4NKRA

The crystal structure of bacillus subtilis mobb
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
163
structure length
148
Chain Sequence
b'FPIVQVVGFQNSGKTTFIERILEKASEQGLNLGCLKHHDRYQAAGADVTAVEGAGVLQLTARRLWDLTRLIELYQFLETDCLLIEGFKKAPYPKVVILSEKEDLEALKTVNTIAIIYRKKEHMTEHQGLPIFHADDPVAVDLVLSQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
molecule tags Unknown function
publication title Insight into the Role of E.coli MobB in Molybdenum Cofactor Biosynthesis based on the high resolution crystal structure
rcsb
total genus 38
structure length 148
sequence length 163
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nkrA00
1X1SA 3AP2A 4US1R 3GJ6A 1VG8A 4R9UC 1ETUA 5KUTA 2QE7A 5LB4A 1ZD8A 5GVRA 2P6RA 1XJCA 4EKDA 4IDHA 4DEXA 1HQYE 4B32A 5K8TA 2AFIE 1NN5A 3GLIB 4GFDA 5EE0A 4F91B 4C7OB 1ZNWA 3EPKA 2ZQ5A 4I1SA 1L4UA 5B2ZA 3RRMA 4LHZA 1NKTA 1KYIA 1KY3A 3A8TA 3V00A 2F1JA 3QXHA 4JLBA 2GCOA 4DDUA 3BBPA 3ONWA 5FPKA 4NPHA 5EZ5A 2HJVA 1MV5A 1NBME 3EWAA 5FL7D 1E2LA 1NVXQ 5FOVA 1JBKA 1KO8A 1ZNZA 2Q0HA 4YMWA 1IXRC 2BKEA 1KSHA 2FE4A 2P2LA 2SHKA 2R2AA 4KBGA 4M9ZA 3QF4A 1E1RA 4ESVA 1ZBDA 1BO6A 3ZGXA 1N6PA 1EFRA 2IEYA 2AD5A 1KDTA 3LW8A 4PSAA 3R9IA 2WJGA 3TW4A 421PA 1S0UA 4MUAA 2XB2A 4YMTA 3BFKA 2YVUA 3B7GA 2HCBA 5EP3A 5AR1A 3ASZA 4EDHA 4XWOA 3FB4A 2VHTA 2RGNC 3BFVA 5TXGA 3W5JA 2BOVA 3T15A 2C03A 3WNCA 1DPFA 5HKKD 2L0XA 3TUZC 4CW7A 4D2IA 2W2VA 5C46F 2QAGB 2OUKA 3RS5A 2FGKA 4LBWA 2XZPA 2ZSEA 1X3SA 4RFVA 4HAVA 2H92A 1U9IC 3HJNA 1OKKD 1W1WA 1FZQA 1C1YA 1G3RA 3QPWA 4IOKA 5FBQB 4F38A 1ZC3A 3BH0A 4JLMA 4TZ6A 1W0JD 1KO1A 3ND8A 3CBQA 3IUYA 3ICEA 4LYAA 2J7KA 4AC9A 3A1VA 3HU3A 2X1VA 1BKDR 1TQDA 2O5VA 3ND9A 4Z1MA 1F60A 2O0JA 1T5IA 2EYQA 5FFMA 4ZCLA 3C14C 1H8HA 4BLSA 1Q3HA 4UNQA 5DIFA 3Q5EA 1UKVY 4I99A 4C3ZA 3K0FA 4LI0A 5J4KA 3K70C 1J8YF 3L82B 4DB4A 4E22A 3TIFA 1NLZA 1F2UB 3F0TA 4FMCB 1AS3A 3ZS8A 3SOPA 4ESHA 3CF6R 3FVQA 1IXZA 3P27A 3PR1A 5CK4A 3IPYA 3OHMA 1ZJ6A 3NIBA 1T6NA 1U94A 4LGMA 3SYLA 3KUCA 2QQEA 3FMFA 1YZKA 5FTNA 4TSFA 4A0RA 3Q7PA 1FMLA 1KI4A 3PUWA 1UBCA 2PJZA 3CPHA 3QEJA 1Z8FA 1II9A 1TF5A 1VCNA 2FFAA 1W7AA 1XD2B 1CBUA 4G5QA 2KB0A 2J59A 2WV9A 3JVUA 2QTVB 4GOXA 1UEJA 4JVNA 4ZDIA 1KO4A 1GAJA 1K5DA 3B5JA 5J40A 4XIGS 2OFWA 3K9GA 3PEVA 1IQPA 2CLSA 4OYHA 4RZ3A 3SHFA 1VECA 2P3SA 1WA5A 3PCRB 4NCJA 4B71A 4LK2A 3I5YA 4F4CA 3IHWA 2G6BA 3ECCA 1M6NA 4A4DA 4HATA 2RGCA 4U00A 3DM9B 1BMFA 2IXEA 5JJIA 5HZHA 2QY9A 4QNRA 5BQ5A 4C30A 2AWNA 5FR2A 2D3WA 2AL7A 1Q21A 1EFHA 3I72A 2RB4A 3GFTA 2A2ZA 5LBIA 1GKUB 1OYWA 4AYXA 1N0VC 5J4LA 1IXSB 1ZIPA 2GKSA 4MQBA 2HLDD 4QHTA 3U3RA 3CRRA 2QP4A 2Q21A 3I3SR 4LJ8A 5A5GA 3GEIA 5DHFA 1OKKA 4AKGA 2IS2A 3GLHE 4C0QC 1SHZA 2ZJOA 4PC6A 3B1VA 3MWYW 2CE7A 1U8YA 4G5SA 3WBJA 1OIWA 2V7QD 4LHWA 3T5GA 2GILA 4MRNA 1DO0A 2WWWA 4KVAA 4FMBB 3FPAA 3FMOB 4TTPA 4TMWA 2CL7X 2EFDB 5AJVB 3T34A 4AYWA 3K70D 4V0ME 3DKPA 1LF0A 3ADBA 4V03A 2IYUA 2NPFA 4DLWA 3CKLA 3NBZC 1KSJA 3OEHD 4DT1B 1WCV1 3R7WA 4TL9A 4XD7A 5DGXA 2EVWX 4LJ7A 4CEJA 1EFUA 1G3UA 1PUJA 2W0SA 3KFXA 3NVAA 3KZ1E 5CITA 3CZPA 2CCJA 5FBVB 1MRSA 5IK2D 3PG5A 1N6HA 3FTQA 4AKEA 2QL6A 4IKEA 1QHYA 2QZ4A 2CK3A 2XJ9A 4NDZA 2QRNA 4GMXA 3G5UA 3T5DA 3RAPR 1L8QA 2KBEA 3AP1A 2I3BA 2R6AA 4GT1A 2XJ4A 1CJMA 1OHHD 1LV7A 2IHBA 3IILA 4HUQA 3OEHA 3SC3A 3U3JA 3VR1A 3SS8A 2HYIC 5TY0A 2VEDA 5JEDA 4TZ0A 2AD1A 2ZI6A 2ZVPX 1J99A 4N0EA 4AIIA 4TTQA 2OFXA 4XTRA 2GA8A 2A7QA 1P62B 4JLDA 2OBMA 2FNAA 3RHFA 4PHTA 2I1VB 3A4MA 3RS2A 1ZMXA 2GWHA 3PIRA 4GNKA 3TBKA 3AEZA 1R5OA 4M9QA 2J45A 1A5TA 4IDPA 3TAHA 2AHOA 3AB3A 1DE0A 2DPXA 4A0GA 3LQRA 1Q1BA 4P4TA 4HLDA 3F8TA 1Z5ZA 1NN1A 2YWEA 4Q4HB 1ZCAA 3ZJYA 5EE9A 4IXNA 2CHGA 1LS6A 2GZAA 2YOHA 2RMKA 1E32A 5IRCD 1E2FA 2OM2A 3IIJA 4Q9IA 2XAUA 1N6IA 2JIZD 5DSZA 4DDVA 1DAFA 3LDAA 2NQ2C 1T91A 2ZRGA 4BFWA 3L0OA 2YOFA 5SZJA 3IBYA 5G40A 1CS4C 5D3MB 2W6ID 3QG5A 3M1IA 4UJ3A 4JYCA 4ZDKA 2VRWA 1AQYA 5AUOB 5JLJA 3VQTA 1E3MA 3TSZA 1H8ED 1LNZA 2BV3A 1ZU4A 1Z0DA 1ZP6A 1GP2A 3B9QA 1E2NA 2P0EA 2REOA 3BJIC 4L9WA 5L3SB 2BVNA 4C7OA 4ZI2A 5A4JA 3R7WB 5IF9A 2ZR9A 1EFTA 1WRBA 4IOJA 4EJSA 3CF0A 1HURA 2PJRA 1AS0A 4HAZA 1VYUA 5JSZB 2OXRA 4RD3A 1ZD9A 2CJWB 3C15C 4GPTA 1BH2A 4LV8B 1ZUHA 1Z6AA 2NG1A 5EP4A 4YXWD 1ONBA 4ASUD 1KZ7B 2GXQA 1HQCA 2A78A 4NL4H 3IQWA 4RSGA 2VO1A 5JMTA 1EXMA 1XTSA 3AF1A 1GNPA 2PL3A 4R2HA 1AM4D 4ZCMA 4TQUS 1UKYA 3TSWA 1GRQA 3TUJC 2O8DB 1SULA 4ZV4A 3FKSA 4EJSB 1SXJD 1YR8A 2ONJA 1R0ZA 4DLXA 4DDTA 1SXJB 2G83A 2P67A 5JSZA 2R6GA 4ZDJA 1VMAA 2FA9A 4FWTA 2WAXA 1NLFA 4S2EA 1TL7C 1W4CA 4KCGA 2WPDA 1Z0FA 1I2DA 1E79A 4GOKA 5B58C 4JZKA 2QMEA 5CK5A 2RAPA 4XTCS 2WIAA 1CLUA 3SN6A 3LLUA 3A1UA 1VCIA 4MGZR 3PUXA 2W6JA 2ZI5A 4Q1FA 4WBSA 4WZ6A 1RYHA 5TARA 4MRVA 1YR9A 2ZJ2A 5IK2A 1Z6XA 2BJWA 4JKIA 1E9RA 1TF2A 4RFSB 4WOPA 4EUNA 4XVUA 2OCBA 4B3DA 4NKRA 1VG1A 4ACBA 1RYFA 3UG7A 1KDPA 5KDDA 2IF0A 4YC7A 2C78A 1E0SA 1ZCBA 1AQUA 1W5TA 2GRJA 4YQFA 3IBGA 4D0LB 1E96A 4KYUA 2FFBA 1PLKA 3KDSE 4LOAA 3SDZA 4B76A 2V7QA 1YZTA 1M1YE 3AVWA 1HT2E 4YMVA 2G1KA 1E6CA 1ZU5A 4EQ6B 3WRXC 3QKSA 2ZRPA 4JSYA 3RWOA 1U8ZA 5CDFA 1XPUA 2H1LA 3OAAA 2HJGA 2GF0A 3TW8B 4M4SA 5C4GB 1NSTA 4DHEA 1P4SA 3ICQB 1M34E 2ORVA 3EZ9A 2D74A 1U81A 3LFUA 2JASA 4I1UA 3ZYCA 3SBDA 1IN4A 1WMSA 3BD9A 4MGKR 4GP6A 3K1JA 4UNRA 3X1WA 1ZM4A 4PZLA 2VP2A 5CJ2A 3X1XA 3P4YA 4PPNA 1SVSA 2IK8A 4X8LA 1T0HB 3LO5A 2IS1A 3HR7A 2XNDD 1IM2A 2WWIA 2WTUA 2O8EB 4PO1A 4ITRC 2EFCB 1OXSC 4MKGA 2V4ZA 4RJLA 1ZVQA 3LBIA 2XZOA 2A5FA 4KFSA 4PC7A 2CDNA 4BEJA 3RRYA 1PVOA 3AF4A 4XJXA 4BGDA 2ORWA 2IWRA 4QBFA 3NBYC 2WSSA 1W49A 3REFA 3GQBA 3O8DA 3EZ2A 3K0CC 1CIPA 4GZMA 1W36C 3U2QA 4EPTA 2ZRDA 4BFXA 1WQ1R 5DE3A 1E2HA 3DL0A 5G41A 2IS4A 5HR5A 1KNQA 4JVMA 1AGRA 5DHAA 1GNRA 3WHLA 1WP9A 2F7SA 2REXB 2WIBA 4HLUA 1W0KA 4ACAA 1RKBA 1Z0KA 1CKEA 5D3MA 2J41A 2D4HA 3KKMA 4JLJA 4Q7JB 2R62A 2CLDX 2OCPA 2ERXA 2WKRA 3RWMB 3K9NA 1JI0A 4LY6A 1J2JA 2LKDA 1OXVA 2XTMA 4D4KA 1JJ7A 2ZJZA 3CB4A 3CRMA 4D26A 2IYSA 1ZM2A 1CU1A 4ZO4A 3ZIAA 2G0NA 3T1TA 2IT1A 1X86B 1KSFX 3QKSB 4QBIA 3WNDA 3ZVNA 4EPVA 4M1WA 1N5LA 3W90A 1OXXK 3THXB 3DVLA 4PC2A 3R9XA 4OQFA 5EUMA 4DSOA 4D4MA 3MSXA 3U61B 1EWQA 3CRVA 3IO3A 2X77A 2CVFA 4IRUB 2Q3MA 1XZQA 2CBZA 2HEIA 3EIHA 3HPRA 1JR3D 4TTRA 3SR0A 4CT4B 2RKOA 1R0YA 4LHYA 5FPHA 3HYRA 3DOFA 4MDFA 2HT1A 4HAUA 4IVQA 2H5EA 1A1VA 1G8YA 2ZETA 4YMUA 1S3GA 4V0KA 3HU2A 1RRFA 1U0HC 3P1JA 4YDHB 1VKJA 2FMXA 2BIFA 4ZDWA 2CMKA 1JR3E 5IDVA 2FSGA 3U6BA 2IYYA 3U6KA 1G8GA 1P2VA 4WAUA 4TYPA 1QF9A 4M21A 4RFSA 3B1XA 4PSVA 4DCUA 4M1YA 1SXJA 2OILA 1E2JA 1IBRA 3HYTA 2Z43A 4URUR 3KTAA 5HZKA 1A2KC 2P5TB 4NP6A 1E0JA 2EFHB 3Q72A 2NOAA 5CB6A 2XTNA 1XEWY 4KAXA 1X8KA 4J0QA 3SJAA 1JPNA 3N5CA 4B74A 2WJYA 5G53C 2J0UA 4OK3A 1G19A 5AJXA 1JEDA 3OE7A 621PA 2FSHA 1IOZA 5JZVA 5F3WB 4B6EA 4KLNA 4M1OA 5JFGA 1GILA 2XNSA 1DVRA 1BS1A 2O8FA 4TSFD 1FQJA 3AF3A 2QN6A 4B2LA 5EP1A 1T0JB 2KI5A 4Q02A 1EG7A 5EP2A 1EK0A 4B48A 3VNVA 1XU4A 5CLQA 4Q4LA 4HZIA 2PEYA 4BFUA 3GJ4A 1P2UA 1E0KA 1IAQA 2BEKA 2CEAA 4L8GA 3PEYA 2NGRA 4LZZA 4RKFA 2XB4A 4KITB 4KFRA 1NI3A 3AUXA 3E70C 1KSGA 1J90A 2CVHA 2JJ8A 1NMXA 2GXUA 4RZXA 3X2SA 1AZTA 1UBFA 4EAQA 5FBWB 3THXA 3TMKA 1EX6A 3KJIA 4UKDA 2WAYA 4CT5A 3I32A 5H1YA 5KPJA 1S8FA 3DMNA 3WMEA 1E9BA 4EPXA 1XD2A 1U8AA 5E3HA 2IX3A 4FWIB 1S9DA 5H68A 4DZZA 1QHNA 1ZNYA 1COWD 2LCFA 4PHGA 3BB4A 1G17A 3EA5A 1KOFA 2J7PA 1YJ5A 1W4AA 1EGAA 3AGQA 4A8JC 2O8BA 1YQTA 3WRYC 1NY6A 3B2EA 5EXTA 3RRNA 3RYTC 4Q7LA 3PUZA 3VR4A 4PZZA 1E2KA 4HLCA 2F1IA 4IDOA 1BIFA 3QSYA 2ODNA 2VYFA 3KJGA 3BXZA 4F4IA 3V4RA 1Q1QA 2OV2A 1U0LA 1SGWA 2IYWA 5JJKA 4L5BA 4BFTA 2Z4SA 1NJGA 2PCLA 4NYIR 3B9PA 3I92A 4HDCA 1YR6A 4R71A 5JCZA 2Q3FA 3CNNA 3CO5A 3SFVA 1XJ0A 2R65A 4AD8A 1G9XA 1SKYB 2IHYA 5J5CA 3MFYA 2FOLA 2QP9X 2VHJA 4QBHA 4OHWA 2VA8A 3CLVA 4JJZA 4Q66C 3RSOA 2GXAA 3S1AB 1JECA 4BRUA 3MCAA 1NNEA 5KNBA 2ATVA 5GJVC 4QXAA 1PJRA 4US0R 2FGJA 4PQYA 4KU4A 2W83A 2AWOA 4KSBA 4H1VA 2EQBA 3T1VA 2PX0A 3U44B 1XD8A 1GDDA 2C5LA 2J3EA 1KKMA 1Z6TA 4XH9B 5HCNA 1NIJA 1P6XA 5SZIA 5SZKB 3RC8A 2YWHA 1N2CE 3HPQA 4LBVA 2BBOA 3FMIA 3QUSA 5AJZA 4G1UC 4JL6A 1U2RA 5EE3A 4B3CA 5DISB 4F92B 2AK2A 3AM1A 3IO5A 3OIUA 4IOMA 5AJWA 3QKRB 2J7PD 4B2PA 2R6FA 1IONA 1EFRD 2QUZA 2GJ8A 1E0AA 1TU4A 1NF3A 1E1RD 1P60A 1Y63A 3R9WA 3CZQA 1S3SA 4IDQA 4WXPA 5HTKA 1DAHA 1MO4A 1RE0A 4O2RA 1GNQA 3AF2A 3TGPA 2ZRMA 3N70A 1K5GA 2AK3A 2JLUA 4KFUA 3VTKA 4DIDA 4PX9A 3QXCA 3KL4A 1US8B 3RABA 1CF4A 3VFDA 1TUIA 3J81k 4HAYA 4URVR 1CEEA 3FHOA 3EPJA 3H0KA 1Z83A 1BMFD 3BORA 2LWIA 5H70A 4CDGA 3P32A 4EIWA 3SEAA 2XGJA 4QFMA 3W6PA 2GEVA 1RZ3A 1UKEA 4K81B 1DAMA 4YDSA 5DO9A 1XPRA 3C8UA 5P21A 1RRPA 4QRHA 5FOSA 1JXOA 2H7VA 3NKVA 4FCWA 4BZPA 4EFLA 3K9LA 1GFIA 3QPUA 1KIMA 4NHOA 4PANA 4FCVA 3QY0A 5BYJA 1CR4A 2QA5A 2XOKA 2O8FB 4IW3B 4HDOB 3K09A 2QRZA 2WHXA 3THWB 3KTAB 1NG1A 3X1ZA 2YC4C 1V5WA 3EZFA 4DLVA 1G5RA 1CP2A 1RPZA 1VCOA 4BZQA 1OXUA 5B57C 1M7GA 1W0KD 1D2EA 4PZYA 3U3MA 1Z0JA 2BBWA 2IS6A 5KU1A 3W6OA 3K0SA 3AVVA 2VP5A 4C2TA 1F2TA 2VIIA 1F6BA 1E1QA 5E7MA 4M22A 4W5WA 1OLOA 2NO9A 2X2EA 1G21E 1G41A 1GL9B 2E1RA 2XNDA 3U44A 3ZVLA 1E2QA 3AF0A 3NBXX 3SE0A 2QEQA 4DUGD 2QPOA 3DOEA 3DM5A 5F98A 1CJUC 2F6RA 1KI7A 2H8KA 4MITA 5LPNA 1P73A 3PUYA 2ZE7A 2PZGA 3TLXA 3IEVA 4TMVA 3QEOA 4F4JA 4LSGA 4TT3A 4WW0A 3AVUA 1NVWQ 3UWOA 4BLOA 4OQMA 3NH6A 3RC3A 2ODBA 2V3CC 2ZR7A 2IYXA 4AK9A 5DH9A 1M7HA 3RS3A 1DAKA 4NE2A 3PXGA 5LB2A 1DAIA 4QGGA 2JDID 4QM7A 4ILEA 4LPSA 1JPJA 1BOFA 1TQ2A 2FZLA 2VP9A 3EZ6A 3SHWA 4ZCIA 4FN5A 4HI0E 3ZZ0A 2ZYTX 3ADCA 4O25A 1H65A 1VHTA 4QBGB 2V6JA 3VU9A 1N6OA 3NEYA 2GCOB 2F9MA 1B23P 4PAOA 3CH5A 3SNHA 1Z63A 1MO5A 4OJQA 1XNJA 4Y0VA 3B1ZA 3U7EB 4ERNA 2C8VA 2DFNA 4C2UA 1TQ4A 3A4LA 1XEXA 1KI1A 2FU5C 2H57A 1Z2AA 3FFAA 5EXPA 4RD6A 2G1JA 4DCVA 1UEIA 4Z8XA 3NC1C 1GKIA 2HYDA 4Q7MB 1MH1A 4UXHA 4FMDF 1OH5A 2I4IA 1R4AA 1E2EA 2GJSA 3IPXA 4PPQA 4GL2A 5FI1B 3VX4A 1NRJB 1FTNA 4JLAA 2ZJ8A 5JJLA 4OQLA 2ZAMA 4GSYA 4TLAA 2XTZA 3EASA 3NDBB 1E9FA 3QXXA 1XJQA 4V0LA 2BWJA 2GVDC 3U3OA 2FJUA 1D8TA 3OFND 1W36D 4DWJA 4DRZA 2BHRA 3OZXA 2Y8EA 4RZUA 2V54A 4KYIB 3RS7A 4CRWB 1OV4A 3T12A 1FUKA 4B33A 1G8HA 3GLGB 4NTZA 1F2TB 2OE2A 4Q48A 8OHMA 2YYZA 4BEBA 2RGEA 4P4SB 3MUFA 4OKSA 1ODFA 4B73A 1KAOA 4Q9KA 2A30A 4NCHA 3O8RA 5DNYB 3SBEA 2VSXA 2ZSAA 3OESA 3FHTA 4BFSA 4ASUA 4NZYA 3U5ZB 1M74A 2B8WA 4OQXA 2QPTA 3QPVA 4FMDB 4TN1A 1KKLA 2Q3HA 1T5LA 2RCNA 4C0AC 1S9HA 4AG6A 3VKWA 4C0JA 2OAQ1 4JLNA 3QENA 1SVOA 1KGDA 1JALA 5B64A 2FN4A 2W6JD 1W2GA 4IVPA 4AKIA 1NN3A 3B60A 3LAWA 1OFHA 3QKRA 1QHIA 3M6AA 5KDLA 1VCMA 3EC2A 3A36A 4QGAA 4AWXA 1SQ5A 1S4QA 1E2PA 2PCJA 3R8FA 2A5GA 3D7MA 1E98A 4LC0A 2RGNA 3K9HA 3Q9LA 2E9SA 1UBGA 3OE7D 1M7BA 3VMFA 4HSEA 3WP1B 3UMRA 2OZEA 3TVTA 4H1UA 2QT1A 4DCNA 5BN5A 1GITA 3I4LA 3CRW1 3C5CA 1G64A 1ZC4A 4LHXA 2OEPA 3V9PA 3DO6A 4UNSA 4HDQB 4LJ4A 1H8EA 3DMDA 2V1UA 3CPJB 1TUEA 4Q4AB 3W9YA 4A92A 2DBYA 2ZUBA 4LJ9A 2DWQA 3EAQA 1KO7A 2ZEJA 3EW9A 2XITA 2ASEA 3B82A 4IDNA 3WY9A 1YRAA 4L15A 3T1OA 5H8WA 3GLFB 2RGGA 3C5HA 3KXKA 4YMSA 4CZ2A 1JQJC 2WSSD 3SJCA 1T3HA 4XSHA 3GFPA 4V0OA 3ZVMA 2ZJBA 4N3NA 5FR1A 1P72A 4X8OA 1P9RA 3B8HA 4DSTA 2AXPA 2ZRLA 4Q1AA 5FPTA 3GLGA 1CXZA 1ESNA 1RJ9B 2ZROA 3NWJA 2O0HA 2HV8A 3T1QA 1CJKC 3BH6A 3TJZA 4GDFA 1Z22A 3THYA 1OPXA 2PX3A 4B34A 2QSZA 1NJFA 2JLVA 2J9RA 3IGFA 1I4LD 3K8YA 2O8CA 1Z29A 3VAAA 4P4SA 2MMCA 2O8BB 3QXJA 2XXAA 2ZI7A 2ECKA 1RC8A 1E69A 4BFVA 3IKJA 1ZAKA 1P2TA 2YZ2A 4D0NA 4JJKA 2O8EA 3GCGA 4WIAA 3PEWA 4YONB 1WB9A 3K0CA 2FSFA 1QVAA 4TYNA 4M53A 2V9PA 3TQCA 2NZ8A 2JLQA 3B78A 1JR3A 3O8BA 1R6BX 4JLVA 2JAQA 2ZUCA 2P5SA 4C0SA 3OIYA 3FKSD 3GJXC 3VR6A 1QHGA 3W34A 4A6XA 1LTQA 3NC0C 3UK6A 3WYAA 6Q21A 3CH4B 1NBMD 2UZIR 3C16C 3EPLA 2GK7A 4C0KA 2OG2A 1K8RA 2OT3B 2B6HA 4Q1BA 2FPLA 3A1TA 4I81A 5AK0A 5G3YA 3LLMA 2Z0MA 1G18A 4M9SA 4C4PA 2IL1A 2DR3A 1NKSA 3AUYA 3K09C 3I8XA 2HCJB 2WJVA 4JBYA 3ZZUA 1Q12A 4C0HA 5FBLB 3GLIE 1KMHB 4DSUA 1CR0A 1NN0A 1FNMA 4A2QA 3ZDQA 2HDNB 4MYCA 3UATA 1W2HA 1JEEA 1FFHA 2IC5A 4B3BA 1N6KA 3D3QA 5JRZA 2CCKA 3SJZA 2GZDA 4E09A 1SKYE 1RVDA 5E4FA 4IHQA 1E2MA 3BOSA 2QI9C 1NVVQ 4GRAA 4OI4A 3CNLA 4M1KA 4Z8YA 1SHKA 2H18A 4EPYA 4OI0A 1DO2A 3G82C 4LDJA 821PA 1E2IA 5GJBA 4QKQA 3RS0A 4PFSA 1K6MA 3BC1A 4EFMA 3UG6A 3JZAA 2BMDA 1YRBA 1FPMA 2P65A 1I4DD 1DS6A 1WF3A 1OYYA 2EFGA 5KSOA 2VSOA 1GM5A 2C96A 1FNNA 2JLWA 2N1BA 2XX3A 1UFQA 1YZNA 2QQ0A 2HXSA 4PXAA 1FOEB 4DSNA 3A6PC 1XEFA 1QG2A 1YHNA 1IY1A 2CNWA 2QAJA 2KE5A 1WDTA 5HCIA 3K53A 1D2NA 4XVQA 4M0LA 2AR7A 2QAGC 2IA5A 3IIMA 4LC1A 4LJAA 4LWZA 2XSZA 2ZE6A 5DI3B 3UWKA 2FH5B 4BLQA 3VR3A 4AKHA 1T3LA 4NYMR 2ZAOA 2B7CA 1Z07A 1XRJA 5AUPB 4PO8A 1R7RA 2WWGA 4DCSA 3EIQA 4EPWA 4OHVA 2CHQA 3Q5DA 1LVGA 4LBYA 2ZPTX 4PPGA 4WVFA 4ZIRB 1R0XA 4HB2A 2GXSA 4MKHA 1DAGA 3VU9B 4DLUA 1PUIA 1TU3A 2G88A 4OI1A 1UADA 3U3KA 3CWZA 1OFUX 2ZREA 4CGZA 1IY2A 3K0AB 4Z51A 4W9MC 4PO9A 5KPDA 4DDWA 4JT4A 1XF9A 2UVQA 3SJBA 5LDDC 3GJ0A 4UNNA 3VKGA 2NTYC 2QBYB 3PQCA 4Q9JA 5L8VA 2O8DA 3L0SA 2RHMA 3MMPA 1MKYA 2BJVA 3MWLA 1YKSA 1X8LA 2IXFA 2UKDA 3BE4A 5JECA 1OJLA 2JCSA 3LXRA 1TADA 4WA7A 1OH6A 2W6IA 1GTVA 2WPDD 4MGIR 4Z1MD 3H84A 4PPFA 2ZYUX 4PQRA 2JJ1D 2VHCA 4BQSA 3QVUA 3U60B 2VHUA 2JLZA 1GSIA 2ZANA 1G3QA 2BDTA 4P31A 3SU8A 4NCIA 1KTVA 4NH0A 3GMTA 1YZUA 2VTKA 3NHAA 3C41J 3CF2A 4MKIA 4URWR 5FH9A 1OIXA 3BH7A 2YWGA 4CEJB 1KDRA 3D6TB 2ZRNA 3LVRE 5D3QA 4QGFA 5FOXA 2N46A 5EE1A 1UDWA 4F93B 1ZM9A 4KBFA 4QNMA 121PA 3L8ZA 3LX8A 3NBFA 4CEIA 1KNXA 3QQ5A 1RIFA 3QF7A 1CRPA 2PMKA 4URZR 5CB8A 1P75A 1SVKA 2BM0A 4L9SA 3HWSA 1KI3A 4DC9A 4AY2A 4NMMA 4MUBA 5L3SA 3QI2A 1VIYA 3DDCA 2OXCA 3THYB 5FOTA 3QBTA 5JI2E 3KQUA 2O8CB 2C9OA 1KY2A 2WWXA 2DHRA 4PC1A 4MRRA 1V43A 4PSKA 2DYKA 2QSYA 4JL8A 1KI2A 1MO3A 3VHLB 2ZS7A 1VG0B 2XZLA 5FTJA 4QJ3A 3F3YA 1DAEA 1Z0AA 4JLOA 4X8MA 3W8RA 1XXHB 4CYMA 1OB2A 4L4UA 4H9GA 1NP6A 1G7SA 1GWNA 1E9AA 4BE7B 3N2IA 3T61A 3T06B 1G20E 5GADl 1M8PA 1UM8A 3ZD7A 3I62A 4DLRA 2D2EA 2ZRBA 1WE2A 2ZE5A 1D9ZA 2ZRJA 3BWDD 3TAUA 2R8RA 1RRGA 5LD2C 5FTLA 2VL7A 3AH8A 3FOZA 4P4UA 2IF2A 5K8LA 5KNDA 1GZSA 1OIVA 2NO7A 4ABYA 4UNPA 1H8HD 4B3XA 1Q1ZA 2ODWA 5L3RA 4FW9A 4G5GA 1MRNA 1GIAA 2NMVA 3LW7A 2J87A 1G7RA 2ZR0A 2GBLC 3NHBA 4NYJQ 3KQNA 2QP3A 2AKAB 3GLFA 1NG9A 2RGDA 4BECA 1XTJA 3WHKA 3TR0A 3AGPA 4RVCA 3CX6A 5CLLA 3IHLA 4QC2A 1MO6A 4D80A 3QJYA 2IUTA 4DUGA 3MWJA 2K5UA 1FMJA 1G3MA 4DJTA 3WNBA 4KSCA 3THWA 1OH8A 1XMJA 2IUUA 4TMXA 5L3QB 3F5FA 2AXNA 4AG5A 4QL3A 2PEZA 2CE2X 2GJKA 2QENA 2WJIA 4R2IA 3WMFA 4DLTA 1L7VC 1XTKA 2A5YB 3TUIC 2OHFA 3A37A 5FBRB 4WXRA 2W2XA 3AP3A 1XXHE 3LBNA 5JCPA 1S1CA 3GLIA 2ZIAA 1DTSA 1TPZA 4OBEA 5KHOC 2A3RA 4MRSA 3UANA 4Q47A 1JR6A 4Q9HA 3U4QA 4LUCA 2IYLD 4TYQA 4MRPA 3DPUA 4JT2A 4O3MA 5K8UA 3DEFA 2AKYA 3DZ8A 3LRPA 1IN7A 3EA0A 4ZIRA 4DLSA 1DELA 1TF7A 1UKZA 3L43A 2QGNA 2WWHA 2GF9A 2XEXA 3AKEA 2ZS9A 2OLKA 3QBVA 1W48A 2CHVA 1QHXA 4C0BA 2YV5A 3GD7A 1CR1A 1GUAA 4Q4AA 4RD0A 2FFQA 1LY1A 1M2OB 2KWIA 1WBDA 4B6FA 1W4RA 1W47A 2VBCA 2EYUA 4II7A 2EU8A 1Q20A 4E07A 1N5KA 1G291 1TMKA 3ZQ6A 2QBYA 2ZVQX 1AIPA 3RANA 2FG5A 3OEED 2FX3A 2H17A 3RRZA 1ZD1A 2WZQA 3BK7A 1IN5A 4DT1A 4M1TA 4V02A 3UXMA 1HEIA 1RFLA 2GVZC 3TRFA 4IEEA 5FPYA 3D31A 4PHHA 1KMHA 3TSOA 1AKEA 2PLRA 1XCMA 5FL3A 2ANCA 2QU8A 2FPMA 1OXTA 3K70B 2DCUA 2FFHA 5C2JB 2GEDA 221PA 5HE8A 3X1YA 2JATA 2QM7A 2RGAA 2IYTA 1P5ZB 1FP7A 4HAWA 5B30A 5EE5B 2C9CA 2RGBA 5E95A 2B21A 3C7KA 3CPEA 2ZUDA 4QM6A 4B75A 2J0VA 1R8SA 2ZI3A 1AK2A 4TYWA 4JKYA 2DWPA 3PJRA 5JS8A 2QMHA 2LKCA 2P6NA 3N2EA 2GTPA 2WWFA 3EC1A 4NYIQ 4BWYA 2MMGA 3I61A 4DIEA 3UMSA 5JS7A 5HPYB 4Q4JA 1D6JA 3LBHA 4AI6A 1N5JA 1R10A 4NYMQ 4BUJA 2HXYA 2VHQA 4TMKA 4LJ6A 4Q21A 2JLYA 4YLGA 1SXJE 3GFOA 2C98A 4GBMA 4JBWA 2F3RA 1NMZA 5FUYA 2QGZA 5EZ6B 4E03A 1NMYA 4EJSC 2NO1A 2ZI4A 3KKPA 5DYGA 4RD4A 4DLZA 2BBTA 4N1AA 4Q1CA 1ESMA 2FSIA 5DI9A 3OEEA 1DOAA 1Q0UA 4KLZA 3KJEA 1KK3A 2WMNB 4MYTA 3SZRA 1IJEA 2TMKA 3PEUA 3GLFE 2AFHE 2ZI9A 4ZKDA 2ZXUA 2FDCA 3L2OB 1Z28A 2QG6A 2NO6A 2WMOB 4JLKA 2QNRA 1HT1E 1U9IA 1W4BA 1ZW6A 4RCYA 3RVBA 3WYFA 2IEZA 2GAAA 1AS2A 1W44A 2ZRKA 1BYUA 3PV0A 5FL7A 1ELOA 3QG1A 3GJ3A 1FTSA 4HLUC 1BYIA 1XMVA 4U02A 2XSZD 2QROA 2GESA 1N0WA 4TLBA 4OHYA 1GKYA 2GJAA 1D9XA 1I4TD 4Y0AA 2REBA 1ZM3A 1VYVA 1XTIA 1WXQA 3RLFA 1AN0A 2C2HA 3KXIA 1U98A 2D2FA 1J7KA 5JWHA 1GL6A 3B85A 1XBTA 1W0JA 1EX7A 1AA9A 2D7DA 2NIPA 1GRNA 2EWVA 2VP4A 4JBXA 1XZPA 3U7FB 3ZH9B 721PA 4A2PA 1E1QD 4Q18A 3LY5A 4KI0A 4P33A 1KAGA 5E7IA 1FQKA 4A9AA 2KSQA 4LRWA 2O52A 4IJMA 2Z4RA 2ZJ5A 4JIMA 2IYRA 1LW7A 2PT5A 4LV6A 2ZE8A 4BLPA 4TYYA 4TMTA 4D25A 1E99A 1X6VA 5GJCA 1IY0A 3QKTA 2ANBA 1D5CA 1JJVA 2C77A 5FI0B 3WYGA 2ZYVX 3LVQE 3VHXA 1J8MF 5DI3A 1OHHA 1UBEA 1P61B 2V8OA 4TMZA 5EJEA 4BZXA 1NIPA 2CK3D 2OSBA 2DB3A 2IW3A 2B92A 4QG7A 3BB1A 3GLGE 1UJ2A 4PHFA 2F55A 1XX6A 2X2FA 2YWFA 3QVVA 4FXPA 1KI6A 4DCTA 4XD7D 1G5TA 1W5SA 4KV9A 1ZUIA 1N6RA 1JXMA 2D62A 2GBLA 3THOA 3MRSA 2F1HA 1HYQA 1N5IA 2BEJA 4MH0R 1SVWA 2QE7D 4A6PA 5FOWA 5IT5A 2ZRHA 3PITA 2FWRA 5HE9A 4D6PA 1RRCA 4A82A 3L0IB 1DARA 4HZUB 3AVTA 3AKCA 3T35A 1YZLA 2VQSA 5KSPA 3ZIAD 1LF5A 2F43B 1EFCA 2FV8A 1YZGA 2E87A 1E2GA 4V0NA 2V6IA 3MG9A 4L16A 4BASA 5J4VA 3BERA 1RW4A 2Z5FA 1F48A 1VDZA 3HDTA 3TKLA 2WBLC 4MYUA 3CR8A 2WWYA 3AKDA 1Z0IA 1E79D 5FTMA 3AVXA 2ZRAA 1YE8A 2ZRCA 3U7HB 3KQLA 5GVSA 1E94E 5FUXA 5F9HA 3GLHB 1G1MA 4AURA 4M8NE 3R8CA 4WZAE 4BFZA 1S96A 3TVDA 5KO2A 4DKXA 1TTTA 1MOZA 1OT3A 3L8YA 2EFEB 1AZSC 1N6NA 2IYZA 1HE8B 1ZM7A 3WXMA 3OIVA 1NY5A 1XTRA 3B1WA 3P4XA 4TL8A 4OL0A 2WM9B 3MJRA 5L3QA 3ZD6A 3Q7QA 3ADDA 2BMFA 1UPTA 1CJTC 4UXIA 5AUQA 1G6HA 2ODEA 2ZRFA 2OO7A 2QTFA 2A5JA 1FW6A 3GEEA 3DHWC 2GDJA 2AX4A 4HYYA 4OHZA 2Z6VA 5CJPA 1KK2A 2VPPA 5BXQC 5J47A 3I5XA 3JZMA 3KKOA 1DG1G 4O2LA 2NPIA 3W5IA 2VSFA 2NO0A 3LNCA 3FDIA 5EXXA 5L3VA 5FUVA 2EW1A 4NCNA 2ORIA 2ZU6A 3OIWA 4M2LA 5K8IA 2BMJA 2ZSDA 3M0EA 2GETA 4GMDA 4Q19A 4UQOA 3EWSA 1TNDA 2H16A 4IFEA 4JYBA 3H86A 2MSEB 4DVGA 1ZYUA 1ZIOA 3BFXA 5C4MA 3KKNA 2ZSFA 4ZI3A 4LBZA 4QJ5A 2FZ4A 3NDPA 4TQAA 3VNUA 2PH1A 4GZLA 2HF9A 2BBSA 1KK0A 1LS1A 2R6DA 2GHIA 1XWIA 3B6EA 1QZXA 2GNOA 3H2YA 4QJ4A 5AUNB 3I73A 3CX8A 4LCBA 2QMOA 2BM1A 4LJ5A 1Q57A 2G77B 1WBBA 3CX7A 3E5HA 3VX3A 3EARA 4CVNA 3IDQA 2IYQA 5EQTA 4R7ZA 4Q01A 2QTHA 2ATXA 5FTKA 3ZVRA 4GP7A 2YNMA 1R2QA 1ZUNB 1SVIA 2VP0A 2WVJA 2ZS8A 3FHCB 1G4AE 5JWRA 2Q9BA 4PTLA 1KJWA 3S1AA 1C9KA 3CONA 3EIEA 4U7DA 5DYIA 1SVLA 2W0MA 5TDHA 3L0PA 2ZITA 3ZLJA 1Q1EA 3AQ4A 3SYNA 3UPUA 4TL6A 2BCJQ 1KJYA 1XTQA 4C9BA 1HY3A 3SFZA 3TE6A 4XWAA 1KZGB 2YC2C 3A1SA 3W6NA 1DADA 4G01B 3NTUA 1B0UA 1XEXB 2V55B 4F7WA 5KDOA 4MGYR 1G16A 1G3IA 2QAGA 3CM0A 5TB5A 5TMPA 1A2BA 1ANKA 2JLXA 1G7CA 5C18A 1Z6YA 2VH5R 1HE1C 2JEOA 1Z3IX 2BC9A 2CLCX 2JJ2D 4W7SA 2KJQA 2DY1A 2VLIA 2J1LA 1NSFA 2RHDA 5FPSA 3RS4A 1Y3AA 3RDPA 1II8B 1T8TA 3HU1A 1KI6B 4KO8A 5JHHB 1TEVA 2CL0X 2QT0A 1AKYA 3GJ5A 2J5XA 1JAIA 3BS4A 1OW3B 2JJ1A 1LB1B 1E9CA 4LHVA 1QG4A 4JVSB 5CDFE 1MT0A 4KXFB 1CRQA 4GOJA 5BYKA 5JI3E 4KVGA 3O47A 1QDEA 1F2UA 1KMQA 4XVRA 4M1MA 2C95A 2JLSA 1QRAA 5BN4A 4DXAA 3IEUA 1ZRHA 3BRWD 2B8TA 3P26A 3FKQA 4TWZA 5G3ZA 1FX0A 5KSZA 5AWFC 4S35A 3CNOA 1DBSA 4LPKA 1I2MA 1HUQA 4D81A 1JAHA 3D8BA 4KODA 4LYJA 1R5NA 2OAP1 1YU9A 3ZZTA 1VIAA 1SXJC 4A0HA 4A8JA 4A36A 1Z6GA 3MLEA 1G8PA 4D82A 4RY2A 5J4HA 5EUQB 4US2R 4KHZA 2F43A 3MAAC 1Z47A 2F1RA 5KOYA 2WKPA 2JIZA 4IXMA 2IXGA 4N0DA 5JBQA 2GCPA 2PZEA 4B47A 1C4OA 1G4UR 4R98A 1QHHB 5M04A 1DG3A 2HF8A 2P6UA 3FGNA 4HB3A 2OLJA 3PFIA 4YXWA 1NVUQ 2J46A 4DBLC 2MSCB 2C04A 4LX0A 1XEWX 2WKQA 2CNWD 2PZFA 2WOOA 4HEJA 2IYVA 1UAAA 1JNYA 3BB3A 1Z2CA 4TLCA 5SZHB 2CCGA 2YOGA 3CWQA 4LYHA 1E9SA 1NLYA 5CYPA 2ZU0C 3Q85A 4HB4A 4Q1DA 3K0EA 4BLTA 1TQ6A 3UIEA 3CR7A 3LQQA 2GZHA 1QHHA 3FE2A 1TEXA 5FUWA 1E9EA 3O8CA 4LYFA 5F9FA 5KYKA 3QF4B 5F2EA 1N25A 1GRRA 4QHYA 4HUTA 3W3AA 4FD2A 4POAA 3FFBA 4HAXA 1TAGA 1OFIA 3KB2A 3K0FB 4RZ2A 1MABB 3AVOA 1E4VA 3KB1A 3HP1A 4FI3C 1AJEA 3GJ8A 4ON9A 3MWKA 2ZRIA 4OHXA 1GVNB 3NG1A 4JVLA 1JQLB 1OB5A 1F5NA 1Q22A 3LA6A 3SQXA 4W5JA 1NVVR 2GEUA 2IWHA 2ERYA 4BFYA 1T8UA 1Z06A 2X8AA 5IHPA 5FOUA 4P32A 1RJ9A 1J70A 3SI7A 3MD0A 1T4GA 4MYHA 4WZBE 3KJHA 2PMDA 2J0QA 1YR7A 4CIDA 1W46A 4LV5B 1FL9A 4RD1A 3W3ZB 4URXR 4MDEA 5J4YA 5JRJA 3I1FA 2OBLA 1HA3A 2QPAA 5CM9C 4DEYA 3SQWA 3FYHA 1VG9B 1XP8A 2QM8A 1D2MA 3GPLA 2G9NA 5HKKA 4O0MA 1Z08A 4RCZA 2CL6X 3EX7C 4A15A 2D06A 2BCGY 1L2TA 2QORA 2XXAB 2ZYWX 1ZNXA 1HTWA 1E4YA 1OFTA 4NCKA 4NU0A 1XMSA 4JL5A 4NONA 1A7JA 2BMEA 5KTYA 1GL7A 1VTKA 1ZINA 4MKFA 2Z83A 2UZ3A 2F9LA 2IUSA 1N0UA 3LH5A 4M1SA 1SZPA 2NZJA 4B3FX 3KUDA 4JMPA 3Q3JB 3GLHA 1HV8A 4IOLA 2CJWA 1XD9A 1S1MA 1NBMA 1OF1A 1QVRA 2YHSA 2AN9A 4JSTA 4TT3D 1O3YA 1UF9A 3BAFA 4PQFA 4DB2A 3PUVA 3IIKA 3QE0A 2JDIA 4PAQA 3E2IA 3OFNA 4BPBA 3VR2A 3LX5A 4FIDA 4I4LA 3EG5A 4Q4HA 1II8A 2ONKA 1IHUA 5TVKA 1U0JA 1SKQA 1X8JA 1Q3TA 1OSNA 3FWYA 3NH9A 4UXJA 4CEHB 4OJKA 2FPKA 3BGWA 3H1TA 2DWOA 1GOTA 1S2MA 3U4QB 2IBMA 3A1WA 4RD2A 1G8FA 5BWMA 1DEKA 3CUEF 4NBSA 1P9NA 1F3OA 1QBKC 5AJYA 1MABA 3EXAA 1KHTA 4Z54A 2OBNA 4V0MA 2VF8A 5EXSA 4EPRA 3UMFA 1OH7A 3E1SA 2CXXA 4UJ5A 3X1DA 4K46A 4PAMA 5CYOA 3OF5A 5GJWC 3ZS9A 1XPOA 4QGHA 3LD9A 1EWRA 4IFBA 4PR0A 3HR8A 1G7TA 4OQNA 4QHSA 1XDBA 5C1BA 2C99A 2PLFA 3M4YA 1KI8A 3KQKA 1II0A 1O87A 1YZQA 4AYTA 1P9WA 2XOKD 4NYJR 5UKDA 2ZM5A 1CULC 4KFTA 2QMUA 2A9KA 3TK1A 3V4FA 2OFOA 4Q9LA 3I8SA 2MSDB 4PC3A 3CW2A 4CF7A 3GP8A 4HB0A 5KSYA 5DN6A 1CTQA 1XFAA 3BIFA 2HUPA 2ZJYA 4Q03A 2HT6A 3EZ7A 1EESA 4Q00A 2JJ2A 3WP0A 1R0WA 1P2SA 3KXLA 5CM8B 2GJ9A 3MGCA 2A5DA 1KJZA 1KI9A 3W8NA 2D7CA 1CJVC 3NXSA 4FMCF 4I1VA 3TNFA 4A0FA 1GG2A 3OAAD 1MR3F 3TH5A 1FUUA 2DFKB 3K0AA 4OI2A 1SVMA 1U90A 5JHGB 4ARZB 2R44A 4G3XA 1HH4A 3TQFA 5KNCA 3G0HA 3Q8XB 2C9YA 4FCTA 1VPLA 2W2TA 3QKUA 2JA1A 4OK5A 4QOSA 4HUQB 3WMGA 5JEEA 3C4JA 5TV2A 2W00A 2VF7A 3KKQA 1IN8A 2WJJA 3CIOA 4TLDA 3ZQJA 2X19A 4E5UA 1VHLA 5ELXA 3GJ7A 3AVQA 3B13B 2J0SA 1UDXA 1A4RA 1VYTA 1PLJA 2KBFA 3RSLA 4I1OA 4TQ9A 4RKEA 2VP6A 4M9XA 4TLEA 2PBRA 1YVDA 2G3YA 5CIQA 4BLRA 1N6LA 2G0TA 3MJHA 2JGNA 3A58B 5A0FA 2WSMA 3QNUA 4IEIA 4P3YA 2YJTD 1P7CA 1TX4B 1U99A 1T3SA 3CRQA 3FMPB 2Q9CA 4CEIB 2WJHA 1IJFA 1KDOA 4B43A 1FP6A 1G6OA 3PVSA 1L4YA 1FX0B 2WOJA 2GAOA 4ZKEA 5JWOA 4G0NA 5BN3A 2EWWA 3GEHA 3JVVA 4P0TA 4MA4A 4HLQB 4JS0A 1NL3A 2Q9AA 4W5HA 2F3TA 1XCPA 4A8JB 3REGA 3R20A 4LJYA 5E7JA 1CR2A 3IQXA 2OCAA 1KK1A 2R6CA 3QXSA 3P20A 3LV8A 3UKDA 1PV4A 4JLPA 2GCNA 3B1YA 1X1RA 4B3GA 4FINA 1US8A 4KJZA 3EPHA 1R5BA 1W36B 4Q7KA 4K8OA 5DLQC 3AKYA 1XXHA 2HLDA 3LWNA 3RNLA 4B2IA 4B44A 3KX2A 3NEJA 1G5PA 3AVPA 1N3BA 2FF7A 3WBKA 2WICA 5DN6D 4Q5IA 4DLYA 3U7GA 2YKGA 1XCGB 5BW8A 1R8QA 1XB2A 3KQHA 4XWKA 3ETLA 1KO5A 2I1QA 2Q6TA 3ASYA 4A2WA 3TR5A 1COWA 1JB1A 4D0GA 4TL7A 1XMIA 3QIAA 5ANRB 2ZTSA 3QOFA 1LFDB 2FEMA 4EFNA 2YINC 4A1FA 4XSGA 1T9HA 2V1XA 4C0LA 3PENA 1OE0A 2N42A 2RGXA 3KFVA 3DZDA 1P3JA 1PLLA 3H4MA 4Q4JB 2JLRA 1IN6A 4ARZA 4Q1EA 4IVRA 3VKHA 2W58A 4G5RA 3ADKA 4XOIA 4EQ6A 2R9VA 4U5XA 3SYKA 2ZSBA 3A4NA 2ZJAA 2RH5A 2B7BA 4D4JA 4CEHA 4OK6A 3DKVA 4URYR 3AVYA 4B35A 2DFTA 4X8HA 521PA 1PZNA 2O0KA 2OESA 4ZPXA 1QHSA 4GI7A 4BRWA 5CIWA 1E9DA 2BKUA 1Q44A 2PT7A 1AGPA 2DFLA 2FEOA 1E2DA 3AV0B 2J0UB 4HZUA 4D4LA 2OCYC 4G5OA 5LD2B 1A82A 3VR5A 2GK6A 3LXXA
chains in the Genus database with same CATH superfamily
1SEPA 2C4TA 3QHQA 3EZYA 2ON6A 3AP2A 3UJBA 1VG8A 4BMSA 2PRIA 4R9UC 4UC0A 4L6AA 5LB4A 3AUSA 5GVRA 2I7CA 2P6RA 1YB7A 2WSBA 2AW5A 3SSMA 1VBKA 1HQYE 4B32A 5K8TA 3ACBA 1M1UA 2QVCA 5SYAA 1ZFNA 3UN1A 4OSEA 3ZHSA 4CQMA 3JALA 3TEJA 4BGVA 4D46A 1LLCA 2Q5LA 3IAUA 3PUIA 4QSHA 3EPKA 4TM7A 4X7BA 3QWIA 2QRHA 5B2ZA 1NKTA 1KYIA 1KY3A 2O7SA 3A8TA 3HFRA 3JQAA 3OLCX 3WLOA 2BFCB 2BE9A 3TTSA 1J5EB 4JLBA 4LE0A 3KXDA 3OZWA 3QY9A 4H35A 3GAZA 1NBME 5FL7D 1JBKA 4FNGA 4LRSB 4N8EA 4D8WA 1ODIA 5EHGA 1WUJS 4KBGA 5A3VA 5FOQA 1YJXA 2BUBA 1ULBA 2FWJA 2P77A 4D8VA 4YHHB 4ESVA 1NI4B 3ZGXA 3FOAA 3GAMA 1EFRA 1QRDA 1CJBA 4X92A 3LW8A 1Z4KA 4UEOA 3NO4A 1E1DA 3SOZA 1P45A 1RYZA 4WHMA 1Z5OA 5EP3A 3DYVA 4E2YA 1FMFA 4EDHA 3QSGA 1J7JA 3FB4A 2VHTA 2RGNC 3W5JA 2BOVA 1RMQA 2CNOA 2GPJA 3W7BA 2A4KA 2HA2A 3HCCA 3C8ZA 4JV5B 3BMNB 3KCNA 1RWPA 3ZG6A 3A9TA 4DG5A 1T8SA 1G63A 5K45A 2OUKA 3FR8A 4DT1B 4FFPA 3ZY5A 5IZCA 2QKYA 1R6UA 2J3LA 2QE6A 2WFLB 3DL4A 3MQFA 3O8QA 4CTKA 1K5PA 1YK0A 2G4CA 3HJNA 3KJNA 1W1WA 4C2AA 1G3RA 3QPWA 4UZEA 3TRHA 1XWFA 1ZC3A 2PPVA 5SY6A 3SM3A 1W0JD 3F71A 2HHHB 3ETNA 3ND8A 4JY7A 5E3JA 4DXHA 3QFCA 5D5HA 2I4OA 3BXXA 1P0FA 4MZXA 3R5KA 2WIFA 3JRNA 5CGQB 5HKBA 3T38A 1TQDA 3HNPA 3LIIA 4H2DA 4K05A 1J1UA 3ND9A 2XDQA 4ZCLA 2YW9A 2C2XA 5K01A 1Q3HA 3B9RA 5INTA 3E4CA 2P8JA 3GVHA 4FFBA 4ZU6X 3T5PA 3K0FA 3NOXA 3C3MA 4L78A 4DR5B 2R2GA 3S2SA 3K70C 3M82A 5EVJA 4DB4A 2LDBA 2EJVA 1VJDA 3LIPA 3TIFA 3T9BA 1PFQA 1TFUA 1HBJA 4X85A 3WDMA 3DLAA 4GGOA 5DKFA 4AJIA 4PZAA 4GKKB 4ESHA 2YW2A 3WGIA 2L19A 3A14A 3P27A 5CK4A 3PR1A 4EI8A 5BV0A 4LGMA 1YJ8A 4W63A 1USUA 3FMFA 4JUCA 3OZRA 4L28A 2WAAA 5EA2A 5FIUA 2H9YA 1UBCA 3PUWA 3ESQA 1IVYA 1Z8FA 1I30A 4UVGA 2M6LA 5DP1A 3CUYA 4BVLA 4RM2A 4P8RA 2QTVB 1UEJA 4MI9A 4ZDIA 1GAJA 4R1LA 3QW4B 4XIGS 5J40A 2CV1A 1WPRA 3LZ6A 1KTIA 3VGJA 5TGZA 2VCYA 4GBGA 1I51A 1AOXA 2CN1A 4N9WA 4OYHA 4WK0B 3IAXA 3SF8B 2D0DA 4NNPA 3EQ8A 1RTKA 2VDKB 5HWSA 1CF9A 1CS0B 4MQLA 1N1MA 1N5MA 1CF2O 2PFSA 1TZJA 2VH1A 3KOZA 3V4OA 4F2GA 1TCBA 1F38A 3A32A 3FF4A 5KWVA 2FZVA 2AFIA 1M6NA 1ORTA 2H31A 3N76A 3PI7A 3LGXA 3HXTA 5CG1A 4LDZA 3K6SA 3ZNOA 3I39X 2LD4A 2C2GA 2DHEA 3DBRA 4FGKA 4IAOA 3DKKA 4R2LA 1MV8A 4YI3A 1CVRA 4Z0TA 2ZT6A 3G2OA 5JYDA 1EFHA 4H17A 3I72A 3GUCA 3UBTA 3GFTA 1C3VA 3TECE 4YJ3B 2YVQA 4PG7A 5HFNA 3ANTA 1IXSB 3UGQA 4BMOB 5CT8A 4MI1A 1E4OA 2DQSA 2GPBA 3CRRA 3I3SR 1YIOA 5C8YF 5HZMA 3TLAA 4EG8A 2OY0A 3D6UA 3ESXA 3A0UA 3R3JA 4HP8A 1MVNA 2NYUA 3DH0A 4WLFA 3UOGA 5SYMA 5JASA 2J09A 1V2HE 2FMIA 1MN6A 2CE7A 1IDOA 1UKCA 2HMAA 2KS6A 3DEIA 3NAZA 3OJLA 4G5SA 3E5MA 4OAOA 1CUDA 4M1ZA 3T5GA 1H4VB 3OU2A 4GGMX 5IC6A 1YDMA 4FOOA 4DIMA 2UUCB 4LXUA 4EG5A 2YXNA 3ZDRA 4TMWA 1HMPA 1NTRA 3C3KA 2EHDA 3NKFA 3NIFB 3DKPA 1NBAA 1O95D 2Q3BA 1JFFB 3FIJA 3DDNA 2IYUA 3VKUA 2NPFA 4CV1A 3OEHD 3NX4A 4G0VA 2IZZA 3R7WA 3HJRA 3R4VA 3TB4A 5DGXA 1A8HA 1EFUA 1G3UA 1HC7A 3KFXA 2AFHA 3VH1A 4OBBA 5CITA 4X66B 2WJ6A 4C4YA 4DLPA 5FBVB 1MRSA 3ANXA 2A0WA 6CHYA 3CVWA 3C5WP 3C6QA 4ISCA 2WNIA 5EWJB 1WY5A 2HDHA 1UM9A 3UOAB 3OQPA 3JQ8B 1QHYA 1TC1A 2GN9A 2CK3A 2YWDA 4NDZA 4GMXA 3G5UA 1XNGA 3D7KA 1QGOA 1QUFA 3AP1A 4GT1A 5AP9A 4BQEA 2X0FA 3KKKA 1MHPA 3P9PA 2IHBA 5EJ4A 1C0EA 3OEHA 3ZXSA 3DL7A 1ESZA 1O0CA 4U4AA 4NVRA 4JLSA 4UCFA 4GWKA 4YAFA 4D3YA 5J3JA 1X7GA 5LP1A 4OQYA 1GV0A 3F7TA 4NBKA 2ZI6A 4RTSA 1J99A 4X0EA 1F0NA 1ULUA 4CU2A 2GA8A 2VT3A 1ILEA 1P62B 3GWGA 2WF9A 2OBMA 3FCAA 2FNAA 4EEXA 3H8WA 3VNSA 2HJSA 4X20A 2AR9A 3EVAA 1ZMXA 4LK3A 3SS9X 4GNKA 1PYDA 3AEZA 1R5OA 3LZCA 4M9QA 2EKZA 4RETA 1J5XA 3COZA 3ZCPA 3TAHA 3AB3A 3QYJA 3STTA 2DPXA 4GR5A 2AFIB 5BMOA 3F8TA 5A9TA 1O94C 4DOMA 4B9AA 3KO8A 1GQ2A 5EE9A 4IXNA 3FSGD 1LS6A 5E9AA 4FE7A 2I54A 4UE3S 2E4YA 4X6UA 4Q3EA 2OM2A 2VJKA 3OZBA 3IIJA 2FTKE 2O1EA 2XAUA 4PYRA 4WY8A 3ZGNA 5FNVA 1KEEB 3GPCA 3W8DA 1X15A 2ZJ4A 3Q9SA 3B5IA 4C4RA 2C3OA 2SKDA 2YOFA 1NFRA 3IBYA 3UUGA 5GONA 3K9BA 4UHCA 3M70A 3VR5H 1H85A 2QTMA 1A4IA 4M60A 2FPGB 5BMVA 1KDZA 3GWZA 1VGVA 4ENUA 3LY8A 4ZDKA 4LZWA 2J9ZB 4XUDA 5JLJA 2ZIXB 3ZIUA 2X9GA 3W8FA 5CA1B 1CY1A 1E3MA 3PFNA 3WLIA 3UHJA 1LNZA 2KW5A 1QH9A 1ZU4A 4JQCA 3G68A 4LOKA 4P6VF 1G5IA 1A9OA 1JLHA 2P0EA 2REOA 3BJIC 3DBLB 2Z6QA 3AHHA 5KVQA 1GAQA 5HKAA 4WDRA 5CTJA 1FLDA 1OOEA 3MGBA 1LWOA 1ESEA 1ONOA 4ND8A 3AYXB 4R0VA 3FGPA 5DTMA 1QBGA 1B8VA 2W6OA 4EJSA 1HE4A 3G7SA 4EHAA 4CM8B 2C1XA 1JXQA 2OXRA 2CJWB 1PR0A 2YZ7A 3CQ9A 3GD5A 1T9AA 5EP4A 1F5SA 1Z13A 3EGXB 1YOBA 5ALSA 5IH3A 2AFHB 4YXWD 4PN3A 5ALNA 5JZOA 1M2VA 4TV9B 3IMFA 4TGLA 3LUJA 3IQWA 3IXMA 2YRFA 2AEEA 4M0PA 2P68A 3KBOA 4QVKA 2CJYA 3NGXA 4M9CA 4D79A 5LWHA 1N4DA 1MIOB 4ZCMA 4P93A 4KSYA 1PUXA 1UKYA 3KT0A 1GRQA 1Z75A 1RXSA 3G5MA 5B12A 4G5XA 3IVMA 3ER8A 1BFUA 2YDYA 1SULA 3H8JA 4ZV4A 3FKSA 5JC1A 2FMKA 5EWLA 2HSJA 1SXJD 1IMOA 4M6WA 1R0ZA 2YBEA 2QR3A 4UM9D 1GLNA 5CVDA 4DDTA 2Q3CA 5TT0A 2PMCA 2AOUB 3WNQA 3IDOA 2ZG6A 4MVJI 4S2EA 4ZTBA 1N3IA 4DA9A 5BRJA 4KCGA 3FTCA 4FX2A 4XFDA 4YUAA 3OPNA 3A4YA 3PDIA 1PKEA 3ZE1B 4JZKA 4ZEOA 2RAPA 4XTCS 1NX6A 1XJWA 1A0OA 1R18A 2GR9A 4W9NA 3KVRA 5C8XA 2ZUEA 4MGZR 2PZKA 2R8BA 1E92A 4MUEA 3LUBA 2ZJ2A 1T25A 5IK2A 2H1SA 3G1UA 1T1RA 1E62A 2IZ0A 1ECFA 3TNLA 1IUNA 5G0SA 2W42A 3I76A 3LT1A 4M37A 1UP6A 4MS3A 2QRGA 2XE8A 4NKRA 1VG1A 2NU8B 4ACBA 2WQ6A 4ATNA 4W8GA 1B26A 1PIWA 1A04A 5KDDA 1O4VA 2CBXA 1OC4A 1I7DA 2C78A 1E0SA 2QLTA 1AQUA 2GRJA 4L57A 2P5UA 3IBGA 1JSRA 2RAVA 4R1UA 3IOBA 4JENA 3ISTA 4QQ8A 1WNTA 1JTEA 4FYKA 4JK3A 5HS4A 3SDZA 1PLKA 3K92A 3KDSE 4ZP1A 3OC6A 1WWKA 2V7QA 4B76A 2UZ0A 4WY5A 2XCTB 1L1EA 1HT2E 2VBIA 5DLEA 4YY3B 7MHTA 3MS4A 4DA4A 5B3AA 3HJUA 3QKSA 2B3DA 2TMGA 2CD9A 3RWOA 5CDFA 3OAAA 2WD7A 3ZNNA 5CA1A 5JVDF 3MBIA 2C20A 4B6QA 2CLMB 3BJZA 2JGKA 4FQ7A 4NBUA 1H1LA 4EQ6A 5BV7A 5E1OA 4D42A 4I1UA 2GEBA 1L7OA 1GU0A 1UOQA 2YV2A 1L7AA 2DOKA 1GGVA 3BD9A 3L5OA 1Y7IA 4MGKR 5TF0A 2OQVA 3M6IA 5K4HA 3ZV5A 3K1JA 3WISA 3DFUA 5CJ2A 4GICA 4PE5B 1ECLA 4PS1A 5AW0A 5CFRA 3P4YA 4MQFA 4KUGA 2IK8A 1REQB 3A05A 4GPBA 2V8BA 1T6XA 4N0QA 1EX1A 3HR7A 4U8HA 3TGWA 3HVIA 3UH0A 1TYCA 2WWIA 4JNKA 2EX1A 4PO1A 3T1HB 4ITRC 4EH1A 3RSGA 2XHEA 1OXSC 4LKOA 2KLBA 2ZYIA 4NFHA 4BL5A 1G0NA 4EB6B 4G2NA 2IH2A 4RJLA 3IAFA 3P5SA 4K03A 1K2WA 1T36A 1ZVQA 2AEMA 2QW8A 4OGWA 2P4SA 4FZVA 4RFLA 5G4KB 3GYGA 1PVOA 1USKA 3HZZA 4XJXA 3DP7A 5YASA 3HEAA 2ORWA 3RSSA 3TIGA 4AUKA 4CFZA 1SQFA 3NBYC 2O3RA 3DR3A 3ONEA 2RBKA 3O8DA 4XOUA 3EZ2A 2MYNA 4DEVA 3CVUA 3I53A 3D7LA 3U2QA 2ZRDA 1WQ1R 5DE3A 3DL0A 2QD2A 1PS8A 1KNQA 4JVMA 4DCOA 4D5GA 5EJ6A 3NT5A 1TZ2A 1XELA 4UBIA 1DUVG 1ADGA 1ZMBA 3PDIB 4HEA6 4RHEA 1NUTA 5M34A 5C53B 4I66A 5JISA 1W0KA 3R7BA 1JFTA 1S02A 5D3MA 1M1XB 4JLJA 5A7GA 4Q7JB 2IHVA 2REQB 3C24A 2ERXA 3MUNA 4AIRA 2WKRA 4MLZA 3RWMB 1T5SA 4XQGA 4AJJA 1EK2A 1JI0A 3G9QA 2X0KA 4AUNA 4U7PB 3R9XB 1IDN1 5H5JA 4MAMA 1OXVA 4JHXA 4D4KA 3IA7A 3PTLA 1SKUA 3JQ6A 3CB4A 2AI3A 2VK2A 5DEOA 3NAGA 3MWEA 4LIPD 4MV1A 4ZQHA 5DF1A 4D26A 2W6QA 4WESB 1VP9A 4KR7A 1MH9A 2EBFX 2AYZA 2BFBB 2O54A 2B8NA 3VJMA 2AG5A 1ICEA 2G0NA 4UATA 4BO5A 1X86B 5KVAA 3P9KA 1SELA 3H11B 2VZ9A 3HCAA 1YGPA 4R40A 2P69A 4RL6A 1C8KA 2AHRA 2ZM6B 4M1WA 4PZEA 1MAHA 1P4HA 1N5LA 3A9CA 1XYGA 3L92A 2OFPA 3QU9A 2HQBA 4FT2A 1LPNA 2HC9A 4QBKA 3TS1A 4OQFA 4PGMA 4PLZA 1FVOA 1TVCA 1W5EA 2WB4A 4GS5A 4Y67A 2XADA 4N54A 3G89A 1EWQA 5C1PA 3RJZA 2WD7B 2X77A 2CVFA 3HABA 4IRUB 1XZQA 3EIHA 4H27A 2CB9A 3SR0A 3HXOA 3LBFA 1PDWA 1TLLA 2I7VA 2MDTA 3QK7A 4KQMA 4EWLA 3BJEA 1ZUWA 4HDNB 3HYRA 3UICA 4EJ0A 5KNLA 3A27A 2O5RA 3D2CA 2ST1A 3S70A 4DNOA 1SOVA 9ABPA 3P0HA 1G8YA 5HFAA 4KPYA 1IQRA 2HIGA 3IIIA 3LUPA 1SXQA 2HIAA 1S3GA 3H4VA 1V25A 4JXKA 3HU2A 4MWZA 4AU1A 4R2MA 3IUPA 3ELWA 5FD8A 5IKOA 4DJEC 2RBGA 2BIFA 1UXOA 3Q11A 4CM6A 3VYRB 4DXDA 3BSSA 2FSGA 3UHFA 1TGVA 4BO2A 4C0WA 3U6BA 2AVNA 3G9UA 2GBPA 3H2BA 4QYMA 4TYPA 1JQDA 4M21A 3HDGA 1PT5A 3C6BA 3C6XA 4PSVA 1SXJA 1X0XA 2C61A 1IBRA 8GPBA 5DHSA 1KRHA 3AZQA 3IP5A 1BD3A 3FYUC 1ZRNA 1Y0BA 5CH5A 3KUKA 2EFHB 3AY6A 4DUPA 4EVSA 5CB6A 3IR6A 1NPYA 2XTNA 4WXEA 3ETHA 1X8KA 3CVVA 3BMQA 4ND5A 4BE9A 2IBSA 1BXKA 4B74A 3IMKA 2J0UA 4MP8A 1YE3A 1J20A 1GA6A 1JLMA 3A6FA 3OHSX 1IHOA 2GD6A 3BTSA 3GN1A 5DM60 621PA 2LZ0A 5GM2A 2JAXA 3MLBA 4JC5A 4CCYA 1CUXA 4AZ3A 3BK2A 3OX4A 4BWFB 1FQJA 3TD9A 4WFKA 2QN6A 3I1YA 3S4YA 2KI5A 1KVQA 2B30A 2VHVA 3HZRA 4NE9A 4OATA 4Q02A 4BGIA 2XWSA 4DBZA 3T5AA 5FPPA 1EUDB 5A9SA 2Q4OA 4IHJA 1ZJJA 5ES4B 3VNVA 1ZSVA 4HRVA 3Q0EA 3AUKA 4N40A 3OU7A 1EFVB 5C8DA 1PJQA 1A97A 2WE7A 1VE5A 2BEKA 5F1YA 2CEAA 4KB5A 3ZBTA 4BZWA 2EDCA 3D4PA 3SXUB 3OCJA 4LZZA 2XB4A 1CZRA 5IVDA 3TW6A 4H18A 2OVFA 1NI3A 1QPGA 5JSQA 2CVHA 1GNSA 2GD2A 2JJ8A 2QX9A 3X2FA 1H4SA 1AZTA 2HA0A 3D3WB 3GH3A 5A3QA 3U80A 4CT5A 1EX6A 3NT2A 4DV2B 3PX7A 2HB6A 3HKBA 3I32A 4K3UA 5EOVA 1S8FA 5HSGA 3WMEA 3PGKA 3ZLVA 5LJLA 3RS8A 2WLSA 4C89A 2CFSA 2XKAA 5CLFA 2HBQA 1UQUA 4LMAA 3WYEA 3EEOA 2WF8A 1S9DA 4J6EA 1U9ZA 5HJ2A 1ZNYA 4TT8A 5GOZA 2MR5A 1FRVA 1COWD 1M83A 2QVXX 4J94A 4P80A 4EYQA 3BB4A 2C57A 2Q1YA 2R86A 1SUEA 5F51A 1HQDA 2HMWA 1Z73A 1IZZA 3KB8A 1KERA 3O92A 4RF3A 2O8BA 2DF8A 3QHPA 5ELLA 5EXTA 1G55A 3DPIA 1I94B 2QGFA 4G1MB 4RV4A 2XGOA 4AQYB 1PR9A 5F73A 3KYJB 2O07A 5DX0A 1BIFA 4PTZA 4F4IA 1M34B 3H17A 4ARVA 1WS6A 1LJUA 2OV2A 1BX0A 2WJPA 3I05A 5A5VA 1M54A 2XWQA 1SGWA 5JJKA 1X14A 2H08A 4YWHA 4GM1A 4BX0A 3FCXA 3V46A 1J6UA 4Y2TA 1JDSA 1T24A 4LG1A 2Q3FA 2PX4A 3NVMB 1U3TA 1MU0A 1Y34E 4RXUA 2ECFA 5JMWA 2R65A 2GAJA 2OHXA 3UFXA 4CTJA 3MGKA 2FOLA 1O1YA 4UQLA 1SUWA 1Z74A 2QP9X 2QJRA 1JAXA 1U3DA 2VHJA 3HVKA 1DIRA 3L06A 3KPUA 3ONNA 4QBHA 1NXWA 2XZDA 1G6KA 3PZRA 1Q0PA 1YS2X 1ORHA 3OBBA 2V5UA 3L6RA 1LSSA 4JJZA 3EXIA 4Q66C 3RSOA 3E3OA 3I6MA 3ZXIA 1CPYA 5HOEA 2GXAA 3MTAA 3S1AB 1W6UA 2DULA 3MCAA 2ATVA 4HDKB 1FFXB 2PRYA 2VJLA 3OI7A 4O4HA 3ACCA 4D6XA 1PL0A 1LFAA 1C3XA 4N7MA 2BEVB 5K3DA 3R9KA 5C5IA 4LFAB 1K9SA 1XCOA 1CQJB 3GL9A 4LXHA 2AWOA 3V33A 3QTLA 2EQBA 3ZLBA 3EXHB 1HT3A 1XD8A 4E4YA 1GDDA 2WEKA 3SIXA 2VPZA 3Q3EA 3PQ3A 2XHZA 1M1YA 2YZNA 3RFCA 4UE6A 5HCNA 1NIJA 1K7YA 1B6TA 5SZKB 2YWHA 3O1JC 1ZQ1A 4UOEA 1UANA 4WN9B 2H00A 2GPYA 4RK7A 3QELB 5AJZA 2W6PA 4H0NA 5EE3A 4G1UC 5DISB 4OYLA 3HQ4O 3OIUA 3FZYA 3THXA 1CEXA 3HBLA 1PS9A 4UVIA 5SYNA 3OQ6A 4RK1A 1UZMA 3DVQX 4KE9A 3JD4A 1Q84A 3TI9A 1E0AA 4RX1A 2ZDQA 3WZ2A 1P60A 3PWKA 4K1LA 3NKLA 3R9WA 3CZQA 4NPAA 1WUIS 4O1MA 2Q3DA 2CB0A 2VXYA 1YZYA 3MWDB 1JG1A 3NPAA 1T6BY 4IJQA 3A3PA 2IDMA 3SHTA 4F9GA 1PW7A 2DHCA 4Y2SA 4E5MA 2J5RA 2JLUA 2FR1A 1NX9A 1NBOA 3NS7A 4JBIA 5DNDA 2D1RA 3VTKA 4DIDA 3ANNA 1E3EA 3QXCA 1I13A 3AC0A 2A8YA 3RABA 3E27A 3UYLA 1U2GC 3C4QA 4URVR 4FKZA 3FHOA 3KUXA 4HDRA 4OQDA 3EPJA 3K31A 4D44A 4CMIB 4GI3A 5JAQA 3P32A 5F5LA 5J2UF 3HKEB 1UMBB 4P7JA 4MR8A 1K4MA 4E6PA 4MMYB 2CWDA 1RQPA 4NV0A 1UKEA 4DM7A 2C2KA 3A0RB 1O7JA 4DQXA 2HA3A 4KWIA 3STXA 3BIOA 1LSJA 3C8UA 1RRPA 1M1NA 4R1PA 5FOSA 2AN5A 3QXGA 2H7VA 3OKAA 2FRVA 1VI5A 1JUDA 1KIMA 1V8PA 2HV9A 4GRDA 4MS4B 2QSJA 4AFNA 1U0TA 2PMBA 3UAWA 1YDEA 1TIBA 4HDOB 2WHXA 3ZZMA 1QAQA 1NG1A 2MINB 2PUWA 1M10A 2G09A 3EZFA 1FUYB 4DLVA 1RPZA 3RC8A 1TPYA 4BZQA 4ZYLA 2W8BB 3A11A 2IELA 4LFCB 1MQSA 2F90A 2PKCA 3K7EA 3UHPA 4IRMA 4JEUA 2B1RA 3QBEA 4PZYA 3RVJA 5CXXA 4CCAA 4E5DA 3PD7A 2IS6A 4A16A 1X92A 3HB9A 1Y6JA 5KQMA 1F2TA 3S2FA 1MXHA 3RIMA 1F6BA 1E1QA 4N6NA 2RHBA 1D03A 2KMLA 3B52X 3HCNA 3THRA 5I7AA 1OLOA 4GR9A 3AY7A 2XNDA 2E1RA 5KYGA 1KP3A 2ZKLA 3LCRA 1E2QA 1VSQA 1Z8DA 2W48A 2QEQA 3DLIA 1W5AA 1PGPA 3EQ9A 1CJUC 3IELA 5FI3A 2HMUA 3ABIA 3AEKB 3JCZA 2VF4X 3VSAA 3VJRA 2H8KA 1QZTA 4FR0A 4XJVA 4ND8B 2CVQA 2LRHA 1STOA 3ACDA 4LRQA 4TKLA 4A6DA 4AJ2A 4WW0A 1NVWQ 2Z5GA 1D0SA 1LK7A 3MJ4A 4BLOA 2O4UX 2GJ4A 3RC3A 2NP7A 2ZUWA 1P4RA 3RF7A 4AK9A 2ZWAA 3UJPA 4TSRA 4R2XA 3QVGB 5JSFA 4WKOA 2DKFA 4B40A 5A02A 2CV0A 3AIMA 3KOWA 4WZAB 2PBFA 2GO1A 1DAIA 3NZEA 3PQ4A 4XYEA 2E5LB 4REQA 5BN1A 4CMEC 3O9VA 4R3NA 4ILEA 2X6QA 1H2ZA 1BOFA 3TKAA 3EZ6A 1QGDA 4FN5A 1FP4B 4HI0E 4S1TA 1UH5A 1E1CA 4WX2B 4R9NA 3OHPA 4KVFA 3MPOA 4B3MB 4ECAA 2X58A 1OXKB 4QBGB 5CT6A 1ZUD1 4I1YA 1U1DA 1TD1A 2F9MA 2HK7A 4JJFA 4K5QA 4QO8A 1B23P 1VHQA 1PK8A 1RNLA 1WIWA 3CH5A 3PHCA 1MO5A 1YUBA 2D0IA 4OJQA 4W6ZA 4I55F 4Y0VA 3L8FA 1MQ9A 4BMNA 3B1ZA 4NF2A 3T7JA 4C2UA 1TQ4A 2BLNA 5ICSA 5L51A 2FU5C 1GCGA 2H57A 4WBNB 3OY7A 2F67A 5B7GA 2H4YA 3FFAA 2AMYA 1WMEA 4HH1A 4HYQA 1N9ZA 3ZU2A 1UEIA 3MT9A 2CLEB 3HZHA 1D6SA 1NUPA 4XCQA 3X1KA 4JD5A 4UXHA 3HADA 5ULLA 5KNBD 4B80A 2B5VA 2GJSA 4G4SP 3UGJA 1FDVA 2PRSA 4JCOA 4GL2A 1X1BA 3Q3VA 1AD2A 4WRRA 5THQA 1PFUA 2AF4C 2H06A 2P0YA 1ODTC 4MSUA 5JJLA 4GSYA 4FDVA 3WB2A 4HJXA 1E9FA 2PXAA 3QXXA 5DBOA 4B4OA 1K4YA 4E5SA 3NDBB 1GQOA 4K9LA 4B3RB 3U3OA 3KV3O 4CL8A 1D8TA 4D3DA 1DWQA 3ESDA 5JYBA 2AB0A 3OZXA 1A9ZA 3FWZA 2V54A 3T94A 4CRWB 2JFGA 1G8HA 2J48A 4IIDA 4Y2JA 4I5DA 4MW9A 2B83A 1IHYA 2H11A 4C5CA 2YYZA 3T7SA 1PGQA 4P4SB 3FLAA 3PNMA 3DWEX 1ODFA 2YJNA 3C7AA 4GKBA 1QRUA 4UCXA 1PFKA 1P74A 1RMYA 1PWEA 3G0IA 2ZULA 4GMGA 2VXOA 4M55A 4QAJA 1KZHA 4J0EA 4QDXA 4M46A 3O8RA 2VSXA 2GO7A 4BFSA 3ZHZA 4X61A 1M74A 2J6HA 3KHTA 2G82A 4OQXA 3SYRA 1YRLA 4NK4A 4HPJB 5C9ZA 1UXKA 3KT3A 4C0JA 5TX7A 2FYTA 2OAQ1 1QQ6A 1UP4A 3AEKA 4JLNA 3QENA 1H0SA 1PZXA 4X3PA 1KFJB 5JOQA 3OTOB 1SVOA 1PTKA 2Y1XA 1QF6A 2FN4A 2W6JD 2XUIA 4IVPA 4AKIA 3HCBA 3PP8A 1Y33E 4M38A 5FLYA 3B60A 1NURA 3ML1A 4G8DA 1VCMA 3A9WA 3C8HA 3EC2A 4O1IA 4ZRNA 4FFNA 1XHFA 4BMPB 2HLNA 4DVJA 2F48A 1S4QA 1FXWA 1V1RA 4HH0A 4MCAA 4QWWA 3HO8A 5I9NA 3GNTA 5T4BA 1JFVA 1YDGA 2D1SA 4Y7CA 3PICA 1KC3A 2CNKA 2CKMA 3DOJA 1YACA 1U63A 4MVJP 1UBGA 1V7PC 1O03A 2DGDA 1H3FA 4CM7A 4HSEA 2I4RA 3UMRA 2BFAA 2XUZA 3HDVA 3IODA 1HWYA 2OGUA 2PZAA 3GJRA 4LVOA 3GRZA 4DCNA 1TMGE 1NA5A 3L8CA 3A3KA 4QTTB 5FWXA 3DO6A 2GLUA 2LW7A 4IZ6A 1RJWA 3WGOA 2MSLA 1LBTA 4ZAWA 3TRKA 5KYWB 1VJGA 1Z2EA 2FXVA 3EXG2 2YXBA 3Q15C 5K2OA 3I01A 2FPOA 2H29A 3ZTTA 1Y8QB 2DBYA 4ZANA 2HREA 3EAQA 3HYNA 4RKRA 3EW9A 2HJ9A 3BL6A 5EHXA 4IDNA 1BG6A 2FK8A 2G06A 1GAEO 2YHAA 3BG5A 1VE6A 1YRAA 4RZHA 3ECSA 2RGGA 4DG9A 2REQA 4CZ2A 1VYHA 2WSSD 3OEYA 3F8SA 4ALMA 3DXFA 2P1RA 1R0KA 4CJXA 4P7FA 1PTJC 1E6LA 4N3NA 1PCXA 3GHHA 2C0CA 5FR1A 1P72A 4M76B 3M2TA 3TW8A 3ZX4A 1Z7WA 4B17A 4ND4A 2AXPA 2ESRA 2JD2A 2ZRLA 1NV8A 2VJBA 1ESNA 3OIDA 4IDGA 5IUKC 3GGSA 3ZCSA 2QNIA 4H60A 1DT3A 4E31A 3OURA 2O8DA 3ZVKA 3T1QA 1RKQA 3BH6A 3TJZA 4GDFA 4PPYA 1P0IA 2QG4A 2PX3A 3NRJA 2QSZA 2XTJA 5KSWB 2W8ZA 3K8YA 4J1TC 4Q3BA 2MSNA 2P9EA 4CV0A 2SICE 4P4SA 5G1OA 4HWKA 3V97A 3WQHA 2F8TA 3QXJA 2XXAA 1SG9A 2ZI7A 4NU5A 1RC8A 4N03A 1E69A 3EPRA 3IKJA 3HXPA 2H1IA 2AEFA 1FBTA 3ES9A 1P2TA 2QV7A 1PW5A 3D6MA 3MIIA 2O8EA 4YCSA 3CLUC 4WIAA 4F9FA 2A0FA 3W04A 1J2EA 1DJLA 1WB9A 1BVHA 1QVAA 1NXPA 2O1SA 1I7PA 1RRVA 1NRXA 3P94A 2JGDB 1N5RA 2V9PA 1DGQA 3GUUA 2NZ8A 4M36A 2J3IA 1WSWA 5E1DA 1OWMA 3RU3A 3O8BA 3ZCRA 1RQGA 2JAQA 7YASA 5AI9A 4C0SA 2GKGA 3NGLA 1CUZA 2ARKA 4YI5A 4C07A 4DIBA 2B5OA 5FO0A 3VR6A 4EKEA 3S28A 4CIBA 1D2HA 4HNAB 1PE0A 4FNMA 4QOEA 3EBPA 3F90A 4QYWA 3G2QA 3UTDA 4NQRA 2PUGA 3CH4B 4IX1A 2BM9A 5JVDA 2ZFUA 2D5IA 2OT3B 2B6HA 3P4UA 5DFAA 3ZE8A 4I81A 4J3JA 4LDQA 1WZEA 2IL1A 1X87A 2DR3A 2X0RA 3AUYA 3PC2A 3AW9A 4TWJA 1L5RA 4JYAB 4DNPA 3X1MA 2VEOA 1UBUS 1VPTA 1U6JA 3CLUD 2BSXA 4URFA 1KFCB 3OMXA 4GPEA 3K6SB 5ALKA 5JQGA 3LC0A 1FNMA 4RY0A 2VTBA 4NZ9A 2PVPA 2HDNB 2Q5CA 3UATA 4RMNA 1VHDA 2IC5A 3KSMA 4W1PA 1KPIA 3EMBA 4XIYA 5IKXA 3ZWAA 3DD5A 4IH1A 3BXFA 1EDEA 1XEAA 4JGIA 3VUFA 4BLUA 3TQIA 1YS4A 4JH0A 1ISMA 3SVTA 1NW3A 1Y80A 2P2NA 3JAKB 2QI9C 2VJOA 1Y4DE 3I0ZA 4IHQA 3ZNPA 3F2VA 5ALWA 5HF8A 4A26A 1O97D 4OI4A 2NU7A 3ENKA 4FS8A 4OHKA 5LXTF 5B3LA 2RE8A 2OWDA 5HXAA 1DAOA 1OBFO 5JFTA 4OI0A 5DK4A 3I2KA 1L4KA 3TXAA 3TLMA 3GT0A 1E2IA 3ILXA 3L8HA 4BU1A 1EK1A 3EQ7A 3RS0A 3RAGA 4RTQA 1M33A 3WL8A 5A9SB 1NLMA 3T9EA 4F5ZA 2PWBA 2XBMA 3KE9A 1YRBA 2JIBA 2NXJA 3EDRA 1OLSB 4EL0A 1U8XX 1DS6A 2R751 1OYYA 2YNMD 4J0KA 2VSOA 5SICE 4DZTA 4F7DA 1RKVA 4YP0A 1FNNA 2OXFA 5BVGA 2RIRA 1XZCA 2XX3A 3B2NA 4TV8A 3MGGA 3R7SA 4QOFA 1QG2A 4HQ6A 1SBHA 2TRSB 3T4PA 3H13A 3GELA 3GCXA 4CCWA 2FRDA 1WDTA 2O4CA 3MJVA 1PAUA 2WG2A 3T7TA 1D2NA 4WBNF 1PJBA 1TM3E 1N7GA 2CHEA 1Q14A 4JDPA 5KQSA 2QAGC 2HWUA 4EI7A 1UC4B 3FX2A 2IA5A 3CXUA 4LC1A 4Q3OA 1VBNA 4L72A 5DI3B 3HVHA 1DO8A 3VR3A 4CI9A 4KREA 1VL1A 3IQHX 2VF5X 4ZVNA 4RPGA 4EI2A 3BRWA 2W98A 4I2VA 3SDBA 2IBTA 1R7RA 2R48A 3Q3CA 3FUXA 2ZB8A 4UCQA 4DCSA 3GH1A 1A96A 3LTEA 1LVGA 2O2HA 3L7YA 2P1ZA 3KFLA 4HB2A 3UJAA 1M75A 1QNFA 1XRQA 1LK0A 2BE7A 3BFJA 3O6VA 4O4IA 4OLJA 1TU3A 4PLPA 4ZVMA 3WGYA 2IY9A 2Q4TA 1N92A 1UADA 1KQNA 3NIDB 2J3HA 4IHKA 4Z51A 3NATA 2WYHA 4OQPA 4TWAA 3OM1A 2QJWA 4GOMD 1DRJA 1DRUA 5AD1A 4HTFA 3GIWA 4X71A 5KYNA 5TPWA 3PQCA 2UZ1A 1R12A 4O5AA 4ZC1A 5L8VA 1ZH0A 3MMPA 1MKYA 3BDAA 3W4IA 4EMTA 2W2QA 4CN9A 1I9GA 3PYLA 1YKSA 1X8LA 2Q99A 2B1GA 2W5UA 2JCSA 4AN0A 1BDJA 4F04A 5D6OA 3HE3A 4WA7A 2BPOA 2D3TA 4AT1A 4QVGA 5JJ5A 1X39A 2JJ1D 2F64A 2QYSA 2VHCA 4Q9DA 1L7BA 3SEFA 3QVUA 2XMQA 2Q8QA 2VHUA 3RKRA 5HIMA 2FEKA 4RQUA 1E1MA 2NXNA 4P31A 3N8NA 1IHXA 4NH0A 5HIJA 1DIOB 3K5HA 4MVCA 4N82A 3TMAA 3TOVA 3WGGA 4CUZA 5JXJA 4E1AA 1O9HA 2QG9A 5FH9A 5BORA 3E9DA 2HSZA 1Y1RA 3CZ4A 2C2ZA 1EBBA 2YWGA 1KDRA 3HDYA 3O4GA 1DUSA 1QE3A 2YXEA 5DWQA 1KDYA 3IA2A 3LVRE 5FOXA 1CQJA 4U6NA 5TJ9A 4PICA 5ITSA 3T7EA 1UDWA 4ZAVA 3OPQA 2HA6A 4F93B 5BR4A 1TW2A 2NYVA 1E3WA 3NM5A 3NBFA 2X6TA 4K6MA 3ZGVA 5CNJA 2Q8NA 3QF7A 2A59A 5FHQA 2YFHA 1ZX1A 1MNQA 1XLVA 4L9SA 3HWSA 1MB2A 5ALOA 4DC9A 1UJMA 1WUKS 4G5YA 3O1LA 3QI2A 4TRNA 1DKLA 2OXCA 3THYB 2C97A 5LUBA 5I8PA 5JI2E 2C83A 2HA4A 2AGVA 1LA2A 4RK0A 4ILKA 5A4FS 1VRVA 3HB0A 5J2UA 3NOOA 2WYUA 4IYJA 2JANA 4DCPA 1P1FA 1V43A 4PSKA 4UMVA 1D4FA 2QSYA 2V97A 2X9LA 3M6LA 4IFIA 3QU5A 4IJKA 1XK7A 2VPXA 4XD2A 3MCTA 2EZ9A 2G9ZA 3E61A 3F5QA 1NQVA 5A1JA 2P7HA 3ZGZA 2FPRA 1U8EA 2WUDA 4D5EA 3W8RA 5EXDA 1A4XA 3IH5A 3KZXA 4XLTA 3DF7A 4RJKA 4CYMA 4F1WA 3ERCA 4H9GA 4ZGWA 2C5EA 3IVXA 1NP6A 4EGAA 4OHPA 4JFRA 1T8WA 2IYEA 4HDRB 4HYEA 1JYFA 4H3SA 3T5TA 3T61A 1IPFA 3AZOA 2UVPB 1G20E 1BTOA 1M8PA 4ZQBA 2GKOA 3SC6A 2I3DA 2Q5JA