3L41A

Crystal structure of s. pombe brc1 brct5-brct6 domains in complex with phosphorylated h2a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
KRVYITFTGYDKKPSIDNLKKLDMSITSNPSKCTHLIAPRILRTSKFLCSIPYGPCVVTMDWINSCLKTHEIVDEEPYLLNDPEKELELGCTLESALKRARAQGPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCSTLNVYNKRLARHLEDGNVVLITCNEDSHIWTNFLDNASQNKTIFLQNYDWLIKTVLRQEIDVNDRIADEFARAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title gammaH2A binds Brc1 to maintain genome integrity during S-phase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
molecule keywords BRCT-containing protein 1
total genus 75
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l41A01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3l41A02
3PC8A 3AL2A 2EP8A 3I0NA 1T15A 3PC7A 1L7BA 2EBWA 2AZMA 1T29A 1Y98A 3COJA 3SHTA 1IMOA 4Y18A 3L41A 1OQAA 3PC6A 1GZHB 5ECGC 3II6X 3EF0A 2D8MA 3K05A 3SZMA 3K16A 2COKA 4ID3A 3PC8C 2INGX 4BU0A 1CDZA 3OLCX 2VXCA 3AL3A 4BMDA 2ETXA 2E2WA 1IN1A 2WT8A 2ADOA 3JVEA 4IGKA 3UENA 2M2IA 3PD7A 3HUFA 2COUA 4N40A 3QVGA 3FA2A 4XQ0A 3PA6A 1N5OX 3SQDA 3T7KA 2COEA 3K0KA 2R1ZA 4U4AA 3K15A 3PXBA 2HTFA 3T7IA 2JW5A 1KZYC 1T2UA 2NTEA 3EF1A 1L0BA 3I0MA 3L40A 1Z56C 4IFIA 3PXAA 4OFBA 2XNHA 3U3ZA 3T1NA 4JLUA 2EBUA 1JNXX 2K7FA 4BMCA 3PXDA 4XPZA 1WF6A 2XNKA 3QVGB 3L46A 3SHVA 2K6GA 3KTFA 3PXCX 4BU1A 3UEOA 2VXBA 3PXEA 3T7JA 3HUEA 4Y2GA 2LE0A 2DUNA 3K0HA 1T2VA 2L42A
chains in the Genus database with same CATH superfamily
3A31A 2ZJ5A 2VDLB 2C4UA 4MQ6A 1P5RA 2W2MA 3PKZA 3M2PA 1AXGA 1N2CE 5B1IA 3Q88A 3VGPA 2FOXA 3VOAA 5D5HA 3MTIA 4DV2B 2SCUA 4YRFA 2Y6UA 3SF0A 2EV9A 5KSPA 3MF4A 2E7ZA 3OESA 3PFBA 2XUQA 1A7KA 3JQFC 4XRGA 3VR4A 3U7HB 4Y9TA 1E1RD 3G8BA 5AJYA 1Q14A 2WAYA 4Z4FA 3AYXB 3K9GA 4L3WA 4D9FA 1L5MA 5HBRA 4I4TF 1H2YA 1QHNA 4RK0A 3STVA 3ZCRA 1WCWA 3DCIA 4PYQA 3GIWA 2ZIAA 1B4DA 4EBFA 1Q19A 2A6PA 5IASA 2VAXA 3H1FA 3SVTA 3DVAB 5KQGA 2CMDA 2CLHB 3G6KA 3L3BA 1ULAA 4PLZA 3SI7A 1YTUA 2WILA 4IEIA 4I36A 4ALNA 2VUUA 4S0XA 3F78A 4Q1DA 1RLTA 1IIRA 1SCUB 1FNBA 3U4GA 3D8BA 3VOTA 2OHHA 1FQJA 4BN0A 5HBGA 2XCSB 1WCV1 4UU1A 2PBZA 2AWNA 3H2SA 3MMPA 4I6GA 4QDJA 4RVOA 5AK3A 4TL7A 4ZCSA 1OA1A 1XDSA 2CCJA 3M83A 1BJTA 5GPBA 5HOEA 1X39A 2IIVA 3AIOA 1BNCA 1N0UA 1ZEMA 3EPRA 4QXRA 3TTXA 2JJ8A 4A26A 2UZ0A 5DIFA 1IN7A 1MG5A 1IIBA 3FF1A 4R0NA 1T36A 3VO9A 5TQ0B 1IY1A 4C30A 3LXRA 3UQZA 3JQQA 1SC3A 3OBBA 1OI4A 1DFIA 4B3CA 4YMIA 4B35A 3AM5A 3HJHA 4HXFB 5FL7D 2CLIB 4UBIA 3CF4G 1G19A 3C6MA 3D8NA 5B37A 4DYDA 1IOWA 3KM0A 1PG5A 3KOMA 3D6NB 1XELA 5J4HA 1Z34A 3OLYA 3Q9NA 1G0NA 5CAEB 1QE0A 4KXNA 1YJXA 4LMAA 4C01A 1COWA 1Q1QA 1TCBA 1RJGA 5AM4A 3NHLA 1TQDA 2C5BA 4MUAA 5J1TB 4CFYA 2Y9MB 3JQGB 2UYCA 1RQ2A 4XKJA 5K8VA 2FAXA 3ENWA 3EOBI 3FPLA 4AY4A 1YJAA 3K2QA 1P2GA 3QUCA 2NUBA 2WJYA 1TO2E 3KZKA 3G0OA 3K9BA 4ZT4A 2JRLA 3BUSA 3THYB 1QVWA 2CVHA 4MRMB 3TMAA 1FYEA 3QU7A 4H77A 4JYMA 4XX0A 2DU8A 5ER9A 3ZHQA 1R4AA 3DKVA 4R6WA 2ZI9A 4RIEA 5B1SA 5FOQA 1J5EB 3H4MA 1SU6A 1NI4B 1QP0A 4LKOA 2GERA 1JSLA 3E0QA 3R8XA 5G41A 1HZZA 1YS7A 1PNVA 3H1PA 3NZEA 4DMHA 5BN4A 4Y1EA 5JNWA 2VRWA 2UYQA 3IEMA 1GILA 3HJCA 4OAQA 1C4WA 3UHJA 4NXNB 2H1CA 3T1HB 4MCIA 4TZKA 5HE9A 2OHOA 3UAVA 4DEXA 2B4QA 1M2FA 4MQBA 4PFJA 1DAHA 2A33A 2A5LA 4W5TA 3W5IA 4J0HA 3HCWA 5IM5A 2X4IA 4YV1A 1X8LA 2EKLA 4IRUB 1BA3A 2GBCA 4Q24A 1QX4A 1W1UA 4F71A 4H60A 1OJLA 4ZAWA 5AW4A 1GG2A 5GV8A 4RLFA 4YH1A 2QTNA 4GLJA 2HA2A 1R0LA 2VZ8A 5CA0B 3WWPA 4A92A 3U3MA 3IUQA 4OJKA 3LRXA 4JU9A 3N0VA 4KYUA 1BDHA 1K8YB 4KIGA 4TLAA 4JGBA 2ECPA 4Z5XA 3LRTA 3N05A 3K32A 1YB5A 1A77A 4PHGA 4E0BA 3AF6A 1G64A 2UYOA 5E1OA 1RXSA 4LJ9A 2JG3A 5BOSB 1T1JA 1IY2A 4IHJA 4LYAA 3AM4A 5F1YA 1J25A 3T06B 1UJ6A 4HQFA 5KSOA 3GVPA 1WS6A 1D4FA 5TEWA 4YT8A 4YJGB 5DCYA 5KWSA 3GJ7A 3KOWA 4MCHA 4DXDA 2QY9A 5AUQA 3NIBA 2CLMB 4EOGA 4JLPA 2G0TA 4MYTA 3FUVA 2JD1A 3SC2B 3P9XA 2ZJ3A 4BJHB 3OLQA 2J5XA 4LDAA 4UFOA 2ZBFA 3ZU6A 2H63A 4PLPA 4REMA 5EHQA 4EB6A 4DDTA 4UU0A 4HFRA 1VCMA 2AH5A 3U7FB 3VQTA 3H5RA 5GJCA 3CNLA 3DEFA 1EGVB 1QHGA 4E4TA 4ZV4A 2A92A 4P80A 4C0SA 1J0DA 3G8CA 1M2OA 5EJMA 3T52A 3NH6A 2P62A 4XWKA 2Q27A 2R5WA 3V8PA 2ZSJA 1BEUB 1WP9A 3R1IA 3E9RA 4KFRA 4V02A 2JFYA 3HL0A 3RUPA 4XSVA 3CRMA 1UJ4A 1AUXA 1Z5NA 4ZVUA 1ZW6A 1RCFA 5H81A 1PDOA 3ZS9A 2LRHA 3AHHA 4NEHB 5FPPA 1T3HA 1QH8A 2QPOA 3OUZA 1EXVA 2VP3A 3DSRA 3H1TA 2G1JA 4QTZA 2WSIA 4LDQA 4P4SA 4KRXA 1ZN7A 4TQAA 1O0CA 3A70A 1JH9A 5GZ1A 4IH1A 4YRCA 5K0LA 1TIBA 4RPKA 4B6JA 1CUYA 3RS8A 1ZA1A 4OQMA 5TGZA 2EEZA 4EEZA 4TMTA 4AX8A 2FY8A 3TJMA 1E2UA 1BWQA 1NXPA 3CPJB 2FR0A 3EAFA 2E0IA 4MVXA 5WRFA 1A9QA 2Q6TA 2XZPA 4QYWA 4L4RA 4NENB 2AOVA 4Q7MB 4RZSA 4D0GA 4D0SA 3HBJA 3SCZA 3RUDA 1MA3A 1M6EX 3TIFA 3K30A 5JLJA 5I51A 1C1XA 3CJQA 1P4GA 1Z5VA 5CFOA 2I67A 1CV2A 1A97A 3L0OA 3F6PA 1SZPA 1S1MA 3NTXA 4JEIA 3WSVA 1QS0A 4QJ3A 1GXSA 1DEKA 3V8EA 1Y8ZA 2WB4A 4MWOA 2H48A 4IIVA 2GETA 3DLTA 3X2EA 4TMZA 4KHPB 4C03A 4KMSA 1JMKC 3R74A 1W85B 2DUNA 3ES9A 1MDBA 2P67A 4EYQA 3O95A 4ZEVA 1TGVA 3I5MA 4G5GA 4KXLA 1GTG1 5D1NA 4Z3DA 3PNPA 2EIHA 2Y71A 5L3RA 1E3LA 2OUIA 3G7NA 4CQNA 1E20A 2EP8A 4V0LA 2N75A 2NIPA 4RDXA 1FEZA 2FZVA 1PVVA 3MWEA 2IQIA 4QKQA 4LVNA 4TMWA 3LSYA 1IZ9A 1QVRA 2BEWB 3CY6A 2X15A 3I6BA 4AX4A 3CSDA 3A6DA 4YIKA 5IEJA 2C9MA 2P9GA 5L4SA 4MB0A 1I5RA 1U0FA 3DKRA 3EWNA 2ORED 4H1TA 4J3JA 3L6EA 3X1DA 5CA1B 3UB2A 3MYYA 3D2CA 1FMJA 3RCBA 2HIGA 3ELUA 1OYVA 5K2MA 1EVLA 4K9SA 1XKTA 1WLYA 4PCAA 4LOAA 5JPDA 1BGXT 2G08A 3GRKA 4NXMB 1CDOA 1DFGA 1JPVA 4LNUA 4TLBA 4BAGA 2CXRA 4EKYA 3M4ZA 2AN4A 1BE8A 3EFOB 2D1YA 3FH0A 2D0DA 3QPUA 4U7WA 5FBLB 4FN4A 4KYIB 1LBIA 4MWSA 5ALGA 4COOA 1EESA 4KO1S 4ERXA 4G5HA 2DCMA 1IAVA 5KREA 4NNJA 1PT5A 2AV6A 3UAGA 3ZK8A 1PX0A 2I6GA 1PZHA 3INGA 2QQ0A 4HDNB 4Y2PA 2A0XA 2IZOA 1Z16A 1YZUA 3A9TA 4EABA 1G21A 4B3GA 1YR8A 4W4TA 3ZQJA 1VA5A 1X1RA 4FXOA 3NVKI 4KNVA 3ZWCA 1MAVA 4HDMA 4PPGA 2FWIA 3BRCA 1JDBB 2WUFA 4PINA 4GI3A 1ZUNA 4P93A 4IPTA 1ODFA 5JYBA 2ZU0C 1ZMBA 4MV7A 5FBWB 3WMXA 1CJBA 2ILTA 3HGQA 3LK6A 3NFYA 1R9GA 2NVOA 4CVNA 1QJ4A 2QTMA 5KTOA 2CD7A 2HWYA 5I9MA 1PR4A 4LV5B 4ZCRA 2ODNA 2AW3A 5JMOA 3V33A 5B2ZA 4ZN6A 4J1SA 4DJTA 1ZR4A 4N5MA 5KCMA 3LTNC 4G84A 1U3UA 2C8LA 4IMIB 4QELA 1D03A 2J1LA 4KRYA 3K0SA 1LK7A 4KSYA 4LHVA 4PFKA 4KX3A 2IH5A 5HTKA 4KXQA 2O3UA 2ZZKA 3PX2A 1A5SB 4DL9A 4O08A 3C6BA 1CJVC 2PRYA 1J8VA 2IDJA 2PO5A 1C1DB 3N2KA 4AO8A 4BX2A 3KRTA 1QZTA 3M1LA 3QUAA 4WE3A 4DR7B 3AKEA 2FFRA 4P9NA 1TVCA 1MG0A 1U02A 2X6RA 4KMOA 3IRVA 2OVFA 5JAPA 5JS1A 1JQDA 3G8AA 5KJ6A 1T5IA 1NFFA 3JZIA 3RSCA 1E18A 2PRJA 4O63O 2NU8A 4KCGA 1X14A 3H5IA 2HN9A 3ZY3A 5KOIA 4YACA 2Q2NA 4DA4A 4U9HS 1XPOA 2WZCA 1YRHA 2IYFA 5L7WA 1PR2A 2HO4A 4MW7A 2JJQA 4Q12A 3MS4A 3E9QA 3IPLA 5I8WA 4WEQA 3RK1A 5HM8A 2J45A 3KSRA 5CGZA 2Q49A 5THKA 3CLTC 2D4AA 1NVGA 1ABBA 5KQPA 4YR9A 3LOUA 4Q4DA 4YP1A 5F52A 5LOVA 4UQPA 2JEYA 2VDWA 3F1LA 3GIDA 4HNUA 3K96A 1NPDA 3MTJA 1W36D 2AEJA 1A3CA 2VPTA 2YYSA 5JCJD 2JHPA 4LXIA 3I2JA 1H8ED 2YVKA 4KWTA 2B7CA 3ASZA 3GQVA 4TZTA 1RNLA 4F7DA 1AB6A 1X15A 3S2FA 3F7OA 1HK7A 2ZJ4A 3F67A 1L3CA 5DTQA 3I4FA 3K0CA 4ZOAA 5BNWA 2NX2A 3KUXA 5KWVA 3VYRB 1PVOA 2SICE 2B3DA 2ZJBA 2VP6A 1Y3CE 4UU7A 1JQJC 2PWZA 1DC7A 1M2KA 1ONSA 1DIAA 2ZRFA 1NLYA 1A2BA 4MPPA 1F0KA 2HRDA 3H1BA 5I01A 5T57A 1N2CB 2XWBF 4PO8A 1Z39A 2AI1A 1QXSA 4QQRA 5ALTA 2H54A 3A27A 1DADA 3FUCA 2C4WA 5CM8B 1GQ2A 1T35A 3BAZA 4J8PA 1YB4A 2ZT5A 3AI3A 4M9SA 3EQZA 4V0KA 1MW9X 4F2HA 4DNXA 1PFYA 2YXEA 1Z06A 4MWGA 8LDHA 6ADHA 3DF7A 5DHFA 1ZM2A 4JP3A 1BCRB 3WOVA 4XFDA 4JUCA 3A58B 4OHMA 4OL9A 2BJWA 1ADJA 2I7VA 4RGBA 4JVMA 5ALWA 4A0RA 3FVRA 5ECWA 4LV6A 3GDOA 1E1KA 1XJCA 1Y81A 1Z5PA 4ZU3A 3T5AA 3B8HA 2VS1A 2XCRB 2ZBEA 1SFRA 4BLTA 3ROKA 3DEYX 2CW5A 4F93B 4OX9Y 3UJBA 1KMQA 4I5GA 4OOEA 2E1PA 3OIFA 1YR1A 4WH0A 3RR2A 1FP6A 1ZSVA 2JFHA 1IHXA 2ZXFA 3ZU2A 3K0FB 4YR7A 2QG6A 3GUVA 1WCXA 1JMYA 2YZ2A 4Z7NB 3ZUPA 1MX9A 1KK3A 1J09A 2PH5A 3M1AA 5IT0A 2AQHA 2LNDA 5K3FB 3UMFA 1RLMA 2Q3FA 3NC4A 1INLA 1XQYA 4E6EA 3OPYB 1PFQA 5JFGA 2IV2X 1RZRD 2IS2A 2EIXA 2R2AA 1ONPA 2W2QA 2A7QA 2G6TA 3CIOA 3R5SA 4NFSA 3K8ZA 1NURA 2WOOA 3AFMA 3PNSA 2PKRA 2Q0XA 2XWSA 4KREA 1LQ2A 5FOWA 3N9IA 4L6CA 4K9LA 2V6JA 4UTZA 2L82A 2ZRGA 4D3DA 3ANMA 4EJSB 1ZNZA 2E4XA 2IXEA 4YFYA 3E48A 3VMMA 5IKPA 5HW0A 1OYOA 4DV7B 3QQPA 3B3JA 2W43A 1E3WA 4FS8A 4ARVA 5JNUA 3PRJA 1QCCA 1QIEA 1XZFA 4BB0A 4LCEA 3GBVA 3L0ZA 2YIJA 3I62A 1GYQA 3E9DA 3AW9A 1SCUA 2OV4A 4LK3A 4ZAYA 4UTNA 1GR1A 1YS4A 2WD8A 4EUKA 5EZYA 3UGTA 2DPMA 1KJNA 3PHLA 5DM4A 1SQSA 1Z07A 3BIXA 5C32A 3TDMA 3BD6A 3AUUA 3MUOA 3WGUA 5KYYB 1KZ9A 4LTMA 4TMXA 4DQVA 1QQ5A 2FXIA 2IDZA 2PGOA 5I47A 4DR2B 1Z6AA 1HPLA 1ZHFA 2GHRA 1LTKA 2X8LA 2QM7A 1BU8A 2Z57A 4F5EA 3PFGA 4BWVA 4YRAA 4AM8A 2IELA 5HRCA 5BUCA 1Q95A 3P97A 4MEAA 4E4RA 3FTEA 4RD3A 2QAGA 1QV6A 3JQCA 1V25A 3IDOA 5KHLB 3EGEA 1BE0A 2IXGA 1KEVA 4UM7A 1ZD9A 3KQPA 5TB5A 4IVQA 3VHLB 4D3XA 5A5VA 1QYIA 4NSNA 2ZJAA 3BB3A 3HWRA 4AUKA 3LUBA 1I2ZA 1TQ6A 1CUIA 2ST1A 1YGPA 1LI4A 3UMYA 3NBXX 1XPJA 4ZCIA 3EXHB 3DE4X 3ZCQA 3TS1A 3UV6A 4I50A 2R1TB 2PA0A 2POCA 1LY1A 2B8NA 2QYHA 4MIEA 5JNLA 5IM4A 2GK6A 1N8TA 4R1QA 4QFCA 4BX0A 1SVNA 4PLWA 5JEDA 2GD1O 2QMUA 1D07A 4L5YA 2BBTA 2DFNA 5ALDA 1TEXA 3AXSA 3IV9A 3KZVA 5ALVA 4D8UA 4FOTA 2KX7A 5JSYA 3K7EA 3L8FA 1DHTA 5IAEA 1RCUA 4DG8A 1VRVA 4F1WA 5A3VA 2YFYA 5ALLA 4AFNA 2Q9BA 3V4PB 3WGTA 5K3EA 2AMVA 1N25A 2YWRA 3K9LA 3OZDA 2CWDA 1GKUB 1U0GA 4QECA 1N2GA 2GGSA 1VLLA 3PHGA 4TLMB 5A71A 2FW8A 2Z3WA 2A3RA 1NW4A 2IXDA 4C7XA 3WK4A 3ZNNA 5HS4A 4DCOA 3LVFO 1VCNA 3M6IA 5AJXA 1WRBA 1EEXB 1FDUA 1VPLA 1XMPA 3BD8A 3LQRA 3NLLA 4YRMA 4JC0A 3VJKA 2XR1A 4JI1B 5FTKA 5K3DA 4LX8A 3U7QB 3D31A 3DBLB 3PT9A 4MZDA 4GOND 1ZIXA 3HYRA 3V1UA 4PC7A 3ONEA 1A7AA 4FYJA 4HNAA 1RQXA 4TYPA 1PZEA 4YQFA 3VDQA 2VH5R 2GN8A 4Z0PA 4YAJA 1T3TA 2XA2A 3IPAA 4PYLA 4NESA 5A4AA 4FE4A 2IA5A 3DYIA 4MR8B 3I9KA 1TGYA 3A6HA 2PRKA 2RJOA 2ZYWX 4NL4H 4XOIA 3OP4A 1S2OA 5IKOA 3RUAA 3FY4A 5J2UF 2O8NA 1QQ7A 2WT8A 2CYBA 2DBZA 2MT9A 4QDZA 1GUFA 1PJRA 4XEUA 5KQSA 4QTYA 4YUXA 2VZ0A 2Y6VA 3OC6A 2GD0A 2XEXA 4UMEA 2Y1XA 1OZ0A 3ZJYA 5H82A 3GFTA 1PT8A 5HVNA 4RTLA 1ISMA 2PSDA 4X62B 1Y1PA 3CSSA 1Y3FE 4FOSA 3QIVA 1H69A 2OAGA 4WD3A 4LDPA 1KRXA 4H59A 2IYPA 1T43A 1ZL0A 2PWBA 1YJCA 3H5NA 4G0ZA 4BLPA 5LYJF 4MEJA 3UWSA 2ID4A 3E9YA 2PMWB 4RJLA 3PT5A 2CLLB 4YO7A 3B89A 1V16A 3I92A 1NF2A 4ODIA 3U17A 3I8XA 1CUZA 2DPXA 4TV8F 2PLAA 1K68A 4GD3Q 1AO3A 1SULA 1GPDG 1T8UA 4DCSA 4A2QA 4Z4QA 4RZ2A 1HT3A 3HKDA 1UPUA 4KN5A 4D9GA 4XJTA 1WY7A 2GKGA 2ODEA 1V9SA 3B9PA 4NHEA 1IN6A 5JTTA 4JZKA 4QBTA 1ZIPA 3PC4A 5FOVA 3CONA 2QIOA 1EU1A 5DX1A 3NUGA 1DI0A 3STWA 1ARZA 3IQWA 3M1YA 1E6CA 3Q9UA 3OE4A 2AOXA 1MJGM 4BGIA 4Z6KA 2Y0DA 3T3OA 2ZVQX 1HTTA 4M89A 3SYLA 2OZPA 2VJLA 3IAM6 4C1BA 1X7GA 3M3PA 4G41A 5EJAA 5IPFA 4DRYA 1U7DA 5CX1A 1DVRA 1F2TA 1VE1A 1XKQA 2WVGA 3EGXA 4XASA 4D98A 3WYCA 3J81k 4I4LA 1U0JA 2FPKA 2SECE 3KXKA 4W5HA 3IE1A 2O0LA 3AY7A 4RHUA 4Y9UA 2D62A 4E08A 1E7MA 4O1IA 3VR2A 3W2EA 5LQCA 3IOYA 1H1DA 4R7TA 3CF0A 5U4QA 2DLCX 1M1NA 2JVIA 4AROA 1JYFA 1V5FA 2C2MA 2CL0X 2W8ZA 3BSSA 5H7XA 1XZIA 3CBGA 3TE7A 3TZCA 2DXIA 2HSDA 3SIPA 5HCNA 1QG2A 1XAGA 2KLBA 2NGRA 5DGIA 3VVBA 3RRZA 3AR3A 1WV0A 4KRGA 4LMPA 4UEJA 5F5NA 2IPAB 3VU9A 5DOVA 1DEOA 4WOJA 3KLNA 3EXHC 2NVWA 2OK7A 4OHRA 4YCBA 3TXXA 2H1WA 3ML1A 4F5ZA 5LOVF 2WV9A 4NFYA 5EQFA 4QG7A 1U28C 3MTBA 3D5EA 2R6R1 1CR2A 3EC2A 3E9EA 1YNSA 4HPWA 1YR6A 2Q2QA 3LY8A 2FPRA 4Q05A 1D2NA 1BYUA 1VFPA 1TQ2A 4RTOA 3QBEA 3K73O 5A06A 3BJIC 1Q1BA 3GA5A 2IHJA 2R6AA 3AZQA 3IAUA 4EZIA 2PK3A 4K86A 5DBFA 3TOZA 5DLPA 1QK5A 3P2JA 1WZIA 1V8ZA 3VPAA 4F4UA 3ZCXA 2FMKA 4H4EA 1UBHS 1BHQ1 1ONNA 3BSWA 4Z1MD 3BCRA 1W5FA 4OFWA 3GLIA 1XRNA 3PX3A 2QIPA 1MABA 1E1MA 4OK3A 2C5GA 1CUSA 1P2DA 2VYVD 2ZPTX 3EHDA 3OT1B 1KO5A 1XTBA 5KYVA 2OCGA 3QUBA 3KPUA 2FR1A 1MENA 3FI0A 1NQAO 4R8VA 2WLSA 5ALUA 4D57A 4AQYB 5KS2A 3P9PA 2CJWA 1G1AA 1LLUA 4XQGA 1O9BA 2PS0A 3ZUGA 1EWVA 3KOZA 1T4CB 5C9ZA 2ZJOA 3FLAA 2X9GA 3PIRA 4X1YB 4D8YA 3D6FA 5HR5A 1GZSA 1NF9A 3WAGA 2ZYUX 4GSLA 4WA7A 1MJHA 2ZRAA 1QHFA 3RW9A 4E3WA 4ZHSA 5LJLA 1WMDA 2LKDA 1GA1A 3LBIA 2PN1A 2Q0SA 2QSUA 5D01A 4ES6A 2JK0A 2HW8A 1N0WA 1QFZA 3OAAA 1FYVA 1RVV1 5HQJA 3VV3A 3W5VA 2QLTA 1VPDA 1EAYA 5KMGB 3U6KA 1H2EA 4Y2QA 4CFSA 4N6GA 1NW8A 3LBNA 3ZBQA 2RGNC 3K5WA 1NVKA 2XADA 3NKFA 5B57C 2NSJA 4QO7A 3MWKA 4X97A 1DQRA 5G1PA 2EF1A 2J59A 2FWJA 2YWDA 4KPUB 1AGRA 3QMPA 4MCAA 3OE5A 4FX5A 2XT6A 2DKOA 1OB2A 2O1WA 1B7GO 5A1JA 1CD5A 5B30A 2ZIUB 3IPRA 2HV9A 1OFHA 4Q4HA 2X8BA 1CEYA 1N7JA 1OILA 3A1TA 5LQDA 2IHNA 3IT2A 3KYCA 2HF2A 3AR2A 3EEQA 3JQ7B 4UHDA 4MROA 4KITB 4QGAA 3L4KA 1P29A 1PV4A 4UXHA 3IUJA 3CB2A 2QXYA 3KKEA 4KVAA 3WA6A 5DM70 4CEJB 1JKXA 3LKVA 3QLVC 1E6EA 1M6YA 2A0FA 5KU7A 1X7ZB 1OAOA 2V74B 1UDRA 4PYJA 4K9NA 4RE5A 2QSZA 3WL7A 4WIAA 1W35A 2DPGA 3BXOA 1TKBA 1RIIA 3LD9A 1Y3DE 4LSZA 2P2ZA 3QPWA 4YRRA 1IPFA 3AI7A 1PJAA 1CZHA 1KP2A 3TW0A 1ILEA 4LOJA 1WG8A 2DULA 1CK4A 2BGIA 1AB5A 1GFIA 1WKVA 1XDWA 5ES4B 2HHHB 2OQRA 4W5QA 2FQWA 2Z83A 2QL6A 4GXTA 2Z5FA 1R8SA 5ED0A 1TIKA 2O7SA 3P2KA 2C5EA 5D87A 2ZIWB 4A6PA 2XVYA 1GSIA 2WAXA 3ENVA 2I55A 3QYPA 3HU3A 3TPCA 1YDWA 3EW7A 3EDMA 2UZ4A 2C2GA 3FMVA 2OZLA 4X64B 2WMDA 2E4YA 1D7AA 1WTAA 2GZAA 4B0PA 4QT4A 2BUCA 1T9BA 2EL7A 1WL8A 1V47A 1XFDA 4PZPA 4OMFG 1AD2A 2FR8C 2ZWIA 4QASA 5KTSA 5LOVB 2BC9A 4IL5A 1K5GA 2WA2A 2R6ZA 3PKIA 1CFJA 1P81A 1TM3E 4PPQA 2AJBA 3LPLA 3TKLA 4WBNA 4YDSA 1XCPA 3PJGA 4Q16A 2D8MA 2ILVA 4ALKA 2IUTA 1IN8A 3DHNA 2G07A 3F5MA 3OCZA 1VKOA 4JA0A 1CULC 4RK6A 2HAEA 1VRWA 4HDAA 4I9NA 3RRYA 2EFCB 2WQ7A 3QXHA 4J3NA 1NX9A 1QX3A 1VJCA 1FS4A 4JHLA 1SVWA 5FUVA 1I6MA 3A3YA 4FHZA 1DJNA 3O31A 4I1SA 4DCUA 3HSYA 5EIEA 5C1BA 1DG1G 4UHCA 1K0UA 4M9RA 2H4FA 2X0FA 3H7AA 3ZWNA 4U02A 1VYUA 3PHJA 4NNOA 3WNBA 5KOJB 1DPFA 1HRDA 3ETCA 5C7YA 1N2CA 1FJXA 2BFCA 1MB9A 2PMCA 2PNFA 4F8YA 3ZLJA 3OTHA 4YP5A 4G81A 3RD5A 4L9AA 5K45A 4X1IB 1NBAA 3LCCA 4JLVA 1F51E 4N9QA 3KUCA 1FMLA 1WDTA 1UPTA 2ZLBA 1GWNA 5KPJA 3ISVA 2QTLA 3DAFA 1ZBQA 1A8SA 3KL4A 4IDBA 5LZ8A 3JQEA 3L7DA 4ZCMA 1CNEA 3F46A 5LB2A 2OBFA 5IJ0B 4DXHA 4AQ7A 3E8MA 3NM6B 1RHRA 4H2DA 1U1FA 2GN4A 2OWEA 2Q9CA 1TW3A 1GPYA 3LAWA 3MJFA 4EJ0A 2MSDB 4JLOA 3H9EO 2OXCA 2BGNA 4C88A 1ZD2P 4BC0A 2DP4E 3A9SA 1R6DA 3SSNA 3PGJA 5KX5F 3QMMA 3Q7RA 3KSUA 1NYRA 2ZYHA 3ME5A 4HEA1 4D44A 4J1NA 3V4ZA 2BVNA 3PF8A 4F4IA 1FDVA 3S3TA 5DTRA 1BD3A 2ZJ7A 2GF2A 1E66A 3O3MB 4QO8A 5GV7A 5JHGB 5LQJA 1RS0A 1BXRA 3ZW7A 5FBVB 2WM9B 1XO1A 2P90A 2NQ2C 2ZXEA 1FNNA 3FPGA 3IA7A 4KQ9A 4N18A 2G8NA 1TT5A 3WLTA 4AYWA 4DS3A 5JAOA 2ERCA 3KBOA 1G3MA 2QAJA 3HR8A 2WIGA 3E3AA 3B51X 3R0IA 2IEIA 2EFGA 1BMQA 1BHO1 2ZQ5A 3IKMB 3OX2A 2EG9A 2HSWA 2QA5A 4R1LA 4ROSA 1YZGA 5ECYA 5FL7A 3CINA 4P2BA 2FJ0A 2LWIA 3D8SA 4FHCA 5GAJA 3UQYS 2MINB 1XMVA 3MNFA 2J0EA 3RTDA 4TTJA 5H3LA 4QOGA 3SR4A 2BM1A 1TRHA 4IKEA 2LPMA 3FPEA 1SZCA 3GRUA 1EI9A 1QDEA 1TM2A 1WQ1R 2JFVA 5CCXA 4PVDA 3F6BX 1E7WA 3QTBA 2ID9A 1USWA 3ADPA 1QYXA 1VHJA 4MAFA 1MQ9A 1V1JA 2ONZA 1W88A 1N8SA 1NXQA 3IOCA 3A6ZA 1FFDA 4LK2A 1H9AA 1SA0B 2GWHA 2XI4A 3EVZA 4NR0A 4PG7A 4ABYA 5HF6A 3OEWA 2BBWA 4BFZA 4G01B 1IZYA 4NU8X 2HF9A 5EWLA 2IE0A 1VZ3A 3C8DA 1MOZA 5F73A 5KDDA 1AC5A 4YV2A 1C7JA 4O33A 3WGMA 3BH0A 3TLYA 3WO1A 2J9YB 3HEMA 3O3OB 5T67A 5DE3A 3TTTA 4BATA 5TJHA 1QH1B 1LPOA 4JL5A 4DNPA 1WAMA 1EFDN 1TKCA 3WIDA 5IT4A 1Y98A 3PEFA 3L92A 1UJNA 2C83A 2HLDA 3L79A 2IYLD 2GS9A 3SHTA 1IM8A 1U2DC 1WNTA 2ZULA 3U44A 1J1UA 3FKSD 4Q3EA 2HWUA 3WMEA 4G3XA 1EVZA 1HDYA 3LQFA 1CRWG 2C4MA 4GL4A 1VGRA 4QFBA 1V3VA 3U4DA 3WZLA 2HXGA 5JSUA 3BFKA 5A6SA 1GAQA 1GZ7A 2DVMA 3EDCA 1VLQA 2HMSA 4WZBE 2VJMA 2R8YA 1SQ6A 4INAA 3U7GA 4K6FA 4NJEB 3K35A 5JHHB 4PFSA 3MRSA 4TUYF 4B82A 5HGXA 2NXWA 2B92A 3A14A 1SQFA 2BPOA 3SM3A 4EL0A 1TKRA 4UQLA 3WWOA 1QFSA 1WB6A 3HA3A 3RG2A 4YT4A 4DV6B 3QFSA 1EB9A 1Q12A 1U8ZA 3DT6A 4CG0A 1OFUX 2Q4BA 2J3HA 2RHGB 2WIFA 3JATA 5IFLA 4LYDA 4A8PA 4B1FA 5LP6B 1GUAA 2OXRA 1XPRA 3UWDA 2GPYA 3INYA 1M0WA 4AJIA 4EQ6B 5HILA 5JC8A 3O3CA 2I91A 2ODAA 3QKRA 5TY0A 5I7AA 4PIPA 2ZIFA 3WGVA 5AWFC 4OU5A 3E6AA 3NHFA 4K9PA 2HMWA 3D0KA 4RMGA 5FHRA 2BTQB 1R6BX 1EE9A 2WWGA 3VYVA 2PBRA 4PQRA 1O94D 4M38A 4AZ0A 2J9GA 1GU0A 2Y4NA 3FDXA 2FYTA 2W22A 3EZ6A 4GC9A 1UEJA 5GONB 2QRQA 5JCPA 4G89A 1EZ1A 3E7FA 4W7IA 4WLUA 1SB8A 2FW6A 3UTDA 2FJUA 1M2VB 2IEGA 1P5HA 2GMWA 4UHBA 1XVLA 2CLCX 1GLNA 2Q1TA 3TQTA 4GI1A 4MHSA 1QV7A 3FOZA 2XDQA 1FX1A 2JW5A 2JIQA 4J2HA 2GJ4A 3NORA 4NWIA 3D3KA 5FLKA 3LT1A 1QWSA 3OJ0A 5C8YF 1G8JA 2DPYA 3PJDA 4BFXA 5KTNA 1P0PA 1TM7E 2HPHA 2FUCA 1HYEA 4PZUA 3OOWA 4QYXA 1I7NA 1KARA 1NQUA 4LRYA 5IM4F 3RFUA 2YYZA 2RIPA 1M74A 5LJIA 2PJUA 3A2KA 1WWKA 1T13A 1NKVA 4MUNA 4WZAE 4ZKDA 5KO2A 1GAEO 1YC2A 5K2OA 3RVNA 2I0FA 1K8ZB 3I37X 2BBOA 4XPZA 3JWEA 1EDEA 1BZYA 1SQ5A 1XUOA 3L8HA 4HAUA 3ELBA 5LP1A 4O2RA 3LHDA 3H7IA 1EFCA 5E6SB 2H16A 1F4VA 1R4MB 5GTDA 4HLNA 3S1AB 5T8KA 4WOBA 4YASA 2C95A 5U1PA 4PANA 4BRWA 1Q22A 2J0UB 3DB1A 4CTNA 2FJPA 4URVR 2XTNA 3I05A 4OGGA 3NGXA 3VX4A 4CR7A 4GZMA 1KFCB 4BKPA 1CEXA 3FFBA 1TFUA 4LQ4A 3RROA 4CG2A 1T26A 1WVGA 3SS8A 5A62A 1CVIA 1K75A 2ZYSA 2QJRA 1W34A 1EH5A 3HKDB 1KO4A 3NHJA 1V43A 4RKFA 4FEYA 2PA3A 1KDOA 4K2AA 2XITA 4Y6OA 3RSOA 1XNRB 2G1KA 2ZWAA 5F7XA 2ATIA 5MN4A 1ZVMA 3D2LA 3F7MA 2ZRQA 3PFIA 4IJUA 3AV3A 3F71A 2WU0A 4L6AA 5J5AA 3C1OA 3MOSA 3T3IA 3ZBPA 3ADDA 4BDSA 3BULA 1E62A 2RGUA 3IVXA 3TXAA 3VNBA 1KYVA 1NBEA 1XI2A 2OD9A 3N75A 3AR5A 3UJ3X 4LVUA 4RDHA 3WLSA 1XTVA 5CX1B 2X13A 2B78A 2XTJA 1BDIA 3FTFA 1G17A 1O87A 2DTEA 3DE1X 1VCOA 4X20A 3V1LA 1DBVO 2BSXA 3Q7TA 4TS1A 4YXWD 3TFOA 2HSJA 4L57A 4M88A 4ML3A 4UKDA 1TVEA 5HMMA 3TRKA 4HGOA 1JLSA 3NEYA 5AJTA 1B0ZA 3R7LA 5HRUA 2NUPB 3HRHA 4I8XA 4OFXA 3R7WB 4AWXA 5IVIA 2RGBA 1XT6A 1IJFA 1E64A 1YKGA 5CLHA 1X8XA 1UOPA 2RAVA 2NUTA 2XMCA 4HUJA 1JWBB 4KOAA 1D04A 2C2BA 3AEQB 1WQ3A 4FMDF 4PS1A 1JBKA 1QFJA 1D1SA 1JDNA 5CB8A 1XNHA 4IUYA 1RWVA 4NAHA 3I6IA 2Z8ZA 3U9SA 3VU9B 1HZZC 2QDXA 3SC3A 4CU5A 4Z4CA 3CNHA 3KFVA 2BDEA 2UVPB 3C3PA 1MXFA 1NPTO 2XIJA 4IGKA 1M33A 1ORWA 1NNLA 1E1QA 3FZYA 4N76A 4WZBB 1JV2B 3V7WA 3AK4A 4I0WB 2FMUA 1OIVA 3RF7A 3SC6A 3ZZTA 3R0XA 3C7AA 4H0CA 3QV2A 3AH8A 5J40A 2GPJA 3GAFA 5ESXA 3G5UA 2BR3A 3UFBA 3E4CA 5AKIA 4DCVA 1GQSA 3DDOA 3U16A 4LECA 2H1RA 5LMUB 1X6VA 3V8QA 3WP0A 1TTHA 2P27A 4YRLA 3Q15C 3KJFA 3PHCA 1FSGA 1E2JA 1G7SA 1NV8A 4HB2A 3GGGA 4MULA 1QK4A 3OZUA 3IOBA 3RFVA 4C6RA 3CE9A 3TEFA 4DIDA 2DFPA 3GPIA 2G83A 4IYRA 2RGRA 1Z3CA 3MK31 1JEYB 3OEED 1L5HB 2ZS9A 5CLLA 4DLBA 3THYA 1DLIA 2C5AA 1H5QA 1A76A 3IODA 4O4HA 1NVAA 4OGFA 3OX4A 1PT9A 2HNBA 3O8NA 1XMJA 2C20A 2CJWB 2G25A 2P4HX 4G97A 3OT4A 1DAEA 1G18A 3WZMA 1J1ZA 5AUPB 2ON6A 1A8QA 1NI4A 4EHAA 1JNXX 1J5XA 4G5OA 3ZTTA 3TUJC 2PYZA 4ALLA 3A4VA 3GEIA 5CVJA 5ALNA 3VDXA 1AO0A 2E1RA 4HKTA 4AK9A 1LZKA 4EG1A 4OQXA 3EWSA 3R9IA 3IYLW 1ZVKA 4ZU1X 3UXHA 4WXRA 1FQOA 4BVKA 7REQB 7YASA 3GMSA 1FB5A 1M7GA 2UZ1A 3K0AB 4QNMA 4R6XA 2CF5A 3PUIA 4NBLA 3OQNA 4HJXA 2NO9A 4HDKB 4BNHA 1ORIA 2G09A 3ZIAA 1EWYA 2DHDA 2JFXA 1SIWA 1LDYA 4CQMA 4NATA 3NV9A 1JR3D 4BNJA 1E1DA 1R8QA 3PJRA 3MD0A 4FXPA 5A05A 3UPDA 1Z5ZA 1AU9A 1OLUB 4G9EA 3RVBA 1GDDA 3FCAA 5DLYA 5BURA 4FX2A 2VNHA 3VA7A 4O1HA 3MAJA 5JBIA 4Q4HB 2FUEA 2G9RA 1EP1B 1RPNA 2WUGA 4PRYA 5HFNA 3WQBA 5JD3A 3ED1A 2IVZA 5CNJA 3SLRA 4X65B 3R5HA 4IDOA 4L27A 2O8EA 3KJQA 2GI4A 4I4NA 3ZWBA 2CNKA 4GKVA 1SC9A 3BB1A 2PL1A 2JD0A 4YQZA 3W8RA 4W7HA 2CXOA 5EJGA 5BOSA 5I7HA 2AQKA 1FF9A 3DKPA 4JELA 4BN5A 4ENVA 4ZODA 3UXYA 4LXUA 3HDYA 2HBYA 3AEYA 1QM5A 4TN5A 5A5DA 2AI2A 4RCVA 5DO9A 1QBGA 2VPQA 4YMTA 3WK7A 2TMDA 4H08A 3HXTA 2WZBA 3E03A 4JR0A 1YQGA 4KQ1A 3OCXA 3HMQA 4IIJA 3TG8A 4GGPA 3PDIA 4MKRA 1SG9A 4BO1A 2DUJA 1W87A 3GFFA 4HDSA 4Q21A 4FWIB 1PEKE 3CO0S 4MQFA 1Y3AA 4HNQA 1FDRA 3AC0A 2W98A 2X2OA 1WPQA 2BCGY 3BSFA 3OPVA 1RDFA 4M7WA 4O4IA 4ESOA 2XEDA 4M1SA 2RH8A 3L93A 1WBDA 5AIBA 5F5XA 1N8KA 4ZQFA 3SYMA 1NA5A 2I34A 3KB6A 4FJ0A 2HL6A 2QRUA 1GG5A 2WFAA 3LLMA 1J5PA 3PPVA 1YS2X 1P7ZA 1TKAA 1XQVA 1X0VA 1I4WA 1ZX1A 2OHFA 2AGVA 4FSDA 2CXQA 2F1RA 4CM5A 5JSFA 1WXFA 2P4SA 3KQHA 3FPSA 4ZRNA 5HKAA 1N34B 2JCYA 1JLMA 3GP5A 3QXCA 1OU0A 3Q4GA 1B73A 1FOEB 2HLDD 1GPH1 4JJIA 1ZK3A 5DK6A 1T4DA 1ZO8A 3EDYA 3Q7SA 1XTJA 3ITDA 4BASA 1K98A 1US8B 4TXNA 1S8OA 4ETNA 3FWPA 2ZBGA 2X42A 4QDOA 4ZRDA 2C58A 3QVGA 3IJEB 4LXYA 1AT1A 4DZZA 1ZVVA 5E9QA 1R15A 3G89A 1YZTA 1XEAA 2GK3A 2JIRA 3SAJA 2NVUA 4U6NA 4C5AA 4D42A 4E5SA 3B1XA 2FRDA 2KSQA 2Q9AA 2O2XA 2VUHB 4IEFB 4DLZA 5A0VA 3KZMA 1CY4A 1NXVA 2PBLA 2QVXX 2WMOB 3L05A 1A2OA 1GVHA 1RP7A 1X87A 3O4HA 5K0EA 3H65A 3TLXA 1CJTC 1ZMTA 3DHEA 4WNCA 2FGKA 2Z6VA 3EGDA 3FRJA 1J23A 3J81A 2ZJ2A 1Z83A 2WWVD 2JI4A 3DONA 3PFNA 2CNNA 4D8XA 3ZD8A 4LRQA 4M0KA 1NC3A 1BVUA 2VQFB 4B87A 1LF0A 4IIHA 1ND5A 1DU4A 1MN6A 4CMGA 4IJQA 3GGSA 4K9OA 3V4SA 2AR0A 3QY0A 4NICA 4PZLA 3U80A 4DJFC 3I3OA 4Q9JA 4LJLA 4XXHA 2O8DB 2IXFA 1E94E 1QS0B 2A9KA 1M1XB 2QL7A 5ICCA 2WU1A 1V96A 5AR1A 4QGSA 4QRDA 5E6UA 4EY7A 4YMUA 3ZJ4A 3M3DA 4MNTA 3EYAA 4TXHA 1PJ4A 4HXYA 1J2YA 3CS3A 3W5SA 2B94A 1T6BY 1B00A 1ZESA 3D7LA 2K6GA 4WY8A 3LHIA 1OFVA 3GUUA 4DQXA 1JEJA 3G88A 5D3MB 3IBTA 1LH0A 4ND3A 1O8CA 1G3IA 2XMGA 3GPBA 5E6RB 5G1OA 1EGHA 1RKUA 2B2CA 3RIYA 4NAUA 5M34A 1YA4A 2Q5QA 1U0SY 1JIXA 3CMMA 2IUUA 3UK1A 3C5WP 1MVOA 3AHGA 4KO3S 3L2OB 2FMTA 3RC2A 3BAFA 1YQQA 1NVMB 4RTSA 3UMMA 1AHHA 1SHTX 3QENA 1FW8A 4WEOA 1C9MA 1QMPA 5L53A 4YBRA 3RU3A 4IOJA 4XVUA 2H3EA 5LYJA 1HI9A 3U6BA 1UDBA 1A9ZA 4JEUA 5AI0A 3RANA 3GCXA 4LXTA 3RU7A 3AF2A 1VMAA 2MCFA 1U5BB 4X84A 4ZYYA 4Z86A 3HUDA 1GUDA 1ZOLA 2AVDA 3WGYA 4B3JA 1N2BA 5CB0A 2IL1A 5EWJA 3U3DA 5DYNA 3JAKB 2A57A 4YJDA 1R0KA 1OQAA 3TQHA 2MINA 3S4YA 1I3OA 2ZTLA 3I4LA 5E9AA 1XQXA 4F3YA 3GLGE 2AI3A 1AN9A 1QLWA 3BWEA 2P79A 1A9RA 3NJ8A 3UK0A 4C3OB 4U2FA 4L4XA 4ZTBA 4HVCA 1DXQA 2F3QA 3JVDA 4Q39A 2QX9A 1B15A 5EJ7A 1OSNA 1E8MA 4QDKA 4RANA 1KH3A 4XARA 2FSGA 2VYND 4JZYA 4G0UA 2B4AA 1GZDA 2OKGA 3JQDA 4UHEA 3K09A 4GMKA 3K5IA 2O2ZA 1Y80A 3TE6A 1F9AA 4JKIA 3UT5B 3OLWA 1M1YB 5NULA 2OHVA 2OOKA 4DLVA 1WEKA 5LIPA 1ZFNA 4GI2A 3T34A 4YRDA 3UCFA 1MB3A 3B1VA 4LBZA 3SZGA 4R54A 1T2NA 1O6CA 2VYNA 2CEAA 2XOEA 2RHRA 3VMFA 3ROXA 2AOWA 4OTZA 4EKGA 3T0FA 2EHDA 2R3SA 3AEKB 4I8IA 1VE7A 4PZ9A 2GN6A 3UAZA 2BH2A 1UP4A 5IJZA 1GZ3A 5C37A 2VTBA 3GNTA 4FFWA 4HTFB 2NU6B 4E2XA 3DTTA 3B2EA 1XZHA 3GT0A 4P08A 5FORA 5A6SB 3UA3A 2UVQA 3P5SA 1TA0A 1U65A 4BV9A 4ZMSA 1VKRA 5E2AA 3LW8A 3QXGA 2VZLA 1WNFA 2WJ4A 2FZEA 5CFQA 2XECA 2O4CA 3ANNA 3E2PA 3PJEA 2AOUB 1M2GA 2BUBA 4TRMA 2WDPA 1J7JA 3VR6D 1QHHA 4LXHA 1DEHA 1C7QA 3THXB 1X1QA 1Y5RA 4P81A 3W7BA 1VG1A 4BCDA 2J7KA 1Q1GA 2OCDA 1U99A 4PHHA 4QWWA 4W9NC 4DABA 3LCUA 4D8WA 4TRNA 4GBMA 3G8YA 1AMOA 4S2EA 5TF4A 4ATNA 2CXXA 2VF8A 1X1TA 3M6WA 5JMPA 4BKRA 2O0MA 3HEAA 4BQOA 2XCOA 4N3CA 1P45A 1XEXB 2NZUG 4WOPA 2V7PA 2W6NA 5I7EA 1NMEA 2Y1DA 3B5JA 1CJMA 2VF2A 2XMBA 1USUA 5DPMA 2PUVA 4OJMX 1SQGA 1FS5A 1HDRA 1TM5E 2C78A 1D2RA 1IM5A 3HXPA 4XR4A 1JLKA 3WLHA 2QRVA 4LBYA 3E3MA 1UPCA 4QYIB 4RTJA 2XNDA 2NMVA 4DBLE 2QJFA 4JL6A 5IJXA 3QFHA 2DR2A 4RZIA 1OLXB 4QXQA 1T2EA 2PT7A 4OBWA 4F8JA 1M75A 3PENA 1PTJC 4DMMA 3AIKA 4FB4A 1PVDA 2GEDA 2NG1A 4NH0A 4TMKA 4JDUA 1EGQA 1A8PA 4R1SA 1H65A 4FC7A 4MB6A 2XDAA 3D7KA 2R87A 2VP2A 3M6VA 1TCCA 2PFSA 3O7WA 4CMEC 1T2VA 4C6TA 5JJBA 4ZQCB 3N2GA 3W6ZA 3AVWA 2P91A 1TF7A 2GTPA 2NU9A 3PC8A 2K2WA 3IIMA 4RQUA 3IUNA 4XVHA 1EG2A 1ZEJA 1KVRA 3UW3A 1E0KA 1E3IA 2C3OA 1XU7A 4RH3A 4YV7A 1G38A 1Q0UA 3ICCA 4IIUA 2HBZA 1FYXA 3E7DA 3TOCA 4HNHA 2HADA 4IUDS 5FYQA 1SK8A 4CIBA 1XWFA 1T6ZA 3GYGA 3R6GA 1XKLA 5TMBA 1P4AA 1RU3A 2ZJ8A 2Z4SA 2VP0A 2ZVJA 3E84A 3ILYA 3AF1A 5CT8A 3GEGA 2E6UX 3BEOA 2EEPA 1LXCA 1JFLA 2VK4A 4YP0A 4JL8A 1N9ZA 1U7ZA 2VNJA 4TV9F 1PR6A 3B3AA 5KTPA 1A4RA 1L5FA 2WIBA 3FCEA 5G4KA 1IUPA 4Q9DA 3L7IA 4QXPA 3CG0A 1DAIA 3MJEA 3RJMA 4HB3A 1THMA 2IY9A 3JSXA 3F73A 2HF7A 3DQZA 3H9JA 4HT3B 1F1JA 4X7MA 4BZZA 1SHKA 5IF9A 3D4NA 4Q7QA 4YAUA 5FFMA 5I3ZA 4DRXA 1SBHA 3TNYA 3I5UA 4OYLA 1O97D 1ACLA 2QAGC 2VL7A 5DGDA 5EMKA 3V8RA 4AJEA 4DDWA 5LXTA 3UIEA 3LCVB 4DDMA 5JD5A 2GAOA 3EARA 5EN4A 3SZUA 2XMPA 3R5FA 4NQZA 4QJBA 1UFQA 3C7TA 1U4OA 2Z2XA 1RWBA 2V03A 2W37A 4MGYR 1U2RA 1H2AS 2CB9A 1ZSNA 1TXGA 1YJBA 3JV7A 1Z29A 1B76A 1JILA 2EOAA 3LUDA 3PWSA 3W34A 4CI9A 3A04A 3JYOA 3PJFA 3O2JA 1SBTA 3TNJA 1J2RA 2DBVO 2PFGA 1IHDA 2OGWA 3AESA 3KLOA 3KEFA 5EQJB 3X1ZA 4C1NA 5CBPA 1R18A 1ZAKA 5BSRA 4RH0A 4ZVMA 3TLBA 1EK1A 3EIXA 3A4IA 4ER5A 4BO2A 5KNLA 1HY3A 1DEXA 2IIPA 2RB4A 4FQ5A 3FSGD 1U1DA 1ZVJA 3GDGA 2YHIB 2WWWA 2YR0A 3O92A 1RRFA 4NC9A 3AJDA 5KYYA 1YC5A 3M6LA 1SKBA 2IP2A 2NUTB 4ZC1A 3QVTA 3WLJA 3KEMA 1HA3A 2HDHA 1PGOA 2HBRA 4RY8A 5LLDA 4HGZA 2Q5EA 5F35A 1C7FA 1W36C 1NLZA 2WKSA 2Y4OA 4C07A 2VJBA 1G6HA 2C2KA 1EMDA 1PI3A 5F76A 4CKYA 3OFSA 3EXEB 4ENQA 1GNLA 4L3OA 3UG6A 1XMQB 2HF8A 4EZBA 3UT6A 1ZRSA 3JQ9C 4HH4A 4PAOA 4CUJA 4AO7A 2NYRA 3FWNA 2WYVA 5TPWA 4BTVA 3IKVA 3LPCA 2CXTA 4RFLA 3FWHA 3PC2A 4IMRA 3SXPA 4YRTA 1YI8A 5CM2Z 2YJTD 3PWZA 4JAVC 4MP8A 4MWBA 3RK4A 4E5YA 3PXCX 1JAIA 4Q3NA 1BXKA 3HCBA 4JBXA 3TKYA 3UCEA 1URPA 4FYXA 1N1EA 4WNYA 3ZV5A 2Q50A 3RYIB 1P5JA 5LDHA 5LD2C 1P7CA 1NMSA 2Z09A 4U5QA 3H8WA 2YC2C 5F7JA 4ARZB 3TB6A 3I1IA 5A3RA 1GGNA 3GZTB 4Q9LA 4TL8A 4EF6A 4RZ3A 3W0LB 5L8VA 3O4JA 4M1TA 4CMBA 1L2TA 4O0MA 3VYSB 1GGJA 1PR9A 2P2SA 4WKOA 3CRQA 4FI3C 4GQBA 1Y6FA 3IXMA 2VP9A 3F2VA 3MTQA 5PGMA 3L7OA 1GU7A 3UTCA 4EAQA 2R25B 1Q1NA 3AI2A 3H8SA 1MOSA 5ICFA 1NW6A 2XKKA 1Q7TA 1S3FA 5DGXA 1CQJB 5CB6A 1CB7A 2E5LB 3DWGA 3HLKA 3WAJA 4DA6A 1QC5B 5AVUA 3JRNA 2RHMA 2Z2KA 4MYUA 4CF5A 1GNQA 1V4NA 3VR5H 3E27A 3UK2A 3U7QA 4GKJB 1OX4A 4XDZA 4EW2A 1B8VA 4MWTA 3GLTA 1I32A 1OI2A 1KYIA 4HDKA 5EIHA 2ZBDA 2CYAA 4MOWA 4NECA 2AN5A 2RI6A 3OUUA 4KWEA 4IJ5A 3C45A 3U1TA 1G6OA 5JATA 4FBLA 1HBJA 1RAHA 2QKYA 2QVBA 4EJSC 5JNRA 1OASA 1HNZB 1K7XB 4GQAA 3C6YA 3KPJA 3HV0A 2XQGA 5CD9A 5JSZA 4QNNA 3ZHRA 5G3YA 3WI7A 1ODIA 3IE2A 5JG7A 4WT7A 5EC8A 1GTL1 5LYYA 2VATA 1HXHA 2YJ6A 4Y7DA 4G5SA 3T4EA 3EAGA 4LFAB 4AD8A 2GD2A 5EKDA 3IIJA 3LWDA 4ZMRA 3ANSA 4G26A 4XE5A 4QREA 3HA7A 3IJ5A 3BERA 4F46A 3V55A 3H1EA 3PNYA 3OZBA 3R9KA 4B6SA 3C4JA 3NP7A 2ZU6A 4LJYA 4HC4A 1GJRA 2GLTA 2H5JA 3MM4A 4MIYA 4ZVQA 5I4CA 1MA0A 2HJRA 1XAJA 2HU7A 2VSFA 2ZRNA 4KBYA 5F3RA 4BLQA 2VQDA 1OWNA 4XRRA 4K7JA 4KHZA 1JPJA 1UPAA 2VH1A 2VIIA 4KIFA 4ZQIA 4YK7A 1L5NA 3TN7A 4C0KA 3R6DA 5ITWA 2XX3A 3EA4A 1AKVA 2QENA 3O0DA 4K9MA 4EATA 2CDCA 3SGLA 4B80A 1XXHB 4RKYA 4M3NA 4XDHA 2VO1A 4Y9DA 3ROTA 5ARBA 1WCIA 1B2RA 1A27A 1TU0A 1U28A 1VL2A 4OSOA 1KEEA 3LYLA 1UF9A 2Q2WA 2E87A 4WNAB 2AYZA 1JI0A 4RVDA 2PUFA 1JU4A 4LOIA 1U31A 2DUWA 4M9ZA 2C5HA 2XB8A 3KC2A 2OLKA 2ET6A 3L4EA 3TAHA 1QE3A 1LGYA 1NBHA 2X5OA 4ND5A 4A23A 2JLUA 3C3EA 1US8A 1ZIDA 2HRCA 4X6XA 3U48A 2VA9A 5GP1A 3KV3O 1A7UA 4EENA 5AW7A 3EGXB 1KSGA 1IH8A 3DLHA 3BT7A 1LSSA 2HNKA 1QUFA 3EG9A 3V8MA 4YUVA 2ZAMA 2PX8A 5BR4A 1UXHA 1VZ2A 2MJLA 4LDRA 3CZPA 1NXSA 2MYUA 4GP7A 1L7NA 2KW5A 1TJYA 1UBJS 3D6HA 2IYNA 4NK5A 5HGJA 5LMZA 3EVAA 5E95A 3ORQA 1E69A 3OQIB 5D85A 1F3OA 3K2BA 3IEIA 1JX6A 3O26A 4EMSA 3I8OA 5IMBA 1YRAA 10MHA 4JJ8A 3D43A 1MMFB 1SOUA 2JJ2A 4FGJA 4JP2A 1TEVA 2A0WA 5EMHA 3S5JA 3BJMA 3IDAA 4OLJA 1S0UA 2HMVA 4A8TA 3EIWA 2HMAA 4RORA 4B8YA 1UUFA 1TJPB 2AMYA 3OZVA 4P4TA 4EA9A 4A15A 4Z54A 1GPUA 4Q66C 5K0GA 4MKGA 3Q8WA 3JYPA 2DSNA 4TLCA 2V1UA 1Z37A 1UT5A 3E7XA 3MCAA 1JA9A 1H4QA 2JAWA 2NWQA 3DYVA 3AERA 3EQ8A 4YECA 3UJCA 3SQOA 4QAJA 4W1PA 2HQSA 2CYCA 3LHSA 4KJXA 1JKMA 1YQUA 3CURA 4DKJA 1RAGA 2P9TA 2W2VA 2ZT6A 1QPBA 3T3DA 1UM9B 4MZXA 1ICIA 1KDYA 3TDNA 5EI5A 4RENA 2CD9A 2C04A 3HPQA 1W47A 3Q0TA 3ZWOA 1XZPA 1IEWA 5KYTA 2PXAA 4MVCA 4NYMR 2QL9A 1K27A 1EFUA 1BMFA 1MABB 2OV3A 5K5EA 2D06A 2QMQA 3L02A 3RVLA 1Q77A 4Y2YA 1KSHA 3GLFA 3HA5A 3R24A 2R7KA 1H05A 3NYRA 3RWBA 5JASA 4W9MC 1DZ3A 3BG5A 1ID1A 1E9DA 1GEEA 2WP8J 2H4JA 3LUCA 4XIIA 4CM9A 3AGQA 4HY3A 3ACCA 4K26A 1WIWA 3OH8A 2YHBA 5LA6F 4BMDA 2ZI5A 5LPNA 3NYWA 3H2JA 2ORYA 5HZGA 1SWVA 3MBOA 3NHWA 2X5XA 3OY2A 3UANA 3UOAB 1CSEE 2IE8A 1AZTA 4B2IA 1BIFA 1KQOA 2JLBA 3AW8A 5FTJA 3T15A 2RHTA 3SWWA 4AJKA 3EMVA 4NBSA 4YJHB 5CVTA 2CSXA 1U5AA 3K92A 2QRLA 1PT6A 4NV3A 1TMKA 5D5QA 1RZUA 4J91A 2I2XB 4QTTB 2GH1A 3DBRA 1PHRA 4OMUA 2OB2A 1D7OA 3WNVA 4FNAA 3R3UA 2BGWA 2HTFA 1ZONA 3VR5D 1MAAA 4V3BA 9LDBA 1TOAA 2A8YA 2XLCA 5EQTA 1CRPA 3LQYA 4J0IA 1P72A 3WYDA 4C0AC 4ZP1A 4ZQBA 4DBLC 2OMEA 4U6QA 4TN1A 1Q6YA 1QANA 5CTAA 1Z13A 3SKVA 1T3SA 1SUDA 4CL0A 4D0RA 3ZDBA 5JH7B 2IW1A 3RS7A 2MSKA 4YPFA 4CEJA 2I6UA 2Y76A 1SOWA 5FQNA 3UMJA 2ZSHA 4DWJA 1KZ7B 1TQ8A 2UXCB 1GNRA 4MJ3A 2QAIA 5FBRB 1C9DB 1M6VB 1IEQA 2BFMA 4UBJA 1B6GA 3PU6A 2W71A 2BRUA 3K4HA 4CKXA 3LQQA 1O96B 3E9ZA 1NG1A 3GJ4A 3MCUA 3HP4A 4E70A 3UJDA 2PRZA 2ZSUA 3LKBA 3R3XA 4PQGA 2PJDA 1WVMA 4IKOA 3IVCA 2B4RO 3MPOA 2DZDA 1VJTA 4LOHA 1U3GA 1LLDA 3W2HA 1X8JA 1ZLXA 4ZO4A 4C7OA 2HDOA 1N3BA 5DFAA 3A1NA 4DMGA 3LY7A 3QH4A 4ZJPA 3MRXA 2DY1A 2EJUA 2PLWA 3NHUA 4I1VA 4E2WA 4AF6A 3A0UA 5M7EA 2PZFA 5ITSA 2YNMC 4PV7A 3VRHA 2XWQA 1NM5A 1OXVA 4KZKA 4B48A 4K6KA 1F4PA 3F8SA 1GTMA 4LVOA 3ND7A 4M55A 5ALRA 4BO4A 4Z7QB 3JTMA 3AF4A 1JB9A 1PX2A 2C84A 3TL6A 4QM7A 3HXQA 4B9EA 3VZCA 2NSDA 3E18A 4RPHA 2AFHE 2PKCA 1V1MA 2A58A 5K8JB 1ZMOA 3UYKA 1F5NA 4C0WA 3PBKA 4KIUA 1P61B 4EPWA 4KPYA 4ZO7A 1TPZA 3DZKA 2J0QA 4EEXA 4UVDA 2F1IA 1RPZA 2QG9A 5ALQA 4OHPA 4DSAA 3RLFA 2FWAA 2Q4OA 2ZRHA 5CPBA 1V45E 4BNZA 3DA8A 5K4HA 2J9ZB 4CODB 3GRAA 3A1WA 2A9JA 3BGVA 5FLXA 4DUGD 3H9GA 2FN3A 5ICMA 1KXJA 4OATA 1G5RA 1M0TA 2CLKB 4KN9S 1MEOA 2QX6A 1U2GA 4X1IA 4D9IA 3ROFA 4AZSA 4EO9A 4DAEA 2V58A 4BUCA 1ZNYA 5JJ5A 4XCVA 2YWEA 1QGAA 2JFPA 4TZ6A 3ZOZA 1JH8A 3KDSE 1L4HA 2JB9A 4DYVA 5AJUA 3JVEA 3N2NA 1TM1E 3EVNA 1IWPB 5F2NA 4AJJA 4HS4A 3AP2A 3ORSA 5SYAA 1NBWB 4DR4B 2QX8A 3E3OA 2YH2A 4Q4LA 3S27A 4PZDA 3V46A 4B85A 1GNVA 4FDUA 4LPSA 3ICEA 1AF4A 2ZG6A 3PA6A 3L4BA 3WQSB 4CIXA 3BE8A 3HCOA 1M5RA 3ZH2A 3NOVA 5T4FA 2RBEA 4GR4A 3RUCA 1OIXA 3C14C 3G2NA 1NJFA 1UL1X 4EI7A 3B6IA 2A9RA 3NHZA 1BG6A 1FY2A 4DDHA 4DIMA 2UUOA 1Z6YA 3AEUB 2JANA 4F45A 2KHZA 2PZLA 4OHKA 3R20A 3PPXA 6PFKA 2F9MA 2QE7D 1LQTA 4N7BA 1J21A 4KQJA 4NE7A 5ALIA 5G4LA 4ZANA 4XQEA 2G7ZA 1BE6A 4MWDA 2WYOA 4DCJA 3ZEIA 3TD9A 3T61A 4OM8A 2P30A 3PXXA 3HKBB 4CE6A 2R7MA 1TLTA 3VPHA 7ABPA 1TCAA 2YASA 1EFPA 1P4SA 1ZCZA 3PFFA 2H2DA 4W6ZA 3TSZA 2V4UA 2ZETA 4WTOA 3TR6A 3W5HA 4R83A 2JDIA 4RDIA 4EG3A 4QG3A 4UM9D 3HFJA 4KUEA 4LHYA 3ZXXA 4C87A 5INTA 3VU0A 1QH9A 3CZQA 5TEVA 1ZRMA 3DR5A 1EFVA 1R74A 5SY9A 3IUEA 2VDQB 3VVCA 5JWHA 3SBEA 1B2LA 1UBGA 3TSAA 5FPQA 3GRPA 3K0EA 3CH7A 1BEZA 1FTSA 3H2GA 1UOEA 2JHAA 4BZXA 2O3JA 4TSFD 4DA7A 2WJ6A 3V7FA 4YJ2B 4EG4A 3FHOA 2I22A 1GPMA 4QC2A 2GN0A 1VKJA 1PNOA 1V11B 2F8MA 3CZMA 1XPUA 3MCTA 2ATEA 1ESMA 1RT9A 3I01M 1LK5A 5GM2A 1ZI6A 2WABA 1K4KA 2RHHA 2DUUA 1GZ6A 1OC4A 5A3SA 3GOHA 5YASA 3ZNQA 1NWCA 3C85A 3CV3A 3LBAA 4IR7A 1QH1A 1Q11A 3LGAA 4Q37A 3KQNA 1XZAA 4H7JA 2XIQA 4C2AA 3F96A 2ISQA 1DCMA 1GQQA 2GOYA 1RQLA 4XYLA 1BXGB 3CZ5A 1FDSA 2AMFA 2EERA 1ZM3A 4U7HA 1E8DA 5KMGA 1M34A 1JWLA 1J42A 3KDPA 2A59A 2V55B 5CLQA 1S96A 4DRZA 1KEUA 2GEVA 5C4GB 3V4VB 3PC6A 1XLTA 1YD7A 2QV7A 1OTHA 4ID9A 4PLCA 1IHYA 1PZGA 1R0YA 2A0UA 1O95A 2AFIE 4QSHA 4A0SA 2QRHA 1I0LA 3FPBA 4GH5A 2Q3CA 1Z38A 2GASA 5DBGA 2AK2A 2H5LA 1JR3A 1ZH8A 2JJ1D 3QK7A 4CR8A 1JJFA 3TPFA 3D59A 1LNQA 1A5ZA 5CEJA 1X7YB 4A5OA 4J2OA 4E21A 4N8DA 1W0KA 2EU8A 3OF2A 1EK5A 2Q8NA 4RS4A 1IBKB 3UHPA 2JCBA 3BC1A 2D59A 5KNDD 1U63A 1QIGA 3L7KA 4FOLA 2XJ9A 2PIAA 4EQ6A 4M1KA 1P7YA 3WRYC 2EQ5A 3O4RA 2PSEA 3QNUA 5IH3A 5FWXB 1PWEA 4XJVA 3VH2A 2CUZA 2YHSA 2HIMA 1YZLA 2VQSA 2HYDA 2B98A 4KWCA 2P9QA 4A5SA 1PJZA 1TC2A 3JASB 3O47A 5AI5A 4CKWB 3P2OA 3UJNA 2VXOA 1H66A 3DLBA 1LI7A 4R9VA 4TKMA 4N8SA 4IIBA 2PUCA 3IBSA 3H5AA 1QHYA 3NANA 2EKZA 4LI3X 1VFNA 1UBNA 5CMLA 4DKXA 1YU9A 5HZMA 5FI5A 1KE1A 4NH4A 1Y37A 5CB4F 3RHSA 5A7GA 4YCJA 4S05A 4KFTA 4J0DA 2X2PA 2YJGA 2WFLA 4EP1A 5CTJA 2KPOA 3L40A 3PVCA 1M2WA 1B42A 1MFZA 1VP3A 2EWMA 4AJNA 3DM5A 2VHJA 2OHIA 4ZICA 1ANKA 4J29A 2OAEA 3V3TA 4CKBA 1AA6A 1JQLB 3NHSA 1LPPA 4YY3B 4FMCB 3B1ZA 4EK9A 2IUSA 4HLCA 2O07A 1JFTA 1KPGA 2PY6A 4S1WA 1N4AA 1HC7A 1CYDA 1Z15A 5EYPB 5JCXA 3FTQA 4RMJA 2ZP1A 4ZZ1A 1B26A 3WA7A 4DJAA 4HAZA 4D9JA 1CR0A 1KNXA 1G4AE 3CF4A 5K20A 4C76A 2V65A 1VM6A 4MVJI 1JHVA 1SXJD 4KW7A 1O94A 1EBBA 2YVUA 2OCLA 2YJ5A 2JBAB 3RVOA 3V48A 4WQMA 5A2GA 1WJGA 1KYXA 4AT1A 4MIOA 2FK8A 2DBQA 5JJLA 1Y1QA 4LQDA 3MILA 3MRVA 3HY6A 4QUKA 4RK4A 2G9NA 4KAFA 4CPDA 1GAWA 4YJ3B 5KQLA 5F2OA 2YNMA 3ICWA 4RADA 3R5KA 5IW8A 1E3TA 3LCMA 3PWKA 4CQJA 2JAPA 5KNCD 1OVGA 5A9SA 1UWLA 2SKDA 4BEWA 4MRVA 1XA0A 1L5OA 5DT9A 1T29A 4FINA 3BMCB 4XX0B 3IR5A 1NMZA 3FBTA 3AT1A 5EINA 4YCSA 2WUWE 3F5FA 4H4CA 1HSZA 2JEOA 3I2YX 2YNMD 5CJPA 3FD8A 1I80A 5H1YA 5ALSA 3DMDA 3Q5GA 3I32A 2XUIA 4JI4B 2EJVA 3BGDA 4MO2A 4H7IA 1KJJA 3VR0A 3ZE9A 4EJFA 3U81A 4JXJA 4C4RA 2XQJA 1LB1B 1HORA 1SXJB 3OWOA 4GMGA 5HKKA 2BYTA 4Y9RA 1P4RA 1S4QA 2V7QD 3DMNA 3FTDA 4N7RA 3ZDXB 1JIUA 1EK6A 5KOHB 4S35A 3V6LA 1ZGBA 3T5GA 3RIEA 1NUTA 2A3NA 1RC8A 2OKCA 1MGOA 1GL6A 4MUYA 2O6LA 3CKLA 4IH4A 5KKNB 4E1BA 4ID3A 2QN9A 2SNIE 3WJ7A 2DHEA 4JBYA 4ZXPA 3D0OA 4JKOA 4Q3LA 2C3YA 2A84A 1R00A 3AHDA 3QU4A 4X24A 5E0KB 2NXCA 1R0SA 4GLFA 4FPXA 4RHTA 1TFRA 5AK0A 4LYEA 4BB6A 4B4KA 4OX9B 4Z53A 2NYUA 2Q5OA 4DWOA 3PE4A 1PCXA 1U2EA 1IU9A 3ZOKA 3GA7A 1GCOA 2O0JA 3NASA 1JIQA 3ZIUA 3W2FA 4LY3A 3T3MB 2NO0A 2BM8A 5KJEA 1IQPA 3NIWA 3KKNA 1U7UA 1VL6A 4E07A 1ODKA 4PGAA 4Y2RA 1HV8A 3OI7A 1DAMA 1HOXA 1PIWA 1PFVA 2A78A 1AXEA 3EJWA 3ND9A 3WFJA 4E4YA 2ONKA 2GTIA 4IP0A 2D7DA 2B82A 2HC9A 3LGSA 4RZXA 2DSTA 5LQSA 1F0PA 1OJ7A 2BHTA 2BMJA 2REXB 1U9IA 1M9NA 4D4GA 3IBFA 2Y27A 5B3JA 1R8YA 1TA4A 3PA8A 1CIVA 2R8ZA 2FPUA 4R41A 1DWPA 4GYWA 2AIRA 4AJ1A 1ECLA 1NVVQ 2PSHA 3ZVMA 4G85A 2BKUA 1LQUA 3B2NA 2FPOA 1WPRA 1GY8A 2ATVA 4JJEA 5A3JA 5KDOA 2ZOSA 1XZKA 3F6YA 3L7MA 4IM7A 1EA5A 4IX9A 3ZNOA 2FSSA 3OOYA 1QTQA 4XIYA 1G20A 3EF3A 4RX1A 3QE4A 2CNLA 1CKEA 4OU4A 3TCKA 5IT5A 4AB1A 5JWRA 3CMCO 4QTUB 3CN9A 5DBEX 1SD2A 3WP1B 3ZD9A 1GDTA 1OCEA 4HSEA 1AKEA 5E7IA 3W3AH 5DASA 5AICA 2PKQO 2JA2A 4J90A 3DGFC 4UEOA 4FUTA 4IO0A 2IYSA 3EY9A 3R7BA 2IHYA 4R9UC 3QLVA 1O54A 3HU5A 3DV0B 5DYGA 1SIOA 1NWHA 4FDMA 3VNRA 5AQ1A 5B64A 3DOEA 1YV9A 1GOTA 2CN1A 3DFIA 1VHLA 4JQCA 16PKA 2GJSA 1NX6A 3CT6A 2ZBPA 1YACA 4W6QA 4WL0A 3R9WA 1B43A 5ALHA 1C1XB 1AZSC 1Q57A 3DW1X 4TSKA 3VPDA 4B43A 4O2LA 4DV4B 5SYMA 5I5GA 2ZCUA 2AUMA 3TM5A 4FCVA 4ZIRA 4PTZA 3QE2A 4ETIA 1H23A 3PL1A 2RGCA 2V59A 3VR6H 3WMRA 4C0BA 3CVWA 2ZI3A 1FRNA 3AJRA 4IF4A 3RABA 4RAOA 1IRIA 2V98A 3O5AA 1UZUA 4OSPA 1GPBA 4KACA 4NKRA 4Q1FA 3K05A 5AKXA 5C7OO 2C5FA 3ZDDA 4C7OB 2QI9F 2BTOA 5FNVB 1EP9A 1DIHA 4MO9A 5DWDA 3PPIA 1J6UA 1T5SA 3BDVA 3CQ9A 2RK3A 3MWDB 3Q9LA 4WI1A 4ZO9A 1MJ5A 3T7EA 1YE8A 5IZ4A 3B3FA 1DTEA 5HIKA 1E2BA 4BZWA 1XCOA 4CKCB 1C3OB 2W6JA 2QMEA 5FNZA 3KOYA 3K8YA 1FQWA 4Q19A 2RD2A 1WZEA 4U7DA 3W3ZB 4D9MA 1Q84A 1Y0BA 5CA1A 2GEUA 1XBTA 2I33A 4OXRA 5AT1A 5TPZD 4LJ5A 3OJXA 1RE1A 1Q91A 2WJGA 1ELOA 1JQKA 2FCRA 1O95D 1OA0A 4TYYA 4M0DA 5EKTA 1RQGA 4G67A 3C3AA 4Z9AA 3TQIA 1NN5A 2ONCA 2AC2A 4TV8A 3FYCA 5FCDA 4ZGBA 5K9ZA 1U0TA 3AUKA 4G25A 2RMKA 4RMHA 5FFNA 3C5EA 1LDNA 2RHLA 4Y1RA 3ZE6A 2WU4A 2B1IA 1WP4A 4JSTA 3ANTA 2BEVA 4IF6A 5IJAA 2POQX 4NBKA 3HCPA 2QT9A 2BKLA 3PSAA 4I46A 1GL7A 5B7GA 2UUCB 5C5CA 2VTEA 1PS9A 1QHXA 4JOBA 4GPAA 4IDDA 3DEHA 3D3JA 1MHTA 2QYTA 3TUIC 1XTSA 4ICIA 3TZEA 1IN4A 6CHYA 5EIXA 3KP1A 1DWOA 3DAPA 3INRA 3F1KA 1DDIA 3LQ4A 4MDYA 4NBVA 5F3DA 3B38A 3RGGA 3V2UA 1EUCA 2P9HA 4M21A 3EXG1 4M1ZA 2W5UA 3KWLA 1YCDA 1WB4A 1NNSA 1VSVA 2B35A 3C3KA 3O8OA 1C3LA 4JA2A 3CNQS 2G71A 3LHKA 3OQ6A 2BFEB 3D6UA 3TGWA 4AKTA 5JROA 3NTUA 1FYFA 3K70B 2ZTUA 4WCDA 4KYTA 1NE2A 3VOBA 4DIFA 5E2IA 4NY1A 1TC1A 4S1TA 5CNKA 4RPIA 2R00A 4R8RA 5E8RA 3S8YA 3IV7A 1OWPA 4R2MA 4EG5A 1L5ZA 1RXYA 2DH6A 2VRCD 1JW9B 1W48A 1CERA 3I2HA 3ILSA 3FROA 3PDWA 4FCWA 4OREX 4YS6A 1YXMA 3ESXA 1HMYA 1RXIA 3DDHA 4UATA 1Q92A 1X7WB 1ZDMA 3G23A 4Y7CA 3DBIA 1HDCA 4KPFC 3V80A 3TQQA 3GH3A 4UTRA 1FP4B 1U8FO 4R2JA 4XB6B 1I5EA 1QPGA 1EXWA 3QW4B 2PXCA 3EMBA 4EUFA 5FRDA 3R3VA 4QU8A 3ZLTA 2WF7A 2FH5B 2OBBA 4OQLA 3GF4A 3M6XA 5GIPE 4N39A 1YVEI 4GC5A 1NN0A 1PZNA 2CUTA 1MORA 2PQMA 5AO9A 5EUBA 3ZXIA 4EO7A 3HN6A 5C34B 2WIAA 3UPUA 5GIOE 1ULUA 2Z8YM 2F3PA 3P9NA 1RAFA 4OFZA 5BSEA 1E5XA 4EY3A 4XAQA 2WMYA 5FQOA 3RM3A 2HRRA 1JPUA 4WK2B 1UJCA 1P18A 3IHKA 1Z7YA 5THQA 1X2BA 4Q9NA 4LHXA 4L95C 3WB0A 4BQNA 4OHWA 4YMSA 2BEKA 4NCKA 4OQ4A 3RT1A 4L7VA 3O1JC 3WMGA 2P7IA 1RKVA 2G04A 4UDYX 2PQ2A 4GX5A 3STHA 3EQ6A 4P53A 4OI0A 5HDBB 4YAOA 3W6UA 5CNMA 2YV1A 2BGLA 1YVRA 1HOTA 4EUSA 2ATXA 5CVCA 1XHEA 5FTWA 5BQOA 5A04A 2BFFA 3TRJA 4C06A 2ODTX 1V11A 3A1SA 3W3AD 2D0IA 2PSSA 8OHMA 1KRHA 3H05A 1GUBA 1PF7E 1GPWB 4OBXA 3OQBA 1C7EA 3SC4A 3TQOA 5EJ4A 4M6WA 1CXZA 4QICA 3FYDA 3T4UA 1UEIA 4IDHA 1VKHA 3DO5A 2DPLA 5IARA 1M2HA 2JJMA 4UUNA 1FRVA 3ZWXA 5EHZA 1N2HA 1ZK4A 1AKUA 3U7RA 1SUBA 1EWKA 2QTHA 2Q3DA 1NGSA 2VTBB 3DZIA 1JHOA 2QN1A 5BSTA 2X41A 4F84A 4D9HA 3IMGA 5EJFA 4LWZA 1VRCA 2Q3LA 4U3JA 3AVXA 4D74A 2PKQP 1QGZA 4HGNA 4N5DA 4OEHA 4Z1OA 4FEEA 1YASA 1H85A 2MSEB 1TECE 3OTQA 3NQ41 2X2EA 1IPHA 1T0JB 4OCZA 5CP8A 3K6KA 5FBHA 3RYHA 3F7NA 4CCYA 5CDUA 3LMKA 821PA 3QVJA 5BY2A 1Y5IA 2GZDA 2XMDA 3P96A 4RWZA 4V1CI 4FM9A 3FOBA 1SZJG 1UC4B 2IDKA 3ORFA 3X2SA 3CJTA 3K20A 4BGDA 4UD2A 1N9KA 1NAIA 1U9IC 1LI5A 3E3NA 1KF0A 1NI3A 2PMFA 2XAUA 3LHFA 3FGZA 1WHTB 5ILQA 1DDGA 2D5IA 5LZ7A 4GGMX 4IIEA 3WHLA 4LQLA 4XSHA 3BRWA 5P21A 4XVQA 3R0QA 4MR9B 2VA8A 4MW1A 5ESWA 2H4HA 4NZNA 3BMQA 6REQB 3EXG2 5HHTA 1FLVA 4JLKA 4LZLA 4NEGA 2FE4A 3EH1A 3V97A 3WV4A 4QYIA 3K09C 1S2LA 1XMSA 3A05A 1OZAA 4FGSA 1JIJA 4L5IA 4BXOA 1KJWA 3QTTA 4PFQA 2AXEA 3WLLA 4CKWA 4P58A 4QRIA 2A1UA 5BV1A 1VI5A 4RZUA 2PWPA 4UQOA 1T1GA 3MXOA 1I7PA 4PEVA 3WJ2A 4B84A 3I8SA 4O4LF 4JROA 2GEJA 2XVAA 3UYLA 4HATA 3WE7A 5E38A 4HDRA 1NUAA 1NQ5A 2GPTA 2XXJA 3M6AA 3W5DA 3N2GB 4DSZA 4QVIA 1FUIA 1XRJA 4Q48A 1TF5A 3AIMA 1AKWA 1YVUA 2CV1A 3ABZA 5ENZA 3IDSA 4QDXA 1QTRA 4GPZA 4P4NA 2PSJA 1Z2EA 2CHEA 5IP5A 2NADA 4AIIA 5JPIA 4RDCA 2AE2A 1X7HA 4BZPA 3HACA 3HB4X 1ZIYA 3JD1A 3HDTA 5B1HA 5IVKA 4RM2A 5IG2A 1RP1A 3GI1A 3HY4A 4CV3A 3COZA 1L7VC 3HKCA 2C2OA 4PSVA 4DIEA 2EZUA 4JIGA 2C9DA 3G0IA 3TD2A 2JKVA 4PNZA 5F9HA 2IW3A 3DS8A 3FNHA 5CH3A 4EDFA 3EGVA 2ZRLA 4AC9A 3II6X 4K3UA 3EUFA 1U8YA 3H0CA 4I50F 2HUNA 4V0RA 1S1CA 4YWHA 4LWPA 4IEEA 3S6JA 2D1TA 2J3EA 1PJ8A 4IYJA 2V7XA 2P9ZA 4CM3A 3COYA 4H16A 5KBYA 1DQPA 2LXNA 1EB8A 3H9BA 4QOFA 1DTWA 4YP6A 2NP6A 4B3XA 1C41A 3Q40A 3SZMA 3TSCA 4QYSA 4E94A 3U4QB 1WR8A 3FUXA 5IC4A 3QMVA 4JQSA 3UICA 3VR6A 4OD0A 5EVCA 1OH5A 2C8KA 1Q2UA 4C4ZA 1YOVA 1T0PA 3EB9A 1JE1A 4M76B 2VH2A 2QLFA 3D0RA 4R68A 3WHIA 3WNCA 5A9SB 5IHXA 1SCBA 1PN3A 4TKVA 3QPVA 4DA0A 2BE9A 2BISA 4N54A 4RQAA 1RMYA 3KAKA 1RABA 1O6GA 2ZI7A 4LQCA 3TDKA 3QELA 2COUA 2P2LA 5D5PA 3HNOA 1S4MA 4WXEA 3WYGA 1J0BA 1IZ8A 3UJ7A 4CBVA 3OZCA 4BMSA 2R00C 3AG5A 4LYHA 4CM8A 1S8FA 2IKQA 5HJ7A 5KDLA 5IS2A 3LVRE 4MKFA 2DAPA 4U00A 4HK4A 3W2IA 3G5TA 3N2LA 3H5LA 4RK1A 3A3PA 5AW1A 3MS2A 4Z49A 4HVTA 3NCHA 3GFRA 2ZATA 1H4SA 1CTQA 2VBFA 1EVKA 4KZPA 3W1WA 5B5SA 1XZMA 3WNQA 3WGZA 2JZOA 2PLNA 2F8LA 3IAEA 4CM7A 4DR1B 4Z1MA 1YDMA 2C92A 4DUPA 3EZLA 2YV5A 3I0MA 2RAFA 2ZFUA 3SQNA 5TQJA 3N6RA 5H0IA 1HQKA 3O3NB 5EESA 3T1NA 4LZZA 4ZVLA 4MS4A 1DEAA 3V4RA 4HGQA 1U1EA 3T9BA 5IF3A 4NBWA 3HTXA 4R31A 2IBTA 1L7XA 3ESYA 5JBNA 4I1RA 1T10A 2VRNA 4L73A 3FCYA 3Q6IA 5DM2A 1U8AA 2VUSA 2JGMA 2NYVA 2JS7A 5TPZA 3ZVKA 4R0VA 2C0CA 4LXXA 5C81A 1Z18A 1XP5A 1IM2A 1Z73A 1FXWA 2BZSA 2K2QB 3DVLA 3FMIA 3GBSA 1ISPA 5AK5A 1TYEB 1E2HA 1AY0A 4KVFA 4DCCA 3MLAA 1U2SA 1UM8A 3E53A 1UC9A 3T3GA 3KUUA 5ELMA 5FOXA 4PAMA 1K3UB 5BMOA 5H9WA 1DX4A 2DCUA 4FR0A 1AV7A 4IW3B 2CC2A 3GLHA 2WJPA 2NO6A 4FOOA 4UBOA 4AXBA 2G28A 2SBTA 4GMFA 4B2PA 5A4IS 3OIGA 7ADHA 1UR5A 1E99A 5FLYA 3F6SA 2QNBA 3B48A 1R6UA 5AKEA 2E5WA 2L2QA 3OIUA 3IUSA 4DMKA 1EQ2A 1T9AA 5BV7A 4EPXA 4X92A 2FP3A 1FVFA 4RVUA 2PKYX 4HHEA 2OO5A 2XOXA 2QRZA 3F6EX 4HZGA 1PSDA 3KVRA 2GJ8A 2XGSA 3O0TA 3Q87B 3HCEA 1HLPA 3Q7IA 1MVNA 5ESDA 2ZRDA 1OLSA 5C8DA 1QP4A 2XUPA 3KQQA 1LF5A 1H22A 2WVJA 3IJRA 3HWWA 1ZGZA 3NXSA 1E63A 4KQMA 4DG5A 4GDMA 4F6RA 5JQGA 2NO5A 2BLLA 3CH5A 3PV0A 4QPZA 1U7WA 2EW1A 4FC6A 1RCTE 4R1NA 2D3TA 3JQ9A 5D2CA 3NEAA 2QE6A 1W25A 5A4DA 3FYHA 4A36A 1Z62A 1GA6A 1N92A 2VPWA 3U9LA 3QWHA 3WB1A 1W73A 2CFRA 1BS9A 1ZP6A 2YY7A 1ABEA 3E5MA 1KJIA 1T5TA 4HWRA 1W59A 2O7VA 3K1TA 5DHPA 3DTYA 5EUQB 1G59A 1E2IA 3RQIA 3DFKA 1FMTA 1QYDA 4YLYA 1PL6A 1HQDA 4U0KA 2MYNA 1ZUWA 2O2YA 3IIEA 4DOMA 1Q0TA 1V9CA 5HQTA 5HUQA 5HJ2A 2E4AA 4GEKA 4XUEA 2Q5FA 1M2NA 2JZCA 3RBXA 3QFCA 3TL3A 1I4TD 3AKZA 4FEAA 3M9LA 4EPYA 4ND7A 5AVXA 1SXHA 1ZH4A 4EPRA 1QRUA 4JD5A 2PL5A 2JKYA 2ZQZA 2JGDB 3DMYA 4J43A 5CCDA 4RA6A 1TQHA 3QWIA 2ESRA 1V6AA 4OQDA 5JS8A 2GZMA 1GRNA 3SZ3A 5F98A 3C6QA 4NU6A 3RADC 2QU7A 2X76A 3QU2A 3B5EA 1T9ZA 2WDZA 2PX0A 4AS1A 1CHDA 3IMEA 4UDXX 1IHUA 4D2IA 4CN8A 2YOHA 5HPYB 4HDOB 2ZUFA 2LGJA 1YIDA 4DUGA 1QFXA 4LZJA 1X94A 2EKBA 4URYR 5G2OA 1V1RA 3RBVA 4MVJF 4CL2A 1TPYA 2Z5VA 4HRVA 4MWZA 1Y7HA 4NULA 1VLMA 2WIDA 5AXBA 3A7DA 4CN9A 3BF7A 2HPAA 2B5WA 1UP7A 5FA5A 4EHFA 4KQIA 1EZZA 1HFWA 4H7HA 4BNDB 1N2ZA 4IAOA 1OHHA 3IP5A 4OHUA 1RRCA 4DR6B 3RVKA 3QUTA 3L1UA 4KXFB 5TX7A 5HS6A 1T9HA 1UBCA 5ERXA 2F67A 4ZYUA 2C1XA 2GHTA 3BXFA 1H93A 5A4KA 2HU2A 3LK7A 1CUXA 3MAGA 3TW8A 1I94B 4MINA 4QPPA 2YZKA