4NKRA

The crystal structure of bacillus subtilis mobb
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
163
structure length
148
Chain Sequence
FPIVQVVGFQNSGKTTFIERILEKASEQGLNLGCLKHHDRYQAAGADVTAVEGAGVLQLTARRLWDLTRLIELYQFLETDCLLIEGFKKAPYPKVVILSEKEDLEALKTVNTIAIIYRKKEHMTEHQGLPIFHADDPVAVDLVLSQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein B
publication title Insight into the Role of E.coli MobB in Molybdenum Cofactor Biosynthesis based on the high resolution crystal structure
rcsb
total genus 38
structure length 148
sequence length 163
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nkrA00
4A0GA 4Q47A 4BUJA 2EFCB 4PQRA 3AF2A 4BLSA 3LX8A 3S1AB 4JKIA 2WKQA 4OQNA 4XWOA 2GCNA 2GCPA 1OXTA 3O8DA 4AYTA 1H8HD 2A5JA 2D62A 2F9MA 4I4LA 4LCBA 4URXR 3FVQA 2VSFA 1KK3A 2HDNB 1J70A 1GG2A 1F48A 1Z2CA 2C98A 2ZM5A 5JJIA 5CIQA 1QBKC 5FTJA 4JVMA 2AXNA 1JAHA 1P2TA 2Z0MA 5A4JA 5FTLA 2OXCA 2KWIA 5JCPA 4Q48A 3BH7A 4FMDB 2R44A 5IT5A 4PAOA 2J5XA 3JVVA 4ASUA 2RGGA 3SS8A 1TUEA 1CJMA 4IXMA 1SKYE 1MRNA 3VX3A 1NKSA 4A92A 2PCLA 4CEJA 2A3RA 2WZQA 4D0LB 3LWNA 2YHSA 4Q1CA 3U44B 2QEQA 1T0JB 1PLJA 2RGDA 3BORA 2X77A 2CHQA 1X86B 2ERYA 2WAYA 3AP3A 4Q1EA 4EPYA 4CF7A 3AVUA 2GVZC 1KOFA 1KJYA 4IDHA 2DPXA 2P2LA 2ZS8A 1II9A 4RSGA 2XNDA 5GADl 2GAOA 2WWYA 4OI0A 3K0AB 3CO5A 3AVTA 4HLDA 1G7SA 5JJKA 4ZCMA 2BDTA 1P61B 2GTPA 2J0UB 5FR1A 4DCUA 1EX7A 1W0KA 3KKNA 2EWWA 5J4HA 2ZVQX 1E99A 3G0HA 2OFXA 5KDDA 4B43A 3VFDA 5JECA 5FUWA 3THWA 1W5SA 2WKRA 4NKRA 1G3IA 5DI9A 5FBLB 5FOSA 2JIZA 4LX0A 2J46A 5KDLA 2JDID 2IS4A 3W6OA 2FWRA 2IYTA 1W0JA 1A7JA 3KXLA 1DTSA 1N25A 4POAA 1RC8A 4MYCA 3KB2A 4A1FA 2F1RA 4CEHB 3C4JA 3TK1A 2X2EA 1RYHA 4BRUA 1UJ2A 3VNVA 3CNOA 4MKGA 1D5CA 5CB8A 1N6KA 4OL0A 1R5BA 5C4MA 1TMKA 1E4VA 2P5SA 4PSVA 1ODFA 2YVUA 1SXJD 2B92A 1E2MA 1KZGB 1OXUA 4CGZA 1OPXA 2NO0A 3GEEA 3C14C 4PC7A 4KV9A 4TL9A 2PCJA 3V00A 2OCYC 4BLTA 2H7VA 2ZSEA 2GF9A 1QHHB 2OBMA 4LY6A 4TYPA 3ADBA 4UJ3A 1VCMA 5JS8A 1FP6A 3BJIC 2IYQA 1DAHA 5H1YA 1S9HA 4IOJA 1G5RA 4Q02A 3VTKA 3WMEA 3TGPA 4M0LA 4LJ6A 8OHMA 4DCVA 4NYIQ 4R71A 3EIHA 1QHNA 2DWPA 2W6ID 3AB3A 3BH6A 4RCZA 4WZ6A 4NZYA 2J0QA 4ZCLA 1DAFA 3GJ0A 1G4AE 4JZKA 4URUR 4R2IA 2Z43A 4JSYA 1ZD8A 1GNQA 4JLDA 2E87A 3ZVNA 2O8BA 2BMEA 2OESA 1BYUA 4URVR 1NN5A 2JLYA 2GILA 2IC5A 2QAGA 1W7AA 4JS0A 4HAUA 5JFGA 1OF1A 1F60A 1P9RA 3E5HA 4OI1A 1D9ZA 4EFNA 5DIFA 3CPJB 5TXGA 1LF5A 2A5DA 4OHVA 2JLRA 4KLNA 4EQ6B 3QJYA 2WIAA 1XPRA 2PLRA 2IYYA 4HB3A 4O0MA 2F3RA 3HU3A 5CM9C 1XCPA 1B23P 2G88A 1I4LD 4PQYA 4MYUA 1UBCA 4IDOA 3R7WA 4BLRA 1ZNYA 4PHGA 4DB2A 4N1AA 1U99A 4HDQB 1CJKC 4LPKA 4CVNA 4D4KA 3FB4A 2OG2A 4HAYA 5B58C 3EA0A 5JWHA 1DAMA 3BIFA 2WWIA 4KODA 5EXXA 3UG6A 4Q9HA 4ABYA 2ORWA 3QBTA 2OUKA 1XD8A 1NMXA 2PEYA 5EUQB 2ECKA 3GFPA 5G3YA 2CVFA 3B78A 4Q9KA 3VAAA 4KYUA 2JJ2D 1PVOA 2BKUA 4ZDWA 3UK6A 1Q1QA 5DLQC 1YKSA 4GL2A 3VHXA 1E0KA 5KNBA 1KJWA 1FX0A 2J7PD 3J81k 1EWRA 3HJNA 3BH0A 5EE3A 1VCIA 1YRBA 2IT1A 2W0MA 3QPWA 1V5WA 5IHPA 1ZU5A 1P62B 5FTKA 2XNSA 3WMFA 4B2IA 3WP0A 1G9XA 1S9DA 2FF7A 3REFA 3QBVA 5CLQA 4IOMA 1N6HA 2CJWB 5TV2A 4AG6A 1YR8A 4ASUD 2DY1A 5DN6D 3THXB 1N6IA 4DLUA 1KO8A 2AK2A 1U98A 1RPZA 3BS4A 5AUOB 3AUXA 3IHLA 1HYQA 3NKVA 4RCYA 4TLAA 4R9UC 3T12A 3SBEA 5JHGB 2UZIR 1I2MA 1XXHA 3QNUA 1OFUX 2O0HA 1E0SA 4Q9JA 3AF3A 2FNAA 4EUNA 5TARA 4OBEA 1R0ZA 4WW0A 2ORIA 4AC9A 2ZETA 3GLFA 2V8OA 2XNDD 4TQUS 2KI5A 2RHDA 3KX2A 2FZLA 4TT3D 1E2PA 3S1AA 3PCRB 3B8HA 2GDJA 2O0JA 1E2QA 2ZRFA 3LH5A 3RRNA 4PQFA 3UMFA 1KMHB 5K8IA 3CF2A 5L8VA 4MITA 4ESVA 1MO3A 1FNMA 4WIAA 4B3GA 3OZXA 4F4IA 2OT3B 4A8JB 2DWOA 1GKUB 3EC1A 3HPQA 1UBFA 4LBWA 1DO0A 1XMJA 4K81B 2BMFA 5KUTA 4RFVA 2BMDA 3PEWA 5AK0A 2GK7A 3IUYA 3LX5A 1AM4D 2YOHA 3VR2A 2QMUA 1W0JD 2IX3A 1AIPA 3EIQA 3P20A 2ZITA 1X3SA 4GRAA 2OE2A 4LJ8A 3GLFE 2AHOA 2OILA 2W58A 4DT1A 4W9MC 2O8DB 4BLOA 2QUZA 3AUYA 1WXQA 1XEXA 2VP2A 3ZDQA 3KQHA 1SXJB 2JLZA 3RDPA 4FWTA 2NO6A 3ADCA 3Q5DA 2V1XA 3VR5A 3U44A 5KSYA 4TMZA 2NZJA 4KJZA 1Q3HA 5DYGA 5TDHA 3UIEA 3MRSA 4B71A 1E69A 3RRYA 1JXOA 1L2TA 4L4UA 4MRNA 5DI3A 2B6HA 4C2TA 2BC9A 3MJHA 1HV8A 4LK2A 4B6FA 3K0AA 4M4SA 1G8YA 4R2HA 5F98A 5FUYA 1W36D 2P6NA 4B3BA 2EW1A 2J0UA 2CCJA 1PZNA 1KI8A 1TF2A 2HXSA 4DIEA 4B3CA 1DAIA 4ILEA 3HWSA 4PX9A 2IK8A 3T1VA 4KITB 4DB4A 4KU4A 4KFTA 4OYHA 4HUTA 2ONKA 1DOAA 2VHQA 2ZROA 3LD9A 3AH8A 4A82A 1M7GA 1P5ZB 4JLPA 3Q72A 4ZKDA 5E7IA 3PUVA 5FH9A 2ANCA 1T91A 1QHIA 1KK0A 1VYUA 4I1VA 4MRRA 2C8VA 3R9IA 3Q7QA 4MUBA 3B9QA 4XVQA 2J0SA 3ND9A 4XVUA 1BH2A 1X1RA 2R6FA 3M6AA 1S4QA 3MSXA 3P32A 3OEEA 3LQRA 2ZJ2A 3PUWA 1DVRA 1OIXA 2KJQA 1Q12A 1TUIA 2F1JA 1JR6A 421PA 3KKMA 1KO5A 1SZPA 2B21A 4H9GA 1OXSC 3WNCA 2HYIC 1CJVC 1VPLA 3T1OA 1QHHA 3QIAA 4WZBE 2XXAA 1L4UA 4TSFD 1E9AA 1U0HC 2DCUA 3TAHA 2BKEA 2LKCA 4PC1A 4QHSA 3QVUA 1JNYA 3D31A 4QGGA 1R8QA 2NO1A 4KYIB 2VP4A 3AM1A 4I81A 1T5IA 3ZLJA 4E03A 2AX4A 4M21A 2P5TB 4RZ2A 2FSIA 4D0GA 3LBHA 2QT1A 3W6PA 5G3ZA 1DG3A 3L82B 3MWLA 1BKDR 4D6PA 3SYLA 2FEOA 1UM8A 1HE8B 2C5LA 4URYR 2BJVA 3TE6A 1LY1A 2NIPA 5CDFA 2O8EA 821PA 4B73A 3Q3JB 5FR2A 1T6NA 1WQ1R 2O8FA 1P7CA 4NYMQ 2O5VA 1GKYA 3LFUA 3B60A 4D80A 3TLXA 5DE3A 3N2EA 4BEJA 1LW7A 1XTSA 4QXAA 4DEYA 1K6MA 3M1IA 1CTQA 1D2MA 4CEJB 3BD9A 2N42A 4V0ME 1PV4A 2YOFA 1XMVA 3SHWA 5FOVA 5TY0A 3AQ4A 4B47A 3AKCA 4L5BA 3ZZUA 1SVWA 4MUAA 2ERXA 3QPUA 3N2IA 4DWJA 1GP2A 4XIGS 2XB4A 3B7GA 3QENA 3K0EA 1GSIA 3T1QA 3TBKA 5KTYA 5JRZA 2WJJA 4QBIA 2GEVA 2XJ9A 5CB6A 1OE0A 3B1WA 4XOIA 2ZAOA 3B9PA 5CDFE 5D3QA 4TQAA 4HLUC 4NBSA 3KQNA 2FPMA 2JLSA 4LWZA 3N70A 2VP5A 3K70C 2C9YA 4G5OA 4QBFA 1H8HA 1XEWY 1FUUA 4DRZA 4MKHA 3K0CC 5DHFA 1G18A 1MABB 2ZPTX 3THWB 1Z06A 1OFIA 2J3EA 4DDVA 1G1MA 1E9CA 4DCTA 1W47A 1ESNA 1RRCA 2GCOA 3TJZA 1FMJA 1Q44A 2HXYA 2QT0A 4DHEA 2H1LA 1C4OA 4BEBA 3SQXA 1RIFA 1SQ5A 1AGRA 4GOKA 1IXSB 2WICA 3PG5A 3BOSA 2BJWA 5C1BA 1IHUA 3CH5A 4XSGA 4YXWD 1Z83A 4MYTA 3CM0A 3EWSA 1E32A 3V9PA 4UJ5A 2ZTSA 3PFIA 2IYSA 1E9EA 3KB1A 2QN6A 5D3MA 3A4MA 3THXA 1VCOA 3D6TB 1BOFA 3L0PA 3GJ7A 2P67A 4G1UC 3NEJA 3LXXA 4DSOA 5CYOA 1E9BA 1XJ0A 1GIAA 4M9ZA 1GM5A 1CJTC 1NIJA 1UDWA 3GLGA 4BLQA 4TZ0A 2ZI6A 3A1TA 5IDVA 2ZSFA 1EFCA 2F6RA 1W48A 2EYQA 5LPNA 1CR2A 5L3VA 1CU1A 4D81A 2ZI7A 3QSYA 1KI2A 3ZS9A 2JAQA 4IKEA 1FPMA 4WA7A 1XJCA 1DPFA 2OCBA 3Q8XB 1TPZA 1FQKA 2VP6A 1XD2B 4RZXA 4DEXA 4HB0A 1W36B 2CLCX 1ZD9A 5E3HA 2NO7A 4LV8B 4PO1A 2JJ1D 3CW2A 4M1KA 5EE1A 1Z3IX 1D6JA 2F1IA 5BQ5A 5AUPB 3K9HA 1U8ZA 2AKYA 3R20A 2YWFA 4PFSA 3TUIC 2Q3MA 2O8BB 5H8WA 4F92B 3I62A 4TMVA 1XNJA 4A8JA 2W6JA 4QGFA 1W46A 2PZFA 2QAGB 1OXVA 1ZJ6A 4E5UA 3BB4A 2ANBA 3LVRE 3VKWA 1Z0DA 1KAOA 2JGNA 2WMNB 3GLGE 4KVGA 5HE8A 3WBKA 5KSOA 4TLEA 2R65A 3NHBA 2QGNA 3KTAA 1RFLA 2F55A 2ZU6A 2BBWA 3X1XA 3QE0A 3N5CA 2ZE8A 1FTNA 4OQFA 5FPTA 2VA8A 4ZKEA 3TQFA 5AJXA 4GZLA 1NBMA 4GDFA 1U9IA 2Q3HA 3GJ3A 2YOGA 1SXJA 4PHFA 2IA5A 3NIBA 5JWRA 4AKHA 3AEZA 3IHWA 3TSOA 4KSBA 5ELXA 3U3OA 4NCHA 1TL7C 3DKPA 3AVWA 1DADA 1KSHA 1J7KA 1UBGA 3SI7A 2ZSBA 3TR0A 1E0AA 2H8KA 1KKMA 2RHMA 1XF9A 3EZ2A 3WYAA 1W4AA 3ZZTA 4DDUA 3QXCA 2P65A 2ZUDA 3NBXX 1DE0A 4JMPA 5J4KA 4OQLA 1SVSA 1DARA 2UKDA 3K1JA 2W6IA 3NVAA 1MKYA 4Q7JB 1GRQA 4TL8A 1W1WA 4A9AA 3I5YA 2IBMA 1FX0B 3JZMA 4ACAA 4X8OA 2D74A 2GXUA 3LNCA 2ZI3A 1NBME 1VG9B 4NU0A 1KDPA 1Q3TA 1Z5ZA 1XTQA 2I3BA 3KZ1E 3GEIA 1SXJE 2ASEA 2CHVA 2A9KA 3OEHD 1M7HA 3PIRA 3T1TA 4M9QA 1ZRHA 5FBRB 3SE0A 4JKYA 1G64A 5CK4A 3TVTA 5SZIA 1ZBDA 2BCGY 2HCJB 4RD0A 3KKQA 3IBGA 1JEEA 2V7QD 1N0WA 2RMKA 4KAXA 3Q9LA 2ZE5A 3TH5A 5L3QA 3W5IA 1KDRA 2ZJYA 3TSZA 4EIWA 3QKTA 4TL6A 2ZXUA 4DZZA 3LA6A 4RD3A 1II8B 1CR1A 2WWXA 5CJ2A 1R0YA 2CHGA 4TLDA 1LB1B 1NJFA 2VH5R 4GT1A 4G5QA 2BEKA 4QNRA 4DLXA 1Z6AA 4JLMA 1P6XA 1XXHB 4P31A 5FI0B 1KHTA 1HH4A 2BBSA 4NE2A 1AS2A 3L0OA 1TQ2A 3EXAA 4URWR 1NIPA 1A2BA 1XU4A 3PJRA 3ECCA 2VHCA 3CRVA 2QL6A 2ZEJA 1NVWQ 2AK3A 4PZLA 1FUKA 4QBGB 4CT4B 2GZHA 2YWEA 2W83A 3FMPB 1MO4A 4YDSA 1KNXA 1PUIA 2ZR9A 4V0KA 4EPVA 2GWHA 3CX8A 4TTRA 1F3OA 4A0HA 1ZC4A 2QRZA 3GD7A 1N6NA 2DFLA 2JJ2A 2FV8A 4JLOA 1GKIA 4LBZA 1FP7A 1P3JA 2VP0A 4KLZA 3CH4B 3B85A 1I4TD 1YZNA 2R6GA 1OV4A 2J7PA 4LI0A 2DFNA 2B7CA 4MGIR 3SDZA 1QHYA 3EPLA 4N0DA 3BFKA 3WMGA 3X1DA 1P9WA 4WXPA 3U3RA 3FMFA 1OLOA 3PXGA 4LUCA 3ZYCA 2ATXA 3RS5A 2QGZA 4PSKA 1GITA 1ZUHA 3SFVA 1KI3A 4HYYA 2XX3A 3U7GA 1E1QA 2YZ2A 1C1YA 3HYTA 4IFEA 3SJCA 2XJ4A 4EJSB 3U61B 2JLVA 5GVSA 4DT1B 5DN6A 5KSPA 1NVVR 1NMZA 3PITA 4NPHA 2OCPA 3GFTA 1XEXB 3P1JA 4WOPA 5JJLA 2CMKA 4G5SA 5E7MA 4C0BA 4F7WA 1VDZA 1E2HA 5CK5A 3VR3A 1R8SA 1NKTA 2FSGA 4BFTA 2X19A 1QVAA 2G1JA 1COWD 4CEIA 4LV5B 4F91B 1M7BA 1DAEA 1CS4C 3EAQA 3K09C 1KI7A 2BOVA 3IIJA 5KYKA 2FGKA 5DI3B 1S8FA 2ZRBA 5E4FA 4IVRA 1VYTA 2GJ8A 3KXIA 2QNRA 4BGDA 1OSNA 4BQSA 4H1UA 4BFUA 5J4VA 2H92A 4HB4A 1IJFA 1IY1A 1RYFA 1VHLA 4TT3A 3CWZA 3JVUA 4BFSA 2RGNA 3X1ZA 1J8MF 3NXSA 5JLJA 4LHWA 2ZRKA 5F9HA 3PQCA 2QAJA 4DLRA 1JR3D 4FMCB 2DYKA 2Y8EA 2YYZA 2NTYC 3AF1A 3BXZA 2D4HA 1MABA 4DUGD 2ZJZA 4MRSA 3U7HB 2W6JD 4KFUA 3RHFA 1QHGA 1ESMA 3GJ5A 4B33A 2Q9AA 4BFWA 3SJAA 1A1VA 1F2TB 4Z54A 1LNZA 1HQCA 2MSCB 3B6EA 4LBVA 1XP8A 5M04A 1VG1A 3QKSA 1CJUC 3IPXA 1ZW6A 1KI6A 4B74A 5ANRB 1NF3A 4LYFA 5L3RA 3R9WA 5EXPA 2XOKA 4I1UA 2XTMA 4CT5A 1YRAA 2RGEA 4XVRA 4D25A 4LGMA 1NBMD 3WRXC 1D2NA 2JLUA 4WZAE 4LHZA 2ZANA 1X8KA 1IXZA 3QXXA 1HT2E 3GPLA 1XTRA 2QA5A 2R62A 1G3RA 2F43A 2IS1A 4QM7A 4M2LA 5H70A 4YMTA 2IS6A 4IOLA 1LFDB 2J41A 1NN0A 1OYYA 2IUSA 1UADA 1YR7A 2J9RA 3U3MA 1CRPA 2J1LA 2CDNA 3U6BA 2XXAB 4XTRA 4IEEA 1T8UA 5HTKA 3FKQA 3MGCA 4GPTA 4ZI3A 1R5OA 4GP7A 4DSTA 1KK2A 1G4UR 1W44A 2OO7A 4BFYA 4RD1A 3HDTA 3RS4A 4V0OA 1KSJA 1XD2A 3CLVA 2V1UA 2BVNA 3FTQA 3DZ8A 3SZRA 2NPFA 4IVQA 5FUVA 1ZAKA 4HB2A 1TQ4A 3RYTC 5FPSA 4RKEA 2XZLA 2CEAA 3QY0A 1VECA 4LOAA 1ZM2A 1Q0UA 2J7KA 1NRJB 4QGHA 1KSFX 4D4JA 2CBZA 2HJGA 3A6PC 1NMYA 2G0TA 2H17A 3OHMA 4Z1MA 2O8EB 3CRQA 2XB2A 3RSOA 5KNCA 1EFTA 2IYZA 1KO1A 4LSGA 2FG5A 3D7MA 4OQMA 5KOYA 2O8FB 2IF0A 2TMKA 4A15A 2DFKB 1HE1C 4FD2A 1JB1A 1KIMA 5FBVB 3NH6A 1AKEA 2MSDB 3K9GA 4HAXA 5AJZA 4IW3B 3UMSA 2J87A 5KHOC 2YWGA 1Q57A 1SHKA 1GVNB 5LD2B 2ZI4A 3W9YA 2QMOA 3G5UA 3TMKA 2WVJA 2D7DA 4IJMA 4UNRA 1UFQA 3CRMA 1SVKA 4S35A 2WWHA 4RZUA 4XTCS 3WYGA 4EDHA 1UKZA 1XCMA 1XEWX 3QF4A 2FSFA 2JEOA 3A1SA 4CZ2A 3B1YA 1LF0A 3RRMA 2VTKA 4WVFA 4GOXA 1QG4A 3A37A 2EQBA 2H18A 2VP9A 2R8RA 4TLCA 3UKDA 4AG5A 4ZDIA 4L8GA 2WTUA 4TSFA 1CXZA 3PEYA 4KFRA 1TF5A 2VSOA 2GJ9A 3RWMB 1XRJA 4FMDF 1NVVQ 3FFAA 3P4YA 1NY5A 4LJ5A 3PEUA 1E1RA 5L3SA 1LVGA 3G82C 1XD9A 3EC2A 1O87A 1R6BX 4ON9A 4AWXA 1E9DA 3T5DA 4UXHA 2GCOB 1XZQA 3SYKA 2DFTA 3RLFA 1KK1A 2ZRHA 3MFYA 3GLHB 1U2RA 2GZDA 1G16A 2MMGA 2ZJBA 4OI2A 3AVPA 4UNSA 4AD8A 1G7RA 4FMBB 4DXAA 2GEUA 1E1QD 1EFRD 1N3BA 5E7JA 6Q21A 2ZAMA 2VBCA 2IYXA 3M0EA 2BM1A 2BWJA 4PO8A 5D3MB 3CZQA 4KHZA 3ASZA 4A8JC 3EG5A 4QL3A 4XWAA 1ZNWA 2P3SA 4L15A 3U3KA 1II8A 3QPVA 2QPOA 1N2CE 5AJWA 3CR8A 1XMIA 5GJWC 3DL0A 1AZSC 1TAGA 3BC1A 4Y0AA 4IXNA 4LRWA 4O25A 4JBXA 3GLGB 2AFIE 4FMCF 1D9XA 1E3MA 1KI4A 1OB2A 5C18A 4KBFA 3RSLA 1S3SA 2R9VA 3VU9B 2OSBA 4W5WA 4M1TA 5BN5A 1SVLA 1BIFA 3A58B 1XZPA 3RANA 3VHLB 3NC1C 4LJ7A 2YC4C 3H84A 2VQSA 4G01B 1A4RA 2H57A 4N0EA 3PENA 4U7DA 4MQBA 2OV2A 1J2JA 2C95A 2ZE6A 2Q9BA 4DLZA 3AVYA 1P72A 1AQYA 4TL7A 1G8HA 2NO9A 1E79D 4D4LA 3LAWA 4TN1A 3B2EA 5HR5A 1R5NA 2IYLD 1ZM4A 3AF4A 1JAIA 3QUSA 3VNUA 1LS1A 1E2KA 1WMSA 3T5GA 4EFMA 1XXHE 4QHTA 3GJ6A 2ZREA 3LLMA 1HA3A 2IUTA 3PUXA 4LHYA 2KE5A 4DLYA 2IUUA 4MDFA 3OIYA 1AA9A 1R0XA 1M8PA 1Q22A 2XOKD 4JJZA 3MMPA 4YXWA 3KTAB 5FUXA 3IEVA 3FPAA 1M34E 3OFND 2FFQA 4EJSA 3A1VA 2F1HA 2WWGA 4YMUA 2CLDX 1G20E 2GJKA 1QDEA 4QOSA 3KUDA 3TIFA 2D7CA 1E9SA 3BAFA 5DHAA 1VG0B 3CX7A 4QG7A 2E9SA 3KJHA 3WBJA 2ZE7A 4ZIRB 4MH0R 2FN4A 2IYRA 4O2RA 4AKEA 1JECA 1VKJA 4F38A 1N5IA 2ZJ5A 3Q7PA 4BFXA 5EP2A 1OYWA 1G8GA 1YR9A 3RS0A 2AXPA 2IYUA 2QP4A 3ZVMA 5FOUA 2FFBA 4E09A 1F5NA 1J8YF 3IGFA 3MWJA 4B44A 1XTJA 1K8RA 2CE7A 1SGWA 3OF5A 2JJ1A 3GCGA 3I4LA 1FMLA 1T0HB 1F6BA 1ZYUA 4XH9B 4JIMA 3E70C 2ZJ8A 2W2TA 1FW6A 4I1SA 2YINC 4PPFA 4GSYA 4Z1MD 2AWOA 2FU5C 2HYDA 4I1OA 1J90A 4MKIA 1F2TA 1MO6A 4WBSA 2YWHA 4RFSB 3WYFA 2C99A 1N0UA 4V02A 4M22A 1G3UA 5SZHB 2CL0X 2RKOA 4IVPA 2GEDA 4HI0E 1XMSA 5EQTA 5L3QB 4Q1FA 4TMTA 4LYHA 3EX7C 3DMNA 5G53C 4S2EA 1GL7A 1IN7A 4Q4HB 3V4RA 3FWYA 4GZMA 4KSCA 1IY0A 4NL4H 3VR4A 521PA 3DOFA 2CLSA 4OHWA 1O3YA 4D82A 4OK5A 1ZCBA 1Q1EA 4MRPA 2BCJQ 1WRBA 2DHRA 4UXIA 1M74A 3GJ8A 4W5HA 2GJSA 1BS1A 2PEZA 4M8NE 1OH5A 4GOJA 4Q18A 5KDOA 5AJYA 3I61A 4P0TA 4OJKA 2FX3A 3IO5A 1Q20A 3IBYA 4NDZA 4M9SA 1KNQA 4ZDKA 1E1RD 4IDQA 2GESA 3SNHA 4DSNA 3U7EB 2QMHA 1H8ED 1XB2A 721PA 1G19A 3E2IA 1DO2A 1R7RA 1GFIA 4LJ4A 4DJTA 2V6JA 3FFBA 2XGJA 3EZFA 3IQWA 3AGPA 5DO9A 2OHFA 4JLJA 2O52A 3SR0A 3OEHA 3KQLA 1GWNA 1DG1G 1RW4A 2JLQA 4LHVA 5AUNB 1HY3A 4QJ5A 2HF8A 1P60A 3L43A 2BEJA 4Q1BA 1R2QA 2V7QA 1OIWA 2ZQ5A 4RJLA 5IK2D 5SZJA 4Q00A 2FFHA 3RVBA 1OH6A 1ELOA 4GMXA 1ZIPA 3B5JA 4Q4LA 2BM0A 4QM6A 1Z0KA 2P6UA 4HEJA 4P4TA 1IN6A 4XSHA 3SN6A 3DEFA 4A6XA 3AKDA 1D8TA 1CLUA 2LWIA 3LBNA 4G5RA 4PPGA 5AR1A 5EZ5A 4CEIB 2EU8A 5A0FA 3UPUA 2QSYA 5C2JB 3DVLA 3QG1A 4DDTA 1JBKA 1TADA 1TU4A 3B1VA 2W2XA 2GA8A 4UKDA 1ZD1A 3KUCA 4KBGA 3EPHA 2O0KA 1Z07A 5SZKB 4US0R 3Q85A 4JL6A 2QG6A 3FGNA 2HT6A 2SHKA 3F5FA 3QVVA 1G5PA 3H4MA 2OAQ1 5CIWA 3SQWA 1MRSA 2NPIA 3RWOA 1EGAA 2WOJA 3L8YA 1U0JA 2EYUA 1TX4B 4L9WA 5KPJA 3MUFA 3BWDD 2EFHB 4M53A 4B34A 4B48A 5JSZA 2PZEA 1UKVY 3QKSB 1KYIA 1H65A 1EG7A 1KI6B 3C16C 3DO6A 3GLHA 1N6PA 1ZUIA 4IHQA 5BXQC 4B3XA 4BWYA 1WA5A 5A5GA 2BBOA 3VQTA 3KJGA 2YKGA 1T3SA 5GJBA 1RZ3A 3A1WA 3RS7A 3C7KA 4TMKA 2ODWA 1Z0AA 3MJRA 1NN1A 2QAGC 3MG9A 4OHYA 2F43B 121PA 2WKPA 4C4PA 5DISB 3L0IB 3IILA 3ZZ0A 4LZZA 3TAUA 3TUJC 1COWA 1W4CA 3WY9A 3OIVA 4V03A 3SEAA 2ZSAA 1FQJA 4Q4JA 3BK7A 3IKJA 3VU9A 2DWQA 4NH0A 3VKHA 4MYHA 2FH5B 3GLHE 4PANA 2BBTA 4C3ZA 2IEZA 3WNBA 4QJ3A 3VKGA 4D2IA 1ZINA 2VO1A 1RRFA 2OCAA 2FJUA 1YU9A 3B82A 1UDXA 4JSTA 4LBYA 5BWMA 3IIMA 1G21E 3OIUA 2ODBA 1EXMA 4XD7D 1JR3A 1Q21A 4ARZA 2WM9B 4KO8A 3LW7A 1VG8A 2WPDD 2J59A 4DUGA 3FDIA 1V43A 4NP6A 2A5FA 3LW8A 4XWKA 4NCJA 4YONB 1CEEA 2PJZA 3TKLA 1K5GA 4ZI2A 3AVXA 1MV5A 2DR3A 1XFAA 2IXFA 3GLIB 2G6BA 4BZQA 4L16A 1NG1A 3U5ZB 1TTTA 3QXHA 2Q6TA 5KPDA 1WB9A 4PZYA 2ZI5A 4JT2A 1XPUA 3X1YA 5FPKA 4TYYA 1CR0A 3PV0A 3HR7A 4TZ6A 1Z6TA 4C0JA 3QXSA 2RGXA 2FFAA 1EK0A 1Z29A 1KY2A 1X6VA 3QF7A 1JR3E 3QF4B 5HCNA 1KAGA 4EFLA 4QNMA 4AI6A 3LY5A 4FCVA 1OHHA 3TNFA 1E98A 1S96A 4YMWA 4ZIRA 4GP6A 4Q19A 3FHCB 3ZQJA 1NJGA 2CCKA 3E1SA 1Z8FA 1MR3F 2CE2X 1YZUA 1EWQA 4NCIA 4RKFA 4E22A 5FL3A 1QF9A 4YDHB 4Z8XA 3KKPA 5KO2A 2QMEA 1FFHA 1ZCAA 3H86A 4DCNA 3CF0A 5HZHA 4U00A 4DVGA 3BB1A 5L3SB 1NVUQ 1E9RA 4GBMA 2ZRDA 4LJAA 1CF4A 4Q5IA 4TQ9A 5TVKA 2C2HA 5AWFC 3LQQA 2Z83A 1XTKA 2VHJA 4PPNA 4C0KA 1IOZA 2OAP1 4TWZA 1OJLA 1Y63A 1Y3AA 1CRQA 4CRWB 2OLKA 1J99A 3R9XA 1KI9A 2GXSA 2ZYVX 3LXRA 4JL8A 4CDGA 2ZUCA 4RFSA 3WNDA 2WHXA 5EUMA 4Z51A 2MMCA 3NC0C 2G3YA 4Q9LA 4PC2A 1ZM9A 4LYAA 1P2VA 1NSFA 1E6CA 2QRNA 3CX6A 1N6LA 3IEUA 1NP6A 4M1SA 3SJZA 3QEJA 4F4JA 4Q4HA 1II0A 2G83A 2QTHA 1PLLA 3T34A 3WXMA 3O47A 1E2EA 1Q1ZA 1N5JA 3AVQA 2W00A 3P4XA 4Q01A 5EE0A 5J40A 1NSTA 1IN8A 2VSXA 5HCIA 1S1MA 3I73A 2D2FA 4FN5A 4FXPA 2V3CC 3AVVA 2BV3A 1X8LA 1KI1A 4UNNA 2XAUA 3NH9A 1TF7A 1VCNA 2WJVA 5TB5A 2VRWA 1AS0A 2PH1A 3EW9A 3FMOB 2YNMA 2IHYA 1ZC3A 3DPUA 4A6PA 4AK9A 2QSZA 5JS7A 1GILA 1HT1E 1W4RA 3CUEF 1JI0A 1OT3A 2CL6X 2YC2C 1RRPA 2ZRNA 1IAQA 4ZCIA 1AJEA 2ZRAA 4A2WA 4NYJR 1JPJA 4YMSA 3KDSE 3U4QB 1E9FA 1SVMA 1W4BA 2EVWX 2QPAA 1OIVA 2OBNA 2UVQA 5CITA 1M2OB 1JEDA 4X8MA 1L4YA 2WJYA 4GMDA 3ZD6A 1US8A 2AL7A 3OAAA 1XTIA 2FOLA 1KY3A 3FYHA 1GUAA 2MSEB 1LTQA 4OHZA 2FEMA 1YZTA 3EPJA 1Z28A 1EFRA 1RJ9A 5EE5B 3H0KA 1KMQA 3A4NA 3H1TA 4DKXA 2XTZA 2WOOA 1Z0JA 1DEKA 2R6DA 2BHRA 4TMXA 4M1MA 2YV5A 3B1ZA 4BZXA 2KBEA 2IYVA 3U2QA 4R98A 4ERNA 4JJKA 2VF8A 3CONA 1ONBA 2GZAA 4C7OB 3LRPA 3EARA 3K0FA 3ZS8A 4AKGA 3QEOA 2GK6A 3DZDA 3P27A 1YE8A 3GEHA 4DLVA 2EFDB 1BMFD 1RE0A 3DDCA 3REGA 1ZP6A 4QC2A 1QG2A 2REOA 1ETUA 4IRUB 5LB4A 1IN4A 4TLBA 3MWKA 4X8HA 3UMRA 1YZKA 1K5DA 3A1UA 4IFBA 3CNLA 1VYVA 4ZPXA 4OI4A 3U3JA 1E79A 3KJIA 4V0NA 3TW8B 2CXXA 3SBDA 2NGRA 3MLEA 2WJGA 3CRW1 1JQJC 5H68A 2QE7D 2NQ2C 4Q66C 1GTVA 1XCGB 3RC3A 1XBTA 1Z0FA 4DIDA 2V6IA 1P4SA 1HUQA 2LKDA 3PR1A 3VMFA 4DCSA 3QG5A 2QM8A 3EPKA 3T35A 1OFTA 2AFHE 2D2EA 2VL7A 3BB3A 1CKEA 4LC0A 4G3XA 5J47A 1JPNA 2VPPA 1WE2A 5AUQA 2FMXA 2ZJAA 4FCWA 4LJ9A 1MO5A 4PR0A 2N46A 2QI9C 2QTVB 3OFNA 4NMMA 2ZS9A 1F2UA 4EPTA 2A2ZA 4AIIA 4HUQA 1WBDA 2ZYUX 4QBHA 2FDCA 2X2FA 2GBLA 4B35A 5EE9A 2IXGA 3AKEA 2IHBA 1CR4A 1JXMA 2V9PA 3TUZC 2GXAA 2HLDA 4JYCA 4JVLA 2CNWA 3NBZC 3KQKA 1OHHD 1Z63A 5DH9A 4BZPA 4JVNA 2ONJA 2OXRA 2QM7A 1HQYE 3HYRA 4K8OA 1OKKA 3PVSA 1OW3B 4Y0VA 3IPYA 3EWAA 5BW8A 5LB2A 4P33A 1QVRA 1WP9A 1Z47A 2REXB 3RNLA 2QBYB 1LV7A 2FPLA 2XSZA 4QJ4A 3MAAC 3BFXA 3QXJA 2ZRLA 5BYJA 5G41A 5LD2C 2XTNA 1P9NA 4C0SA 3K8YA 2C9CA 5KSZA 1TEVA 3DMDA 4KCGA 4R7ZA 4UNQA 3SC3A 4FW9A 4HLUA 5P21A 4HDCA 5JRJA 2PX0A 3F8TA 1SHZA 2CL7X 4LDJA 3THYB 3RAPR 3CB4A 2A30A 3K0CA 1I2DA 3RC8A 1A5TA 3UG7A 4C9BA 3UANA 4D0NA 2DBYA 2JATA 2B8WA 2AKAB 1T4GA 3GLIA 2ATVA 2B7BA 2WBLC 1NLYA 3OE7A 2H16A 2OLJA 1WBBA 2Z4SA 4LYJA 3SHFA 3O8RA 4D4MA 3ZVLA 1UEIA 3U6KA 2QU8A 1QHSA 5DNYB 5F3WB 4A0RA 1NY6A 3A36A 3DM5A 5FPYA 1DAKA 1NVXQ 2IF2A 2ZI9A 1WDTA 1ZVQA 1C9KA 1RVDA 1R0WA 4NYJQ 2AN9A 1E2JA 2VIIA 2A5GA 3H2YA 3QOFA 4A2PA 1KO4A 4EPWA 1UKYA 3W8RA 2D3WA 3UWKA 1KTVA 1YZLA 2EFEB 4QHYA 4TTPA 3NBFA 4JVSB 5CM8B 1AQUA 3ASYA 2ODEA 1U0LA 1GAJA 2IL1A 1MOZA 1PUJA 2P6RA 2QQEA 3ADDA 2VF7A 3FHTA 4A2QA 1BO6A 2PJRA 3GLIE 2REBA 5J4YA 3NHAA 1GDDA 1G291 1XJQA 2KBFA 4B6EA 2PMKA 2W0SA 2ODNA 5C4GB 4UQOA 1KGDA 2Z6VA 4BE7B 1AS3A 3AGQA 2CK3A 4MRVA 4A4DA 4QKQA 1G3QA 1H8EA 4CIDA 1AN0A 2A5YB 1RKBA 2NZ8A 4HZUA 1OXXK 2RGCA 3A4LA 3D3QA 3JZAA 4JL5A 4F4CA 5JSZB 4O2LA 4PHHA 4L9SA 5JBQA 4A0FA 3EIEA 4TYQA 4B3FX 4P4UA 1Z6GA 3OAAD 5BN4A 1X8JA 2PBRA 1CULC 5K8UA 2X8AA 3T15A 4PXAA 2PT7A 1KZ7B 1DBSA 3LBIA 3UATA 3ZH9B 4NCNA 1G8PA 3FKSA 2IS2A 2PX3A 2ORVA 1IN5A 5EXTA 5IK2A 2EFGA 4Z8YA 3UXMA 3GQBA 3CRRA 2HT1A 2QTFA 2V4ZA 1FOEB 3EZ6A 2YJTD 2VHUA 4JLNA 4B3DA 3ADKA 1CBUA 1T3HA 1SVOA 2EWVA 3DHWC 4D26A 4Q21A 2L0XA 2VLIA 1GNPA 1JJVA 2F7SA 4EPXA 1E2FA 3ICQB 3OESA 3W3ZB 2RGAA 3L0SA 1NL3A 1Z2AA 1SVIA 1JJ7A 2WSSA 4KXFB 3HU1A 4Q4JB 2J45A 4M9XA 2ZYWX 4B32A 3KXKA 3SYNA 3WRYC 4F93B 1U9IC 3I92A 5F9FA 4DBLC 1S3GA 4EKDA 4OK3A 4HDOB 2C03A 3ZQ6A 1SXJC 1Z08A 1LS6A 5HKKA 4YC7A 3LDAA 4O3MA 2D06A 2O8CA 1AZTA 1TU3A 3IIKA 3L2OB 4PC3A 1HTWA 4OQXA 4ARZB 1SULA 4NHOA 4P4SA 1E2IA 4IEIA 5KU1A 1I4DD 3QKRA 5K8LA 4QRHA 4OJQA 2IEYA 5C46F 3U4QA 1GZSA 2GVDC 3K9LA 4FINA 4G5GA 4JLVA 3RS3A 1T3LA 4NYMR 4ITRC 2OZEA 3W5JA 3LLUA 1KSGA 3ZVRA 1U81A 2B8TA 5DYIA 2IWHA 1W0KD 1E2DA 4X8LA 2AR7A 5JI2E 4Q7KA 4FCTA 4HAZA 5JCZA 3NWJA 5FBQB 2PT5A 1U8YA 3CPEA 2FGJA 5FTMA 5JEDA 3MWYW 4LHXA 1NNEA 3EASA 1OB5A 3B1XA 5EP4A 3HP1A 2OFWA 3QQ5A 2QQ0A 1EX6A 2JIZD 2XEXA 1D2EA 4PZZA 3DKVA 2HLDD 1VHTA 1YQTA 4PO9A 1CP2A 1A2KC 2CNWD 2R6AA 3AP2A 3FE2A 2K5UA 4AKIA 1P2UA 1OKKD 4Q1AA 5FOTA 3NDPA 3ZD7A 1GL6A 4C7OA 2GXQA 1T5LA 2WWFA 4RD2A 4UNPA 4XJXA 4G0NA 2XSZD 4B2PA 3T06B 3ETLA 3KKOA 3I1FA 5FL7A 5BN3A 3I5XA 2PL3A 1YHNA 2VHTA 2ZS7A 3BGWA 5JWOA 3SU8A 4BRWA 3CKLA 4A36A 4Q1DA 3BE4A 4II7A 3K70D 2ZRIA 4U5XA 3L8ZA 4C2UA 4XD7A 4DLWA 3ZIAA 5EP3A 2VEDA 1VIYA 2WPDA 4LV6A 1X1SA 2OBLA 2GJAA 2V55B 2WJIA 2ZU0C 4WAUA 5DSZA 3U60B 1Z0IA 4PPQA 3CNNA 1XWIA 4V0LA 1E94E 2GNOA 3O8BA 4LPSA 3TSWA 3KFVA 3OE7D 4Q4AB 5K8TA 1G3MA 2ZRJA 4I99A 4K46A 2G77B 1S1CA 2G9NA 3PUZA 1AKYA 4ACBA 1W5TA 5BYKA 3WHKA 3KL4A 1PLKA 1OFHA 1ZNXA 2GETA 2IW3A 1ZMXA 2FPKA 2WIBA 1DS6A 2QENA 1UF9A 2PLFA 1VIAA 3GJ4A 2WMOB 1P2SA 2WSMA 4JT4A 5UKDA 1GNRA 4YQFA 2OM2A 3X1WA 2WV9A 3LO5A 5HZKA 2IYWA 2FSHA 4Q03A 3GJXC 3LV8A 1G17A 1T9HA 4OK6A 3M4YA 5FPHA 3T61A 3NEYA 3K0SA 3U7FB 1N6OA 1E96A 3GFOA 3K09A 1FTSA 4P32A 4EPRA 2ZRMA 3KFXA 4CEHA 3FMIA 1W2GA 2G1KA 2WAXA 4ZV4A 5IF9A 2QBYA 3I72A 2OEPA 1NI3A 4PAQA 5AJVB 2CCGA 4GNKA 3W34A 1M1YE 1YR6A 3A8TA 3KJEA 5B57C 4RY2A 1G6HA 3RABA 2CK3D 2PZGA 4JLAA 4W7SA 2N1BA 2A78A 3RRZA 3TQCA 4DDWA 3NBYC 1E2GA 4DSUA 2Z4RA 2C04A 4JYBA 2JA1A 2V54A 3W8NA 4W5JA 4US2R 3THYA 4PSAA 2X1VA 4C0AC 3EZ7A 1Z22A 4BFVA 1OH7A 2H5EA 1US8B 3BRWD 2RGNC 3KQUA 1G7CA 3WHLA 1SKYB 3AKYA 5LDDC 3CIOA 3D8BA 1FZQA 4IDNA 2KB0A 1NG9A 1RJ9B 2F9LA 4M1YA 1IQPA 1NLZA 5GJVC 2BIFA 3F3YA 4QFMA 4V0MA 4MKFA 1JALA 3FKSD 4RZ3A 1L8QA 3O8CA 1S0UA 1KO7A 5LBIA 3NDBB 2JLXA 2ZR0A 4PC6A 4RD4A 1Z6XA 3ZGXA 1ZNZA 5JZVA 2C77A 3IO3A 5B30A 3SOPA 5IRCD 2WSSD 4P3YA 1BYIA 4BASA 1AK2A 2HEIA 3K0FB 1G41A 4MGKR 4ZDJA 1YZQA 3IDQA 4JLBA 3ICEA 4J0QA 2RB4A 4PAMA 4RVCA 5EXSA 5J5CA 3V4FA 1CIPA 1TQDA 2GBLC 4EQ6A 1YZGA 4C0QC 5HKKD 2QPTA 2NMVA 2XITA 2OFOA 4GFDA 4YLGA 3C5CA 2JCSA 4BECA 3I8XA 4CYMA 1KDOA 1P75A 3C15C 2QZ4A 2ZRPA 3IQXA 4IDPA 1ZUNB 2ZR7A 4DC9A 5DGXA 5CLLA 5FTNA 1IONA 1SKQA 3ONWA 4FWIB 1W36C 4AURA 2HJVA 2XZPA 4HLQB 4QGAA 3HU2A 1E0JA 1TNDA 2XZOA 2ZRGA 1Q1BA 1G7TA 4C0LA 1RRGA 3BERA 3CBQA 4CW7A 4EAQA 3MCAA 4HZIA 3EZ9A 2VYFA 4BPBA 4GI7A 1F2UB 1N6RA 4B2LA 4HUQB 2IWRA 1MT0A 3R8FA 3TVDA 4TYNA 4TTQA 3K53A 1UKEA 2I1VB 3F0TA 2JJ8A 1ZM3A 1DELA 5HPYB 2HCBA 2JASA 2QY9A 2ZVPX 4B75A 1G6OA 1KKLA 3AF0A 2GAAA 2CJWA 621PA 2RGBA 3CR7A 2QP9X 1G8FA 1W49A 3WP1B 1BMFA 1E2LA 2F3TA 4U02A 5FL7D 4C30A 4DLSA 5B64A 1AGPA 1WCV1 4HATA 2WJHA 3W90A 3VX4A 1QRAA 3R8CA 4C0HA 1KJZA 1TEXA 5JI3E 1VMAA 1N5KA 1B0UA 3K70B 1UBEA 3ZIAD 2NOAA 2RH5A 3PUYA 1YJ5A 1NLFA 3W3AA 4M1WA 3X2SA 2ZIAA 2FE4A 2QE7A 1EFUA 2W2VA 4TYWA 4Q9IA 3I8SA 1UEJA 1GRNA 2HV8A 3C5HA 2HF9A 4ZO4A 4AYXA 3HR8A 1A82A 1EESA 3C41J 1P73A 3Q5EA 3QI2A 3CPHA 4KI0A 1KMHA 4US1R 2E1RA 3CWQA 1IXRC 1DAGA 3K9NA 3AVOA 1M6NA 221PA 1W2HA 4M1OA 4OHXA 2R2AA 3NG1A 4TMWA 4N3NA 3BFVA 3SFZA 3ZJYA 1XX6A 4RD6A 1ANKA 2JDIA 3W6NA 4BFZA 1UPTA 4Q7MB 2QROA 3C8UA 4WXRA 2AD1A 3I32A 2Q3FA 1S2MA 1N0VC 3PEVA 5EJEA 4MDEA 3OIWA 4MGYR 5TMPA 3P26A 3RS2A 5KNDA 4B76A 1IBRA 3NTUA 3OEED 1HURA 2O8DA 2FZ4A 5CYPA 4JBWA 1FL9A 2ZJOA 2DB3A 2J0VA 1JQLB 1QHXA 1E2NA 2QP3A 1OH8A 2IXEA 1MH1A 2Z5FA 3BBPA 1U90A 3R7WB 3MD0A 5F2EA 1YVDA 4HLCA 2CVHA 3AV0B 4HZUB 5CJPA 3GMTA 1XPOA 1UAAA 2Q21A 1WF3A 2UZ3A 3TRFA 3GP8A 4AY2A 4NTZA 1TQ6A 1KDTA 1Z6YA 1L7VC 2RCNA 4UXJA 1U8AA 2AD5A 4KVAA 3THOA 4LC1A 3TW4A 4JBYA 4NONA 4LJYA 1N5LA 2G0NA 2GKSA 2FA9A 2ZUBA 1ZIOA 2ZSDA 2Q9CA 3EA5A 4HAWA 4Q4AA 2QORA 5JHHB 3FHOA 1ZM7A 5FOWA 1HEIA 2I4IA 3HPRA 2GF0A 4OKSA 1T8TA 4JLKA 1PJRA 3DM9B 4HSEA 4H1VA 5JMTA 4YMVA 2RAPA 4PTLA 1NN3A 1U94A 4PHTA 1GOTA 1ZU4A 2ZYTX 1XEFA 4FI3C 1E4YA 2NG1A 4MGZR 5HE9A 1GRRA 4E07A 2GRJA 1VTKA 3B13B 5E95A 3VR6A 3CF6R 4FIDA 3LVQE 3CZPA 4BLPA 1IM2A 4EJSC 3DOEA 2PMDA 4MA4A 2JLWA 2C9OA 2GHIA 1IJEA 1EFHA 2Q0HA 4NYIR 2AWNA 3QKUA 4Q7LA 2R6CA 5B2ZA 1G5TA 1XDBA 5FOXA 2C96A 5FI1B 1IY2A 2BMJA 2O8CB 3I3SR 2A7QA 1FNNA 3ND8A 3SJBA 3UWOA 4AYWA 4ESHA 3VR1A 2ZRCA 5JEEA 2P0EA 2KSQA 3AP1A 4P4SB 2WWWA 4NCKA 1QZXA 4KFSA 4URZR 3QKRB 3FOZA 2C78A 4IOKA 4DLTA 5EP1A 2LCFA 1R4AA 5J4LA 5FFMA 4HAVA 1GL9B 5FBWB 3GLFB 5G40A 5EZ6B 5GJCA 2HUPA 2I1QA 3TR5A 1R10A 5GVRA
chains in the Genus database with same CATH superfamily
3CH6A 3DOUA 3AF2A 3K2BA 2XF2A 3LX8A 5EIOA 4CMJA 4JKIA 4OQNA 1JDUA 3F74A 4XWOA 4EA6A 4GBGA 2XQVA 4J90A 3CSSA 1OXTA 2F9MA 2QQ5A 4LCBA 2JIMA 1P9LA 4RAOA 2WWTA 2NSJA 1KK3A 2HDNB 3IAM1 4RVUA 1PR1A 1F48A 3EF3A 2UUPA 1XRPA 3KOMA 3UBMA 4Q6WA 4BNNA 3NVKI 1HPLA 5EEGA 1VSBA 2Q2VA 2AXNA 2QG9A 3CT6A 4G37A 2Q2WA 1JAHA 1APBA 2Z0MA 3EFOB 4PYLA 3IHKA 3AOEC 5FTLA 3URKA 9GPBA 2V65A 5JCPA 4Q48A 3GPDG 5JSZB 4DMFA 2C54A 2J5XA 1DGQA 1I7QB 3JZIA 2W7TA 2RGGA 4W4TA 2ENWA 3DBIA 4WD3A 4OBBA 2XOEA 4IXMA 4ZO8A 1U1GA 3VX3A 2VHYA 3G85A 4ZO9A 3CCCA 2OZLA 3QOWA 2I3DA 4DCOA 1HNWB 5IDQA 1NWHA 2WZQA 5BQ3A 4EABA 2DUMA 1BMTA 2PUFA 5LIRA 1PLJA 1AKQA 4NU5A 2CHQA 2WAYA 4REQA 4EITA 5KYTA 3ZE7A 3AFIA 3FTEA 1KOFA 3OU7A 3BAZA 4D3ZA 1ZUNA 2P2LA 4JJ4A 5AVKA 1CDEA 1II9A 2B4KA 2ON6A 3P2YA 4KXQA 1F4PA 2QUAA 2GAOA 4A7PA 3K0AB 3O26A 6CHYA 4OFBA 1G7SA 1CQZA 4V0QA 2BDTA 5DBIA 4ZCMA 1P61B 2J0UB 3ZV7A 2CMFA 1TGVA 4KPGA 2PKXA 1EX7A 2PUBA 2HU7A 3CJQA 3H65A 4D0SA 3C3DA 1BJTA 2HBZA 3N8IA 1E99A 1Q6ZA 4PONA 2OFXA 2ODPA 3G0HA 4BO2A 2TECE 2ZWVA 2XMRA 4KIFA 4WLOA 3RJMA 1Q0HA 1SUPA 5JECA 1O6ZA 3R6DA 4L4ZA 3TW6A 4G4GA 3E7XA 5HJEA 1PJCA 2UVPB 2ZWMA 3MWEA 3FNGA 5LLSA 2XYRA 2J9YB 1SA0B 4HEA1 3SJ7A 2WYVA 5KDLA 1N9GA 3P45A 1QYWA 2ZYAA 1TQHA 4L02A 1J5PA 1X9GA 2FWRA 4OOFA 2VHZA 3DZKA 4A1FA 1IMJA 1NDUA 1GGNA 4L6AA 1WU8A 5EJ9A 1YL6A 1KETA 5FFNA 1VBKA 4DILA 2BDUA 3ND5A 4XCVA 2QF7A 4ZQCB 1D1PA 5BSRA 1EWTA 3KXDA 3PKZA 1AT1A 1R5BA 2YZMA 3CEPB 3H42B 5CHYA 1R6AA 2O5CA 4C4XA 3KQMA 1T26A 2LRHA 3AWDA 1NZFA 3PXCX 2SNIE 4JT8A 2OFPA 1SBCA 3HWRA 3Q0EA 1OPXA 2W2QA 1NDHA 5AO9A 4CKZA 2FCRA 3QVXA 1GAXA 1WMEA 4EYSA 3SJUA 1XNGA 3C14C 3JQ7A 4LZOA 4MV4A 3SKXA 1YQXA 3WK7A 3SP1A 3G2LA 2OTCA 2RI6A 4XR9A 2OCYC 2P27A 3QVLA 1JVNA 2H7VA 2GF9A 2ZSEA 3I2YX 3LUDA 1QIIA 3Q41A 4TYPA 4JQOA 5JS8A 1VCMA 2BGLA 1K89A 3BJIC 5H1YA 3QRWA 4XB2A 3A70A 4IJ5A 4HLNA 2NW6A 2YVLA 1B42A 3CKYA 5BV8A 2VZEA 5KTSA 2AUNA 3AM4A 1ESCA 5DWVA 5CXSA 1M0TA 3WMEA 3TGPA 2AOTB 3COVA 3OKCA 1QQ6A 1J2UA 1L8OA 4NYIQ 1S01A 3FCAA 1PL8A 1BGXT 4HK4A 5AD1A 4ZALA 3LT4A 4J3NA 1XZHA 3P9ZA 3BH6A 4KO3S 5HF9A 4R9RA 4WZ6A 1VJTA 2BFCB 3ZCRA 4YT2A 3EFBA 4ROSA 5CVUA 4UVEA 3BG5A 1U2DA 1COZA 4FMPA 4URUR 4YASA 2J4CA 2Q27A 2QJWA 3QI7A 1GNQA 2E87A 2O8BA 2BMEA 1Y8RA 3ETGA 3R7BA 3C6QA 4OVKA 1NN5A 4ZCRA 3QA3E 3LQ2A 3DCYA 3DL2A 3VR6D 3IQFA 4UTVA 2QIPA 2V9ZA 5IC6A 1C3XA 4CL8A 1GU1A 5EINA 4HAUA 4BTLA 1KORA 1OF1A 3NATA 1P9RA 3T7IA 3PE3A 4WOJA 3VVCA 4BCDA 4D3SA 5DIFA 3CPJB 1VE1A 1LF5A 1XVAA 3RASA 2BYTA 3I9LA 1OREA 3ZGYA 4B3IA 5K8VA 4JI0B 4EATA 5GM2A 1KPIA 2F2TA 2BFDB 3R3SA 1MXHA 2OFFA 1XZ8A 3GP5A 4BLVA 4KGXA 5C35A 2OQ2A 1M5TA 5BW4A 1M75A 3CS3A 2QRHA 3PFBA 2NO4A 5GONF 4IDOA 1QUFA 2WG2A 4EW2A 4PHGA 1ISGA 4Q3CA 3D0OA 5IAJA 4HDQB 4RF2A 4LPKA 4Z1OA 1K2WA 2JHCA 5FV4A 2C4KA 2G36A 1BDJA 1MEEA 1DPGA 2XQFA 3V42A 1YA8A 1DAMA 5TF4A 3GDWA 5DM70 4Q9HA 2BE9A 2A0UA 3IAEA 1WHTB 3OPMA 4FVTA 1NMXA 1TT5B 4PQEA 5EUQB 3GFPA 2FZ5A 2PV0A 4Q9KA 3R74A 2EJTA 1K27A 1L7OA 2JJ2D 2ONCA 1V25A 4JI6B 1QGUB 4ZHQB 5DLQC 4RJ2A 5ES3A 3USZA 3IR7A 1Y8QA 1E0KA 2V5AA 3C98A 3DBHA 1KJWA 4N9WA 1XNQB 4E1AA 3A4TA 4QJIA 4C2BA 3BH0A 4ED9A 3K8ZA 2W0MA 4M1ZA 5IHPA 3KDPA 3EF1A 2PZMA 3M5PA 1P62B 1EGQA 2XNSA 3WMFA 4QUJA 3V33A 3WP0A 4QPNA 4Y2QA 3ZJ4A 2C2MA 1D7AA 1N2EA 1QB8A 2AOVA 2QVBA 2WMDA 5CLQA 4NFLA 4GI2A 5A3VA 4IOMA 4AP9A 4YI5A 5TV2A 3RSCA 4RSRA 4AG6A 4BS9A 4Z4FA 3KT3A 4Y67A 2DY1A 5FF9A 2GBGA 4Y2RA 5KX5F 4S3MA 1OBOA 3THXB 4FHCA 4L76A 2GM9A 3RJ5A 1MHTA 1KO8A 3R7AA 2M6LA 2JBHA 2YY6A 4CDMA 2X7HA 3MSCA 4TLAA 1DEXA 3FR8A 3SBEA 3ZW9A 2D4AA 4YRNA 4DLBA 1YR1A 2DOKA 4HXFB 4MICA 2UZIR 4DQVA 3ERCA 3IUMA 3WGNA 2ZM6B 2VCHA 5T7BA 3DDUA 3DMRA 2YRFA 5C81A 2FX2A 1NZDA 4NZPA 5IKEA 1X19A 2JGLA 1FSSA 4XUCA 3O8QA 4FE7A 5A2GA 4FYXA 1BDHA 2V8OA 2Q5OA 3FGPA 5DXJA 4UBMA 3KX2A 4E5NA 2FZLA 5HIMA 1G55A 1NONA 2YIJA 3H17A 2GDJA 3OFJA 2OCGA 3LRXA 4WNAB 3VU1A 3ZI0A 3JQEA 3IOBA 3RS8A 3K73O 4PQFA 3DAHA 1KMHB 2C1EA 2BGIA 3EUWA 5K8IA 1QR2A 1PWEA 2YWCA 4MITA 1MO3A 1FNMA 4ODIA 4WIAA 5DX0A 4J75A 4JOBA 2WEKA 5GM1A 4LRSB 2DTXA 5AKEA 1JIJA 2DWOA 1X38A 5CD9A 4LJKA 5HIJA 1DO0A 1V95A 1XMJA 2VSYA 3OCZA 2BMFA 5F1OA 4Q16A 3AWIA 2Q3LA 1USGA 4RFVA 5AQ1A 4HY3A 1PJSA 4I5EA 4X6UA 5AK0A 2QMUA 1LTHR 1B93A 1W0JD 3P20A 3M2TA 5K1ZA 2F59A 1QYDA 2UZ1B 2OILA 4P7FA 4P2GA 2I9KA 1Y81A 3CLUC 5AVXA 3UCFA 3H9JA 4S0XA 3L07A 2J33A 4Y2XA 3E5RA 4O4JF 5DX1A 2QUZA 5DXFA 4I50B 3ZK9A 4CFZA 4R6XA 3FF1A 1WXQA 1H94A 4HO1X 4J7UA 3CW9A 3MWDA 1R9JA 1J4AA 2PGAA 2XE6A 4BTVA 1SXJB 3HMKA 4E2WA 1AZLA 4FWTA 2WYHA 3DNFA 4FX5A 1SVNA 1QG6A 3LRTA 3R23A 3U44A 3SF8B 4P0PB 1QTNA 2L18A 2YWXA 3EVGA 5FWDA 2CMGA 3V4OA 5BV1A 5DI3A 1P7PA 3PPIA 1RTKA 3FNRA 1T5HX 1HV8A 3KDAA 3G8DA 4IGKA 3WGGA 3PSHA 1D7OA 3N0WA 2Q3JA 2HGSA 2P69A 4JY7A 3HXKA 4P92A 4RMNA 1G8YA 2D2XA 1B3RA 1AXRA 4KQEA 3RYHA 1KTIA 1O96B 5F98A 4RANA 4IHKA 1XFDA 2EW1A 3PDWA 1QLHA 4OSEA 4PLWA 1GV1A 2DUNA 4R51A 4B3CA 4UUMA 3THXA 4FFSA 3N28A 1W581 1K3UB 2DQ4A 3LWDA 4KITB 1R6VA 2HK7A 1GXSA 2ONKA 2ZIZA 2P3QA 1NQXA 2ZROA 4ZP1A 4ZRDA 4BMOB 3EE6A 3LD9A 5DGHA 5BV0A 1M8GA 1M7GA 4WZBA 1P5ZB 4F3RA 2PJDA 3DTVB 3CRZA 3EH2A 1JSRA 4YHHB 5C7LO 4ZKDA 2AG1A 5ILGA 3ZWBA 1WXGA 2K2QB 4YQEA 4OHRA 2MOKA 4BE9A 5FH9A 2G1PA 1N5DA 1MAVA 1T91A 1KK0A 3VJRA 1WDLA 2C8VA 3AR5A 4YJ3F 1KPGA 5LA6B 4AKTA 4MUBA 4GEGA 5AW6A 3B9QA 5CURA 3TTXA 5H9WA 2DBZA 2FN8A 2ZVJA 4FR0A 3VKUA 1QYCA 3MSXA 2AEJA 4IQGA 2FW6A 4M8SA 2QN7A 2WKWA 2ZJ2A 4UQLA 3OTGA 5CDYA 2WTAA 1XC7A 1KQ3A 2H1VA 1JR6A 3NZEA 1GLVA 3OCXA 421PA 3OOJA 1ZAYA 3WLPA 5IXSA 1OXSC 5HUHA 3MTJA 4L08A 1CJVC 2FX5A 3T1OA 5JSHA 2A94A 3QIAA 4WZBE 3QVGB 3EZYA 4WECA 4BNMA 1QHEA 4K9LA 4DBLE 3TAHA 4F4FA 4CG2A 3EBOA 2LKCA 4MR8A 4PC1A 3MB5A 4RHYA 3H5TA 4F5DA 4GNRA 2H8GA 2NO1A 3MT9A 4KYIB 4U4AA 4D43A 4YP9A 3AM1A 1NV9A 1JYEA 5EPOA 4I81A 4E5SA 3SICE 3O4GA 3O9ZA 3QWHA 2AX4A 4M21A 2P5TB 4RZ2A 2FSIA 2WVHA 3LBHA 1LSUA 3MXOA 4N6OA 4TV8F 1R18A 3BHJA 3W6PA 5K0GA 4YCNA 3JALA 3GXBA 1MG0A 2VQDA 3CZAA 3QOXA 1M66A 4K6CA 4BNUA 4IQ8A 3HACA 3AW8A 1PR6A 4BNGA 4UUNA 1P3Y1 2H7CA 1H6AA 2G7ZA 4BN4A 1JEYA 1UM8A 2C5LA 1CETA 3WGYA 2GASA 3BF7A 3BFJA 4YVFA 2IBTA 1BN6A 4F8EA 1J0DA 4G4JA 2VUSA 5K3EA 2IBSA 821PA 4R1OA 1Z9BA 4XCXA 3NPMA 1JJIA 5FR2A 5MFPA 4I9GA 3E8MA 4ZT5A 5DCWA 4S24A 1NQTA 1P1FA 3UA4A 1LC3A 4WA8A 2O5VA 3ZE2B 4Y9SA 1W1UA 3IA2A 5DE3A 3RYFB 1XZLA 3N2EA 4MB2A 1RYNA 3RVKA 1AUOA 1XTSA 1E1KA 1U7WA 2A4MA 4ARIA 3LT1A 1E64A 2FRXA 3H1BA 4TKLA 1TZ2A 2BISA 3ZHYA 1CRZA 2EF0A 4V0ME 2FPOA 4AZWA 1SCUA 1U0EA 3PVCA 1WUKS 4MQLA 3FNBA 2AC4A 3AQ4A 4QEZA 1DINA 5ALYA 3ZZUA 5KBYA 4EW1A 4LRYA 1TM4E 3G7SA 2ERXA 4L5CA 3N2IA 2K7FA 4FE3A 4N03A 1LZKA 2RGYA 3DBLA 1JQEA 3RTDA 5DP1A 1K0FA 5A9TA 5JRZA 4MMXB 4MS1A 2GEVA 3HBJA 3PXAA 1XZCA 3H18A 4QBIA 2IZOA 4UPVA 5BUQA 4XOIA 5I9TA 5LQCA 5LZ9A 3ESYA 3F7MA 4TQAA 1Z2PX 2HXGA 3HCRA 4HLUC 4NBSA 3ETEA 3WOVA 4D8XA 2Z2YA 3T9BA 1YBVA 3OQ6A 4Z49A 3K70C 2C9YA 3KQSA 4RE5A 1OTXA 3OA0A 1DFIA 4Y6SA 4DA7A 3NIDB 3T54A 1U7OA 2C2XA 4GC5A 4XW2A 4WSOA 3K0CC 1MABB 5AYVA 3KSBC 3THWB 1Z06A 2ZT6A 4LN1A 3AEKA 5BWBA 2WYIA 3PDIA 1RWMA 5AVOA 1RRVA 3TIGA 4WQMA 3PL1A 4WOCA 1STOA 4PXSA 3E58A 5F2OA 4D46A 2QT0A 1VBNA 3MBIA 1C4OA 4BEBA 3LCCA 1U2PA 5T3UA 1RIFA 1E3JA 1AGRA 3PKJA 3LYAA 1IHUA 1M2HA 1JPUA 4X84A 4YXWD 1X80A 2PSFA 4RS3A 1E32A 3V9PA 4DS3A 1R8JA 1F14A 2GGSA 4RTPA 3KB1A 1ZJJA 5EC8A 4ALMA 1NASA 4MS4B 3HB9A 4CLHA 3PJEA 3L49A 1SHUX 3LXXA 4DSOA 2FETA 3W3AH 4B3SB 2BKVA 3GPBA 4MPRA 3R76A 5B36A 1JKJA 2HK6A 1GIAA 3UWMA 2JCBA 1NIJA 2FQXA 1PR9A 2YS7A 2C2YA 4BLQA 5AXBA 1C3LA 2ZI6A 4M0DA 3HC7A 3AV3A 4O2BF 1C8BA 1KP3A 1EFCA 2XYQA 4FEEA 4MUEA 2HMUA 5LPNA 4C3OB 1LI5A 1QCZA 4I8XA 2P1DA 4TKUB 3HRIA 1XJCA 1DPFA 3AB7A 3C97A 5GOZA 3TDKA 4HH1A 2VP6A 1W36B 3P2IA 4HB0A 3EISA 2CZCA 2PT6A 3O21A 5FBKA 3RVJA 3WIVA 5E3HA 1AZWA 1POXA 2H4ZA 2MINA 2XIQA 4FS8A 2E4VA 2R8BA 4L50A 4LOIA 1EDZA 3CW2A 3MHPA 3S7ZA 1AQLA 2PPLA 5EE1A 3TD2A 4EY4A 1P39A 1MB3A 3I34X 3BTOA 5EWLB 4PLFA 4KSYA 5FO0A 3TUIC 2CLHB 4MLDA 4TX1A 5H8WA 3G0OA 3TZLA 3SHOA 3O9MA 3WL8A 2FKNA 1UCFA 4QGFA 8GPBA 1BS9A 1PSZA 2QAGB 1TVKA 2YWRA 1AX9A 1UXHA 1DQRA 2RIPA 3ZR4B 1XZKA 1Y34E 3CNEA 3AT1A 1KOJA 3LVRE 1Z0DA 4IIVA 2QRPA 4RA9A 1I01A 2GN1A 3QVKA 4Q3OA 1EGHA 1XL1A 4TLEA 1PJ8A 1JNXX 3ENZA 2QGNA 3KTAA 1QH1A 5JS2A 3JZFA 4RZSA 2ZE8A 5EWJA 1UC8A 1FTNA 1NFFA 2I4MA 3TQFA 3UYKA 1P1KA 4GZLA 1XSEA 3PYXA 3V1LA 1U9IA 4EKGA 4LFAB 2G8LA 4ZVLA 5BVHB 1V41E 4KQFA 5AXCA 1MAUA 4KKXB 1YCGA 4WBNF 4TSRA 5JWRA 4AKHA 4HWTA 4B5KA 2VTEA 1PWHA 4EEXA 4H1WA 5H7XA 2FDXA 3W9UA 3GU3A 1V37A 2Q99A 3C1OA 3TSOA 4KSBA 2X0KA 3MJDA 5JVDB 3U3OA 2POCA 5IVIA 3MYRA 2I5PO 2ZUFA 3VAYA 1VXRA 3H2BA 1DADA 4IZOA 3SEZA 1KSHA 3IP6A 4URFA 4I55A 4ZO7A 1L4NA 1NVMB 1CCWA 1EM6A 1KKMA 1QP8A 1CY0A 1XF9A 2Z30A 1W4AA 3CY6A 3M5WA 1YHYA 4M0MA 3ZZTA 1KAHA 4D9IA 5MDHA 2ZUDA 5C7OO 4JMPA 3HUUA 1T24A 1DARA 2E48A 2Z5GA 5CH5A 4TL8A 4Q7JB 3I5YA 3VHXB 4A9AA 4PCLA 4AJHA 2YBEA 5BRNA 3FFWA 2ZPAA 3P9NA 3LNCA 3EHDA 3KLBA 3FBWA 2B0JA 3DE0X 4CMEA 4NU0A 1KDPA 2CNNA 3LBAA 1XTQA 4AP6A 5KTOA 3RSHA 5LUAA 1R6TA 2ASEA 3PIRA 2PS1A 4JI1B 3OEHD 4JLWA 3RB8A 3U4HA 4JJAA 4D9EA 1L5LA 3TLCA 5CK4A 1C1DB 4M0EA 3UXEA 1SBTA 2HCJB 4XGNA 4E5KA 2FUEA 4OAPA 4UBNA 3P9SA 1ABBA 4KI7A 2OOKA 2PFSA 5CT5A 4KE8A 7ADHA 1WL8A 2NU8B 3JWHA 1LDGA 3TH5A 1KDRA 5BXYA 1MPXA 3QKTA 4Q3BA 3RREA 2XUAA 3VSBA 3SX0A 1IEWA 1BVYF 3MGKA 1CR1A 2WWXA 4OSPA 5GOTA 4BVJA 4TLDA 1ETHA 2R96A 4GT1A 4QNRA 2BEKA 5HFJA 4RY8A 1Z6AA 1GL3A 5CYFA 4BNJA 3WI7A 1S5PA 2Q0SA 4RFLA 4R1UA 1FYVA 1ORIA 1L9XA 1HH4A 1AS2A 5C1IA 2A0FA 2XWBF 1RQPA 1OU0A 1TQ2A 2HI0A 3NV9A 1J5XA 4Q93A 5CFQA 6YASA 3PJRA 3ECCA 1M6VB 2VHCA 3R0VA 4LWOA 5FQNA 3N6XA 3BQNB 3BCHA 1M34B 1XDDA 2VDQB 3RWBA 1NFRA 1D6NA 4FDVA 4YDSA 4ALNA 3EEQA 1FFEA 5ECYA 4PYQA 4R3NA 3RLIA 1WSBA 3OPXA 2MR5A 4UMVA 3RU3A 1QNFA 1RHQA 3CX8A 4FHFA 5K9ZA 3LNTA 2QRZA 3QW4B 3VV3A 7AT1A 5KEIA 1D6MA 4NOMA 2JJ2A 3M70A 2EW2A 4ZQEA 4X97A 1J39A 1GKIA 1FP7A 1P3JA 3HKDA 3L8HA 4FYPA 4Z9YA 3CH4B 5ICSA 1DJPA 3WGLA 1ZOLA 5CB4A 3CVJA 5IUKC 3PFCA 3KKKA 2ZT7A 4RSMA 5EIBD 2XUGA 1TJNA 3DD5A 3GLRA 3N2ZB 3M6MD 3Q11A 1P9WA 4PRLA 4WXMA 3FMFA 1OLOA 1FRQA 4LUCA 4S1PA 2DULA 1XWWA 3BA6A 3DZFA 4C4TA 4NENA 3KEOA 1PHPA 3SFVA 3UHAA 4EFKA 1KI3A 1MAHA 3VISA 3MGBA 3OWHA 4B3RB 4B7AA 3JASA 3PFFA 5AVQA 2AMYA 1C1YA 3QMWA 3KYCA 3IUNA 2QW1A 2F3UA 3SJCA 2C2BA 1SPBS 2QW0X 1WO8A 1EZ4A 2OXEA 2RGUA 1KYZA 4DT1B 4Q3LA 1EWYA 9LDBA 2Q2NA 3AFHA 4JQZA 4X45A 4L4YA 3LECA 4WOPA 1YZFA 2CMKA 5C5DA 2C57A 5HMLA 4UHDA 5J2TA 1E2HA 4P58A 2VZ8A 4MS3A 4N40A 3VR3A 3WWDA 2FSGA 4BFTA 2H4YA 3IBSA 4H08A 1KOLA 2ID7A 1JA0A 1UZMA 3D8SA 4CEIA 5DWQA 4RGQA 5IZCC 1DAEA 1NW3A 1PEKE 1RLTA 2VK2A 3ZCXA 5KYKA 2FGKA 3IB3A 2JFHA 4TRJA 1JHDA 1ODJA 3H1GA 3KHUA 4JBHA 3H5AA 1BDMA 2GJ8A 3LIPA 4L8LA 5E4FA 4E11A 4BVEA 4BQSA 4AKSA 1KGSA 1X7ZB 2A7XA 3LY8A 3WGQA 2H92A 2NSLA 3I4CA 4HB4A 2EDAA 2JRCA 3SIRA 3U7IA 2PUDA 3GCXA 1LFAA 4ARUA 1H1LA 2MT9A 4BB6A 1NF2A 2QN8A 4KBYA 4E7PA 3PNKA 4LHWA 3UT5A 3V34A 4DLRA 1JR3D 5HSGA 2PXCA 2YYZA 2IIPA 2P6OA 2H63A 4Y0NA 4DUGD 3U7QA 3B5IA 3UMMA 3DE1X 3NI2A 4Q1VA 1PNQA 2W6JD 2X5XA 2XCRB 1QHGA 1C8KA 3GJ5A 1LW6E 2Q9AA 2BSXA 2F4VB 3UGTA 4TV9A 3STXA 4Z54A 1G2OA 4FKMA 4MOWA 5C80A 1VG1A 4GUAA 4LMRA 1CJUC 3IPXA 4H35A 4ZMSA 5IX8A 3R77A 5KTKA 3GJSA 4HUJA 4K6FA 4PS1A 4LDNA 3PGKA 4PPYA 1CUDA 2C5GA 3KUXA 4F6RB 4ER0A 9ATCA 1XAIA 4J6EA 5F5NA 4FJ2A 5HF8A 4AQ7A 2C9DA 4XVRA 5JAOA 3T41A 1Z8DA 2HADA 2QTCA 4EI2A 3HL4A 1NBMD 2VOJA 3ESRA 2MCFA 2JLUA 2WE8A 2CJYA 1L4KA 1J0CA 2O23A 2QRVB 2WHQA 3QXXA 3A1DA 1XTRA 2QA5A 2JKVA 1YUBA 3IXQA 2W42A 1H05A 2IS1A 1O5IA 2IS6A 3D59A 1C7QA 1LFDB 2J41A 1UADA 1YR7A 1K5PA 1IK4A 3PWSA 3ZCSA 1GPH1 1Y9DA 4KTTE 2CBXA 3IOYA 1NJ2A 2DQZA 2P5UA 3Q1KA 1Y6QA 3U6BA 1CRPA 4ZTBA 4UHBA 1KDZA 4JJ7A 4XM2A 3JYOA 1UJMA 1VJCA 1VL1A 3FKQA 3FTDA 5DYWA 5IS2A 5BR8B 5EIFA 3JYHA 1KK2A 1G4UR 1W44A 5EY5B 3KHKA 3L1HA 4U0KA 2HHLA 3RS4A 5BOSB 1YDMA 4RK7A 2B98A 4EB8A 4EKEA 1KSJA 2QRMA 3CLVA 1FP4B 1IK6A 2W9XA 3DZ8A 3FTQA 5HMMA 3R0ZA 3SZRA 1IUKA 1UM9A 2CKDA 2KMLA 4IVQA 3PXUA 5FUVA 2XVZA 1LRJA 2P9YA 3MCTA 5ICMA 4EHNA 3WADA 1BWPA 4UTOA 2XDWA 2PGNA 4CLOA 5LL6P 3DVQX 1ZM2A 4LOAA 1M73E 1Q0UA 2J7KA 4BV8A 3FA2A 3LZ6A 4AN4A 1A9YA 3L5KA 3A6PC 3F78A 3VZDA 1T2FA 3OHMA 3W6UA 5A5VA 1DRJA 5JY1A 3N3AC 4DJ5X 2XB2A 1ZGAA 4RTRA 2FG5A 2C3YA 3D7MA 4YV7A 2GEKA 1R3UA 5IU6A 4A15A 2DFKB 3CFYA 5EZYF 3K05A 2IP4A 1JB1A 4BMSA 3EULA 4LGCA 4O1MA 4DPLA 5FBVB 3NH6A 3SQMA 1XHFA 4ZEWA 1QIGA 4HAXA 2NPOA 1UT5A 4IW3B 4KP7A 5C31A 1OD6A 2YWGA 4CM8B 1OX6A 2ZI4A 3B52X 5JCOC 2CT8A 1SPXA 3G5UA 4OXQA 3N2KB 3F96A 3AJ8A 4UNRA 1S7GA 1WVGA 4YRRA 3PUJA 3WYGA 4BQQA 3LC7O 4GPZA 1XEWX 1XCMA 3EVTA 3QBEA 3W0LB 3ZG6A 1LQ2A 1AN9A 4U7HA 1RABA 1ZK1A 1NPYA 1W73A 2PKEA 2RHJA 1X14A 3A37A 2H18A 3PXXA 2IVFA 2VP9A 4GQAA 3T7EA 1C2YA 3WK6A 2NSDA 4KFRA 3R8XA 3UMJA 1JXQA 2ALJA 1U02A 4FC7A 4PE5B 2HC9A 2JEYA 2Y6UA 2RK6A 3NYIA 5JW6A 3LX4A 3V1YA 4ZVKA 4PYOA 1WSDA 4LJ5A 5E3JA 1ZRSA 2OAGA 3JQBC 1SRRA 1LVGA 3MUOA 3EC2A 5MGNA 1R6BX 2B8JA 2QTNA 4FFLA 2RHBA 1RYYA 2BHSA 2HHCA 4G0PA 4UXHA 2DFTA 3VZQA 3KEMA 1BDIA 1KK1A 1XLTC 5IWAB 3SY8A 2VS1A 5E9JA 3SZLA 2O3TA 1R4MA 1A8UA 2GZMA 2H7XA 1G16A 4HTFB 4UNSA 4AD8A 1G7RA 1BFUA 1E1QD 2AX3A 1DBPA 3GA0A 5JQGF 3PGXA 4HGYA 2IYXA 1QFMA 4HRVA 1ZXLA 5HOEA 1U0BB 1NXQA 1TYCA 2DFPA 1JTVA 2IEAA 2ZAIA 4PO8A 1QRTA 2RHTA 1W9HA 1OV6A 4JYMA 1CUSA 2RFLA 4A8JC 1SUCA 5IFLA 4XWAA 1ZNWA 2P3SA 1ODKA 1WNTA 4L15A 3WLJA 1SQ0A 4R7TA 3GDOA 3G5LA 1A4UA 3NRCA 1TPYA 5GJWC 4E31A 1DV1A 1Z4LA 2JH8A 5A3JA 3N39C 1YFKA 3I6BA 4HGQA 4LRWA 4WH0A 4Y0AA 3TOXA 3GLGB 3DZCA 3TLZA 1WEKA 2CUNA 4ZU1X 2N47A 1E3MA 1HWYA 1M76A 3ORHA 3O6VA 3VU8A 5IYZA 1JEOA 1MF7A 4KBFA 2R9VA 1Z62A 4MAFA 4R31A 1EJ2A 1YAHA 2JLAA 3VU9B 2IEBA 1L5NA 2O59A 3MCWA 1BIFA 1E8MA 3A58B 1XZPA 3KSAC 2YRXA 2W8BA 3RANA 1IQRA 4G1EB 4V3BA 1I51A 3GQVA 3DEKA 4AY3A 2XA2A 4LNHA 4Z53A 1A4RA 1G20A 3V8BA 4ZEMA 5K6AA 1ZIXA 2XVMA 3GY0A 3PD7A 2VJAA 1A2OA 2ZE6A 2QYTA 3OCVA 2HJSA 1EUDA 4IIJB 4TL7A 1G8HA 3WAGA 1E79D 4YNBA 4TN1A 2OA0A 4G41A 3U62A 5HR5A 1DL5A 3I1JA 3UHOA 3ORRA 1JAIA 2VBFA 2XWJI 3IUSA 4Y2VA 2H2IA 2XNCA 4G1FA 5ALLA 2MR6A 4CKEB 1NE2A 3T5GA 4BY9E 1XXHE 4MR7A 2ZREA 4IS3A 1QIJA 4DTCA 4UZEA 2CXTA 5A1TA 1QGOA 4MDFA 2VWQA 3HBMA 1AA9A 1DQNA 3MMPA 4YXWA 5FUXA 4REOA 2PQ2A 1JI3A 1N3YA 3TL3A 4EJSA 1JG2A 2FEKA 3QX9A 4RDIA 3EDYA 4KR7A 3VR5H 4N3AA 3BGVA 3KZVA 1P4AA 1BX1A 3V80A 1N57A 2WWGA 3GDFA 1A4XA 4WLVA 4YMUA 1G20E 3HCDA 2VSQA 2PGXA 4FFBA 4L8YA 4WMLA 4PSCA 3TIFA 4YJ2A 1E9SA 1PDOA 4D9BA 5L6LB 4Y6GB 2VUUA 3K9WA 3RHTA 2QLTA 3IXMA 4G65A 4RMGA 5IM5A 1XU7A 4RSHA 3ANLA 3E9ZA 2ZE7A 3MT7A 4WNIA 4ZIRB 2VJMB 3HY6A 1ZOOA 1VDMA 1ZA2A 4MH0R 5LKRA 3ZHCA 1GCAA 2CLMB 1JHUA 2Z8YM 5ERGB 2ZJ5A 2E37A 4ID9A 3KOUA 3IUQA 2C7GA 1YR9A 3H13A 4FE4A 5CMLA 2N3ZA 5CU7A 4EAAA 2JHPA 2M2IA 1RCUA 2QP4A 5FOUA 1OX4A 2WTNA 2PUGA 2XR1A 1TLLA 4IMJB 4BBAA 1P74A 1T0BA 3IGFA 1JDZA 4LECA 1U1FA 5K3OA 1XI2A 2PXAA 2RARA 2WPNA 3M6WA 3N53A 1QC5B 4HYTA 1EEHA 4F46A 3OF5A 4YR9A 3DE7X 1GSOA 3I4LA 5KMGB 4MWGA 3CVYA 4XH9B 1ZYUA 2F8LA 4JIMA 1GPYA 2I7TA 2ZB7A 3STHA 4ZCTA 1B00A 1URPA 2NVUA 3INNA 1H85A 1GPJA 4EF5A 3C43A 2A1TS 2BI8A 2JJQA 3CTPA 1XYYA 3MN1A 1XVUA 4HEA6 3NP9A 4OHCA 4YPFA 3PGJA 1I0IA 4P6VF 3C2QA 2FK7A 3JCZA 4WBSA 4R1PA 3M83A 3LX6A 4RFSB 1TCUA 4HPXB 1N0UA 5G4KA 1VP3A 3RU2A 4S1TA 3NKLA 4WKNA 4M22A 1WY5A 5SZHB 5KYWA 1PQYA 4M46A 1XJWA 4J0DA 2P2SA 4IO1A 4Q1FA 4LYHA 3EX7C 5H3CA 3IOEA 1R8XA 4S1VA 3S5JA 3UK1A 1J23A 3U16A 3LSTA 2VHEA 5G53C 5I51A 3KSUA 1G5IA 3UA3A 5DX8A 3N9IA 1GL7A 4K03A 4BQEA 2OKCA 5C37A 3FWYA 5U4QA 1EKXA 4M7RA 1T5DX 4ZHQF 2CLSA 4TVSA 2QQGA 2RH4A 5F4BA 4C06A 4KWHA 1C3VA 1Q1EA 4F60A 4MRPA 2ZSJA 4HMPA 1B14A 3A14A 3FLBA 3HZOA 3KELA 1SU6A 1GQQA 5F64A 5L7WA 5DVZA 5KVCA 1U9ZA 3OY2A 2HJHA 2RB5A 1ECJA 3O5AA 4XASA 4BUZA 1OH5A 4JASB 2XZTA 1AF7A 1LNSA 3MB8A 5AJYA 2H1FA 3I61A 1B1AA 1WKBA 1RQXA 1F0YA 2PL9A 1JH9A 4CFSA 4P0TA 4OJKA 3LO8A 1E1RD 1V8DA 1JZQA 1TRHA 2VNJA 1YBMA 2Q1TA 2VPQA 1WMDA 4CL2A 3DP9A 4NJEA 1RWWA 4ZAFA 1T9AA 3OZGA 4YP1A 1RS0A 3OO0A 5AK5A 5EZQA 2V6JA 4DJTA 3I9OA 2C4NA 2FWAA 2NSYA 3RUEA 1EWKA 2WD8A 2XA1A 3IQWA 3KEFA 1CQJB 1M2JA 3SVZA 5K5EA 4JLJA 2PGDA 4RIEA 4OLHA 2PV7A 3OEHA 2G63A 1FYEA 3BVPA 1DG1G 3E35A 1RW4A 2JLQA 4G2NA 4LHVA 2X40A 4GPAA 3WLQA 4AJOA 3OQVA 2RAUA 2HF8A 2J08A 1P60A 3AUSA 3OZ7A 4QJ5A 4Q1BA 1R2QA 1OCEA 3I2IA 5IVHA 4HNVA 1WXFA 2C1ZA 4KIGA 1ZL2A 1GUDA 2ZQ5A 3F8WA 5SZJA 3OO1A 1ZHOA 4DNQA 5ALUA 4POOA 1N7HA 1XHLA 4DR3B 3WLRA 4Q4LA 4OY3A 1NC1A 1TO2E 3KP1A 4J3JA 1Z0KA 2P6UA 1LI7A 4HEJA 5C8ZA 1NXVA 3SN6A 1UMDA 1Z8NA 4TVOA 3HHPA 1JQKA 4A27A 1BC5A 4YAGA 5CNKA 4W63A 3RU7A 4RVNA 5HS6A 3ESBA 4G5RA 5EZ5A 1M67A 3TM5A 2OHGA 1EFPA 1JU3A 3A2KA 1JIIA 1NBEA 2QSYA 4X71A 3VTZA 5BQFA 4CKXA 4DDTA 4N54A 3GEMA 1GA4A 2DKNA 4D3FA 3GZNB 4X6YA 3B1VA 5SYMA 2ADOA 1FYXA 2ZDGA 5J23A 3RADC 3HH8A 4X6LA 3F46A 3RBVA 4KRFA 2DX7A 3DT8A 5LZ4A 4QA9A 1GPDG 2QG6A 4TTIA 4WZAB 3QVVA 2Q8NA 3AHEA 3F5FA 4NU6A 2HKIA 3EIOA 2YWBA 4HADA 4I4NA 3GA5A 2ZJ0A 3BGOS 3O03A 1L5HA 4MPPA 1ZWLA 2OGSA 2XWPA 5EYPA 3UJ3X 1RQ2A 1YE5A 1RSZA 3ZI7A 2WOJA 5JUWA 3L8YA 4OXIA 1FDIA 4BXOA 1N2XA 1WUTA 3FYDA 4I50F 3VPSA 4B7XA 1E4EA 2AN1A 5HTOA 1O8CA 5JSZA 2XHEA 1A7UA 1CY2A 1WDWB 1E5TA 4G0UA 2P7HA 1H65A 1KI6B 1P77A 1ZEJA 1L3IA 5A5EA 3BULA 5DCYA 4XQGA 1RWXA 4QDXA 1Y1PA 5E8JA 3K72B 1JKFA 5A5GA 3NETA 1M0SA 1U2DC 1BW9B 3BXEA 3GOHA 5T4EA 3O73A 1V4NA 1RZ3A 4GR9A 4I5FA 4X20B 3KHTA 1PGQA 3WRWA 4QGSA 4YIHA 2DR2A 3C7KA 4TMKA 2JIBA 1Z0AA 3REQB 3T1YB 2FCAA 4WCDA 2JCVA 3CBGA 2BI7A 3S0JA 4XQ9A 4MROA 4H7PA 1Z73A 3UV3A 4HNRA 2F43B 4H7DA 4YBZA 4TSKA 3LPMA 3R5FA 121PA 1EK6A 1NR7A 1W5FA 2VDNB 2ET6A 2WKPA 2YICA 3IILA 3L0IB 3TAUA 2IP1A 4WNCA 3WKCA 3NOQA 1W4CA 3OEYA 3R1IA 4GGMX 4CKBB 3OIVA 5LP1A 3DULA 2BR4A 2I3AA 1E1YA 4V03A 2X8LA 4O3FA 5BMVF 3AIKA 3G5TA 1U5AA 1N2BA 2NACA 2UAGA 1AC5A 3DOHA 3BMOB 1OU4A 3VKHA 4BX2A 3D43A 4XDHA 2C97A 4RKWA 2IEZA 4ZANA 5DM0A 5TQ2B