4NKRA

The crystal structure of bacillus subtilis mobb
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
163
structure length
148
Chain Sequence
b'FPIVQVVGFQNSGKTTFIERILEKASEQGLNLGCLKHHDRYQAAGADVTAVEGAGVLQLTARRLWDLTRLIELYQFLETDCLLIEGFKKAPYPKVVILSEKEDLEALKTVNTIAIIYRKKEHMTEHQGLPIFHADDPVAVDLVLSQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
publication title Insight into the Role of E.coli MobB in Molybdenum Cofactor Biosynthesis based on the high resolution crystal structure
rcsb
molecule tags Unknown function
total genus 38
structure length 148
sequence length 163
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nkrA00
1UBEA 1GIAA 1E1RD 2VP2A 4JLMA 5DO9A 3BB4A 5C4GB 3R9WA 3BJIC 3K9GA 2EYUA 4L5BA 2HJVA 2FSHA 1VKJA 2R2AA 2V4ZA 1YZGA 3AP3A 5LB4A 3WNCA 4FI3C 3CWQA 2ZU6A 2GEUA 1K5GA 3U3JA 1KI3A 2C03A 2XXAB 1EFUA 1QHIA 3CNLA 1EX6A 2ZETA 3MGCA 1LNZA 2AWOA 4DLVA 2QENA 3A4LA 1XEXA 4G5RA 2J3EA 1NJFA 1Z0IA 2Z6VA 2PT7A 4IXNA 4OJKA 1MR3F 2J46A 5FTLA 1SZPA 2WKPA 3QOFA 4DIDA 3A1SA 3SYLA 1S3SA 3QKTA 5BWMA 3U6KA 3CR8A 1Z22A 4II7A 3ZGXA 2FSFA 1FZQA 1NG1A 1FQJA 4OBEA 4AG5A 1Q12A 3DKPA 4Q03A 3TR0A 3ZDQA 4TLDA 4PPGA 4TN1A 1DAGA 2FEMA 2EFDB 2ZRMA 1NMXA 3BIFA 1NN3A 1FNMA 4WZBE 3B1YA 3T06B 5TV2A 3ZVMA 4B35A 3K70D 4ZKDA 2YZ2A 3ICQB 2VLIA 3PITA 1CTQA 2P0EA 1XCGB 2ZYUX 1B0UA 2D3WA 3I62A 3RRZA 1OFTA 1OYWA 2ONKA 3C4JA 2ZM5A 4B43A 4G5OA 3WNBA 3EWSA 4AK9A 3LH5A 5AR1A 5CJ2A 3CBQA 1GRQA 3PQCA 4M22A 3VX3A 4BLRA 4ESHA 5CK5A 3TVTA 3FOZA 3WNDA 4RFVA 1NMYA 3TUJC 2F1HA 1O3YA 3WBKA 2E1RA 2NTYC 5EE0A 3SOPA 4V02A 5JJIA 1N2CE 4F91B 2V9PA 2EFHB 4A4DA 2Q3FA 4TLCA 3FFAA 1A2KC 4UJ3A 3K09C 2ORVA 3RS5A 2D62A 4C7OA 3EZ9A 3G5UA 3K9LA 5EP2A 4HB4A 2ZITA 4BFXA 3C14C 1W49A 3FHOA 1WMSA 2JDIA 2KB0A 2PMDA 2BC9A 4JBYA 2RB4A 4IDOA 1ZJ6A 2YOFA 4GMDA 1YZQA 1EFRD 3L2OB 1BKDR 4Q9KA 4B3GA 3AF0A 1KHTA 3MAAC 1NBME 4EQ6B 1Z0DA 2R9VA 4OK6A 4Q7JB 4ARZB 1GL6A 1G8PA 4YMTA 4M2LA 1NNEA 2W6JA 1TQ6A 2DPXA 1NVVQ 821PA 5JS7A 3X1DA 1P9WA 2J45A 2ANCA 1ZM7A 3FDIA 4Q01A 3U7EB 4Q5IA 2CE2X 4DCTA 3OESA 8OHMA 1ZD1A 3DOFA 1R5NA 1COWA 3SZRA 3KB1A 1N6LA 4EIWA 1S2MA 1HV8A 1U81A 4M8NE 3U3RA 4XOIA 3PG5A 4JLDA 2ZRKA 3AVTA 3F5FA 3QF4B 3PEWA 4XD7D 4PO8A 1LY1A 1RIFA 4R98A 4BZQA 4D4JA 2W6ID 2ZRBA 3FMIA 4JT4A 4QFMA 5BYKA 4Q7LA 3IPYA 1FW6A 4CDGA 1W4BA 1Z6TA 2QBYB 1A7JA 3W5IA 3K0AB 1DVRA 1FPMA 3L0SA 4LYFA 2HJGA 1UFQA 2IYXA 3LBHA 1RW4A 4OQLA 4TLAA 4UNQA 1XXHE 4Q1BA 3AVVA 1DADA 1I2DA 2JJ1D 4FCWA 1OYYA 2GZDA 2OBMA 4IOJA 3DO6A 1XMJA 4BLOA 2P5SA 1JBKA 1PLKA 1SVSA 3R20A 2DFNA 1E2IA 2PH1A 4FMBB 2BV3A 2ZXUA 3GPLA 1DE0A 3BS4A 3CX8A 4IFEA 1S8FA 2OLJA 3WRYC 3KX2A 2BBTA 2WAXA 1M7GA 2XOKD 4US2R 1Z63A 2BEJA 3FMFA 2BHRA 4CEJB 2JLXA 2HLDD 1DOAA 3UXMA 1Y63A 4JJZA 2GVZC 5DN6A 1K8RA 4RCZA 4RKFA 1XBTA 5H1YA 4LBZA 4C2UA 3LQRA 2V7QD 2X1VA 5BQ5A 2BCJQ 1NRJB 1JAIA 3K09A 4WBSA 1KI6A 1Q3HA 4ZIRB 1JALA 4RZ3A 4JYBA 4FCTA 4BEJA 4W5HA 2V6JA 4M9ZA 1JR6A 1KSJA 5GVSA 3WY9A 3RC3A 2VA8A 3EIHA 3CRVA 1F2TB 3IIKA 4QNRA 4G01B 4YQFA 2ZRIA 2QM8A 2Z4SA 4AKIA 2WWYA 3ADCA 3ADKA 1LS6A 1G7RA 1X8JA 1KI4A 4TQ9A 2ZE7A 2AD1A 5F9HA 4PHFA 1EFTA 2O8CB 4DSNA 1NL3A 2OV2A 1OIVA 4GMXA 3R8CA 3H2YA 1XTKA 1JPNA 2GESA 4HZUA 1Z08A 4WZ6A 4LK2A 1VYTA 3RRMA 2YYZA 5IK2D 3AF3A 1N3BA 4XSGA 3PUYA 1Z2CA 5CK4A 1FX0A 2FPMA 2QAJA 4POAA 4RCYA 1OXUA 1R0WA 1E2JA 3QXSA 2O5VA 4RZUA 3UANA 1KZ7B 1AQYA 1R5BA 2QSZA 3C7KA 4EDHA 4AKHA 3EARA 1OIXA 4FW9A 4MKFA 3CRRA 5LBIA 2PJRA 3KTAA 2XGJA 1E2MA 2F1RA 3AVQA 2YJTD 2ODBA 1XEWX 3WHLA 4A15A 2VIIA 1NLFA 3WMFA 2LCFA 2IYTA 4QBGB 4PZLA 2H5EA 2HF8A 2FF7A 2QT0A 3CM0A 4WXRA 2FV8A 2D2EA 1BMFA 4QHSA 4ZO4A 1ZC3A 4A92A 3QI2A 1F60A 2ZJ2A 5JCPA 4DUGD 2B8WA 4A9AA 4A36A 1P75A 4NBSA 1ZM9A 2YKGA 1X3SA 4DXAA 4NCKA 1YR7A 2BBWA 3KQLA 2NZ8A 1DAIA 5KO2A 3I92A 1D2MA 3PXGA 1VIAA 1XD8A 4B71A 5IF9A 2QU8A 1G19A 1DPFA 4LHXA 5GJVC 2OFXA 1YR6A 1KDPA 1EWQA 3JZMA 4ZPXA 3RS3A 3FFBA 4TTQA 2JASA 2H57A 4HI0E 3AVPA 3ZH9B 4PZZA 3BFXA 3NWJA 2WKRA 3DM9B 4GDFA 1DO0A 3BH0A 2WWHA 1JPJA 1CBUA 2QP4A 3UK6A 4Q19A 3LVQE 1QZXA 4UNNA 2VP0A 2FJUA 1E2DA 5FBVB 3B82A 2NIPA 2JLVA 1E2FA 4JLAA 1Z5ZA 1CRQA 1NIJA 4FXPA 4HB0A 1CJMA 4D0GA 4MGZR 4QGGA 2WIAA 4OK5A 1B23P 1G6OA 1IBRA 1A82A 1UEIA 1P2UA 3P27A 4NHOA 2OBNA 4JBXA 5BN5A 2UVQA 2BVNA 1P60A 2EYQA 1DS6A 1KMQA 1QHGA 2Q9AA 4A8JB 1E1QA 2RGAA 3T61A 2IF0A 1GILA 1N6OA 4QJ5A 2REBA 3BK7A 3MJHA 3B85A 5FTNA 4C0KA 1XTRA 4BFVA 2O8EB 4Q4HB 5JBQA 2O8BB 4OQMA 4AYXA 4TMTA 1UDXA 3O8DA 2ZRNA 4YC7A 3ZIAD 4U7DA 4D25A 3Q9LA 4FINA 1TU3A 4F38A 5TMPA 4OK3A 4TYYA 1E0AA 4B3FX 3THYA 2VO1A 1ONBA 2G0TA 1GNQA 3W6OA 3OEHD 3HR7A 1ESNA 1W0KD 4GFDA 4QHTA 3BB1A 4B76A 2FZ4A 4JL8A 1VYVA 1K6MA 2IEZA 1JNYA 3C8UA 1AS2A 2B7CA 2IL1A 1YZKA 1DTSA 4ZDKA 1G5RA 2W00A 1ZNXA 4BECA 3A4NA 1VPLA 3IO5A 1QHHA 1W46A 3PUVA 4NKRA 2QE7D 3LBIA 1KMHB 2AKAB 3K0FB 4XVRA 1IN8A 4LYAA 1RRFA 2ONJA 1PVOA 3MCAA 2GCOB 1N5IA 2XXAA 1HH4A 2GK6A 1VG8A 4RD3A 2C96A 4CRWB 2QG6A 4QGHA 1E9BA 1XTSA 2EWWA 2JLYA 1W2GA 3CW2A 2A9KA 4C9BA 2V8OA 3KB2A 1Z0KA 3HPQA 3TW8B 1G5TA 1E2EA 4IXMA 1G4AE 1T4GA 2WJGA 1MT0A 5EP4A 1NP6A 3EA0A 4F4CA 2ORWA 5FOTA 4MRNA 1W47A 4Y0VA 4QGFA 1A5TA 3SN6A 3GJ6A 3PR1A 4A0GA 1KTVA 1L2TA 5TY0A 4L16A 2Z5FA 2EQBA 5K8TA 4MKIA 2RAPA 3EZFA 4NL4H 3AVOA 4IJMA 2KBFA 1SQ5A 1CJTC 3GEEA 1SVOA 4ACAA 4V0KA 4HAUA 1N5KA 4A0FA 4DCSA 3CUEF 2CE7A 1NBMA 5TARA 3A37A 4D82A 2XSZD 3K1JA 4TMZA 2ANBA 5J40A 3U3OA 1XWIA 4AC9A 3AP2A 5IRCD 2DHRA 4F4JA 4OJQA 4B44A 1KK3A 1IN7A 5BW8A 2YV5A 3SFVA 2NZJA 3SDZA 2AD5A 5EJEA 5J4VA 2F1JA 2XNDA 3AV0B 3QXCA 1SVLA 5DYIA 5TVKA 1JI0A 5JLJA 2UZIR 4Q1FA 2AR7A 2C8VA 2FFBA 3SR0A 4P3YA 2IXEA 4GOJA 4B47A 2ZAOA 5HKKA 4RY2A 5FH9A 1XTIA 4URWR 2BMJA 5KNBA 1ZINA 2IYZA 1CR1A 1V5WA 2XJ4A 2DFTA 2NO9A 5GJWC 5SZHB 4C0BA 2HUPA 4EJSB 4JLJA 1DAKA 4M0LA 5HCIA 3KKOA 2GF9A 5D3QA 1UAAA 1VG1A 2CCKA 2AL7A 3RRYA 3A36A 1T5LA 4IEIA 2HEIA 2ZI5A 3BORA 1SXJD 2VQSA 4EQ6A 2JLUA 4F92B 4ARZA 1OXXK 3BAFA 221PA 3W6NA 4HAWA 5HE8A 1E9EA 5FOWA 5UKDA 1ZW6A 5AWFC 4QKQA 3HDTA 1QG2A 4JVNA 4KFSA 3U7FB 4K81B 2LKCA 2CEAA 2HDNB 2ZI9A 3N5CA 1G1MA 4Q1DA 1IAQA 1RC8A 3B1WA 3VMFA 4DLRA 4JSYA 3OIWA 1W7AA 5KDOA 3QF4A 4YXWA 4QXAA 2QPAA 4A0HA 2VPPA 1Z28A 2A78A 1KAGA 4MKGA 3VR5A 3B1VA 2IF2A 3IBGA 4LBWA 4LBVA 1FQKA 3K0AA 3I73A 1SKYB 3NVAA 1QG4A 3MWJA 2FU5C 1PJRA 2XJ9A 5KPJA 4M1WA 4PC1A 4ZDIA 3U4QB 5HTKA 2FNAA 2ZSDA 4TMXA 2F55A 5TB5A 1NY5A 3QSYA 1NN5A 1N6PA 1X6VA 1IY0A 3IIMA 3MWYW 3AKCA 2W0SA 4Q9IA 3QENA 2GJSA 2V1XA 3Q5EA 2OCYC 1UF9A 1XPOA 3CH4B 4KODA 4ZCMA 2FG5A 4CEJA 2HT1A 3I4LA 4F4IA 4EPYA 1HT2E 3ZJYA 1X1SA 2I1QA 3QPVA 5K8IA 1EFCA 2AXNA 5EUQB 4LPSA 5KYKA 1R0XA 3TRFA 1BO6A 1XPRA 1R2QA 3KKMA 2IYQA 2OESA 2BEKA 2WJJA 1J90A 5H8WA 1L4UA 4ZIRA 3KQNA 2O52A 2PEYA 2QRZA 3Q8XB 2ZIAA 4IVPA 3LLMA 1HY3A 4AKEA 3JVVA 3UPUA 2VP4A 5DE3A 2NO6A 1LB1B 4R71A 5KPDA 1F2TA 3T1VA 1A2BA 1WXQA 2AN9A 1SKYE 2JLSA 4GBMA 3REGA 4RVCA 3B6EA 1NVVR 1E9SA 1U9IA 1G3MA 4RJLA 4MQBA 5EE3A 2OFOA 3SJAA 1JAHA 4KU4A 2G77B 2ZUCA 2GJAA 4K46A 2O8CA 2ORIA 2AX4A 1FP6A 2DB3A 3GJ3A 1PLLA 1ZU4A 1UM8A 2Z0MA 1NJGA 1OE0A 1OXVA 4A8JC 2ODNA 5JRJA 1CR4A 3V00A 3VKWA 2YC2C 4ESVA 1ZNZA 5FTMA 3ZS8A 3W8NA 2VF7A 3WP1B 3OFND 4LX0A 3T15A 1RVDA 2BJWA 4PTLA 5FBQB 5EXXA 3B78A 4MRPA 2YWHA 1E69A 1VCNA 4TYQA 2A5JA 3NXSA 2GEVA 2DY1A 5FPSA 3BERA 4BRWA 2XB2A 1ZM2A 2NO7A 2XAUA 3L0IB 1W4AA 2BIFA 3C41J 5CB6A 3VKHA 3R9XA 1OFUX 1MO5A 1JECA 2B6HA 4NPHA 3C15C 2JEOA 5AUOB 4OKSA 5IHPA 4BE7B 4P4SB 3THXB 3CPEA 4Y0AA 2QMEA 4JLKA 3RDPA 1F2UA 3RSOA 2YHSA 3EIQA 3LXXA 3CWZA 2ZANA 2MSEB 1IQPA 2IHYA 3DMNA 1Z29A 4Q18A 1KK0A 5FUXA 4N3NA 2W2TA 1N25A 1DAFA 3AUYA 4RSGA 2QMOA 2DBYA 4DKXA 1Z0FA 3FKSA 2XNSA 5DH9A 2RGGA 1AIPA 4W5WA 1XMSA 3C5CA 5K8LA 3QPUA 4O2LA 4KV9A 2CDNA 2QM7A 3ND9A 4C3ZA 1ZUHA 4BZPA 2F9LA 2J5XA 1T3LA 4LUCA 4DLWA 4TLBA 5G41A 1HURA 2N46A 1R8QA 2EFGA 4V0NA 4KLZA 3EWAA 3EC1A 1P2TA 4KYIB 3DKVA 5FFMA 1KK1A 2IYWA 4X8OA 1E4VA 2CL6X 5JRZA 3ASYA 1GFIA 3VX4A 2GVDC 4JBWA 5JHGB 2X77A 1OB5A 4NYMQ 3WMEA 2JATA 2OHFA 2ZR7A 4E22A 1KI2A 1JQJC 5H68A 5DI9A 1ZIOA 1JR3E 3CRMA 3VHLB 3BRWD 2BBOA 3QVVA 4ZI3A 3GEHA 3QXXA 4F7WA 4JZKA 1Z47A 2P5TB 2HF9A 3EA5A 1NY6A 1U8YA 2FZLA 2J87A 5JWRA 3QE0A 3MWLA 3PUXA 2HCBA 4GRAA 4FN5A 4A8JA 4A6XA 2PJZA 4MRVA 4H9GA 5P21A 3VR2A 4V0LA 3ZLJA 3AVYA 3DDCA 2O8EA 3CONA 1KDRA 4G5SA 1YZNA 4Q4HA 4GSYA 2GETA 3BBPA 3FKQA 5HPYB 2JDID 2O8BA 3EZ7A 3OE7D 4UNPA 3OIVA 3QXJA 4E5UA 5CITA 2FDCA 3SJCA 2H92A 3P4YA 1Q1QA 2C9YA 3TAHA 5B30A 2JJ8A 4HSEA 3NDPA 1O87A 3NBXX 4OQNA 2J59A 3OIYA 2V6IA 3W8RA 4EJSC 3QG5A 1W0JA 2VSXA 1AGRA 2QQEA 1OLOA 2R62A 2JJ2D 1QHYA 3GCGA 5EP3A 3BH6A 4D0LB 4GL2A 5DIFA 1XJQA 2X19A 2A5YB 1KMHA 3K0FA 2G0NA 1Z2AA 3SYKA 1M8PA 2WPDA 2RCNA 2GCOA 5KSYA 2B8TA 1US8B 2A5DA 4LZZA 3RRNA 2N1BA 2IX3A 4TL9A 4AIIA 1MOZA 4BUJA 2H16A 4FMDF 4HATA 1II8B 2ZE6A 1OH8A 1II0A 1HYQA 2OAQ1 1XMVA 5EZ6B 1KSGA 3G0HA 1F3OA 5EQTA 2GHIA 5FR1A 2I4IA 1UPTA 3KUDA 5JMTA 1ZNYA 5JZVA 4IVRA 2PX0A 4PX9A 3QEJA 3EPHA 3B5JA 1P2VA 4L9WA 3CF6R 2OCAA 1SVIA 2RMKA 2ZPTX 2PEZA 5L3VA 3QG1A 1RFLA 2FFHA 2Q9BA 3WYAA 4A2QA 5JS8A 1G3QA 2WOJA 1HA3A 3T35A 1N5JA 4DVGA 1KOFA 1WCV1 3AB3A 5DSZA 4MDFA 5FOUA 3VAAA 3T5DA 3DPUA 2F3RA 2PZGA 2CK3A 4DLXA 3HYTA 5M04A 1KO4A 2GXQA 3QKSB 4XTRA 1G8HA 3UKDA 2OUKA 3TBKA 2QRNA 2TMKA 4PQFA 5AUNB 3B7GA 1Q0UA 2REOA 3TQCA 1XCMA 4OL0A 5KTYA 3A6PC 1I4LD 1NVXQ 3PIRA 3TUZC 1WB9A 1KJZA 4QM6A 5C2JB 4X8LA 2QSYA 1ZM3A 1G18A 1Q1BA 4S35A 4JLOA 4URYR 3TW4A 4EPWA 4TTPA 3J81k 2NOAA 2IUUA 1XDBA 1GM5A 1G41A 1CJKC 2RGEA 1G3RA 4Q66C 4M1MA 1J70A 4DCNA 2CBZA 5GJBA 5FI1B 2PBRA 3CX7A 2B21A 2CLDX 3PJRA 2ZI4A 5CDFE 1QBKC 2LKDA 1Q21A 2OG2A 3IDQA 4BLPA 2ZSBA 4EJSA 4MGKR 1FP7A 2QGZA 1GNRA 1OXTA 3D6TB 1P3JA 5L3RA 3KKNA 4RFSB 5CJPA 4IDNA 3L8ZA 3NC1C 1HE1C 1DG1G 4DLTA 4P33A 1P2SA 5AK0A 2ZJBA 1XU4A 4D81A 4GT1A 2RHMA 4IOMA 1IJEA 4TQUS 2FMXA 3PUWA 4PAOA 4TZ0A 3TIFA 4GP7A 4DB4A 3IUYA 1NLYA 3KXKA 4ACBA 4C0SA 5AUQA 3GP8A 4PHGA 3VR3A 4TYNA 1IXRC 4HZIA 3U3MA 3TH5A 1BYIA 3NIBA 1MH1A 2ZRCA 1Q1ZA 3JZAA 1IXSB 1ESMA 1LV7A 1NLZA 3DZDA 3LY5A 4Q4JB 2GJ8A 4BFSA 2BDTA 3UWKA 1CLUA 3QXHA 1MKYA 2PCLA 5JWHA 2Q3HA 2DCUA 2IEYA 2ZRGA 4EPVA 2FOLA 2NO0A 1T3SA 3EG5A 1UADA 1ANKA 1CEEA 2WKQA 1TL7C 4BRUA 4JYCA 4TT3A 2QMUA 1YZTA 1W36B 3SNHA 2PT5A 3TGPA 3LX8A 2OZEA 1E3MA 2CCJA 3TSWA 2QP3A 4XWKA 3U4QA 1TX4B 2BKUA 4ASUD 3E1SA 2Q0HA 4I99A 4DLSA 3B8HA 2RH5A 1MABB 3ZVRA 3LXRA 6Q21A 1TQ4A 1KK2A 3B1XA 3CPJB 1WA5A 2IT1A 4PHHA 5DLQC 2YWFA 1NG9A 1P9RA 3BXZA 3IEUA 2PMKA 4QNMA 1T91A 1N6HA 4CEHB 4O3MA 5KUTA 2WJYA 5E3HA 3LRPA 1SVKA 2HCJB 4NZYA 4UXHA 1E9CA 1G3UA 4WW0A 5DI3B 3R8FA 2QP9X 4KJZA 1E79A 3AP1A 3OF5A 1E2NA 4R2HA 1HTWA 4TSFA 2VHCA 3I5YA 2FGKA 2FX3A 2WWIA 5IDVA 4DCVA 1OH6A 1TF7A 2J0SA 1ZRHA 2BJVA 1TQ2A 1YZLA 4HAZA 3QKRB 5FPKA 2ZROA 3KKQA 1NF3A 2G88A 5FUWA 3I8XA 2ODEA 1RKBA 4KSCA 4DLZA 4MDEA 3BWDD 1L8QA 1HQYE 1E2HA 2CL7X 3IGFA 4HDQB 4MITA 1RRGA 1E1QD 1XTJA 1PUJA 2OE2A 4IEEA 2CHQA 2OBLA 4KFTA 2IS4A 1MRNA 1GKYA 2H17A 2O0KA 1IY1A 2WHXA 1Z3IX 4XJXA 1CJVC 3QEOA 4KXFB 2VRWA 2FSGA 3GEIA 4TWZA 5K8UA 4DLYA 1N6RA 3ICEA 2ZS7A 2W58A 4DDWA 2GZHA 3BE4A 2IUTA 4NYJQ 2ZUDA 3MMPA 4B3CA 4O25A 3L43A 1GL7A 1DBSA 2H18A 4N1AA 4P32A 4YMWA 4AYTA 3IQWA 1ZP6A 3BD9A 4JVLA 4R7ZA 1FTNA 2GF0A 2YNMA 2ZQ5A 4XVUA 1Z6XA 3AM1A 4LJ8A 3QQ5A 5KHOC 4LJAA 3R7WB 2OEPA 2C95A 4XD7A 2RGCA 4V03A 3U7GA 1SHKA 5AJVB 2VSFA 5FL7A 3IKJA 3B9QA 1JR3A 3W9YA 4AWXA 1U99A 4P4SA 3THXA 2OSBA 3CNNA 4NCHA 4EPTA 4MGIR 4R2IA 3MUFA 3LLUA 1A4RA 1MRSA 3PUZA 1FOEB 2JJ1A 5KOYA 3IIJA 3M0EA 4YMSA 4V0ME 4JSTA 3MFYA 2XZOA 2ZE8A 3EW9A 1CU1A 2WOOA 3F8TA 4KVGA 5EXPA 1NVWQ 3B1ZA 4EPRA 4QG7A 1I4DD 2IYSA 1F48A 3B9PA 2JLRA 3SU8A 4B2LA 1CF4A 5EZ5A 3QUSA 1FUKA 2PLFA 4EFNA 3VR4A 4E03A 3FPAA 1N0VC 2SHKA 4P31A 2HYDA 1NBMD 3KJEA 2V7QA 4OQFA 1E96A 4RD4A 3X1WA 1N6KA 3TE6A 3KQHA 2HT6A 2R6FA 4FD2A 1P5ZB 4XTCS 2GJKA 3T34A 3F3YA 1P61B 3HJNA 5J5CA 1XJCA 2R6AA 3TSZA 2XNDD 4EUNA 1RRPA 2PL3A 2QI9C 3IQXA 4P4TA 4B74A 4B73A 4LV6A 2OO7A 1IM2A 1AM4D 3Q72A 3VTKA 3QF7A 4LYHA 1YRBA 3AKYA 4QRHA 1J8YF 2AWNA 4QM7A 4KFRA 2A5GA 4D4MA 1GZSA 2J41A 2QPOA 4DIEA 2NMVA 2WSSD 2ZRJA 3CO5A 3KJGA 1P6XA 3D3QA 2CCGA 5CM9C 3SBEA 1G4UR 1XTQA 3M6AA 4RD2A 4RD6A 4A1FA 4QC2A 2YINC 1ELOA 2WMNB 5B58C 1Z07A 2R65A 2YWGA 1OFHA 4WA7A 3ZZUA 3THWB 4WAUA 5AJZA 3L82B 1S0UA 1OPXA 2ZEJA 1IONA 2IYUA 4NCIA 1YKSA 2YWEA 1R5OA 3BB3A 4LWZA 4BPBA 3CLVA 3QY0A 3NBFA 1ZNWA 4LHZA 5GJCA 3IEVA 4AI6A 1U0LA 1US8A 1AKEA 1E0JA 5L8VA 1OW3B 4X8MA 5KU1A 1KDTA 1VTKA 4KITB 1DELA 1II8A 4QOSA 1KY3A 5DHAA 3QVUA 2OM2A 4I1VA 1QHXA 3T5GA 1G5PA 3U2QA 4L8GA 2FGJA 5C4MA 4MA4A 4US0R 1ZIPA 4NH0A 5HZKA 4W5JA 3ZVNA 1GAJA 4OHYA 3RVBA 5C1BA 5EE5B 1VECA 2IA5A 4IVQA 4NYMR 5CDFA 2QUZA 2FEOA 4ZI2A 5E7JA 2GCPA 1D9XA 1GG2A 1KDOA 5FTKA 2GAOA 3DMDA 4US1R 4TYPA 3THOA 3GFTA 1GKIA 2ERXA 2QAGB 4B6FA 4JS0A 3D8BA 4DSOA 4LV5B 1ODFA 3SE0A 2F9MA 4GOKA 2QTHA 3K0EA 3LD9A 4G0NA 1W36C 2W83A 1CS4C 3TJZA 5L3SB 1AKYA 5J4LA 2YOHA 3OEEA 5SZKB 2I1VB 3QKSA 2O8FB 2HXSA 4JJKA 4LDJA 4OHZA 4QGAA 3BGWA 3S1AB 4D4LA 1MV5A 4MKHA 1CRPA 3QBVA 2HYIC 5FBWB 4DB2A 2GAAA 3ONWA 2JA1A 3QJYA 4QHYA 2ZVPX 2ECKA 4OI1A 2GWHA 2D2FA 1G8YA 2GILA 3OAAD 4RZ2A 2WM9B 3P32A 2AK3A 4BQSA 1TTTA 1GRRA 3KKPA 2D7DA 2C9OA 5J4KA 2CNWA 4XSHA 1U9IC 3NBYC 4MUAA 5LD2B 4JKYA 2RKOA 5FPTA 3ZVLA 3WMGA 1H8EA 1GNPA 3C16C 1S9HA 3FYHA 4C30A 1UKZA 3A8TA 4RFSA 2ZS9A 5FL3A 5KSZA 1Z0JA 4HYYA 2FA9A 5F2EA 4BWYA 2MSDB 2EFCB 1KNQA 3LWNA 2O8DB 4I1OA 3GLIB 1J99A 1S1MA 3RSLA 1W5TA 1NKTA 1Q57A 3UMSA 3A1UA 5J47A 2QE7A 1HT1E 2KJQA 3AEZA 1E2GA 5KSOA 3ZQJA 4NTZA 3CZQA 4Q9JA 2G9NA 2QY9A 3UMRA 1Q1EA 1FTSA 1G8GA 2QBYA 1Z6YA 2FE4A 4Q4JA 4IDQA 2D4HA 3GMTA 4M1KA 4OQXA 4IDHA 4OI4A 2W0MA 3RWMB 4ITRC 3L8YA 4N0DA 3KJIA 3NEYA 5HE9A 4DHEA 1EXMA 3GFOA 1N0WA 1ZC4A 2VP6A 3K70B 1I4TD 2OXCA 2G6BA 5KNDA 5ELXA 1UKYA 4S2EA 1HE8B 2JAQA 4Q1AA 2ZRHA 1GOTA 1GVNB 4MRRA 3O8RA 4RD1A 3MD0A 1E32A 4L4UA 4JKIA 521PA 4DT1B 2A7QA 5BXQC 2QL6A 3ZD7A 1XNJA 1ZCAA 3GFPA 4LV8B 1MABA 2IC5A 4FWIB 2YC4C 4L15A 2F43B 1OHHA 1QHNA 5D3MB 1R10A 5G53C 1N6NA 4TZ6A 1E9AA 2XSZA 3SEAA 5E7IA 3GLFB 4A2WA 4B75A 4WOPA 4CEHA 1P72A 3PEYA 2ZS8A 4HLUC 4C4PA 3IPXA 4Q7KA 1E94E 2GBLC 3DOEA 5DI3A 3IO3A 3U3KA 5AUPB 4IDPA 3FVQA 2J0VA 2XEXA 4GP6A 2QMHA 4M9XA 1MO4A 1TEVA 5CB8A 3W3ZB 3P20A 4QBFA 2RGBA 1E0KA 5J4YA 4ZDWA 1IHUA 1J8MF 1U0HC 2ZYTX 4FMCB 4YDHB 5CLLA 4JMPA 3SYNA 5KSPA 3BH7A 3QKRA 4Z8YA 1RE0A 3AH8A 3KL4A 2IYVA 1CP2A 1AS3A 2GNOA 1CKEA 2C77A 4M1YA 1UKEA 2Z43A 4M9QA 3CRQA 1QF9A 5SZIA 4HLQB 4MUBA 1D2EA 3KFXA 1TNDA 3H1TA 4NMMA 3K0CC 3WYGA 4GPTA 2OAP1 4KCGA 1NI3A 5EUMA 1VIYA 1H8HA 2WVJA 4HDOB 4V0MA 3H84A 5GADl 1N0UA 4A0RA 3FB4A 3GLFE 3BOSA 3H86A 1W44A 2QN6A 4TYWA 5FPHA 1K5DA 1KYIA 1NKSA 1WQ1R 3CH5A 1W1WA 3LA6A 5FOSA 4DEXA 1W0JD 2WICA 3MLEA 3LBNA 3CR7A 2ZAMA 3CX6A 4LBYA 3UWOA 3Q85A 3KQKA 1W48A 1Q3TA 4D0NA 2WSMA 2WMOB 3RYTC 1TF5A 4Q21A 1IN6A 2ATVA 3T1TA 3X1YA 1UEJA 4BGDA 1TUEA 2WPDD 2OT3B 2G3YA 2IK8A 2ZJAA 4OI2A 3R7WA 3SC3A 1Z06A 3X2SA 2F6RA 721PA 4KBGA 2P2LA 1LFDB 4PSKA 4HDCA 3EPKA 2QPTA 4PC2A 1E98A 1XD2B 1E2KA 2X8AA 2P6NA 3VQTA 1G7TA 3SS8A 2PCJA 2XX3A 1KGDA 3A1TA 4PXAA 1HEIA 1LS1A 1U8AA 3VR6A 4B48A 3U5ZB 1RZ3A 1Z83A 2CVHA 1XZQA 2XZPA 3NEJA 1OSNA 3AGPA 4HLUA 2GBLA 5JEEA 4JLVA 3I8SA 1AZSC 1E9RA 1GRNA 1VMAA 2FPLA 2MMCA 2DFLA 2X2FA 4A82A 1OH7A 4RD0A 2RGNC 1G20E 1KKLA 2R6DA 1TAGA 2CHGA 4CGZA 2CK3D 4B6EA 2ZREA 4Q00A 2ZUBA 4RKEA 1VCIA 2J7PA 3GQBA 3ZYCA 2IBMA 3RHFA 3I72A 4IRUB 4LGMA 1II9A 4EFLA 1J2JA 1PV4A 4PC3A 4B3DA 3V9PA 4GZLA 3I5XA 2FFQA 1VG0B 1XB2A 3DHWC 3SQWA 1M74A 1Q20A 3LV8A 1WBBA 3FHTA 3K0CA 5JECA 2ASEA 4I81A 1CR0A 3PVSA 2N42A 2G1KA 1T8TA 4TMWA 4NYJR 4YMVA 2OILA 1YQTA 1KO8A 2IS1A 2EWVA 3U7HB 4PFSA 2J9RA 5A5GA 3NHAA 2JIZA 2BCGY 3SFZA 4PZYA 3U61B 3RC8A 3SQXA 1N6IA 3AVWA 3P1JA 3C5HA 4Q1CA 4XH9B 3HR8A 1S96A 2W6JD 1HUQA 1UBCA 3KJHA 4Q9LA 4TL7A 4EKDA 4Q47A 3IHWA 5AJXA 4Z1MA 2ZI7A 1R4AA 2ZSAA 3OFNA 4M1TA 5LD2C 3KXIA 1E6CA 1COWD 2AK2A 3ADBA 3THWA 1OKKA 1JQLB 3R9IA 1QHHB 1G3IA 4KHZA 2GXAA 1UDWA 4TLEA 5HCNA 3P26A 2WWGA 2FPKA 1ZUIA 1KAOA 1KKMA 4XVQA 3K9HA 4BFZA 4W9MC 3E70C 1XX6A 3I61A 4LJ5A 1Z6AA 1IOZA 2QQ0A 3FMPB 4Q48A 4X8HA 3U60B 2QT1A 3NHBA 4L9SA 1TUIA 2BMFA 1ZMXA 1ZVQA 2C2HA 4Q02A 4U00A 1GUAA 3U44B 3OHMA 2V55B 4A6PA 5LDDC 1DG3A 4LPKA 4NP6A 4M53A 2R44A 5G40A 4DBLC 2QA5A 4MYUA 1D2NA 4Z54A 4RZXA 1BIFA 2RGNA 3NC0C 1R7RA 1RJ9B 1KI7A 1UBGA 3NH9A 4TT3D 4Q1EA 3UMFA 3L0OA 2K5UA 3W3AA 1LW7A 2ZRDA 4CT4B 5JSZB 4TL8A 4KI0A 3QIAA 1U94A 1G9XA 5DN6D 3HWSA 3A4MA 3QPWA 3K70C 1BYUA 1LVGA 2MMGA 4HB3A 2QAGA 3KZ1E 2A30A 1I2MA 3MRSA 3REFA 4XWOA 3AVUA 3D31A 1VYUA 1EFHA 3ADDA 4CEIB 3TAUA 4HAYA 5L3SA 1JXOA 3N2EA 5L3QB 2O8FA 1EESA 1E79D 1L4YA 3LNCA 2FFAA 3S1AA 2BM0A 3AF4A 2REXB 2VH5R 4TSFD 3H4MA 4B3BA 5F3WB 4IOLA 2PZEA 1SULA 4G5QA 5JJLA 1P7CA 4H1UA 4JLNA 4LY6A 1NIPA 4URVR 4CF7A 4NYIQ 1OJLA 2OXRA 3T12A 5JCZA 3QNUA 4O0MA 2Q6TA 1AN0A 2IWRA 3HP1A 1TU4A 1T3HA 4QJ3A 3GLGB 2GXUA 2HXYA 1OFIA 2KI5A 4JLPA 1E2QA 1E1RA 3OE7A 2GTPA 4M21A 1XXHB 5G3YA 2WIBA 3EPLA 5B57C 1G16A 1G7SA 3O8CA 3EX7C 2AKYA 1R0YA 4UKDA 4YDSA 2VEDA 2DYKA 2QTVB 2NO1A 1AQUA 1YVDA 4C0QC 2V3CC 2GEDA 5E7MA 2WBLC 4BZXA 4Q4AB 2O8DA 1RYHA 2AXPA 2JJ2A 2Q3MA 3QBTA 3GLIA 1ZD9A 3BFVA 3M1IA 4Z8XA 3JVUA 4I1SA 3ECCA 2ZSFA 4BFTA 1FMLA 2GK7A 3PEVA 3RABA 1E0SA 3F0TA 5G3ZA 4GNKA 4KBFA 4ZDJA 3WBJA 1BMFD 1GKUB 5FI0B 1TQDA 2FSIA 4JL6A 3TUIC 3D7MA 5KDLA 3TMKA 3EZ6A 3ZQ6A 1XD9A 4Q4LA 2QROA 2BMEA 2P6UA 3VR1A 4FMDB 5FL7D 1XPUA 2JCSA 2CLCX 1JR3D 2JLQA 1UBFA 2NQ2C 4IFBA 2B7BA 3WHKA 3E2IA 1IY2A 3GLGE 2WZQA 4AYWA 1TEXA 1ZUNB 2OLKA 1AA9A 5EXSA 5A0FA 4CZ2A 1JJ7A 2QTFA 2R6GA 4HLCA 4J0QA 4YLGA 2GA8A 5EE1A 3E5HA 3B2EA 4LRWA 4MGYR 5TDHA 2ZJOA 4DT1A 1MO3A 2AFHE 4QL3A 5FOXA 1FMJA 3VU9B 2VBCA 1U98A 2AHOA 2VHTA 5BN4A 1J7KA 3T1OA 4XWAA 2F43A 1NVUQ 1IN5A 1WRBA 4K8OA 4KVAA 4LOAA 5D3MA 4BEBA 3T1QA 4LHYA 5CYOA 2ZSEA 3GLFA 4KYUA 2KBEA 1XZPA 3RAPR 2ZYWX 3AKEA 3O47A 4AD8A 2F7SA 4B3XA 4UNRA 1M6NA 4TMVA 2YOGA 3AF2A 3RS4A 2CHVA 4D6PA 2UZ3A 3W34A 1CJUC 2GCNA 1W4CA 2E9SA 3O8BA 2F3TA 4FCVA 1L7VC 1OV4A 4JIMA 4ZV4A 1VHTA 1P9NA 1EFRA 4LCBA 1SXJB 3H0KA 3HU2A 2FH5B 2ZRFA 2IWHA 4KSBA 3TLXA 2VSOA 2PX3A 3MSXA 4R9UC 1BH2A 1YJ5A 1FUUA 1LTQA 1ZM4A 2WWWA 3CKLA 4BFWA 4D26A 2C5LA 4AKGA 4NDZA 2ZJ5A 4B2PA 4YONB 2D7CA 1RYFA 2GJ9A 1YE8A 1TADA 1DAEA 1S4QA 4CW7A 5C18A 2R6CA 4PPNA 1XJ0A 1G8FA 2CJWB 2XB4A 1OH5A 1YU9A 3EZ2A 1XF9A 2A3RA 2NPIA 1IJFA 2W6IA 1KI1A 3TQFA 2P3SA 2XTZA 4HUTA 5FPYA 4HUQB 1OT3A 2ZTSA 4PO1A 4XIGS 1NN0A 4TQAA 4UQOA 2VTKA 3IBYA 3W5JA 1U2RA 3EPJA 3A58B 1OF1A 5CLQA 3FHCB 5HZHA 3N70A 2Q21A 5F98A 3EC2A 4QJ4A 4YMUA 1F2UB 1SXJE 2G83A 1IXZA 1KI9A 1XD2A 2QZ4A 5DHFA 1XP8A 2H1LA 1D8TA 2ZVQX 4N0EA 4NONA 4B33A 2V54A 2VP5A 2IYLD 3CNOA 5ANRB 5TXGA 4UXIA 3WXMA 1CULC 1AZTA 1S9DA 2XOKA 1Y3AA 2B92A 4DLUA 2FN4A 1C1YA 1ZAKA 2HLDA 2D06A 2AFIE 1P62B 3GLHB 3UATA 4ASUA 2WJIA 2GRJA 2FWRA 3LAWA 1C9KA 4DJTA 4E09A 4BLTA 1AGPA 4DEYA 3HU1A 1DAMA 1JEEA 3LFUA 5EE9A 2BMDA 2J0UB 1QVRA 3RS0A 4PANA 2ZI3A 2QEQA 1ZCBA 4O2RA 1KO5A 3EXAA 4LJ9A 4B34A 3CPHA 3V4RA 5KDDA 4U02A 4BASA 3OEED 2C04A 2VHQA 3NDBB 1TF2A 2Q9CA 2MSCB 2VP9A 4DCUA 1YZUA 4C2TA 5H70A 1E9DA 1ZU5A 3KXLA 4URZR 4MRSA 1QHSA 2C78A 3PFIA 5HKKD 4GZMA 5LPNA 3GJ8A 5FBLB 4LJ6A 4M1SA 3AUXA 3RLFA 5B2ZA 4D4KA 1QDEA 2QGNA 2NGRA 1EX7A 2IUSA 4U5XA 4WVFA 4EFMA 2PLRA 3B13B 4P0TA 1DEKA 1F5NA 4DSTA 1BS1A 4DC9A 1G64A 5IK2A 2CL0X 4HAVA 3DM5A 4CT5A 3KQUA 1AK2A 4F93B 2C99A 3MG9A 1UJ2A 1G7CA 4HEJA 2CNWD 3GLHE 2VYFA 4P4UA 3IHLA 3SHFA 1P73A 2DWPA 1BOFA 2OCBA 4BFYA 4BFUA 1H8ED 3NH6A 3BFKA 2IS2A 1N5LA 2BBSA 4V0OA 2ZRAA 1E99A 4LHWA 3LQQA 2LWIA 1RPZA 4LI0A 4QBIA 4LJ4A 3HPRA 1JJVA 4UJ5A 3UG7A 2OFWA 3LW8A 2C98A 4IKEA 5DYGA 2CXXA 4C0HA 1E9FA 1P4SA 2R8RA 1XEXB 4CVNA 2XTNA 1Z0AA 1E2PA 1MO6A 1M2OB 3A1VA 1W2HA 3EIEA 4YXWD 2CLSA 1CIPA 5SZJA 1D6JA 1YRAA 4DUGA 2ZI6A 1ZD8A 3ETLA 3I1FA 4DZZA 4GOXA 1DARA 1GITA 2P65A 3N2IA 1NSTA 5FUVA 3SBDA 4ZCLA 5AJWA 2EU8A 621PA 1LF5A 2BOVA 1G6HA 2L0XA 2GKSA 1IN4A 2ERYA 3U44A 3IILA 2ZJZA 3SI7A 2GZAA 3CIOA 4MYTA 4GI7A 1H65A 1S3GA 3CF2A 4M9SA 2BM1A 5EP1A 1R0ZA 2WAYA 2J0QA 1RJ9A 4PQYA 1X86B 3CZPA 2ZR9A 2H8KA 1QRAA 4ZKEA 1GWNA 1W36D 1W4RA 1D9ZA 5JSZA 2XZLA 1DAHA 1KSFX 2F1IA 3NTUA 1GTVA 2EW1A 2ZJYA 4D2IA 2BKEA 2UKDA 1DO2A 3PENA 4LJ7A 1NMZA 1Q44A 2JLWA 2VL7A 1R8SA 1XMIA 2ZRPA 3CF0A 1OHHD 5FUYA 5FBRB 4AG6A 5HR5A 2W2VA 4TMKA 4CEIA 2J1LA 5C46F 4OHWA 3KFVA 3UIEA 4DDVA 5L3QA 3GJ0A 4URXR 1E2LA 3M4YA 4C7OB 3RNLA 2ZJ8A 1KIMA 3U6BA 4EAQA 4FMCF 1XFAA 3TKLA 2WJVA 1XRJA 3AF1A 3TK1A 2J7KA 2ATXA 3ZIAA 3ZS9A 1T6NA 1T9HA 1A1VA 3GJ5A 3OIUA 1KJWA 2DWOA 5JEDA 1M7BA 4AY2A 1KZGB 4M4SA 1T8UA 3OEHA 2OCPA 1W0KA 2WSSA 2DR3A 3VKGA 1EK0A 4URUR 3GLGA 1JB1A 2ZYVX 1WE2A 1NN1A 2WJHA 1XXHA 1T0HB 4BLQA 3TSOA 4KAXA 1H8HD 421PA 1U0JA 1SXJC 5F9FA 2KE5A 1KJYA 1VCMA 2GDJA 1Z8FA 2ZR0A 4PO9A 4Q4AA 3ZZTA 4CYMA 4OI0A 2X2EA 4OYHA 2NPFA 1SGWA 2DFKB 3GJ7A 4LYJA 2H7VA 3FMOB 4E07A 4M1OA 3LW7A 1OIWA 4LJYA 1E4YA 5FOVA 4C0LA 2ZRLA 2WV9A 5CIWA 4Q9HA 4PSAA 1G17A 2RGXA 4I1UA 3ND8A 3W6PA 4IHQA 4B2IA 2EVWX 3V4FA 3PV0A 1TPZA 3K0SA 1PZNA 4PAMA 2Z83A 1FL9A 2P6RA 3KDSE 3PEUA 2DWQA 1XCPA 3FKSD 3X1ZA 4NU0A 4WIAA 1SKQA 4G5GA 4MYHA 4JVSB 3VHXA 3FGNA 4D80A 1XEWY 1G21E 2A2ZA 2VHUA 2V1UA 3NKVA 4UXJA 4JT2A 4FWTA 4B32A 3GLIE 2E87A 5B64A 3WRXC 2C9CA 3DEFA 3PCRB 5JFGA 4EPXA 2IHBA 1U90A 4PSVA 4C0JA 2D74A 2IXGA 4Z51A 3RANA 4HLDA 4BLSA 1RRCA 2IYYA 4PPFA 1ZYUA 3RWOA 3W90A 3VU9A 1KI6B 3VNUA 4ABYA 1GDDA 1ETUA 4LSGA 4PR0A 4Q7MB 1KI8A 4NYIR 3GJXC 3DZ8A 1FNNA 1JXMA 2O0HA 5JWOA 2Z4RA 1X8KA 1YHNA 2RGDA 2G1JA 5JI3E 5DNYB 1Q22A 2J7PD 1KNXA 2YVUA 4LHVA 5KNCA 4MH0R 3A1WA 1NSFA 1EGAA 3K53A 3AQ4A 1JEDA 4PAQA 2NG1A 3X1XA 3UG6A 3FTQA 4DRZA 3HU3A 4AURA 2O0JA 1YR8A 4ZCIA 1SHZA 1T5IA 4I4LA 3OAAA 5FTJA 1X8LA 2IW3A 5AJYA 2XITA 4HAXA 1M34E 121PA 4HZUB 4JLBA 5CYPA 3WP0A 3QKUA 2KSQA 4G1UC 3EAQA 4NE2A 3ZD6A 3RS7A 2WWXA 1SXJA 2VHJA 4H1VA 1FX0B 3ZZ0A 1M1YE 3Q7PA 4NCNA 1WDTA 3FWYA 3LX5A 4TTRA 2IXFA 3DL0A 1VDZA 2CVFA 4ON9A 2A5FA 3CB4A 2JIZD 3K8YA 1KO1A 1CXZA 1VHLA 3SHWA 1KY2A 5A4JA 1GL9B 2IYRA 4G3XA 4ERNA 1V43A 4LC1A 3KTAB 4OHXA 1W5SA 3L0PA 4C0AC 4TL6A 4DWJA 5JI2E 1WBDA 2ZE5A 1F6BA 4Z1MD 4JVMA 4DDTA 3I3SR 2IS6A 3NG1A 2PZFA 5BN3A 2P67A 3AVXA 1PUIA 3GD7A 1Z6GA 5DISB 5CM8B 2CJWA 4DSUA 1OKKD 1SVMA 4IW3B 5BYJA 5EXTA 3K9NA 4HB2A 1S1CA 4HUQA 3TNFA 3OZXA 5GVRA 2VF8A 5J4HA 3WYFA 3Q5DA 3Q3JB 3G82C 4OHVA 2WWFA 3LO5A 4KFUA 1YR9A 4IOKA 1FFHA 2KWIA 1XEFA 1WF3A 3BC1A 5LB2A 2XTMA 5JHHB 1D5CA 3MWKA 1G291 4PC6A 1HQCA 3HYRA 3VNVA 4KLNA 3KUCA 3LDAA 4WZAE 4WXPA 3ASZA 2CMKA 4W7SA 3VFDA 1OB2A 2QNRA 3MJRA 3GLHA 4KO8A 4PHTA 3SJBA 3AKDA 3B60A 2QORA 4PPQA 2JLZA 4A2PA 3EASA 5FR2A 3I32A 2J0UA 5E4FA 1T0JB 3TVDA 2QAGC 3P4XA 1M7HA 2BWJA 1LF0A 1TMKA 1U8ZA 4FIDA 3DVLA 4CIDA 2WTUA 1PLJA 1C4OA 2Y8EA 2I3BA 4QBHA 2JGNA 1EG7A 5DGXA 1GSIA 1OXSC 1AS0A 1UKVY 2GXSA 4DDUA 4NCJA 5JJKA 5CIQA 1SVWA 1ZBDA 1KO7A 2W2XA 3SJZA 4PQRA 3RS2A 5IT5A 3LVRE 3Q7QA 2RHDA 4MYCA 3AGQA 4LC0A 3GJ4A 1GP2A 1EWRA 3FE2A 4UNSA 2EFEB 4ILEA 1CR2A 2HV8A 1VG9B 1WP9A 4PC7A 3THYB 3CRW1 3TR5A 1VCOA 1KSHA 1R6BX 1QVAA 5E95A 2ZU0C 4JL5A 1AJEA 2ODWA 3NBZC 1X1RA
chains in the Genus database with same CATH superfamily
4I3GA 3I1YA 4HWPA 5JAHA 3A25A 2Q4DA 3C48A 4Y1FA 4L8FA 4OLBA 5I4KA 3BJIC 1DIOB 4L5BA 3JWGA 4EJ2A 3WAGA 2FSHA 1VKJA 3ESYA 4LJKA 1YZGA 4RAQA 3VPSA 4BTVA 1WEHA 2ZU6A 2GEUA 5KYXA 2VBIA 3ENVA 2ZYGA 1T24A 3LL4A 4RJJA 4YJ2B 5DX0A 1DAPA 3U3JA 3F49S 1JWLA 3IERA 1L4HA 3REQB 2EKBA 4C5CA 2DULA 2Q2QA 1Y8RA 2BFMA 4X7RA 2POQX 4OGLA 2AEFA 1JPVA 2PBLA 3RG2A 3RUAA 2J46A 4G0YA 3ZHCA 5KTMA 2P3LA 5LYJA 2UXDB 2XMDA 5SYAA 3SYLA 4A27A 3QKTA 3L1JA 1UPBA 5F7JA 3CR8A 1Z22A 4QQKA 4PXYA 5T4FA 4CU5A 1KRWA 1R00A 2FZGA 3SS9X 4HD8A 1RKQA 3DT9A 1M2HA 3ZDFA 3IXQA 3ZNOA 5C8YF 2NTEA 2FMFA 4NBNA 5LMUB 2BGTA 3TIVA 2P62A 4QPJC 3NBUA 5B1HA 3DKPA 2WFLB 3IP9A 4L5JA 4WY2A 4MS4A 4TN1A 3CZRA 4PPGA 1W8IA 4WZBE 2JG3A 3BIFA 1NMXA 3KR2A 4NQRA 3D4BA 4QVKA 4GXQA 3RHTA 4INZA 2IPNA 5FULA 3R2JA 2K87A 1TO1E 1XZDA 1XCGB 2ZYUX 5L4NA 2D3WA 4DQVA 1GEEA 3DC2A 3RRZA 2ZBUA 4B1FA 5DBIA 4KK4A 3FF4A 5AI9A 1JR2A 1JSZA 4FQ7A 4G5OA 3WNBA 4JC8A 4II3A 3EWSA 3CBQA 4X20B 3PQCA 3QU4A 4WLFA 4OLJA 3VX3A 1FNBA 4BLRA 2WJAA 3L1VA 4Y67A 4BLUA 4HYTA 3FOZA 4I46A 4BB0A 2WNSA 1AVTA 2P9CA 4RFVA 1NMYA 4ETNA 1CEQA 3QU7A 2R7AA 4R83A 1KDVA 2H1CA 3TUJC 4KK3A 4O2AB 1ZY2A 4XM1A 2D1FA 1GPH1 4EYOA 3WBKA 3CG4A 3VAZA 4EG0A 4C4ZA 1JYEA 3F6YA 3WGUA 3FAKA 1N2CE 1ZA1A 3SZ3A 8ABPA 2V9PA 1SBQA 4BKOA 4TS4A 1HYBA 4N5NA 3TN7A 5KX5A 1CWUA 4UJ3A 4ZV7A 3F7MA 1MT3A 4J2HA 4MHOA 5FF9A 3RS5A 4D9EA 1SXQA 3EZ9A 4F6RA 3G5UA 4OHFA 4Z3KA 2FPRA 2IFTA 2AC4A 4RH1A 3NTVA 4LTMA 4CCYB 4KR9A 4O4HF 2OXTA 1TEHA 1WMSA 1WXFA 1M72A 2PMDA 4UCQA 3ZE0B 5G0UA 2BC9A 4ZICA 2RB4A 2XBLA 1D2HA 3HDHA 1ZJ6A 3ZUGA 4GMDA 1PD0A 4AJ1A 1O96B 3WLHA 5C7YA 3L2OB 1FRNA 3NJRA 4EO4A 3T95A 4DRXB 1Q0HA 4KQ1A 1TZKA 4QTUB 3W8FA 5AW1A 3T3MB 1YCDA 2O07A 2VHZA 4YMTA 3U19A 2W6JA 1TQ6A 821PA 2NYRA 1P9WA 3X1DA 4AVYA 2J45A 4DDMA 4YWJA 5HIAA 5E38A 3FDIA 5JS6A 2QX6A 4H7FA 4Q5IA 4Z2YA 3D8TA 3N6RA 1DWQA 3SZRA 2Y1LA 5SY6A 3KB1A 4OQ4A 2P30A 2QLNA 2W43A 4C07A 1VGQA 2DUNA 1KJ8A 4XOIA 4JLDA 4K6FA 5AW6A 3AVTA 2FDXA 3LKVA 1KQOA 4HGQA 5EJ4A 2H4FA 1E66A 2O50A 4R98A 2QRPA 5B58T 4FGWA 2W6ID 2ZRBA 3HNPA 4B82A 1OI3A 1D4AA 4Q7LA 1V47A 1Y82A 2BFEA 2AMVA 3EQ8A 3FETA 3OCYA 3PX3A 4CDGA 4Y9RA 1FW6A 4CG1A 4FONA 1W4LA 2ZB3A 5LZ2A 1DVRA 1YT5A 3TIIA 4Q15A 2HJGA 1UFQA 5D5QA 4V1CB 1FLAA 3TKYA 4BMSA 4TLAA 4QUEA 4D99A 1MDBA 1XXHE 3AVVA 1PT5A 1DADA 1I2DA 4R1OA 4FCWA 1PL7A 2BW0A 1HORA 4FSDA 4BNFA 4DQDA 4LJRA 2OBMA 2DAPA 4FHDA 1GPMA 2R00C 3S29A 3GI1A 4EGFA 1ZL0A 1I51A 3QOXA 1SVSA 3R20A 4FMBB 3DDZX 2BV3A 4B7ZA 3BS4A 1LDNA 1GRCA 4X93A 1M34A 1S5PA 1H66A 3HXLA 1ZK3A 4MINA 1M7GA 2H5JA 2Y9PB 2BDEA 2Q27A 4ZO7A 3UK7A 5A2GA 2BEJA 2DT5A 2QVXX 1LNSA 5FO0A 2BHRA 2QZSA 2ZCVA 2D2XA 4RANA 3IQZA 1SU8A 5CXUA 2OGTA 4EB6B 1S7CA 1UL1X 2JLBA 5H1YA 1NLMA 2V7XA 3JWPA 2X1VA 1W35A 4QQNA 3RU7A 3AY6A 3ZE8A 4EYQA 2IYOA 1B16A 2PS0A 2BCJQ 1NRJB 1TI7A 1CE8B 1UZNA 3BJMA 3K09A 3KU1A 5EFOA 2PVPA 4MB2A 1Q3HA 4JI5B 4ZIRB 5DIZA 1JALA 4JYBA 4Q3OA 2NLOA 3HVIA 4YAOA 5THQA 2PLNA 3RVOA 1RJFA 2DP4E 5JZOA 2HK7A 4QFDA 4QXPA 1P33A 4JCOA 2VA8A 1FY2A 2X9GA 4QYMA 2P2CA 2X9LA 5IULC 1YZFA 4JYAB 4FEYA 4G01B 3UV6A 4YQFA 1TM2A 3GPCA 2ZRIA 2QM8A 3M6MD 4AULA 4DCCA 3UXEA 4JUDX 4YMGA 4AKIA 2JGFA 5FNZA 1XC7A 4UQPA 4C4OA 1G7RA 3NRCA 1O8BA 2A8YA 4TQ9A 1YB1A 3RIHA 3DVSX 4DCOA 2JCBA 4GLOA 3UOAB 3C6YA 1PEAA 1RPAA 1MU0A 2IDMA 3KIPA 4ARCA 2XMQA 5JAQA 1T8SA 1SCUA 2HA0A 4XB6B 1JPNA 1OZFA 2GESA 1W85B 4HJRA 3AY7A 4CR7A 2C7GA 3OQOA 4L5IA 4OFXA 4DLKA 2YYZA 3KSBC 3X2EA 2X0RA 2IH4A 1Q2UA 5JD5A 2HMYB 3PR2B 2Q0QA 4POAA 3WQRA 1OXUA 3RSGA 4RZUA 4BVFA 1KZ7B 2O3JA 2ZUSA 3U49A 1NV8A 2AXEA 1EK1A 3C7KA 1O97D 1P1RA 3T9CA 4EDHA 3L5KA 3QEKA 5JQGF 3B5EA 3ZHUA 3I6MA 1OIXA 1WPQA 4MKFA 2Y9MB 2WSIA 3C3AA 4QOFA 3AY0A 1E62A 1O4VA 2YJTD 4BNVA 2ODBA 4IIHA 2H7YA 2VIIA 1GR0A 1L1EA 4JR2A 1XDDA 2FTKE 3TNYA 3LM8A 1IBLB 1C8KA 2AQKA 1QMPA 1I2CA 1PR9A 2J6IA 4FQ8A 4PZLA 3TZCA 3RAFC 2AVDA 4RYLA 3HSSA 3HN6A 1ZRNA 5M2QA 2WW8A 1I0LA 3CM0A 3O74A 2FV8A 3ETDA 1I6LA 1OLUB 2O19A 2HRCA 2ZYSA 1E7SA 2WG2A 3QI2A 4RCVA 2ZJ2A 1NX6A 1NAHA 1HKHA 3GEPA 3R0XA 4Y2HA 5HFNA 3CSDA 3KZKA 3VSDA 2DFPA 3P0FA 5JCPA 1RLUA 3WRYA 2OZLB 2YKGA 1VPWA 1R6UA 4N7JA 1QV6A 2DH6A 3NHLA 4IV8A 2ZBQA 4YCAA 4HN9A 1AGNA 3IKVA 1BW9B 3KYIB 3RTCA 2I4RA 1G19A 1I94B 1DPFA 1JDBC 3LT5A 4X6YA 2F8MA 5KOJA 1YR6A 3TFOA 4I1PA 5HOQA 3L6DA 4L0QA 5KNCH 5C81A 1EWQA 3L7AA 1F1JA 4H35A 5E9JA 2Z3ZA 2H57A 5IBRA 2YMLA 3DMHA 3F6BX 4YRDA 3ZH9B 4PZZA 4EHHA 1I7PA 4U9HS 4EO7A 5BQXA 3EXHA 3NDRA 2CVZA 5JCOA 3UCFA 3G49A 3W8EA 3JYLA 3K9FC 3VZCA 4B4VA 5KQLA 4JOBA 3UK6A 2RH8A 4CMIA 2C0CA 3LZ6A 4BAUA 5DYNA 2WNIA 5A5DA 4L7VA 4UNNA 2VP0A 1RTTA 3H97A 1CQPA 1RAGA 3M6UA 3B82A 1TTPB 1IJKA 4BP9A 1MBZA 5T7BA 1Z5ZA 2YHIA 1RAIA 2EZUA 2HKIA 3VV3A 3M4ZA 3PFHA 3T3PB 4GX5A 5ADVA 4OK5A 1V3QE 5I8PA 1EBFA 3I9V6 2YBEA 3A32A 2XYPA 3R75A 3OO1A 2IEBA 4DA4A 3P27A 3U4AA 4I8XA 4ZJUA 1SEVA 4IEFB 2UVQA 2BVNA 1DRVA 3GHHA 3SC2B 4WOJA 4I9NA 1FFCA 2Q9AA 2RGAA 3T61A 3W2FA 4R2LA 2DTEA 1IB6A 4KGVA 3A11A 4C0KA 1GTMA 4BFVA 2ZBPA 4Q4HB 2HREA 3ESDA 1I6MA 1Z7YA 1C0EA 3PPYA 4AYXA 3MB8A 5DX8A 4YC7A 2ZRNA 4U7DA 4TYYA 4F38A 1P5HA 4QYWA 2KS6A 3TSCA 4B3FX 3CIFA 3ZD8A 4RA6B 1GNQA 1WEKA 2ETXA 4BLWA 2W9XA 3OEHD 4LXQA 4GFDA 4RADA 1FVFA 6ADHA 5DWDA 1J5EB 4X1YB 4D6YA 4O4IF 3TPZA 3LGXA 4BFCA 4HGRA 3C8UA 1YZKA 2P68A 4GX1A 1DTSA 4ZXFA 3ACDA 2W00A 3AIMA 4QULA 1M2FA 3U39A 1VPLA 1PGJA 3IO5A 4XWGA 4C7KA 3PUVA 4EI2A 2P2GA 3DKKA 5IH3A 4XVRA 4GI1A 1HEUA 3IJRA 3KYDA 4KMSA 3D5TA 4ML3A 5TPZD 1XRNA 3O8QB 2XXAA 3EGDB 1RCTE 3FGPA 4FNMA 4PAWA 1HDGO 3S28A 4CRWB 2CNDA 2EWWA 2VFAA 3OC6A 2R0QC 1OX4B 1JAYA 3PF9A 1BKSB 1Z0KA 3KB2A 4PBTA 3DWIA 1G5TA 1V41E 2IX9A 2IE0A 3ZY6A 3FGOA 4IXMA 1G4AE 1T4GA 1MT0A 5JH7A 1VBKA 1NP6A 2QTMA 2H52A 4ZO9A 2ORWA 3P94A 4J2OA 3UH0A 3R5SA 3HYCA 4MVYA 3EGIA 2B98A 4G09A 4C6RA 4BO2A 4EFDA 4K9MA 2Y1EA 3D1VA 3PR1A 2N0SA 3LUKA 1ZS9A 4CTNA 1Q7BA 1J0AA 5AVOA 2B1GA 3G1TA 4B6QA 1E1KA 2XT0A 2R2GA 4IJMA 3E9QA 4CBVA 4K6OA 1Q2XA 1SQ5A 4J1TC 4CCWA 3GEEA 1SVOA 4ACAA 4NI5A 1XK7A 4V0KA 1XZ8A 4HAUA 3L18A 3D7SA 5EWMA 4U1RA 1H1LA 1C41A 1X7DA 5EHNA 4A10A 4DCSA 1AQ6A 1UDCA 1VKRA 4YT8A 1I30A 5FEUA 4RW0A 1XWIA 5IWAB 4N82A 5IRCD 5ARDA 3GJQA 4MV7A 1CVIA 3NGLA 4OJQA 4AQDA 1XIVA 4ZMRA 4B80A 2NZJA 1UR5A 2XNDA 1VLJA 2PJUA 2Z2YA 1J21A 1JI0A 4QXQA 1ZCZA 5U4QA 4L74A 4UCFA 4Q1FA 5BSGA 1PS0A 1O2DA 2FQWA 3E61A 2FFBA 3GGJA 4P3YA 5DBHX 3SR0A 3HL0A 3JAWB 5AD1A 5C53B 3FOWA 4B47A 1VBNA 2OOSA 3M1YA 2AJTA 5FH9A 2ORYA 4H7KA 4KO2S 4UUMA 1ULZA 4B7XA 4N6NA 1GPNA 1H9BA 1U7XA 3SX0A 2NQTA 5D6OA 3G3EA 5J1SB 3SZUA 4C0BA 1GCOA 4NEGA 3JSXA 4XX1A 5A62A 5EIOA 4RHCA 3FAZA 3OVMA 4MRAA 3HVHA 3O90A 1F9EA 1YC5A 3AK4A 4X6XA 2DBQA 2LCIA 3KKOA 5CPBA 3FOEC 5FD8A 4GPBA 1VG1A 5A4DA 1NZJA 3M3PA 3MLBA 4EKIA 2CCKA 1U3GA 1N2OA 3A36A 4I6GA 1T5LA 2DBZA 1BH6A 1KZYC 1SXJD 2VQSA 1ECPA 4EQ6A 3PFWO 2JLUA 4I55F 3NWOA 4XOUA 4CNBA 3BAFA 3BE8A 3W1VA 1HQDA 2JAWA 4WKBA 3B3QA 4P4LA 1A71A 2KMLA 4HAWA 4OHPA 5DWVA 5JLAA 3UV7A 5FOWA 5AVKA 2BFDA 1TE2A 1KMMA 1ZW6A 5KYUA 3HG7A 3N2LA 3E4CA 1QG2A 4P3OA 1PFKA 2B1RA 4R1MA 4K81B 2LKCA 2HDNB 2ZI9A 4AF6A 2ISCA 3DEKA 2ZSJA 3DZIA 3PSHA 3VMFA 4Y2XA 1WMEA 5T6MA 4KLCA 4KUHA 1D6MA 1EGHA 4I4NA 4P82A 4UU0A 2GCEA 4YXWA 4QXAA 5KDOA 4UOEA 4CF5A 3JASB 2JD2A 4DNXA 4IHJA 1U2TA 4B81A 3O8OB 2H65A 3V4PB 1KEPA 5JYEA 4N39A 5DWQA 2FWMX 1VSTA 3F7OA 3RYFB 2E1PA 2ZJ4A 4KE9A 1FQKA 3F46A 3ZE1B 2BFBA 3K0AA 5JZMA 4CQNA 1Y5MA 1CUIA 1SM4A 2XODA 1Z6QA 3I73A 4HWGA 4IKPA 2ZUFA 1WUTA 1U3VA 3NVAA 1QRSA 4PINA 1DKQA 1OGJA 1BQ4A 1NBIA 1T5TA 3EXEA 1BX0A 3FZNA 1OBFO 3RFCA 3SCZA 2CMGA 5F3RA 1K88A 3VR6D 1XG5A 2IDZA 1QE5A 2PL5A 1Z4JA 3AV3A 2FR0A 5TB5A 5IDQA 5BOSA 2IXDA 5JCJD 2BHSA 1TZBA 2GN4A 3ICVA 3IEIA 3ETCA 1IY0A 4X62B 1KY4A 1DCMA 2W0SA 1Y8QA 2X8WA 2GJSA 3Q5EA 4LYEA 2OCYC 1DT5A 2J31A 4U0KA 2K6GA 5BORA 1XPOA 3ERCA 4KODA 2WHEA 4RC9A 2OO5C 3MJSA 4MROA 2BM8A 4JU8A 4C4AA 4YCJA 2IZ0A 4X63A 1TQHA 5KYKA 5EHIA 1R0XA 3HKDA 2RHTA 2Z8XA 3RPEA 1G8SA 3S2SA 1XPRA 4FJ0A 1QE0A 3H42B 1LBSA 2O7SA 3A6ZA 1J90A 1M83A 2GMWA 2WT8A 2XI4A 2XQFA 1ZMTA 3KQOA 2OORA 3KLPX 2YXPX 3LLMA 4JJ7A 5B12A 3JVVA 2VP4A 2NO6A 4R71A 3SG0A 1XO1A 4NULA 5TQ0A 1A2BA 2HA7A 4IO0A 1RWBA 1E5VA 3VBCA 2AN9A 3P19A 4M9RA 4Y6OA 4AMYA 4RVCA 3V48A 3WRVA 2ZYHA 1K6XA 2PWBA 1EEHA 5EE3A 1OXBB 2UYQA 1NULA 4E1BA 1BDIA 3EXFB 5CT5A 1JAHA 4XKJA 3H5RA 2G77B 2O5EA 2WTAA 1OFUA 2GJAA 3ZZMA 1QGDA 3EPRA 2O8CA 2ORIA 2F4VB 3AX6A 2QD4A 4XWYA 5CH3A 1ZU4A 2Z0MA 4D97A 3HGQA 2ODNA 2B36A 1VHQA 4ZZ2A 1S02A 3V00A 5JRJA 5L40A 4G5HA 2XD4A 5FTMA 2A94A 1Y6FA 3W8NA 4DIUA 3H6HA 2VF7A 1V39A 3TWOA 2OMKA 3RHZA 3DL4A 4Q93A 2BJWA 5FBQB 5TMDA 3R7SA 4QXMA 1LNQA 2EG5A 4R2XA 5U9CA 4IZOA 1AKTA 2R48A 3CH7A 4JI7B 3BERA 3LZDA 1UP7A 2YWBA 1KAHA 2TSYB 2XYVA 4OUDB 1W4AA 4KPUB 1CVLA 4HDNA 3JYOA 4CCSA 3NB0A 4ETWA 3F47A 5CB6A 2LUOA 1B3BA 2G80A 5C3MA 3VKHA 1MO5A 3MCWA 1JECA 3GVCA 5A9SA 1YQWA 5DGCA 3PC4A 4MSUA 4BE7B 2X86A 2HRBA 4H18A 3THXB 3G88A 4RSHA 4Y0AA 2BFAA 2GEKA 4MXDA 4JLKA 3RDPA 4RDCA 3LXXA 4QOEA 2MSEB 3AJAA 1KK0A 1Y89A 2W2TA 1N25A 3SK0A 4BX8A 4RSGA 5EYPA 2NM0A 2YDYA 3ZWBA 1LPMA 2DBYA 2VT3A 1Z0FA 3FKSA 3PKJA 4YUAA 1OCEA 4YRSA 3K0KA 1QMGA 1XMSA 1ZWLA 3A06A 3HB4X 4Y6GB 4O2LA 1BJRE 1JN0A 3FLMA 4WBNB 3A1FA 2CDNA 3DEIA 3N39C 3ND9A 4HXFB 4MV5A 2H1FA 2J4FA 4BZPA 2B78A 3CEPB 4DLWA 2O2CA 4ZCSA 2J5BA 4TLBA 4N9WA 4NXMB 1UP4A 2XAAA 1JEQA 2QYTA 3EWAA 2AI1A 3IT0A 1P2TA 1XTZA 3OIFA 4FUTA 1U7HA 5CT6A 2ON6A 3V1MA 2HLPA 5FFMA 3QFTA 2PT9A 5F5XA 4UE2A 4X8OA 3RVSA 3C3XA 2SCUA 3VX4A 3ZX4A 3C98A 3C6QA 2H07A 2C31A 2IVFA 3ANLA 3I39X 2FEKA 4HPJB 5DYTA 5EGNA 1WCWA 4CKBB 3WGIA 3DULA 4Z53A 3AEUB 1O94A 4NYMQ 2VHYA 1GGFA 1GQOA 2ZR7A 1KI2A 4ZODA 2R47A 1IQ0A 5K5EA 4AY4A 3CRMA 4JEHA 5KTTA 2XUGA 2BBOA 3SZOA 4NU6A 2P27A 3MOIA 3D8SA 4I1RA 5JAUA 2V4MA 2P5TB 5JWRA 3OMXA 2L17A 3MWLA 4EG8A 2EZ9A 4RJKA 3N07A 1PQWA 2HWXA 2QL7A 1LQTA 3BRCA 1L6RA 3N9IA 3V8MA 3Q87B 3OEYA 3EQ7A 1ISJA 1H0SA 3ZGVA 3GCXA 4H9GA 3VR2A 1UBUS 5LR6A 4G5SA 1A9SA 1YZNA 2HPAA 3KYCA 4FBMA 3WFJA 4IIUA 4B84A 1ID8A 1FE8A 1E64A 3BBPA 3FKQA 4S0XA 5LXTF 1IMOA 3KJZA 5TEVA 3EZ7A 4CQLB 1KAQA 3OE7D 5F1YA 1XZLA 2H08A 1YRYE 3UMVA 4REQB 4BBPA 2FDCA 2OUIA 4FQ5A 2H92A 5TX7A 3SJCA 2C9YA 3TAHA 5B30A 4BUCA 3NDPA 4YH1A 4C76A 1GFSA 2C3PA 3FN4A 1YZHA 4OQNA 5AOAA 2J59A 3IB6A 1XVTA 4AJHA 3OE4A 2FW6A 3I0MA 3N8GA 2I6GA 3H9UA 3WOVA 3H1GA 3OCXA 3MRTA 1QHYA 3U4CA 2JIDA 1L4BA 4GL2A 4RNDB 1XJQA 2ORED 2P1ZA 3D6AA 1KEZA 4MW5A 3LQ1A 3VMMA 1RLTA 4GKAA 4KC0A 4MQFB 5I9IA 3LUGA 3SYKA 3DV9A 2RCNA 3NHKA 3QWHA 4HDRA 2GCOA 5KCMA 3ZCPA 3EY9A 2B8TA 1N2ZA 4NICA 1SBYA 1L4KA 3TQIA 4B31A 2IX3A 2XWBF 4BUJA 1N9GB 3M9XA 1OILA 3BGOS 2GEJA 1II8B 3JQQA 2OXFA 2I2AA 1C3LA 3FIJA 4FFSA 4HATA 4HPWA 1HYQA 1KSGA 5JNLA 3L4KA 2MJLA 1OAOC 4L4YA 3GBVA 4N3GA 1K66A 1UPTA 3DONA 2VAPA 2QX4A 3KUDA 1ZNYA 1CJCA 4RL6A 3DBRA 3RIYA 5C0OE 3LIPA 1PYGA 3VU3A 4Y2TA 1VXOA 2AQHA 2OAEA 1P7VA 4K9PA 4PX9A 2YUIA 3QEJA 3DQPA 5TRTA 5JNWA 1JKJA 3B52X 3R3ZA 1H69A 2J30A 4I2NA 2HCFA 4ENWA 2GOYA 5AJHA 2IZ5A 5A71A 2JFWA 3TSAA 4L02A 1G3QA 2FLVA 1JQDA 1N5JA 2I91A 1JU9A 3ABQB 1KOFA 1T1JA 2QN9A 4C01A 1ZFNA 3WYEA 3CFYA 3ZV4A 5DSZA 5FOUA 1N0HA 3VAAA 4RF5A 1TRHA 1HZJA 2VUUA 4TXLA 1DC5A 1O1YA 1Z75A 3PHJA 4AROA 1BD4A 2GXQA 3QKSB 4ADSG 1CY4A 1SQ6A 3UKDA 2OUKA 3WIEA 2FHPA 2QRNA 5BNWA 2QZ9A 4PQFA 3UAZA 1DRWA 2V7TA 2REOA 1SO8A 1XCMA 3KV3O 3OX3A 4UTXA 3VKUA 3T1HB 4LNHA 1JEJA 4UM7A 4GBED 4ZI5A 3PD0A 1WB9A 1FFYA 1WAMA 1YNSA 4QM6A 3ZHVA 5C2JB 1DDIA 2Y67A 4K9NA 5A2QA 3PFBA 2RGWA 3AONB 1PWEA 3DTYA 3NO4A 1U2ZA 2ODPA 4TTPA 3RT7A 2NOAA 4XLZA 2FB9A 2VP3A 2RGEA 2Q1WA 2PUBA 1PZFA 1XVUA 2NYVA 2XMCA 3HN7A 3ZWXA 1AV6A 1VKHA 3Q6NA 1G3RA 2CBZA 4X1KB 1ARZA 5FI1B 1P5JA 4PZ9A 2E6UX 1NE7A 4ZV9A 5A3SA 1MTZA 4HVCA 3CX7A 1DDOA 2ZWVA 1MORA 3H2BA 2XCQA 4XW2A 3MJDA 3TM5A 3BMCA 5CDFE 3I09A 2YN4A 1L7BA 2LKDA 5GONA 1X7YB 1Z7EA 2HRRA 3KZMA 2QGZA 2GPWA 3PBKA 4KRXA 5CB4F 3IP1A 4MW7A 1OVGA 4RELA 4IDNA 5M7EA 1UIMA 3L8ZA 1RP7A 4K2AA 4D1YA 4ZYZA 3G5TA 3NC1C 3PB3A 2QM3A 1PX2A 1P2SA 1NM5A 5AK0A 5BR4A 1AUXA 5CBKA 4EY5A 2YJ6A 3L3BA 6REQB 2WWRA 3H4IA 2KYRA 4JWTA 1HDYA 3TMAA 1GZDA 3T7DA 3PUWA 2CW5A 1XU7A 3S1LA 3DE3X 3M4XA 1AZWA 1RQ7A 4C0SA 3V7NA 3GP8A 3IMGA 2O7VA 4FZ3A 1U7ZA 4XQ9A 5CVVA 2IVZA 2PKQP 1TZ2A 3U3MA 3U1VA 3TH5A 1EXDA 4GO1A 2PKXA 3NIBA 1NW4A 1ACMA 2DT8A 3QU9A 1Q1ZA 4X92A 5DTRA 4AWAA 3SJ7A 1LV7A 2VZ0A 2X3FA 3T3IA 3WGZA 5IYZF 3IBCA 5B3AA 4TV9B 3QXHA 1Q17A 4KO4S 2PCLA 2X22A 1C9EA 3R09A 5JWHA 4YI5A 3CLKA 3VI4B 4G86A 1NNSA 2IEYA 5DTEA 2VPWA 1T3SA 2YNMC 3L8CA 1PJAA 1GGKA 4OMFG 3JATB 1UADA 2D0IA 3AEKA 3C8DA 2LCQA 1CEEA 2H1VA 2B30A 2W5UA 1GR1A 2AOUA 3IBFA 4BRUA 1PIWA 4WTOA 2UDPA 1D0SA 1A9YA 3BRQA 3QI7A 3D3NA 2TMYA 4BU0A 2X15A 3PC2A 2JA2A 3PFGA 4N18A 3SVZA 3VHXB 1E3MA 3DMPA 1QLWA 2BKUA 1O7JA 4ASUD 1GKKA 2RH5A 1MABB 1FU8A 3F9RA 1KK2A 3B1XA 3RC1A 2IT1A 1QFJA 2X58A 3GLSA 3N05A 4O4JB 3EXG2 1B14A 3I2GA 4XQCA 4QNMA 5IM5A 4CEHB 4NJOA 1IFXA 1IUKA 2GD6A 1Z4IA 3HVJA 3AHCA 4US2R 1SVKA 2HCJB 3K0HA 1E9CA 1E58A 1VL0A 1I2ZA 2JAXA 2PMWB 4M0CA 1E2NA 1XVVA 1HTWA 3EIOA 3STHA 5FWYA 2Y1FA 1ORDA 1GU7A 1BRTA 1B0ZA 3UMMA 5HFJA 5IDVA 2O3SA 1RE1A 5CCEA 2J0SA 2HI0A 2BJVA 1XDUA 2MU1A 4HAZA 2H1HA 4YQEA 5SYNA 2HZ7A 5BMVA 1SOAA 3KKQA 1NF3A 2G88A 3G9QA 2VQ6A 1TKRA 3H16A 1ZK1A 3I8XA 4KSCA 4AZ3A 1EUCB 3BWDD 3W5BA 4R8RA 2V45A 3WGGA 1E2HA 3IGFA 4FFLA 2AG8A 2AYYA 2CKMA 2OE2A 3K2EA 3STXA 2FXIA 1FU4A 2P9QA 5I01A 2GPJA 4CKEA 5IEJA 4Y6SA 3E82A 4EYKA 1GKYA 2H17A 1Z38A 3OPYB 3F1KA 4BMCA 1D7OA 3HXQA 3A6HA 4YRQA 1TB4A 4KXFB 1CDZA 1TW3A 2FSGA 3HKEB 1WY5A 4OPMA 4DLYA 4NCBA 3VR5H 3A31A 4MUIA 4DDWA 3WLEA 3BE4A 1U2EA 3ETEA 1CDDA 4Z0HO 3F4KA 1CS0A 3PHLA 4G2TA 4B3CA 2HU7A 1AA6A 1PYOA 2QUIA 3HEAA 2E4XA 5TQJA 3TPFA 4UAUA 3ZHXA 3DLAA 1YKGA 4XR9A 5AM3A 5KYYB 3B3JA 4Q3AA 4NENA 5GAJA 2VYCA 3G8CA 3VU8A 3DVAB 2O1EA 1YR2A 3LP6A 4FS8A 4EJ0A 4LOHA 3AM1A 4BQIA 4LJAA 5CAEB 3R7WB 4MLDA 1TRKA 4J0IA 1REQB 5ARBA 5KWVA 5JTTA 1YV9A 3OHPA 3ER9A 1G66A 3U7GA 3O31A 4WINA 1C0KA 1JR3A 1NBAA 2CBGA 3W9YA 5BSRA 1LPNA 1U99A 1GU0A 3RK4A 4L22A 4RF4A 1XDSA 5BNFA 2FRDA 3L7YA 5IJ9A 3EIUA 2GHTA 3NGXA 4P3PA 4KMMA 1T36A 4J3NA 4EPTA 4R2IA 4DV6B 3OTQA 4KDRA 4P9NA 1FOEB 3TPCA 4EMBA 3L8MA 3IIJA 3GDFA 1RMYA 2Y1XA 2XNCA 1SIUA 2OSVA 4JSTA 2DUMA 4YMSA 2GUGA 1JMYA 1O89A 1CU1A 1L5VA 2EF1A 1Z35A 2C2KA 2LPMA 3F8TA 1ZI6A 3LL7A 1NYLA 1JQEA 1EXWA 1PV2A 3IJ5A 4B2LA 4ZHQF 1CQXA 4I5FA 3ZD9A 2PLFA 2RARA 2DHDA 1GAWA 1UXOA 4N8EA 4D3XA 3GPIA 3G13A 2VPYA 3PDCA 5LNK6 4E03A 3TFQA 3NM6B 5BUSA 1ECBA 4G1CA 1VPDA 3FUUA 5AKYA 4RD4A 3KYJB 4OQFA 3UMBA 3S3TA 4CKCA 4PN7A 5LOVF 4YI3A 2Y1DA 1SU4A 1TMYA 4XTCS 1WV0A 3JR3A 4GPZA 4BHTA 4W1QA 3HO1A 1IG0A 2PX5A 1GG5A 5DKFA 2OA0A 4UM9B 4AICA 2A88A 3HNOA 5B7PA 3T3OA 5K0JA 3E6AA 3ZWWA 2R6AA 1ZVKA 3DR3A 4MVXA 2QQGA 4YRJA 2XNDD 3RFTA 1RRPA 2QI9C 3F3KA 1XK6A 1NFQA 2OO7A 4PGGA 3Q72A 4B85A 3MYYA 3W2GA 3GJZA 3QF7A 5CDGA 3AKYA 5FJJA 3UOGA 5JCXA 4FOSA 1FNDA 5HNKA 5FHRA 4QM7A 1TLLA 1U31A 3BSSA 1QC5A 3DQQA 2A5GA 1OI2A 4IRMA 1GZSA 1ZQ9A 4D4MA 3MGKA 3NBQA 1PSZA 5GONF 2Z9BA 2JI7A 2WMYA 3NALA 2QPOA 1C1DA 2X0FA 3RYHB 4DIEA 2MR5A 4OA5A 1BWSA 1OREA 3U3DA 3LC1O 4L6CA 1WSDA 1SIBE 3OOSA 1HKUA 1VMEA 4BNLA 1LLFA 5CA0F 1IVSA 2XCTB 4RY8A 5CM9C 4A1FA 1MVLA 1YMVA 2RB5A 1BXKA 4L73A 2VF2A 3VO1A 2XUIA 1JJAA 2WMNB 4ZVKA 4I1YA 5TNXA 3IUJA 1AKQA 3ORHA 2YWGA 1OFHA 3SX4A 3ZZUA 2A0WA 3THWB 5AJZA 4YY3B 4ZVLA 2Q50A 3LOQA 3WL8A 1IZYA 1C3OB 5BSEA 1A9QA 1L4EA 2YYYA 4I4TF 2RGYA 3UKJA 2D8MA 2IYUA 4GWKA 3S0JA 2VDJA 4QYSA 1BVHA 1RRVA 2VZ9A 4X91A 2PZJA 4BPBA 2ZIXA 1JHYA 5LIPA 1KKUA 1GDHA 4LHZA 4N0QA 2J9YB 1K5PA 5GJCA 4ZCPA 5I51A 3IEVA 2XVMA 4DA9A 1DL5A 2RCYA 4ZI7F 1AKEA 4I36A 4DM7A 1OW3B 4X8MA 4IJ6A 4EUEA 1KDTA 2RHOA 3K6JA 3O3OB 3OSUA 3ELWA 3ZCSA 4QOSA 1Q0LA 2VNIA 4D8UA 1U7WA 2VHXA 4FB4A 3BMXA 5LKAA 1QHXA 1HC7A 3I83A 4HNRA 1XZIA 1WHSB 3O5AA 4JCCA 3PNVA 5FNVA 3T5GA 4TRMA 4L8GA 4XCVA 3UZUA 5I4CA 4ER3A 4AJLA 3FH0A 5C4MA 4US0R 2QJOA 4O3FA 4W5JA 2VTBB 1GAJA 2DQKA 1TAQA 2D1RA 4GMHA 3T8YA 5G4LA 1VECA 4NYMR 1J9ZA 3TCKA 5KTNA 1AT1A 1T9CA 2Q28A 4P36A 5E7JA 4EAAA 2OMEA 1KJIA 4UDYX 5FTKA 1FDUA 3IBSA 1Z88A 4US1R 4ZVSA 2RHCA 3TXAA 3GFTA 2ERXA 1AXGA 2QAGB 4HPXB 4BFLA 1W25A 3A3PA 3DFUA 3JYQA 1ODFA 3IHTA 3MCUA 3KM0A 3RTGA 4H31A 3SE0A 1Q50A 4GU5A 3I53A 1UK9A 2W83A 2YY7A 1HF3A 2I4NA 5L3SB 3TXXA 2GD0A 1AKYA 4RM2A 5SZKB 5D3ZA 1TFUA 5REQA 2A4KA 2E4ZA 5DTIA 2P9TA 3AUUA 4JN6B 3U17A 5D3KA 2HXSA 2P3OA 4JJKA 2XCLA 4GYJA 4LDJA 2OCDA 3BGWA 4C1NA 1U8EA 3S1AB 1JTFA 1HX7A 1Q1GA 1TA4A 3FI9A 1CRPA 2FZWA 3VZBA 2VKTA 3QRWA 2ZQYA 5IFKA 3K71B 2UU9B 1PU2A 3HHPA 2E2WA 5FBWB 2D1TA 1NJ8A 2XCOA 4HH1A 1HI9A 3MWDB 2BSXA 4QHYA 5HF6A 3P97A 3ZU4A 4OI1A 1S2NA 3KAPA 1FXUA 2E85A 1F6DA 1G8YA 3FPKA 3I04A 1FP4A 4QODA 4RZ2A 2XZDA 2AK3A 3OQVA 5IN5A 1JEYA 1TTTA 1P5RA 1YNOA 3V46A 2C9OA 4MHTA 2B8JA 4HLNA 3TLMA 4YNBA 4YN3A 5BY2A 5LD2B 5EMHA 2RKOA 1JWBB 5ALIA 2H0QA 3E22A 3DTNA 2F1KA 4TKMA 3A1DA 2RG1A 3C16C 1S9HA 3ZKAA 1Q6YA 3EQ2A 1GL3A 4CKWB 2X7XA 1U2QA 2Q2NA 2G9RA 1NRIA 3PJEA 4HYYA 2R96A 2PAFA 4QPZA 2V6MA 5T3YA 4ICIA 1EGMB 2J9FA 1QRTA 1Z3CA 2WPNA 4WPGA 2EFCB 2IY9A 1MEOA 2QNBA 1NX9A 1ZG3A 4HX5A 1UWVA 4GH5A 4MWEA 4RPGA 3ACBA 4F3RA 1P81A 1W5TA 2XB6A 5J47A 3HWWA 3MGBA 3KQQA 4B8WA 1RLJA 4RAOA 3VNSA 4JP1A 1WVIA 4OYLA 4RHUA 3ZQJA 3NEPX 3K5HA 2GPSA 2G9NA 3O3CA 3WWOA 2P75A 2QY9A 2Q5HA 4JUAA 4MARA 1DINA 2DPLA 3LG2A 4U5QA 4OP2A 4PFQA 2Q9UA 3AI1A 5EIWA 3FCCA 1CQJB 1DEXA 1QIHA 3Q2IA 4Q4JA 1E3WA 2D4HA 5ERXA 2WVGA 1QK3A 2IHVA 4M1KA 4JUFA 3DUFB 1Z13A 4OQXA 2A9VA 4IY1A 2D3TA 5ABPA 1GQSA 2D7JA 4G37A 3JQAA 2W0MA 3PP8A 1V6AA 3UY4A 2GYWA 4I9FA 1IVYA 4QGSA 3DAOA 3G8YA 3N2YA 4FIZA 5AHXA 3EFHA 5BQOA 2FF5A 5HE9A 1QLJA 1KFKB 1N0WA 1B76A 2P6MA 2QZPA 2V4UA 2R1UA 2V7VA 3A6FA 3CLSD 3TI7A 4W7HA 5I7UA 5KNDA 1WU7A 4TTJA 2P4EA 3O03A 2PKEA 2JZOA 3I5MA 5A3JA 2CUZA 3M6FA 4ATNA 2WF7A 3H5LA 4EUHA 1R66A 1YGYA 1HDOA 2A7QA 1LTHR 3ZNQA 3UICA 1ZCAA 3GFPA 4LV8B 5LZ9A 3H2JA 4YALA 1OHHA 2L82A 4R1LA