3NIWA

Crystal structure of a haloacid dehalogenase-like hydrolase from bacteroides thetaiotaomicron
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
266
structure length
266
Chain Sequence
KYKLIVLDLDGTLTNSKKEISSRNRETLIRIQEQGIRLVLASGRPTYGIVPLANELRMNEFGGFILSYNGGEIINWESKEMMYENVLPNEVVPVLYECARTNHLSILTYDGAEIVTENSLDPYVQKEAFLNKMAIRETNDFLTDITLPVAKCLIVGDAGKLIPVESELCIRLQGKINVFRSEPYFLELVPQGIDKALSLSVLLENIGMTREEVIAIGDGYNDLSMIKFAGMGVAMGNAQEPVKKAADYITLTNDEDGVAEAIERIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase
publication title Crystal structure of a haloacid dehalogenase-like hydrolase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 90
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2010-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 3niwA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3niwA01
2HO4A 3OPXA 3OCVA 1T5TA 2OA0A 3WKCA 1TA0A 5ALTA 2R8ZA 4XOUA 3HYCA 3A1EA 5AK4A 2HDOA 3OTQA 2WF8A 1YV9A 2QYHA 3OCYA 1L7MA 1RQNA 1S2OA 2NO5A 5ALOA 5ALSA 4J2TA 4UM5A 1NF2A 2OYCA 5AK5A 3L0CA 2Q5EA 3R4CA 2C8KA 2Q4TA 3WKAA 3FPBA 4EENA 1CQZA 3WK8A 5AIBA 1Z88A 3EF1A 2YBDA 3I6BA 5AW9A 3WK9A 4H1WA 5ALLA 3AR8A 2B0CA 4KX5A 4OD0A 5ALQA 4HGOA 3WK6A 2G80A 2YMPA 2RAVA 3SMVA 1RLMA 1EK1A 2RBKA 3L1VA 2FPUA 2IOHA 3ZI4A 2G06A 2WHEA 3U13A 3KC2A 4UMFA 5AVTA 4Y2XA 2FPWA 5AM2A 5AVRA 2IOFA 3A1DA 1X42A 5AW2A 5ALXA 2ZBDA 3L8FA 2JAUA 1Z4OA 3WKEA 4QQFA 4CF4A 3ZVMA 3E81A 2I34A 3BWVA 1PW5A 3EF0A 2P11A 2CFSA 3ONNA 4RESA 4RETA 2HF2A 4BNDA 5AW7A 3U7EB 1S8OA 3PGVA 3EWIA 1Z4PX 3NAMA 3GYGA 2B82A 4BX0A 1TJ5A 5ALRA 5AM0A 2FPRA 3QUTA 4ZEWA 3QNMA 2PQ0A 2BY4A 4Y2YA 3WK5A 2EATA 2HEGA 2B1QA 5ALYA 4KYTA 5T41A 3M1YA 2Q4RA 4Y2TA 5ALKA 2FEAA 3AR3A 3OCWA 2C8LA 5ALNA 4Y2UA 2WF9A 2B30A 1YJ5A 4ZEVA 3TLMA 1U2TA 5AHXA 4Y2QA 1RMYA 5AK3A 2JAWA 5AKKA 1CR6A 2FPSA 1RKVA 3E84A 3K1ZA 4NWIA 4BBJA 4BX3A 5AW0A 4QJBA 1Z4NA 3MC1A 3QU7A 3RFUA 1Z4JA 5AVSA 2HX1A 5IT0A 5ALZA 3I1YA 3R9KA 4IG4A 2BDEA 2C4NA 3E58A 5AM1A 5AI6A 5A3RA 5ALWA 2I7DA 1QQ6A 1U7PA 4IFTA 1ZD5A 2P27A 5ALJA 3ESQA 3FPSA 2RB5A 1ZS9A 4J03A 3ZTWA 3UM9A 5FP0A 2W11A 2C88A 1XPJA 3ZX5A 3L0BA 3AR9A 1L8OA 4FFDA 4I9FA 2WM8A 4ZEXA 4DW8A 3PDWA 2ZBFA 3QGMA 4EX7A 4AP9A 1Z4QA 1QQ5A 3DNPA 3A1CA 5A3SA 5AKGA 1Y8AA 5AKXA 4C4TA 1T5SA 3QUQA 4FE3A 2JARA 4CE6A 2NO4A 1YMQA 3WK7A 3WGVA 4CNQA 3R09A 2I55A 5AKJA 1RQLA 2VKQA 2EARA 3U19A 3AR2A 3PCTA 4L6CA 3DV9A 4EELA 2I54A 5AW6A 3MPOA 4G9BA 2NYVA 3J7TA 5AW4A 3KOOA 5AW1A 1EK2A 2GHQA 1ZD2P 4L6AA 2CFTA 3QU9A 3FM9A 3MN1A 1O08A 2GFHA 4OHFA 5AKLA 1FEZA 4EEKA 4GXTA 1N8NA 5AKEA 2YJ4A 4Y2VA 4Y2PA 5AKHA 1AQ6A 1RPZA 4G63A 2YMMA 5IT4A 1L6RA 2X4DA 3F9RA 3NANA 4EZEA 1RKUA 5ALUA 2CFRA 2IYEA 1YNSA 2R8XA 3ESRA 4O8CA 2HI0A 3QX7A 3U26A 4YCMA 3UMCA 3ED5A 2P9JA 5AM4A 2GMWA 1RMQA 2G1AA 1L7OA 3HLTA 4KNVA 4UAVA 2YJ5A 4MUMA 3KDPA 4NABA 5AI5A 2O9JA 2ZOSA 5AI8A 1ZOLA 4UM7A 5AKZA 4HAIA 4KX3A 2OM6A 4B6JA 4CF5A 3SKYA 5AI0A 3ZVLA 1MH9A 1RKQA 5ALPA 4FYPA 4UMEA 4BNDB 3CZ4A 2HHLA 2YMQA 4JB3A 1Z4KA 1RLTA 2YJ6A 3SKXA 3ET4A 3OCXA 2G07A 1U2SA 4Y2JA 1YDFA 3UMBA 5ALIA 1WVIA 5AESA 5AVYA 4HGQA 1F5SA 4L57A 2JGAA 2AMYA 3U7GA 2WF7A 3L8HA 2R8YA 5AVUA 1RC8A 2FPXA 2CN1A 3WK4A 4HGRA 1QYIA 3QU2A 5AW3A 3QXGA 1JUDA 1ZD3A 1XVIA 3NRJA 3N8GA 3A3YA 3QLEA 4UU0A 1WR8A 2P69A 3L7YA 1TJ3A 4NFLA 2MSNA 4BKMA 2W43A 1NNLA 2GHTA 4XPZA 3ZX4A 4CF3A 1L7PA 1U02A 4UATA 3ZWKA 2ZBGA 4YIKA 2GO7A 3ET5A 3NASA 3UMGA 3I28A 3N28A 1ZRNA 2G0AA 2O2XA 3WGUA 3AR7A 3IJ5A 2AH5A 5AI9A 5ALVA 3NUQA 3ZW7A 3FGOA 3L1UA 3WKBA 1RLOA 3SF0A 1SWVA 3BA6A 3QUCA 2WFAA 1ZRMA 5AW5A 3QU4A 3KBBA 3N5KA 3NALA 4OFZA 3OCZA 1J97A 3I76A 2I33A 1LVHA 4BEVA 1VJ5A 3ZTYA 5AI4A 3EPRA 4C4RA 2B8JA 5AKYA 4XE5A 4E88A 3U7FB 4AS3A 5A3QA 5AM5A 5AK6A 1SWWA 2HSZA 2YN4A 4C4SA 3IB6A 4F72A 2QLTA 3S6JA 1LTQA 4HGPA 3ZVNA 5AKIA 4Y2SA 3L8EA 3L0YA 1ZD4A 5ALFA 2D2VA 3N1UA 4UW9A 5ALGA 2ZXEA 2ZBEA 5AM3A 4F71A 2ODAA 3DAOA 3N07A 3QUBA 1VFPA 3FVVA 4BX2A 1U7OA 5ALHA 1RMTA 2PR7A 4Y2RA 3AR5A 2G09A 5ALDA 5AIAA 3KZXA 2HF7A 3W5AA 4BYGA 4HYTA 1WPGA 5ALMA 3AR6A 2AGVA 3D6JA 2HOQA 4NV0A 5ALEA 3SD7A 1RDFA 1K1EA 3FZQA 4AS2A 2YJ3A 1L8LA 3DDHA 4UAUA 1Z4LA 2FI1A 1Q91A 4MWOA 1N9KA 3IRUA 1Q92A 4HGNA 5AW8A 3L8GA 4YH1A 5AICA 3QYPA 3W5BA 4YIHA 3NIWA 2JAOA 2DQSA 1L7NA 3QU5A 4UASA 3M9LA 3RF6A 1QH9A 4DFDA 2FUCA 5AVXA 3ZU6A 2WF5A 4UMDA 4EX6A 2FDRA 4JDPA 2ZG6A 1RRCA 1O03A 4NAVA 1ZJJA 4BEWA 3E8MA 4XQ0A 4DCCA 3L5KA 3W5DA 4KNWA 3W5CA 2AUTA 2OBBA 4KN8A 2PKEA 2YMLA 3U7HB 1SU4A 3B8EA 4GIBA 2EAUA 4OCZA 3SHQA 3P96A 2R8EA 4YCNA 4PNHA 3B9RA 3MMZA 2C9MA 5AVQA 5AVWA 4YGYA 2B8EA 3PGLA 1NRWA 1IWOA 1QQ7A 5AVZA 2BDUA 2RARA 5JJBA 1Z5GA 5IS2A 1KYTA 2FUEA 3OCUA 4UMVA 4UU1A 4YCLA 1T9ZA 3WKDA 2IOFK 4Y3UA 1YS9A 1WZCA 3AR4A 3SLRA 2MU1A 2B1RA 4DWOA 1XP5A 2HCFA 1Z4MA 3B9BA 1J8DA 3CNHA 1VJRA 3VAYA 3ZWDA 2YY6A 2G08A 2IA5A 2WF6A 1Z4IA 1TE2A 5AVVA 5E0OA 3ZUPA 2I6XA 1TJ4A 3KD3A 1Z5UA 4I9GA 4UARA 2W4MA 2YFYA
chains in the Genus database with same CATH superfamily
2HGSA 1KVSA 2XMQA 3I4LA 3HXOA 3ZDZB 4BMYA 5G0TA 4QWMA 3GFFA 4RD6A 1XL0A 3MCWA 1A5SB 4BU1A 3F3MA 1PK8A 2HD4A 2DP4E 1U7UA 1YK0A 2R4QA 4U0JA 1XG5A 2C57A 3LUBA 4UFPA 2QLJA 1UK6A 3BL5A 4Z9BA 4D25A 3DHYA 3RDPA 1SXHA 2QZJA 4HWGA 3IE2A 1VB5A 2BKXA 4PLVA 5JSQA 1QG2A 4L8VA 2EW2A 4FJ0A 3KD2A 2WF8A 1NJGA 4JI5B 1H5QA 1VMEA 1VJTA 2JFUA 1Y5NA 3ND9A 1RQNA 2ZJOA 1Y6JA 4MYHA 3KJXA 1SVUA 5KWSA 4OYHA 1VPDA 1L0BA 2JCBA 4NFYA 4UM5A 3W8FA 3AHGA 5AK5A 1Z8FA 2B3DA 3L0CA 3NC1C 3R4CA 1UWKA 3AHIA 4NNPA 2GCOB 1CQWA 1O96B 3VMFA 4NMXB 2RJOA 3WK8A 5JAMA 2FPLA 5BNIA 1E1CB 3G0GA 3KHTA 4KK4A 4UKDA 1KA9H 2IIBA 1G8KA 1ZN8A 2WTXA 1PAUA 2VOEA 4LOJA 4NYMQ 4JC5A 3SGLA 4OYRA 4TZKA 5ALQA 3V7FA 3MS7A 3Q98A 4X00A 5GIOE 1NKVA 1X14A 4KN6A 3L82B 3RLIA 3WGJA 4WJLA 5K3OA 1P3Y1 1CIPA 5ICGA 3ROQA 3LP8A 4Z3OA 5CB4A 2X8JB 2WTNA 3N8KA 5EP4A 5FNVA 3SS9X 3WLKX 2EBUA 1TMYA 3KJEA 4HRVA 2HMYB 1OIWA 2VRCD 3KK0A 4Q4AA 4IQ0A 2B6HA 1RXIA 1RE1A 2ZJ6A 1JB9A 5DN6D 1EX6A 1JIXA 1UMCB 2C9YA 1SY7A 4X7BA 2PXXA 4BO2A 1RYDA 5AUNB 4LJYA 4L95C 3VO2A 4FWTA 5HMLA 1T9KA 3CKKA 3C45A 2A0KA 3TMKA 1DKOA 3T0GA 1O0BA 4J6FA 4FZ3A 4LDPA 4HKTA 1XTZA 2VK8A 4TSKA 2DHEA 4WXHA 1G98A 3OKCA 5JFGA 1PW5A 1VE6A 4D9CA 5HYVA 3QX8A 1FRVA 3UB2A 1J33A 4BQOA 1C3JA 1GZ3A 2BFMA 3U7EB 4AMYA 4GLFA 3UHOA 1SKYE 1LW7A 2C3UA 2OUKA 3NHUA 4DHEA 4Z51A 1J5PA 3JD1A 4HMPA 1GPKA 3WIUA 1E7RA 2P40A 4JHXA 4MQEA 2Q0SA 2R00C 4FGJA 5ALRA 1F1BA 4OAOA 4WKOA 4FGWA 2WTBA 4GZMA 1NBMD 3N2ZB 2QX9A 2PTGA 3EGIA 3SCZA 1E1DA 4CUZA 1ZUNA 5JASA 5LP6A 1L5OA 2P2DA 3C8HA 4IDFA 4TXLA 4GOKA 3BVPA 5E7JA 5DMXA 2J31A 5KNBH 2E6KA 2ETVA 5LQSA 2AOVA 1U8CB 3BL8A 5JZBA 2V0GA 5MN6A 1AZWA 1T26A 3NNDA 3GQBA 4L8FA 1VE7A 3BCSA 2ATVA 3SLGA 2C2BA 3H1FA 2IF2A 4IJWA 3A70A 2I22A 5HRUA 3TE7A 2OV8A 5C7YA 4C4PA 3QWFA 4O63O 5A0VA 3TD6A 5DM60 5M29A 3ME5A 3HPQA 4P36A 1GL6A 4F91B 3BTUA 1CNFA 1YE8A 1KOJA 3UJ9A 1XTQA 5I7RA 1NRXA 2EBHX 5KDDA 1P3DA 2UDPA 2VP3A 5F7ZA 1CUYA 3K05A 3WGTA 5FO0A 2JAWA 3I53A 2CYBA 2VXBA 3P9SA 4NZPA 3E84A 1K06A 2BFNA 1U1FA 1YVPA 4QJBA 1ZU5A 4XASA 3SBEA 2HXYA 3NEYA 2WK1A 3H9BA 2HX1A 3HFRA 5IT0A 4UZSA 3K4HA 4UZEA 3WYEA 3H42B 5KKNB 1VLHA 1DFHA 1U3FA 3R8XA 3EXHB 5EIXA 3CSSA 4CLRB 2QXYA 3PUKA 2ZTVA 3UF0A 4MHSA 2IUSA 4OG2A 2NIPA 5DBEX 3GLIE 4AAYA 2JEZA 3E58A 3KVRA 3SZ3A 1B15A 2ERXA 2D5BA 3KVYA 5CH8A 3JR3A 4M6WB 4XCVA 4ZKDA 5A3RA 5C35A 3AHFA 2OO3A 1C3XA 4Z1MD 4YJ2A 3JVEA 4Z2AA 1AMOA 3G68A 4DREA 4UBMA 2E1PA 2RHOA 1EHCA 4WOJA 5FTJA 4A23A 1QE5A 3A4LA 2X2FA 1GPMA 2XT9A 5JYDA 3AFGA 3OETA 4L2IA 1ZITA 5JDIC 4CKZA 2V1XA 3STXA 3NVKI 3Q9LA 3WBFA 1NN1A 4PPYA 5A7FA 1YDEA 1IL0A 1XTBA 2EX0A 1Z63A 2R7KA 1Y9EA 3LDUA 4RHFA 4IPTA 2JC3A 4WBSA 1JFTA 2X8WA 3EDYA 3ULKA 2O2HA 1NRIA 1PEDA 1A9XB 2W58A 3G2QA 2HW8A 3HK2A 4TZ6A 4F8EA 5CBPA 5G02A 1WKVA 3MPUA 4IEEA 4RZXA 1NV8A 4IGIA 1GR0A 1YRQA 3DXXA 3DNPA 4KO1S 4KYIB 1QLJA 1QGYA 2EKZA 4YMGA 1P7YA 3DV0A 1QOZA 4F8YA 5I4KA 3JQGA 1VKHA 4PSDA 4CHGA 1Q1EA 2Q4DA 2Y4NA 3K35A 4KGDA 1MOSA 4L78A 2XRYA 1E62A 1SBTA 4M38A 3U3ZA 1WOMA 2FE1A 1TZMA 2O7RA 4E13A 1U6JA 3KKOA 4KP7A 2ZIZA 4OOEA 2H16A 2RK3A 3D2AA 4R9VA 1S8AA 2KPOA 5CH3A 2R6HA 1F2TA 1CFJA 2J5QA 4U7GA 3R7WA 2EARA 3SNKA 2HK6A 1WCWA 3VH1A 3KR2A 2PEYA 1VBFA 3H3XA 1EDDA 4EUFA 3SY8A 3PFCA 1KDTA 3ILVA 1WMAA 2C4KA 3LD9A 4RLHA 1OT5A 3QPCA 4XFJA 3SVZA 4CQMA 2VJYA 1XZDA 4K3UA 4MV7A 4WNIA 2RGBA 2FLVA 2ICAA 1A5ZA 2QM8A 1BOFA 1ZX1A 1T9AA 4N7MA 2H63A 1EG7A 2ZE6A 2GHQA 1F2UB 1P5ZB 4HRAA 4DIEA 1PHPA 3R7SA 4X94A 5KTRA 1VMDA 1M5TA 4L6AA 5DIFA 5WRFA 3TWOA 3E03A 1CY8A 4XTCS 1RPAA 3RVPA 1D6NA 4FI3F 5DTIA 3KKLA 1GZVA 3FBGA 2CDBA 4Y2PA 4WOPA 4I1UA 5BSHA 2QRJA 4JLMA 1GCIA 4KHZA 1FTSA 5E1BA 2PLRA 5K3SA 4GH5A 1WHSB 2HI0A 4R8RA 3VX3A 2NPOA 1BXRB 3S2ZA 1GA6A 2SNIE 4RZQA 1FB5A 5D1NA 5ESXA 1WXXA 3MERA 4W8GA 1M0WA 4JYBA 2DLNA 4B09A 1QVRA 2QB5A 1HFWA 3GEEA 3DP9A 2QD3A 1YB1A 5IPFA 5FOSA 4E4RA 3BZBA 3HLTA 4AY6A 2YYZA 3BBPA 3H9UA 5TT1A 2D1RA 3RWMB 1DQNA 1KQNA 3W4KA 2PGLA 2VI5A 2WTMA 4E2YA 5JC8A 5JRDS 4CL0A 2BD0A 3OUTA 1Z25A 4LBVA 3PX2A 1ZIXA 1ZOLA 2A5GA 4LE1A 5JWOA 1QP8A 2C82A 2QRVB 2VJNA 3ETJA 3H65A 3KJIA 3UAOA 4BIIA 2ADMA 4JJ4A 1N78A 4TLAA 4AKTA 4DV3B 4FEGA 2I0FA 2I6FA 1J8FA 3ETEA 4R3NA 3EFOA 1JR3E 1JFLA 3H9GA 3MTIA 3VR4H 2CK3A 5T3UA 3JWHA 1CK4A 5K3FA 4JCCA 3FMOB 4HMOA 1IXSB 2GNAA 3ABZA 3ZU5A 4BNFA 5KUTA 3KKKA 1RIFA 4W5QA 1AZSC 2DPGA 4YAOA 5C5CA 2O52A 3COJA 2WKPA 4PCVA 5D84A 4E07A 1UAAA 1JFVA 3F4LA 1IZ0A 2WJJA 2AHRA 4H7DA 3WRXA 4P4SB 2BMFA 2CZQA 4J91A 3AY7A 2ZRJA 2G7MC 4NOMA 2J3KA 1N92A 2FETA 2WOJA 1VHDA 4DIFA 4EPYA 3H11B 5LJIA 2I2BA 2EOAA 1WMSA 2F67A 3DS8A 1IIBA 3NRJA 4R2JA 3WYGA 4YAUA 3VR6H 3DEIA 3QF4A 2JFYA 5BNZA 2CXQA 1ULSA 3HWSA 4PXAA 1Q1GA 2JGIA 1MFZA 5JS8A 2JKYA 1P0PA 2DULA 2X8AA 3SHTA 2V7XA 1KKUA 2QN3A 3C74A 4LZLA 1I5EA 1E3WB 3ORHA 3UH0A 3VA7A 3A0UA 2JA2A 3TL2A 1NUHA 2Q5HA 3IUQA 4B35A 1CUBA 1Y4SA 2JKZA 2OD9A 2YIDA 3IJ5A 3OI7A 1JQ3A 5EKSA 3SKVA 1N3IA 4B81A 1XR3A 1S3SA 1SRRA 2B83A 5CLGA 4BMDA 5K6AC 3IERA 3L9XA 1P9WA 4NTZA 2WD8A 4U7JA 1NIPA 4LY3A 1GFSA 4E1BA 2XY4A 1IBKB 1YHYA 2PMCA 4RSGA 3VGPA 4K03A 2GCOA 2XYRA 1HLPA 2UAGA 2XA1A 2Z83A 4CKYA 5CX1A 2G4CA 2R6AA 2CT8A 5IC5A 3FLMA 3FVTA 4EDFA 1JIJA 5AW5A 3O3CA 3UPUA 2B4YA 1L4LA 5A7HA 4CT5A 4KTTE 1JSRA 1Y5MA 3WTCA 4HNGA 2JD2A 3I52A 3VYWA 3HZRA 4N0EA 4L85A 1A04A 2V98A 3VYUB 4EKGA 1ZW1A 1SCNE 4A7PA 1PNTA 4KO3S 3E82A 2H11A 4DF3A 3VUEA 2Q5JA 3JVIA 3IS3A 3VDQA 1G6HA 3O3MB 2RDMA 1Z28A 3GLRA 1V11B 3AZQA 4HB0A 1NZDA 4IX9A 4P98A 1CZHA 5IN5A 4LWPA 5JCOC 3AVOA 5AKYA 3ZXYA 4EA6A 1RKXA 3GAAA 4UEOA 3LRTA 4KKXB 1D1SA 3CURA 2Z8YM 3TOXA 1LTHR 4NK4A 1O5OA 4YMIA 1M1XB 3ABQB 3BMQA 3KPVA 4MS1A 3DAFA 2G1UA 2V9ZA 3FYTA 3KEQA 4YUVA 1LTQA 2DFDA 3A6HA 3FDXA 1FFGA 5T64A 3WAJA 5JCJA 3X1ZA 4AP6A 2GGSA 2RI6A 3LAWA 3BPSA 5A5GA 3E5HA 1AXEA 4Y2SA 2LDBA 3AF0A 3ZZUA 4E3ZA 2HU5A 2SKEA 4D96A 2GF0A 1TTQB 3GBSA 3N1UA 1XF1A 1UBKS 2EG9A 1MQ9A 4P7GA 2VUHB 4UW9A 5ALGA 2BCEA 4ZAZA 5FJJA 1F1JA 1M10A 3FVVA 4GW3A 2DX7A 3KQOA 4AWAA 2P2LA 4YMWA 5A9RA 1QFSA 3B5JA 2NLOA 1ZBQA 2FDXA 2PZ8A 3RSHA 2MCFA 2QN8A 3F7MA 4YJGB 1P31A 3ROTA 4BYGA 3MJVA 1ACMA 1A8QA 5KAPA 3P0HA 3AJ9A 5BUSA 3BMCB 3PS9A 3U3JA 3SD7A 4DJFC 3NO4A 8OHMA 3KUCA 5LKAA 2H5LA 1LGYA 3ACCA 1L8QA 4M7RA 4YRRA 4D9KA 3HXLA 4ZT5A 4NOLA 4ECEA 4BB0A 2ACKA 3A06A 5HUQA 3IRUA 2AN1A 1C1XB 3CUEF 5I5GA 2P6RA 4EB6B 2VAPA 1NVGA 4RVGA 3NR2A 2IBSA 3LU1A 5AUOB 3AXSA 2GA8A 2YC2C 3QFTA 4EL5A 5H9VA 2H1OA 3QYPA 1V47A 1IOLA 4H35A 3R40A 3GUZA 3RBZA 1FNDA 4K05A 1L5MA 1WP9A 3OZEA 4V02A 5FTWA 3DZ8A 2YHIA 1SXJD 4LSWA 5BVGB 3IB3A 3D7RA 5IUKC 2XMRA 1Z73A 2IWHA 3W77A 1XALA 3NKVA 4JH0A 5JANA 4ER7A 1JG6A 3FWZA 2I2WA 2F1JA 2D0OB 2GD2A 1SU4A 2BKAA 2OCYC 3IHLA 1VIAA 5JJCA 1DAMA 3HYNA 1WBBA 4WECA 5BSGA 2P7IA 4CLRA 4RELA 3OURA 2TYSB 3JYOA 4RIFA 5AVQA 3UAZA 4F3YA 1JKJB 2CVPA 4M6WA 2JJ1A 3QG1A 1QQ7A 3MWKA 3D9QX 4US1R 1GGNA 1T2DA 4Q16A 2RARA 2XD4A 2Y6UA 4AURA 4XGQA 5JJBA 4KFSA 3T3DA 2C98A 2PTHA 4MS3A 3W6OA 4F2WA 3F97A 1T9HA 2ASEA 3C3PA 1C8LA 1C0LA 4R1QA 3ZY4A 4R0VA 4RKWA 4ZXPA 4EHIA 5T57A 4AXXA 1NQ5A 4RSRA 5EJ7A 2RHDA 3HRKA 4B4KA 3PQ5A 2BONA 4LK2A 4JFRA 5DT2A 1R6TA 4HFMA 1XP5A 1SVIA 2Q3DA 3BSYA 4JDUA 4Q9HA 4XRRA 5E95A 2AS0A 3NXSA 4BKRA 3OFSA 4ENUA 3DBLB 4YRSA 5CNKA 5AJVB 5A6SB 1R4NB 4TMYA 4D74A 4IQFA 3R77A 1Z4IA 5BSEA 1V37A 2X0RA 2I65A 2P2YA 4YCDA 3UGJA 3V7YA 2F3SA 2A1IA 1NWCA 4OFWA 1EA7A 1UMDA 2QT9A 5GJCA 3QTTA 3L7BA 1HLGA 2B7LA 1TX4B 1W6RA 5E7QA 5GOTA 3W2GA 1GL9B 3D0KA 3QTLA 3OCVA 4IBOA 4K3VA 3UHJA 3GMSA 2DHCA 4HEA1 1XZQA 2G36A 4H16A 2XIQA 2I9PA 4KJZA 3NWJA 1CUCA 2E21A 4N39A 5KTTA 4KQGA 2XTAA 2X3UA 4TTVA 1NNEA 3PLAE 3PL1A 4XR9A 5HE9A 3BIWA 2WQZA 4JENA 4BJ1A 3DMHA 1N0UA 2B69A 5C8VA 2HUNA 4B2LA 3GJ4A 3CEPB 3V1KA 1KF0A 3CM0A 1GPNA 5GVRA 2QTWB 4Y8VA 3UCFA 1PFVA 3NWBA 3GPCA 3O8NA 4J2TA 3U3DA 5KDOA 5F1OA 3TNFA 1C8KA 4Q4DA 3M2PA 4BZZA 2V3CC 1TEZA 3LTEA 1TGVA 2YRWA 2ZRBA 2BFAA 4WOBA 3VU9B 1WY5A 4EENA 2V97A 1J0XO 3EUFA 3H9QA 4JK3A 1KKMA 3DDSA 3VC3A 3SVLA 4R2HA 4TV8F 1YI1A 2HRQA 1K3FA 3A4IA 4QNNA 4G0YA 3RPEA 3EY4A 1FYEA 3PHCA 5GZ1A 3OESA 1Z16A 2FSVC 3SIXA 3VTFA 3ZHCA 4OYLA 2QVLA 3U40A 1GDDA 2W8BB 1QNFA 2QZZA 3E9YA 4HGOA 4R2WA 5EY5B 1DAHA 1D07A 4G5GA 1SU7A 1AS2A 3NEPX 1LS6A 5LXTF 2NNLD 2ZYWX 4DC9A 5E9AA 4CGYA 1XDBA 1Z5PA 5BVHA 5REQB 1LX7A 4J7CA 4URZR 5FI5A 4K9MA 3ZDEA 4IV0A 2C9BA 3JQCA 4GYKA 5LB4A 1VG9B 2IOHA 2D06A 5I9NA 4X1OA 4HBZA 1CVLA 3N2NA 3PTAA 1D0IA 3TTVA 4M0UA 1U5CA 3RSCA 1NOKA 3W6PA 1E5XA 1GL7A 1Q1BA 1RSZA 2IU4A 1GM5A 3RYIB 2ZDHA 2CVZA 5F35A 2AC7A 3PC4A 2R5FA 2OP1A 1MT0A 4ME6A 1YRLA 5HTKA 1N0HA 2ZRPA 3RTDA 1I32A 1EXDA 1TAQA 3EC1A 1N5DA 3EVAA 3RC7A 4WKBA 4X6YA 5FH9A 1A71A 3R0JA 2Y1EA 1QKKA 4YDSA 3BGVA 1LBIA 1A7AA 2GTIA 4RXTA 4TUYB 4BNLA 2XUOA 2WSLA 3JQRA 5LBIA 1L7RA 1ZM2A 4B5LA 4ENWA 3KQVA 2NXNA 1MO2A 1EAMA 3P2KA 5AVKA 2PZBA 1YRHA 5TJ9A 4GF5A 5MF6A 4Z7NB 1OWPA 4WXYB 1ODCA 2XOKA 4NIMA 1O57A 3GZNA 2EATA 1I3CA 4IIYA 1ISRA 4P4SA 4TV9B 3DPIA 4YXWD 3GWGA 3DC2A 1OHHD 3H99A 4I3HA 1X7WB 1OZHA 1SVLA 3D8BA 3OCCA 4MKIA 4OAPA 4ZIRA 5ALYA 5C4IA 1M6VB 1E9SA 4LQDA 4H27A 4OP2A 3TCKA 1P4RA 1A8HA 1AHNA 2MINB 4ND5A 3WWCA 5DTMA 2EFDB 4KXWA 2ZUFA 2E6UX 4AMZA 1Y4DE 1RZUA 4GGOA 4TTRA 1N34B 3LYAA 3P2OA 3CF6R 1XXHE 2O20A 1G5QA 2ZDGA 4MW5A 2C2OA 2NGRA 2ACEA 1KSFX 3O03A 1XLWA 3ZLTA 3N0RA 4E5MA 4F46A 1XDGA 1E3WA 2ZSAA 5EJGA 3KYDA 4IMPA 3IEVA 4TX1A 4MYSA 3LQQA 2F1IA 4ZEVA 4BFYA 5GJBA 3F5SA 3GJXC 4O1IA 1O6GA 1KRWA 1C0KA 4ZCTA 2EX4A 5KWEA 1HUQA 3WRYC 2PMKA 3BF8A 1F6BA 3OY7A 4D4GA 4NH0A 3RVSA 4TVBA 4ZMBA 4GKKB 3ZR4B 3SR3A 5ECWA 5BPHA 2FLKA 2HY7A 3IO5A 2RHLA 4Y9RA 2F6RA 2P9EA 3T3HA 1SKBA 2ZSIA 1GTMA 2HRRA 2J09A 4F3KA 4UXHA 1JAXA 2VF4X 1BS9A 3ELDA 4AMBA 1FNSA 2PJDA 5FI0B 2VOJA 2IUUA 1H8HA 4JKIA 1WMFA 3N2KB 5LLDA 3EQ7A 5EE9A 4YK7A 1N5OX 2R7LA 4FX2A 5C5EA 3D3WB 1NZJA 4H3VA 2F9LA 3TPZA 4F5ZA 3E1SA 1P18A 2CW5A 2UXDB 1IY2A 3ZS9A 2RKWA 1GNQA 4LDAA 3A6FA 1AZLA 3LA6A 5LLTA 1KWKA 4P4LA 1TMOA 1JGTA 1SUWA 4PBTA 3DMYA 1VL6A 4QNMA 3OVMA 3L6CA 2FWRA 2FQWA 2IC5A 2PL5A 2PA3A 3FFWA 4NYJQ 1ZOIA 4G9EA 3LUJA 4RTRA 1W4ZA 4IIBA 4FP9A 3A6GA 2FEWB 3L0BA 4GMFA 3SXPA 1JQDA 4UNSA 1JSCA 2Q8NA 2YZGA 3GJ8A 3QOFA 4DT1A 1AH2A 1X0XA 2WPDD 5L3RA 3AM3A 2Y0EA 1N4DA 2NT4A 5ULLA 1R3UA 3FNIA 4BX8A 3U56A 1EFUA 5A3SA 1Q7CA 3CKMA 3GEGA 4JLNA 4KCGA 4ZRMA 3TAHA 2J9XB 4LHVA 3WDKA 1KZ9A 4BMSA 4C4TA 3TZQA 1EUDB 1QG4A 3G7UA 1QF9A 1PEYA 1YQQA 4LZJA 4RD4A 2W4QA 3AC0A 4U5QA 2LVBA 3DEYX 1M6YA 4FPXA 3SX0A 1ND6A 3WSVA 3WGVA 4OQFA 3ZGZA 5FR1A 4CNQA 1NF8A 3ZDXB 2WWGA 4PR3A 4YJGA 5LDGA 5KOIA 1R5OA 2B78A 3B52X 4HAXA 4RTKA 1N8TA 3EYAA 1JBQA 3DDOA 3FHJA 1J1ZA 4I8DA 4RZUA 4YP7A 3S1SA 4RD3A 4QULA 2JIQA 1L5NA 4YO8A 1PK7A 4M9QA 3Q7TA 4N4AA 1AQIA 5HKLA 1EX9A 1GKIA 1RAEA 1G63A 2WIKA 3N8DA 3JQPA 4O1MA 2VTBB 3EVFA 1TD1A 3NONA 4N9QA 2QTCA 2Y68A 5E6UA 3O8RA 3IKVA 3PC8C 3GLFA 3KFVA 5BO5A 4WNAA 3V80A 4HPXB 1JE1A 4LZWA 1GVNB 2I3BA 2Q2VA 1XZGA 2V96A 4LCBA 5C34B 9ABPA 3BL6A 3D6UA 1WEKA 4ITUA 3RUDA 4EB6A 4TXNA 2VSOA 5KREA 2XB8A 3B85A 16PKA 2CKDA 2IZZA 1JB1A 1YQGA 1FVXA 2YZKA 1AQLA 1VZ2A 3G2IA 1FUIA 3LKVA 2VYND 5K99A 5M5BA 1D6MA 2JH9A 1PU2A 5DSXA 2YJ4A 1O4VA 2EF0A 3EDMA 2PX2A 3JQ9C 5K0GA 1RPZA 3RS0A 5LQRA 3MAAC 3R6TA 1C1DA 3EPJA 1MV5A 1MHPA 8LDHA 2ZZMA 2AG6A 4P3PA 2ZTHA 4A8JA 4EFLA 2Z3VA 1SXIA 1V7CA 4UE2A 3M3HA 4CXMA 3COVA 2A78A 2W2QA 3JATA 4MUNA 4B43A 2G8NA 2NACA 3MTJA 5LZ7A 5BV2P 2GEJA 3RU9A 2ORYA 5KNCD 5A05A 4RWZA 3DSRA 2PRIA 2JH3A 2V6GA 3L93A 4P4GA 1CLEA 4TPKA 4NCBA 4RKYA 4B3JA 2D3TA 2QLFA 4BNHA 4RZ2A 4CQJA 1P2GA 4ZT4A 5ICCA 4B9AA 1P7PA 1PJQA 4N0MA 3TD9A 3JWEA 4KRXA 5C52B 3B82A 4LF5B 3KB6A 2QNBA 1Y48E 4Y1RA 4YGXB 3PEWA 5L8VA 2GAJA 2P5YA 2VDPB 4V0NA 2WSSD 3USES 2RSLA 2GCIA 3ZH2A 4ED9A 5JCZA 1VIMA 5AVOA 3V9PA 3GLSA 5J4LA 5CPBA 2DB3A 2FP4A 4Q37A 5KHLB 1WULS 3PBKA 1HTTA 1EXMA 3GAZA 1QHGA 4EG1A 1E18A 1EI9A 1QV9A 2FRDC 3KJZA 5L3SB 1W44A 1KSHA 1ZMTA 1I2AA 4JB3A 3L46A 1E92A 4BKUA 4X6LA 4GYYA 4K1LA 4NP6A 1YDFA 2B2NA 5AESA 1JA9A 5AVYA 5CT4A 2VXYA 1JHPA 2UVDA 3KR0A 4ZQFA 5KTYA 4P0PB 4GLLA 5HP4A 3MTBA 4JZYA 4Q3OA 3G5UA 2FXIA 4N9WA 3R24A 5AVUA 3T3NA 1Q3KA 2PG3A 3GCWA 1Q6ZA 1Q1NA 4V0RA 3GIWA 1DPGA 5DTEA 2FFRA 4C0KA 1E2BA 3KZMA 3MS4A 1CUDA 3AL3A 4OMUA 2QRNA 4OV6B 4QHSA 1ZD3A 1B8PA 3G23A 4O3FA 1D04A 2EVWX 2VHYA 3NBUA 1UR5A 2QY6A 3A3YA 2H1RA 4N3AA 2OORA 4HEA6 4DSNA 3AF5A 2NSLA 4NFLA 1RTKA 4YECA 5HK8A 3A27A 4TWJA 3GJYA 3ZX4A 3U9SA 3Q88A 4B6PA 2PVPA 4K9KA 3W7VA 2C7RA 1YXMA 4PGGA 1H2BA 3FSGD 3ZWKA 1NVBA 4DJTA 2JIZD 1RCFA 3UMGA 1ZRNA 2G0AA 2WHYA 3QPUA 5ELMA 4CFSA 4EB3A 2J3MA 3H8SA 4D41A 4RGBA 5C18A 3C5VA 4RA6A 5KOJB 4GGMX 2IZ0A 2ZVDA 4C6TB 1KEEB 1DP4A 3E05A 3FETA 3H18A 1XJCA 4FNMA 4IUCS 4JVOA 1ZUD1 4WESB 4O4JF 4Q0MA 5FQOA 4JI4B 2XEDA 3BQNB 4RVUA 4E1AA 2FEMA 2J0VA 3VU9A 2PS3A 1JEQB 1UM8A 3DBRA 1DC3A 4RTJA 2DHRA 2QGZA 3TEMA 4G0PA 1F6DA 5EJIA 5EJ8A 2GBCA 3RS3A 2Y3IA 5CFRA 1DAGA 1ULZA 4G86A 5DGXA 1GRCA 1GFZA 1IXKA 3FN4A 1NASA 3O8QA 3KBBA 3N5KA 3R5TA 4IUBS 1ZK1A 4PYJA 1ZU4A 2VLBA 1LPOA 3CRQA 1UCFA 3G8YA 1G17A 1E2UA 3HYSA 3IT0A 4POAA 1YJQA 3DOIA 4TS3A 2I33A 2RH8A 3Q8MA 4RHTA 1YQ9A 1VSTA 5EJ9A 3OHMA 3NHAA 2A94A 4BEVA 4E1VA 4CM5A 3KSRA 5EXTA 5F5NA 3V55A 4EKIA 1K7CA 2BKLA 2RBEA 3DPUA 3ZDAA 5LIPA 1G8MA 3REQA 1R9JA 1U3VA 1QAMA 1V8ZA 2CLCX 2QYOA 3K6JA 4WNYA 4AJPA 5JSHA 6AT1A 1BHJA 2OOSA 1SA0B 3N7AA 4D6XA 4ESHA 4F6CA 2YN4A 1LDBA 3WQHA 3H2HA 3G8BA 3LXXA 1DIRA 3FIUA 3GHYA 4HGPA 3G89A 1HXHA 3Q6NA 2AWNA 2OSVA 3H5IA 4M37A 1B73A 1GCUA 3MTGA 1X8KA 3BSSA 3I45A 2H2AA 1N32B 2HWYA 3OZ7A 1DBRA 3EQ6A 4RQAA 4YUAA 1YF3A 4CQNA 2VRCA 2P7HA 3DAOA 4RGYA 4C0WA 4B47A 4LF4B 1VFPA 4FCWA 3U31A 5DN6A 5ITVA 2PZGA 5EMMA 4MTLA 1QDUA 3CNEA 1XHEA 2RHJA 3AR5A 4W6ZA 1JALA 1QZ3A 1TC1A 3BRWD 5HNKA 5KTKA 1MDBA 1RHMA 3GRYA 4RF3A 2F2TA 3QW4B 3THSA 3TLGA 2G25A 5HJEA 3AF1A 2AE2A 2KHZA 4TTIA 3K0HA 1T5HX 1W88B 3IO3A 4GI5A 5DHTA 2UZ4A 1TYDE 3DCNA 4I50F 3UJ7A 4D43A 3TRFA 2XT6A 3MILA 2EL9A 2GASA 3DOEA 4QNRA 4R51A 4UOZA 1IMOA 521PA 3DHEA 2KSQA 2YJ3A 3CH7A 3ZBUA 4RTSA 5KO2A 4L75A 4CM9A 2C29D 1YI8A 2Z4RA 3ZWWA 3DWGA 2AX4A 2NO9A 2HADA 1IATA 1IWBB 2FPMA 3LQ1A 3A7DA 4D8YA 2OPBA 4FYKA 3ISJA 3BXHA 4A92A 4EW3A 5LYJB 4WVLA 3E7XA 2HA6A 5K1ZA 4GZ5A 4Q03A 3UHFA 1C7RA 1EM8B 1G21B 4TKLA 5CXXA 4DANA 2FPOA 2NADA 3BUSA 2AC2A 4YJFB 5H0IA 4E51A 1TCBA 1KHTA 1W1IA 2PWAA 1QOPB 1YUMA 4M0CA 4MJXA 3M4ZA 1GTZA 4TQUS 1B4DA 1N2ZA 4NR0A 4X6XA 1ZM7A 4EX6A 4N76A 2GAFA 5IJZA 3TX6A 1RRCA 4XQ0A 1HEUA 4KNWA 4GX1A 1Z68A 2D1YA 3UWOA 5AOCA 5A62A 1OA1A 4MDFA 3DKVA 3T1YB 1T9CA 3EPKA 3VO1A 3SHVA 1PJSA 1FMFA 3MMZA 4JP1A 4QEKA 2J3IA 5FBWB 2C9MA 4QQRA 1EP3B 1DU4A 3H5RA 1RZRA 3ZGVA 5LFAA 2FQYA 3TQTA 2ZJ0A 2R65A 1WCV1 3B1ZA 3MWDB 2B8EA 2GLXA 3EIUA 4WRRA 2GRJA 1VLQA 5GTDA 4B4DA 2IVFA 1E0KA 1KIAA 4FGZA 1AVTA 3FB4A 5CT9A 1J7KA 2B92A 3A2NA 3FOAA 3FXAA 4ZRDA 5GONA 5JSZB 3FR8A 4O4HA 4Q3BA 5HS6A 1J8YF 3D0OA 1UC4B 4GL2A 3HBJA 3DXYA 5C1PA 2H2DA 2HMTA 2VP5A 3FVWA 1FNCA 1VCIA 4UBKA 3T9CA 1MF7A 1A5AB 3KJQA 3ZHZA 2PBZA 5LU9A 2QT1A 2OB2A 2PBFA 3FDFA 3G5AA 1VKJA 2W22A 4GX2A 4OBEA 4XYBA 1ZNWA 2OLEA 2VBGA 5EJ4A 1SKQA 1BW9B 3EXIB 4OUDB 4HDMA 4Z1MA 1LWOA 2YY6A 3HKCA 3AO0B 3HBLA 2A9KA 4HWPA 3WICA 1QRSA 4I0WB 2VEDA 3EOBI 4G89A 1GAXA 5JZMA 2GD1O 3PC6A 3EWSA 2GERA 1J0EA 2G28A 4Y9TA 1KJ9A 5H5JA 3LSYA 4CI0B 5K6TA 4OHZA 3RT9A 2ZRAA 4O02B 2LGJA 4W9NA 3WMFA 4H6XA 1SRQA 1I01A 1N25A 2GM9A 1JPNA 2HSDA 3DM5A 4GX0A 3KKPA 3OPXA 4ZYXA 4H6PA 2LP4Y 4CN9A 2G9ZA 5I7HA 1GZ5A 5DJ5A 1OLSB 1KBQA 1Y1TA 3RASA 4C29A 2QTFA 5EE0A 2H59A 5CNIA 2J33A 4QTXA 2F4NA 4OH1A 4QDKA 1IPFA 2AG8A 4WCDA 1R6UA 5EWJA 4P54A 3I4FA 3RSQA 1Q50A 4EATA 3WSWA 1NYLA 4EHHA 3BF7A 2J3JA 2JGDB 5EIEA 4J0IA 3OU7A 1UINA 3UYKA 3QLUA 4DV6B 5I48A 4L02A 3GDGA 1TZ2A 2CWWA 1VLJA 4LV5B 2E9SA 3BSFA 1NL3A 2OR3A 4HDKA 4ZVKA 2A92A 5DSZA 1NBEA 4ZK2A 4F3CA 5CA1B 4YEDA 1DARA 1TAHA 1H2EA 5I7VA 3KOYA 1BO6A 2OK8A 2GBLC 4EHJA 3LKZA 2AOTB 2PWPA 3TLAA 1P5FA 4UTVA 4UXJA 4GLJA 1IVSA 4GQBA 4GG1A 3VNSA 4AZ0B 2Z1DA 3WLQA 2GCPA 4F7DA 2Z9CA 2BLNA 3F7NA 2NZVG 3U9LA 2CLKB 2GO1A 2L18A 2G17A 1AHIA 2UU9B 4ZDIA 5HM8A 3IKMB 4QVGA 1VKNA 2VNIA 4NJEB 4GSYA 7REQB 3O93A 3LZ6A 3O8LA 2JLSA 4XIGS 2ZI9A 1OF1A 3KETA 2HIMA 3OX2A 4M7OA 3RAEC 1OX6A 5KVVA 3VNQA 1E7WA 1W2WB 4JVLA 4I5EA 4QDOA 2E4YA 1DG3A 5DNWA 1SU8A 2O57A 3VPFA 4S1NA 3H9EO 3T1QA 4MQ6A 1AKNA 1XN4A 2C00A 1XU4A 3U3MA 2R0QC 1F06A 1MEOA 2XOEA 2XUIA 3NT2A 3BDVA 4IXNA 4WXPA 3WKEA 4BVKA 4A26A 3HJBA 1M8FA 4ARZA 5HIMA 1RXYA 1TQDA 3C6ZA 3K2QA 3ZVMA 1GRVA 4Q7KA 3OTWA 3KCNA 4LXUA 5M34A 1YUBA 5KNDH 5DNEA 2OESA 2ZAIA 3AEYA 3AFNA 4W5HA 1BQ4A 2VWGA 4NDZA 2OV1A 4DBLC 1T5LA 4ZYWA 2F62A 3JZMA 4RADA 3BCUA 5BWOA 3KOMA 2GEDA 1JTEA 1CUGA 3RYCA 1UC9A 4RH1A 1S01A 2FWMX 4MVCA 4V0LA 5LB2A 1JVSA 5JQGF 1LD3A 1W1UA 2FFAA 3AGQA 1OV6A 4R1OA 4UPDA 5KJ1A 4JUFA 1AC5A 1MRNA 1TGYA 2EXXA 2BY4A 4NZ9A 2D2EA 4PYRA 4BNYA 2F4VB 4YP5A 3ZY3A 4HAWA 1VP9A 3RADC 1S1MA 1HX7A 1UXOA 3E48A 5CFLA 2GWHA 2CXNA 1RJ9B 1JIIA 1QGED 2QSYA 2ZSBA 4OJNA 4Z99A 3UWDA 1CUZA 1V8OA 4KYTA 4QVIA 4NCAA 4KR6A 4GOJA 4Q9IA 3IDQA 2Q4RA 4XLZA 3EAGA 3KP1A 1CDDA 3STVA 3FKSD 4RLQA 1Y8RB 5TNXA 2R1VB 2FUG1 3V4PB 4RU1A 4DSAA 3GFSA 2AI1A 4F5YA 1XOIA 2H3EA 3C8DA 4E08A 4PBRA 3T7CA 5LZ5A 2YS7A 1EUZA 3I34X 3B2NA 3DO6A 2A8YA 3I5MA 1XMJA 2C5EA 3LKDA 1C9KA 2WF9A 1P2BA 2GB4A 5TT0A 3T3MB 1N1GA 1NN3A 1T3SA 4K1XA 2IHKA 3JXEA 4UHFA 1A9TA 3AM1A 3A4YA 1I51A 3GD7A 3HR7A 3TCXB 5HR5A 1MU0A 1WQ4A 4RAQA 3NHKA 1KEEA 3PYXA 3C1OA 4WESA 4C0XA 1ONPA 1SEVA 1JU9A 5LWQA 2FN9A 1XJWA 4HNUA 1ZVQA 3NORA 1CR6A 2EJVA 3FPEA 3X44A 4MV5A 1KEWA 3AI7A 3EZ7A 1UT6A 2HQBA 4ER5A 1P2VA 4JI2B 2ZYDA 1DG9A 3M0EA 2QQ5A 4UVHA 4OJTA 3UA4A 3UMFA 4AY4A 1LK7A 2F9MA 3ZU2A 3NHPA 5FDFA 5IHXA 2PGIA 1FFBA 3IBGA 4ZANA 5KMGA 4EEZA 2ZB3A 2K4MA 4L76A 2FB9A 1KC3A 1M2OB 1RZ3A 3T38A 3EIQA 1L3IA 3FDJA 1WMBA 4AC9A 1T2UA 4MUIA 4RFVA 5AOAA 4MWTA 4WZBE 5BN5B 5L3ZA 5K0FA 1Z06A 4WK0B 4C22A 1FP6A 1Y80A 3ITEA 4FHEA 5D5PA 3VYRB 3EVEA 1YCFA 1XMVA 4F3RA 4YRNA 4QPZA 1RPJA 4M8IA 1QX4A 4EGJA 4GBJA 4QBFA 4G09A 4NF2A 4WEQA 4UBLA 2J67A 2OMKA 4Q1BA 5CCBA 1JS1X 4DYHA 4ZU3A 3DE7X 3SZRA 1Y37A 4HTFB 3AGPA 2NYAA 3G82C 4DAOA 1FK8A 4XWWA 2J6BA 2G4VA 1L7EA 1OC2A 3OU2A 4LOIA 4PC7A 2I8LA 1S4QA 4EABA 1A4UA 1FXWF 3E5NA 3GNTA 4PNPA 1A9OA 3KZNA 4PZUA 5K8TA 1ZO8A 5EPUA 4BLQA 4ESOA 2CLMB 2UYQA 4G4SO 3UICA 4D5GA 4JROA 4LDNA 1NXQA 2BSAA 4PINA 2NO4A 3KJNA 4HC4A 1LVGA 4HWSA 1AHHA 2VH2A 1EJ2A 2WU4A 4H7HA 3D7LA 4NECA 3A3KA 4Y18A 1RQLA 3DVQX 3MK31 3FFXA 3LSTA 4FQ8A 1MB3A 1W88A 1NNSA 2OQIA 3DO5A 4OJKA 3SBDA 1DAOA 4CQLB 2ECFA 4DLBA 1NBIA 3CX4A 3HVJA 4FT2A 4EELA 5C32A 5I7EA 3WYFA 2FQQA 1RRKA 3EXEB 2B1IA 2HJGA 1M1YB 2J3LA 4MXDA 5KCMA 3RYHB 4NMMA 3MPOA 2C77A 2PD4A 4G9BA 1N77A 3QKRA 3L3BA 4EMSA 2IXAA 4Z0PA 4WFKA 5CYPA 1WHTA 4M8LA 4DSUA 1BXZA 3ZGLA 2ZRQA 4J0DA 4Q7JB 4WBNF 2JG3A 5LYJA 3LY8A 3U60B 3H3JA 4HGYA 2RH9B 5DYTA 3X2FA 1VIVA 2XW6A 4BV9A 2IPXA 4UM8B 3U62A 4GDMA 1W1WA 4BXOB 1O08A 2GFHA 1GSIA 4H7KA 4EEKA 1KYQA 1LSOA 5GV8A 4MTCA 1E4OA 4MWGA 2JAHA 4ANFA 2IEIA 4YJFA 4Y2VA 5FUVA 3CYFA 2NU6A 2ZIEA 1FP4B 4RBNA 5KJEA 1Z26A 5IU6A 2NMVA 3DTVD 4ND8A 1JR4A 3C8MA 3NANA 5ALTA 4RUKA 4BQPA 4AJEA 2NP6A 3F2IA 2G6BA 4OQZA 1C50A 1NUQA 1LRKA 1V8FA 2PUVA 2R66A 3EOZA 4KRYA 5FRDA 1C4XA 5H16A 1R2QA 4C05A 1QM5A 4G0NA 4EZIA 4ID9A 4RZIA 3MYRA 4EF5A 4NXNB 1JR6A 4QTUB 1JDJA 2WSIA 1OZGA 2Z2XA 5CXQA 1NVTA 3CVOA 4YN3A 2GAAA 3ZHOA 5K09A 4U8GA 3VYTB 2BGLA 5I9MA 3HBAA 1KSGA 4KNVA 1I6LA 2ZYHA 3C98A 4PZCA 3HS3A 5EYPB 1JHYA 1K98A 3AOEA 2XKAA 3ZNNA 4KH0A 5EMKA 3V1LA 2ZIVB 2CFCA 1NONA 2HCBA 3RD5A 1ICIA 3EIFA 3EUAA 5IDXA 4EI8A 2GH1A 2X6TA 1QC5B 3KXLA 5A1TA 2B99A 5JSZA 2PY6A 1E3LA 3JASA 3GHHA 1DUVG 5EINA 1C29B 1FLDA 3KQLA 2YMQA 3OPQA 3CT4A 1QO9A 2FPIA 1VGQA 1QXSA 2ZU0C 2WSYB 3COWA 3HDQA 3SKXA 4G84A 1MN6A 1K0FA 3B1YA 2NU9A 1GUDA 4YRLA 5KOHB 5JBQA 3LDHA 3I9V1 1F5SA 4TS4A 3GFRA 4LDRA 2WWIA 1J90A 2PYDA 1MNQA 1OH7A 4RY0A 4AG3A 2RK6A 2GNPA 3UW3A 4FHZA 1VZ3A 4L6IA 3ZHXA 3ZWYA 1QYIA 5AW3A 5KOJA 4KQEA 3HACA 1BQEA 3OQVA 2LIPA 4BZPA 1XVIA 1XNJA 2GK4A 5FADA 1MTOA 3X1KA 2ODWA 2ZS8A 3WIOA 4ND1A 4PCLA 3FOFC 4W1PA 3GXOA 3RRZA 3GK3A 5MHTA 3HCBA 4BKMA 3QE3A 3BHNA 4NYIR 5C46F 1F4VA 1U02A 4TT3D 3OT1B 1PVDA 2P2CA 3AEKB 5F4ZA 5G3ZA 3T1VA 4OSOA 1Z0AA 3ZCQA 1VJDA 1PV2A 3GLTA 2WAYA 1VRWA 1Z2CA 4C3UA 2PH5A 3UAGA 5JS7A 1XPRA 3AR7A 5AI9A 3JQBC 1JQKA 1IHOA 2P9FA 4NE7A 1DRJA 4R1PA 3ZD6A 1FSZA 2V03A 2ZPTX 2P90A 2VF8A 5DIZA 2XT0A 4E5DA 1OOEA 1W7AA 5C1IA 1S1CA 1YNOA 2OZEA 3UKJA 1SEPA 3E0XA 4KAXA 4X1YA 5ILOA 4NEQA 3QFCA 1V1RB 1NXOA 3D6NB 2H31A 4LYDA 3T1HB 2WFAA 1NX9A 3ENZA 4QDTA 2JK0A 1Z62A 3O75A 3Q5GA 2X5KO 2K7ZA 2ATEA 1SO8A 3AYZB 4LK3A 4LVCA 4QYIA 4YP1A 4V0OA 2RGWA 3JZFA 1MR3F 3UPDA 3QZUA 3CXUA 3KNZA 1GSHA 2GZ2A 1FUKA 1KERA 5JHGB 4TMFA 1EFLA 1IHDA 7REQA 4YR9A 3GGJA 5IRCD 5J2UB 4DM3A 4DZRA 4IHQA 3BJIC 3NC4A 4CCAA 2OWEA 4GO1A 2HJ9A 1FDRA 4IOKA 1S3GA 4CUJA 1R3DA 1QGUA 1TXGA 3C4VA 1UDCA 1UK7A 3SS7X 2FSUA 3GJSA 4J8PA 2QX7A 3RT1A 2AR9A 4PW0A 2X58A 1PR3A 3T52A 3LUCA 2PUDA 3PFNA 1ZVMA 4K81B 3PLNA 5I9IA 3HO1A 3IB6A 3SYMA 1Z6PA 3AU9A 4QXMA 4G8CA 1NW5A 4QBKA 3OLYA 3MHPA 4ZC1A 5B36A 4TKUB 5F9HA 2O1EA 1NJ6A 1JXAA 1L5FA 1W49A 4HLUC 5BV8A 5JH7B 3IAAA 1V25A 4AN1A 2IV7A 1LBTA 3EZXA 1LPBB 5YASA 4WVFA 1K88A 2ZXEA 2AR7A 3HO8A 1JW9B 5AM3A 4IXDA 4NJMB 1FFCA 1J8QA 5KYYB 5C8YB 2H6EA 4O6VA 5BNFA 3KSZO 3WR5A 2FCRA 3ZHQA 1DMSA 2EHDA 4QARA 2K5UA 4RK7A 4PFSA 2GK6A 2GHRA 4BPBA 5TGDA 1MHTA 1P2FA 4IGEA 3AUJB 2WZDA 3SDBA 5BURA 3QKUA 5DLEA 1V5IA 2ZU6A 3KKEA 3K32A 5IF9A 1MIOB 4P5PA 4JLVA 2IHYA 2R6GA 4FFMA 4U8HA 4N18A 4BO7A 4UNRA 4YV0A 4QX6A 3TR5A 1OYOA 1PUXA 1YJAA 1R0ZA 2VJAA 3F47A 4JS0A 4DHWA 1MVLA 2QN7A 1CRZA 2VP2A 5J4HA 3R8FA 2O3UA 3QEJA 4HHEA 4M9RA 1A1SA 3PIDA 4QUKA 1N9KA 2FUG6 3I0NA 4PRLA 1X1TA 3T06B 2YQZA 1RWWA 4AQ7A 3VPXA 3UMYA 2R4UA 3T4EA 3VI3B 4U39A 1O6CA 1BS1A 4YCSA 2DGDA 4II2A 4JOCA 4EVRA 3BWCA 1XPUA 5EJMA 1VL1A 2W7TA 5BMVB 4YXWA 5CITA 1BWRA 1SOVA 4E32A 4BDSA 1OHHA 4CKBB 5CXUA 2FUCA 3IVMA 3T9DA 5AH0A 2XADA 3TL6A 1G5TA 5FPPA 2AZTA 4CCYB 2ZXFA 3P9PA 1Q22A 4GPAA 1WD5A 2BIFA 2F7SA 3CR3C 4UEKA 5F2EA 4BEWA 3W5DA 1XD9A 1XEWX 1DBPA 5TQ2A 1FQKA 1UOEA 4CT4B 3W5CA 3Q85A 1UC5B 3FI9A 3D6AA 2E85A 3FNQA 4J1QA 1WQ3A 4Z9FA 5A4AA 4IX1A 2FN4A 1V2HE 3AP1A 1KVRA 3PE3A 4PNHA 4YCNA 5CLIA 5EXXA 1SIUA 1A88A 4YVFA 4UEWA 3HVUA 3O3OB 5A4JA 5LOVB 3WV4A 1TUEA 4Q18A 4AO8A 3CLTC 1EQ2A 1UIRA 2QTAA 2QTVB 3AUAA 2F48A 1QFMA 2H17A 5JAQA 1RI1A 2C42A 1VHQA 3HZZA 3MWJA 4ZREA 5IKPA 5DM70 4ZCQA 2R86A 1PFUA 2PD3A 2RGDA 4UDOA 3IQZA 2ZSEA 2QQ0A 2NU7A 3B12A 3KKNA 1NVWQ 5F78A 3WJAA 3G2HA 1ZI6A 3CB2A 2OXIA 3AFOA 4NLLA 1VBMA 1QF7A 2RCYA 4QAJA 3KSBC 2IU3A 2ZROA 1FUEA 1K75A 1Z4MA 2HCFA 3B9BA 3G3EA 3LQ4A 4IVRA 5DBIA 4DXHA 4L3VA 3QPWA 4HAOA 1CR0A 1E4YA 2CL0X 3L7CA 4BC0A 4MP3A 2DT8A 2PUBA 3PHHA 3M6UA 1YMUA 3LLMA 4P84A 3VDRA 2JKVA 3AIIA 5JBIA 3I9NA 4RL6A 3SJZA 4MA0A 3REFA 2OBYA 1CE8A 4REQA 5F3RA 4YREA 1KDOA 1UBLS 1NVEA 3L79A 1CZRA 1A98A 3AI1A 2HO4A 4G5OA 2YWEA 1FP7A 1V16A 4HCJA 4MQ4A 4O4IF 3TDKA 4CU2A 4FMCF 1DZIA 3KEFA 3PQ4A 4G23A 3T1NA 4LZPA 1EG2A 1XVAA 4BGDA 1WWKA 1E94E 1Y42X 3RFXA 1DKLA 1R8YA 2PX5A 2WPDA 1PWHA 3QMVA 1P4JA 5TDHA 3EE6A 4M87A 3ITDA 1KBZA 1PTJC 4N1AA 3IVGA 2M2IA 2P0YA 1M1YA 2WKRA 1LLQA 4HI0E 3OM8A 3WNVA 2QG4A 4S3MA 5JY1A 4QTZA 4IJMA 3C3AA 5FWYA 4H4CA 3HM9A 2DFLA 3N2GB 1DTEA 3TDMA 3ZCPA 4C3VA 2BJWA 4MPPA 1BRMA 3I92A 4BLTA 4DUGD 1LSJA 4A03A 3OA2A 4AVYA 3FI0A 1E6LA 1WW8A 1KPHA 3TUIC 1FX0A 4RTLA 1RI3A 3HG7A 4JFAA 1E9VA 4ZZ0A 4EKYA 3F9IA 3TGLA 2IS6A 4HAUA 2WSMA 5JI2E 3LDAA 2H18A 3GVIA 4GBGA 5FCDA 1NUAA 1AO3A 4Z4EA 5K3BA 1FP4A 1KOLA 3WDMA 5LNK6 1K7YA 1QJ4A 1GNTA 2D2FA 4E2FA 4QDUA 1KVUA 3HRHA 4N8DA 2V6IA 4KX5A 1OI7A 4OQDA 1DAIA 5CGZA 2NP7A 4H1VA 3Q0TA 4D4IA 1XAJA 5J4VA 2RMKA 2O7QA 1MAVA 3QEOA 2G40A 1IFXA 3AQIA 4LJSA 4O25A 4YLGA 3F6YA 3K9HA 1I4LD 3PKIA 1RC0A 3QE9Y 2DSNA 3HYTA 3NHMA 4FOTA 1OILA 4M1ZA 3SMVA 4ETNA 1CDOA 2SCUB 3AESA 1QDEA 3QLVA 4O33A 5B7PA 2QVYX 2VPZA 1SKYB 1YUNA 3ZQ4A 1TO6A 4DIKA 1USVA 1IN6A 1VHLA 3X0DA 2PKQO 5EYPA 4OQPA 3D7NA 1M6EX 1X42A 2ZRFA 3LPNA 2ZBDA 1UBJS 3CTMA 2NOAA 2NQ2C 3LWBA 2HZ7A 1SBHA 4AZ3B 2ERCA 3EC7A 2VDWA 1IHXA 3E81A 3EG9A 4KDEA 5BQPA 2E2WA 1IBLB 2V7GA 4OGFA 4NKRA 1JJFA 2HHAA 4KITB 3ONNA 3TLZA 1BWSA 4P31A 1CJSA 2FSIA 3H2IA 2BRUC 3ZVRA 5GADl 3FOCA 3QELA 3RC9A 4C30A 1EWTA 3LK7A 2YZMA 1NT4A 2VBIA 4FE4A 1PHRA 3NUGA 4L74A 1XE3A 4NH4A 4US0R 2I3GA 3BKXA 4DA7A 4ZQGA 3HN2A 5JNUA 3D0RA 2F1KA 1WW3A 4PZZA 3CWZA 2Y0DA 3ICCA 3ROPA 3VHXB 4FUTA 3G6KA 2WSSA 1ZIPA 1H9AA 4N3GA 4QRHA 3Q8KA 2OBMA 1I6KA 2MYTA 1EK6A 3EEYA 1VRCA 4PRKA 4FBGA 4PZ9A 3FTNA 4HNHA 3DMRA 5EXDA 3QKSA 3MJCA 3PWTA 1TZJA 4RCZA 2CDCA 3BOSA 3CLUD 3CHYA 4B7XA 3LVFO 1T9BA 3HJRA 4OM7A 4D3DA 1T8UA 3ENQA 1CQPA 1D6SA 3FMIA 3HSYA 4NPHA 1F2DA 1OW3B 2K2WA 1I5RA 5C1BA 2QBYB 1QVVA 4I55F 3MW8A 5FFMA 3ZTTA 3LBIA 1GZSA 3RV3A 3LPLA 1J25A 1JDTA 4QRDA 3AEKA 2M98A 1M76A 1NVKA 3BTVA 1GUYA 3MG9A 4A9AA 4MRPA 4EA8A 2OXTA 4G5SA 2UZ1A 3E18A 4K8OA 2ZJ1A 3CF2A 2ODTX 1V4BA 3WGZA 1UFOA 1EUYA 2Q1TA 1NDHA 2DM6A 3M82A 5DBFA 4ZEOA 3ZBPA 3CR8A 3OZDA 4EHFA 2B2CA 4D4KA 4RHUA 1DIBA 3F4BA 3PK0A 4MITA 1RR6A 4XFKA 4KQHA 5KVQA 3S2GA 3SQXA 2PLWA 1RKVA 1CU1A 1PF7E 2JLRA 1M0EA 4B7ZA 2VWQA 4W82A 2X23A 1CP2A 2JHCA 1ZVKA 2HA7A 3DZCA 1OROA 3KFXA 3K2IA 1Z74A 2G76A 4PLPA 5FPSA 3QQ5A 3RFUA 5GZ3A 1TQ8A 2Y76A 4BNNA 4QM6A 1E6KA 5ALZA 3FSGA 1R6AA 1AS0A 2PBRA 2JIZA 4EK9A 3WXMA 3A2MA 1T4CB 2NYUA 2BDEA 2IGTA 2ZYAA 4BP8A 1H1DA 2XQJA 2ZI6A 4NE2A 2YVAA 3JD0A 1PEKE 3D4BA 3HEAA 3UAWA 3VISA 4RZHA 1YC2A 5FULA 2XMGA 3MJEA 4RKEA 1WPXA 3GZJA 4MUKA 4L4ZA 2WWTA 2Q1YA 2DKNA 2BV3A 1RQ2A 1NQTA 3LY5A 1MJNA 2WJAA 3BJRA 3ILSA 3EGCA 4FWIB 5H80A 1RAGA 3GMIA 4IDCA 1LDYA 1G6OA 3QYJA 3TCNA 4DARA 4DNQA 4G0ZA 1RQRA 4DTIA 4JWKA 3RO7A 3C1TA 1YAJA 1QHYA 4K9SA 2RKBA 1B42A 4OHUA 2GKSA 4C07A 3CVUA 1H5NA 1D5CA 3AP3A 4ENSA 2J5XA 4BP3A 1MGOA 4R16A 2OCGA 2YC4C 4GP9A 2OZKA 1FJGB 1DWPA 1J2EA 2ZBFA 1SCQA 4QUIA 1K7EB 5FWNA 3T3OA 4LFBB 2EGGA 3E7DA 4ZCLA 2JGEA 4DCOA 4D45A 1MBZA 4K2AA 1U0TA 1Y8AA 2FG7C 2P6NA 2QZSA 2BFOA 5FFNA 5KQLA 1GTG1 4PYOA 3I12A 2L82A 3PQ7A 1P3JA 3OMWA 5CT8A 2X4LA 5KU7A 2QY9A 4MIEA 2CFIA 3RYTC 2BN4A 3QHQA 3ZU6A 3OJCA 2BUCA 3DVLA 4MOWA 4EI2A 3HBNA 1KQFA 1IC6A 1U1IA 3R09A 1FW6A 1T9DA 2OT3B 2R7NA 4NDNE 2QPAA 2N46A 1RXCA 5J5AA 2R79A 4O29A 1HLDA 1OASA 1C7FA 2Y99A 1LB1B 1PUJA 2C9DA 1MIOA 1QHHA 1TEXA 2GCNA 2IDZA 3EODA 4OOFA 2M6LA 3DV9A 1CEYA 3LX5A 2QAJA 1JG7A 1T8RA 1QYWA 3JVUA 2RGUA 4ZVLA 4RH3A 3W3ZB 1FZTA 2I54A 2MWMA 5G2OA 3B3QA 1FX1A 4EVQA 3NS7A 5B12A 4QYWA 4CMEA 4WN9B 3SBXA 2TRSB 2RG7A 3UH1A 3JQ7B 2I7TA 3ETGA 4D6YA 4N5HX 1KYIA 3JARA 1KS9A 2ODQA 3I6ZA 1F12A 5DH9A 3WNZA 4YBZA 3N5CA 4E7PA 1Z07A 1UFVA 3GH3A 1UDAA 2ZWAA 1I3OA 4FFNA 1M2HA 1DQZA 4CKBA 1DELA 1C2TA 4XUGB 3NBZC 2VYCA 4WINA 3H13A 1IQPA 2HA3A 1X94A 2E0IA 5HXAA 2HBYA 3PUVA 4Y2GA 4YAWA 3PP8A 1YNSA 4UTRA 3VTZA 1B6TA 1DINA 4KQKA 4FZJA 3HPRA 3NU1A 3RC1A 3ZWPA 1DX4A 3ED5A 4BRSA 4RSHA 2G1JA 2QD4A 1UBOS 2BR4A 3J81k 1JEAA 3BMNA 3LVQE 4FE7A 4JQOA 4QYTA 4OXRA 4KU4A 4LPSA 1TU3A 5CMLA 4DXAA 3WLMA 1KYYA 1LDMA 1YDMA 4D9EA 1LV8A 1NC1A 2QTVA 1JQ5A 4IIUA 3UN1A 3C3BA 1MUUA 1K97A 3CRW1 1RM3A 4K6FA 1PGQA 2ZB7A 4TMZA 5ANRB 4AY3A 4DEVA 4DV0B 4LMRA 4JLWA 2Z5LA 4E6PA 4YAKA 2O06A 5DTJA 2ZRGA 1DBWA 3C4QA 3SKYA 4Q3EA 3ZJYA 2WC1A 4PWYA 1M5RA 5ICEA 1W47A 1AB6A 3IVCA 3LBNA 3RSOA 2QE7A 1NJ5A 5BV7A 2QORA 2JH8A 2PGJA 5FXMA 4KI7A 3JAWB 4KQMA 5TRTA 1Y6ZA 3KT8A 4AJJA 1W9HA 3L7KA 1FNBA 2GYYA 1ZAKA 2WYOA 4FXPA 3BD6A 2IYTA 2JGAA 1CR1A 1QIHA 3KEOA 4JP3A 4H7EA 2PQMA 4BJ5A 2J8ZA 1YQDA 4KXUA 2CHFA 3UXYA 4YJHA 2GFQA 1ZHHA 2VJPA 3RUEA 4HN9A 1PVVA 3EWAA 2CN1A 3OM1A 3KSAC 1T0JB 4DRZA 3O8CA 2JGKA 3QPVA 2BGMA 3MOIA 3RWBA 2XZOA 5ELXA 2O5VA 1OFIA 3QE0A 1HMPA 3COZA 5EZ5A 3B1KA 1ADBA 2DTDA 3NAGA 4RVDA 2PGAA 5FNVF 4CDRA 5HK9A 1WR8A 3VZBA 3B7WA 3K16A 2JHFA 2NT3A 4NS1A 3OEYA 1CRPA 2MSNA 3EOAI 4U2KA 3W7AA 1NF9A 3PV0A 3RS2A 3ED1A 1QF6A 4MUAA 4ROSA 3TN7A 3LM8A 4WZAA 5A9TA 3CPHA 5AO9A 1U11A 2Z2ZA 1U7HA 3NASA 2PMEA 2IYNA 1KAOA 1MJHA 2BZGA 1EJ0A 2W2LD 3F3YA 3T7EA 1NOIA 1O0CA 4B6OA 4R2LA 4FNOA 1YK1A 3ZKWB 2YHSA 2FZLA 3LCVB 2QVBA 3C3WA 3V6MA 2WJ6A 4Y30A 2EKBA 1O95C 1N3BA 1V6CA 4NBUA 4JGBA 4MS4B 4PO9A 5J2TF 4ZIRB 4DLPA 2PCJA 3M4JA 4G07A 3STYA 4YMVA 2AZDA 3T5TA 1Y7HA 1U4SA 1L7QA 1XHLA 1BA2A 1ZRMA 2WT8A 1FY2A 2XYQA 1A27A 4L5JA 4OX9B 3B6EA 4O3MA 1Z12A 1YR7A 2FOLA 2Q3MA 2BISA 4LV6A 1TADA 3M7IA 3N87A 4JYZA 3AHEA 4UEJA 4MW9A 1UM9B 4F4UA 1ZQ9A 2BBOA 3P0EA 1U2QA 4LKRA 5HF6A 1J39A 4QAQA 4Y1EA 3ZV6A 1J70A 5C4MA 4UBIA 2PANA 1V1MB 3M6WA 3FTCA 4B4UA 4X3CA 1R8QA 3DE6X 3IVXA 1PLJA 4RHXA 1OC4A 1G2QA 1WD7A 4RFSB 1EE2A 1JDUA 2B8JA 2I4NA 5HOEA 1QQAA 4ZZ2A 1U8EA 3E7WA 2IH4A 1MPXA 1P17A 5U4QA 1SC9A 3V32A 4WHMA 2XWQA 1ZZGA 3O7WA 3X1WA 1MG5A 1ZMOA 3P2EA 1Z0KA 1AKRA 1SUIA 2HU7A 1H6BA 2R00A 1E1KA 4QOHA 3E5MA 1U0OC 4YB8A 2EJWA 1IVYA 2IV3A 2O8CA 3I6YA 3LY7A 4BGEA 3CE9A 3WJ1A 1C3LA 4Q34A 5BN3B 5E1MA 2OFWA 2H4JA 3MTDA 1U0NA 4X91A 2VPXA 3RRXA 2NWQA 5BSFA 2GXAA 4XDYA 1KAHA 4K9PA 2XTNA 5DGIA 4BWYA 4ZYYA 4V3BA 2WG2A 3VHXA 1EGAA 2X86A 1MA3A 5CP8A 3U44A 1JQAA 4HYTA 1KE2A 4GUDA 5CCDA 5ALMA 2ZETA 2ZYUX 5EZQA 1U0LA 3BXEA 2B4AA 4NX2A 4Q1FA 4GE3A 3HY3A 4ZT2A 1P0MA 5JPDA 5THQA 2OLKA 2A4MA 1NMEA 3RAGA 3MMNA 1MAHA 1Q77A 2JGLA 3A36A 2VF5X 3ACBA 3DE3X 3QXXA 4MEJA 2W0MA 1E9RA 3L7NA 2B6NA 1KI2A 2E18A 4FCVA 3RH0A 4URFA 5FTKA 3Q2KA 4FFLA 4HEQA 4LYGA 1BH6A 4IDDA 3TOZA 1C1HA 2R60A 4QL3A 1X6VA 2BHSA 2VJMB 4IV5A 1X8XA 1XTSA 3ZWNA 2IOYA 1THMA 4QLAA 2CHGA 2HDWA 4KQCA 4DR5B 2X9VA 1Z6ZA 1E59A 1RTTA 3HV2A 1ZM3A 3K2EA 2YS6A 4JP2A 4U3JA 1QYDA 5DHSA 4M2LA 2Y93A 3H4TA 3NTLA 3U2QA 4J75A 2ORWA 3KTOA 2OQRA 4Y6RA 4C1BA 2BGWA 4FYYA 3K0AA 4AZVA 3B2QA 5CDHA 1YR1A 2M32A 4PYKA 2QTHA 3GFGA 4FDMA 3LXMA 3FNHA 4XDZA 3DB1A 2FW8A 3S2SA 2NSYA 4EA7A 2JLYA 2FSSA 3D8HA 3KWFA 3LUKA 1OAKA 1E64A 4WT7A 5DYGA 1GU7A 5ERXA 4DCCA 4S12A 3NJ8A 3CEHA 1T1JA 2GSWA 4WASA 1KGSA 5SV2A 1M1NA 3B1JA 2YMLA 3GF4A 4PGHA 4GIBA 4I6EA 4R8MA 5KQMA 2AFRA 1WY7A 2WZBA 1WTAA 5KYKA 4II3A 3OC6A 3MGBA 4PFKA 2J0UB 3UUEA 2EFHB 3I05A 2Q99A 1S6YA 3K9NA 4OH7A 4R1TA 4AECA 3ADOA 1FJ2A 1FFWA 5I9SA 3T0IA 4DM4A 1G8JA 2HSEA 2KM1A 4KSYA 3EDCA 5EHGA 4M0FA 4BS9A 2PZJA 4F86A 1MABB 2D59A 1M0TA 4JASB 4MQFA 2ECQA 5F1PA 1WDKA 3TBHA 3MJFA 4AM8A 4KXNA 4DVGA 5DW0A 4JQZA 4Q48A 3WISA 1KYTA 3EJWA 4WTOA 5T8KC 1RQGA 1ULAA 1M2EA 2P5UA 4FHGA 1G8FA 1V9LA 1ID1A 2IOFK 5EZYB 2NV2B 2VP0A 2DPXA 1OPRA 4OHPA 4M99A 4BUCA 1EZ4A 3VMMA 5TR9A 1SBZA 3GGDA 3F3SA 3DLIA 4FNAA 1HMYA 1RQXA 2HLHA 4FGKA 3W6UA 1AIPA 3UJ6A 4UM9B 3TB6A 5C3MA 1W0JD 2KQUA 2W2TA 5CHYA 2OBNA 4CV2A 5BP7A 1MOQA 4G36A 3LC1O 1M75A 4P2GA 4BMXA 5B6PA 2YQ5A 3ESAA 4H1TA 1DHRA 3ROFA 1EK5A 4F9EA 1XYVA 3DF7A 4D9JA 1ZEMA 5CFPA 1KZ1A 5JNTA 2IX9A 2C7PA 4L22A 1ZY2A 2XAUA 1CRLA 2XITA 3WLHA 1I0IA 4HG2A 2GF9A 4QGFA 4FOOA 1T1SA 4UU0A 2ZAMA 2Q9UA 4HS9A 2DFVA 3ODGA 2BFPA 4ALKA 3SE7A 1T5TA 1SCDA 3GJ3A 3GA7A 2BUBA 1NVDA 1TA0A 2O2ZA 4LJ6A 1BX1A 3THOA 3VPGA 4L1KA 4BNIA 2OCAA 4CMJA 5ED4A 2XNSA 1C3OB 1N5MA 3FAKA 3A1EA 3GCZA 4OI4A 2C95A 5JEDA 1EFAA 4DDUA 4OHCA 4NXMB 3QVXA 1Z36A 2DCMA 1JLLA 4MQBA 2M6SA 4LF7B 4F56A 5LM3A 1B8NA 1CXZA 3IJEB 2VNHA 2V74B 3ANLA 2OYCA 2P4SA 4AIRA 4YQEA 1WSAA 1A9RA 1XDUA 3WSTA 3T3IA 4PZLA 5DCUA 3DO8A 3QUAA 1W5TA 4GKAA 3FSEA 1GGMA 3KOXA 1TK3A 3CJRA 3WMWA 4Z4HA 1Z0SA 1Z88A 3IE0A 4V38A 1H6AA 2YBDA 2ZAGA 2YCBA 4L9SA 4S2EA 5IJAA 3WK9A 1EBBA 5EKTA 3GP8A 1Y5LA 4AZTA 2HDNB 1G66A 1K89A 4QXOA 2BF7A 2FOIA 1E3DA 1NMXA 1ZOOA 4H31A 4OD0A 5G1OA 2EQAA 2PT9A 4WUTA 3S2YA 4L5CA 3WVNA 1XYYA 1MQ8B 3PDJA 1EBFA 2GHIA 3N76A 4U5XA 1X1SA 5EZSA 4DLVA 3D1LA 5AJXA 2FWBA 3S2UA 1TUBA 3G02A 2QUBA 4RO0A 4UUNA 4KXQA 2PFKA 2PHZA 4TMXA 4LHXA 1ZM9A 5SZIA 3VV3A 3MS2A 4CKWB 4KBGA 5KQSA 2IY9A 4RF2A 4UULA 1NURA 3ZQKA 3DKRA 4ZDKA 4CKCB 4F12A 5I8ZA 2WWWA 1UEIA 1USWA 3E7FA 4G0VA 4ZI7B 1R10A 2YZ7A 2G3YA 1VG1A 4NCXA 1E5TA 4PSKA 5CD1A 4HYQA 4KQ1A 4F5DA 3L6EA 1C9DB 3J81A 5HIKA 3RSSA 3V4ZA 3IOYA 1JVNA 5B2EA 2QSJA 4AMVA 5H9WA 4IIGA 2PLFA 1IEXA 3QMPA 2J87A 2C20A 5A1JA 1V1JA 4KO8A 1YFZA 2EBWA 3V46A 3FGNA 1A1VA 1KPGA 2P11A 2CFSA 2VATA 1KU6A 2HF9A 5L7WA 2HF2A 4YAEA 3WBJA 2V8BA 2VWPA 3NP9A 1JFSA 3R3VA 1Q0SA 1ZNQO 1LSSA 2AB0A 2I6GA 4LXHA 1JFRA 3LIPA 3JAWA 3K7EA 4CDGA 4CTMA 5T7BA 1GGJA 4L07A 2BTOA 4AICA 4BX0A 3FWNA 9GPBA 3H8JA 2IH5A 1GN9A 1XXHB 3QENA 2PVCA 5D5HA 2XGGA 5DGCA 3V2HA 2YIVX 2JIBA 3E9EA 4YT4A 1PW7A 2A0WA 2VHWA 4UAJA 5CM8B 1EH5A 1ZISA 2GRUA 3EHEA 1XRMA 4QUHA 3UW1A 3K20A 1EGQA 4H6VA 3QYFA 2CBZA 4D79A 1XD2B 9LDBA 2G0TA 5K6AA 1PNQA 4F92B 5T41A 3FOEC 3GI1A 5HTOA 5AHWA 2V9CA 2OWDA 3ES9A 2HH9A 5JW6A 3O1LA 5FLEX 1P2SA 2P9CA 4YS6A 2NN3C 2Y1XA 3SJBA 4FR2A 5ESRA 4BAZA 4Q7QA 4G56A 1CWUA 4ZWNA 4ZQHA 3O31A 4CFZA 1T2EA 2NQ8A 3Q8XB 4RPLA 1DTSA 3NI2A 4NZOA 3NPAA 4RVFA 4FYWA 3T7SA 4LQ4A 2W37A 1P19A 1HBJA 1AMNA 2HZBA 1ZA2A 3I39X 1E4EA 3MCZA 1L7VC 1UBFA 1DI0A 4O4LB 4QGBA 4RK5A 1GU0A 1TM5E 4IFIA 5EHXA 3EMDA 1Q3HA 2ZS9A 4MS4A 2XYGA 4TYQA 1UBUS 3EB9A 1YDGA 2EEPA 4YDHB 1Z4JA 2FX2A 3Q0EA 4IIJA 4IW3B 1ETHA 2C9ZA 4J49A 4TT3A 2BH9A 5JCOA 4BC1A 1UBMS 2Y9PB 3SEQA 1XZEA 4BO6A 1QRAA 3ANXA 3PXEA 4M0LA 4OMDA 1QHSA 3ENWA 3HY6A 4HDNB 4IG4A 1CJMA 1UM9A 1DKMA 1HNNA 4MDYA 4MNTA 5AI6A 2QUIA 2P8SA 4UVGA 3KYCB 3HB0A 1V1MA 3PR1A 4XVCA 1KI4A 3DUFA 3IOEA 1II8B 4MPTA 5C7OO 6NULA 5C81A 3WC4A 3ICVA 3NMUF 5BNTA 3JAKA 3NOQA 3D3NA 1EGMB 3DZDA 1MMFB 1P7WA 3DF9A 3EY9A 4M21A 1DG1G 1CHNA 3H7AA 1SBQA 4D9HA 5IVHA 3R7FA 2EG5A 1A76A 3UV3A 1LPPA 3HEMA 5LQDA 3KO8A 3V97A 1ND5A 2IPOA 3M6LA 4CEJB 2NTNA 4JSRA 1AY0A 3WIEA 3BHMA 5KX5B 2QENA 3A32A 3GNSA 4DIMA 4B7UA 1CT9A 4X3PA 2F1RA 2UVPA 3MGGA 1GG5A 2F59A 3IIJA 1E66A 2JAPA 3WBBA 1PSZA 1E96A 2QIOA 1J23A 4NYMR 5DM2A 4C7MA 5TE9A 1UKBA 4PYMA 1SHKA 1TZBA 1Z4QA 3MGKA 4AP9A 3A1CA 4C88A 5BN3A 1VMKA 1V3QE 2YW2A 3IXLA 2FEPA 2AOUA 1M1UA 4PXYA 3C5CA 1YZUA 4K40A 5FIUA 1ZNYA 3CH6A 4IGAA 1BQ3A 2SHKA 3PB3A 1L8XA 4HNSA 3ZEAA 2PRYA 2QMQA 1ONOA 1OB5A 2BL4A 2HK8A 3AW8A 1ZCFA 1ITZA 2HTEA 3PXXA 4IH4A 3V1YA 1SUDA 3EEOA 4HPWA 2BKUA 1TLFA 4X93A 5LSAA 4I1RA 4IFBA 4DV7B 3QWBA 3SS8A 4CODB 3DE4X 1M2FA 1VI2A 3Q9SA 1YIAA 3H86A 5JSUA 4AJ2A 3K6SB 2CSXA 5JS6A 4GC5A 4KLRA 3CUTA 4L6CA 4MR8B 2HV9A 4JBIA 1QRTA 4ZN6A 1T5DX 2P1ZA 3RSLA 1OU0A 2WM2A 3CMMA 3L41A 4TRMA 4LY9A 4R3UC 1I7DA 4GZLA 4PYNA 1GSAA 1BDJA 1O9BA 1W52X 2WUDA 2WP8J 3BQMB 3LUGA 3M89A 1GT6A 3LE8A 2VJMA 4ZCPA 1OA0A 3IPAA 1Y4UA 3F5DA 3DM9B 4N0PA 1NHWA 2O1WA 3LK6A 1GAEO 4OP3A 3WLSA 2ZI5A 3R7LA 3UV7A 3ZWAA 5A4FS 2OC9A 3AVVA 1PS0A 4ZPXA 1I24A 3BXFA 4RPIA 5DK6A 1PNRA 3S7ZA 1AQ6A 1KFJB 3T34A 1EFPB 3WL7A 7AT1A 2RJ3A 2PFSA 4FVTA 8AT1A 4TZ0A 4EG7A 3K9BA 4EAAA 4MGIR 2R8XA 1BCSA 5LKRA 1PYGA 1YB7A 2C2MA 2Z2JA 4D8TA 3ZE0B 1UJ2A 3E70C 2OYSA 3HEBA 4WOKA 3UJ8A 1PD1A 1SH7A 4UDNA 1H4QA 2ESRA 3VM6A 4EQ6B 1OWNA 1K27A 4MYDA 1Y1PA 2J0UA 3ADKA 5FHRA 2IUEA 3TB4A 3ISVA 3AKCA 3A6JA 3KOUA 3AVUA 3H19A 1HGXA 2V55B 5K3DA 1LF0A 1WP4A 3H4VA 3STWA 3VKGA 4P80A 1NQUA 1Z13A 2NQTA 4P38A 1UPUA 2PXHA 3QFRA 4J3FA 5IANA 3WLPA 5KDLA 3HSKA 3U39A 5IKXA 3JQ6A 1Q3TA 3S81A 3MMPA 4IDPA 4OO3A 5ILGA 2H1IA 3JQEA 4MI9A 5F77A 3WO1A 3KAQA 1HE3A 1XAHA 1KK1A 4AKEA 4TYPA 3E23A 2VYVD 3CNNA 4HAZA 5F7OA 1UXKA 3E15A 3LUHA 1DT5A 3KHKA 4C7BA 5B7QA 1X92A 3JRXA 5K8CA 4OFXA 2OZVA 3ICOA 3DBHA 3GLFE 4C4XA 2GYUA 3NTXA 3KQPA 1JBEA 2YJ6A 3O4FA 4WK2B 1W0KD 3ZCUA 3ET4A 5CHEA 3AVYA 2UZAA 3GMTA 1U2SA 3ZKAA 3OQMA 2RGRA 1WVIA 4D81A 3AM4A 1ZWKA 4DCNA 1XKXA 4JC0A 3OQIB 1CZNA 3OWOA 5IM5A 2HUPA 4A1OA 3IUNA 2NUAB 3L8HA 2QRHA 3OZGA 1CZKA 3WI7A 3PR2B 4B6RA 1RC8A 3ETLA 3L02A 3N74A 4DMGA 1JQJC 3O8OB 1F38A 3GGOA 5DLPA 5TVGA 3HCEA 3S2EA 1Z15A 2QP9X 2WVGA 2OQVA 1L5SA 1QHNA 4G1MB 4MCIA 1C4KA 4DNOA 3AY6A 5ILQA 4CIXA 2J6IA 5CJJA 2ZREA 1AN0A 1WV0A 1EFTA 4NHOA 3L7YA 2OGWA 4TTPA 2B25A 2Q49A 1B23P 3MYYA 4LQLA 4PG5A 4OK3A 3AIMA 5E8JA 1WA5A 2AR0A 4JIMA 2NUPB 2OVFA 5CRIA 5FV7A 4GOLD 3TLJA 1L7PA 3R6WA 4P81A 1QSGA 2I78A 2JF0A 3AM5A 2GILA 3IP9A 3OMXA 5HW0A 5IXYA 3WGUA 3N28A 3RREA 3LQFA 1ZKMA 2O8FB 2M1XA 4QJ3A 3DVSX 2FSVA 2GCEA 1P1HA 1QLWA 2XF8A 4ZYLA 1PN3A 1RI4A 3PCRB 4IJVA 3ND6A 4JB2A 3PXBA 1FZQA 2IK8A 4NRDA 4WCFB 5L51A 1ZI8A 5FOUA 2NO6A 3TZLA 1V4NA 1OYVA 1GPWB 1KMCA 2JCGA 1T34A 4NU5A 4CG3A 2QF7A 4HV4A 5H7XA 3B9QA 1WW2A 3PEUA 4LVNA 3CX7A 1J22A 4WXMA 4QGSA 5K05A 1K5DA 1Q15A 4UFNA 3CIFA 3VHLB 1BGXT 3W0LB 5IXSA 1BMFD 2IXGA 3PENA 4LAFA 4E5NA 3CX3A