5JCJA

Trypanosoma brucei ptr1 in complex with inhibitor nmt-h037 (compound 7)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 94
structure length 249
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jcjA00
2X86A 2A4KA 4B8WA 3DAGA 4UULA 3LC7O 2GYYA 2HK9A 3GDFA 2PD3A 4A2CA 2VHYA 5G4KB 3HJAA 4P4NA 3WYEA 4DPMA 4BO2A 3KYBA 5ICSA 1GEGA 2X0NA 4MPDA 2DM6A 1H9AA 1T4DA 3FI9A 7ADHA 5KVCA 3MOGA 1E6WA 3EC7A 3PZRA 3DBHB 4TRMA 4B7CA 3RUDA 1VSUA 1ZMTA 4CLEA 1XEAA 3AUUA 5HTOA 4JROA 2GPTA 2P68A 3TL2A 1ZK0A 3OEWA 4LGVA 1F8FA 3BMOA 2PTGA 4AICA 3KEOA 3DQPA 4B8ZA 4N5MA 5IDYA 2X4GA 1E7RA 2HKIA 1PL6A 1YJ8A 2HRZA 3KZVA 3HHPA 4N7RA 1DIGA 4CMKA 3DDNA 3FN4A 1IUKA 1YBMA 5ENVA 4HKTA 1ZK3A 3D5TA 3EY4A 2OBYA 4I8XA 4CMGA 1E3WB 1DAOA 5JY6A 3ZWYA 2NU8A 1JLLA 4FC6A 1U2DA 4GMGA 4BUCA 2UVDA 1MC4A 4KDFA 4OM8A 2D2IA 4CLHA 3AWDA 4WLFA 2W98A 1VLLA 3RCBA 4BV8A 2ZCVA 5CPFA 2YV1A 3DZFA 3M1AA 2YHIA 2EXXA 4GKBA 3OQ1A 1D8AA 2FMUA 4U0JA 4B4UA 3I4CA 2Q1UA 1Z75A 3GG9A 4UVEA 1P44A 3O38A 2D4AA 1DO8A 4KMSA 1ADCA 2FR1A 5G0VA 3GEMA 4DBVO 3RUHA 4K26A 3RUCA 3R3SA 3H3FA 4QSMA 3CE6A 4K6FA 3PFFA 4J7CA 3SEFA 4KOAA 3FWZA 3QW2A 1PGNA 1R37A 1MX3A 4K1LA 3F6YA 4PZEA 1H2BA 3X2FA 1ZZEA 5TSDA 1SEVA 1JWAB 4EDFA 1ONNA 5EPOA 1IY8A 3JQGB 2HJSA 3H8VA 3H7AA 2QHXA 4CODB 2AEFA 1C0KA 2XXJA 1R0KA 4L0QA 1S6YA 5CG2A 4UEKA 1CJCA 2V6GA 3NT5A 3Q2IA 5JS6A 1ZXBA 1GQYA 4AJPA 1ZKMA 2DFDA 4J16A 2B36A 3WLEA 4CMIB 1C1DB 5C7OO 4RJTA 2DUWA 5I8WA 1R4NB 3U4IA 4PG4A 1V35A 1A7AA 1XU7A 2O2SA 3G1TA 4R16A 5AVOA 4BS9A 3U5TA 1W4ZA 4H16A 2QX7A 3JQ7B 1NAHA 1VSVA 4HUJA 5LCXA 3VTZA 4EW6A 4ND5A 1YONA 1JVBA 3FD8A 1NFFA 2ZB7A 2VUTA 1FJHA 3I9LA 2GN4A 5CAEA 3UXYA 4RVSA 1YOVB 4UUPA 3QVSA 2FR8A 2VUUA 2O23A 4YCAA 5FFFA 5ICMA 1SAYA 5A3VA 4B3IA 5JYDA 2CSUA 1M2WA 1ZSYA 4QECA 4I9HA 4EYEA 1K6IA 4BMSA 1LDYA 2VYNA 2ZJ0A 2DBZA 2GN9A 3KSZO 5AXBA 3VZQA 1B15A 3ITDA 3PGXA 3NAQA 4A0SA 2W2KB 3WTBA 2P9CA 4HBGA 4Z3DA 4MVJI 4C7KA 2Q3EA 4KTTE 3LF2A 2VWPA 4HFNA 3PHHA 2Q50A 1QMGA 4EBFA 1FK8A 2D8AA 1E5QA 1WPQA 3E5RA 5TJ9A 4E2WA 3AM4A 4PLWA 3RU9A 4DL9A 4RPLA 4UREA 3BMQA 5I7EA 4RPJA 3PJDA 2ZIZA 1OC4A 3JTMA 1YJQA 2O3SA 4PLHA 3L4BA 2W90A 4EUHA 2PY6A 5A05A 1FDWA 4D43A 5JAMA 1YL5A 1NX6A 1JWBB 1O5IA 4WLOA 2HMVA 1XCBA 5B4TA 4J91A 1TT5A 2C07A 3JSAA 1CQIA 2VT3A 1PS0A 1Y6JA 4LMPA 5DOZA 1DRUA 2C5EA 1A71A 5L45A 1VKNA 1BVRA 1R6DA 3QIVA 4OAQA 5JPIA 1ZNQO 1L1FA 2X0IA 9LDTA 4J2OA 2DPGA 4BQPA 1X1EA 3GG2A 2O4CA 3BMNA 5F1PA 1H6AA 3DOOA 5T64A 4AJHA 5IZCA 3RBVA 4E0BA 3KB6A 4AJEA 4N18A 1YQXA 4WCFA 3CZRA 1HDOA 4NU5A 1PZHA 4PLPA 3D7LA 1XLTA 4UVIA 4O0LA 1WXDA 4TRNA 1LEHA 5JY1A 1UXIA 5K6AC 3PYLA 3BXXA 5B1YA 4NIMA 3T7CA 1GAEO 2C29D 3PZBA 4FIZA 3W1VA 1ENOA 1BTOA 1DOHA 3AM5A 3I6IA 2AW5A 2AXQA 3Q6IA 4R9SA 5K9ZA 3E03A 4E32A 1B8VA 1NQTA 3MCVA 3PK0A 3FBGA 4A27A 1GR0A 3ZNOA 3RWBA 1UDCA 3MJ4A 3ONEA 4IIVA 5ITVA 5A9SA 2FN7A 2FPGA 3UAGA 3U49A 1X7DA 4MKZA 4YT2A 3JQBA 3QVWA 1V3UA 2FZEA 3TZ6A 1Y9EA 3V5NA 1Q7GA 3WDSA 5G0UA 2Y68A 3OEYA 4P4LA 4YAGA 1DEHA 3ONFA 2G0TA 5IN4A 2DKNA 1EK5A 1ADGA 4NI5A 4Z6KA 9LDBA 1A4IA 3GF4A 1VKOA 1GYQA 3D3WA 3U4DA 3FTPA 5CDUA 1PR3A 2E37A 4II3A 4L4XA 1BWSA 3SC4A 4B4OA 3GY0A 2V7PA 2ZCUA 4ROSA 3ENKA 3L9WA 3FNEA 4NK4A 5DN9A 1PL8A 1ISJA 4FCCA 5COBA 3GQVA 1XYGA 1H6BA 3V1TC 1BW9A 1ZFNA 3ZDFA 4E30A 3VZRA 3H3JA 2DTEA 2Y1OA 4MKXA 4E6PA 3L9XA 3GVPA 1VL8A 1HDYA 2VYND 1KBZA 1XSEA 4FDAA 1PWXA 2X5OA 3OQ6A 3DFZA 3LF1A 5JO9A 4NBVA 1U3UA 1HYGA 2HMUA 4CJXA 3E9QA 5CDGA 2Y1FA 3OA0A 1O8CA 4BO5A 3QV1A 1A72A 4YJHB 4CLRB 3H5RA 4PG7A 4IJVA 4N5LA 3OJLA 1YXMA 3VH2A 1EDOA 1YB1A 2D0IA 1E1MA 1LDMA 5JBIA 2YDXA 2EERA 3L4SO 3JQAA 4ZJUA 1WMBA 4YRAA 4L73A 1EQ2A 4RPGA 1G0OA 3QVTA 4IDDA 2RBEA 2X58A 3G1UA 5L4NA 3NYWA 4DBZA 4F45A 3T4XA 3DZBA 4ZA2A 1PGJA 3HB4X 4BL5A 5JLAA 3PI7A 2O50A 1VJ1A 4J49A 5L7TA 4GVLA 1P74A 3S2FA 4BNUA 2G1UA 3C1TA 2VNAA 4PVCA 4AJ4A 2OOSA 3FR7A 5IZCC 4XYLA 1M75A 2R00A 1E1NA 1EVIA 4YJGB 1QR6A 1TLTA 4FFNA 3H65A 2ZTLA 3LC2O 1JN0A 1KVRA 2WYWA 4KZPA 1HDZA 3GVHA 4CV1A 5IXYA 1Z45A 1O6ZA 4F46A 2G17A 3D4PA 3JQ8B 1GD1O 1I01A 2X5JO 2POQX 2DVMA 2WSBA 5FYDA 3PHGA 3D0OA 3ZWXA 4XA8A 5TT1A 5IFLA 4WCDA 1J5PA 5EN4A 4DYDA 2YZ7A 3DBVO 1IHXA 1U5AA 3NDIA 6LDHA 1S7CA 2VZ9A 3PDUA 2VQ3A 4BNLA 4Q3DA 2AE1A 4FJ0A 1WWKA 2VUSA 5MGBA 2IYPA 3ZWWA 4M54A 5DDIP 4E5PA 5JMWA 3JQBC 3UCXA 1ZEMA 1C14A 4M1QA 1O9BA 3C8MA 3ZI0A 1C0IA 4CQLA 1E3EA 3UN1A 2J5KA 3GMDA 4XYBA 4BV9A 4PRKA 5GMOA 3RUEA 4DA9A 1UJMA 4LVUA 4TZTA 2DC1A 1ZK2A 3OIGA 5AYVA 1DFGA 4YJDA 1VI2A 5A3JA 3TRIA 4WK6A 3GGPA 1EVYA 4R9RA 1PGQA 1NVGA 1PJSA 5L40A 5CP8A 3EVTA 2AG5A 4P4GA 3KYCA 4S1VA 1DC5A 5KOIA 4ALLA 1EDZA 3HFGA 3ZNQA 4EJ0A 4AJOA 5JDIC 3KM0A 2NSDA 3KV3O 2EGHA 3OJFA 4PZDA 5JNLA 2Q4BA 2PWZA 1PJBA 2NVWA 3WWZA 4Y8VA 3NJ8A 4CPDA 1UAGA 2C7VA 4YAJA 1D1TA 4II2A 3W4IA 5TX7A 3F4BA 2VWQA 2Q1SA 4CLOA 5JW6A 1K6XA 1P9LA 3AW9A 4IZHA 2HLPA 4U6SA 2NVUB 3ETDA 4N54A 3L77A 3PHLA 1AHHA 4NK5A 4Q3CA 4RF5A 3RC7A 2VHWA 3I9JA 4PLYA 4D3SA 1HEUA 2EHDA 1R66A 1FDVA 3DTYA 4ESOA 5KVSA 1KVQA 1NFQA 2NTJA 1EZ4A 5CDYA 5C3MA 3PEFA 1B0AA 2ZJ1A 3GGOA 3OJOA 4IZIA 3GA0A 4PVDA 1FDSA 1NAIA 3GH3A 4CV0A 1NQOA 2B35A 1UZLA 1P1FA 2GN6A 3E5MA 3IP1A 4QO7A 2VWGA 2OMEA 3INGA 3TN7A 1U1IA 4URFA 1IE3A 1Z6ZA 2AQHA 3H2SA 5G0SA 1WVGA 4JX8A 3KBOA 4CQMB 3KRTA 1GY8A 4U8GA 5DCWA 4YACA 4I5FA 1BXGB 4J4HA 2F1KA 3H4VA 3DC2A 2X6TA 3JQAD 4NBUA 1H6DA 4WECA 2O3QA 4OOFA 1U3TA 4CMHA 1X13A 5HA5A 2FPIA 2IRWA 3GMSA 2P4HX 4RQUA 1UZMA 4TVBA 3RC9A 2CD9A 4WLVA 3WBBA 2VHVA 4ND4A 1N2SA 5F3RA 4O1MA 1DB3A 2VN8A 4IDBA 4FS3A 3IUSA 5F5LA 2IYOA 1I32A 2B5VA 4KTVE 3O8QA 4YQYA 1PZFA 3KEQA 5L3ZA 3B1JA 4NJMA 4BGEA 3I23A 1D4FA 1UXJA 1Y8QB 5KVQA 3L6OO 3R0IA 1MV8A 4GSLA 3UVEA 4XWYA 3GPDG 5CPBA 4M86A 3RJ9A 4HXYA 3QWHA 4J43A 2AMFA 3AOGA 4P22A 1SOVA 2C20A 3QQPA 4Z9FA 4FJ2A 1GEEA 4HNHA 1I24A 4AG3A 1BDBA 4J90A 4IQGA 5JAIA 4DLLA 1K2WA 4BGUA 1KC3A 2BHLA 5DT9A 4BO8A 1QSGA 1T4BA 2A94A 3RBZA 3W4JA 1H0KA 5I8ZA 3BTUA 1IOLA 4EUFA 5JXWA 3Q2KA 3AUSA 4I5EA 3ULKA 3VH1A 3DZKA 2WDZA 3TNLA 2D5AA 3S2IA 1GU7A 1KVTA 3AFNA 4OH1A 4GLOA 3GN1A 1T2AA 4LRTB 2GD1O 5GZ3A 2WMDA 3GGGA 5IN5A 5FEUA 1SZJG 2B69A 4CMJA 2NU7A 8LDHA 4QFCA 1ZJZA 4Z9YA 1LLDA 3ANLA 3AI2A 3MOIA 3CXRA 4FC7A 3H2ZA 1PSDA 1DC4A 3EZYA 4AJKA 3MTJA 3NV9A 4W99A 4JLWA 5FI5A 3WFJA 4IBOA 1KY5A 3B70A 3F5SA 1HLPA 1NNUA 4Q3EA 2IZZA 2NUAA 2RHCA 2EIHA 5U4QA 1HT0A 5FI3A 2HAEA 5TC4A 1UZNA 3P7MA 1OZAA 3W6UA 1UR5A 2ZTVA 4XIJA 4PLZA 1I0ZA 2OBNA 2CDAA 1XWFA 2Y0EA 4RVFA 1ORRA 2X23A 4TMFA 5JAQA 3DBRA 3PWSA 4QEDA 2YYYA 1NASA 4J0FA 3UUWA 5DNAA 4GI2A 1G1AA 3EK2A 5AOVA 3C3XA 1YBAA 1LLCA 1MXFA 3TWOA 2XOXA 1PGPA 1YQDA 2FPPA 3PQFA 2B4QA 1C1XB 3AOEC 3INRA 4WPGA 2J8ZA 1MFZA 3DWFA 3H6KA 3K30A 3SJ7A 1Z7BA 3FTNA 4RDIA 1LSSA 4CM6A 4FFPA 1GZ4A 1ONPA 4HX5A 2AEJA 4EJ6A 1LNQA 1QV7A 1HYHA 4BNMA 3NTQA 4UVGA 3OF2A 4DLBA 4OSOA 1TT5B 3B20A 4GX0A 4GWGA 2GZ3A 3H9EO 4RZIA 5KKCA 1YDWA 1HDXA 4FOSA 4WE3A 8ADHA 1JAYA 5IDWA 4Y6PA 1JVSA 4RVDA 4W4TA 1E6EA 1LC0A 4FD3A 3KLPX 1J4AA 4FFRA 5I9NA 4B4WA 1P1IA 4UUNA 2VNSA 4YVFA 2GERA 3WFIA 4TKMA 1CETA 3GEGA 3ORFA 3ETGA 3QLJA 1UH5A 3H9UA 4H3VA 3IDSA 4BNHA 1BHSA 1RYDA 2UAGA 3ZHBA 1VM6A 1E6UA 3OJEA 3PQDA 4CMAA 5CEEA 3GAFA 2HJRA 5BR7A 2I66A 3C85A 4INAA 1Y9AA 2IEDA 1JAXA 3UGKA 4WNCA 1J49A 3WB9A 4DC1A 1KEWA 4BNNA 4MO2A 1DFHA 1EK6A 1NPYA 5HBRA 3ZWAA 3DL2A 5LDHA 2GZ2A 3H9GA 3BZUA 4M49A 2W8ZA 3PWZA 3FRJA 5HRUA 4LCJA 2JL1A 3NT2A 2VCYA 2Y1EA 3GVIA 4R1NA 5DBGA 5CDSA 2JHGA 4AL4A 3PJEA 4CL3A 1NPDA 3WGOA 3WSVA 3JYQA 3AM3A 1PJLA 1LLQA 4PIVA 1YE3A 2HMTA 4BB6A 4XQEA 1NPTO 3D1LA 3VZSA 3UOGA 2CDBA 1PGOA 1LSUA 3F47A 4BMVA 1XA0A 2CUKA 3DZJA 1V8BA 3DZGA 3UH1A 3K9QO 1YVEI 2C82A 2E82A 2ZYAA 3ZWOA 5A03A 3PRJA 2IZ1A 4J6FA 1HSZA 3OA2A 2PH3A 5B4VA 2PLAA 2X9NA 5BNTA 5B4UA 1NYTA 1LRLA 5COQA 3N58A 1Q1NA 3RASA 4CMEA 3PTZA 4HFJA 4QX6A 3UKOA 1MC5A 4RDHA 4RVHA 1G6KA 1B16A 5IDQA 3JQDA 3L6EA 5G2OA 4O5OA 3L6DA 4CV3A 1Y5RA 4NBWA 1F0YA 4JP3A 3I9MA 3GK3A 3HZZA 3LC1O 4PLFA 4DC0A 2AHRA 4CR8A 5DCUA 5T8KC 1UXGA 2RH4A 3E6AA 5CDTA 4OSPA 3BAZA 4CM4A 1GFSA 5T67A 2WD7A 3DMTA 4J0EA 1ZSVA 1M6WA 2OP1A 3ZNNA 1Y8RA 3E18A 4XJTA 1Z82A 3DHEA 4BO6A 4AFNA 4DVJA 4DUPA 5EESA 5KIAA 5DP2A 2CF6A 3ITKA 1XQ1A 3PFWO 1SCUA 1BSVA 3DXFA 4YJFB 1OOEA 4CUKA 2AQIA 4J9UE 3DTTA 1K89A 4MP6A 4MOWA 4H7PA 1CERA 1ZK4A 4JP2A 2DU8A 1F8GA 1V3TA 5F21A 1VC2A 4O6VA 3RUAA 5A9RA 4D0SA 1LU9A 4OKIA 3ZU2A 1IZ9A 2VHZA 4H15A 1JDJA 4Z3KA 4ND1A 2JFGA 4I5GA 3O4RA 4UEOA 2EWMA 1NQ5A 3WJ7A 2J3HA 4YT4A 3SVTA 2W2LA 4ZD6A 1DRVA 1O0SA 2C2YA 4D42A 2Q45A 1AXEA 3P2OA 2RH8A 1CIVA 1AHIA 2O2YA 4W82A 1E0DA 1N7GA 4NG5A 2AG8A 1DLJA 4L76A 5CHEA 4YBZA 4ALJA 1U9JA 1RM3A 3Q9NA 1NHGA 3DAPA 4FN4A 3QWIA 3HN2A 4DRYA 4XGNA 5G0TA 4DIBA 2VT2A 1C0PA 3JD0A 3C1OA 5JDCA 3OETA 1GZ6A 3ZU4A 4E2YA 2QZZA 1PJ3A 1R15A 3ANNA 5I9MA 1FXSA 1XKQA 3JD1A 2JD0A 4WEQA 4DQUA 4EUEA 3SC6A 5IXSA 3O9ZA 3SJUA 4E2XA 3MZ0A 5F1OA 3A28A 3K73O 2SCUA 4LSWA 3V8BA 5KJ1A 4DQXA 2BFPA 3IAHA 3HQ4O 2Q4EA 2QYSA 1DIAA 1N5DA 2FOIA 2QIOA 3IUPA 1U3WA 3IL2A 2QW8A 3VKVA 4E5MA 4Y67A 4YT5A 2Y1DA 4E5KA 5L9AA 2VTEA 4IM7A 2GF2A 4CMEC 4XDZA 1WDMA 1Q0LA 1U8XX 2B5WA 2VOJA 4RF2A 1IHYA 3WNVA 2EEZA 2P5YA 2HUNA 2BI8A 2H9IA 1UAYA 2XXBA 2XF8A 4XD2A 1GV1A 3QJ5A 1FF9A 3BHMA 1YWGO 3LVFO 1EUZA 7MDHA 4O63O 2NU9A 4UVHA 2BF7A 4BO3A 1G0NA 4OXNA 2DBVO 5TRTA 3O03A 3C7AA 1NR1A 4CQMD 1A7KA 1WP4A 3W6ZA 5TT0A 1EEHA 2EW8A 3WWYA 4O59O 4A5OA 4EZBA 2PZJA 2QRKA 4Z9XA 4NU6A 3RUFA 2GO1A 3D4OA 4IQ0A 4G81A 4NDNE 1GCOA 1CEQA 2JD2A 5JCJA 4KUHA 3RC1A 4D41A 1U2GA 2P5UA 2G5CA 3V1UA 4IXWA 4CM3A 1P1JA 1DHTA 2CMDA 4KQXA 4G2NA 4CR7A 3INTA 4PLCA 3GDOA 2D3TA 3M2PA 4OO3A 2Z1MA 3U62A 3ONDA 5ITWA 2HQ1A 2V6MA 4ZQGA 4J2HA 3ZWMA 5KJ6A 3KYDA 5EMHA 4E2ZA 4XKJA 1X7GA 4D3FA 3K31A 1EUDA 5FF9A 1JKFA 1I3LA 1N9GB 3DOJA 2B0JA 4JJGA 3RKUA 3V2UA 5G4KA 5DBFA 3OIDA 4NZ9A 3DONA 5IF3A 3HE3A 1KERA 1F06A 3PLNA 5HWSA 1H2HA 4ZU3A 4CUZA 2JCXA 3FSRA 3DBHA 3BTOA 1DC3A 5CEFA 2W2LD 3WXBA 3MWDB 4AJNA 3I4FA 1ZW1A 2NM0A 4CM1A 4BKUA 3ASUA 1NVTA 2I9PA 2V65A 3O26A 4WGGA 3IJPA 4IMRA 4QXMA 3JYPA 3GZNB 1KOLA 3ZWBA 1E92A 3NGXA 1FMCA 2QRJA 3QWBA 4XRGA 1ONOA 3KETA 2IXAA 1EVZA 5ILOA 1ZSNA 2CFCA 2I67A 4JBGA 3FPCA 1E3WA 4W7HA 3DZHA 2BFOA 5LDGA 4CMBA 3OIFA 1W6UA 3B1FA 1XU9A 3LK7A 1UDBA 5DF1A 3U3XA 1YBVA 2IEBA 3A14A 4LRSB 2G76A 3JCZA 3ZWCA 3JV7A 4IINA 4PG6A 2JKVA 3L4BC 2BH9A 3RFXA 2EKLA 3TJRA 1CWUA 2O3UA 2HO5A 3AJRA 1MG0A 3R6DA 4BB5A 3WMWA 3LQFA 4AJJA 1I33A 2GCGA 3GZ4A 2HRBA 1P45A 2P9GA 4DREA 3PGJA 4TQGA 3C1AA 2PKRA 5A5EA 3UICA 5KJCA 3I6QA 2B37A 1ZIDA 3D3EA 3SLKA 4D79A 4YEDA 5JO0A 5BNFA 1JW9B 4U0KA 2ZQYA 2GLXA 3T4EA 2VOEA 1PZGA 2RIRA 1H5QA 3DMYA 3GRKA 4IDAA 3QY9A 1ZMOA 3BMCB 3K92A 2A92A 4BO9A 4WCFC 1ULSA 2GN8A 3JQGA 4BIIA 2W4QA 1AUPA 3LT0A 1WMAA 4WOJA 1P1RA 1NQAO 3AI1A 4LN1A 1C0LA 1HWYA 1N7HA 1QP8A 1QXSA 1IL0A 3JD2A 2Y1CA 4QO8A 4BO1A 4CMIA 2YQ4A 3C7DB 1C1DA 1RPNA 4U5QA 1R4NA 2NQTA 2Y66A 3UHAA 3VPGA 3F5QA 5LC1A 1VPDA 3DEYX 4YYZA 3E9NA 1B8PA 2WEKA 5TNXA 4GKVA 1WZIA 3JQ7A 4IGFA 4GLLA 4N5NA 1PJCA 2ZB3A 3AUTA 3GUCA 3TF5A 5BSGA 2FY8A 1Q0HA 4NR0A 4QFDA 4JJFA 4B7XA 5CG1A 1U7HA 1SNYA 2WTBA 2Z1NA 4HFMA 4MKRA 4UVDA 1HE5A 5BSEA 3ETEA 3VZPA 2YV3A 1YOVA 3D64A 4BKQA 4AJLA 4AVYA 1H94A 1ZUD1 4AJ2A 3MJSA 5JCJD 4RF3A 1Q2XA 2PGJA 3FNFA 2CDCA 4IXTA 4R41A 3IMFA 1W8DA 4X54A 2QZ9A 2X0RA 2NQ8A 3RSHA 1N1GA 1T25A 3MJTA 4R5HA 2PFGA 3TSCA 5I9LA 4ZICA 5BQFA 3ANMA 2W2KA 5T6BA 5L7YA 3RAJA 2HK8A 1I36A 1U28A 1XQ6A 2X8LA 4JN6B 4BOYA 4QQRA 4PLVA 1DPGA 2UV8A 2RAFA 2E6UX 4A03A 5EIOA 1HDGO 3WTCA 4TROA 4E12A 5KVVA 3DR3A 5DOVA 1UP4A 3R3JA 1TB4A 4HP8A 4E13A 1MFPA 4CM7A 3RVDA 3GPIA 4OOEA 1R4MB 1XR3A 2B83A 2UYYA 1TA4A 1YKFA 3GC6A 4RCVA 4IJUA 2CF5A 1DC6A 1LA2A 3NRCA 2YHUA 4MIYA 4M8SA 1GCUA 1HYEA 4WUVA 3HWRA 2J5QA 2J6IA 4L4SA 3CPSA 3M2TA 1E77A 1PS8A 4PFJA 1EUCA 4LMRA 2BGKA 4QTZA 3WGZA 2PNFA 4BNXA 2VRBA 5I7FA 1N8KA 2DT5A 4R5MA 3RI3A 4BQRA 3OJ0A 1DFIA 2IE0A 5JC1A 1QYVA 4OKNA 4NFHA 1P1KA 4PCVA 3DZIA 1K3TA 2AQ8A 2Q2VA 4YAEA 1LSJA 1NM5A 1P77A 1LQTA 4RPHA 1F17A 1YRLA 4BKOA 3JQFA 1GUYA 4MVJD 1ZXLA 5B37A 4YDRA 3T7EA 3RD5A 1HZJA 1E3SA 1YH3A 1DDOA 1KVUA 3KSDO 1PQUA 2P4QA 3BMOB 4IJWA 1DJQA 2WJPA 2HMWA 3PHJA 1T2DA 1I10A 1PR9A 1GUZA 1SMKA 3DHYA 4R1UA 4C4OA 4CMCA 3D4NA 4RQTA 2BMAA 4YAIA 3TDKA 3X2EA 4EITA 2JCVA 3I5MA 3TPCA 2R00C 3S8MA 5C5IA 1I3NA 4I1IA 4KWIA 1ML3A 2ZKLA 1GL3A 3OBBA 1R16A 3FWNA 3VVBA 3GHYA 1DAPA 3P2YA 1K5HA 1LRKA 3HSKA 3E9MA 5JFOA 1BVUA 4WASA 5DP1A 1Z74A 3RKRA 2ZTUA 4FR5A 4MVJP 3RQSA 5B12A 5U9CA 1M76A 3K96A 4OGWA 2GSDA 3FPLA 3W8EA 1Q7BA 3NDRA 2YHIB 4D7AA 3BHJA 3C24A 4IPTA 4GMFA 2C0CA 1YGYA 1O89A 4XX0A 3AY7A 1U4OA 3S55A 5COAA 1XGKA 3QRWA 3ZV5A 2VRCD 2EJWA 1HL3A 3IKTA 1UUFA 2A35A 5A04A 1DRWA 3NDJA 3B6ZA 2O4UX 2NV6A 4IDCA 2O3TA 3OH8A 5HS6A 3OFSA 2D1YA 4IDGA 1PQPA 4EEXA 3G17A 3PHIA 4MDHA 4UUOA 3AFMA 4GL4A 4Z0HO 1ISFA 2I76A 3CTMA 2O3JA 3AK4A 4XYGA 3KHUA 1I30A 5IAAA 4R01A 2DTXA 1DHRA 2IXBA 5EQFA 1CF2O 1E3LA 4Q3AA 4BNKA 4FGWA 4Y98A 2YV2A 1GDHA 5TS3A 3TFOA 3DAFA 2CZCA 4XB2A 3F46A 4HV4A 2OZPA 3CINA 2Y99A 1IPFA 4FQ8A 3HB5X 1KIFA 1PJQA 1XDWA 4FFOA 1OC2A 4IDFA 5GY7A 1H93A 3S1LA 4JXKA 2OP0A 2WWRA 3OICA 1LDNA 1LSOA 4MVJH 2DTDA 5ER9A 1T26A 1JKJA 3VPXA 2Q2QA 5L7WA 2ZB4A 4ZQHA 1QORA 2G82A 5GZ6A 4CLRA 3S2GA 4YJHA 2PZKA 1D3AA 3JYOA 4IGEA 3CKYA 3TZCA 2FR0A 4E4YA 4GQAA 5KJEA 3VH3A 2Z95A 3EHEA 1DIHA 1ZO8A 4NQZA 4P8RA 1LDGA 3N74A 3AY3A 4CM8A 1AGNA 1ADBA 4XR4A 3ZV4A 3KLMX 5KTKA 1X14A 1I5RA 3HADA 1KYQA 1WDKA 3GUYA 2X9GA 3GNSA 4YT8A 5BNIA 3PYXA 2P2SA 4Y6SA 3NKLA 4P38A 4GH5A 3WIEA 2X7HA 3BTSA 4CLDA 2CVZA 4YJGA 3A06A 4QT0A 1KEVA 4W7IA 3NTOA 4R69A 3CMMA 3COSA 4XEHA 4NMHA 1YO6A 2DBQA 3TOZA 3LZ6A 1A9YA 5G4LA 3DHNA 3WIDA 1PU2A 3JQ8A 3DO5A 3BMQB 1P0FA 4ND2A 4KDEA 2JAHA 2Y0CA 4A10A 2H63A 3P19A 3ZU3A 3EGOA 3AI3A 1SB9A 2PGLA 1L7EA 2HU2A 1P3DA 1VL0A 3AU9A 4KUEA 4RF4A 5C37A 1SBYA 2ILTA 1HDRA 2JFHA 3ZNPA 1QG6A 4BO4A 1X7HA 1HZZA 2FP4A 4ID9A 5TJHA 4IMPA 4LISA 2CVOA 2WE8A 1HETA 4E5YA 1MG5A 3TZHA 3FNGA 1F14A 1YB5A 2HSDA 4MP3A 1ISGA 3JQ9A 3BMNB 3I3OA 4I9NA 3VPSA 2XPCA 1E1LA 3IKVA 4J3FA 4OYRA 5TQVA 4CUJA 1SB8A 4RVGA 1PQWA 4G5HA 4WCFB 4EI2A 2JFFA 1J0XO 1M6HA 3GNQA 4RORA 3FCOA 3EMKA 1YB4A 4YB8A 1TI7A 4UUMA 4XQ9A 3HG7A 3K2EA 4JK3A 2AEMA 3VTFA 4WOKA 1LJ8A 4XDYA 4PG8A 3PJGA 4XB1A 4M89A 1SPXA 1YS4A 4FB5A 4EEZA 1NHWA 3MJEA 3TZKA 3BHIA 4PLGA 5JMPA 3W8DA 4A7PA 3L0DA 4NHEA 1BMDA 4L4RA 2PZLA 1JA9A 5DULA 1HE2A 1HLDA 3JD4A 5A9SB 4AJ1A 3PXXA 3LSYA 2JAPA 2GDZA 2NVUA 2VZ0A 2BD0A 3M1LA 4XZ3A 3UFXA 5H83A 5BSFA 4OMUA 2PGDA 2B4RO 3S2EA 2FRDA 4BNTA 2V6BA 4JBIA 2A9FA 1OMOA 1U3VA 4HWKA 4XQCA 3TFQA 1ENYA 4IY1A 2NWQA 1RWBA 5ER6A 3RJ5A 4D3DA 2BLLA 1MUUA 3D3WB 4JQCA 5A06A 3R1IA 1DLIA 3UF0A 4FJ1A 1KETA 1UDAA 2Y1GA 3TOXA 2ET6A 2CNBA 3PIIA 3H9JA 3MJVA 1E7SA 4JIGA 4L75A 4ZQBA 3GR6A 4CQMA 1P31A 4XIYA 1U4SA 2NU6A 4J7UA 1KEUA 4B7UA 5EERA 4M87A 1BW9B 4FFLA 4RLHA 2X9VA 1BXGA 1V9LA 1E7YA 5I7VA 1YDEA 2J5RA 1KY4A 2TMGA 1RM0A 1TT7A 3WGHA 3VVCA 3TQHA 4BKPA 4PRLA 3EYWA 2X1HA 4Q9NA 2OHXA 1XHLA 2WYUA 1NFRA 4DQVA 1ZJYA 1RKXA 5CFZA 1HE3A 1KVSA 2HDHA 4TRJA 1NR7A 3VOSA 1BGVA 1J6UA 5L51A 4BGIA 2EKQA 3LT2A 2NTNA 3DBLA 3EW7A 4GX5A 5AQ1A 1GPDG 5THKA 2PD6A 4XR9A 4DTIA 4NFSA 4ZHSA 2YW9A 5FWNA 3LYLA 3JQAB 3EAGA 2NADA 4BNGA 3ASVA 3NTRA 1Y8QA 1RM4A 1EFKA 2LDBA 1I2CA 4YQZA 4JNKA 1IZ0A 3A9WA 4K28A 3ROKA 4Z0PA 4OJNA 1NWCA 3W4KA 5K6AA 2QG4A 3JQ9C 3V2GA 5KNLA 2R6JA 1JKIA 4OXYA 1BXKA 3SX2A 1Q0QA 4M55A 3WGIA 1X0VA 1B3RA 4F6LA 3TZQA 1DXYA 1PTJA 1SC6A 1I2ZA 1CRWG 4L8VA 1XIVA 5A1TA 1T2FA 4DIFA 1GQ2A 2I3AA 3SXPA 3HUDA 1GV0A 3WGYA 1B3BA 2BFMA 4BVAA 4BNWA 4JJIA 2D5CA 3GRPA 1HDCA 1WW8A 2NNLD 3OSUA 4IS3A 1QRRA 2OXIA 2VZ8A 1D1SA 3GAZA 1VL6A 4GPD1 1E7WA 2YY7A 4ZN6A 4OL9A 1QKIA 4MJLA 4Q39A 2PV7A 3QSGA 3RIHA 2V6FA 4OHUA 3UCFA 3JYLA 1GQQA 1P0CA 1NWHA 3WICA 1PJ2A 4R4JA 3ZWPA 1K0UA 3AUAA 3W8FA 4C7JA 5G0WA 3ZV6A 4BNZA 4XYEA 4CQLB 2EW2A 1AE1A 4B3HA 4IJKA 3K8ZA 1LC3A 1MGOA 4YTEA 1LUAA 4WJZA 1DJNA 4FPXA 5DBIA 5EQDA 4MVJM 1ZEJA 1VJTA 4MVJE 3U09A 5AXDA 2FHSA 3KYCB 5BT9A 1QYWA 1TXGA 3GVCA 2J3IA 2LDXA 4TWRA 5HM8A 5F5NA 1D7OA 1V6AA 2ZB8A 1RM5A 3JQEA 1HKUA 4CV2A 4DMLA 1EVJA 2Y05A 1IPEA 5IZ4A 4L9RA 5A5FA 2C59A 4ZVVA 4CLOB 2I65A 1C1XA 4GBJA 4TZKA 3HFSA 3G0OA 1LQUA 2ZYGA 1M66A 3RUIA 3F9IA 2QYTA 2BRUA 1NXQA 2EV9A 2GGSA 4XRRA 1ZK1A 1KS9A 1AN9A 3DMTC 3PLRA 3KXDA 1IULA 2GASA 2I3GA 3NX4A 4R68A 4HNGA 1WLYA 4CLXA 2EP5A 3PIDA 1CYDA 1PS9A 3ZH2A 1B26A 4BNJA 5THQA 4FSHA 4ITUA 5KJFA 1ZH8A 2YUTA 3B1KA 3P5SA 1C3VA 3H9QA 3IJRA 1WDLA 4OQYA 5L4LA 1Z7EA 4G65A 1IYZA 3BA1A 4ZRNA 4K9DA 2BGMA 3F1LA 4DPLA 1PJTA 2BGLA 2JD1A 3FHLA 3FNHA 4WEOA 3ZHXA 4KWHA 4RV9A 1QLJA 4Y6RA 3E1KA 4F6CA 5I7SA 2J3KA 1L7DA 3V2HA 2PZMA 2UUOA 4Q3NA 1ULUA 1IB6A 2DQ4A 4J1QA 2E48A 1LRJA 1EQUA 3WSWA 4RVUA 4EJMA 1QYCA 1T24A 1QYXA 3OECA 4HFRA 3ABIA 4D44A 3RBXA 4CL8A 1EBUA 1RJWA 3HDYA 3KO8A 2C7GA 1E7QA 1P33A 1ARZA 3H5AA 1HTBA 3RFTA 3GHHA 3LU1A 3G49A 5IDXA 5MDHA 1DIRA 3PYMA 1FDUA 1GPJA 2OFPA 2HCTA 4BNYA 4NPCA 4TKLA 3O8QB 3ENNA 1DIBA 1ENZA 4I08A 3K6JA 4NJMB 3ADPA 5JDCC 1E3JA 5A02A 1T2EA 2Q49A 3IC5A 1UP6A 3VDRA 4DLAA 5TLSA 3VHRA 4MVJA 1M67A 3WJAA 4NJOA 4XCVA 5T57A 1I3KA 3ZU5A 4YRBA 3M6IA 2FZWA 4RLSA 5H82A 1V3VA 1B7GO 1EFLA 3D5QA 5JDIA 2EJVA 4ZRMA 4R3NA 4ALIA 2PD4A 1E3IA 4CM5A 3WS7A 4IDEA 1VE9A 3V1YA 3CSDA 4JGBA 4U7WA 1K6JA 4DYVA 3SLGA 1PZEA 1ZCJA 5GZ1A 3E8XA 3Q1LA 4RGBA 1E7MA 4YXFA 3BIOA 1Y5MA 5T5QA 2VHXA 1LLUA 4E5NA 1UXKA 4HY3A 3IQDB 4K6CA 2PKQP 2H5LA 4NBTA 2D59A 2JCYA 2JJYA 2O7QA 3A1NA 4ZQFA 2J3JA 5CEJA 4ILKA 2UDPA 2EG9A 4J1NA 2QRLA 4D46A 2WYVA 5JC8A 4CM9A 3LLSA 4PGFA 2EP7A 1OI7A 3QVOA 2IDZA 3DFUA 1AXGA 4J4TA 5EJ2A 1CDOA 5L95A 2BFAA 3WMXA 2CVQA 3WR5A 4CM8B 5K0ZA 1GUFA 4TSKA 1I8TA 4YJFA 1DSSG 1N1EA 2VRCA 2X22A 1QYDA 1R12A 2UUPA 4DWVA 5IG2A 5EL0A 1GYPA 4S3MA 3NUGA 3TL3A 2AE2A 2CY0A 4LK3A 3K2BA 4QUKA 5KKAA 4IS2A 3LT4A 3F3SA 2FSVA 3HDQA 4PLTA 1KC1A 4R3WA 2E49A 1HXHA 3WG9A 4E33A 1Q7CA 1A27A 2F00A 3I52A 1NBOA 5EINA 2YFHA 3DBRB 1EE9A 3EVNA 4IUYA 4I5DA 1T1RA 2IODA 2Q46A 1DBVO 1BDMA 4F3YA 4GVXA 3IP3A 5JCXA 3CEAA 3HDJA 3QP9A 4RPKA 2IZ0A 3DB2A 1TVEA 4R54A 1MXHA 1OBFO 2FWMX 4GGOA 4PG5A 3PP8A 4YPOA 3QWFA 3ZWNA 2I6TA 1UP7A 3PPIA 1WNTA 1YQGA 3H5NA 3NGLA 1TEHA 4XYMA 4MIEA 1LXCA 4TVOA 4KP7A 4J9VA 4LVCA 1O95A 2RCYA 3HDHA 2Q2WA 3PJFA 3WNQA 2EKPA 2H1SA 2VTDA 3LDHA 2PK3A 3CUKA 2O7SA 3NJ4A 3CMCO 4LCEA 2OUIA 1U8FO 4LSMA 2Y93A 4YR9A 1ISHA 1UXHA 5ES3A 1YL7A 3EZLA 4MVJF 4NNJA 4YAKA 5L4SA 1BRMA 3I1JA 4B4VA 3GFBA 1NVMB 1PEDA 3ZW9A 1HRDA 3ROQA 1SEPA 2DAPA 3HNPA 3KTDA 4BKRA 4E31A 3WOHA 3C7CB 1WAMA 2BI7A 3K5PA 2GUGA 3NT4A 5TF4A 1LX6A 3AY6A 2Y0DA 3WGGA 5JE8A 3EUWA 2I99A 5L53A 1LI4A 2VWHA 3JQCA 1VJ0A 1JTVA 3CZMA 2DLDA 4U6QA 3BYZA 3LLVA 2P9EA 3IS3A 4GAEA 1FDTA 5AXCA 4ND3A 2NTVA 3FBTA 3GOHA 4OXKA 1XG5A 2EGGA 2VYVA 2EF1A 3UW3A 3QVXA 3KVOA 4ALNA 3OP4A 4FOOA 3VPFA 4OIMA 4MP8A 2Q99A 3KUXA 3I83A 4RZHA 1ENPA 4RL6A 3U4CA 4CR6A 1LDEA 1BXZA 4Z0TA 1ID1A 3IOYA 3QWAA 2YJZA 1ADFA 4WLNA 3WYBA 2YFQA 5C7IO 4NH4A 1HE4A 4KUGA 3I9OA 4J7XA 2OO5A 3KSUA 3Q11A 4Q3BA 4DPKA 2HMSA 5DZSA 3N7UA 4FBGA 4ALMA 1Y81A 3GVXA 1JQBA 4CM9D 5AXAA 1GZ3A 2PA3A 3WQSB 2YQ5A 2NVBA 4FW8A 1GTMA 3JQ6A 1BG6A 3ZCXA 4BNVA 1A9ZA 2WE7A 4BNFA 3AOEA 2P91A 5JSFA 3JD3A 4A26A 1N9GA 4MIOA 3Q0EA 4EGFA 3E48A 3U4HA 3JYNA 1R0LA 3VC7A 1N92A 4D0RA 4PZCA 4CM4B 3KOUA 4BHTA 4XJSA 2WD7B 4DMMA 3PDJA 3A4VA 3OHSX 3BTVA 1Y8RB 3VH4A 5A4DA 3CIFA 1A5ZA 3ZWVA 1JU9A 3ADOA 4XGIA 5DCYA 2DFVA 4JCOA 3DBLB 4ZQEA 3RFVA 1HF3A 3ICPA 1R0SA 5IJZA 3GEDA 5KCZA 2AA3A 2OL4A 3ROPA 4J1SA 1A4UA 3G79A 4UAGA 3VDQA 2OORA 3VPHA 1MB4A 2GR9A 3ZHYA 3ZHZA 1OAAA 3ICCA 3ZW8A 4WLUA 3PQEA 2ZYDA 2C5AA 3F4LA 1YL6A 3VKUA 1ZBQA 5KWEA 1KEPA 3GZNA 5JYEA 1PJ4A 3OMLA 2PH5A 3G3EA 5TGDA 4YRDA 3PWKA 4PN3A 1U7TA 1ISMA 4J4BA 3EDMA 4GWKA 4ONEA 4DIOA 4W9NA 4W6ZA 2GRAA 2NLOA 3GLQA 2C54A 4NBRA 4WLEA 3OM9A 1PL7A 4GSKA 1PIWA 1LTHR 2ZQZA 3ST7A 1I3MA 2X0JA 1F12A 2JHFA 3Q3CA 2B4TO 2E4AA 3F1KA 1WZEA 3GN2A 1LDBA 4GX2A 4GX1A 3MEQA 1E1KA 4DXHA 3WLFA 1V0JA 1T2CA 2YDYA 4R1TA 1B8UA 4UEJA 1X15A 4WKGA 3RC2A 3I9KA 1EE2A 3GT0A 2ZK7A 1B14A 1U5CA 1X0XA 3WBFA 4IQ8A 4J1TA 3UCEA 5HS4A 4R51A 2BKAA 3U9LA 4E21A 1W0CA 1I2BA 1RYEA 4BO0A 6ADHA 3JQFC 3I9NA 4AJIA 3LT1A 1O94A 1Y1PA 2WM3A 4RO0A 3RU7A 3WYCA 2R2GA 4MVJG 1X1TA 4L74A 1QLHA 1ZVMA 2QQ5A 3BMCA 1SOWA 3ZGYA 4YWJA 3MJCA 3QE3A 5ILGA 3ROMA 5J23A 4I9UA 3RROA 3E82A 4B79A 4TRRA 5F1KA 3HN7A 3WX0A 1EBFA 2Z5LA 5BSHA 3GDGA 4E3ZA 2PKQO 3PVZA 2C2XA 3ZV3A 4B3JA 4XGKA 2Q1TA 1SO8A 5C7LO 3CH6A 3MTGA 2FSSA 1XELA 1NTOA 2WD8A 1MP0A 1ISIA 1PWZA 2VYVD 1QV6A 3L07A 3STHA 2OGUA 4KQWA 3FR8A 3IIEA 1Y7TA 3AU8A 2GZ1A 5ADHA 4BO7A 5T8KA 1E5LA 4MINA 1OFGA 3Q9UA 3WGQA 1CQJA 4Y9DA 4BNIA 1T1SA 4XQGA 2Y67A 3U0BA 2AQKA 4YA6A 2ZATA 4FGSA 1PX0A 2Q1WA 4BMNA 4GGPA 4ALKA 5TIIA 4BGVA 1W73A 2O48X 2DBRA 4NFYA 1VRWA 4A73A 1H9BA 5JAZA 2H6EA 1EMDA 3ON5A 1Z73A 4FFMA 4IIUA 4HADA 2TMDA 1H6CA 1B2LA 1MA0A 3NEPX 2DPHA 5H81A 2O3RA 5ENDA 4DGSA 1GYRA 3GFGA 3QHAA 3QA9A 1P1HA 2ZTMA 3OQBA 3WQRA 3VAZA 4R1SA 3WQQA 4WNIA 3WGTA 2X5KO 5A9TA 1R4MA 2BELA 2I5PO 3MWEB 4JBHA 4ZGWA 1NP3A 4D45A 2DUUA 1LBEA 2XAAA 4OQZA 2PR2A 3ZZNA 3GNTA 1MLDA 1HSOA 3FF4A 2GNAA 3SBOA 5U1PA 3ZN2A 3KYDB 2NACA 2HK7A 4W9NC 3DOCA 2RHRA 1GADO 4LW8A
chains in the Genus database with same CATH superfamily
2ADFA 1MPTA 4B7XA 3EIEA 4BDSA 1UPAA 3V7WA 1BN7A 1T6XA 2GYYA 3CNBA 4LYDA 2BF4A 5K4AA 4A2CA 3D6NB 3NH9A 5G4KB 3HJAA 3SQDA 2JVIA 2QVGA 4E22A 3MGCA 3F2VA 2FZ5A 3DPSA 2KM1A 3KYBA 3P9QA 4HVLA 1U81A 1ZN8A 2NUPA 1R5NA 1U0EA 3LCVB 1U9CA 1KSFX 3FYSA 1ZX1A 1G20B 2DM6A 4IILA 1DARA 4K6HA 1ABEA 4JJAA 7ADHA 3MOGA 3LWNA 3PKJA 5KVCA 1OROA 2REBA 3DBHB 4TRMA 4B7CA 1UJ2A 2ANCA 2GEBA 4MTCA 3RUDA 3M3PA 3PL5A 3HB0A 2ATVA 2BEKA 2D2EA 1RJ9B 4M0CA 3UC9A 4BMXA 4BMYA 1XEAA 3ENQA 4C6HA 3SN6A 5KWIA 1SXPA 2GPTA 2P68A 2YASA 4LGVA 3TZLA 3BMOA 1EI9A 4QNRA 2IJGX 2JC3A 3MC1A 4UU1A 4FKMA 3BL5A 2BGJA 2X7JA 3RT1A 3NBZC 1GHTA 2X4GA 5IDYA 4DR2B 1M2VB 1YJCA 1K2VN 2VJOA 5E7JA 4IH1A 2Z6UA 1GKYA 4Q9HA 2X0FA 2HRZA 3PNOA 4N7RA 1A7UA 1P3JA 2A9QA 3ICOA 2WPDD 1BA2A 5KQMA 3FN4A 4HNAB 3D4BA 4HKTA 5DM2A 1S8FA 4WW0A 5ENVA 3EY4A 1H65A 2SNIE 2OBYA 4XAQA 4CMGA 2YIDA 1RAIA 2OCLA 5DV9A 3F7MA 3H5OA 3ZWYA 2VJBA 1YQTA 5LYYA 4GMGA 2NU8A 4CLHA 4M9CA 4CYMA 5JPDA 1MC4A 4P35A 2I71A 2D2IA 2FVXA 4GYYA 4OM8A 3AWDA 1AMOA 3BE5A 1T3SA 5AKKA 4ZK2A 2W98A 3QVMA 3HCPA 4O0MA 2XT9A 1V26A 1POWA 2A78A 1SBHA 1RKVA 1XB2A 4ZZIA 3RCBA 4X44A 3BCUA 3OPNA 5BORA 2NXJA 1PSWA 2PWYA 2ZCVA 2UXCB 4KNWA 2GPWA 2LE0A 3KZNA 1DT3A 4RABA 1FMTA 3M9WA 4BFSA 3K9WA 1PJ8A 5HCIA 1WU7A 3NAMA 3QLVA 2Q1UA 3IAM1 4UVEA 2C99A 1Q83A 1P44A 1U6KA 1XNHA 3IKJA 4KO8A 5DM0A 5HF8A 1DO8A 1QGDA 3NBKA 4YECA 4Z86A 5K0JA 3GEMA 4IX1A 4NV0A 4FYPA 3TRKA 4K26A 3RUCA 3VNSA 1SJ9A 1M1YA 2Y0PA 2FFJA 3C87A 4K6FA 1NF8A 2WOJA 1FRFS 4J7CA 3SEFA 4DVGA 1SBNE 3QW2A 1E59A 3FH0A 4GRDA 4Q1FA 4PZEA 1A7JA 1H2BA 1WKCA 4YFYA 2BLNA 4HLCA 1SEVA 1JWAB 4RZ3A 4D9CA 3PD1A 1YRWA 2FZGA 2HJSA 2WG0A 4LY3A 3ZKWA 1QPGA 2YC2C 1JEYA 2XB4A 3SHQA 1C0KA 1SBIA 5JWOA 1ZWKA 1R0KA 3VO2A 3OPYI 4PYKA 4OX9Y 2QORA 3D7KA 1DO2A 4P4TA 1I80A 3Q2IA 4M76B 3TDNA 5MGNA 1KRWA 3ZVMA 1EIWA 2XMCA 1ZKMA 3CH5A 3WLEA 1RQ7A 2FFAA 1L5YA 2JGNA 4NMXB 3RS4A 4EJ2A 1R4NB 3PR2B 1V35A 1A7AA 1XU7A 3D8HA 2HWYA 5CLQA 1YMUA 2PMBA 3CYFA 4MLCA 4H16A 2Q07A 3WV5A 1ZAYA 1XJ0A 4UKDA 1H1LB 2ZRAA 2Z30A 4EH1A 4EL5A 3K1AB 5DLQC 2BKUA 4B6FA 4EW6A 4KFRA 3W5BA 1YONA 1JVBA 3DV0A 1NFFA 2WWGA 2HSJA 3TW6A 3MGGA 5K8VA 3QUBA 1JIIA 4D9NA 4KPUB 3UXYA 1IN8A 4UUPA 4C78A 2HHJA 4B83A 1ZUWA 5CFOA 4AK9A 2IA5A 4NQRA 5HUJA 3DLPX 5A3VA 5JMOA 2CSUA 1ZSYA 4QECA 3M5CA 4D02A 1AJEA 4RIEA 4Q4AB 2HV8A 4BMSA 4LF6B 4PQRA 3IV6A 2G1KA 4TS9A 5FOTA 5KYWA 3VZQA 4XJXA 3IX7A 4JT9A 3ITDA 3N3BC 4A0SA 2W2KB 3PUJA 1FFAA 3DGFC 3UAOA 1XV5A 4FEEA 4W6QA 4Z3DA 3VPAA 4MVJI 2QUBA 2JLYA 3NIFB 5K3FB 2QX8A 4C3ZA 3A1SA 3P1JA 3Q3VA 3Q3HA 1QMGA 3LOQA 5A9RA 4RD1A 2HNBA 5CMLA 3RS5A 3E5RA 1FLAA 2FEXA 3WGJA 1PT6A 4QNNA 4RD2A 1AQIA 3Q98A 4PLWA 3RABA 4C0BA 1NGSA 2WILA 3QEOA 3DL4A 6ABPA 3BMQA 5I7EA 1S01A 3EPPA 1RQXA 1OW3B 4Q02A 4QVGA 1V6CA 1LW6E 3JTMA 4JD5A 1ZN2A 5ESWA 1YJQA 3NHRA 4DIUA 4PLHA 2XMZA 3L4BA 2W90A 3D7NA 3DOIA 4TWAA 4DB2A 3UA3A 5JAMA 3DEZA 2CNWD 3G7UA 1KI3A 2AR0A 3Q72A 1BA3A 1JWBB 4YCJA 4KI7A 1G16A 2YJ5A 4EF6A 2C07A 3JSAA 3F0TA 1CQIA 5E4FA 1ITZA 1CFZA 5TGTA 1U63A 3RRJA 5L45A 2ZUEA 1VKNA 4FHGA 1R6DA 3HV0A 4XFJA 4P31A 4RDCA 4D9GA 3VX3A 3AB3A 4LDAA 1VGRA 2L17A 4FHDA 2ZJ3A 4G25A 3EXEA 4MQ5A 1EK0A 4BQPA 1R74A 3H05A 3Q0TA 4MJXA 3BMNA 5F1PA 5AW1A 2JIOA 3ADCA 4G09A 1H6AA 2J07A 3DOOA 3AR4A 4RC9A 1VJGA 4EYGA 4E0BA 3KVNA 4N18A 1YQXA 3P0IA 4HDAA 4G1UC 2CB0A 3CZRA 4WCFA 4C4ZA 3NVKI 5AJZA 3WB0A 5JSUA 1MAAA 1USWA 4CIWA 3FCYA 1U3CA 5EUQB 4O0LA 3UB4A 2WHQA 3N2KA 3PYLA 1PR4A 4B82A 1LS6A 3I5XA 1W5EA 3R3HA 1W4BA 5JS2A 2AZDA 4MUJA 1JNXX 2UYOA 1I5OA 1JZQA 1EJ6A 1ODIA 2MYUA 4HXEB 4GS5A 1DX6A 1ENOA 1OXSC 5CVDA 3TPFA 5C5EA 3K0FA 5IVKA 2J5BA 1T9HA 3JVVA 2MTBA 2AW5A 2AXQA 4H7IA 3HC7A 3W1WA 1J9EA 1YDHA 4R6WA 5BN4A 1NQTA 3MCVA 3R6LA 4ILEA 4P3XA 4RGQA 2W42A 5ILQA 1MOPA 3HU3A 5K0TA 3MJ4A 3ONEA 1BFUA 3D8RA 4EVQA 1NW5A 1Z35A 2QD5A 2FPGA 4GM4A 4FXPA 2M1XA 1X7DA 5LBUA 3TUJC 3U49A 5IS2A 4GP7A 3N6XA 1FTWA 5TQ2A 2BM9A 3H19A 3E7PA 1WUJS 4L2IB 3TB6A 1L5HB 4Z49A 1V3UA 3TLEA 4PQYA 1UQRA 3ZI4A 1XTSA 3BPSA 1BYUA 1K88A 1GXSA 2F9MA 3MT0A 3NPAA 1RWKA 4HH4A 4XX0B 5EKTA 5G0UA 3VPBA 1T3LA 4EHKA 5I45A 4E51A 5LPNA 1OYYA 3P9CA 3V7FA 1WXIA 2HJ9A 2V74B 4TKVB 2NPFA 2G0TA 5IN4A 3S0JA 3GIWA 1A4IA 4DCTA 3B6MA 3VU1A 1YFKA 4WESB 1DQSA 4L51A 4Q6BA 3D3WA 4U2EA 4RTLA 1MF7A 1WM1A 2AHOA 3BWVA 1YRQA 1PR3A 3T0FA 3U44A 4II3A 4FDVA 4AG5A 5B30A 3KOXA 5KBYA 1NYQA 5J2UA 3SC4A 4DDMA 4B4OA 5AVJA 1ZRHA 4M8NE 5ARDA 3RR2A 3EZ2A 1UJ4A 4QZVA 3TTXA 2EVWX 5AD1A 3L9WA 3HUTA 4D6PA 1FDRA 4BP3A 3ESBA 2NXNA 4NK4A 4KQEA 1J33A 3GQVA 3ICVA 1L4YA 1P2SA 4JITA 4QQKA 3TBKA 3TLJA 1MX5A 3R7BA 1BW9A 2PJUA 2XE4A 2YWFA 3V1TC 3WNZA 3T1QA 4F21A 1NLZA 5CNJA 2DPXA 3VYTB 3U19A 3L7JA 2J7KA 3L9XA 5HKLA 3I0NA 1EU1A 3GJ0A 2ZS9A 4NU0A 1NVVR 5ALUA 4D3YA 1N9ZA 4LF7B 3AEUA 2IEYA 4UE3S 2OBXA 4RM3A 1PWXA 1RAHA 1HYGA 2IOFA 2V5AA 2WTMA 5CDGA 1SELA 1ZAKA 2FN9A 3I39X 3A6DA 3BJMA 3QV1A 3H5RA 3TEJA 3M81A 4PG7A 1NATA 1ORWA 4F38A 4N5LA 5KQGA 1H0HA 4QUJA 3ND6A 1EZZA 5JWHA 1EDOA 4ZWNA 4C0JA 2D0IA 2ESRA 1EBBA 3WKCA 3X2SA 2GPNA 3L4SO 1NYLA 2V7VA 3A3YA 3FGNA 3N05A 4WN9B 1EQ2A 1A98A 2KS6A 4FI3F 3WKDA 4BZQA 3QVTA 1JR2A 4A36A 2EX0A 2OHIA 1EWKA 3FJ1A 5CDFA 4F1JA 3KK0A 3T4XA 5KTTA 1GTSA 3DZBA 4ZA2A 3I53A 4J49A 4MHOA 3EC2A 4X1YA 4O4HB 4TXMA 1UKAA 2G1UA 3TDMA 3PC4A 4FDUA 3V8NA 5J5CA 3QMVA 5HR5A 2YWHA 3FR7A 3H1EA 1KE2A 2OCXA 4GOKA 4DNOA 1IY1A 1XMXA 1EVIA 3CLTD 1FDOA 2IQIA 2WF6A 3K1YA 1SY7A 1TLTA 1YB6A 1RHJA 3H65A 1XK6A 2ZT8A 4KIUA 4DUZB 5IM4A 4MROA 3MXTA 3BWEA 1NRXA 1Y0BA 2G7ZA 2WYWA 1HDZA 4JODA 1QQAA 5DSXA 3UK2A 3LKZA 3KP1A 4NJEB 1Z62A 2QL6A 3PVSA 5GVSA 1I01A 1Q21A 2POQX 1RP7A 3D6HA 2C4UA 2WUWE 2WSBA 3SSAA 5H16A 4DJ5X 3ZD6A 1RWQA 1PDWA 3W3AA 4FZVA 4KV9A 3BFPA 3IVAA 1CX9B 2AC7A 5EMNA 5K2OA 3L7BA 1FDIA 3NIGB 4XA8A 5TT1A 3S1AA 5IFLA 4JI2B 2MINA 2AN3A 2K5UA 3NLLA 1NE7A 3T3DA 2FDCA 3C74A 2YX1A 1PP4A 1B0UA 1IC6A 4K9RA 4Q9JA 4F85A 5BXQC 6LDHA 5ED0A 2G07A 2BMJA 2VQ3A 4BNLA 1JJIA 4WOBA 4ZP1A 3ETNA 3K0CA 1MB9A 3URKA 2IYPA 3D6TB 3D81A 4R1MA 4M54A 3IO3A 4Q16A 3SFVA 5FNVF 3LQRA 1T6YA 3JQBC 5FOXA 1KTIA 1NV8A 3L0OA 1P9NA 1MO2A 2ZKIA 1NJFA 1RHMA 1BWRA 2X8AA 4MQMA 4LXYA 1E3EA 1WG8A 1YV9A 2PEYA 5AT1A 3RM3A 3UATA 3UN1A 3U4QB 2R3SA 4N4AA 2BBTA 2GA9A 2VSXA 3KZMA 3OC6A 4K3UA 1GKIA 1TQHA 4PAMA 4TZTA 2B9VA 2Y71A 5FUYA 3DEJA 3CWZA 1BS1A 4KGXA 3SBXA 4DCSA 4OHKA 3EVFA 4WKPA 4GYWA 3T5DA 4YWHA 2XUOA 3TRIA 1FMJA 221PA 3IDOA 1EVYA 4XXHA 3CUTA 1YHYA 2C8KA 1CE8A 3TSYA 4D8TA 1PJSA 3ACCA 1N2HA 4PYLA 3QVJA 2HMYB 2C88A 2J9XB 2WZCA 3DE0X 3HBNA 3ANSA 3BULA 4HDNA 4S1VA 5CP8A 5FJIA 3HK2A 4FINA 4FILA 3EXAA 3HFGA 5C4IA 5FOSA 2JGMA 1J1ZA 2W6OA 1YDMA 3DZ8A 3KM0A 4ZODA 4MVCA 2EGHA 3K3PA 4JA0A 5A71A 4S0ZA 3WLAA 1W85A 2WC1A 4MV4A 4AG6A 4P32A 5EHNA 4DLKA 1T13A 3W4IA 1T15A 2VWQA 2ZBVA 4X8LA 4IEEA 1K6XA 3L6RA 5DJ5A 5JW6A 4B5KA 3UAYA 4U6SA 3T6KA 1G9TA 2VF5X 2W6IA 4FNGA 1Y3FE 2R86A 3BD6A 1KO5A 1U8CB 4UCWA 5EP4A 1JDTA 4TOIA 2Z5FA 4Q3CA 4UUAA 3I9JA 2VKQA 4PLYA 4CKEA 2R84A 4OXRA 1HEUA 2EHDA 3E3LA 1FDVA 3DTYA 3FUXA 3K70B 2FYTA 1ES9A 1LPAB 2G70A 5DLYA 3QM1A 4B6SA 2RKOA 4I6GA 3AR5A 4QYWA 5JAHA 5C3MA 1B0AA 2ZJ1A 4B6JA 1EX1A 1LBIA 4FFVA 4A6XA 2VJLA 3GA0A 4HAWA 3GH3A 1Y6GA 5DNYB 1NQOA 3N86A 1UZLA 3GLSA 4W5HA 1KFEB 2OHVA 3TLBA 6Q21A 3QJYA 5CB4F 1Q7RA 4YCMA 3TN7A 1OVGA 3C5HA 5HE8A 1Q3KA 1NW7A 1A82A 4URFA 3QF4A 3RTDA 1Z6ZA 2AQHA 2ZPAA 4H0FA 4Y7CA 1WVGA 4O4JB 4JX8A 4DDHA 5LZ5A 2P5TB 5BMVF 4CQMB 3JX9A 2D7DA 5EXXA 3RTGA 4UHEA 1J8MF 3BWBA 4U8GA 2O6LA 5BW8A 3SHVA 3Q3IA 4IDNA 3AHIA 1JH8A 1BXGB 4J4HA 4DHWA 5JTTA 2X6TA 2X2OA 1UKYA 1WDTA 1V37A 2D1SA 2FPOA 2NSLA 2TMKA 3PWTA 3S4YA 5DXAA 1C80A 3UTDA 4H60A 4DDKA 5FV4A 1N6IA 5HA5A 2ONCA 2FPIA 4R2HA 4F9GA 1QCDA 5M34A 4BRUA 5KYYA 1X2EA 1TEXA 3PQ4A 4NX2A 4ER6A 1HNXB 4HGYA 3MN1A 2P2CA 4WLVA 1Z5PA 1AV6A 2R5FA 4HGQA 1XCJA 2JGFA 2VN8A 2CLEB 1CNFA 2EX4A 1JFRA 2IEGA 1EAMA 1SQGA 3AHDA 4GUDA 3RHZA 1QZ3A 4MRRA 3AB8A 4OBWA 1V71A 1SVNA 1WPXA 2AF3C 1Z13A 1OV4A 4LG1A 3R8CA 1U6IA 1UKEA 2XBMA 3LPLA 1N2EA 1D4FA 4JI5B 3FWYA 4XFKA 4X64B 4EAQA 3OFKA 3UVEA 1QG4A 3HJBA 4MAAA 5LNK1 3U5ZB 3V3TA 3F3MA 1WBDA 1AKTA 4J43A 2AMFA 3AOGA 3W3AD 4P22A 1XVTA 5EHQA 4D6XA 1SOVA 4F56A 1RIIA 3QQPA 4GWLA 5KNDA 4U9UA 2P9HA 3G82C 3OP1A 4ENTA 1I24A 1BDBA 4J90A 4IQGA 3UWMA 1Q44A 2OQRA 1K2WA 1T5SA 4YQFA 3O2NA 3K4HA 1Z5GA 4AF6A 3DXYA 2DLCX 4B84A 1NZJA 3OI7A 3PRYA 5IARA 3L7MA 2PQMA 4LOAA 3UANA 3HYRA 4Q4CA 3M6LA 2BP7B 1QE5A 1IOLA 2I4LA 2Z5VA 1DBPA 4EUFA 4AT1A 4H1WA 1RWVA 4JC4A 5JXWA 4A4DA 1A9OA 2XW6A 1N2XA 4ARZB 1UBFA 2YZGA 4I5EA 3T1VA 1R0BA 2ID8A 3QBVA 4YRTA 2APJA 4HWPA 3TNLA 4YMVA 3S2IA 1GU7A 3RAEC 4KAJA 1NI3A 3AQIA 4OH1A 2FEAA 4ED9A 4GLOA 1PNQA 1C1HA 1N7JA 1T2AA 4J0IA 5GZ3A 1T1JA 2WMDA 3EGVA 5EE3A 3VR0A 3GGGA 2H4WA 1SBZA 2YCBA 4UW9A 5FEUA 4M3NA 4LK2A 2A9RA 1NJSA 4HZGA 4U8HA 4O4IA 4WOPA 4X1OA 4KFCA 3TQCA 5HG0A 3X3HA 1VBMA 2FA9A 2KX7A 4V0QA 2XGSA 5FL7A 4UEQA 4Z9YA 3KAKA 3ANLA 1U0RA 3MQFA 4B45A 4A0FA 4EG1A 3H2ZA 3AUYA 1DC4A 1R9MA 3ZVRA 4TQ9A 2R1VB 5ICFA 3W1EA 3AQ4A 2AT1A 4AJKA 2A5YB 2ZJ5A 3LC0A 1IB0A 1JSRA 2PANA 1VRVA 1WB6A 3DTVB 1XROA 1TM5E 4IBOA 2ILVA 3B70A 1MB0A 2JFPA 2PSSA 3DQQA 4LE0A 3HRIA 2JRCA 1DEOA 2ISCA 1SCIA 2NUAA 3CTPA 3DOFA 5U4QA 2XMGA 2PM8A 3I2JA 2ZAOA 2M32A 1JG7A 5IULC 1N8TA 1C4KA 4G9GA 2W6ID 4K6GA 4MWGA 1O6GA 2H2HA 2D2XA 4ZI5A 4J0KA 3R7WB 1UR5A 3N59A 2ZTVA 4R84A 5G3YA 2LCQA 5J1SB 3SAJA 2Y0EA 3HVKA 2CMKA 2J0UB 1US8A 2C92A 4E1AA 5KTSA 4QEDA 2LGJA 4UE6A 3UUWA 2QG9A 1UDWA 4YAFA 1Q11A 2IHUA 3GQBA 5AOVA 2R1ZA 1ZVVA 3ABOB 1ZHFA 2QZ4A 3TK1A 2VPPA 2XOXA 3LBNA 2X14A 2ZSEA 5FCDA 4IW3B 2B4QA 3CIOA 1NN5A 3INRA 1MFZA 4TYWA 2CT8A 2ZSJA 3K30A 1C2YA 1LJUA 3HY4A 4HDOB 4RDIA 4DDVA 4EI8A 4AKIA 4UZSA 1GZ4A 4MS3A 3NDBB 3A9RA 2P3OA 3R7AA 3G68A 2P90A 1QV7A 1D4AA 1JMYA 2IE8A 3I2HA 4BNMA 3D8SA 2TS1A 3NTQA 1DAIA 4DLBA 1IVYA 5AM4A 1K9SA 1QVAA 2GZ3A 3T3IA 2AL7A 4UCXA 1AQYA 2R8YA 5DI9A 3E53A 2ZPUA 2RAUA 3IVGA 1T0HB 4KXMA 1E9BA 1FVHA 2ZJ7A 1J2YA 3JZDA 1JVSA 4RQAA 1DT5A 1PF7E 2HNKA 2I2XB 4G0OA 3UMFA 1ZD2P 4BX8A 1NRWA 2QSJA 1J4AA 2I29A 3KLPX 4JUAA 4ZEWA 4B4WA 4DEYA 5FOQA 1E9VA 1A1SA 4BDTA 3QOXA 3N0TA 4Z2YA 3TTVA 4AYWA 1KO8A 5KSYA 2F55A 3KNZA 1UBEA 3S1SA 1FOEB 4N3CA 2ZAIA 3OPYB 3KPWA 3H9UA 3HR4A 5FO1A 3FOAA 1XNRB 4BNHA 4E5SA 1RLOA 3HPQA 3GGCA 4A8PA 4G1VA 3BRCA 1E6UA 5K0LA 3T3GA 4A23A 5CEEA 3EG9B 1MOZA 1HV8A 1T4CA 1F48A 2HJRA 2PL3A 5D1HA 2JFYA 2Q0SA 3G5MA 3SE0A 5BN5A 2PAFA 1ACJA 4WNCA 3D6VA 2B6HA 4MULA 4BNNA 5DNDA 3LCUA 4NCIA 4KX5A 2GZ2A 2QVZX 5BWMA 5LUBA 4LXGA 1IJFA 3H9GA 4GF5A 5JROA 5AJTA 3BHNA 4RCYA 3ZW7A 5JRZA 1V9CA 3FRJA 5KNDD 1ODCA 2J41A 2VCYA 5DBGA 2EW1A 2PA0A 5ECGC 1IEXA 1TGVA 2HF2A 1LVHA 1ZC4A 2ZRDA 2AJ8A 4JHLA 1E3TA 2C5BA 3STWA 3WSVA 3SJZA 1ACLA 5C8VA 4E6EA 1L5MA 3DNMA 3N0RA 4LOJA 4C7VA 3G0HA 2GM5A 2VK4A 3IE2A 1FFXB 3K1JA 4I4TA 2F3PA 4BB6A 3GLIA 3UOGA 4D9HA 5TQ0B 1O94C 2ZR8A 2Y76A 3W5VA 2CUKA 3UH1A 3DZJA 1V8BA 4KLCA 2YZMA 1JBQA 2E82A 4RIIA 1Q20A 1GG2A 2AF4C 3DKVA 3CNLA 3R6WA 4BC1A 2QSUA 5A03A 4B44A 1LQ2A 4B73A 5L3QA 3K71B 3II6X 4KX3A 3K94A 4KDRA 2PLAA 1T3GA 3NORA 3B5EA 4YO8A 1C8BA 1PHRA 2GH1A 3AB7A 1Q1NA 4CMEA 1XJQA 3NQ41 1E2UA 2CLKB 4C01A 3AEXA 3UKOA 4G5YA 1MC5A 4RDHA 4JL8A 4WACA 3OTQA 3FTEA 1IZYA 1B16A 2JPDA 5D6OA 1C2TA 3OX1A 3U7EB 3JQDA 4XE5A 5G2OA 4WERA 5CCXA 1XF9A 3LRXA 4PGHA 3CNHA 5LDDC 1H2YA 1E60A 1LPBB 4JP3A 3GK3A 5B55A 1X74A 1W4LA 2C78A 5EMKA 1LV7A 2ZSIA 3MGKA 4GG1A 4CTJA 2IYAA 3BAZA 2JAOA 4CM4A 4K2AA 1T0PA 3R0QA 5T67A 4RFLA 3RIMA 3G9XA 4CKXA 1R6BX 3IOBA 1QLWA 1M6WA 2FW7A 3P9RA 2QTFA 3GI1A 2WIFA 5FA5A 3E18A 3IPXA 4ZVQA 3BK2A 4NOLA 2FZCA 2G5TA 3DHEA 3WB1A 4BO6A 3LQQA 3KPJA 4IIJF 4I3GA 3Q5DA 2QYOA 5KIAA 1N3LA 1M2OA 2M6KA 1HE8B 3H87A 1XN4A 2HYIC 5AM2A 4NE7A 1UPXA 4NONA 2TMYA 4ZOAA 5KX5F 3LW8A 2J1LA 1D2EA 1Z7YA 4YJFB 5CB4B 3ND9A 1RHRA 4C4AA 4J9UE 3LCRA 4CFZA 2WR8A 4V0ME 3MRVA 3FZGA 2DU8A 3OEEA 621PA 1R5JA 2JFUA 1FQWA 3Q9LA 1M2KA 4BQOA 2CV1A 4UATA 1EQAA 5K1ZA 5IHPA 1U0SY 2FOXA 4L22A 1QDEA 2ZBPA 3OQJA 2NMVA 4C7OA 5LYJA 3S2UA 1NUQA 1YS1X 2B8JA 4IJMA 3DQZA 1U0TA 4I5GA 3FNRA 4N0MA 3EGCA 5BO5A 2W70A 4B81A 1SUCA 5I4IA 1LZKA 3TKLA 5KU7A 2Q45A 4IRXA 3CPEA 1RR6A 2PRKA 3OZBA 5BMOA 2J4FA 1CIVA 3A1TA 5D8DA 5I9BA 4WBNF 3U1BA 3U7GA 4C9BA 1Z38A 5KEIA 2B78A 1UK8A 5C52B 2AG8A 4L76A 5CHEA 4DILA 2ONJA 4ALJA 4X94A 3S2ZA 5BR8B 4Q3LA 3IKMB 1RM3A 3Q9NA 3D59A 5IT5A 4M7PA 4DIBA 2VT2A 2VS1A 5CVCA 3C1OA 2BE7A 1Z6TA 2DWOA 2ZUSA 4MV8A 2CXPA 4CT0A 2RKWA 4E2YA 4OUDA 5D85A 4ZVUA 1PJ3A 4FYVA 2G9ZA 3OMXA 5JJCA 4GXQA 4LRYA 1L1RA 1TRKA 1NG9A 3PEUA 4OYHA 4WEQA 5G1OA 2CXXA 4EUEA 4M83A 4XWWA 3SC6A 2HBZA 1TUGA 3MZ0A 4LC9A 3K73O 1NBEA 3ZJTA 4R8VA 5SY9A 3VR1A 5KJ1A 3FDXA 4DQXA 1T8UA 1NMYA 1YS6A 3IAHA 4HNQA 3HR8A 2Q4EA 1MC1A 2FQQA 1NRIA 1YB2A 3L7DA 4FUTA 4HS4A 1N0WA 3S7TA 3F74A 1EVQA 5FA8A 2FOIA 1A1VA 4TV8B 5KYKA 5TPWB 1SM4A 2C2GA 1U8UA 2C84A 2K87A 4PQFA 2PUFA 4US0R 3BGSA 1J9ZA 5L9AA 2VTEA 4HAIA 2P79A 3MD9A 2OCDA 1UADA 3ZS9A 1N1DA 4XDZA 2IOQA 4L78A 5LQNA 1U8XX 4RF2A 1IJKA 3BKXA 2RHTA 1VRCA 3CONA 4JL6A 1CYEA 2HUNA 1MOQA 3CCCA 2XXBA 3H2KA 2OV4A 4XD2A 1GV1A 4F5ZA 4MPTA 3RWOA 3CBQA 5C51B 2WJAA 1U7UA 2Z3WA 1JE1A 3DH0A 3NOOA 1S2DA 2NU9A 4UVHA 3TOSA 2XNJA 4GGMX 4BO3A 4DMHA 1G0NA 3C15C 4OXNA 4YLGA 4YRZA 3BWXA 2DBVO 1LY1A 1NXWA 2R751 1YVDA 4N7JA 5TRTA 4B3MB 1A7KA 1U0NA 2QTBA 3W6ZA 5TT0A 4A0GA 5AM3A 3NAGA 5C8YA 3CUWA 3JARB 1YQEA 2QV7A 4O59O 1Q1GA 5I9SA 4A5OA 3PFCA 4UZEA 1OU0A 2Q6TA 2QRKA 2JEOA 3MD0A 3DR5A 1TNDA 2B20A 1YTLA 3T52A 3EIHA 3KZCA 4JJ6A 1BH6A 2GO1A 1RPAA 5AVSA 4JJEA 1K86A 3K16A 1EFHA 1YF3A 3V4VB 5JVDF 1GCOA 5FI5A 5A4AA 1CUVA 1ZD8A 2X3YA 1U2GA 3A0UA 3O4FA 3GJ8A 3TTUA 3IODA 2BBSA 3Q3JB 3V1UA 2VEDA 2WZQA 3GAAA 1P1JA 3LGAA 1DHTA 4LEIA 4MW9A 5DHTA 5FJJA 3RF6A 4CR7A 2CLHB 1J42A 2L82A 5J2TB 2D3WA 4PLCA 1T10A 2IHTA 3BXGA 4K40A 3SC2A 4HQFA 3W06A 2RGGA 5ITWA 3FJYA 2BKVA 3D9QX 3Q5EA 4HEHA 4M36A 5JU6A 4MI1A 5KJ6A 3ZIAD 3KYDA 4CI0B 1NP6A 4JU8A 2IZOA 1XZJA 1XRRA 3R8XA 1BWPA 4E3WA 5FF9A 5DX8A 1YQQA 1K5DA 1K0FA 3NRJA 4ZOEA 1U0BB 2OGTA 3F7TA 3GX1A 4NYMR 3R7SA 3BG5A 3V2UA 4FX2A 5G4KA 4RKFA 2O2IA 4BLSA 2PT7A 1RKUA 2UVQA 2JDIA 3DONA 1KERA 3HE3A 3OEED 1DMRA 3EIFA 4Z4FA 1G20A 3EZ7A 2A5GA 2F2TA 2FR8C 2QPAA 2V45A 3BL8A 3IIMA 3QE2A 4Y2RA 4ZU3A 5B7NA 5BRAA 3DBHA 1Y37A 1FSZA 2J08A 2H1VA 1DC3A 2ABWA 4X7BA 1RJ9A 3IUEA 3BB3A 3CJRA 3HLKA 1WY7A 2MSNA 1JXMA 1NT2A 1ZYUA 2P6PA 3P0FA 2CCJA 3RU3A 4EY8A 4CTNA 1SG6A 3QNMA 1XDUA 1Q16A 5EP3A 5DGXA 3I4FA 1HNZB 3A32A 6PFKA 1YR8A 4CM1A 1M2VA 4MMXB 2QRZA 1K1EA 1NVTA 1QIKA 3O26A 3DHVA 1U2ZA 4IMRA 2I2AA 1D4ZA 3I09A 4PE5B 2YFYA 4IF4A 4TYPA 2QGNA 5HPYB 2QRJA 2HXYA 2P30A 2VDWB 3DVSX 4WOCA 5KYUB 4L7VA 4AX4A 4HNAA 1RYBA 2AOVA 1ZSNA 2CFCA 3L1KA 3P2JA 3WYDA 2JB9A 1TFRA 3FPCA 3KXIA 1MIOB 1JLRA 1IAQA 1YOBA 2JHPA 3MYYA 2BFOA 5LDGA 3O21A 2FWNA 1C9KA 1XU9A 2H0RA 1CR1A 3LK7A 1E58A 2IQ5A 1YBVA 1ZVQA 2IEBA 2ZYRA 2JI7A 3U3XA 3TM4A 3WGNA 4A6DA 5JT1A 3AONB 4Y1EA 3A6LA 3KSAC 4B3SB 2VAXA 3OQPA 3PUKA 2GZMA 4ZO6A 3JV7A 4IINA 1OX5A 2JKVA 1KXJA 1YZHA 2PKYX 1DOZA 2BH9A 2WFMA 4FYKA 2EKLA 1V8PA 2NO9A 2VFAA 5CFRA 1RRVA 3A9TA 2ONKA 4MK4A 4AQDA 1R8YA 4Z7NB 3R0ZA 4KXWA 3LQFA 1FNDA 1I33A 4JVNA 1A9QA 1V1JA 2HRBA 1P45A 4RYDA 3V1LA 3PGJA 4PGAA 1K6MA 1M0TA 4YK7A 3C1AA 4NEHB 1MZVA 4FI3C 4YO7A 3W6PA 3OPXA 4X3PA 4DCNA 3TXYA 1ZIDA 2WYOA 3D3EA 1A8PA 4EGAA 4YEDA 1ZJ5A 5JZOA 1TZBA 3T94A 4FOLA 2I6SA 2EYUA 2ZQYA 1S8NA 3T4EA 4L6CA 1R10A 1PZGA 2VOEA 3W6NA 4BBJA 1WXFA 4IDAA 3QY9A 1ZMOA 1RQ2A 1SZPA 3IEPA 1RHUA 4QYIB 4NYJQ 2GN8A 2WINI 1WVIA 2W4QA 4KQ2A 4BIIA 4EBBA 3LT0A 3ER6A 3DAHA 4BYMA 4B3RB 3AR3A 4P2GA 1AA9A 1SXIA 5K0SA 3AI1A 4MRPA 1GNQA 3BXEA 1L0BA 3VDXA 5C7YA 4C2UA 2OHJA 2Y1CA 1G8GA 5KUTA 3LBYA 4RMHA 1Z2CA 1D2GA 1R4NA 2NZJA 3PV0A 3W5AA 2E7ZA 1J0EA 3F5QA 3TKAA 1FTYA 3DLAA 4KDCA 4QEKA 3CRW1 4YYZA 1B8PA 2O2DA 1PK9A 2PZEA 2WEKA 3BX1A 4I14A 2ENWA 4ZKDA 1FUKA 1VG0B 1WVMA 2DX7A 2OGWA 2YIMA 1IBMB 2IH4A 2PUDA 1CZKA 4C0HA 3HJRA 4N5NA 2X4DA 1Z4NA 3G1WA 3K1AA 3MUNA 3AUTA 3GUCA 4X0EA 3TF5A 3U3RA 2FY8A 4G36A 3DLCA 2FG6C 4L8WB 4C43A 4DLSA 1CQJB 3HBMA 3PG5A 5DBHX 2ID9A 3IT3A 2DETA 4MKRA 1E20A 3WADA 5BSEA 3O8OB 2YV3A 4KPUA 1G21B 3GZJA 3NBYC 4AJ2A 1VCOA 4DWWA 1ZM3A 1E63A 2BJHA 2PGJA 2XQVA 4F4IA 1ZN7A 2RAVA 2X0RA 1G291 3WGUA 3EOZA 4Q4AA 1G8JA 1NIJA 1GOTA 2C3MA 2VXCA 3HZHA 3MJFA 1VKZA 3RSHA 3DMHA 2WWHA 4OGLA 5M5BA 1GTG1 4HPJB 4CN9A 4ZICA 1H8EA 2V4MA 4PPNA 2W2KA 5L7YA 4LI0A 1LI5A 1XQ6A 2CJPA 2FSIA 3KT3A 2JFOA 5H7XA 4ZT3A 3UMSA 2G1PA 4XUGB 3CB2A 4X62B 4A03A 5K3FA 2CD7A 4E12A 5LLTA 1W0KA 3VGPA 1RQRA 2GJ9A 3SHTA 1SC4A 1P2TA 1UP4A 1VMAA 2PGAA 3H7IA 1QMPA 1XBTA 3R3JA 1MTOA 4Q01A 4XIIA 4E1VA 1OXBB 4CM7A 2FE4A 4YCSA 3G02A 3OTWA 4RCVA 2F3TA 5BYBA 3GC6A 3AJ9A 4IJUA 2QTZA 1LA2A 4MIYA 1PVVA 1TM4E 3NRCA 4RV4A 1HTTA 4M8SA 1GPNA 2HXGA 5KSOA 1CUFA 2C96A 2Z8YA 1F3LA 3ILYA 4IUCS 3M2TA 1RRPA 4PFJA 1TQ6A 1U99A 2DRIA 2GJKA 4PTLA 2OAQ1 5HJ5A 5TMDA 1ZD9A 2BGKA 5KVAA 1OH6A 1C50A 2EJCA 1EVLA 1XTQA 2PNFA 4E70A 4OHFA 1J2EA 1SHLA 3A1WA 3TAUA 1EP2B 4R5MA 3RI3A 3RHFA 1MO4A 3I1YA 3SSNA 3ILXA 4PCVA 4NFHA 1QP0A 1OUMA 4BLOA 3G8CA 5FKJA 5TF0A 1L5QA 3DZIA 2HRCA 4A8JC 3FTFA 2Q2VA 3KXKA 1TVCA 4MRAA 1P77A 2OXCA 1LCIA 4BKOA 5JQGA 4C21A 4POAA 5B37A 1G3QA 3GELA 2G5PA 5ECDA 2CLIB 5KQPA 1E3SA 1YH3A 2VJDA 3U7FB 1D8TA 4LBVA 4QXQA 4UDOA 3TSAA 5KDOA 2H1FA 2D00A 4LYJA 2A3NA 3PHJA 3WZMA 2DP4E 1I10A 4R1UA 2C3OA 1J0DA 3N5KA 4HAVA 4IV0A 2D4HA 5LXTB 1CF4A 3A1CA 3D4NA 3TD6A 4KQGA 4PQGA 5LSAA 2CLLB 4YAIA 2VQDA 2JCVA 1SVKA 3AF3A 3I5MA 3TPCA 4ITVA 3D7MA 4AY6A 3RNOA 2DR3A 1L5SA 1BMFD 3B78A 4UU0A 5DB4A 4KEAA 3EH2A 1SKMA 2DWQA 2DH5A 2O20A 4FFBB 4GOOD 4DZRA 2JHCA 3FWNA 4O3MA 1XQ9A 1P1BA 2AVNA 1VKJA 3ELUA 3GHYA 3MILA 1LRKA 1JT2A 1JLLB 1JUDA 1Z36A 3HSKA 1M7GA 5IKEA 3CLRC 5JFOA 1JG4A 4YR7A 2JLCA 5DP1A 3PE3A 5B12A 2ZTUA 1EFRA 2G3YA 4JMLA 4MVJP 3RQSA 1I1OA 1RC1A 4ZJZA 2GSDA 1KE1A 4MCAA 4TWBA 2XODA 3MK31 4RE6A 1Q7BA 1FXUA 3NDRA 4L2IA 4RV5A 5PNTA 1L5HA 4IPTA 1F5NA 1NBHA 3QKWA 5AW5A 3MUOA 3W6OA 2P6NA 6REQB 2C0CA 2I55A 5LD2C 2NV2B 2BUBA 4XX0A 4KN5A 5COAA 1CZRA 5WRFA 1W76A 3SIWA 3ZV5A 4D0SA 2BCJQ 4TT3A 1HL3A 1Y6RA 1REQB 4KW7A 4TKVA 3AMVA 4WBXC 3WRXA 4GDMA 4WESA 2A35A 2WHEA 1YCHA 3C3YA 3ED5A 4Q4DA 3BJRA 4N3AA 1KR2A 2V7GA 4PN7A 1ND5A 2BUCA 2IHNA 1T9GR 2O4UX 2HFKA 2E0IA 5HS6A 3OFSA 2D1YA 2XTJA 4IDGA 4Q21A 5DLPA 4EEXA 3DKIA 4LOIA 1QO0A 2ZYTX 2IT1A 1JQDA 3L8DA 4NAVA 3V8MA 1HFEL 1KRXA 4KR3A 4N5HX 3AFMA 4C22A 1J8VA 4Z0HO 3K53A 1VE5A 2Q9CA 3U48A 3C5WP 4ZAZA 4GKJB 4JLJA 4XYGA 3AK4A 3LWDA 1I30A 3HWX1 3FFXA 2IXBA 5EJ5A 4MPRA 4DCGA 2R0QC 1CSEE 5HQJA 4B34A 1LD3A 2FGJA 3OKPA 3DAFA 2CZCA 3UJ9A 3D2CA 5HQ3B 5J4YA 1FL9A 2C8JA 1EFCA 2FCAA 3HA7A 4ZPXA 1F2TB 5JXGA 1KIFA 5CH5A 1OLSB 4C05A 4I55B 2ORIA 2R79A 4FWBA 4EVRA 2OP0A 4AS1A 1UBCA 1KDTA 5F2NA 2N46A 5SYNA 2VA8A 3SZMA 1QH8B 3Q40A 5EXEA 4WXMA 1JVNA 4MLZA 1H8ED 1LPNA 3AC0A 4HTFB 3TBHA 1PG0A 3VPXA 5K0EA 5L6MB 3OD5A 5EA2A 1XJ5A 1QORA 4O33A 3RAGA 2PUJA 2QVLA 5NULA 3D6MA 3A6JA 3DE7X 4Y6GB 1D3AA 1N0UA 1S2IA 3OQHA 1HUQA 1G64A 2AYZA 2FKNA 3K32A 1Y8CA 4F84A 1V41E 4LBYA 5FAKA 2P9YA 1J7JA 3BORA 1D6MA 1EB9A 1BCSB 3AJAA 3IQZA 4WN9A 4GLJA 4B7AA 1AGNA 2ZSUA 1WR8A 1X14A 4G5QA 3C43A 3JVDA 1KYQA 3GUYA 3GNSA 2RGXA 4MSUA 1BJRE 1YR7A 4AUMA 1HFWA 4IGKA 4O4HA 3GGSA 5LA6F 3Q2OA 4YLYA 2O07A 3H6HA 1SC1A 1Z6XA 4RE5A 5KNBH 2X7HA 1SOMA 5J58A 4CLDA 2YL2A 1CQPA 4NATA 3UPTA 5JZMA 4QT0A 5SYAA 4W7IA 5IF9A 1LH0A 5JCOC 3CMMA 4NMHA