3PC6A

X-ray crystal structure of the second xrcc1 brct domain.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
b'ELPDFFEGKHFFLYGEFPGDERRRLIRYVTAFNGELEDYMNERVQFVITAQEWDPNFEEALMENPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQAHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein XRCC1
molecule tags Dna binding protein
source organism Mus musculus
publication title The structural basis for partitioning of the XRCC1/DNA ligase III-{alpha} BRCT-mediated dimer complexes.
pubmed doi rcsb
total genus 28
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pc6A00
4BU0A 4Y18A 3K0HA 1T15A 3PA6A 2EBWA 2EBUA 4BMDA 3UEOA 1Z56C 2L42A 2K6GA 3QVGB 3SQDA 2LE0A 4BU1A 2ADOA 3EF0A 3AL2A 3K16A 1IMOA 3K05A 3T7JA 3EF1A 4ID3A 3L40A 3PXEA 2VXCA 3T7IA 1GZHB 4N40A 1L7BA 2JW5A 3T1NA 3SHVA 1T29A 1OQAA 1CDZA 3T7KA 3K15A 4JLUA 2COEA 2COKA 2M2IA 2WT8A 1L0BA 2AZMA 2E2WA 2R1ZA 1N5OX 3PC8C 2VXBA 2K7FA 1WF6A 2XNHA 4XQ0A 1IN1A 3COJA 3HUEA 3KTFA 3K0KA 4XPZA 3L41A 3I0MA 3QVGA 2NTEA 2XNKA 2COUA 2INGX 2ETXA 3OLCX 2EP8A 3PXAA 3PXBA 1T2UA 4OFBA 3SZMA 3PD7A 2DUNA 3AL3A 3U3ZA 4IGKA 3PC7A 3SHTA 4BMCA 3I0NA 3UENA 3PC6A 3II6X 3FA2A 1Y98A 3HUFA 4U4AA 4Y2GA 3PXDA 3PXCX 1T2VA 2HTFA 1KZYC 3PC8A 3JVEA 1JNXX 5ECGC 4IFIA 2D8MA 3L46A
chains in the Genus database with same CATH superfamily
3L7CA 4F6RA 5D8DA 5AHWA 4FE3A 4BNYA 4YJ2A 1ZFNA 1CT9A 3UTDA 4OAQA 3V00A 3W5BA 1TAUA 3I09A 1B8OA 1KOFA 5ILQA 5KJ1A 1DXHA 5JD4A 2BHLA 5LXTB 3GH1A 4WBXC 2BZSA 2BSAA 1TI7A 3BGWA 1KZHA 4ENPA 1I1NA 3QKRB 3AF1A 3BBPA 1NQTA 4D3FA 4QX6A 3AW8A 1KVSA 2HJWA 2IHZA 3GFTA 3RBXA 2ZTLA 5EJIA 2QQFA 1W4CA 3T99A 4L2IB 3WKAA 1VPVA 5AOCA 4B6OA 3I61A 3VNRA 1IY2A 1XD9A 1G5FA 3WWEA 4E5NA 1F9AA 1JNYA 1NY5A 4E33A 2E1RA 4JC0A 13PKA 4G8JA 4BKQA 2RFLA 1B6TA 1YI1A 4IVQA 4LF9B 3PR2B 3RT7A 2O8EB 1JQEA 4M49A 4AJEA 5LKRA 1L7PA 2P6OA 4P5EA 1JIJA 1FBNA 2HI0A 5CAEA 2TMGA 2IEBA 3A3KA 1QGUA 2GFHA 2IIVA 1XEXB 2W2TA 4F97A 1V1RB 3CBGA 2FSFA 2IHTA 3KL2A 4G63A 4XARA 2IU4A 4X60A 1EX6A 3LY9A 1JA9A 3T4EA 3NBYC 1WPQA 3GC6A 2WPDA 4KR6A 1Z73A 3QBTA 3AP1A 4A8TA 1YQWA 4HMQA 3B60A 2CNOA 5F78A 3ZWVA 2FQWA 2O2EA 1ENYA 1FYXA 1ISHA 1LSOA 3VU9A 1RVV1 1HMPA 2D74A 1IQRA 4M37A 3V8MA 3EEQA 4Q0MA 3Q7SA 3GDGA 4EF6A 2RBKA 2CV0A 3IOYA 3UBTA 1OOEA 2QTRA 3ER8A 2Z04A 4G9GA 1OZHA 1U6JA 4AJNA 3TUJC 4FUTA 2Z1NA 3HO8A 2UU9B 2QJTA 3QHPA 2K4MA 3PDCA 5AJUA 2PS9A 2OPHA 3DPUA 3G1UA 5IUNC 1CD5A 3RB8A 4RORA 3B7GA 1MX5A 3DOEA 2D8AA 2FR8A 4U5QA 4R16A 1I1QB 1ULTA 5LDHA 3M6WA 3F5FA 5B3KA 5AW0A 3G7NA 2XUHA 1KIAA 2C00A 2JD0A 2NIPA 2VKTA 3RTCA 3OT1B 5HJ7A 1JQJC 5DM60 4Z4QA 3OPYI 3GRZA 1C0LA 3NWJA 3R5FA 5KYUA 1SVIA 2GMWA 3I83A 1VPWA 4U7FA 2PM8A 1P9RA 2CC2A 2JC3A 5BSMA 4X00A 4BECA 2PS3A 3C8UA 3MWFA 4P3XA 4PHFA 1PR6A 1S6YA 1TW2A 4HX5A 2G1JA 2WUGA 2EFJA 3PFGA 1SUIA 4FZ5A 4LDJA 4MS4A 4MR8A 5A06A 1UXOA 4XB1A 1UM8A 4UATA 1EAMA 5BMOA 5JYEA 1KEZA 2H0QA 3KAQA 4CR7A 1IZ9A 2OV4A 2X2EA 4EPYA 2GBFA 3BH6A 3DEHA 2CZQA 1NRXA 1QZXA 4F8JA 3R6GA 4NZ9A 5BV8A 5JNWA 4RVHA 3FPBA 5CHYA 4E21A 3E8SA 2GPBA 2O7QA 2ZWVA 3H3JA 4CUKA 2O7VA 5K2OA 3ZTWA 2EJVA 2R6AA 5BSKA 2X8BA 4L07A 4HB0A 1OIVA 2C83A 4W1SA 4I8IA 3RC9A 3DUWA 1NE2A 3QUTA 5LC1A 2WWGA 3IOEA 1VL2A 2HPZA 1JHPA 1U0GA 1EP3B 3BFXA 2IOQA 3ODGA 3HJUA 5HRUA 1SCBA 2BEJA 2KW5A 2FR0A 5E8JA 2WNHA 4DREA 3RSHA 1UDAA 2FQQA 1C81A 3UHAA 4ENSA 2C5AA 3TQFA 3PPXA 4R54A 4BNNA 4WBSA 2XRMA 2BELA 2SKCA 3MTQA 4YGXB 7MDHA 3ADCA 3RM3A 3AM1A 3JYOA 4NENA 2R7AA 4S1WA 2JHGA 4OHRA 4B8ZA 3VJRA 5F1KA 3SEZA 3TB6A 1ENZA 4E1BA 1RP7A 1VSBA 1YS9A 4LXTA 3F3MA 1XTZA 2UKDA 1PUJA 3HXLA 4IAOA 5ALIA 1VJTA 3BC1A 3QWAA 4PZZA 5GAJA 3V4FA 3QELA 1Q3HA 1CVIA 2QS9A 3MUFA 2HAEA 2QZPA 4LA4A 1EK0A 2OUKA 1DKQA 3PF8A 1TADA 5BN3A 2Z9DA 4HAUA 1GGFA 2WTEA 4V1CB 4HGQA 2DTXA 3TM5A 1S9DA 2A88A 2P79A 3W5VA 1OASA 3FHOA 1U8CB 2WSMA 5FBLB 3D6UA 1J0AA 3GWZA 2ZUSA 3BB4A 4OI1A 2IEYA 2Z4TA 3HVUA 2R48A 5CLQA 1JIUA 1JKJA 4EDFA 2OHOA 4IUBS 2B8NA 4N48A 5DSZA 1V39A 3UUGA 3KO8A 1FFWA 2GILA 4OXIA 4EKIA 1Z4MA 4J1NA 4ZDWA 4RTKA 2AJCA 2CDAA 5F7OA 3S27A 3H5VA 1UFKA 2O2SA 3N7TA 3PYMA 1V9SA 3NBQA 1QH1B 3R09A 4D4IA 4FZJA 3I4FA 5L3RA 2GBCA 4L72A 5HFAA 2X1LA 4E5YA 4LQ4A 4US1R 1O97C 2PJRA 4M99A 5EWJB 4NYJR 5BSUA 3SY8A 3WQBA 2J3QA 3KQSA 2OM6A 5J40A 2HX1A 2WRZA 2OGTA 3W90A 2VK8A 4ECAA 5IXJA 1LEHA 1ISIA 4O33A 4RAOA 3EPRA 2WY2D 3ROKA 3UMVA 2PSFA 4BO0A 4CT4B 4V0SA 1RQRA 1N8TA 2YV3A 4KQKA 4WOKA 2PZEA 3QA9A 1U7PA 2ZRKA 1T2UA 1AUVA 3NHJA 2RKBA 3KHSA 5GVRA 2HK7A 3NT4A 3RTGA 3TSZA 1C7FA 4RHEA 4ZEWA 3RASA 1KVUA 3GVCA 1TYZA 3RGGA 5CB4B 4QYMA 1UDXA 2AR7A 2YUTA 3K5PA 5TE9A 2BEWB 2CZGA 3A0UA 3W6PA 1O8BA 1V7QA 3REQB 1DBPA 4MHOA 5H5JA 5KSWB 4MRMB 1PNOA 3OJWA 3EUEA 4KTVE 4OTZA 4TTJA 4RQUA 1GXSA 3JAWA 3RK0A 4C1BA 3QYJA 1TTPB 2Z3WA 3AZOA 5K0GA 1TJPB 4HAIA 2ZQYA 3QK7A 1EFCA 1FYDA 2PR2A 1ADGA 4I1IA 4LOKA 1AKWA 4HX2A 4QRIA 5AP9A 4MDYA 4MJLA 3T35A 1BW9B 3PXDA 1WKBA 2G82A 4PLCA 4BFVA 1Y1QA 2JFFA 4YCDA 4LCEA 4P86A 2QX7A 1IBCA 3AHGA 3K1AB 4OJTA 1T8UA 1K7FB 3PNKA 2RHOA 3BIJA 3BFPA 2GD2A 3M9LA 2A94A 1QIIA 4BP9A 5JS8A 2OO5A 2P0AA 4XQGA 2HEIA 3QBVA 2A78A 1RBYA 4JJZA 3TLGA 3IBGA 4BQQA 4JC4A 1G9TA 4LRWA 3F46A 3WRWA 1WW3A 3U44A 1U5AA 3QXHA 2EBWA 3AZPA 4ZJZA 1C9JA 3QV1A 2BM9A 4KMOA 4JBNA 4PZ9A 3UJ6A 4RGQA 1Z6YA 1H0SA 3EZ7A 2XNDD 3OQBA 1HQYE 3P5BA 3R8XA 3TM4A 1A9QA 1B0UA 4HL6A 4Q39A 4RM3A 3JD0A 1I6MA 2WDZA 3OFKA 1NUPA 2FHSA 4G97A 4OLAA 4M8SA 4B3TB 1J0DA 3FCSB 3O8CA 1KR5A 5ALXA 3WISA 1O96A 3GLVA 1ABEA 2P75A 4UHJA 4JLKA 3QVXA 3MPOA 1PT5A 5DTEA 1DZIA 1M1UA 1DJLA 1DKPA 1OI7A 1TAQA 2G9ZA 3AU9A 5FUMA 3DCJA 1Q5PA 1PZFA 2FYTA 1DS6A 3AKYA 1GV0A 3ZHTA 5CVJA 1JEEA 5T57A 4I81A 4TZ0A 5JAPA 5DI9A 2PX4A 2EIXA 4F3RA 2V58A 1GUFA 3BD7A 4KO3S 2JGLA 2Q7XA 3Q3GE 4X63A 4KO2S 3MSCA 4QUGA 3ND9A 4D0LB 4CCYB 5AVTA 1E1YA 4CRWB 1TGYA 5C34B 1OD6A 2C7VA 4FILA 4HUQA 5E6UB 2IYZA 3HGTA 3AF5A 1T3ZA 1KEEA 1J1IA 5JAHA 2OUIA 3OC0A 2GJ8A 4GNKA 3VXKA 5ALQA 1UAYA 4KPUA 5FNVB 5COQA 4KQXA 2E87A 4AZ0B 4N5MA 2F43B 4LE1A 2V54A 1EM8A 2XNHA 4K6FA 2Y27A 4Y0NA 3MXTA 2BW0A 4BAUA 4CIWA 1LPBB 1QV9A 3E9DA 4GPIB 3D1LA 4M3NA 4ZV9A 4B3IA 1Y9EA 5F7ZA 4C0LA 4UFOA 2XZLA 5G0WA 1YGPA 5BVHA 1YVPA 5E4TA 4QFMA 4TT3A 1NNLA 2NXNA 3CZ9A 3ZBTA 2JDIA 4H7KA 4PIVA 3K2IA 4HDAA 2F6RA 5TS2A 5K0JA 2XSZA 4JGBA 1TZBA 1VL6A 3C7DB 3DCYA 4RIEA 5DGXA 5TVGA 3RWMB 2QN3A 3U4DA 3ZGNA 3TW0A 5B12A 1E9RA 5AW7A 1UDRA 2FW1A 1M2EA 4D45A 1IK4A 1E6CA 2HTEA 5IHXA 4NU6A 3C3XA 4BVHA 2XTNA 4YT2A 2P6UA 4NEHB 1JDNA 3WO0A 2JHPA 2WVGA 2JI8A 2VHVA 5JPDA 3UANA 1W1UA 2ZRMA 3OLCX 2PZJA 3QE4A 4IJUA 4PAMA 4CMEA 3UB4A 1R0RE 1PQUA 2ZYRA 4HR7A 1V2GA 3O9VA 3I58A 4MA5A 2KYRA 2VA9A 3PLRA 4QXMA 1CP2A 4WNAA 4Y1RB 5TS3A 2WWHA 4C0QC 4FFOA 1SUBA 3H86A 1E5LA 1Q50A 4PG6A 2XVYA 1D4OA 1F2DA 2D06A 4MEAA 5CW1A 5D3QA 1Q6ZA 2OFOA 1MJGM 5L7YA 1Y6RA 1YR9A 2C5FA 1X7XB 4RX1A 2JLBA 3MEQA 4U63A 5FUYA 3B6ZA 4Q4JB 4JUIA 4OK6A 2GNPA 2XODA 4IIBA 5ALJA 1WW8A 4BCDA 1L5MA 1WPGA 2AOTA 2G70A 3ONNA 4YUYA 4O5OA 4TUYA 4BE7B 5FT9A 4F6RB 3AEZA 4CKZA 2YWHA 3LX5A 5K3DA 1OLOA 1OLUB 3A7DA 2TMYA 3WHKA 5A4DA 1EH5A 1XNGA 1JN0A 4NC9A 4BC0A 1GP2A 2XUQA 3WLMA 3AJ9A 5JUWA 2FE1A 5KYNA 1QNLA 2AW5A 4J91A 3PUIA 3NALA 1A1VA 1SK9A 3EJ6A 4J9VA 1CXZA 3GAAA 4I99A 2QQGA 3MCVA 1JG2A 1GPH1 1HL7A 2XYVA 3IHLA 4XJSA 4Y6PA 5EPUA 4BTEA 4BV8A 1SKYB 3S3TA 4D98A 5LYYA 3AB8A 3OWHA 3D5TA 4Y98A 1R0ZA 3OEYA 5F5NA 2B0CA 1QHHA 2VJOA 4WINA 1L5WA 3E23A 1N3IA 3HKCB 4ABYA 2I4RA 2JCVA 5C4IA 3TKAA 3PHGA 1X9HA 1L4EA 2CL7X 3N39C 3EF0A 4J2HA 3SR3A 5IN4A 1IUOA 1VGRA 3V1LA 4GMHA 3WGZA 2FFQA 1ZIXA 1JG3A 3IVGA 1ZGJA 2NTJA 2PYZA 2WJJA 3CLKA 1DOAA 1ODLA 3GB9A 1ISMA 3DL0A 3KYJB 4MI6A 5IHPA 2YVQA 5AM5A 3TLKA 1EVKA 1H2XA 2GTPA 2BRUC 1YHZA 4GDMA 2FFJA 2FSSA 2H31A 1R74A 4QDXA 1ZSYA 3IE0A 2IYFA 2O2YA 3GD7A 6Q21A 4Z9FA 4BX9A 4LHWA 5C2JB 3WB2A 3GEPA 1UR5A 2CUKA 3EF3A 4I55B 5HF8A 5AK0A 5A3VA 4Q7QA 1ELOA 1O5IA 4G81A 4KC0A 5ER6A 1APBA 4OHWA 1RWBA 1VSUA 2OO7A 3AR7A 1PL7A 3UWKA 3HCWA 3O8NA 4M1TA 3LQRA 3O8LA 1UBCA 2V5VA 3GARA 1A2BA 4DMMA 5CBPA 5D2CA 1NBME 4GBJA 5KNCA 1LTHR 2B4TO 4UUNA 3PRKE 1U8EA 1XKTA 1RWVA 4EG7A 1GPAA 5G0VA 3MS4A 2X6TA 1XDBA 2OBMA 4JL8A 2I2FA 5JSZB 3ZU2A 1Z88A 1ZM4A 2AMJA 2EV9A 3O8DA 2JGDB 1FRNA 3HSYA 4CLOB 3HWSA 4GIBA 5LQRA 3C15C 1PJQA 2C4KA 1V5FA 1ZAKA 1HNWB 3OQ1A 1ICIA 3FYTA 3S0JA 3E7PA 4A6PA 2GD6A 3RDPA 3U1BA 3W6NA 4KHZA 2Q3HA 4FKBA 1T8TA 1OX6A 3GF4A 2JH3A 1OB5A 1VDMA 3NZEA 3L5KA 1X0XA 1F51E 3SOPA 1R3UA 3KB1A 5HE8A 4XX1A 3DZFA 4CDMA 4EVSA 1IFXA 3ZWNA 3UJNA 1DTWA 2J07A 1Y6FA 2KLHA 1P2DA 3DZBA 5EKDA 2QV7A 4KRGA 1W36C 2ZETA 4LBYA 3RC7A 4HNRA 4PGFA 5JH7F 4F4HA 2EP7A 1DBWA 3U7RA 1AO0A 3EZ6A 2EKZA 2Y1KA 5AJWA 3WGTA 1WXWA 3FUXA 1QPBA 4K9LA 4MVJI 5MN4A 1AGRA 5DX1A 1X80B 1UKAA 3DMNA 5MGBA 3S7ZA 1BKYA 3D8BA 4UFNA 2P62A 3AKEA 2CMKA 4RA9B 1O6CA 1AA9A 1M8KA 5KMGA 4BIIA 4CMIB 1LLUA 3IUYA 2IH2A 4CQNA 1DU4A 3T3NA 5BOVA 1XFAA 3CWQA 3ZWXA 1KJYA 4GLJA 5KWVA 2F1HA 3WLIA 2W2PA 2OBFA 3D7NA 4JR1A 1ZD8A 3DEAA 5B2ZA 1VM6A 4MW0A 3ZDCA 5E2AA 2JNWA 2IIPA 4JU9A 4FEEA 1MB3A 3TCKA 1LFAA 3EXIA 1E2DA 4EF5A 4KPYA 1M83A 4Z7JA 1LDEA 1Z5UA 2ZJ6A 4RD0A 2EHDA 1CZOA 1AXEA 1MABA 1KOLA 3ORQA 4IGAA 2JLAA 2SCUB 2OV2A 4HYEA 2P0YA 4RTPA 4F2GA 1P2SA 4OQ4A 3CR8A 2I2WA 5ALLA 1H9AA 4JXXA 4HB4A 4LNHA 3T3HA 6NULA 1XYYA 2OBNA 1HETA 1HY3A 1O97D 2GA9A 3P2KA 4RZQA 1KKUA 3NDRA 2FOXA 1Z8DA 4BYGA 1E94E 3U2QA 1XZMA 2FW8A 2W2VA 3JX9A 3MOGA 4FYXA 5F73A 1HKHA 1KJ8A 3WDLA 1X9GA 1PIWA 1T3TA 4LF6B 1SY7A 3D0KA 2G9UA 2Z8YA 3E9EA 1KZ7B 4PS1A 2ZJOA 4DXAA 5LD2B 4ZQHA 5DT2A 2PUAA 3OX4A 3TRDA 4KBGA 3EZXA 2DBVO 3C24A 1Z0SA 3KR0A 3ONVA 4TM8A 3UFXA 5BQ3A 1R5JA 2MSEB 4O1MA 4DLKA 1W85A 5K8JB 1BGWA 3H65A 4MWTA 5FWDA 3P45A 4NPHA 1PK9A 4I36A 3PIDA 4B2PA 4DADA 2WTNA 3KM0A 3ICVA 3X1WA 1VLZA 3GAMA 2HHJA 3EFEA 3RSQA 3KQHA 4LJ9A 1ISJA 2VT3A 4Q6WA 2JCSA 5DBIA 2PSEA 4TRRA 3C43A 3G0IA 5D7BA 5FBWB 3QLVC 1W5TA 5FWYB 3LDHA 2QQ0A 4NE2A 2NUPA 3WIOA 4WNAB 2JB9A 1T3LA 3D6MA 4NONA 2AYXA 1RPNA 3CG4A 1YOVB 3NONA 2H11A 4HMPA 5HGJA 3WJ1A 3LJKA 3BDIA 3N2LA 2CJPA 2O57A 1YR6A 5DWQA 5EOVA 4JI6B 3ZD8A 1EVZA 5BQOA 3DV2A 3HO1A 5JHGB 3PENA 1ARZA 3FZGA 3LNTA 1MN6A 2I1WA 4LQDA 1VE3A 4FGKA 3U9LA 3VUFA 3VVMA 1ECJA 1HOTA 1RKUA 4H3HB 4N18A 3AVVA 4PRKA 1B2LA 1YCHA 1K6XA 4HFRA 5FTJA 5BVGA 5EMMA 1P8AA 1HTBA 5EZSA 4CG0A 3IT2A 4BEWA 2IOHA 1P4GA 1A5SB 5LNK1 1M33A 3ZQ4A 3O94A 5AKZA 1ZL2A 2O06A 1S7CA 1YZYA 4TLLB 1PNQA 3DWEX 4UUQA 5JZSA 1DEKA 3ECAA 3EEIA 3JQDA 1JLRA 3GLUA 3IHWA 5JV5A 4LK3A 3T1HB 5K0FA 2X6RA 3OZ7A 1NYLA 2D2FA 4U2BA 2QROA 2FSVC 3WRXC 3AKZA 1T0IA 2DUWA 4DEVA 5EJEA 3PLAE 2ZIFA 1KDYA 1QTRA 1NUUA 1MAHA 3PEWA 4KVAA 3BOSA 1EVEA 1RI2A 2I4TA 3OHSX 1IULA 1CY0A 5SV2A 3STXA 3VV2A 3WLFA 2O8VA 4DSUA 3OQMA 2APJA 4PGGA 1GQSA 2XMRA 4ENUA 5LZ8A 1FYWA 5FAXA 1RI3A 2DH5A 4IFTA 4OL0A 3TCNA 4WZBB 5GZ6A 4I6JA 4JLWA 4IPTA 2RHCA 1P2GA 1YDFA 2A9FA 5JQGA 3M4XA 4N3GA 3ZWWA 3ZDDA 3KYDB 1D6JA 5FPTA 1UJ4A 4F3YA 3TTTA 4NMLA 2J6CA 3BFKA 3CH5A 4JX8A 1Y0BA 2EBUA 2C5GA 4GVLA 3UICA 1CK4A 2ERYA 2ODBA 2ONCA 1MTOA 1WZNA 4MB2A 3LP8A 1M6WA 3SM9A 4K26A 3T5DA 3ZNOA 4B84A 2IHKA 2VYFA 4BBJA 1J1ZA 5A1TA 2QMZA 3G2MA 1FP6A 3TTUA 1EWRA 3ZNNA 3WGJA 3SQDA 5AHXA 1ZA1A 2HFJA 5F2NA 4NAVA 3PJFA 4AN4A 5L7WA 1CF2O 4GZ6A 4N8EA 4PCAA 2ONZA 3TO5A 1JIKA 4PQGA 4U7WA 4BQFA 1SRQA 2CWWA 1SOVA 3HZOA 1YJAA 3DMDA 4DLTA 1C0EA 4EAQA 1DIRA 4R2LA 1MDBA 4HWOA 4GHWA 5AM4A 2IYLD 1JKIA 1HYHA 1ZD2P 4I1UA 3W5UA 2FHPA 3K1YA 3V1YA 4FHCA 3IOMA 1RPTA 2DU8A 3F6CA 3LPDA 1Q7CA 4H35A 5HIAA 4JBGA 1P29A 5FUBA 3IALA 3RTEA 2IQIA 1Z63A 1XQ1A 1WL8A 1DAHA 1DO2A 4OHFA 1YB4A 3UJDA 3CUYA 4CM9D 3OPXA 4BX8A 3ER6A 2AEEA 3BCRA 1OFVA 1DBSA 1HLDA 2R1ZA 2OHGA 4LOJA 4ZO4A 4IQ8A 5INTA 3UG7A 4BKRA 4XGRA 2XUKA 4B75A 4JA0A 5LN1A 1NNEA 3G6WA 2JIZA 4NYIQ 1QR6A 1EFPA 3L49A 5M3BA 1CP3A 1K06A 2QG6A 4J4HA 3WG9A 3K35A 2PNJA 3MQFA 4B4UA 2C0CA 4BS9A 1SQ0A 3AHFA 1P80A 3QEOA 1XZBA 2WMDA 2NWQA 3BGVA 5DTIA 4QGFA 2AOWA 3VOBA 3O03A 2PXAA 2VYQA 4UZSA 4AKIA 5A5DA 3H5RA 3CZMA 3HPQA 4TKUB 1CUXA 1CF9A 3OM0A 5SY4A 1FSZA 4QPJC 1H8HD 3ABIA 4JBXA 4R98A 1DIAA 1T4GA 2W83A 3AILA 2VCHA 2NTEA 3BL5A 1PWZA 1ZG3A 2FZ4A 3S2EA 2NVUA 1RE1A 2YTZA 4B8YA 4QUDA 4LHXA 1GZSA 3D8HA 1B8PA 2O3RA 1SCAA 2Z98A 2ZXEA 4QE3A 4DV4B 2B94A 2Y68A 3FGZA 4BVJA 3JTEA 4CVNA 3ISVA 1C9EA 2ZBGA 1ZU5A 2AMLA 3AVQA 1KBZA 1FU7A 2BN4A 3U4GA 1GUZA 4BFCA 1C3EA 3LC0A 2PTGA 3AF0A 4HNQA 3BEDA 1HZZA 3I0NA 4YCAA 2HNBA 4O0MA 5C3MA 1KI4A 4HDSB 4MARA 5B37A 5JYDA 4RPGA 5IWAB 2QD4A 4JKIA 5AI9A 3SKYA 2X0DA 3KE8A 5IAGA 3ZDRA 3BYZA 3W2GA 3INGA 4FKZA 1NN3A 1NVVR 1V35A 2IYTA 4M60A 1HURA 4DILA 4Q4CA 4FNOA 1TJ5A 4FI3C 1SQFA 2VPTA 3GQBA 3OLZA 3AF3A 3ZY5A 4BMYA 1GEEA 5KJ6A 1Y1KE 2H1HA 5DF1A 3D8TA 5HS6A 2P2SA 2Z9CA 3L8EA 4KQJA 4Z86A 4AJIA 1F06A 2C2WA 2JFVA 4P53A 5GV8A 1ZI8A 1ZUNB 3M3HA 2JLYA 2IWRA 1KYXA 3AH8A 3JY6A 2V96A 3G5UA 4IDOA 4QTUB 4BXOB 1HA3A 1YOBA 2QUKA 3B1ZA 3PQ2A 1DRVA 2CYBA 4B6JA 2ORVA 4JR2A 1WB5A 2GAJA 5GZ3A 4KWTA 2I3ZA 5BW5A 2XWPA 3BORA 3MQ2A 5FOVA 5C31A 5M7EA 3HU2A 3U5TA 2WILA 1ACMA 1E9DA 2BHSA 2WIGA 1I3MA 3GJ0A 3P9XA 4Y7DA 3K6JA 2W90A 3GCGA 1MH9A 4CGYA 4E4RA 5FP0A 3CVVA 1T9BA 2GAFA 4DMLA 2EF0A 1T5OA 5EZ5A 2ZRHA 5ALNA 2BTOA 2FPSA 4H3KB 3VR5H 2MWMA 1SXJE 1YXMA 3A05A 4TMVA 3KS9A 4EG5A 2G1UA 1GZ3A 4YRFA 1DZ3A 1F2TA 1X1AA 3BMOB 2XT0A 3GRYA 3KV1A 4EF4A 2ADMA 3HC7A 2JEYA 4I55A 2ORED 3WY9A 3L4BC 3EVGA 1DUIA 1PJ4A 2PIAA 3CEAA 3FB1A 3I04A 3M5CA 3E7XA 5AI4A 4CLRB 4RIIA 5EE5B 3JZDA 1SUEA 3P9CA 1RR6A 2C98A 2G0TA 4ECEA 5FL3A 3ANXA 4EFLA 3DP7A 5KU1A 3STVA 1OTXA 4LK2A 3REGA 3ENWA 2O5EA 1OQAA 4RU1A 1TMOA 2VP5A 4JXZA 3EE6A 1CLUA 1YJ5A 1MO4A 4R3UC 2ZJYA 3W1VA 2XMDA 1NMSA 1DBIA 4YONB 5EJ4A 1SK8A 1NN0A 2D1YA 5G4KB 2YY7A 4W82A 4HCJA 1GHTA 2WR8A 4BMPB 1PJ8A 2QP3A 2C7OA 1FTWA 1PDVA 2QU7A 2JBWA 1QMPA 2OCAA 3TLJA 1KGSA 2GYVA 3KTAA 1HE4A 5FTKA 3PZBA 1A2QA 2C96A 4BB0A 1P60A 1UBEA 2FF5A 4YIKA 1N5KA 3IBYA 3PQ6A 4ZU3A 2BVNA 1XOIA 2IU6A 4HNVA 1K0FA 1II8A 3NHPA 4D82A 1PDWA 5HK8A 5AW9A 2I6UA 3IKVA 1KNXA 3DFMA 3NW9A 3TMYA 1C7IA 1DBQA 1TUIA 3FGPA 3HB0A 3OLVA 4K2AA 4L5JA 4G1MB 4NYIR 3TZEA 1FZQA 1SAYA 4I8DA 4QDJA 1T2NA 1KK3A 3AVTA 4D3YA 2PUGA 1T5HX 1TA0A 2DMRA 3SVZA 2DFVA 2PLRA 5BO5A 3J7TA 1TYDE 5EYPB 2ISQA 4MKRA 4DM7A 1YA6A 5E1OA 4ND8B 1MAWA 3FKSD 4JLOA 4NH0A 5JS2A 3HLTA 5DHPA 5B7QA 5K0TA 3R41A 1NUQA 2GPAA 1N2CB 3L7DA 4GR9A 4DWWA 4YV0A 2YFYA 1JHQA 1KWGA 3VZQA 1JU4A 5JMWA 5B4TA 1XG5A 1KYVA 1NNUA 2YL2A 2VF4X 4IDNA 1S8NA 2E4YA 2ZBPA 1QWSA 1HLPA 3PHHA 2C9OA 3SE0A 3H6GA 4U7PB 1IC6A 4AJPA 2CBGA 2YV5A 4L8LA 3UV3A 3H1TA 2D4AA 4UNRA 1P1JA 4DLRA 4IJMA 5KX5B 5CCBA 4DV7B 5JVDA 1G64A 3NAQA 2B9EA 3D8RA 1T9ZA 3ZXUB 2FUNB 4ZGGA 3KJFA 1R0BA 4RHCA 2QTTA 2YJ6A 3QX7A 4PYLA 5H16A 3PC4A 3QLVA 1VBKA 2KM1A 2FFHA 2WTXA 1A88A 3CZ4A 5B1YA 5ICGA 2C7QA 2XGJA 1MABB 1PV1A 3F9IA 3G8AA 1UEIA 3HVIA 4WMLA 1O77A 2V3VA 2JAPA 4LJ6A 3PDHA 2ZT8A 1OXTA 3AGPA 1RAEA 3HEMA 3UCEA 2F1RA 3UWPA 1P4HA 4UEKA 2BD0A 2O07A 1WCIA 5FORA 3VFDA 3V1UA 1MFZA 2BJVA 3D5QA 1PF7E 3FDZB 1HI9A 1EHYA 3EGDA 4WX2B 1U7XA 3Q72A 3NIBA 3S8EA 2DFDA 3ZBPA 4G1EB 9LDBA 4BMSA 4MR8B 1YMUA 4E7PA 3OX2A 3DH0A 3GGOA 4MR7B 1LW6E 1HTWA 2PCLA 3LRXA 3P5SA 3Q2KA 4MW1A 3RVDA 3ENNA 3UOGA 2VQ3A 2Y1GA 3EDYA 4RTQA 1GNTA 2RG7A 1Y81A 3NRCA 3OFVA 4MEJA 4DA6A 2YN0A 4D3XA 5IKEA 5TDHA 5FOWA 5FOTA 1CLEA 2IDZA 5EE0A 1N2EA 3O6VA 5UKDA 1XX6A 4FTWA 1Y9AA 3CIFA 1G8MA 1J9GA 2H52A 1M3SA 4ZYTA 4MW6A 1G5RA 1DC5A 1L7BA 1WY7A 4YI5A 1ZCJA 1RJDA 2XDYA 4ZQEA 4KI7A 1C2YA 2B21A 3BL6A 3JRWA 3LF1A 1X1BA 1M1ZA 1NTRA 2WYUA 4A8JC 3MGGA 5CCEA 4K8OA 2WWIA 3V1MA 3GMIA 3MIIA 1RC8A 3EOBI 4GM1A 1CHDA 3E2IA 4J0JA 4QXOA 5JALA 2FWJA 2BMVA 4IIGA 4YRRA 1M8GA 2CVFA 3LRPA 2G8LA 1LVHA 1M73E 1TXGA 2J9RA 5FHQA 1H0KA 1RXYA 3RUDA 2EQAA 3V8BA 1ZY2A 1VL5A 1YJXA 2QRVA 1RYZA 4XCVA 5FF9A 1IEWA 2VNSA 2ZAGA 1PLLA 4OO3A 4S12A 2BFFA 1W0CA 5BNTA 2AN4A 1SCUA 4QYTA 3QFFA 1XE3A 2IS1A 3C8ZA 1MGPA 4F9EA 2Z1MA 4R68A 5I7SA 1BDJA 5GQSA 4F5WA 4FHGA 2XB6A 4AM8A 2YWXA 5CEJA 4YRMA 3QPCA 1QK5A 2KMLA 1AKUA 5C0OE 5CVCA 5ED4A 2XQJA 5CFPA 8LDHA 2ZI9A 5HZMA 3GRCA 1UIRA 2ZT5A 5FUVA 3VPXA 3N9IA 3WGNA 4MUFA 4QAJA 2GCNA 3GOQA 1RIFA 3AEXA 3PSAA 5LFAA 3H5LA 3GJZA 4NU5A 4KPEC 3O95A 1W49A 5COBA 4K0RA 1KAEA 4PTLA 5DN6A 2RE8A 4K6MA 1PVDA 2Q5FA 4OXNA 3A9SA 3L0ZA 2JBHA 1KR2A 4GOOD 1J70A 3BWXA 4BY9E 2IX9A 2OO3A 1KI9A 3L05A 4HLQB 3WLPA 2OMEA 4ND1A 5E3IA 4BMVA 4JEHA 4AS2A 1BH6A 1VMAA 3AL3A 1GSAA 3EMBA 1NVBA 2PU7A 3P26A 4GMGA 3OURA 2OKGA 1AN0A 3A6DA 3U7GA 4JENA 2EFHB 2XQFA 4OHZA 4HXFB 1EWTA 1BQ3A 2ZIXB 3MTEA 2HT1A 4I1RA 1E6WA 1N6IA 1I7DA 4YUZA 1E3MA 4ZVKA 1H1LA 2X7HA 4MW9A 3PXCX 4QPCA 2RHBA 2YHSA 3HK2A 3KT3A 2GM3A 2Z6AA 4IIVA 3M2TA 3JCZA 2YWEA 2FMKA 1C7ZA 5JFGA 1YL7A 3RKUA 5ESWA 1XVLA 2ZCVA 3GFRA 2GZHA 3IAEA 4LISA 4NFLA 4ZVRA 1VRWA 1CSEE 3GT0A 1R3DA 3OO1A 3HR8A 2G88A 3IVMA 4OMUA 4N54A 4FOTA 2ZUTA 4IH1A 1SWWA 3EB9A 4IIDA 4FMBB 4XYEA 4OXKA 1U0LA 4YNBA 2NX2A 4E6PA 3DV9A 3CLHA 3EZ2A 3RAEC 4O29A 3ODPA 2XWSA 1RYEA 3RJMA 1ZK1A 2A9VA 1YCDA 5DLDA 3EQZA 3TUZC 3VU0A 3WKBA 3IUEA 3G7UA 1MP0A 1P31A 2H9AA 2W58A 2WWFA 2QPLA 3UMSA 3P0EA 1AG9A 3VV3A 2XOKD 3PRJA 4NCBA 2VDUE 1NM5C 4ZC1A 1GAEO 2XVMA 2R1TA 3FUVA 3NV7A 4IW3B 2O5CA 3EOZA 2P65A 4D26A 4CLXA 4RQAA 1V7CA 3TFQA 1Z37A 1WDWB 4AP5A 1AZWA 3SDSA 1UKCA 5A5EA 4DNPA 1FP2A 3LBNA 2HA7A 4LXHA 1Z28A 4ND2A 3T52A 3TOSA 2PUBA 3CKYA 1RWQA 4NFHA 4JLAA 2QW1A 1KI6B 2QRZA 4RK6A 1FS6A 4BEVA 1SZPA 1DJPA 1F4LA 1OPXA 4RCYA 1GDDA 1IYZA 1OE0A 3ME5A 5J4YA 1NPYA 2P2DA 1R9JA 2W43A 3G89A 3ESBA 4E4YA 4C7OA 1TQDA 3SC6A 3BWDD 1GTRA 1YBHA 1JZQA 1X2BA 4ND5A 4NNPA 2J6BA 1N5OX 1ZMTA 2Q9CA 2ZSUA 2W93A 2POCA 1LA2A 3TG2A 3IFSA 3GRRA 3E2PA 5B30A 1F6BA 1LVGA 2X0KA 2WD9A 4UARA 1HK7A 5C81A 1KK2A 1M2KA 3E22B 3JQCA 5CA0A 3B1XA 3EY9A 2WSBA 2JVKA 3Q6NA 1YKSA 4RD6A 3GNQA 2RBEA 3IAUA 2QV0A 5HFJA 5LKAA 3BL8A 2NU8B 3COJA 1MEEA 4S1NA 5TLSA 1UDBA 1NVKA 3FJ1A 5MFZA 5T64A 5AQEA 2OY0A 4G86A 1NLMA 3F98A 2QJWA 2JRCA 3MJCA 4IOMA 4N5LA 2GXAA 3D8NA 2QR5A 4EPVA 3QTTA 3R4CA 1FU4A 1CYDA 3KEQA 3C5VA 1UJNA 2BLLA 2RGNC 4FHZA 4C78A 2Q6VA 2BZ1A 3NUZA 1RZRD 3GBSA 2FDXA 3IQGX 4ZANA 2E48A 5KBYA 1KY4A 4XQCA 2H7VA 3DUFA 2B98A 4B40A 4CCYA 3LGAA 1TYEB 4BDTA 1WO8A 4KYUA 4BNWA 4QRDA 4KKXB 4XQ9A 4MUJA 3KQVA 4JLDA 2J3JA 1E64A 2H2IA 2YNMC 4M6WA 1FQKA 2XYPA 1BWRA 1Q21A 2SKDA 2AG1A 2EX4A 1J8MF 3JAKA 4JBWA 2H2HA 2ISCA 4H9GA 3GHYA 1U0FA 4IKOA 4YJGB 5TF4A 3C97A 1TQ2A 2R66A 4AZ0A 3TIIA 4XVQA 4DCGA 1UCFA 3CEMA 4HQNA 1JDPA 4NHEA 4NG5A 4RPCA 4UBLA 3T9EA 5BV0A 2DSTA 1GL9B 3AUAA 3T5TA 1N3YA 1T1RA 1T3SA 2IUEA 2JBAB 4KWEA 4R51A 1NOIA 4H31A 4ZQBA 1PK7A 3VPSA 1UBFA 3UAGA 5LD2C 2G06A 4RV4A 3DTNA 3JALB 4PBRA 4IIJA 1WNFA 2XRYA 2FPKA 4D80A 5LWQA 3RVMA 3LKDA 4R8KA 3T7DA 2G17A 4TPKA 3TDKA 1L1FA 4MQBA 3ZX5A 2D1FA 2QWXA 3A9RA 3C2QA 5TARA 4QG3A 3WGIA 4NR0A 2B69A 4I5DA 4H16A 3L92A 1RTKA 3TR6A 1TM4E 1K3FA 2W2LD 2WQ6A 4HN2A 4JP3A 3MLBA 3AOEC 3ZLVA 4B31A 4BNVA 2Q27A 3GFPA 1G21B 4ZPXA 1QKIA 3SZ3A 4ARZA 1P6XA 2OGUA 2I3GA 3WLHA 4EJMA 1C0PA 5K5EA 3CVUA 1FLAA 1ZK3A 1DX9A 1NOJA 1T15A 4CEHB 3WIUA 3HABA 1WUTA 4MTCA 2PVSA 2WABA 3OAAD 3DZCA 2W6CX 3EC2A 3GZNA 3PR1A 2RHHA 1SKQA 1N57A 3SX4A 4EO9A 5KPJA 2ZULA 5JJBA 1S2LA 3Q7QA 2EL7A 2C5BA 3TBFA 4DJTA 4YAFA 4MKXA 3AL2A 3RR2A 3STUA 1E9SA 1D04A 1AVTA 2HUPA 3RJ5A 5BUSA 1PBNA 2X23A 5ICSA 3GLIE 3EEOA 4G0QA 1KXJA 1ADYA 2UZ1A 2CK3A 1XMJA 2R1VA 3WJ2A 4OP2A 2CBXA 1BC5A 1JVBA 2X9LA 4TQAA 2EZ8A 3DOIA 4N7JA 3P96A 2C8LA 4LMPA 4X41A 1I2DA 2UV8A 5CR9A 2P5YA 1M2OB 1BWPA 3ZDAA 1ZI9A 3D59A 3ONFA 4RK0A 2QVZX 5CX4A 4WOBA 1ZO8A 3SS9X 3SQXA 1Z6AA 1QORA 1P7CA 3PI6A 2BKXA 4HP8A 4BEJA 4WY8A 2LR0A 4KMMA 4OQMA 1Y1TA 4KFCA 3B9QA 1QQTA 1X38A 2QW0X 1CZHA 1V5EA 3UMYA 5JBIA 4XWTA 2RI6A 3D5EA 1UL1X 2L69A 5CLJA 3ZHRA 5KIAA 1II8B 4I3FA 1E63A 1EPUA 2YMPA 2P6RA 4HC4A 4I1OA 3TBKA 4BNFA 1E18A 4C01A 4D4KA 4OSEA 1ZZEA 4G8BA 4QSMA 5C1BA 3M34A 4FUQA 3ES9A 3MT9A 1MV8A 1T13A 1XVVA 2GESA 3HG7A 2JIRA 3KVVA 3RV4A 1YJ8A 1CNFA 2X8WA 4E2XA 1NW4A 3LXMA 2GZ1A 4MO2A 3UW1A 3ZD6A 1P5HA 3GIWA 5AI6A 1FW6A 5FFMA 2JFHA 4J1TA 3F97A 1JIIA 1P1BA 2ORWA 2Q2OA 1C8BA 1H65A 3B8HA 4EYKA 4H6WA 1Z18A 4HEA1 2ZI4A 1ZMRA 2Y6UA 3LOUA 2WIKA 3KB2A 3IUQA 1WCXA 4KQHA 1EEXB 2VSYA 2IXGA 4GVXA 4NLLA 4IFBA 1U7OA 1N1EA 3CZ5A 5LL6P 4KNYA 4GGOA 5EKXA 1JKXA 2VLIA 3G88A 4M76B 4PC2A 5K03A 1ZINA 1SHKA 4UASA 4EMUA 4RJLA 3N58A 4X90A 4LX8A 2HLHA 1B16A 1M0WA 3MGCA 5TQ0B 1YB2A 1BA3A 3ROTA 4R9RA 3BB1A 5AMXA 1A82A 1Q1AA 5DWDA 4MRSA 5HMMA 1U1DA 3JQ8A 3OCUA 4TZKA 1UADA 1L5RA 3PVZA 3OPYB 4IV0A 5FOQA 3NEPX 2IBTA 2ACEA 2BFDB 3FR8A 1N8KA 2R1TB 5GOTA 1PFKA 2RI0A 3BQ9A 4D8XA 1XEWY 3RVNA 1O1YA 4CL2A 1NUAA 3H9BA 1LPPA 4JDPA 4GOXA 3IIEA 4TL7A 3ANNA 1VSQA 2PEYA 1NZJA 2OK8A 1G4AE 4Q9IA 3O75A 1U2DC 5EG5A 4MK4A 4DY4A 4ZMRA 5C32A 1PZMA 3VZCA 3IVCA 1CQPA 2D62A 5HKOA 1KI6A 1IDN1 4NDZA 2B7BA 4RW0A 3GYBA 4EB6A 5K4GA 4MMZB 4EVIA 1HDGO 5FA5A 1LDMA 1HSZA 4NXNB 2EWWA 3VBEA 4DABA 1YI8A 1V71A 4MUMA 1I8TA 3OEED 3VDRA 2GN2A 2HHLA 3BKWA 2VI5A 1G17A 3OTGA 3K4HA 1UFVA 3MXOA 3SICE 2C0QA 4EBBA 4R81A 4LRSB 3F5QA 1VKRA 4DNXA 3E0QA 1K9VF 3FBTA 2QVGA 1JB9A 3DF7A 4A92A 4J94A 4H3VA 1GA1A 3P20A 1WVMA 2FY8A 1Y4ZA 4BFLA 1DIOB 4JJ6A 4GFDA 1VIDA 1Q77A 4MKFA 2EZ9A 3O8QA 4YRTA 2QJOA 3ANMA 1YKGA 2C5SA 3HACA 1D2CA 2R85A 1E92A 3ORRA 4TTRA 3GLIB 3INTA 4OXXA 1T6NA 1QHGA 1QS0B 4JQOA 2D4HA 3DEJA 4GLFA 4A6XA 5ABPA 1BQ4A 4YRZA 1EIWA 4OP3A 4HDKA 4Q3LA 3HS3A 1KHHA 4MVJG 3BMNA 3NBAA 2HNAA 1E79D 4M89A 1KDVA 3V3KA 2KBFA 5JATA 3T3GA 2JHFA 4QOJA 4YJ2F 3CVJA 1MEJA 2QXUA 1BKSB 2H2WA 3R77A 1NBIA 1R0SA 3LOPA 4RDCA 4BLRA 2PX3A 2AUMA 3M83A 4WA7A 2YQ5A 4Q9KA 5E0KB 2ZBFA 5LP6A 1RQNA 3C7AA 1DWQA 2OCPA 4ZQIA 4W5JA 1BMDA 1T4DA 4LMRA 2XNDA 5B1HA 5CB6A 5FA6A 4AFNA 3MMNA 3WDKA 4MXDA 3LYHA 3W2TA 1EBFA 3DEIA 3H05A 1U7TA 3BK7A 4PAGA 2BI4A 5CH3A 1LTQA 1U31A 3DBVO 4WJKB 4AMZA 4E30A 3KYCA 1RZ3A 4KGXA 3HB9A 4R2KA 3AT1A 4EW3A 1SUFA 3VYSB 2H54A 3GFGA 3H8VA 2ASEA 3U3JA 2QT1A 2CN1A 3HBAA 3RV3A 2HJRA 4WCDA 3J81A 3F3YA 3PNOA 3N0XA 3ZVKA 3DEFA 3DKRA 2VL7A 2P4EA 4G3XA 4XI9A 1ONSA 1WPRA 4Q5IA 1N25A 4IZOA 4UDYX 4F7DA 3C74A 821PA 2AUTA 1JPUA 1PSDA 3EMKA 4II2A 1YS2X 4TS4A 3IJPA 4Q21A 3K6RA 3PB3A 5E6RB 4D43A 4MWBA 3WLNA 1PGPA 3HVHA 3OH8A 4F06A 2PMKA 4D42A 4CTNA 4GQBA 3OUUA 4FC7A 2ZCUA 1YV9A 2PMBA 5AVRA 2NZWA 3OBBA 2X6QA 1SHJA 3NEJA 3ISJA 2B99A 1OR8A 3PUKA 4LRYA 3PDJA 1J23A 4AO8A 1Y42X 1UPAA 2VHEA 2QD2A 4AYWA 3C4JA 3KT0A 3PUJA 2FPUA 2FWBA 4DCPA 1DADA 5L3VA 1O95A 2JAQA 1KMMA 3AXSA 3FZNA 2AG0A 2ZB7A 4RVDA 3T0GA 4DVJA 4YRLA 2IZOA 2ATIA 1P73A 2HIGA 1PYOA 2VR1A 4XFKA 1ZOSA 3PC3A 3HSSA 1OGYA 2H18A 4Q00A 5EJMA 1XWFA 2UYHA 1E2KA 4NVRA 3GHHA 2ZCJA 2MU1A 2NNLD 2JIBA 2QTCA 3ZWMA 1ONPA 4RANA 3OTOB 4DL9A 3RFUA 4DR3B 16PKA 1PD1A 3LPNA 4B48A 3LLCA 5SYMA 4BMDA 3R5JA 3OFJA 3ZZTA 5KQGA 1Z5OA 2WJ6A 3BZWA 1DAGA 3I23A 3TZLA 1CVLA 4FDVA 1Z5ZA 1VE1A 2PL5A 5JU6A 4QBHA 4UXIA 4WOJA 1YRBA 1Q6YA 5E7QA 1AU9A 1DX4A 1U3UA 3HADA 2QE7D 5HDBB 3NTOA 2CLOB 3ELWA 1V8DA 1ZJJA 3NOOA 4OOFA 3OOWA 1JW9B 1T0JB 3H5OA 3LCMA 4GQAA 2YDYA 1A9OA 1JG4A 2XKJE 1C7QA 1GL7A 4UM9B 4ZOAA 4C0BA 1FVXA 5AUQA 4E94A 5G3YA 3DYIA 4NV0A 4RENA 2ZE8A 4C3OB 3JRNA 1JR6A 3HHPA 4H15A 1BX1A 2MIIA 3D4OA 1L4NA 1B14A 1KJ9A 3C3PA 2J0UA 3Q7PA 4HPWA 1WIWA 2FPXA 5TB5A 4EEXA 4TKVA 3Q8MA 1PZGA 2DVMA 3VH3A 5K45A 3DPSA 1ZGAA 2ODAA 2RAPA 1EZZA 3HFJA 3ONWA 4PSKA 3GPLA 2TS1A 2RD2A 4H0CA 2IODA 1W0JA 1D7OA 2WKPA 5KHLB 4EL5A 1USVA 5BR1A 2YFQA 2ZG6A 4TV9A 1KI1A 1L0BA 3CF4A 3BJMA 2N75A 1DB3A 3EWNA 2WNIA 5LZ9A 1K8RA 4N0EA 1FTSA 5NLLA 2QTFA 4ALNA 4JB2A 3DXFA 3BF7A 2DFPA 4F71A 1PVOA 4X6XA 2OVBA 3X2EA 4PX9A 3QFSA 3C4VA 4P31A 4RLSA 4TSKA 1ZJYA 1OV6A 3DAHA 1Z0DA 2W6IA 2RGCA 1ISFA 3PUHA 1ZX1A 2GOYA 4MAAA 4OAOA 1FTNA 3ENVA 1P0FA 3SC2A 2E4WA 9GPBA 3G2OA 1TO1E 3PE3A 3B6MA 2J3EA 1MCZA 1R1DA 4RF4A 2VT2A 2NU7B 4CNBA 1WQ1R 1VJ0A 3SOZA 2GS9A 1Z17A 4QYIB 3DDCA 5FL7D 3R6DA 4L02A 3IR7A 4OP1A 3P9ZA 3MINB 4MMYB 5CMLA 1QO7A 3LDGA 2AZDA 1DAIA 4A6EA 4DXDA 4J0CA 4MQFA 4RFVA 1LNQA 2HZ7A 3FSEA 2GLXA 1O9GA 3I92A 5CJPA 5ALGA 2BI7A 3LCVB 5F4ZA 1P44A 3NORA 1JAHA 1L4BA 1O4VA 2XE6A 1JG7A 1NVMB 5B58C 4H0NA 5KNBD 1ZCFA 3ZCQA 2B36A 3TDNA 2A86A 1AKEA 4S2UA 5D5PA 3KSAC 4AJJA 2PXXA 1W5EA 5JRDS 3IP3A 4V0ME 3G2IA 4CIXA 4HPJB 4YCNA 1L7QA 3JASB 3PC6A 3U7QA 5KNBH 3FF4A 1FS5A 2VF8A 1IWPB 1EVJA 1O6FA 1RWMA 3OHMA 3DHWC 4QOIA 1JYSA 1AUQA 2G7ZA 1J8VA 4GKAA 4YALA 1U8YA 3QTLA 2BE7A 5FWXA 2CMFA 4L6AA 2J3IA 5KCMA 4WLEA 3UJ8A 2Y3IA 3KYIB 5BN5A 1NJ2A 2Q6KA 4G41A 1RAFA 5ECDA 3SEFA 5TEWA 4ZHQB 2QTVB 2GZ2A 3EGOA 3MRVA 4MAFA 4Q3EA 4EW6A 4FBMA 4IH9A 2WA1A 2HW8A 1JJFA 2Q4EA 1R4MB 5BNZA 3TS1A 2RGGA 4CQMA 1ZC4A 5E2BA 5LUBA 3NMUF 1RPAA 4MVWA 1UFOA 2RGAA 5ALTA 2I0FA 4X3CA 3L0PA 2B6NA 1KO4A 2QTLA 2FN8A 3SXJA 3VJKA 2W2NA 2M6SA 5FLYA 2VNKA 4CQLB 1QLHA 3GDHA 1LF5A 1DXYA 3ETNA 2WFMA 3R40A 4LRXA 4YBZA 1SBHA 3TOVA 5BVGB 1GU1A 4GI5A 2FSUA 1PHRA 4PXYA 3RRNA 2CCGA 2YQZA 3BE4A 3TSOA 1CJUC 2ZSIA 5AW1A 5JAIA 4WH0A 3QW4B 2GBLA 4TTIA 4WTOA 3A9VA 5AO9A 1D4FA 1C7RA 1D6MA 1G7SA 1IBSA 1OX5A 1V43A 1ZK0A 4ILKA 4BCCA 1V45E 4F4IA 2IXEA 5JECA 1P3DA 1Z06A 3HL0A 3E9ZA 3IX7A 4Z4FA 4R1MA 3NETA 3ILYA 5B1EA 1CQXA 3CM0A 2XXBA 3RK1A 1GYPA 4AWBA 1K5HA 2G9QA 3I5YA 3H0CA 3QPAA 3EVCA 4IM7A 4F4JA 2QZ9A 3A11A 3IEIA 3JXEA 4DA0A 1T9HA 2M98A 2COKA 3PGLA 4HF7A 4RABA 2VXOA 3AC0A 5B1IA 3O9ZA 4RE6A 1D8AA 2JLRA 1J0EA 4IDDA 4YMGA 5IJ9A 1PL0A 4E2FA 4UCFA 1XTJA 4BEBA 1BE0A 2PLAA 3EGVA 4LN1A 3GLQA 2L19A 4QT0A 2PD4A 4LYYA 1S2DA 2HA0A 1OI4A 2E5WA 2HA5A 3F3SA 4G5SA 4MO9A 2MR6A 4P4LA 4ZOLA 5L3SB 1IJBA 2OYSA 4PFQA 1I4WA 2SHKA 4C7JA 1MU0A 3EGXA 3PEYA 1YVDA 3KEOA 1L5VA 1F2TB 1G8JA 2XGSA 2GEKA 3V9AA 1KXZA 3TL3A 4JSTA 2ZSFA 5FLEX 3GL9A 3OFNA 4NCIA 2IYRA 3T7EA 4LC9A 3FNEA 5EJ6A 3QPUA 2VJAA 3FOZA 1XFDA 4ZFNA 4I9UA 4JP1A 4HOYA 5B3AA 3LQ4A 5DEIA 4FYPA 2WA2A 1C80A 1NC3A 1ZKDA 3QQ5A 3WI7A 2DSNA 3E8MA 2BCGY 4V3CA 4ZVSA 4AW9A 3GJ7A 1G3IA 5HG0A 2GLTA 4CDRA 1I5OA 5COAA 4MUEA 2DHQA 2Y1LA 4WKBA 2FDRA 3OZGA 2AKYA 2QZSA 1GUAA 1PWEA 3L9XA 4WFJA 4CPDA 1JFFB 3AR2A 4CTKA 4WBNB 3KVOA 4CCSA 4GGMX 2V8OA 1ZR2A 1XALA 3SEAA 1MJNA 4AZWA 3DLPX 4B0PA 1Q95A 3CSSA 3OCXA 4WKCA 4BV3A 1TTQB 3DLAA 3TOZA 4Z6KA 1W2GA 5TPWA 1YRHA 2AE2A 4U2CA 1RBQA 3A6JA 3UMJA 3EQ8A 5IF3A 2OAEA 5IKPA 3NGMA 2BEVA 3WK7A 4ASUA 5BWCA 1HYQA 1H6CA 1Q0QA 3B51X 4HBGA 4CR8A 2QGNA 2FRXA 3VYTB 5K0EA 1SBTA 5DISB 4R8SA 4ZP1A 3KHUA 5F7JA 5KOHB 1F2VA 1ABBA 1JU3A 5EIEA 3BHIA 2IU3A 3AESA 4P98A 1TF5A 3BZBA 4XPIA 5DTRA 3TEMA 2WMOB 3UT5B 1F3LA 4BNDA 4CF3A 5K3FA 3DL2A 1BCSA 2IYNA 5FNVF 2IT1A 2JAUA 1JMKC 2FA9A 2H9IA 1EFAA 4RGYA 2J0UB 2ZOSA 5IULC 3LP6A 3CF2A 2PL9A 1W35A 3PHBE 4HQ6A 4HRAA 4Q18A 2C7RA 2ERXA 1QHFA 1N2CA 3ORYA 3PFCA 5CT5A 3LE8A 3FPHA 1W75A 4YDSA 2AUNA 5CDSA 3HUTA 3UEOA 1OC4A 2GYUA 2HNKA 1HX7A 3MM4A 2F3QA 2VUHB 3DDOA 1TEXA 3HWWA 4G23A 1RWWA 2DF8A 1IXSB 2XA2A 4MIOA 4BNTA 5KX5A 4LTDA 4E0BA 4MHTA 1GPLA 1WCYA 1XZIA 5ESXA 5I7RA 4ZICA 1ZONA 5DNEA 2PSDA 4DIBA 3DNPA 3HDQA 1OXXK 2XD9A 3GBPA 5FB3A 5LXTF 3OPNA 1YBAA 4L16A 1Z4LA 3SIRA 3ZXYA 2IZZA 2GM4A 4C4OA 4W9MC 1AS0A 3EFOA 1SMKA 1DQYA 3HZRA 3KR1A 1JQBA 4YLEA 5H68A 2G9NA 2HXSA 3LLVA 1XPUA 2IYYA 1GAXA 1KEEB 3D02A 1O54A 3OSZA 2C7BA 2PK3A 1FUKA 4XB2A 4EITA 3VAYA 4JLUA 4WKOA 3NC4A 4L27A 1R9NA 2C97A 1ZJ4A 1CQWA 5FPPA 1ONNA 2VK2A 5H0IA 5BN1A 3L7KA 4II3A 3PC8C 4ZTZB 2JANA 3ZWQA 1E62A 1U1EA 3NC1C 1KMNA 2CNKA 1D7AA 2ZTVA 4RZ2A 5JCZA 2V55B 5JADA 1KC3A 4QQFA 1JJAA 3AR9A 1F1JA 1LBSA 3WTBA 3BSSA 5KJCA 3NTLA 2NM0A 4M0UA 4MP3A 4OY3A 2ZZMA 2GSWA 5EN4A 1TM7E 4UAGA 3HP1A 4DHWA 3IV9A 5DRYA 1GPKA 2O2XA 1RXSA 5TR9A 3IO3A 3HNOA 3WL8A 5KVVA 1P7YA 3P4XA 4MVJF 2OD2A 2PR7A 5KQRA 1K6JA 3CB2A 3QIAA 5E6SA 4UNIA 3EXHA 4BGUA 3NR2A 4ROSA 2HMUA 1PNVA 5FULA 1WDTA 3OZIA 3KUUA 1E6KA 2HA6A 1P2TA 1H23A 5IH7A 3K8YA 2FEWB 3RSCA 3ZJUA 1O3YA 2O23A 4N6NA 4BL5A 2A59A 2QN7A 2DJ5A 3B85A 3EEBA 4XVUA 1ZGGA 4UDNA 3LUJA 1U4SA 2B92A 2W8ZA 1UP7A 5GONA 4G0WA 5BSGA 1BG6A 1V3VA 1VMDA 2KSQA 3SD7A 4UEWA 1RQGA 4H77A 5JNSA 4N1AA 2FCRA 1FUYB 4DBLE 1QGOA 5CFMA 4DHEA 1XMPA 4CLRA 2JFBA 5B7PA 4F9FA 1U2SA 2BR5A 3DNFA 3K31A 2DJIA 4MIYA 4TRNA 5LA6F 4QVIA 4EP1A 4W5TA 1RWOA 3LCJA 2HU5A 3P19A 4D97A 1XTBA 1UJ5A 2Z4RA 4AY2A 2H08A 5DJ5A 1M75A 4G0ZA 3U1TA 2V7PA 2IRWA 5TVKA 3LMKA 4XE5A 1QVWA 2QUIA 3H3FA 4UCXA 3M89A 1GZ6A 4ZAVA 4UJ3A 2I66A 3O93A 5AVKA 4B6EA 4RADA 1PQWA 3QMVA 4YEDA 1I32A 2NYVA 3REQA 2Y2VA 3GDOA 3SBDA 2WAXA 3L79A 4CMGA 2ZAIA 3UMMA 4Q7JB 4UQLA 4MV5A 1GXSB 2PSJA 2C2YA 4H7DA 2ES4A 4KFUA 4DLWA 5LMUB 5AESA 2V9CA 1E2GA 5IDQA 1NVFA 1SN7A 2OCKA 4C20A 3HKBA 2CHFA 1DQSA 5F9FA 4IFIA 2Q2QA 4KIUA 3F7MA 3HN7A 4Y0VA 1ATIA 2PS0A 5D3MB 3RQIA 3A9WA 3D0RA 1OH5A 3ANYB 3PL1A 3S6JA 4GBED 1B6GA 4NBWA 2B37A 3IP8A 3LI2A 5A7GA 1H5UA 1SIOA 4UMEA 4LJAA 1N5MA 1UBUS 2ANBA 2QUJA 5IAKA 3SQLA 2XB4A 5F76A 4P6VF 1G3UA 1PFVA 5CLGA 1V16A 4PZEA 4ZVLA 2YWFA 1GTSA 3EXFA 4IQ0A 4JP8A 4QXAA 4TL9A 1F2UB 4XIIA 1GGNA 2QI9C 2WZCA 3MS2A 4PS0A 5ALOA 4AG6A 1UH5A 2FSHA 3BHJA 1N5DA 1I7LA 3EAQA 1XZJA 2ZIXA 4W1QA 5K0BA 3W5AA 1P7WA 1NW6A 4MTLA 2ZKIA 3UT6A 1W93A 5GJVC 1CRQA 3GG9A 1Z5WA 3LF2A 4A0HA 5A4JA 4OX9Y 2FZGA 2YJ4A 4D4JA 2WLTA 2YFHA 5IJZA 4I4TA 2VXCA 3LFTA 1DWPA 2E0IA 2BP7A 2PKWA 1X7WA 3WLEA 1GJRA 3FZYA 4P58A 4OJMX 3F6SA 3NIFB 4YRBA 4HVLA 1JEQA 2FZ5A 1J2UA 3E9CA 1YJQA 1LBHA 1XRSB 1ZNYA 2R79A 5FI0B 3ZJYA 3ZS9A 4BUZA 2A92A 2X3FA 1K2VN 2I22A 4X20B 3ZNQA 2J59A 3TL6A 3WLLA 2PZAA 4XQEA 3VKWA 3TKLA 4CG3A 3MZ0A 5HM8A 1JMVA 4IDPA 4LCBA 5DO9A 5AM1A 1QIHA 1TZCA 3Q9LA 4I46A 3MWGA 2HXGA 3VZBA 1NNSA 1M2VB 1ORWA 2E4VA 1IHOA 1F6WA 2YX1A 2ZJ3A 3R4VA 4K3VA 4EI9A 5H02A 1QUEA 1HF3A 3E48A 4MVJP 1Y6JA 4HNAB 4DYDA 1CPYA 4HDMB 3AQ4A 2UZ4A 3DGFC 1AM4D 3ESAA 3GJTA 2XGOA 1FCJA 1FRVA 1QDEA 2FPPB 1QJCA 1X74A 1WV0A 1C5KA 2XIJA 4FQ7A 3L8GA 1E2FA 4N3CA 5F9HA 1N1GA 1BCRB 2VJCA 4J0IA 1MQAA 1XCBA 2BGRA 3B82A 4IJ5A 1SOAA 4NDNE 4OKIA 2HQOA 5K01A 4U1RA 3A6KA 5IVKA 4KE8A 3DGEC 2PO5A 1JAYA 4MRPA 4WQMA 2Q4RA 1P45A 1L3CA 4LBVA 5JW6A 3BIFA 4IIXA 3SR0A 5KYXA 4EA9A 1A9PA 3FDFA 4I8XA 3F4LA 4G4JA 4L4ZA 1E9VA 2F7SA 2GJ4A 4IP0A 4J49A 5JXIA 1JEAA 3QVTA 3ITEA 3SLRA 1PJTA 2QB5A 5NULA 5K2MA 1NVEA 5JHHB 2HPAA 1H2EA 1RCFA 2O1WA 1GLGA 3FTCA 3RLIA 1WXHA 3H11A 4LTMA 2G72A 4D8TA 2E9SA 4CIAA 2JLVA 2DB3A 3N70A 3OE5A 1VGQA 1PQPA 2D3WA 3RI3A 5K6AA 1TFUA 2CJYA 2AT1A 5C46F 2J9FA 2BFCB 2ZUWA 4B2LA 1N0HA 1QGZA 3NWPA 2OMKA 4DJFC 1U9JA 1XRQA 4JVOA 3S1AB 4FR5A 4MKHA 4ZRMA 1UMDB 4UW9A 5T8KA 3ID6C 4LCJA 4CN9A 4X8LA 1ZK2A 1JAZA 1WBJB 2EZUA 2PDAA 3R5TA 3R74A 1RXVA 3EZ9A 4D46A 3T15A 5ILGA 4L57A 5ICFA 4OU5A 1CJVC 4NPCA 1CJTC 5CDFE 1HZZC 1SJ9A 3K6KA 3HY3A 2HD4A 1NBMD 4YIHA 4JLVA 5C8YA 3IOCA 4NYMR 4Q16A 4V0MA 2L2QA 4ZK2A 1KP3A 5DGCA 3WWOA 4Z7OB 1YAHA 2QN2A 2Q3EA 4D9GA 1Z15A 4US2R 3FUWA 1RXCA 1YULA 4JL5A 4XEUA 4F3NA 2I2AA 4D9CA 3HCPA 4X6UA 2W00A 2B1IA 1NYRA 3D31A 3GEMA 3K05A 2QU8A 3OESA 3UV6A 3LXUX 4V02A 1RE0A 1JR3E 3I5AA 1M10A 3FMIA 3NHFA 4K0KB 4Y3UA 3WKEA 3T0IA 5J2TF 1O5OA 1LLFA 2OYRA 4Z0NA 5HGXA 4Y6QA 3OCJA 1Y6QA 2A5GA 2WW8A 2ZXFA 3EQ9A 3QVUA 1M6YA 1ESZA 1H2ZA 3TSWA 4OA5A 2VHZA 2QBYB 2P6PA 3MTAA 4CI0B 4HNHA 2MMCA 4O2BB 4LQLA 4RJIA 1Y7PA 2NUAA 1PKXA 1AKTA 1MB0A 2Z2KA 1Z5NA 3G2PA 1FRFS 3LQFA 2H92A 4LUCA 4NOJA 1S9HA 4OIMA 4GYYA 1H1LB 4RHTA 5EQFA 1G60A 3E7FA 4B33A 1LV7A 1RM4A 1W6UA 1WEHA 1X1SA 3A1FA 3KQYA 4O4IF 7GPBA 5K6AC 5LMNB 4CGZA 3RHFA 3EPKA 2I5PO 3N0WA 2DULA 2MSLA 2HGZA 1DG1G 4YAUA 1T2EA 1TO2E 3AYXB 4TYMA 1I14A 5AIAA 4YMVA 3F73A 3EXAA 4O02B 1CEYA 4O4LB 2RGXA 3LBHA 1MB9A 4O2AF 5CB0A 5BN4A 2GN9A 4UPDA 4YP5A 5A03A 5BT9A 1NKTA 1RJWA 4WNIA 4WZAA 4YPOA 3HLKA 1L7XA 5KOJA 2DQYA 2QGFA 4E5SA 4D7AA 2QMHA 2AFIE 2GGSA 2PUDA 3HRIA 5CITA 1YZQA 5AICA 3EA5A 2XAAA 1RXEA 1OU0A 3PWTA 1GDHA 2FV8A 3AHEA 2XNKA 4AZSA 3CLVA 5HKKD 5I4IA 4DF3A 3QUSA 2COUA 1F12A 2AFRA 2PRJA 4REQB 4B5LA 2UYCA 1QO0A 2CKDA 1ISRA 1X1QA 5T3UA 3VSBA 1TVKB 4NBLA 1JS1X 3KVRA 1KJNA 4DG5A 3OE7D 1NX6A 1T36B 1VLMA 5REQB 2XY4A 1JDTA 5FPKA 2ZS7A 3HJNA 4YYEA 4GYWA 1RTTA 2ZR9A 3OPMA 4FFWA 2EARA 5FADA 3RC1A 4H27A 3V48A 1VYUA 1FJGB 1L7RA 2C1ZA 2OBXA 2VLBA 3NT5A 4GKKB 1NR1A 2YR0A 3CT6A 3DHEA 1H5NA 5GGYA 3IEMA 2I34A 2PX2A 3MWEB 1TK2A 3JS5A 4IJVA 4C4RA 2WYIA 3KJGA 1COZA 2VNJA 4ND4A 1GYRA 1HKUA 2ZYIA 2BT4A 4FX2A 3S5JA 1JIXA 1EFHA 5EP3A 4CKYA 1KZYC 1QG2A 3W6ZA 3W4KA 3E1GA 3KYDA 1BDMA 1SIUA 2DCMA 3T3IA 3VOTA 4EY3A 5I9IA 1DMRA 4JJKA 2IYAA 4PZUA 3QM1A 2IXFA 4TLDA 3LTNC 3K0BA 4B4KA 1BKDR 1H2HA 5IJAA 3THXA 2PBRA 4RNCA 1Z7BA 3ZWKA 1S2IA 1SHTX 2DOKA 2FXVA 1R5NA 1AS2A 1BVRA 2JJ2D 1QCZA 5DBOA 4QLBA 5HJ2A 4EWLA 1KK0A 1ST2A 1IUKA 2I2XB 5HF5A 3UXHA 3HHEA 1HYEA 3M1IA 2FJ0A 5I47A 3U80A 2XBLA 3VSDA 4PTZA 2CEAA 1PX0A 2SNIE 4GC5A 1C3JA 2WT9A 2PBFA 5I9LA 3VQTA 4UAVA 1UQTA 3BRWA 3OA2A 1THMA 5EEHA 1J2EA 4F5ZA 1WKVA 3G3EA 5F33A 4PN3A 4K6HA 1Y3HA 4P32A 1N7IA 1M8PA 3PEUA 5DNUA 1U0BB 2XUFA 4YJGA 1OBHA 1RVDA 2X4DA 2XX3A 3C1AA 3QEMB 3ZE1B 3U17A 4F21A 5A1JA 1U3TA 2C3YA 2I33A 2PGJA 4B73A 5A05A 3WNVA 3BTVA 1DC6A 2ZB2A 3BA6A 1VJCA 1VHDA 2WM8A 3DZJA 2QX4A 2NXJA 2D3TA 2EU8A 3T7SA 1I1HA 1OCEA 3SFTA 3ZYZA 4YQYA 3AO0B 3LD9A 3O1IC 1RKVA 4KVFA 4H7IA 2HV8A 2BH2A 4OA8A 1IHXA 2CZCA 4KXFB 1JIQA 1MC5A 2AC7A 1GN8A 3TCXB 3M6XA 3QLJA 1Q11A 1VG8A 3EBOA 2QLTA 2PVCA 2XVXA 1IJEA 2I7TA 4M9QA 2R6FA 1GZDA 3SIPA 4N0MA 3ND7A 3GLRA 2Q99A 4P5DA 5F51A 3O92A 2H3HA 3O3MB 3UOWA 1Y7TA 1JG1A 3OJCA 3TLZA 5KSZA 3I2YX 2PFGA 1GQOA 4K5QA 4XZ3A 3MK31 3R1IA 4BLPA 5K05A 3UHFA 4LBWA 3PTAA 3FNBA 2CFSA 4IDBA 2Q9AA 4BV2A 2GDJA 3DDNA 3HDHA 3ZE0B 3SSOA 4H60A 1UWLA 4IQFA 4ZIRA 4MYCA 5BV2P 4G1CA 4WCFA 3WNDA 1CQIA 1QS0A 2HJVA 2GD0A 5D3ZA 3GAFA 2CT8A 4YVFA 2HU8A 2X8JA 4W8HA 4MDHA 2GEFA 2OCLA 2PT9A 1DWUA 5HCUA 1FX1A 2ZQZA 1SURA 1NVWQ 3EPPA 2E18A 3V7WA 3WS7A 5KS2A 1N1DA 4RWEA 5FHRA 2ZYUX 3DB1A 4FSDA 4YRGA 5K99A 2AFHA 2CFTA 2JIPA 2NPIA 3IJRA 4DMHA 4DRXA 3B1YA 3FOFC 4FJ2A 3ZDXB 3CBQA 4NXMB 3P27A 1D5CA 5GM2A 1Q7EA 3OZCA 4MGHA 4JBLA 1VJ1A 3T9CA 1AK9A 2C3PA 3KZOA 2I91A 1QIEA 3IT0A 1SA0A 1RCTE 1N7HA 3GQBB 4HHEA 1WZCA 1YHNA 2OOSA 4EAAA 5AT1A 1GTZA 2QOEA 3REFA 2PRIA 5BURA 3KOUA 1TT5A 4XJXA 3UJAA 1KDRA 5EZ6B 3DDWA 5CLLA 3V9PA 3CO5A 4HSGA 2D7CA 1SXPA 2PPVA 2GCIA 4JQYA 2ZBVA 4NCJA 3GVIA 3FMFA 5D5QA 2O8EA 2WKQA 2TECE 5A3QA 1DTSA 1UK8A 4R1OA 2Z43A 3EK2A 4A0SA 3MHTA 1G2OA 1G3MA 4QA9A 3ZHXA 4NJOA 4FS3A 5A3SA 2JD2A 4RV9A 4AYTA 1J8FA 1GPDG 3WLAA 2HMTA 2FMIA 4DIUA 2FGKA 5DBHX 5JBQA 1Y6GA 2IE0A 3ZLUA 3D4BA 4JLSA 1N5LA 3DMYA 1QRSA 1Z0UA 4Q7MB 1C29B 3LHFA 1ZNWA 2HFKA 3WV4A 4YMTA 5L6MB 5FO0A 4EGJA 1NZFA 1GKKA 1P2UA 1CERA 1QLJA 4G25A 3RS7A 2O2IA 4JJ4A 5JO9A 3FYDA 4MWOA 3DM5A 4A8HA 4E5PA 1WVIA 2C57A 5DYNA 1E1KA 3MLEA 1AZSC 4GPTA 3ER9A 4B3HA 1SCKA 5CG2A 2WSYB 4CMKA 2R2AA 4Q15A 1Q15A 1UBNA 1N5RA 5HIMA 5CA1A 3NWOA 3UO8B 1DKOA 1TZKA 4DIMA 2VDJA 2NU6A 3GGGA 3THYA 2CYAA 4DA7A 4YV2A 4NBUA 4QNRA 5EUQB 1GNQA 3WRXA 1GADO 1EVYA 1KAQA 5EXPA 1UIMA 2FX2A 3ESXA 4L0MA 3REOA 4XYGA 2AWNA 3SHVA 1EXWA 2C1EA 3P0RA 3ZNPA 4EB0A 1PNTA 4M38A 4QC2A 1CQZA 3AHCA 1MO6A 3OP4A 5E2IA 4B1FA 3OPYA 5IK2A 3EIXA 1BDBA 1HC7A 4KLCA 4OJKA 1PI3A 3KKKA 4ISCA 5B36A 1D4ZA 4C88A 3K9WA 4R7ZA 5E95A 4TWBA 1G41A 4KITB 1GUYA 1YZLA 3PVSA 3DKVA 4QUHA 4HGRA 4BJ6A 2FPPA 2YV2A 2ZITA 1PUIA 2F1KA 5L7TA 1SD5A 1ZH2A 1PYDA 5I5EA 4RBNA 4FFVA 3X1JA 2AXPA 4RACA 1NPTO 3ZW9A 3IAM1 3NKFA 4Y8VA 4ARBA 4V2UA 5TJHA 2A9QA 2PUFA 1JSCA 1NRIA 1RD4A 2HHAA 2RGUA 1MA0A 4NSNA 2D5IA 4CCWA 2B7CA 4IHJA 5DLPA 3WK8A 5IVPA 1M2HA 1G59A 3C3CA 1IJFA 4OK3A 1DI0A 2ZRNA 4QU8A 2VQ6A 2QTWB 4QFCA 2H17A 2XMZA 2ZU0C 3K9QO 2ZIUB 2CKMA 3T1OA 1QYDA 3PUXA 3M6IA 4FMPA 2V97A 5C35A 1AS3A 4FZVA 1W4LA 5IAEA 1BDIA 2BKEA 1QP4A 5H8WA 2ZROA 3H84A 4KQ9A 5GM1A 2H8GA 5E4FA 4X97A 3U61B 3ZLJA 1QCYA 2NSLA 1DJNA 2O50A 5F21A 4KRYA 3H1BA 4FU0A 1GGHA 1V6CA 3D7KA 4OHCA 2A0UA 4L5CA 1JTEA 3GLKA 2W6ZA 2QENA 2R97A 3Q1KA 2PWPA 3V34A 3LWBA 3ZIAD 1QRTA 5IM5A 1HGXA 2NYAA 2GD1O 4FP9A 1MR3F 1I3LA 3R3YA 2NVUB 3W3AH 1EXVA 3OZWA 4EHDA 2GK4A 4PAQA 2NSDA 3JQBA 3FLEA 4UMFA 4XDZA 4DV5B 1ZN8A 5DNDA 2AR9A 2E4ZA 3KHKA 4OM8A 1NASA 1ZD5A 5IM4A 2H4HA 1W2WB 3LBIA 4HN9A 2E85A 1BROA 2PX5A 4KDCA 2GPJA 3NANA 1T9GR 1L4FA 4FE7A 2P9YA 2IPLA 1XBTA 3RAJA 4W5NA 1JXQA 2Y1CA 3PPYA 4PYQA 3ZWOA 1PD0A 1NBWB 1TQ4A 2B4KA 1DO0A 2NPOA 4Z0PA 4AG5A 3KLOA 5BSHA 5EJ9A 5IMSA 1T3GA 2Q50A 1EM8B 1R66A 1XVTA 3SC3A 3NP7A 5BWNA 4CL0A 1TE2A 1CUBA 5ENDA 4PCLA 4OYYA 3KAPA 1N0WA 3IQWA 1YS4A 2AKEA 2RI1A 2H2DA 2I8LA 4V39A 4WLVA 4BQPA 2I4MA 3UAWA 4CM6A 2OORA 4MR7A 4WK0B 1KH2A 4F56A 4HFNA 1QE5A 4EECA 3D81A 2BTQA 4GE0A 3QKTA 4D3ZA 3UMFA 1J1UA 1Z3IX 1FJXA 2R6R1 5CT9A 1ZHOA 3CX6A 1DKRA 3OO0A 2ODTX 1ENOA 4ZN6A 2HDWA 4EELA 1QONA 4BO6A 2QPOA 3NDPA 5JT1A 2F8MA 4FZ3A 1U90A 2PX0A 3MT8A 2H4JA 1E96A 2GTHA 3HDJA 5KTOA 4FPXA 4EPRA 1DUVG 2ZWMA 3V8NA 1UBOS 2XQVA 2AC4A 1TD1A 2QN8A 3OKCA 9ATCA 2HGSA 1ZVVA 1QG0A 2AJ8A 3O26A 4URUR 1XTVA 1SOUA 3IQZA 1EE9A 4TV8F 1PEAA 4CCAA 4QU5A 2MCFA 4JMLA 3RLFA 3DTVB 4IJWA 3CN9A 1E8DA 1A8IA 2H1RA 3M4YA 1FP7A 4O4IB 1P7ZA 1ISGA 4RZHA 3EG9A 2F1OA 4IEEA 5AHKA 3H2IA 4A5OA 3D7LA 3P2IA 3AY6A 1NN1A 3QPWA 4QJ5A 4TXNA 4EABA 4PRZA 4S2EA 4IWXA 5IWCA 2Z0MA 1DKLA 3DT8A 3U81A 1NUTA 3NFRA 5CDGA 1PYGA 3HLYA 3WGLA 3NFYA 1J00A 1G98A 3RBVA 3GO4A 1VG0B 3DEZA 1FX0A 2JLUA 3QLTA 1X7HA 1Z33A 4MV8A 1QQ7A 1H8ED 4G84A 2JEZA 4UUPA 4E32A 5J2TB 2VP2A 5EI5A 1TK9A 4GMXA 1IZ0A 3L7AA 5AUPB 1NOKA 1HDCA 2V74B 5HMLA 3O4IA 5LP1A 1QHHB 1M0SA 1V8FA 2RJNA 1B42A 2BFAA 2OV3A 3BD6A 3FTNA 3HZHA 5AKKA 4A6DA 1AHPA 2BDTA 1NFQA 2JLSA 1NJFA 3CKKA 3Q5EA 4RWZA 2ZBDA 1G2PA 3KXKA 2DHRA 1W4RA 1JHAA 1CULC 1V2HE 2AD5A 5E4YA 2PMDA 2FMFA 4UVDA 2WBLC 2UUCB 1MW8X 1JLLB 1W48A 3AERA 2F17A 4EYOA 1X7ZA 1RHUA 3MOSA 2VJMB 5KC9A 1ZM9A 1U4OA 4I19A 2QVLA 3I3SR 3PHLA 5D3KA 5B6IA 3ZR4B 1NYTA 2NZ8A 3N8HA 1XLVA 1GZ7A 5ERYA 3AHHA 5IASA 3SHWA 3AI1A 1UK6A 4Y2GA 3ZYCA 2PT7A 3OECA 2P2CA 2VT7A 1KZ9A 2XXJA 3LRTA 1VXOA 4NH4A 5HF6A 1Q0SA 1H1DA 2TMDA 5DN6D 3OUZA 4BWGA 4XTRA 1ULBA 2R751 2N0SA 3H4VA 4ARVA 4YRPA 2D13A 3QP9A 4CM5A 4INAA 1M8FA 1SXIA 3U4MA 2GPYA 1KDTA 4S35A 2YICA 1QOZA 1ULZA 2GCEA 3M1YA 1OLSB 4GU5A 1IBLB 1N5JA 3GJRA 4GSYA 3WBBA 4MI3A 4E51A 3N2IA 4FC6A 4FB4A 4C14A 1G1MA 2CSXA 3W04A 4M21A 2VK4A 4C0AC 3DZDA 2C9YA 1E1QD 1DAPA 2GNOA 1Q14A 2W6OA 5AR1A 3Q8KA 4K40A 4BFTA 4J0GA 3KR9A 4RSMA 3EGEA 3DVLA 3DPIA 3MINA 5JCPA 1N6RA 1WKCA 2VVTA 3BF8A 3EDCA 1E7RA 4HYTA 3LZDA 4IZHA 4D9HA 6REQA 1EU1A 1XHLA 4YJFA 1L8LA 4FFBB 2BISA 1L6IA 1TA4A 1Y8CA 2XCQA 5B64A 5KYWA 1ECCA 2QF7A 3TL2A 4B7CA 3IT1A 4RTMA 4R1LA 3LP5A 3AUJB 4TTVA 3FUCA 1REQB 4CZ2A 3NXSA 3FTEA 2XCIA 4BNDB 5CIWA 1PE0A 5J1SB 3HU3A 1Y33E 3L7NA 5I7UA 4HAXA 4P2GA 2DR3A 1HG0A 3CNQS 1NQUA 4WERA 4ILEA 1OLXA 4EEKA 5JSFA 2CXPA 2J41A 4YQEA 3LS2A 3OLXA 3NH6A 3PWZA 2WMYA 4JCOA 621PA 1IY0A 5F23A 2FFRA 4RZ3A 3X0DA 1YBFA 1G8HA 2W2KB 3FTFA 1EMDA 4MGEA 3RWOA 4UDXX 2BJWA 2V45A 1NMYA 1YNSA 2OCBA 1ENPA 4NZZA 3A0RB 4ZALA 3BRQA 1CZKA 3U4QB 4U3JA 1BH2A 3C16C 4YRAA 1QO0D 3LLMA 2O3UA 4G24A 4D99A 2JJ1D 2WP8J 1P62B 2W2OA 4EKGA 5JDCA 5BRJA 1ZRHA 2YINC 4HZGA 1BNCA 5EHQA 3VVLA 5K6TA 3H4MA 4A2CA 5KAMA 2E55A 1KFCB 2C54A 1GD1O 2V98A 5JMOA 2JARA 3N87A 1LJLA 4J76A 4PV7A 1G66A 3OIYA 4XPZA 4ZZ2A 3GEIA 4Y2VA 3TX6A 4B3RB 2VYND 5AVWA 1H4SA 4LGMA 2CDCA 3A10A 3DCNA 3A4LA 2JF0A 3R7SA 4QG7A 1KA9H 5LBUA 3GFFA 5IZCA 3G8CA 3VC2A 2QY6A 4GO1A 4N3NA 2E5FA 3L1VA 1G0NA 1VLJA 4KB5A 1LV8A 1X1TA 4C3VA 4WXHA 2VWQA 4NMMA 5HCNA 1O0BA 2JHAA 3DE2X 5IT5A 1EEHA 5CRIA 2OVFA 4L3OA 3GP3A 1JFLA 4EJ2A 4JYAB 1GZ4A 1EP2B 2C5HA 1JPJA 3I01A 3IDAA 1RWKA 1JAXA 4KSCA 3NJ4A 2P2ZA 2XHEA 3PDIA 4EJFA 1K4YA 2IEZA 3GWGA 4HLUC 4KN6A 1TTTA 1YRAA 3Q87B 5B2FA 1TT5B 4X62B 2OHIA 3ZV7A 1YTLA 1F6DA 2CF6A 4FYWA 4JVSB 4PHTA 4PEVA 1C1XA 4U9HS 1NIJA 5FBHA 2K7ZA 4ZCSA 5K3CA 3VR4A 1L7VC 4U6QA 4NZNA 4WT7A 1GRVA 2OB2A 1NV8A 2QAIA 2X7XA 3CF6R 1N9GB 3NBXX 2ATEA 3W8RA 3HFSA 3U19A 4HAWA 3L1KA 1B2RA 4JKYA 3DZIA 3UGJA 2FEXA 2QTZA 2YBDA 4M0FA 4QQKA 3A2KA 1DVRA 4HJXA 1XXHA 2VDKB 2DXIA 1QYIA 4J6EA 1WWKA 3EIQA 2P41A 4FDLA 2WK1A 1TB4A 5IDVA 3T7TA 1G21A 1R8SA 4LOHA 1JNXX 2ZE5A 2ZSHA 1SC6A 3LT5A 4FFMA 4CG2A 1N7JA 1X8JA 4D02A 1BVHA 1VE7A 3AR6A 1FF9A 3I5XA 3PFNA 2AI3A 3I1JA 1M2WA 1L8QA 4I9HA 2V7XA 2WFZA 1HYBA 2BMWA 4DBZA 1YOVA 1JHMA 2X2OA 4UAUA 2B6HA 3AV0B 1U98A 3A9CA 3BHNA 3IEVA 2FW7A 1W87A 4CKXA 4IF4A 3RGWS 1QF7A 4IIYA 1PW5A 4BJ5A 1JMYA 2DTDA 3DTVA 1C41A 3KCQA 1L7OA 1R15A 1I6KA 2VTVA 3HKEA 3OP1A 1W29A 2HQSA 2ODWA 5AJHA 2X2FA 2BSQA 2WJGA 2XNSA 3T34A 3AUFA 5ARDA 4ARUA 1VLQA 3EF1A 4E6EA 1UEXC 3BMXA 1A8QA 1E2EA 3Q6IA 2QSZA 4UNNA 1I6LA 4G0VA 1Y37A 5JXHA 3UJ9A 1R8YA 2XA1A 4R8RA 1OT3A 4PQFA 1M6VA 4RZUA 1JEOA 1D03A 3Q15C 3ROFA 1XQ6A 3GEGA 4ZVTA 1B8VA 1J8YF 2IEGA 1V3QE 4C4YA 3EGIA 4L15A 5F2EA 4QASA 3DBLB 2IW1A 3L8ZA 4M1MA 2GF0A 4LDPA 2JH9A 1B73A 5TT0A 2PZGA 3N2GA 2ID8A 1BDHA 1TCVA 4KO4S 4GX1A 2GPNA 4DTCA 5BPFA 5A7FA 1HNNA 1E0DA 1MBZA 4Y6GB 1W34A 3OZEA 1N8NA 1CCWA 2OLKA 3MF4A 1O95C 1K6MA 1EFRD 5GJBA 3T3EA 1MH1A 5EJ8A 1USKA 2AD1A 2MSCB 2XTMA 3D6FA 3TQRA 4D79A 3ZKWB 4C30A 2FG7C 4AKSA 2NPFA 1E1QA 2ZTSA 4MAMA 3U0VA 4X0EA 5H81A 3ZVMA 3GLTA 2V1UA 2EFDB 5JQGB 3JQFA 1EK1A 3B78A 5AVXA 1QPZA 7REQA 1B93A 5TQVA 3DB2A 3G1WA 4BO8A 4B3CA 4J29A 4F60A 1THZA 8ATCA 4EI7A 5F35A 5J2UA 3LY5A 1JQAA 1R6AA 4LWQA 1BU8A 1F8XA 3UQZA 1E2PA 2Q2WA 3KDAA 1DBVO 2I8AA 3INNA 4C0WA