3NIWA

Crystal structure of a haloacid dehalogenase-like hydrolase from bacteroides thetaiotaomicron
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
266
structure length
266
Chain Sequence
KYKLIVLDLDGTLTNSKKEISSRNRETLIRIQEQGIRLVLASGRPTYGIVPLANELRMNEFGGFILSYNGGEIINWESKEMMYENVLPNEVVPVLYECARTNHLSILTYDGAEIVTENSLDPYVQKEAFLNKMAIRETNDFLTDITLPVAKCLIVGDAGKLIPVESELCIRLQGKINVFRSEPYFLELVPQGIDKALSLSVLLENIGMTREEVIAIGDGYNDLSMIKFAGMGVAMGNAQEPVKKAADYITLTNDEDGVAEAIERIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Haloacid dehalogenase-like hydrolase
publication title Crystal structure of a haloacid dehalogenase-like hydrolase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
total genus 90
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2010-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 3niwA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3niwA01
4G9BA 4CE6A 3TLMA 2IOHA 3A3YA 3L8EA 4AP9A 5ALTA 1KYTA 2MU1A 5AKEA 3ZWKA 4UU1A 5ALNA 3OCUA 3QUCA 1O03A 3RFUA 5AI5A 5ALMA 1RLMA 5AVSA 1S2OA 4JDPA 4MUMA 4Y2VA 2FI1A 2R8XA 3U7GA 1NF2A 1QQ6A 2FPXA 5AVRA 2YMLA 5AM4A 4NV0A 2ZG6A 2RBKA 2HF2A 4Y3UA 4BBJA 3W5AA 5AW2A 3WK4A 3SKXA 1QYIA 2X4DA 4FFDA 4I9GA 1RMQA 4I9FA 3P96A 2HX1A 2NO5A 1RQLA 4E88A 2GMWA 2HOQA 2P9JA 1ZD3A 4IFTA 4EEKA 3KBBA 2OA0A 1ZRMA 2AMYA 3PGVA 4RETA 2B82A 1T9ZA 1Z4QA 4BNDB 3ZX5A 3QU5A 2HCFA 2C8KA 2FPUA 5ALRA 4EX6A 3I28A 4NAVA 3ZW7A 4DW8A 4BKMA 3R9KA 3ZI4A 4UW9A 4FE3A 3ED5A 1ZD4A 4PNHA 1WR8A 3FPSA 3UMBA 1J8DA 5AESA 2P11A 2YMPA 2I55A 3FGOA 1LTQA 2C8LA 3SKYA 3NAMA 4ZEXA 3WKDA 4J2TA 5AM3A 2PQ0A 3A1EA 3IRUA 3N1UA 4CF5A 5T41A 1MH9A 3N28A 4HGPA 4NFLA 3NALA 3U7FB 3ZVLA 1L6RA 3L0BA 1Z5UA 3B9RA 3E84A 3QU4A 3I6BA 4Y2UA 1U2SA 3UMGA 4G63A 4BX2A 1TJ5A 3R09A 1Y8AA 3M1YA 5AVYA 5A3SA 3QXGA 2FPSA 3MMZA 2G08A 3FVVA 1YNSA 2HF7A 4UMDA 3PDWA 3ESQA 3A1DA 4UMFA 2GO7A 3IB6A 5AM5A 3A1CA 5AHXA 5AKHA 4C4TA 2BDUA 2JAUA 1CR6A 3QUBA 4CNQA 1RKQA 1RLOA 3QX7A 1F5SA 1JUDA 3KC2A 1RDFA 1ZS9A 2QYHA 1L7MA 2RAVA 1CQZA 4OCZA 1TJ3A 4Y2JA 2GHTA 4HAIA 5ALGA 2DQSA 2NO4A 2YMMA 1VJRA 3SHQA 1TE2A 4KX3A 1ZOLA 5AVTA 1XVIA 3D6JA 2ZBEA 3N5KA 3B9BA 3EF0A 5AM2A 2B1RA 5AI9A 3CNHA 3R4CA 4UAVA 1RKUA 1Z4IA 2Q4RA 4L57A 3I1YA 2EARA 4OFZA 1NRWA 3U13A 3HYCA 3ZVNA 4EELA 2FPRA 4HGQA 2YN4A 3DV9A 3NASA 3ZU6A 2Q4TA 4B6JA 1RRCA 5AW1A 1Z5GA 2B1QA 2HI0A 3AR9A 1U02A 3BA6A 3L7YA 3CZ4A 3GYGA 3M9LA 4AS3A 3ZX4A 1FEZA 4QJBA 2WF7A 2WF6A 3QU9A 1U7OA 1WVIA 2OM6A 3KOOA 2NYVA 3E81A 2FUEA 1N9KA 3EF1A 2YJ3A 2W4MA 1L7PA 1RMYA 2PKEA 1VJ5A 2C4NA 2YY6A 1QQ7A 1Z4JA 2B8JA 4BX0A 5AK3A 3WKBA 2ZOSA 3ET5A 3QUQA 4YIKA 3N8GA 1TJ4A 2PR7A 3N07A 4J03A 5AW4A 3ZTWA 3FPBA 5AW9A 3SD7A 1U7PA 3NANA 3W5BA 5ALOA 2HHLA 1Z4KA 2ODAA 5AVXA 4NWIA 4QQFA 2ZBGA 2WF8A 3OPXA 3IJ5A 2EATA 1N8NA 1K1EA 2G0AA 3OTQA 4KNVA 1Q92A 3W5DA 2YBDA 2GFHA 4YCLA 2EAUA 2G80A 4C4RA 4KN8A 1PW5A 2JGAA 4BEWA 3UMCA 5AW7A 3S6JA 1RQNA 3W5CA 3K1ZA 2FPWA 2I33A 3OCZA 5ALYA 2CFSA 4KX5A 4ZEWA 5AVWA 1YJ5A 2WF5A 3QYPA 2I34A 4CF4A 1XP5A 1SU4A 3WK8A 3U19A 4UATA 3WK5A 5AM1A 5ALUA 4EENA 4UASA 5ALSA 2IYEA 4CF3A 3L8HA 4UAUA 5AKLA 1IWOA 4ZEVA 2P69A 4AS2A 2W11A 5ALPA 3E8MA 3QUTA 5AICA 2G09A 3ET4A 5ALVA 4EX7A 1J97A 1Z4LA 4OD0A 3AR7A 3WK9A 2I6XA 4YCMA 1RPZA 5ALLA 4XOUA 5AW6A 4L6CA 4UMEA 4F71A 4GIBA 5AVUA 2YJ5A 1WZCA 3NIWA 3L1VA 2YMQA 1VFPA 5AVZA 3NUQA 2HDOA 2RARA 1X42A 3I76A 5AKYA 5ALQA 3QLEA 3DDHA 1SWWA 1XPJA 1L7NA 2WM8A 3F9RA 4HGRA 4Y2YA 4BX3A 4YGYA 1Z4PX 2YJ6A 5AKJA 1YMQA 1EK2A 3EPRA 2OBBA 1YV9A 2JARA 2G1AA 2OYCA 3AR6A 4UMVA 5AW3A 5AKXA 3DAOA 4OHFA 3KDPA 5AW0A 3J7TA 5AVQA 5ALZA 4XQ0A 4DFDA 3AR2A 2GHQA 4HYTA 1T5SA 5ALXA 4BEVA 5AIAA 2I7DA 5IT0A 3HLTA 5ALWA 2R8EA 5IS2A 4Y2XA 2B30A 1LVHA 2C88A 5AKZA 4MWOA 3MN1A 2YJ4A 2BY4A 5ALEA 4HGOA 5AK6A 3DNPA 4Y2RA 2G06A 4UM5A 5A3RA 4C4SA 5IT4A 3L5KA 3WK6A 5AW8A 4UU0A 3OCVA 3QU7A 1Z4OA 4RESA 3KZXA 2P27A 2AUTA 2IA5A 4BNDA 2FDRA 3L8FA 2C9MA 5AK4A 2JAWA 1L8OA 5AK5A 5ALHA 3FM9A 4L6AA 1ZD2P 1TA0A 3MC1A 2ZXEA 4UARA 2WFAA 4DWOA 1WPGA 2R8YA 3NRJA 2B0CA 2W43A 2MSNA 1L8LA 5AW5A 3VAYA 2HO4A 1SWVA 2AGVA 3QNMA 4GXTA 5FP0A 3ZWDA 3U26A 1U2TA 2JAOA 4XE5A 2QLTA 3AR3A 2R8ZA 3U7EB 4UM7A 2I54A 2IOFK 1Q91A 1ZD5A 3OCWA 1ZJJA 4JB3A 1RKVA 3ONNA 1Z4MA 1ZRNA 2RB5A 5ALKA 3EWIA 1QQ5A 2YFYA 5ALIA 2HEGA 1Z4NA 2CFRA 1YS9A 2VKQA 4BYGA 5AVVA 3E58A 4Y2PA 2CN1A 4IG4A 3ZTYA 4DCCA 1YDFA 3WGUA 4HGNA 4NABA 5A3QA 4F72A 1S8OA 4EZEA 1EK1A 5E0OA 2G07A 3ZUPA 3UM9A 4YCNA 3ESRA 1O08A 3PGLA 4O8CA 5AKGA 3SF0A 3QGMA 2WHEA 1AQ6A 3KD3A 5JJBA 2ZBDA 1RC8A 5AKIA 5ALJA 1RLTA 1T5TA 5ALDA 5AI0A 2D2VA 2HSZA 3L0YA 1L7OA 1QH9A 2O9JA 3SMVA 3AR4A 1NNLA 1RMTA 2IOFA 2BDEA 4Y2SA 3L8GA 4XPZA 5AI8A 3WK7A 2ZBFA 3OCXA 5AM0A 3QU2A 3SLRA 5AIBA 2WF9A 3AR8A 3U7HB 1Z88A 2B8EA 4YH1A 5AKKA 3FZQA 3WKAA 3AR5A 3WKEA 5AI4A 2AH5A 3L1UA 2FUCA 4Y2QA 3RF6A 3B8EA 3OCYA 5ALFA 4KNWA 2O2XA 3MPOA 4H1WA 3WGVA 4Y2TA 4YIHA 3ZVMA 2FEAA 2CFTA 4KYTA 5AI6A 3WKCA 3L0CA 3BWVA 3PCTA 4FYPA 2Q5EA
chains in the Genus database with same CATH superfamily
1YB5A 3QLVA 1XXHB 2W48A 3UAOA 1ZIDA 1FQOA 2FN7A 2KW5A 1FK8A 4B87A 1NBOA 3DUFA 3F5SA 1KDTA 3RH0A 3IC5A 3HK2A 3HLKA 3ZWKA 3EYWA 5DGXA 1E1NA 3ONWA 1Z2OX 3OEWA 1G20A 3UB4A 3CX6A 3BULA 5FNVA 2Q5OA 2DPYA 3SXPA 3JQ9C 4PBRA 4DR2B 3ZNOA 1GGNA 4PO1A 1J90A 1MX5A 3OJWA 4I8DA 4AQYB 3M89A 4YP0A 3GFSA 2G0NA 2IDZA 4PZUA 2I4TA 1MF7A 3I8OA 1K6EA 3C3WA 2ONZA 4R1NA 1UPUA 3TQFA 5KMGA 4P3KA 4UM8B 1ZICA 2DM6A 1P0FA 2ID8A 2OCYC 2CVHA 3GLFE 4AVYA 2QPTA 3R74A 1QKKA 2A8YA 2D62A 3W3AH 4DMGA 1V9CA 4HQLA 4CF7A 3AF6A 1D1SA 2DJIA 1UZAA 4ALJA 4MA0A 1T8YA 2FP4A 3TL3A 2VI5A 4E88A 2Z6AA 5JYDA 3GJZA 4UM9B 1WUIS 2QY6A 4RKWA 1V7PC 4DQLA 1IB6A 1DQYA 2OA0A 4FCVA 1EWTA 1PNQA 2H17A 4X45A 3M3DA 2FXVA 3OZRA 4LGMA 1EI9A 3NTVA 3UWPA 3A1VA 5TF4A 4N7JA 1FLNA 2WLTA 9LDTA 2ZB3A 1VCHA 4HMQA 1ATZA 3H2YA 5FEMA 4JL5A 2CL7X 1GQRA 3HJAA 3QHAA 1ACLA 1B8NA 4PXAA 2DQYA 5C8YF 4DW8A 1JBEA 3KPJA 2RGUA 5FFMA 4FYVA 4J16C 1S3SA 3WIUA 5AJTA 4PRZA 4CCWA 1AQLA 1D2NA 2VPWA 5KKCA 3B6IA 5F98A 4G36A 2PSDA 3R7SA 2LTAA 3SSOA 1PBTA 2AOUA 2F1RA 3B7PA 3TFOA 1P4AA 1Y1PA 3R0VA 1Y9JA 2IIQA 1I80A 3CUVA 1Z0IA 5AK0A 1A82A 2JH8A 3E4CA 4IIEA 1XCPA 2WWIA 2Y6UA 2BD0A 2BFFB 3I4CA 4JLKA 2YYYA 3DE5X 5COAA 1FJGB 3MGKA 5LSAA 4RVGA 5BVGA 2ZATA 1LU9A 1ZD1A 1TMYA 1XN4A 3GLHA 4NFLA 2I9KA 2JGDA 1GA4A 1WDWB 2K2WA 1JTVA 1F2UA 1TYZA 3DR3A 3G68A 3UJHA 2ZJ3A 1KQNA 5ERGB 2PGAA 1QE0A 1V7CA 5DM0A 3OZGA 2OAP1 4UEKA 5C2JB 3EIXA 1C9MA 2DG2A 1AS2A 4GLOA 3FYHA 2EIHA 2A86A 2RCYA 4TYQA 1DKOA 3THXA 3W2IA 2QSZA 5K4GA 3IMGA 4HLUC 7AT1A 1V3QE 1PZNA 1ENYA 1Z83A 2W6IA 4B2YA 4RMJA 3RDPA 1VPTA 1C3VA 1K5PA 2Z0MA 1NRJB 4NPAA 5DK4A 4R2IA 1L4YA 4LYFA 3UJDA 4CG2A 4U6NA 2X8JA 1VHQA 3OZFA 13PKA 1GZ6A 3I2YX 1P1RA 2GFQA 1J20A 4HNAA 5LZ8A 3S28A 1ZAKA 4BU1A 5B37A 4P82A 2CYAA 2GCPA 5JT1A 1BVRA 1T2CA 2HYDA 3MTQA 4TN1A 4PHCA 5EMJA 3TQHA 4YAKA 2IH4A 1OW3B 4Q4AA 4V0KA 2GB4A 3SVZA 4BB6A 2QRVA 2FX2A 1UT5A 4PYIA 2FCAA 1A4RA 1SFRA 4WXPA 4RTOA 2OWDA 1FS4A 1VCOA 5BSGA 3PNSA 5F5NA 5D7BA 3KV3O 3TSAA 2CNDA 4KBGA 2ZBEA 1N2OA 1Q11A 4I1SA 4ENSA 2V58A 3T7DA 1BDBA 2PFGA 4JYPA 4ZJYA 2G4LA 3K9WA 4FS8A 3O4JA 3H8JA 1C3JA 2D1QA 1M1YA 1UC5B 4M1MA 3RRYA 2X5KO 2L69A 4ZI7B 1T1GA 1BGVA 1SA0B 3PRJA 3T9AA 4Z1MD 1XWFA 2Z9CA 3BWCA 4JSTA 4Y98A 3KCNA 4XUDA 4FMDF 1NV8A 4YAUA 5CTAA 3CJTA 2C8JA 5GGXA 3ZVNA 1WBDA 2GZ2A 1KO5A 1P4RA 4FUQA 2ZRIA 3QPVA 4MI1A 3CWZA 3IUJA 3TMAA 3BS4A 5HE8A 3D2AA 5C31A 2UZ4A 3LYLA 3CLRC 3JQBA 1K08A 3OVMA 4WFQA 4KPFC 4E2WA 7ADHA 2BEVB 2OO5C 1BX3A 1S4QA 2QMQA 3EVBA 5ADHA 1KK2A 2Q2WA 3VFDA 3D31A 3QOYA 4CMIB 1HYGA 4YT4A 1T9CA 1W4CA 3R7LA 1ACMA 5JJBA 1GQQA 2V3CC 3A10A 4ZV4A 5TPZA 1XZBA 1B2LA 4RQBA 4P36A 4BMNA 1QVWA 2OV1A 4TMKA 3AERB 3DKVA 4Z8YA 5FYDA 4BGDA 4JR2A 3OJLA 2A58A 2F17A 2G6TA 3AFNA 1RI3A 3AEXA 3TZHA 4A5OA 5IM4A 1FRQA 1UDWA 2BJVA 1E1RD 2WF6A 4M55A 4QXPA 2Q9UA 3PENA 4JLSA 2C97A 4UD2A 4UBNA 4Y9TA 5JRJA 4C5CA 4TS4A 5KX5A 4OHWA 5B12A 3D1JA 1HI9A 2R1TB 1HDGO 1PJCA 3OH8A 2BHSA 4ZYUA 1BXKA 1I32A 2D1SA 3B13B 3BK2A 1RWMA 3ND6A 2JIOA 4FCTA 4TXLA 4KR7A 3FVQA 5EVCA 4FOLA 4R7TA 1QORA 1XC7A 2ODPA 1MAUA 1ZCAA 4TVOA 1Y5RA 1USIA 3VV2A 3LCRA 4NBTA 2CMFA 5GM2A 4RA9A 4JL6A 4BNMA 4L8GA 3U61B 2CLCX 2P2ZA 3CLUD 1V5FA 3HYLA 4NECA 1RAIA 4F6RA 3KZ1E 4BKQA 2X0FA 3M6LA 4B3DA 1Q7EA 1BVYF 1KIMA 2HA7A 4P84A 2WICA 2PZ8A 1DU4A 4C2BA 3S81A 3GFRA 1GN9A 1SBCA 3TLCA 2SCUB 4S3MA 3EK2A 3ILYA 4G1UC 3NJRA 1LPMA 4M60A 2BCGY 1JIUA 2J30A 2R1VB 8MHTA 4LFCB 2ZTMA 1UKZA 2E21A 4GKJB 3R5JA 3FPBA 5TGDA 5HQTA 2OQ2A 4UNIA 3DC7A 4XCVA 4CM6A 3KAQA 2NXWA 2CW5A 3KWJA 2PMWB 1YZVA 2XB9A 2YXBA 4QFCA 4BO6A 3NHBA 3T5BA 1S7CA 1LPNA 2I67A 2KBEA 1BXRB 1H8EA 2RGNC 3I6MA 4RUKA 4AUEA 4P86A 3GCZA 3BHIA 3EZLA 1UDRA 1R4NA 3TEMA 3E0QA 5KTKA 1IHDA 2ZR7A 3IJ5A 4HUQB 2JW5A 3LC0A 4KFCA 3NQ41 3BGVA 1ORRA 2G0AA 5BR7A 3TNYA 2B2XA 1VRWA 3QENA 4W9RA 5J58A 4C89A 3KO8A 5KNDD 2W4IA 4Q1CA 1V7QA 3OZWA 4KN8A 2ECFA 4FYHA 1XU7A 2REQA 2WWRA 4YJGB 3OETA 4Z9BA 4OLBA 5JCOC 3IT0A 4UAGA 4ZVLA 1Z5PA 3BAZA 2G83A 5DVZA 1VMEA 2VCYA 3DXYA 4AJNA 2SHKA 3UJNA 1W0CA 1LKZA 1SC9A 1TQDA 2CFSA 1IBKB 1MIOA 3MXOA 1ZZGA 3RYCB 4AJKA 2XIJA 3GEDA 3HWSA 3EZFA 1FNSA 3K4HA 1MJGA 1XP5A 3ILHA 3L0OA 2REOA 3LQKA 4K0RA 4N12A 4RPIA 5CM2Z 4Z4GA 1CV2A 1TTHA 4OHZA 2OM2A 2ZLBA 2HQOA 1VGVA 4AUNA 1D6MA 3HKBB 2HXSA 2D2FA 1MC5A 2KQUA 1PZMA 1VGRA 3ADKA 5LB2A 1A4IA 3I04A 5JLAA 1IWOA 2GPAA 4I0WB 1NMZA 2P69A 1SQFA 1VKJA 5DT2A 3QUTA 1X7ZA 3VVBA 3L7DA 4KUHA 2V97A 3GJRA 1GAWA 3JAKB 1V0JA 1E2BA 3ANYB 4M0LA 5IBQA 5BV0A 1FUIA 1UM9A 1VG0B 5C7IO 3DMHA 1NC1A 1PEDA 4A82A 2C07A 2I62A 2IV2X 2PSFA 2P79A 4BMOB 4LXXA 3RSGA 5HVNA 4M4SA 4R31A 3NBXX 3H65A 1A9YA 3H1TA 3JPYA 4BNYA 1N36B 3PUVA 2PBFA 4HY3A 4JWKA 4AU1A 1KOGA 3PLAE 2OILA 3NIWA 2ZK7A 4XA8A 1CU1A 2N75A 1Q1NA 1V1MA 2VRBA 3HM2A 1KEZA 2WG1A 2B9EA 1PAUA 3G7UA 4JBLA 2J8ZA 5F4ZA 3T54A 4DLYA 3DLPX 5FA5A 2C4HA 4BP3A 4DA7A 5MGBA 2X6QA 2AR0A 1K2VN 3R9IA 2QRQA 1KWKA 4NCHA 2R7LA 3WBKA 1VHLA 3MOSA 2CWDA 1TJPB 2AQHA 3HJCA 4FBMA 4HRVA 4JFAA 3R9XA 2HQRA 1PVDA 4DWVA 1Q7BA 2G7ZA 2FV8A 4Q1VA 2ODQA 1DBPA 2O3QA 3ENNA 1NRXA 3GVCA 1LQUA 5IEJA 4OJMX 4QM6A 1ZKDA 2AW5A 2D4AA 4XFKA 5K6TA 3LT2A 5I7WA 2C3OA 4QL3A 5EKXA 3ZPXA 4C20A 5B58C 1XZMA 3ZH2A 3JYHA 4V0ME 1WUKS 4N5MA 4PWYA 1YCFA 4F9FA 3AR6A 3DT9A 4LJRA 2J3QA 4FS3A 2H7CA 1F48A 3C41J 2QZJA 5CBPB 1W49A 1XVAA 1J1UA 1VKNA 3LXXA 3PXEA 3NXSA 2A3RA 2VT2A 2R6DA 2FG7C 1L1EA 1VLLA 3T4UA 3RT1A 1HZJA 2X23A 3L4EA 2GYUA 2EL7A 1EFLA 1SCBA 2EW1A 4JNCA 3KUUA 3AXSA 4XLLA 3COZA 4AX8A 2PUBA 1W36B 2IS1A 3D6AA 4QU5A 1B76A 2ZQZA 3TK1A 3A4VA 4PSDA 2E1RA 2E4ZA 4WRRA 5EN4A 4I1VA 5EZYA 4UFPA 3GQBA 4HDKB 4TLEA 4DEVA 1HKHA 2ZETA 3QI2A 5LLTA 3HMQA 5EXXA 4WLFA 4KREA 1P2BA 3TUZC 2XLBA 4TMYA 4WVFA 5ALEA 5SICE 4O2LA 5BMVB 3U60B 1X1TA 1EFAA 1ZK3A 3QG5A 5L45A 3RR2A 2RH4A 3IE1A 4DCSA 4LXGA 4QASA 3V46A 1DB3A 1RFGE 3JVVA 4R1MA 1KGSA 3EQ8A 4DSZA 5L4SA 3PHLA 3CRRA 1KMQA 1SHTX 1E18A 3ELUA 2AA3A 2NQ8A 1DL5A 4KH0A 3RHTA 1KIFA 3ITEA 4XB1A 2FWNA 5COBA 5E3HA 4DG8A 2ZIZA 4W1QA 1BKSB 1L4GA 3AZPA 1OIWA 3VR5D 4S1VA 5GVRA 3PQCA 4L9WA 3VDNB 4G25A 5ANRB 5DN6D 2MTBA 1A9PA 4K2HA 4E46A 2X9LA 2VXYA 2VYND 2IYUA 1VLMA 1WY7A 2PE5A 3BRWD 1RABA 4IKEA 5JD3A 3A7EA 2V03A 3SC2B 3NM4A 4C05A 4N7RA 1US8B 3A58B 4HXEB 3WZMA 3TUJC 3UQZA 3I9KA 1VBKA 1IFXA 1XR3A 4GXTA 4HLDA 4TROA 3VJRA 5JNRA 5EESA 4QJIA 3TXAA 5F33A 1SGWA 5KSPA 1V3UA 2JAOA 3IQIX 4GGPA 2KSQA 3X1DA 3FLBA 3TPZA 4NE2A 3DVAB 3DE7X 3I30X 4FR5A 3OTIA 3KL2A 4R2HA 1NOKA 4HR7A 3AOEC 3ZEIA 2K87A 4TTJA 1E3TA 4MUGA 2IBMA 1W73A 2EYUA 2J9GA 5K3BA 3VNAA 3WLRA 1JFLA 5ELLA 1LSOA 1JTFA 5EWMB 2OCAA 1S9HA 4BWVA 3B2EA 4LZAA 3FPHA 4M0EA 2PUGA 2WHPB 4B6QA 3ZD6A 1LPPA 3CLHA 4IJMA 4JOQA 4MZDA 2K7ZA 4X44A 3EDQA 3VKVA 4WXRA 1XDZA 1N1GA 2HK9A 3HCWA 4J0HA 1EHCA 4KFSA 4COKA 5A5FA 3EGXB 2V8BA 4Z54A 5ILOA 4TT3D 4FHZA 2XMSA 1O94A 2ACEA 2ZUDA 1N2JA 2FMIA 3DE2X 2ZI6A 4W9NA 5CNMA 1P3JA 4B6FA 1H2XA 4MV6A 5FNVF 3R3VA 3KQVA 2GZ1A 3FPGA 1TGVA 4FHFA 4DNPA 3KTAB 1GLNA 1MB3A 3ZHOA 1OCEA 1I4TD 4U39A 3PEFA 2G8NA 2UZAA 3HL4A 3OQ6A 3I09A 4LXIA 5DHRA 1NY6A 3CNNA 4NJOA 1NXPA 3LBAA 3RUAA 5AUNB 2J4FA 3OIGA 4GLFA 4UHDA 4JI1B 1L7OA 3TFWA 3VNSA 2A94A 1SVLA 1A69A 2D13A 1ZGGA 2HIMA 1O6GA 2PU7A 3LUFA 5CLIA 5HF8A 3DO6A 3WGZA 3ICWA 4FD2A 5EGNA 1DC4A 1S2LA 1KI6A 1NPTO 2PWAA 1G5RA 2IYTA 3B5EA 5LCXA 1XCOA 3L7MA 3QU2A 4JU8A 4P93A 3QYJA 5FWXA 5JYBA 3DM5A 3TD6A 3O8LA 3WNBA 5HZHA 3KB8A 2ZSAA 3FZQA 1G1AA 2EFGA 2J32A 4G8DA 4QJ4A 5AVKA 1QIFA 5BSHA 5K0GA 4P0QB 1KIAA 1YB7A 4YYEA 3S8EA 2P5SA 5CXXA 3MW8A 1Q14A 1UINA 3OPQA 4LMBA 4Y2QA 2W2LA 3ROPA 2P0YA 3IJPA 3V8MA 3J80A 1UEJA 2M98A 4DHWA 4CM7A 1YT5A 1L5LA 2QRKA 2JK1A 4YRSA 2XUKA 3HKDB 2IZ7A 3MJHA 2ZIVB 2FQWA 4CKCA 4AKSA 1K63A 2Y4OA 3LUBA 3VYUB 1DQSA 2I2XB 2Z57A 2RKOA 1NURA 2AC2A 2DHCA 1IZ0A 1VFNA 3GLSA 5ITWA 1QE5A 3TKLA 2HU5A 1U2PA 2GD2A 1S3FA 2XADA 1N1DA 1NVTA 4L4SA 4OREX 1PUJA 1FYFA 2A0YA 2CVOA 4ZFNA 2RE8A 2IKQA 3N2KB 3VPCA 5ALTA 4TV9A 1NTRA 4BNIA 4YJHA 4DJTA 5ALNA 3OWHA 3QW2A 2CZGA 3DEYX 1Z82A 2VHEA 3LO5A 1MGPA 1UJ6A 9GPBA 5JE8A 4EF4A 1T6XA 1ZUHA 3EXEA 1VE9A 2ODNA 1EFCA 5K0EA 5AQ1A 4UQPA 1ZAYA 2FWMX 2I2DA 1QBGA 2V4ZA 4P3NA 4RXTA 2H1IA 1FBNA 5AVJA 3WNZA 1VMAA 1XTVA 2HL6A 1AKMA 3OLQA 4OH7A 4JMLA 3LKDA 1T4BA 2A4MA 3NDIA 4LK3A 2CUKA 3MD9A 4MR9A 4Q66C 1GT91 1LXCA 2J07A 4TTQA 4UUBA 3G0HA 3FI0A 4KFRA 3SKXA 1X94A 3H2BA 3TTXA 5JJLA 1LWOA 2GPNA 4D3DA 2R96A 3AJAA 2WKRA 4B8YA 1AV7A 2FG6C 3FPLA 2ZJYA 2ETVA 2V9PA 5FBLB 4P0TA 4DJ5X 2CV2A 4F45A 1RAHA 2AF4C 4Q4HB 4JJEA 4D6PA 4RPJA 3LXUX 2A9KA 4CVNA 2GGSA 2VH2A 4S2EA 1DFHA 3ZWQA 1GPLA 3AIIA 1PLJA 4NG4A 4BMVA 2POQX 1K0FA 2B4KA 4H9GA 3EG9B 3AESB 3U2QA 3KALA 3LQ4A 4NAVA 3TW4A 1IB0A 3TLKA 4D9FA 1QFXA 3GBSA 3EIWA 5EXEA 2JIZA 3T8YA 4BLSA 4G0VA 3RVLA 1HK7A 3ETLA 4D6YA 4ALLA 1ZCBA 1SH7A 3S2FA 4NK5A 1RE1A 1SJ9A 2YZ7A 3BFJA 4W99A 3TLYA 4RTKA 2CBXA 3VVCA 1PYGA 5CCEA 2BFDB 2I1VB 4MULA 1BN7A 5IARA 1SXPA 1WR8A 1UJMA 1WCV1 1E2IA 4D02A 3S4YA 4CUKA 4DR3B 1T8WA 4B33A 2TMYA 4RTJA 2JFOA 1JR3A 2JI4A 3AHDA 3I6IA 3VPXA 3HB9A 1MQ9A 1YIDA 1Z2NX 3CG0A 2BRUA 2NAPA 2XQJA 4GMFA 3UMVA 3OOEA 5GVSA 2C2ZA 3IQHX 2C5HA 5KYUB 4DSAA 3NTXA 1JTEA 1NBAA 4IRXA 3OQJA 3O83A 5T41A 1XDGA 4EHFA 1C8VB 1T1JA 4UHEA 3IAHA 4MRMA 4XPIA 1RJDA 2M9MA 1X2EA 3A4YA 1QJ4A 3KD2A 3OU2A 5AXAA 4RMHA 3N8IA 4N5HX 1QPZA 1Z62A 2X0JA 3EIEA 1B6SA 4B3IA 2HJ9A 3CEJA 4LDZA 3UW3A 3GBPA 4YPOA 1FSZA 2Q3JA 1RWNA 1VJ1A 4XYGA 4Z7NB 4JGIA 1IXSB 2OBFA 5C4MA 4AS1A 1T9HA 2YOFA 3OPYA 4XWYA 2NU8A 3Q8LA 4QQ8A 4NENB 1UJNA 1DRUA 1P61B 1WXDA 3OFNA 4QZVA 3NKLA 5BXQC 2WTUA 2W2KA 1Y1SA 1N5JA 2OYRA 1ZJ6A 1FDRA 3KKNA 2JLUA 1XRMA 3NNSA 5L3ZA 3A1CA 2VP3A 3PR2B 5A02A 5CX1A 2QLMA 4BKUA 5FEUA 5A5DA 5JASA 2ZE5A 1Z5WA 4L02A 5IM4F 1E20A 4K6FA 1JSRA 4EI8A 1TYCA 5D7NA 3GVPA 2C9BA 3NW9A 4NMMA 1MFPA 3SIXA 4JLBA 1DTSA 4HUJA 1R12A 3EMVA 5JAHA 3VKUA 3SQOA 4V39A 3ABSB 1XCLA 3G0IA 2EW2A 5IUKC 3SIRA 3E1SA 2NO4A 5KTPA 1VE3A 5IBPA 4LOLA 3BVPA 3R8FA 2H07A 2P7HA 2IHYA 2J0QA 4XYBA 1FTQA 1XVIA 2I2AA 1PJZA 4KPYA 2V7QA 2UDPA 3FCCA 2YNMA 3RADC 1KXJA 1H5NA 2W98A 2FMXA 1WXIA 3R4CA 3CNHA 3QWHA 5JJKA 1RI1A 3EPLA 2B6HA 4WNYA 1T29A 4URUR 3VU9A 3ZWCA 2J5QA 1UAAA 1E61A 1VL2A 4GHWA 2DPGA 1LX6A 3DEZA 1JW9B 2ZBUA 4IX1A 4IWXA 4UJ5A 1EIZA 4GZMA 3BMCB 2TMGA 4WOCA 2ZRBA 4BVAA 3M33A 2D00A 2ENWA 3IVXA 3O7WA 5IDWA 3EZXA 2Y93A 5FF9A 1WZIA 1Z0ZA 2QAGA 2WUEA 2PYDA 1KVQA 4GECA 2MJLA 1ESEA 3ABQB 2AWNA 3KCQA 2FWRA 2UZIR 3CYFA 4YV7A 3FUCA 2VDOB 1J8MF 1TA9A 3PKZA 4MLDA 4MWGA 1WZ2A 1KNQA 2B1QA 2VDPB 1ICEA 3B6EA 1I2AA 4X3OA 5EAIA 1FDWA 5FTMA 3HVUA 5KYXB 1E3SA 2IYFA 3WHIA 3GJ7A 4FFSA 3QVGA 4RH0A 3T9FA 3PCRB 2GS9A 4Z4FA 2HLDA 3KUDA 1RYNA 4YA6A 4MA4A 3GJ3A 3UHAA 4J29A 4F1WA 5DM4A 4M0CA 3UHPA 5JY1A 4C0WA 1WEHA 5DX8A 2Y6VA 3O91A 3RGWS 4AS3A 2XVXA 1W88A 1J99A 3RVKA 2PUVA 1DMSA 1DG1G 2HUNA 4NTZA 2F3UA 3G2HA 3PL1A 4QJBA 1YBMA 1W93A 3VNVA 1G6KA 1JV2B 1UPAA 2FSVA 3SK0A 4HRAA 3HY6A 2P4SA 3FMFA 2G8LA 3WGLA 1E3WA 1Y3CE 3IUQA 4MUKA 1A0OA 4K03A 3C6QA 4QSMA 3WLMA 4GQBA 2O3UA 4XWAA 4DG9A 3I0NA 4E6EA 1R4AA 1AQYA 2ZVPX 1BXZA 3IIIA 3O94A 2WE7A 3KQWA 4CV2A 2WBLC 3ICQB 3WMFA 1HV8A 2HMVA 3VPHA 2WKSA 2OCXA 2YQ5A 3SX0A 4BX8A 5MFPA 1M7HA 3ET5A 2DKNA 4L5IA 3Q3IA 1SUPA 4O4JA 1ZKMA 2NUTA 1TKBA 2XUJA 3IR6A 4AD8A 3Q72A 1T1RA 1VA4A 2I99A 2I2BA 2JFXA 1LBEA 2PMFA 1P17A 3IDQA 3NKFA 3QTBA 4K9OA 1YQ9A 3IULA 3PF8A 3DYIA 1P0QA 2C7GA 3PNOA 5CYOA 3L8CA 4U8HA 5T5QA 2O23A 3AY7A 3GOQA 1JFSA 4KACA 1RWQA 2CUNA 3VPFA 1GGMA 4J7UA 5HMLA 5KI6A 2D5AA 4ZKEA 1UBNA 3ZS9A 4EATA 2BFEB 5CVTA 4HQ6A 4QQFA 1Q1ZA 3BRSA 5KSZA 4WUVA 1E8NA 4MKGA 4MYTA 4CEHA 4F86A 1DINA 1G8JA 1UKBA 3C3PA 3CMCO 3WGHA 2HXYA 3PNKA 3ZV6A 1CETA 4BXOA 1OWNA 4N0EA 3QBVA 4BS9A 2IS2A 4EPXA 2OC4A 4H77A 2QD4A 4DM7A 3LGAA 3FNEA 4IPTA 4X1IA 2B4QA 3U7IA 2FPWA 5CNKA 2BMJA 2P9HA 3VR6D 1H3FA 4KX5A 2XJ4A 3RSHA 1W5FA 4B47A 1J2JA 2V7UA 1UMBB 3LC7O 3E23A 3I64A 3LI2A 3QFSA 4Q3KA 3WBBA 5A04A 1YJQA 4W5JA 1Z2EA 1OF1A 1GCAA 3O8QB 4FZ5A 4CHTA 4EO4A 4D4LA 2HA5A 2G76A 4UASA 5DGCA 1PO7A 3NHSA 1AH2A 2WSBA 4CQNA 3CRZA 3LM8A 1ZN7A 4RELA 1A9OA 3IYLW 4ZTBA 3OICA 4IXMA 4KQGA 3CW8X 3GMTA 1I10A 4EW1A 4EZIA 2FFHA 4ZAWA 5FDFA 3GH1A 4AY2A 2BI4A 1RXUA 3FAKA 2PFSA 1RCFA 5EZYF 3HR4A 4LF7B 1TK3A 2HMWA 3E3AA 2OG1A 4GBGA 4Q9AA 3IBTA 1PJ4A 1MEJA 2VXBA 3WK9A 4YDQA 3F49S 4XOUA 3W5UA 1PBNA 3FB4A 4EHHA 3CVOA 1E2KA 2LDXA 3IVGA 3Q6MA 5AVUA 1GNPA 2GLTA 3CLTC 3FNGA 3CPEA 4MPDA 4EPRA 3NHJA 4RIGA 3QLTA 1GAXA 4MGZR 5DWDA 2VEDA 1RZVA 2CFCA 2OGTA 2X7JA 2V8OA 3F8WA 4KMSA 4QBTA 2FHSA 3D43A 3ORSA 4JX8A 3ADOA 3ZLJA 4JYCA 3CSDA 4ETIA 5B3JC 5K45A 1U63A 1W2GA 2JBAB 1GXSA 3ELYA 4KFTA 2C3PA 1CJBA 1VXOA 4IZHA 2PD6A 3OO0A 4WLNA 5FUWA 4KITB 4XWOA 3N39C 2AJ8A 4JITA 4EUFA 3E61A 4YRNA 1HT3A 1YR7A 2SICE 3DVQX 3PDIB 1BW9B 4N65A 4JVNA 2E87A 4US1R 4V1CA 5AKJA 5EQJB 1HNZB 1TYBE 1A9RA 1X7XA 4C04A 1WLSA 3L79A 2C5EA 1I7DA 1GFIA 2VYVD 3BK1A 3ETJA 4QE3A 4YP1A 3ZJ5A 3QX3A 1FPQA 3HKCA 3ZGZA 3BJIC 3T1HB 1NP6A 5AKXA 5GY7A 3ZY3A 3VZCA 1XLVA 3KDSE 4RHTA 1KY5A 4OU4A 1U3GA 3RTBA 2X7HA 4O4IA 4JEMA 5AUOB 4KOEC 3DUFB 5HDBB 5BYAA 4NSNA 4W7HA 3KDAA 1N32B 3BMQA 3FVTA 1D7OA 1EB9A 3KXDA 3MFYA 4G89A 5DCLA 5EZSA 5LYJA 4NCIA 4X6YA 1GDHA 5FNVB 4GRAA 3DM9B 3NBFA 3S55A 3HVKA 1EMDA 2QYOA 5CA1F 5IMSA 2XMBA 4CM4B 3GD7A 1SCNE 3PQ2A 3RJ5A 1K9SA 3MJSA 2IGBA 7GPBA 1KK1A 1QHIA 2NYAA 2NTEA 1E1QA 1SUWA 1TADA 3WWPA 5KMGB 5E7MA 1NUQA 2F8MA 3F9IA 3OX1A 4GSKA 3KM0A 4Q1AA 1X1EA 4RTNA 5EUQB 2Y05A 4H1HA 1FFDA 1GU7A 3CRW1 3QYAA 4C4SA 1TVKA 2NOAA 3KLOA 2A88A 5G2OA 5BRAA 3TF5A 1B8PA 4MP8A 1H42A 2A67A 2B25A 3PC8C 1RJFA 4UAJA 4G9GA 4ZV9A 2FP4B 3OCJA 1UMCA 3IVAA 4LF5B 1NZDA 3UK1A 1R7RA 3VH1A 5HR5A 1XXLA 3IEPA 3HR8A 2YDYA 3Q7IA 3L01A 3HCAA 4KQFA 4ZOAA 1BJRE 2B4RO 1NU8A 1SXJE 1WHTA 5P21A 5B5SA 4X97A 5EXTA 3ZV7A 3NBYC 4D4KA 3B70A 1PT8A 3B7GA 2EU8A 3A32A 3S2YA 3FOAA 1SXJC 3IXQA 4TTPA 4Z0NA 3T41A 3CNQS 5KU7A 1T9DA 3AM1A 3U4IA 1CDZA 4DR4B 3ZE6A 3V4FA 2WJWA 2WY2D 1WUHS 1BDHA 1TA0A 4I9UA 4CKEB 1N0UA 4UCFA 4MWTA 4AKTA 2IXTA 2X5OA 2ZAGA 1E8DA 1WPGA 2RHLA 4M38A 4PNZA 4PCUA 4A0GA 3DAYA 5AMXA 4FFBA 5KUTA 1MB4A 1SKBA 3ZXYA 1OT3A 2B3DA 1TI7A 4RYDA 4WKBA 4ZOBA 4E03A 1AMUA 1F14A 1J2EA 2IW3A 4XSHA 5L53A 2IYAA 4ZO7A 2GA9A 2ONYA 4IO0A 1DC8A 2YZNA 4JAVC 5K8JB 2IEYA 3Q8XB 1M8GA 3CJRA 3QFTA 3T5AA 2IOFK 2LIPA 3AHJA 3LY8A 3OCWA 4MIYA 4Q39A 3ZCVA 3GLHB 4MVJI 4G56A 3AG6A 1RKVA 2JGDB 1KPGA 3DPIA 2PRIA 3IELA 1F2UB 3EGWA 3L0IB 3NC4A 4XKJA 2DLCX 3RRBA 2O2IA 4D0RA 4ZEMA 4QVKA 3VU8A 4J94A 3EQ9A 2PVCA 4KLAA 4PPFA 4A5SA 2ORVA 1GA6A 3NZEA 4J76A 4HG2A 3P97A 1HDYA 4KDEA 1KDRA 2UXBB 2BGIA 4HGZA 4LJ7A 2NIPA 4Y2PA 1TVEA 3BTVA 4RGQA 1YACA 3L1JA 4FSDA 4ROSA 4DMLA 5CUQA 5TB5A 1GM5A 4KFUA 4K1LA 4LVCA 2Q46A 1CR1A 1OREA 1XZQA 4TV9F 5I5GA 2B5OA 1ONPA 2OV6A 5GAJA 5IP5A 3NEJA 3DGFC 1Z37A 4CCSA 4L4ZA 3RC7A 4AXBA 3FHCB 5JFTA 2KE5A 2PMDA 1LLCA 2BEKA 2NO9A 5JS6A 4GDMA 1Z06A 1FFWA 1L5WA 2D8AA 1B0ZA 3E53A 3M1LA 4A8JA 1PZEA 3C70A 2PKCA 2WU4A 4FJ1A 2NZVG 4K8OA 4Q4AB 4RCZA 2OCDA 4TPKA 2LRHA 3PLRA 2WM9B 2B4AA 4Q1EA 3BGWA 5CDYA 1NI5A 1KQ3A 2IWRA 4D9NA 2BMWA 4PG5A 4D56A 3L4KA 1E3DA 2XMPA 1A77A 3LPDA 4LYAA 4Y2SA 3FTNA 3QLJA 2GCOA 4KQIA 3D6MA 1DJOA 1OXSC 4LDNA 3TH5A 5AM0A 3CISA 3SLRA 1QNFA 3FKJA 3AR8A 1Z88A 2G5CA 4HNRA 3HZOA 1R8JA 2WKPA 3ZU3A 4I36A 1Z3CA 5DHUA 1WQ1R 3AHEA 3H75A 3NH9A 4XOIA 5KYYB 3PG5A 4CW7A 3MGGA 1M1YB 3K71B 1H2RS 2I7TA 4RQTA 1HFWA 1IHXA 4KRGA 2QTZA 5CM9C 3WOVA 1FJXA 4KTVE 3VC7A 3VDXA 5B1EA 4BGIA 4HTAA 1X13A 3DOIA 2WFLA 3WWCA 3IPLA 3MPOA 1WRBA 2NVOA 3E15A 3O0TA 1KEEA 5C7OO 4MQ5A 1P75A 2YHBA 1Z34A 2WP8J 1Q12A 1XCGB 3A8TA 2V1UA 4LDQA 4TSRA 1VG9B 2VH1A 3AO0B 3OHSX 1N6NA 2FX3A 2ZI9A 2DULA 4OL9A 4D4MA 1TKRA 3NAGA 3PS9A 4MDHA 4EYQA 4PC7A 1MD9A 3H7AA 1KYTA 5EQFA 3LXRA 2XUGA 5G3ZA 4C2UA 3JQGB 3Q9LA 4IMIB 3L9XA 1PG0A 1O03A 4EFKA 3DDZX 1SIBE 2IX9A 1MTOA 2G82A 3AGPA 3E5NA 5AOVA 3THYA 2OE2A 3RBAA 3WAGA 2YX1A 1RTTA 2RI1A 3CZRA 3O93A 4PQRA 4CIYA 4DV7B 2R7AA 1OH6A 5HZGA 1VHJA 3SFVA 5KX5B 1ZD8A 3AETA 2BSQA 1SQ0A 2BONA 3CX3A 1WSWA 2WSSA 4IIHA 2EBHX 2ZG6A 4UDYX 2ODTX 3H8VA 1MZPA 5D5QA 5A6SB 4BBJA 3O3NB 2P3SA 3USCS 5KYWA 3O4FA 3WK4A 4BMZA 2H1VA 4FFDA 3HR7A 3AMVA 4LJ5A 4RK4A 1JIKA 1YCHA 3P96A 1JMYA 3ROKA 1WE2A 4RA9B 3RFTA 4JU9A 4IMPA 4PSVA 2CE2X 5MN5A 1TM5E 5H83A 5HJEA 4FI3F 2P9JA 2Q2QA 2G71A 1OFIA 1KFKB 4NXNB 4EA8A 1DG3A 4N0MA 1JIIA 2HWXA 3MUFA 2IXFA 1IPEA 3INYA 3QXCA 4AT1A 1C8LA 3HB1A 2FPPB 2W6QA 1TQ6A 4YI3A 4CTKA 1APBA 2QMHA 1PVVA 1RXEA 3IFSA 1TZCA 3Q7SA 1HNNA 1BZYA 1CLUA 4FSHA 1NWHA 1KR5A 4JT2A 5CBKA 1DXQA 2KX7A 2P9TA 3ANNA 3D1VA 4ZVOA 4YP5A 3LK6A 1CDEA 3P9QA 3VR3D 4KIJA 4L4XA 3T3HA 5CT8A 3L8YA 2VHJA 4QELA 2AV6A 2B37A 4PNHA 5IJ0B 1F7UA 4EGJA 3TVDA 1XAHA 3O26A 5JANA 2GESA 3FPSA 1P7CA 2IUEA 3FGOA 5J5CA 2PS3A 3PWTA 3L92A 5EE9A 3BICA 2RHHA 3UZUA 3TGPA 4O2AA 2I91A 3CF6R 2A35A 4CEJA 2RJ3A 3TW0A 1E2JA 5B36A 4KGVA 3U3KA 1X1CA 1BWQA 1G60A 2X2EA 1CB0A 2PDAA 3KEMA 3N6VA 1RP1A 3G9ZA 1XAGA 3TN7A 3ZVLA 3W2HA 4B2IA 3B3FA 1MIOB 2ID7A 3UXYA 3CY6A 1QOPB 4N3GA 4U7DA 1W0KD 4JJFA 1LUAA 1O6ZA 1II0A 1RXSA 3MUOA 3GN2A 4XDYA 1VSVA 1BRTA 1GQOA 2BHLA 3M1YA 4YQYA 1F6WA 1TU0A 2VHQA 4ZT3A 4EJ6A 4Y9RA 1AN9A 4EGSA 3TE7A 3NR2A 3EAGA 4JBIA 3COPA 1WVGA 3F6PA 1I4DD 4JH0A 3E9YA 1FXUA 4DUGA 3ZHZA 2OK7A 3ZW8A 1O8CA 3EJ6A 1X7ZB 3IUPA 3RAGA 1UZUA 1HDRA 1WY5A 2QRLA 3KUKA 2QHXA 1B42A 3ED1A 3MTGA 1VPWA 1XTPA 1UM9B 2M1XA 5IANA 3K16A 4WK2B 3IIMA 2OCKA 2F59A 1C3XA 3VSDA 4BMDA 4OYLA 5KWVA 2I7XA 2I4LA 1DEOA 1JEQA 1QC5B 1JDJA 2Z56A 4OFBA 3W77A 2QTGA 2WIAA 4L07A 4LE0A 4MQEA 4KDCA 4QUDA 4OCZA 3VMFA 5DYYA 1LNQA 4JKYA 3TB4A 3BHJA 3M3HA 4M9CA 3E9EA 1V1MB 5BW6B 1CY7A 1J0BA 4CLRA 1YDGA 5MHTA 1VJCA 4OBWA 3N58A 2GAOA 5EPOA 1ZOLA 4K6MA 3WB0A 3NTQA 1GPYA 1T35A 1VBNA 3AZQA 2X4GA 3O1LA 4O4JF 4HFJA 2JHAA 4K87A 3GJ0A 1XZLA 4PGGA 2VJBA 1U28A 2VSQA 3L5OA 1KK3A 4I19A 1BOOA 2NU7B 4MVJG 3JAMA 4EG7A 1DJLA 1ISFA 1OFGA 3LYUA 1V11B 4RDHA 3RIXA 1X7WA 3HXPA 3W3AA 5DMXA 2YHIB 4MVXA 3B12A 5DCWA 4YRQA 3U13A 2B21A 1NR1A 1GITA 1LPBB 2M32A 2TMKA 3CKKA 3LNCA 4QPPA 4PGMA 2ZI5A 5AJVB 1WIWA 5M04A 4MYSA 2VNKA 2AFIE 2XQGA 5JAPA 5J1SB 4ABYA 1KPIA 2P2SA 1P1JA 3EGDA 2C4KA 3TZBA 4HAZA 1XZGA 1QO0A 3RIEA 3C8HA 4O02B 3VJKA 1MHTA 1C9DB 2VJMA 2ZSKA 2XTNA 4WH0A 4UFNA 2Q4OA 3OUZA 3FVWA 3IP1A 5LP6F 3I9V1 4O08A 3UGQA 2HK7A 2F90A 5DYGA 4H6WA 4B84A 1DQNA 2WILA 1ZLYA 2MYTA 5KYNA 3GQBB 5CEEA 1DC5A 3OE7D 4RF4A 4YVFA 3VGPA 1ZK2A 3I5MA 3MGBA 4OQQA 4ESOA 4CKZA 4JA0A 5EJ6A 1T0JB 4B3GA 3IP8A 4KR3A 4BO9A 2IEZA 5E1MA 1HX7A 1EFTA 1FB5A 1YFZA 1L1QA 1XF1A 1HC7A 3N0TA 5EJ8A 1NI4A 5EE0A 2MIIA 3A11A 3WTBA 1YQTA 1I3OA 1MVNA 3AM4A 2QWXA 4EHDA 1UZNA 4CIAA 2BVNA 2VQSA 2XI4A 4GQIA 5DW0A 3SBDA 1VIVA 4BZQA 4C0SA 3PDJA 2H5EA 4CF6A 1JFTA 2QTBA 4R2MA 4ALMA 1FNMA 4UVGA 4A0HA 1U2GA 1HYHA 1JA0A 4LI0A 4Z49A 2CV0A 1GQYA 4XTCS 3CUSA 5I7UA 5JZVA 3NV9A 1W1IA 3FPAA 2XUFA 1DAPA 1C50A 2GVNA 4F60A 3LQRA 3CUTA 4DANA 3KEOA 1YVEI 3ECSA 2C4UA 3L1HA 3G6WA 5B4VA 5CHYA 4MGIR 4J2OA 3PPIA 1VBMA 3JRWA 4O1IA 3GLFB 3LVQE 4D5EA 3GYBA 4DLNA 1SBZA 1VA5A 1CDDA 1YZUA 1A5ZA 1Q77A 2NNWB 2ZIEA 3JYPA 3OD1A 3PUZA 2C77A 3QMPA 1QHGA 1XRRA 3GD5A 4G3XA 5LA6A 4A2QA 2YKGA 3HJRA 4EGCB 4F9EA 5FL7D 5HM8A 3HU2A 3U0BA 3MIIA 4NG5A 1XD2A 4E2ZA 2NNLD 2IYOA 3W79A 3PPVA 4DXHA 3REOA 1U0TA 2G40A 3ZV3A 1JKJA 2JGJA 4IIUA 2QTVA 4C03A 4BKRA 3NNDA 3SYRA 2IODA 2CYBA 4TUYA 3WLFA 4ZQHA 1BDMA 4CLHA 5I01A 1LPSA 2QQ5A 5IZCC 4LKOA 3MMPA 3PUJA 4HVTA 4CTJA 4ZU3A 5K20A 3G5AA 1XJ0A 3P2KA 4LFBB 1AO0A 1L4UA 1LDGA 3R9WA 2IF0A 1BYIA 4EY3A 1HM5A 2IZ0A 4UTVA 1R5BA 2Y9PB 3RVQA 4R16A 4ZA2A 3QYPA 1AB6A 1PX2A 2I34A 4LHZA 1SU4A 1PD1A 2PS0A 2RHOA 3MMXA 5GP1A 3VTKA 1G41A 4PYJA 1FP1D 1P4HA 2DUJA 3JU3A 4UATA 4O4IF 5TLSA 1FRNA 4II7A 3MTEA 4BWFB 5F3DA 4M37A 1TO6A 3JWGA 3P7MA 3ITKA 1AB5A 1JHRA 3NRBA 3NWOA 4I50F 1P0CA 2HNAA 4O4LA 1VE1A 5DN6A 1WMAA 4RZXA 4TMZA 4BB9A 1NJ6A 4ZKDA 4XSGA 3FR8A 1J21A 3EZ2A 5E4JA 3NMUF 4ENPA 1BS9A 2WUGA 1SZPA 1WTCA 3BRWA 1VIYA 4IFBA 4OB8A 4RE6A 4AICA 1M2OA 1PEKE 1J97A 4JXJA 3CQ9A 3DQPA 4PTLA 1XEWX 5SZKB 3REQA 4AUMA 3WL7A 4RLFA 3DHEA 5H80A 3NG1A 5DK6A 3A6FA 5AW6A 4OHMA 2I3AA 4R3UC 4B4DA 1YL6A 4FFMA 1OXKB 2Z98A 5YASA 2NQ2C 3V4ZA 5CVVA 4B7ZA 1Q1AA 3W04A 2F43A 2LP4Y 3WWZA 3TQOA 3RJ9A 1KI6B 1UC4B 2FMKA 3JPWA 5CFRA 3A6KA 5FWXB 3OOHA 2ZPAA 3PKJA 4N54A 2ISQA 3AUYA 3K09C 4N18A 5E8RA 4CTNA 2H85A 1OB2A 1E1DA 5ENVA 5KPJA 1DCKA 2C0QA 3CA8A 4GBJA 4NZPA 1O54A 2OHXA 3KQOA 1QVVA 4IDCA 3G2OA 1NJFA 1QIJA 4TT3A 4CMKA 3IEVA 4IZIA 2YJ6A 2FF7A 3GPDG 4PLWA 3IXLA 4GMGA 5D51S 4ID3A 1W4BA 3LY9A 4LBVA 3V8QA 4C0JA 4PINA 2OBBA 3KVVA 1LJ8A 3OX4A 4H4DA 2Z2ZA 2FMFA 3VC1A 1K68A 2UUCB 3BIJA 1THGA 4X24A 3SYLA 4YY3B 1JQJC 3I83A 4KJXA 3DYVA 3G1WA 5AHRA 5GIPE 2BFNA 5C37A 2PA3A 1KK0A 4NYMQ 3T61A 5AVQA 1R74A 2QRPA 5J40A 3QJ5A 4TV9B 1K8QA 4PO3X 1OKKA 1K4MA 4K28A 1K7FB 4LCBA 5DKFA 3UHFA 2HH9A 4KR6A 5TGTA 2PT9A 1JHXA 3W5VA 5KREA 4KV7A 2Q5FA 4IWYA 1KRHA 1IXKA 1HL7A 3EDCA 3CNEA 3PIRA 4G1VA 3EXEB 3VPSA 2OMKA 2OD2A 1BJKA 2XYHA 3E82A 4PZDA 1RVDA 1RS0A 1UP4A 1YKGA 4MQMA 1ADGA 1W8IA 4FLMA 5BWBA 4P4SA 1R6DA 4M0PA 3MB8A 2PUFA 1AKYA 3PGA1 5AFSA 4LMRA 2X5JO 1P2TA 2L82A 5IN4A 2AF3C 2XNDD 3L7IA 4UM5A 4Y2RA 2RC6A 4WCDA 4O5OA 3IJRA 4CKWB 4S04A 2OORA 3CURA 1P9OA 3M6WA 4U5QA 1U99A 2IIBA 5A0VA 4YJ3A 5MGNA 3LD9A 1ZRHA 1LWNA 1KBOA 2CDNA 1MOQA 2VAXA 5EMLA 3KZXA 1Y5MA 2RONA 1M5UA 4KQ6A 2R4TA 2QVXX 3AH8A 4JI5B 4BNDA 2AJTA 4RSGA 1RYFA 2NZ8A 3GDHA 3HSSA 3V7NA 4EG1A 2AIRA 3C8UA 2C59A 1VLVA 2VAVA 3PFFA 4AZ3B 3DS8A 1J70A 3M1AA 3O95A 4HWPA 1A95A 4KE8A 4MGKR 2WP0A 3RVNA 2C2HA 4J0FA 5K01A 4MMZB 2IHZA 4PN7A 4U2GA 1ZD2P 4C3VA 3RC3A 2NU9B 2OD9A 3L8DA 3OZSA 3SM9A 1ZEMA 3F6YA 1IQ0A 3E7PA 4E5NA 1NQVA 5AYVA 5TT0A 2WJ6A 1KI4A 4UOZA 3OUTA 3K6KA 5HG0A 5LXTA 3VYRB 2QZZA 3EQZA 1Z0AA 2IELA 4XRGA 4B35A 3ENVA 2W2VA 3FSGD 2I80A 3IP5A 2CHFA 4CL2A 2XA1A 4XIGS 4LUCA 3RSQA 3WP0A 4QTYA 1QGZA 1Y4UA 5JVDA 16PKA 1DEAA 1VPEA 1DEXA 3DLTA 3KRTA 4DE5A 1RZ3A 2Q50A 3GZTB 2XD4A 2ZCUA 1LLQA 3GIWA 4V0NA 1NFRA 1ZD5A 3DDWA 4Q18A 2V6MA 5I9LA 4MW4A 5FQOA 1AJEA 4MRMB 5TY0A 3ZWPA 1G4UR 2X9QA 1ZRNA 4QFBA 1IQRA 5JSHA 2BBSA 2BGUA 2YZ2A 2CK3A 2L17A 3RREA 4X20A 1GDTA 5IWAB 4QQNA 3KXIA 3NOXA 3VPBA 1E2MA 1EXDA 3WADA 1M10A 4DBLE 4CR6A 5JEEA 2AJCA 4J75A 2WJAA 4NBUA 4CQMD 5ER6A 4YPFA 2C7QA 4P6VF 3PC4A 1U1CA 3M81A 2FR1A 4DBLC 2W90A 1MDFA 4R2LA 5EIHA 1UPTA 4HGNA 1RQ7A 2CLDX 1Y7TA 4NYIR 1TUEA 4G1MB 4QGAA 3WBFA 2XMGA 5H4GA 5GADl 1YZYA 3RSSA 3PGLA 3RRNA 4L3WA 4BC0A 1ZHFA 4LC9A 3UANA 1HZZA 2AKAB 3SF0A 2NT4A 2P6OA 3N0WA 4WLEA 4BTEA 2ZS9A 3PQ4A 1I24A 4LWPA 3PJEA 5BQPA 1JJ7A 4IYRA 5AKIA 5ICFA 2R48A 3FSRA 5DNUA 1UP7A 2JJQA 4D26A 3KV1A 1YU9A 1RLJA 1CXZA 2WZCA 4PQFA 5KTYA 1M2KA 4E2FA 3AUSA 3C4JA 3N53A 3MMNA 3S2SA 1NJ2A 2AQ8A 1QCDA 4GYWA 4M49A 2OXFA 3RS4A 4QUIA 3D4PA 2JI8A 5I7AA 3LW7A 2NPIA 5CDGA 4HO1X 3EGOA 1GL3A 1LY1A 3N3BC 2OZKA 4Z3OA 3NHZA 5EUBA 2OFXA 2Y2UA 3ZNPA 1JHDA 1QYVA 1VKZA 3GJTA 2FJ0A 1YI8A 4D4HA 1HH4A 2DFNA 5AUPB 5JAMA 4BPBA 3WKEA 1GLVA 5EHZA 2AH5A 3HCRA 4JYAB 3B5IA 4DLWA 3VU9B 3LSYA 3R77A 5J4YA 1Z0DA 4OV6B 2EQBA 5KTMA 1U7ZA 1I0LA 4QDZA 5HCIA 3PIDA 5TJ9A 4NVRA 1SCUB 3I2KA 4MR8B 1G8FA 3SXJA 1PWEA 1VJTA 1FDVA 4R68A 3WJ2A 4ZZ3A 1PLLA 4B79A 4LF9B 2QAGB 3D4BA 2VWGA 1F1JA 2ZZKA 1AM4D 4J3FA 5BQ3A 2P3OA 2Q5EA 3SJUA 1PEAA 4FMCF 1UIMA 1EVKA 1CUZA 3A2NA 5LVAA 2A78A 3H9JA 5AP9A 1MENA 2R6R1 3NORA 4YUVA 1PZHA 2QLFA 2Z5FA 3MT7A 3EN0A 4O2AF 6AT1A 1PFQA 5KDOA 5EY5B 2QTFA 4GMHA 1YR1A 3FNFA 4WBNA 1AKUA 2ZITA 1IJBA 3DFMA 2ZWAA 3CV3A 4IKOA 4N49A 2GHIA 3CKYA 3WX0A 1J33A 2D3WA 2EJVA 4UHJA 5CDUA 5AVSA 2VDKB 5JLJA 1ISRA 4HS4A 4E08A 4Z3DA 3SFTA 1JL3A 4DRYA 5JMWA 3M4XA 3OP1A 4HMOA 4K86A 5DYIA 1UJ4A 2VSXA 4U5XA 4QUGA 1E6CA 4KEAA 2HF2A 2XV1A 1T5HX 3EPPA 4EZBA 3IVCA 5KTSA 1W4AA 4FZ3A 3EOAI 1F0YA 2X4DA 3EEQA 3G0BA 2FEOA 1XPOA 5EE5B 4LY6A 1KVRA 4F3NA 3DHNA 4OUKX 3KB1A 1YZNA 3PJDA 3EWNA 4V02A 4ZK6A 2W6ZA 2WIBA 1MIHA 2QSUA 5DM60 2F3TA 2C9YA 3UG6A 2D0OB 2QL5A 1YULA 2H5IA 2IYXA 3M3PA 4DJEC 2VF5X 4F84A 2ZGVA 1MP0A 3NEYA 3Q3GE 1ZOIA 3UKJA 5CVUA 1Y1QA 5EHXA 4M7WA 5HKKA 1TEHA 2AD1A 1AG9A 2CZQA 3KB6A 4J0KA 4Z0TA 3SJ7A 2W2TA 4P5EA 3ETHA 4A92A 4UEJA 4PLHA 2BJWA 3TZEA 4DMKA 4ARVA 1WUYA 4HPJB 2GCEA 3CH5A 1EINA 1I1NA 1RLIA 3RTDA 3JZFA 1Y3AA 4ZQIA 2R7MA 4JOSA 4IIBA 1XTQA 1LNZA 4Q47A 4XVRA 1M73E 5LMNB 1LQ2A 2YYZA 3T1NA 3A6LA 4CEHB 1KVTA 2IH5A 4WK6A 3WLEA 3ND8A 2I2WA 4ZEXA 4CKBA 3MWJA 2FUNB 3ACBA 3K9QO 1YB4A 1KJWA 1J8QA 4X1IB 1DKNA 4M1KA 5A4AA 5FR2A 3O90A 3L0BA 4I7EA 4Z53A 3I6BA 4B6OA 1OX6A 4FOSA 1ORWA 2YDXA 1EJBA 3EZ9A 5TPWA 3SQNA 4KQMA 3TAHA 3UMGA 5M7EA 3ONVA 3NAQA 3ZD9A 2YWXA 4D96A 4B2PA 3IE2A 1NUAA 2CL0X 2HA6A 2VJCA 3JD1A 1C5KA 5K7SA 1H1LA 4BWYA 4MGEA 5LM3A 1YU6A 2O50A 3ACDA 3HDGA 4IR7A 1UQTA 3SKVA 5B6JA 3MINB 1COZA 4B3BA 4UTRA 4LFAB 1FTGA 2NYUA 2PUTA 3HBFA 2NVUB 2A9RA 2Z58A 3SS8A 2NAFA 3HVIA 3SPXA 1FMJA 2VTBA 2EFEB 3SBXA 4EMTA 5CA0B 4P7FA 2Y27A 4M1QA 3VO9A 2FSHA 4L8YA 1T6BY 3HUDA 4HPWA 3TUIC 1UOOA 3MB5A 4D79A 5SYNA 1JXAA 3PUHA 3WL6A 4WA8A 1TT7A 2Y0CA 4LC0A 5HCNA 4DQXA 1DO8A 2VSOA 2QQEA 1ZBQA 1GL6A 4EKGA 2O6LA 1I0ZA 3A3KA 1R10A 3DDUA 3QBDA 1XMQB 4CJXA 3EG5A 3PDUA 2XE4A 1L1RA 4NULA 1NZFA 2QP4A 3VR6A 2Y2VA 3D0KA 1CQPA 1ST3A 3BGOS 4K26A 5IAEA 3K2IA 4YRAA 4ZYWA 1GXSB 5CXQA 3KAKA 2VUIB 4EKYA 3A9RA 1IN6A 1ECBA 3K8OE 1IUKA 2A9PA 3C3MA 4MW6A 4X0EA 3RNLA 3ZOZA 1V26A 2JLRA 3CZAA 2ZE6A 2ORYA 3C5VA 2EG5A 4HB3A 5K2MA 4R5HA 4Y8VA 1DI0A 1QIKA 3QYFA 5FPSA 1O1YA 1X7XB 2EWWA 3SNKA 3I0ZA 2PR2A 4GPZA 4TRNA 4JI0B 3GJSA 4FDUA 3K5IA 2VPIA 2FPRA 3Q7QA 1Y3DE 1BE6A 1G5FA 2N0SA 5CM8B 4HGQA 1W7AA 4V0OA 3KR2A 4QYXA 2M6LA 4G8BA 5DLYA 5EPUA 3PFWO 1TKCA 2WHYA 4LI3X 4PNPA 4JYMA 1PQPA 1VI5A 4DRXA 4TUYF 1ZONA 5DLQC 4BATA 1BA2A 3S7ZA 1IONA 3P71T 1OBVA 5A4MS 3QHPA 3G49A 4ISCA 5LQJA 3A2LA 3LIIA 4RAQA 3W05A 2Y99A 1EZ4A 5FPQA 3IDFA 1SCKA 5F2KA 5GWXA 1NW8A 1PK8A 3UH1A 4B4OA 1LD3A 4JLNA 3K1JA 4G4SO 5IAGA 3ORQA 3WYCA 3OG9A 5F3WB 1CG6A 3W7BA 3O4HA 2IVFA 2EX1A 4RVUA 2XDQA 5ESXA 1YVDA 1VBFA 2H06A 2ZTSA 3RS0A 4MICA 4RVOA 4FBGA 3WFJA 4O4LF 1QHSA 3GLQA 4E1BA 5JJ5A 2Y0PA 4LW8A 1BFDA 5B30A 3L7CA 2FMHA 2O8NA 4QHTA 5ADWA 3C14C 1Z25A 2WIKA 3OSUA 3WMRA 5ITZA 5K3EA 1K7SN 1KJIA 1XDUA 1U8UA 3LBIA 5LOVA 4L5JA 1WHTB 3IAEA 2VP2A 1OLSB 2Q7XA 4KK4A 2EX4A 4TS1A 4NAHA 1ND5A 1VZ2A 4J49A 1WZNA 3BORA 1EUZA 3IUBA 1TCVA 1PT5A 1N6KA 3B51X 1JXQA 5KHLB 3DO8A 4QOSA 1JG4A 2OC9A 1WDTA 2Q3FA 4ZDIA 1N92A 4UNQA 3RFXA 1NW9B 3LUPA 1P8AA 3ROMA 5C80A 3SD7A 3A9CA 2BGTA 1TU3A 1J1IA 4V0QA 4EPVA 3ESAA 3R5FA 2A5GA 2H4JA 1NSFA 2VDUE 1G55A 2VJPA 4YRDA 4G07A 2HHLA 4J4HA 2CJWA 1KH3A 1MJNA 2GHRA 4NWIA 4TSFA 2WV7A 5JAIA 1BD3A 3W4IA 3WJAA 2QM3A 2UVQA 3COYA 1NVVQ 3DCJA 3FWYA 4ZRMA 1NVWQ 1KP3A 5AHOA 3W5DA 2QUBA 4F12A 5KSOA 4M7RA 2O8EB 3PNVA 3B82A 4P58A 2W8ZA 2XNKA 1DBSA 3A9TA 3IR7A 3ZWNA 4ZJZA 4DSTA 3B5JA 4KBFA 4IOMA 3RUEA 1OAAA 3WFZA 4A4DA 3P0RA 2B78A 4GLBA 3N05A 4B75A 4R40A 1GPKA 1TGYA 1L5HA 3S3TA 1HSOA 5FI0B 1CHDA 2WF5A 4LSMA 3RSLA 2EP8A 1USWA 4KO1S 1SD1A 1IUNA 5CTJA 1ODIA 3N70A 4JBGA 4KDRA 5ARCA 4M9ZA 1YMUA 3ROTA 5D3QA 4HTFA 2B1GA 1HTTA 2UYQA 5JO9A 2Z8YM 5KVQA 2FB9A 2GDZA 4ZXFA 3KU4A 3VHXA 3WLSA 3UENA 1D1PA 1S01A 2R0QC 3BJEA 4GGMX 1A2OA 1E7MA 1I3KA 4WCFC 5C5DA 1EUQA 3NGXA 5ALPA 4EHJA 3E8MA 4KQHA 1NU6A 1C1YA 4ESHA 1P5FA 3NETA 2ZR0A 4M8KA 5A4DA 3K8YA 3P9KA 3AY6A 1XEXA 1YI1A 3PRHA 4RF5A 3SJAA 1M2EA 1E4EA 3QPWA 4G67A 4LEIA 4MQFB 3K0HA 1H5UA 1GKKA 5BQ5A 3TPFA 2BOVA 2IVZA 4UDOA 4U7HA 3HJNA 5J2TB 3U56A 2YJ5A 1T3ZA 1TTQB 1PRYA 2F3RA 1QRTA 1IY0A 4PLTA 3QVSA 4YJ3F 2EF1A 3P4XA 4BQRA 3DDSA 4OJTA 2GZ3A 3UMJA 1M6EX 2H92A 1U9IA 4B32A 3RUPA 3P0HA 4C4YA 4DC9A 4CIWA 4WN9A 1O95D 1C7RA 1P7VA 2CCKA 1SWWA 1IUOA 1J6UA 1XPJA 1POXA 2H3HA 2IRWA 2Q0SA 2ZW9A 1WCIB 3AEQA 3ME5A 2JASA 1E94E 1V9SA 2BKUA 2CGEA 3O0DA 2GEFA 2K5UA 3AF4A 5KCMA 1KYXA 2HIGA 2JJYA 3EDOA 1KY4A 3F67A 2WDPA 1ZZEA 1I2BA 5F2NA 4O4HA 4BTLA 1T2VA 3LF2A 5BN4A 4RE5A 2BE7A 4XWGA 2QXYA 1P31A 2WFLB 4CG0A 1GTRA 4HWTA 4MTCA 1CWUA 3EIUA 5A7GA 5LQKA 1M76A 1ZISA 3TRHA 4CI9A 3IH5A 4PX9A 1CUHA 1N5KA 3K1YA 3AFMA 4GO1A 3M34A 3GCDA 5AJXA 1UH5A 4BFCA 4BNVA 4C5BA 1Y9ZA 4PZ0A 3GUCA 4OSOA 3QPBA 1P91A 1FZQA 1XCJA 4HNGA 4CMBA 4JJ4A 5C1IA 3LP8A 4KC0A 3H1EA 5JVDF 1UFOA 3A1NA 4Z4EA 1SB8A 4HYTA 1HBJA 1TEZA 1EWYA 5FOXA 4KYUA 5K3SA 2ZRPA 4XJXA 1U94A 1GZUA 1XAIA 3QKUA 3THYB 1U0BB 2YCLA 2J1LA 4FKBA 3D81A 4G86A 3QMMA 4C7KA 1UBOS 1YB2A 1KA9H 3PZBA 4YQEA 2P3QA 2B30A 3Q85A 2I78A 2QW1A 1DG9A 4IJ5A 1Z0KA 4JLDA 4MWOA 4DLAA 3MN1A 4TQUS 4LZJA 1AKNA 2E4WA 3EZYA 4EB3A 4OATA 2GPBA 2ZJ6A 1N0VC 5DNVA 1Y8RA 4AYXA 1SC1A 1AN0A 3EVDA 3GLUA 1FU4A 3TBKA 2ZJFA 1G7CA 4C88A 1WABA 2CF5A 2VUHB 5FI3A 4JXZA 4RMNA 3USZA 2J45A 3FUWA 2FDRA 3VUFA 3C3XA 4KN5A 1F4PA 2HBQA 1NMEA 2R62A 1LZLA 4HN9A 2HZBA 2IYZA 1BAPA 3GAFA 3HEBA 4IGFA 3P94A 4HH3C 2OV2A 4I8XA 3HYTA 4WOPA 5BSFA 5EL0A 2AZ4A 3CUKA 1NN5A 3RD5A 2EKDA 3MC1A 1TRHA 4XRRA 4F3CA 3L41A 2WG2A 2HREA 2IEGA 1RKBA 4ZDWA 2ZWPA 5A0TA 4TT8A 1BS2A 4DWOA 3T7EA 2H4HA 3ICPA 1PE0A 5C8XA 1FLAA 4XD2A 1NN0A 1L8LA 1REQA 4H3KB 2GAFA 3SYTA 4N9QA 1P6QA 1GFZA 4K6CA 4A27A 3WY9A 2J31A 3JY6A 2J3KA 5H5JA 3JZIA 3V4SA 5IFLA 3DV0B 5JWOA 3E5RA 1YC2A 1A1VA 2ZQYA 2Z2KA 3PC2A 3AR3A 5TMPA 1ISJA 3BFVA 3TAUA 2R8ZA 1D4AA 4CEJB 3O7MA 4FKZA 4PHHA 1UJ5A 4D25A 1ML3A 1F8XA 4QUAA 3WA7A 5T67A 2HWYA 4I4LA 3LKBA 3TJMA 4AJLA 4B74A 3HCEA 2PX2A 5JBNA 2HA2A 1G8GA 4TTSA 1A8UA 5E0KB 2RGBA 3IP6A 2RI0A 1D4ZA 1Z4NA 3LCMA 1N8KA 4Q1DA 3T7KA 4EJ2A 4GI2A 1R6BX 4HAUA 3E58A 4BYGA 2ST1A 4DMUB 5AVVA 2ONKA 5TEWA 4TLAA 2JLCA 2NZXA 4R9SA 3A4IA 1KVSA 4RLSA 4CFYA 4CEIA 3EFEA 3ZTYA 1JLMA 1GUYA 3BX1A 4ZHQF 3EBOA 2HT6A 3Q12A 5EFZA 2YN2A 1M2VA 2G17A 4YQFA 2D74A 2HJHA 1W59A 4F72A 4WBNF 3LX8A 1UPXA 2G07A 3ZE7A 1LI5A 1ZOPA 2QD5A 5CNIA 3FOEC 2CCJA 3MLEA 2WU3A 1SXIA 3D6HA 1NLMA 1NX9A 3VNBA 3W9BA 4C21A 2A5JA 1N2CA 2C8VA 3IP9A 3KXPA 1DIGA 1KMMA 3C3CA 4Q7LA 1SVOA 2O20A 1JEQB 2D1FA 5TXGA 2QM0A 1RLTA 2IF2A 2R00A 3GA0A 3NEAA 2PJRA 5IC4A 4MQEB 2NXNA 4D3YA 2OFWA 3KYIB 2C29D 1PN3A 1PNRA 2JIPA 3KYJB 4GVXA 4EAAA 4G6ZA 2VSNA 3F8TA 1KFCB 3I34X 4B8WA 4O33A 3LDUA 4OI1A 1KVUA 2ZBFA 4YECA 1A7UA 3DHWC 3ZY4A 4G1CA 5JQGA 2ZYHA 1JG7A 1QGYA 1GPUA 3UHOA 2ZYRA 3TOSA 1CR4A 1TZJA 4EJSC 4EL5A 5HX7A 3IUNA 3IE0A 1J2TA 2D1TA 4QAJA 4TM7A 5K99A 1U0EA 3L8ZA 2P2CA 3H17A 2X19A 3DTVA 4EJ0A 5JNVA 3H1BA 3L04A 4W1SA 5AI4A 4TLBA 2X9VA 1D5WA 1JZQA 3H2SA 3SX2A 5DU2A 4IVQA 1V9LA 1YQDA 1UFKA 5DBHX 2RHCA 3UJBA 4MVJD 3FFWA 1TF2A 1P1FA 5ALFA 5K3CA 1X7WB 4DARA 4KLRA 3WQRA 2X1MA 2F9MA 4Y9UA 5I7FA 1KEWA 3BDAA 4I46A 4JZYA 3IMKA 1THMA 2B99A 3OPYI 4WNAA 2ZVQX 1F06A 3SDZA 1IMJA 3WR5A 4EVSA 2FX5A 1XRQA 1I1OA 4NZ9A 2H31A 5K0SA 3O9VA 3KJGA 4ER7A 3EGDB 4G9BA 4L28A 4PZEA 2A1TR 1KE2A 1GNTA 4DLPA 3G9TA 3OTHA 2R8OA 1VIMA 3EFOA 2XCSB 4R69A 1SUBA 2VJMB 2FZKA 1S3GA 4WK0B 5EOVA 4OI2A 5B3JA 5BO5A 4I08A 3RFCA 3LK7A 3VTFA 3HCOA 2DPXA 4Q24A 3QV2A 1MG5A 4M9XA 4XLTA 3W8EA 4FDLA 2PZFA 3ACCA 1NONA 4JVLA 5E38A 1XFAA 3GB9A 2O1SA 4B4UA 4U1RA 1VKRA 2EOAA 1SXHA 2ODEA 3DE4X 2O2JA 4MUMA 2BF4A 1QFYA 3QE4A 4Y2VA 4ZEOA 4Q9JA 1Q57A 1SZDA 4V3CA 3QEMB 2Z6QA 5HDQA 3UFXB 1EP3B 5JWRA 1SIWA 1NI4B 4F3TA 4RWZA 2JJ8A 4EUHA 4KQWA 3DXXA 2BKLA 2ECPA 2IXDA 1F3LA 5JQWA 3T4PA 5AW2A 2RGEA 2OY0A 1C9KA 2WIDA 5A71A 3ADBA 1EK6A 2W6OA 4IRMA 2QQ0A 2EQ5A 4LTMA 3UYLA 3COJA 4PV7A 2H8KA 3IOYA 2I8CA 3KBBA 3F3KA 5T4BA 2QE6A 3AVXA 1YQUA 4AY5A 4IIJA 1T9ZA 1TU4A 3N8HA 2CNKA 4I3HA 3LC1O 4WXHA 4OG2A 1T26A 4RM3A 1I7LA 2FPUA 3C45A 3OY2A 1K4YA 1SHUX 4JLAA 3UJPA 4D2IA 5LBTA 4EVQA 4ZHSA 4HADA 5HQ3A 1KH2A 2BTOA 1XP8A 4LZOA 1PNOA 4PYNA 1SVWA 2IL1A 3WRXA 5LA6B 4GL2A 2B94A 2GNPA 3ABOB 1I2CA 2I6FA 4J0IA 3KHUA 1ZD4A 1GU0A 3D2CA 3PR1A 2ZVJA 3DW3X 2LVBA 2EP5A 3PUKA 4FFRA 1JKJB 1DAMA 2FAXA 1TYAE 1U3UA 1FMCA 3MCVA 3NCTA 4RKYA 4Z0PA 4LDPA 4JLUA 1NXTA 4TUYB 2QA5A 1ZVKA 3NDRA 3M4YA 4RIEA 4AMZA 3FCXA 2GSWA 3JQRA 1SKYE 4P5DA 5IZ4A 3Q3EA 5EKDA 2I3BA 1KYWA 3IRUA 3N28A 3ND9A 3IT1A 3IPAA 1L6RA 2PWBA 3B9RA 4KKVA 1X7HA 2G1UA 4ZP1A 2DH6A 5EJ5A 2IKSA 1WV0A 1BHO1 4XDZA 1N7IA 4FJ0A 4H16A 4H3SA 3VA7A 1WO8A 3ANLA 4DLUA 4ALNA 4RHXA 5F1KA 1Z6XA 1QF6A 3ETCA 4NCBA 1B73A 1E0SA 3LDHA 1W29A 2WT4A 3KIPA 1NBMD 1X19A 1XALA 3KKPA 4UXIA 3V80A 1R8YA 2QX6A 4LXUA 3UJ6A 4QUHA 4L9AA 1KTIA 1YJXA 2ZSFA 2ZJ4A 1TQ2A 2PL9A 2ZSUA 3PQ5A 2PRKA 3TECE 2P2LA 2Q1XA 4BRSA 2ZUWA 3IB6A 1X15A 4IUYA 3M5DA 1F7VA 3AUXA 1K7YA 1M2OB 3C16C 3FDXA 4A6EA 3L4BC 2O06A 3BMOA 2YIVX 1NVUQ 1CUUA 2X1HA 1CUBA 1FCJA 4L75A 2PLWA 4AWBA 4DIMA 3HJFA 4GUDA 1S8NA 2OAGA 1RRPA 1DAHA 5L95A 2F43B 2R6FA 3Q5DA 5BWCA 3K70B 2GERA 2J0UA 2QVZX 1TC1A 1XTBA 2QLJA 2ZWIA 1KP2A 4KR0A 3A1FA 1KJJA 3AU8A 4L0CA 3AQ4A 1AXGA 2HK6A 1PYDA 3G88A 4G24A 1L4HA 4NATA 1HT0A 3JQ8A 4RHCA 1A5BB 1DOAA 4LTNA 4OTZA 3TZQA 4ZOQI 5LYJF 4NU5A 3AF5A 5THQA 1TPYA 3QPDA 4TRJA 3P8ZA 3DBIA 3GAZA 1CUWA 4HCJA 4YJFB 2L2QA 3C7AA 3BT7A 3PP8A 1CF9A 4S1NA 3BAFA 4DPMA 2GM4A 2WNSA 3MRXA 1NQUA 4NEQA 2UAGA 2PHZA 2C7BA 3V00A 5KSYA 4JBHA 4BWGA 1SR8A 2GBGA 1DRVA 2Q4RA 3DFZA 3MHPA 1GGVA 1V41E 3A1UA 2JK0A 3PGKA 4A16A 2XRZA 5EIAA 4QRIA 2PWPA 4AMBA 3N2EA 2VRCD 4KAXA 5CLHA 2WDZA 2D54A 1SEPA 2HPHA 5CT4A 2QYSA 3WO0A 1M8FA 5LR6A 4MW2A 5T8KA 2NYRA 4Z2YA 4TKVA 1HURA 3MWDB 3DV9A 3NASA 5I8PA 5KVCA 1OV4A 3KFVA 4BCBA 2XGSA 3F0TA 2FZ4A 1ZUNB 2HTFA 5FOTA 3UB3A 4KVGA 3KTOA 2HADA 2R85A 3DAHA 2A92A 4ODIA 1FL9A 1CY1A 4AF7A 3IMCA 3CZMA 2CHGA 2QAJA 1PK9A 1JDVA 2MSDB 4A73A 4KXLA 4H7IA 3VYWA 4FDTA 4TQAA 1AKTA 4XSVA 5DDIP 3SZMA 1OAOC 4D9KA 4DUYB 5EE3A 1IATA 3KR9A 2FEMA 3MCTA 4BCCA 4J1NA 2IP2A 4QBIA 1KO7A 2CJFA 1QTQA 1Q84A 2GARA 3VNRA 2DRIA 4KAJA 4AN4A 4L3OA 4NJEB 4BKOA 4DQVA 3MWEA 5AHWA 5EYPB 1T9GS 5DTJA 2TYSB 3OM8A 4UVHA 5DBIA 5CDFE 3CW9A 1TT5A 5CJJA 3R7DA 3UAWA 5C7YA 2J87A 3EW9A 2B8JA 2D6FA 4BX0A 1RXIA 3GEMA 3QWAA 4OL0A 5DTMA 4EL0A 4XCXA 3B9QA 5K6AA 3EQ2A 4D4JA 4V1CI 4UVIA 3RFFA 4R2KA 3K2QA 4QPJC 3UV3A 4KWEA 4HS9A 4J03A 3V4LA 3Q1LA 1T3GA 4ZD6A 3PVCA 3GJYA 1IRXA 3R24A 2JJ1D 5HIIA 3FLMA 2GJKA 1K97A 1P2GA 2ZRCA 3FMOB 1IOZA 1EFHA 1E60A 1KRXA 3BA1A 3LT4A 4NMLA 5DM2A 2Z8ZA 2F8LA 2HKIA 5FPTA 4CL8A 4ITVA 4NAUA 1OUMA 3X2EA 3HXMA 3KJEA 4NU0A 3EGEA 4IILA 3VQTA 5EHQA 4CYMA 2OCBA 5LXTB 4NQZA 3QBTA 5T7BA 2IHKA 1FRVA 1N2HA 4D6XA 3LUJA 2VP5A 3E7WA 4LSGA 3ZDCA 3VOTA 2C2BA 4RVHA 3CF0A 1MXFA 1N3YA 4R1UA 5K3DA 1NDHA 3ZY5A 5JZOA 2VAWA 4O4HF 1V6SA 3FCEA 2XF2A 3R6LA 2HW8A 4XDHA 4DKXA 3T3EA 2ZUBA 2XE6A 2QMEA 4C4RA 5BSEA 3WAJA 2EBFX 1N34B 1ODCA 2EERA 3GUVA 3JQFC 4B4KA 1YE8A 1RC1A 4Z7OB 5K3FB 4Q4CA 3CT4A 3C4QA 3O1IC 2JIMA 3GGOA 1QGAA 4HQRA 3U1BA 3D9QX 1VM6A 3IOMA 1HWYA 5CA0A 2WJ3A 1X1RA 4JYZA 1ZWKA 2AOTA 3URKA 3BIFA 3U9LA 3VJMA 2BZ1A 2YVKA 2BJHA 5DHSA 2EKQA 2J3HA 2GBIA 2W9XA 3MWKA 1ZMRA 1NW4A 1B3RA 4XCQA 1CF4A 1Q50A 4ZI3A 1AT1A 2GJ8A 1ODLA 5FBKA 1D6JA 3M49A 3PWSA 2DR2A 5LQRA 4UEQA 5DOZA 4B31A 1RRMA 4OGGA 5D01A 4IOLA 1BMFD 1C80A 1SAYA 3JRXA 3WLPA 4EBFA 2VG8A 2ORIA 1JSCA 2R8BA 3BH7A 4JV5B 1IBLB 4B80A 1Z4LA 1SB9A 2K7FA 2G9QA 4MQBA 2WZQA 2EWMA 1NDQA 4E09A 3Q7EA 1PGQA 4YROA 2O2CA 2X41A 4LXQA 2R6CA 4W1PA 1KDZA 2JJMA 4LJ9A 1NYQA 3U4QA 3LUDA 1H22A 4EPTA 1R9NA 5JTUA 3BWXA 3KWLA 1IZYA 3AY0A 3BHMA 1UJCA 4ND6A 3HP4A 4BJ5A 1ZM3A 3PUWA 5EJIA 5LNK1 1CUJA 3KSRA 3P9CA 4ZCIA 1JHQA 1T1SA 5FB3A 2RARA 3DG9A 1QUFA 1GTJ1 1E0DA 3ROEA 3EPHA 1U9JA 2G0TA 1U2DA 2AI2A 5ALQA 4TKUA 3R0IA 4NHOA 3FLAA 4U6SA 1U0SY 2PK3A 1JA9A 1QONA 3PB3A 5K4AA 3V4OA 3K5WA 3AEKA 4EDHA 5DBFA 1GGKA 4J1QA 3AFIA 1EXWA 3ZYZA 3A70A 3B36A 2AK2A 1XTIA 1U11A 1FFCA 2XCQA 3KQTA 2P9CA 3ZXIA 4D1YA 1JGTA 4RTSA 4NKRA 2HWKA 3ZGYA 4BASA 5IVPA 1V4VA 2AMVA 3CO0S 1ZEJA 4BLOA 4UPEA 4JI7B 3E8XA 2FZCA 4JEIA 2CT8A 1A1SA 5E8JA 2X8BA 4PE5B 5I48A 4QXAA 3V1YA 1UXKA 3GGDA 1DBQA 1G21E 4F2PA 4N47A 3IA2A 4BJ6A 5D87A 4RKFA 3IT2A 2HB6A 3I9NA 3D4IA 2D8MA 1FZTA 2JKVA 3MGAA 3PE6A 1HE3A 3DNFA 1C3OB 2Q07A 1H2YA 2CMHA 4CF4A 5B7PA 2C54A 4OQ4A 2C92A 2H1FA 3KJXA 3IDAA 3RUIA 2HDHA 1EM6A 4BVFA 2OKCA 4Y2XA 3ZLVA 3V9PA 1AK1A 3L4SO 3I23A 1MJGM 4GX1A 1XMOB 1RZRD 2DX7A 3Q3VA 1XBTA 1WMBA 1L5YA 1YB1A 5KTNA 1YBAA 2DBZA 5FI1B 3W06A 3OZCA 5JUWA 3HNRA 3LLUA 1W94A 2FPIB 3VH4A 4C29A 4DDHA 4QYIA 3MHTA 1Y37A 3I04M 5C4IA 1D1TA 2QN1A 2XSZA 1CNFA 1LPAB 3C6XA 3R23A 3VPAA 1SOUA 4GXNA 1SBNE 4Q05A 1IAQA 1F2TB 2H4WA 4LK2A 4YDSA 4URFA 2WWYA 4V0RA 1RAFA 1VP3A 4H35A 1UJBA 4CM1A 1Y6GA 4NBKA 3RWMB 1CQIA 1JT2A 1T4MA 1XQXA 2MINB 3IESA 1CUYA 4NU8X 5AUQA 3RJZA 3WYDA 3K8ZA 4EI7A 4AJJA 2IBSA 1VHDA 3EZ7A 2WLSA 3P0JA 5JDIC