5JCJA

Trypanosoma brucei ptr1 in complex with inhibitor nmt-h037 (compound 7)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 94
structure length 249
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jcjA00
3DBRA 4Q3EA 3CTMA 4OKIA 4CJXA 1VL6A 1A72A 1ONOA 4ND2A 5H83A 3TOXA 3AFNA 1LEHA 3C1TA 3L6OO 3ZU4A 1NQ5A 4CM9A 3PFWO 5JO0A 3AM5A 3ONDA 3KYBA 5JAZA 5L4LA 2O3RA 4MVJP 4ND3A 5T67A 4DQXA 4QUKA 3WGYA 2PKRA 2X9NA 4RVUA 4XQEA 4NU5A 2Q1WA 1ZEMA 4F46A 4LRTB 3U0BA 1MXHA 4MVJD 1E7QA 3BMNA 1IZ0A 2C2YA 1NFQA 4RVDA 2PGLA 5GZ6A 3GC6A 1P1RA 4J4TA 1HDGO 3FNHA 3VPGA 3V2UA 1WLYA 2YFHA 3VZRA 1PX0A 4J7XA 2WEKA 4XQCA 3E9NA 2IZ1A 1C1DA 1VC2A 4IBOA 1P33A 4NG5A 1PJLA 3Q9UA 4DYDA 1VL8A 1KY5A 1XLTA 3KEQA 3OQ1A 1XGKA 1HDOA 3DFZA 3E5RA 3TNLA 3LT4A 4J90A 3ZWPA 3HZZA 5KIAA 1ZXBA 3QVXA 4YACA 3FF4A 4IINA 5THKA 4CMEC 3E5MA 3L9WA 3ZU5A 5L9AA 2O4CA 4CL3A 1YOVB 2NTVA 5JMWA 3F4BA 2I3AA 3I4FA 1UH5A 2UVDA 4W7HA 1L1FA 1EFLA 3OQBA 3ANMA 5B4TA 5TNXA 4M86A 5C7OO 4I9UA 2OXIA 4XYLA 1XR3A 1EFKA 1GDHA 4OIMA 5L45A 4RGBA 5L4SA 3L77A 2OUIA 2VWPA 1E3EA 3P5SA 3V2HA 1LLDA 3LC7O 4PGFA 1LTHR 5TQVA 4PG5A 1HDZA 3VZQA 1D7OA 3K6JA 4BV8A 4DIBA 4UULA 4EEZA 3LK7A 3PYMA 2WMDA 4BHTA 2W98A 4RLHA 1TI7A 3OA0A 1NBOA 2FOIA 1DDOA 3OBBA 4AICA 1GEGA 1UAYA 2CDAA 2X9VA 3H8VA 4RF3A 5A5FA 3WB9A 3GDOA 3PGXA 1ENPA 2FSVA 1LSSA 5JE8A 4IJVA 3RC1A 4ZQHA 2UAGA 1B16A 1UXGA 1VJ1A 2DQ4A 4LRSB 4BKOA 4R4JA 2R6JA 1SC6A 4Q39A 3UCEA 1SBYA 2ZJ0A 4E5MA 3I52A 1WVGA 1PQWA 2DVMA 1EDZA 2H6EA 1IUKA 3C7CB 3IP1A 3CUKA 3JQ8B 3FSRA 5L7TA 3EHEA 1VL0A 1UP6A 2Y0DA 3GAZA 3ETDA 4TWRA 2FZEA 4UEKA 3TFQA 3I9LA 3NKLA 3EYWA 5LDGA 3HDJA 1OZAA 4RJTA 1IL0A 3GEMA 4NJMA 4D45A 1X1TA 3Q3CA 4I9NA 3OJLA 8LDHA 1H6BA 2O3JA 1DAOA 1B7GO 3QP9A 1V3TA 3H9UA 2Q1UA 1GQQA 3D5QA 3HN7A 4GX2A 3S2EA 1C1XB 4LK3A 4DXHA 1A9YA 2HDHA 3PFFA 3I5MA 4HBGA 1X7GA 4QO7A 4YTEA 1M66A 3GRKA 3AM3A 1GQ2A 3QVWA 1P74A 1T2DA 4RPHA 4GX0A 3LF1A 2CF6A 1VE9A 3OJOA 2BGMA 5THQA 3SJ7A 3BMOA 3K30A 2FPPA 1EZ4A 5TJ9A 3RI3A 3H6KA 3CZRA 3IJPA 3JQAB 4J4BA 4K9DA 3RQSA 3L4SO 2P68A 4R3WA 4BKUA 3TZKA 4CV0A 2I9PA 3TZQA 1GAEO 4J1SA 3JTMA 4F6LA 3NT5A 1VJTA 7ADHA 1MC5A 4JJFA 4BNKA 1IY8A 1QYCA 1MA0A 4HWKA 3MJSA 4ZU3A 4R1UA 4E30A 3E82A 3DZHA 1SAYA 1SNYA 4WGGA 1T2EA 1T2CA 1W4ZA 1P0FA 1UDAA 4WPGA 4RZIA 1AUPA 3ZV3A 3EGOA 5G4LA 3U4DA 1LDMA 1P1FA 1PL6A 2BD0A 5L40A 3R1IA 4QO8A 1E3LA 4PLVA 1WW8A 3EDMA 2VRBA 3QVTA 4K6CA 4MVJF 1MLDA 2P91A 1A27A 3Q1LA 4Z0TA 1IULA 1G0NA 1FMCA 1MGOA 3ZHZA 3HG7A 3GDGA 4CMEA 1J6UA 2IRWA 2FWMX 3VH1A 4R16A 3DDNA 5KNLA 1MP0A 4IDCA 5I9NA 1FJHA 4FGWA 2C5EA 4YT4A 1ZJYA 4WUVA 1Z6ZA 2Q2QA 3PLNA 2OBNA 4BNVA 3D7LA 3LDHA 1O89A 4Y67A 1DFGA 3CH6A 3HWRA 5GMOA 1VKOA 3FNGA 3UH1A 1DFHA 3I9NA 5TX7A 3HDQA 5JY6A 4OYRA 4KP7A 3RUDA 2X6TA 5F5NA 1Z73A 4YDRA 4OXYA 4I5GA 3V2GA 4UVGA 4JP2A 2GUGA 2UDPA 4PRLA 1ZK4A 5FYDA 2UUOA 4YRDA 5IJZA 2PH5A 3WQRA 3LC1O 4J16A 3GPIA 3PXXA 4MP8A 1G6KA 5C37A 5L95A 4BUCA 2QHXA 5DOVA 1Y8RA 4CMBA 1LLQA 1TT5B 3BHIA 3PVZA 4MVJI 2HMSA 2FRDA 1NPDA 3WGZA 3U4IA 2YHUA 4AJHA 3DBVO 4R9SA 4AJEA 3NAQA 1E5QA 5DT9A 4CUKA 1OOEA 2OOSA 1H6DA 1GZ6A 5CHEA 4NFSA 1HDXA 3GN1A 1SPXA 3OICA 2IYPA 4A03A 2VTDA 3AW9A 3WDSA 1EK6A 4D0RA 2X5JO 3AOGA 3PDJA 3DZBA 2V6BA 1ISJA 1SMKA 4OXKA 1ZJZA 1Z82A 3VDRA 4A10A 5TRTA 1P1HA 3AUTA 1N9GB 1HL3A 3GNSA 1UXIA 4XR9A 3KRTA 3RJ5A 3DBHB 3M2PA 5KCZA 1NASA 1R15A 3GK3A 4YVFA 3GNQA 3GVCA 1U2GA 3X2FA 5IN4A 1JU9A 3L07A 4TRMA 5TSDA 1FDTA 4KQXA 1TLTA 3ITKA 4J3FA 4ZGWA 4B4OA 2OFPA 2O7QA 5I9LA 3JQAD 5J23A 3ZNOA 2YV1A 3RROA 1SOVA 2A94A 2FR1A 1LDGA 4TKLA 4MVJH 4MVJE 6ADHA 2GN6A 2XF8A 2GZ1A 4Y98A 1PJTA 5HA5A 1YBVA 3V8BA 3FR8A 1O94A 1EBFA 4R5HA 2I6TA 3HB4X 3BMCB 4CQMA 1EMDA 2Q4EA 1NPYA 4B3JA 1LC3A 2IZ0A 2WD8A 3DZKA 5EESA 4GWGA 4KTTE 1WNTA 3PLRA 1Y5MA 4FFRA 3H9JA 4J4HA 5A05A 4E0BA 2EP5A 4XEHA 1LUAA 1PQUA 2GASA 2EEZA 2DTDA 4KUGA 4QQRA 2O2SA 5L53A 4FJ1A 3DONA 2EW2A 3SJUA 3K8ZA 4ROSA 4BNJA 3ZW9A 1IZ9A 1X0XA 3KTDA 2ZB8A 5JC1A 4K6FA 5ITVA 1L7EA 2VYVA 4XYEA 2F00A 4Q3DA 1CWUA 2X5KO 4BL5A 2J5RA 3M6IA 2CDBA 1LSJA 1RM3A 2DPGA 3OIDA 4D44A 3W8EA 1ISGA 4NHEA 3RJ9A 1ULSA 4XRGA 3RC9A 1BVUA 4RQTA 2AA3A 5JBIA 4LSMA 3DMTC 1Y7TA 3F47A 1DC6A 1YL5A 2OZPA 4KOAA 3OFSA 1I30A 1F8FA 4BNWA 3GZ4A 3JQ7A 2O50A 2EGHA 3DOCA 5GY7A 5BNIA 4HP8A 2ZB3A 3K92A 2VWHA 4O6VA 4BNYA 1YVEI 1M75A 1BGVA 2P5YA 2DM6A 3RC2A 2JFGA 1QR6A 4OO3A 2D0IA 2OO5A 3GVIA 4BO4A 3ADPA 3E8XA 1JKIA 1OI7A 4EUEA 4IQ0A 2W8ZA 2OP0A 5TIIA 2G5CA 2X7HA 3OJEA 2ET6A 3PP8A 4U6QA 4LMRA 1J0XO 1N1GA 1TT7A 1Y81A 1E77A 1GPDG 1IYZA 4RPGA 4CLXA 3HJAA 2CNBA 3VVCA 4XD2A 3STHA 1BDBA 3V5NA 1I01A 4HNGA 4P4GA 1CF2O 2VNAA 4L76A 2R00C 2V6GA 4YJGA 1M6WA 2NU7A 1BVRA 3H4VA 3NT4A 2DFVA 2ILTA 2SCUA 3WGQA 1WZIA 1ZMTA 4FJ2A 5G4KB 4G81A 1RYEA 2JCYA 2VHYA 4WOKA 4GVXA 4IZHA 4IGFA 4AFNA 4G65A 1ZW1A 4ZRNA 4CM4A 2XPCA 1QORA 4H16A 4MKXA 4NMHA 2TMDA 3DOOA 4MINA 1F0YA 4YRAA 1HDCA 2I3GA 5I7SA 3KEOA 1U8XX 1PGJA 5F1OA 1YJ8A 1Z45A 1ZXLA 4KQWA 1T1RA 1UP7A 3TRIA 1CQIA 3TL3A 4AJKA 1NVGA 1MX3A 1PJ3A 2HK7A 4CQMD 3ZI0A 3JYQA 1FDUA 2DTXA 3ETGA 3TL2A 4CV3A 1H6AA 3DTTA 5BNFA 4EJ0A 1KY4A 3A1NA 4BO7A 1R4NA 3P19A 1ID1A 2PZKA 1M67A 4EJ6A 1PJ2A 3JD2A 3N74A 4WK6A 1JAXA 1HWYA 1JKFA 3OIGA 3GZNA 2PA3A 4KTVE 4CM3A 4HV4A 2PKQO 3GVXA 5CG1A 2BFPA 4EBFA 3PWKA 1GUZA 1DIAA 3QWAA 3WGIA 2VNSA 4MPDA 4ESOA 3D4PA 4CQLB 4IM7A 3WLEA 4F6CA 1PS8A 2GN9A 3VZPA 3F1LA 9LDBA 4BIIA 4KMSA 4BKRA 1ENOA 1N2SA 4FIZA 4M87A 2EWMA 4QFDA 5T64A 2NNLD 1U3TA 4Y9DA 2W2KB 5KKCA 4IDAA 2B4QA 4FFOA 4FCCA 1ZZEA 2I99A 3GT0A 2ZQZA 5A9SB 4UEOA 3H5RA 5CPBA 3S2FA 2HAEA 5IDQA 3DHNA 1ZCJA 1XA0A 4GVLA 4WCFB 3IC5A 2C2XA 5HBRA 1U1IA 1VSUA 2B5VA 4XDZA 3PTZA 1NAHA 3DMTA 5JO9A 3IIEA 5A3VA 2ZYAA 1HLPA 4B3HA 1HETA 2NQ8A 4D41A 3DZIA 5L3ZA 1F17A 2AEMA 1EDOA 3UAGA 5TF4A 1E0DA 5BQFA 2A9FA 2IZZA 4ALKA 2QRLA 4IUYA 3D5TA 4MO2A 3D0OA 4OSOA 1CERA 4RLSA 1HF3A 1PIWA 3KV3O 5MGBA 3WFIA 3UCFA 3BTUA 4R68A 3IQDB 3AI1A 4PG6A 5DCUA 4Y8VA 3PDUA 4PIVA 3V1UA 3ZWVA 3B1KA 3ZZNA 3UF0A 1BXKA 4JLWA 3VTZA 3ZWXA 3PZBA 1WXDA 2GF2A 2CUKA 4BNLA 1QV6A 4JXKA 4CMCA 4A2CA 4BMSA 4MVJA 3D1LA 5JY1A 4IJUA 1YDEA 4Z9FA 4EW6A 4HADA 2GRAA 1GZ3A 4TVBA 2V7PA 3JYLA 4H7PA 1YWGO 3WX0A 1P1JA 2ZYGA 4JN6B 4YAJA 2AHRA 1DJQA 5AXDA 1PEDA 1ZEJA 2RCYA 3R3JA 2V6FA 1MUUA 4MDHA 3QQPA 3NDJA 4LVCA 1LLCA 5BT9A 2Q4BA 1J5PA 2OMEA 3BIOA 4Z3KA 2ZB7A 2OL4A 3AI3A 2BMAA 3EC7A 1NHWA 5G0WA 4CLRB 3FHLA 3OQ6A 4M8SA 1LU9A 4I5DA 1M2WA 5C5IA 1R4MB 3UFXA 2IXBA 3ENNA 1AGNA 4ZQEA 1GYQA 3IUSA 2RH4A 3U3XA 1IPEA 1MFZA 4FSHA 2E49A 3FPLA 1AXEA 2WE7A 1ZNQO 3JD1A 3COSA 1DBVO 4OM8A 3KB6A 1V0JA 1LDNA 2D1YA 4N18A 4N54A 4EI2A 2G82A 4LN1A 4A73A 2PD4A 4Q3NA 1O8CA 4E6PA 2WM3A 4BO5A 2WYWA 3AUAA 3FBTA 4PZDA 3DWFA 4DPMA 2D8AA 4YXFA 1GYPA 1CDOA 3H9QA 2LDXA 4GMFA 4EGFA 4J0EA 3INGA 3I6QA 5G0SA 2BGLA 4NU6A 3OJFA 3BMQA 2Q2VA 4JJIA 1HE3A 1GD1O 1H2BA 1TA4A 1Y5RA 3GMDA 3GPDG 3I83A 3D3EA 1YGYA 1VLLA 5BSEA 4BS9A 2HJSA 2VZ0A 1DPGA 2X0RA 2D59A 2DAPA 3CINA 2FR8A 3JYOA 4CM8B 3MWDB 4UUOA 4PG8A 3TZCA 1ZSNA 5T5QA 3NUGA 3BAZA 3GA0A 3HQ4O 3E9QA 2NVUA 3QWBA 2B35A 2DBQA 1Q7GA 1X13A 2UV8A 3L4BC 1C0IA 3WLFA 1B8PA 4CM1A 4DLBA 4UEJA 5DULA 4ALNA 1H5QA 4PG4A 4S3MA 1C0KA 1B8VA 1QG6A 3JQ9C 3GRPA 1PGQA 3DAGA 4YJHB 5BR7A 3WGHA 1N5DA 1DIBA 3DO5A 1KC1A 3DXFA 2P9EA 3C7AA 4TSKA 2DUUA 1SO8A 2PLAA 3DAPA 5EQDA 1OC4A 2LDBA 4G2NA 3S55A 5KVVA 3TSCA 2FHSA 2JFFA 1EUCA 1KETA 2JJYA 1QLHA 2NTJA 4BMNA 5FI3A 3AOEC 4YJFB 3DEYX 4XYMA 4RPLA 3C1AA 3L6DA 3WNQA 3B1FA 2B83A 1ZO8A 1BTOA 2DLDA 2ZQYA 1YE3A 2WD7B 1RM0A 2YY7A 5B1YA 1T2AA 5JW6A 4INAA 3CMCO 1EEHA 1B15A 2NACA 1NQTA 4A5OA 4BKPA 4EEXA 3PJEA 1NWHA 1XWFA 4I5FA 1YKFA 1RJWA 4GL4A 1YB4A 2RH8A 2C0CA 1Q0LA 4W9NC 1KBZA 4CR6A 4WLUA 3TJRA 1YOVA 4QT0A 3ICCA 2HO5A 1T26A 4P22A 4NH4A 4IXTA 2IDZA 2YJZA 2DU8A 4J1QA 3M2TA 1BHSA 1U4OA 2QRKA 4D3FA 5JCJA 4R1SA 5AXBA 4D79A 3HUDA 5HS4A 3O8QB 4A7PA 1UZLA 3C24A 3AUUA 1IPFA 2AQIA 2AXQA 4E3ZA 3NTQA 3A28A 3KYDB 3RKUA 5I7EA 3G1UA 4Y6RA 3ZV5A 1NP3A 3K2EA 4M55A 4R5MA 1C1DB 1JVBA 2J8ZA 3SC6A 4BGIA 4C4OA 2VRCA 3AY3A 4Z9XA 3AFMA 3QJ5A 1GUFA 1DIRA 3IJRA 5I9MA 4R51A 1MG5A 1LSUA 3WSVA 3H9EO 4NIMA 3UHAA 3LF2A 4BV9A 3EAGA 4E2WA 1Q0HA 2PWZA 4II2A 1I2CA 2DC1A 3WMWA 3K73O 1Z7EA 2ZB4A 3IDSA 2OORA 1E6UA 1R16A 5F1KA 1WWKA 1ADCA 2B4RO 3PQDA 1YQXA 3AI2A 3TFOA 4GKVA 3EUWA 3OF2A 4ZN6A 2YHIB 4E13A 5L7WA 2QZ9A 5IXYA 4UVDA 1PJ4A 2CMDA 1IHXA 3WG9A 2W90A 4GAEA 1ZK1A 2V6MA 3JQ8A 1XDWA 4ZQBA 3DB2A 5CEEA 1B3BA 3WTBA 3MTGA 2O2YA 1U5CA 3O26A 1AHIA 2JCXA 5AOVA 4CV2A 4YT2A 4XDYA 2O7SA 4YQYA 3ZNPA 5CEJA 1YONA 2Y1CA 3L9XA 3O38A 1G0OA 5C7LO 1E3WB 4DIOA 5TGDA 2X0JA 3NJ8A 2OHXA 5KJ6A 4FGSA 2HRZA 5EIOA 1KIFA 3H3FA 1YO6A 5T6BA 3ETEA 5A04A 3JCZA 4E31A 1Z74A 4TKMA 2X22A 3L4BA 1C1XA 3VH3A 5CFZA 1QYXA 3ZWCA 4FPXA 4BNMA 1HSZA 4QSMA 5EN4A 4CM6A 2JAHA 3FWZA 4OL9A 3IKVA 1LA2A 3RUFA 1ZUD1 3JQ9A 3WWZA 4UAGA 1ISMA 1RM4A 3GGGA 3TOZA 2Z1MA 5H81A 4XGKA 1R0SA 3SBOA 2AQ8A 4AJOA 3GGPA 2J3KA 4CMIB 5JDIC 2QX7A 4B7XA 1UXKA 2EV9A 1U5AA 3JQAA 4CL8A 3L6EA 2EERA 1ADFA 1KERA 1QXSA 5AYVA 2GR9A 2ZTLA 4E32A 3WTCA 3PHHA 2VHZA 3VPSA 3MTJA 4GKBA 3GH3A 3AOEA 1FDSA 1P0CA 4HY3A 4YAGA 2Y05A 3X2EA 4WE3A 4MKRA 3CIFA 1PSDA 1I0ZA 5HWSA 4HUJA 1BW9B 1E6WA 4HFJA 4J7UA 3B70A 3ASVA 3UXYA 2DTEA 5I7FA 1JQBA 1SB8A 4FC7A 2PV7A 5JCJD 4KDFA 2FPGA 1JLLA 1T4BA 3DBLB 4BNNA 4IDEA 1A5ZA 1MG0A 3Q2IA 4B7CA 2GDZA 3P7MA 4PZEA 2FMUA 2I76A 4XZ3A 2ZJ1A 2VWGA 4WLNA 2Q1TA 2QYTA 4WCDA 3A4VA 5LDHA 1Y8QB 2VRCD 4ZHSA 3A14A 3UICA 4AG3A 1AE1A 1HKUA 3DHYA 4W9NA 4D42A 3W6UA 1DAPA 3OETA 5JYEA 1ORRA 2HU2A 4NJOA 3GOHA 1SCUA 3LU1A 4IIUA 4WKGA 1EVJA 4H3VA 1OBFO 1LNQA 1OFGA 3F46A 3ZWWA 1GADO 1DC5A 1EVZA 1HEUA 4JBGA 4PN3A 1DOHA 4GQAA 5IDYA 4R41A 4KDEA 2B36A 4AJ1A 1CYDA 3ORFA 4E2XA 1UXJA 5MDHA 1FXSA 1DRVA 3UGKA 1T24A 4UUNA 1TT5A 2J6IA 1HE2A 4O63O 4JNKA 4Z0PA 3AJRA 5KVCA 2BGKA 3OP4A 5ICMA 4NR0A 2Q3EA 3KBOA 5FI5A 3SVTA 1K3TA 2C59A 1JAYA 2NADA 4BO8A 1TXGA 1PZHA 3INTA 5DP1A 1SEPA 1RKXA 3ZHBA 3ZNQA 5F21A 3U09A 2GO1A 1EUZA 2NU9A 3I23A 4N7RA 1V3UA 3MJ4A 1UDBA 3MWEB 2YDXA 1ENYA 5JFOA 3WMXA 4OKNA 3SEFA 1N9GA 4LSWA 4J1NA 3K2BA 3DBHA 2J3JA 4RDHA 4TRNA 5A03A 3W6ZA 3DC2A 2H5LA 3P2OA 2EJWA 4BNUA 1H0KA 1PQPA 4PFJA 1KVQA 2B4TO 2VWQA 3CMMA 5KOIA 3ICPA 3QWFA 3U62A 4KWIA 4X54A 1EQUA 4QECA 3GAFA 1BDMA 1E1KA 4Y6SA 2VYNA 3OM9A 2AE2A 3WWYA 4BO6A 4E21A 8ADHA 5IDWA 3EW7A 2B37A 7MDHA 1JW9B 4DIFA 3QVOA 4I8XA 5IAAA 2D5AA 1IE3A 2AW5A 3PQFA 3BMCA 3TF5A 4OAQA 2Y1GA 3UCXA 4RL6A 3ZWBA 3PHLA 4WEQA 4YCAA 5TJHA 3IS3A 3OIFA 1NM5A 5I7VA 5JDIA 4NI5A 1HDRA 1QYVA 1UAGA 4U5QA 3NDRA 3Q0EA 4CPDA 1LDEA 1ONNA 2Z1NA 1ZMOA 3AU9A 3WIDA 1U8FO 1PTJA 3DR3A 3PI7A 1AN9A 4XWYA 1DRWA 2UUPA 2P9GA 4BO1A 4MIOA 1A7KA 1E7SA 4GWKA 3D4NA 3ZN2A 1QYWA 1C3VA 4RVGA 3RU7A 4D0SA 3SX2A 3UUWA 2BFMA 1I33A 2HQ1A 1UUFA 2E4AA 2Y0CA 3I9KA 1HDYA 1O0SA 2W2LA 3DOJA 1GYRA 1BG6A 4GH5A 2EJVA 5IF3A 2JL1A 3B6ZA 5KKAA 1KOLA 4GSKA 5ICSA 1QMGA 3NV9A 2GNAA 3RUHA 2Q1SA 5BSFA 2DPHA 4FJ0A 2QZZA 2O3TA 3T7CA 3QWHA 2HMVA 3JQGB 4ALMA 2QRJA 4LVUA 1ZFNA 1P45A 2C20A 3KOUA 2TMGA 3G1TA 3EZLA 1HZJA 4XQGA 3RUCA 3DL2A 3H2ZA 3JQBC 2HK8A 5JS6A 4ALLA 2JKVA 2VN8A 4BNTA 4YRBA 2VTEA 4MP3A 1KEWA 3E03A 1GUYA 2POQX 2P4HX 1NVTA 4IGEA 4YBZA 5IFLA 5TLSA 3O03A 3CSDA 4YEDA 4B7UA 2DBZA 5JAMA 2Y1DA 3WIEA 4D3DA 5JAIA 5A9TA 3KHUA 1EBUA 1W8DA 3K5PA 3UKOA 3VDQA 2XAAA 3OH8A 4DPKA 2P5UA 3WS7A 1QKIA 4B4VA 3PHJA 1PL8A 4YR9A 2VHVA 1EUDA 2PD3A 1D4FA 4L4RA 3C7DB 1Q7CA 2I67A 1CEQA 1QV7A 3GHHA 3HFSA 1Q7BA 4L0QA 5G4KA 3RIHA 4Q9NA 1PS9A 1NWCA 3JQCA 2FPIA 1A71A 3D3WB 4JIGA 4XCVA 1SB9A 4C7KA 5ITWA 1KEVA 1LJ8A 3N7UA 1XSEA 3CZMA 3PJGA 1IB6A 4P4LA 3PIDA 2VYND 3AY7A 3QWIA 3U4CA 2I66A 2PGJA 3VH2A 4GI2A 3VPHA 3FTNA 3VZSA 1AXGA 2HJRA 1JTVA 1MXFA 5DCWA 3AK4A 1PR9A 4YWJA 3G3EA 2ZCUA 3S2GA 1M6HA 3NGLA 2V65A 3CXRA 2H9IA 3WYBA 1O9BA 4W7IA 4DTIA 2O3SA 3F5QA 2NQTA 1DHRA 5TS3A 4TVOA 2Q99A 4FOOA 4WLFA 3WYCA 5B12A 3NT2A 3GY0A 5DP2A 2W4QA 3RSHA 4O5OA 5HRUA 2CFCA 4I08A 4P4NA 3OEYA 1GEEA 1ULUA 2BI7A 2O3QA 2ZKLA 5CPFA 3U49A 4CQLA 5DOZA 4HFMA 1H6CA 1OC2A 4MVJM 3ROKA 4FFNA 1RPNA 2ZATA 1QRRA 3F6YA 1E3JA 1I3NA 2YZ7A 1Z7BA 2EF1A 4JCOA 2W2LD 1ISIA 2B69A 3GEDA 5DBIA 3WBBA 4NFHA 2NUAA 2BFOA 1ADGA 2X9GA 2W2KA 5ILOA 3BTSA 1NQAO 4PLYA 4J7CA 4NK4A 3LC2O 1YQGA 5A9SA 1YL7A 1T25A 1E7MA 2E37A 4CMJA 3GUCA 3HN2A 4QEDA 1D3AA 1NNUA 4WCFA 3H9GA 3RBXA 3QA9A 3K96A 1PZFA 2VQ3A 3GFGA 4BQPA 1N7HA 3MEQA 1KVSA 4TMFA 4BNFA 4J2OA 3JQFA 4UVEA 3DQPA 3S8MA 3ZU2A 3I4CA 1H2HA 4NBRA 3W4JA 1GZ4A 3LYLA 1J49A 4R69A 4WOJA 4DMMA 1EQ2A 5L4NA 2C7GA 4CLOB 1UP4A 3DZFA 1CJCA 4LCJA 1XHLA 2CY0A 4ZQFA 5U4QA 4CMAA 5JC8A 3JQBA 3HE3A 3VH4A 5HTOA 2Q49A 2WE8A 1P1IA 3JSAA 4YT8A 5C7IO 4CODB 5H82A 1U3WA 1IHYA 4P38A 5CEFA 3IAHA 2JFHA 1E3IA 4OSPA 4UREA 1WMAA 3E1KA 4XIJA 4JK3A 3QE3A 4BGVA 4B79A 1YBMA 4II3A 5DZSA 5EL0A 5IZ4A 2B5WA 4XX0A 3GUYA 4OH1A 1MB4A 1LC0A 2XXJA 3PJFA 4BNZA 1GCOA 1U7HA 3DZGA 3KZVA 4L4SA 1VKNA 2PD6A 3JV7A 4CR8A 4FS3A 4CMGA 3PGJA 2YDYA 4NBVA 4E12A 5IN5A 1E7RA 1V3VA 1V6AA 1X7DA 3VKVA 3GVHA 4CLRA 4RF5A 3BXXA 3VKUA 3ASUA 1DIHA 4GBJA 1M76A 3WNVA 4WNIA 3NEPX 1N7GA 4ZD6A 1PS0A 4PLPA 1R4MA 3FWNA 1DB3A 4PVCA 4AJJA 3PYLA 3F3SA 2HMWA 1HLDA 3OSUA 1I8TA 5KWEA 3RC7A 1C14A 2VOEA 3MOGA 4RF2A 4CR7A 3RBZA 3FNEA 1R6DA 3UW3A 1EE9A 3PRJA 3RUEA 3HDYA 3B1JA 3F1KA 4XB1A 4M89A 4E5NA 1A4UA 3AWDA 2AG5A 1MFPA 3QY9A 1F8GA 2Y1EA 3E9MA 3JQDA 4A0SA 3ZCXA 4R9RA 2BELA 3A06A 1FDVA 2RIRA 1ML3A 2A92A 2VOJA 4FR5A 1X14A 1LXCA 4XYGA 4BGUA 3GGOA 2PZMA 4IDGA 2Y66A 2X1HA 4U6SA 2QYSA 3CPSA 1W6UA 1R0KA 5EMHA 3ENKA 1B3RA 1HYEA 2C7VA 3FCOA 3K9QO 1ZVMA 1LRKA 1U7TA 4G5HA 4J43A 2FY8A 3G0OA 2C82A 4E5PA 5A9RA 3W4KA 5TC4A 2P9CA 3CEAA 3RKRA 2BRUA 5GZ3A 3C3XA 2X58A 4CM8A 4RPKA 4EYEA 4KUEA 4I1IA 4BVAA 4NBTA 4D43A 4O59O 3WBFA 4JBIA 1NQOA 2QIOA 3M1AA 1LDBA 1HXHA 2BF7A 1Y1PA 5AXCA 1T4DA 4EZBA 1GFSA 4ITUA 1LRJA 1BXGB 1LLUA 2WJPA 3H5NA 3TQHA 1QP8A 1HE4A 1YL6A 2A4KA 3JD4A 1H9AA 3H65A 4L9RA 4LMPA 4HX5A 1U3UA 4U0JA 2YW9A 3RUAA 1E6EA 4IIVA 4YJHA 4MIYA 2I65A 2X4GA 4RF4A 3DFUA 4IS2A 5FEUA 4WLOA 3KSUA 3FPCA 3PQEA 4DLLA 1P31A 4ILKA 1D1SA 2DBVO 1X0VA 4GSLA 5IZCA 4YAKA 1NPTO 2BLLA 3SLKA 1CRWG 3FR7A 3NYWA 4D3SA 3RAJA 1U2DA 3LT2A 1OMOA 3KYCB 2CDCA 3OMLA 5ENDA 4TZTA 4YJFA 9LDTA 2Y93A 3Q2KA 5JYDA 2C5AA 2NLOA 3VOSA 5KVSA 4Z9YA 4IS3A 1ISHA 2WD7A 3MJEA 1D8AA 1K5HA 1SZJG 5ADHA 3ZNNA 1A4IA 4J1TA 2VHXA 4PLZA 4C7JA 3DBRB 1HTBA 2VT2A 2NVWA 4DQVA 2ZTVA 3D4OA 3GR6A 3G49A 2O4UX 1UJMA 2UYYA 1F14A 2YUTA 3EMKA 1E92A 4GX5A 2PTGA 5AVOA 1UZMA 2JAPA 4AJLA 4DPLA 5A4DA 2HMUA 1JWBB 1QLJA 1BMDA 5FF9A 3LLVA 3RWBA 1CETA 1I2BA 3IP3A 1EE2A 5FWNA 1MV8A 3D64A 1YXMA 1WAMA 2GPTA 1WDMA 3RVDA 2HUNA 1O95A 2RAFA 2JCVA 1YB5A 3BMNB 3T4XA 2VUTA 3O8QA 4B4WA 3ZU3A 1UZNA 2VZ8A 5GZ1A 2OP1A 4OJNA 3KYDA 1LSOA 1LRLA 2X23A 1Y6JA 4EITA 1HZZA 1CIVA 3GNTA 4XA8A 4IMPA 1XCBA 4PZCA 3RFTA 5JSFA 4GLOA 2D5CA 4CLHA 3MCVA 4U7WA 4PCVA 3U5TA 2CVQA 2YFQA 1V8BA 1SOWA 5DN9A 4DBVO 4BMVA 1V9LA 4CUJA 4ALJA 4FFLA 3TZ6A 1MC4A 1GV1A 2Q50A 3FRJA 3AU8A 3LQFA 3MJCA 4FOSA 4GPD1 4OOEA 3ROPA 4RORA 3TPCA 2Q2WA 1C0LA 4O1MA 2GN8A 3GG9A 4DMLA 3CE6A 1KVTA 2YV3A 4IY1A 4XGNA 1ENZA 4CM7A 4UUPA 2QG4A 2B0JA 3ROQA 2YHIA 3RU9A 2IEBA 4OMUA 4FW8A 2WYUA 1E1MA 3K31A 2Y1OA 5CAEA 3NX4A 4W6ZA 1VPDA 2DKNA 1B8UA 4I9HA 4DC1A 4MOWA 3OHSX 5COQA 1O5IA 4ND5A 4QTZA 4L8VA 4R01A 3FNFA 3ST7A 3VVBA 1S6YA 4GX1A 4ZRMA 1KEUA 3DTYA 1E3WA 4DUPA 5B4VA 2J5KA 1NTOA 2GZ2A 4UVHA 4RVSA 1I24A 1HE5A 3C1OA 3LLSA 3JQEA 4H15A 3ZH2A 2FR0A 2IYOA 4OQZA 5AXAA 2RBEA 3NJ4A 3H5AA 1DIGA 2ZTUA 4K26A 1JWAB 2PNFA 3E6AA 4IQ8A 5A02A 3KLMX 2VCYA 3HSKA 1VM6A 1P44A 4NDNE 2Z95A 4ID9A 3HFGA 4JQCA 3INRA 3LT1A 1K2WA 4FC6A 1WMBA 3N58A 3NDIA 4FD3A 4CMIA 4XJTA 3HADA 2AE1A 4YB8A 5KJFA 2AEJA 1LI4A 2PKQP 3RUIA 4CM9D 2C29D 1IOLA 1UDCA 5ER9A 1FF9A 4AL4A 5JXWA 1XEAA 4HKTA 4TRJA 1PJSA 1K6IA 3VC7A 1ZSVA 4FDAA 3RFVA 1RM5A 3I9MA 3E48A 4NJMB 4J0FA 5KJCA 4FQ8A 4IDFA 4B8WA 4BGEA 1BW9A 3KSZO 4I5EA 4Q3BA 4OHUA 3ADOA 1WPQA 3LZ6A 3Q11A 1YQDA 1PZEA 2Q46A 1SEVA 3DBLA 4DQUA 3SC4A 3EZYA 2DBRA 2JD0A 4CM5A 5JNLA 3PJDA 4FFPA 4Q3AA 1H9BA 2Y1FA 1Q1NA 4GGPA 2O48X 1Y8QA 1RWBA 2JHFA 1ZIDA 3QSGA 2Q45A 3DMYA 4JGBA 3PWSA 4CV1A 1HSOA 2BH9A 2PK3A 1E3SA 4P8RA 2HKIA 3BMOB 2JHGA 1I3MA 4BO2A 4Z6KA 2Y67A 1U28A 1XU9A 3C85A 1QSGA 1PWZA 3QRWA 2X86A 2XOXA 4XGIA 1HYHA 2VUUA 5FFFA 2CD9A 2GSDA 4Z3DA 3UN1A 4Q3CA 1Q0QA 3A9WA 4YA6A 3PZRA 2NVBA 3QVSA 1PJBA 1R12A 1GU7A 3AUSA 1ZH8A 4J6FA 1I3LA 4IQGA 3RCBA 1QYDA 4BO3A 3KLPX 4AJPA 1ZBQA 2NU6A 4O0LA 4BQRA 4AJ2A 1Z75A 1N8KA 3C8MA 4HNHA 3I9JA 4IJWA 1E7WA 3ZW8A 1ARZA 4D7AA 1NX6A 2AQHA 3ITDA 3QV1A 4A27A 1I32A 3EK2A 5I8WA 1KS9A 2PZJA 2YV2A 2G0TA 2ZK7A 1K6XA 3VTFA 1DSSG 2GCGA 1C0PA 1JA9A 4GLLA 1DO8A 4QXMA 4XJSA 4TQGA 1BWSA 2O3UA 2NV6A 5IG2A 1H94A 3ULKA 4JP3A 3IL2A 5COAA 2EG9A 2FN7A 3KVOA 5A1TA 2ZTMA 4M49A 4LCEA 1PU2A 4LGVA 2PZLA 3ZV4A 3PIIA 1N92A 1PZGA 3VHRA 2PGDA 1Y8RB 2IE0A 2NU8A 3BA1A 1X7HA 1XU7A 3VPFA 5F5LA 3F4LA 4IDDA 4AVYA 4MVJG 2I5PO 1VJ0A 3WICA 3IOYA 3WJAA 2WDZA 4U8GA 3ZWAA 2JD2A 1I5RA 1W0CA 4CLEA 4PLFA 5K6AC 5JPIA 2YQ4A 1F06A 1L7DA 1D1TA 4IMRA 3WGTA 1GQYA 3WFJA 5F1PA 1GV0A 3B20A 4XIYA 2HSDA 1EK5A 1GPJA 4XRRA 5EINA 4BKQA 1DC4A 2BHLA 1N1EA 3KSDO 5G0TA 4WECA 1CQJA 4L75A 5F3RA 1JKJA 3U4HA 5K0ZA 4ND4A 1E1LA 3MZ0A 1TB4A 5JDCC 3T4EA 4NBWA 4FBGA 1I10A 4HFRA 3JYPA 1DHTA 5EJ2A 4RQUA 4M1QA 3WOHA 1JVSA 4AJ4A 3HB5X 1NFFA 5C3MA 2AEFA 3OEWA 3ZWYA 1B2LA 1PGOA 2Z5LA 1E1NA 3I1JA 3P2YA 4KUHA 4NQZA 4WCFC 3ONFA 5G2OA 3WGOA 5BSGA 2EHDA 3WGGA 3LT0A 4UUMA 3ZDFA 1J4AA 3W4IA 4CQMB 4DGSA 3F5SA 4NFYA 4EUFA 5CDSA 3JQFC 4ZQGA 4PLGA 3BTVA 1U3VA 1UR5A 2E48A 3JQGA 4ZICA 3NRCA 5DF1A 1ONPA 2IODA 1PGNA 4E2YA 3GFBA 1WDKA 1ZK3A 2DT5A 2OBYA 4R1NA 2XXBA 4J9UE 5K9ZA 1P77A 4DBZA 2C54A 3L0DA 4RZHA 3WYEA 3ZGYA 6LDHA 1NR7A 2EKQA 1OAAA 4YJDA 5A3JA 4IXWA 4BO0A 4KWHA 4HFNA 4OOFA 1JN0A 5T57A 1XKQA 1XG5A 2RHRA 2QQ5A 1A9ZA 4WLVA 5BSHA 5CDUA 4IZIA 1S7CA 3WQSB 4DVJA 4MJLA 1W73A 3QIVA 3PHGA 4QX6A 3JD3A 5EERA 1GY8A 4L4XA 3ZHXA 4OQYA 1P9LA 3QLJA 2J5QA 3HDHA 1DLJA 4ZVVA 1I3KA 2VHWA 3JQ7B 3IKTA 4NBUA 2D2IA 5COBA 5KJ1A 1BSVA 1YBAA 3RD5A 4B8ZA 3EVTA 4XYBA 3GVPA 4FFMA 1K89A 4BNHA 3D3WA 3GF4A 2IEDA 4JROA 4EDFA 1Y9EA 5CDYA 4WEOA 4JBHA 4NK5A 4DREA 5JCXA 3Q6IA 3S1LA 5U1PA 4AJNA 1KVUA 5KTKA 3O9ZA 3F9IA 3GN2A 3FI9A 5TT1A 4OGWA 4L73A 3GMSA 1LBEA 1LQTA 2YYYA 3I6IA 4M54A 3MJVA 1VRWA 4Z0HO 4YAIA 2WYVA 4YQZA 3VPXA 1O6ZA 1B26A 3KXDA 3OECA 1T2FA 4TRRA 4IPTA 1BXZA 4WLEA 4EJMA 4Y6PA 4UVIA 4F3YA 2JD1A 2R2GA 2PR2A 3SXPA 1ZKMA 1YS4A 2AQKA 3FD8A 1Y9AA 1HRDA 2BFAA 1GL3A 1NHGA 3PPIA 5CP8A 5LCXA 1R0LA 3BHJA 2H63A 2X0NA 4YJGB 3LSYA 2YQ5A 3UOGA 3BYZA 1NXQA 2AG8A 3V1YA 2CVZA 5KJEA 4CLDA 3KM0A 4R3NA 2G1UA 3PEFA 4XR4A 2FSSA 1FDWA 1KVRA 1H93A 1HT0A 1R66A 2F1KA 2VT3A 2HRBA 2NSDA 4CM4B 5HS6A 5I8ZA 5A06A 1P3DA 3KO8A 5LC1A 4ONEA 4W82A 3TN7A 5K6AA 4QFCA 4DRYA 1JDJA 3ONEA 3RASA 4PVDA 4DWVA 4TZKA 4S1VA 1NVMB 4RO0A 2CSUA 2G17A 5CDTA 5JMPA 3H3JA 4U0KA 4E5YA 2E6UX 3O4RA 2G76A 1I2ZA 1GTMA 4BNXA 1GCUA 1LX6A 4NZ9A 5T8KC 2X5OA 5DBFA 3R3SA 4K1LA 1XIVA 4BO9A 4OXNA 2P4QA 4LW8A 2Y99A 2GN4A 2BKAA 4GMGA 1NFRA 5JDCA 2J3IA 2J3HA 4L74A 1R4NB 5ILGA 3WR5A 4AJIA 1YB1A 4YT5A 2DUWA 2VYVD 4FB5A 3GZNB 2X8LA 1KEPA 2BI8A 3W8FA 3BTOA 2Y68A 3NTRA 4J91A 3T7EA 3WXBA 5IZCC 2HMTA 4DL9A 1YRLA 5ENVA 4WASA 2A35A 4E2ZA 4CUZA 4MIEA 1DEHA 4ZJUA 1YDWA 2VUSA 2C07A 3BHMA 3QHAA 1ZSYA 3EVNA 1TEHA 4B4UA 4R54A 1DLIA 4CLOA 3I3OA 3GEGA 5IDXA 5ER6A 1RYDA 3I9OA 2D4AA 1PR3A 2WSBA 1K0UA 2GERA 1WP4A 3GLQA 2NWQA 1ISFA 1NR1A 2VZ9A 5DBGA 1DXYA 3V1TC 5HM8A 4EUHA 3ABIA 1XQ6A 1KC3A 2WWRA 1X1EA 4TROA 3QW2A 3NTOA 1PGPA 1PJCA 1HYGA 1XYGA 2H1SA 5KVQA 4BB6A 2ZCVA 1B14A 3GHYA 3MJTA 4GGOA 4MP6A 1PWXA 2ZIZA 3JD0A 3FTPA 4BNGA 3CKYA 4YPOA 1NAIA 1VI2A 2EGGA 4LISA 3TZHA 3U9LA 4F45A 2FP4A 2HLPA 2RHCA 1PL7A 4W99A 3M1LA 3KUXA 3NGXA 4HXYA 2D3TA 1E5LA 4BNIA 2FZWA 3VAZA 4E4YA 3RFXA 4J2HA 1TVEA 2EXXA 4J9VA 4RDIA 4DA9A 5AQ1A 5B37A 4D46A 5L7YA 4B3IA 1GR0A 3GDFA 5DNAA 3ZV6A 3ANLA 2EKLA 3GQVA 1A7AA 3G79A 4W4TA 3WQQA 4NNJA 1BRMA 3OJ0A 3DAFA 4XQ9A 5G0UA 1XQ1A 4RVHA 1UXHA 3HHPA 3PYXA 1NYTA 4CMHA 1ADBA 2PFGA 2CVOA 5EPOA 4YYZA 4K28A 1VSVA 2QW8A 1B0AA 1U4SA 4ZA2A 2P2SA 5B4UA 4N5NA 3IUPA 4PG7A 2R00A 2IXAA 3FBGA 4J49A 2HK9A 1T1SA 3ZWMA 4NPCA 1P1KA 4RCVA 4PLCA 2EKPA 5CG2A 3EY4A 3ZWNA 2O23A 5ES3A 3SLGA 3MOIA 5DDIP 1ZK0A 5U9CA 4KZPA 4DC0A 5IXSA 3E18A 2Y0EA 3ROMA 4A26A 4IJKA 4DYVA 1ZK2A 3PK0A 3Q9NA 4PLTA 3UVEA 5EQFA 3IMFA 4YAEA 2CZCA 2DFDA 5JLAA 1Q2XA 4IDBA 4PRKA 1E7YA 1YJQA 3W1VA 3WSWA 4PLWA 1G1AA 1EVIA 3GG2A 3PWZA 3H7AA 3KETA 1EVYA 1YH3A 5A5EA 2HCTA 2EP7A 2PH3A 4URFA 2X0IA 2GYYA 1DFIA 1PJQA 2EIHA 4R1TA 3DHEA 3S2IA 1R37A 4E33A 3DZJA 4PLHA 4BB5A 2NM0A 2OGUA 3ANNA 3ZHYA 4RVFA 1BXGA 5TT0A 4BOYA 5DCYA 2AMFA 3G17A 5T8KA 2WTBA 3RBVA 3OA2A 1LDYA 5G0VA 4MKZA 4N5MA 3HNPA 3TDKA 2E82A 1DJNA 5BNTA 2GLXA 4CMKA 3ON5A 1AHHA 1LQUA 2CF5A 3R0IA 4JJGA 3AY6A 4ND1A 4JX8A 1V35A 1U9JA 1X15A 2GD1O 3AM4A 4XB2A 4ALIA 3BMQB 1F12A 2GZ3A 1XELA 4WJZA 1WZEA 1KYQA 3TWOA 3H2SA 3KYCA 3WJ7A 5CDGA 1FK8A 4WNCA 2EW8A 1WDLA 4FN4A 4RPJA 1K6JA 5JAQA 3W8DA 2PY6A 3PHIA 3JQ6A 1I36A 4DLAA 3ZWOA 1DC3A 4XKJA 3FN4A 2NVUB 2ZYDA 3R6DA 4N5LA 3LVFO 4RV9A 4E5KA 5L51A 2GGSA 3BZUA 3JYNA 1DRUA 2NTNA
chains in the Genus database with same CATH superfamily
3QYPA 4XVHA 1IY0A 2JGMA 3BGVA 1VL6A 1KNQA 4ND2A 5H83A 1AZTA 3VU8A 3A3NA 1LZKA 3C1TA 1L8OA 2X8JA 3L6OO 1NQ5A 3AF0A 3PFWO 4RWEA 4CM9A 2JDIA 4RCYA 5JO0A 3JPYA 1KZYC 2HSEA 4I1SA 4PHGA 1MZVA 3S7TA 4BLTA 4ND3A 5JAZA 2XEDA 3VC1A 5L4LA 1SXHA 4PU0A 5AKEA 1EP3B 1Z8NA 1WRBA 2VDRB 3A4NA 5IC5A 1SKYB 4ARIA 2IUFA 2G09A 3ABSB 5K01A 6AT1A 2X9NA 4EHBA 1L1RA 1M1NB 4XQEA 3ONNA 4I55A 5IAKA 3QPBA 3C43A 4LRTB 1M8GA 4KG7A 5DN6D 4MVJD 1U28C 2FQYA 3ZJUA 2W0SA 2HWKA 4QGFA 2XWBF 1NFQA 2AZTA 4U4AA 5CNJA 2IEYA 1VQ1A 3GC6A 4J4TA 3GZJA 3EXEA 1OU4A 3MRVA 2CE7A 2CB9A 2Z5GA 1PX0A 3NHUA 3OOSA 4IV5A 1OH8A 3CEHA 1VZ3A 2XHZA 3DTVA 3Q87B 4QAQA 5JS2A 4F8EA 4QLBA 3BWDD 2PZEA 1PG2A 4WWHA 5C51B 2G7ZA 5AT1A 4QASA 3SDBA 1RWMA 2Y1WA 2XGSA 1WKVA 1PJLA 5GJVC 3R44A 3S7ZA 3RWOA 3WLJA 1XLTA 1E3MA 1FU7A 1CDEA 3BORA 3L0PA 2VAPA 1IEXA 2F3UA 1ZXBA 2O2DA 4EUKA 1C3EA 3U1BA 4QD3A 4CKWB 3FF4A 3TLEA 3EMDA 5FBQB 1DKPA 3FHJA 3U1TA 4EJFA 4DR2B 4CMEC 3E5MA 5ALVA 1B6RA 3ZU5A 3PPXA 2WB4A 2PXXA 4JVNA 3I5UA 2B78A 3EWIA 4FKMA 1CJBA 4Q4HB 5P8WA 1G5TA 5IPFA 3HRHA 1F3OA 1U8EA 3KTOA 5CXSA 2HK6A 2X3FA 1FDIA 2Z8YA 2I3AA 3AH8A 1IXZA 1N3LA 3I4FA 3QTBA 4KGXA 4U5XA 3U1VA 2P0AA 3M6LA 3DE0X 1J06A 5KKNB 3ANMA 5B4TA 1BDIA 4KSBA 4RZ2A 1E4YA 3SSMA 4FZVA 2ONYA 5AK6A 4LXUA 3MA0A 1QKKA 4AZ0A 5CX1A 4Z1OA 2C3YA 4MVCA 2R6R1 2XRYA 3FOCA 1T36A 3TI7A 2F7SA 5A4JA 2OUIA 2H1VA 4M1WA 5I4BA 2EBWA 3A2LA 3EWSA 4J16C 4QDTA 1Q16A 2OXCA 2JFQA 3OTQA 4OU5A 4RHFA 4TZ0A 5K4HA 1WCYA 1D7OA 4ZOEA 2ATCA 4DIBA 2XUPA 1JXOA 3D4IA 4UULA 5D1NA 5G41A 4EEZA 2K87A 2ZWVA 2CVHA 2VP6A 4YBRA 2IXDA 2XJ4A 4PRYA 3HR7A 2FOIA 1CQPA 1DDOA 3O8DA 2WKPA 4AICA 1PWYE 2CDAA 2FEXA 3OLCX 2RGBA 4L51A 1A69A 3OIWA 1A5TA 5DKFA 4IG9A 1BFKA 2A9QA 3EVGA 3GDOA 3PGXA 4MVWA 3SC2B 3TW4A 1R6VA 5CNKA 4ARZA 1NYQA 4IJVA 3K9FC 2BAGA 2IYNA 1A1SA 1KAHA 1NRIA 4D4HA 1AHNA 4IJ5A 1SVLA 3DV0A 4X1YA 1VJ1A 1ZA2A 4LRSB 4I4IA 1J9ZA 4BKOA 4KSCA 2R6JA 3WK7A 1Y33E 1SC6A 3QFTA 3F3KA 3UV3A 1MEJA 4LEIA 4NBNA 2K7FA 1SBYA 2QMZA 1D2RA 1G6HA 1PQWA 1WVGA 2AJTA 1XVLA 2DVMA 1IUKA 1PD0A 3CUKA 2IPNA 3KG2A 4Q9IA 2QTWB 1U2GC 1QWOA 4YAWA 3ROGA 3RU3A 3ETDA 3OQIB 3SFZA 3TW0A 3HWX1 3TFQA 2I6FA 1L6IA 3TEFA 4DCMA 4MQEB 1PR6A 3NNDA 4CEIA 1PV2A 3C7TA 3ESDA 1WHSA 4KPFC 1A8IA 1BDJA 3G2PA 3TX2A 3Q3CA 1NSYA 3GCDA 8LDHA 1QPZA 4ZU6X 1KDZA 4XWGA 2P2YA 5FB3A 4ENPA 1MQ9A 4IIHA 1VIAA 3W9BA 2PQ6A 1ZMXA 1Z0IA 2PX4A 1TPZA 2Q6LA 3B2QA 3QXCA 3FE2A 2VSQA 4RY9A 4UU7A 3PX2A 5AKKA 3SQWA 3IAFA 1JQ5A 1L1QA 3HN7A 4GX2A 4WKOA 3AHCA 2UZ0A 5CW2A 3OQOA 2WTAA 4GMHA 3I5MA 1Z6QA 3AFOA 2BJWA 3RS2A 3WLLA 2P0YA 3DOFA 2RGGA 4GOOD 1FL9A 2XUAA 1NUSA 4YTEA 2JFPA 4X66B 3VI4B 4B09A 1M66A 3DE7X 3HEMA 3BA6A 4IGAA 3LGSA 4WACA 1X8XA 4J0DA 2NPOA 4GLJA 1IK6A 3OE5A 5SICE 4BQFA 3LF1A 1VE9A 1EWKA 3UMFA 5KTPA 3OJOA 2H4FA 4I6GA 4UMVA 3SJ7A 5IUJC 3BMOA 3EHDA 3H8WA 3OY7A 4M0EA 1DRJA 2VH2A 1EZ4A 2G1JA 4R81A 4TTQA 4TTRA 3IJPA 2XDYA 3CZRA 2X15A 4GGPA 2VNJA 4NOJA 3ZIUA 2JIZD 1L5QA 4BKUA 2NO5A 1L0BA 4KLNA 3VNBA 2ZG6A 3PEVA 2ZSFA 3SF0A 3TMKA 1T8RA 2WPDA 1R8XA 1E4EA 1X77A 2EP8A 2ZT8A 1VJTA 4MR8A 1PDOA 4B35A 1TJ4A 1IY8A 3MWLA 4BVKA 4ZU3A 4R1UA 3P9KA 3ZDAA 3B53X 1CR6A 1SNYA 1CVIA 1HE1C 1T2CA 1T2EA 1W4ZA 2OAEA 3CRVA 4TV9F 3WLNA 1P0FA 4IXNA 4DZZA 2ZI6A 5ADVA 1GTJ1 4HLUC 4RMIA 1AUPA 2AOWA 3I3SR 2I1WA 5D3MB 5H5JA 4QO8A 5JSQA 1JLLB 3FOEC 3KR9A 4ZVRA 1C7IA 1WW8A 4NCIA 2MR6A 4CNBA 4F97A 2ZBRA 2I1QA 3GLTA 4N47A 1MV5A 5KNCD 3GJZA 4IWYA 1MLDA 1U8TA 2P91A 5IKEA 2CE2X 4JYBA 2P4UA 1UADA 5D3KA 1FMCA 1MGOA 5SYAA 3UJPA 1FNBA 1ABFA 3ZHZA 4DCNA 1JIIA 4KEAA 1J6UA 4LOLA 2IRWA 1UINA 4HWPA 5FOWA 4DQ0A 4DV7B 4GIBA 2C04A 2IHTA 4HRXA 4MEJA 3P71T 5E4JA 4RELA 1L4MA 2VUHB 3U81A 5EWLB 4C4RA 2A58A 4D9EA 4PSVA 3NVAA 1ZJYA 2GMWA 1SUFA 1Z6ZA 2PO7A 3BRQA 3ICEA 3ETJA 3D7LA 2VPWA 2QTRA 3EC2A 4G8BA 3VNSA 4JUDX 1DFGA 1FJ2A 3CH6A 1LW6E 3HWRA 3LHFA 4KLZA 1QIDA 1DFHA 3I9NA 4DVGA 1PFVA 3KOMA 4NS4A 5K0TA 5A3RA 1EX1A 1G5HA 4YONB 4YDRA 1LNZA 3IP5A 3V2GA 2V96A 3H1GA 2YRXA 3L7OA 4BN0A 3W1EA 1BVYF 2PEZA 5FWAA 1I7QB 4MP8A 4N3GA 4N5DA 3R5JA 1H3FA 4EK9A 3PRHA 4WJKB 5JQWA 5DOVA 5FO0A 2EFEB 4DV1B 1PDVA 1LLQA 1TT5B 1YA4A 3BHIA 1L1EA 3IT2A 1ZOIA 2G80A 2O6LA 3TCXB 4MQFA 3WBKA 2YHUA 3LX8A 4LHSA 5AI5A 1NJFA 3LDFA 3RVBA 4A9AA 3WKEA 3PC8C 1O8BA 4FCWA 5DT9A 5TJ9A 2R79A 4RZ3A 4C6SA 3QU5A 1VDMA 5BV0A 1G21A 4G4GA 2VPPA 1GZ6A 1X3LA 2DPLA 2Z3VA 2HXYA 3HVUA 4LYFA 1U31A 1M1UA 3VO2A 3OICA 2IYPA 1I6MA 4JENA 4JGGA 4L7VA 4PW0A 2I22A 2VTDA 4UUQA 2V59A 4BDSA 4M36A 4HLCA 4RUKA 2DGDA 5TMEA 1Z34A 1SVKA 1F48A 1SMKA 4EB8A 3WIOA 1WPXA 2OTCA 1V16B 4F3RA 1Z82A 2ESRA 3VDRA 4A10A 1Z17A 5A4KA 1PHRA 4OGLA 1JJIA 3MJDA 5FBLB 5KNBA 2E4XA 1X7XB 4FD2A 2PBRA 4MYTA 3ZHQA 3M2PA 4KIGA 4BY9E 4PHTA 2YWXA 1JZTA 3EGEA 2QVZX 2WUVA 1PNRA 1E62A 4W1RA 3X2FA 4KI7A 4MS3A 3IXLA 2W8BB 3JZDA 3MGAA 4PQFA 3UWOA 1VL5A 3X1DA 2IYAA 2GS9A 5JV5A 4ZGWA 4TMTA 2FG6C 5I9LA 2C5LA 2NXNA 2VSNA 2X4DA 2C58A 3KKMA 5FNVB 3RROA 3J80A 1KHHA 4JOSA 4ER6A 4ZU1X 2O05A 1NUTA 1QE0A 2DJ5A 1BFDA 4D9JA 4AS3A 1YDGA 4A23A 4J07A 3EAFA 4OHKA 3LYAA 4ZI2A 4H60A 1N5RA 1BHJA 4MVJE 1STOA 2GN6A 5LLTA 2J08A 3E61A 3TO5A 1AMUA 4AZ3A 4QBHA 1B93A 1HMPA 1WUTA 2BMDA 1YBVA 1QHEA 1XDDA 2C00A 1K3UB 4QNRA 3ZGNA 1EBFA 3IUYA 3T52A 4CQMA 1VXRA 3CG4A 4DLSA 3AKDA 4BU0A 4DG5A 3EZGA 4PZLA 4B3JA 2YCBA 4HT3B 4E09A 2OVBA 1ZD2P 2DZDA 4H7KA 1T8TA 4WDRA 5LQRA 3GUZA 1WNTA 2B9VA 3KUKA 3PLRA 3H9JA 3C8HA 4C2BA 1N5KA 4HBZA 2IOFA 4D02A 5FO1A 5A05A 2EP5A 3ZCUA 4IHJA 5E6RB 3UA3A 4IJQA 2F90A 1LUAA 2IE8A 1SBIA 2GASA 2XCOA 1PKXA 2Q0SA 3AO0B 1V5EA 2OHVA 4IWNA 4QQRA 4XDGA 4JI7B 4P5DA 1Z6PA 2QAJA 1FSFA 3QFFA 4QBKA 4WXHA 3K8ZA 2Q29A 4MWZA 4ROSA 1QR2A 4BNJA 1IZ9A 3KTDA 4DC9A 1WP9A 3U56A 5CB4A 1CWUA 3U3RA 4BL5A 1HI9A 2VQ6A 3EUFA 3H6GA 3S4YA 1F9AA 1FNMA 1JT9A 1UK7A 5D5HA 5BPHA 1G9XA 1HFKA 2MCFA 4QT4A 1G7TA 3EGXA 4NHEA 4XRGA 2O14A 2RJ3A 3WHPA 1BVUA 2ICAA 4RQTA 1AQLA 3HB7A 2OV4A 4O2RA 1V9CA 4QGGA 2J3MA 1QQAA 3NBQA 1G7CA 1YL5A 2OZPA 4N76A 5JXHA 1E4VA 1YR8A 3I6ZA 2HBZA 4BNWA 4P58A 4EG0A 3I45A 3IPLA 2AD5A 2O50A 3NBYC 3DOCA 1N6PA 4K7JA 2ZUVA 4Q21A 2GVZC 5GY7A 1J2YA 3ZK8A 3ZLBA 2ZB3A 3K92A 2VWHA 3KLBA 5IKMA 4LWOA 3QE9Y 2QJRA 1BGVA 2RKOA 1F6WA 3ADDA 2P5YA 1QTQA 1L5RA 3QJYA 4E88A 4BTEA 1KEZA 1JG2A 1OFUA 3BVPA 3D6FA 3OU2A 5EMJA 2H7CA 3A4YA 5HKKD 5CH3A 1NDQA 2D0IA 3NWOA 4R1QA 4U02A 5FWDA 5AHXA 5C8DA 5AW7A 3HNOA 4I50F 5IRCD 3NHSA 2ZBPA 3I2YX 1X1BA 3FCAA 3ZV7A 3CB2A 2C7QA 4GT1A 4LY6A 2IW3A 2HA0A 2X7HA 1Z3CA 3BE4A 4EX7A 5IANA 3L1VA 1Y4SA 2QRVB 2PNJA 1PW5A 3BSSA 4LMRA 1J0XO 1NA5A 2FPUA 1N1GA 3L7JA 1TT7A 4X1IA 3DMGA 1Y81A 3K9BA 1E77A 1GPDG 1ZY2A 3DPIA 4MRSA 3KR2A 3CS3A 1I5EA 1M2EA 4I9FA 2ETXA 2CNBA 4X71A 4PSUA 1DEXA 1WXQA 3F7MA 4NCXA 4X7BA 4XD2A 4DIMA 1G5PA 1BDBA 1I01A 3RJZA 3PU6A 2EHJA 4LNUB 2E21A 5EUMA 4BKMA 4RTLA 3SZOA 4HNUA 3NT4A 1ZS9A 2DFVA 1MABB 1T3GA 1M72A 5AK3A 3G6KA 1YF3A 1N57A 3UC5A 3EGDB 1RYEA 5EEHA 3L41A 3QPWA 4GVXA 4IZHA 4HO1X 5HDBB 5BQ3A 2BKEA 2QE7D 2XH8A 1BQEA 4I3FA 3UHPA 3F96A 2ANCA 1QORA 4N8DA 2TMDA 3NHFA 5I7SA 3BSYA 1HDCA 2I3GA 1YR6A 3A4MA 1D2EA 2XWJI 3KEOA 3LY8A 1FLAA 1PGJA 1X42A 2D3WA 2H5IA 5F1OA 5IUKC 5JQGA 2DETA 4ND8B 1CVLA 1ZXLA 4GLBA 3GAAA 3WRYC 4QUJA 4XQ0A 3BULA 4BV3A 1WV1A 1CQIA 1XNGA 2E5FA 2SKEA 3LQYA 3PFIA 2OQVA 3D3QA 1KYIA 5B3JC 4G9BA 1CHDA 2XGOA 3FNIA 3JYQA 5M2QA 4YJ2B 5FR2A 1XNHA 3ND8A 1PW7A 4CV3A 2GJAA 2AWNA 3DTTA 5BNFA 1Q1EA 4EJ0A 2OPHA 1AVTA 5JZ9A 3REGA 2WG0A 4Y1GA 1UZUA 3URKA 4BO7A 1KSJA 2JFOA 1XDUA 3TG2A 3ZCRA 3BL6A 3K1ZA 4C7MA 4G1MB 2PXHA 1PJ2A 2P7HA 2VRNA 4JLBA 4YJKA 5JJLA 1DXOA 3I5AA 2NZ8A 5ALQA 1XZJA 3GZNA 4Z1MD 1SXJD 4CT0A 4M0DA 3R5FA 1RMQA 4GZMA 3AYZB 1NN0A 3X3HA 5IAEA 4ZIRA 1QGOA 2BFPA 4UNIA 2AYZA 2P9QA 1OZ0A 1KJNA 4IDQA 2IEGA 3QWAA 2CNNA 3CJRA 4MPDA 4RW0A 4S1NA 1J2JA 1D5WA 1QQ6A 1XZBA 2A5LA 2OC9A 2IHBA 2ZS7A 3D4PA 4TL8A 4WDQA 3V7NA 3REQB 3SYNA 4UDXX 1UPXA 2GN9A 2BMEA 1ES9A 3VR6A 4MVXA 4KMSA 2J4DA 4BKRA 1W93A 2VDLB 4BFLA 1ENOA 5AKLA 4H0FA 3L0YA 4PRZA 1TM1E 2WAMA 2I62A 4BJ5A 4DLYA 3GU3A 2WFMA 3EVDA 4KR0A 2YVLA 3EA5A 3OLVA 4RK4A 4Y9DA 1I51A 2MSCB 4IDAA 2B4QA 4FFOA 4QU9A 1Q0PA 1XU4A 2I99A 2AX3A 3Q7TA 3RAGA 4LZJA 4RK6A 3DL0A 4YMTA 5A9SB 5K0JA 4J8PA 1K8YB 3DCIA 2PT6A 1FYXA 5CPBA 3KXPA 3A9SA 4F91B 4B85A 1E4OA 2ERCA 4ZVUA 6GPBA 3NJ4A 5IDQA 1XA0A 1CW2B 3LECA 4R2JA 1W5SA 1H2YA 1DVRA 2GEDA 1J8VA 4H4EA 721PA 3IC5A 5K0EA 1BDHA 1FVHA 1DO2A 1KRHA 3RC8A 2IX9A 2F62A 2M9MA 1CT9A 1Z37A 1KFKB 4FYVA 4R31A 3V2IA 5JO9A 1YE8A 3PTZA 4XCQA 4Y0VA 2J6CA 1DX9A 1AKTA 5FRDA 2CN1A 1CX9B 1TTHA 1EDOA 5FPSA 1BJRE 3OE7D 1ULBA 2IX3A 4IDPA 2ZIXB 4W5TA 1RCUA 1T6ZA 2B7LA 2HU5A 3CF0A 3LQQA 3NUZA 4N65A 4XSHA 1CERA 2IA5A 4RLSA 4ND7A 1C29B 1IU9A 4KQ9A 4CWAA 1KK0A 3WJ2A 4DM7A 2QLBA 3ETNA 2LCIA 3G2NA 3HKEA 2GETA 3H75A 3SAJA 5JNTA 3IQDB 2BGJA 3RYFB 2VL7A 2CV1A 1K2VN 5EE9A 1UK6A 5I9IA 3ZY5A 2WA1A 2JA1A 1M7HA 4ZJPA 4F9FA 5GVSA 1QHIA 4PX5A 4JLDA 1S4QA 1JSLA 3KCNA 5DNUA 2P6UA 2YHSA 3VJLA 1ZLXA 1LBTA 1QV6A 2JRLA 1RYMA 1JT2A 2AFIE 1HOTA 1RRPA 2FQWA 3EEIA 2PQ0A 4NU8X 3H1BA 1XEWY 1Z5NA 3AG5A 4Z2YA 4RTKA 4RWZA 1W94A 3MJRA 3D1LA 4FN5A 2BE7A 3NIGB 3QHQA 4JY7A 3SY8A 4Z9FA 4QJ3A 4HADA 1WUJS 2GRAA 5CVTA 5ADUS 1T0IA 1NN1A 1VMEA 1WZUA 1XDBA 1ZBDA 3FB4A 4LXQA 2FGKA 1U4NA 3OM1A 2YHAA 2NPFA 2AHRA 3UT5A 5AXDA 2O8DB 1FLVA 1XYVA 1ZEJA 4BBJA 2F1IA 4OB6A 3VVMA 2V6FA 4Z49A 5A5VA 3QKSA 4ZGBA 3NDJA 4LVCA 3DVSX 3U3DA 1SXPA 2MHCA 2OGZA 3B48A 1P2DA 3LLCA 3MGGA 3GEPA 1J5PA 2D4HA 2PS3A 3NXSA 2ORWA 2ZB7A 3ZOKA 4CCSA 2HRDA 2OL4A 3P4YA 3AI3A 4I1RA 2WOJA 2JANA 3FHLA 4V02A 1HYQA 1WSWA 3VPDA 3W3ZB 3TVYA 3MMNA 1LU9A 2QPTA 4I5DA 2XTNA 4Q4LA 4QLAA 3ZG6A 1R4MB 3ENNA 2WFZA 1G7SA 1Z4LA 5HSGA 1GYQA 2P79A 2DKFA 2H2HA 2QM0A 1UJNA 1MFZA 3UJ6A 2N46A 1HA3A 1KZ7B 3R5XA 1UFQA 2WB2A 4BMDA 4LZOA 2W7TA 4U6NA 2DX7A 1E1RA 5DYWA 3M9WA 3COSA 1JHQA 2OORC 3F6SA 2OGWA 4OM8A 3U44A 4IIXA 1TQ2A 3W1WA 2IBSA 1ZCBA 1H1LA 3LXXA 4W5NA 4HTAA 2C4UA 5D3QA 2G82A 1MB0A 4K9OA 4E6PA 3K94A 1P0QA 1QK3A 3R9WA 1GCGA 2WYWA 4J3NA 1MNQA 3FX2A 5E9WA 4Z0NA 5KOHB 2GEJA 4K81B 5HIAA 5LP6F 1AGRA 3C97A 4PZDA 3DWFA 4OB8A 4PYRA 3EDOA 3UEOA 4ZYTA 1TZJA 1H4SA 3IYLW 2BR5A 1UIRA 4KDRA 1CDOA 2PLRA 3UWKA 4YXFA 4GMFA 4WUTA 4M8LA 2QRQA 4NU6A 1N9ZA 2ZQ5A 3BMQA 4F84A 4D82A 1HE3A 2NXEA 1H2BA 3GMDA 3UAWA 4BFWA 3GPDG 2ZAIA 5AM4A 1SBZA 3I83A 3EPLA 1VLLA 1Z3IX 2LGJA 4HRAA 5SZJA 1QE5A 4RIGA 4TS1A 5JSUA 1G5RA 1GARA 2D59A 2LKCA 2ZYVX 1U6IA 2FR8A 4JOBA 4B2IA 4LRYA 1I80A 1Y9DA 2PSJA 3B5EA 3M5PA 3P96A 3WNZA 2CBGA 3QWBA 3N8HA 2YFYA 3E9QA 1W19A 2BTQA 1YNSA 2ENUA 2W22A 3PI6A 1LW7A 1PLJA 3QYAA 4EQZA 2B7CA 3FVRA 3NP7A 4DE5A 1Y3IA 5JXIA 3K9CA 4CM1A 1FU4A 4AMYA 5D00A 13PKA 4OBEA 4HVTA 4PG4A 4ALNA 3KKLA 4MPRA 1D8TA 1B8VA 1GGMA 1O77A 3B36A 3GRPA 1D2GA 1UOPA 3QOFA 2RGRA 5LP1A 4I3HA 2GD0A 3WGHA 5M04A 4BJ6A 3FPGA 1XQWA 4J7AA 4EBBA 4MWOA 4YK7A 1KC1A 2HCFA 1Z0UA 3UBTA 4CTNA 4X1KB 2H4JA 1SO8A 4WBSA 5JNSA 3WLOA 5JCPA 3GCXA 3H2HA 3QVLA 4I7EA 1OC4A 4G2NA 5EQDA 1H0RA 3O4JA 5KU7A 4ZOCA 5AM2A 4OUKX 4Q6BA 1ODJA 5JAHA 3R7DA 2R751 1QF6A 3ROEA 4ER5A 5CXUA 4XARA 1XZQA 4YJFB 5DW3A 2VPQA 5FTJA 3I2FA 1GGKA 3V8QA 4RPLA 3C1AA 3GRUA 1TJ5A 3L6DA 3B1FA 2WHEA 5M7EA 2V4ZA 2OZKA 2FWIA 4E94A 2FFRA 5HKLA 1YE3A 4QUIA 2OHGA 3Q7SA 3LZCA 1TJ3A 5DHUA 1T2AA 3Q10A 1KYWA 1U1EA 2GPNA 3UJ8A 2DPXA 1ZINA 4ZI5A 1WUYA 2PMWB 4INAA 3SC3A 3LIIA 1MJHA 4AX4A 5IVPA 1CRQA 3OG9A 2QZ4A 5AUQA 5KO2A 1NQTA 1RMTA 5FBKA 3F5MA 3IX7A 4A5OA 4EEXA 4C7XA 2AV6A 4YDHB 2ZR8A 3GXOA 3K3PA 1RJWA 2ZT7A 4GL4A 3L1UA 4CI9A 4J75A 3LV8A 2B1JA 4CV2A 3GLFE 4FDMA 2C0CA 1Q0LA 5DHAA 5JRJA 4WLUA 3I0ZA 1TE2A 1VB3A 2XIJA 3KJNA 2NSHA 1I1OA 3BK2A 3FVQA 4RH3A 1KOFA 5F1YA 4E5SA 5EMLA 4GO1A 3GELA 2OZLA 4KK3A 4QYTA 1TYCA 3NNSA 4RETA 4X20B 1P2SA 3AVPA 2RGWA 3M2TA 4EMSA 2VK1A 5DTRA 4D3FA 2QN8A 3KJQA 5CMLA 3AUUA 3N2LA 1Y5NA 3VU3A 3S70A 3BWCA 3RKUA 4GRAA 4FZJA 4QTYA 3ZV5A 4I50A 3DMHA 2IBMA 1JVBA 1YMQA 4HPJB 5TMDA 2NSLA 5JASA 1N8TA 1ZD8A 2ZBDA 5CR9A 2AR7A 1TC2A 4K87A 3AFMA 4YP1A 3VX3A 1UBGA 3V9PA 4YRPA 4LJ7A 3KUDA 1RKUA 5DGHA 2GYWA 5EQJB 2FPXA 1SQGA 3WSVA 3P9YA 4ND6A 4OHMA 5DYIA 1SBQA 1G3IA 5LA6B 4E2WA 1SXJE 1C3LA 2AI2A 2AW3A 5EJ9A 3HFJA 4MRVA 2C9BA 4II2A 1I2CA 3M1IA 1JQEA 4OHZA 1Z62A 3OQPA 4HDMA 2XNDA 1TUBA 2B99A 1Z7EA 1J5EB 2H51A 1N2XA 4GPAA 1NVUQ 1R16A 3L3BA 4ZYYA 1WWKA 4G8JA 4N01A 4HEA6 1AMOA 3FTFA 3L0OA 4L08A 3D0KA 3L7BA 3AHHA 1KI9A 1C8BA 2PUHA 3OX3A 2UVPB 3HABA 2YHIB 2XVYA 3NHJA 3W90A 3HO6A 1W1WA 2QZ9A 4M6WA 4MEAA 4QPZA 2QTGA 2WWYA 4B6SA 2XOEA 4UVDA 4YREA 3T0FA 2AZXA 4XM2A 1KQPA 3JWGA 2IYUA 2JKZA 2R48A 1OD6A 3ELUA 2CT8A 3T8YA 3GW8A 4QBGB 2Q0HA 4GAEA 1P9NA 3FDXA 1NW3A 3DB2A 4REMA 3F97A 4DCUA 1G2PA 3EDYA 1KI6A 1ZR2A 5EKDA 4P98A 4IRUB 2A67A 3IE2A 3O26A 2B20A 1LK5A 2OECA 4XDYA 1O3YA 1Q50A 1TVKA 2O7SA 4YQYA 3RM3A 1YONA 4ZCMA 4B2PA 4I1VA 1G0OA 2GM5A 1KYVA 1E3WB 5C7LO 1BU5A 4ID3A 4JI8B 3RRNA 4U39A 2X0JA 2ZDGA 2OHXA 1FX1A 1OREA 4PCLA 3OFNA 2HRZA 1F8UA 1KIFA 2BCGY 3LNTA 3M4ZA 1WG8A 3O73A 2J0UA 4DB2A 4E31A 5DNEA 4TKMA 1Y1RA 2HF7A 3IFSA 4NBSA 3P4UA 1QYXA 4R9NA 4TV8F 4FPXA 4YYEA 3AM1A 1RI3A 2NOAA 4KO3S 1J0AA 1WCIA 5EN4A 3FWZA 4CU2A 2R6FA 2Q5OA 2A1UA 3AI7A 3VYSB 7YASA 2R7KA 4IUDS 1HO3A 5FTNA 1DQSA 5FUBA 3AG6A 5DV9A 4E4TA 1NM5C 2HLDD 5B1IA 3WLPA 2J3KA 3DBOB 5K3OA 4JLSA 1TTQB 1KMCA 5EGSA 3EASA 1NNSA 2M32A 3LHDA 4JKOA 1TJPB 4WXYB 3ETCA 3RS0A 4CL8A 2O8CB 4URVR 1KDTA 1ADFA 4KAXA 4HAYA 1P9OA 1NJ8A 3OPMA 1PTJC 1RW4A 3BRSA 4H59A 4E32A 5HKAA 2PMKA 1NONA 3HP4A 2VHZA 2WHPA 3AT1A 3UWDA 2LPMA 4BP1A 1SXJC 1X8JA 1ZM3A 3AETB 1VPVA 5ICEA 4HY3A 4RYLA 4UXHA 3SQOA 5DTEA 4BQQA 3X2EA 4WE3A 4MKRA 1I0ZA 1GGVA 2B8EA 2R7MA 1C30B 3K9LA 4J7UA 4MKIA 4I99A 2O57A 3PC4A 1XVUA 3UXYA 5D2CA 1JQBA 1SB8A 1X86B 1QQBA 3NHPA 2VSOA 5IW8A 2FPGA 1T4BA 2G04A 1KYTA 3BZBA 4KKXB 1MG0A 1SWWA 1VLJA 4EYSA 2GDZA 3JU3A 3MC1A 4PPNA 4QRHA 2RGAA 1N2EA 2ZJ1A 3LCMA 5SZHB 2PGAA 1Z26A 1SRQA 2CEKA 3KT0A 4WZAB 3PBKA 3A14A 2Q7DA 1KMHA 5FPQA 4JI5B 3N75A 4AG3A 1D04A 4ZVNA 3MNFA 1OWMA 1VE3A 2ZYWX 4EAAA 1A9XB 3W9SA 1XD2B 3CNOA 1SCKA 2Q4TA 1CJMA 1EFCA 3O1HB 4HYYA 4KQ1A 4BMCA 1NOJA 2WJWA 3LU1A 2GN1A 1KAQA 3H5WA 2B30A 1JMYA 3E4CA 3NVMB 4B6JA 1IY9A 1OFGA 3EFOA 4H3VA 4NU0A 3LQ2A 3ZDRA 3VU9A 3ZYZA 4BUJA 4EMTA 2GXAA 3DDHA 1ATIA 4ETIA 4M1MA 5JAPA 2Q4RA 1HEUA 4B3BA 4CETA 3LBHA 3LX5A 4S04A 1SZCA 4HGYA 4KDEA 4R41A 1CYEA 2AG6A 4AJ1A 1CYDA 1JEYB 3VR5D 4JH0A 3H17A 1K1EA 4R8MA 1D7AA 2IP1A 1XZIA 1YDMA 2G9ZA 3I6YA 3MW8A 5CIYA 1VE1A 4OA8A 3CX4A 5KDOA 2X42A 5C53B 2ERXA 2PS0A 3BH7A 3HJUA 3G5MA 2L19A 1QDLB 2HJVA 1Z6AA 2B3TA 3AKEA 3E70C 5LZ4A 3WWPA 1CF4A 2JEZA 4RSMA 3V42A 4GOLD 1CB7A 1FMTA 4R1PA 5BYJA 4L0DA 4HNVA 5ICMA 1ZLYA 4X7RA 2OY0A 2O8BA 1JAYA 1PR0A 1T8UA 1XWWA 2NADA 2OLEA 4JUIA 4Z4EA 1TXGA 5DP1A 4HWSA 1RKXA 2DR3A 5FL7A 4I81A 1QC5A 2GCOA 3GDHA 5KYTA 1NW4A 4G0YA 5B3KA 1XRPA 4RVCA 3II6X 3UFBA 1GPWB 3MJ4A 5K2MA 4GUDA 1GVHA 2FG5A 2X76A 4RLQA 1OHHA 3OT1B 4DSZA 3U7QA 4PIPA 5KYYA 3DV2A 3KZXA 4LOHA 1JSRA 1IFXA 2QLFA 2QY9A 1LNSA 3CR7A 4NHOA 3ZK9A 2NN3C 3WBJA 4AZWA 3G8CA 1C7ZA 2E18A 3DBHA 4RDHA 5TVKA 2OK8A 3HPRA 4WN9A 3W6ZA 4EA6A 3B9BA 1F7UA 5IT0A 4C0SA 3T5MA 1QFXA 1KVQA 4G41A 3L6BA 4MW9A 4XUEA 4JJ8A 3UB4A 5KOIA 1CUDA 2GBFA 3BFXA 4J0IA 2NU8B 2P41A 3VR4A 1VJGA 3ABOB 5K0CA 5FOVA 3AYXB 4KWIA 4X54A 1ORVA 4KAJA 1E1KA 4MW2A 2DF8A 2VHEA 3ZXXA 3OM9A 2A7XA 3CIOA 4BFZA 4E21A 5KTSA 2CUTA 4QPCA 5IDWA 2P4EA 3F8WA 1VHTA 1JW9B 7MDHA 4DIFA 5LP6A 4B3SB 2KM1A 3SICE 2FW6A 1E9AA 3T7RA 4CKEB 2GPAA 3ESRA 3MB5A 4FSDA 4NBKA 4EA9A 3VBCA 3TF5A 2XT6A 3ZZ0A 2G5TA 1YUNA 3MFQA 3SKYA 5EZ5A 2BEUA 1WABA 2ISSD 3HY6A 3N2NA 4WXEA 5FLKA 1YJXA 3ZWBA 1WMSA 3PHLA 3LUJA 1E8DA 3OCVA 1F38A 3IS3A 3OZEA 3EE6A 4JCCA 1UMBA 3SZGA 2XVXA 5I7VA 5CB0A 1HDRA 2D2XA 2HM7A 4U5QA 2H48A 1T2VA 3TLZA 3KQSA 2I7XA 1USGA 2GF9A 4JUAA 4PC3A 3AKCA 3AU9A 1P75A 3I5XA 5CUQA 3DR3A 5B5SA 1O96B 1AN9A 4CW7A 3CUYA 4LUCA 1PJZA 4JLVA 1E3QA 5GV8A 2P9GA 3NCHA 4TTAA 4BO1A 5DNYB 3QBJA 3AB8A 2CJWB 5LBUA 1E7SA 1GRVA 1OAOA 4PQYA 3AL0C 3VU1A 2ACWA 1N2BA 3NIBA 4QOGA 3AF4A 1R5BA 3L8EA 3CLVA 3LPMA 4FI3C 2GZDA 3AJ8A 3PTLA 3UUWA 4DDUA 2O8NA 2Y0CA 5DASA 3PNMA 1YVDA 1T5OA 5ARCA 4JWKA 2ZUDA 2Q2OA 3R2JA 4EPXA 1GYRA 1VYUA 2DFKB 4O08A 5IF3A 1UWVA 1V5WA 4FDUA 3B6ZA 1H66A 5FOUA 5KKAA 1KOLA 4UHEA 2FA9A 3TUIC 3RUHA 3QE0A 4XVRA 1TQ6A 2QG9A 2YYZA 3QH4A 3AR9A 5BSFA 1QP7A 2ZE5A 2DPHA 5ALSA 3FDZA 4FJ0A 4K6MA 1JF8A 3CCFA 5HIIA 1J9EA 2HMVA 3G23A 3T5BA 2XE7A 4DNQA 3TNJA 1P45A 2P9YA 4BEVA 4GOXA 1ZOPA 3RYIA 1IJBA 2WF7A 3JQBC 1IUOA 5BUZA 3N2KA 3FWKA 5C3UA 2VDVE 4CIYA 1G38A 4HR7A 4YCLA 3HGQA 3B7WA 3O83A 3IAUA 4YRBA 5KQMA 4RABA 2CYCA 4U7GA 5BT8A 5JEDA 1JALA 3IBTA 2NZ2A 4LV8B 3UAYA 1RAFA 1RVDA 4P7FA 3E3OA 3QF7A 4BV2A 5TLSA 1USKA 2DBZA 2E4VA 2GHQA 5F12A 1WQ4A 2ZTSA 3HBNA 3WIEA 4D3DA 4PYQA 1KJQA 3EH1A 1G5QA 3SGLA 1QOZA 1W8DA 3UKOA 3ER8A 3V32A 1VE5A 1MJGA 2C88A 3OH8A 5CIWA 4JP8A 3WS7A 4AP5A 1HNNA 4M9SA 4YR9A 3P2MA 1EUDA 1GN8A 2FRXA 4L4RA 4MLPA 1YZQA 1K4KA 1CEQA 2AX4A 2RI0A 3GBSA 2N1BA 4L8YA 2QSZA 4EMUA 5JADA 2OD9A 1L4EA 2V7UA 1PS9A 1NWCA 4X64B 1V5GA 5JU6A 1HEYA 1MHPA 4H35A 3F0TA 4H1TA 3IV9A 2EZ8A 4TM7A 3RR2A 5CT8A 2IU6A 4NCJA 1P4SA 5MN6A 1MB9A 4ZCRA 3KJIA 5TY0A 2M1ZA 2X5NA 1KEVA 2IK8A 1UBKS 3EXAA 3N7UA 2GARA 3QBDA 2YNMD 4LGYA 1I13A 2C8LA 3T1OA 4P4LA 5AKZA 1TM3E 1FYEA 2JLAA 5AP9A 3S3TA 2VYND 1IXYA 3MCAA 3U4CA 1ODSA 1QVVA 3HB0A 3A6KA 3B78A 1S8NA 2PGJA 1J8YF 4UBIA 1ZISA 1J09A 4CF7A 3QX3A 1UJ5A 2G5PA 3AMVA 3DUFA 4DDKA 5G1NA 3VZSA 4FM9A 2HJRA 3BN3A 2NYVA 3MERA 1KQFA 3MUEA 4TKVA 2ETVA 2VTBA 4QOSA 4EP1A 1W5FA 1U3CA 3G3EA 3DWGA 3LGAA 4G36A 4O3MA 2IS2A 2QLLA 5HJ7A 2BOVA 2GA8A 3NDBB 2ZUWA 4KXVA 1A77A 1HK7A 2O3SA 1SFRA 7REQB 3C3MA 7AT1A 3IKMB 1BE6A 4ZT6A 2JVIA 2AJLI 3AFHA 4FOOA 4PV7A 1IDN1 4FEGA 4Q19A 5B12A 3NT2A 4Q9LA 1SZDA 5DP2A 1NYLA 2W4QA 2VA8A 1UODA 1OIWA 2ODAA 1KDVA 1OH5A 2CLDX 2CHUA 2PGXA 3FFXA 3H4IA 2QUKA 4I6JA 4CF6A 5CPFA 2AXPA 2O3QA 3X44A 2EKDA 3DL7A 2UZ1B 1ZR4A 4U7TB 3U49A 2BRUC 1OX4B 2G06A 1XF9A 3N5KA 4CQLA 5KYNA 4UAJA 4KLRA 2JJ2D 4MVJM 4IILA 1RYBA 3E81A 1RIFA 5AOAA 1FTSA 4G1VA 1KJ8A 1GNTA 1QRRA 2GM3A 1E3JA 1FUEA 2XGMA 2YZ7A 2ZATA 3PNSA 3GEDA 2B69A 4FT2A 4TSRA 5REQB 1L7NA 3KOOA 1QH1A 2NUAA 3IT3A 2BFOA 3ZBQA 4Q1DA 5D5QA 3K53A 1W5AA 4PICA 4RHUA 1ZD1A 4LOIA 3BTSA 4JHXA 1RPTA 1UOOA 4WKCA 2WWTA 3O9MA 3SQXA 1TMYA 4TV8A 1Y6QA 1V1MA 5EJIA 2XE8A 2E37A 1G59A 3MGBA 4QEDA 5C1IA 2AT1A 4ML3A 4JB2A 1D3AA 4ZT5A 1NNUA 2C1EA 4WCFA 4S2EA 1NG1A 4JB0A 4UCWA 1Y3BE 2QR3A 3K96A 3HKCB 2UZIR 1NW8A 1VIMA 1N3BA 3CV3A 4V0RA 5DGTA 4BQPA 2QMOA 3ZCVA 3BH6A 5LOVF 2IKSA 3UPTA 2GJSA 1T6XA 3W04A 3WOVA 3ZU2A 2PXAA 1NW9B 3THOA 4OP3A 1ZM4A 2XZLA 1MJFA 2JFXA 2JEYA 3JPWA 1G41A 3FCEA 1J49A 3LYLA 4R69A 4WOJA 5LNK6 3R9XA 3OEED 2RH5A 3WZ2A 2N42A 3HO8A 2WV7A 4TLAA 4OX9Y 3E7WA 1SVNA 1Y48E 1WD7A 1CJCA 4LCJA 1E99A 1U6JA 4A1FA 4L07A 4AKHA 2QP3A 4WCVA 5E4TA 4CMAA 2JCGA 2V7XA 3SZMA 2IT1A 4C07A 4O8ZA 4IG4A 2Q49A 1K7CA 2C94A 3BREA 4KE8A 1XZMA 2ECKA 3NORA 2CC2A 3EIHA 4OV6B 4CODB 1ZJWA 1IHYA 2EVWX 3OE1A 1P5ZB 4QREA 4W6QA 4BFXA 4JMPA 4F7DA 4ZOBA 2LCFA 2OD2A 2XCIA 3T3IA 1E3IA 1WMAA 3P27A 4LV5B 4N0MA 1OFIA 2JF0A 1BU8A 1WULS 1T9GS 4J0JA 3N0WA 5IJ9A 1Z0SA 1AUVA 2B5WA 1ORTA 4OH1A 1NJ1A 2Q3HA 3KWFA 3DJFA 3RF6A 4BNZA 2XUKA 4YQFA 1EDDA 1NQVA 1U7HA 3CF2A 3DZGA 3GX1A 4L4SA 4TWBA 2G28A 4MDEA 1WB4A 1JP7A 4IWXA 2FP4B 4FS3A 1KWGA 1GXSB 4KQKA 2HF8A 3SPXA 5JRZA 2R2AA 1E7RA 1WPRA 1RWNA 2FX5A 3LUDA 4R8VA 3GP3A 1HZZC 4MQ6A 4QXOA 4U2KA<