3NIWA

Crystal structure of a haloacid dehalogenase-like hydrolase from bacteroides thetaiotaomicron
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
266
structure length
266
Chain Sequence
KYKLIVLDLDGTLTNSKKEISSRNRETLIRIQEQGIRLVLASGRPTYGIVPLANELRMNEFGGFILSYNGGEIINWESKEMMYENVLPNEVVPVLYECARTNHLSILTYDGAEIVTENSLDPYVQKEAFLNKMAIRETNDFLTDITLPVAKCLIVGDAGKLIPVESELCIRLQGKINVFRSEPYFLELVPQGIDKALSLSVLLENIGMTREEVIAIGDGYNDLSMIKFAGMGVAMGNAQEPVKKAADYITLTNDEDGVAEAIERIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a haloacid dehalogenase-like hydrolase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
molecule keywords Haloacid dehalogenase-like hydrolase
total genus 90
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2010-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 3niwA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3niwA01
3J7TA 3EF1A 3FPBA 2G0AA 4CF3A 2CFRA 4Y3UA 3MN1A 5ALSA 1QH9A 1J97A 2P69A 3QGMA 5AM1A 2Q4RA 2WF6A 1LVHA 3OTQA 1N8NA 2I55A 3QU9A 5AW2A 3CZ4A 3AR4A 2FPWA 4UAUA 4I9FA 1Z4LA 2RBKA 1U2TA 2IYEA 3ZX5A 5AW6A 1YV9A 3U7EB 5T41A 4UMDA 3WKEA 4XPZA 3ZTWA 5ALZA 5ALDA 5AI5A 3BWVA 3WKDA 5AW8A 2I34A 2MSNA 5AVRA 1L8LA 3ESQA 3NANA 3AR3A 2YFYA 2BDEA 3R9KA 4YCMA 4UAVA 3E81A 4G9BA 3E8MA 4YCNA 1RKQA 5ALFA 1T9ZA 1L6RA 3L8GA 1TE2A 2I6XA 1WPGA 3FM9A 4DW8A 4AS3A 1VJ5A 2YJ3A 2O9JA 4AS2A 5AW1A 1Y8AA 3L1UA 3DAOA 3N5KA 3AR8A 3AR5A 3ZX4A 1RLTA 1U02A 2HHLA 4BX3A 5FP0A 3ZVMA 3EPRA 4PNHA 3SKXA 3WGUA 2PKEA 3QUCA 1S8OA 3FVVA 3AR6A 3U7FB 1RQNA 5ALJA 2YY6A 2JAWA 2Q5EA 3L8HA 3ZTYA 3GYGA 1ZS9A 1VFPA 5ALIA 3M9LA 1IWOA 3FPSA 2AUTA 3KDPA 2P27A 3N8GA 3BA6A 3QU7A 3B9BA 4KX5A 3ET5A 2IOHA 3SF0A 4YIHA 2EARA 2HSZA 5AM4A 4BNDA 5ALUA 4BYGA 3FZQA 3I1YA 4Y2YA 4UATA 5ALKA 3IJ5A 5E0OA 2B0CA 3KBBA 2GFHA 4UARA 1RMQA 3AR2A 2WF7A 2HF7A 2IOFA 2R8EA 4OD0A 1Q92A 5ALHA 4NFLA 5ALQA 1Z4IA 2GHQA 4KNVA 2HOQA 3MC1A 1RC8A 5AIAA 3QU5A 5AKHA 2R8XA 3WK7A 4Y2VA 3L7YA 3NRJA 3L0CA 2JARA 3RF6A 1SWWA 5AM0A 4IG4A 1YS9A 4UMFA 2AMYA 2W11A 1T5TA 2YJ6A 4MUMA 3KZXA 3WKAA 4Y2SA 3L0BA 4HAIA 5AVYA 2ZG6A 1Z4NA 2OBBA 2FI1A 1AQ6A 4BNDB 4MWOA 5ALWA 4F72A 3OCYA 3OPXA 3MPOA 4YH1A 4Y2PA 1YJ5A 2HDOA 4C4SA 1RLOA 2CFSA 1S2OA 3QXGA 2GMWA 4HGRA 5AK6A 1WR8A 5AVUA 3D6JA 4UMEA 1QYIA 4H1WA 2HX1A 2FDRA 4RETA 3ZU6A 1JUDA 4GIBA 5AKZA 5ALMA 4J03A 1MH9A 2FPRA 3I76A 2RB5A 3I28A 1ZRMA 5ALTA 4HGPA 3AR7A 2CFTA 2G08A 2WF9A 5AK4A 2FPXA 5AESA 2ODAA 4BX0A 1QQ6A 4CNQA 4E88A 4NABA 3ZUPA 5ALOA 1RKUA 5AVVA 1QQ7A 1Z5UA 3QU4A 4GXTA 4UU0A 4EEKA 1Q91A 3HYCA 5AKGA 1Z4JA 2EAUA 4Y2UA 1TA0A 3A1DA 4KYTA 4KX3A 2FPSA 2C8LA 3DDHA 2YMMA 5AW3A 1RLMA 1RRCA 3QU2A 2FEAA 3PGLA 3QUQA 2PQ0A 2W4MA 4UM7A 4DCCA 1RPZA 1KYTA 4OHFA 5AKIA 1FEZA 4CF5A 3E58A 5AW9A 2NYVA 2YN4A 2JGAA 4DFDA 4Y2JA 4YCLA 3ZWKA 2ZBDA 5ALLA 3R09A 3ZI4A 3L8EA 1RMYA 3L5KA 1ZD2P 4RESA 5A3SA 1CQZA 4CF4A 3RFUA 3N28A 2AH5A 2YJ5A 2R8YA 3U7HB 5ALRA 1ZD3A 3QYPA 2D2VA 3PDWA 3W5AA 3R4CA 4OCZA 2YMLA 5IS2A 3M1YA 2WF8A 3ET4A 2QYHA 4Y2TA 2B82A 4HYTA 1SU4A 3NALA 2C4NA 1Z4MA 1YNSA 3ZVLA 4NAVA 4UM5A 4BX2A 3L8FA 5AI0A 2WFAA 2C8KA 2PR7A 4F71A 2RAVA 1VJRA 5AVTA 1YMQA 4HGOA 4Y2QA 4UW9A 1Z4OA 1PW5A 1F5SA 5AICA 5AVWA 2BY4A 1XP5A 3UMGA 4XOUA 2ZBFA 4EELA 4ZEVA 1XPJA 1NRWA 1XVIA 1L7MA 3WK6A 4I9GA 5AVQA 2OYCA 4CE6A 5ALNA 1L7OA 1SWVA 2P9JA 1RDFA 5AW4A 5AW0A 1ZJJA 2BDUA 1Z4PX 5ALEA 5IT0A 3UM9A 5AI4A 3NIWA 4L6AA 1RKVA 3N1UA 2NO5A 2P11A 3NAMA 3W5CA 4FYPA 3HLTA 1ZOLA 5AI6A 3OCXA 1U7OA 3WGVA 2C9MA 4QQFA 1TJ5A 4HGQA 4UMVA 5AM3A 2C88A 3OCWA 2IOFK 4L57A 4HGNA 4XQ0A 2G80A 2MU1A 2B8EA 2DQSA 3VAYA 3OCVA 3L0YA 5AIBA 4J2TA 2RARA 3SKYA 3S6JA 3PGVA 5IT4A 4ZEXA 1NF2A 4L6CA 3SMVA 2O2XA 2IA5A 2GHTA 3A1CA 2ZBEA 1WZCA 1K1EA 1L7PA 1N9KA 3P96A 1WVIA 2I33A 4XE5A 1O03A 3E84A 5ALPA 3UMCA 5ALGA 3ESRA 3OCZA 5ALVA 1T5SA 2FUEA 2B1RA 2G09A 2B1QA 4EZEA 3QLEA 2HO4A 2YMPA 1RMTA 1J8DA 1QQ5A 2AGVA 5JJBA 4BBJA 2ZXEA 3B8EA 3ZW7A 3KC2A 1Z5GA 5A3QA 2B8JA 1U2SA 2G07A 2Q4TA 4JB3A 4BEWA 4Y2XA 3U19A 4UU1A 2HCFA 4DWOA 2X4DA 3TLMA 1CR6A 2VKQA 3U26A 3NASA 2FPUA 4C4TA 1YDFA 3CNHA 2YBDA 3K1ZA 2W43A 3WK9A 2OA0A 3WK8A 3ONNA 5AW5A 1EK1A 4EX7A 3QNMA 2WF5A 3WKBA 4IFTA 4ZEWA 4FE3A 5AKEA 5AKYA 1X42A 3WK4A 3L1VA 2WM8A 5AM2A 2GO7A 3AR9A 4QJBA 3OCUA 2HI0A 3SHQA 4O8CA 3SD7A 3ED5A 4OFZA 1ZD5A 5AK3A 5AVZA 5A3RA 3KD3A 3QX7A 3N07A 5AHXA 3EF0A 5AI9A 1L8OA 1Z88A 3DNPA 4YGYA 4B6JA 3WKCA 4YIKA 3U7GA 1Z4QA 2R8ZA 3FGOA 2OM6A 5ALYA 2CN1A 5AKKA 2HF2A 1EK2A 2YMQA 2WHEA 3MMZA 4NV0A 5AVSA 2YJ4A 5AKXA 3ZWDA 2HEGA 3U13A 3B9RA 1ZRNA 2JAUA 3I6BA 3KOOA 5AK5A 2G1AA 3W5BA 3WK5A 2NO4A 5AI8A 4EENA 1TJ4A 1ZD4A 4BKMA 3DV9A 5AW7A 3W5DA 1TJ3A 3EWIA 1O08A 2B30A 3F9RA 1Z4KA 1LTQA 3SLRA 1U7PA 4AP9A 2EATA 4NWIA 5AKLA 3QUBA 4Y2RA 1RQLA 4JDPA 5AM5A 5AVXA 4C4RA 2G06A 2QLTA 2I54A 2I7DA 2FUCA 4G63A 4KNWA 3IRUA 3A3YA 2ZOSA 5ALXA 1NNLA 3UMBA 2JAOA 1L7NA 3QUTA 4FFDA 3IB6A 5AKJA 3PCTA 2ZBGA 4KN8A 4EX6A 3A1EA 3NUQA 4UASA 3ZVNA 4BEVA
chains in the Genus database with same CATH superfamily
4MMXB 4XR9A 5C0OE 3ESYA 1L7VC 4I0WB 3SX4A 2HJGA 4DLUA 4I6GA 4NEQA 4TLEA 1G41A 2M1XA 4LDQA 1DB3A 4CF3A 5GAJA 5KNCD 4TKVA 1DCTA 5H81A 2ZI9A 1U31A 3I8XA 2PWPA 5D7NA 1E1NA 2QIOA 3SMQA 3FI9A 1TADA 5CB8A 1VG0B 4WK6A 1I10A 1NWCA 1MG0A 3DGEC 4IVPA 5K3FB 1N8NA 1T6YA 5K8TA 2QJTA 1IIRA 2HXGA 4O8ZA 2WW8A 4PAMA 4RTQA 4GDFA 1NTRA 4CIXA 1F0KA 1W5TA 1M72A 3WA7A 1XA0A 1E3JA 2CNKA 2RC6A 1SOWA 4IKOA 4MWTA 4RHYA 4BEJA 2A86A 4X7MA 1IY1A 1IMOA 4DSUA 3LOQA 4QPDA 5JVDB 1JWBB 2R7MA 1IIBA 1S02A 3QI2A 1HZJA 2AX3A 5ALZA 4EP1A 1PZNA 3E7PA 4QGGA 2OO5C 4G24A 4PXAA 5AW8A 3EXIB 3QEBZ 2G8LA 2Y0BA 3GJ6A 5CD1A 3WQBA 3ZHTA 1UJ6A 1EG2A 2JIPA 4KN5A 2Z4SA 1Y3HA 1JXAA 4B33A 1SBIA 1NQAO 1Y9EA 3EVTA 7ABPA 1PJ4A 4GOND 5LQUA 1R6XA 5JBQA 5ALFA 1DIOB 2H54A 3WYCA 3VPAA 4JC8A 3HVUA 1A7UA 5D51S 2BHTA 1YR6A 4R3UC 4JXKA 2A8YA 4QHYA 3CR8A 4CW7A 2W2LA 2WWXA 1EXNA 3NHFA 1UEXC 1KJ9A 1BWRA 3ZDRA 1B26A 3DGFC 4Q4AB 4N0EA 4BN0A 4HK4A 2Q1UA 4DJJA 2QX4A 3OLXA 1Y8AA 4D98A 2NYAA 4P38A 5BRAA 4P1ZA 3E5NA 2R86A 5CIYA 1CUGA 4CFSA 4KTTE 1OBOA 3S55A 4ENPA 2RKBA 3ROQA 1S4MA 4F3NA 1JHPA 1XUOA 2V5VA 1ZJ4A 3MS4A 4OA5A 4DB4A 1S8OA 3FVVA 2G9NA 2QE6A 1T26A 4MVJE 5B2ZA 5L53A 1M1NB 5A9SB 1N6KA 1X7ZB 2FG6C 4EGQA 2WABA 4ANFA 5CLFA 4NPAA 1K9SA 1TZMA 2QLJA 1XROA 2C7OA 4KPUA 1AK9A 4TL9A 4BU1A 3RVSA 1D3AA 4RLHA 3PRHA 3MIZA 1PJQA 2WAYA 1FUIA 2INGX 1GL6A 4CTOA 3LDUA 2DE0X 1L8XA 2QP9X 2VJQA 3AERB 1HXHA 4HD8A 1NC1A 1XL0A 4YI3A 1WNFA 1YI1A 4YIHA 3DBRB 5GONF 4QTXA 1W0KA 3VTZA 1Q1AA 1GQQA 4U1RA 4XD7A 2Q2WA 5TMBA 3LDHA 1O58A 1IATA 2D5AA 2NO1A 1XB2A 2HK6A 4XWGA 2OOKA 4PQYA 1E2NA 1L3CA 1F6DA 1VTKA 4NZMA 5GVRA 3ZY5A 2WSLA 3LW8A 3M5WA 1BWPA 3LP6A 3ILYA 3TINA 4UARA 5IX8A 3LZ6A 3KUUA 3SC3A 5EKSA 5KNCA 1TQ4A 3EMBA 4RANA 3DB2A 1P4HA 1WJGA 2R97A 3S5JA 3J81k 5KTMA 1W4ZA 2OLJA 4U00A 1K8QA 3U37A 3MA0A 4NFLA 5ALQA 1J9ZA 4RF4A 4UHDA 1Q84A 4OI1A 5F9HA 4U7DA 1JFTA 4D81A 5BN1A 2ORWA 5AIAA 1YJAA 2XXJA 1M10A 2AHRA 3QMPA 3IAUA 3Q9SA 2WWGA 1KQ3A 1P0CA 2JARA 3BFJA 4PLHA 2DWUA 1U65A 4IG4A 2GH1A 1C4WA 4UMFA 2IP1A 1HNNA 5FRDA 3B51X 3RDPA 1E99A 2Q1YA 4JSRA 1U99A 3KZXA 4QFMA 4DMKA 1MU0A 1QAQA 2VHCA 3BDVA 3RS9A 1YS4A 3PRYA 4ZDJA 3B3FA 3B53X 5LP6F 1XWFA 1AQ6A 3DBRA 3HCNA 4ITUA 1BEZA 3AW9A 3BFKA 3W04A 4YH1A 3O1LA 3JAKA 2IZ7A 3R9WA 1V5WA 2FW1A 2B2XA 3KYDA 2CFSA 2A35A 4DA4A 5EXXA 1J70A 2HD4A 2ZRCA 1MRNA 1TD9A 5IZCA 2PGXA 1EDDA 4DEVA 4X8HA 5HQ3A 4MGEA 4PPQA 1N6OA 2X4IA 1MCZA 1S3GA 3G02A 1K0UA 5FPPA 4BNZA 4COOA 2QIPA 3BB3A 1BWSA 4UNQA 4XD7D 5CNIA 3UAGA 2F3RA 3ENZA 3DHYA 3LIPA 1JYFA 3AB8A 4IDBA 1BXRA 1GNSA 5FH9A 1UINA 2NWQA 1DJOA 4M1EA 4NSNA 3QVSA 3L4EA 1RYZA 1C3XA 1Z7YA 1JBEA 2I78A 3OHMA 1O3YA 3T9CA 3BG5A 1Y3CE 1UBSB 2B9VA 4B40A 1PEDA 2XVMA 3DR3A 2OSVA 1TYAE 4ZU3A 4HFRA 4V1CB 4XSHA 2VNJA 2C9DA 3GRCA 4KSYA 2GN4A 3N2NA 2ORED 3QVOA 4ZYYA 4AD8A 4BKPA 3PPYA 4J1NA 4QOEA 1HSZA 3VHXA 2Q5QA 3WIOA 5CFNA 4C01A 4A3SA 3RIEA 3ORSA 5ECGC 3ZE8A 1ZXXA 5AESA 3EC2A 4UBNA 2NZYA 4O2AF 5BMVF 4OBXA 4AJ4A 4UREA 3MQ2A 2ZVDA 4EA8A 1JVNA 1YASA 1I7SB 5L3SB 4BL5A 4RW0A 2R47A 2AMLA 2NXJA 4LF8B 5TJHA 3OLCX 3OSUA 1GT6A 4HH0A 2D1QA 1D2MA 4EKEA 3ESDA 4RD6A 4NC9A 1CVIA 821PA 3S3TA 2A0FA 2EL9A 2YWBA 5BV7A 3KWLA 2V97A 4Y2UA 1VP3A 1N0HA 1X19A 1ZM9A 4BMNA 1OB5A 2FPSA 1QRRA 1W36C 4YJ2A 3UJ6A 4ETIA 3IAS6 1NJ1A 1NKVA 4Q7MB 3QUQA 2VJDA 4IDFA 1E2DA 2H1OA 2G6TA 5P21A 2RGCA 3A4YA 2PXAA 5KQPA 5DP2A 5AKIA 3UBTA 3PEYA 1JIQA 1UT5A 2LCIA 2POCA 3QZUA 1R1DA 3BMCB 3VZQA 4W5JA 3ETGA 1DC6A 1BE8A 5HF6A 2GZ3A 5E6SB 5FUMA 2NP6A 2AIRA 2JGKA 3X1YA 5LQDA 4H18A 1A2OA 4UEKA 1OVGA 1TK9A 1NUQA 2C31A 5MFPA 3IPRA 5CA0B 1IPFA 1XJQA 1Y5MA 3FHJA 3HRIA 5ER6A 4WKPA 4AJHA 3ZGXA 2WP0A 4FDLA 1GPKA 4UDNA 2GFQA 3MYYA 5BXYA 3V4OA 1QOPB 1ILEA 4JUIA 2LDXA 4FSXA 1HE4A 2F3SA 4I1IA 4MSUA 3RFUA 4ZVQA 1XNQB 4ZJPA 1IB6A 4DCSA 2GZ2A 2AXQA 3CLTD 2IXTA 1TL7C 3MLEA 3I9NA 4EUNA 3Q10A 1T2DA 1FRVA 4WMLA 4RJ2A 4URHA 4DIOA 2QBYA 4UM9D 2G28A 1LV7A 4RMNA 1GGKA 3DAFA 3VPDA 1ULBA 2GCOA 5CM9C 3AEQB 1YU6A 3U48A 2Q6TA 2ZT8A 3RTBA 3L04A 3UAWA 5HM8A 5IHXA 4HX5A 1J8MF 4E7OA 1BRMA 2JCSA 3LDAA 3RU2A 4EHFA 2ZCJA 1JJFA 4FKBA 2FR8C 2P2SA 3L8FA 4Z9BA 4D1YA 1IUOA 4PYNA 3F98A 4E94A 3K31A 2DC1A 2IYSA 3DM9B 4C88A 1VL1A 3GCDA 3KOZA 1VE6A 1AN9A 4PN3A 1U3DA 4ARZA 1XXHB 3BIFA 3PI7A 3BWCA 3V97A 2LE0A 3C15C 3DO8A 3VHRA 3BGOS 3IUEA 3GZJA 3WS7A 4UHKA 3MEQA 4UTZA 2W8BA 1AUXA 1J2YA 1RLIA 4KBYA 5G02A 4Q7EA 4GRDA 5G0UA 1AGYA 1L7MA 1XEWY 4XQGA 5GWXA 2H85A 3DBVO 1KDZA 3WK6A 4AMYA 4DLTA 1TUBA 3DXXA 2DFVA 3I0ZA 4F06A 1JVSA 2PSDA 1GZ3A 3PPXA 5EXDA 2I7TA 1RDFA 2R96A 1Z4PX 3KJHA 3K0AA 3UM9A 4OOEA 2Z08A 2Z98A 5H7XA 3KQOA 2EJBA 1AKMA 4YRTA 4F3YA 5LDDC 3KJXA 3FAZA 4NI5A 3ZOKA 4KFTA 1ISPA 4URZR 2P3QA 1KMCA 1UZMA 5B2EA 5C37A 3Q8MA 2P6NA 1VCHA 2E89A 3ZHCA 1QWOA 1AO0A 1ZOLA 3N2KB 1U7OA 3CX3A 3OCXA 2C8VA 4R6WA 1HM5A 4K26A 1C50A 4NCXA 4YRRA 1PCXA 2ZPTX 3OQVA 3BIJA 1UBNA 3U44A 3BFPA 4DQXA 4KQ6A 1AB5A 1E1YA 1ZXBA 4MCAA 2G4CA 4TWJA 1QP8A 1XPOA 1V4VA 3AIIA 2MU1A 4RM2A 4QTYA 1IN4A 4BLOA 4J29A 3HB7A 3OCVA 3MS2A 4ZPJA 4TN1A 1US8B 4MWCA 2BZGA 4XIJA 3OJFA 4JS0A 4PWZA 5ED0A 1ATIA 2AOTA 5TQJA 4DJAA 4W9RA 4EI2A 4RULA 4RJTA 3TLYA 3O8QA 3Q9NA 4RAOA 5B4TA 1RJGA 1ZC4A 1ZGBA 1KEUA 5F64A 4JJ4A 3LTNC 1CZNA 1WZCA 4TTVA 4DDMA 2FMFA 4B75A 1LV8A 4D92A 1OXBB 3IDOA 3D4NA 1MVLA 3NATA 2I1QA 1DDIA 2VPPA 3KEGA 2HU2A 3U40A 1OZGA 2VXCA 2ZIVB 3KDAA 3EK2A 5ALGA 3L0PA 3UT5B 4IHQA 1ZH4A 5EQDA 5EIEA 1IZ8A 3CLUC 3GDGA 1BDHA 3PQEA 5B58T 4BN4A 4D9HA 3GEDA 5BR7A 5I4KA 1Z7EA 4JVLA 4LHYA 4IUBS 1Q14A 4I8IA 3V7UA 1Y80A 2YWXA 2E2WA 1Y5IA 3CWCA 1QQ5A 2RCYA 3HABA 3AF2A 3OX2A 1XU9A 1PLKA 2ZBVA 5T4BA 3JSAA 3MWLA 1MXHA 4BGUA 3VH2A 4AKEA 2W8BB 3KSMA 3C7DB 1EM6A 1OHHD 2GCGA 2PX0A 4I4TF 4B2PA 3H83A 2CMFA 4PLCA 4BUCA 1NW7A 1WSAA 2KS6A 2QU8A 1Q7RA 1FSGA 1TUBB 3FVQA 4IDPA 4PO3X 4XW2A 3MGAA 4QXPA 3TSOA 4DWOA 2XYVA 1OTYA 3JQEA 4FEGA 3R3YA 4LXHA 1ORRA 4WINA 1JEDA 5FTKA 4ZC8A 1F8GA 1ZIDA 1P39A 3BCHA 3NHJA 1IQPA 5IU6A 3BUSA 2CFIA 1DBPA 2M6RA 3COWA 2AB0A 3JASA 4TV9A 2FN4A 1N1EA 2HA2A 3O4GA 1KK0A 4P4TA 3P9XA 1WUYA 2ACWA 3IODA 3QENA 3QKRA 3N2KA 2FFRA 4FFSA 5E1DA 3UKDA 3AT1A 2Y71A 2EC5A 3PENA 3TSWA 5KSYA 3ER9A 5HYVA 5K0FA 1UXKA 1N2GA 3E9ZA 3MWJA 2HT1A 1KF0A 2PRZA 2Q0HA 5AKYA 3EVEA 3TIGA 1O5IA 3VO8A 1RBMA 1X86B 3L1VA 1Q0RA 4DNQA 3PNQA 6LDHA 1E1KA 3V1TC 1Y1RA 2CL7X 3VZSA 3LPMA 3PHGA 1VJ0A 4O2BB 2HLPA 2NGRA 3SDSA 3NYWA 4WKOA 3K8QA 1BCRA 3CNNA 5LJLA 4L5JA 4TS1A 5A3RA 3WBFA 2WU0A 4HNHA 2E0IA 4DSAA 4DKJA 3VH4A 4XZ3A 1YB1A 2K5UA 2RHCA 1UANA 3ZZNA 1PGQA 4RLFA 4CLHA 5AUQA 1ACLA 1PR2A 4HQFA 4D3DA 1OB2A 1JKFA 4QUDA 2BCJQ 1QUFA 4DV0B 3HSSA 3PPVA 3BE5A 3WKCA 2VP9A 3R7WA 2W6MA 2O7RA 2CHQA 3KNZA 5JOQA 4HG2A 2O5EA 1I6KA 1QG6A 3KUDA 2QHXA 2QVYX 3O4JA 4P58A 1UM9A 3LGAA 4Q7KA 3W6PA 4GQBA 5ADWA 2FPGB 3D43A 2KW5A 3EEYA 4GKAA 3E5MA 3UT6A 4DLRA 2DFNA 2QD3A 2ISCA 2RGEA 2HW8A 4DLAA 2V3CC 3KQLA 3D8UA 5AVSA 5IXYA 3C7TA 2MINB 1GLNA 1QVAA 2X8JB 4DLLA 4EO4A 1TVEA 3CNQS 4MWZA 4N01A 4PR3A 1Z15A 5K3AA 1T1SA 2JH9A 1LRLA 3BWXA 1G6KA 5I3CA 4M8SA 3L77A 1ZBQA 3WLNA 3T7AA 3INTA 4EENA 5IJ0A 1P0QA 3TN7A 2E4AA 2TRSB 1JB9A 3KOMA 1LLCA 4QM7A 1LNSA 2PH7A 1Q7CA 1CJBA 3EGDA 3RABA 1D2HA 2BZSA 3MF4A 1GFWA 1CTQA 3BL5A 3BWDD 1MXFA 4BRZA 3ZJVA 1XEXA 1V35A 1C4OA 4D46A 1YB7A 2XUHA 2Q6VA 3ABOB 3TQTA 5JAHA 1UPXA 1NJGA 4CL8A 3GOQA 1QNLA 4JAVC 3V32A 1NQOA 3PEEA 4XX0A 5KS2A 3MRTA 4NBUA 2ZOSA 5CVTA 3EG9B 4KWTA 1RC1A 2J7PD 3BD6A 2IYRA 4UBLA 4BKRA 1EX1A 2NUAA 2B78A 1YC2A 2P78A 1W2WB 3V8VA 1K7FB 1IBCA 3RGWS 1Y3FE 2QRPA 1YS2X 1SB9A 2WSMA 3FLEA 1YIDA 1JI0A 3B82A 2F7SA 1Z08A 4ASUD 1T0IA 2GASA 1MVOA 3U60B 1QPZA 2RSLA 1DKRA 1SJ9A 2N3ZA 1SUSA 1NVBA 3BE8A 3OFJA 3OCCA 1GQ2A 2JLCA 1M2VA 1U2RA 3BYZA 4N3GA 4O5OA 1JG2A 1P5RA 1ZH6A 2G0AA 1TCCA 3UK6A 4F4HA 1YI8A 2GPBA 1NP3A 1U8TA 1CHNA 4UTRA 3HH8A 4RVDA 1U8XX 1VRVA 1VE9A 2V7PA 5M29A 1EA7A 3LJKA 3GA5A 1YKSA 4H4CA 3ITEA 4RXMA 3GIWA 1LF0A 4DIFA 3H3FA 4B2LA 1DWOA 4C3UA 1C3VA 2JI9A 2UZ1A 2P2YA 3PHIA 3CZ4A 4Q4JA 1KERA 4NVRA 2L18A 1XEXB 4O5AA 3A2MA 1WXWA 1ESDA 4IOMA 4MITA 2GN2A 4QYTA 1JJAA 4D97A 2GFIA 2HQ1A 3JPWA 3IP9A 2OZLB 3B20A 4XYGA 2QRKA 4LTNA 3W7VA 3OZBA 4CDMA 3H65A 4KXNA 1XTQA 4IIUA 5AVKA 1LBTA 3EQ6A 4R7ZA 1E3EA 1S2DA 2PZEA 4HWPA 2E4WA 1TM4E 4GT1A 2RDMA 1KP3A 2WE8A 3EN0A 2WZBA 3K4PA 4UHHA 3W4KA 4A7PA 3O2SB 4PLYA 4S35A 2H5EA 2JK1A 2JZCA 4W1PA 1DO2A 4M53A 5L3VA 3H19A 5T5QA 4B3SB 4OL0A 3V8RA 2ZTSA 1QO0A 4FZJA 1L6RA 3FNEA 1VHTA 1FXWA 3W78A 1X1AA 2TECE 3OLZA 1INLA 2C9ZA 3PGKA 4IKEA 4LZJA 3T0GA 1VJ5A 3N2ZB 1A4UA 4EJSA 4F38A 4JVNA 5EYPA 2JJ8A 4BZWA 1AD2A 5DX1A 2AZTA 5A2QA 4BTEA 2JEOA 2ZUUA 4IDCA 3LVQE 3N5KA 3NJ8A 1U02A 5DLDA 1KFJB 4XUDA 1Z7WA 4RPGA 1FJGB 3D64A 5FP0A 4BNMA 1XTJA 2DUJA 3R23A 1M6NA 1WXDA 2OFXA 1SZCA 2PPLA 3L6DA 3OZSA 5THQA 5FUYA 3TZBA 3WGUA 1ST2A 1JH8A 4RK7A 3F8TA 4MPRA 4ZCMA 5JAPA 3G3EA 5A3VA 3V4FA 5EUCA 4QTTB 2V6IA 3ZCPA 3H2SA 4XWWA 1QGAA 4GWLA 3DBIA 1FU8A 3CB2A 3KDPA 2OD2A 4WNAA 3WNZA 1T8RA 2ZSEA 1DWQA 3UCEA 1P2BA 4EMTA 1T43A 2ZIUB 1N7HA 2GWRA 4EHAA 2FMUA 1L4MA 3WIUA 2FUNB 1VYVA 1U4SA 1ZAKA 3MTJA 3SF0A 4CKWB 2QA5A 3FNGA 1K63A 2W6CX 2QTAA 3LT4A 5AM4A 3RRXA 3CCFA 4XQCA 2Q9AA 5EFOA 4CKYA 1ZKMA 1NU8A 2GN6A 1GG5A 3C6BA 4R0VA 4S12A 1U90A 2ZWIA 4FJ0A 4GZMA 4MKZA 5LDGA 3ENQA 3M0EA 1H9BA 1TLFA 4G5YA 2ARKA 3B9PA 5EINA 4MYDA 4YVFA 2PH3A 3CLKA 2FSGA 2FWIA 1OGYA 3MGKA 5FUBA 1H5QA 2YASA 4MV8A 1PYDA 1QCDA 1GUFA 1FTSA 2B0CA 4FCTA 1GNVA 3R7WB 2VWGA 1G4AE 1G3IA 2BP7A 4PHCA 4UOEA 3R0JA 2LKDA 1QCYA 5GZ6A 2H0QA 3BJRA 5E2IA 2FTKE 2IOFA 3B6JA 3HKEA 4R40A 4JDUA 3TL3A 5FPKA 3TOVA 4PTZA 3S2GA 1ZVJA 1GY8A 1SQ0A 4TS3A 5CNMA 1NQVA 1T91A 3F46A 2QW0X 1ZP6A 2R7KA 4BZQA 2XODA 2YW2A 4EKGA 2OUKA 3QU5A 1KO1A 2RHTA 1WKCA 4NBSA 5EP3A 4NZNA 1XRMA 2P8JA 3AUYA 3IA2A 1RPTA 1RE1A 4RPCA 1ZONA 2ZYDA 1LSOA 3EAQA 5ESRA 3GFGA 3KQNA 4U39A 1B8UA 1FTNA 1RHMA 1UZLA 3HRKA 1V6AA 4YQZA 3L0BA 1M1XB 2FSFA 1XTPA 3IXLA 5FORA 2QX6A 2WPNA 1DG3A 3CZCA 1E4VA 3QEKA 3EH2A 4G67A 1E0AA 3OPXA 5LCXA 1WWKA 5BV2P 3PNKA 4E5SA 2JCXA 2RE8A 2IZ0A 2QX7A 4EB3A 1DWUA 1S2OA 3FW1A 3MCZA 5JALA 1ZOOA 2E9SA 4GOXA 4LNUA 1HZZC 2IYFA 1U0HC 3DDUA 3USZA 2A7XA 4H15A 1DC7A 1WQ3A 1U1FA 4BP9A 3UIEA 1UJ2A 2GTHA 3S28A 5F7ZA 3W6OA 4FFWA 5EWMA 1A97A 4JOSA 4QHTA 4HAVA 2F00A 3TOCA 1GYPA 2GNAA 2BMJA 4AECA 1R4AA 4C6TB 2PGNA 1SG6A 2CEAA 3I53A 1EK0A 3LBNA 1PO7A 5NULA 4DZRA 1YJ8A 1EIWA 2Y6UA 3DFUA 4HGPA 2XDQB 2G9VA 3DZDA 5CG2A 2IYOA 3AMVA 1ADFA 2VP6A 1PQPA 1FRZA 1U7XA 2CC2A 1YTLA 2W6ID 4X6UA 4MUBA 1EI9A 1RC0A 2ZJ1A 3VNUA 1E7YA 1OWLA 3IEXA 3K09C 3KKNA 4K9KA 4MVJH 4B3DA 3CKMA 1ECFA 5B1DA 4CMIA 4DCUA 2WIJA 3HR7A 3VZDA 3W8FA 4GNKA 5G53C 5HX7A 3OA0A 2ASVA 1SAYA 2G9RA 2WJGA 2AF3C 3AEUA 3ICPA 3AVTA 5T3YA 3P32A 3PC3A 3ZC3A 1IVYA 4AWBA 3KQMA 1G20E 5FLYA 2GZDA 2P90A 3ASUA 3UO8B 2GKGA 4U8HA 3DP7A 3UK7A 3GJSA 1LQUA 1P6XA 3BDAA 3H3XA 3FOFC 2BR3A 3DHEA 4K7JA 1ECLA 1I3CA 1ML4A 4CV2A 1W7AA 4PPNA 4IGIA 4O4IB 1GL9B 2H65A 2VT6A 4HXFB 2ZXUA 3WL4A 1S2IA 4N1AA 1JWAB 1TA0A 1PJCA 5F1PA 3WL7A 1XALA 3OZ7A 4F4FA 1BMFD 4NBWA 2R1VB 2O2YA 4ZMRA 1Z38A 4MVJG 5AW3A 4CTJA 5TVGA 1RM5A 4R1QA 4TV8F 2BGWA 3UICA 3DOIA 3K53A 3KVYA 1DS6A 5FBHA 5FWAA 1GA1A 1ENOA 5H83A 5LZ5A 2EX4A 3I92A 1UBRS 3I5MA 3GUVA 4C4OA 1Q1ZA 1D2EA 3EDRA 5F9FA 3D4IA 4UJ5A 1NRIA 1LS1A 1YAHA 4Y6OA 1R0BA 3AKDA 4DLYA 3VU8A 3B70A 1PF7E 4H60A 3D7NA 4DCNA 3ZCXA 4JI2B 521PA 3W3AD 4QUBA 3AOGA 5DTIA 3R76A 1EZ4A 3TLBA 4OHWA 3V1LA 3V9AA 4BGEA 4X94A 2ZJYA 3BRSA 1FX1A 1CPYA 1TEVA 4HDKB 2XJ9A 5IDWA 3I0NA 3N28A 3L18A 5FBLB 1EWQA 4KQCA 4EY4A 3NO4A 4JK3A 1CBUA 1WZ2A 3B1JA 4LYDA 5IC4A 3DZHA 4JBXA 2R65A 1X1TA 2I2AA 2XKAA 2OGZA 2VEDA 2PT7A 4ZD6A 3D3EA 2H0AA 3NPAA 3RIHA 4O4IA 1NE2A 4A0HA 1AGNA 4YHBA 2XDQA 2JLRA 1FA9A 3EGXA 3O8CA 4OHPA 5LQMA 2HM7A 1UJBA 4HNSA 1UOOA 1USVA 5IDYA 1E66A 4PTLA 5IH3A 3ZVLA 2EZ4A 3MUEA 2LZ0A 1DMSA 1GGEA 1XZFA 3A4VA 1KDYA 1T0BA 3T3IA 1JU9A 2PZMA 4NJOA 4EG8A 1E2BA 2QVXX 5IKXA 1Z7BA 2WR8A 1TCVA 2AR9A 1GRRA 4CT5A 2R6R1 2WRZA 5J47A 4CNBA 3JQ9A 3Q1KA 1XQXA 4TWAA 2GNOA 3IP1A 2A9RA 3L7OA 4TPKA 4TV9F 4YLEA 4HEQA 4L28A 4DMCA 1PEKE 2V59A 1V7QA 1TIPA 1VLQA 3KJIA 3LUFA 4HAWA 2IDMA 1OILA 2J4DA 2IWHA 2V7QA 1GARA 1TW2A 2VH5R 4EKNB 9LDTA 4I9GA 3TRJA 1A9OA 1XQ9A 3PP8A 3QY0A 3OQIA 4N0MA 3RNOA 1NP6A 3HL0A 1ZJJA 4HL6A 3G17A 4RF2A 2WT9A 1CY2A 3E8SA 4BB0A 3PEUA 3VISA 4CUJA 1SA0A 3AW8A 4E30A 3BX1A 3M8KA 5CURA 1PK9A 4JYPA 3PVZA 1WUJS 3KZMA 2Z2YA 1XHEA 4FYPA 4G5HA 6YASA 4RE5A 4L4SA 2HJRA 3DS8A 4ZODA 3WLEA 1PZFA 5IRCD 1NJ6A 4F1JA 1MABA 1QDUA 5ESWA 4A6PA 5HRAA 3SQWA 4J9UE 1I4OA 3FRHA 3FUCA 3GD5A 4GECA 4TTPA 5FL7D 2GS9A 5LOVA 1SULA 4ZQHA 4XVUA 1YRQA 3N0WA 1CX9B 4KVAA 5K8JB 2BGIA 2DHCA 2VSQA 4WA8A 5KWJA 3S8EA 1W34A 4G4SP 4OIMA 2UYOA 1KY5A 1LRKA 1Y48E 2YJGA 4IRMA 1H1LB 1JYEA 4OVKA 1B15A 3EVGA 5DBFA 5FNVA 1YJQA 1KMHB 1AXGA 4B35A 4I8XA 4QXAA 1EGMB 3RAGA 3GFVA 3QTTA 4JLVA 4CTNA 3ZWBA 5JH7F 4YRSA 2AZXA 2Q7DA 1F4VA 1ODTC 2X76A 3NH9A 3WRXA 4GRIA 3LIIA 1L7PA 2IPLA 1TEXA 4HF7A 3VR4A 2CB0A 3QLVA 2B98A 4AQDA 1JFLA 2KM1A 5KU1A 4H9GA 5GOZA 3AGPA 3SBOA 1IXKA 1TYBE 1L7BA 1X7WA 1E8NA 2CLCX 1UDWA 1T0JB 2HH9A 2ZFUA 3P8ZA 1AH2A 4H16A 1KZ7B 3E2PA 1QZZA 3CVJA 1EK6A 3QA9A 1T5SA 2Z09A 1SUBA 3UWKA 4A0SA 1O95A 5DIZA 4D4KA 2G09A 2H5JA 4DCVA 5CBPB 5I45A 3FOZA 2DR3A 2GJ4A 2IY7A 4KL8S 5B58C 4UVIA 5ELLA 2XTJA 3PGJA 5LUAA 1YZVA 2PSFA 1KI7A 4E13A 2IU3A 2YMPA 2P9HA 2LNDA 1P9RA 2V7TA 1NW8A 3IV7A 3L0OA 1Y63A 2B1GA 4Y1RB 4URUR 4WCDA 4RD2A 2ESRA 5C7YA 5IYZA 5JJBA 3CVWA 4C0AC 3GJ3A 1KRXA 2QUBA 3T41A 1CZLA 5EP4A 3CNBA 2OCXA 3SHWA 1P45A 5CD9A 4DKXA 4QLAA 3GLFB 1A3CA 1G8JA 1VMIA 5IYZB 1UK9A 3WB1A 2QW8A 3OC6A 2AN9A 3BTOA 3MGGA 2EEPA 2ORVA 4NV1A 4Q18A 1QGOA 3TLMA 5HBGA 4YMVA 4YUWA 2XMGA 4I55A 3RU7A 3WAGA 5HFJA 4IEFB 1GNLA 3DTYA 2X41A 4X20A 2XITA 3OTGA 3NGXA 4BRWA 3BB1A 3GAMA 5B30A 5JNWA 2Q5LA 1EA5A 2ZB2A 3FUTA 4LUCA 3D3QA 3OI7A 2IT1A 4G2TA 1N5JA 3AETA 5I9TA 2GN9A 1D1PA 2IXFA 2WHPB 3KTAB 4WXHA 5HNKA 3WKBA 1CNMA 2Z9CA 3T5GA 5LIRA 1F12A 1L3IA 3L5OA 1EXVA 4TKUA 1RYMA 4JVOA 1PT9A 2OEPA 1UM8A 4RBNA 2ZYVX 1AX9A 2CW5A 2WHPA 2A84A 3SS9X 4IBOA 4B0PA 4KKVA 4JJ7A 5TVKA 2O8FA 4L6IA 4HZUA 2QR5A 3FUWA 3R24A 4RPKA 1ES9A 5G3ZA 1VL6A 1H8HA 3K72B 2JHCA 2ETXA 4PAWA 2FSUA 2ROQA 2OV2A 3L6EA 4FHCA 3OF5A 4HEA1 1WAMA 4ITRC 4RZSA 3SD7A 3WNCA 4ZCQA 3VHQA 2BH9A 3CPJB 4LYEA 4HDKA 2XB6A 1VYUA 3QLVC 1RZ3A 1KYQA 3IULA 4NU0A 1JNYA 2ZRNA 4GSLA 1R88A 2C9CA 4A92A 4KXMA 4DC1A 4DVJA 1ADYA 2ZCUA 1RM0A 3F7TA 3KT6A 3OHPA 1B74A 4KZPA 4LTDA 3URKA 5KJFA 4PYOA 4IIJA 4IM7A 2NZWA 3HU2A 1S3FA 3LLUA 4G8CA 2XOEA 4JASB 4OQDA 2F1KA 4BLWA 3ZQUA 1NVUQ 2DFPA 4HDRA 2G5PA 1SXJC 3JQ8A 1CS0A 3A32A 1E4EB 1H66A 3KOXA 4UBJA 3U7GA 3UPUA 2ODEA 1FUEA 1T9KA 3E05A 1GUAA 4X6YA 5CIWA 1G6OA 1SC6A 1XTRA 2WD9A 2V6MA 1LSUA 3U17A 2B0JA 2FB9A 1NMXA 4R7GA 1NMEA 4DNOA 2YWFA 4R2IA 2PHZA 2HRBA 3PQ4A 3R6TA 2XCSB 5C52B 3VR4D 2AOXA 1AQNA 4I08A 1BJRE 4LZZA 2F8TA 3I6BA 2VDLB 1RYFA 4E7PA 1P9WA 5TS3A 3GLFA 1TJ4A 3QNUA 4YDHB 2FVYA 1FFAA 2X19A 3CUEF 1H2XA 3DTTA 3FPGA 3MOIA 2X0FA 4XARA 3W5DA 1P2UA 2IEYA 1JG1A 3A6HA 1FLNA 4NFSA 3GF4A 4RWEA 3B2EA 2XNDA 2G1UA 4G9GA 3N3BC 4WAUA 4ZJUA 1J5PA 1ZWKA 1M6EX 3GGCA 4K9SA 1WXHA 5AKLA 2UYCA 4FFNA 4JDPA 4KGVA 3HZOA 5KWSA 2I5PO 1CDOA 4D45A 3VYUB 1IM5A 1DRKA 3M3DA 2ECFA 3TNYA 1M0TA 2WUFA 3GUUA 3QTBA 5EMMA 1YCFA 4LXTA 2WBLC 1HRKA 2X1MA 4MPTA 3TUJC 2AOWA 3AHDA 2B69A 3JQ9C 2WWTA 4WZBA 3TQFA 1TVMA 2J9GA 3NYIA 3QEMA 4C03A 1M8KA 2PS9A 5DJ5A 5L7WA 3CH4B 3U6KA 4TT3D 1LK0A 3ZS8A 5THKA 1JEEA 2L0XA 1E3SA 4OOFA 1AZSC 2HY7A 4OG2A 4R8KA 4QO8A 2X6RA 2WWVD 3V2UA 3VDXA 2UU9B 4JBGA 1ODLA 2G77B 5L3QB 5IABA 4NICA 4WKBA 5A5FA 4XFKA 5ICGA 4TMKA 4UDOA 3KT3A 2ZYWX 3W5IA 1SUWA 4Y3UA 5I01A 1ZHOA 3HDVA 3QJ5A 1DADA 4QUAA 3IV6A 2YYZA 2QLLA 3HE3A 4N5IX 3H2JA 2VAVA 3FDXA 5DI3B 5K4HA 4S24A 2YBEA 3GAAA 3HCFA 3Q0IA 5K03A 3G89A 1QRTA 3WICA 2O8EA 1WO8A 2OL4A 4R54A 3HI6A 2DRIA 3P7MA 1MHTA 3HKCA 4LJRA 3U0BA 2IGTA 3ZWOA 3FWPA 5BRNA 3L7LA 3ZE6A 4DIDA 4GVXA 3T7CA 3TVTA 2FPWA 1QAMA 4MDEA 2X14A 3HR8A 1BROA 1H5UA 2G76A 2R68A 3LRTA 3UK0A 4GPBA 1LFDB 1M33A 5MN5A 3M4YA 1JDJA 1YS6A 1W75A 2JD2A 5HRUA 3WY9A 1PGJA 4K40A 4I1RA 2GEDA 2W83A 1NMYA 4WTOA 2PNFA 1AV6A 5I51A 2PRJA 4AO7A 1JQKA 4KJZA 2OHOA 4Y0NA 3OZFA 1G16A 1MO5A 4BQNA 1XCBA 1FUKA 3VMMA 1OXTA 3LDFA 1G8AA 3WI7A 4G2NA 1NLYA 2H2AA 4RQTA 1ZEMA 2PWBA 4CQLA 1PSZA 3WOHA 5EAIA 1U8EA 4MI1A 2J4CA 1XTIA 3KPVA 4UXIA 3LT5A 2Q4EA 4RF5A 4DIUA 4BMOB 2HNBA 1O97D 4CKXA 4IIDA 4TKVB 1E20A 4HWTA 4BMSA 1E1DA 2KHZA 1VKHA 1W5AA 2X5JO 4IWYA 3HY6A 4CEJB 3RYIB 4JOCA 2FW9A 2Q8PA 3DMDA 3NHUA 5J5AA 4DZZA 2E3JA 3G13A 5E7IA 5FYQA 2ZUEA 3NI2A 3TOZA 2IUFA 3PF8A 1IK6A 2BEUB 3KAQA 1DZIA 1NR1A 2WA1A 1N1MA 4R8MA 4UCXA 5TPZA 3T06B 2NV2B 1KVUA 1DVRA 2PKEA 4TMXA 4F7DA 1Z63A 4IDGA 1XNJA 3OQHA 3JQGB 4H1VA 1QG0A 2Z2IA 3U6BA 3KUXA 5BWOA 4YLYA 4Y1EA 5F33A 1I0LA 2C61A 3HKBB 3B1FA 3TNLA 3GQBA 4Q1AA 3BQNB 4G0QA 5ADVA 5E6RB 1N8KA 2ZU6A 4JYCA 3THYA 4HAZA 5KVAA 2Y0DA 1IXSB 1NJSA 3EB9A 1L5RA 4YMTA 1K8ZB 3O91A 3HKBA 2O20A 5KCMA 3GYBA 5CDTA 1PFQA 3PQ5A 5E6RA 3AEKA 4CGZA 1PNVA 4D4GA 4FFBA 2HF9A 4CCYB 1TD1A 2EIHA 2J08A 2WLSA 3CN7A 4PCLA 3JYPA 3JAWB 5ALKA 1MQAA 4OUDB 3V5NA 1D5CA 1J1ZA 2VDQB 1W5BA 2VT2A 2ZWMA 1W96A 3OJLA 3WP1B 4BC1A 2CT8A 1V71A 3CIFA 4HO1X 4HQOA 3PKZA 3PZBA 3VHLB 3N0VA 2W48A 3WGQA 1Q1EA 1O0CA 1HOXA 3M6MD 2PBZA 2DPGA 1SFRA 2W2VA 5DW3A 1QCCA 3IQIX 4QOIA 1P2FA 1RWBA 4HLDA 4X93A 4AWXA 4L5YA 2MINA 4Q47A 5FUQA 3RYFB 4GSKA 5HQTA 4IZIA 5EPOA 3K9WA 1NUHA 2OXFA 4QUEA 4KNVA 1E9VA 3N0RA 3TTVA 3W4IA 3MUOA 1TJPB 1AA9A 1QR2A 4LV8B 2B20A 4MW1A 3Q3IA 3GB9A 4Z8XA 3RKSA 3ULKA 3PDUA 3HCAA 1T5TA 1TM2A 2YHIB 4BV8A 1VBMA 4CDGA 3WQQA 1OT3A 3EA5A 4W9NC 1R8SA 4ONEA 3V42A 4MH0R 3WKAA 1I14A 1LBIA 2FE4A 3DVSX 3GDOA 4PG4A 1C1XA 2I2CA 5GM1A 1XVVA 1GQYA 1WB5A 3IFSA 1GILA 5KPJA 1VI6A 3TR0A 1U3VA 1QVZA 3ZDFA 2J45A 2YRFA 2BGTA 1CRZA 1UOPA 1J0XO 1L2TA 1TRKA 1XMIA 3FPHA 4JROA 4YROA 2OYRA 4NCKA 2D4AA 5BNWA 1CQPA 5A7FA 1FU4A 4XI9A 2R6FA 2V8BA 3RK1A 3RRNA 3R3HA 3KLPX 4DXAA 1YQWA 5KKAA 3TNFA 1L8AA 1H2HA 1OY1A 4URWR 5G4KA 2I4TA 3HXTA 4KIJA 4RETA 1U2QA 5K0CA 3VR6A 1ZSYA 3N6RA 4WVLA 2P77A 5EJ8A 2JG3A 3OOSA 5AOBA 1RTKA 1O5TA 1OLUA 2OHJA 1V41E 3G9TA 3H5LA 5HWSA 1C9DB 1DOAA 2EJWA 1RRKA 3R74A 2RB5A 2RG7A 3SZ3A 1OKKA 4ZVRA 1CULC 3X3HA 1TEZA 2JFPA 1JTVA 3A25A 2O3UA 3KFLA 1OZAA 5IJAA 2A30A 2VDWA 3NORA 4KV9A 3EUAA 3T7KA 3TAHA 3KTOA 1K6JA 3PD1A 4C04A 4IY1A 5KNDH 3RVKA 1V5GA 2O05A 4HRYA 4CF7A 3LY7A 3OM9A 3P2MA 4LA4A 1HDIA 3A1TA 4GZLA 2XTNA 2ZT7A 2VRWA 4AIRA 5KOYA 3W2FA 1YR8A 2P2LA 3K2EA 5CUQA 5LD2C 1OCEA 4C5AA 4FHFA 3HKCB 3ABQB 2VJMB 3H0EA 5B1HA 1HDXA 5JTUA 2XF2A 1T25A 2HWUA 2NU8A 1TOAA 4JEMA 4HDNB 4RF3A 3RD5A 3RS3A 2VPXA 3ETEA 3TXXA 3DV0B 1VI2A 3ANTA 4QRHA 3W2EA 2BLLA 3GEEA 4V0NA 5EG5A 4A73A 4CODB 1PT8A 2ZR9A 3DAYA 3QTLA 2W6OA 4RLSA 5TGTA 4DSNA 5HGXA 3MTAA 1MLDA 1COZA 3LZCA 1AUOA 4G5GA 4JYAB 1XBTA 1S5PA 1EB9A 3HRHA 5HOQA 3ZGVA 3PTLA 2X1HA 3TIXB 3OP4A 4U2BA 3HG7A 3SIXA 2M98A 4B3HA 2C7RA 3BXEA 3H16A 2CXOA 1YOVA 5K6RA 1TVKB 2W4MA 3BGSA 2F9LA 2YHIA 3K5WA 1W9HA 4L2IA 4OHFA 3DEKA 2TMYA 1TYCA 4OXRA 2PRSA 4Z5XA 2D13A 2R48A 1EYZA 3OZUA 2LWIA 3RFCA 5DX0A 3V3TA 3LUBA 2PVPA 3RB8A 4G0WA 1XAGA 3EW9A 1DFHA 1MJGA 4BO5A 4CEIA 1YR2A 3BQMB 5IZCC 1D2GA 1E1QA 3KYBA 2PVCA 2AEJA 2P9GA 3K1JA 3K1AA 3L8EA 4TRMA 3WNDA 4CIVA 4CU2A 5A03A 4RTOA 1E1RD 4EB0A 4GSYA 1ZOPA 1CQZA 4H3VA 3W05A 1WP4A 4FFPA 1SURA 1EGAA 5FV4A 1VCIA 2R8YA 2VXOA 3DF7A 4KFCA 4GH5A 4GI5A 4RMJA 1D6NA 1YQQA 4TN5A 3CEJA 4ZV9A 1Y5LA 4OHVA 4E5YA 5C9ZA 2AOVA 4YJFA 5FULA 1MDBA 5ILQA 3WGYA 3OFNA 2J48A 1W76A 4NL4H 1YGPA 5A4JA 1GUDA 4FGLA 3CYFA 3HEAA 1AHNA 4HUQA 5LQAA 1Y6RA 4HPJB 2Q2OA 3T5DA 2NU6B 1PUXA 1C0IA 2DPMA 1T5LA 3MWGA 1VSQA 4G9EA 5CFZA 5KWVA 4WBNF 1UMBA 2EBFX 3PQ3A 1UPUA 4BX2A 2ZI6A 4UM5A 3EXG1 2BF7A 1RVDA 2PZJA 1EINA 4KODA 2ETVA 3D59A 3REQB 4HDSB 2EYUA 1V1RA 3HPRA 5JCOC 3LA8A 4KLZA 1K7CA 2KE5A 2JGLA 5AVTA 2Q4BA 1SXQA 1KMMA 3NTQA 3PXAA 4Z9FA 3UUWA 1TAUA 1GSHA 5A5VA 5F77A 2F8SA 4PNZA 1ZD8A 3F3SA 4OIFA 3PE4A 4PYRA 5IKPA 4Z4IA 5DLEA 1GCIA 4A10A 4OX9B 3AHHA 5EJAA 2DM6A 3Q9LA 4JITA 1PRYA 2OZPA 4ZVNA 4RFLA 2QF7A 1ESNA 3PEWA 4Q03A 1EUZA 2JLXA 1YB4A 1L7OA 4HR7A 4DYVA 1OC4A 2CUTA 4YJFB 1N5MA 4ND4A 1GZ5A 1V11A 5EZYA 2OAP1 3CF4A 5FHRA 3NIWA 2HMWA 1IC6A 3FOBA 4OQQA 2WM2A 4KSBA 4L6AA 4XGRA 4BWFB 2A2ZA 4EQ6B 1WVMA 2VRCD 2ABWA 3EBOA 3S81A 2FWMX 4AURA 5BURA 1R5OA 3QXCA 2W6JA 1WLSA 3NAMA 4HAYA 3UWOA 1TIKA 1VYHA 1ZIPA 3NTRA 4U2GA 2YQ5A 5I9NA 2VSNA 2F4VB 4C7OB 4AI6A 4KACA 1FQWA 1A1SA 4H1HA 2C9MA 3UWMA 1QHNA 3BWMA 3R7FA 4Q3AA 3QP9A 3F3KA 2I65A 2PD6A 2QG6A 3GOHA 4JQOA 4UMVA 4MKXA 5BSGA 3OCWA 1XMQB 4NENA 4P4UA 4HJXA 3D8NA 4HGNA 5EIHA 5C3MA 1B0PA 3FZNA 2EZUA 2JRLA 2DQSA 3M6VA 2PFKA 1OTHA 1N2OA 1KBOA 1NM5C 3R3UA 4EQZA 4EYEA 4D8TA 1CUEA 3DT9A 1WDLA 2H7XA 4AULA 2VLBA 3GDWA 4N5HX 1EWVA 2PX8A 1ADJA 2WD7B 2ORYA 4KXXA 4YFYA 5DGHA 5H9VA 5TQ2B 1OI4A 4CKCA 5ARCA 2PGOA 4X00A 4WZAE 4RDIA 5B3JC 5SYAA 1LX7A 3BE6A 4XIGS 4H7EA 2ECQA 3D9QX 3Q3JB 3FWYA 1L4FA 4Z1MD 2FAXA 2FPKA 1KPGA 2XT6A 3LUGA 3KFXA 2FNAA 3N86A 1FFGA 3TJMA 4EO9A 1Y7HA 4ZZ0A 5HJEA 3K5IA 5F73A 5BVHB 1BSVA 3Q8XB 5C1IA 2QVZX 3S70A 1NN0A 4MUYA 4MWEA 3DEHA 3NHRA 2XBLA 4TKMA 1FLVA 4X1OA 5JS8A 1NA5A 5DW0A 3B8EA 3DPSA 3PJRA 4X45A 2OFPA 3GAFA 2I3GA 5DN6A 4UUBA 2HA0A 4AYWA 1PVOA 5B3LA 2BR4A 4JI7B 2G3YA 1DBRA 2SHKA 4HCJA 4AU1A 3AX6A 1OLXA 4RTKA 3JY6A 5JNTA 4K1LA 1V3UA 4AROA 2O54A 1VL8A 3VBCA 4A9AA 3EDCA 1DEXA 5IFKA 1H6DA 2CEKA 2J09A 2FKNA 5HQJA 1X39A 4MGKR 1JR6A 3F5QA 1C7ZA 3UEOA 2QB5A 3FHOA 5DVZA 1IBKB 5FO0A 4MA5A 2W43A 4AX8A 2XAUA 1E0KA 3OD5A 3P26A 2YYAA 4G65A 4Z9YA 4EQ6A 5EHZA 2YWDA 5I7AA 3TMYA 4EW2A 2YJNA 3Q2IA 4WNIA 5KHAA 3ZDZB 1VYTA 3JWGA 2ONJA 1R5NA 3WR5A 3MS7A 1TKRA 4IFTA 5CDFA 2VQEB 3COYA 4FE3A 2D7DA 2O2SA 3I42A 2PSSA 1B1AA 1XZLA 4IJUA 2VZ9A 3TNDA 4RXUA 2F3PA 4NQZA 3K9BA 2AG8A 1QMPA 2CLIB 2QRMA 4MJ3A 2OHGA 2QYSA 2KB0A 5CTJA 1BMTA 2WD8A 4LHWA 5LBUA 1R9JA 2OR3A 4PSKA 4KGZA 4MW5A 4S1PA 1C0LA 3PCRB 4YAOA 2X3YA 1DX9A 1N0VC 3A26A 5M3BA 3ZHQA 2WB2A 1SKUA 1C8BA 2WG2A 3UW1A 1EJ6A 1PGNA 3OPYA 4D26A 4R2MA 2OFOA 3TL2A 1KO8A 1ZM7A 4KREA 1DDOA 1ESZA 2HC9A 1TZJA 3WGLA 4R69A 2FOXA 2AFRA 2PYZA 3STYA 1E9BA 4IG9A 4BO4A 4TRJA 1W1UA 3GFBA 4EJFA 4LOIA 4YJ3A 2C5FA 1N3LA 3I62A 1JSCA 4DHEA 2CJPA 1ZW6A 2WIAA 3K9QO 3OOYA 3TW8A 3AC0A 5TGDA 5B5SA 4BFSA 4A6EA 1TTHA 3V55A 4BNJA 3EVCA 1XTKA 3H2IA 5JQGB 2DCUA 3E61A 5C1BA 4P7BA 5JZBA 3E23A 3OJOA 3CZ9A 5HRCA 1PBNA 3NXSA 3EIWA 3S99A 3VR0A 4B6GA 3AY6A 1DRJA 3PX2A 1R0KA 3SOPA 4BNTA 3DMHA 4J16A 4RYDA 5AK5A 2V3VA 2GK4A 4L7QA 3CW9A 4PV7A 3DNMA 2P5TB 2KBEA 5GJVC 3ROXA 3MWYW 1QGED 2YH2A 4P7GA 1XLVA 2CE7A 4QFDA 1TMGE 2WFLB 3L6UA 4YRMA 4WASA 4TWIA 1NY5A 4L3VA 3W2HA 1KA9H 2AK2A 5KOIA 5ED4A 2EATA 1Q3HA 2EU8A 4BJ1A 6GPBA 3H87A 2WVAA 2GBCA 4IVNA 2HRDA 3KQTA 4JBYA 4JLOA 4B3BA 3TGLA 1EEHA 4D9GA 3PC8A 1GDDA 2V4MA 1ZUNB 2VSYA 1NAIA 4J1TC 1Q57A 1Y6FA 1V11B 5EZYB 2XUFA 4E5DA 5ITVA 3FPFA 3HXMA 5CXQA 4HTFA 2BGRA 3E22A 2JLAA 1VSTA 3FAKA 1QIHA 2RGAA 3GGPA 4YV2A 2C7VA 4IJ5A 2QBYB 7REQA 1F17A 2W2QA 2IHZA 3DL7A 4M8KA 1AHPA 1CNEA 1P1HA 2ATIA 2XWJI 3P0JA 5CT9A 1Q3KA 2WUGA 2QAGC 4UQPA 1DNPA 2PQ6A 1JXQA 3EIUA 1SIUA 1BVYF 1UR5A 3I04A 4G1UC 2X42A 4GAEA 2HL6A 4AN4A 4KLNA 1QMGA 1VLMA 2MDTA 4I1PA 2A0UA 2YR0A 3WHPA 3LS2A 4YCSA 1E58A 1AK1A 5JC8A 4YAIA 1JKJB 2D1FA 2H16A 4QYIA 5TC4A 4AYXA 1SVMA 1UEJA 3II6X 3WG9A 1Y0BA 2IUEA 3HJTA 4JLMA 5E3HA 2QRGA 2QXYA 4FGSA 4Q9HA 4RZHA 2O7VA 5T67A 3SVZA 1PWEA 1XXHA 1AGXA 3DWFA 1II8B 1BCSA 4X66B 1DAGA 5FKJA 5D00A 1CQWA 1HMPA 1B2LA 1HBJA 3FYUC 1JKIA 3OZEA 1FVFA 1NXVA 1RVV1 1KVRA 3D6HA 3U7EB 2WTUA 1UBJS 1VBFA 3CLRD 3OWXA 4KQGA 4EK9A 1DU4A 3GCXA 4ISBA 2NUTA 3GLGB 3CN9A 3X1MA 3RC8A 3M7IA 3JZMA 2JCVA 4KB5A 4MS4B 2E1PA 5B1SA 3IOEA 2IPOA 1I13A 2Z6VA 1HL3A 3BN3A 3FKSD 4H17A 1C0EA 3B1ZA 1SUFA 3KXDA 4EB6A 2BGKA 5L6MB 2P9FA 3TCKA 1MRSA 4RPJA 2QW1A 5AOCA 5SY6A 4AG5A 4C3OB 1R4NB 1EWYA 3GJ8A 2B5VA 1THMA 3OVMA 4NCIA 2VAXA 3TAXA 3A58B 3T5BA 3WRXC 2OC4A 1SVNA 5T57A 3KKEA 1UBKS 3FBTA 2NYRA 2ZRIA 3L8GA 3RSFA 4QATA 3BGWA 3G1TA 2Q3HA 3UN1A 1ACJA 1R9GA 2C4UA 2EW2A 4GGMX 4QDJA 3NLLA 4X41A 1NASA 4AS3A 1Z2EA 2Z1MA 3RVMA 5HPYB 5J2TB 3WGIA 1NBHA 1PR1A 3MWKA 1J9EA 2C1EA 5DE3A 3ON5A 4JR0A 2OUIA 4AS2A 4YXWD 1G63A 3BJZA 4TTTS 3FTPA 1BCRB 1XEFA 1H22A 1XCGB 1QJ4A 1KI3A 1TZKA 3KHSA 1C0PA 3NBMA 4I66A 3CH5A 1L5FA 1TXGA 3N0XA 4LOKA 3PFGA 4IGFA 2FPOA 2B1IA 3OEYA 4P4NA 2DHDA 2G1KA 1F38A 3SXJA 3UW3A 3FDIA 2FLVA 2ZUVA 2YIVX 3ISJA 3PUKA 4HXGA 4OY3A 3L7BA 3Q88A 4R3NA 5K3BA 2PXCA 3T99A 3TQSA 1HYHA 4F85A 1A04A 4P84A 3O82A 1XQVA 4HLQB 2PZAA 1TDJA 3QV1A 3OICA 4FGKA 4TVOA 3HVIA 1M34B 3PDCA 2WM9B 1U5CA 4HNAA 2AV6A 4IOJA 4GVPA 1BS2A 2I6GA 1GV0A 3ZEIA 3D31A 4PYJA 1KY2A 1NUTA 2EFCB 1UAYA 4MUGA 3M6FA 1WCIB 1E9FA 2QTZA 2WSBA 4HNGA 2H0RA 4QT4A 1G1MA 2A14A 2RK4A 3EQ2A 4BYGA 4DCMA 4JI5B 2A6PA 1MB4A 3N2GB 3QMVA 1K9VF 1QFSA 4RABA 4O59O 1G0OA 4HDRB 3LSTA 4LJ4A 5GIPE 3R6WA 4JA0A 4C7KA 1R0RE 4E6PA 4QUKA 1XWWA 4BVJA 1JKJA 2FG5A 1LPNA 1LSJA 2WSIA 1YE3A 3SEQA 1N7GA 5DNUA 2NZXA 3MOGA 4RK4A 3U3OA 2CZCA 1DP4A 1NBME 2VK8A 4F5YA 3AI2A 1YTUA 2WF7A 4E11A 1IFXA 4MS4A 4LRUA 5T8KC 1KR2A 2JPDA 5K0NA 1DX4A 2JBAB 2R11A 2HB6A 4TV8B 2R00C 4F11A 3SR0A 4J0EA 4DMLA 2ZJ0A 1E2FA 4P3KA 4V2UA 5E9JA 1UKCA 4KG7A 1JX6A 2COKA 5KOHB 1BG6A 4O4IF 7GPBA 1M8PA 5BQPA 3AV0B 4Q39A 4ETMA 1X2EA 1KSHA 2CXSA 2PH1A 4L4RA 4DLXA 2H2IA 3EFOA 4BQIA 3T3MB 5CNJA 2CUZA 3WQSB 4N82A 4FCVA 1L5SA 3AVWA 3DEFA 3M6UA 3AUXA 1LPBB 3EEFA 1W8IA 2AN5A 4D3SA 1JH9A 5CBKA 4S0ZA 2DG2A 4EI8A 2E55A 2DFKB 4OYYA 4CG1A 1EVIA 2YV3A 3QXGA 1Q1QA 1KRHA 3K16A 4RGYA 3KSAC 2V6GA 2V45A 1J9GA 5H4HA 1N1GA 4KBGA 2UZ3A 3TTYA 3ZHZA 4AWAA 4H1WA 2RD2A 4JKOA 4CM9D 4FFVA 5IUNC 2UUCB 5A1JA 2MIIA 1MB0A 1RWMA 2VPYA 2XW6A 3I76A 1P1CA 1Y6ZA 2DMRA 4GMKA 4BE7B 2H52A 2GZAA 1ADCA 1K3FA 1S8NA 2J3MA 2OXEA 3BULA 2IXEA 3KK0A 5H0IA 1W44A 1M2VB 3UOAB 4DMFA 1IBRA 2PWZA 1AGPA 2WOOA 3OM8A 5JEEA 3AEXA 2YIJA 1E5VA 1YC5A 2WF9A 4YQFA 3IR7A 1C9YA 1D4OA 3R3WA 2XUDA 1DG9A 1FNSA 1GNTA 5E4TA 3TBKA 1GG8A 4BBPA 5CLQA 1QC5A 4BVLA 4NOMA 3REOA 5EFZA 6ADHA 3PKIA 3ZKWB 4P08A 3RAJA 4A36A 3GFSA 3HBAA 1QYVA 1IZZA 5ESXA 1IUPA 5BWBA 5F4BA 1S8AA 3RGGA 4YRKA 1G59A 1Z5PA 1F0NA 1FQKA 4MCHA 4W5HA 2VBGA 1FX0B 4D8UA 1KYVA 4LJSA 1SU6A 4ER3A 3JYOA 1TMYA 4WSOA 5A4AA 1IL0A 1ZKDA 1VMAA 3TQCA 4BJ3A 3OETA 4LYYA 2JI6A 5DRTA 5HDQA 2GSWA 4ER0A 2C07A 3BA1A 1FPMA 3EASA 3IELA 4R83A 5FEUA 5DIFA 4M9XA 3RVDA 2XCOA 2QGNA 2YMMA 3HSKA 3O8DA 5F21A 1XTVA 3TF5A 1XP8A 2YWRA 2DFTA 2FEAA 3IVGA 2PQ0A 1X15A 2PGAA 3C70A 3H2HA 3LMKA 7AT1A 3HJBA 4WZ6A 3S1LA 4B6RA 1XO1A 2H4XA 5GY7A 3OEHA 1RCUA 3IE2A 4GF5A 1HNWB 1CRLA 2OM2A 4WKCA 3PIIA 3VR2D 3OOHA 1SMKA 3AFMA 2ZBDA 3LI2A 4N5DA 2ZAGA 5CFRA 4WEOA 2R751 3QUSA 2W2TA 1P1RA 2DTDA 3DDOA 5BQOA 1XLTC 3PE3A 1EUYA 5ECDA 1G7SA 3E7FA 2GKSA 4D99A 5B7PA 4PNPA 2Z8XA 2J3IA 4XJVA 1ZU5A 3ILVA 4BMXA 3QVVA 1DAOA 1O57A 3GMDA 3PRKE 5DDIP 1ZL2A 4ZZ3A 3WBJA 4FUTA 3CVVA 3ESCA 5EP2A 1UFRA 1U5BA 4PSDA 4C30A 1M0WA 1OTXA 1FSFA 3DZFA 1KVSA 4ZGWA 4YEDA 3UATA 4R2HA 1BEEA 2R8PA 4G4IA 5F23A 2EKQA 1D6JA 1A50B 2VCHA 4B84A 5EIOA 4ZIRB 4HLCA 4PFSA 2JHGA 4DV5B 1WQ1R 4OFWA 4NAVA 4ZVPA 4ZI2A 3HZHA 2Z3ZA 1GCGA 1UM9B 3D8HA 4CBVA 5DU2A 4CMHA 2AMFA 4IQ4A 3JALA 4ZIRA 3WJ2A 4F56A 3DLTA 4HN4B 1N0IA 5KYNA 4OI0A 3EZ2A 4UTPA 4DR7B 2NZVG 1DKQA 1H6CA 3S7TA 3UBMA 4G8DA 3KOUA 1CE8B 1X8JA 4HFMA 3K4QA 3AP1A 3W2IA 4YRIA 5IM4A 3G8DA 3DOOA 3OFSA 4IQFA 5KYKA 3U5ZB 1JLSA 3C7AA 3RTCA 1O96B 4OHYA 2VF4X 3KQQA 4C7XA 1VJ1A 5CXUA 1K92A 3M6LA 4JP2A 2XDYA 5H80A 1JQ3A 1T0UA 3KQPA 4LQLA 4OJQA 4UUMA 3HO8A 4WOPA 1X3LA 3TSYA 5HIKA 5DHRA 5CYFA 2TMDA 4F1WA 4F2PA 3WLJA 1FOEB 4EY6A 3KSUA 1NHGA 1NQXA 2J8ZA 2DR0A 4BO1A 1BE6A 3O4IA 5B1IA 1R18A 2RGXA 4ZWNA 3SPXA 1MC1A 1QDLB 3CWQA 4MS1A 2J6HA 3CB4A 4MZDA 1OYOA 2A5FA 1TC1A 2MSDB 4K87A 3ZV5A 1JAXA 3MTIA 2ENUA 2XZDA 5AJWA 5EERA 4P34A 3W6UA 5EHIA 4B6EA 4UTVA 4GBJA 3HCDA 3JTMA 4V1CI 2QJWA 2JGMA 2ZTVA 3DOHA 3Q7TA 4FOTA 4UEWA 5ISMA 2KJQA 3X1JA 1OH8A 4JLBA 3TSZA 2W6JD 3MCVA 1ULHA 3W90A 3THWB 5KYVA 1N3YA 1N92A 2VRNA 1FMTA 3B7WA 3TI9A 3MWEA 3RC2A 1WX1A 3F6EX 3L05A 2R0QC 3EQZA 1SBHA 4DPMA 4YO8A 5DF1A 3TFOA 1P5FA 4E5PA 3MMPA 3T1YB 3GJ7A 1UBOS 4C2TA 3H11A 3O90A 2ZDQA 5L7TA 1Z74A 3EEBA 3RREA 6REQA 2B34A 4C89A 2AXNA 4IMIB 5JJ5A 1Z36A 3CUWA 2C0CA 2WKQA 2W2MA 3VR2A 2DKOA 4HOYA 4RH3A 5D2CA 1GR1A 2HXYA 3DT8A 4WY8A 1N9KA 1CYDA 1G42A 1Z35A 5HIJA 2AWOA 1N5KA 1VP9A 1RWOA 1OPRA 1B4DA 2J6CA 2UZ1B 4B83A 3Q3VA 1HNXB 4PYLA 5FI0B 3TEMA 3ZWWA 2H9YA 4IUYA 4XAQA 3VAAA 1Q17A 3H6GA 2P1RA 3R41A 4BMCA 1L7XA 1WXFA 3F7MA 3QYJA 4EB8A 2YN0A 5KTTA 3QLUA 4C9BA 4QZVA 2EXXA 3N0TA 2HADA 4Q48A 5FPHA 4DY4A 1KI6A 4KLCA 5KTRA 5KWIA 1T36B 2O2HA 2VJYA 4U7TB 4TLLB 4A6XA 2GPWA 2IPNA 4BBJA 3RC1A 4DCTA 1NZFA 2PJRA 3KC2A 4RK6A 1JILA 2BD0A 2Q4TA 1DC5A 4FYIA 3JVEA 1X1QA 1VE3A 4CN8A 1NBEA 1XDBA 2C5GA 2XGMA 3FTDA 4GPIB 3AVYA 3CA8A 3U19A 3JYLA 1J4AA 2ERYA 4J0KA 1XC7A 4M37A 5DBEX 5EUQB 1KO4A 2ILTA 3ROTA 1TNDA 7MDHA 1TF5A 5PNTA 2X4DA 1VIDA 4XOIA 4E2YA 3LRPA 5KNBA 1XXLA 3U4MA 3TJRA 3NHZA 2VYNA 4TZ0A 3IRVA 1IVNA 4TMWA 1CUXA 1C30B 1E5QA 4QBGB 5FO1A 1G38A 4URYR 2R1VA 3EHEA 3H8SA 2CXQA 2VOJA 4P4GA 2PSEA 4Y1FA 4UBOA 1A5BB 4NZYA 5K0BA 3HWSA 2WF5A 3SQDA 5J3JA 2GEFA 3E70C 5GJCA 2BRUA 3CV3A 3MMXA 4BVKA 2C4MA 4C2BA 3IOCA 3DTNA 1XNGA 4C4AA 1T2CA 4ZCPA 1DT5A 2GM5A 1F0YA 4S0XA 3OWOA 3QKIA 3VGJA 4B46A 5K4GA 3RAFC 3NOXA 1N2HA 4PC1A 3EPLA 2IUYA 2BSAA 2OBLA 3UV6A 3FWHA 1E6EA 4L78A 2NNLD 2OLEA 3N76A 1A8PA 3PWTA 3KKOA 3MINB 4NYJR 3TZEA 4Q4AA 2YNMC 3AM4A 1TO2E 1MO2A 3N3AC 4DJEC 4M76B 4FNOA 2FW8A 4ZQFA 4OFZA 4RVHA 5CPBA 2VF8A 3A4IA 2ZQ5A 3PBKA 1HO3A 3ACDA 3E3MA 4LV5B 3D7SA 3HNOA 3ZTTA 1XE3A 2WJ4A 5C1DA 1I3KA 4LS3A 2ODQA 3OUTA 3ZHUA 3R3XA 1HQCA 1L7AA 1FXUA 2ZP1A 3EHDA 4G81A 3HEBA 4G5QA 4QM6A 5FPYA 1CJSA 3T3HA 5HKOA 2JIZA 5EJ2A 5KJCA 1PFYA 2X6QA 1U0OC 2WU1A 2X13A 2R66A 3DMFA 4TS4A 2D74A 3WLQA 2J0EA 3FWKA 5GPBA 3LUPA 2JLQA 3BL6A 4FHEA 4OMUA 3S2IA 4JV5B 2ONKA 1CB7A 4M55A 5JCJA 1BMQA 1DUSA 3N8DA 4J0FA 3L6OO 8LDHA 1QRDA 2V1UA 2P1ZA 1TI7A 4D80A 2YFHA 3DLBA 3G5AA 2GCIA 3MELA 1SVSA 3GLHB 3NIFB 4OQZA 4RCYA 4U7HA 5AMXA 3ZWCA 2O50A 1YKFA 2VQ6A 3C41J 4CV1A 1JFVA 3UPTA 2VDVE 3AFNA 2NG1A 2UV8A 4LZNA 3JYQA 4TYMA 3WK5A 1I7QB 3VBEA 4Q9AA 3LQYA 3W5BA 1ZPDA 3E6AA 1R15A 3MINA 4I4TB 1FZQA 5DLYA 3PNMA 3LWZA 3OE5A 3WDSA 5K6TA 5FYDA 2NN3C 2EBWA 3KXKA 4YCDA 1RZVA 3MERA 3RJ9A 4O1HA 5JT1A 1I2DA 2C58A 1UXIA 1N2CA 3IP6A 3TI7A 3STXA 4PZAA 4CHGA 4QRDA 1LPMA 1KDRA 2G06A 4J0QA 1DCFA 4MAAA 1K8YB 4N12A 1V26A 3ESAA 3ELUA 1W0CA 2XZLA 3OT5A 1U28A 4AF8A 3EDOA 1CUCA 1P2VA 1VMKA 4R16A 4Q1FA 2VAMA 1D6SA 4R2LA 3FKQA 1C2YA 3WTBA 4B17A 2OCDA 4CHTA 4P32A 4KHPB 3ASZA 5JFGA 2IYYA 3OFKA 4YDSA 3BT7A 2VSFA 1GTZA 3KETA 1AA6A 4B3FX 3NEYA 2NUPA 3NDPA 3F5SA 1DTEA 1CNFA 2AFVA 3NW9A 1O8CA 2FZVA 5IFLA 1HE5A 2YXEA 3BSSA 3ENNA 5DM2A 2POQX 1TM3E 2BBTA 1BHSA 3D6MA 5EE0A 3S2FA 4BO6A 3OZWA 1VQ1A 4KW7A 3GEGA 4FI3C 3WWZA 5BN3A 3FPBA 1XRRA 4D8XA 3QFFA 5L4SA 1GM5A 2D0PB 4Q4LA 4W82A 4GL4A 4LX8A 2CWWA 1QH9A 4RH0A 1C80A 2XNKA 1Q12A 2C2ZA 5BSMA 5BR4A 1V8PA 2OWDA 1YOBA 1N2XA 1XDGA 5J2TF 5JI2E 4EHNA 2FETA 3VSEA 4EPRA 4EGAA 1I8TA 2X4LA 1F3OA 1VSBA 3GPIA 3IQFA 1JMYA 3RSSA 4YX9A 3GG9A 3OM1A 3AF4A 5J5CA 2DP4E 3MAGA 3HDJA 3Q6IA 4QFBA 4UD2A 3THRA 4GM1A 4HN2A 3V80A 1KR5A 4HDMB 2P8SA 1DRUA 5TQVA 1YV9A 4CLRA 3WLKX 2Y0PA 3L4BC 4K8RB 4XPZA 5BSKA 4XB2A 5HIIA 5JANA 1G9XA 1RWPA 4Y2HA 2FRDC 1N0UA 1V5IA 2MSEB 3RH0A 2XCUA 2PUAA 2BBWA 4FZVA 1G20A 3KE9A 1QH0A 5HUHA 1QLHA 1KI6B 2FF7A 3AM5A 3OM0A 2GSDA 2P62A 1G21B 4JHXA 1JE0A 3GFFA 4M8LA 3RSHA 1KJQA 2J9XB 4BNKA 2GXAA 1YQGA 4GMFA 4PQFA 2PM8A 2ZKLA 1KI1A 1QHGA 3IPXA 4CT4B 5KQRA 3SMVA 3DVAA 2GCEA 4G0NA 2ZJAA 3E18A 1N6IA 1QYDA 2CLKB 2JIRA 3K3PA 4MQMA 2NX2A 3AF5A 2DPYA 4OHBA 4OP3A 3JVIA 3SIWA 1UBFA 3RSZA 3UWSA 1XVTA 2AYZA 2I99A 3B13B 1M54A 3CISA 3JX9A 3ZCUA 2EFGA 2PIAA 5AW1A 2ADOA 1X7HA 1L5NA 4UCQA 4N9QA 4PZUA 1PJLA 1EAYA 3F3MA 5JRZA 1A1VA 5DGCA 1D4FA 3FFTA 3H3JA 3GG2A 3DE7X 2PBLA 3M81A 2C96A 2X5NA 2YJZA 3W3AH 4R05A 4C07A 5AJTA 3VXKA 4N03A 3OQ1A 3MBIA 4DJTA 3OEHD 2O2ZA 4BP3A 2ZE8A 3GGSA 3FPKA 4JB8A 3ORYA 2BIFA 1YIAA 1VG1A 2HWYA 2P5YA 3DLAA 4TKUB 1KGDA 1XZAA 3PUVA 1NTOA 1Y4ZA 2GZSA 5K09A 3RTGA 1IWOA 1H4VB 3AWDA 4OHZA 2ZUTA 2O8FB 2AJDA 2F64A 1K88A 3RG2A 1GG9A 3DQQA 4MROA 4Q5IA 4AQ7A 1NNI1 2F55A 3KWJA 3TX2A 1EHIA 3UK2A 3WGMA 2EEZA 5DHFA 5FUWA 2FX3A 2G72A 2QMOA 3ET5A 5FEMA 4K03A 3HLKA 5FWXB 3B6EA 2IQIA 2JEZA 4G0YA 2G04A 2ZZNA 2HSJA 3I1YA 3Q3CA 5KQGA 1IBSA 2H7CA 5CA0F 5JPCA 1GTVA 5FT9A 4TKZA 4NXNB 3L8ZA 2FRVA 2H5LA 4BUJA 2ODBA 1ENPA 3W2GA 2FWJA 2V5AA 5I48A 4RIGA 2MR5A 3G0CA 2D1SA 2QTRA 4L73A 4PC2A 1QE0A 1RMQA 2JFBA 1Y7TA 2R8EA 4FBMA 1XTTA 3ZLJA 1GKLA 2B35A 4P82A 1C8KA 1KKLA 3FG9A 1KHHA 2H2HA 3S2YA 3K96A 1KK2A 1SBZA 5JPIA 3HHPA 4F2WA 3E0XA 2PL9A 3L49A 1XD2A 3WK7A 2R8XA 5BPHA 1ZJWA 3L7YA 4WZBB 2G0TA 2B8WA 5D84A 4YA6A 4FNMA 3VNQA 4A0FA 5A4FS 2DZDA 4AZ0B 5ER9A 1IBMB 4LHEA 2HCRA 1W581 1W93A 2BGMA 1DKPA 4EPXA 2Q99A 1RWQA 4FPXA 2EZ9A 1R3DA 2OQIA 3UOWA 4A2WA 4BLQA 3PTAA 4WXRA 3M1IA 3EJWA 1SQFA 3HM2A 1ZMRA 3OIVA 4UVGA 3OESA 4BATA 4CLOA 3OCYA 4CM9A 1TA4A 1IN1A 2G4VA 3WISA 3A1FA 4F21A 4F8JA 1TU0A 1L7RA 3G2HA 1XZEA 3LL7A 2HRQA 2DSTA 4M99A 2Y1FA 5CXSA 1M34E 5D5PA 1M1YA 4HLNA 4UMEA 3OIWA 3LY8A 3R0VA 4DA8A 2QMYA 4WLUA 2FDRA 3CZAA 4PBSA 2PLNA 4GIBA 3DKRA 1K5HA 2XE6A 2GPTA 2F8LA 4HDCA 4QOJA 5IARA 1NW6A 2J32A 4J03A 4L7VA 3FHTA 4YACA 2ONCA 2DHQA 3K8YA 4XM2A 3RYFA 3WGGA 3BWEA 3DTVA 2J3QA 2G1PA 2DTXA 3GFQA 1WMEA 3NBAA 2ZRMA 3RJMA 1PFVA 5J5VA 1GTSA 2VPIA 3HN6A 4PG8A 3FKSA 4LY9A 5DTRA 1IJBA 1IZ0A 1V9CA 3FNRA 1HDCA 5DEOA 2Z4RA 1JDBC 4IH9A 3VU1A 4RL6A 4NPHA 3GRKA 1FYFA 4TSFA 4AY3A 2ODAA 5FV7A 1PD0A 4EA7A 4NCAA 5HZMA 2IUTA 3TNJA 5EJFA 3RWMB 2GZMA 4TLCA 3JTEA 1B8NA 2AEEA 1CEXA 3O8LA 1E3TA 1JDTA 4ID9A 5DNEA 4BX8A 4DIBA 2EQBA 4PSUA 1Z5UA 3ED1A 5JEDA 2HQSA 2V6JA 1MOZA 5IWAB 4EEKA 4N76A 2FQYA 3AEKB 2OFWA 3P4UA 1U63A 3OU2A 1OI2A 1SQGA 3BJEA 2DR2A 3HYCA 3FUVA 3BRWA 4CCYA 5T6BA 5AD1A 4EJSC 2XOKA 3DYBA 4EW3A 4AKGA 3TLKA 2QZ4A 3WWDA 4DCJA 1UPAA 5IYZF 1HT2E 3PX3A 2VN8A 2C8LA 4DBLC 5KC9A 2WK1A 4W5OA 1GZ4A 1WZIA 2ACEA 1ZA2A 3IBCA 3SJ7A 3IQGX 3YASA 5C7IO 3EGCA 3QJGA 2QTBA 5B6PA 4DCCA 4EGJA 1DWPA 3ZK9A 2C5HA 4QTUB 3I5UA 5E0KB 4PYKA 2IC5A 3PC2A 3OQMA 1IWPB 2JW5A 1YQTA 3UJCA 3OH8A 2AOTB 4GDMA 4PFJA 1UPCA 3ZG6A 2JGAA 2WAMA 3UFXB 4ISCA 1NVAA 4RK1A 2VRCA 5EJMA 5G41A 5LLDA 3O0DA 2PD3A 3EX7C 3ZDCA 5JJLA 3THOA 2ECOA 2VA8A 3L4BA 3R09A 1EHCA 1YULA 2XRFA 3WRVA 4B9AA 4QU8A 1E5TA 1SB8A 2X40A 4QBTA 2PX2A 3H7AA 3NG1A 4BUZA 4R9RA 2Z6QA 1NUSA 1PAUA 4DDHA 1B3RA 4QJIA 5KYUA 1O94D 2CGEA 2OVFA 4IKPA 4YAFA 4AY4A 5JD6A 1QR6A 3E22B 2R44A 2XUJA 2JFGA 3GU3A 1MAUA 3A6ZA 4QAJA 4CCSA 2BKVA 3O8QB 1N5DA 1X7XA 4P3OA 5IBQA 2Y0CA 4KYUA 3X43A 3W5AA 3CR3C 3MJDA 3UAYA 2ZSUA 2QZJA 5JXHA 5T6MA 1OLSA 1ODFA 2QDKA 2WF8A 4ARUA 2WHRA 2A59A 4FJ2A 4D8VA 2VF7A 1GPYA 4P2GA 1RM4A 1YDHA 3TYXA 3RRBA 1OYWA 1CY6A 4H08A 3NALA 5DXFA 2YCBA 4JQZA 3R8XA 1NDHA 3IBFA 4BN5A 2PLRA 1KAMA 4G36A 2FMXA 4XGNA 1MAHA 4HPXB 4JUFA 1AK2A 4L2IB 5T8KA 1WKBA 3C87A 1G98A 3GMSA 1W35A 4L5CA 5EZQA 1Z0IA 5AHKA 1Q1BA 4CMJA 1YS1X 1YMQA 3U80A 4ECEA 1QF7A 3KKZA 4KCGA 4P80A 4TLMB 1W85A 1JAHA 5EGSA 1HWYA 3GO4A 3QWIA 3VVMA 3ZU4A 2BLNA 2NVBA 4LHSA 1N2SA 5FADA 1T35A 1U28C 2B9EA 3ZZ0A 3G1WA 4BX9A 3BJIC 3A3PA 1QGZA 2YIDA 3DW1X 3GBSA 4Y8VA 3PIDA 1YUBA 3IT0A 2OMKA 4C06A 1UODA 3PLNA 1SWVA 3RUDA 3LLSA 2WU4A 3M9XA 1S7CA 5KI6A 1YVRA 4WBNB 2YXLA 1SVUA 2J07A 5U1PA 3FSRA 2X3FA 4WV3A 3ZGOA 4FX2A 3JASB 3F90A 3ODPA 2HQOA 4TV9B 4BNFA 4U7FA 5JVDF 5KSWB 3EVFA 5EXEA 2QVCA 4G97A 4LXYA 2YDXA 4XJTA 3L40A 3GUHA 3S4YA 5BVGB 3TDMA 1JT2A 1J8QA 4BCBA 1ML3A 1IM2A 1LS6A 2AK3A 1KP9A 3QOXA 1SCAA 4P5EA 1TJ5A 2R6ZA 2ZUFA 5F5LA 4B09A 5IAOA 1V6SA 5BT9A 3EMKA 1XZPA 4L57A 4DSZA 1CZOA 4DRYA 5I3ZA 2QNBA 5JAQA 1XVUA 2RGWA 3OECA 1SBTA 4WXMA 4BB9A 1CV2A 1O54A 1RRGA 4PQRA 2E82A 3GH3A 5IBRA 3SHOA 5JWRA 1CC1S 1OD6A 4J0IA 4MINA 3V4VB 4US2R 4P31A 2RK6A 2R1TA 2FFJA 3HBNA 1Q0UA 2ID8A 3MJSA 1NN5A 4B44A 5JAIA 2DEUA 1CWUA 3CUTA 3DWIA 3V3KA 2V7QD 4JUCA 3G6KA 2XB8A 1LBEA 3AVUA 1C2TA 4PX2A 4S2UA 4EY8A 4V0RA 2D2EA 3H0CA 3BERA 3KYCA 2AQKA 3P96A 1UC5B 3OPMA 4UU8A 1WZNA 2WWHA 5EZSA 4BTVA 2WI8A 7YASA 3F3YA 3VKHA 4P9NA 5ERYA 1IY0A 1O03A 3A1VA 4DAOA 3EXHA 3MRVA