1S2LA

Purine 2'deoxyribosyltransferase native structure
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
167
structure length
165
Chain Sequence
MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFEIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine trans deoxyribosylase
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
total genus 49
structure length 165
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s2lA00
4I7EA 4MCJA 3IMKA 5ITSA 4P5DA 4WL0A 1WEHA 3O8NA 1KZHA 2PFKA 1S2IA 3GH1A 4JEMA 4I36A 1S2LA 2F48A 1F8XA 2F2TA 2NX2A 2IZ5A 1S3FA 1S2GA 4PFKA 4HX9A 3SBXA 4A3SA 2KLHA 3K2QA 1F8YA 2Q4DA 4LJKA 3MAJA 2PMBA 2F62A 1WEKA 1T35A 3PFKA 4P5EA 2HIGA 3O8OA 2KHZA 3EHDA 1PFKA 4I4IA 1S2DA 1ZXXA 3QUAA 2A33A 4MEJA 3UQZA 1RCUA 4OHBA 2IZ7A 5AJTA 4NPAA 1YDHA 4KXMA 3HNOA 4FYHA 2F64A 3O8OB 3U39A 4FYIA 4RH3A 4KXNA 3F5MA 4LJRA 6PFKA 1MTOA 2A0KA 3OPYB 4JELA 3O8LA 4OHRA 3OPYA 4U1RA 2IZ6A 2F67A 4JENA 3BQ9A 5AJUA 2Q4OA 4FYKA 4LJLA 4KXLA
chains in the Genus database with same CATH superfamily
1P4HA 4YV7A 1JR3D 1YU9A 3K0AB 2YR0A 2DKNA 4GQAA 2DHEA 4U7WA 1ITZA 1K6IA 1R0CA 2FX2A 1QHYA 2ZRMA 4OKNA 2J7KA 5K4AA 1PBNA 3WRXA 1J33A 3LQ1A 3QXCA 5JSZB 5JCZA 2B1RA 4A8PA 4ZRDA 1L5KA 3SF8A 4CKWA 1OV4A 4M86A 3AB3A 4QQ8A 3HL4A 3INTA 1O9BA 3ZDQA 4JEMA 3W7BA 5HQ3B 2AX3A 4PF1A 1VHDA 3CLKA 4HNQA 3MJCA 3RFUA 4MWEA 4A7PA 4WASA 3D7KA 1USUA 1FJHA 2C9BA 1N9GA 1QG4A 2Q3LA 3CJTA 3CCCA 3E23A 1ONBA 1F5SA 1SO8A 5D84A 3ZCQA 4EB6B 5F7XA 5T6BA 4MA5A 5LSAA 5FL7D 2BWJA 2CB9A 2P7IA 4UBNA 5AK0A 1K66A 3QLTA 3ZXYA 1ZN2A 3SJZA 2Y9PB 2DTDA 5JS8A 1HYQA 2DBRA 2AEJA 3BWYA 2KLHA 1T5BA 1KDZA 3N0TA 6NULA 1GGMA 3BMNA 1A9QA 1C29B 4QYWA 1CG6A 5AI4A 3KSZO 4P4TA 1J8QA 2XF8A 1FDRA 2W5UA 4JL5A 4QDJA 3RYHA 1FNCA 1Q15A 2L18A 4F72A 3NASA 1TU4A 3DYBA 4ZK2A 1RT9A 5FPKA 4ASUD 2G17A 3NPMA 4X1IB 4YRFA 1UJBA 1XMIA 4YQEA 4IV5A 1X8JA 3EQ7A 4A6XA 1KFJB 3D4IA 4QT4A 4S3MA 2AI3A 1F14A 5JC8A 5MFPA 1LV7A 1THTA 2D5LA 2Z3WA 1P5ZB 2WJGA 4CLEA 1B0UA 5HRAA 2D5CA 2QM8A 1M34A 2QMOA 2RAFA 4U7FA 3THYB 2GCNA 2A57A 3E8SA 3W77A 4TXNA 4BBZA 5I9SA 2AZ4A 3PGA1 5A02A 3WBFA 5LQAA 4N6GA 2COEA 4XD7D 1B8OA 1IZ9A 1CLUA 2O7VA 2QPLA 2ISSD 3CZQA 3DZDA 3RG2A 4M9CA 2H1RA 1Y98A 4Q48A 5IWCA 1OBVA 1U5AA 2HGSA 5KNDD 2GTHA 2JLAA 2R1UA 1MNQA 2JGDB 2H0RA 3L5KA 4PSUA 1C9DB 5CYFA 1WXGA 4G26A 1AS0A 1QC5A 1KJ9A 2BKUA 5AQEA 2GEFA 3U13A 3PGMA 1L7PA 3KVYA 3AF4A 1Z47A 2O1WA 2AX4A 2ODWA 2ZDQA 3LP8A 3MWDA 3R3ZA 4KJXA 4V2IA 1R8QA 1PBTA 2WU4A 4HF7A 4XEHA 3V8EA 1FFDA 3ICWA 1IM2A 3GXBA 3OFNA 4QPPA 4EQ6A 1NE2A 3FYUA 5TC4A 1KNXA 4AJPA 1DAEA 3CVWA 2V58A 4HGZA 5EA2A 3KWJA 2BGJA 4BASA 1L1FA 3B2EA 4UXHA 4K40A 2ERXA 3FNHA 4XSVA 3AZPA 2PD3A 4N8EA 3W2EA 5F98A 4MGIR 4ND1A 4Q4HB 1WD5A 2VYCA 2JKYA 1BZYA 1KKMA 5CVVA 1A71A 4TKUA 5J4KA 2WMNB 3U7QA 1YE8A 3RC9A 1G0OA 3HCOA 2JLUA 3QE2A 4Y6OA 1J39A 1EWRA 3WIOA 2ZS8A 4K87A 2G08A 1NOKA 2QG4A 4B6PA 4F9GA 1J1ZA 2CLIB 5AK5A 5G0UA 3O9ZA 2WJIA 4GWLA 4OHOA 5I8WA 1GTSA 4GPTA 1BU5A 1HY3A 2B0JA 3NIGB 4AM8A 2FFQA 1TYAE 5JXWA 4B33A 4TLDA 1QHXA 1USIA 2J0EA 4F97A 2W43A 2P79A 3LE8A 1CERA 1N92A 1SQ6A 4U3JB 5FOTA 1NF3A 1NM5A 2DEUA 3U6KA 1QHHB 3LYAA 4ZJPA 3RASA 4TWRA 4FHFA 2AN3A 5JZVA 1NVXQ 4I1OA 1KEEB 3GCXA 4Z1MD 5JXGA 1E9EA 2H51A 1YE3A 2PKEA 4ZYYA 5IM4A 1PNQA 4W5JA 3NW9A 3QXGA 4KRGA 1A2OA 5EP1A 5IUKC 4NY1A 1QCDA 4TS3A 5DLYA 5FHQA 1PVVA 1ABEA 2CL5A 3PDUA 1QPGA 3PX2A 4XX1A 3S7TA 4BQSA 5K9ZA 3GUZA 2E4AA 4NJMA 1G5HA 1H2BA 2PU5A 5U4QA 3IVRA 2VP5A 4JITA 3RQSA 4X8HA 4MJXA 2G4CA 5M34A 1IB6A 4IV8A 3HA5A 4HDNA 4IMRA 4B3JA 1RE0A 3F67A 4PCUA 4OJMX 5MN6A 2XNDA 4U0JA 4CJXA 2B7BA 1YCFA 1TM4E 2DFTA 1CZKA 1GARA 5KB3A 3GCWA 4EL5A 1OOEA 1J25A 4CTJA 1KVRA 1NU8A 1FNBA 1E9SA 1DS6A 1OLSA 1GUZA 3B5IA 1G98A 2AOUA 2H07A 4DIEA 4BNKA 4YC7A 4EPWA 3EPKA 1VKOA 5H83A 1DQPA 1EZ4A 3IE1A 1N5OX 4KODA 4DDWA 2FSUA 1P73A 5GJVC 4Q7QA 1ZHFA 2GARA 4NMHA 3ASYA 4NATA 1T2UA 1KDOA 2H7VA 3H5VA 3GG9A 4Q37A 1TCAA 2OCLA 2O07A 3DEKA 4Y1EA 2VTKA 2NMVA 1U0HC 2W6QA 2VATA 3GL9A 4LHWA 3EHDA 4IDOA 5FPTA 3UOWA 2MDTA 3D2AA 1CQZA 2QSJA 2JHAA 5CJ2A 2FFRA 3DL2A 3RYFA 5GIPE 1PTJC 5H9WA 5FBKA 1YR7A 2RMKA 4U7TB 1E0SA 2IPXA 4NZMA 2Q99A 1S2MA 3GT4A 2B4AA 3L49A 1G6HA 4J0GA 4E5VA 1E63A 1WB4A 2IYOA 2Y27A 2IUYA 3F5FA 1NP3A 1EK5A 4W7SA 1QONA 3VR4A 1Y8QA 2R5WA 2R1VA 2W9XA 2GRUA 3KEGA 5BVHB 2WMDA 5IJXA 4J8PA 1Z4IA 3PDHA 1SG9A 3I01A 1CJSA 1ZLXA 3N0XA 5B4VA 4FGLA 2HB6A 4BQIA 4F3YA 3NEPX 4REOA 4OH1A 1LPOA 2WKRA 1O97D 3AB7A 3AUUA 1JDZA 4YROA 4MRSA 4YR9A 2QAIA 4PSVA 4ZVRA 1X8LA 4R9UC 3TX2A 3JVDA 1MT3A 4N3BA 3SSAA 4OK3A 2YOHA 1CUEA 1BCRA 4BGIA 4KJZA 2GH1A 2JGLA 3GFFA 3T9DA 1ZOIA 3D3NA 5F7ZA 2GDZA 4ZQHA 1E8MA 4HXEB 4LS3A 3AM1A 1E5XA 1ISPA 1WPRA 2MU1A 1JKIA 1SRRA 1D4ZA 2PLWA 3A1CA 4A15A 1PL8A 3WKAA 4G4SO 4RC9A 1E4YA 4MI9A 3Q1LA 2F3SA 4TYYA 4RVCA 4J1TC 5KTTA 3P0FA 2VHUA 1STOA 1G2IA 3EVEA 1XTTA 3YASA 4QGBA 1O94D 4BVHA 4R8RA 3W90A 6REQB 4DUYB 1X9GA 3HCPA 1A0OA 1IDOA 3HJTA 3REFA 4D3FA 2DTEA 2EBHX 3IKTA 2JIOA 3NVDA 4MQ4A 4Z9FA 2NACA 2XHEA 3MGAA 3SMVA 3OHMA 1J2YA 1E8NA 3M70A 4HSGA 4ZMSA 4KFUA 4R1MA 1R5NA 2EQ5A 2NM0A 1JJVA 5GV7A 5HP4A 3K09C 2C2HA 4O2AF 2O2YA 4XM0A 2IHBA 3AY7A 2W8ZA 5D3KA 2XE4A 3DOFA 5EIBC 4EB3A 1VGVA 3AR7A 3QVUA 1H1TA 4H35A 3AJAA 1R6TA 1E20A 2ID4A 5LOVF 5KSOA 1BKYA 1QH8A 2Y1OA 5JALA 4F45A 1TK2A 2R1TB 4I55B 4JMPA 4FJ0A 3V1YA 2HCJB 1F1JA 2RDMA 1CHDA 3MCAA 4W5HA 1JDNA 4CF6A 5D3ZA 4Q7KA 1O58A 4PNHA 3ZJYA 1ZNQO 2CBZA 1J42A 4C4RA 1JA0A 1IE3A 4LDNA 4XE5A 1GPLA 3A9VA 2QVBA 1Q7BA 3NB0A 4BQFA 2XI4A 1AKEA 4OI2A 4BB0A 2XGOA 3PNMA 4B44A 4MUAA 1I0IA 1P81A 1U2QA 1XYGA 5HFJA 1JBKA 2BEWA 5AM5A 5JAQA 3L6EA 1H3NA 2FAXA 3VUFA 3X1ZA 3R9WA 3BTVA 5EJIA 1CF4A 1RW4A 3WL3A 4CKCB 3HHPA 1UJ6A 2ALJA 3GIDA 1LFDB 4J2HA 1DDGA 3OTWA 3ISTA 3I1JA 2FSIA 3K0KA 5K05A 4WBSA 4UAUA 5DV9A 3UWKA 1Z16A 3T15A 1SHUX 4MQFA 2O3TA 3Q11A 5IJ9A 2IUEA 5DASA 1O7JA 1PEKE 3JYOA 3FYDA 3W1EA 5I8ZA 2QZSA 3MUEA 3DNPA 3LHSA 1GRQA 2XUJA 4G5XA 5AKHA 1Z6GA 2QUAA 1H9AA 2VR1A 3DFZA 4PN3A 4CG1A 1H0HA 1W47A 2NU7A 2OK7A 4F4DA 4MEJA 5BNTA 1OAOC 2G5PA 5BXYA 2BMJA 2B4YA 2W6CX 3HFJA 4NBKA 3GDGA 3TKLA 4DL9A 5IU6A 1UEJA 5CXUA 1WHTA 2C96A 1HE5A 4QOEA 3IV6A 1DTWB 1MZVA 2EYUA 5JZSA 3Q7RA 4B2PA 5EXSA 4HATA 1EDBA 3A11A 1Q0UA 4J7AA 3SS9X 3C3EA 4NAHA 3TRDA 2JAWA 4Q6WA 3ZI4A 4XYBA 1RBQA 3EBPA 1YVDA 4JR0A 2W2NA 4RH3A 3M0EA 2V9ZA 1EB8A 3IOCA 4FMCF 1Y1KE 1Q77A 3MTEA 2IV7A 3RUHA 1PQYA 1L5ZA 3UENA 4F2PA 4JOQA 4QBGB 3PC8A 4TQGA 1XWIA 4KBYA 3IQFA 5MDHA 1EYZA 2Q1SA 3DHNA 3PBKA 4AO6A 2FWJA 4EO7A 2E3JA 5A06A 4PQRA 1WVMA 5AVWA 5JOQA 3WGMA 2I7TA 4V1CB 5FUMA 1YR8A 2ZSAA 2FPWA 5EE5B 1SC1A 4BWGA 5B7QA 1QRSA 2BFNA 5DYGA 1TLTA 2XB8A 1KY4A 2QQ0A 3LTEA 1XAJA 2C97A 3EF1A 1SBQA 1OI3A 2WYIA 2BOVA 4HRAA 1XEXA 3DBHA 3KYDA 5K0LA 3RTAA 1R6XA 1GIAA 3L8CA 4FFWA 5B2FA 1E3MA 3B7GA 3CRMA 1RWWA 3ZZMA 4LSMA 1ZMXA 1AK2A 3WK5A 2ZZNA 4GZ3A 4H6WA 4HLNA 3K8OE 4HO1X 2FUNB 4B73A 3CR3C 3ZD8A 3KKQA 3IQZA 3TDMA 2WWVD 1DRJA 4DBZA 4KXYA 5ETJA 2QP9X 3L7IA 4HP8A 3EISA 2GUGA 4JR1A 4WY8A 2WWRA 3C6KA 1XDUA 5CPBA 3A6PC 3B7PA 4XB2A 1KOLA 2OD7A 1YB7A 4NRDA 5I48A 1A9SA 2GBPA 3KEFA 5DX0A 3LT1A 4UM8B 2OM6A 3MIZA 3I04M 1IOVA 1P6UA 1YT5A 3CLVA 1Q7RA 4IUYA 1T0PA 2VO1A 1IXSB 2ZW9A 1NKVA 1P8AA 3ABRB 3KT0A 4FSXA 3MRXA 3THWA 4Z2YA 2PBLA 3WSTA 2XCIA 3B1ZA 4OQ4A 3TLMA 4Z3KA 2C3OA 3EBLA 1MQSA 1OZHA 1TM5E 5K6TA 2ZROA 2D6FA 1PJBA 3RUAA 3EGXA 1Y8CA 1MGPA 4DILA 4GWKA 4MVJM 3QE4A 2C8LA 5ALYA 4IDBA 4TTVA 2G07A 1WU8A 2CZGA 2JCGA 2AQKA 4NBLA 1D04A 4IFTA 3W06A 4A6PA 4W9MC 2BFEA 5A05A 4KGVA 2EERA 1RQNA 2B8WA 4MJ7A 1H05A 3PC6A 5EOVA 2AOVA 4DQDA 4EI8A 1F4VA 4BQRA 1N2HA 3DDSA 4OYRA 2VBCA 4DNXA 2IY7A 1OBOA 2H4ZA 4G2TA 2C9ZA 3FHCB 2C31A 1JR2A 5IT0A 3M6FA 4MUFA 2RIRA 4IWXA 4GT1A 4Q34A 2HO5A 4EY8A 5BPHA 2O3SA 3ZV6A 1B14A 4LYHA 4BFCA 4RHYA 1BXRB 2VXBA 1H1LB 2EEPA 1B74A 1RJDA 3P5SA 4II7A 1BOFA 1P0IA 2UVDA 4RF5A 4YRQA 2WE7A 4B5KA 1J1UA 4MLPA 4P3XA 2NUTA 1UBTS 4BN5A 3O95A 3TLGB 4INOA 1P5RA 4LSZA 1E64A 3FMOB 3CA8A 2IUUA 4NKRA 4V24A 1IRIA 5JNVA 1CUJA 2HUPA 5CITA 2O1XA 4LE2A 3WGTA 3DDZX 5B3AA 2YJ6A 5I4IA 3LD9A 4YY3B 1Y1PA 1II9A 1Q83A 4P2BA 1W34A 3CT6A 5KTYA 1MVOA 1E6LA 3WJAA 3NRCA 2F3QA 3IP5A 4ECAA 4R71A 1GLGA 1ZWKA 1TUGA 5IZCC 2ZR8A 2R25B 2Y6UA 2X6QA 2A9JA 1N3LA 4MVJP 3ROMA 2BUAA 4TWIA 3P97A 4N0MA 2OFFA 3NVKI 4WBNB 4Q12A 5CYPA 5AVKA 1RZRD 3F5MA 3VMMA 2AC2A 1ODSA 5I7AA 3S27A 5JXIA 3SX2A 3GNSA 4JI4B 4G81A 1T3HA 1ADCA 1JAZA 3K0AA 5FPYA 3RYIB 2G25A 3FETA 5EHXA 5CFMA 2AJTA 3KZKA 1FNMA 2WQ7A 2OECA 2P35A 1V96A 2RHMA 1AXRA 3AJ8A 3RSFA 3BVPA 3TSWA 3D6UA 3U4AA 3GT7A 2X5NA 2ZSIA 2JGJA 4UQPA 4NK5A 5EMMA 3WMGA 5HQ3A 1EXNA 1JI0A 4ZOLB 3MWEB 2DR3A 4KR7A 3REOA 2PZJA 4ER6A 2HA3A 3EIEA 5DGTA 1YS4A 2CLFB 1V3QE 2FTKE 3B12A 1AQUA 4NX2A 3ADDA 1JSLA 2PFSA 4YT4A 4ZD6A 4U6NA 4EB6A 3JZAA 5IMSA 1AGRA 1BC5A 4V02A 1TEVA 2YJGA 4C0HA 5L6MB 3DLHA 2F4VB 1XD2A 3A2LA 3KELA 4TTJA 3Q9LA 4TTAA 1HE2A 3MMPA 2TS1A 4FYYA 2AXPA 1ARZA 2FZLA 3VH3A 3QPDA 1NZDA 3WGKA 1R50A 3L7KA 4J6FA 4QSHA 2FXIA 4WXMA 4UARA 1CY8A 4XDZA 2F48A 4C5AA 1VBFA 4ZAYA 1Y7PA 4TL7A 5K0FA 5J23A 4CLRB 4GXQA 1NP7A 1U1GA 3GEDA 4OD0A 4BX9A 2ZG6A 2H9IA 1AV7A 4HHEA 1WCYA 1IBCA 4B6JA 3EDMA 2JZNA 1K8XB 3IVMA 2WJPA 3LFUA 4XFDA 2Z4TA 4DZRA 3GJ5A 1H2XA 2Z2KA 3TEMA 1R10A 1KIFA 2NQTA 5LZ9A 3RVSA 2A4KA 1OXTA 3THYA 1WO8A 3DL0A 4O8CA 1L5WA 3I9FA 3QOXA 4H31A 3GEHA 4RORA 2C3UA 2QE7D 1TYEB 4WVFA 4OHVA 4WE3A 3QBJA 4JASB 2PAAA 4P0QB 3ZD6A 5IM4F 4CKBB 1HDRA 4CMCA 4F8EA 1HNWB 5ESDA 4R5HA 4NYJQ 3OQ6A 3RUCA 1WZEA 1RQLA 1OBCA 1H2HA 1MNAA 1RLOA 2AA3A 2ZRFA 4ZVTA 3QHPA 3VZDA 2JGDA 3FROA 4L27A 3Q15C 2DR0A 3RTGA 4E5KA 1YZQA 3R0QA 2RGEA 1XXHB 2BFCB 4DZTA 1GQFA 1IONA 3ML1A 4UDOA 2JLXA 3LA6A 1NKTA 3NXKA 2O2IA 2P2SA 4GP6A 1FFSA 1T2NA 1ZGCA 4YMIA 1RAEA 4WECA 2CV2A 1W7AA 2Q6VA 4PBRA 1CIJA 1G7CA 1QO9A 3DBRA 4O4HB 1S2OA 2C7PA 1GWNA 1SC9A 1GEEA 4MVJD 3CNNA 4N3NA 5E2BA 4OHBA 4X1KB 1UL1X 3SDBA 3SY8A 3PSHA 5A04A 5BMOA 7ADHA 5KNCA 1M5RA 1P4RA 4MXDA 4JD5A 4B3DA 3OJOA 2FWMX 4MKXA 4V1CI 1VZ2A 1P9OA 1ZGHA 2I6TA 3D1VA 5FPQA 1JDSA 4M7OA 3H9QA 5HS6A 5D7NA 1PNRA 3I6IA 3JRWA 1RAHA 3T7TA 3KAJA 3LVRE 3RHFA 4C7XA 4ZDJA 4HBZA 1E6WA 3EA5A 2A86A 2R8RA 4PXYA 1HI9A 2J0SA 1HT3A 2O5VA 4A0HA 4EJMA 2VKQA 1PSWA 4TS9A 4OH7A 2CLEB 1R18A 4DQKA 3T7DA 1HURA 3D4OA 3LA8A 4M0LA 1GTG1 2OE2A 5CXXA 4U3JA 2RKBA 1KXJA 2J9RA 3ZWWA 3EW9A 1OA1A 1QHHA 1ZUHA 2ON6A 3NHUA 5IFLA 3ZLBA 3OO1A 4Q3OA 1XB2A 2WZBA 3QWAA 2IV2X 3RS2A 2AZDA 4J3JA 4MGYR 4DLTA 2Z43A 3PQ2A 1OWNA 1XVAA 5EI5A 4NBTA 5ITZB 1DQSA 3HFRA 4XOUA 3C1AA 4OATA 4G63A 3OIVA 3AEUB 5CA0A 1HO3A 4FYKA 5KINB 1ZUNB 2DGDA 1RWOA 4LYDA 3TUIC 4GO1A 3I3SR 5JJBA 2V1XA 1AG9A 1FVHA 1NFFA 4IRMA 4WXYB 3V4ZA 3ZNPA 1JFRA 2H2IA 2EYQA 1PWXA 3C87A 2H2DA 2JI4A 4JQSA 2WWIA 4KWIA 1V1JA 5IF3A 3NAGA 1V26A 3WLTA 4BTVA 1QQ6A 4HDSA 5EIBD 4YCSA 3GLIE 3EC1A 2I6UA 1GL7A 3KE8A 5DN6A 4PIVA 3TM4A 5ICEA 3EQ9A 2GWHA 3JVEA 1MT0A 4ND6A 2A0FA 1M1UA 2Q2NA 3LDGA 3IAEA 3VNRA 1PZFA 2FZGA 3KKLA 2H4HA 4FFDA 3E03A 4PIPA 5L7YA 3NOQA 4TTTS 2QX7A 5KYGA 3C39A 4H0FA 3P9NA 3CG0A 3G1TA 3KOOA 3TSOA 1M5TA 4BFXA 4OI0A 3DO6A 2VDWB 3KWMA 2PL1A 4H3HB 4KAXA 4TV8B 4C14A 1Y33E 5AOAA 5TQ0A 3RU7A 1FFCA 1ONNA 4TL8A 3UAGA 5ALOA 1C4KA 3F7OA 3H5OA 2A5YB 2XWJI 1RQ7A 1MAWA 1DG1G 3R3VA 1I9GA 1VIDA 3DAYA 3UATA 4TYWA 1YB1A 2QU8A 2PT6A 2GKOA 1BVYF 3VVCA 3DJYA 4QVKA 2AC4A 2GK7A 5G1OA 1HR0B 2R8BA 5JSHA 3AJRA 1YBFA 2GD0A 3FPLA 4WN9B 4XTCS 3M6LA 4YN3A 1BA2A 3EEQA 1GGJA 3EDQA 4YECA 4EJ6A 2I7VA 1BXGB 4MV5A 5A9TA 1SXPA 4TMYA 3GLGB 3NIDB 5DMXA 1SVSA 1N6HA 2HJHA 2WPDA 4GPAA 1T9AA 2DKOA 2IY8A 4BV3A 2CEKA 2Z30A 1L5RA 2XCSB 5IAAA 1A2QA 2C88A 3VV3A 1N0VC 4MVXA 1KYIA 4CGZA 3WLJA 4KQKA 2G40A 3W9SA 3GRPA 3ITEA 1DJLA 1YDGA 1YS7A 1QH9A 2YASA 3U44A 4EA9A 5T6MA 2I65A 3R77A 5LQUA 3WYFA 1HZJA 1GCOA 2Z58A 1WXHA 4M38A 1KQFA 3NIFB 3PC2A 1BDHA 4M87A 1RYZA 2W6IA 5ALMA 4WBXC 2AJ8A 2GYUA 4L9AA 5F1OA 4UJ3A 3HVIA 4Z7OB 1VLLA 1A5ZA 2Z5FA 3P2MA 4EY7A 3SWWA 4EGJA 4OUDA 5EG5A 1ZHHA 1CVRA 2BRUA 5HOQA 1FDWA 3OZVA 2GLXA 3E2MA 3TLBA 3HNRA 1D0SA 2QRGA 1UXHA 2WUVA 1OC2A 1RC1A 4MLZA 3RKUA 4B6FA 4R0MA 4IGIA 1E4VA 1GEGA 2V0CA 1HT1E 3ZWBA 5AW4A 4X3OA 4AKTA 3PXXA 2OXRA 4EMBA 3S2UA 2HW8A 3G13A 4YJGB 3RC7A 3T41A 3WDLA 3GCZA 3OEEA 1K6JA 1SA0B 3ADCA 2XWPA 4JI5B 2HAEA 1RXYA 1XA3A 2PXCA 3DGEC 3DS8A 4FCCA 4BCDA 3IAFA 3TR0A 7YASA 4D3DA 1NQ5A 5FLXA 1UBCA 3ZHQA 4WXHA 1UKAA 3ZQJA 1JS1X 1BHJA 2R1TA 3DF7A 1KZGB 4OLHA 1LDMA 4Z9BA 2OBXA 5T7BA 3EZXA 1LBQA 3L0PA 1L4UA 1HYHA 1JU4A 1M9NA 3HU1A 3JWPA 3OZXA 4H6XA 4K9NA 3SIRA 5A4IS 5JTUA 1YA6A 3QE0A 3ZBTA 1IBLB 2MHCA 3FNIA 4MRVA 1OTHA 1QOZA 5FLYA 5I01A 1Y6RA 2RI1A 4GRDA 2CJWB 1Y1QA 3WO1A 2WKQA 4AF8A 4O2BA 4QUAA 2XVAA 4QNRA 1OSNA 4CKCA 2VAXA 2R8EA 2Z8YM 3F8WA 2QRLA 4FR5A 4G4SP 4JXKA 1EP9A 3R0VA 3QPBA 1QO7A 3BXZA 4XM2A 4G4GA 1GNQA 2QPTA 4KPUB 1FB5A 1QZZA 3I62A 1JA9A 3OT1A 2WVAA 4F9TA 5K01A 3IP7A 1RYBA 2ZRHA 1KK1A 3FH0A 4MHSA 4R1NA 1SZDA 2HDWA 2E6KA 1GYRA 4KBFA 4TXJA 3MWGA 4KWHA 4XUEA 5EIOA 5IT4A 3UBTA 1QE5A 1T24A 4DRXB 1ID1A 2FMKA 3HP4A 4RD4A 1XZGA 3EPPA 3SHQA 4AX8A 3AVVA 4FC6A 5GINE 5DT2A 3CWZA 3C3MA 2ZWAA 4R6XA 3WLIA 5J5CA 3F2IA 2GKGA 5CM8B 1W4ZA 1ZH2A 4KQJA 3SI7A 3U7JA 2J9GA 2WAMA 4QO7A 1TAGA 5E4YA 3VBEA 4DR3B 2CMGA 3OQIB 3V32A 4UTZA 3E9QA 2R87A 3VR4H 1OD6A 3RFFA 1JIVA 2INGX 4L4RA 4FOLA 4PX3A 4FW8A 2GXQA 2PSJA 5CNMA 1RP7A 1AA6A 5JSUA 4Z4GA 1RAGA 3OWXA 4TZ0A 1A76A 3KYCA 4YCDA 2V0GA 3H84A 3IV9A 2AFIB 3PENA 4TRRA 2PRYA 1VJRA 2QVCA 4MB0A 5TT0A 5AW3A 1KFKB 1QGED 1TO1E 1ZVKA 1RE1A 2QGNA 1KEPA 3DFKA 3OP1A 4X61A 4F5YA 3C7TA 2VQFB 1OFHA 5AJYA 2JFZA 2O8EA 5BSRA 2C83A 4AYXA 3M7IA 3OTGA 1JFSA 4NYIR 2JJYA 4ZU3A 4I81A 3G8AA 3Q5GA 4JBNA 4RABA 1NBIA 2QPOA 1ACLA 1ONPA 1PNVA 1SBYA 4CEHA 3I92A 5B57C 4OGLA 2NIPA 1PD0A 3CT4A 3T5DA 2WD8A 2PL3A 4E5UA 1J8VA 3G85A 2OZPA 4KFSA 5I47A 4CEJB 1PJLA 1VKHA 1BGVA 1I3LA 1VGQA 2ODBA 5HG0A 5KKCA 3UKJA 3LOUA 1LK7A 2ZQ5A 1GNSA 1L3CA 3KZCA 4LQCA 3S1AA 4E2XA 1WBDA 2XZLA 3TR6A 2XDQA 3AMVA 3VKGA 3NGXA 2GBLC 1V1MA 3O4VA 4LZNA 2OYCA 3ICVA 3RWMB 5JBIA 3H8JA 5EGSA 2ZI7A 1S7GA 3HGMA 1AS2A 4D45A 1WZ2A 2W7TA 1JDVA 4CBVA 1ULUA 2Q41A 3GAFA 2PXAA 2F1JA 2SNIE 2PMDA 2VN8A 3NNNA 4D4GA 4YX9A 3NFYA 4RX1A 2CZQA 1RJGA 2YW9A 1GGFA 1TJPB 5F21A 2EBWA 2HEGA 4R3NA 5DHQA 1NULA 2QYTA 5KQGA 1DC6A 4RPJA 4O3MA 1JPNA 2Y1GA 4I9HA 2AKYA 1H2YA 1PFWA 4LDRA 3BJMA 2XVMA 3O5AA 4F7DA 1M7HA 5EL0A 1OX5A 1MJGA 1PRYA 4WZAE 1U2TA 3SE7A 1CZLA 2J3LA 4BO5A 4UAJA 2FSFA 4JYAB 3VKHA 2EX4A 3I0MA 1FU4A 3DDHA 3FPJA 4FEYA 4CVNA 4G0UA 4LIPD 2J3IA 4KRFA 3A28A 1XJWA 3OLCX 1M0SA 4HXGA 5CX1B 5AW0A 2PU7A 3BL8A 4RD3A 3BXOA 4C89A 1N2ZA 5JAZA 3CVYA 2HA2A 3GH1A 2WFZA 2VA9A 3MXOA 5DGIA 3ZTWA 5E2AA 5A0VA 3PPYA 1QVZA 3ZIAA 4F6CA 4XQCA 1HFEL 1E99A 5A7GA 3PJRA 1ZIOA 2DHCA 4RGQA 3OZTA 4EEKA 1L4GA 3DLCA 5CAEA 3VBCA 3NC4A 1JMYA 2CJXA 4TVOA 4DLLA 4IUCS 4DHEA 4L9RA 4ZV4A 2P2DA 2FHSA 3B9PA 1K86A 4U02A 3PFHA 1SZPA 4HS9A 4YRPA 3GPDG 1IXYA 1XQ9A 1JJAA 2SKCA 1C7FA 1MLDA 1E79D 3DTVD 1B2RA 2A9QA 3OF3A 1ADFA 1PJRA 1NASA 3DW1X 1BXRA 2EW2A 1NNI1 2R00A 4JUDX 1GQSA 3SYTA 4RDXA 5GP1A 4YJ3B 1D2MA 3HKCB 2B8EA 3N6RA 2X2OA 2PH7A 4F3RA 5H16A 1P77A 1UKBA 3A6EA 1H6CA 121PA 1SU7A 3VYUB 3ZZUA 3IHWA 1OH6A 3KALA 2FVYA 3GT3A 4M83A 2LWIA 3QVOA 2QW0X 2HMAA 5DXFA 5AVZA 5KQPA 1MO4A 1G8PA 3FBGA 4YCMA 5EHZA 2GAOA 3FXAA 3K9HA 4J03A 2I99A 1NTRA 3DBLB 1W6RA 2I1WA 4FU0A 2R7MA 1CUWA 2C9DA 2I29A 1NXXA 4L0CA 3NWOA 3ZHOA 2ZWOA 3AOEC 3BE5A 3LIPA 3KR0A 5ALRA 1V5WA 4WBNA 1Z39A 3FOZA 4LF4B 3ZGZA 3J7AC 4JKIA 3VR2A 1Q92A 5M7EA 4FNGA 1PYOA 3UMRA 3MBKA 1UPXA 1WPXA 2AFHE 3UMCA 3V8NA 4N76A 2PEZA 2Q5CA 3ILXA 5ERXA 3P2EA 1LPSA 5H4GA 1V11A 1Z9BA 2WE8A 3IV7A 1NXTA 3BICA 4OHZA 3PXGA 2ZLBA 2C95A 2Q7OE 1HNZB 3PE4A 4G0VA 3THXB 4PHFA 3O91A 1QFYA 1M0TA 2IEAA 4GMKA 4DDHA 3KFVA 1N1MA 1XZQA 4F38A 5CFOA 2Q5HA 1KOJA 2ZYVX 1QR2A 4KAAA 1GAWA 1PFQA 5ECGC 4CM8A 3KD3A 2WWTA 3L1JA 4FFOA 4Y2GA 2W2PA 3BSFA 3KSAC 3WADA 1RI2A 1N5RA 1LDBA 2Q4EA 4KV7A 4WINA 4BO0A 4YO7A 3P45A 4P4NA 4N6OA 4DJFC 2GCEA 4ER0A 4KREA 4CF7A 5FEUA 1IZ0A 5G1NA 2E87A 1I2DA 4WZBE 5DGHA 3A06A 1MIOB 3D1LA 3NBUA 5E1BA 5AW9A 4BC1A 3HXQA 5GJWC 4FS8A 1PNTA 1WE2A 1Y3IA 2C4VA 1HM5A 1PKEA 2DQKA 1IN6A 3UXYA 1VA5A 5H9VA 4UXIA 4RTPA 1UJCA 2XKKA 2JDID 4LZZA 1W49A 3EZ2A 1VLHA 3BFJA 3O9MA 1OUMA 2NYVA 4CLRA 1HTWA 3M1IA 2PX8A 1AGYA 1JLKA 4WK0B 5K8UA 3IAHA 4L5AA 1GQRA 3AB8A 3JQFC 1V3UA 2PIDA 3HXLA 2XWBF 1UOPA 2GA8A 5KVSA 3BZUA 1N75A 1J0XO 4NICA 4EJSC 4JQZA 1AV6A 4XB6B 2JA2A 4RMGA 3T35A 4E4TA 1YKFA 3ND9A 3JYNA 2PA3A 3U2QA 2DPGA 4CKBA 1TCBA 2HM7A 5B6PA 5KSYA 5LQCA 3P19A 2Q4RA 4NSNA 5E3JA 4W5OA 3CZCA 4ZJZA 4ERXA 3UHFA 3KQKA 2OC4A 3KOUA 3PUWA 4E30A 4KOAA 3PD0A 4R2MA 3TEJA 5CA0F 3N70A 5A5VA 1L4HA 1QJCA 4C07A 3HMQA 3BSSA 3DBOB 5HCUA 5CD1A 2CLKB 5LP6B 1NBWB 1TMGE 1ZIPA 1XXHA 2DQ4A 3CY6A 4NJEB 4GR4A 3SYNA 2Z04A 1LSOA 2JASA 3COYA 5I6DA 5LWHA 5DOVA 1Z0FA 1AB5A 4NV1A 3AONB 4D8WA 2QE6A 1KR5A 4ICIA 1Y3HA 1C80A 3H5WA 1XFAA 1V7PC 3WJ2A 4M7WA 4O4HA 3L43A 2O8NA 3F3SA 3M4XA 1W30A 4X1KA 3GP5A 3W04A 5K0EA 2V7QD 2FUG6 1O6FA 2QRJA 3A04A 2XSZA 3WMXA 1E9BA 5A7FA 3TPZA 3G0IA 1LC0A 3SG0A 1CUSA 1I9CA 4FMDB 5DMHA 3AR9A 1IIRA 2BJVA 3I8SA 5TVKA 4M9RA 1HBJA 1YZFA 2V59A 4ME6A 1U63A 4EGFA 3AJ9A 2ONZA 1G6OA 4WDRA 4ENTA 4AECA 3CN7A 4DPKA 5IJ0A 5FAXA 5BR4A 3PYXA 4EMSA 2OVBA 3WOHA 1R7RA 4B2LA 3V2UA 3HY3A 3IXQA 2FE4A 4L8YA 5C35A 2I8AA 3GVPA 2HJWA 2EKLA 2RHLA 2HLPA 3DEHA 2PQ6A 4HYTA 1JAXA 5B7GA 3K15A 4ID9A 4LYGA 1E0DA 2AOXA 3DLIA 4HZUA 3GBVA 4ZYZA 5DNUA 3L05A 3BH0A 2V7GA 5FV4A 1ABBA 4UATA 4KDEA 2EGUA 1Y3CE 4ODIA 2B82A 4BFVA 4QEKA 1NSYA 4B0OA 3O8BA 3HM2A 3IAS1 2XOKA 1CP3A 3AHIA 5ITZA 2O1SA 4D25A 3FSJX 3OOSA 1KK0A 3VVBA 4ZKDA 1NQWA 5L6LB 4NHOA 5AJWA 1F2UA 3L1KA 3C6YA 5CCXA 4KWEA 5I4BA 1QORA 3U6BA 3CBGA 5C3UA 3HLKA 3K70B 2N3ZA 3RVKA 1NJ6A 3SVZA 1PQUA 3IC5A 3F5DA 4ROSA 3F49S 1TRKA 4J3FA 3ZUPA 1W87A 1LNZA 2ADFA 1GGNA 3OJLA 5CDFA 4M60A 4UUQA 4CCYA 4DIFA 5K1ZA 3R7WB 1YC5A 2OHOA 4NV3A 1X7GA 4AC9A 4P3OA 4P3KA 3T1TA 1L6RA 1E9CA 3OJEA 4RM2A 1QV9A 3LWZA 1GPWB 4BLVA 2ONJA 3S2GA 4EOGA 5JQWA 4BKRA 4GYKA 4R01A 1IZ8A 5IDVA 2VDWA 4XD2A 4D79A 1DRKA 3F9IA 4TV8A 2FEWB 3DZKA 3EZ6A 2A1UA 2PSHA 3C3BA 2VUTA 3KJZA 1I33A 3AERA 4LZPA 3ROGA 3ZE0B 4XARA 1U3TA 4Q7JB 5B1YA 1ZCJA 4J16A 4ATNA 1TF5A 4BX8A 5KYUB 2PN1A 5DGXA 1PDVA 3AI1A 1SUWA 3WI7A 3W6OA 3VZQA 3H9EO 4BX3A 1TK9A 3IJRA 4C0LA 3JWJA 1POWA 5AFSA 3L8ZA 3HVRA 5IVIA 3PQDA 5JVDA 1PJTA 4YPFA 3H87A 1SVLA 4R2HA 4WN9A 2M32A 4IUDS 5HIKA 1G21E 5HK9A 2BZGA 4HAVA 2H4WA 4D57A 3ZWQA 3Q0TA 3ABZA 4KR9A 2AEEA 2FR1A 2ZUSA 3SHVA 1BD3A 4IIUA 1WSDA 5BUCA 3TG2A 1V8BA 1ZEJA 3MRVA 1XTRA 1W1WA 4DDTA 4QU0A 3NHZA 1USKA 5E9JA 4O33A 4J6EA 1I10A 3OMWA 3RYCB 5FWYB 2E4YA 2M2IA 3QXSA 1WMDA 4GE3A 4L76A 4MW5A 2GEDA 5H70A 3TQQA 3R4CA 5BYAA 3EMDA 1VJCA 4B85A 4MEBA 3CEPB 3F6YA 1HDCA 2BLLA 3GPBA 4O2BF 4WADA 5A62A 3G8DA 4OB7A 4AQDA 4DMUB 1KMIY 4X5OA 3LCMA 5AJXA 3C6BA 3DOIA 4FP9A 1F06A 3ZW8A 3N8KA 5ALTA 1TMKA 5GV8A 4J49A 3FDXA 2DCUA 3UOGA 3UWOA 1L3IA 3BFXA 4US2R 4E70A 4G0ZA 3BULA 1OZAA 2Q27A 3HADA 5GOTA 1X80A 5DCWA 1W0KA 1R0LA 4JNCA 2GEJA 4LOIA 1KQNA 1IBSA 3BXXA 3RK0A 2IHVA 2XMSA 4N5HX 5F76A 5GTDA 3M33A 2VSOA 4W5QA 2FDRA 4V2UA 1CU1A 5JCXA 2FMTA 2VRBA 1THGA 4LBVA 2LCQA 4JXXA 1FDTA 1L4NA 1Y89A 4RDCA 2NP7A 2JKVA 2JJ8A 3O0TA 2OBYA 5DT9A 1EQAA 1G20B 2BFFB 4HNTA 3Q7PA 4CMIA 3C2QA 2RGYA 3MWLA 4CQMD 3B6IA 3F6EX 3N6XA 3SEFA 4I19A 4YJGA 4YGXB 3H0CA 4L6CA 4NWIA 4RJJA 4ZDWA 5ITVA 3HU3A 1SA0A 3EJWA 3VO9A 1U7ZA 1KIAA 1YWGO 3TMKA 3WNVA 1WWKA 3H0KA 4GICA 2P3SA 3F7TA 1U8UA 4L28A 1XNJA 1DFIA 2ISCA 4HDKB 2QW1A 3M6UA 1NUQA 2ZIGA 2O2XA 3U40A 5YASA 2QRQA 3D4NA 1KRXA 4JZYA 3RSZA 2ENWA 5EUQB 3RD5A 2B34A 2HRDA 5K8IA 1ESDA 5F2OA 2GPWA 5I9MA 4MVJG 1VI6A 4PY2A 3VH2A 3EDCA 3FTDA 2Q3DA 4LMPA 1WTCA 2YQZA 2PLAA 5AHKA 3VKUA 1AN0A 5JASA 2V6JA 1F51E 1SUBA 4Q3CA 2F7SA 1FXWA 3D5TA 2PX3A 3G3EA 4NAVA 4B9EA 5AW2A 7REQB 4AI6A 1Z5PA 1Q19A 2ZTMA 4QASA 4TT3D 3MD0A 1G1MA 1I7PA 1VKZA 1QPZA 3FWKA 3CINA 4AT1A 4D3ZA 4CRWB 3TVTA 1AO0A 4IOMA 3DZ8A 3C16C 3O38A 1BE0A 2PT9A 5E0KB 2ZJ2A 3QEJA 2AW5A 1ANKA 3BHNA 2IYYA 2V7VA 3QOFA 4KPUA 4Y6GB 1JBQA 3JZDA 4LRXA 4CZ2A 3TXAA 3CPSA 3Q3GE 3C5CA 3ZEAA 3K5HA 4N39A 1V5EA 4TS4A 4GEKA 1U9YA 3EUEA 3FVRA 1VSBA 2BGIA 2UYHA 1REQB 3I73A 2IKSA 2FKAA 3U3MA 3X1MA 3AEKB 3KHTA 2YWRA 1EKXA 2P11A 1GKYA 1H4VB 3X1JA 5IDWA 2H65A 1GDDA 3OQIA 4AMZA 1PWZA 3I2HA 3V4LA 3NLLA 4ISCA 4WXRA 5LYJB 5ALJA 5IC5A 4RW0A 5CFPA 4R1LA 2A5GA 5IBPA 1GP2A 3NATA 1Z7GA 4RANA 1Z5GA 2P2YA 3AFIA 1L5YA 3IE0A 4RY9A 3MRSA 3DMDA 4MP8A 2LIVA 2WBLC 4CHGA 1J6UA 2F90A 3QMVA 4IDHA 2PKCA 3DLAA 2IUTA 3RW9A 3U4MA 2PMBA 1PP4A 1F3OA 3ANNA 1VJ1A 5K0TA 3JW8A 5CB4B 5JLAA 3C1TA 5K8VA 1TT5A 3JS5A 1E32A 1RWQA 1E6EA 3BMCA 4LYAA 4BAGA 3K9NA 3ASUA 4C5CA 5DTIA 4WLVA 2FQ1A 5KJEA 5DLDA 3GZJA 2AJBA 1CDOA 2C7OA 5ISMA 2R751 3AGPA 3V1UA 3WHIA 2VPYA 2G9VA 4JLDA 4U7JA 1ML4A 4RD6A 1Q50A 3VC3A 4DMCA 2ADOA 1JG6A 1DWOA 4LGMA 1RXVA 4K6MA 5IJZA 3KJEA 3PVCA 3KDAA 3T5TA 3TNLA 1NSFA 2C5SA 4ZO4A 1HPLA 3TB4A 1CUFA 1XRJA 1B2LA 2GT1A 2N0SA 3FVWA 2OHGA 3DCYA 2Y67A 3QPWA 5DB4A 1JWAB 1D03A 3GOQA 3TF5A 2O7SA 1E3EA 2I5PO 2XWSA 2XXBA 3EZ7A 2Q3MA 4JVOA 1CR2A 4J2OA 1MIHA 4MW9A 4X7PA 4I6GA 2G9QA 4PEVA 4EAQA 3LY8A 1QRRA 3SLGA 2D13A 3B1XA 2O05A 1I3KA 3VR5A 2WB2A 3RAPR 2D00A 1BRTA 1HT2E 2GZAA 3MTDA 4JODA 4ZT5A 3UK1A 1Y3AA 4K0RA 4FMPA 5A4AA 2PGXA 4YONB 4DLVA 3N3AC 1NF9A 1DZIA 2LKCA 2WSIA 3SS7X 4WBNF 1XZMA 3ZJUA 4LF5B 2HQSA 3B20A 4RK4A 3LBHA 4CR7A 4HWKA 4L4XA 3LL4A 2WZDA 3H75A 2I2FA 4KFRA 5CX1A 1HL3A 1K63A 1SB8A 4MR9B 2PRZA 5FLEX 1ZK3A 1IIBA 2X86A 1UEXC 3DC7A 4FDTA 4GZ6A 4YRTA 4AJ2A 3BQ9A 4DV7B 1UC9A 1XEFA 4IOLA 4G0XA 4L5YA 5KYKA 4R1SA 4EG4A 5E6SB 1ECJA 3IEXA 4DCMA 1DMSA 1HLPA 1F6BA 3NT5A 4KYIB 4B45A 2A67A 1TDJA 1VLQA 2Q2WA 4HMQA 2A0WA 2DLCX 1C0EA 4ILKA 4MPPA 4A6DA 4QEZA 4KSYA 4ZOLF 2LZ0A 4P32A 4MCJA 1L5FA 3UPDA 3TD2A 4KFCA 3H16A 3IHKA 3ABQB 3EDYA 4FKMA 4L8VA 5JD4A 4D9FA 3LQKA 4CEIA 4ESEA 3J80A 3UW3A 3UAYA 4Y2SA 1BO6A 1XU4A 1GZDA 1R6AA 1YJQA 4MUGA 3R7DA 3TZEA 2VDRB 3R5KA 2B0CA 3SVLA 2QR3A 2V6FA 2G5CA 5CURA 1GNLA 1OFIA 3VDNB 4B9AA 3HKCA 2OOKA 2C92A 1KL7A 2EC5A 1FUYB 1UMCB 2OEPA 3BDAA 2QMUA 2GYVA 3R24A 4QARA 3FAZA 3C1UA 1XEAA 4EZEA 3PXDA 2PGOA 3C3WA 4FFPA 2BHTA 2I3ZA 4ZI3A 3OD1A 4CMAA 1QQAA 3BSYA 2AUNA 2DSTA 3NJ8A 4M98A 3L0DA 3KCNA 3QTBA 3VR6H 2I33A 2XNHA 1FBNA 1KOFA 2MYPA 3D8BA 2XMBA 3LKDA 2I0FA 2OGWA 1G3QA 3G17A 1SCAA 2BI7A 2C4UA 3PUJA 4NONA 1M2VB 2H08A 4C3UA 4BJHB 4GDMA 4WTOA 1UCFA 2VAWA 4QAQA 3TGWA 4QFMA 1D7OA 3HR7A 1Z7EA 3T0IA 3U1TA 5KSZA 3E7FA 3V6LA 3LRXA 1SVOA 2PYZA 3HKDA 4NV0A 4EELA 3V2GA 2WD9A 3QKRB 2C1XA 4YUYA 1JHPA 2ZPTX 4L6IA 3GJ3A 3ZVKA 3LK6A 1SVUA 1C8BA 3THXA 1RMTA 1PW5A 4L2IB 4L4ZA 3H2JA 4L74A 1M1YE 2QNIA 2WKPA 2CL6X 4OFWA 5EERA 4XLLA 3ZGOA 2VP3A 3PJEA 1P0CA 1NPDA 2UVPB 2ZREA 2WD7B 2WT9A 3IIJA 3MCTA 3F7NA 2P8JA 3Q8XB 4ZI5A 1G1AA 4HQNA 4CM5A 2NP6A 3ETCA 3HZOA 2RH5A 1Z68A 2BSAA 3O73A 1KBQA 1DB3A 1IL0A 2O0HA 4JHLA 1YQWA 4O4HF 4QXQA 4E13A 4GWGA 4Q4CA 3MT9A 5J4YA 4YCAA 3ROEA 1QANA 1T6BY 4MS4B 1T15A 5HE8A 3Q85A 1LBHA 1U6KA 4ZQCB 5FBVB 1V9LA 2HQBA 2CUTA 2EZTA 4BDTA 5KYXB 2BSQA 2DFNA 4LWQA 3PP8A 5CDSA 1BVHA 1VL6A 1H22A 3ZNQA 3AQIA 3R40A 1TTTA 5JCOA 5BSTA 4UDNA 4D4JA 2D0DA 5EINA 2R68A 4PLGA 3WRXC 2P5TB 4R98A 3D6AA 3DFUA 2VUIB 3VJLA 1XTPA 3A1VA 4EZBA 3ZWCA 5JY6A 5JYBA 1Y9DA 5KQSA 1M1XB 3DZJA 3UM9A 2JFVA 4LC0A 3RVLA 3OESA 4Z7JA 1M2HA 1ODIA 4B76A 3AV3A 2B30A 2VYNA 4HH3C 5D86A 5D7BA 4YRLA 2W4IA 2VOEA 1IJEA 1UPCA 2GXSA 3U5TA 4AIRA 2OCIA 3ROFA 2W8BB 1T36A 4XW2A 5C1IA 4AN4A 2Q4OA 1IN5A 2HTFA 4ZOAA 5GVSA 5DKFA 2XBMA 3K6SA 3DEFA 4KQWA 3X2SA 2QRZA 3K5IA 3UO8B 4HZIA 2JATA 2QRUA 4MYTA 2QA5A 5KWJA 1Z73A 2COUA 3QTLA 1DJMA 4CCAA 2XGJA 5JRDS 1CJBA 1QSGA 1ZMRA 2HRBA 1KI8A 2FPRA 1L7MA 2GK4A 3R3JA 1JR3A 1Q44A 3AEZA 3I3OA 3OF5A 5AOCA 3W6ZA 5BUZA 2BM1A 3GLQA 2G77B 1JWLA 5L7TA 3ELWA 3KEMA 2YZGA 1T8TA 3QU4A 2FMXA 1CJKC 2A2ZA 2DTXA 3PRHA 1K06A 2OGTA 1E96A 4Z3DA 5SZJA 3UVEA 4D9EA 3JQ8B 1YOVB 3HC7A 4C76A 1NUUA 2F2TA 3FWPA 4ZCMA 3SSOA 5ARCA 5GGXA 1FP2A 3IP8A 1T4BA 1DQNA 4IJ5A 5A7HA 5JNTA 3L6CA 5LZ5A 2EQAA 1I01A 3EF3A 1GPUA 3G2KA 1E6UA 3TSYA 4XSHA 5KQRA 1KQ3A 5GONB 3LNTA 3HN7A 3M9LA 4M8LA 3NNDA 3HSYA 2YZ2A 1DFGA 4TV8F 4WV3A 4ARZB 1WMEA 2Y4NA 4IF6A 4TLMB 1Y8RB 3LCVB 4IZOA 5FL7A 5G41A 4BNDB 1TECE 4NZZA 4A1FA 2B36A 5HIIA 5A4MS 3CB4A 3RVPA 4K9LA 3AU8A 3DAOA 3E3OA 2WK1A 5HUJA 3DMTC 1AKQA 1ZIYA 3WNZA 4ZMRA 3DQQA 2BDEA 1X7ZB 2YC4C 1JEYA 3K4HA 1A9XB 1FLVA 3SQDA 5JMWA 4OXQA 2EIXA 5FCDA 3UT6A 2X0RA 1QKKA 4RL6A 5SY4A 3V6MA 4CKEB 2Y93A 4ASUA 2HA5A 3FYUC 4XGQA 5HJ2A 1CBUA 4MGZR 2YUIA 1ODKA 1G9XA 1VKNA 2X8BA 2XODA 2WA1A 4HAXA 3UJNA 2VJAA 2WINI 4DHWA 3DBVO 5BYBA 2BF7A 3ICEA 3CU5A 3TBHA 1N7GA 1U31A 1WTAA 1YCHA 2F1OA 2HBRA 2YMLA 4XYMA 4BOYA 2GJ9A 4IIBA 3WRVA 1ZMBA 1K7XB 1R0KA 1Q21A 1CY0A 5K99A 1PG2A 3B13B 4XD7A 2ZYIA 3NS7A 3ZHZA 3QSYA 4GBJA 3SJ7A 1TA4A 1EUQA 2JH8A 3LW8A 4AXXA 5KNDA 1T1SA 2X15A 4GKVA 3U37A 1FDIA 3L7MA 3OMLA 5K09A 5DI9A 2PCJA 2WSBA 1QYWA 6GPBA 2RH9B 4N82A 4R7GA 4EZIA 1D3AA 1PWEA 4UOEA 4Z5XA 1VG9B 1NBME 5E6UB 3D0QA 3WFZA 3IUNA 3GLFE 5FWDA 3ZV7A 4YO8A 5BYKA 1YDFA 4FQ7A 1RWBA 1EFTA 2P27A 2R66A 3E35A 4FVTA 2N9UA 4FHDA 3GPCA 4HL6A 5DHFA 1Z0KA 2QG9A 3KHUA 3TJRA 2Y0CA 3DLTA 3W5AA 1UQUA 2AD5A 1JHVA 4P7JA 4MIYA 2W6OA 2BBOA 2PUTA 4MKIA 3V4VB 1J2EA 4V0MA 5FTKA 4WOKA 4EHKA 5KYUA 3NX4A 3DFFA 1PEDA 1QYXA 3MJRA 3WP1B 4Y1FA 3MT0A 1SXJC 2MINA 3ZHXA 4BV9A 4F2GA 5IANA 1DXYA 4ZQFA 2C4WA 3BMQB 1EBUA 3QJYA 4P4GA 1D6MA 2M6KA 3CQ9A 1WXWA 5FADA 4ESOA 2VTEA 3QHAA 5KOHA 1KI4A 3ZEIA 1Q95A 1PK8A 3A70A 4OSEA 5DI3B 2AE2A 2Y1EA 4ZV7A 1LA2A 2CBXA 4TN1A 4PSDA 4RPHA 4EMTA 1NN3A 1YZHA 2L82A 3QF4A 5AM1A 2J87A 4ZXPA 2CXHA 1VCHA 1T2EA 5JUWA 3N39C 3S1SA 5CLQA 3RU9A 2X2PA 5MN4A 2EX0A 4LHEA 1YZGA 2FR8A 2ZIVB 1P31A 3DWFA 4WCDA 4X93A 2GHRA 2OM2A 4MYUA 4Z1MA 2FG7C 4B4UA 1QP0A 4QGAA 2PWZA 4AP9A 1EFDN 3IOBA 5E7MA 1J0CA 1FXWF 2V54A 1IDN1 1R4MA 3KB2A 3OJFA 2SICE 5C7OO 2F1IA 2IPAB 2ZRKA 1KZ7B 5HQTA 3UKOA 3Q3IA 4X7MA 1E62A 4MUIA 4R2JA 3E48A 3HUEA 4YRSA 1W9MA 3A25A 4IS2A 2Z9DA 5L3VA 1K1EA 3M4YA 1JSXA 2NU6B 1GG9A 4UCQA 3PTZA 3ETGA 1WPQA 3TIFA 3UAOA 4E5PA 5I4KA 3MTQA 2C0CA 4RQTA 3KOWA 4C6RA 2WV9A 1P2DA 2BMAA 3LUJA 4HNAB 4RFVA 1MC4A 1T35A 1EZZA 1S4QA 4PZCA 2O8CA 4EF4A 3OKCA 4I14A 4MYDA 1C2TA 3S2ZA 1CE8B 4BN0A 4A26A 2BFFA 2R48A 2QDKA 4N0QA 1E61A 4YUVA 3TN7A 4FDVA 4E51A 2HTEA 2V5VA 1Y42X 3NWEA 2EKBA 3A9WA 3DKVA 2JGAA 3I32A 4OQDA 4PPYA 3AY0A 4I4TB 4DAEA 2NPOA 2QLMA 2OXEA 1IJFA 1ICIA 1M34E 4Y1RA 1SUEA 3OQPA 1L4FA 3ZQ6A 3PQ4A 1F4LA 2FLKA 1RHQA 4BFYA 5C52B 3PRJA 3AVPA 3QF7A 4TMFA 4HDKA 2IP1A 4HEA6 4JLPA 4LMBA 4PGFA 4LTNA 1DWQA 1Q0ZA 4N7JA 3QXXA 1VMEA 1ODLA 1K8YB 4ZN6A 3DONA 3QU5A 4BMYA 4PX5A 3VU9B 1RABA 2CHUA 2ZIEA 1CS4C 2GCOB 3JX9A 4UVIA 3KQHA 1R4ZA 2BF4A 1MO6A 4GLFA 3KBBA 1RQRA 3JQEA 4G5YA 4DV2B 1VQ1A 3TZLA 4J1NA 4D8YA 3RRXA 3UGKA 4G0QA 1YI8A 4IXWA 4RADA 3LQYA 4FGKA 1RLUA 5LBUA 2IWHA 3W7AA 1ULTA 3JD2A 5FL3A 4BAZA 1Z7BA 2E6UX 3IQHX 3OZFA 4OGFA 1W93A 1ENPA 1VDZA 2B61A 4D2IA 1OWPA 1USVA 4IINA 3ESXA 4LF7B 2X7XA 1POXA 1ODJA 5HGXA 1NI5A 3FHLA 4KQMA 8ATCA 2WIFA 2O3JA 1VYVA 3EF0A 4NS1A 4UD2A 2ATIA 4C2BA 1V71A 1E5TA 1W48A 1WUTA 4QIHA 4BX2A 4MYRA 1TUBA 1P39A 1E7WA 3A0UA 1HDZA 4UFOA 1REQA 3WMFA 3ZUGA 4CGYA 2FN4A 1IAVA 3PGLA 4WWHA 1L5QA 2CLOB 2GHIA 2GF2A 1B1AA 5AXBA 3AR6A 4MOWA 3TCNA 1JKMA 2E4ZA 1O94A 2Y1WA 5ADHA 1ISFA 4IO0A 4Y0AA 4JBWA 4AJEA 2PZBA 4QDXA 3IODA 2E4VA 2XXAB 3FGPA 2ZBFA 4E1BA 1A7JA 2QQGA 2WFLB 4F92B 3ADPA 1PJAA 1MA3A 5BYJA 1TZ2A 3KZXA 3NOOA 4OI1A 1E18A 3AFHA 2OVFA 5B37A 5EJEA 1N2CA 4MDFA 1OVMA 1ZVQA 2H4JA 4LWPA 3PEFA 2OXFA 2AOTB 2PDAA 2YXBA 4NCHA 3OIGA 3INGA 1WP9A 2XTAA 4YUAA 1ADGA 1R74A 2WU3A 4KV9A 1IM5A 1NV8A 4RHCA 4ADSG 3U16A 1OTXA 4XQEA 1DJNA 1P91A 1UDBA 4AJOA 1SZJG 3D3WA 3FSRA 4ESVA 3DM5A 1UPUA 4JK3A 4DABA 4IIDA 4WZ6A 2J85A 4MQBA 5C34B 5SY6A 4EH1A 3SBXA 1T0JB 3C3JA 4YR7A 3P9XA 1AZSC 3AILA 4HTAA 3N7AA 1H66A 2AW3A 5EPUA 1Q3KA 2PJDA 3B6ZA 5IDYA 5JS7A 1TZBA 3BHIA 3KXLA 1BIFA 1GR0A 1KU6A 3UAVA 1UKCA 4JLWA 1W59A 1NP6A 5EE9A 5IAOA 1N6PA 4AUNA 1OILA 2GJ8A 4R3WA 1DO2A 5A4KA 3RV3A 2ZWIA 2NUPA 3L8MA 3WDSA 4CDMA 3LC0A 5DTJA 4K28A 4RSHA 4A2PA 5JATA 1M6VA 1UH5A 3B1YA 3JYHA 4JYCA 4PLPA 3R7AA 3WWEA 4OP1A 3D54D 5AVJA 1D8AA 3SN6A 3UJ7A 1WU7A 1HE3A 3MM4A 2E85A 1R6DA 2ZSDA 4HEHA 4BLRA 1CF9A 1PG0A 1M2OA 2QUBA 5F64A 3BMOB 1TA0A 1TM7E 4DVGA 1N2GA 2CJYA 2G1UA 1QK5A 2XKJE 2ZGVA 1VSTA 3FFAA 2FW7A 5BW4A 3ZCSA 1PEAA 4OMDA 1ZPDA 2EFHB 4DA7A 1J0AA 3A7DA 4ZYUA 1QGDA 3B3GA 4QECA 1IEXA 2PZKA 4XIIA 3GK3A 4GPIB 1SEVA 1GZHB 1ZVJA 2EW1A 2VWPA 4MR9A 4Z4QA 1R1DA 1WLSA 4O0LA 1XFDA 4GSKA 3ZGXA 1V4BA 1RVV1 3QVLA 1KP2A 4IGEA 4LZJA 4RF2A 2I87A 4N8SA 5E6SA 2POCA 1QRDA 3G9TA 5JWRA 4M88A 1WUJS 5AH0A 3OPVA 3QFSA 3SGLA 4D0NA 4OPMA 1E3WA 2FWBA 2O2SA 3KZ1E 2GVDC 4FLMA 4OXYA 1CZRA 1SHTX 4CT4B 4YXFA 1ZM9A 2HIHA 1JA1A 2PWYA 3WAJA 1VDMA 2P2CA 4C1NA 3LCJA 3W2GA 5CLIA 2JHFA 1KKUA 2PRJA 4MI1A 3ZDCA 4KNWA 1SD2A 4OO3A 1UM8A 4WCVA 5EXPA 1XMVA 2GN4A 5HRUA 2XQKA 2B2XA 4ZCQA 5LJIA 1QFSA 1I30A 1OROA 2RBEA 3DVLA 1V16B 1X7HA 2D0IA 2QLNA 3KB6A 4PG8A 5JFGA 4MCIA 1EEXB 3FNBA 3GLIB 5LKRA 1DHTA 3H8WA 3ET5A 1RWNA 1WG8A 2F4NA 4PFQA 3Q98A 5ESXA 3GRUA 3SSNA 4F91B 5HXAA 2WOOA 4I7EA 3OP4A 1N2OA 4G65A 4JA0A 4R9VA 1OREA 3UB3A 2PLFA 3W8DA 1G9SA 4Q18A 3A1SA 2FP3A 4TVKA 5HMMA 1FMJA 4V0LA 4R1TA 1VJ5A 4YLGA 4CFYA 2PS0A 3MJVA 3H13A 4WL0A 1RXUA 1TJ3A 3G7UA 2C2WA 1Z0JA 5HUHA 3U0VA 3RAJA 4U2KA 5TQ2B 2PUAA 3SC3A 1MAVA 3PJGA 3G02A 4NCAA 2B4TO 2WWYA 4JUAA 2AMVA 4ARUA 1OWMA 2JGEA 2ZJ6A 2BKXA 5DX1A 1N6IA 1QUFA 4B3TB 2JG3A 3PITA 3HCRA 3E5HA 5H0IA 3KUDA 1WCIB 2D8AA 3LLUA 1E3TA 3A6HA 1AQNA 3WXBA 3EULA 1O2DA 1BKSB 1TRHA 4NQZA 1UADA 4BO3A 1U0FA 4X8LA 2Q29A 2BMEA 4WI1A 5IUJC 1W73A 2IYVA 3DE3X 4MVWA 3UIEA 3DQZA 4L2IA 3NEJA 4DVJA 5KWSA 1Z45A 2BFDA 3BFVA 4FX5A 1A2KC 1CUUA 3NHSA 3DOHA 5KREA 3P94A 4IHAA 4BLOA 5LQDA 2FPIA 1JFVA 2VT3A 1QNLA 1EX6A 2ERYA 3PXAA 4BNZA 1C3LA 4KVAA 4UFPA 1PW7A 3OFND 1X77A 1ISSA 3E6AA 3FJ1A 5HDQA 1RXWA 4KSCA 4EDFA 1EAMA 1BWSA 4N6NA 1GZUA 4W1PA 3K5WA 1NT2A 4GX0A 1X1BA 3IAM1 4JC0A 2HN9A 3PNPA 2Q6OA 5JBNA 3OFVA 3B82A 1X1QA 5T41A 1UZUA 3GAAA 4H3KB 3KR1A 2VWGA 2HU2A 4J76A 5IW8A 5KYXA 3MHTA 2VSYA 4RJTA 4DF3A 3A6FA 1DQYA 1Z75A 1UBFA 5FPPA 1ZRSA 3DTVB 4US1R 2FN3A 2VCEA 3H17A 1ZXXA 3I0ZA 1NONA 4I1YA 4BEWA 1TQDA 2FZVA 4LXIA 4PLHA 2J48A 3QMPA 4J7XA 5KTRA 1P2BA 5BUQA 5TMPA 4GKJB 2IXAA 4M1EA 2HT6A 3R20A 3NM6B 4TLBA 1LB1B 2WV7A 4RFSA 4UDYX 2OHVA 4Z86A 1K08A 4GI1A 3JZIA 1QMGA 2UXBB 2PX2A 5G3ZA 2CYAA 3RC1A 1I5EA 2JBHA 3WRYC 3LDFA 5JAIA 3USES 1J2TA 2F59A 3I6YA 3RJMA 5F73A 4WY2A 5EZ6B 1Z0DA 4O4IA 2W8BA 1R9MA 1RKVA 2BFOA 2PNFA 3PFBA 4PHGA 4D8XA 3TQHA 1PT9A 4PC2A 1XZHA 3TG8A 4YACA 4URYR 3ORRA 2I78A 3LXRA 4KMRA 4OOEA 1KI6A 5A03A 5ENVA 2CBGA 3ROZA 1J09A 4DA4A 1T43A 2IEDA 1VB3A 1XAGA 4PYIA 1O77A 5KOJA 4LJ4A 1TM1E 2I3BA 1H69A 4FHCA 4Y2QA 3HH8A 4BP3A 1RZRA 3EXHA 4Q1CA 1MW8X 4PZUA 1SXJD 3K7EA 4F8JA 5KYWA 1OGYA 1GSOA 2O2CA 4QTUB 1DO8A 4XIGS 2XNDD 4NIMA 3OEHD 3B1JA 3BFPA 4X8MA 4XH9B 1FZQA 2PX6A 3LC7O 3DCJA 2D1FA 3JQ8A 4Y3UA 2F1RA 3UMYA 4Z4FA 1ZNWA 3UCEA 4CE6A 2B9VA 2Q8NA 5KSWB 4RELA 2CGEA 4CKYA 2AG5A 1GAJA 2Z6UA 1ZM2A 3GJ4A 3IALA 3TQCA 2FPPA 3CRQA 2CC2A 1OH5A 1M1NB 4ZVSA 2HWYA 4U7PB 4ED9A 3VX4A 3UICA 1GILA 3UJBA 4CV2A 1FRFS 4J43A 1S9HA 1UMKA 1WD7A 4P58A 3L7BA 3T5GA 4EECA 1I7DA 2UUCB 3IRUA 3CUEF 4X20A 1ORTA 4II3A 4QO8A 4D42A 4D74A 1Y8RA 2PSFA 3EWNA 4UMDA 2YFYA 4YQFA 3AKCA 4K0KB 1ETHA 2I6GA 1E89A 2GRJA 3F46A 4XJVA 5AICA 5ER6A 3GVXA 4LFCB 1I6WA 4C01A 3FOWA 4O4LB 4YRNA 2ZJFA 1KF0A 4AF7A 3ZCRA 3JASA 5AHWA 4LTDA 3CTPA 3B60A 3I53A 3KLBA 4RY2A 4UOQA 3ZKWB 5HJ7A 1GA6A 5JEEA 1X7ZA 4TS1A 4F84A 2ODNA 3R9IA 2GM3A 1FVFA 1WW3A 4F4JA 4QQKA 1A9XA 1QRAA 2OXCA 4MR8A 3KFLA 4MR7B 4EARA 2YBDA 4MARA 3EX7C 2YIVX 4IP0A 1LBTA 1Z15A 5IARA 1YB6A 3R7LA 4QUHA 1DOAA 1E5LA 1PUXA 4W63A 1SG0A 3G9UA 4UEWA 4DGQA 1UWKA 1ZQ9A 1P0FA 1WW8A 1X70A 1ADBA 2F9LA 2HK9A 2Q0XA 3D7SA 3G9QA 1C4XA 4EM6A 2FGJA 4Z9AA 3EUAA 3H4IA 2GM4A 1K4YA 2FLWA 3AXTA 3ZE8A 4IWNA 4M8SA 1HNXB 2QE7A 1NSTA 2V3WA 5H7XA 1RPNA 3I64A 2QTMA 2J4FA 4M9SA 4RK7A 1RHJA 2IHJA 4U6SA 2C2MA 1GCUA 3GV0A 3WAGA 4JJZA 3TW8B 4OLBA 1ZRMA 2YWFA 3COSA 2AUMA 2FI1A 2GAJA 3FIUA 2W6ZA 2JAHA 3ITDA 2Q9BA 3LXUX 1FSFA 2WMOB 3NBXX 4C7MA 3K0SA 4R68A 4HJXA 2DULA 3I04A 3UYLA 1C8VB 1OQAA 1JQBA 5E6UA 3RK1A 1Z33A 3G0OA 4L51A 4K7JA 1YZUA 1NLUA 2EARA 1L5GB 3ZQUA 3FRIA 1J5PA 4IL5A 4H0NA 4Z7QB 4DLRA 1JW9B 1E8DA 3LHFA 4PAQA 3T95A 1FSSA 1R37A 2OGZA 3IB3A 1QK3A 4MVJA 1ISJA 2BTQB 3P4XA 4QQNA 5EJAA 4ZT4A 2QX9A 4K88A 1YK0A 2CHFA 3IQWA 3G0CA 3IAXA 3KCQA 1U2RA 5B58T 3BB1A 4KAFA 4E31A 1BQEA 1OYVA 1G291 2F3PA 1CVLA 2AMFA 3B85A 1WB6A 3HZHA 1RI5A 3NBMA 3C3CA 3LO8A 4RF4A 1T3SA 4KITB 1ZISA 4C4SA 3N87A 1HKUA 5B53A 1OI7A 3FLEA 2BCJQ 1G5IA 3EVGA 1WNTA 3M9XA 4WD3A 2XJ4A 3PKJA 1T9CA 1UKYA 2P68A 3OZGA 5JRZA 2PTGA 3UHJA 1NPYA 3HB5X 3MJTA 1W8IA 1QBGA 4DY6A 1IHYA 5BWMA 1SHZA 1U0SY 4L3VA 4S1WA 2REQB 4H16A 4J1TA 3CX8A 1UBLS 4RVGA 4IWYA 4F86A 1RZVA 1F0YA 3H04A 2Y0BA 4WN3A 4IXDA 3IPCA 1PZNA 5TY0A 1NC3A 2FKNA 2L42A 2GESA 4EEZA 3LWNA 2NUAB 3HRKA 2VHZA 3CX3A 1WSWA 4ZCIA 1IEQA 3V9AA 1UEIA 4NG4A 3EVTA 1T8SA 1KBOA 3OOYA 2Q1WA 1X7DA 5M3BA 2VYQA 2O6LA 2Z2YA 4PLFA 1WKVA 1G17A 1P7PA 3QU7A 1YJCA 5SZIA 1AH2A 1Q7EA 2YZKA 4P6VF 1R8YA 1NQTA 1U1IA 4BTEA 3VSCA 1TI7A 3VYWA 3IEKA 1CP2A 3ISJA 1BWQA 2IA5A 3L7LA 3KYBA 5HNKA 2WIKA 1IHUA 2BGKA 3WLQA 2HPHA 3AIMA 3WFIA 1H8EA 2WJZB 1XJQA 4QM6A 2LDBA 3ZH9B 2W2TA 4QOIA 5E2IA 3ESBA 3HA7A 4C9BA 1U0GA 2JFPA 1CE8A 1P17A 1TVEA 4JJIA 4NZ9A 1O6GA 1UUFA 2NXJA 2W2OA 3DT9A 2D54A 2OPBA 4I4NA 1YU6A 2HNAA 2W2LD 1DQRA 2QF7A 3GGOA 5AI0A 4UTRA 3K1YA 3UHPA 4B46A 4I4TA 4MVCA 3H9GA 4RTMA 4P7BA 1NVTA 3TD9A 1FA9A 1P4AA 4OKSA 4X6XA 4DEVA 2JFGA 1JAIA 3OIYA 4IIJB 5KBYA 1Z83A 4EA8A 1TC1A 1ABFA 1I5RA 3K9CA 3ULKA 2GSWA 1QHEA 5BQPA 1C1YA 1PR3A 3M81A 2I7DA 4OV6B 2C7QA 1Y1TA 5HA5A 1FTGA 1Z36A 2QX4A 3SIXA 1JJFA 1UKVY 3V4FA 1AIPA 5CB4F 4C78A 4TKZA 2AFHB 3N2IA 5L3SA 2HIGA 2ZANA 3KFXA 4N9QA 3VU9A 5JYCA 2GCOA 3F4BA 2NU9A 5KNDH 4AB1A 1PR2A 4Y18A 1RIFA 4C0SA 4D7AA 1VJTA 2YHUA 2EFJA 1TB4A 3MFQA 2ORIA 3DT8A 1HYEA 1OAOA 1QIDA 5TX7A 1RYYA 4N5MA 2OCAA 4X1YA 4PRYA 2P9HA 5LIPA 1I6LA 1UOQA 1FU8A 3H4TA 4HB3A 3LG2A 5E7JA 1KE1A 4JVNA 1UBUS 3L0SA 4GG1A 3U7EB 1CS0B 1CR6A 1WMBA 1O1YA 2H5LA 1XO1A 3E2PA 4YT5A 5J59A 4LHZA 3UJPA 2X77A 2C04A 3ODPA 3QNMA 5CLFA 5ILOA 3ES9A 4NPAA 3AUTA 5HK8A 1E1CB 2MYTA 4U39A 3ZE2B 2RB4A 4MVYA 4RZ3A 1WM1A 3MMNA 1YJXA 3GDHA 4AF6A 1M2EA 1DXQA 1V47A 2EFCB 4FYIA 3TVDA 4BPRA 3PFFA 5THXA 4WZBB 2Q62A 5EXXA 1G6KA 4YRJA 3P4YA 3VYTB 4CLOA 5K0JA 3NMUF 1R88A 1U02A 3L8FA 4RNCA 1A98A 2Q5JA 3IHTA 2ZT8A 3RNOA 3DE4X 4FB4A 5BV2P 4KPYA 2PUCA 4OJTA 1OT3A 1QXSA 1LZKA 1K0UA 3D2LA 3WAKA 4QD3A 5LA6A 4AN0A 3PE3A 1QF7A 3A10A 5AI8A 3K53A 4R1QA 2QRNA 1O4VA 1HE1C 4LRSB 1PL0A 4OB8A 1T9ZA 5CDHA 2NTYC 3ESYA 3M34A 2XXAA 5JFOA 4KGZA 1X1DA 2WFLA 4DLSA 1LC3A 2QJWA 3ESRA 3G5TA 1YACA 4ZC8A 1FRNA 4E07A 4P36A 5EESA 3RLFA 5AUQA 3V1NA 3LW7A 4HAIA 3KL4A 5JU6A 3C43A 1N77A 3I9MA 2HA7A 3QUSA 3BJEA 4CQMB 2ZJ3A 2EFEB 1UBOS 1CB0A 1NLYA 3DHVA 1LVGA 2PX5A 2EZ9A 3MXTA 4J2TA 1AUVA 1BHO1 2WVHA 3DEJA 3IXLA 2ZE5A 1RNLA 1UDAA 2GN2A 3FMVA 1Y8AA 4MV1A 4WIAA 2IYSA 5DBEX 3USZA 2ZRBA 1Z4MA 4QTYA 4N41A 4PNEA 4OJNA 3TEFA 4RGBA 2D0PB 1J07A 1B16A 2YXEA 2Q5EA 1G6Q1 2XLCA 1QK4A 5HR5A 1FX0B 3OC6A 4IMPA 4MQ5A 2RG1A 3DL7A 3OZIA 1L5LA 5C1BA 2DFKB 3OZAA 5TF4A 2BT4A 1NY5A 1IQRA 1PR1A 1UIRA 3F4KA 3JSXA 3PL1A 5G4KB 4BP9A 4E2FA 1S3FA 1EI9A 5CU7A 3UV3A 4EK9A 4CXMA 1FK8A 5E4JA 2DQSA 4HR7A 2BKAA 5K8LA 4O25A 4Y2VA 1XI2A 3KS9A 4QDTA 2XA2A 4YNBA 4YRIA 1U5BB 4B7XA 4IIVA 3DM9B 3DE5X 1GGEA 3LHIA 5CH3A 1UBGA 3JWIA 3NBAA 1D2CA 3QW4B 2ZUTA 3BD8A 3BG5A 1S5PA 3CEAA 3KQNA 3SXJA 1WZUA 4HPWA 2EJBA 4YREA 2OZVA 4N3CA 2PLNA 3L8EA 2P9TA 4RVSA 4DEXA 1TMOA 1OFVA 2I03A 3QKIA 4LDJA 1II8A 4G86A 1GR1A 1UM9B 3PUKA 4FBMA 4DQLA 1IYZA 2I3GA 4TYQA 1G41A 1QU2A 1MBZA 5ICCA 1CYEA 2O5CA 2MYNA 1XKLA 2BFBA 2AG8A 4N3GA 4OU5A 4PQYA 2ZRQA 3ANLA 2OLKA 5GQSA 2IW3A 5LLSA 3WNDA 4MJLA 2MMGA 2YIJA 3E9RA 3X1DA 4GBGA 1U0JA 5COBA 1KP9A 2HRRA 2YV3A 4KIWA 5TVGA 1M10A 3RRBA 2ZM5A 3ZD9A 4JCCA 2D4AA 4TWBA 1NURA 5FI3A 3OE4A 3OIDA 3E81A 4ZO6A 3V8BA 4KIGA 4Q9LA 4IJUA 4DLZA 3TS1A 3CVJA 1RKXA 3ZN2A 3QV1A 1ISMA 4ZYTA 1B42A 1Z4JA 2AGVA 4NEGA 4XDYA 5A2GA 4EKDA 1KSJA 1PUJA 3IXMA 4BXOA 3QFHA 2CCKA 3NZEA 4I1IA 2FLVA 1O5OA 3D8NA 4Q3EA 4QYIA 3HJNA 1D2AA 4HGQA 4BO9A 1U2EA 5HF5A 1A9PA 1SBTA 2IOFK 3P0HA 4IDDA 3UJ6A 4ARBA 4BRUA 1U9CA 2P62A 4IQ8A 4JEHA 1GDHA 3OWOA 2GXAA 1T8RA 4LW8A 1X7YB 5DNWA 1WZNA 4MWZA 5GZ6A 3RVMA 1RRCA 3QKWA 4P82A 4IGKA 3AJEA 4BNHA 5K3DA 3KYIB 4KIUA 2ORWA 4KLRA 1M0WA 4JEIA 1CJTC 1V16A 1E9DA 1P5HA 4HDRA 1KERA 1E9VA 2A3RA 4ZQGA 5EGNA 2FW0A 4LOLA 2OCPA 2XYQA 2XTNA 4LXUA 4GOMD 2ZZKA 1LKZA 5TR9A 5JH7B 1DX9A 3RVNA 5EIEA 1K5DA 3HGTA 4Q3DA 1XZLA 2YICA 3IKLA 4MQEA 5HW0A 2F8SA 5AKKA 3KM0A 3KOXA 3AHHA 1N0UA 4JL6A 4EG5A 5LZ2A 1RRMA 2ODQA 1SUPA 4HVTA 4RHTA 2JD2A 5FI0B 5C7IO 2ENUA 3TLEA 1L0BA 4KZPA 2PD4A 1TXGA 3UK0A 1T2FA 3P2OA 2V96A 5BT9A 1JT9A 1ZI6A 2IYEA 2R2GA 5EJMA 4O4IF 3PEWA 1F12A 3Q72A 2WAOA 4LXYA 3EQ6A 1OHHD 4YMUA 1RRPA 4PLZA 4RZIA 3VGJA 1YBAA 1PJ8A 3WWYA 2GPTA 3D3EA 3FCSB 1KO4A 2PH5A 1MAHA 4OHPA 4N54A 2C2OA 3FR7A 3KHSA 1GCAA 3DNMA 2DHDA 2PZ8A 1G21B 2GBCA 3OX1A 2XMGA 2ZU0C 2JGFA 2NTEA 2W2QA 3SICE 4NZPA 3QVGA 5HKAA 2ZIFA 3OT4A 1Z4OA 3BB4A 3DJFA 3GD7A 4F2WA 3QA9A 3FZQA 3HCEA 3KSRA 5TMEA 3UWMA 3MMXA 2WWWA 2J09A 1FJ2A 3FTPA 3LKVA 1H2ZA 3OT5A 4HH0A 4OBEA 1G63A 5KYVA 3R3XA 4QYXA 4E1VA 4MDEA 2X9QA 4JWTA 1CV2A 5ALLA 4QE3A 1K6EA 2EJTA 2Q0SA 3EDOA 4ZREA 4A03A 2C8JA 4HGPA 3WGOA 1UFQA 4AKSA 4H7IA 4DLNA 4LXXA 4H0CA 3AYZB 3ZS9A 5CVUA 4LRWA 2PPLA 4G1UC 4OREX 4EJSB 4BVGA 1DSSG 3G8YA 2J6HA 4ES6A 3IOEA 5GONF 3DTVA 1E79A 3BRCA 4PZDA 1Z0SA 5H1YA 3RYTC 3ZU2A 5JEDA 1L7XA 3UUFA 3LTNC 2ZPUA 4YT2A 4KTTE 1UDXA 4ZAFA 3CEHA 2X4IA 3NAMA 5DLQC 4N5LA 1EFPB 5KCZA 2F8LA 4PG6A 1THMA 4JQYA 1BDMA 4F96A 2O4CA 5HTKA 5GJCA 1GZ4A 1Y34E 2Q6KA 5T3UA 2OAGA 1IXZA 1P7WA 4HC4A 4KIJA 1Y0BA 2DERA 3I5XA 2R6FA 4KQXA 4QT0A 2QXUA 3D0OA 4LC1A 3M89A 1ISGA 4C0KA 4DMLA 4EI7A 1JEOA 2BHNA 4IG9A 1WDLA 3BILA 3TTTA 1DU4A 2VJQA 2DAPA 2VHTA 3WYDA 1BWPA 1DUSA 3I09A 3QUTA 4F5EA 2V55B 3R0XA 2ZI5A 1P4JA 4GGPA 2HRZA 4OHFA 4PLTA 5DCLA 4MQLA 1K9SA 1YR3A 1E3LA 2YDXA 2G76A 2VP4A 1DUVG 5FI5A 4EQZA 1U1DA 4B71A 4J91A 5JI3E 1UAYA 2PMFA 4ZEXA 4G85A 2Y8EA 2J5KA 3C7AA 4EG7A 5CCEA 4KXQA 1WS6A 3V2IA 2OKGA 1TO2E 3H6KA 4JB3A 4OQXA 2G0AA 3TIGA 1QGOA 5DBGA 4LHXA 4UM7A 2MCFA 1J56A 2PXXA 1JNYA 3GRCA 3F47A 1HKHA 3EY9A 5T64A 4C29A 5BSGA 1EM8B 4JY7A 3RT9A 4C04A 2PWAA 4R8MA 3UOAB 1VSUA 1EUDA 2G8NA 3DVSX 2ZJ1A 1UMDB 3TSAA 5BW8A 1U4SA 4RQAA 1VMDA 4HXYA 1LLFA 4H08A 4F9EA 1LX7A 1KKLA 1ZXLA 4K6HA 4EF6A 5KJ6A 4MWDA 2P6PA 3LS2A 1WBJB 1ICEA 1M1NA 3C3XA 3EN0A 3OPYA 3R0JA 2HDHA 4HN9A 2EJVA 4EYGA 2J0QA 5CG2A 2ZVPX 1GXSB 3F0TA 3T6KA 4MVJF 3VISA 2VJNA 2ZAYA 4JJEA 4BB6A 3S81A 1FY2A 1ZS9A 3PNSA 4BO8A 1YRLA 3ZLJA 4BS9A 4N48A 4YV0A 2PA0A 3RM3A 5JE8A 1RI3A 1E92A 3G0DA 2JDIA 3FYSA 1YNOA 2HF2A 2I2BA 3EARA 5I7HA 2VYVD 4GKBA 3EVDA 4K2HA 1MOZA 1NZJA 2NT3A 5L3QB 2QORA 4IUBS 3ZQ4A 3C7CB 5CTAA 1RM4A 4E4YA 4TSKA 1QE3A 1NVVQ 3B2NA 3ZI7A 4BPBA 2WHPB 3DD5A 5LIRA 3T7JA 3TOXA 4FFLA 1GQOA 1S3GA 2RG7A 4F9FA 3LFHA 1KZ6A 4PG5A 2I67A 1H9CA 4J4BA 3VU1A 4BVJA 4B3IA 3DG9A 1HDGO 1LRLA 4LVCA 5D1NA 1ST2A 1U3VA 2Q9AA 1DRVA 3AEQA 3IT0A 2ZSBA 4NE7A 4MITA 1ZKMA 3PK0A 3ZJ5A 3H1AA 4OQEA 4QGFA 3THOA 1M8FA 4M46A 3I5MA 4QBKA 1RZUA 2XWQA 1T8YA 5ALFA 1IEWA 1JLMA 2FSHA 3UJCA 2J5XA 4P22A 5TPZD 2V03A 2HHHB 4Z0NA 3G5AA 1FPQA 1QJ4A 2I22A 1JHUA 2ODEA 1UC8A 1QDUA 2ZUWA 2GD1O 1FQJA 4X45A 3M5CA 4FD3A 3G6KA 4CHTA 3GUUA 5EXEA 3CLSD 3LGSA 3GNLA 5ICFA 5L4NA 3TLCA 2HO4A 3KE9A 4ML3A 1E69A 2H2GA 3KT8A 1IAQA 1UAAA 1P45A 1HX7A 1JQAA 1P7YA 1XQ1A 1AQIA 2XAUA 4P08A 4CTKA 5FBQB 2X23A 1IXRC 2BTQA 1V3VA 2BFMA 4OG2A 4RH0A 5AJVB 4DWWA 1UFKA 4E14A 2V7QA 3PJFA 3OCYA 1U8YA 1IFXA 1LY1A 1A97A 3V7NA 2J9ZB 1ONSA 3LMKA 5SYNA 5IF9A 4M1YA 4CU5A 4NQRA 3NBKA 5EMNA 3QLVC 3ZE1B 2WLSA 3GYBA 1U7XA 3VNSA 4EHBA 5TMBA 5HM8A 2IPOA 4I4TF 1DADA 4LRUA 5TARA 3VZCA 4G37A 3IUBA 3GN2A 2PNJA 3NJ4A 1NVAA 1ZN7A 3S1LA 5IDQA 4DLXA 5GJBA 4ZPXA 1W36C 3MTJA 3K0EA 2GWRA 3DEIA 3QEOA 3K9LA 3MGGA 2H1OA 3RRJA 5KKNB 3HACA 1BCSA 1WQ3A 4DR4B 1E1QD 3KR9A 4MV6A 3V8MA 4DG8A 4K9RA 1E0KA 1FU7A 3WB0A 3O8CA 3VKFA 3A8TA 5KAMA 2XGSA 3AKYA 1IMJA 1KHHA 1NBOA 3AX6A 4PPFA 1NRIA 1QYVA 2NAFA 3AYXB 4R9NA 3QI2A 3GRZA 3QUCA 4J16C 5EP2A 1FVOA 2AZTA 2QSUA 2WICA 3S2SA 3WY9A 2PKQP 4MAMA 1K89A 1N6RA 1C7ZA 1XQYA 1PJ3A 1HFWA 2ZQZA 2X76A 4XX0B 3ZX5A 2XV1A 4UE3S 4FW9A 5EEGA 5DYNA 5EFOA 1DKRA 3JY6A 4KX5A 5CJPA 2E0IA 2YXLA 3OA0A 3ND8A 5CDGA 4Q39A 5AKYA 2HPVA 4UCXA 4P83A 4B3MB 1UXJA 3DYIA 5K0CA 3N07A 1XNRB 1XZEA 3OX2A 4Q16A 4R0NA 1EUYA 3DUFA 1WF6A 2J30A