1S2LA

Purine 2'deoxyribosyltransferase native structure
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
167
structure length
165
Chain Sequence
MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFEIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
molecule keywords purine trans deoxyribosylase
total genus 49
structure length 165
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s2lA00
2F64A 1WEHA 3F5MA 4LJLA 3EHDA 2IZ7A 4I4IA 1S3FA 5AJTA 3O8OA 4KXNA 1S2IA 1WEKA 4A3SA 4P5EA 4FYKA 4OHBA 1S2LA 2F67A 4KXLA 2F62A 4JEMA 4KXMA 1S2GA 2A33A 1F8XA 1YDHA 3K2QA 4OHRA 2A0KA 3O8OB 3U39A 5AJUA 1S2DA 4LJRA 4P5DA 2PMBA 5ITSA 3SBXA 3UQZA 2Q4OA 1KZHA 4FYHA 4HX9A 4I36A 1PFKA 2IZ6A 2F48A 3GH1A 4MCJA 3MAJA 1F8YA 3OPYA 2PFKA 4PFKA 3O8NA 2F2TA 4I7EA 2IZ5A 2NX2A 4FYIA 2HIGA 1MTOA 1RCUA 3IMKA 1T35A 2KHZA 4JELA 4JENA 6PFKA 3BQ9A 3QUAA 4LJKA 4NPAA 2KLHA 4U1RA 3OPYB 3PFKA 2Q4DA 3O8LA 4MEJA 4WL0A 3HNOA 4RH3A 1ZXXA
chains in the Genus database with same CATH superfamily
2AKAB 1E61A 5FFFA 1W52X 2CJPA 3WO1A 1XVIA 4B4WA 1TT7A 2C57A 1DCTA 5IJ9A 1G6OA 3QMVA 3OE5A 1EWVA 3GNTA 1AQNA 2G70A 3T7RA 2ZB4A 1Z33A 2G9NA 1T9KA 4MVJD 4DWWA 3C3KA 3H86A 3L8ZA 4I4IA 5I48A 3LBIA 1TEHA 4TLMB 1KAGA 4NZNA 3LL4A 4CG3A 2WE7A 2DSTA 2C94A 1A8HA 1BNCA 2ZREA 2IZOA 4KFSA 1GTL1 2WJZB 3EVTA 5FI5A 2CE2X 3NANA 4KAFA 2B8EA 4BJ5A 3B70A 5J2UF 4FFNA 1Z13A 4KI0A 1BU8A 4IH1A 4MRRA 4F21A 2XWSA 2VXCA 4EPVA 2Z8XA 3X2EA 3T7DA 4IGFA 4RMIA 1YR9A 2VTBA 3VHQA 4HNAA 3H5RA 3AVUA 2OFWA 2GBIA 3IEXA 1G6KA 1IN6A 3OIFA 4KRGA 4MVJE 2ZRNA 2A2ZA 2XMBA 1XGKA 3HU3A 4GLJA 4R81A 4BMYA 4FI3F 4YCMA 3BHNA 1GYPA 5J59A 1RQNA 3HCBA 2DKFA 2X0NA 3SF8B 3WNBA 2G07A 2YCLA 3ED5A 1R0CA 4GMXA 1EP1B 1LLDA 1X14A 5EA2A 3V4PB 3PJEA 1Q12A 1U1CA 3Q1LA 1K2WA 8OHMA 2XQVA 2C7GA 2QMQA 2VR1A 3ZV3A 3OT4A 4B33A 2QU8A 1JHOA 1Y4AE 3BERA 3O90A 4KC0A 1K7YA 3IKLA 3MQ2A 4NNOA 4WQMA 1P45A 5BV1A 1GFZA 4NOJA 3UXMA 4NJEA 3F49S 3OC0A 4MUXA 2GSWA 3DGFC 2A5YB 2JASA 4PG6A 4XEUA 2R1VA 2VDRB 1ADCA 2VAVA 4H6PA 2XT6A 1K8ZB 4R2MA 4B6EA 4AJLA 1XJ0A 1KA9H 2VJQA 3K5PA 5DHPA 1NUTA 3MFYA 4LYFA 4OG2A 5BURA 5AJVB 2ZJ6A 4GOXA 2G1PA 1I2AA 1EEXB 2DHRA 3INNA 1E3WA 2VQSA 3K4HA 3FTCA 4H1UA 1NT2A 3PKZA 1H9AA 1KEVA 4OGFA 5IAOA 2H48A 2DETA 1C2TA 1IOZA 1L4MA 1H0SA 1LBEA 5D5PA 1DC6A 2IE8A 1TPZA 4IRMA 4R8MA 5I5EA 3DEKA 4O29A 5HKLA 3QEMA 2DJIA 5DHTA 3WRWA 4BOYA 4EUKA 2C2KA 5LYYA 5BMVA 2QJOA 2QLMA 5CEFA 5HEKA 4JC0A 2Z5FA 1QQ5A 2QN7A 4NEHB 1IY0A 1E7WA 1E5TA 5FOQA 3O6VA 4N65A 4QRDA 4XUEA 1KMHA 4YRDA 3NBKA 4DEXA 1S4QA 1RAGA 3F3MA 3PUXA 4QUDA 3ICCA 4U7FA 4HVCA 4FYWA 5BV2P 2BFBB 3WP1B 2HIGA 5L3VA 2X2OA 4LV6A 4FKBA 4K3VA 5JCXA 2NUAA 3DEJA 3G2OA 3TLBA 3UHFA 1USIA 1RT9A 1KAOA 3TZLA 4B79A 1ZU4A 3A1DA 1W93A 3JQFC 5HQ3A 3O2JA 2VJBA 2QJFA 5LZ2A 4OUDA 5EESA 4HLUC 4J2TA 3E58A 2ECPA 3OCWA 2AK3A 2XXBA 3DKRA 3K1AA 1J06A 1E89A 2Q9UA 4D96A 5CDUA 5LXTB 2JJYA 2VZLA 3B1ZA 4GX0A 1P7ZA 1ZA2A 5HW0A 3PIRA 6REQA 4MDYA 2YZNA 3NNSA 1II0A 5A62A 3UGTA 1MO2A 1T0IA 1JAHA 3ZQJA 1KO1A 2IEGA 2H51A 4LY6A 3RUPA 5GJVC 1PL7A 3NAZA 3ER9A 2AZXA 4GKVA 3ONDA 4TWIA 4EG4A 1EFDN 1M10A 1ZBDA 3B2EA 3E84A 3EIUA 2JGNA 3KXIA 5BUZA 3LZDA 1EGQA 3MYYA 1OXMA 3QI2A 4PS1A 1SQFA 2P6MA 2WSYB 4NKRA 4Z9AA 4DA9A 3M6XA 3BM5A 5IBPA 1YIAA 1Y7TA 1MFPA 3OZBA 2IH2A 1XTSA 1WBJB 3U81A 4FR5A 5CBPA 4DJEC 3AVWA 4Y1FA 1B73A 2BMWA 5F98A 4HXGA 4ND1A 4TWAA 5HIIA 1G7CA 3JASB 5JVDF 1QUEA 1QZXA 1YCGA 5ALIA 2JLRA 3RTGA 4FD2A 2NTEA 3WA6A 3KZXA 5KOHB 5HMLA 2IYQA 1MOQA 1PWXA 2FMIA 4RUKA 3W6UA 2NPIA 1Q7BA 3RASA 2IXDA 1B0ZA 2EJTA 1ZIXA 2GHRA 4JI5B 2CLKB 3WGTA 3M6FA 2AXQA 4H3HB 1YKGA 3G9QA 1P6UA 2XTZA 5EWMA 4Z3OA 5J5VA 4CR7A 1O6CA 2QU7A 2CNWD 1F17A 3C4QA 3N39C 2WLTA 3DUFA 4MUAA 4YJDA 2PGDA 2XUZA 3I8XA 3QY9A 3D6MA 4OX9B 3DTNA 1JS1X 2WD7A 3Q15C 4WOPA 5FQNA 3HSKA 4TQUS 3RT9A 1WIWA 4KBYA 1YL6A 2FP4B 2W37A 2VBIA 2AK2A 5GVSA 1E59A 1NU8A 3VO2A 1BCRB 1DRJA 4KR0A 2BWJA 2Q4RA 4YBRA 1Z68A 2HUNA 2E5WA 1PJ8A 1JHQA 4RHXA 4A23A 1KYQA 4I9GA 3W7BA 4WUVA 1KZHA 1JQJC 1UJNA 1WW2A 4WCFA 3BOSA 3NWJA 3PG5A 2IYYA 2NO1A 5FJJA 3U0BA 1H5QA 1NG1A 4O2LA 3VOBA 5IM4F 3T34A 3OG9A 1JNXX 1WU7A 5ADWA 3V7UA 5D3MB 4QUBA 4EJSA 4LMPA 2F3PA 1AKEA 1O94D 3U16A 4EHAA 2Q46A 3GJTA 3ET4A 3SSOA 4BVKA 1U8YA 2D00A 4EATA 3BHMA 3UV3A 2ERXA 3FWZA 4QG7A 1NW7A 3NP9A 3T9CA 2RBEA 2X6TA 4LFBB 2QE7A 4N47A 3OQNA 5JMWA 3EIWA 1UH5A 4P83A 2UXCB 2VKTA 1C30B 1NQXA 2PZLA 4EJMA 3GLVA 5LC1A 1M0EA 4WD3A 4O33A 3RUAA 4YRAA 2QMOA 4FQ5A 4IILA 4U7GA 2Q7DA 3UW1A 3ZHVA 4KR7A 5K05A 1XMXA 1HC7A 3L7YA 1ULBA 2I2FA 4DDHA 3V5NA 4F5DA 1JZQA 3E9NA 3EYAA 4BZPA 1YL7A 5CVEA 5FXMA 1ZCFA 1GTJ1 2HL6A 2O7VA 2WTMA 5ULLA 1DBIA 3KRTA 2PH3A 1RKXA 3RC7A 3WK8A 3H17A 1TNDA 2XF8A 1GDHA 1QIDA 5MHTA 1NPDA 2IUTA 3I72A 5KC8A 3O47A 1X9IA 3NG1A 1SKUA 1SM4A 2JGMA 4HUJA 4N4AA 4UNSA 1CDDA 1M2EA 8MHTA 2AFHB 4L75A 4YRSA 3TLGB 5KTNA 4JBHA 3ODGA 3RUIA 5MN5A 1W6UA 3ROPA 1BEUB 2HO4A 4BRSA 3PR3A 3PYXA 4AF8A 3GFTA 1FS5A 2P30A 2RG7A 4JY7A 1H85A 2GTHA 1MB0A 2GZ2A 3H5IA 4GC9A 4EW3A 4QDKA 1X87A 3WQRA 2H16A 3OZVA 3VC2A 1I4EB 1Q19A 4K9KA 3CX4A 3N5CA 4EDHA 1T1EA 4EKGA 4P0PB 5AVTA 1Z0AA 1NJSA 1O0SA 1CUHA 1FY2A 1R37A 1U7WA 1VRCA 2CJXA 2CLHB 2Z95A 1X9HA 3IMCA 4JBLA 4RFVA 4B6OA 1YV9A 4IFTA 2HU5A 3FZEA 4I3GA 3EB9A 4XJVA 2GAOA 2I2CA 4HDMB 3TD6A 3W9YA 4ZWNA 3G2LA 2BF4A 4JEHA 5TQ2B 2ZUTA 3GVCA 1BFKA 3QKRA 4ZN6A 3W6OA 1WZCA 2B3TA 3KQOA 3QFFA 3L07A 4GYWA 5IJXA 5A4AA 3S0JA 4C2UA 1G7TA 1E7MA 3ZJ4A 5JWOA 5CPBA 4WADA 3AM4A 3BGIA 4HGQA 2WF5A 1XLTC 3OJ0A 1BHSA 3OZIA 4O2AF 5DJ5A 1MB9A 2ATXA 2VTKA 4GI7A 1K5PA 4CT5A 1NQTA 4WLFA 1V9CA 2P6NA 3PUKA 2WJ4A 3UAVA 5JD6A 2WTBA 4ZYUA 3O4VA 5C7LO 2C4NA 2DPLA 2CDAA 3ZWCA 5B55A 1TU4A 4DABA 2KE5A 1XCLA 3VVBA 2YUIA 4GP6A 1H8ED 1JXAA 2X8BA 3NBZC 3Q2OA 3TSAA 1PTKA 1Q91A 4H59A 3VPDA 2O3RA 4N5NA 2O05A 4B6RA 2AOUB 1N1GA 1W5FA 1WDKA 1OROA 2G08A 2HUPA 3EVDA 2H7YA 4IUBS 2QPTA 2OAGA 1ORWA 1W2WB 2A0FA 1OAAA 1MEJA 4Y6GB 1E2IA 4BNHA 3EBPA 3OQHA 2H4JA 1ULUA 3UMRA 4BNIA 3VV2A 2QLNA 3CYFA 3DLTA 3G7NA 3IDOA 3KQYA 3LCUA 2DPXA 3PWKA 4OQMA 1QE5A 3GUYA 2FW6A 4Y6SA 4B3CA 2FZVA 1ODSA 2ZYSA 3F8WA 1U5CA 1MF7A 1XD8A 3NW9A 1KH2A 2NVUB 3K70B 5KYKA 4JI6B 3RHSA 1GUBA 4Z54A 1UBFA 1LF5A 5JO9A 3I5UA 4ZI7B 4GBGA 2QZ4A 4BKOA 3TECE 4Y2RA 2VUUA 2IWHA 1NAHA 2FWIA 4I7EA 2P2LA 3N8KA 1ZMOA 3HVKA 3RT7A 5KJ1A 3OA2A 4KLCA 3KEQA 4CLEA 1ZP6A 5DP2A 4MUKA 4HNVA 5FHRA 2H92A 3LMKA 4GX1A 5ILGA 3TLJA 2IPAB 1V25A 4W4TA 1T9CA 4BCDA 3PNVA 3RV4A 5JXWA 1XPOA 3GHYA 2O7RA 3AIMA 1NJFA 4Q34A 4GI2A 2XCRB 2PRJA 2ZK7A 4Y9RA 1QG4A 1GPKA 3EJ6A 3MMNA 4OQZA 3OOSA 2Q8PA 3REQB 5K8UA 5F7JA 5C8YA 4PZLA 3AOGA 3OEHA 3NLLA 5TGDA 3AR6A 1Y89A 1V41E 1UPBA 2VJDA 1EHCA 1P0IA 4B31A 4EPWA 2FWJA 2PXAA 3PNBA 5TMBA 4PCUA 3MB8A 3MJDA 2PA3A 3FDXA 1AN0A 3L79A 1BE1A 3KSAC 3JQBC 2QTFA 4LAFA 3BE6A 1U8XX 5B4UA 3F5SA 4IIXA 3WLQA 1REQA 2FOIA 1P7PA 1XTKA 2QIPA 1K7EB 3JQ9C 4IWNA 4X1OA 3HP4A 4KIJA 2X4IA 3CW9A 5BN4B 5L3QA 1SKBA 3ITKA 1K75A 3FPCA 4KRYA 5I7FA 1CBUA 2ZSEA 2QY6A 2GNPA 1X77A 2DWPA 2PU7A 3AJEA 1L4BA 4EHNA 4EJ6A 3AYZB 4XJSA 1ZRSA 1W25A 4UTRA 1QYRA 5CB6A 2HFKA 1VG1A 4K0KB 1R9NA 2H2WA 1KC1A 1NBIA 3ZLTA 4BRWA 1R5OA 3L8MA 3W1WA 1GZ7A 5FEMA 3FTFA 1JQKA 1M1YA 1OLXB 2JC3A 3CKMA 5JXIA 1PYGA 3LU1A 4MMZB 4RVSA 1ZS9A 5I9LA 2GEBA 2HR1A 5KTOA 1PQYA 3NTRA 3QBVA 1DARA 4UBKA 3V9AA 2FTKE 2G71A 3ZXYA 4U7TB 2IHKA 3CHYA 4UNIA 1M0TA 1S2LA 3C85A 1XJQA 2AZTA 2EHDA 1KEEA 2VPXA 1CF2O 3FUTA 1LSJA 3SX4A 3EC2A 1PJSA 4H4EA 4JEMA 5FTNA 3EVEA 4F1WA 4B6PA 5AJZA 4M87A 5A1JA 4BQFA 4EIWA 4RVNA 1GU0A 4AJNA 3BFPA 1DKNA 2X4LA 2PKYX 1GUZA 5CB8A 4OREX 3VR4D 3JR3A 1KQOA 1RLTA 2VUHB 5DCUA 5HVNA 4LC0A 2KX7A 1SPXA 4FYJA 2I9KA 3ICOA 4V2UA 4U39A 2GESA 4B2LA 2O6HA 1PX0A 2ZSJA 3MTQA 2VJNA 3ZHYA 2FRDC 2GI4A 3B3JA 2IVZA 5E7QA 1DWUA 2A0UA 3A6LA 3LO8A 4IDHA 4EKYA 4AN4A 4KVZA 5B5SA 1XMQB 2NSLA 2BJHA 4QG3A 2MJLA 5JMOA 1NLUA 3GEEA 5KQMA 4TTRA 3PGKA 3PGMA 4DN6A 4X7BA 2Q49A 3TFQA 2G5TA 1N2EA 1WVIA 3KSZO 4HGPA 2FW1A 3QMWA 1RJEA 1KDZA 2YUTA 4TTTS 2IV3A 3TLKA 3ZXUB 3UGKA 2GSDA 1QFJA 1R8SA 4I66A 1KYVA 4URFA 3SS9X 2X2PA 5T4BA 2HSWA 1FRFS 2UZ1A 5TR9A 1TEZA 1U8AA 3D3QA 4EK9A 1VPTA 1RRGA 2NZXA 5CG2A 3AINA 4W5NA 4EI7A 4A0SA 4DV6B 3MJFA 4AZ0B 2ZVJA 2ASVA 5J1SB 3RDPA 5DMXA 5I9SA 4A27A 2QUHA 2CD7A 2GBCA 1T43A 1XP5A 1EDEA 3KU4A 5J47A 5DHSA 4J6FA 3WLTA 5IJ9B 1M34A 3H1GA 4MEBA 4PEVA 3I12A 2H1IA 2XA2A 2Q5HA 3VHRA 1R6XA 3AB8A 1VBNA 3NGXA 3P27A 4EF4A 5AW3A 5KB3A 1RYYA 1ZJJA 1RYMA 1HZJA 1HXHA 3C4VA 4J4BA 3T3NA 1M6YA 2QAGC 4P31A 3RJ9A 2G25A 1IWBB 3F1KA 3BULA 5JEEA 4DB2A 1XTZA 4RH0A 2HTFA 4NJOA 4GPBA 3QP9A 3C6QA 1NX9A 2OHVA 2YY7A 4US2R 2CJYA 2PMDA 4KLAA 1NVAA 3I2HA 3RGWS 3FF1A 4I46A 5EVCA 1M1NB 4I5IA 4AZVA 5LLTA 1KJZA 4FOSA 4XQGA 1F6WA 3ZN2A 1XQYA 1O1YA 4AJHA 5HUHA 2YZGA 3DTYA 4CUKA 4LY3A 1C1XA 1LY1A 2C2BA 3DDUA 4CMEA 3U4QB 2Z3WA 4KXFB 3RVRA 1VJ0A 7AT1A 1OU0A 1QHNA 3LQ1A 1RFGE 4KVAA 3UJPA 4BJHB 4D4IA 1FYXA 1XMVA 1MEEA 2R6DA 2XYHA 1NULA 3CGWA 3G6KA 4CIBA 4BB6A 2AI3A 2B21A 1T9HA 4QICA 2J5BA 1U0FA 4RFSA 3KQKA 3HLTA 4KDCA 4PC1A 1RAHA 4HAVA 2CHUA 1U6IA 4K86A 1ZJ5A 4PGMA 5E4JA 5KDLA 1DQYA 3AZOA 4Y2GA 5GGXA 1P74A 3T5CA 4M7RA 3F90A 4LA4A 4PC6A 3BTVA 1YF3A 3RU3A 4MKZA 2IH4A 3DOIA 3TAUA 2R6HA 1F12A 1DIOB 1YFKA 2BFCB 3SYNA 1RIFA 1EWRA 2W2TA 3LKDA 3PI6A 4KITB 1M83A 5JT1A 2V3VA 1MA3A 3WQBA 4C0KA 4AJ2A 3OCJA 4UAUA 5BMVB 4AUMA 1SUWA 1G20A 2ZTHA 3K9GA 4DMFA 2ZYWX 1KI7A 3BMOA 3HU5A 1WQ1R 3ROFA 1BGVA 2OBLA 2ENWA 1MA0A 1YA4A 4NU8X 5C7YA 621PA 3GLIE 2JLXA 1KHTA 1SH7A 2AOXA 1E8NA 2EOAA 2IXAA 2I4MA 2EJCA 2CFOA 2P3LA 3COPA 3GF4A 3A1NA 3NHWA 1E1MA 2DQSA 2C58A 1S3IA 5ITZA 2F4VB 4GICA 1AC5A 3CXRA 1IZ8A 1AF7A 3VNAA 2J5RA 2VWHA 1G2QA 3IXMA 1NYQA 4ZGGA 2VDKB 5LVAA 1G8SA 1NG9A 1GADO 1LTHR 3W5JA 4HVAA 4F1JA 1F8FA 2OHJA 4B3FX 4OPMA 3IEPA 3IVGA 3KE8A 1YQUA 3E6AA 5LOVF 1IOVA 4WV3A 2OENG 3ODPA 4JJ6A 3GBVA 4LBYA 4RANA 5BUSA 1WMDA 3JAMA 3T1YB 1T1SA 2VS1A 3K9CA 3N2KA 3NEAA 1DBQA 2AJ8A 2CL0X 4GFDA 2PUJA 3KTOA 4PLZA 4U02A 2C4VA 1IY8A 5B1IA 3RBXA 4LHZA 1XL1A 2LIPA 2NXCA 2VTVA 2BKXA 2GPTA 3KQMA 3ONNA 5DDIP 7REQA 1M74A 1CUDA 3C74A 1SRQA 4GDMA 4CLOB 1TPYA 3SJCA 4CV0A 3Q8MA 1CUYA 2RAUA 1NMEA 2BHTA 4V0RA 3DWEX 3ZIAA 5B2ZA 3PFNA 3W2GA 4LFAB 1B0AA 1Z07A 4M76B 5K5EA 4BLVA 3KDAA 2L18A 1RXUA 5CHEA 3RJTA 1FQJA 3O94A 2B5VA 5A9SA 3L1UA 3QFTA 4HWOA 2WWYA 1GLVA 3M1LA 1KI6A 2OHIA 3OLZA 4FGSA 4A0QA 3LUBA 4CETA 4G0WA 3URKA 1K92A 1R6TA 2WIGA 3KUKA 4YN3A 3WRYA 4BNGA 1FXUA 4MNTA 1B76A 1J56A 5TDHA 1M1ZA 1P3DA 3IMFA 1F7VA 4B3TB 3QLEA 2GK4A 2H6EA 4I1RA 4MI1A 3I05A 4G1UC 5ANRB 3W1EA 2YY6A 3FMFA 1JAYA 1M2KA 3LWZA 3WXMA 1KSFX 4II3A 1BZYA 1NRIA 4W99A 3RODA 4G4GA 4PLWA 1BVYF 1F51E 2CK3D 1JHDA 2W7TA 1CNEA 2CYCA 3O8QB 5T6MA 2XUKA 1SPBS 1ZMBA 1K8XB 1PRYA 3NTXA 1PS9A 4AD8A 2F3TA 4R0VA 3X2FA 1PT5A 1ZJYA 4IIJB 3D6NB 2BSQA 1IK6A 4ZU1X 5ERYA 1LZLA 1C9YA 1M6EX 4GX5A 2WKRA 3S8MA 3CE9A 2PG3A 5B6JA 2R8ZA 4WY8A 3IA2A 3JALB 1GA4A 1CUVA 3DEAA 2M98A 3R75A 4A2PA 1NE2A 3UMVA 2C7BA 4PPGA 3IQEA 3C48A 4U3JA 5FPPA 3V4VB 1GILA 1VYHA 3TVDA 1FNBA 4PZUA 3USCS 2IS1A 2W8ZA 1YQXA 5LPNA 4WXPA 1JIIA 4NABA 3K4QA 3QIAA 4ZP1A 3VU3A 1JSXA 4LHYA 2RGRA 1G4HA 1ACLA 4RQBA 3PPVA 2RGWA 3BQMB 3EMDA 4G2TA 4D4MA 2W6ZA 2WNHA 1TQ4A 5E6UB 5CDYA 2XF2A 2IJGX 5HP4A 4DCSA 1N4AA 1X8JA 1NI4B 4B45A 1WHSB 3NXSA 1L7AA 1O2DA 4U5XA 1QE3A 2HRRA 2GD6A 3AB7A 1N5JA 2H4XA 4UEJA 2I7XA 1SR8A 4RNDB 5KIAA 4HWKA 3K53A 2VHJA 2HNKA 2Z5GA 3B7PA 5I9TA 4EA9A 1X15A 1LD3A 3FR8A 4FYHA 4LUCA 3I34X 2UXDB 2Q1SA 1E4YA 5EQFA 1E2MA 1HETA 4YRNA 2I54A 5U4QA 3GV0A 3SQXA 1P2DA 2B1JA 2YV5A 3EVZA 4GUAA 3SR4A 1PJQA 2QRPA 3FJOA 2QI9C 3QEJA 1T5OA 2N46A 3KT0A 4WGGA 3V7NA 2P5SA 1XRMA 3MS7A 4OBBA 2EIHA 2JL1A 2ODQA 1EB8A 4G36A 4UVGA 3RF7A 1CY8A 4Z51A 5A5FA 2TMKA 4MJ7A 4ZEVA 4QDUA 2W2MA 1QH8B 2X0EA 2QVXX 4TTIA 3IVAA 3FSRA 1RXYA 4CLRA 5JR3A 3R9WA 4IG9A 4HJXA 1N4DA 1IHXA 4N0EA 2FNAA 4JYMA 4B1FA 2HLDA 2RB4A 1DPFA 3K9QO 4ZQEA 1BJRE 3GFRA 2R7NA 3K9FC 2GJKA 1FLNA 3VX3A 2WJ3A 1ZI6A 1CUAA 2B94A 1GZ5A 4K1LA 1EXDA 2DBRA 3A6HA 4RFLA 3PTLA 1ECBA 1PFWA 3EA4A 3GJSA 3P0JA 1D4AA 4FW8A 3WGHA 3WZ2A 1U7UA 4XZ3A 1M6VB 2HMWA 2IEIA 2VKQA 3TIXB 3MM4A 3LXRA 3AIIA 3VPCA 2PJRA 4JBYA 4MLZA 4IV8A 3DR5A 1P3JA 1E1QA 3Q85A 1KFCB 4H2DA 2WJAA 1ABFA 1PWYE 3R20A 4YX9A 3AH8A 3AEKA 3JZMA 1EUZA 3WWEA 5KREA 2YRFA 2YVQA 3JVDA 3CH4B 4DYVA 3DZKA 3TS1A 4F92B 3WGJA 4LNAA 5FTKA 3QVGA 2NU9B 2JLZA 4N41A 4RORA 4JJEA 1KI1A 1GDDA 1SD5A 4BN0A 3ZGYA 2BEWA 2MIIA 2YQ4A 1ZWLA 3TQOA 4ARVA 2KYRA 1FUKA 2X8WA 4E5MA 1KS9A 2QAIA 1R3DA 1LJUA 1UC8A 1XK6A 3KOOA 4MW9A 2C8LA 3JQ6A 1PD0A 1Y48E 4QLAA 3WIEA 4ENWA 2HADA 1H22A 4EL0A 1QE0A 2BFMA 2H4FA 2G88A 2EFEB 3GDFA 4HZUA 5EFZA 5JS2A 4HR7A 4KK4A 3RS3A 1XVTA 5EHIA 5B1HA 1E3TA 3IULA 2C95A 1RRKA 3G5UA 4QEZA 4YALA 4ZQCB 5SZJA 4KQCA 1DMSA 1AXRA 4R2WA 1KNQA 3SC6A 1ZESA 4UAJA 1PDVA 2BFOA 1TXGA 2QZSA 1W46A 3DP9A 5FORA 4A10A 5AH0A 4CODB 4WOJA 1Y34E 4GMDA 4JXJA 1L5MA 3OICA 4JI4B 1A9RA 4J43A 4FDMA 3PFGA 2YMLA 1UBHS 1GUFA 1X39A 4OQ4A 5IW8A 1IWPB 1GGEA 1KPHA 1Y98A 4M0PA 4F97A 4YMHA 4BNWA 5JCOA 4DTIA 5SZIA 1IL0A 4EUEA 1U9CA 5HFAA 4FFBA 1ZY2A 3K4PA 4BFCA 4D4KA 3P9QA 5A3JA 2XUAA 5B6PA 3QWFA 4Q3BA 4XUGB 2Q3CA 2VK4A 2IHVA 5SZHB 1GCAA 3KU1A 3B6MA 3K9NA 3DZFA 4R2LA 1NMXA 2JF0A 2PSJA 4ZI7A 3BX1A 3IVCA 1GD1O 2ZRIA 4IBOA 4HADA 1NY5A 2XW6A 4REOA 4P5DA 2XD4A 3N2LA 3DOCA 4V02A 1TAUA 1WNTA 5F3RA 3HDVA 3OIUA 2ZIXB 3WICA 5K99A 4ZOLB 5DNCA 1E6WA 4LYGA 1P44A 5C53B 2DLDA 4D80A 1FSZA 4XJXA 1EFCA 5K0CA 5J2UA 1K4KA 3NMUF 3QOYA 2BKAA 4ZVQA 4C5AA 5ALJA 4DVGA 5FOXA 4IXMA 2A58A 2EC5A 2WUEA 2YL2A 4CIXA 3JATB 1D2AA 3JRXA 3NGLA 1IZYA 1F1BA 3LOUA 6YASA 5CYOA 3T0IA 1T5DX 4EYOA 3GJZA 2D5AA 3BWCA 2VWPA 2WC1A 1QRAA 2F17A 3IEIA 3EW9A 1EK0A 4E5KA 4EHFA 3OZFA 2QRJA 2J9RA 4KSBA 1CQXA 4US0R 1GGFA 4UW9A 1RM0A 4QFMA 3OY2A 4CEHB 1GNSA 3ZY5A 1U1EA 3NOOA 4IIUA 4ZHQF 3LBNA 4O1IA 3O21A 2ZQYA 3G79A 4FT4A 2FW0A 3A4LA 1XWIA 4R9SA 1ABEA 2VYFA 5JS7A 1Z6QA 3PSAA 4X60A 5TARA 3WIVA 2LP4Y 3TG2A 5IT9A 2QTCA 1V37A 2PFGA 1V4VA 2H06A 1R2QA 3EZNA 3L7MA 3UG6A 2QM7A 3OMWA 4YCBA 4BPRA 4Q1CA 1D2CA 1CZKA 1I3OA 3A36A 4S35A 4MUEA 1A7JA 4F4UA 4L5JA 5C81A 2X9GA 1E0SA 4U00A 2VEDA 2RGUA 1C7IA 2JCGA 4LTMA 2IEDA 4X65B 2GF0A 4CDRA 1KZGB 1NQAO 2EEZA 4TWZA 3TBKA 4KXUA 4FEEA 4B81A 1VIAA 3GZ4A 1RJFA 1LUAA 3U17A 2WFZA 3BQNB 1CDOA 1ADJA 2FPLA 4QQFA 1BQEA 5AK4A 5BORA 5L7TA 2GVZC 4X1KA 3VBEA 3H1FA 4F6RB 1Z2CA 2OB1A 2WINI 3A4IA 2QTLA 4BMSA 2HNAA 4KQHA 2I3BA 3ZU2A 1KL7A 2QUZA 1L2TA 2XB6A 3NHAA 5FKJA 1W5SA 4AMZA 1WB4A 2VP5A 4IXWA 3JSXA 4YGYA 5K09A 5KSOA 3ZWPA 3R3UA 2ZRFA 3TL6A 5HZKA 2ZI9A 1QKIA 3U4MA 2JFOA 2Y1KA 3WDMA 5IVHA 4NFHA 2HY7A 2UZIR 3PI7A 2FG6C 2D1TA 2QT9A 2RHWA 4OQNA 1DQZA 3B1WA 4D3SA 1KY5A 2YZKA 4IHJB 4O5OA 3OF3A 3ZIAD 4HAZA 4RXUA 2SKCA 1WJGA 1LFDB 4M0UA 1S96A 1BMFD 1CDZA 3ITNA 2C54A 2O5VA 3PE4A 4D43A 1ZM2A 3KEGA 5DISB 2QHXA 1Z7YA 3AMVA 4P5EA 3S5UA 5JH7B 3DTVD 3U7HB 1ZCBA 3OD5A 4BJ3A 4PGHA 5EKXA 1BRMA 5K0SA 2BOVA 5TQJA 2E87A 4BCBA 5K0TA 5AOAA 2ZZNA 2HDWA 4NCNA 2J0UA 3EXFA 3G2IA 2Q6VA 1BEZA 1FLVA 4C4PA 3C24A 3LQFA 2PS0A 2RGAA 2Z8YM 3IMEA 4GKBA 2ZBQA 5TXGA 5DVZA 2AG6A 1A27A 1DUSA 1ENOA 1DRUA 1ZRNA 2J09A 1ETHA 4OP3A 4YYZA 4RTQA 3X1JA 4LF5B 3A4VA 1DG9A 3GLHA 2B30A 3PWTA 2Y0BA 1ZEJA 1RJWA 2XMPA 2ZT7A 3CLSD 3ZEIA 2D1RA 3A7EA 2XKKA 2O8EB 2W00A 2BEUB 2RHDA 4QYIB 3DE6X 3B1KA 2ZXEA 4DF3A 1Y8QB 1ZK1A 2Z4RA 3ESZA 4MW5A 4CE6A 1QANA 4IUYA 3DWGA 4XASA 1H3EA 4KSCA 4JJZA 4XQEA 5BNZA 1LF0A 3ESYA 4DM7A 1M7GA 4ND5A 1L7RA 4M1MA 1CJUC 2WG1A 3H8SA 1WW3A 4JCCA 2XKJE 4Q93A 1WCXA 4N8DA 2DH6A 5BR4A 2CCJA 1M2HA 3ZVNA 1Y9DA 3H5OA 3U3MA 1V35A 1U4OA 2OFXA 2OOSA 1OH5A 1U6JA 4C2BA 4EYKA 2B1QA 2PX5A 5FPHA 5HX7A 2XWPA 4TZTA 4H16A 3U7QB 2WOJA 3GFQA 1Y0BA 1ACMA 4C7BA 1R0ZA 3AHEA 4GWLA 1XZNA 5IZ4A 1ZOLA 1MRNA 1KZ1A 1R66A 2R5WA 3FYSA 2CNBA 1NDQA 2JFQA 1YE3A 1P29A 3EYWA 3PHJA 4HH1A 1CVRA 2BLLA 1MHPA 1GZHB 3BGVA 3A1SA 2GHIA 3NIWA 1PS8A 4I9FA 1JN0A 4JAVC 4LSWA 4Q1FA 1L5OA 1XD9A 5EJEA 3GLGA 3CA8A 2J85A 3ANYB 3AXTA 3WYGA 2QPOA 2GBLC 4TWJA 1H6BA 5HJ7A 3B48A 3U9LA 3WOVA 4HDCA 3EDQA 5KWIA 4NCIA 3MUEA 3QU2A 4NLLA 4RHEA 4AZTA 1MZPA 2F9FA 1GKUB 3H2IA 4QDZA 5LNK6 4JB2A 3BEDA 4BCCA 4C21A 1TUBB 1SB8A 4GM1A 1E2QA 3PEEA 5KSPA 2QRVA 3TAHA 2EVWX 1XZDA 1CEXA 2NVUA 2O8VA 1PNQA 1V1RA 2XNKA 2I9PA 2IS2A 1CNFA 4HXFB 4GVXA 4TSRA 3VVMA 1N6HA 4U2BA 2HJGA 3ULKA 4EY7A 3W4IA 3JRNA 1J99A 4IFBA 4HAUA 3EUFA 1MJNA 4KBFA 2Q9CA 2ZANA 1BROA 4GZ5A 3PEYA 3O3CA 1GLGA 2YHSA 3SDBA 3CE6A 3QYPA 5KJ6A 1WZIA 1SRRA 1C29B 1L5RA 2WDZA 2HPHA 2W2LA 3KQVA 1VZ2A 5CM2Z 1JHRA 1NI3A 4EQ6B 3P26A 2R4QA 3NDPA 2MSEB 2SICE 1FTSA 3EC7A 1M2NA 5CT6A 3K9LA 2I6QA 3TK1A 3ZW8A 3THSA 4CMKA 1TYBE 3EVBA 4OXQA 4JWKA 1H2BA 4IV5A 1RR6A 2CLEB 4LJYA 4YDSA 4DV1B 2DBYA 3CKLA 2AXNA 3MGGA 4K8RB 3DE2X 5HIMA 4DLKA 3FRIA 5A02A 1RWKA 2BFWA 3GROA 1OFTA 4NC9A 2EQBA 4HZGA 3KO8A 1DXYA 3CMMA 1EFUA 3DMDA 5CT5A 2E6UX 5K3CA 3EWIA 4MYCA 5EMHA 4CMEC 1G0NA 1Z88A 3ABIA 1C5KA 5JZMA 4JROA 1EP3B 3KUCA 4BQSA 4KGZA 1Z73A 1JH9A 3K2BA 1P9WA 4M1WA 5FLYA 3BIJA 2ZM5A 4HUQB 4RD1A 2Y76A 1PQWA 1F60A 4ARAA 3KVNA 1FUUA 5BN4A 2VPPA 2WJIA 4O4IA 1G5HA 1U6KA 2J7PD 3IBGA 2XYVA 4Z7NB 3OKAA 5JADA 1USUA 3AVQA 3HFGA 4K6GA 3GRUA 3IUPA 4FXOA 2BEVB 3CF4G 2VXBA 3KV3O 4EKEA 1FFYA 2QQ5A 1YGYA 1KE2A 4CEIB 5B30A 3ISVA 1J8QA 3TDNA 4B71A 1QORA 3PZRA 4ZAZA 5LZ7A 3RM3A 1ZD1A 1WOYA 1O9HA 1TKCA 3EOAI 4WK2B 5CT4A 2LXNA 4QXQA 4R68A 1JYSA 1RJ9A 2GWHA 3O1LA 3GGGA 3OJWA 4IICA 5D3QA 5FTLA 4ZO4A 4UHDA 2R9VA 4MYHA 4TLLB 4AO8A 3KD3A 4JNKA 1BJKA 3FMGA 2W9XA 1L3IA 1DEAA 4KWIA 2QLLA 4L9SA 3V6MA 4YUVA 4IQGA 2PUBA 1H05A 2QA5A 1N0HA 4YMLA 2F59A 1N57A 4LCJA 1TDJA 4HNTA 1ZK3A 3DXYA 4N9WA 2BGRA 1BVRA 1ISGA 2VBFA 3EQZA 2IY9A 2CMDA 3Q3JB 4UHBA 1P4RA 2XHZA 1DU4A 2DY0A 4R98A 4K6CA 3DLAA 2AJLI 1M8GA 2W2NA 2JHCA 1P7VA 1CRWG 1HE4A 1XCBA 2BKUA 3DBLA 1LZKA 1FFWA 4PGGA 5F5LA 5KOJB 3QX9A 1SU4A 1PL8A 1XVUA 1EFRA 1D2EA 1E6MA 4W6ZA 4AL4A 1RYFA 1IJFA 4NYIQ 1OLOA 6GPBA 1J09A 2GK6A 4IDGA 1DJQA 2FF7A 3QBEA 4ZOAA 5AR1A 4Z4EA 5CNJA 4LV5B 4B3SB 4RWEA 4ZKDA 4OGGA 3BAZA 3P7MA 3FZNA 3KFVA 5B3JC 2IHYA 4MDEA 2BGKA 1L4LA 2VYCA 3D3EA 4MQFA 1AS3A 4QYTA 1EFPB 1ZD8A 4FFPA 1W94A 5ESXA 1RPJA 2ZR7A 4C6TA 4BZWA 2HU7A 5KINB 4XA8A 2R8BA 4TKVB 3KNZA 3GFPA 2Q5QA 1H6CA 2UAGA 1T9DA 4HDNB 4L2IA 4TYMA 4MHOA 4OD0A 1P5FA 1YB6A 2NO9A 1W36B 2A5LA 2Y1DA 2JS7A 4G1EB 4UUMA 4BIMA 4QUJA 2VF5X 2NPOA 3QX7A 3G89A 2QN3A 3W8DA 4N6OA 3NTVA 2FSVC 4OB7A 2C84A 4MWCA 3UJHA 4TZ6A 2ECQA 3FJYA 2DBQA 4M7WA 2J87A 2YYSA 3ZZ1A 1PVDA 3U61B 5HM6A 1WKBA 1CJBA 2CVHA 1BXGA 3FDIA 1SOWA 3NFYA 1USKA 1T1JA 2WTEA 4PPQA 4S12A 4EUNA 2A88A 2FJPA 2XMQA 2GN6A 5KBYA 1E4EB 2R8EA 4P98A 3MMXA 3E03A 4XDZA 4BLRA 2QL5A 3UIEA 4B6FA 1E1QD 1Q3TA 1W0KD 3UCFA 2FB9A 4PG8A 4U4AA 1LC0A 3MWFA 2YIDA 2GYYA 1YKSA 3LECA 4HDAA 1K6XA 5CJPA 3FE2A 4W9NA 1O95C 2EW1A 4S2EA 3NHRA 4PYNA 4ZEOA 3RNOA 1RPAA 4FN4A 2R1ZA 4N5MA 3I1FA 4CZ2A 3N58A 3CCBA 3EF0A 3K8YA 1AK1A 3KE9A 3B13B 4XVHA 4ZPJA 3SN6A 4O4JB 2R2AA 1QV9A 2Q5LA 1MZVA 3RFVA 4WSOA 1RTKA 3RS8A 2SECE 5BSHA 4YJGB 1RTTA 3SHFA 4FQ8A 2XT9A 3P9YA 2X86A 3NBAA 4B80A 2TMYA 1JKIA 1HYQA 2MYNA 3DHYA 3K5IA 3NOXA 3SBEA 4NHEA 4FZVA 1ND5A 4D1YA 3U4QA 2ZWOA 2C7PA 2DFKB 2WYIA 3R2JA 4Q3DA 7MDHA 4YO8A 2V55B 2XXAB 2L19A 5KYTA 1GKYA 1J8VA 5L3RA 1DX4A 3AXSA 1IQUA 4B4KA 4RENA 4LX8A 3UH1A 2QYOA 2B5WA 2ZCJA 4UOQA 4GSYA 2BEKA 1UOQA 4F0JA 3HUDA 1T3TA 3OIVA 1B42A 1PK9A 3ITEA 1RI5A 1OI4A 4G0NA 2PUWA 2J9YB 3MTAA 1HQDA 1R15A 3PUHA 3L8YA 3IQHX 1T0PA 3GJXC 3L0CA 3HB7A 2AFIE 4BP9A 5F4ZA 5CJ2A 3O92A 1TLLA 4MCJA 3QHAA 4O1HA 4EY4A 3DC2A 4G8BA 1QP7A 4RZUA 3JQAA 5FUWA 1ZGCA 1QHFA 2XOXA 2QTVA 2G4LA 1B8PA 4CKWB 2PRKA 4YFYA 1TCUA 4H4CA 1VJCA 5IC4A 3SYLA 1L4KA 1JQ5A 5AXAA 2IIPA 3QPDA 1BCRA 3AONB 4AO7A 1FVXA 4QPNA 3D6TB 4CM7A 4HO1X 2BISA 3HSSA 3S29A 5DCWA 4G5GA 3WR5A 4M54A 4DHWA 1U81A 4IIDA 3NNDA 4KXQA 5GP1A 5B3JA 4DLTA 5K0NA 5IKEA 4OKNA 4BDSA 1BC5A 2CNKA 4M1YA 1IVSA 1T15A 2H2DA 3ESQA 2UUOA 3IRUA 4WN9A 1ZOIA 3GIWA 1NE7A 3E2IA 4JELA 5L3QB 5ALOA 3IAXA 4ZPXA 3F67A 5J9FA 4R8LA 1WUIS 3MELA 3KEOA 3N6VA 1IHUA 5DBIA 2OMKA 5E4FA 5TX7A 1QYCA 3X1MA 4FGLA 4I19A 3E3AA 1SZCA 3RSZA 4MYSA 4E4YA 2HWUA 4LTDA 3VNRA 1XMIA 3ILXA 1VPEA 2O2XA 3M6UA 4LXXA 4BNDB 4OMCA 2PV7A 2Q4DA 3E5MA 5FPYA 1D8AA 2WJWA 1YBHA 3HYSA 4V0OA 3I9FA 2ODBA 3MAAC 1ZUNA 2QRGA 3ANXA 3BK2A 3NIDB 4AUEA 5HUQA 2Q3JA 3NZEA 2MDTA 4RTSA 1P1BA 3PHCA 3DSRA 3FUWA 4R0MA 3NH9A 5JNTA 3UN1A 4CM4A 3I04A 3D6AA 2A92A 1N25A 2HYDA 3D6HA 3L4BC 3M34A 1C7QA 4MCAA 3R7LA 4GM0A 1ZQ9A 4WOKA 1ZW1A 1SAYA 3M6VA 1YOVA 1VXRA 1PR6A 1S2OA 3HUFA 1J8FA 2ECKA 4QU5A 1Z2DA 3CH6A 3NQ41 4LKRA 1MV5A 4ARIA 2H2AA 4RTRA 4HPJB 2O4CA 3RIXA 2H11A 4FCVA 1SBCA 5HF5A 3HCFA 1YTUA 2FSUA 2F55A 5FOVA 5E8JA 3DXFA 2II6A 3HY3A 3S1AA 4DIBA 4ER0A 3PDIB 5BNIA 4MQLA 2EP7A 3PFWO 2ADFA 4R4JA 1N0VC 5IBRA 3WHKA 1K68A 2PX2A 3H4IA 1JPUA 1KEPA 2WIFA 1JFVA 4P4TA 4PIMA 3EAGA 4RVCA 3D6JA 5BRAA 2ZVQX 1U3CA 2VVTA 4URHA 1L8XA 3U4GA 1THTA 2A57A 2AI1A 3WO0A 2C03A 3NKVA 3SF0A 9MHTA 3Q7RA 1X3SA 2HHCA 4RY8A 4DDVA 3VRHA 1Z4OA 3FCUB 3CWZA 3AFMA 3DO8A 1M2OA 2YW2A 4II2A 4AUNA 1JQAA 1YJBA 5CB4F 4YRIA 3FHJA 1E8DA 2GEFA 2FSFA 2F3QA 2Z4TA 1SK8A 4IDDA 5KOHA 4OHYA 1UMCB 1Y8RB 1TQDA 2D8AA 4YLGA 3S68A 3TQTA 4CIDA 3RTBA 3SM3A 4YXWD 1WF6A 3I9LA 4CQMD 1EK1A 2ODPA 3VZBA 1Y9JA 1X8XA 3EE6A 1FZTA 3VZSA 2BZ0A 2W71A 4C14A 1QFYA 1GPJA 2WT8A 1JMVA 3OQVA 1DLIA 3ZWYA 3O3OB 1GFWA 1I1HA 2PFSA 4E30A 2IELA 2ZE7A 1G3MA 2ZS9A 4Y9SA 5FNVF 3DWFA 2FWAA 3IAAA 1VHTA 1WZUA 3EARA 2NZ8A 5AJHA 1ESDA 5FO0A 2Y2VA 4YA6A 1VTKA 5CNMA 1DAPA 3HZHA 4BO0A 4J29A 3T3EA 1SUDA 1IPFA 4NDNE 1P19A 3IH5A 4ILEA 3VSBA 4BHTA 1C14A 2H52A 1Z15A 3I1JA 5JQGB 4Q7MB 4XXHA 3OJEA 3BRCA 4JIGA 4Q19A 1OWLA 1REQB 4CCSA 1OVGA 2IOFK 2C0QA 1I1QB 3UB3A 1X8KA 5LQDA 4CEJB 2J3QA 4XB2A 1AUOA 2WRZA 4EJSB 1A69A 3P0FA 3WK6A 3RADC 4LDQA 3U7GA 5C8DA 1J00A 3HVIA 3V8MA 3QEOA 4P84A 4F86A 1VXOA 2HA4A 3A31A 4KWEA 4CF6A 1H2HA 1TIKA 4XR4A 5CVVA 4CFYA 1QIKA 3EVCA 3VZDA 3WWDA 1EP9A 2YDXA 1KIFA 2B8WA 3EA5A 4Z6KA 2FVYA 1CPYA 4YROA 3LH5A 3RUFA 5L4LA 4BNJA 1Z25A 2UZ0A 1K3FA 2ATCA 4JT2A 4MRSA 5DHAA 5H68A 3I5MA 1ARZA 1ADFA 1PW5A 1YDWA 2FN9A 2FP3A 2ODAA 2VDPB 4ZANA 2AOVA 3K6KA 4RH3A 5CX1A 3HYCA 3KM0A 4RY0A 2AQKA 5BSEA 1O96B 1R0LA 1RSZA 2R6ZA 1UDXA 2B4KA 3MD0A 4G25A 2J0UB 4LXYA 2JIQA 5CFOA 1NPYA 1RLUA 1SHUX 1OCEA 4TMFA 1L1RA 4TYPA 1Z5ZA 3E4DA 5J5AA 4D4HA 4KMRA 1CS0B 1KMCA 1MJHA 1PK7A 2IU6A 2P4QA 5EXTA 3U13A 2BJVA 2R00C 2ZWVA 1TKAA 1YDFA 1BE0A 3GVXA 3OZAA 3AF6A 3RS2A 5JSUA 2HTEA 4JMPA 1XCGB 4DSTA 3IJRA 4B2IA 2C5GA 2UV8A 5B3LA 3BHJA 1OX6A 3VZCA 4PU0A 1X80B 4IF6A 4I8IA 1V5GA 4IRUB 3WKAA 3PJFA 4LJSA 2ORVA 4IVNA 3I04M 3KSMA 2ZYTX 4O63O 1IH8A 1H1LA 1UXKA 2MT9A 4I55A 2OCAA 3VI4B 4NV1A 4EMSA 1FXWF 2O0MA 1K7SN 1U80A 1P5JA 3IX7A 3K8ZA 1NUQA 3VXKA 4JC4A 1Z4IA 5CCXA 3WA7A 2NQTA 4LWZA 1U4SA 4JA2A 4C89A 2VATA 5HE9A 1C0PA 2CL5A 4LWOA 2Y3IA 1OBCA 3D4BA 1SKYB 4H3VA 4OHZA 2JGDB 1RHJA 1PWHA 1GQYA 1MAVA 2Q0SA 1GSOA 5IKMA 2VAWA 2FPIA 3P2EA 3D43A 3PXXA 4NNJA 2FN3A 2IL1A 2RI0A 4UAGA 2AQHA 4ERNA 3TD2A 2FUCA 2E7ZA 3FXAA 2JZNA 3V8EA 4MUFA 2YKGA 4KFUA 4KQMA 1H4QA 3EK2A 3PBKA 2X3YA 3R5XA 3WHPA 4N5LA 5EQTA 1UFQA 4XGNA 1U7XA 5HGJA 1YFZA 3ZEAA 1GNTA 3DO6A 4UHKA 4Q6WA 4UXIA 2WE8A 4WFKA 5KX5B 4FCCA 1QTIA 4LGMA 2XZTA 3K0FA 5KNCD 4KPEC 2XBMA 4DKJA 2C9BA 1H9CA 5THQA 1XRSB 2NV6A 3DVQX 1QCDA 2VUTA 5KTSA 1G2PA 1V1RB 3RSOA 5EJ4A 4Q1AA 3ZGNA 4BO9A 4OOEA 2QQ0A 4P32A 3TKAA 5I7VA 2OSBA 3UT5A 1WMSA 1QK3A 2PT7A 3QEAZ 1O94C 5BN1A 1JLMA 3U7RA 1EU1A 1JUDA 1T8PA 3WKCA 3GEGA 1SOUA 2DSNA 1G7SA 5DGXA 2PZAA 3OE4A 1BTOA 1MFZA 1XVVA 3GARA 4C06A 1N2IA 3DBOB 1JEYB 2NVOA 2V5AA 3CLKA 2V0NA 4KAAA 4RXMA 5CJJA 3RE1A 7MHTA 4ZO6A 1KI3A 2WBLC 4GU5A 2R96A 2QJTA 5J2UB 5JMPA 1L8LA 4F93B 4LE2A 4J0EA 3A05A 3H0CA 3DVAA 2WM8A 2BM1A 3CX8A 4MKXA 5TQVA 2P8SA 4Y0VA 5ECGC 5HWSA 1MD9A 5KCMA 5DO9A 3ZHSA 1PGNA 2YZ7A 2KJQA 3O8QA 1BQ3A 1GNLA 1OH8A 4JKYA 2NUTB 1KBOA 1G5PA 3W0LB 1UEXC 3BK1A 3STYA 2D0OB 4QVIA 2WF6A 4OQQA 2AQIA 2HQRA 4XPIB 2DUUA 3PL5A 2R3SA 1T6XA 3HXPA 3D7SA 3G5MA 3SJUA 3V33A 3DW3X 2HC9A 4A8JB 2MINB 4ND8A 4RMNA 3T3HA 4BIIA 2WMDA 3IUQA 2GX6A 3E22A 3ZDQA 1FQWA 3C8ZA 4M1QA 4TKLA 4H7PA 5JSZB 1UDRA 3I0ZA 3BKWA 4TVSA 1B1CA 4EG0A 1OB5A 3OOEA 3R7SA 4L8WB 2Z2YA 2DOKA 5FA8A 4EHBA 2KI5A 1YQTA 4C1NA 4QYSA 4FUTA 2Q8QA 1G20B 4QGSA 4YECA 1Z4NA 1J70A 4RK7A 1R0KA 1HOTA 1PV1A 1QHEA 1Q7EA 2DY1A 2H00A 2AOTA 3OU6A 4IMPA 3RUCA 1IQRA 3QFCA 1ZM7A 3QA3E 1SVWA 3WQQA 1TVCA 1YAHA 4BATA 4BFVA 2V9CA 4C05A 2EZ8A 2YOHA 4OHBA 4N3CA 1R0WA 1W2GA 4Q03A 3CEMA 2GNAA 3WIUA 3W5UA 2DERA 1PGOA 2IUSA 2PQ0A 4QUGA 5G1PA 2QZPA 3B1YA 4TT8A 4CCWA 1GZSA 1WSWA 4KQ9A 4A8HA 1OBOA 1U3DA 3FLAA 4R40A 4DY4A 4D98A 4LWPA 1ZM3A 4ZCSA 2IXGA 3HKEA 1MEOA 5A6SB 1ODCA 1PNTA 2ZB2A 2ZUVA 4JBIA 3LLMA 2Y8EA 1Y3DE 3L0BA 3PQ7A 2J1LA 2IBTA 1QF6A 5FA5A 2VHTA 4XR9A 1SQ6A 1A98A 3FGOA 3CCCA 2GKOA 2E85A 1P7YA 1VSTA 4GOND 3MSCA 1KI4A 4OK5A 2R86A 5EIBC 5CIYA 3SJZA 1Z63A 3HCEA 4RU1A 1JJVA 1T1IA 3FLEA 4X41A 1AXEA 4JU9A 2AWNA 1DG1G 2J59A 1YBVA 3PNMA 5BWNA 1NBME 2WHYA 1FS4A 2IUFA 3VNSA 4OHCA 3EXFB 3GD7A 2JARA 4E5DA 2CUTA 3ESCA 3FPGA 1XQWA 5CR9A 5JMTA 3L7JA 1VSBA 2D7JA 2PXXA 1P4GA 2H17A 2XMSA 1EWQA 1QHXA 1ZM9A 1SIWA 4MS1A 2Q4TA 2OILA 3KB6A 1JPVA 3GLFA 2P5UA 3KYCA 1GZ3A 3HB1A 4BEJA 2FWRA 1PT8A 4QUHA 4UMEA 1Z0SA 1J23A 3UAOA 5DLQC 3SSAA 4DVJA 4OI4A 2V7WA 4F3RA 3KEFA 1ETUA 3C45A 2HMSA 3JAWA 2NU9A 1PUXA 2G0AA 2IEYA 2P90A 2X2EA 3DO5A 3GX1A 3NBYC 5DIFA 4ZQGA 5TMDA 1NVWQ 3RAGA 1BX1A 3RRXA 4GUDA 4DG5A 5IYZB 5G1NA 2FLWA 3EXIB 3TIIA 3TXYA 4EY3A 4XIFA 4A1OA 5CYGA 3RK4A 3ELBA 4QU9A 3UTDA 4LRQA 3E27A 4OUKX 1HH4A 1QLWA 3BRSA 1VMIA 4HZUB 3RSQA 3OX4A 2XUQA 2D5CA 3MLEA 5C31A 3QHQA 3MJVA 3GAFA 5AOCA 2FW9A 3BXGA 3EXAA 5B2EA 1M75A 2GRAA 3V80A 3SDZA 2NTJA 2CBZA 1SG6A 2H9YA 1IHDA 2Y67A 3ASZA 5HK9A 3CLUC 3H42B 1F5SA 1UFOA 2C31A 2GB4A 3FNGA 5HCUA 3RJ5A 3SY8A 4HNUA 3EGWA 1R5JA 3ST7A 1OXUA 3FPFA 2ZULA 1CQZA 4G5SA 4G67A 4WFJA 1GFIA 2QP9X 4Z3KA 3ZX5A 3ZH9B 1JVNA 1JAZA 1YUBA 2XNJA 4LW8A 5JBQA 2ZU6A 2AH5A 2HMAA 4PR0A 5AVKA 3D7LA 5H3HA 2RG1A 1PU2A 2WSBA 3CVWA 4GLOA 4P5PA 4Q66C 2L2QA 3T94A 2VZEA 2KPOA 2J6CA 2CVFA 4N39A 3KVOA 3MCVA 3REFA 3FN4A 1Z47A 2J41A 3WMXA 4KLRA 3ZHOA 4AJIA 4MV4A 3DV0B 2ZXFA 1T0BA 3LA6A 4QASA 2CYAA 1HKHA 1OZGA 1JV2B 1JX6A 1HSOA 4DM3A 1UMKA 3E7PA 3VHLB 1PZGA 4W8HA 4DANA 2Z3ZA 2W2PA 4FYKA 3KBBA 2D62A 4MRVA 1TW3A 1U1DA 1T9GS 5KJCA 2EBHX 1NV9A 2HHAA 3F3YA 1KNXA 1Z75A 2PU5A 4RO0A 2PT5A 4YT5A 2YWHA 5JLAA 4EUFA 2IKSA 2AE2A 1W4CA 1A9TA 5HJEA 2N9UA 1HYBA 1YMQA 2GRUA 4BE7B 1UOPA 2R7AA 3CJTA 3ESRA 3RS0A 2PD4A 3X0DA 4GKJB 1A96A 4MP3A 3N86A 3JQ7B 1U8EA 3K2QA 3FSEA 3PXBA 4RACA 3AVVA 4WK0B 5CNIA 3QPBA 1N1EA 3O8OB 1ML3A 3NCTA 1LJLA 3TEJA 3CB2A 3Q9SA 4CXMA 2LCIA 4TSFA 2V45A 2Z56A 5D85A 3ELUA 2ZEJA 2IZ1A 5K51A 5DT2A 4JQYA 1GQRA 5K0JA 1I80A 3NVKI 3WNQA 3GCWA 3A6ZA 1LVUA 3D2BA 1SULA 3OQJA 4RNCA 1E5XA 4QBGB 5TRTA 1RHMA 4XDYA 1QRUA 2VHVA 3FDZA 3NAGA 3OQOA 2V6MA 2Y27A 3Q0EA 3QUBA 3WI7A 5SY6A 4IEFB 5HK8A 5EXXA 4WINA 3AY3A 3COVA 4U8GA 2GGSA 1Y4UA 1XTQA 2WU0A 4GS5A 5FL3A 4UOZA 3TZHA 1MORA 5CRIA 4L28A 1L4HA 1JHYA 4HDKA 3AKDA 1FX1A 4LHSA 1QIIA 2BI8A 1VSVA 1ZD4A 4BEVA 3ESBA 3E3LA 4RE6A 5AKZA 3WRYC 3FB4A 3WYDA 4AN0A 1JHMA 2PL9A 2XMGA 2CXNA 4OYRA 5H9VA 2VRCD 1UJ4A 4WCFB 2JB9A 4CKBA 1XDWA 3EPHA 5F1YA 5BQPA 4B9EA 3I2GA 4CN8A 5HKAA 1CU1A 4Y2SA 5FBHA 4XEHA 3QQPA 3ELWA 4C0WA 2LR0A 3FH0A 1YJ5A 2N0SA 1G8KA 1T9BA 2FQXA 4IHJF 1EFLA 4ZAWA 2P6OA 4DDMA 3OH8A 1J2YA 1HE5A 2QAGB 5L6LB 4A6PA 1F2UA 2N3ZA 2ISCA 3LZ6A 2M6KA 1E62A 3TEMA 3BZWA 3GEBA 3QPAA 4UMVA 4DLNA 3I2YX 5H82A 1AU9A 2Z8YA 1XTVA 3HADA 4C76A 1OPXA 1PZNA 3MINA 1JH8A 4YRGA 3PF8A 3N0XA 3ZHZA 3H97A 3OY7A 1QZZA 3JVIA 3KHTA 3QVWA 3QYAA 1TEVA 4TLDA 4CL8A 4BTVA 2XJ4A 5B3AA 4BNMA 1B23P 3RWBA 2PWZA 1WAMA 5LP6C 4XX1A 5DBEX 1LDEA 4IO1A 5K6TA 1VL5A 4KKVA 3Q2IA 5JANA 4CLOA 3QV1A 4OL9A 3SE0A 1ZHFA 3VM6A 2HKIA 2GBGA 5IMBA 1T2CA 4NIMA 2EG9A 3BILA 4PZ0A 4Q82A 2C3PA 3QU7A 3LHIA 3WRXC 1G55A 3C0KA 1SQSA 2CNLA 4ZQFA 4GC5A 3IKTA 1OW3B 2BEUA 3KQHA 5J23A 1S1CA 3MRTA 2VH5R 1BDBA 4V3CA 3PDJA 5JD3A 3Q72A 1JSRA 2ZSAA 2QPAA 3W8EA 3KLPX 3B85A 5D2CA 1HG1A 5G0WA 1R4ZA 3DOJA 3JWGA 3ZJVA 4G5QA 1MB3A 1YR3A 4BP8A 3LHFA 1YSCA 3IAUA 2E5LB 5I7SA 3FMPB 3JYQA 2FAXA 3CS3A 2CLSA 1VMAA 3L5OA 1XHEA 5KNBA 2OLEA 4FS3A 5MDHA 2CNWA 2TSYB 4CMBA 2F1KA 2VHXA 2PX3A 3B9PA 3X1ZA 1C0KA 1DKRA 2JPDA 1A04A 1JFLA 2RHRA 3KJIA 3PGA1 3QVUA 3D4NA 4RKEA 1YA6A 1D1SA 1Y5MA 4FM9A 4PLTA 3O03A 4WNYA 3GA5A 3O8RA 4ROTA 4Y2HA 5GOZA 5M29A 4UFPA 5EJIA 1K8QA 1EJBA 1KGDA 4LZJA 4MWOA 1BYUA 4PHTA 2JKZA 4ZJZA 1WO8A 3EA0A 4RK5A 1BQ4A 2LD4A 3OQ1A 4ZAGA 1CXZA 1Z6PA 2XWBF 2O23A 3QW2A 3Q5EA 4YAUA 3TCNA 3VR6H 2VRWA 3PPYA 3ENNA 1AKYA 1E3LA 4KQKA 1TTQB 3TR5A 2PS1A 1XZIA 3DDZX 1TUBA 1G291 3DHVA 3K30A 1Y42X 2R60A 4D8VA 4MDHA 4E46A 3WJAA 3PYLA 1BMFA 3VNUA 4HN2A 5KTPA 4MWTA 2BC9A 4WEOA 4KL8S 2AF3C 3ENVA 2Z2KA 1WHSA 1BH2A 3GJQA 4LHEA 2IU0A 3JD0A 1OBHA 2Z09A 3ENKA 1BN7A 3ICQB 2Q6IA 4YMIA 2AOUA 3ZOZA 2JLVA 4C22A 3U4CA 2WM9B 4ZQHA 2SKDA 3OQIA 4E6PA 5CVTA 1FK8A 4PYRA 2Q5EA 5C1DA 4FYIA 3G2PA 3VR5H 3LY9A 4NXNB 2VNIA 1QRSA 4OHVA 3OZEA 3W8FA 1GZUA 1N7IA 2A9VA 4E5YA 5GGYA 3B6KA 4PNEA 1JHUA 1E60A 3ER6A 4MUBA 4YXWA 1TT5B 5TEWA 2IIBA 3AEZA 1M2VA 3JQBA 3SZ3A 5FI1B 3MOGA 3T5BA 2B99A 2RH4A 5EXDA 2HSZA 1P5HA 2BGWA 3RVKA 3IQDB 3SBDA 1PR0A 3CT4A 3GUUA 1PCXA 3R0ZA 4X00A 3S2UA 3V2IA 5LQUA 2O7SA 4IZOA 1DT3A 1X70A 1AQUA 1U2PA 4XM0A 3HYLA 1PG5A 4D56A 2JK0A 2BGJA 4IJUA 1F2TA 1H0KA 1IRIA 1LTKA 3DAPA 3VZRA 5AUNB 2PLNA 1VKZA 3KJEA 2PVCA 2COUA 4NXMB 3SC2A 4A0HA 3UAYA 3UMBA 1SO8A 2P78A 2VJLA 2H7CA 1EPUA 1XQXA 3KVYA 1Z2PX 3PJDA 4L3VA 3D6FA 5EJFA 3N70A 4I4TF 4JXKA 3STXA 1MQAA 1HNXB 3HR8A 1QONA 4GEKA 1XYGA 2W0MA 4GPD1 4YH1A 5T8KC 1MAHA 3PGLA 1OXVA 4FGKA 4D8TA 3RKSA 4EAQA 1SBYA 1D0SA 2R8XA 3D4PA 5E7MA 1A5TA 4YQEA 2ZRMA 4DQ0A 4JR0A 2IDKA 5CEEA 1RHQA 2JLBA 2WT4A 4DIOA 3KFLA 1U3FA 3H9JA 3P0HA 1Y1SA 1FFXB 3ILHA 4B4DA 1PD1A 3OOWA 1WLYA 3TG8A 1PDOA 2Z6AA 5BPFA 1M67A 4FYXA 1SOMA 2WF7A 3LHSA 4J94A 4DLWA 3I76A 3BE8A 2GZSA 4CI0B 8AT1A 1JR4A 3LW7A 1BS2A 5K0BA 3JY6A 3GJ5A 3LV8A 4FNAA 3NHKA 4IJQA 3E8SA 3GZNA 4JLKA 2YFHA 2EBWA 4JT9A 3H83A 4P58A 3N76A 2CSXA 3W8NA 4JIMA 4Q18A 2IBMA 3SKVA 1GV1A 1COZA 1ZK2A 2JIBA 3OIGA 3VR4A 4WCDA 1I3MA 5G1OA 4CQJA 5JDCA 3E3NA 1QV7A 1RBMA 3WKDA 3OMLA 4G89A 2FUG6 1ZNQO 4RV9A 4UQPA 4WDQA 2CXUA 2PWPA 2RIRA 4IH4A 1Q2UA 4OEHA 4B3JA 1YRQA 4YY3B 1DNPA 1UFKA 3KOXA 3KZ1E 4HWRA 5KTMA 2VPYA 4OJNA 1DINA 4KIWA 4LE1A 3TGPA 4MYUA 2C88A 5IS2A 2ZIVB 2JEOA 5F76A 2YVKA 1NY6A 2FUEA 3TQHA 3TGWA 4BXOA 4JI7B 2BSAA 1Y9EA 1C9NA 2YQ5A 4AY3A 4J3NA 4DJ5X 4ENPA 1K66A 3M33A 4P36A 4DC1A 3BCRA 4I8XA 4DCUA 4MUNA 2J31A 1NFQA 3G1UA 1LK0A 1S2NA 1E1DA 1AKRA 1XMJA 1PYDA 1IJKA 2R1TA 2ZZMA 5U4XA 1GZ6A 4I9UA 4ZYYA 1K5HA 1V4BA 2GARA 2OCDA 5L51A 3EJWA 3CZAA 3R9XA 3OLQA 3FPKA 4C0XA 2PUGA 1Q5PA 1THMA 2WG0A 5DTIA 3D0KA 4K26A 2J9XB 3TZBA 3DMTC 2EHJA 5F4BA 4DXAA 1K89A 2HQOA 2WYUA 1L1EA 3A2MA 3BMQA 3TPFA 4UPDA 3ZE9A 3HXQA 1IB6A 3HLKA 3K15A 1TVKB 2RI6A 3KSDO 4EZEA 4X7MA 3C5WP 3R9KA 5DTEA 4MTCA 1QAMA 5ECWA 2BRUA 4V3BA 4Z4QA 3ETCA 4LF6B 3MVEA 1T5LA 3INTA 4LJKA 3H9QA 4TRJA 4IHQA 1WXQA 1QGDA 3A9VA 3S4YA 4IIVA 1A50B 4UU1A 4FFMA 2ZBGA 3N6XA 2BE9A 1QCCA 1EK2A 3Q0IA 2ESRA 4KQFA 4U9IS 5A3RA 3VJRA 5KKAA 4Z9BA 4NCAA 1H94A 4DJFC 2V7EA 3LYAA 1X0VA 2OD2A 4DXDA 1KO7A 2ICAA 4M89A 3EDOA 2PNJA 3T3GA 4I6GA 5FEUA 4CEJA 4X62B 1PYOA 1RWBA 2ZRJA 1RI1A 3IB3A 5AI6A 1QOQB 4DBLE 2AZ4A 2JCXA 1UIMA 4YRZA 5AVOA 2QLTA 1XZ8A 2VJCA 4RW0A 1N2CE 4HB0A 1P2SA 3AFNA 4LN1A 5FYQA 4DLPA 1XU4A 1MQ8B 4MSUA 4UC0A 4M98A 5JFOA 3OD1A 4PANA 1S9DA 2GM5A 4KTTE 3LUKA 1CVLA 1H1DA 4S1PA 5A6SA 3MFQA 3PRYA 3HKDB 5MF6A 1JKJB 4J0HA 1FE8A 1ZIYA 3E5HA 2ONJA 3PHGA 2B8NA 2Q1XA 2H9AA 4F91B 2QN8A 1C7ZA 1VHWA 4Z0NA 3K94A 2RE8A 2MYPA 3O1JC 3U80A 2P2SA 1Q84A 2DE0X 4R69A 2CFCA 1ZINA 4X1YB 3EEQA 1WY7A 3FWKA 1O5TA 3Q3VA 4Q01A 3UKDA 1HNZB 2Z08A 2FSIA 1IONA 3MTEA 1TTHA 1K9VF 1D2RA 3FTPA 1O9BA 1X2BA 3WZLA 2PX4A 3JD1A 1SXGA 2J6HA 2UVPB 5BO5A 3BDIA 1GP2A 4TQAA 1FL9A 4ATNA 4IHJA 2EW2A 3T1VA 4G5OA 3E1KA 3KUUA 1NUSA 5E9WA 5AW4A 1V3UA 1RZRA 4PVCA 1QQ7A 2EKDA 3HJHA 3TTVA 1HTBA 1GAQA 1MH1A 3JU3A 5IJWA 4NBKA 2YBDA 4RIHA 4U2FA 4I2VA 2CNOA 5C3UA 1BJTA 4BNUA 4BUJA 1NXXA 4QAQA 5F9FA 4QBFA 3ZBPA 1KO4A 4G97A 4KG7A 1NATA 2H1FA 2GK3A 5IRCD 4R2KA 4P53A 1ZGGA 4A03A 1BS9A 1MOZA 2DPHA 3LWDA 2Z4SA 1I3NA 3NCHA 4ID3A 4QGGA 4E2ZA 1E64A 1OYWA 2GUGA 3R44A 2VZ0A 3H11B 3AHGA 5EP3A 1SKQA 2VDNB 5DN9A 2QTMA 2W2KB 1N2CB 3EIOA 4PZCA 3RFTA 4YJ2F 4WCFC 3CWQA 1R64A 1S3GA 3DAOA 5JCJD 3NAMA 1BW9B 4TV8F 4L2IB 1CUXA 3BF8A 3DDCA 2AFHE 3OBBA 4UU0A 5LZ5A 3W3AD 2RAPA 1CQPA 2ZJ2A 2R84A 2VDWB 2ZB8A 3SSNA 3SFZA 3HWSA 1QHIA 2O8EA 4HEHA 1UEIA 1MAUA 2XGJA 5H59A 1LNQA 1AE1A 1D3AA 3O9ZA 1ODFA 3LLCA 1J2EA 1HK7A 1NMZA 3EGXB 3LX6A 1G21E 3OEEA 4EMBA 4KFCA 4PCVA 3Q7TA 5JTUA 1J0AA 1JNYA 1C3XA 1S8AA 4GG1A 4ROSA 3UWPA 2DFDA 4HHEA 3V32A 1AA9A 1CLUA 1HDGO 2B7BA 4M0EA 3MGBA 1PZHA 1WW8A 3H7AA 4AMGA 4E7PA 3FNQA 5CB4A 5A71A 3KQQA 1CQWA 1TYDE 2A1TR 3GLTA 4EHKA 2X1HA 2GF9A 2X76A 3HUTA 3QXHA 4GYJA 1USWA 3JQEA 2JKYA 1FVHA 1RLJA 4KUGA 5LP6B 4NCBA 4UBNA 2V0GA 1MT0A 3LUHA 2AG5A 1OI2A 1I51A 2O1EA 3CZRA 3DT9A 4DIUA 5FUXA 4P4LA 4EFKA 2NUPA 2PQ6A 1E69A 2PUEA 1GGKA 2C2XA 5ALRA 1EXMA 3KZMA 3E2PA 4ME6A 1E9CA 4CPDA 3U7FB 2AUMA 2JAHA 1FJ2A 3T4PA 2JIZA 2P3QA 2PZBA 1JEYA 1TZMA 3W3ZB 1TYEB 3V1TC 4DA7A 3PX3A 4NYJQ 3FYHA 3IVRA 1M5TA 1IVNA 1CK4A 1EFPA 2I3AA 2DX7A 4I08A 2RHTA 4J1NA 4QAJA 2VCYA 5DLPA 4A1FA 2UZ3A 1Q44A 3GRVA 1WP9A 1XV5A 3NUQA 1YFJA 4LJ9A 4P7FA 3VNVA 2Q5CA 3DCJA 3H9CA 4D81A 2FZ4A 4QJ5A 4EGJA 3K6SB 1YR8A 3HMQA 3CH5A 5HOEA 1RQGA 3KPYA 1YB4A 4N7BA 5F2KA 5YASA 1JHZA 4B2PA 1G1AA 2X3FA 2YJ4A 5L6MB 4LQLA 2VP0A 1T5IA 1Q0PA 3IT0A 1RMQA 2XOEA 1U2RA 2FH5B 2HQ1A 2F3RA 4ML3A 1MAWA 1BMQA 1YNOA 5FTWA 4AC9A 5BOVA 4ZOLA 4CQLA 2Q6OA 1ICEA 3STTA 4QOHA 3FSGD 3TXAA 1GFSA 1SUSA 4HRYA 4E6EA 1AKWA 4BFLA 4ZZ1A 3PUJA 3E22B 5J4LA 2NU7B 3N7UA 1P2GA 3VYVA 1Z12A 4MXDA 1L7VC 1OV4A 1UBUS 1U9IC 5HCIA 3FOBA 1W8IA 5D87A 5EPUA 3BDAA 1P91A 5ENDA 5H4HA 3WHIA 4DBLC 5BNWA 3DXZA 3LA8A 2WZDA 3BH6A 5J40A 2IXEA 3CLVA 3FKJA 4ZQIA 2R6GA 2WOOA 1Z5UA 1YDHA 1X1RA 3MQ4A 4B4OA 1T0JB 5KPJA 4IIJA 1ZWKA 4DLSA 1CUEA 1KVRA 3PWZA 4CEHA 2O59A 1M2FA 4C03A 2I7TA 1GG2A 3I8SA 4BVEA 1P0MA 3PVSA 2AOTB 1G7RA 4URYR 1NXVA 2E4UA 3TIGA 1J9GA 1Z28A 2J45A 2POQX 3LIPA 4X6LA 5E3JA 2X1MA 4QJ3A 4FC7A 1U3WA 2EL7A 3MTGA 5K3FA 1UBJS 3KYIB 3HB4X 4GLFA 4HUQA 5FWYB 3ZZ0A 4I36A 4BO7A 3C7CB 3ZUGA 1NR7A 4JJGA 1HG0A 2I0FA 4IFEA 1GM5A 3WGUA 2QBYB 2ECFA 3GH1A 1YC5A 3AFIA 2Y6UA 1AVTA 3K0CA 1Z3IX 3FPSA 5HA5A 1G8AA 4G41A 3K16A 3EQ9A 3NHPA 3HXTA 1VPLA 4BNXA 2FMUA 1E3SA 4JJFA 5KNDD 2VJMA 4H60A 3WLMA 2J0VA 3ZLJA 1WUTA 2Z1DA 3GOHA 4DA8A 3M8KA 3ZVLA 5J4YA 3R6TA 1FFBA 4V0SA 1PQUA 3NBFA 2XEXA 1TZKA 3D81A 1SU8A 1U0OC 4UTZA 3OKPA 1I24A 3FTDA 3TOSA 1G63A 4B3DA 1L3CA 3G8CA 4YCJA 1GAWA 2H5JA 4EVIA 1WETA 1CZRA 3I2JA 5DYGA 4M1SA 1ZCJA 4WECA 3L4JA 2XRMA 5KUTA 2O8BA 2GDJA 1XTJA 2EZ4A 3ZVKA 5K01A 3G2KA 1M73E 1FP4B 4ZAYA 2MYUA 3ZQKA 3PC6A 4XB1A 2MHCA 1KU6A 1F1JA 4J0DA 1JEOA 4EX6A 5HIJA 1MG0A 1QV6A 2WVGA 5ALUA 3SMVA 5T4FA 5EJAA 4AAYA 1VBKA 1UDWA 1TTPB 3WLLA 3A06A 4UATA 1Z39A 3DM5A 3DNMA 1S7GA 3W3AA 1AUXA 4XOUA 5EYPB 4DBZA 5JJCA 3AC0A 4KRFA 1XZAA 3FOCA 1H6AA 3MJ4A 1XMSA 4ZMRA 4HH4A 3G02A 4TM7A 4KJXA 4MKHA 1DBRA 5KYNA 3E8MA 5AKHA 2PA0A 1W48A 1XEXB 5LQJA 2JFUA 1Q17A 2NUBA 2UYYA 3IDSA 4QODA 3WB1A 4QTYA 4Y1RA 3F6PA 5ALVA 3QFSA 4B47A 2GTPA 3GDWA 1WMAA 4Z4HA 1ZONA 4UVHA 1ZJ6A 5HSGA 3DMHA 3DE3X 3ET5A 2AN3A 5EXPA 5GONF 5JRJA 4LYYA 2BZGA 1B41A 3VC7A 3AO0B 1Y8QA 2VHWA 3G3EA 3G7SA 4A5OA 2D74A 2VK2A 4PX2A 1UT5A 3F46A 4RTOA 2YINC 3OM9A 2ZR9A 2F90A 5AD1A 3ZGOA 1YHYA 2CL6X 4IDBA 3B2QA 1VJGA 5BSRA 4C3VA 1TKRA 2DQKA 4D9KA 3K8QA 1I4TD 3PRJA 3U48A 5AFSA 2LVBA 4Q0MA 4QRHA 2H1CA 5I9BA 2ZJOA 2O54A 4B3MB 4EB6B 2P2GA 2RB5A 1T13A 3HBNA 1QYDA 2NO0A 2Q3FA 2ZT6A 3PNLA 2VRBA 5CAEB 5IDQA 1LLFA 4RZQA 1ZW6A 2BCJQ 1U2QA 2CEAA 2OBMA 3AQIA 1CETA 3K0AA 4IZIA 4KZPA 2CT8A 1IBRA 4ARUA 1OFUX 3DPSA 2WTNA 1ISMA 2ZUWA 5J2TF 2RIPA 2ANCA 2Y6VA 1NUAA 1SK9A 3BIXA 4KVGA 2JEZA 4FK8A 3T9AA 1TYCA 1KSGA 4P9NA 2QMYA 2QXYA 3UC9A 2Y2UA 3LX4A 4G4IA 4OVKA 1UBOS 4GQBA 2ZSHA 2W48A 3NHFA 4XKJA 5T41A 5BQ3A 5JYBA 3QVMA 3QBDA 1AZLA 3PNSA 1CUJA 1CY2A 1XWFA 1JJ7A 4B4UA 4H08A 3UUGA 2VSOA 3RWMB 4FDLA 2O8NA 2PYZA 3OJCA 4KLZA 4RMHA 4MV9A 3H3JA 4JDUA 3GLQA 3COYA 3Q7EA 1L5QA 1WPGA 1BFDA 1P2UA 1WXDA 4ETNA 1JBEA 1NBHA 1VYTA 4TL8A 1VIVA 2WHQA 3OM8A 1WDLA 4B5KA 4K9MA 4OI0A 1POWA 2O8CA 5DI9A 3SP1A 2YN4A 3PUVA 2FSPA 1HQKA 4QQNA 5JNLA 2ZIXA 3VISA 5TV2A 1Q7CA 2HDNB 2ZQZA 2ENUA 4YP6A 1TC1A 4PINA 4F4DA 4KO4S 5AESA 3RVMA 4HNRA 4A91A 1AXGA 1DVRA 1XZLA 1E3IA 2Q3BA 1SXJB 1AV7A 2AN5A 1WCYA 3FAZA 3SIWA 1KGSA 3W05A 1YZGA 1Z22A 3PR1A 3W6PA 2WVHA 2H7XA 4AMVA 1NRWA 1AX9A 1QF9A 4RAQA 2UDPA 2W2XA 1GJRA 5AI8A 1QQ6A 2EJWA 4HAXA 3RRNA 4D3FA 5DM70 3Q98A 2SCUA 1ZI9A 2XCSB 3L84A 1M8KA 4MMXB 1PJRA 2P41A 1T36B 3DLIA 3EZGA 3AI1A 4E13A 1L5LA 5K0GA 3I39X 5F77A 4MUYA 1NIJA 3HBAA 1JL3A 3TW8B 4NENA 5BR8B 2J4CA 3WDLA 1G42A 1Z2NX 2F1RA 2PBLA 2XTMA 5K2MA 4CKBB 5BMVF 3UT6A 2HJ9A 3DD1A 1IXKA 1T9GR 3V2GA 1OFIA 3CUKA 1YGPA 2W98A 4QQ8A 4BE9A 4EB3A 4W5TA 2W11A 2IZZA 1EDZA 2PT6A 3MWYW 5LWHA 5ADHA 2QT0A 2ZIWB 4J16C 3KSUA 1FOEB 3M6MD 3PCRB 4XVQA 3R7DA 4AECA 3KDPA 3NEYA 4RLSA 5B2FA 2GDZA 1XROA 1KZ6A 4I4NA 2O6LA 4BECA 3OFSA 4RULA 8ATCA 2CKDA 4LI3X 5CA1A 1UJ6A 3U3RA 1O6ZA 1D0IA 3S8EA 1TOAA 2DF8A 3BS4A 4RK4A 2FHPA 2JFZA 2JJ2A 1I5RA 2WYWA 4OMFG 5JZOA 4MHSA 1JEAA 5KYWA 4TYNA 5KO2A 2YY5A 5DYWA 5AIAA 4ZZ3A 2P2ZA 3QWBA 4NS4A 1IAVA 3KALA 4G9GA 4OF4A 1T9AA 5IG2A 3BT7A 3BFJA 2IIQA 1H2XA 1QJ4A 2Q5JA 5FI0B 4B74A 1E4OA 2GLUA 3F7OA 5LWQA 2FVXA 5EHNA 5BWLA 4UTNA 3NPMA 3CF0A 2COEA 4HEQA 1KMMA 1DTEA 4Z2AA 1WSBA 1QCZA 2J08A 3LGSA 1Z0JA 4MQMA 1Q0RA 4ESEA 4RIIA 3CLTD 5I7HA 4KHPB 4OLJA 1QYXA 5AQ1A 1GQQA 1Y3BE 1UJCA 1B6GA 1FX0B 1RKUA 4EGSA 4PZZA 2HIHA 3HCAA 3LI2A 2V1UA 5AJUA 3CINA 5J58A 4ZAFA 5IYZF 1SCUA 4M6WB 1GVHA 4ZVNA 4BO2A 4LF4B 3SBXA 4L4ZA 2OO5A 5JIBA 2G1KA 2YMQA 4IQ8A 1AURA 5EXEA 2OVBA 1L7NA 2DKOA 2L69A 4GRDA 3IAFA 2P6UA 3BMNA 3QVTA 2WQZA 5DI3A 4EO7A 3S2YA 1XRRA 1YZUA 2HJHA 3COJA 3IV9A 1U0TA 2QGFA 3OZWA 1KMIY 2Z58A 3AHHA 1NKVA 2QLFA 3E7FA 2B9EA 3IIIA 4HNHA 4KGXA 4N82A 2JFHA 3HV0A 1SEPA 4IGEA 3K9HA 2FPIB 3A1FA 1L5NA 4MUMA 4OLFA 1LRJA 3RV3A 5JNRA 2V98A 3TX2A 2ID8A 5K03A 2JD2A 1GQOA 1V3TA 2AR9A 2VP2A 4TKUA 2A9QA 1ID1A 3V8BA 4EUSA 1KJYA 2HRCA 3B1JA 5FBKA 1AK2A 1DAHA 2M6RA 2O5RA 4HMQA 4JA0A 2DUNA 5EMMA 4WMLA 1Z4LA 1ADGA 3D0OA 4IQ4A 4PO9A 4B6QA 1UMCA 1CY1A 1ZUD1 3FPLA 3IBTA 3R6DA 4W5QA 3L4KA 3WE7A 4Y2UA 4EYGA 1AJEA 2WG2A 5CCEA 2B6NA 1PIWA 3KHKA 3LQQA 4Y2JA 5E0OA 3HI4A 3T61A 5B7NA 5LOVA 1U99A 4KNWA 5KX5A 1XKXA 4Q39A 5DCYA 3OZ7A 3SWWA 3ZPXA 1EG2A 1F8GA 3GRCA 2FEXA 2J46A 3KWJA 5HG0A 1ODIA 2Q0QA 1PWEA 2VL7A 3I23A 3NHSA 3NHYA 4JYAB 3DPUA 1C7RA 3SGLA 4XM1A 3M82A 5CIQA 5B1DA 3UWSA 2P27A 4FFRA 1DKUA 4J7AA 3P9SA 5IK2D 3ZV4A 2H1SA 2Q9BA 3JQRA 3EX7C 3V00A 4OHUA 1SIBE 3RH0A 3GH3A 1KS2A 2FPPA 3QBTA 4UEWA 2WK1A 1XA0A 4JQZA 1Z6XA 4ZRNA 3B6IA 4KN9S 3V4RA 2H9IA 3D4OA 4OKSA 1ONSA 1D7OA 1KPIA 3P5BA 3QYJA 4AVYA 1ZEMA 4R71A 5KNDA 3RD5A 3T95A 1FMFA 1M2VB 1S3FA 2QE7D 1JR3A 3EBOA 3LFTA 4H6XA 4AJ4A 3EEFA 5FO1A 3SZMA 2C78A 2GK7A 3BBLA 4RY9A 5T7BA 3EGEA 1GTVA 3HDQA 1JEJA 3R41A 1QF7A 3HPRA 2B36A 4JT8A 5DM2A 2YVAA 1KXJA 4AB1A 4XPIA 4ZCTA 3PRHA 3OFNA 3NC4A 1XPRA 3VSCA 5AVZA 2ATVA 1R18A 2AYZA 4K3UA 4BB0A 2G0TA 3MHPA 1U9JA 5BUCA 2GLXA 2W83A 3EH2A 3NC1C 1PJTA 1LU9A 4EWLA 2WU8A 3EBLA 4CM8B 1G6Q1 1KJNA 4RZIA 3H9GA 1JB9A 2D3TA 3QELA 3WL6A 4W63A 4ARSA 1AUPA 4BV9A 4DB4A 1FF9A 1FXSA 1XMOB 1J7KA 5KNBH 3A9UA 4KN5A 2OZVA 4YRMA 5IMSA 2B1IA 2JVKA 1E96A 4K2AA 1H93A 4URXR 3CUEF 5TY0A 1QLHA 3FYTA 3EWNA 1KEZA 4UBJA 5A05A 5CFZA 1X80A 2HRDA 3OE7A 5K6AA 1HGXA 1YRYE 2DPYA 5E2BA 3PQ4A 3A0RB 1P1JA 2BBTA 4ASUD 2Q99A 3G85A 3SR0A 4C0SA 4RF5A 3MLAA 3GLIB 1E1RD 1T4DA 2R4TA 3FSGA 3NEJA 3OQPA 4FHEA 4R7TA 3B52X 4S2UA 4Q9KA 2C7VA 2A0YA 2B7CA 4M0DA 4RSGA 1CULC 4ALJA 3QUSA 1G20E 1VE7A 3GPCA 4EI8A 1O4WA 1EQAA 2D0IA 2RKBA 3BK7A 4LSGA 3H2KA 4RM3A 4Y0AA 2QAGA 1BAPA 1BA2A 4Z49A 1BD4A 5CUQA 4NAVA 4XIGS 3C3CA 3HN7A 2I71A 4X6XA 4L02A 5A9SB 5NULA 1OC4A 4WZ6A 2UVQA 1EFHA 4EECA 1E77A 3O8NA 3USES 1XRJA 5HRCA 2B0CA 1V1MA 4YVFA 4C01A 5GONA 1WHTA 4AZ3A 4LVNA 2O2GA 1XIVA 3DCIA 4RGYA 3NNNA 3TNYA 4ZMSA 5JJBA 1L7BA 3KHSA 1A9PA 3AM5A 1QK4A 2CYBA 4KODA 4RD0A 4J91A 3UJ6A 1ONOA 2O2HA 4MCIA 5LUAA 2HFJA 3RU7A 1MDFA 3KLOA 4LF7B 4BKQA 4M9CA 4XVRA 1CUBA 1KP3A 3A37A 3WGQA 2CLOB 5CX4A 5I7RA 1ZMXA 3AILA 3OTHA 1O54A 3S5JA 4FWTA 4NCJA 3Q8KA 2EAUA 3LDUA 1E5QA 2H85A 4LDJA 2E4AA 1SQGA 2OAQ1 2ACWA 3M1YA 1SB9A 1DTWB 1F38A 1YRWA 5AJYA 4CLHA 3LK6A 4HPWA 2G7ZA 2UUPA 2GYWA 4JHLA 2D1FA 1JG4A 1LQ2A 2DBVO 1Z7WA 2A67A 2ZJ3A <