1Z37A 1NXXA 2P1ZA 2PJUA 2PNFA 3WLQA 3CW2A 1PJ8A 2ZG6A 1E0SA 5C34B 3DAFA 1KDZA 5C0OE 3OE5A 5TRTA 3RTDA 4TMFA 3LYLA 4WZAA 4ZJPA 4W5HA 3H9JA 3A6DA 1AQ6A 2Q9UA 4XUCA 1LY1A 3ZWWA 1MD9A 4JZKA 1MIHA 4JC8A 1OWNA 2IPMA 2IEYA 1Q92A 1TEVA 3PNVA 1D0IA 3BGWA 1WUJS 4JYPA 1D2NA 4LV5B 3UTCA 4B2IA 4EUSA 5C1OA 1NOKA 4HD8A 1Y48E 2WSYB 1L4YA 5C81A 4WIAA 5BR8B 1VG9B 1M1YA 1P5JA 1Y4AE 1MRNA 1RIIA 2Y68A 1RXWA 2NTEA 1X42A 1Y1LA 5FL7D 2H00A 4TYYA 1U8FO 5HKBA 2DOKA 3EDOA 1E9CA 1ZQ9A 3FJYA 2PKQO 1L7RA 1T4DA 1F3OA 4U2FA 4AMVA 2OHIA 4PG7A 3SHQA 3RKUA 5ALYA 4OAQA 1WU7A 3NBQA 1SHKA 4IIXA 2C9OA 2REOA 1RPJA 2QTLA 2Z1DA 4AU1A 4EPYA 4WNIA 3FLMA 3MWJA 1M2GA 3DR3A 3ZXYA 1QS0B 3FSEA 5F2KA 1WVIA 4N3CA 5T3YA 4DXAA 1SVLA 4OSPA 3RSHA 4J6EA 3T15A 5IANA 4MV6A 5SZJA 2XXAB 1U7XA 1J4AA 2FLKA 3CNHA 1T5SA 3UWDA 1ZH2A 4H60A 5LOVF 3HI6A 3L7AA 1L5GB 2NZWA 1X7DA 3IPXA 2FI1A 2QB5A 4FCWA 5I3CA 5CA1A 4EY4A 3O74A 2RFLA 2V3VA 2ACEA 1HBJA 1VB3A 5ICEA 4RVUA 5FPHA 3SAJA 2BMAA 4BN5A 4BYMA 2IQIA 1ZBDA 3LK7A 2ZRDA 4PGHA 4L16A 2CDAA 1YUNA 4QHYA 5DNEA 3FOBA 4BO7A 1U65A 4F93B 4JZYA 4Z2YA 4G5HA 2WLSA 4H0NA 2P78A 3O9ZA 4XCQA 3QFRA 1QYWA 3SHVA 4XM0A 4KO1S 4DGSA 4X7BA 3TLZA 2GXQA 5LP6C 4B87A 1P0MA 2E3JA 4KXWA 4AX8A 5T41A 2L2QA 5ALVA 2BFBB 2RKBA 5EP2A 3N86A 3R7NA 3T3PB 3A6GA 3FSGA 1IOWA 3MJ4A 1A98A 1X38A 3ZHTA 3IESA 1QE3A 5DNUA 4N5NA 2H51A 3JWGA 3BDAA 4Y1GA 4UW9A 1C9DB 2H4JA 1Y4SA 4IXWA 3A6HA 3GGJA 2HIGA 3BS4A