3PC6A

X-ray crystal structure of the second xrcc1 brct domain.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
ELPDFFEGKHFFLYGEFPGDERRRLIRYVTAFNGELEDYMNERVQFVITAQEWDPNFEEALMENPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQAHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords DNA repair protein XRCC1
publication title The structural basis for partitioning of the XRCC1/DNA ligase III-{alpha} BRCT-mediated dimer complexes.
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pc6A00
3L41A 3K16A 3L40A 2HTFA 1T2UA 1L0BA 1KZYC 2L42A 4Y18A 2COUA 3PC8C 2WT8A 4BU1A 4JLUA 3UEOA 1T2VA 1JNXX 2LE0A 2K6GA 3AL3A 3PA6A 3K15A 3T7KA 3HUEA 3PC8A 2K7FA 4XQ0A 4BMDA 2COEA 3U3ZA 1Y98A 4OFBA 3KTFA 3QVGA 1L7BA 3PXEA 2NTEA 3PC7A 4BU0A 3PD7A 2XNHA 4IFIA 3K0HA 3AL2A 1T29A 1IMOA 2E2WA 3PC6A 2COKA 3T1NA 1N5OX 4BMCA 4ID3A 3FA2A 3JVEA 2XNKA 5ECGC 4XPZA 3T7IA 1T15A 2VXCA 3EF1A 3PXAA 4U4AA 2DUNA 2D8MA 3PXCX 2EP8A 1IN1A 3HUFA 2M2IA 2INGX 3SHTA 3K0KA 3SHVA 1Z56C 2AZMA 3UENA 1GZHB 4Y2GA 2ADOA 3L46A 1CDZA 3EF0A 3II6X 3COJA 1WF6A 3PXBA 2R1ZA 3I0MA 3SZMA 3I0NA 3SQDA 2JW5A 2EBUA 4N40A 3OLCX 2VXBA 1OQAA 3PXDA 2ETXA 3T7JA 3K05A 3QVGB 4IGKA 2EBWA
chains in the Genus database with same CATH superfamily
3BMNA 2H4YA 3PJFA 4MARA 5BSMA 1IB6A 4EVRA 4P92A 5EEHA 3CX7A 4YK7A 3Q9LA 5C8YB 4DM4A 5P8WA 5A6SB 1DRKA 3PNBA 4HGPA 3WYNA 3ADCA 2VI5A 3M1IA 2QRKA 3U7JA 2CNOA 1NZDA 4TKUA 2EYUA 5TV2A 3TDMA 4WZBB 2A5FA 2Z0MA 4O2AF 2WA2A 4AI6A 1ABEA 3DF7A 1GN9A 3B53X 4P4LA 4ZVPA 4RIHA 2KBFA 5K3FB 5C1BA 4CKEB 3ABOB 3FCSB 2H5LA 4RKYA 1ORVA 2R1TB 3CCFA 4MCHA 5SY6A 1VM6A 3A9VA 2RI6A 3OZIA 3OUTA 1OIXA 3TI9A 4C5BA 1W9MA 1DEAA 1PE0A 4WINA 5DCWA 3L05A 4HGQA 2GFIA 5J5AA 2QLTA 1E1NA 1KI6A 1V4BA 5F3DA 1U1GA 4UEKA 4Z1MD 1L5ZA 1GAJA 1N8NA 4NPHA 2WF9A 3WLOA 4CT0A 4PX3A 2QTHA 2IKSA 3I5XA 3R6LA 3I53A 1DKNA 2ZITA 4JUIA 2PLNA 4K6HA 2C1EA 4AW9A 2BHLA 3TW4A 3GK3A 2OO5A 2JK1A 4KC0A 3OUZA 2OOSA 3MRTA 4K28A 4ZVRA 1PSZA 3MCUA 1G3RA 1I3MA 3HABA 3I45A 2DUWA 4XDYA 5DI9A 4C5AA 5LXTF 4NL4H 1QDUA 4P0PB 1GPLA 2OCIA 2A9FA 3DO8A 3F5MA 1SO8A 4YGYA 5EKSA 1P61B 2GTHA 3A11A 3IILA 3RFTA 2QF7A 1PSDA 4QXRA 4AROA 4XWKA 3D6NB 1L4UA 3HP4A 1J49A 3AHFA 3OBBA 1FP4B 3ONEA 1RJ9B 4K6KA 4KO8A 3ZD7A 4L51A 1X74A 1QHXA 1TZJA 4Z4IA 2CF5A 1DQPA 1OZFA 1PUXA 2I0FA 1ZH0A 1SEPA 3NYQA 3PX3A 5CLFA 1VSTA 3FUVA 1N32B 2AR7A 3WA7A 3NFRA 5GV7A 4CL2A 4RA9B 2YR0A 1ZGAA 4WBSA 3WGTA 4CKBB 1PZGA 1Z2DA 3DXFA 5EINA 4ZEOA 1Z0AA 2VAVA 5EE1A 3ZUGA 2HGSA 3ECAA 4UHDA 4Q9KA 1YJ8A 1JGTA 4DG9A 5JS6A 2VDWA 1CBUA 3UAYA 5HZHA 1NYTA 2WI8A 2HC9A 4NLLA 4E4YA 5KDDA 2AQKA 1QP8A 1GT6A 4TV8F 4X6XA 4BVAA 2YL2A 3NBFA 3R6GA 2OCLA 2IL1A 5BV7A 1IG0A 3GX1A 2IJGX 3MMZA 1M6EX 3PKZA 1SVUA 3HCCA 3W8EA 1K3UB 3BSYA 1T35A 1RS0A 3JQ7A 4ZRDA 3RAJA 4EUFA 1AXGA 1EHCA 1Y4SA 2X0KA 1YMQA 1BMTA 4ZJUA 2ACVA 1EVLA 5LB4A 2OFWA 1YR8A 3GL9A 3V32A 1WV1A 3GEBA 4GZLA 2WTMA 3OUUA 5KQMA 4K0KB 2QY6A 2WJHA 3OOHA 4MKRA 5DHTA 3UZUA 3BXOA 2OO3A 3S1AA 1D9XA 2TMYA 1WXWA 2OG2A 1HTBA 3BGVA 3RB8A 4CFSA 3KRTA 1YRAA 2IDZA 1QFJA 1M5TA 2BFDB 3VDRA 4EH1A 3ESDA 1H0HA 1WKVA 3G0HA 5JJIA 5SY4A 4GHWA 3EGCA 1HETA 3IDSA 3OOYA 1JQEA 5C0OE 5ITSA 3PC4A 3SP1A 1VKNA 2GM3A 4BNWA 4A1FA 4NBVA 4A6EA 3KQHA 3GH3A 1J2RA 1T2EA 1OFUA 1J0CA 2HZBA 4I55F 1IZYA 3UK2A 3VZPA 2WQ6A 4NNPA 1TPZA 5D84A 1X7YB 1DMSA 1RRFA 1G2IA 4PX5A 3WYCA 1IN8A 4NMLA 4RORA 1B8PA 3M3PA 5ITWA 4RIEA 1XXHA 3L4EA 4OMCA 1UPAA 2WJIA 1QO0A 1ZL2A 2Q9AA 2IK8A 3BL5A 1GU1A 3UMSA 3TECE 4GYJA 1SGWA 1WV0A 3BB1A 3Q9SA 2Z6QA 2BGLA 4V0QA 5JBQA 2YBDA 2YH2A 2EZTA 3RRNA 2F3SA 3QX8A 2K2WA 4BTVA 1V7ZA 4UXJA 4HYEA 4UFOA 4Y6LA 3HMQA 2IP2A 2DHRA 5DHPA 4K88A 1V8BA 3MGAA 3TSZA 1RM5A 3N70A 3GO4A 4LRWA 3DHNA 5IU6A 1C4XA 4PRZA 2IYSA 5SYNA 2ZTLA 2HRBA 4I5IA 3SBOA 2DQ4A 1C8BA 3TVTA 4C6HA 1P5RA 3OJWA 4PS1A 1YZQA 2GF2A 4CNQA 4OH7A 5BQXA 2VEOA 3MB5A 3OZGA 4BFUA 4BNDA 4D98A 4EB8A 3OZFA 1M2KA 4ESVA 2KBEA 2WJAA 5DXAA 5JXIA 2OKCA 3ZW9A 3SSOA 4EF4A 5TLSA 2P9EA 2PLRA 3EEBA 3T52A 4WE3A 4YGXB 1FUKA 4UTNA 3QVGA 4Y6QA 3CU5A 1WMFA 3GRKA 4Q1VA 1N1EA 3BD7A 4JBNA 3QW2A 1KK1A 3R2JA 4PR3A 2I2BA 5AOVA 4AZSA 4NV1A 4E88A 1JIKA 4YRNA 4EMTA 3L8CA 5LKRA 1JRLA 3NDJA 4YPOA 4EI2A 3QFRA 3T7SA 4EPTA 3MPUA 2I6TA 2GVZC 3SDSA 2GPTA 2O8BA 4AWAA 4DLTA 3LSTA 4MUBA 1JHPA 2ZJFA 4ZYXA 2VOEA 4IS3A 1PJBA 3OKFA 4X1YB 5KSPA 1GUYA 2NZYA 4TUYA 1NSFA 3WHKA 1N25A 4BCDA 5E4YA 1HPLA 2FXIA 3MJRA 2QYHA 4JDPA 3KQLA 4CCYA 1VJDA 2SHKA 4OP1A 1P19A 4H3KB 3F3SA 1FDRA 5LP6A 2A3RA 3PUZA 5DLEA 1MCZA 5DNVA 4KDCA 5IHXA 4ZGBA 2BONA 2O8FA 2JLWA 3IVCA 1CUDA 1GKYA 3NH6A 2FWNA 4GE0A 3RC7A 2C7OA 3IUNA 5BSEA 1YR3A 3IERA 3DXZA 1OFTA 4IMPA 3F6RA 2ZI4A 1P1JA 1MC5A 3PHLA 3EPKA 3AWDA 3H9QA 4NOKA 3C41J 2P1DA 1LH0A 1HZJA 1ZM2A 4UHEA 4EVIA 3QU9A 4RELA 3UQZA 3FPEA 5E0OA 2GBGA 1FYXA 2H8GA 1BXZA 2EERA 2FETA 1YI1A 3KQSA 4NCXA 4H27A 4F2GA 2IHTA 3HSSA 3U31A 3OMXA 2PKXA 1VPVA 1II8B 1QONA 3UAWA 1P7WA 1NI4B 1CFZA 2VO1A 2FA9A 3PBKA 4DBLE 2X6RA 4PSAA 3EZXA 2V55B 3MMXA 3PI7A 3DE4X 4U0KA 2DBYA 3VBEA 3HR7A 1ZK4A 3OLQA 5C80A 3B7PA 4G56A 4Q7KA 4A73A 3R20A 5HR5A 1ZEJA 5LFAA 2BFAA 3PEYA 3WOHA 1QF6A 3A58B 4P54A 3QVUA 3AUFA 2YASA 4A6PA 4YCCA 1QRSA 3ES9A 4MS1A 1YQEA 3Q15C 1CZKA 4H1VA 1DTWA 1PJ8A 4PC7A 3OURA 1ADGA 3TVYA 1AUXA 1PTJC 3G5LA 2JBAB 4DDMA 4GI2A 2OB2A 1ENOA 4NV3A 3KZVA 4QFBA 1EZZA 3M34A 3HS3A 4NG4A 5F73A 5AESA 4G25A 4DC1A 2Y4OA 2A5LA 2AG0A 2J46A 4IWYA 1B16A 1WPQA 3I2FA 4HUQA 2I34A 3CZ9A 3IUPA 1GDTA 1NJ6A 4PLWA 2V7BA 1JHAA 1QG0A 4KI0A 3FMOB 3JW8A 3RC9A 2GBFA 2ZWIA 1V5IA 5FWYB 2I78A 2UVPB 2RAFA 1DC3A 2XE6A 1PWHA 1O1YA 3T12A 3CVJA 2DUJA 1TM2A 2P3QA 3K0EA 1LVUA 2FOLA 1AXEA 1EWKA 1QKKA 3O83A 4JUAA 1S1MA 3KZCA 5TF0A 5CYGA 4H0NA 3M49A 4G0OA 4EG1A 3AOEA 5K1ZA 1KP9A 3OOJA 3ZVNA 1PEDA 2PSSA 2HREA 1IAQA 3QOXA 3SR0A 5M2QA 3F71A 4QUHA 2P3SA 2PWPA 3AETA 2JFNA 1GNRA 1G7CA 1NN1A 2QUIA 3D3QA 3TLYA 1XA3A 3OZAA 5BR7A 3QMMA 4M37A 4C87A 3KZMA 1O9HA 1LI5A 3B1ZA 5DM4A 5I01A 3NKFA 5C8YA 1IVSA 1KFEB 3NBAA 1JN0A 1L6RA 2C82A 1C3XA 2EHJA 3OT5A 3QEMA 5A6SA 1Q0RA 4Q7LA 1FSZA 1E3TA 1WSBA 3MHPA 4ETNA 1KEKA 4PSKA 3GVCA 1TJPB 1UFRA 4TGLA 4WZBA 5HCNA 3OE1A 2W2QA 4IGFA 3NP7A 1PZFA 1OVMA 3GN1A 3UJ3X 3EQ8A 5K3FA 3P9KA 4IDNA 2D7JA 5IJXA 4OREX 4CKEA 1RYMA 4I9HA 3ZQ4A 1TCUA 1NW4A 2JDID 3JYLA 4U3JB 1C3EA 3TNJA 1RLUA 4AY5A 4DG5A 5KSZA 2O8CB 2VKQA 1PFUA 3AVYA 2YFYA 4IV5A 2IEYA 4XASA 3RRBA 2H1VA 3VYSB 2Z5LA 2Y2UA 1LGYA 2BM1A 1J0XO 3DVAB 3QOWA 3VVMA 3LH5A 2E87A 4BMOB 3LWDA 4DREA 5BVHB 3FDZA 2GR9A 2GWRA 3KOOA 1LEHA 1FP7A 2FR8A 2O2HA 2SBTA 4H3VA 1ORIA 3HXMA 4JYMA 3VZRA 2PBZA 3LUAA 3AKZA 3FZQA 4XUEA 3SGLA 1D1TA 1KDTA 3L8ZA 4L9SA 4XJTA 3UFXA 2DXIA 1S3IA 1VE9A 2YWCA 4P5DA 1XWIA 5EHIA 3O31A 2ARKA 2P67A 2WP0A 1ZHOA 2HMYB 2MSNA 4ZIRA 1KZ1A 2EGUA 1Z6GA 3ZGYA 3DBRB 2BGMA 1LY1A 4X8HA 2ACEA 1J7KA 5AHXA 4P93A 1QVRA 3P2YA 4RUKA 4TTIA 4YBRA 4L5AA 3AK4A 1RJ9A 3CF6R 2Y3IA 4INJA 6LDHA 3HVIA 5CVVA 2OHIA 4KR3A 1KQOA 4NBSA 4RLFA 4H4EA 5LQMA 1WEHA 1ZD3A 4UMFA 3BOSA 1NXTA 1V45E 3CRNA 5MN5A 1OUMA 5TPWB 3V8QA 3ZIAA 4G0WA 5FPHA 3G1TA 1N3LA 4RA9A 3WTCA 3TSWA 4CKBA 4GAEA 1I7PA 3T7CA 4QLBA 1NHWA 2JG3A 2UKDA 4Y0AA 3TR6A 4H60A 4BY9E 3ICQB 2APJA 4B3XA 2YHUA 4DBLC 1Z5UA 3GW8A 1NY5A 3LYAA 1O96A 4JASB 1P4AA 5A2GA 1F8FA 3WY9A 1KKMA 4QT0A 5CBPB 4KQ9A 1TAHA 1H9CA 3AFOA 3UJ9A 1R4AA 1BMFA 2C3PA 3CKYA 3QTTA 1K27A 1S89A 4EL5A 3BL6A 4UCXA 2WT8A 5HILA 1IK4A 1QPZA 3R3HA 5CX1B 2I76A 1DTSA 3EY9A 1QYIA 4MULA 1P7YA 3AT1A 1NVGA 3NCTA 1WCV1 4IHJB 2I6SA 2WHPB 5EKUA 1EIZA 3HXPA 4C0HA 1V6CA 4M4SA 4KO2S 4XQ0A 2ECQA 3O8RA 3TXAA 3H0KA 4G0NA 3Q41A 1L6IA 1TW2A 1OCEA 2BFDA 3S2EA 3MMSA 4CI0B 2A4MA 1F4PA 1P4HA 4ZAZA 1FRQA 3BRWA 4G3XA 2WEKA 1WDMA 3I6IA 3BFXA 2Y0PA 4M87A 3G13A 4NP6A 1MT3A 3ONWA 2OHOA 1Y1KE 3IIEA 3ISVA 3IKMB 3FSEA 4MVJE 3MWFA 4B48A 2WFMA 5TS3A 4CCSA 4HQOA 4GL2A 3ZQKA 3HN7A 3PJGA 2C2YA 1X7YA 4RGVA 4TYQA 4BCCA 1G9SA 1N2JA 1UADA 4NYMQ 4KFCA 4LXHA 3S5JA 2IYNA 1K63A 4Z4QA 2OY0A 3KKNA 2GH1A 3JPWA 4Q7EA 2JGMA 2H4FA 3TLXA 2I2AA 4C89A 1N6RA 1U0FA 2KM1A 4WH0A 2DUUA 2ZQ5A 3DTNA 4U6NA 3GMTA 1DS6A 1BA2A 3IKJA 1TAGA 5T41A 2X1VA 1HM5A 3OEWA 4V0KA 1RR6A 5AW5A 1UBNA 3H3JA 4KXYA 3SIWA 3ME5A 2HMUA 2IEZA 3K9HA 4NJMB 1I6WA 1H3EA 3G79A 2GO1A 4FW8A 5BUCA 3IFSA 2RH5A 1XTTA 5FUWA 4OLBA 5JFGA 3PDHA 4HQKA 2RBEA 1OMOA 2X2OA 4B17A 1UQUA 2NT3A 4WXYB 5E6SB 2F4VB 1WMEA 2H0AA 1OI7A 2AEMA 2AC7A 3AHEA 4FYMA 4MIYA 2QN1A 1YL5A 3NUQA 1IY0A 1R8XA 1F1JA 1X15A 4NABA 4DWOA 2PUWA 4FDMA 5JWOA 3U16A 1TVEA 3Q0EA 3R0ZA 3LC2O 3AUKA 4WXRA 1VCOA 1F6BA 2AX3A 3E1SA 4QOFA 4WZAB 5K0EA 2F1HA 1A9OA 2EAUA 3A6EA 5H16A 4YMHA 1XZQA 5JYBA 3A6ZA 3TDNA 1Z7YA 2CZGA 5IKPA 5DN6D 1R6BX 3G0OA 2C9MA 3JZMA 1DX4A 4P9NA 4KE9A 4TMKA 2JLYA 3ZDRA 2GAAA 2PMDA 3TLAA 1N6HA 1X14A 2ZJ4A 3T1TA 4ZAFA 2IU3A 1PT6A 4KODA 1R9GA 4TN5A 4MUNA 1Z6YA 4CU5A 4EUEA 5CIWA 1ZIOA 2Y6UA 5HEKA 2POCA 4EQZA 1W7AA 1JA0A 4UAUA 2OE2A 1ODIA 1YOBA 2WWHA 4MTLA 1ULTA 5EP3A 4BLSA 5ABPA 2IZOA 2DH5A 4PLHA 4TM7A 4URFA 5I4KA 3ZWOA 5C5EA 1A8QA 1PK8A 1KFCB 4DEVA 2WABA 1QAQA 3HCRA 1F9AA 1UBRS 3AJ8A 3O03A 3VGPA 3KJIA 3D2AA 3MCZA 4DMFA 3H42B 1P31A 2H8KA 4V0NA 4AJPA 5DCLA 5HOEA 2W98A 2VJYA 1MJNA 1SQ0A 2XITA 4Q03A 2CXOA 4TSKA 4DQ0A 2YMLA 1I0IA 1XJ5A 2W9XA 4BGDA 4QYSA 1VGVA 3JQPA 4ZQGA 3TZKA 3L1VA 1XCGB 5E3JA 2C94A 1R37A 1HFJA 3FFAA 2IHZA 2P79A 1ZD2P 3R8FA 3JWEA 3AUSA 4D0LB 5KCZA 2EV9A 3NUZA 5BMVF 1OA1A 2F59A 3VAAA 1KJJA 2Z09A 2LDBA 3PYMA 3QZUA 1A69A 3O47A 1ZKMA 1NBWB 1II8A 4G0QA 1L8AA 3LY5A 2Q2VA 4L57A 1NI4A 5KTSA 4OHFA 3J7AC 1NVWQ 1RXSA 1ZMOA 3KV1A 2VDLB 5AK4A 4LJ6A 3U81A 4Y2HA 3WIUA 4MRPA 4Q9LA 3VQTA 1RFGE 2PRYA 2VBGA 2YIDA 4IUDS 4P34A 3GJ3A 2YZMA 2X0NA 1E2HA 3IR7A 1JDPA 2DQKA 4L3WA 3WIBA 1UEJA 2DQSA 2X5NA 2J9RA 3VNAA 4YJ2B 1RWNA 4OI1A 2OGSA 3IRUA 3WO1A 1ZX1A 5GZ1A 3E3LA 3QFTA 3HXQA 4OEHA 3WZ2A 5CXSA 4MW2A 4C01A 4IWNA 5KNBA 1EK0A 2C1XA 3I0ZA 1R4MB 2JBAA 2E2WA 4L27A 3LVQE 1WCWA 5AVQA 5I5GA 5IAOA 1U5CA 3PQ3A 3P9NA 1M1ZA 1R3DA 4JQCA 1N78A 3KIPA 1X1RA 4NMWA 4F6CA 1ZN9A 3AHIA 4MUAA 3FTNA 1ZXBA 4LPKA 3W4JA 4ER7A 4PTLA 2IV7A 4AMUA 3I61A 1MO4A 1ODSA 1F5SA 2ZB8A 3DLAA 4YMIA 2WSSD 1DJQA 2OXTA 4HMQA 1OHHA 2UVPA 1W8DA 1G4UR 3AY0A 4D6YA 1UM9B 2VDQB 4OQPA 2JGDB 2RC5A 2PGAA 3U4IA 3WMEA 1KYIA 1SBZA 4FDUA 1QFMA 4G01B 1FJXA 1LFAA 1XV5A 3SS9X 1YDMA 1UM8A 3LP6A 1DO8A 3EGVA 1EGAA 1U3GA 2QAGC 1IXRC 1SVNA 2X1HA 3RG8A 2DLCX 1G63A 1IN4A 3MTAA 1FOEB 4MCIA 5CH5A 4PN7A 2LWIA 1JEQB 3G3EA 1JDUA 4IX1A 3HZRA 4IY1A 2CMDA 2HD4A 2QKYA 1ZH8A 3GFSA 5AWFC 1L5GB 1UIMA 1VYUA 4O2BF 2J3JA 3FXAA 5TXGA 3EIEA 3AUJB 4BO4A 1Y9JA 1KDVA 1GRCA 4B4DA 5E95A 2XMSA 3C7TA 1D03A 1XRSB 3QUAA 2OLJA 4YASA 2VA9A 1MVLA 2O23A 4GICA 1NIPA 4DA7A 1C9YA 2EBUA 2CXHA 3A6KA 1TA4A 2O8VA 1N1DA 2CVFA 2IYYA 1UF9A 2RHRA 4KWIA 1U1CA 3WHLA 4CMJA 1O57A 1TQ2A 4IDHA 1Y1SA 2D7CA 1XAIA 4KVAA 2QROA 2IC5A 3PENA 4ARAA 5BUZA 1KMIY 3NBXX 2OBYA 5CYOA 4ALLA 4DT1B 2XNJA 4MV1A 4U3JA 4WNIA 4QKQA 1WAMA 3TZQA 3O91A 2RGBA 3KELA 3R6WA 5CRIA 4YRKA 3WA6A 1AMOA 1E3JA 2VAWA 4JYCA 3EWIA 2F3TA 4JP1A 1WM1A 5LP1A 3EODA 3PUVA 3WYGA 3E53A 3DVAA 4Q4DA 3U1TA 4DQLA 4OM7A 5BVHA 1P1HA 3U7EB 3MZ0A 3VBCA 3HNOA 2B7LA 4NZZA 821PA 2XNDD 1MJHA 1JSRA 2Q4OA 2NZWA 1E9DA 3RANA 4EGAA 2ISSD 2RARA 2WUEA 2ZIEA 3EMVA 4M1SA 5FUVA 3KB2A 3RUDA 5CFNA 1MA0A 1PJ4A 2B99A 1E6UA 2OQ2A 3MB8A 4IEEA 1PTJA 2P0EA 4NECA 2I6FA 4K26A 3VU3A 1LF5A 3ICCA 5BWLA 2PD3A 4ML3A 2X0EA 4IIGA 4TLMB 4WXMA 1YRHA 1E5TA 3DBRA 3B78A 3D4BA 4YFVA 4Q3DA 3HACA 3RHTA 3FUCA 5DBEX 1ENZA 5D7BA 2O2IA 4PZ0A 4C29A 4Z4GA 1IU9A 2W4IA 4HJXA 1ATZA 1E4VA 2HLNA 1V2HE 2GZ3A 1CUUA 1V9LA 2RIRA 3EIFA 5ETJA 1DBIA 4E3ZA 5FB3A 2GLTA 2NVUB 3T3GA 4DCMA 1ULHA 4AMGA 1M2NA 1N5KA 4WD3A 2C4NA 1B8VA 4QASA 5EJ7A 5EEGA 3ANYB 5GGXA 1YT5A 3MSXA 4H35A 2OPHA 2C9DA 2TECE 3Q3IA 4KE8A 2XAUA 1T0IA 4S1WA 1OV6A 4ZZIA 2XCQA 3GAMA 3F7NA 1HDEA 2QAGB 1WA5A 5KJ1A 1RMTA 1DEXA 4LVUA 1AZWA 3DC7A 2WSIA 2FFHA 1K7EB 2WWRA 3QUBA 1ZG3A 2H2HA 2ID4A 2LVBA 5CNJA 3CF4G 3I83A 4HDMB 4B8ZA 5C1DA 1USGA 4FHFA 3SBEA 3A4IA 3IVMA 3K09C 4ARSA 2BCJQ 5CM8B 2B6HA 4F9FA 2DU8A 1HNXB 2EVWX 2J31A 3IMKA 2CLIB 5JC1A 5CX1A 1F0KA 2WF8A 3Q12A 4QTXA 1FC0A 3H75A 3HKEB 1H8HA 4OLFA 1V5FA 4TLCA 1I01A 4KIUA 4NDZA 3L6DA 1G8FA 3F4KA 4L28A 2FPXA 3N76A 1PR0A 1KO4A 1BS1A 4DQUA 2OV3A 3C14C 4F3NA 2J9XB 3NEPX 1X2EA 4URHA 3S28A 5U9CA 4RZXA 4BJ3A 1UJ5A 1NUUA 1QZXA 4JVLA 3GJTA 2L19A 5HS6A 4B3HA 2D59A 2CXTA 3PIRA 3UMCA 1C7QA 4NMMA 5KTRA 2J45A 5IKOA 2MMCA 3WIOA 1S7CA 5JCOA 1SMKA 1UK8A 4BBZA 5AVKA 1QG4A 3KZKA 4GOOD 3WGNA 1LW6E 4JJKA 2VHCA 4LNAA 1QCDA 3EHEA 4Q3OA 4RK1A 2VF5X 1E1KA 1YB1A 1E6CA 1IEXA 1RYZA 4G9EA 1EWYA 2BJWA 3NTXA 2IPLA 5CTAA 2XTZA 4PN3A 2JDIA 3CEAA 4HNQA 4ZOEA 2Z3WA 5E0KB 4B83A 4Q1DA 4YPVA 1Y8ZA 4JSYA 2Q1UA 3H1EA 3RYHB 1PR6A 1QWOA 2QT0A 3NTOA 4I9GA 1J0AA 5KHLB 1Q3TA 2VP5A 2XPCA 5HRUA 4OYYA 3N7TA 3ZGZA 1BXGB 4NJMA 4QQKA 2G63A 5EKXA 5KSYA 3D0RA 5B3LA 2HWYA 4RPLA 1Y5MA 4KQ2A 5E9WA 1S96A 4BNVA 1XA4A 2H2FA 4II7A 4P22A 2OTCA 5AK0A 4YLEA 2ID9A 3WGUA 4I7EA 5HM8A 2IYOA 1QKIA 5ICSA 5TQVA 2GZHA 4H1TA 4MCJA 5E6SA 3LO8A 2ZYIA 1FYFA 3K30A 1CQPA 2KMLA 3OHPA 5MFPA 3WGGA 1E8MA 2NQ8A 3PD1A 4EW2A 2BHTA 2DHCA 2WIDA 4KV7A 4DARA 5CG2A 5JI2E 4HQLA 3C5WP 1FFYA 4BNGA 3TZCA 3HXOA 2J3IA 4ZJZA 1Y7HA 2OCBA 3LU1A 2Y68A 3WJ7A 3BX1A 1R1DA 4M1YA 4IZ6A 4WZAA 2ST1A 3PGLA 1AK2A 4IQFA 5BT9A 4WCFC 2ZE8A 3IPYA 2IIVA 3QKIA 3V4OA 2EATA 2VSYA 4C1NA 4EO7A 4ZGGA 3W5SA 1YU6A 1K68A 1C1DB 3WX0A 1DAGA 1CR1A 2EWMA 2FZWA 3B70A 3KHUA 4PE5B 3RFUA 3V80A 3DAYA 4Q19A 1KXZA 3FRJA 4RENA 4DA6A 3LUFA 3GLFE 1M1XB 3MTGA 5AKYA 4A2CA 5C8ZA 2AE2A 4TM8A 4W5RA 2PL5A 2R7LA 3A9WA 4UC0A 2QXUA 2IUFA 1F17A 1MAAA 3X2EA 3HG7A 1V3VA 1ECFA 1HQYE 1KPGA 4H7HA 1BZYA 3DEFA 1GZDA 2BP7B 1OLUB 4KR0A 1I3NA 5A3QA 5SZIA 2FN7A 4J94A 4HATA 5TJHA 4N3BA 2NV0A 3OZXA 2E18A 1G38A 5U4XA 3GPIA 3S40A 4EJSC 4W9RA 2HT1A 3CYFA 1QX4A 2ZIVB 4WLVA 3CE6A 4UNSA 3SF0A 2ID7A 2V7WA 2J67A 3CR7A 1UPTA 3AVTA 1PAUA 4R8KA 4TKVB 3ETDA 3NC1C 3U4AA 2HMWA 2AYXA 3DFKA 4X54A 4GX2A 1D3AA 621PA 1UPBA 3S4YA 1GGKA 3DDCA 2HK6A 1J0EA 4ZYTA 4KLRA 3CJTA 3TTXA 1ZHFA 3BKWA 3KKZA 4B6QA 5IH7A 3OQ6A 5M5BA 5EHGA 4TYNA 1AHIA 4Y6GB 5LIPA 1T5SA 4JJZA 3BXEA 5IPFA 2R8EA 3RYIB 2JFVA 3O4JA 1QMPA 4INPA 4PLGA 4NZOA 4AJ1A 4JUDX 4GM1A 3BSFA 4YJGB 1N1MA 3B1KA 4C04A 3L01A 2BBOA 3V8VA 1NMEA 4CV2A 1CP3A 3V4VB 1SXJD 1XEXB 3GIDA 3PNSA 3W04A 2GO7A 4L2IB 4JEIA 1HNZB 4ZCMA 5HIKA 4QUDA 3IIJA 4MJLA 4REQA 4IVNA 1BROA 1H6DA 1SH7A 1ZGCA 2NPIA 3D6UA 3EY4A 1QZTA 2PQ6A 1RSZA 1CDZA 1ZHHA 1DP4A 2EQAA 2PBFA 3NZEA 3OIYA 4G37A 4Q4JB 2BI4A 1E66A 1MB4A 5CH3A 5K2MA 3VDQA 5KTPA 2P6UA 1ZVVA 5KYXA 5BSTA 1R4MA 4DCPA 3KQNA 1A4XA 4CF3A 1T1IA 2WJ3A 3OA2A 1F7VA 3HGMA 3IUMA 1A5ZA 1JXAA 3K5IA 3KXDA 1Y42X 3FY4A 4L74A 1PR9A 4WCFB 3PHJA 3D1LA 5J2UB 4IGAA 3KWLA 2GXUA 3ONFA 3CVOA 4JYAB 1F2VA 3A2MA 4BVBA 1ORDA 2B3TA 1MG5A 1JLRA 2Q2WA 3RK0A 2HA6A 3CBGA 4J49A 2PU7A 3N8GA 4QDZA 5I7WA 2IYPA 1TO6A 2VRCD 3R8CA 4RVDA 1W29A 2BI8A 4OBXA 1UM9A 3K1TA 3QE3A 2YXEA 2JGDA 4RIIA 4UM7A 5HE8A 4CMCA 4WASA 3ZYZA 4MRRA 5B37A 3DDZX 1T24A 2C2HA 4GZ6A 4RVHA 1ISHA 3QG5A 5CT4A 4YTEA 5DN6A 5HIMA 4KPFC 1N2OA 1R4ZA 1YI0A 2FQYA 5DRYA 3I4LA 2ZSKA 4ZMBA 1XO1A 3LX4A 3I6QA 1KY3A 2YJ4A 4EJSB 2GEDA 2W2VA 4H9GA 3BJMA 3GEHA 3TSOA 4KSCA 2XZOA 4H6VA 1JEJA 2VWPA 5G4KB 4CIWA 5I7FA 5E1OA 1GNLA 1Z4OA 2PS0A 4PHFA 1DXHA 1WTAA 4UEWA 1SFRA 5BPHA 2J6IA 4FMCF 3V1UA 1KI9A 4N5MA 1GUDA 1XVLA 4KKXB 1PFYA 3TW0A 3WMWA 2GXSA 5U4QA 3LTEA 3SOPA 3V9PA 4YJFA 4RD6A 2MR5A 2CLOB 1V7PC 2VNKA 4I4NA 3LHFA 2XA2A 4P7GA 3RU9A 5B6JA 4ZWNA 3WLJA 5J4LA 4AQYB 5LKAA 4DSZA 2FVXA 2EZUA 1IEVA 1XQ1A 3VTKA 5KB3A 1LRLA 3CNHA 3FNQA 4UW9A 1F7UA 3ETCA 1DIOB 1EX6A 3CT4A 4DT1A 2RGRA 1TU4A 4KN9S 5KDLA 1DE0A 3LRXA 3V1TC 2VH1A 4FW9A 1MV5A 1KK2A 4L9AA 4YDHB 1MOSA 1ZITA 4A27A 3O8CA 2R8BA 2CNWA 2X8LA 3SM9A 2CBGA 3HU3A 3H2HA 5F9HA 2XEXA 3C4JA 3IAHA 3ZU2A 3DWIA 1UOQA 4FB4A 3P94A 3ROMA 4L8WB 4EABA 4QJ3A 1QGOA 3QYAA 4FBGA 4BWYA 1X8JA 3ZVRA 2ADFA 4RD0A 2BOVA 3I1IA 2AI1A 3KEQA 3QPDA 3HBAA 4QG7A 4YMSA 5JAUA 2O07A 5JJCA 4IL5A 4S35A 1SIUA 2GZAA 1CX9B 2QTCA 4N12A 1H6BA 1Z68A 2ASEA 5ICGA 1NVDA 4IYJA 2YUIA 1AQNA 3HHEA 4M0UA 3ZD8A 1Z4NA 1UL1X 2HJWA 1V11B 2HU2A 2JAWA 2WG1A 3EVDA 1FTYA 4JMLA 4KIGA 5DM60 4MVJA 4MO2A 5AW1A 3AKCA 1T36B 3ER8A 1ZD8A 1NUTA 3RSQA 1OI4A 2DUMA 4ED9A 1QIJA 1MG0A 4LMAA 1SULA 2OHXA 1T8WA 2A9OA 1YCGA 4IHAA 4U02A 2IU0A 2MYPA 4WDQA 5EUQB 3E4DA 4IP0A 3KXKA 3CS3A 4PPGA 4R8MA 5D5HA 2NVUA 3L9WA 4HPJB 1TK3A 1Z2CA 5AHOA 2WM8A 3OEHD 4AJ9A 1YR9A 1E0AA 4Z7OB 3KBBA 3P5SA 4G5SA 5HFNA 2D5BA 2OBLA 2XV1A 3E9MA 4HMPA 4TXNA 3OSUA 4WY8A 5CLHA 2Y76A 4ERXA 2NXNA 3D8TA 3LX8A 5BORA 4YXWA 1YCFA 1R5BA 4Q4LA 3VPBA 1YS2X 4P3PA 2EJVA 2QAGA 2AC4A 4U7JA 4PLZA 3AILA 3NUGA 3EQ6A 3FDIA 1XTQA 3OKAA 5REQB 1D8TA 2XQVA 1G5IA 3WE7A 1KEEB 4KO4S 3KSAC 2P9BA 4D3XA 4RD4A 4W5HA 3CLSC 4QPCA 2YZ7A 4G1VA 5JAIA 3TSCA 3HGQA 3RVNA 1NF8A 4FFDA 1JA1A 1YKFA 1ZH6A 2MINB 1R12A 2R7NA 4FGJA 2BM9A 4NAHA 4RHUA 2Q3BA 4GXRA 1D04A 4OXNA 3C3WA 4R0VA 3HKEA 3F96A 4Q6BA 1QIDA 2G8NA 2PK3A 3AR6A 4IINA 1QE5A 1XCLA 3BAFA 3U4CA 2Q9BA 2RHHA 1FMCA 1JPJA 2OZPA 3FI9A 3MEQA 1SC9A 5F76A 5EIXA 5I9BA 2HQRA 4MZXA 5KHAA 1GL6A 1RYEA 4ND6A 2NUTB 2WU3A 4KRXA 2WY2D 2FCRA 3PFKA 3WVNA 4DA8A 4ZI2A 2BH2A 2P9GA 5IBCA 5K01A 2XUKA 3NOQA 3OIWA 4NXNB 2GKOA 3CZQA 3EFOB 2V6FA 4HWOA 1BN7A 3KKOA 3RVBA 2JGNA 3R3VA 1X6VA 2C4VA 4DDWA 3Q87B 3ESCA 1CUCA 2W6QA 3NIDB 3OCZA 4H0FA 2OGUA 3Q6NA 1P77A 2VZLA 3VAYA 5L3SA 2C5SA 5BOVA 1ZOLA 1WLYA 2COEA 1TZ2A 4WA8A 3B6IA 4HVTA 3UMFA 2HA3A 2G36A 5JYEA 5A3VA 4DANA 1Y98A 3K70C 3MJSA 2J3KA 3KHSA 3SQMA 1OLXB 3RYHA 2Q50A 2HADA 3HB1A 3LD9A 3NWPA 4TTJA 4JYZA 1BXGA 1RQXA 1A9XB 3KOZA 2C3OA 1NW7A 4LHEA 4KYTA 5F33A 1AGNA 1BWPA 3RSHA 1GNSA 3WLMA 3HBMA 1HQDA 5DI3B 3KZNA 3HZHA 4FJ1A 3KWJA 4US1R 1A9RA 2C96A 3OFSA 3V2IA 2XXJA 3V6LA 2V0GA 5K0TA 1AKVA 2NXWA 1LB1B 3IQIX 1FS5A 4FNOA 4C30A 4ZCRA 1QX3A 3LL7A 4I5EA 3RJZA 1ZVQA 3D3NA 1WVGA 2X9NA 5CTJA 4CDGA 5BSWA 2YWXA 1WIWA 4OQ4A 1QCYA 5D00A 2CCKA 4FSDA 4QDUA 3W4IA 5JW6A 2O54A 1L4BA 3LK6A 1B7GO 2Q7XA 3W5DA 2WFAA 5BWCA 1C4KA 4XPZA 4MMZB 4HTAA 3A4NA 1MTOA 1VL2A 1FPQA 4RAOA 3X2SA 3BHNA 3QQPA 2UXBB 1PFGA 1C1DA 4NI5A 2PJUA 3P0RA 3FOZA 4DKJA 1QHYA 1R64A 1SOMA 1UK9A 1X3SA 4M0DA 2XT6A 1PL7A 4RY9A 3U2QA 3K09A 3EPHA 3BH6A 3VKUA 1L3BA 5JAZA 2GI4A 1M2JA 1C50A 1GPYA 2QX7A 4J3JA 1MOPA 2BGJA 2BKXA 4B8YA 3S2IA 4EF6A 1THMA 1UJCA 4D9GA 2FY8A 4U2GA 4E13A 4QUGA 4QT4A 2P4UA 5HXAA 4IRMA 4CM3A 2FPMA 5EQJB 1U9YA 3FGZA 1VPWA 1HXHA 2G4VA 1CQWA 1H4SA 1PR3A 3UO8B 5AFSA 1ZC4A 4HH0A 2BP7A 1OLUA 4L5CA 1MZPA 4BEVA 1CZRA 2QN8A 2J3QA 4JGGA 3TCNA 4IVPA 5KOIA 4HLNA 3ZV6A 4O4HF 1JG3A 4EG6A 1H1TA 1GPDG 1FU8A 3VZQA 4U39A 1OGJA 2CLKB 3ONVA 4DCTA 4FC7A 4DR6B 2WAAA 3DS8A 2FDCA 1QDLB 3J80A 4PGAA 2ZZKA 1H4TA 1VLVA 1XTSA 4E2WA 4TKVA 1M74A 2Q45A 4DBZA 2YDYA 4Y1RB 4K9RA 4DSAA 5TB5A 4FE7A 3G2KA 4M1KA 2BFFB 4XI9A 2PSFA 4IJ6A 3EGDB 3U4HA 2HQOA 2HTFA 3KSRA 1I5OA 2PXCA 5FBLB 4RL6A 4I1VA 4BLWA 3K70B 1HOXA 2O1XA 4BQQA 2VXYA 1WPGA 5TIIA 4TXJA 4XGIA 3VPCA 3C0KA 4M7RA 4OHZA 3RYIA 2G7ZA 1S8OA 4IGIA 1R7RA 1ISMA 3BDAA 1BEEA 1RRGA 3N0VA 3IVGA 4YJGA 5DM70 3UPDA 1I1QB 4HX2A 1HYEA 4FE4A 1DOAA 3A3YA 1N0HA 4OP2A 1XL1A 4EUNA 1FJHA 4BFLA 1L7RA 4CM5A 1XEXA 3MTBA 3EBOA 1K5GA 1CJSA 1VBKA 2YHBA 4L2IA 5E4FA 4UEJA 3EPJA 2NP6A 1QM5A 3RS2A 2YJGA 1E61A 3QJYA 4YDSA 5TVGA 1Z47A 2GX6A 3AG5A 4Q4JA 5FOQA 4PONA 1J2UA 5JIBA 4N6OA 4TZ0A 2MSLA 4KN5A 1LJUA 3L7DA 5C2JB 5FKJA 2MSEB 3GWGA 1VLMA 1RQNA 5H9VA 3ZV3A 1F0YA 4UBNA 4PG6A 4ARZB 1N2CB 1JAIA 1EVEA 4HBGA 4KUHA 2GBCA 2DERA 4WCFA 3P0HA 3GQBB 1VSVA 5FPSA 5FFMA 2L0XA 5JLAA 5EXDA 1CUYA 1SKQA 1Y4ZA 1QH8B 1ICEA 2ZJ3A 3LF2A 4ZQEA 3RIHA 3DLCA 5NLLA 2V3CC 2ZW9A 3IR5A 3VU0A 1GAQA 1EXDA 4XQCA 2CB9A 4E7OA 2OHHA 3DWFA 2XNHA 5L51A 4LQ4A 5CD1A 1RP1A 4G8CA 3UGJA 4YNBA 4HWPA 1VG1A 3VR2D 3PU6A 1EUQA 5BSUA 1L1EA 1EU1A 4K46A 5FULA 2D6FA 5JJLA 1VP3A 2A1UB 3R7NA 2YMQA 3KYIB 3SNKA 4HEA6 5MHTA 3DE1X 3FDFA 2AN4A 2FI1A 4EJSA 1GGJA 2PAAA 1NDHA 4MWEA 4PLCA 3R6TA 3QSGA 2IA5A 2PGDA 4JP5A 4LG1A 3S7ZA 1TMYA 2Q0SA 2RH8A 3UNXA 3EBPA 5G4KA 5CGQB 1N7IA 4OQYA 2P8JA 3BXGA 4TTRA 3WQQA 3ZLTA 4U2KA 3VR3A 3PJEA 4G4IA 3O7WA 4QQFA 4WK2B 1N7JA 1YZNA 3D4PA 3JV7A 3LL4A 2OG1A 3MJTA 1NW8A 5G4LA 4JGIA 3U13A 4ZYVA 5DJ5A 4BO1A 1XHLA 1E7WA 4EAAA 4ZMRA 1ND6A 4WRRA 5IUJC 2Q21A 1R8QA 2V97A 3W7VA 1L5MA 5TR9A 5K3OA 1XAGA 1XCMA 1SHKA 1W1WA 4NMXB 5H3CA 2I99A 1MNAA 5AJHA 4AMZA 3RQSA 2XRMA 3V8EA 4YS6A 4ZK2A 2GFQA 4PAMA 2R1VB 1S9DA 3T5MA 4EY6A 1VP9A 1G2OA 3I5UA 4RQAA 5E7QA 2H11A 5F51A 3LZ6A 2AH5A 3TLKA 3GARA 2XI4A 2PKEA 1RWMA 1SHTX 2QN7A 4TUYF 1Z4LA 1J9ZA 2JEZA 3K2QA 3U39A 1XVAA 5D3KA 2V98A 4MQMA 4M76B 1B00A 3MAAC 3OPYB 4X1OA 1XA0A 1NFQA 3OCWA 1GARA 2Q5QA 5L7YA 5LP6F 5KQSA 2XT9A 3H8WA 4D8YA 4IDDA 1XTKA 1V11A 1W8IA 2FFJA 4KMOA 1G5FA 2HIGA 1CY6A 3P2KA 1EH5A 1T36A 1KTIA 2M98A 4QDJA 4O8CA 2XBUA 4FINA 2DWCA 3DOHA 2HDWA 2JI4A 3O4IA 4GPTA 4O6VA 2OXIA 4MPDA 4EFLA 5AK3A 1P18A 2DBVO 2GJAA 1GCAA 4LQLA 1YCDA 2NXJA 1U0SY 4RZHA 2ZRKA 3RDPA 2H0QA 3TAUA 3V7YA 2VRWA 3A1VA 1UBEA 3EOBI 3EISA 4B3IA 3VHRA 3L6OO 5DMXA 2JFYA 3VYRB 2D3WA 2WB2A 1V0JA 2F8MA 3D43A 2CJPA 2KW5A 3PQ7A 4HPXB 4PW0A 2VQ3A 2D00A 3A6HA 2QG9A 1RRVA 3C87A 4TRMA 2QVYX 1Y4AE 2FW9A 1PFWA 4HAOA 3IKTA 4ZKEA 5REQA 4EHIA 2V74B 2CK3D 3UMVA 4JJFA 1KEEA 3QHQA 1TM1E 3S8MA 3UOGA 3BJZA 3FJYA 5EC8A 3H5VA 5EXXA 3X0DA 2IXAA 3UA3A 1KEUA 1QQAA 3OTWA 3PEEA 1XYVA 3T41A 1BQEA 4G1MB 3TRIA 4OB6A 3AWIA 2MINA 3KEOA 4V2IA 8AT1A 3KWMA 5C51B 1XNRB 2DHDA 5EIFA 1YFJA 4E5NA 2ZI7A 3CUSA 5HTKA 1PO7A 1JG4A 2XADA 3VR6A 1YBMA 2R6HA 3D5EA 3TPFA 4F71A 4TVKA 2X5KO 4BZQA 3DEHA 3QMVA 2B1JA 2C2KA 3VPFA 1XTBA 2GPWA 4CHGA 1WLSA 3HCDA 1QHNA 2PEZA 3L7LA 3PCXA 2C8LA 4JFAA 4MW4A 2NUTA 2KLHA 1K98A 3HEBA 4MMXB 4O59O 2PZ8A 4PVDA 2QD2A 1L8OA 4RVFA 2ZTSA 2A5JA 3F47A 5A71A 4URVR 1CJKC 5IVPA 2NO4A 3EFOA 4MCAA 5ALFA 3ZZMA 2I9KA 2M32A 3UXHA 1Q20A 1O8CA 1CQZA 3EQ7A 1Q0SA 2ZPAA 4HQ6A 2PSJA 4E5KA 2OBXA 2PFSA 1UJBA 1XDUA 4I5GA 3RD5A 1WR8A 3NIWA 3V2HA 5KREA 1UQRA 5CHYA 3IHLA 1NBME 4BJ6A 2Y0EA 3K94A 1STOA 4F97A 3H9BA 1Y1PA 1PYOA 1UBTS 1PR1A 2WJ4A 3MQ2A 4NYIR 1E2IA 1OLXA 3VH3A 1EWTA 1DAOA 2MOKA 4ZC1A 3IDAA 3M4NA 4PCLA 2GTPA 2QTGA 1A9XA 3HA2A 1TAQA 1W49A 4UD2A 4IDBA 5C8YF 2AN1A 1CD5A 4AMVA 2IZ7A 3QKTA 2IIBA 4QGSA 4TRNA 5TGTA 3HCWA 1HURA 3NPMA 2NVWA 3WGJA 4AL4A 1BE6A 1BHO1 2AEJA 4J4HA 3P4UA 1LC3A 1T4GA 3H4VA 4NBRA 4NCJA 4D45A 4HDRB 3IUQA 4PC1A 1D2GA 1PZHA 2PX8A 2CHUA 2RKWA 3DZDA 4RK6A 5L53A 2GRUA 3PX7A 3TD9A 5L45A 1YULA 2ZRQA 1WHTB 2EFCB 4XOIA 5B4VA 5DU2A 2Q1YA 1NA5A 4N48A 2I80A 4GOLD 4NNOA 2PX2A 2QYOA 1CIPA 3HCBA 3P5BA 4YP5A 4Z9FA 5A05A 4EPVA 4CEIB 3L40A 5F2EA 2F17A 4FR5A 3D7LA 3TINA 2BLLA 3QLEA 2XUQA 4RK7A 1LTKA 5KO2A 1ZD4A 3G8CA 2ZR7A 2AXPA 1DQSA 1ENPA 2Y8EA 2ATCA 3DOUA 2D2VA 4HLUC 4LXUA 5KC9A 1RXUA 4P5PA 1FQWA 1HK7A 1MO2A 3L8YA 5IWCA 2RONA 3EOZA 4EYEA 3KFVA 4A4DA 1T6BY 3NEJA 2V7XA 1CUFA 3ET4A 3L1KA 1FTNA 3PR1A 3F6YA 4UCWA 3N2KB 2DPXA 2D54A 2G77B 2VBFA 2AVNA 1L8XA 2PZEA 2QNIA 4QLOA 4J4TA 2CZCA 1EHIA 1NQTA 1A9QA 1EBUA 1O58A 2PKQP 4PZ9A 1V37A 721PA 1D2CA 1PNTA 1GRRA 2GJ9A 2O2YA 1K7CA 1L7VC 1MGPA 2HMVA 2OL4A 2Q62A 3DP7A 3FWYA 1FXWF 1KIFA 2PKCA 2R85A 3CEHA 5ELLA 4BFSA 1I7NA 2I2WA 5KKCA 1SCJA 1C30B 1Y8QB 2O7SA 1EKXA 3M4JA 3AUYA 3MWKA 2EJTA 4YI5A 4DA9A 5CLJA 3AOGA 4KE6A 5ES3A 3SHOA 2W8ZA 1OE0A 3ZHOA 1LW7A 3H9CA 3UMMA 1XN1A 2Q3MA 4Y1RA 3OJFA 4D4GA 5K0FA 1ZOOA 5JROA 3TFQA 4PSCA 1C9EA 2NTEA 2QX4A 2BFFA 4HZUB 1Q92A 3ITDA 3VTAA 4MWCA 3EUWA 4OX9B 2FUCA 1P2VA 3WNCA 4QNRA 3F8TA 3AFMA 1XZDA 4FYIA 4HKTA 2J4DA 4EPRA 3GF4A 5DYTA 4OO3A 1CUVA 3NVDA 5AJWA 4V1CB 2EG9A 4N47A 1ZCJA 3TLZA 5B5SA 1KYTA 3FYCA 2XUAA 2YXBA 1TZKA 1KE2A 1DSSG 1FLNA 4JN6B 1TKAA 4CODB 4TYMA 2H5IA 1RNLA 5CDYA 4XCXA 1OXMA 4FC6A 2PH1A 5IXYA 3THRA 4NICA 2YFQA 4WW0A 3R75A 2D8MA 4JGBA 2VSQA 5IYZB 4FONA 1DRWA 2PR2A 4A8JC 4G26A 2RGEA 4YRAA 3KUDA 1NJGA 1LLFA 3BG5A 3N2EA 1DV2A 5FT9A 1X92A 2WD9A 1D0VA 5FIUA 4ZCPA 4ARZA 2ZJZA 1U2PA 5M3BA 4LV5B 4NC9A 4BQSA 1RI1A 5JAHA 1Y1LA 4Y7CA 3ZHVA 1NHGA 2HMTA 2ID8A 2IW3A 4OKSA 5ALPA 3GQBA 2QX8A 1IB0A 3ADPA 1SPXA 1FFXB 4ND4A 5C5IA 1QH8A 4BMSA 3CX4A 1MO5A 2CUNA 3I1FA 1JECA 3IODA 1A77A 4JKYA 2XWPA 4U6SA 2JFZA 1E2DA 5J40A 2F1RA 2B78A 4J8PA 2IT1A 2WM3A 5K3EA 4MYRA 3QNUA 3HDTA 3T9AA 3TTYA 1WPXA 3EUEA 1P60A 4MP3A 2YJ3A 3GCGA 3RC8A 1CR6A 2MJLA 1EBBA 2X2PA 4C0SA 3KXPA 1Q7CA 2A1UA 2FX3A 1KWGA 2CJYA 1Z26A 4IIJB 1XNJA 3P9XA 3VR5D 4KGZA 2W2OA 3JRXA 5JVDB 2RFLA 1NONA 1CUSA 2CDRA 2X9QA 3QXCA 1F1BA 1T3LA 4WK0B 4ZT2A 2JIQA 3WDLA 4B3SB 2C0PA 2J5RA 4X71A 4LN1A 1EM8B 4TMYA 4PO9A 5BSFA 1NNLA 1JV2B 4XRGA 3L7BA 1V8FA 3K5PA 1X87A 4Q1BA 2JAOA 3H8JA 2DPLA 3H4MA 3T0FA 2NSLA 2B2XA 3H5IA 3KTAA 3WSTA 3GMDA 3DVSX 1AUOA 3IXMA 3LTNC 3QEKA 3BFVA 3DO6A 3LPMA 1GZSA 3NONA 4H7PA 3B48A 1JIUA 2QJTA 3E9CA 1BX1A 2X42A 1PR2A 2R44A 3HFJA 1M1NB 1U0EA 1U8XX 4KXQA 3ZVLA 4XVCA 1BN6A 1PT9A 2RK6A 1AIPA 4ZHSA 4E0BA 2MSWA 1TQ8A 4RXTA 2YRFA 2ZSAA 2GZRA 3IHWA 4Z86A 2WIBA 1CVLA 2NTNA 5CW2A 4EM6A 4YAUA 1HE2A 2BYTA 4WOBA 2IQ5A 1X38A 2IU6A 2LCFA 3JVVA 2HWUA 4V0LA 4QWWA 4M9UA 3KKEA 5TSDA 3U3ZA 1A04A 3BGDA 2O6LA 2B8WA 1ZCZA 4MUJA 2W0SA 1E1RD 1NV8A 2QVBA 4GMKA 4C4SA 4ETMA 3BC1A 1D4ZA 2C9OA 3EQZA 4FOOA 3OPNA 4J4BA 4HAZA 5CVCA 4A8JB 1OU0A 1N4AA 1PQWA 4PCUA 3OPYA 4QBHA 4KYVA 4C78A 2EFEB 2NN3C 4BB5A 2O5EA 1KYYA 4LWQA 3G9UA 4YREA 5AM5A 5E1DA 3Q9UA 3KCNA 1M76A 5C8XA 2DRIA 3FTQA 1WBDA 2QTAA 4UU0A 5LQJA 1VE6A 2O3JA 1AM4D 4FNAA 1PFQA 1YS9A 3BWVA 1KP3A 1SZDA 1WCIB 2IH5A 2DF8A 1FQKA 1Z4PX 2I1QA 3KR1A 4BUZA 2CB0A 1XAHA 3RUHA 1NVFA 3LOUA 1P39A 3Q1KA 2J6BA 1KO8A 1N0VC 1NQVA 1TA9A 1GTVA 4F96A 6PFKA 1KAMA 4W1PA 1A3CA 1B8NA 1E6WA 2W00A 4HSEA 4F21A 5K8VA 2QAJA 5F52A 3MA0A 4GI1A 4N1AA 4M1QA 4B33A 4E32A 3D6AA 3HWRA 4QOSA 1QGYA 5K9ZA 4RXMA 2YWFA 5L4SA 1XCOA 1KZ7B 2QUAA 1COWA 2X2EA 4YXFA 1XJCA 1ZK1A 4X66B 5KNLA 4QPPA 1E94E 1E3WB 1L1QA 1NQAO 2CSUA 3LE8A 3T38A 3JZIA 2A59A 3SJBA 4DMRA 4D79A 2IOHA 4MYSA 1MEOA 4JITA 1N0UA 3EPRA 2PGNA 1E62A 4TSRA 4YJKA 4V1CI 1XQ9A 5LLTA 3NHSA 3PHGA 4W8HA 3I8SA 4BCBA 4CIXA 1AUVA 2GN6A 1RQRA 4L15A 4LZAA 3UVEA 1MOQA 4X9XA 2AFIB 1IN6A 1SJ9A 3PDCA 3IT0A 3FNBA 1R27A 1G5PA 2E85A 3PI6A 4G4SP 2NSHA 3L0IB 4ZCQA 3EVZA 2VSNA 1G8SA 3L7KA 3PUKA 3Q7TA 4HR7A 4U00A 3SQDA 4B7XA 4C3OB 2G08A 4IW3B 4TXHA 3CNLA 2QTNA 1UDCA 1ZXLA 5FJJA 4P38A 2EG5A 3IXLA 4OLHA 4ZI7B 1XZHA 3L0DA 1D2HA 3WLPA 2CZQA 3PICA 4YRCA 1KAHA 1NJ8A 1ZISA 2PLAA 3FUXA 3N8HA 4HNSA 4PQEA 1HT3A 4J0JA 4GRAA 3VI3B 1WQ3A 4U5XA 1E9EA 1NG1A 4LI0A 4RYLA 4G5QA 2V0CA 4JOCA 3DV0B 4AY4A 1A8IA 4MEBA 1FDUA 1IBKB 4DMMA 2VJQA 1MN6A 1W85B 2VPPA 3M0EA 3M6UA 3TRHA 2CHGA 3T4PA 3BGWA 5TT1A 5BWOA 2V7QA 3TL2A 3OQVA 3BWEA 3TOSA 4W99A 2HRQA 3K1AA 5CK4A 5EWJB 4CIAA 4JB8A 3HDHA 5KWJA 4EG4A 2G5CA 1VIYA 3I6YA 2K6GA 3TJMA 4MGHA 3C98A 3TCKA 4DLAA 4EA8A 3EZLA 3GLQA 2X9GA 2ETVA 2YX1A 1RCFA 4G6ZA 2YIJA 3WISA 1R5NA 3H1FA 4C4TA 2GESA 3G0DA 2BLNA 3H3FA 5EMKA 4HDRA 3GD5A 1CZNA 4W8GA 5KJEA 3NETA 3VDXA 3BFPA 4MO9A 3OG9A 1NQOA 3PL5A 2FWBA 3WLQA 1CYEA 1BCRB 1WHTA 4F1WA 4TZKA 1J9GA 1E1CB 4NU6A 5EZYB 2IWHA 1R5JA 1NIJA 3SXPA 1E2GA 1XCPA 4NK4A 3I5YA 4CEIA 1IZ9A 1KSGA 3THWB 3LQFA 1BE1A 1MX9A 3KKMA 1X7HA 1PN3A 1VTKA 3Q7EA 4L85A 4MYHA 1QH0A 3SJZA 1XJQA 1FRVA 1Z2NX 2SNIE 4Y2XA 4DR2B 4EMSA 4B6OA 2HDHA 3SFZA 3ITEA 3UCFA 5JQWA 1XRQA 2Y27A 3FYUC 2HYIC 2G80A 2XCIA 3E3MA 3EVBA 1U2DC 2AJLI 2H1SA 3K8OE 3PNPA 4ESOA 4F8YA 1XVTA 4GQAA 4IIVA 2NV6A 1L5LA 5JZVA 2NW6A 4L5JA 5LIRA 3T9DA 2ZP1A 3Q2KA 4JUCA 1SKYE 4YONB 1U7DA 2FOXA 1OH6A 4JP8A 4NXMB 4LF9B 3WLKX 2HEGA 1CUIA 1K75A 2V7TA 5FLYA 5IZ4A 1C3OB 2YWGA 2QTWB 3FYSA 1ZP6A 3IP9A 4OU4A 4DBVO 1SNYA 7ABPA 1MB9A 2D1FA 1ZNZA 2JKZA 2X76A 3BEDA 3NBUA 4GYYA 1ZMTA 4OGKA 5EUCA 2Q6KA 1ADFA 1Y8QA 1DADA 1C30A 1Y3AA 2CEAA 2GYYA 3IH5A 2DM6A 3EDCA 1LDBA 4NEQA 4TMVA 4G4JA 4R7GA 3BULA 3CLTC 3JQFC 5L4NA 1TAUA 2V96A 2A58A 4L7QA 3V4LA 4ZXFA 3KEMA 4L3VA 4KPYA 3K8YA 3SZOA 3AVQA 4EPWA 3G6WA 4WY2A 3MLEA 4HC4A 1B8UA 1VLHA 1VL0A 3CPEA 3KPVA 3O6VA 3LKVA 3G2NA 2WWFA 4L07A 2O8DB 1O6GA 4GOKA 4PYRA 4JYBA 4EHLA 4EHHA 5JU6A 1EFAA 1XEWY 4BNNA 3T1QA 5JNLA 3HVKA 5J5VA 1P9LA 3AV3A 1KIMA 2AG5A 1C80A 2FDRA 2HBQA 3JSAA 4M9QA 4UD6A 5SZHB 3GEDA 1EB9A 1KOLA 3SSNA 2CNKA 3I76A 3ZDFA 2IY9A 3G2HA 1M8KA 4LHXA 4AUKA 3DF9A 3T35A 3QUSA 4J76A 1FSGA 3QY9A 4C4ZA 3DFZA 5I8PA 2X77A 3V97A 4HH1A 3L02A 2PUCA 4X7RA 1OJ7A 2Y1LA 1EZ4A 4MEAA 3MCTA 1KY4A 3EXIB 3M9LA 4POOA 2VH2A 4FN5A 5JC8A 1N5JA 2VBIA 4OI0A 1UKEA 5J23A 3GPLA 1KORA 2GZSA 2YWDA 5IYZA 1F8XA 1O54A 2ZFUA 2SECE 2XBLA 1NN3A 4P2GA 4BV3A 2YWHA 3OKPA 3HL4A 3GUUA 4RCVA 1V2GA 4O5OA 2V6JA 3LSYA 1J2TA 3G1UA 2E0IA 3L0CA 1DWQA 4IEFB 1I3CA 4OM8A 5FI0B 1FFXA 3FIJA 5JYCA 1UOEA 3QIVA 2PA0A 5FJIA 2P78A 2AHOA 1VE3A 1HV8A 3R0XA 3FYUB 1V8OA 1GU0A 2AWOA 1FDVA 1MAWA 4L4YA 4JQSA 4QBIA 4YALA 5J2TF 4B7ZA 4X24A 3JTMA 1KKUA 3QVTA 4ITRC 4R3UC 4AZTA 1TI7A 1PW5A 4KCGA 2JJ2D 5J5CA 1J07A 1I2AA 4BWGA 3KV3O 1XZNA 2HRZA 3EZ6A 2AUMA 3AUUA 1G8JA 2P9FA 3JQQA 5DHAA 4FFVA 3VO9A 1Q0UA 1TUIA 4EKDA 2Q5FA 4X90A 2WQZA 1Q0QA 1TEVA 2GEKA 2R6JA 3FKQA 3GT3A 3IP1A 3LX5A 5JVDA 1DTEA 1E7MA 1ZOSA 4N03A 5KU7A 1QTQA 4TSFD 4BZPA 4RL4A 2YIMA 4QU5A 1NP6A 1V26A 4PZDA 2XGOA 4XSVA 1AKWA 1QIEA 4OHRA 5D6NA 3UJ8A 2QW8A 2C29D 1TZMA 1BQ3A 2WIFA 1JPVA 2Q3JA 4HS9A 4NAUA 1TQHA 1W25A 2UUCB 3AI2A 4CQNA 4JVNA 1NMQA 1T43A 3HA5A 3O4FA 1YH3A 4BQPA 3RSCA 3UMGA 2FWJA 3WYAA 5GOTA 4ZN6A 1M1NA 4GGMX 1F48A 3T1HB 2YICA 3ORFA 4HQFA 3TD2A 3A4LA 2PKYX 2GILA 3UG7A 1JWBB 1VI5A 1OGYA 4LWOA 5LSAA 3P2IA 1WXIA 3UBMA 1A1SA 1UBMS 3ETNA 3Q7SA 4R0MA 2JARA 3Q8XB 3RVLA 5FNZA 3F3KA 3KTDA 4LDJA 3DYIA 2BUCA 5H4HA 2GYUA 1IHXA 4Y6PA 2YMMA 3H8SA 5DBGA 4D81A 5CFRA 2Z6AA 1N2IA 5D01A 1YGYA 4AJ2A 1ATIA 1N57A 4M1OA 1Z5VA 4TL9A 2NZUG 1Z4IA 3A36A 3GYBA 4JT8A 4MJ7A 2PM8A 2YQ5A 3JAWB 4HOYA 1O87A 4A8JA 1Z4KA 1A72A 2P4SA 5D6OA 5FBRB 3RHSA 2ZVPX 3MWYW 4ER0A 3CRZA 3MS2A 2CXUA 4V3CA 3JQ9C 3ROZA 3LLUA 4AFNA 3NAQA 5FV7A 4C7KA 1OI2A 3DAHA 2GEJA 3QFCA 4BGVA 4D02A 3NKVA 3Q3VA 1EE9A 1NW6A 1ZC3A 2VHEA 1WCIA 2DFDA 1SVMA 2IPAB 3LXRA 5CUQA 1Z9BA 1IHOA 1GTZA 3BWXA 3EUFA 3SEFA 3GDWA 5I9NA 1YB5A 1B15A 2OHFA 3KJNA 1TKCA 3AEXA 4ZYLA 1MO3A 4Z6KA 2OZEA 1NBMA 4O02B 2B4KA 1L4HA 3HP7A 4M86A 3UV6A 4MW1A 1Z8NA 3NV9A 4BNMA 1G0NA 3A05A 4GMFA 3GP5A 1FU4A 1NNI1 4YCDA 3X1XA 2QY9A 2QRHA 1P6UA 4M8IA 2R6R1 3VSCA 3WB9A 3SC4A 4NFYA 3A6PC 4WSOA 4ARUA 1T25A 3AINA 3ORQA 4GBED 4RU1A 1OWPA 3KS9A 2DG2A 2VATA 4LNHA 3FMFA 1ZIYA 2X3YA 2R4TA 4OXIA 3Q4GA 4MA0A 3DSRA 4A9AA 1E3WA 2XCUA 3N6RA 4OL9A 2O8CA 1KSFX 3SEQA 2WNIA 2JGIA 3KDAA 1OKKA 1XLTC 2F8LA 4LXQA 3V00A 3OFND 1T5OA 3ZY6A 2Q3FA 4X94A 4KLCA 2JIZD 3M7IA 1R8JA 3TWOA 5AOCA 5A06A 4M89A 1LTHR 4NESA 2AFIA 1GA4A 1G6OA 1VG9B 4FD3A 4W6QA 3WK8A 1DXQA 3H11B 2Z43A 3A1UA 4MVJH 3X3HA 2V6MA 4JEUA 1GZ7A 2O2EA 4ZYWA 4NJEB 1XK7A 4E09A 2MTBA 5AI5A 2JZOA 4QLAA 1JAYA 4WOPA 5LDGA 1G3QA 2Z5VA 4AJLA 4JROA 2XYPA 3UWKA 5DM0A 4ZI7A 3GEGA 1AHHA 4I1SA 1XMIA 2CVHA 3WQSB 2H08A 1MNQA 3A9SA 1B73A 3U40A 1OWOA 4RMNA 1BE8A 3TGPA 2NO6A 1J5PA 1RJGA 1U9CA 3DMTC 5LZ5A 1HORA 3ASVA 3WFIA 3DV0A 5SICE 1A96A 3DYVA 2B61A 1HZZC 2E4WA 1PBTA 2EYQA 3EJWA 5FI5A 5JCZA 2JI8A 3IAUA 1YGPA 1VIMA 3HYCA 3D8RA 3NHMA 4YCLA 1E77A 2VJNA 4BP9A 1ORRA 1UT8A 1W4BA 4C43A 3B1JA 2IIQA 5CLGA 1K7SN 3H2GA 4O0LA 3MTEA 2Z98A 2WSLA 1H94A 2P6RA 5FAXA 5BSGA 2BMDA 3GJ5A 3NVMB 4L6IA 4YA6A 5EWJA 4BECA 5AJXA 3LXMA 4ZKDA 4E07A 4UCQA 3WGLA 5G41A 1Z29A 2CXXA 1FLVA 4X8OA 3TQIA 1RWKA 2Q6OA 2HA2A 3TW8B 3ZU6A 3JQDA 2CCGA 2V8OA 4EDHA 1HE4A 3BZUA 4TQGA 1E1YA 2XR1A 1NOJA 2OWDA 1G41A 4BJ5A 3C4VA 2ASVA 3ZCQA 1T4DA 2QTVB 2R5WA 5KTOA 2GUWA 5KVSA 3PS9A 5E3HA 4F8JA 4HAIA 1BCRA 1Y33E 4DNQA 4Y2GA 4LYJA 1E1CA 2G82A 4LOIA 5EZYA 1IOWA 2JLBA 3QPAA 4FHDA 4JK3A 4QVKA 4YEDA 2Q1XA 4DADA 3GJ6A 3THWA 4J1TC 2MYUA 4FX2A 1NWHA 1RM4A 4NOJA 2E9SA 2NP7A 4I8IA 3WKCA 2PWZA 2H9AA 1EWRA 4HUJA 2VYVA 3KU4A 4WJKB 4YMWA 4LYHA 4E2YA 1Z5ZA 2JLZA 3B6EA 2ZREA 4G41A 4LRUA 3GNLA 4MUEA 3ACDA 5K6RA 4PZLA 2ZDQA 2IYZA 4MUHA 5AW3A 3UB3A 2QU8A 3I73A 3OSZA 3LWBA 4YRLA 2I5PO 3ZK9A 3KZ1E 4QXMA 4FFSA 3RTGA 3A10A 3LHKA 3LFTA 3PJDA 4RANA 5KQLA 5HKLA 2C61A 2A7QA 5KZMB 2XLBA 3DWGA 5FPYA 4BKRA 3PR3A 4JL8A 4MVJF 4CMBA 5GINE 1C3OA 3E81A 5AW0A 5IT0A 2C2WA 2KLBA 3VHLB 1H0RA 1BS9A 1JHQA 3FPSA 5KQGA 3KSDO 4EDFA 3DBLA 3ET5A 4UATA 2WD7A 3DJYA 2HSZA 3MBIA 3CGGA 2VDNB 4V0SA 5DIFA 2VK8A 1IOLA 1MABB 2C77A 1OYVA 4AKHA 1SXGA 1BVYF 1T0PA 2GBLA 2QNRA 1FYEA 3S70A 3PQ2A 5A4MS 3KX2A 2EC5A 1QLJA 4FMDB 5T4EA 3TZEA 1Z6TA 3TTUA 3N8IA 4FBMA 4HY3A 1SB9A 1VJRA 3GEMA 2BEKA 1FP1D 3KL2A 3P20A 2O8DA 2R8OA 1XLWA 2O9JA 2UYYA 2X2FA 2YDXA 3OQIB 4HNGA 5JOQA 4EHBA 1F0NA 1HNWB 5JPIA 3SYRA 4DNFA 1FDTA 4I9NA 4LFAB 4GWGA 5JJ5A 2JK0A 1L5QA 1O9BA 3EEFA 4A16A 3N8NA 2PGLA 3W8FA 1ZRMA 1O0SA 3ZHCA 1GPMA 3BA1A 3CZAA 3W77A 4X84A 3FJOA 3ZE2B 4EEXA 1U6IA 2G4LA 4DV7B 4BXOB 4P31A 4NBKA 4UVIA 3SCZA 3FUWA 2EU8A 3FZGA 3PFBA 3DQZA 4OATA 4OQEA 4HNUA 5EPEA 3EXIA 3GXOA 2X5OA 1EVZA 1Z0FA 4RCYA 2W2LD 4ZOLA 1CR4A 2C3YA 3A9UA 1HC7A 2X40A 3U7RA 3RRZA 3OZ7A 2J3HA 4CTOA 3AL2A 4KBGA 3WAJA 1J06A 1VCNA 3MAGA 3D2BA 1QH9A 5ARBA 2BL4A 2VUUA 1Z0DA 3OEED 3COPA 1LNZA 3W5HA 2VQ6A 5EQTA 3WLAA 1E7SA 3S44A 2VC2B 4YAWA 5LYJB 2EWWA 2DWUA 3F7OA 4Y2RA 3IE1A 3LCVB 2WFLB 3STVA 4X62B 3ABRB 3ACCA 2FGKA 4ZQHA 1IH8A 1IXKA 1F8GA 3B20A 4AECA 5ICCA 2PL1A 2FSIA 1U2DA 3V2GA 2WTEA 1GADO 3STWA 1QGAA 2GHRA 1ZH4A 4RQUA 1UXHA 2G67A 1ZK3A 2H51A 1TRKA 2XVZA 1Z28A 2G6BA 1PGQA 1NUQA 4H59A 4N6NA 1J21A 1HA3A 2ZZNA 1JX6A 3DZGA 1RQGA 1V47A 2OVBA 4FGWA 3T7RA 4E1BA 2OZKA 5IEJA 1X8LA 2HF9A 2HAEA 2V5UA 3QRWA 2WKPA 2Q4RA 2WJPA 2ZRPA 4EY7A 4RGBA 3AF6A 2QLJA 2O57A 4KR6A 3RVDA 2JFBA 2HIAA 3GJQA 3JQFA 3U9LA 5LQCA 4QBTA 2OCDA 3K6KA 5AJYA 5I45A 2FMUA 3I0NA 1L8LA 2OD2A 2P9HA 3QXXA 3B7GA 5EIBD 3W2EA 4Q66C 4X1KB 4CMAA 2C3UA 2JGRA 3CHYA 3LFHA 2XT0A 3EH1A 2HPHA 4P83A 4BEWA 1VHDA 3TS1A 2W2MA 2PD4A 4L0DA 5CCDA 3AI1A 4ZPJA 3TI7A 4Z1OA 3BZBA 1MFZA 1KK0A 1PZMA 3W2HA 1JDTA 2O4UX 2QIPA 2W2XA 1A5AB 1M75A 2CUTA 2VSXA 3OD1A 2MR6A 5ENZA 5C81A 2BTOA 3V1NA 1QBKC 2VP2A 4YP6A 4HNRA 2VLIA 3TZLA 1IUPA 3R7AA 4JXXA 1O95C 3PP8A 3HSKA 4PYQA 2G9ZA 3K53A 1Z45A 1HOTA 5EZQA 4ARCA 3DZJA 1VKRA 4B4UA 5KYTA 1VIAA 1M1UA 1NMZA 1RBYA 1XC7A 1E1QD 1PBNA 2G17A 3QWBA 6GPBA 2I29A 4CQMD 1E2FA 4KWTA 3X1KA 3PFIA 3LT2A 3PNQA 2O3QA 3Q3HA 2GD0A 2SCUB 2RHBA 2I55A 1GOTA 3BYZA 3QE9Y 4N76A 1TU0A 1N5LA 2LE0A 2DPMA 3JAWA 4YAFA 2GCIA 1X1CA 3E7DA 4H7DA 2Z04A 2ZJ7A 1OT3A 2ZSDA 4RMIA 4B4WA 2P90A 5IF9A 5FHQA 3I9MA 2DWOA 5ALTA 1RZRD 2D1SA 1RBMA 4KQ6A 4CV0A 1TGYA 2XDQB 4C0KA 3FWPA 3LUPA 4TWZA 2Y2VA 1Y34E 2Q3DA 2HWXA 3FCCA 1O5TA 3W8RA 4I6EA 1XDDA 1RKUA 5DCUA 4D3ZA 4RFLA 5JECA 2Z6VA 1TMOA 5DLYA 5ERGB 3MW8A 4ASUD 4BKOA 5J4HA 3OQMA 2V3VA 3C8DA 4TLLB 2HA0A 1O77A 3FI0A 3VMMA 2RGUA 4LX8A 2C78A 4QSHA 3LUHA 3PQ8A 2CNBA 4TTSA 5J4KA 4QA9A 3CLRC 5HF5A 1WBJB 4ZCSA 1ZBQA 3HA3A 1KOGA 3PD7A 4ZI5A 1WDKA 3O3MB 3LY8A 1MD9A 3JATB 3Q72A 4KB5A 4BNTA 3AR2A 4LKRA 3TIIA 3SC2B 1XQYA 4D8TA 2NAFA 2WUVA 5CB4B 5ARDA 3T7DA 4MB0A 4AUMA 3UPUA 1Q0LA 1JWAB 1T8PA 1TTQB 2QZZA 4X20B 4L08A 4F06A 4Y6OA 5K09A 3IV9A 4V03A 4XJXA 5DIZA 4A82A 2W4MA 1D6NA 4TL7A 4YMTA 1OW3B 4WJLA 3HGTA 4L78A 1DLIA 3TUZC 3ELDA 4DIFA 2PUAA 3WYFA 2B5WA 1Y5RA 2GNPA 3HJBA 4W1SA 2JJ2A 4YP7A 1T15A 3ZHXA 3ZXXA 1Y7IA 3K73O 4DPMA 4DV1B 4UVDA 1G4HA 1ST2A 2ORIA 3E9NA 1M83A 3H11A 3MUOA 3E3OA 1QSGA 4BE7B 1U2TA 3ICEA 4MKZA 1C2TA 4NJEA 2V7EA 1CPYA 1ZONA 3DTVD 3OLZA 4QXOA 2F48A 3E15A 2INGX 2PMKA 1U4OA 3CPHA 1P17A 3NBYC 2AI3A 3O9VA 4C0JA 4KFTA 4OQQA 2YOGA 4DAOA 5AW6A 4BN5A 3NI2A 2CVPA 5AIBA 5B2FA 2F4NA 3AF1A 4EGJA 1J2JA 3C4QA 3RJMA 4D0NA 2E5LB 2RB4A 3AF0A 3CG4A 2LPMA 3TOZA 3SFTA 5CCBA 2PIAA 4NEHB 4GOND 5JNUA 1GXSA 3AUXA 4V38A 1W1UA 4ZMSA 2BGUA 3KT6A 5KEIA 1JHXA 1I7DA 2A6PA 1ULZA 1I36A 1BFUA 4Y9DA 1XTUA 1Z38A 1TMGE 2HPAA 4GX5A 4ZT4A 3T1OA 4AS3A 4PNEA 5IN4A 3CIFA 3AFHA 5JEDA 2IUTA 4W6ZA 1MGOA 5JNWA 2OZVA 3WL7A 2Y71A 3LRTA 1T1SA 5IF3A 4XSHA 3JQ9A 4WK6A 1G1MA 4GRIA 4ESHA 4YJ3B 4BNIA 3QVVA 1ZZEA 3S2ZA 1EBFA 5K3DA 3ZJ4A 2Q29A 2JANA 2QQFA 3VR6H 1M0WA 1EB8A 5C3UA 3GLHE 1AD2A 2WAOA 5FL7D 1J1UA 3JX9A 2QTVA 3C6MA 3M9XA 1G5QA 1Y9EA 1ZO8A 1OROA 5EJ5A 2GD1O 4A0RA 5KHOC 1XMQB 2X8BA 4O1HA 4BX8A 4CMKA 1DQYA 5MN6A 2Q4BA 4Y2SA 3QJ5A 1QRTA 5NULA 3AL3A 4AJEA 4Z7JA 1YFKA 1E18A 2AXEA 2EDAA 3UB2A 4X0EA 1RLTA 1SCQA 1T10A 2HWWA 3KR2A 4PO1A 4K7JA 3SVZA 5IHPA 4MGEA 4R41A 5KINB 5CT5A 2VL7A 3W2FA 2FRVA 2VG8A 1Z39A 1E3IA 1XLTA 3DMGA 4X1IB 2G5PA 2FSUA 1G5HA 3K7EA 5ULLA 2I65A 2LRHA 4Q3AA 1SVIA 1OXKB 1NR7A 4OOEA 3AXTA 2AMJA 3AU8A 4NK5A 4F60A 3JQEA 4N0EA 1HKUA 1USVA 2PUDA 1P45A 2CVQA 5G02A 3QYJA 5BSHA 2VPIA 2E1PA 2V8BA 4XX1A 1VL6A 2PFGA 1UPFA 2GK7A 1EEXB 1XMVA 2G07A 3DCIA 4JA2A 4X64B 3U4MA 4NCIA 3W7BA 5KAMA 1U7TA 1KZGB 4CCAA 4BTLA 2G5TA 1VPLA 1Y48E 1BW9B 2X6TA 3HVUA 3LUGA 3OFNA 3Q1LA 4OH1A 5EPUA 4JLWA 3M6IA 2IHBA 3W79A 3L84A 3UMYA 4DJEC 3N5KA 4DIBA 3SEZA 1MABA 1V5EA 5JQGA 5HJ7A 3PZBA 4ARBA 1GFZA 2C2OA 1HZZA 3O4HA 3PVZA 3ZCRA 4CIVA 3ZZ0A 4A3SA 4DJFC 1KQ3A 2GAIA 2ZIXB 4XVUA 3CA8A 3F78A 2W0MA 4NHEA 1TCBA 1D6SA 1O7JA 2AG8A 2PIDA 4M0FA 1N6OA 4C4OA 3FJ1A 1Z83A 3LQYA 4LDRA 3OQIA 3MERA 1NTRA 3CEJA 4B8WA 3F5SA 5CMLA 2F2TA 3K0AB 1GA1A 4IZOA 2YWEA 3O26A 1U04A 1O6FA 3QGMA 4EB6A 4MDFA 3K92A 4HXEB 2NNWB 2GCGA 1KPHA 4GW3A 1W4AA 5AXCA 4MVJM 4MUFA 2I8AA 3U4GA 1A97A 2O5CA 1H9AA 2PT6A 4OXXA 3CRRA 5T3UA 3SC6A 1DKUA 3NWOA 3AU9A 2QB5A 2QJRA 4J7AA 3SKVA 4FILA 4L0MA 3Q0TA 2I1WA 4WUVA 2WJJA 4BXOA 2BFOA 5DP1A 5JFTA 4UJ3A 4M0PA 5CVJA 3L49A 3WKAA 1SC6A 3ZE7A 3ZYCA 3WDKA 3WS7A 4HVLA 1GUZA 1WMBA 4DXHA 1FXSA 1OFIA 4ZOCA 3ZJ5A 1YSCA 2VZEA 3THXB 4ILKA 2P0AA 2ZYDA 4OKNA 1U11A 1LS6A 2DHQA 2CT8A 5B7QA 5AXAA 2YXLA 4S2EA 4Y2TA 3VSBA 2D06A 3JYQA 4J1TA 1QKJA 4KQJA 4KUGA 2RGXA 2OFOA 5C18A 1EX1A 2FZLA 2R6GA 5IZCC 2G9UA 7ADHA 3LT0A 4MLDA 2Z58A 5LYJA 3FHTA 1SIWA 1ZQ1A 4YRFA 4DWVA 5JUWA 3TQCA 3RSOA 4HB3A 3QWAA 5CCXA 1RDFA 2IDKA 2VNSA 4CEJA 3CC8A 1MTZA 1Z25A 2DPYA 5FWXB 4N5HX 4X7MA 3T5TA 4E2XA 2EP7A 4JBXA 4BYMA 2BD0A 3ZVMA 5T4BA 5PGMA 3RRFA 3A1FA 1ZWLA 1ZSYA 4I8DA 3J81A 1RAHA 2OKGA 3K32A 5CNKA 3K1JA 4UAVA 3BWBA 2BKEA 3ETGA 1QF9A 1T1GA 2QPLA 3I04M 2FPRA 3NBMA 4MWBA 4QQNA 2FX2A 1DBWA 4PHCA 4FFRA 4BLUA 1H0KA 3HCPA 3PGJA 2VA8A 4CFZA 2YQZA 1PI3A 3IHTA 5EJIA 4DC0A 5K8TA 1NASA 1PGJA 4PY2A 4W63A 3TNLA 4GR4A 2W83A 4D4KA 1IUKA 1WUJS 3I6MA 2NSJA 4YQYA 4JLOA 2HSEA 3GCZA 1Z17A 4ALIA 3NHAA 2MWMA 2NWQA 1T5TA 2R8PA 3JYHA 1JQJC 3NXSA 5HFJA 1Z2OX 4M2LA 1MA3A 1X9HA 2MHCA 3IAXA 2WTAA 3CZ4A 4XM0A 3VM6A 4MRNA 2HTEA 1LJLA 5HDQA 5JD6A 4X1KA 4AKSA 5L95A 1W4CA 4FKMA 4AZVA 1FUIA 4M8NE 3BH7A 5K0GA 1OOEA 2B98A 1EDEA 4EG8A 1T9HA 4F45A 2ANCA 2XQFA 1LU9A 1L5VA 3MWDB 4BMPB 1I3KA 3EIOA 3Q2IA 4FT2A 2DKNA 3HUDA 3KWFA 4GYKA 4DKXA 3Q3GE 3M3HA 2QG4A 2QS9A 4CKWB 3HYNA 5EL0A 2CLDX 4UTVA 3KD2A 5IH3A 5SYMA 1ES9A 2OCYC 1UODA 2EEZA 4IH4A 2A0FA 4O4IA 4Q9IA 4NMHA 2ZVDA 4RM3A 2E55A 4FXOA 4EWLA 2F43B 3DOIA 1SCBA 2FPIB 3EOAI 3GJZA 5CA0B 3S1SA 2BKAA 4ZT7A 5EGNA 5JARA 3RVRA 1NWCA 4QRIA 4KAXA 1O94D 4N7BA 1LNQA 3NC4A 4S1VA 4WOCA 2BGIA 2YNMC 3RTEA 2SCUA 3RIGA 4BFWA 5F2NA 5ER6A 2JGJA 2YXDA 1CF4A 3WP0A 3NW9A 1JVSA 4EOGA 4LJAA 1TA0A 1W75A 2WFZA 1CY2A 1HH4A 4DRXB 4DQXA 1U3VA 5B57C 4J9UE 2DECA 1ZD1A 4D74A 2VJLA 1T0HB 4RV4A 5ADWA 4B6RA 2XDQA 2QLLA 1NVEA 2QMEA 2PUVA 1KR2A 3G2MA 3GNQA 4UM9D 1TCCA 4YIHA 5JAMA 1Z7BA 2EJCA 1SXQA 1EX7A 5G0SA 3LA8A 5EG5A 4YT8A 3CUTA 2ZJBA 3PITA 3STUA 4DV5B 3K2BA 3FOBA 1YRBA 2AJ8A 3AEKB 4UVHA 4B84A 2RAVA 4EFNA 4EFDA 4DYVA 2R68A 4DDKA 4JNCA 1H85A 2WSYB 4QAJA 4PC3A 1D4AA 3WK4A 1KDPA 3OECA 4TLDA 3E84A 1IBMB 3VVCA 3JATA 3U7IA 1UWVA 1UZNA 1XX6A 4J0HA 5IX8A 2RKBA 1WZUA 2FYTA 3SBXA 3SC2A 1PR4A 1RHMA 5CB4A 3FPAA 3QJGA 3RR2A 5FPKA 1WKBA 1WULS 1GG2A 4RK4A 1SURA 3I9NA 4X20A 5T64A 2D0PB 4GPD1 2FZKA 2REQB 4ZZ1A 2XYHA 3GLHB 2ATEA 5GZ3A 1XPUA 1KSHA 3ROKA 3KYBA 4JDUA 1ZU5A 3ZDQA 1Y3FE 4Z4EA 1YS4A 4LJ5A 1GZUA 3T06B 1CQJB 1E60A 4MNTA 3C3AA 1T4MA 4XUGB 2DP4E 2BM0A 4F92B 2JAXA 3MTJA 3TB4A 5ILOA 1DIAA 3NPAA 4Z7NB 4OGWA 3EYWA 2AXNA 2HCBA 4PGGA 4MINA 5TC4A 4BQOA 4C20A 4PBRA 3L3BA 2P9CA 3PC8C 4GGOA 3U4QB 1BJRE 1UDRA 4C1BA 1A1VA 4REMA 5HUHA 2ZYWX 4YRPA 5F4BA 4ZTZB 5DLDA 1OBCA 3S8EA 3LF1A 3KSZO 4GP6A 3NRCA 2HPVA 2QRJA 2C7PA 3BK2A 4F5EA 3HJHA 2FE4A 3O3CA 4WXPA 2BEVB 2VDUE 1WB5A 2VHUA 1KPIA 1CJCA 1K4KA 3AKEA 3F6PA 3FNFA 3ABIA 3O3NB 4XD7D 1NXOA 3CZ5A 2VQFB 3KP1A 1U7UA 1AKEA 2JBHA 1BD3A 1X7XB 2WDZA 2ODBA 1I33A 1WY5A 4BWVA 3GCXA 1EINA 5CT8A 3LUJA 5HBGA 4KYIB 1J20A 1G3UA 5AM1A 5C35A 2DQZA 3UMBA 2JIDA 5IS2A 1G9XA 2Z8XA 3WNBA 4QNMA 3ELWA 4KYUA 5HP4A 3KJFA 3FCAA 1ZJJA 2HFKA 4P4TA 4XJVA 4B9EA 8MHTA 2VNHA 4D4MA 1AUQA 3ZWDA 3L6CA 2V5AA 4YJ3A 2WV9A 3FPLA 4CLHA 3R9WA 4U8HA 4URZR 5ALJA 3NHBA 3GJRA 4YUXA 1Z7WA 3NGMA 5A5FA 1NI3A 1XP5A 1KJIA 3I4FA 3ILYA 1N6LA 3EIWA 3MIZA 3P0IA 4OHBA 3S55A 3OIDA 1P9RA 3R5XA 4RNDB 2Z4SA 3TEMA 4TN1A 1EIWA 2FEXA 4PYKA 2FUNB 3NM4A 4PPQA 1M67A 1XF9A 1DJMA 1XD8A 2IGBA 1KZ6A 3C8ZA 5BURA 2NYAA 3VC3A 4YRZA 5JPCA 4DC9A 4EGSA 1SXIA 1ZI8A 1OU4A 2ZRGA 4RAQA 4AO8A 5AYVA 1Q5PA 1IZ8A 1JU4A 1YUMA 3DJFA 3I6ZA 4ECAA 4ZEMA 5A04A 4KWCA 3NJ8A