3NIWA

Crystal structure of a haloacid dehalogenase-like hydrolase from bacteroides thetaiotaomicron
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
266
structure length
266
Chain Sequence
b'KYKLIVLDLDGTLTNSKKEISSRNRETLIRIQEQGIRLVLASGRPTYGIVPLANELRMNEFGGFILSYNGGEIINWESKEMMYENVLPNEVVPVLYECARTNHLSILTYDGAEIVTENSLDPYVQKEAFLNKMAIRETNDFLTDITLPVAKCLIVGDAGKLIPVESELCIRLQGKINVFRSEPYFLELVPQGIDKALSLSVLLENIGMTREEVIAIGDGYNDLSMIKFAGMGVAMGNAQEPVKKAADYITLTNDEDGVAEAIERIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase
publication title Crystal structure of a haloacid dehalogenase-like hydrolase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 90
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2010-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 3niwA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3niwA01
2W11A 3NANA 4O8CA 4DFDA 3L5KA 2WM8A 2I34A 4XPZA 2HF2A 3WKAA 3E58A 5ALUA 4XQ0A 4AP9A 3N07A 3L8HA 3CZ4A 2IOHA 1QQ5A 4JDPA 4L6CA 2OA0A 3UM9A 5AM0A 1EK1A 1T5TA 1RC8A 2FEAA 4GXTA 3AR6A 1LVHA 5AESA 2B8JA 4Y2RA 5AVUA 3IJ5A 3QUBA 3U26A 3R4CA 2AMYA 5AM2A 1PW5A 3ZUPA 4UU0A 3SF0A 1QQ6A 3OPXA 1RRCA 3NAMA 1ZS9A 5AVWA 1RMQA 2GMWA 1XPJA 5ALKA 3WK8A 3PCTA 5AI4A 1TJ3A 4ZEWA 4FFDA 1YMQA 3W5AA 2I55A 4QJBA 3KOOA 1U02A 2PKEA 4AS2A 5AVZA 3OCUA 3ZTYA 3QU7A 4Y2PA 5AM3A 1XP5A 4F72A 5AI8A 5AW6A 3NIWA 2C88A 1CR6A 2B1QA 1X42A 3ED5A 1TJ5A 4F71A 4CF4A 4CE6A 2OM6A 2YJ4A 4I9FA 3B9RA 3DAOA 2HHLA 1ZD5A 1ZRNA 1VJRA 3OCZA 5AKJA 3WGUA 4YH1A 4KX5A 1WPGA 4YCNA 3N5KA 3QU5A 3HLTA 4UM5A 2GFHA 2GHTA 3U13A 3A3YA 3FPSA 2MU1A 2P69A 5AK5A 2C9MA 1RDFA 2JAOA 2HO4A 1U2TA 3L8EA 2G0AA 5ALXA 5AW1A 4Y2YA 2WF5A 5AW4A 5ALVA 1O08A 5A3QA 3PGLA 3WGVA 1WVIA 5JJBA 5AW2A 4UMDA 5AKKA 4H1WA 5FP0A 5AK4A 4KNWA 1Z4NA 4QQFA 5AVXA 4JB3A 3M1YA 5AKZA 3R9KA 1U7PA 3EPRA 2GO7A 2RAVA 1YDFA 2P9JA 1Z4MA 3PDWA 4BX2A 2I33A 3QU2A 2QLTA 3AR9A 2ZBFA 2AH5A 2C8LA 4I9GA 1ZOLA 4EELA 2C8KA 3N28A 5ALDA 2FUCA 5ALSA 2BDUA 1U2SA 1YS9A 2YN4A 5AVRA 1L6RA 1VFPA 3M9LA 4CNQA 3QXGA 3R09A 3AR4A 3OCXA 1YNSA 2JAWA 3K1ZA 2YBDA 1S2OA 5AM1A 5AW5A 2YMMA 2G09A 1RLOA 1Z4IA 2HX1A 1TJ4A 3FVVA 3QU9A 3QGMA 1J8DA 3L0YA 4RETA 2MSNA 4DWOA 5AW8A 3L8FA 2D2VA 4UMFA 2YFYA 2YMPA 3EF0A 4L6AA 4RESA 3QLEA 3OCVA 4HGOA 5AW0A 2R8YA 3A1DA 3VAYA 1F5SA 3I1YA 1ZRMA 3DNPA 5AHXA 2ZBEA 4DW8A 1ZD3A 2FDRA 1QQ7A 5E0OA 2CFRA 2B0CA 3ZU6A 3QUTA 2FI1A 3N1UA 3W5BA 3WK7A 5ALHA 1TE2A 4KNVA 2B8EA 2ODAA 4OD0A 5ALNA 3WKBA 1Z5UA 5ALGA 4Y2QA 4NAVA 4KYTA 4E88A 1Z4LA 4EX6A 1RMYA 4GIBA 4IG4A 1XVIA 3PGVA 1RKQA 4Y2SA 4BX0A 4C4SA 5IT4A 2HDOA 2WFAA 2RARA 1RLTA 2JAUA 4FE3A 4BEWA 2DQSA 3WKCA 3S6JA 3KDPA 3ONNA 2NO5A 5AI0A 4CF5A 3D6JA 3SLRA 1RKVA 4BX3A 4CF3A 5ALMA 5AW9A 3L8GA 3ZI4A 2HF7A 2X4DA 3ZWKA 2GHQA 2FPWA 1S8OA 2G1AA 5AW7A 4G63A 3E84A 1Z5GA 2JGAA 4OFZA 4BKMA 1FEZA 5ALZA 3BA6A 3MMZA 3UMGA 5AI6A 2IA5A 3F9RA 4NWIA 2ZBGA 3KD3A 3J7TA 4YIKA 3IRUA 4Y2TA 1RQLA 3SHQA 3NASA 3U7EB 4Y2VA 5AKYA 1Z4OA 2FUEA 3U7HB 3FZQA 3WK6A 3AR5A 4BNDA 3WKEA 2PR7A 2IOFA 3SMVA 4UAVA 2RB5A 1L8LA 1Z4JA 3AR3A 4UM7A 3MPOA 5ALEA 5ALIA 2ZBDA 3EF1A 1J97A 3KC2A 5AKHA 1U7OA 3ET5A 3U19A 2NO4A 2FPSA 2R8ZA 4BBJA 3EWIA 2JARA 1AQ6A 2WHEA 4MWOA 1VJ5A 3I28A 4Y3UA 2OBBA 5AKXA 3UMBA 1K1EA 1O03A 3RFUA 3QYPA 3KZXA 3P96A 5AK6A 1T9ZA 1L7NA 4UW9A 2EATA 1Q92A 4UATA 4BYGA 5ALWA 4EENA 4L57A 5ALLA 2W4MA 4G9BA 4UAUA 1JUDA 5AVQA 3FPBA 1L7PA 5AIBA 1TA0A 2G80A 1SU4A 3NRJA 2NYVA 5A3SA 2C4NA 2Q4TA 4J03A 3ZVNA 1SWWA 4UMVA 3SKYA 1QYIA 3E8MA 1RKUA 4EX7A 2I54A 2YMQA 3AR8A 3WKDA 3QU4A 3UMCA 3ESRA 1Q91A 2ZXEA 5AVSA 5ALRA 2B1RA 5AKIA 2FPXA 5AICA 4C4TA 1ZJJA 2CFTA 4FYPA 2G06A 4C4RA 3MC1A 3DDHA 2QYHA 4UARA 3E81A 1T5SA 2YJ5A 5AK3A 3ZWDA 2FPUA 2HEGA 5ALJA 1N9KA 3ZX5A 3B8EA 3U7FB 4HGNA 3QX7A 2YJ6A 5AI5A 3AR7A 2I7DA 1EK2A 2R8EA 2W43A 3DV9A 3FM9A 3I76A 1RPZA 3BWVA 5ALTA 2Q4RA 4KX3A 3MN1A 5AVVA 1KYTA 3ZVMA 4YCLA 4NV0A 1WZCA 2HSZA 1WR8A 4NFLA 1NF2A 2BDEA 2G07A 4OCZA 2P11A 5AVTA 1Z88A 2YY6A 4B6JA 2WF7A 4UASA 1MH9A 2EARA 1L7OA 3A1CA 1NRWA 5T41A 3L1UA 4YGYA 4YIHA 4EEKA 2WF8A 5ALOA 5ALQA 5AKEA 5AW3A 5IT0A 4YCMA 4UMEA 2VKQA 2CFSA 3QUCA 1CQZA 5AKGA 2IOFK 2B82A 2FPRA 3FGOA 3W5CA 1ZD4A 2HI0A 2ZOSA 3ZW7A 4NABA 2AGVA 4ZEVA 3B9BA 1QH9A 2YJ3A 3ZTWA 2WF6A 1L7MA 3KBBA 4Y2JA 5A3RA 5ALFA 3OCWA 4PNHA 2BY4A 4Y2XA 2WF9A 3OCYA 4BNDB 4HYTA 2Q5EA 2EAUA 4AS3A 5ALYA 4UU1A 5AM5A 2O2XA 1Z4PX 3QNMA 1IWOA 4Y2UA 4HAIA 1YJ5A 2AUTA 2RBKA 5AI9A 3ZX4A 2HCFA 3WK5A 3NUQA 3WK9A 4KN8A 3SD7A 3AR2A 4MUMA 2O9JA 4HGRA 3L0BA 1RLMA 2G08A 2I6XA 1Z4QA 3HYCA 3QUQA 4DCCA 4XE5A 4EZEA 1ZD2P 3L7YA 3A1EA 3N8GA 2YMLA 1YV9A 3L1VA 4J2TA 3GYGA 5IS2A 3SKXA 5AM4A 2ZG6A 3WK4A 2R8XA 1NNLA 2HOQA 3IB6A 4HGQA 3I6BA 3ZVLA 4XOUA 3ESQA 3ET4A 5ALPA 3RF6A 1SWVA 2PQ0A 3NALA 1RMTA 4IFTA 5AKLA 4BEVA 1Y8AA 3TLMA 1RQNA 2IYEA 3CNHA 4HGPA 3W5DA 3L0CA 4ZEXA 5AIAA 1N8NA 1L8OA 2OYCA 2B30A 5AVYA 3OTQA 2P27A 1LTQA 3U7GA 2CN1A 4OHFA 1Z4KA
chains in the Genus database with same CATH superfamily
3DE3X 2JGFA 1SVIA 1U3CA 3FMPB 1DEXA 3CVOA 1HDGO 4LCEA 1X9HA 3FWHA 1W52X 5SY4A 3T41A 4CIBA 1U31A 2XUJA 3WMXA 5DHPA 2HF2A 5HDBB 3SOZA 2FPPB 2QD3A 4XR4A 2BGTA 3MWGA 2W0MA 2VP2A 3GLHE 3INNA 4J4BA 2LGJA 3VA7A 1X7DA 4TL6A 2RK3A 3N07A 4TKUB 3WYCA 4EUNA 2PUFA 1G4UR 1FSPA 4MKRA 2LTAA 3Q5EA 5ER9A 1NG1A 4KBGA 2QTFA 4PCUA 3LX6A 1OBOA 2QHXA 4C0AC 5KYXA 2OOKA 4TQUS 5JPCA 4UVEA 1T6BY 2IYNA 3CZCA 3F1LA 3FFBA 1QPGA 3I1FA 2WHPB 1HYHA 3FRIA 2YY7A 3ROGA 3AKZA 4W99A 1RHMA 4MRVA 3LBFA 1F7UA 2WWYA 3ITKA 4GPAA 1T2FA 2BFOA 1D9XA 1PW5A 3DYBA 3OPXA 2PX5A 3DFUA 5EHGA 3OUUA 1WETA 2CMDA 4RTOA 1L3IA 1FQWA 2P1DA 4OI4A 2OB1A 3MERA 1E6LA 1HMYA 4HNAB 4JX8A 3DEHA 3IEIA 4QDZA 3MJEA 1K3TA 4YAUA 4JVNA 1SUDA 3D9QX 3A26A 3KQQA 3MUNA 4LMRA 4ZI7A 1TF5A 1KYVA 3MFYA 5AYVA 5INTA 4X66B 1TK2A 3Q9LA 2W8BA 5C5IA 1KWKA 2W4IA 1VLHA 2C3UA 5I7VA 3ZTYA 2D59A 4A8JC 4UOZA 3AVQA 4X62B 4TTRA 4BATA 2AQIA 4FI3F 5JNVA 2NUTA 1OIXA 3FXAA 2RHHA 3MK31 4NV1A 1WV0A 1DT5A 2ERXA 1J7KA 2AD5A 1CR6A 1XMJA 4FC6A 2XCOA 1UFKA 5AJYA 1Q84A 3MBKA 1X87A 4I9FA 3EGXA 3OZAA 2ADMA 3K16A 2SECE 1DU4A 4HAXA 4ZT2A 2C95A 1C9EA 2ZTSA 2ZSAA 2C92A 2BCEA 3OJFA 1TIBA 1CJTC 4AF7A 3OEHD 1E5LA 3G5LA 2F64A 4YH1A 4MLDA 2GBCA 3AY6A 5FD8A 2HK9A 1LBQA 3FRJA 3WNCA 7MDHA 3WDKA 2YCLA 1QQAA 3AZOA 2YXPX 2ZIZA 1Q57A 3B20A 2QAGC 3H9UA 3HP4A 4BAUA 1TT5A 3T38A 1OZGA 1DWUA 2QMUA 5LNK1 2H8KA 2LE0A 4F9GA 4NZPA 2ZVDA 4Q3DA 3AIOA 2A6PA 3QLVC 1ZUNA 4MUGA 4B5LA 1GSIA 4JUIA 4RTMA 1GTZA 4F4FA 2LCIA 2RE8A 1IVYA 3AHGA 4OMUA 1CRZA 5T4EA 1ULHA 3OZRA 3EYAA 4XDGA 4I3HA 1Q44A 1KVTA 2QLLA 4IDHA 5K4HA 4CEHA 4BO5A 3RU7A 4ZEOA 3RLFA 1DWPA 5HSGA 3AEKA 3CY6A 2ZJ5A 4H1WA 5FP0A 8LDHA 3DPSA 5EP2A 4B43A 2XB4A 2F9FA 3PQ4A 4UFNA 2RG1A 2A84A 2EQBA 4NATA 3AINA 2JC3A 3E7XA 3NYRA 1NMZA 2PSDA 2NU9A 3HV0A 4JL8A 4LV8B 3BDVA 4UPVA 5FT9A 1DXYA 4TPKA 4XGKA 4O2RA 1SC3A 4LSZA 1FFEA 1FMJA 2UVQA 3KFXA 3TXYA 2RAVA 2NZVG 1CSEE 3VC1A 1P3DA 3C0KA 5KDDA 4EY4A 3PDWA 3LVBA 2I33A 4J1QA 3UATA 5KKCA 4E5KA 2A9RA 1CQIB 1I24A 2RJNA 3CBGA 4AXBA 3VZCA 4JBHA 2II6A 2QK4A 3A3NA 3P2KA 4UBKA 4M7RA 4D98A 2GLUA 5F33A 3N28A 3QSGA 4PTYA 4UEJA 4EA6A 3K6SB 5JEDA 1HYGA 1AT1A 1H1DA 4HYYA 4QJ4A 1M34E 4PO3X 3VVBA 3IQIX 4HOYA 1FX1A 1GZ3A 4YPOA 1UWLA 1L3BA 1SUIA 4PGHA 4GXQA 4KWHA 4PHFA 4BCBA 1F2TA 4YLYA 1ZPDA 3L6DA 4IVRA 2Q1UA 4X20B 5L4SA 4I55F 3F3KA 2EG9A 5GOZA 5FPTA 1M2WA 1NXTA 3S44A 3VQTA 4X45A 1K63A 3IUSA 1WWKA 4ZQIA 1KF0A 3G6WA 1JMKC 3G79A 3GRUA 1Z8NA 3RBZA 3EK2A 2G09A 3KLBA 2QV0A 3PJFA 3QNUA 1KPHA 1W2GA 3FVVA 4OB8A 1Y1TA 4PXAA 4TKMA 1QSGA 4JYBA 1X15A 5CH3A 5J4HA 2YJZA 1E1CB 4QXRA 1JHQA 3O7MA 2GAIA 5CT5A 5H0IA 3U5ZB 2LBPA 3R74A 2Y1FA 4TV8A 1TYCA 4MJLA 5CLHA 1HL7A 2YMPA 3H8JA 3K09A 4IYRA 2VPTA 4RESA 4AIIA 5EJEA 1E18A 3DZKA 3ETLA 3GMSA 3IULA 3MJSA 1Z18A 3FY4A 1XQVA 3OTIA 3LUAA 4U6SA 5DNEA 3ZV7A 1BDMA 3KUDA 2OBNA 2G88A 4ZT7A 2G82A 1KI9A 1FYDA 2YXNA 4PSAA 4DLYA 2P5TB 4PU0A 5DYWA 4MQFA 3OPQA 3V4RA 1C7EA 2AJDA 3K9HA 2AF4C 1DJPA 4IGFA 3DLBA 3NWPA 3N39C 4KE7A 1QMGA 2GEDA 5D87A 2IPOA 4R2IA 2P77A 3OX3A 1QF6A 3ZU6A 2FN8A 4CTKA 1SKQA 2XB8A 2PKXA 2CNKA 2ZAMA 3BFJA 2GCIA 3TIVA 4F3KA 5F7ZA 1TMKA 2JCSA 3WK7A 1L5ZA 2VP4A 2J48A 3WWEA 1ZIOA 1W8IA 1XVLA 3RUIA 2EJTA 5BSMA 1PJZA 4Y2QA 1DFGA 3QE2A 4HQNA 1KAMA 5F5LA 3T9BA 4HRAA 4C01A 4F5ZA 5DM2A 1K9VF 2QL6A 4GIBA 1FUEA 2BP7B 3L7JA 1JSLA 3CJTA 1SCJA 1MO5A 3VRHA 3AI2A 1ZN2A 2I1QA 3DDUA 4JJ8A 4GVPA 3H9GA 3TLAA 4HDNA 4MMYB 2RH9B 3MEQA 4CMBA 2P4UA 2WFAA 2WG0A 3KZ1E 3LO8A 4LHEA 4LZZA 5ECYA 1ZAYA 4MQUA 1W5EA 2BBWA 2BM0A 1DQPA 3O4HA 4WFIA 4L9WA 4NCAA 2JGDA 2GCNA 5FFMA 4BUCA 3B89A 4DSOA 3SZ3A 2C4WA 4B2PA 1ECFA 1KSFX 2IXDA 5CJJA 1FFHA 2WU1A 1E61A 2AC2A 1MJGA 1S8OA 1WW2A 1SCUB 2O50A 2R4UA 3MWDB 4HN9A 2IUEA 3AEQA 4V0RA 2VEDA 4PTLA 5TC4A 4LJ4A 1Z5GA 2WSSD 1GNPA 3LFUA 3DF7A 3PEUA 4M8SA 2BEUB 3RUFA 3U3MA 3HBNA 4YCSA 3O2QB 1SBTA 4BAGA 4BLQA 1DWOA 1COWA 2IA5A 2B2CA 4GZLA 3CX7A 4LZOA 5AI6A 1AKVA 1ABFA 5DIZA 2J08A 2YJGA 3FOCA 3AFOA 2LW7A 2UAGA 3MLBA 1H9CA 2P91A 3LLCA 4FDVA 4YIKA 4EPTA 1SA0A 2WD8A 3Q98A 5KPDA 1IMJA 4B7CA 1RQLA 2X13A 4NU5A 1YZKA 3U7EB 3BKXA 3AGPA 3FE2A 3IO5A 4IG9A 5JNSA 1FVXA 4OX9B 3RFFA 2GPJA 4UJ5A 4V0LA 4FCCA 1KEZA 5D6NA 3QVXA 4IR7A 4D26A 1R0RE 1EUZA 3NBYC 4DQ0A 5FF9A 2VHJA 1ZK0A 3CPSA 4JJ4A 3A1NA 3BL5A 4D6YA 1IH8A 5C37A 1J1UA 1XVTA 4M89A 2BFFB 3AUTA 3PBKA 4P4SA 3FPGA 4WNYA 4B7UA 6GPBA 4LNAA 1KZ7B 4WT7A 1ZVVA 1WQ4A 1DDGA 3L1IA 4AMBA 3DDWA 4R01A 1R1DA 2D8AA 3F6SA 3MS4A 3PE6A 2FH5B 3K15A 4H7EA 3VZRA 3VZDA 4KPYA 1QNFA 2XYHA 2O0MA 3JRNA 4BBJA 2DSTA 3M1IA 3I73A 4PNEA 3M81A 1U3VA 1DG3A 3DTVA 4MWOA 4NZYA 2R87A 1SXJE 3H9QA 5DB4A 5IJXA 1BXZA 3KPUA 1LXCA 3TG2A 1Y6ZA 4YACA 5L4LA 1EFPA 1NONA 3OJLA 3NZEA 1VOTA 3D2CA 3RFUA 1E6MA 3UGTA 2REOA 4BAZA 5AJWA 2Y4OA 2V4ZA 2BFDB 2WZDA 2FOLA 3X1KA 2VKTA 1AUQA 1GPDG 1EFHA 2WIAA 2ZU0C 2G71A 2BI8A 3M6VA 4GKAA 2VXCA 1KAQA 3DZIA 4BV8A 5IRCD 1S3IA 2G1KA 4IDFA 5EJIA 4EO7A 2OLEA 3PPXA 4I0WB 4QT4A 3KYBA 1L0BA 2W6QA 3KKEA 2W4MA 3N3BC 1NUQA 2B34A 2KQUA 5DX0A 3VU3A 1AQNA 4KRFA 1JG1A 2HPAA 4WKCA 4DLZA 1Z6GA 1Y6RA 2TMKA 4RH0A 1MT0A 1WCWA 3QKUA 1ENPA 5SYNA 1DO2A 2C54A 4AJEA 5GAJA 4I7EA 1MZVA 3RR2A 4BGDA 2B1JA 2VTBA 3A4YA 4ZT5A 1ICIA 2LKDA 4P7KA 1P1IA 3R9XB 2VZ0A 1PVOA 4CKEB 4P3OA 2OQVA 2W58A 2Q1SA 3K4QA 2QRPA 4BQEA 3K9QO 3MWFA 3AHHA 1YR1A 4AI6A 1DC4A 1D2RA 3VGPA 4QA9A 5LP1A 3V34A 1H4TA 2IVFA 3SP1A 2CVQA 3AFNA 2OHHA 4F6RB 2QQEA 4F4UA 4P3NA 4Z3OA 3HFSA 1ZXLA 2JGJA 1X7ZB 3FUUA 3QV2A 3EQ2A 1GQFA 3IPCA 5TARA 2NWQA 2DMRA 3DO5A 2B1RA 4MGKR 4KJZA 5AICA 1KI6B 2P9BA 2Y27A 2RKWA 3JR3A 2CFTA 3TQIA 4F7WA 2VI5A 4RVSA 4BTVA 5JNRA 1L7DA 2HBYA 1XRSB 2OO7A 1ML4A 3DDHA 3H5WA 4KR3A 2DERA 3OPNA 2XUFA 1OTHA 4WDRA 5EJMA 1U9IA 2N75A 2Q5OA 3UHPA 2VN8A 3OIFA 2YJ5A 4DA6A 2BEVB 3R6WA 1KJ8A 4S1WA 3G1WA 3LF1A 3U7FB 1PQWA 2EWVA 4R1UA 1HDYA 1ULAA 2Z04A 1GUFA 1MAAA 3VSAA 1F9EA 2E55A 1K3UB 4YXWA 1JU9A 5AJHA 4QUGA 3S7ZA 2IZ5A 3N58A 2VRWA 3K53A 4YQEA 5AVVA 4NCHA 4ZCMA 4D7AA 1CQPA 5B7GA 4NV0A 3BXFA 4DN6A 4M8LA 5A4KA 2QRKA 4IJ6A 3WHPA 7GPBA 3OLZA 1Q0UA 1C41A 2GM3A 3OU2A 2FA9A 3T7KA 1V71A 2JEYA 2K7ZA 1YULA 2JEOA 4F3TA 5HK8A 1J0AA 2Z43A 4TYNA 4IF6A 4PAQA 4UEQA 3BMOA 1ZONA 3A9RA 4GLJA 1SG6A 1DTWB 2IBMA 3FVQA 3VTFA 4YIHA 5DXAA 2BVNA 2N1MA 1YUBA 3A25A 4FS8A 4QQNA 5ALQA 1GR0A 2QZZA 3LV8A 3OA2A 4MITA 3GLSA 5C53B 1JYSA 2W6OA 3A4IA 1RZVA 2VDVE 4FM9A 1D5CA 2AJLI 4YUAA 1TQ8A 3KR1A 3X2SA 1QH0A 1DAFA 1P2GA 2OV3A 3O9ZA 1UEXC 3R5FA 4I4TF 3V7FA 2B82A 3ZGZA 1BW9A 1VL8A 2Q45A 2ZT5A 3CLRD 5LWHA 2PX4A 3ZW7A 2VC2B 3B9BA 4EABA 2KWIA 4DR5B 1O7JA 5JSUA 5CX4A 3ZTWA 3U7JA 4E11A 1YZ3A 1Q1AA 1YDEA 1L1FA 3K0KA 4KXYA 1A8IA 2BUCA 2EIHA 2WVAA 3LDUA 1G20B 3F9CA 3Q7RA 2F7SA 3S3TA 3AB7A 4BNHA 4URZR 5CCDA 5JCJA 3WNVA 1QV7A 3GV0A 3K8QA 4CGYA 2BZGA 2JH8A 2O52A 1FMLA 1RRKA 4HDSB 4TMXA 1XR3A 5DTJA 1ZC3A 3KYDB 3N7AA 2V9ZA 1GFWA 5KOHA 2J6HA 6PFKA 1XMIA 4JWKA 3MRTA 3RQSA 3ZD8A 4AS3A 1Y7TA 4C2TA 1SIUA 5ALYA 1Y3AA 3U4CA 4UU1A 3RAGA 5HKKA 1GA6A 2G8NA 4Q3KA 3VR4A 3D6HA 3F5DA 1TNDA 1NRXA 2KJQA 3N74A 4XGRA 4NCKA 3DOIA 2PQMA 4RGVA 5KNDD 1QDEA 1QPBA 2QROA 2VH2A 3KQWA 4MRNA 1IAQA 1NJ6A 3P9ZA 1L4LA 2OB2A 3EZGA 5J4KA 2JATA 2H4XA 4ESVA 5KC8A 3CA8A 1XDUA 3PX3A 1Z4QA 3N2KA 4P0TA 2QX7A 2WSLA 4I2VA 5KYKA 2NQTA 1QZ3A 5IKOA 3HZOA 1PUXA 1GPKA 2GKSA 1ZD2P 4Q4JA 1A5AB 5SY6A 4US1R 1HG1A 1TC1A 3VDNB 5JXWA 4WJLA 2V3CC 3AI3A 3GYGA 3IAXA 3DFKA 4WINA 4WCFB 5FRDA 1JSZA 2CDNA 1N36B 4B79A 1NI3A 4XJSA 4YJ3A 4JLNA 4CIXA 5I5EA 3FTCA 1QOQB 1YDHA 1PT8A 2VPXA 4DLNA 3TK1A 5T3YA 5HHTA 2PRSA 4IDGA 5JCJD 1OA1A 1OAOA 1WPRA 3STVA 3IDQA 2NLOA 1IPHA 1KO8A 5A5DA 4TXNA 5KTOA 3R20A 4N0DA 5HZMA 3IB3A 2ZJ0A 1RZRA 2Q2QA 4GBGA 1B26A 3A7EA 4WUVA 1N3BA 2BCJQ 2E4WA 2Q9CA 5EIFA 5HDQA 5HKKD 2GM4A 2OYCA 1Z38A 1N8NA 1CU1A 3B2NA 3E48A 2LUOA 2C7GA 2YRFA 3H9BA 2AJBA 1ZJZA 3FBGA 1YOVB 4GU5A 3P9CA 3PQ5A 4G0NA 5DKFA 4AY2A 4WLFA 2CN1A 1G8YA 1G8JA 5JVDF 2VXBA 3V42A 3HJUA 4L27A 1M0TA 4PLHA 5HW0A 5JAIA 4WZ6A 3MMXA 1JDJA 2BLLA 2J5XA 3AEXA 4WMLA 4DFDA 2C78A 4FSXA 3ZWWA 1RCFA 3VNUA 2QLBA 4FLFA 4HDRB 2AYYA 3SZGA 5GZ3A 1U9IC 2JHPA 1LPOA 1M1NB 1STOA 3EDCA 4QXQA 4EZBA 5BVGA 4OQEA 1K92A 2HXYA 2Q28A 3HB0A 1MB2A 2ERCA 3QF4B 3RHFA 1KC1A 4NCJA 4NCIA 2WUVA 1KJZA 1Z5WA 3TL3A 3RUHA 3V2HA 2A0XA 1DXQA 2CFIA 4GDFA 3GMTA 3L43A 1P6UA 1O94A 1VE1A 2RHRA 2FDCA 3MMNA 3QX3A 1EVZA 4OSOA 2I76A 1LC0A 1S1MA 1C4XA 3EZLA 2IXGA 5JNTA 3Q5DA 3V48A 5HF6A 1EZ4A 4EG3A 1R9JA 1H2ZA 3I4CA 3URKA 3A7DA 3KLNA 3X1ZA 5JWOA 1DX6A 4D41A 2F3SA 4M0CA 4BGEA 1RWOA 3SNKA 4AJLA 2O23A 3OF2A 5C9ZA 5TR9A 3FNIA 1L5RA 3VMFA 1ZICA 4FFVA 3C5HA 3KT8A 4R8KA 1FP7A 3QVKA 1Z0SA 4WKOA 3I6IA 4BNZA 2GWRA 4G0MA 1JHYA 3DWIA 5KYUA 1YMQA 3P9XA 4IXNA 3ZNQA 4BPBA 3L1KA 3KOOA 3FZNA 1TPZA 2O2EA 3NHJA 5KJ6A 2VNIA 4RTPA 2QENA 4C4ZA 3RG8A 2GRJA 2FG7C 3LT1A 2G1JA 4Y2PA 4ER5A 4MRMB 2HJVA 4TS3A 4CLOA 2I9PA 2ORWA 3GP8A 1CS0A 3KIPA 3GWZA 2ATEA 2O6LA 4KXNA 4RMNA 5TRTA 2B36A 4OJQA 3C8HA 3RJZA 5AW6A 5B58C 1CUYA 2NO9A 3WP1B 5FPKA 2MSEB 5T3UA 1TJ5A 3CEJA 3WRXA 4F3CA 4E4RA 4R6XA 3ZDDA 2Z95A 2AN1A 2O2SA 1N9GA 2IT1A 2WJWA 1GEGA 4H31A 1EGMB 3L1JA 3WXBA 1CDDA 1OHHA 1JJFA 4UM5A 3HLTA 1OAKA 1S3FA 2FKNA 2CNBA 2GFHA 4OHMA 4IZOA 4D46A 1KU6A 2YJNA 4AKSA 4Y9SA 3NOVA 4Q4DA 3ERCA 3EXHA 1R8YA 2MU1A 1KQNA 4BV9A 3EIOA 1QORA 2P69A 1MABA 3LWBA 1CUZA 5KTKA 3NHBA 2DHRA 4MINA 5AVOA 2WAXA 1NC1A 3PPIA 4WN9A 3PEFA 2G1PA 5ALXA 1LX6A 2IF0A 1IU9A 3R24A 1C7FA 4C7BA 1VG9B 3TH5A 4EMUA 4A6XA 3PXUA 1WDMA 1AK2A 5CNMA 8ATCA 1A7KA 3KXLA 3UHJA 4DR7B 2J6CA 4JVOA 5FV4A 5JJBA 5CCXA 1JFTA 2MYTA 3MB8A 4Y7CA 1LPMA 2JJMA 2CHGA 3VPHA 2E1PA 4JB3A 4D8TA 3PTLA 1QS0A 2JFHA 3NBKA 3WAJA 2F90A 4JL6A 3O21A 4PLZA 1VCIA 2AKAB 2HZ7A 5FCDA 1AZLA 1MBZA 1U7PA 4PXYA 3N8KA 1DFIA 5CVDA 4YUVA 3WR5A 3K71B 1MEOA 1XNRB 2JKVA 3IDAA 5CG2A 2HN9A 1W46A 2JGLA 3AG5A 4CRWB 2P9JA 3QJ5A 3PHBE 4MS4B 5CURA 1XYVA 5FL7D 5IJAA 5J40A 3OTOB 5ESXA 4WSOA 3LX5A 4BFZA 2C96A 4YUYA 1OAOC 1UKAA 2A5GA 2B3TA 3MJ4A 4LJYA 1D4OA 1PKXA 2DR0A 5DYYA 3OLYA 3OQOA 1OF1A 2FXVA 3B5JA 3KETA 2GEUA 2XT6A 4DIKA 3O4JA 3BEOA 5JALA 1T1RA 1AUOA 3M3DA 1MMFB 4RY2A 4B83A 4C6TA 1C9YA 3AR4A 1G3IA 1VLJA 3L7LA 5EMNA 3IKJA 1D1TA 2PQ2A 1QG4A 2DBZA 5F35A 4HPWA 4UPEA 5J5VA 5CFMA 9MHTA 3OE5A 5J47A 5LQJA 3EPKA 2VQEB 2YBDA 3K4HA 4MUJA 5FHRA 5FV7A 5TPWB 1SPBS 3QGMA 3S2ZA 4HWGA 1LH0A 1WHTA 5JH7F 3HKDA 1VP3A 2BGJA 3KALA 3NNSA 4RC9A 4GYKA 5FA5A 4WZAE 4FEAA 3UAWA 1ZEMA 4P81A 2BFWA 3EGIA 4YP9A 3TZHA 1KYIA 4YRDA 2QP3A 5JZMA 1HO3A 1R00A 4L95C 1LSOA 2Q21A 2VLIA 3EDRA 5DGCA 3R2JA 4HGOA 4EF6A 1FUKA 4K05A 1IM8A 2I7XA 2OBYA 1QIJA 1TA4A 3BRCA 4H16A 1BGWA 2DQKA 5EJ6A 5HCUA 3HSKA 2H4FA 3PDIA 4RO0A 1MJNA 4HSEA 2I4OA 2FOIA 2C4KA 2R5NA 3KWLA 4G1BA 4KO3S 3GH3A 4TL9A 5AHXA 5HQ3B 3DD5A 2CHEA 2VSYA 4PQRA 1K7SN 2D0IA 3OD1A 3TD2A 3JVDA 2JDIA 1T9GS 1AO3A 3W1VA 4TN5A 4IEFB 4AC9A 3I8OA 5K3AA 1US8B 4KMOA 4J0QA 1IOWA 3PRJA 4AY5A 1JKJB 1JTVA 1Q19A 2VJAA 4ND7A 4REOA 1FXWF 4DMRA 1E7MA 3W05A 5DHSA 1MJHA 3SZUA 3PUHA 4ZU1X 3KLMX 3LDFA 4EG1A 2AWOA 1MO6A 4ZXFA 3LBIA 3KP1A 1GTSA 1E4EA 3QFRA 3GZ4A 5D7NA 3FTDA 2WIFA 4W5OA 1KKUA 1O96A 1Q22A 1SVMA 1TCAA 4JC0A 1JALA 3RS0A 1NSFA 3ITDA 3DBHB 4IDPA 4O4JA 2EBHX 5J2TB 4ZZ1A 3ZY6A 1KMQA 1CQJA 4BNVA 2WT9A 4O63O 1QHYA 2TMDA 1GXSA 1MOQA 2FZVA 3E3NA 3LP8A 3O94A 3ROEA 1AGYA 1XDBA 2PU7A 4JC8A 2ZIXA 5FI3A 3V1KA 3VR5H 1HDIA 2BH9A 1P18A 4HDMB 4AJJA 4RVFA 2WYHA 1RC0A 1P19A 2E49A 4G41A 2RI1A 1T0PA 1T5BA 3MCVA 4MP6A 3PD0A 4ARZA 4BN5A 1EGQA 2QN2A 4FD3A 4NQZA 2KHZA 3O5AA 3OLWA 3WICA 1CZOA 2FPMA 1P7WA 2J33A 2FPWA 5DVZA 4PTZA 2PZAA 2WG2A 3NC0C 2VWHA 2OGUA 4PF1A 2H5LA 5E4YA 4BE7B 4DBVO 1PQUA 2BHTA 4ESOA 3C3YA 4Y9RA 2CYBA 1FEZA 2FSPA 5EKSA 2I2CA 1YQGA 5A9SA 5BW4A 4E6PA 1GQYA 5EJ4A 4KQMA 3C3DA 3F74A 2AWNA 2XVZA 2YXBA 2WJZB 2WUEA 2XH8A 1UQTA 3CG4A 2PVCA 2WR8A 9ATCA 4DADA 1NBME 1K3FA 1UCFA 3OM1A 2NTYC 4A9AA 2AMJA 4BLVA 1T0IA 3TINA 4NG4A 3GCXA 2DSNA 2BF4A 4KHPB 2ID7A 3HWRA 4Y2VA 2VRCA 2ZUTA 2XXAB 1DUVG 2HQOA 3GNLA 2NAPA 2QRGA 2QSZA 1LWNA 1NJ8A 2J3EA 3I9V1 3RUEA 3GO4A 2IOFA 3HU3A 2Y1OA 3U4QA 4L0CA 1DMRA 3J81k 4M8NE 4JXJA 2Q0XA 1F2UA 3TW6A 4RIIA 2PBLA 3HACA 4LE2A 4F4IA 1EUCB 4RFSA 1XXHA 5AH0A 3LYHA 1FYEA 4JEIA 1YACA 1EJ6A 4JJIA 4NE2A 1Q1BA 4KXUA 4G9EA 4CL0A 1PW7A 2BONA 4BJ1A 2FPSA 2GPAA 3F5QA 2VSFA 4ALMA 3EZ7A 3UJ9A 1R6BX 3EXIB 4DBZA 4X7BA 1ZCFA 4L8GA 5IK2A 3T35A 4RTNA 2PD4A 2AI3A 2ZVJA 4WKBA 3BTSA 3N6XA 4LJ8A 1J06A 1UMCB 2J7PA 4GOLD 1HRKA 1PVDA 4WJZA 4YP5A 4XX0A 3ST7A 2HPHA 3VPDA 1DQSA 3U3XA 5A9RA 1O03A 4Q9NA 4ZVMA 2DQYA 1AB6A 2XGGA 3LQQA 3KZXA 3HBMA 5GWXA 2G4LA 2IFTA 4YRNA 3B2EA 2GS9A 1HEUA 1TVKB 1ZM9A 3EVZA 5CPFA 5HIJA 4J2HA 3DVRX 1QXSA 1SKYB 5EP4A 1Z5OA 3JQBA 1G5IA 2A7QA 3SYNA 4OK5A 1UOEA 1BHSA 1P0QA 3DDZX 1E8MA 4MV0A 4YJ2F 2VRCD 2VS1A 3RRYA 4HNSA 5JYCA 4HF7A 2OE2A 2VAXA 3AJRA 3C3BA 5ALWA 1L1QA 1N4DA 3G9ZA 2HCBA 4G2NA 1M0EA 3GG2A 5JHHB 3RBAA 3PJEA 5DH9A 1YIAA 4GI1A 4I5FA 2YH2A 2Q41A 3F6PA 4G1MB 1L5OA 3DXZA 5K5EA 2Z1MA 4KW7A 1IZZA 4BP3A 1BCSB 2B3DA 3D59A 3L6EA 4HH3C 3OIGA 3SQOA 1JPUA 2GASA 3BHNA 2WI8A 3DVAA 3HV2A 2EKZA 3OKCA 4JBLA 5F9HA 2WE8A 1UPUA 4JJFA 3HR8A 3ETEA 3KV1A 1V3TA 4TQAA 1W36B 4I6JA 1F14A 1UJ5A 1TAHA 1Z2AA 2J5RA 2UZIR 4BB6A 3T5PA 3W06A 1D09A 1E0AA 1V5GA 4EX7A 3FFXA 3QVJA 2HW8A 1KZ6A 3JQGB 3RIEA 1HTTA 1JT2A 2CXRA 1QLWA 2H06A 4JENA 3T34A 1HI9A 4A8PA 4TVSA 2VK2A 5ALRA 4P7JA 1VKRA 2W6CX 1N2CE 4XPIB 2GD1O 3COYA 3T4XA 3ZWCA 2XF8A 4ZYZA 1H85A 3BWMA 2HL6A 1TUIA 1C4WA 3N75A 2E4XA 2QVZX 2FFRA 4C4RA 4EKGA 1WSWA 1GG8A 4MGYR 1U3FA 4IVPA 5SZHB 1I80A 1GU7A 3I2JA 4JROA 2VDNB 4XYGA 3UJCA 2H1RA 5CM9C 3AHIA 5K3DA 1RJDA 5EPUA 4EHAA 4Y1RB 2C5EA 2XCIA 1TYZA 3BILA 4MKGA 5DNAA 3V1MA 3U4GA 3QNWA 4JLBA 4B71A 5JEEA 3UOGA 1V8PA 4MUIA 5JJ5A 1NU8A 1Z82A 2NU7A 3AR7A 3AETB 4HTFB 2Z2ZA 2OSVA 1SQ0A 1T8PA 2ENWA 3F71A 1TM3E 4KN9S 1P45A 4Q1FA 1XTRA 1LBTA 3ZC3A 2N9UA 4DQUA 1CB0A 3I76A 3S2YA 5FOWA 2VK4A 2X5KO 4KX3A 2SCUB 3MCAA 3O82A 4MVJA 2ZGVA 3LHFA 3D0RA 3IEUA 4Z8XA 3DDNA 4L9SA 4CF7A 3ZVMA 4JXZA 1QFZA 5G3ZA 4B4DA 4YMHA 3U1BA 5DK4A 3VGJA 5E6RA 1L5HA 4DDTA 4NL4H 2BDEA 1OMOA 5KWSA 2G07A 2GUWA 2ZJ3A 3CKLA 3EF3A 3JARA 3KKMA 4NTZA 4EYEA 1KEEA 2OC9A 3GN1A 1Q16A 5C5CA 3A58B 2P4SA 2Z8ZA 4ND8A 4IH1A 1MH9A 1T8UA 4PS0A 4R81A 4DNQA 4V1CI 1NRWA 3IGFA 5T41A 1B1CA 2V7GA 2XWQA 4EUHA 4MNTA 2JFBA 3H18A 5ALOA 4J6EA 5DI3A 2PD3A 2BSXA 4JA2A 2JLYA 3ZBUA 3FFWA 4DE5A 1FMFA 3K0CC 2A9OA 4YCMA 3D5EA 4O33A 4UZFA 2C9CA 1G8HA 4KXMA 2K5UA 2RGRA 1CQZA 5K6AA 2FNAA 1M8FA 1O95A 4PSDA 2G76A 4TV9A 5AKGA 3NATA 3ZNOA 3KR0A 1S2DA 2CL5A 3ZHOA 1ZIYA 2BW0A 2G6BA 3TL2A 4Q66C 3R7FA 1EUYA 3ZDQA 1DCFA 2QD2A 3TZEA 2LNDA 3H9CA 3K1AB 1KR5A 4FX2A 3ZV4A 1GD1O 4BO9A 1HYBA 1FJGB 4Q7MB 5F98A 2PD6A 3R3VA 4OQYA 3TFWA 3TLXA 1QAMA 3DP9A 1ZLXA 2AIRA 3V5NA 5KTRA 4UOEA 3ZHTA 2IV2X 2GFQA 4LRUA 5FBQB 4HXEB 3SYKA 2Y1EA 1BXRA 2QTNA 2WYOA 2XODA 1RW4A 3AESA 3A9WA 3Q10A 4PNHA 4V38A 4KOEC 4ZEMA 5JXGA 2NOAA 1PGNA 1QYXA 3OPYB 1JA9A 4KDCA 2A9JA 1AS0A 1CXZA 2C5AA 2CMGA 3BXEA 3EH2A 5AQ1A 6YASA 4RCVA 2O2GA 3UUFA 2AOWA 1E66A 2ZT6A 2JG3A 1CFJA 1RD4A 2QORA 2WJVA 2O2XA 3ICQB 1IVSA 2B8NA 5I5GA 4QREA 7AT1A 3ANMA 4B6QA 5E2BA 2CXPA 4ZHQA 4WVLA 4MUXA 1U8FO 4CU2A 3DUFB 4PPYA 2GBFA 2B2XA 2AN9A 4GWGA 2XEDA 4DR6B 4O2BA 1FS6A 3SD7A 4X6XA 1I1QB 3ZWNA 1ZW6A 1WKCA 3GA0A 4MUMA 4P86A 1RLMA 1EZ1A 2ZE8A 3GEIA 2I6XA 3IDOA 3HYCA 3JQBC 4AT1A 4EP1A 4F5YA 5KYYA 1FDUA 1KIFA 1I1OA 2PGAA 4CKBB 1KYQA 1PDWA 1DUSA 1VBNA 2WKQA 4KIWA 4B3DA 1G291 4XRGA 2E87A 2PBZA 3ANSA 1IB6A 3BJMA 3GEHA 4DRXB 2A94A 3V2GA 5CUQA 4NBKA 4XM2A 1EM8A 2H2IA 3M7IA 4AZ3A 4QVIA 5EUBA 3SC4A 2X22A 3OWHA 3EY9A 4PX3A 2AFIA 3BSYA 3FGZA 1NJFA 1E3WB 1VXOA 1EJBA 1MQSA 3RF6A 1ECJA 4P1ZA 5HUJA 3JATA 4US2R 1V4BA 1OJLA 1YB6A 5EKXA 3RJ9A 3RRMA 3CVUA 4RHXA 3MQFA 3H1TA 4JXXA 3WSVA 2QX6A 1Q0PA 3DWFA 4KI0A 1ZBQA 1RKXA 3EMDA 3M33A 1ZK2A 4OEHA 3ESBA 5CJ2A 2R9VA 4AO8A 4EW2A 3O7WA 1GU0A 5DTEA 2ZS9A 1AMOA 1H2YA 2HU5A 4LKOA 1FNDA 2XX3A 3BFPA 4UHBA 2X9LA 2CLKB 1P3JA 3KOZA 5JLAA 2QOEA 2WM2A 4I5IA 5I7FA 3Q1KA 1ZG3A 1UXHA 1MX1A 1ZZEA 1WCXA 3TTSA 5JAMA 2C82A 4CL3A 3DEIA 1OFHA 4LOLA 3NTQA 4ZCPA 2C2GA 3ROKA 4W5WA 1R4MB 4FMBB 4D6PA 2W2XA 3OO1A 2H1WA 4V3BA 4PAGA 3W8RA 3WJ2A 2HU2A 3UHOA 1CUVA 1PEDA 1PJ2A 2XMQA 2ZSJA 1OWNA 3OQIA 4HLUA 1NF8A 3DBOB 1XZLA 2V0NA 3QX8A 4JDPA 4LSGA 2B1IA 4BO7A 4NYIQ 2C2KA 3QF7A 1EFKA 1RC8A 3PRHA 4E03A 2FWIA 2X15A 4BB0A 4L5YA 4CKWB 2VDRB 2ZRLA 1MW9X 3DCYA 1QOPB 3OPMA 4AP5A 4RDXA 1E7YA 2BSQA 1HY3A 2FF5A 3QYAA 1JHMA 3ID6C 3O4IA 1TD9A 2OORC 4LVCA 3T1YB 1X7WA 2JGRA 1VSTA 3PQ8A 5I47A 1KFCB 3HM9A 3WAKA 1ZWLA 1LK0A 4LGVA 2ZRQA 3WQQA 3L05A 1TM7E 2JGMA 1RM4A 3CVVA 1OIVA 2HT1A 4YROA 2QL9A 4E4TA 5JAQA 3USES 4MWCA 3TIFA 2RG7A 3NP9A 4U39A 4QBFA 2PDAA 4HWOA 2WJPA 1I7SB 1JEDA 3Q6NA 4YPFA 4EEXA 5DCUA 3AERA 4X1KA 1OH8A 4CG3A 2EFYA 1RLUA 4DIDA 2YV5A 2RIRA 1K0FA 2AOTA 2P5SA 1VCOA 4OUKX 1N6OA 4CN8A 2EKDA 4F97A 1DP4A 5EKUA 3HPQA 1Y8RB 5CB0A 5IAKA 1XP5A 1FXUA 3KOUA 3O31A 4KQFA 1RAEA 2QBYB 1ZXXA 1ZUD1 3GJRA 2WUFA 3LH5A 2XUZA 2BAGA 3JQ6A 3OZVA 4N3BA 4UVDA 2A58A 2BHRA 4UD6A 4BVBA 2CE2X 1J24A 1Y4SA 4HMQA 4CLDA 1X19A 2W2LA 3KUKA 1Y89A 1YVEI 1FMTA 4CMCA 2PLNA 1QBGA 2IIVA 4A2CA 4OP2A 4RSHA 3DAOA 1T3HA 2VJBA 4FDAA 4UVHA 3ZH2A 4DPMA 3HO1A 4F4DA 2WAAA 3GXBA 4KFRA 4LISA 4DF3A 1Z0ZA 2QN3A 2JASA 4KN5A 5EFZA 5J1SB 1QHHB 3QU5A 3UMVA 4TYYA 1G6KA 2Z5FA 4O4LB 3NXSA 1XCBA 3L5OA 4LVOA 4PC7A 5ECGC 1TQ4A 5ER6A 1CEXA 3P9RA 1U2RA 3K70C 5FAKA 4RULA 4K26A 1VA4A 1GUZA 1UC9A 1C3OB 3R23A 5J43A 2D1SA 2YUIA 4FQ7A 3R5JA 3OSZA 1VSQA 2XZDA 2Y1LA 1GCUA 4MW0A 2V6JA 4MQ4A 5DEOA 3SJZA 3U81A 3K92A 4IMPA 2HUNA 2OCGA 4Q9HA 3RAPR 3GDGA 1XHEA 2WDZA 1O08A 2W2TA 4RABA 4ZVRA 2UV8A 4MUFA 1ENYA 1U8EA 2GCOA 4X90A 5I7WA 4TTPA 1N5KA 1RQXA 2D3WA 1GPJA 1G6Q1 3UMSA 3LQRA 4G1FA 4NENB 2C3PA 4LDNA 1E9DA 1C50A 1NVWQ 4PFKA 4QQFA 1ACJA 4BMNA 4DXHA 2JJQA 4WA7A 1I3LA 3P9KA 3Q72A 3VC7A 1NBMD 4HYEA 3M1YA 4WCDA 3QJYA 5KVSA 5DX1A 5EPEA 5KBYA 3WOHA 4C3OB 2BF7A 3G9TA 5ICSA 3MILA 2GZDA 2I87A 1W2HA 2JVJA 1LUAA 2QXYA 2W2PA 1WDKA 1C7QA 4YJFA 5IKPA 1ZA1A 4HY3A 3D4OA 3BD7A 1QR2A 4JB2A 1KJWA 2GQ0A 5EGSA 4XQ0A 4H3HB 1LI7A 5FBVB 1K7XB 5JYDA 1IWBB 1Q2XA 1V1RA 1T2DA 1HNNA 2HV9A 5AVRA 1FA9A 3JQAD 2JAPA 4RPGA 3HWX1 3QENA 3GJ4A 2WWVD 3A2KA 2C99A 3G9UA 1LNZA 3QXSA 4L16A 2H9IA 2OPBA 3FMFA 2PY6A 1V9SA 2VF4X 1TF7A 2POCA 3GOQA 4ARBA 3NPAA 5IEBA 3JQ7A 3QY0A 2JAWA 4E2ZA 2XRZA 3HXMA 4Y6PA 3MA0A 1B2RA 3B5EA 1EBBA 2XOEA 3O3CA 5K0EA 4I36A 5IT5A 1ZQ1A 4L22A 3IP6A 3WLPA 2OQIA 3GZNB 4Q0MA 3OECA 3PD7A 3PVSA 4B6RA 4IZIA 3TXXA 3ITNA 4S12A 4DRZA 3VNVA 5HTKA 4J0DA 1RXIA 2YFYA 1ZINA 4QYTA 4AW9A 4HJRA 1REQA 4UBIA 3ZHSA 2LZ0A 4PZPA 4UE6A 1NZFA 3FWPA 3SR4A 1UFVA 1IN7A 1HURA 1EJ2A 1R0WA 2G5TA 4HDCA 4NS1A 5CVUA 1IOLA 1EK0A 4QUIA 4ZJYA 1R6XA 2BGIA 3M5CA 2PMWB 3C74A 3ORFA 1RACA 2ACWA 4E14A 4B7ZA 1XLTC 1ZD3A 1NXPA 2H2HA 4GKVA 2PZJA 3GEEA 1YDMA 1BA2A 1B6GA 1LC3A 2H18A 2YV3A 2P6MA 3NHWA 2O0JA 4LXUA 3VUFA 2FN3A 4BLRA 3RWMB 3S4YA 1Z16A 4D02A 4R54A 5BW5A 4D0NA 1HLDA 1XTQA 3CRW1 1JH9A 3PQ7A 1G5RA 1DBSA 1MUUA 2V59A 1LQUA 5E9AA 1NXXA 1TE2A 2JFQA 3ADPA 5L3SA 4QX6A 3SVLA 4OD0A 1DMSA 1KTVA 3WZMA 3R0IA 5JO0A 2QRQA 4RS4A 5JXJA 3HVUA 1ZD8A 4QEZA 1ZI6A 2Q3JA 2F2TA 4YAKA 3VPAA 2NVOA 3UMYA 4DHWA 4O3FA 4ZCRA 3GFRA 3AY7A 4ZOBA 4LF8B 4MPJA 3O4GA 3SICE 1NDHA 4DM3A 3DZGA 1QYDA 2ACVA 1ZMRA 3AJEA 1L1RA 1S7CA 1RWXA 5HEKA 5B58T 4I8IA 5T4FA 3FOBA 4WNCA 4RVHA 5TQ2B 3UV3A 3VSBA 3LQ1A 2PUAA 3BGOS 4C0SA 2PEZA 1GPH1 4UBNA 2PU5A 5C31A 3DBVO 3S6JA 1IUKA 3WSWA 2JIQA 3ULKA 2PMCA 3RODA 2VLBA 3QFFA 4IZHA 4FSHA 3WLNA 4LC1A 4N40A 2BOVA 3GH1A 4HB3A 5IJ9B 1OD6A 2JZNA 3UPDA 4CF3A 3G7SA 1Y0BA 4LMPA 4ZV9A 1QO7A 3F7OA 4ETIA 4A8JB 4KQGA 1GZ6A 2YZKA 2VTDA 4AMVA 5DO9A 2ST1A 3ADCA 2C9BA 1Y1KE 1KK2A 1VIAA 1XMSA 2ZS7A 1GKKA 3OAAA 4L02A 2YUTA 1KR2A 1TU3A 4W5JA 1NNI1 3BXXA 4R3WA 3U37A 1GUDA 3SHWA 5CD9A 1SQGA 2NTJA 1V25A 2RIPA 1VPLA 4QFCA 2G7ZA 2JKZA 4EW3A 1X70A 3L6CA 4REQA 5AMXA 1DJQA 2FZCA 3J7TA 4LV6A 4MKXA 2C4UA 4DUGA 3T4UA 2O8DA 2WD7B 4IXTA 2VHTA 4KR6A 2WVGA 1IQRA 3S2UA 4ZP1A 3MWJA 2VCEA 1RQRA 1TTTA 5CR9A 2VP6A 4RZIA 1I51A 2FLWA 4C1BA 4KVFA 4DLAA 4M8KA 3U3DA 4YRIA 3RU9A 2FW7A 1II8B 1NLYA 3FDFA 3VISA 2C7RA 1NMYA 1U99A 2B9VA 2O6HA 2A67A 3NRBA 1BNCA 4HX2A 2FJPA 3EGOA 3JQ9C 4RF3A 5E3JA 4N47A 4OLBA 3E9RA 1PUIA 2AN4A 3AJAA 5KYGA 2VCHA 2NO4A 3NT4A 4LF7B 2WFZA 2R4TA 4GGOA 1XCPA 2XI4A 3MWYW 4N8SA 5F52A 3C6BA 4G0OA 2KE5A 5AJVB 3TNJA 3SYRA 4ZDWA 3EVGA 4W9MC 2IXAA 4ID9A 2P4EA 3PX2A 3I28A 4QUKA 5GM2A 8GPBA 4K9QA 4O1HA 5JU6A 2F62A 3UK6A 4KO2S 1CR4A 5G0UA 1GZSA 3E1GA 5EZSA 5FWXB 3H2YA 2AS0A 3LVQE 2ZSUA 1EBUA 2X41A 4QTUB 2NXEA 4I9HA 3HCPA 2QXTA 3VR6H 4ZQFA 1DXHA 3TKYA 4DUGD 4XYEA 1RRPA 5JO9A 3WHIA 2HHCA 3QOXA 3E2IA 1LFAA 5KAPA 1O6GA 3K6KA 4GLOA 3FHOA 4AJ1A 4YUWA 1Q92A 5EUMA 4O2LA 3SVTA 3G5TA 3RHSA 4U7GA 1E9RA 2FJ0A 3FYUA 1E5VA 1YD7A 1U2EA 2Z30A 1P62B 2UXDB 4UAUA 1VLLA 2ZSEA 1WMAA 2WABA 2R6R1 3R3YA 5D01A 2J8ZA 5H4GA 2I6SA 2PUWA 3OJOA 2I80A 2A57A 1IONA 3VBEA 4FVTA 4RGQA 4KGXA 5EXSA 1N5IA 1SU4A 3F3SA 4DA4A 5KOYA 3M9XA 1Y81A 1FNMA 3FPCA 1FLNA 1ODKA 4FIDA 2WJHA 3PX7A 3ZJVA 2BFCA 2J46A 3BERA 2WJIA 5DSTA 3LGSA 3PENA 1E2NA 3MWEB 4DWVA 1G42A 1WUTA 2Q0QA 1SQ5A 1UPXA 3L8CA 4PZCA 3RJ5A 3BBPA 3K35A 2FZLA 4LW8A 4N5IX 4QXOA 4AWBA 3QMPA 1P31A 1H2WA 5IULC 2ZRHA 3HMQA 1KXZA 3AUYA 1GGJA 2WFMA 2VK1A 2YNMA 4NBSA 1CQXA 4OMFG 2Q3HA 3HDVA 3OIDA 4FYPA 4Q82A 2QDKA 1NXWA 3ZKWA 3P45A 4XXHA 1KYWA 5KYXB 5C51B 1UT8A 2YHSA 4RE5A 3SMQA 2BMJA 4R6WA 4F91B 3RAFC 1OFUX 5E9WA 1SQ6A 4UUNA 5KTMA 1RRFA 4A0HA 4E30A 2OILA 1IPEA 3DE6X 1J5PA 3BGVA 4LJLA 3K96A 1WCIA 3QX7A 2XUHA 3FIJA 4ZOCA 5DHQA 5H16A 3V6MA 1UF9A 4PQGA 1C4KA 3ZHVA 2HD4A 3DBIA 1MDBA 4N01A 2W43A 3FM9A 3OM9A 3PE4A 2G8LA 3C70A 3L2OB 3JQFA 4N8EA 3ZQKA 3BT7A 4LZPA 3PEYA 1M6WA 4MV1A 1VKZA 2M98A 2XUDA 1NUTA 2E82A 2IYRA 3DZ8A 3WGZA 3WFZA 3M6LA 1Z39A 2HADA 1QVRA 1EP3B 2Q0HA 3KFVA 2PT9A 2XB6A 4PN7A 1W85A 3QW2A 2DUJA 1WZCA 4LHVA 3R76A 3U3RA 4BVJA 5HKBA 2QTVB 2AYXA 4IVNA 4QG7A 2MJLA 1NIJA 1D4AA 2FEKA 2W8BB 4OCZA 2PRIA 3GJZA 3BD9A 4MDFA 1PLKA 2FCAA 2PKQO 3ZGLA 1D3AA 821PA 1HX7A 2IEYA 5AOAA 3DEAA 3N2YA 2J32A 1HFWA 3A1UA 3LGXA 2NUTB 2YNMD 4IDCA 4W9RA 5HZGA 1GDDA 3ISVA 1R9GA 1XI2A 3JSXA 4RSGA 3W4KA 5B64A 1W87A 5F3RA 1RTTA 2AA3A 3RYCB 3PKJA 1XO1A 1SZPA 4KO1S 1RYFA 8OHMA 1XJWA 3EGXB 4RELA 1YB2A 3T3OA 5I7AA 4WAUA 1XLUA 1QU3A 2WJ4A 2H65A 2Y67A 5CK4A 1P75A 1DC8A 3PG5A 1PZXA 2PNFA 5K45A 2IY8A 3BK7A 2IRWA 4ZEVA 2NAFA 2CSXA 1SELA 1TFUA 2IEBA 1TAQA 1XL0A 3DZBA 4TZKA 1VI6A 1UADA 1SHJA 1KVQA 1TT5B 3H3XA 1KJIA 1NSTA 2VBFA 2WE7A 3S55A 4DCTA 2PRKA 4K03A 4RA9A 4EMBA 3ZD6A 4L6IA 2C5GA 2XOXA 2D7DA 3IIMA 3GAAA 1IBLB 4N5LA 1U2GC 1OYYA 2ASEA 2P1RA 4KGVA 4YRMA 1GPNA 1DT3A 3F5SA 3F90A 4X1IB 2QJFA 5K0NA 3OQMA 3GLRA 1ZOOA 1OVMA 3CO5A 1B3BA 3EGCA 4QPPA 1RZ3A 1KHHA 1YDWA 3L6BA 4KXFB 4CEHB 4FGSA 4C0HA 1D6SA 1MRSA 2DHQA 5BN3A 4N7JA 1TM1E 2YC4C 3AEKB 5EXPA 2R7MA 4AECA 1ELOA 3ORHA 2I3DA 2I6FA 1IWOA 1YE5A 1Q5PA 3IT1A 4NDZA 5EI5A 3SEFA 1UBNA 2NU9B 2P2NA 2VT7A 3WK5A 3Q8KA 3I5YA 4KN8A 3PJGA 4KE8A 1FDIA 2FAXA 2W6NA 6CHYA 1OB2A 4DV7B 2X14A 2VNSA 1ZOSA 1QVWA 2VNHA 4J6FA 1JPVA 4BNWA 3L7YA 4D97A 1UUFA 5B12A 3D7LA 4ZV7A 4XD7D 1V39A 5ERYA 1T4MA 1VKJA 3K9CA 1KORA 1USKA 1J9EA 3SKXA 4L4YA 3KS9A 4ZTZB 1F2TB 2P1ZA 3NHMA 2VDMB 4MS3A 5AOBA 3ZIAD 1TADA 1BQEA 4FN5A 2ALJA 1W8DA 1A2QA 2H57A 1P2BA 4PLCA 3GJXC 1ODLA 4HVTA 1ZBDA 3BSFA 1QRRA 4QYIA 4C3UA 3IJRA 2W83A 1Y8AA 4QXMA 1MJGM 3SKVA 3BWEA 4JJEA 2AG0A 4EKDA 2H1SA 4MXDA 4TTJA 3MOIA 1ML3A 6LDHA 1F17A 3GCGA 3C3WA 5FYDA 1FDOA 1TQDA 4RZHA 3KKZA 1P9WA 2ZAYA 1ZH0A 1DRVA 1ZU4A 3D1VA 3DAGA 3AFMA 4TV8B 3TKAA 1EFTA 2YNMC 4OO3A 3T1OA 1DTEA 1PSWA 1YONA 1ZGCA 5DU2A 1IY2A 2Z2XA 4A0SA 3KL2A 2WDPA 2OV8A 3LW7A 4XFJA 3D7KA 3MRXA 2IYAA 5K2MA 2B92A 5G4KA 3ZU5A 2H11A 5JAOA 1ZGJA 4FE7A 4K7JA 4MQEA 5TGTA 2Q8PA 1SG9A 1W4ZA 1XRJA 2DAPA 1TA9A 4HC4A 4EBFA 3DOEA 4MQFB 4F56A 3QWFA 4GE0A 3B6ZA 3RSFA 4H35A 1Z2OX 3KAJA 5C8YF 3T54A 1BYIA 5THQA 5B1YA 3NLLA 4UTXA 3WIOA 2IEAA 3B52X 3FPJA 4B1FA 5BW8A 4LJAA 2PWBA 2GFIA 3JQFC 5DDIP 3DF9A 2HHAA 1KDRA 2YV1A 3OEEA 3QUBA 4JASB 4BBZA 2XMDA 1NOKA 4PWYA 1UMBA 4NCNA 4TVKA 1GZVA 1VJCA 5HE8A 2VP5A 3ESXA 4E5NA 3SF0A 4F04A 4FR2A 4Q12A 1Y1PA 3GRAA 1OTXA 4QFMA 1EHIA 2R1VB 4LNUB 4BNIA 1XTTA 1E0KA 1RMQA 1LQTA 3CZRA 4NPAA 721PA 4OH7A 2ONZA 3HGQA 4IFIA 3TLZA 3UV7A 1QCZA 5E9QA 2EBFX 4TOIA 5EMJA 3MIZA 2D1TA 4HDNB 1VB3A 3W3AH 3GT0A 4Y9DA 1BS1A 1TD1A 2VNAA 4JC5A 4YTEA 2XADA 3T15A 1C3EA 1NY5A 4IM7A 1F06A 1J33A 3A6FA 2OYSA 4QJBA 4O59O 4QNMA 2I71A 2PJZA 4N9QA 1HE8B 2N42A 2FQXA 2JGDB 1FQKA 1BFUA 2LDXA 1XD9A 1M2JA 4G0ZA 3BBLA 4ROSA 2ZRNA 2IYVA 1GLVA 4FOLA 1QTNA 5TQ0A 4FOOA 5JDCA 3N2LA 3RHTA 5EZYA 2OHGA 4G5FA 1B8UA 2NW6A 3FNEA 2M9MA 2VQFB 1L4FA 2JF0A 3GU3A 3AEQB 4KQEA 4OXIA 1KDTA 4ZKEA 3DFIA 1U3DA 5HTOA 3EAQA 5KWEA 1WXIA 1SKBA 1UOQA 3GGOA 4WOBA 1G5QA 3B9RA 4UCFA 1V5WA 4ZI5A 3SZOA 1VJRA 5DT9A 1QWOA 5EY5B 4DM4A 5CJPA 1FYVA 1U2DA 2QV7A 3MD0A 1SA0B 2E3JA 3NBMA 1VSVA 1YC5A 3GJ6A 3I53A 1Q7BA 3IE1A 3HCCA 4U7HA 2A35A 3LQ2A 7ABPA 3D8RA 2QTCA 1X7GA 3IOYA 1G5PA 4M36A 5MN4A 3JAKA 3B1ZA 4HUQA 1EX1A 3M4XA 1P0MA 2G0AA 3I23A 3QI2A 1T3TA 3E9DA 1QK3A 3I6QA 1RZUA 5BUCA 5JJCA 5KU1A 5TS3A 5ED4A 1SCKA 4P4SB 3CIOA 1FFBA 1JG7A 3C7TA 4BQOA 2XUOA 4RKRA 4LGMA 3FA2A 1AO0A 4M1MA 1LZLA 2CLDX 3L7BA 3TW4A 2OV2A 1U7TA 2A0UA 3I2FA 4PBTA 5AK4A 5KC9A 5JYEA 4JI1B 5LDHA 4HDKA 4MULA 4OYHA 4AYXA 2XNCA 4LTMA 1PR2A 1MRNA 3DTVB 4ZZIA 4CIYA 4JVLA 3S8MA 1U6IA 4QGBA 3W90A 2X0RA 3JVIA 2OWDA 4WLNA 1ZH8A 1OZAA 1EFPB 3V3TA 1QZUA 4K2HA 3D43A 2FR8C 4EPXA 4O4LF 4E1BA 1JKXA 3QELB 4DMLA 3EFHA 4Q4HA 3VJLA 2ZBFA 3JVUA 3SGLA 5LM3A 1XA0A 4A26A 2ZUEA 1UBEA 3S68A 3SFVA 3IJPA 1H6DA 4NE9A 1N25A 2JI9A 2PYZA 2ZAGA 2FN9A 2ZBUA 1YS9A 1NTRA 3HCFA 4X63A 2BHLA 3KQNA 4JGIA 4IWXA 1UKCA 1K98A 2OGSA 5DHAA 4UUOA 3RT7A 2VF2A 1YQTA 1O1YA 1TMYA 3BIJA 4YBZA 1MQ9A 3RVLA 1KTIA 2VFAA 3E7DA 4IQGA 1KHTA 4V2UA 4RA6A 1J2YA 4M98A 4H4EA 1JDNA 3IAS6 2QEQA 2QYOA 3K1ZA 2FCRA 3GLIE 5AHKA 2VTBB 1Z4IA 4JGGA 4XEUA 1WZNA 1NPTO 1P8JA 2G3YA 1NMSA 2JPDA 3CISA 4N3GA 1VSBA 1XTSA 1VJGA 1EXWA 3ENNA 3D4LA 4KBYA 4MAMA 1LD3A 4RD4A 5CM2Z 4F84A 5BV0A 2O4CA 2ODQA 2G5CA 2GH1A 4CL8A 2HJ9A 2GPNA 3BZBA 3MTAA 4JODA 5CG1A 2IUFA 1K5GA 3W4IA 1P91A 2E4UA 4X7MA 4IS3A 1GQ2A 2PLRA 4GP7A 4ZDIA 2RGCA 5BN5A 4LRWA 2GERA 2P40A 3WL8A 1RHUA 4Q7KA 1RRGA 1CK4A 1COZA 1ID1A 3W9YA 1SKMA 3GRKA 1Q7EA 2Z5LA 4KWTA 2PCLA 1NYLA 3IOBA 4Z54A 3IEMA 1BU5A 5DNDA 2GN0A 2WYUA 4E2XA 1RYDA 3W8EA 3GNTA 5BP7A 5CLIA 3WC4A 4CR6A 4BO6A 4EJ2A 1K7FB 1R74A 2A9PA 3A2NA 1D6NA 1DKRA 1EK6A 1FFCA 4DLSA 2AEEA 1B8PA 5DIFA 2HGSA 2H5JA 2VCYA 4F3NA 3BXHA 2O8CA 5EMLA 2PR2A 2IL1A 5ENVA 2JJ2D 4CNBA 5CXUA 1UOOA 3HGTA 5CMLA 1PF7E 4UNIA 4FB4A 2WTNA 1QZTA 4DLXA 5ENDA 3HBJA 1P2UA 4G0XA 4RXTA 5KSPA 1WU8A 4ETNA 4D8YA 1EUQA 1QGZA 3RK4A 3ICEA 5EIXA 1WEKA 3UHAA 2RARA 1TKAA 1ZWKA 2VHUA 3V7WA 1XAHA 1YA4A 1UAAA 2IYUA 3LPLA 4OYLA 5BWOA 3EVDA 4YY3B 3MCWA 3BMOB 3SX2A 1RBYA 2Q3LA 1O9GA 1VHDA 4INOA 1B42A 1T3GA 2JH3A 3D6JA 2VHWA 1PWEA 2FYTA 3X2EA 5C81A 1V11A 2R7AA 5A3VA 3GJYA 3ZI4A 2W6ZA 4KDFA 2GHQA 3CRVA 3DZJA 1LRLA 1S2MA 1U2DC 2Q7XA 3PC3A 1JW9B 3TCXB 2OZLB 2V4MA 1SD5A 4M53A 3V1YA 2O57A 1RI1A 4EW6A 2GN6A 5HCNA 1CJCA 3VU1A 4GI5A 1KH2A 3DHNA 3CF4G 1BW9B 4B45A 1PYDA 3EJ6A 1MAVA 4R16A 3FPAA 3HKCA 1ONPA 3L3BA 3GIDA 5CIQA 1QAQA 3P32A 3WLJA 4AM8A 2PV7A 1M73E 2BMAA 4R2JA 1GM5A 1K68A 4HB0A 2G4CA 1G0NA 5UKDA 1VI5A 4WKNA 4DG9A 1PJCA 5EE5B 4BLWA 1U98A 3A3OA 1O4WA 1JMYA 2H2FA 4FDUA 4RK5A 1MCZA 4BX9A 1K8QA 1JKIA 3PNYA 1PG0A 1W4CA 5FAXA 4Z2YA 1JMVA 2ZYSA 1J07A 3LRTA 2IY7A 1ZJWA 1RYEA 3INTA 4E1VA 2JRLA 2H1CA 1SOWA 3I5AA 5KOHB 3OE7A 1DS6A 2A1UA 1Z5VA 1U1DA 4QPJC 4UM7A 3DKRA 4E7OA 3SR3A 2J4DA 1EP1B 4K88A 1P4AA 2QM3A 4QIHA 3ETDA 1IC6A 3FOAA 3RVMA 2SKDA 1N32B 1JIVA 1JTEA 1ACMA 1EVEA 1PWHA 1G7TA 1TZCA 2HJGA 2GT1A 3HA5A 1GILA 3FF1A 3IMFA 4J90A 4PNPA 5BSUA 2H92A 3O8OA 2V8OA 1AKUA 1FP2A 1R5JA 2NV6A 3P0HA 1T9KA 1C7JA 3RC3A 4A8HA 4AMUA 1XD2A 3N2KB 1I6LA 1NAHA 3LBAA 2CNWD 3BXOA 5AKXA 2DPGA 3HADA 3I45A 4F3RA 5DBFA 2TSYB 4Q4JB 5LLDA 4FBGA 1G9SA 3DEFA 4YT8A 2B1GA 2OCKA 4I9UA 5A71A 2VYCA 3WGNA 4J0JA 4D9HA 5LKRA 3HFRA 2PJUA 2E4ZA 3ANTA 4YJ3B 3RO7A 1HE1C 2FU5C 4RFLA 4Z7JA 1ZCBA 3G5AA 2GX6A 1KFEB 1V2GA 3U0VA 4JT9A 1C9NA 3EIUA 4TUYA 2D54A 2Z2IA 2W8ZA 3ZCPA 2Q5IA 2JGNA 2YFHA 1S2LA 3TQFA 1O89A 4CDGA 1VDMA 2C7PA 4TROA 1GAQA 1SU6A 3RNLA 2CDBA 3E23A 3LLUA 2W71A 4GR9A 4PC1A 1NBWB 1F4VA 2HNKA 3JZFA 1T5LA 4RAQA 5D51S 5AVQA 5KQGA 1BH6A 1I3MA 1KOGA 1O5IA 2IOQA 3ND8A 2G80A 5G0WA 3QBVA 1Y3IA 1B0ZA 4OPMA 1DIGA 2J31A 2O0KA 5A3SA 5F5NA 4FLEA 1VJ0A 4Q7QA 2CHVA 1ZK4A 1C1DA 4Y1EA 3PDUA 4TLAA 2IUUA 3PUYA 3MRSA 1EQUA 2R8OA 1JI3A 1DINA 1MRZA 3V1LA 4QD3A 1H9BA 1NX6A 4YAIA 2KLHA 3EGWA 5BVGB 1QTQA 4Q93A 1AXEA 1WQ1R 3ELBA 5AUPB 2YZMA 2BI4A 4MV9A 3OICA 1Y82A 2A88A 2HWYA 4C4TA 3IA7A 2BE7A 3M5WA 4YHHB 1H3NA 4OMDA 2Z9CA 4G1EB 1VPWA 2YHIA 3DL0A 1YL7A 1M8PA 3BREA 2OENG 2P5YA 3QKIA 5CFOA 4OQ4A 1TCUA 3BDAA 4Z4CA 3DLHA 3A27A 1CDEA 3OLXA 4P33A 4AJ4A 2WNIA 4P38A 1CHDA 5THKA 4ER6A 1L7RA 5D85A 4NZNA 4IIGA 2HO5A 2L17A 3MGCA 1FS4A 3QBJA 1E7WA 2YJ6A 3H9EO 1JS1X 2IPMA 3B12A 3O9VA 4I1IA 4M21A 3T61A 3U3JA 5JASA 2ZWMA 1Y4AE 4KLCA 4DWWA 1FX0A 3MT0A 3N8NA 3L7AA 1RQ2A 5GJVC 4DKXA 2WJAA 5I45A 1KNQA 2IUTA 4IF4A 4XD2A 1DADA 1WULS 2H0RA 1PSZA 3BOSA 1L5LA 5KYUB 3W6ZA 2A33A 4HVAA 3ER6A 4FWIB 2NXCA 1DJMA 1ZJ4A 3SS9X 2FOXA 4JT2A 4UASA 3WBKA 2EARA 2FR1A 1L7OA 1PFQA 2H4JA 1WXWA 3P8ZA 4CLOB 3GFQA 1BA3A 1CS0B 1MQ8B 1VI2A 4UFPA 4QG3A 4CQMD 5IASA 5C52B 1C80A 2RKBA 2HHJA 1RNLA 5IN5A 4KMMA 5A6SA 5B37A 2RGYA 5E4FA 5F51A 1T0BA 1IHXA 4BNGA 1N9GB 1Z29A 4UJ3A 1UQUA 5ARCA 4FS3A 1OXUA 2X2PA 1SXGA 4YA6A 4F1JA 1Z3CA 1ULTA 4P35A 1ZP6A 3RVBA 4DBLE 4UXJA 2Q5LA 1OFIA 4MZDA 1I5RA 3MINA 1N2ZA 4BP1A 4Y6QA 3NYQA 1K66A 2JGKA 2PL5A 1XF9A 1SXJA 1W6UA 2G5GX 2OFWA 4KACA 4X1YA 1OX4A 1QH9A 3ZY3A 4V0OA 4HH4A 4I5EA 1E0SA 1CZRA 3EXHB 3ZDZB 5F12A 3FPKA 2FVXA 1MABB 2CBZA 3JTMA 3R5HA 4Y2JA 3UNXA 1WNFA 1XUOA 3AUFA 1KEVA 1LB1B 3HS3A 4FFLA 2QRLA 3TLYA 3FRHA 3UAYA 4JMPA 3UKJA 4E15A 5C46F 1D7OA 1FRQA 1DKNA 1F0YA 2AJ8A 1IK6A 5FOQA 5K0FA 4EG5A 1EIWA 1ISMA 1DV2A 2GN2A 3FNGA 2R97A 4M1EA 2P7HA 3HL4A 1M2EA 5JQGF 1PL6A 1GTRA 1C8BA 1XHFA 1QS0B 2AUTA 3KZCA 2OYRA 4M7WA 3U3ZA 3MUEA 3MD9A 1SIBE 5DNUA 1SCAA 1JXOA 3OFSA 1VE9A 1VHLA 2E4AA 2IU0A 4AQYB 3TECE 3LUGA 1DEKA 4Z1MD 5LOVF 4BIIA 2O2IA 1JPJA 1DLIA 5GGYA 4DLWA 1IVNA 3QUQA 4R8LA 3M83A 5B3JA 3MJVA 2FP3A 2GTHA 4ZI2A 2JJ8A 1K86A 1WB9A 1ZNZA 4IXWA 1YK1A 5IVHA 1PRYA 3UAVA 5B30A 4EG8A 1A96A 3BX1A 4S1OA 1GPUA 1XDGA 2IHKA 2XA2A 2ZM5A 3CC8A 3TPZA 2PQ0A 2CYCA 3JQRA 3L9XA 2IXTA 3TI9A 3ZQ6A 5BUSA 4IFTA 5F9MA 3M9WA 4HB2A 2IELA 1GNTA 5I7UA 2BL4A 3G1TA 1F8GA 1GKYA 2O8FA 4BZPA 3TNFA 1I1NA 4E5PA 4C08A 1H2EA 1LDNA 3FGPA 4JBWA 3IVAA 4OKSA 4WOPA 4F06A 3WFJA 5B1SA 1GG9A 2Q3MA 2X6QA 4DSNA 1TZBA 3KCNA 1WHTB 1IBCA 3ICCA 3HKDB 3RVDA 2OTCA 5AOCA 4OA8A 4B3BA 4D9GA 4EGQA 9GPBA 2ORED 1TW3A 1PL0A 3OHMA 2NSYA 4UVGA 3GCDA 1YCGA 1H65A 2F3QA 1A8HA 3HMKA 5TSDA 3KSAC 3CH6A 3OZBA 3VZPA 3QVVA 4WQMA 2C9ZA 1A9SA 2JLBA 4N0QA 3H5IA 4H6PA 3E58A 4MHSA 4QATA 3B70A 4AX4A 4NXNB 3PDIB 4KGZA 4QFDA 1IPFA 5KSYA 1H3FA 1I5OA 2Z8YA 3IMEA 3DLPX 5FWNA 2J3DA 2G9QA 1G6HA 4LJ5A 1T26A 2V96A 1H1LA 2JBWA 3L8HA 3PQEA 1UMKA 1HQKA 3O91A 1UWCA 4OJNA 5JNWA 4DV1B 2EP7A 2X6TA 4RLFA 3L40A 2GVDC 3TVYA 3VHLB 3GIWA 2FEAA 1MAUA 3D7MA 4PLTA 2EEZA 3TAHA 4EA7A 5AQEA 5KB3A 1SAYA 1P9NA 4MPPA 1U7XA 3T7TA 2EFEB 4OXXA 3PHCA 3ZIDA 1V3UA 3U56A 1GEEA 3ZI0A 1FUIA 4KK3A 3MIIA 4V3CA 5HG0A 2X23A 5IFLA 3IQWA 1J7JA 3GJ5A 2HFKA 2WIGA 1BXKA 3SJCA 4L0DA 1E4EB 1OXMA 1Y3DE 4C0BA 4R1QA 4CTNA 2UZ4A 1J8YF 4V39A 1O96B 2P78A 2QTAA 4OJKA 3QYJA 5FULA 2H00A 1FB5A 2X6RA 2XIJA 3PQDA 4M46A 4TV8F 2B69A 1EX7A 2YICA 4MGZR 5KDLA 3H83A 4G5YA 5AO9A 3WMWA 2EHDA 1CQJB 1GGMA 1N8TA 4DANA 2HQRA 2PX3A 2IZOA 3TGPA 4ZEWA 4FFDA 1GXSB 2BBTA 2J6BA 5TQVA 1EVQA 3X1YA 5EIOA 3Q8XB 2ZIXB 3TEMA 3V7UA 3WIBA 2Y8EA 3UUWA 3EZ2A 1G3RA 2PKEA 1FFAA 2VSOA 3QVUA 4ARZB 3PC8C 4B6PA 1FYXA 2V74B 4GOND 4LDAA 1KP3A 5EL0A 1G64A 3VH2A 4LTDA 1ZZGA 2WYVA 4E3WA 4Q34A 5EQDA 1Q3TA 3IJEB 2GN9A 1M8GA 3EZXA 1AZSC 3Q3CA 4GMDA 1FU4A 3ZOZA 2ZETA 3EODA 3AWIA 3EZYA 4BP8A 5JANA 1HOXA 3GJ7A 1X94A 1HNZB 4LOIA 2YJ4A 2EZ4A 5A9SB 4KG7A 2HT6A 3UYLA 3K72B 4HNHA 3D1JA 5ABPA 3KAKA 3KPYA 5BQFA 4YMWA 3F4LA 2VBIA 1CERA 4H08A 4PR0A 1HMPA 1WF6A 2C0CA 2RCNA 1VCNA 3HCRA 4PZ9A 2H08A 2X9NA 1XBTA 3RTCA 4G8JA 4OBEA 4P93A 5DXJA 4BVFA 1JHAA 2EOAA 1CUIA 2PT6A 2BMWA 5AK5A 1H8EA 1VPTA 3EX7C 4LFAB 2EBWA 1SVKA 3HDHA 4UDYX 3MT7A 3UA3A 5CFQA 3U4QB 4H4CA 2FETA 1EXNA 2VDWA 3OJ0A 4RFVA 2I66A 1Y9DA 4KAAA 3RBVA 3EMVA 1R18A 1F2UB 4KXXA 1DBIA 1QVAA 4NFSA 1Z45A 4YRSA 2I2FA 4HMOA 1ZNYA 2Q6TA 1I7PA 1SY7A 1XXHB 3M49A 4PZLA 4QHTA 1OXTA 2HF8A 3V2IA 1RADA 1YS6A 3CZAA 1SJ9A 3HXTA 1B43A 1DI0A 3QOWA 4U1RA 4BY9E 1VHQA 1HYQA 1LF0A 2J9GA 1YJAA 3L7OA 4BN0A 1YS1X 1GZ7A 1H22A 1HV8A 1IHOA 1R64A 2QTRA 3FWZA 1XWIA 4IOJA 4JLDA 4NU0A 4PHGA 5B3JC 3RNOA 1II9A 2WTAA 4W5HA 2C7BA 4Z7OB 2VRNA 3FSEA 1DIRA 1N8SA 2FKAA 3I8XA 3LUFA 4MVJM 1PG5A 1G20E 4XX0B 2IBSA 1OASA 1YDFA 4LHWA 1M6HA 1A97A 3AHFA 3DOHA 5ESDA 3H11A 2O5VA 3WYBA 5KNLA 1W25A 1P17A 3NRCA 3KSRA 5JW6A 4GSYA 4H7IA 1T5DX 2FEXA 3BGIA 4EELA 5L53A 3HYNA 1T2NA 5GV7A 2FUCA 3WQRA 4OXQA 3T9AA 1BMFD 3JYPA 2C29D 4X8OA 2G9NA 2X40A 3GT3A 2ORVA 3ME5A 1CRPA 3QV1A 4IAOA 3OC0A 2NUBA 3G89A 3M0EA 4JIGA 1BAPA 4IH9A 2C2WA 3GB9A 3K7EA 4O08A 1UBJS 3R09A 4QTXA 5FLEX 4DGSA 5C80A 3IMGA 3UB2A 3WNBA 2O4UX 4EO9A 2H6EA 5CDYA 1YS7A 1ESDA 4XYBA 2O8NA 4UBOA 1E5TA 3CXUA 1JR6A 5IM4F 4B40A 5D3ZA 4M1YA 5I3CA 4NBWA 2FFAA 4OB7A 2YMMA 3IA2A 3NKLA 4EKYA 4DR3B 5IUJC 3QU9A 1IM5A 3JXEA 2QY6A 4MAFA 3H13A 3X1XA 3ODGA 4DIOA 4YUXA 4AMYA 5AW8A 3LOUA 3U7RA 3I3SR 3GLGA 1BRMA 5EYPA 1G3UA 4IX1A 4UDXX 1I01A 4W1SA 2IS4A 4L6AA 4ROTA 3O1LA 1MPXA 4OLAA 1FC0A 3OCVA 5CD1A 3K9FC 1PX2A 4IVQA 1E20A 4YJGA 3ZGOA 1HT1E 1NBOA 1SGWA 3UJ3X 4Y2GA 1UAGA 5CH8A 3PI7A 1U5BB 1GGHA 2JBAA 2PSEA 4LV5B 1EH5A 4TT3A 4M0MA 2XCSB 1ACLA 1KYZA 1Q74A 2P8SA 1NF3A 4KRXA 4LXIA 4DILA 5G02A 2PZGA 3LY5A 4YPVA 2FDRA 3E0QA 3ZZ1A 2D8MA 4BUZA 2WA1A 4IGKA 4II2A 4WK4B 2E85A 3JQQA 5CLGA 4D3XA 3RV4A 2E2WA 3Q3HA 1FFSA 1MV5A 2GZAA 2W2QA 1PS8A 3L0PA 2NU7B 1C29B 1YB4A 1ZJ6A 2LIVA 5FBHA 4DDUA 5EZ5A 2ANBA 3HCNA 5E3HA 4FC7A 1AVTA 4XWKA 1GQOA 2AR0A 3AXSA 5JQWA 1G2PA 3WS7A 4AK9A 5C34B 5B7PA 5KTPA 1ZISA 5K7SA 3WO1A 4JJZA 3RU3A 3GGSA 4NYIR 3SF8A 3TW8A 5BWCA 7ADHA 5HR5A 2OECA 3NS7A 4M9QA 4BX0A 2W42A 2H1OA 1D8AA 3JARB 3WDLA 5B6PA 1KEEB 1IAVA 3Q3EA 1D6MA 1QX4A 3CM0A 3EISA 2J9FA 4ABTA 5DHFA 1U6KA 5BXQC 2ON6A 3DKVA 2V3WA 1Z26A 1OU4A 3EVEA 4XIIA 3DZCA 4OIMA 5D1NA 4BO8A 2WTBA 5DI3B 3SLRA 3AOGA 3TF5A 1HKHA 1LK5A 1TT7A 1HT0A 3NWBA 2ZZNA 3CWQA 1L7VC 4ZOEA 4R31A 2ODNA 4TZ6A 1Z36A 5DOZA 3IPAA 4D4IA 2I7TA 3UQYS 1KDZA 2ZROA 3KPVA 4K9SA 3D7RA 1Y63A 4TTTS 1ZN9A 3ZJTA 3VJKA 1TO6A 2HC9A 3LSYA 4ILEA 4NWIA 2JLCA 1NVEA 1KRHA 3FPLA 4IJUA 4G8BA 3R7DA 3RGWS 1UPCA 4BP9A 4F8EA 4A1OA 1IBRA 3KDAA 5IXYA 3X44A 3EEIA 5CT6A 4HUJA 2RGNC 1CUEA 2B5WA 2EWWA 2HQBA 4L5JA 3WJ1A 4DMHA 3PPWA 5ADUS 1BXRB 2RGDA 3H75A 3RARA 1ORTA 3AESB 2VJYA 3EPPA 1E2UA 1XN4A 2IYOA 3K70B 2VJLA 1W5FA 1W5SA 3C98A 2P5UA 3FCUB 3K0EA 3VO2A 3FYDA 4HV4A 3IBCA 3NKVA 1X3SA 3C2QA 4W7SA 3UXEA 5IKMA 5E1DA 2ZBDA 2JD0A 5AKHA 2EXXA 3QA9A 1W5AA 3IV7A 4LYAA 4RLSA 3MUOA 5DT2A 4ZHQB 2IPAB 1ABEA 3HE3A 4F11A 4KIJA 5KNDH 4O2BB 1HFEL 3UV6A 1I33A 1V3QE 3IQDB 4TLLB 2WHEA 4Q9IA 3RS4A 1DGQA 2GXUA 2O1EA 1ESZA 5KYYB 5HIAA 3HJGA 1JAHA 3FOWA 2X7XA 2XRYA 3INYA 1B6TA 1NPDA 4NFYA 1FZTA 5JOQA 1FDSA 1UAYA 1TYAE 2CLCX 1TCCA 2IU4A 3N0RA 3N8DA 1GT91 3ED1A 4FEEA 4UBJA 4ZANA 3RVQA 3WDSA 3THXA 1EM8B 4J7UA 2UYQA 1K7YA 3DTNA 4AZ3B 5JSKA 5K1ZA 3RSGA 1E79A 4EGJA 3IEPA 5CEJA 2BR3A 1IEQA 2VJMA 2AFIB 2X1LA 2YZ2A 3V4LA 1QRDA 3HR7A 1XN1A 5CH5A 2Z3VA 3L7KA 3GDHA 3LG2A 3JATB 4FYWA 5HFNA 3HCWA 1V6SA 3S29A 4B35A 1BE1A 2JNWA 3BMCA 1WVMA 4CUZA 3FKSD 3PYLA 3LP6A 5TV2A 4W5RA 3I2HA 3UENA 3KVNA 3D5TA 3IPYA 4M9XA 1EINA 3IX7A 1ULZA 3S99A 3CURA 4FBLA 3H6GA 2OD9A 4EM6A 1N5DA 5AIBA 2PPLA 3Q15C 1QHXA 5K0JA 3CLUD 4ZOLF 4B3MB 1IXSB 4IIVA 3BQNB 1K5HA 5CYFA 4P08A 3IAHA 4EFLA 3G2HA 1XJQA 4LQCA 1NVTA 4HGYA 2I54A 4N3AA 4D9MA 3EMBA 3AR8A 4CIAA 1BZYA 3G0GA 1IIRA 3JWIA 4PV7A 1G9TA 3JZMA 3KB2A 4HX5A 5BO5A 4Q03A 2Q8NA 2PWZA 3ZJ5A 2GZRA 2OY0A 4FYJA 1NR5A