5JCJA

Trypanosoma brucei ptr1 in complex with inhibitor nmt-h037 (compound 7)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 94
structure length 249
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jcjA00
3CPSA 3NTRA 3ADOA 2IRWA 5BQFA 3INRA 1I33A 4DLAA 4PZDA 1U1IA 2CY0A 3K92A 3AW9A 3JD0A 2GYYA 4EZBA 4PLYA 5KCZA 5KJ6A 2VHVA 1TVEA 2HO5A 1GYQA 3ZWOA 3OIFA 3VVBA 3R3SA 3AY6A 4RGBA 1VL0A 4R1SA 2DBZA 4GWKA 4XIYA 5DBIA 1D7OA 1EUCA 2G82A 1KYQA 2E4AA 5HBRA 1DFIA 3AOEC 3RU9A 4DYDA 4WLNA 1ARZA 2D1YA 4JCOA 3B1KA 4JIGA 4QEDA 1SMKA 4BS9A 3RAJA 1Y9EA 1PGPA 2DKNA 1LA2A 1ML3A 5JYDA 4ZGWA 3GT0A 3JD1A 4XJTA 3ULKA 4AJJA 3OQ6A 4UVDA 4CLDA 3VPFA 3VOSA 2LDXA 1PGOA 2I5PO 2DT5A 1H9AA 1ZSVA 3RFVA 1BDMA 5IG2A 5CEFA 1JW9B 1PJTA 3GVHA 3GEGA 1Y9AA 1HLPA 2WD7A 1I10A 4BNZA 5T8KA 2DPHA 4KOAA 4PG8A 3KRTA 5JAMA 1VC2A 2HMUA 4J7XA 1ZK4A 2X0IA 5I8ZA 3QJ5A 3I9MA 4YCAA 3AUTA 1JKJA 2Q46A 2QZ9A 4YJGB 2HRBA 4WNIA 3WJAA 3NAQA 4M54A 3UCEA 4NNJA 4WCDA 2RHRA 4MINA 3KUXA 3PIDA 4RPJA 3VVCA 2DBVO 3HB5X 1R4MA 2HK9A 3JQ8B 1E7SA 1HEUA 2AEMA 2EEZA 1U28A 3RC1A 3D5QA 3QSGA 4WOKA 3U4HA 1NPYA 1P1KA 1TEHA 2A4KA 4CM8B 1DFGA 3DBRB 3DQPA 4JX8A 1ENOA 5JNLA 4DIBA 4NK5A 3JCZA 2R2GA 4AG3A 2C5AA 4FS3A 1PJQA 2OFPA 3D4NA 1KVUA 1W0CA 2BHLA 4YDRA 1ZBQA 3SJUA 3TDKA 4OM8A 4YEDA 1AGNA 1HTBA 2AEJA 3CMMA 2CDCA 2YJZA 4JLWA 5JO9A 4BO6A 5DT9A 4XYBA 5JY1A 3JQGB 2NU9A 4B3IA 3F5SA 4R54A 2X9NA 4M1QA 4CMAA 3FNFA 4E31A 1SO8A 5ITWA 1NWCA 4AVYA 1K2WA 2PZMA 4XRRA 2FR0A 5B1YA 3ONFA 4F46A 1H6DA 1P0FA 2PA3A 4PIVA 1ZW1A 3IMFA 2OUIA 3IL2A 3EC7A 1A7KA 1Q0QA 3N58A 2FP4A 2HMVA 1C0PA 2QG4A 2H6EA 1PL7A 1E1NA 4ZRMA 3OECA 5K6AC 1RPNA 3Q6IA 1LRKA 4Z0PA 4WK6A 4GH5A 3GRPA 4IMPA 3AUSA 4GKVA 4FC6A 2PFGA 3H9EO 1U3VA 2Y99A 4XB2A 1QP8A 5T6BA 1GPJA 2JHGA 3I4FA 2ZCUA 4OSPA 3K2BA 1ZSYA 1CRWG 2PNFA 1PTJA 3V1UA 1M76A 2I66A 1UUFA 4RCVA 5A5EA 1ZK3A 1TB4A 4KTVE 3OQBA 4MVJA 2HMWA 1DHTA 4L8VA 3WGGA 4WCFC 5G0WA 4D45A 3DWFA 5G0VA 3ZWMA 1PL8A 4YAKA 4BL5A 4ZQFA 2YW9A 3L6EA 3ADPA 3DBVO 4NU6A 2AE2A 2C7GA 1YS4A 4CMHA 1UH5A 5C7IO 1XQ1A 2CUKA 3Q2KA 4PCVA 4BGUA 4IXTA 2NU6A 3RUAA 5AXDA 2D0IA 3JQFC 5TGDA 4CLRB 4Z6KA 3U0BA 3WGQA 5IDYA 4W9NA 1E92A 2UUPA 1E3EA 1L1FA 4R01A 2J3JA 3U4CA 3ZV5A 4AJOA 5TX7A 4D0RA 1JKIA 3ASUA 5U4QA 1YXMA 4N7RA 2P5YA 2BGKA 4RZHA 2AG5A 3HDYA 1DEHA 5JY6A 3WYBA 3DZJA 2HAEA 4M55A 3WBFA 1Y8RB 4J4BA 1B2LA 4NQZA 4R69A 1E3WA 1NM5A 2P9EA 3DMTC 4XIJA 1ZMTA 1P1IA 5L4NA 3A4VA 3ASVA 3VZRA 3IS3A 4C4OA 1RM3A 4L74A 1V3TA 4RQTA 1CIVA 1U3WA 4WOJA 4IS2A 4BNNA 3PIIA 3PQEA 4O1MA 4U6QA 3TRIA 2X6TA 1EMDA 4GGOA 3V2HA 1MUUA 4EEXA 3GVPA 4OXNA 2ZYAA 5T57A 4UUPA 1MG0A 3HB4X 4CQMA 4D3FA 1PJBA 2Y0CA 2CVZA 3JYOA 5ER6A 3SC4A 4KWIA 2EJVA 3JTMA 2RHCA 2OZPA 4F6CA 4GAEA 4X54A 2YV1A 4LN1A 4M8SA 4BMSA 2BGLA 1VSVA 2I67A 3OP4A 2HJSA 1LC0A 3R3JA 3JYNA 1P3DA 2HK7A 3RBXA 5L9AA 5CG2A 1CETA 1ZO8A 2CNBA 1U9JA 3P2YA 1NAHA 2O3UA 1F14A 4FBGA 3O26A 3AM3A 4CR6A 5ER9A 5G0UA 3FRJA 2AQIA 4YRAA 1ZEJA 2V6FA 4B4UA 1KEUA 3ENNA 3K2EA 2FR8A 4YAJA 2OOSA 4H3VA 4L73A 3MJTA 1BWSA 3OJLA 2QYSA 1KVSA 1P1FA 3F6YA 1AUPA 1VJTA 4MVJI 3WBBA 4AJ1A 3WGZA 2YYYA 3JSAA 4BNHA 3DHEA 4WPGA 3FNEA 1PJ3A 5F3RA 3RASA 1YRLA 1I3KA 4YR9A 1R0SA 1DC5A 4PLZA 2VRCA 2BF7A 4Z3DA 5U1PA 3PWZA 1QYCA 3C7DB 1RYDA 4PLWA 4EUEA 1T2EA 1LJ8A 2WD7B 4IDEA 2WE8A 2OXIA 4JP3A 2PH5A 5TQVA 1E7WA 4CL8A 4YRBA 1G0OA 4MKZA 1AXEA 2PD4A 4OQZA 3GR6A 1E77A 4J0FA 3WGTA 4R16A 4AJ4A 4IPTA 3WX0A 3DHNA 2PGJA 3ICPA 4IDCA 1NAIA 8ADHA 4J49A 1K6XA 1T4DA 3IJPA 4IXWA 4UULA 1EZ4A 3GFBA 3EW7A 2A94A 1R4MB 4Q3DA 4CMIA 4E5MA 3W4KA 4IGFA 4NBRA 3LZ6A 4PLFA 2FWMX 3RUCA 3TZQA 4D3DA 4I5DA 2Q45A 4OHUA 2OHXA 5BT9A 4RLHA 4EBFA 1HKUA 1IULA 2LDBA 1JDJA 3H9QA 1OC4A 3V2UA 2X86A 3WQSB 4E2ZA 3K9QO 1GYRA 1EQ2A 1VRWA 4TVOA 3BHJA 4W7HA 3SXPA 3GMDA 3H5NA 3JD2A 4URFA 1PZEA 1X1TA 3GHHA 3JQEA 3PRJA 5DDIP 5T64A 1E1LA 4CLHA 4MP8A 1P1HA 3PYLA 5EL0A 2NQ8A 2ZKLA 5EMHA 4HADA 4N5LA 3GG2A 4DTIA 5I7SA 2NNLD 1KVTA 1EK6A 2G1UA 4J2OA 4Q3EA 1VLLA 4RO0A 4UEJA 2ZTLA 1CQIA 2JD1A 2O7SA 3GAFA 5LDHA 2B5VA 1SB8A 3CE6A 1I5RA 1XKQA 3PWSA 3QVSA 3WGHA 4GKBA 2E49A 4XGNA 3VZPA 1GZ6A 2VN8A 3GAZA 4YRDA 2JFHA 1K89A 1DIGA 3ZWAA 2D3TA 2O7QA 1Z73A 2PH3A 4BO0A 1GUZA 5IXYA 4RPKA 5K0ZA 2PWZA 3LT2A 4BO4A 2IXAA 3CTMA 2VNAA 1QSGA 1BXKA 1BXGA 3DONA 1LDGA 3G49A 3NUGA 1UZNA 3TNLA 4TROA 1ULSA 1E6UA 1YBMA 3L4BA 3K73O 3RFXA 4IDAA 3VH2A 1F0YA 4MDHA 3ZNQA 4NFHA 2XXJA 4R41A 4WJZA 4J3FA 4D41A 2O3SA 3G3EA 1NHWA 2VZ8A 4A73A 1P33A 3PHIA 4HUJA 3Q2IA 3WNQA 2X8LA 1UDBA 5C37A 3OEYA 4C7KA 5CPBA 1BW9A 3VPGA 1JQBA 2F1KA 4RLSA 1GEGA 5DNAA 2AW5A 4CLOA 2BFOA 1YL5A 2Y1EA 2YFHA 4B79A 5CEEA 2BKAA 2VWHA 2VOJA 3R1IA 5JLAA 3ZWVA 4UUNA 3C1OA 1KVQA 3AFMA 4NFYA 2ZQYA 3PJFA 1GR0A 2E6UX 3ZHXA 4EJMA 5G4KA 3I9JA 2FPGA 1O0SA 3H9JA 3W4IA 3ZHZA 2SCUA 3B70A 5HA5A 5IN5A 3V1TC 4JJIA 4Y6SA 2D5AA 1XIVA 3AOEA 4QFCA 4DA9A 4ESOA 1J4AA 2JAPA 3D4OA 2FHSA 5G4LA 4XR4A 3QY9A 1QLHA 3GEMA 4J1SA 3GPDG 2ZYGA 3UOGA 5B4TA 4UEOA 2V6BA 1WDKA 1RJWA 4NJMA 3DXFA 3K30A 3M2TA 1E3WB 1PJ4A 1E3JA 4JBIA 3VDRA 1VJ1A 1LQTA 1FDWA 3A28A 3PJGA 1PJSA 5JDCC 2R00C 2YQ4A 3HN2A 5ICMA 3AI3A 2Q1TA 3RJ9A 1B8PA 2B35A 1BVUA 2QRLA 5JC8A 3P2OA 4CPDA 2FZWA 1DXYA 1TXGA 4NU5A 2H9IA 3DO5A 3ROPA 1X15A 3MJVA 1IZ9A 2GD1O 3U9LA 2FPIA 2Y05A 4PLHA 2G76A 1NNUA 4OKIA 2JD2A 3UVEA 3P19A 1TA4A 3OA0A 3FD8A 2I65A 3DOOA 5EN4A 2B83A 2PZJA 3GFGA 1R66A 3EGOA 4RPGA 3EY4A 5DOZA 2Z5LA 4MP6A 1LSOA 2GERA 2YDXA 3WGOA 4OMUA 3DBHA 4YJDA 1VJ0A 4R3NA 4HY3A 2RBEA 1B26A 4NJOA 5T67A 5BSFA 1VSUA 3PHJA 3WTCA 4QT0A 4ZQGA 2Y0DA 3HWRA 2J5QA 3OHSX 5TNXA 1YH3A 2BRUA 4LSWA 1C1DB 3GNSA 1MXHA 4EEZA 3MOGA 4CUZA 1N9GB 1WXDA 1D1TA 4J90A 5KVQA 5DF1A 3TL3A 4KUGA 1EEHA 3TFQA 3S8MA 1I0ZA 3OIGA 4F45A 3RUHA 1ULUA 3I3OA 1X7HA 1DO8A 3T4EA 1HZJA 4RVFA 5FI3A 2IYPA 4MVJH 3H3JA 4U0JA 3MJSA 4I9HA 4WE3A 3KOUA 2X9VA 1LLUA 4UVEA 5L4LA 1VL8A 3WS7A 3HQ4O 4MVJE 2BH9A 2VWPA 2X5KO 4FDAA 5K6AA 1FK8A 1WPQA 3BMQB 3TQHA 3WWYA 5COBA 3PJDA 1HYEA 2Q3EA 4B4OA 4D79A 2JD0A 3WIEA 4HFNA 3F1LA 1Q0HA 2Y66A 1PR3A 3H9UA 2OMEA 1ID1A 1CJCA 4YQZA 2NSDA 3EVNA 2J5KA 3PPIA 4K9DA 4BGVA 1NXQA 4CODB 3KB6A 1IB6A 3GC6A 2UDPA 3FPLA 3EMKA 4TRJA 4MKRA 5EPOA 4K28A 3IC5A 2X0JA 4WCFA 1R15A 1UDCA 4CMIB 4YAIA 1UR5A 1B0AA 1NVTA 3QWAA 5C7OO 1HE5A 3U5TA 1Y1PA 1X13A 4BHTA 1KBZA 1W8DA 2RAFA 5A05A 1LLCA 2FSSA 3PZBA 3RC9A 1ISHA 1K0UA 4NBVA 3D7LA 2HSDA 3JQFA 3NEPX 4P4NA 2G17A 2ILTA 5CDSA 1T2DA 4TMFA 2VHZA 3WTBA 1Q1NA 2Y1CA 1JAYA 3BA1A 3I9NA 2BI8A 2QYTA 2IEBA 4O5OA 3RFTA 4RF5A 3PGXA 1PU2A 1WZEA 4LVUA 2UVDA 3IKVA 4TRNA 4OGWA 4XYEA 1E3IA 1GDHA 3BXXA 1YVEI 4XDZA 5IDWA 4IZIA 5IFLA 1R16A 3EVTA 3E82A 3L6OO 2DTDA 3AI1A 1CF2O 1M6WA 3HE3A 4NR0A 5CDGA 2CSUA 3KETA 5F5LA 2QIOA 1ISMA 3QWHA 5EIOA 1JTVA 1YOVA 1ISFA 2C7VA 5JXWA 4ALJA 4AL4A 3H7AA 2X4GA 4INAA 2QQ5A 4MVJD 4AJEA 1MX3A 1NQ5A 3HNPA 4IQ8A 3R0IA 5L7WA 4RF4A 4M49A 1Q7GA 5IZCC 3NT5A 3MJEA 1V0JA 3PI7A 4O0LA 3WGIA 1DLIA 3RUFA 2EKQA 5KWEA 1RKXA 5CDUA 1ZCJA 4XGKA 3S1LA 1U2GA 1YBVA 4I9UA 2PK3A 2EW8A 1ISIA 3RCBA 1HSOA 1IOLA 1U8XX 1IPFA 1QKIA 2PZLA 4J2HA 4ONEA 4CLOB 2NVUA 1Q7CA 3D3EA 4R1NA 2O4CA 3BHIA 2WWRA 1J0XO 2JKVA 3W8FA 1C0LA 1DIBA 1Y7TA 4O59O 1N8KA 5A3JA 4AJ2A 1U5CA 2BI7A 1OC2A 5TC4A 4DPLA 1ONOA 3IAHA 3ETDA 4J0EA 3GNQA 2YV3A 3L07A 5JBIA 3QVXA 4MJLA 3HG7A 1EUDA 4BNWA 2B4QA 2WYVA 3GVCA 2EKLA 1V3UA 1A7AA 2TMGA 2XXBA 3I9KA 1AN9A 4B8WA 2EP7A 1YBAA 4U0KA 4BB6A 4ND4A 4D44A 3CUKA 4IINA 2DAPA 3KSUA 3ZI0A 4ZVVA 2GN8A 2CZCA 4DWVA 4NJMB 3WR5A 2BD0A 4PLVA 3B1JA 3TZ6A 4WASA 3LLSA 1OAAA 4CM9A 1SC6A 1UP7A 4DLLA 2XPCA 1JU9A 2VYND 3GVIA 4PLTA 1K6IA 4J4TA 4S1VA 4Q3BA 3VC7A 4CM5A 4YXFA 3F9IA 4BIIA 3PFWO 3W6ZA 1NVMB 4IBOA 4Y98A 5FEUA 1D4FA 4RDHA 3DAGA 1HDGO 4OJNA 3ZWWA 1E3SA 1E1MA 5A9SA 4E6PA 3JQAA 2EJWA 1F8GA 3CSDA 3PHGA 3IP3A 4HFJA 4BO5A 1U7HA 1EDOA 2C5EA 3FPCA 4BV8A 5EJ2A 1WAMA 1B3RA 3PEFA 3TOXA 3TJRA 2RIRA 4BO1A 4EW6A 1EUZA 3M1LA 3KYCA 4J16A 4R1UA 3DBHB 3F4LA 1LTHR 1QYVA 3GG9A 1EBFA 2GRAA 3JYQA 5AYVA 3EHEA 4NPCA 1EVIA 2VRCD 3H5RA 1E3LA 1U8FO 1BGVA 2C0CA 2I76A 2WE7A 3FF4A 3OJOA 3QWFA 3C24A 3NDRA 4IDBA 2O48X 4LK3A 1HDXA 5HS4A 2PTGA 5TLSA 2VNSA 1HRDA 4E30A 2WMDA 3VH3A 4W99A 4A2CA 1GCUA 3D4PA 2Q2WA 4XJSA 1MG5A 4AJKA 4BKRA 3PTZA 5FYDA 5GY7A 5GZ1A 3VDQA 5G0SA 3EYWA 3MJCA 4ITUA 5TJ9A 1G6KA 4XKJA 1A27A 4QQRA 1E7QA 3L77A 4XB1A 3H8VA 3Q11A 3B6ZA 1XWFA 4BNUA 1QXSA 5IDXA 2AQKA 1GUFA 1R0KA 3HZZA 2E37A 2WJPA 4M86A 1ZH8A 1CYDA 4J91A 1NP3A 3ZU3A 5BNIA 4FSHA 4IZHA 2ZB7A 5LCXA 1O5IA 1W6UA 2Q1SA 4RF2A 4RVGA 4RPHA 4WNCA 4Y6PA 4GX1A 3M1AA 2Y0EA 5A1TA 3WMWA 2EWMA 2Z1NA 4WCFB 5CP8A 2VYVA 4FD3A 5CDYA 3DZHA 2VT3A 4E5YA 5HWSA 1VKNA 3NJ8A 4EYEA 4RDIA 5AXBA 4GX0A 2HJRA 3ZV6A 1TLTA 2Q1WA 4FQ8A 4PZEA 1BTOA 3F1KA 1AHIA 1ZXLA 3AOGA 3VZSA 2GSDA 5FI5A 2OL4A 3BMOA 1M75A 5B37A 3WG9A 1ENPA 2Z95A 5L7YA 3G1TA 4ZQEA 1H6AA 4RVUA 2DBQA 3GLQA 4XYLA 4L4SA 4B3HA 3RIHA 4FFNA 1B8UA 2VZ0A 3DMYA 3HDHA 4GWGA 1E7RA 1OZAA 4I1IA 1I2ZA 3AK4A 5A5FA 3R6DA 4CLXA 3B1FA 3VPXA 4PVCA 3GEDA 1C14A 4HFMA 1KS9A 4MPDA 4CQLA 2Q2VA 2GCGA 5GZ6A 4XYMA 1H5QA 3PWKA 4FGWA 2Q4EA 1DB3A 4KMSA 2NM0A 3S2GA 4IQ0A 4B3JA 4D43A 2FOIA 1FDSA 7ADHA 5F21A 1CDOA 5DP2A 1X7GA 3MJ4A 1LDBA 4II3A 4YWJA 1YOVB 1YGYA 5IN4A 2WD8A 4Q3AA 1LXCA 1KIFA 3M2PA 4W7IA 1T2AA 2EHDA 1UP4A 4EITA 1DRVA 1LDYA 1GFSA 3U4DA 3UCXA 3WLFA 2YY7A 1UXJA 3DL2A 1ZEMA 2NQTA 2XOXA 2DFDA 4BUCA 5DBFA 3DZKA 1YWGO 3KO8A 4YJFA 2FZEA 1IUKA 4L76A 4MIOA 2VUUA 3QA9A 3UW3A 1U3TA 1LSJA 3C3XA 1MA0A 1WLYA 3LU1A 4LMPA 3WXBA 3PDUA 1R12A 2NVUB 1S7CA 3SLGA 3NTQA 1H93A 4RVHA 1D3AA 2OP1A 2ZJ0A 1Z74A 4Y6RA 2DU8A 1JVSA 2D2IA 2V6MA 3ITDA 3S2EA 1UP6A 3QRWA 1H6BA 1KEPA 2O23A 1NWHA 4B7CA 1ZUD1 1YL7A 4QXMA 3DOJA 5J23A 5ITVA 4OIMA 4GPD1 3UFXA 2FY8A 4BNTA 3JQ7A 2DQ4A 3AJRA 4L9RA 5KJCA 3ZNNA 4CR7A 3NDIA 5IZ4A 4BNMA 2GZ2A 1NQAO 1QV6A 3VPHA 4N5MA 2ZIZA 3P5SA 5TIIA 4JBHA 4R9SA 2X23A 1QR6A 4NH4A 1V9LA 3D5TA 3PK0A 3IUPA 3BYZA 3TZCA 4B7XA 4J9UE 3H2ZA 3BAZA 2VUSA 2ZJ1A 1MXFA 4BMVA 3ETGA 4TSKA 4LRTB 3KEOA 2GN9A 3E1KA 4R68A 1SOVA 2PGLA 3PQFA 3ENKA 2B69A 1V35A 1HSZA 1QRRA 2OBYA 3L6DA 1EVZA 5A9RA 3FHLA 1U4SA 3KSDO 2B4RO 2J3KA 1HDRA 2J3HA 1BVRA 2V65A 4HNGA 4E2XA 1YJ8A 1C0IA 1QYWA 5A9SB 3JQAB 4DIOA 1T26A 1QORA 4IJUA 1E5QA 3HADA 4LRSB 4RZIA 2E82A 1XCBA 1R0LA 2Y1DA 3KHUA 1NASA 4AICA 1ADBA 1H94A 1ENYA 2J3IA 3G79A 3S55A 4FN4A 3NGLA 1BDBA 1VM6A 1W4ZA 5L53A 2NWQA 4NBUA 1OBFO 1VKOA 1LI4A 1I30A 3KLMX 4MP3A 2WSBA 4II2A 2PKQO 4KTTE 4XCVA 3JQ6A 3KYCB 1V3VA 3W4JA 3HDQA 2JAHA 5ILOA 3BTUA 4YAEA 3EZLA 3MZ0A 1M67A 2B37A 3DC2A 1T1SA 4J7UA 3DAFA 2HMSA 3ONEA 4GBJA 3WOHA 5JDIA 3JQBC 1Z82A 3ZHYA 3GQVA 2YQ5A 4J7CA 2PGDA 2WM3A 4Y8VA 2YFQA 4FFRA 4PN3A 3HDJA 3TFOA 1H6CA 1JWAB 4D42A 1LLQA 2NVBA 3VKVA 4UVHA 5T5QA 2VHWA 2AXQA 1SBYA 3ZWCA 1O95A 1O89A 1Z45A 2H63A 2GPTA 3FNHA 5BSGA 4BNFA 2DTXA 1ZNQO 2QRKA 1E7MA 1GY8A 3I52A 3O03A 4FC7A 4RV9A 4HXYA 4QX6A 5T8KC 3INTA 2YHIA 4IDDA 1T1RA 3PGJA 2OP0A 3EZYA 1K3TA 3ZDFA 3K31A 4XQCA 3O4RA 1NPTO 1P44A 1UZLA 2BELA 1F8FA 3LVFO 4MVJP 4FIZA 5IZCA 3TL2A 1VPDA 2Q99A 3NRCA 1P45A 1E0DA 2CMDA 3GNTA 2BLLA 3ANNA 1Q7BA 4J43A 4L0QA 4AJPA 1E5LA 1PIWA 5LDGA 2JCYA 5DULA 4DLBA 3P7MA 5CDTA 1Z7EA 3B20A 5DN9A 1SEPA 2W8ZA 4IJWA 3BZUA 4BO8A 3LK7A 5B4VA 3RBZA 5I7EA 5AXAA 4CLEA 1WMAA 3PZRA 1YJQA 4NDNE 1X0XA 1PEDA 4CMBA 1XA0A 4R4JA 3ROKA 3KYDA 3LSYA 1N92A 3BMOB 2I3AA 4IMRA 5ICSA 3ANMA 4R1TA 1FDVA 4YQYA 4EI2A 5BNFA 4YT8A 1RWBA 3SBOA 4E5PA 1XYGA 2GN4A 2IODA 3AU9A 4FFOA 1OOEA 3Q3CA 2VHYA 5L95A 2VWGA 3IKTA 5U9CA 9LDTA 3A1NA 3STHA 3V1YA 3I23A 1SPXA 3RKRA 1YQXA 1XGKA 5K9ZA 4PG5A 3VZQA 1L7EA 4WLEA 2GZ1A 2W2KA 2EKPA 5COQA 5JSFA 1A5ZA 1MC5A 4BQPA 1O9BA 4LISA 2W98A 3BMCA 2VRBA 2HRZA 1ZSNA 4XQEA 4G2NA 3RSHA 2B36A 4OYRA 3TZKA 4ZQHA 5BSEA 1P9LA 1O8CA 3WFJA 5BR7A 1UXGA 3GUYA 4BO2A 4C7JA 1TI7A 3Q0EA 3GDGA 3I6QA 3O9ZA 3L9WA 1M66A 1PJCA 3ZWYA 1ADCA 2X9GA 2HQ1A 3E18A 4YJFB 1H0KA 2DBRA 3T4XA 3RUIA 2WYUA 4EJ0A 1JVBA 5FWNA 4MO2A 5JMWA 1KOLA 4FJ2A 3LF1A 4CQMB 4ND3A 2ZTVA 4LCEA 4CMKA 1Y6JA 2Y1FA 4TZKA 4YT4A 5EINA 4IDGA 4W9NC 4I08A 1B8VA 3G0OA 2NV6A 3ZV3A 3A9WA 1NR1A 1GZ3A 1G1AA 4ID9A 1P0CA 3H4VA 4GL4A 3VH4A 2OGUA 5TRTA 3OEWA 4ZRNA 6ADHA 1YDEA 3OM9A 3CEAA 4NHEA 4AJNA 5JAQA 2EIHA 2GGSA 3PYMA 1UJMA 3U4IA 5KTKA 2FR1A 2YZ7A 1ADFA 1EE2A 3GZNA 2WTBA 1O94A 3A06A 2PLAA 1H9BA 2IEDA 1EVYA 3C1AA 3WIDA 4MOWA 3JQAD 3BTOA 1YKFA 4E2WA 1YE3A 1WNTA 5KKAA 1HDCA 1KY4A 3DAPA 1GV1A 5I8WA 1YONA 1QYXA 3FSRA 3JV7A 5L40A 3CINA 4Z0HO 1FJHA 4R5MA 1PWXA 2HLPA 4BKQA 2AQ8A 3C85A 3H2SA 3UN1A 3E5MA 5JPIA 2I6TA 4FR5A 2O50A 3JQ8A 4A5OA 3TF5A 3QIVA 1EVJA 3CIFA 3WQQA 4ILKA 2F00A 1PQUA 2YV2A 3ANLA 3KBOA 5KVCA 1ONPA 2AMFA 2DVMA 4DQUA 4E5NA 5CAEA 4A26A 5JS6A 2GDZA 4ND2A 4KDEA 1E6WA 3AUAA 1RM5A 3OMLA 4Z9YA 1LU9A 3C7AA 3VHRA 3WICA 1NFRA 1SZJG 1M6HA 2QRJA 4BNJA 2Q1UA 4XR9A 1J49A 1EFLA 1SEVA 3ABIA 3S2IA 1ZK1A 3LQFA 4Z3KA 4YTEA 4I8XA 4O6VA 1HXHA 4CMEC 2EV9A 2OORA 4PGFA 4HV4A 3ON5A 2AA3A 5H82A 3WYCA 2W2LA 2ZYDA 3ROMA 4YVFA 5MDHA 4IY1A 1LRJA 1JA9A 1B15A 1HF3A 5AOVA 2O2YA 4P4LA 4U6SA 5L3ZA 3KZVA 4AJHA 3DR3A 4ZN6A 3UKOA 2X5OA 5TS3A 2EW2A 2P9CA 2A9FA 1BRMA 4GX2A 2X22A 4Z9FA 2GZ3A 2NUAA 2O3RA 3C7CB 5EQFA 2RCYA 4DQVA 2P2SA 2X1HA 2X58A 3PLNA 5JCJA 2GN6A 4E32A 4Q9NA 1R4NA 2ZB4A 2H5LA 3GRKA 2DM6A 4F3YA 5A3VA 2G5CA 3OQ1A 5JAIA 5A4DA 1ZJZA 2YHIB 3NTOA 4B7UA 3CXRA 4JXKA 1Y5RA 4DMLA 2VYVD 4OSOA 1WDLA 5KKCA 4DVJA 4ND5A 2HU2A 4CM7A 1UZMA 1G0NA 4WGGA 4KUHA 3DMTA 3I1JA 4HX5A 4M89A 4BNXA 1B3BA 3RBVA 1FF9A 1DLJA 3SC6A 1N7GA 2EP5A 4OOFA 5AVOA 2D5CA 3GUCA 4XGIA 3PXXA 3QQPA 1DC4A 1K6JA 3QVTA 3UAGA 1LDEA 1WDMA 2NADA 2X5JO 4ND1A 5JO0A 4PZCA 4W4TA 3Q1LA 1ENZA 2IZZA 4DBVO 1Q2XA 1BXGB 1X1EA 5JYEA 1LEHA 2HKIA 2QW8A 4J4HA 4P4GA 2NTVA 4B4WA 4PVDA 3U49A 4CV2A 3QP9A 5BNTA 2OBNA 1YQGA 1O6ZA 1F06A 2NU7A 4NI5A 1XSEA 2IYOA 4YT5A 4FFLA 1B14A 4H7PA 5EERA 3WGYA 3ZHBA 4FFPA 2AG8A 4MVJM 2B4TO 3COSA 1BW9B 3VH1A 3PHLA 4IIVA 1XQ6A 3OF2A 2PD6A 2QX7A 4R9RA 5I9MA 1NVGA 3BMNA 3ZH2A 4ALIA 3ZV4A 1GL3A 1U4OA 4JNKA 3WQRA 1AHHA 1AXGA 5ENDA 2EF1A 1PWZA 5TT1A 1DPGA 3ZGYA 2PV7A 2ZB3A 3FI9A 4KDFA 5G4KB 1T24A 1L7DA 1T4BA 3T7EA 3KVOA 1IE3A 5I7VA 3H9GA 1NHGA 1OI7A 2I3GA 4BNIA 2P5UA 2W2KB 3FWNA 1LBEA 2ZB8A 3H3FA 3ZWNA 2DTEA 3C8MA 2GLXA 2UAGA 3PQDA 4BO3A 1PS0A 4AFNA 1E1KA 1PZFA 3ZNPA 4A0SA 4XYGA 4E13A 3L4BC 1GEEA 4M87A 4CQMD 1Y8QA 2UV8A 1BHSA 5CFZA 2CVQA 2ZTMA 3DFUA 3ITKA 2X0RA 4L75A 4AJLA 3HFSA 2C2YA 1GTMA 2P68A 4GGPA 1U5AA 1NYTA 3EAGA 4J1QA 3ZWBA 1MP0A 3FN4A 3AWDA 1D1SA 3FR8A 1WVGA 3WSWA 2Y93A 4OOEA 3DB2A 4XEHA 5COAA 3JQBA 2VUTA 4A27A 3I9OA 2DFVA 3PVZA 4RVDA 4BNLA 1P1JA 4ALMA 1LX6A 4E0BA 4CM4A 2A92A 1HE4A 2Z1MA 4JGBA 4JROA 2C29D 4WLVA 4YA6A 1PR9A 3HFGA 5C3MA 3QE3A 4WUVA 2PKQP 1D8AA 5G2OA 3GZ4A 4N18A 4OAQA 5F1PA 2YUTA 1IYZA 3GDFA 3MTJA 2OO5A 4IS3A 4NBWA 3FBTA 3GZNB 5A03A 1ISJA 5CHEA 3TN7A 4HKTA 4J1TA 5ES3A 4ZHSA 5CPFA 3RKUA 4DMMA 3MWDB 4H16A 1ZJYA 5DOVA 4XD2A 3F47A 4ROSA 3G17A 4IGEA 1GD1O 2DUWA 5IAAA 1DAPA 3IIEA 2QZZA 4DREA 5GZ3A 1LUAA 2GASA 1C0KA 3W8DA 1HL3A 2B0JA 2Y1OA 2Y67A 4PG7A 3ZU2A 1F17A 3DFZA 2PR2A 4IJVA 4OQYA 3KLPX 4MKXA 1XELA 2EG9A 4O63O 4YB8A 1LDNA 1YO6A 3M6IA 3UUWA 1HDOA 4K1LA 4XQGA 2VQ3A 4QUKA 9LDBA 1BG6A 3FTPA 1I2CA 1N7HA 2XAAA 1RM4A 1T2FA 3I4CA 4PG4A 3BTVA 3TZHA 1DHRA 2X0NA 3E9QA 5THKA 3UXYA 1U3UA 3E8XA 3SJ7A 1SCUA 4DL9A 1BMDA 1LSUA 1PX0A 2NTNA 1DOHA 4JJGA 4OKNA 5AQ1A 3N74A 4KWHA 1PS9A 1HWYA 5DBGA 3I9LA 1WP4A 1TT5A 3CH6A 4GVLA 1KY5A 3D0OA 4BB5A 4E2YA 4YT2A 3JYPA 4TRRA 1N2SA 2O3TA 3DZGA 3GN1A 4WEQA 1XG5A 1AE1A 1ZK0A 3LT1A 4YBZA 1HT0A 1ORRA 1I3LA 1N5DA 4UAGA 2IZ1A 1R4NB 1ZZEA 4GSLA 5IF3A 1JWBB 5KNLA 3EUWA 3OJFA 3WB9A 3IUSA 1X0VA 1GU7A 3JD4A 3SLKA 5KJ1A 3KXDA 2O3QA 2GUGA 4ZJUA 3ST7A 3OETA 3HJAA 4IJKA 1MLDA 1JLLA 2EXXA 4WLFA 3MOIA 4XZ3A 2BFAA 2P4HX 4OXKA 1VL6A 5JDCA 1PSDA 2R00A 3LC7O 3CZRA 4UVGA 2ZK7A 1C3VA 4J1NA 1U2DA 4DUPA 5TT0A 3WJ7A 3I5MA 5DCUA 1NBOA 2ET6A 3HUDA 1B16A 3GK3A 2GO1A 3BHMA 3UCFA 4P38A 4TKLA 5DZSA 4CUKA 1XDWA 4KUEA 4W6ZA 3V2GA 1HETA 4YPOA 1YL6A 3H65A 4JBGA 1I3NA 3CZMA 3WSVA 3ZW8A 4IIUA 2NVWA 2R6JA 4WKGA 4CUJA 1ZVMA 2O3JA 2VCYA 3OBBA 3OFSA 4CMJA 1A4IA 3F3SA 1IZ0A 2JFFA 3AFNA 3AI2A 3UF0A 4E5KA 5GMOA 3GHYA 4WLUA 3HN7A 3WMXA 1OFGA 1I01A 4TWRA 4Q39A 2EGGA 5HRUA 1DIRA 5H81A 2PY6A 2J8ZA 3EK2A 3F46A 2VZ9A 1HE2A 4PLGA 5A06A 1DJNA 5I7FA 3BMNB 3NYWA 4GMFA 4BV9A 4HNHA 1PL6A 1ADGA 3QWIA 1GQ2A 3E9NA 2CD9A 3OJEA 3JQDA 1IHYA 4IUYA 1GPDG 1A9ZA 2D59A 2P4QA 1NPDA 1PGJA 4ZQBA 3ZWXA 4Q3NA 1V8BA 3LT4A 2IE0A 2E48A 3GY0A 3UHAA 1I8TA 1LSSA 3JQ9C 3TSCA 4A7PA 5DCWA 3GMSA 2DPGA 3U62A 3U09A 4BO9A 3JQCA 1DRUA 1V6AA 2C07A 4J6FA 4OH1A 4ZICA 4OXYA 2EGHA 2VYNA 3SEFA 3FBGA 3WYEA 3CMCO 1LRLA 1DRWA 4WLOA 3DDNA 1Y8QB 3JYLA 3NJ4A 2C54A 4FGSA 1XU7A 2I99A 1BSVA 3LF2A 3K96A 3KM0A 1PJLA 1LLDA 4CM6A 5JAZA 3KEQA 1LNQA 5ILGA 4NG5A 4YJHA 4DBZA 3X2EA 3MEQA 4WEOA 1IHXA 2FN7A 2EERA 4XQ9A 4CMEA 4GLLA 4EGFA 1QMGA 4A10A 3Q9UA 1C1DA 1KEWA 1MFZA 3E9MA 3NKLA 4IM7A 5H83A 1N9GA 5EESA 3T7CA 3PFFA 1NTOA 3AY7A 4BMNA 1IY8A 2FPPA 4MVJG 1GAEO 2WYWA 1HDZA 3QW2A 1YDWA 4N5NA 1PQWA 3JD3A 5KVSA 4CM4B 4A03A 3TOZA 3NGXA 4U8GA 5C7LO 1MC4A 1B7GO 4B8ZA 3LLVA 4K26A 1SOWA 3EDMA 3RWBA 3NDJA 3VPSA 3D3WA 3DZFA 2FMUA 3DTYA 3BMQA 3DTTA 4I9NA 1A9YA 1P77A 2CVOA 2ZQZA 2NU8A 4QTZA 4E33A 1GCOA 3QLJA 5HTOA 5KVVA 1FMCA 1JN0A 2W90A 1Z7BA 5IDQA 5BSHA 1IL0A 3A14A 3PYXA 3OICA 4E4YA 1SNYA 4KP7A 3D1LA 1GV0A 3H6KA 4G81A 4I5EA 3MWEB 4LVCA 3E03A 4QSMA 5AXCA 4NIMA 4ZD6A 3ZCXA 2RH8A 3U3XA 5TF4A 3DOCA 3G1UA 3QVWA 1I24A 4IQGA 5C5IA 4LW8A 1GYPA 4JJFA 3OJ0A 3WLEA 4E12A 1Z75A 3ZU4A 1SAYA 4FCCA 2AE1A 3E6AA 4EUFA 4HFRA 3OIDA 3FR7A 1E6EA 1PJ2A 1KERA 1MFPA 1CQJA 2P9GA 3QWBA 5G0TA 3D64A 1JKFA 1Y81A 2XF8A 1EK5A 3O8QA 4PRLA 2UUOA 1MB4A 1UAYA 4B4VA 1CEQA 4BGIA 2W2LD 4JK3A 3ZNOA 3O38A 3OSUA 1BXZA 3BTSA 2V6GA 4PLPA 3WDSA 4JP2A 5JCXA 3VTFA 1I3MA 1C1XA 1XU9A 2VOEA 2ZATA 2VT2A 3L0DA 3RJ5A 3GGPA 3IP1A 4BKPA 4R51A 3C1TA 3RQSA 4GLOA 4FB5A 3RROA 4BOYA 5I9NA 3FWZA 1LC3A 4R5HA 3QV1A 4Z0TA 1I2BA 5JCJD 1MV8A 4FPXA 4FJ0A 3X2FA 4P22A 2JL1A 3ZU5A 1TT5B 3AU8A 1A4UA 2NACA 1DAOA 1P1RA 5DCYA 4DGSA 1LDMA 2VHXA 4BKUA 5HM8A 4D0SA 2DLDA 3TWOA 4QO8A 4BVAA 4D3SA 4GQAA 1Z6ZA 2QHXA 1YQDA 1T2CA 3ONDA 3H5AA 1I32A 5L4SA 4GVXA 4TZTA 5KJEA 4UREA 3RU7A 4KZPA 4TVBA 1KC3A 4E3ZA 4NBTA 3ZW9A 1EBUA 3L4SO 1QLJA 2JCXA 4CM1A 3PP8A 5F5NA 4S3MA 1QG6A 2HK8A 2UYYA 4FOOA 2G0TA 4NMHA 4PLCA 2HUNA 1YB1A 4XA8A 3K5PA 2C82A 4CQLB 3RVDA 1UXHA 2AEFA 5CEJA 4UVIA 3AM5A 1QYDA 1LQUA 3FNGA 4KQXA 3VAZA 5CG1A 3KV3O 4FW8A 3IOYA 3WWZA 2VTEA 3DBLA 3PHHA 4RORA 3ORFA 4ZA2A 4DC1A 1PZGA 1NX6A 1U7TA 1JAXA 4EUHA 4BNYA 4CMGA 4DIFA 1EDZA 2Y68A 1H2BA 1W73A 4E21A 3AM4A 2Q4BA 4RVSA 3V5NA 1ZIDA 3L9XA 1HLDA 4DC0A 2DC1A 1NFFA 1CWUA 4LGVA 1E7YA 2D8AA 2JFGA 1YB4A 2JJYA 4PRKA 2Q2QA 1F12A 3PLRA 1QV7A 1N1EA 1Q0LA 3GOHA 1RM0A 2BMAA 3ZWPA 4YYZA 4TQGA 2Q49A 5B4UA 4FOSA 4U7WA 6LDHA 3N7UA 3ICCA 1IPEA 3VTZA 1HDYA 4CM3A 3RC2A 4DPMA 5EQDA 4QFDA 3F5QA 1DSSG 2BGMA 1ZK2A 2O4UX 5TSDA 3W8EA 5IJZA 3GA0A 4NZ9A 3NV9A 4CM9D 5LC1A 3JQ7B 3RUDA 5JE8A 3GGOA 4RF3A 4GSKA 1Y5MA 2O2SA 4Y67A 3V8BA 3QHAA 1DIAA 2J6IA 4ALNA 5L7TA 2C2XA 1XR3A 3WFIA 5TJHA 3PDJA 4H15A 2C20A 4CR8A 2HCTA 2P91A 1DC3A 1J5PA 1PQPA 3GF4A 3NT4A 1KETA 3IQDB 4LMRA 2CF6A 1DBVO 4XWYA 2PKRA 4YJGA 2JHFA 5F1OA 5IXSA 2RH4A 4N54A 2CFCA 1J6UA 5F1KA 4HP8A 3W1VA 3MTGA 1P31A 4YJHB 5FF9A 1NQTA 1PS8A 3CKYA 3FTNA 1K5HA 1KVRA 1R37A 3INGA 4LSMA 4TRMA 4RPLA 5JW6A 4I5GA 2FRDA 2PZKA 5JC1A 4L4XA 4IDFA 4PFJA 2ZCVA 3LC1O 1PZHA 1SB9A 3K6JA 2WDZA 4AJIA 3Q9NA 4I5FA 4CM8A 2YDYA 4CJXA 2HMTA 3DBRA 1UDAA 5ADHA 4ALLA 4LCJA 4GX5A 1KC1A 4MVJF 4YAGA 5KJFA 1I36A 1UAGA 1VE9A 2B5WA 3HHPA 3SVTA 4CMCA 1DC6A 1CERA 1NQOA 4J9VA 1PGNA 1XEAA 4XX0A 4MIYA 5THQA 4KQWA 4BGEA 5DP1A 1HYHA 3HSKA 3D3WB 4RL6A 3JQGA 5A02A 3ETEA 4U5QA 4DRYA 3OH8A 8LDHA 2C59A 4MIEA 5KOIA 4BNVA 2JCVA 4W82A 4CL3A 2GNAA 2DUUA 2HDHA 3AY3A 2CDAA 4UUMA 5KIAA 4DQXA 3DHYA 4UEKA 3I83A 3UGKA 5ENVA 1X14A 2ZTUA 3GGGA 4EDFA 4G5HA 3SX2A 4Q3CA 1MGOA 3GH3A 4RJTA 3NX4A 2IDZA 1HYGA 1RYEA 3I6IA 1KEVA 4OO3A 2D4AA 3BIOA 1TT7A 3UICA 4EJ6A 1H2HA 4QECA 3IJRA 3LDHA 3GN2A 3DEYX 5JMPA 3IDSA 1WWKA 3GPIA 1EE9A 4GMGA 1A72A 4D7AA 1ISGA 2A35A 3DZIA 3UH1A 4G65A 4K6FA 4QO7A 3O8QB 4BKOA 5B12A 2TMDA 2IXBA 1YB5A 3K8ZA 1UXKA 5A9TA 3KYBA 1FDTA 1OMOA 2CF5A 1WMBA 4CV3A 3GDOA 4XDYA 2Y1GA 5I9LA 1C1XB 1DDOA 1ONNA 4JQCA 1DFHA 2J5RA 3TPCA 1X7DA 3S2FA 1HZZA 4BNGA 1R6DA 3ZZNA 3KTDA 2Q50A 3RI3A 3ZN2A 5JDIC 2POQX 1NR7A 3AUUA 4ALKA 2CDBA 1UXIA 4CV0A 1EQUA 3NT2A 5JFOA 1PGQA 1DJQA 3QVOA 4WECA 4CLRA 3OA2A 3E48A 4F6LA 1FDUA 1XHLA 1FXSA 1P74A 4BO7A 2FSVA 1ZMOA 2IZ0A 2X7HA 3LC2O 4XRGA 4DXHA 4PG6A 4NK4A 4OL9A 3RC7A 1GZ4A 4DPKA 1GUYA 3KYDB 2WEKA 1T25A 4ZU3A 4FFMA 1A71A 5MGBA 1WZIA 1XLTA 2NTJA 4R3WA 3JQ9A 1GADO 1VI2A 4HBGA 1M2WA 4RQUA 3LT0A 2PD3A 5FFFA 1Y8RA 1S6YA 1WW8A 1GQYA 3WNVA 1GQQA 5L51A 2H1SA 7MDHA 5A04A 3RD5A 1N1GA 3PJEA 3FCOA 4P8RA 2AHRA 2V7PA 4CV1A 4UUOA 2AQHA 1ZFNA 4HWKA 1EFKA 3W6UA 2YHUA 3RUEA 4DYVA 4JN6B 3KSZO 4FJ1A 4NFSA 3BMCB 4Y9DA 2BFMA 1HE3A 3DBLB 1NFQA 3DZBA 2W4QA 3VKUA 2VWQA 2GR9A 2BFPA 4YACA 3F4BA 2GF2A 3MCVA 2VTDA 2I9PA 3GVXA 5HS6A 4L4RA 3LYLA 2NLOA 1ZXBA 1DIHA 3E5RA 3ROQA 5L45A 4TKMA 4BNKA 4D46A 1ZKMA 4Z9XA 4GI2A 4BQRA 4K6CA
chains in the Genus database with same CATH superfamily
3L8GA 2DFLA 4DA8A 2AKYA 4DLAA 4ACBA 4NOKA 5FTMA 2CY0A 5HW0A 4ETIA 2OCKA 4P3XA 3AW9A 3CZQA 4RA9B 2XUZA 2CJYA 1CUIA 4IF6A 4KNWA 5EE9A 4EZBA 5KCZA 3GUUA 1P19A 1QYRA 2REQB 5KJ6A 3VNUA 2O06A 1SUEA 1DWOA 2R3SA 3D8BA 4NFLA 3ZWOA 1EVQA 3R3SA 4MGKR 2EFGA 4IIGA 3SD7A 3C4QA 5BY2A 1QQTA 5LSAA 1KYQA 1M2HA 3DLAA 5HBRA 1DFIA 5ALVA 2I6XA 3RU9A 5J2UA 2D1YA 3B1KA 3JZIA 4M38A 4QEDA 3FCYA 3HJFA 3AF2A 2V5VA 3RB8A 2JK1A 1IEVA 1Y9EA 4JMLA 1PGPA 4H6XA 2DERA 1ATIA 3JD1A 3JZMA 4XJTA 1DC7A 3A37A 2H85A 3AHHA 4XPIA 5IVPA 3NMUF 2ZT5A 2ENWA 3NTLA 4CLDA 4DLNA 1PGOA 1TC1A 4C7XA 1D07A 1TCCA 3O8LA 2G63A 3UWPA 3EXFA 3EY9A 5IG2A 3IOCA 3VA7A 4ZK6A 2F48A 3GVHA 4H17A 2C7OA 2WD7A 3LCJA 2B34A 2DPHA 3T9AA 1TLFA 5CA0B 5KKNB 3ELBA 4XVUA 2X0IA 2IS1A 5I8ZA 1Z63A 3HU5A 3HDGA 3Q0IA 1BZYA 4YNBA 4P6VF 1JKJA 1N6KA 4Y2QA 5FNZA 3BQMB 1QO0D 1A50B 1ZINA 3NUQA 4WNIA 5DM2A 2GKGA 3HBNA 2E0IA 2REXB 3HN6A 4WCDA 2F1OA 4MUKA 2Y27A 3LHKA 4EECA 3NPMA 2I4NA 3PGA1 2XOKD 7ABPA 3PX3A 3UAWA 1SC4A 3IR6A 1R4MA 3JQ8B 1CTQA 1R1DA 4X91A 1WF3A 1UOQA 4C5AA 1HEUA 1G59A 1XNQB 4D25A 4HGNA 4ML3A 3A3PA 3I2FA 3D5QA 4HNQA 3QSGA 5IM4A 4L3WA 4G36A 4AX8A 4WOKA 4YCDA 4CM8B 4IYJA 1GPKA 1LK5A 2ODTX 4LX8A 4GBGA 3DBRB 3A1WA 1DL5A 3DQPA 4JX8A 3CPEA 3AEUA 4NK5A 3COVA 1E89A 1ZJ4A 4TKUB 1L8OA 3BF7A 4QTYA 4YDRA 4R05A 2E3JA 3ZYCA 5KS2A 3TDKA 4YEDA 4PYRA 5EMJA 4BO6A 2AEJA 2YJZA 1QG0A 2D62A 4OHOA 1O94C 1QAMA 3MHTA 1O95D 1P81A 2BZ1A 2CB0A 3EZFA 2OQRA 3O1LA 1KMCA 1Z25A 4B3IA 2D1FA 3ADBA 2X9NA 3FNFA 4E31A 5ITWA 1NWCA 3KWFA 2IHVA 3RAEC 4XRRA 1XTVA 1TZCA 3UYLA 1KDOA 1YACA 2PS3A 5ALOA 2VBGA 3AYZB 5FUWA 3TEMA 4CE6A 3RDPA 1RC1A 3A4IA 3H75A 3MT8A 4ME6A 5IWCA 3KT0A 1PT9A 4HWRA 4YP7A 3N6XA 5SY6A 4BMYA 1RWPA 3IQHX 3N58A 4KBYA 3DGFC 3Q87B 2FP4A 3E61A 1C0PA 4PGMA 1WJGA 1U81A 4EAAA 2NXJA 4FBLA 1RJ9B 1HRKA 2QPLA 3NNSA 5AT1A 4GH5A 1B0PA 3AUSA 3P27A 3UC5A 1KI1A 4GKVA 2E89A 1WV0A 2PFGA 3H9EO 1YJCA 4WZBB 3DDWA 1QP8A 3AQ4A 4XB2A 3SJCA 2EG5A 2VCEA 4V2IA 5T6BA 3ZQ6A 1L5FA 1P7YA 3MWYW 1RYNA 1DE0A 1ES9A 3ZE2B 4LJYA 4EHIA 4AY2A 2A88A 4HEA1 1DTWA 4OSPA 1XAJA 1CRWG 2PNFA 3P8ZA 1PTJA 3ZU6A 4QJIA 4KDRA 1M76A 2GK3A 4FMBB 4F85A 5AVWA 4F0JA 5A5EA 2HA5A 3HMQA 1RQXA 3PF9A 4FOTA 1POWA 1KZ6A 2VF7A 1FMFA 3V9AA 1EFPA 2OORC 1ORTA 3DWFA 1PL8A 3ZWMA 3FPEA 3TFWA 3BG5A 4Z1MD 1SY7A 1TLLA 1K7FB 3L6EA 2EZ9A 4FMPA 4KWTA 2ZUBA 3DUWA 4LZOA 4TXNA 4ES6A 2AE2A 3FIJA 1V16A 4FONA 4UTXA 4LNUB 5EP4A 4JB8A 4BTEA 3EPHA 4H7EA 2V0NA 4YJ2B 4MZXA 5AXDA 1TW2A 1W44A 2HYDA 3II6X 1T6NA 3C15C 4KE7A 2VA8A 2H0AA 2V7EA 4MR9B 1NXOA 3TTTA 1M34A 3N3AC 4R01A 5JZVA 4KPUA 1GSAA 4BPBA 4UC0A 5AI4A 1RTTA 1L4HA 4GP6A 4G63A 3W79A 4JB2A 1WCWA 1V96A 2G5PA 1PYDA 5AKXA 1J8QA 3WADA 1LK0A 1W0JD 3AI7A 2AG5A 3T9BA 4B83A 3HDYA 2P1RA 2JFYA 1GSIA 1KBOA 2QORA 5BR1A 3HACA 4Q93A 3QPCA 2IYWA 3DZ8A 3JWGA 4L5AA 3DZJA 1N6RA 2RFLA 3WBFA 1J90A 3BXZA 4LV8B 2GOYA 1XMSA 4K2AA 3M1YA 4NOMA 3KR9A 3RSZA 3DMTC 4PSVA 1I2AA 1ZMTA 4FN5A 1J06A 4TYQA 4WDQA 3NHZA 2ZVDA 3D6TB 1SQ0A 2ZT8A 3B7PA 4C4OA 5HNKA 1RM3A 3K70D 4Z4EA 3I5AA 1V3TA 3IO3A 4OM7A 4F9TA 1C2TA 1P4GA 3MINB 4TYPA 4WOJA 4BNNA 2BEUB 3GQBB 1UJ2A 4OIFA 1IXYA 1D2CA 1U0BB 2J48A 1C9EA 1L5VA 2GZRA 3DULA 4WK2B 1Y1RA 3L40A 1GAQA 3V2HA 2HFKA 3KKPA 3L1UA 4OXNA 4C0SA 1KYIA 3H8JA 2BM8A 1UKEA 2Y0CA 3BWBA 5K8JB 3NVAA 3JYOA 5ER6A 1NJGA 1W4AA 4A0QA 2EJVA 3DW3X 3HYTA 3JTMA 2WV7A 1R10A 1GZ7A 1XFAA 2J6CA 3D6MA 4IRMA 1H3FA 4BBPA 1Z5VA 2YINC 1KYVA 4LN1A 4XGRA 4OX9B 3MUFA 4BMSA 4RABA 2WOJA 1SRRA 3C5CA 3P20A 1CZOA 2ZSIA 5HF8A 2G4LA 4G37A 2HK7A 5CYOA 1JG2A 1CETA 1GKYA 1BKDR 2ERYA 1ZO8A 2P6PA 2NW6A 3DV0A 2FQYA 1UMBA 4KSCA 4TM7A 3ADCA 2GFIA 1KMMA 4FU0A 4TTJA 3VOTA 5CDHA 1IY1A 1F14A 2XQIA 1NVUQ 3N53A 1M6YA 1T6ZA 2AQIA 4HXEB 5CLIA 2PA0A 4YRLA 4K1XA 4JCCA 4ZEXA 2IHUA 4CN9A 2O5VA 4YAJA 2OOSA 3MJTA 2R62A 2AK2A 2PMFA 2CYBA 3OJLA 1KVSA 1U1DA 5J2UB 1AUPA 1VJTA 4MVJI 3MNFA 3FUUA 1WY7A 2JIBA 3JSAA 1ETUA 3BGOS 4GP7A 4BNHA 1QFMA 3DHEA 3ZI4A 3E05A 2O0HA 3LQYA 4WPGA 4EYOA 4XPIB 3L5KA 5FPYA 4BP9A 1Z0DA 1XEWX 2XZPA 3WQBA 1SJ9A 2PSDA 5EMMA 5JXJA 5BWBA 2UZIR 1RRVA 1A8HA 2PS1A 1JX6A 1E98A 1E62A 1BJKA 3C7DB 1YE5A 3EXFB 3GJZA 3A05A 4WKCA 2Z8YA 3KUCA 1A4RA 3AIOA 1GLNA 3P0EA 4PPFA 2WD7B 4IDEA 3BX1A 2ZBUA 4U9IS 3RANA 4CI0B 4RV5A 4DEYA 4JP3A 4DIKA 2LIVA 4B3TB 3VSBA 3EOZA 4D9IA 1G0OA 5EP3A 3JVEA 2ONKA 6REQB 1NKTA 1E18A 2ORIA 3CZAA 2H08A 1JKJB 3CF6R 3R2JA 5AJHA 4DR4B 4REQA 2CV0A 1L4GA 2B1JA 3DEKA 1TE2A 3HPQA 2H4XA 4ZT5A 4BP3A 2ZZNA 4LFBB 3ICPA 2G5TA 1DAIA 1JF8A 2QAGA 4IDCA 4DJAA 5JECA 4K9KA 5ES4B 4J49A 3ECAA 3I04M 1Q0SA 3IB3A 2VIIA 1X6VA 4MI9A 2Q9AA 3FCEA 1XTSA 4KMMA 4ER3A 1R4MB 3GLFB 3TAHA 5ALPA 1WY5A 4KXWA 4PLFA 2FWMX 1AKEA 2GEJA 1JHMA 2OGTA 4UCFA 4BVLA 1OFTA 5EIHA 2PGXA 2Y6VA 5JXIA 2DFNA 4RJIA 2LDBA 4UHJA 1JDJA 3W7AA 4FI3C 4I81A 4OQMA 2C57A 5ARDA 3AEUB 1RADA 1VA5A 1V1MA 2G7MC 2H4JA 4IIFA 4DM3A 2QR3A 2ZU0C 3K9QO 4E2ZA 1EQ2A 1VRWA 2DY0A 1C7JA 2XSZD 2AUMA 3ND5A 2E2WA 3BHJA 3O8BA 1I1QB 4HD8A 4XIIA 3GP3A 3SXPA 3H5NA 3ONVA 4HZUA 3JQEA 3TXYA 1ELOA 4CRWB 3W2EA 2PLNA 3P9RA 3THXA 4D4KA 4CL0A 1P1HA 2OCPA 5BQOA 5EMHA 1BX1A 2O8NA 4HLNA 3LW8A 2F90A 1EAMA 1NV8A 4P2BA 2OCXA 4QLAA 3R5HA 3DH0A 4OQQA 4Z1OA 4Q02A 2G1UA 2J9YB 4YRGA 3P0FA 1YOBA 2JD1A 1SB8A 3CE6A 3EARA 3RVLA 4RKFA 5LQNA 1M0WA 2YBDA 4IVNA 2B1QA 4PYMA 4Y2YA 4AXXA 3DMPA 2E49A 4XGNA 4NONA 2AN4A 4XJVA 5K0LA 2JFHA 5FR1A 4AKTA 4DKJA 2WPNA 2LD4A 9ABPA 2QTHA 1YQ9A 2QN8A 1QHNA 2O7QA 3PQ5A 1Z73A 5DTIA 2XWBF 2PH3A 2AZXA 3E7XA 3NANA 1W5AA 5K0ZA 1KI4A 1E8DA 2V9ZA 3ZG6A 1AM4D 1U0SY 4QGAA 2IXAA 3W5HA 4MPRA 1QSGA 2NO6A 3NUGA 1TO2E 1LDGA 1BKYA 4ND8A 1VCHA 3UT0A 4DDVA 1KQ3A 2G83A 5EHXA 1VLMA 1UC4B 5ARCA 3Q12A 3S70A 3JARA 3K73O 4IDAA 2EYUA 4XFKA 3RFXA 3Q7RA 1F0YA 3VH2A 4FHGA 1DTWB 3LUJA 4S1NA 5H02A 1I4TD 2B92A 3VNBA 2JLWA 1IOZA 1HV8A 2MWMA 1K06A 3OCXA 3DE2X 3M6XA 4I55A 4UM5A 2YHAA 1WQ1R 1GEGA 5DNAA 4I6JA 3T1NA 4MRNA 4FYPA 1EFPB 1VP3A 3HVKA 1TMYA 2YFHA 3LCVB 2VSQA 4CLOA 1C9DB 3LECA 2BGJA 4B79A 1QQAA 1XNRB 3HO1A 4UUAA 1L3CA 1KVQA 2MU1A 1BVYF 2AW3A 1D6JA 4BX3A 1IJKA 1JL3A 1VIDA 1V16B 2E6UX 3R8CA 3ZHXA 4DZTA 5IC6A 4B2IA 1XTZA 4EJMA 2H9YA 3I9JA 3OPQA 2FPGA 3H9JA 2X77A 3W4IA 2IYLD 3ZHZA 1LH0A 4B6JA 4CHTA 3T3NA 4LYGA 4Y6SA 1M7GA 4DA9A 4QFCA 4ESOA 5LP1A 3CSUA 4UCXA 1ZW6A 3ZE1B 1JJ7A 1DEXA 2V45A 1M34B 3F8WA 4US1R 2XCRB 4G0WA 3FFTA 1V11A 4BQSA 3TGLA 5I9SA 3ZY4A 1N78A 1E59A 1NMQA 2OV8A 2J1LA 3V4LA 3UJNA 5G4LA 3WK6A 4K0KB 4QDJA 3T61A 5AO9A 4E6EA 2IZ7A 5FKJA 2XJ9A 5HBGA 4H4CA 3GEMA 4J1SA 2PQ2A 3OQHA 1ZICA 1W59A 3K8QA 1SKAA 4TN1A 2VPXA 3SG0A 5IYZA 2CBXA 2XYGA 3IPRA 1M8GA 5ENZA 4ERXA 3SBEA 1UPAA 2BGIA 2VQ6A 1G4AE 2OTCA 2WJYA 1PJ4A 4RK4A 2WY2D 3R7LA 2RKOA 2V1UA 1QM5A 4LWZA 1CUWA 2ODPA 4GF5A 4U2BA 1F2DA 3PPXA 1Q74A 1Q11A 1VOTA 1IY2A 1W87A 2BMVA 2GN0A 3MYYA 4GEKA 3HYNA 1YJBA 4B2LA 4CKCA 3T1YB 3PCRB 1PG0A 3H3XA 2P11A 5CT8A 5EXDA 4D5GA 1B8PA 3PJRA 4O4IA 5JC8A 2WAMA 3P2OA 1PFYA 4CPDA 4FDUA 2FZWA 4PIPA 2PX3A 2O7NA 4IDOA 2JI6A 4NU5A 2H9IA 3DO5A 5BN1A 5BSUA 4G01B 3FAKA 4Z7OB 2FZCA 1YQTA 4ASUA 3QX8A 4LX0A 1XX6A 4UFNA 2G76A 1EX9A 2CL0X 4HDAA 3STYA 2NUPA 1QH0A 3AIMA 3UJDA 3K6SA 1OPRA 2QUIA 1G4UR 5B36A 4QGGA 3GUHA 2REBA 2I65A 3MD9A 5EN4A 2MINA 5TY0A 2QLFA 2YJNA 4ZOEA 3ZZ0A 4X0EA 2P2DA 2W6JA 5CU7A 4RPGA 3D8TA 4Y1GA 3DNFA 4MP6A 4MAFA 1JR3A 5EJFA 1JR4A 4HQRA 3VJMA 1LSOA 1FXWF 1J5EB 3WGOA 4GDFA 5IAKA 1I6MA 1HQKA 1T8WA 1UMBB 5LIRA 1T5DX 4RMHA 5KX5F 1V5WA 1D6NA 2YWJA 2QMZA 3LUPA 4KLCA 4W8OA 3A7EA 4BQOA 3AVWA 1O57A 2VP9A 3B12A 4ON9A 3AYXB 3EDCA 3OHSX 5TNXA 4WXRA 2AOWA 1SBTA 1Z47A 3IELA 1C1DB 1P18A 1MXHA 3GNSA 3E27A 4IMJB 5DWDA 4CUZA 4UJ5A 1N9GB 1WXGA 4PV7A 4WNAA 2I78A 2PCLA 5KVQA 4HGZA 3TZLA 5DF1A 3TL3A 5DPMA 4KUGA 1IY9A 2CXSA 3ORSA 5L3VA 2P4UA 2H4FA 1ULUA 3I3OA 3AV0B 2BMJA 2LGJA 4HDQB 4NPAA 4RVFA 1J07A 4FILA 4MTLA 1QGOA 5FI3A 3T4EA 4A0HA 5KPJA 4MVJH 3LBYA 3LD9A 3IT1A 4L6CA 4PAMA 4QOGA 5AJYA 2WPDD 2X9VA 2CVHA 5K0GA 4B87A 5L4LA 3C6MA 3UUEA 2GH1A 1EYZA 2ENUA 4NULA 2X15A 5FXMA 2IZ6A 2VWPA 2X5KO 3NWPA 3R09A 1VMDA 1H4VB 2PWAA 3AVYA 3EVEA 1FK8A 1TJPB 3BMQB 3CLHA 4H59A 1J70A 2O05A 3U13A 4AKEA 1V8FA 2F4NA 3WWYA 2FXIA 1G8YA 3LRPA 4CFZA 2QLMA 1W48A 3W6NA 2WP8J 3PJDA 2Q3EA 5EWLA 5IK2D 5D7BA 1PTKA 4Y7CA 2OBFA 2NO0A 1F0NA 3W5AA 4REQB 1CJCA 4LAFA 3O0TA 1NXQA 2ZVQX 4W1RA 4ZYZA 2UDPA 4NCAA 1IN1A 4TRJA 4NH0A 4HRVA 4X1KA 1WZCA 1FX1A 4RAOA 3T0GA 1JYEA 1R15A 1YI8A 3HEBA 3ZOZA 1B0AA 1NVTA 2WB4A 1V37A 1Y1PA 1X13A 2BHSA 4Y2RA 3SJBA 1W1UA 5CK4A 3BK2A 3OZ7A 1W8DA 2RAFA 5C4GB 1LLCA 1I6WA 4F5WA 1ISHA 4P4NA 4PSCA 4RK5A 1VLJA 2ILTA 4TUYB 1T2DA 1VJCA 1Q1NA 2DKFA 4GHWA 4TTRA 3TTVA 1Y8AA 1JLRA 2Q5JA 3BA1A 3I9NA 4UXJA 2CK3A 4RF5A 2OK8A 4HZUB 2OB1A 3THXB 1PU2A 4LVUA 2UVDA 3IKVA 4TRNA 4YK7A 3WNCA 4JQOA 3P2EA 2WFZA 1T15A 4G25A 1GDHA 3O82A 4XDZA 2A1UA 2DJ5A 3LUBA 1X3LA 2R47A 5AW9A 3P0RA 5K0SA 2FW9A 3E82A 3L6OO 2JFNA 3AI1A 3SNKA 1Z2NX 1M6WA 2C8JA 3KETA 3T6KA 5F5LA 1HFEL 4JT9A 5KQPA 1H8HD 2I4OA 4M76B 2WDPA 4QUDA 4XASA 3VC2A 4AN1A 2DOKA 1Y3IA 2F3SA 1HKHA 3PUYA 4N8DA 3FPGA 1T0PA 4ZHQF 4IIEA 1FP7A 1M1UA 1JG6A 4U2KA 5EIOA 1RLTA 3V42A 5DI9A 1ISFA 3I2IA 2ZPAA 3U6BA 1BXRA 3ESXA 1WMDA 1Z2AA 3V32A 2QQ5A 4DABA 1W85A 4R8MA 3U4MA 1FUYB 4IQ8A 1XZMA 1U6IA 4ND8B 1IBMB 2Z3ZA 5D51S 5FLXA 4QARA 3L0ZA 2NOAA 4UTRA 1JMKC 3D6HA 2HDNB 4RD2A 2CLEB 4YUAA 3NT5A 3JARB 1T9HA 3PI7A 4O0LA 1L5KA 1XXLA 1J8FA 3AHEA 1WL8A 5CDUA 1M6VB 3N9IA 1BMFD 3K5IA 4V0RA 1SC3A 3A4NA 3ZCRA 2XTZA 4BZQA 4OI2A 4KIUA 4I55B 3UGTA 1IOLA 4M9UA 1IPFA 4RMGA 1U0JA 1ZGAA 4CLOB 2OUKA 2NVUA 2Y8EA 1JE1A 3OZFA 1FRZA 4KWCA 5JT1A 5CLHA 4AZ0A 2WWRA 1J0XO 4RWEA 3VUEA 3CNOA 1L7NA 3DL7A 1INLA 3TLYA 1C0LA 1F5NA 1Y7TA 3W8FA 2ZRJA 3ROEA 3NC4A 5TQ0A 1U5CA 2XECA 1ZD9A 5E4JA 3R0ZA 1JBEA 1QO7A 4LJKA 5GM2A 4EO4A 1USGA 2FPGB 2O57A 3GFRA 3GNQA 5TARA 3V6MA 2AG0A 5FDFA 5JBIA 1QVRA 3QVXA 3K0EA 3U1VA 2W00A 3UNXA 3HG7A 5M29A 2BBSA 3V7UA 1MBZA 3QUBA 2ZI3A 4P53A 3SY8A 2I71A 2HTFA 1V3UA 3VR5D 2QROA 3HPRA 1UPBA 3DA8A 3JR3A 4NBLA 4C1BA 3V4OA 2MDTA 5LOVF 5KPDA 2OBLA 1IHDA 3SHOA 5HJ2A 5FHRA 1P72A 3HKEA 4ND4A 2R6DA 4OA8A 5I48A 3FPFA 4C43A 1JUDA 1PT7A 4IINA 3KSUA 4DOMA 4ZVVA 1IXRC 2R8ZA 4DWVA 1VI6A 1QX3A 4MI6A 2DPLA 4PLVA 2VNIA 1N3LA 2FPUA 3B1JA 4KBGA 3TZ6A 4CN8A 1OAAA 1R0RE 2ZRHA 3L04A 5F33A 3VJRA 2Q5FA 2YJGA 3AW8A 3FX2A 5DHRA 3OCZA 5INTA 3VC7A 4CKCB 1TGVA 4FUQA 4QVGA 3BBPA 3K3PA 4NCBA 1YGPA 3BCSA 1P4SA 1DEOA 3IE2A 3O6VA 3W6ZA 1SQ5A 4FNOA 4Y98A 2NAFA 4O4IB 5FB3A 4F1WA 1WB6A 3UK2A 2C9CA 4JASB 3OOYA 2F1HA 4GNRA 1FFHA 1XDZA 2YRWA 1GGKA 1LNSA 5CXXA 2L69A 2H57A 2B8WA 5EEGA 5F35A 1XPOA 3JQAA 1R5OA 4EGJA 2JFXA 1JDZA 5JS1A 1F8GA 4S2EA 1AUQA 2H5EA 3G0GA 2NUPB 3IP3A 3L49A 4BO5A 2OCAA 3W1EA 1ZNXA 4Q1CA 5GJBA 1KRHA 3RJZA 1E2DA 4CKWA 3GWZA 3QUQA 1SXJA 3RIYA 1IDOA 3ZGNA 4EG3A 4JOCA 2P8SA 2JZOA 2WIKA 4EPRA 1REQA 1FDRA 4ZJZA 3X43A 1N5JA 2RIRA 3KR2A 4ZKEA 1SM4A 4AK9A 2JJ2D 4MWEA 1A8IA 3AR6A 4IXNA 4HLCA 1ECLA 3P1JA 4PHTA 4HSGA 1LTHR 3IP9A 1MGPA 4C14A 4IO0A 5HZKA 5I7WA 1UKBA 3EHEA 4GE0A 4UHFA 1YVDA 5IC5A 4NPCA 4IOMA 4C0JA 1HTTA 3H5RA 4TTSA 1K5DA 1BGVA 3DT9A 3FF4A 3P96A 4QGBA 1L5LA 2VBCA 2PG3A 4C7VA 4IDBA 2BFNA 5IABA 1OW3B 4FKBA 1U1FA 4HBZA 4WNAB 2ZYIA 2WFLB 1X74A 3IUQA 3VH3A 1AN0A 1U8CB 1Z06A 3KKNA 4EHBA 4BCDA 2HEGA 3BD7A 3R41A 4LG1A 5M5BA 1OROA 3K0CA 5EP2A 1YJAA 1AQIA 1GCUA 1Z4JA 4XJSA 3WP1B 4ZZ3A 4RUKA 1J2JA 3G8CA 3W5DA 2ST1A 3LH5A 3VDQA 4PFSA 4RY8A 5A6SA 4ITUA 5TJ9A 5DRYA 5E38A 1PHPA 1RRPA 1FTNA 2UXCB 4HDRA 1L8AA 1ECGA 2IIQA 2Z8YM 4XB1A 3G2MA 3BICA 3GRFA 3KQYA 3PUKA 3Q11A 5B3AA 2ZJZA 4Z49A 1QXSA 3PG5A 2W48A 4WINA 3RRXA 2Q5HA 4NBSA 1GUFA 4BFTA 1I4WA 1ST2A 1R0KA 5EWLB 1L9XA 1YDMA 1V2GA 2XD9A 3NXKA 3RS4A 221PA 3OZGA 5BNIA 3K9BA 3DYBA 1SVMA 5LCXA 1A9PA 3N39C 1O5IA 1W6UA 2X4LA 1Q0TA 4RVGA 1CCWA 4J0HA 4Y2UA 4KR0A 2Y3IA 4O08A 2JFBA 2EWMA 1PV4A 1JU4A 1MJ5A 1YR6A 3CUEF 4RD0A 4EYSA 5BPHA 1E2KA 2RGGA 4FD3A 1XI2A 4LS3A 1QHEA 1XZEA 4PQFA 4Q16A 3KJZA 4LHZA 3TJMA 5EJ5A 4R81A 1FRVA 5NULA 3NJ8A 4C04A 4DR6B 1MX1A 4LOHA 2WUGA 5KO2A 1TLTA 1FUUA 1DUSA 2BCJQ 1A9QA 2Q1WA 4FQ8A 1BTOA 2HV8A 1SN7A 3K94A 4XWAA 4Y6OA 3ZTTA 4HGRA 3C6BA 3AOGA 3DTNA 2QVLA 2OL4A 3R24A 3BMOA 4DA7A 1IPHA 4JBWA 5B37A 3FUXA 2Z95A 2PBFA 5L7YA 5LLDA 2DCUA 3ZXUB 5CCEA 7REQA 1KRWA 4ZQEA 5KBYA 2GBLC 2JZNA 2DBQA 2QUKA 3FW1A 1CV2A 4LJLA 1E9CA 4JJ4A 3W05A 1I80A 1SHJA 2FGJA 4KQIA 1TW3A 1VE7A 5KVAA 3P9KA 5IUNC 3HDHA 2A1UB 2A5FA 3CZ9A 2Q0QA 4FQ5A 3OFND 2DCMA 4I1IA 1NUHA 3AK4A 4P4UA 4URHA 3SXJA 3R6DA 4CLXA 2P1DA 3FPKA 3B1FA 4EHNA 4TV9B 4EO9A 1D09A 2KQUA 4KHZA 2FZLA 1NW7A 4MPDA 4RD1A 5G1NA 2Q2VA 2GCGA 1FFDA 1H5QA 4DJFC 4I4TA 4RY0A 3B2NA 5CFQA 3BWCA 4KMSA 1CEXA 2AV6A 5DTMA 3GZJA 3CR3C 3WK9A 1UFKA 5F21A 4NSNA 4C4RA 3JRNA 2ZT6A 3JASB 3N1UA 4II3A 2JI4A 3HO8A 1S2NA 2B2NA 1VTKA 2GJ4A 1T36A 1WKBA 1BXRB 2GXQA 2HU8A 2RGNC 1VXOA 4WCVA 5EXXA 2ZIWB 4EW3A 1WV1A 3CKKA 5E7MA 1Z2PX 3QITA 3BS4A 4QODA 2D1RA 1KSGA 3ZX4A 4FMDF 5LDDC 1GFSA 2QZ4A 2Z2XA 4BVEA 4MV0A 1UXJA 3DL2A 4Z9BA 3EMVA 2NQTA 3RRNA 2O9JA 2J67A 5DNEA 1EP3B 1Q5PA 1CRLA 1DUIA 1RRMA 2KMLA 2YMPA 4IV5A 4OEHA 1JDVA 4V0OA 5DBFA 3DZKA 4BUCA 4HG2A 1XWWA 2GM5A 1NE2A 4WZAA 1EDDA 2FZEA 2COEA 5HDQA 5I6DA 1EPUA 4L76A 1W35A 4MIOA 3BCHA 4FBMA 1EB8A 3FSJX 3QA9A 4JLAA 4JU9A 4ND7A 4NESA 4OY3A 3TLAA 3UW3A 1N1DA 4E51A 4F96A 1MA0A 4LMPA 4M9ZA 1DQPA 1EZ1A 1NUPA 1WW3A 5NLLA 4Z53A 3GFFA 2NVUB 3DLHA 2ZZMA 4AZ0B 1U3DA 1MPXA 5DX8A 2ZJ0A 1JYSA 4HAZA 3R7SA 4MVCA 1TYAE 4QGFA 2BKUA 1UMCA 2DU8A 3ITDA 4KDCA 5I7AA 1L4BA 1HOTA 1UP6A 2R8EA 3I5YA 3Q7SA 1VBNA 4IP0A 3R4CA 1NWHA 2AS0A 3FJOA 4H1TA 4J3NA 5ICCA 1JJVA 5DXAA 2QU7A 1CYEA 4YREA 3M5WA 5GONF 3HBLA 1E2GA 1JFFA 3ZBTA 1YUMA 3R5TA 5ITVA 3IV7A 2XNCA 5KQRA 3UFXA 2FY8A 3VR2A 1MO4A 1QUEA 1EHIA 4JBXA 1XLTC 2P3SA 3P9YA 1FS4A 1KP3A 1WCV1 3H2GA 5KJCA 1M1ZA 1IHOA 1LW6E 1BS1A 1PZXA 3LY7A 1K4KA 3C3KA 5IZ4A 1HE1C 4BJ1A 3ER8A 1NQAO 3HGTA 3LTEA 3VPHA 3RK4A 2R8BA 1L5NA 1B76A 3P5SA 1X7XB 2ZRDA 5GTDA 2QGZA 4NH4A 2MIIA 5JZOA 3DJYA 2Q62A 3D5TA 3HP1A 2QG6A 3BYZA 2CL5A 1V4VA 4FXOA 1SU8A 2QLLA 3JVUA 2IWRA 4UZFA 1GA1A 1SCNE 1VYUA 2JLCA 4YCLA 1AB5A 2K2WA 2WTUA 3O47A 1JRLA 4IZOA 4JI4B 1QE3A 2PGLA 2WSIA 3ENKA 2VXBA 3LUCA 3PQFA 1RHKA 3ZLTA 3IIMA 4AZWA 1L7PA 3JVDA 1XXHA 4WI1A 2RGEA 2F6RA 3BRQA 1EVZA 2C5GA 2JIDA 3DEZA 3KSDO 3FVQA 3L6DA 3HNRA 4L9AA 4LYFA 1QG2A 2G9RA 3KB1A 1HDRA 3X3HA 1ULBA 4E2XA 1YJ8A 3Q3JB 2HV9A 3PCXA 2ZR8A 3SSNA 2P27A 3JQAB 3KP1A 3FVTA 2BMWA 3K1TA 3TPFA 1T26A 3H87A 1YJXA 4LRSB 5GP1A 8GPBA 4RXMA 2QL6A 2GTHA 3KHUA 2WZCA 1NASA 3HO6A 2AKAB 1QCZA 1ZY2A 2J3IA 1IU9A 1JB9A 2X1LA 2RJOA 3G79A 3NIGB 4FN4A 3L7CA 1BDBA 3MT7A 3S55A 4QU8A 4DJJA 1A9TA 2PSJA 3E5NA 4CKWB 1SXJB 4BEWA 5LB2A 3K0AA 4NBUA 3B48A 3EIHA 3ABOB 1LI4A 2TMKA 2UZ1A 2WSBA 3EOBI 2JGDA 4XCVA 1RXYA 2PT5A 1EFVA 1V3VA 1LX7A 4RAQA 2QTMA 3KHTA 5AM0A 2JAHA 3W4JA 2X0KA 2GPSA 1NBAA 1DWQA 4N7MA 4P3PA 3DC2A 2QR2A 3NBMA 2QRNA 1AQ6A 2HMSA 2RHTA 2WILA 3O4GA 2AC2A 3ONEA 4NMLA 3HP4A 4WWHA 4X97A 4YJ3A 2PE5A 5HQ3A 3TB4A 1OFHA 5LQJA 3GQVA 3IAEA 3ZD8A 1FJGB 4B33A 2AJLI 3MGGA 3SZGA 3NBUA 3B3AA 4PN3A 3HDJA 2NZXA 2X9LA 3IX7A 4YMTA 1LLQA 5KYNA 3VKVA 2CLOB 4L5YA 3A6KA 3KE9A 4Q15A 5T5QA 2AXQA 5D3ZA 4TMKA 3RHTA 4ZTZB 2EIXA 1O95A 1O89A 2H63A 2GPTA 16PKA 1XZIA 3FBWA 4OHPA 3RAPR 5BSGA 3U7QA 1G9TA 1ZNQO 2QRKA 4ZVQA 1L8XA 3EA4A 3L0BA 3O03A 5AH0A 1E0KA 5A6SB 2IXTA 3INTA 4HDRB 3E58A 4IDDA 4TT3D 4J1TC 3IHWA 4IH4A 3G5UA 2NU9B 2HU7A 1YZKA 3EZYA 5CD1A 4RMNA 4LJ8A 2N75A 3O4RA 1X42A 4DG8A 1VQ1A 4EG4A 2P0EA 1F8FA 2ZU6A 4AT1A 4MJXA 1QFYA 3PFGA 1XRRA 2IUFA 3NQ41 5FAXA 5CFNA 4EH1A 1N0IA 1VPDA 2B61A 1E1CB 1UWCA 2YN0A 3NRCA 3UH0A 2W6OA 1Z0FA 3FXAA 1ANKA 1ZUNA 3T3IA 1DVRA 1MHPA 2BLLA 5C53B 2V3VA 4WD3A 5AKYA 1XCMA 4L0QA 1RQPA 1E5LA 2B6HA 4V03A 5KU1A 4G86A 4Q4HA 2AJTA 1XJCA 1KO8A 4DLBA 1NSTA 5LBUA 4JL6A 4M37A 3B20A 5TMBA 721PA 4AWXA 4IJWA 1L4NA 3TSWA 4IWXA 4LJ9A 3LK7A 3P32A 3RAFC 4W9RA 4YV1A 5ALGA 2ZAYA 5H9WA 5BSWA 1YNSA 4XAQA 5I7UA 3QEKA 5LKRA 4Z54A 1YJQA 2ZDGA 4ZV9A 3V7YA 4ENPA 4AMGA 4C0BA 1GRNA 1XA0A 3MWKA 4E70A 1LY1A 3IA7A 1V1RB 2WHQA 3BMOB 3DEJA 4L72A 2FLVA 4Z1MA 5IT4A 1I5OA 1YDFA 3SS8A 1OA0A 1VHLA 2I3AA 3GEEA 4IMRA 2J7PD 3ZDRA 7REQB 5ICSA 1OREA 2HNKA 1GTL1 1DUVG 4H3KB 1RACA 2L19A 2Q6IA 4YQYA 3M7IA 4YT8A 1RWBA 3L7KA 1Z4QA 3SBOA 2X2OA 4LK2A 5HKKD 5GJVC 1OOEA 4P36A 3Q3CA 3B3JA 2RJ3A 3UMFA 1RKQA 1FP6A 2VWGA 3D2AA 1G5PA 1QPBA 1Z4LA 4Q7MB 1ND5A 1UJ5A 3A1NA 4RENA 3STHA 3BSSA 2AR9A 2OEPA 4YDQA 2ZR0A 3U60B 2G0AA 2PKEA 5J58A 3T4UA 2H4HA 5IS2A 5K9ZA 3VZQA 2XEDA 1EM8B 2RJNA 5DW0A 2UVPA 4I4TB 5J63A 3I73A 4RPCA 1JMYA 1V1JA 2VT6A 1JQEA 4HT3B 1WULS 3F5MA 1YB2A 2J0SA 4OHCA 5DH9A 4CIAA 1QX4A 5F2EA 5ED0A 3PEEA 2Q28A 1T3TA 1ZSNA 2ZYRA 2O5RA 4PQEA 5LYJF 1RJDA 4OHVA 4BFYA 2OFWA 2QX6A 3UHPA 5KTYA 1P29A 3L7IA 1IBLB 5K6RA 4Y0VA 1SUPA 4H4DA 1RE1A 3C14C 4BY9E 4UNPA 1KU0A 3WFJA 4MDFA 5MF6A 3FSGD 1UXGA 5CDFA 2JLZA 2C9OA 2ZRMA 3WGNA 3HXQA 5LLTA 1TI7A 4QGSA 3TCNA 1MHTA 3SU8A 1P4HA 4OJKA 1GPYA 3I6QA 3LPAA 3TQFA 3I6MA 4JXZA 4RZXA 1XZQA 3L0YA 2QXTA 5E9AA 1CLUA 2JCBA 2Y1KA 2AMYA 3ZWYA 1AF7A 3AR9A 1MB2A 4GLJA 4TKVA 2BFBA 2H1VA 4ZO9A 1D0SA 1T9GR 1H0KA 1P5HA 1TD1A 2RGAA 1D4ZA 5D3MB 4ZVMA 3RUIA 4IFIA 1T8UA 3EA0A 4V0QA 5CB4F 2WKPA 1T6BY 3LXRA 3NVDA 3OLWA 4EJ0A 4D9KA 1GOTA 4B6GA 2I1QA 3MWJA 4ZOQI 4MO2A 5JMWA 1KOLA 1XJ0A 1A3CA 4FJ2A 1RABA 1S96A 1G38A 2ZTVA 1G291 3IUJA 3U7FB 4PWZA 1Y6JA 1UMCB 3NIBA 3RYFA 1M10A 1XU4A 1TCAA 2Y1FA 4P83A 5FWXA 5F7OA 4ABYA 2QMUA 1VHWA 1JA1A 3OVMA 3KPVA 4NCJA 2YXPX 3X44A 5F9FA 4L4UA 3ZV3A 2F3QA 5AHWA 1L4MA 5C46F 1V9SA 3GH1A 1GHTA 3L7BA 3KJXA 4I4NA 4F4FA 1XT6A 4L95C 3H4VA 4ZCIA 3PA8A 4NV1A 3UFXB 2Q3FA 1CDDA 4TTTS 5TRTA 3S68A 4PGAA 3PSHA 4MGZR 3OM9A 5JCPA 4O33A 3L06A 4AWAA 3KE8A 1YKGA 2H4ZA 1M0SA 3MWFA 4P0TA 3V4VB 2JHPA 2LXNA 2PKXA 2FR1A 4PEVA 4ZCTA 5BUCA 3L8MA 1EE2A 2WTBA 1I7LA 3PNVA 2ZJ4A 4XM0A 1EVYA 2AG6A 1YKFA 3BTOA 4DDWA 3ZHTA 3LPLA 2IU0A 1OT3A 3MGCA 2VPQA 4LGMA 2P77A 1YONA 2WU4A 5I8WA 3THWA 3NBQA 5B58C 4R5MA 3KUDA 1PWXA 4MYSA 1I13A 4MKGA 2RMKA 2YZGA 3ENWA 3C85A 3GP5A 4CBVA 3SSMA 4PF1A 4D74A 2I6TA 4D4GA 4FDTA 4EKNB 5C4IA 2PYDA 1U8UA 4BE7B 5I5EA 2AN1A 4EYQA 4KLRA 1IQRA 2QVYX 1OXSC 4QU5A 5E9JA 1XZAA 2F00A 2YV2A 2IXEA 3KBOA 1LF5A 3UJBA 2YOGA 1P7PA 4DV6B 2AMFA 3EZXA 2XTAA 4A6XA 2IPOA 4E5NA 3ILYA 4LEIA 5CAEA 1TA9A 1LJUA 4AYWA 3EQ2A 4C4YA 4RM2A 3AUAA 1STOA 1DKNA 3H2HA 2JVKA 3HR7A 1SZJG 3LGXA 3KQQA 2QRJA 1CJKC 2HYIC 1S8OA 4XR9A 1EFLA 2VP0A 2UZ1B 3N75A 1SEVA 1P6UA 2W83A 1GKUB 3ABIA 3BFJA 1MQ9A 3F6SA 3QHPA 2IP1A 1EFVB 4MLZA 1HLGA 3LQFA 4A16A 4I8XA 4YV2A 5BN5A 1RNLA 4Z4QA 3UPDA 1GG2A 3KVNA 3N5KA 4GNKA 3VBEA 3GLGE 3V4FA 3QOWA 1TZ2A 2QLNA 3A1CA 4IVQA 5LMCA 1P61B 5H82A 4A36A 2VAWA 1EX1A 2CBGA 2W2LA 1KTVA 1OLUB 4IY1A 1VIAA 2OO3A 4F38A 4OI0A 1B15A 4JA2A 1E2UA 2G6TA 2O2YA 4P4LA 4U6SA 4V3CA 5FPSA 5L3ZA 2ZE5A 4ZAVA 3IP6A 3GLRA 2F8MA 2CFIA 3TMAA 1TYBE 3F7MA 2PRJA 2WSMA 5F98A 2NGRA 3NW9A 5F3DA 3UKOA 5TS3A 4YR7A 2EW2A 1IK6A 1XHEA 1BA3A 1J1UA 1BRMA 4ZREA 1NQWA 5GGYA 2X22A 5J4KA 4L4ZA 3ECCA 3C7CB 1EWTA 1Q57A 4EO7A 4DM7A 2P2SA 3STUA 3ZDZB 3PS9A 2X1HA 2X58A 3PLNA 4K9NA 2O52A 4JC5A 2AR7A 2IHYA 4H6WA 4YCCA 2DM6A 4PCAA 5H4HA 2A2ZA 1R2QA 5A3QA 2ZBGA 4RD6A 4YX9A 5BOSA 3NTOA 4B7UA 5F4BA 4JXKA 4K9SA 5MN5A 3J81A 1RZ3A 4DMLA 2IS2A 2VYVD 3M6LA 2B82A 4OSOA 5KKCA 3ADDA 1OB5A 1FFCA 2ACKA 2QRVA 3QXXA 3O21A 1J21A 5A5VA 4YUVA 1OI2A 1P2BA 1Z4NA 2Z30A 4Y2VA 1B3BA 1AUXA 1GWNA 1WCIA 2CHUA 2R1VA 3D8UA 1NE7A