1S2LA

Purine 2'deoxyribosyltransferase native structure
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
167
structure length
165
Chain Sequence
MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFEIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
molecule keywords purine trans deoxyribosylase
total genus 49
structure length 165
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s2lA00
2IZ5A 2PMBA 4I4IA 4HX9A 3U39A 1S2GA 4LJKA 3PFKA 1F8XA 4A3SA 4OHRA 4MEJA 2F64A 2IZ6A 4KXNA 4FYHA 4KXMA 4FYIA 2A33A 2F62A 4NPAA 5AJTA 3OPYA 4KXLA 3K2QA 2NX2A 2A0KA 1S2DA 4LJLA 1S3FA 6PFKA 5AJUA 4OHBA 3O8NA 4MCJA 1PFKA 4P5DA 1T35A 1S2IA 2HIGA 4FYKA 4I36A 2F48A 3O8LA 3MAJA 3GH1A 2PFKA 2F67A 3O8OA 3EHDA 4U1RA 4LJRA 4JEMA 3SBXA 3UQZA 2Q4DA 1YDHA 2KLHA 1WEKA 2F2TA 4WL0A 4PFKA 4RH3A 1MTOA 3F5MA 3IMKA 2Q4OA 1S2LA 3QUAA 3OPYB 4JENA 1KZHA 5ITSA 3HNOA 2KHZA 4I7EA 1RCUA 4JELA 2IZ7A 3BQ9A 3O8OB 4P5EA 1WEHA 1ZXXA 1F8YA
chains in the Genus database with same CATH superfamily
3QFSA 3LPMA 2P9GA 3R5FA 1NATA 1TJ3A 3HXKA 5CU7A 5EIHA 2FJPA 3KJQA 4KXQA 1U0HC 5EZ6B 1AS0A 2O8CA 2NXWA 2JJ1A 5F9FA 3O83A 2NTEA 4O6VA 4AICA 5A0FA 1HETA 3SYLA 5SZKB 4LSMA 1NF9A 1VJTA 4WV3A 4YB8A 2WJHA 2H4ZA 2WWTA 4JBHA 3AFOA 1AKTA 1HYHA 1CR4A 1OX4A 1MG0A 4K9OA 3DYIA 2IE8A 3NYWA 3S8MA 3UFXA 1XCOA 3ZV7A 4PR3A 4CI9A 5KQPA 5ER9A 4XR4A 3GFQA 4Y6PA 3MTJA 5JAUA 3NS7A 4ESHA 1U90A 4CHGA 3G7SA 4H7IA 3MFQA 1E1RD 1EXNA 2HCTA 1CRLA 2C2ZA 1K8QA 1FFDA 3RTGA 5JRJA 3EPJA 2XUPA 3F3YA 4TYNA 3MCAA 4EFMA 3KTAA 3OLXA 3SCZA 3CF2A 4PV7A 3UKDA 5JD3A 3LYAA 2OENG 2O2JA 3ZQKA 2BGUA 3E58A 3RJ9A 3M4YA 5IJZA 5AW2A 2XQIA 3B1KA 3FMFA 3I4CA 1X7WA 3PD7A 4IW3B 4ILEA 4LE0A 4PC1A 4R01A 4W5QA 3SC6A 3TD9A 1KZYC 2ZVJA 3E9QA 4KVAA 5A3RA 4DCSA 4RL4A 3ZJUA 3H5VA 3PFGA 4X0EA 2H1OA 2ZRNA 1P1CA 1BCRA 1HORA 1DT5A 3R0XA 5EJ4A 2XYGA 3A4VA 4H6XA 4AP6A 4WZBA 1O5TA 5IVPA 4TWZA 5FNVA 2JARA 4PYMA 2V0NA 2E7ZA 3U4GA 3I8SA 1TK2A 3SR3A 4CCSA 5BSWA 4N40A 3W7BA 2R6AA 2YJ4A 2PRYA 5B1IA 3FYCA 3BXEA 1TAUA 5AKZA 5D84A 3EC1A 3I5UA 4YP0A 2VCEA 3ND7A 1FFAA 5IC4A 1IVNA 5EHZA 4GLLA 2W43A 3GGSA 4GR4A 3EFEA 1ZL0A 3P0RA 4LZJA 4MCHA 2G1AA 2OK8A 4XYBA 3EJWA 3IQXA 2FAXA 2QU7A 2Q6LA 4MMYB 2I3BA 2Z2KA 3I8XA 4MH0R 4HWOA 5EWJB 2WIKA 4BNMA 1YUBA 4HYEA 5DK4A 1KEKA 1W581 1K3UB 1E4EB 1CQIA 4Y1EA 4JV5B 1UBGA 1J56A 1BN7A 1J6UA 2QHXA 4PSCA 3SYKA 2G9QA 2I78A 4FWTA 1M74A 3EW7A 1GOTA 3HV0A 2O7NA 1GPKA 4YRDA 2GBIA 2F8TA 1QCYA 2PH7A 5DM2A 3BAFA 3USCS 3V1TC 4MB0A 3VHXB 4G0WA 3ZWYA 1SCJA 5CDFA 1X70A 4DR3B 5CEJA 3ELYA 3AFIA 3OOHA 4YRAA 3NBQA 2QTRA 1GEGA 5DSZA 3VVMA 1NJ1A 2ZT6A 3D0RA 3ZU3A 1D6SA 3ZTTA 5DJ5A 2WR8A 2HHCA 1PT5A 1A4IA 1FYWA 1SMKA 4PQRA 5C1DA 3A1DA 1YZTA 1GZ5A 1MAAA 3OC0A 3QM1A 4F72A 1GGJA 1SVNA 4L5BA 5LQRA 1C9DB 5KQGA 5EI5A 1G2PA 4B34A 5AR1A 4KQHA 4Q16A 3T1YB 1V1MB 3H5TA 1OUMA 1YIDA 4N3AA 2Q1YA 2I5PO 3CLSD 3I9MA 4XVUA 1H69A 1UOPA 3KUCA 1OBOA 1Z4NA 2Q6KA 4Y2UA 5C9ZA 3IL2A 4M0MA 1BGWA 1XDUA 3CY6A 3HRHA 2ISQA 3EDOA 4TMXA 3X2SA 2CLHB 4QWMA 3U4AA 3PFKA 3I58A 1IN5A 5LQUA 1GFSA 1X80B 1VE7A 4EELA 2BMDA 3CRZA 2Y1KA 1MVNA 2M6LA 2AEFA 2CFRA 2P40A 2EKLA 4LZPA 4AS3A 1GTJ1 1QUFA 2VOJA 3GFRA 2H1HA 4C05A 5KYXA 4EABA 3BFJA 1ZK2A 1PV1A 2RHTA 1WDKA 3JWHA 1XJ5A 2G0NA 3OF2A 4G2TA 4TS3A 4ZO7A 5FPPA 3SM3A 3VZRA 5BT8A 1B6SA 1C2YA 1J9EA 3NFRA 4RGYA 4XWTA 1Z7WA 3RYHB 3T7JA 3TJZA 1UJCA 3DFZA 2XECA 3FYTA 1K2WA 1PJBA 3L04A 3S81A 4X3CA 3ETHA 1YONA 1SKQA 1PFYA 4YPVA 2XOKA 3QWAA 1E7WA 3VR6H 2QQ5A 2GVDC 1L0BA 2F9LA 2DFLA 2ZAMA 5I45A 1YFZA 4PSDA 5JXGA 3G0HA 1IH8A 4S05A 5IKOA 1NM5C 1TC2A 3MCZA 2H1SA 3HVIA 3AU8A 4UAJA 1OLSB 3HN6A 3C8ZA 3MUFA 1YIAA 1AQUA 3KZMA 4D3ZA 1ZA1A 4ALMA 1YVDA 1P1JA 2ANBA 2EARA 1O95D 3QKRA 5E9JA 4D9HA 3LLVA 3N8NA 3I53A 3QHPA 3EGXA 3QPWA 3WOHA 4L50A 2O2YA 1VKRA 2VP2A 2X4GA 3HYNA 3MGAA 4PXYA 1Z7BA 2QE6A 5IRCD 1FMCA 2XNDD 3I09A 1VHJA 3GDGA 4FILA 4KDRA 1WG8A 1T8UA 2JAOA 1SOAA 2OSVA 2MIIA 2WC1A 3QXGA 4B40A 2F17A 3HFRA 4QFMA 4P92A 3V2IA 4CNQA 3RADC 3KE9A 3WBKA 2J6CA 1WD7A 3B7GA 4MPRA 4O08A 2W7TA 4HN4B 3TTWA 2G07A 2K6GA 1TQ4A 1EFRD 4FEYA 2VF2A 5FNZA 5BV7A 4F56A 2A57A 4KYIB 4WNAA 1LW6E 3X2FA 1LUAA 3VOBA 3GFBA 2OHIA 2I3DA 3BORA 3IA2A 7REQA 3T5DA 1TGYA 5I9IA 2AMJA 4FGZA 4IMJB 1GAXA 4L3OA 4BCCA 2ZIXB 1F5SA 5BMVF 3L6CA 1SCBA 3OX4A 1GCUA 1PV2A 3HCEA 3V1UA 3WL6A 5K4HA 4E51A 3NHYA 4DQKA 3ZLJA 1D2AA 1R9NA 4KNVA 4MUJA 4QGGA 1QBGA 2R44A 2PH5A 3QMVA 1QLJA 4IFTA 1C30B 1G7TA 1WX1A 2ON6A 4AKIA 5J1TB 2YV5A 4D8TA 3U56A 1R66A 2ZE5A 4II2A 1QRSA 2H5JA 3VNAA 4F3RA 1F6WA 3BWVA 3CTPA 4MQFA 3FNRA 1Q0UA 1Y5IA 1DEHA 3IOYA 5CG2A 5K0FA 1DE0A 1GFIA 1D03A 1XZMA 5C3MA 1WUTA 3K8QA 4D8WA 4YH1A 2H59A 2IZ7A 3ZC3A 3M1IA 1IMOA 2BM8A 2JZNA 4N3BA 1ZXXA 2VK4A 1ADYA 3M81A 3SLKA 1Z12A 2EZ9A 3RIEA 4ER3A 3ER9A 5TS2A 3SLRA 4D82A 3HO1A 2HDNB 3Q15C 4A36A 5B36A 4OQPA 3GPBA 2JEZA 4QDOA 4Y2SA 3UPDA 1T8PA 3VX4A 1ZJ6A 3CRVA 4FEEA 1MX5A 3WLMA 1M8KA 1IM8A 3MPOA 4ZAZA 3U3DA 4BKQA 1RP7A 1RMYA 2AXNA 3D59A 5FFFA 4Z7JA 3A26A 3NHAA 4YT4A 4QPCA 5TQ0A 1Y6JA 4K88A 1MJFA 3E0QA 4P3YA 3FSGA 4G2NA 4JI1B 3P19A 3NTXA 4HEJA 3GLFB 4P7FA 1OR8A 2VHQA 1TU0A 1SIBE 4JJZA 4MKXA 1ZMOA 2W48A 4HVAA 1RJ9B 3Q2KA 4PY2A 3S68A 4CMIA 4LNAA 5LWQA 5L6LB 4F46A 1E0AA 3UJBA 4LKOA 3SJZA 3KJNA 3PEYA 2R8OA 4Q4HB 4L3VA 5HSGA 1RS0A 3WLHA 2ZVDA 5FX2A 3QW2A 1XMVA 2CUKA 3MVEA 3UCEA 1X87A 3KPWA 5BT9A 3H97A 3HN2A 3NIFB 4NYIR 3OCJA 3SSOA 3ZWKA 2XCRB 1VYTA 4IGIA 1N5JA 3LCRA 2EG9A 2Q2QA 2YJ5A 3K5IA 4HH3C 1AKVA 4LFCB 1G98A 1Z26A 3FMPB 3IHTA 1CNFA 1ZESA 1Y8QA 1EA7A 4IDOA 4OV6B 4E0BA 3MWLA 3Q1KA 4N48A 5JT1A 3CLRC 3DMYA 4YRTA 5EZYB 3KT3A 4BRUA 4YV7A 4JZYA 5BSFA 5ARDA 3LWZA 2JLRA 2RHHA 5D1HA 4C3ZA 4EH1A 2QRVB 4MIEA 4QUGA 2QG9A 4I9GA 2VA9A 4CR6A 4J1SA 4PGGA 1HE2A 1M1YA 2RAFA 2VHXA 4JX9A 5CXXA 1L7NA 1Z45A 3V34A 1W4AA 1OT3A 2DPLA 1YR8A 4RKQA 3UUFA 3BEOA 3IXMA 4A0FA 1C4WA 2PLWA 1O6ZA 2PO7A 2ZAOA 4KVZA 3KEFA 4LK3A 2C2GA 3RYIB 3F6CA 1EQ2A 3E48A 1TTHA 1FYDA 3OQBA 3VOSA 1OPRA 4ARBA 3JD1A 1QK4A 1YBHA 2WD8A 1K66A 3MAJA 3KZCA 4HH1A 3SC3A 4P3PA 3EAGA 5DRTA 1N78A 1D5WA 1BH2A 5J2UF 2BGRA 2ZS8A 4ZU3A 3UC5A 4DV7B 5ER6A 1XGKA 1EHCA 4NBTA 4N9WA 1NOJA 3DF9A 4UASA 5C3UA 1IPEA 1L1FA 3ETCA 2DR2A 1Z5OA 1OWMA 4MUIA 1CZKA 3AHFA 4U2EA 4Z5XA 1P6UA 3RS9A 3E9DA 2DTDA 4U8HA 2PIDA 4QGSA 2CEAA 3W9YA 1Z4LA 3CZPA 3WSVA 1UKYA 4NQZA 5BWLA 3ZDBA 2WHPB 1WTAA 1GIAA 1LX6A 1RPJA 1U9ZA 4ZANA 4QEKA 3AB8A 1KAMA 1OC4A 3ORRA 1COWA 3DLIA 3OF3A 3U3ZA 4DRYA 3IMKA 3A1CA 4OOFA 4Q3DA 4MUAA 1LCIA 2P4UA 1T9HA 4HMPA 2GBCA 1R6VA 3BE6A 2P3LA 2LIVA 3UBMA 2GKGA 1JDPA 3IUBA 2HC9A 1G8SA 3DMFA 1GPUA 1T6YA 2H31A 3LT2A 3OEWA 4DUYB 2PIAA 2Q0SA 3JZIA 3WLNA 2EBHX 4AP5A 3O31A 3ICEA 2FCRA 1ST3A 2CWWA 1NYTA 3LKVA 1IY0A 2RAVA 4RF2A 3ICWA 1P5JA 1V26A 1DXQA 2B82A 2HRBA 1C29B 1KEEB 3CKKA 2WTAA 3F4LA 3H8SA 4H2DA 2ZVPX 5DXFA 1KJYA 3UK2A 4HTFB 1IUNA 3RF7A 4DSAA 2C5GA 4EBFA 1YR7A 3EVDA 3PXXA 3G79A 4YDHB 3IYLW 3ZQJA 3U4MA 1SHZA 1A77A 1KIFA 1MZVA 4D4HA 4D80A 3CJQA 2AS0A 3RK1A 3WRWA 2J87A 3CNLA 4W1RA 3EOBI 4CVNA 1PK9A 2GJAA 3DAGA 1SCUB 4AKEA 1OJLA 2C9OA 2Z56A 2PVSA 9ATCA 4AVYA 2DBQA 7MHTA 3OFKA 5HILA 3SZRA 2AN5A 2FSPA 1RPNA 5KTMA 1ZIPA 2AOTA 2QSYA 1JKJB 1FNNA 1DC5A 2BW0A 2P1ZA 3A06A 5C8VA 4G5QA 2C4KA 5ALMA 4ZT4A 2LNDA 1T9GS 4OX9Y 2WMOB 4NBRA 5KOIA 2BMVA 3TFQA 3ER8A 4JHXA 2JFUA 3PVSA 4EO7A 2R5FA 1LBSA 1I3MA 1IJBA 3F78A 2P78A 4LZOA 5HZGA 3GAAA 1OXBB 4GT1A 2OBBA 2PMDA 2OLEA 3DE6X 1AQLA 3TZKA 2O2DA 2VWGA 3RSCA 1RP1A 1EGQA 3GT0A 3L01A 2Q2OA 3JQBC 4GMFA 5LOVF 4GLBA 4HUTA 2ZUWA 3AUFA 3DDNA 2CFTA 4FEGA 1W6UA 4PZCA 3P9CA 2F8MA 4B85A 4UHDA 5KTPA 3ADOA 1DFGA 1K7YA 1J4AA 2MYNA 2V7WA 3KVOA 2I2BA 4C30A 3TB6A 1J20A 5DSTA 2D7JA 1G38A 4N49A 1QR2A 4ZZ2A 2ZBVA 4XLLA 1RBQA 4WWHA 2JFZA 3ZJVA 1GPAA 4WJKB 3CZMA 3ND8A 5DASA 1DRVA 4N9QA 2A5YB 3E5NA 3B89A 3RYFB 1DSSG 3A36A 3GB9A 3QITA 3RYCB 2B7CA 4A6DA 4UBJA 2PZMA 4EY8A 4WKBA 4F12A 1WB6A 3V7FA 1RNLA 3RYIA 2V74B 3PDIA 2BGJA 4BWYA 4RC9A 1C80A 4BO1A 4JL6A 4F3NA 4LGYA 4QBGB 3GFFA 5A7FA 4XX0B 5TQJA 2L17A 4HQ0A 1PT8A 4HC4A 1FS6A 1FXUA 4ZCLA 3O8CA 1XEFA 4PZDA 1LPPA 2Q3DA 3AB3A 3L6EA 3BILA 1CZHA 2GT1A 3HR8A 4NZNA 3UFXB 3VM6A 1TM4E 2C88A 5CBPA 1WXHA 1BSVA 2DPGA 2PXXA 4I50F 4I6JA 3RSHA 2HUPA 4B2PA 2RHOA 3BE8A 1XZPA 3DC2A 1CDEA 3CX3A 3KRTA 4K1LA 5LZ8A 2CD7A 5JZ9A 2XNCA 1QIEA 2IW1A 3OZ7A 3Q7EA 5IH3A 1VMIA 2C7BA 1VE9A 3BJZA 4CETA 4OFXA 1XU7A 1ZJYA 1ODKA 4MUHA 3STYA 1CLUA 1N2GA 4GXQA 2ZWAA 2AJDA 1ORDA 1A7AA 1U2DC 1ILEA 1LA2A 3E35A 3WHLA 4WUTA 2UAGA 4Z7QB 4AWBA 3BQNB 3SS8A 3ECAA 3WYCA 2EEZA 2QBYA 1WDMA 3C8DA 3WMEA 2XGJA 3K0SA 3KDPA 3TR0A 2Q49A 4QZVA 4HAYA 2QLMA 1J39A 4YONB 1DARA 4ZI5A 1PS8A 2J5BA 4TT8A 3ZDQA 2NLOA 1DBWA 3CN7A 3HCNA 4NYJQ 3NIBA 2HQBA 3G13A 4RFSA 5HJEA 2R7AA 2WFMA 3IVMA 3LIIA 1E0KA 3OZDA 4IUBS 4Q12A 2I8AA 5T3UA 3S99A 4WDQA 1I10A 3KQMA 1WQ3A 3ED5A 1Z2AA 4RK5A 1G7SA 4D46A 2V6JA 1E3MA 1MB3A 4KJZA 2R1UA 1OXSC 2IFTA 4JKYA 1RXIA 3DVLA 1BYUA 4B87A 1UM9B 4FOLA 1H5QA 4AQYB 4E31A 5H0IA 5D6OA 2QD4A 4XYLA 2PL9A 1QGYA 1T15A 1FPMA 1Q15A 2Q3HA 1MDBA 1PAUA 2OFFA 4BP1A 4EFDA 1N1EA 2DUWA 4N82A 3VISA 4TLMB 3NHWA 1MBZA 1CJBA 1UBTS 3JQPA 4M1TA 3D43A 1T2UA 4RQTA 4X8OA 4DDKA 4TV8A 1TO1E 4MVJI 4FGLA 2J4CA 3HCPA 2O7RA 1P74A 3R5JA 4DBZA 4B79A 1ELOA 1U1IA 4UD2A 5K9ZA 1G2OA 2DFTA 2XNHA 3AF4A 3G8YA 1BJRE 1H2FA 4B45A 1WOMA 1QX3A 2PUAA 3T06B 3PUHA 4NENB 2FSUA 1L6RA 2I3AA 3DBOB 5KSPA 3SEFA 1X9IA 4Q34A 3VHXA 4AF8A 3DDZX 1LX7A 3EAQA 2QL9A 4JT2A 1ZUWA 4PZ0A 4D4GA 1WAMA 1Z7YA 2JJ8A 2ORVA 3SNHA 4J29A 2TYSB 3PLAE 1DMRA 5AVSA 2GNPA 2WWFA 5GV8A 3BYZA 1A82A 2AWNA 4D2IA 2WJZB 3LQ1A 3ELWA 3TSOA 4ROSA 1W59A 3A9CA 4XIJA 2A94A 2VZ8A 3OQMA 1T5TA 4V3CA 3R7SA 1PWZA 2QIOA 3UCFA 5HQTA 3ZTYA 3K1AB 3JY6A 2H5EA 3MTDA 1K08A 2J41A 1AZWA 4DLPA 2ZRPA 1GN9A 3CVUA 2FNAA 2A9QA 1ZGHA 1WPGA 4QHYA 4CL0A 2PSHA 3U4HA 5IKPA 2GXUA 2VUHB 1ND6A 3DBRB 3OCYA 5BYJA 5KTNA 3QVXA 2FMIA 1CF2O 3TZ6A 3AEXA 3DBLA 3G2IA 1XZKA 5ESXA 1GUBA 5KQSA 4B3SB 1IJKA 2ACKA 3NASA 4ZP1A 5TPWA 2DWUA 1K7XB 2HGZA 2JGLA 4YA6A 3E6AA 3GIWA 4BS9A 4XYEA 4BQQA 3NV9A 5C5CA 1JHQA 3GLHB 2Q45A 2W6IA 1QVZA 2Y2VA 3DEHA 4JSYA 3WI7A 3DTYA 3ZWOA 1DXOA 5GZ6A 4KXFB 3A9UA 3EMKA 2O8DB 4KRGA 3Q6NA 4P38A 4QXOA 4EHAA 4GPD1 2YINC 4YP9A 1L5HA 1ACLA 1BH6A 1HSZA 2J0UA 4KI7A 4DS3A 3D81A 4B75A 3ZIDA 2FZLA 1J0DA 5BW6B 3TGWA 1SH7A 2CDCA 2P2SA 5EMLA 1TVKA 4OXNA 1P3DA 1RZVA 2Y2UA 2ZWVA 4LTDA 4U3JA 3STUA 3WWOA 4LX0A 1MJHA 3A1EA 1WP9A 4JCCA 2UUPA 3GDHA 1UFVA 5FFNA 2ZSHA 4EG3A 3FCEA 4ENQA 3B6MA 1SKYB 4G5HA 1KS9A 4P83A 4TRNA 4JBNA 2WG2A 2ZXUA 1IK6A 3PR1A 3IAS1 4YLGA 1WKVA 3L8FA 3THYA 4U9HS 4DCTA 3O8OB 3OKPA 4G86A 1U2EA 1BE6A 3G3EA 1MAWA 5AKIA 4YMWA 3WB2A 1OFIA 4EB3A 4MW4A 4A73A 3NC0C 3I30X 3A05A 4OP1A 2Y0DA 3TM5A 1E69A 3DOJA 5JCJA 4DREA 1F60A 2F3PA 3H9JA 3V8RA 2VLIA 3V7NA 1S9HA 5KAMA 2GPJA 4IF6A 1P7ZA 4IGEA 1WKCA 3KVNA 3R3HA 4KPGA 5H59A 5TMPA 1NN0A 1S7GA 4ZGWA 4RZ2A 3UG6A 2Q5IA 3H18A 4DCVA 5FLXA 4UEQA 3UIEA 3FOZA 2ENWA 2WTBA 1HXHA 1HO3A 2WT9A 1NJSA 4OYLA 3VU0A 4RPLA 1H94A 3QKSB 5EHQA 3O26A 1QYDA 4X6XA 2XGOA 2CYCA 2HDHA 2QUKA 5FTWA 6NULA 5TMBA 5JROA 2HJGA 5KYYB 4MDFA 1SU7A 2WTXA 4EG0A 2QRNA 4EQ6A 2XJ9A 5ECWA 1XRLA 1QCZA 1TUEA 2SCUA 3FSEA 4BP8A 1U28A 1AKUA 3GCDA 1BDHA 1JG7A 2RONA 2X2EA 4DSZA 3S28A 4MA4A 3FPJA 3IQEA 4IEFB 4X1IA 2EG5A 1UJ5A 4AIRA 1WCV1 4W82A 4B4UA 3A6FA 4FIDA 4BMPB 4IHJB 2NNWB 4B3JA 1CF9A 4KCGA 1MR3F 1QGUB 2Y92A 3H2KA 4L72A 4CN8A 3H2HA 3IP6A 5KBYA 4QM6A 4LYAA 2EKBA 5IWCA 3T3EA 4GZ6A 4ND8B 2GILA 2ZQ5A 4DVGA 1OFUA 4J8PA 1JHVA 2YL2A 1AGYA 5HZHA 2VDMB 4OHYA 2O06A 2CBXA 2IDZA 3ASVA 2ZGVA 3DQPA 1X7XA 4JJ8A 2V1XA 1URPA 3A6ZA 5AKEA 2PVPA 4S24A 4X66B 3UGQA 1VIMA 3CE6A 2BFFA 3H0EA 4KZKA 4N5DA 1XV5A 2WSSA 5KHLB 3NAZA 4CKXA 3VZPA 4D6YA 2IQ5A 3LGXA 4HQFA 3FNHA 3ET5A 5TRTA 5IM4F 5J40A 2BR3A 1ESMA 1EXMA 2ORYA 3ZDXB 1W7AA 1QF7A 3FUUA 4MB6A 3QNMA 1C3OA 2WDZA 1LC3A 1LBIA 4N0MA 4FN5A 2NXJA 1WU8A 2AHRA 2MR6A 2XMPA 4OMFG 3QVVA 4MGEA 1HL7A 4F3CA 1C7JA 2O8BB 2QUBA 2VNAA 2Y1WA 2RGBA 2VQEB 2IIQA 3BPSA 3KVRA 4F2HA 2ZEJA 4Y18A 4BGIA 1VYHA 4M98A 2RGCA 4TKVB 2MSKA 4OSEA 1W44A 3T9BA 4DIOA 3QE4A 2Q4EA 1OE0A 2OBFA 4AXXA 2H1VA 1UXJA 2DJ5A 4HRAA 1KZGB 3UJCA 2X3FA 2WWWA 3I45A 3W79A 4K6MA 1Y3HA 4Q1BA 4NCAA 3H13A 4QARA 4MW0A 5KPDA 1DQRA 3B13B 3OFSA 2NO5A 3MMZA 5LMZA 1H4QA 2PD6A 4DVJA 2JIMA 4D0SA 2FW9A 1PHPA 1G19A 2P5SA 1K75A 3AUAA 3ESQA 4RZXA 3STVA 5TDHA 3AQ4A 3H83A 3VR2D 1U9IC 3EEBA 5AI0A 2F8LA 2Q9UA 3BT7A 1RBMA 4K8RB 1PZXA 4MVJG 4D97A 4YV0A 5LNK6 3OTIA 2J4DA 2L2QA 3AG5A 3GJSA 2E89A 3S5UA 1UANA 3F1KA 3RJTA 4GPIB 3HXQA 1IHOA 3SPXA 3W34A 1I9CA 1V5FA 4J1TA 1Q0HA 3U39A 1NI3A 3OIWA 2O3SA 3H42B 4Q4JA 4X65B 2R8BA 3CLUD 1W0JA 1B93A 4KQXA 4BO8A 3NATA 3EOZA 4PC7A 3URKA 1I5OA 1RHKA 3R2JA 3VH4A 2MCFA 1NSTA 3GEMA 1O0SA 2HJSA 1U2GA 2HSWA 1QG4A 3AUJB 3IBCA 4RLQA 1VL2A 3Q9LA 2A9OA 5JCOA 5CBKA 5J4YA 5JJCA 1CD5A 1A4RA 1JHUA 4ZVLA 4JIGA 1BWQA 2WHPA 2G17A 1NNI1 1CUBA 1M6VB 4JMPA 3QHQA 3VAYA 2R2AA 3EX7C 3Q7SA 1OJ7A 3FAZA 4LY6A 3TS1A 1SHTX 4BNYA 2B6NA 2BH9A 3QQ5A 4HAVA 4KACA 1T1SA 5DN6A 4CCYA 3LW7A 3L0CA 4TYQA 2FA9A 4AMGA 2CNWA 2G1PA 1GSHA 1VE3A 3RFCA 5PNTA 4HEQA 3IH5A 3TLKA 2HWWA 1DX6A 2WNSA 5AVJA 4H9GA 1ID1A 1GXSB 3U49A 3K8YA 5COBA 3VTAA 3RKUA 3NDBB 2G7MC 4UBLA 6LDHA 2OZPA 1GUYA 2NQTA 1TI7A 3ANNA 2IYQA 1CZLA 1QHSA 1VIVA 3KZOA 4TWBA 5B7QA 2BM9A 3A58B 4J07A 4BNLA 2HUNA 3HJAA 3LECA 3OLWA 1ZVVA 1SQSA 2AB0A 3ZWVA 1X1DA 5AESA 5HVNA 4FYKA 3OAAD 2YXBA 2C7OA 1GKKA 1KYXA 1YQQA 4BE4A 4A82A 2GNOA 5K6RA 1ZHOA 2RHCA 2NIPA 4UDXX 3T3DA 3WGOA 4AW9A 2I0FA 3TEMA 1E6EA 1RWWA 4M7WA 1TFUA 3ZW9A 4OIFA 5GONA 3L4BA 5LQAA 1YDWA 3WWYA 4QKQA 3ROXA 1ZOOA 2IYNA 3L7MA 4J3JA 2BFAA 1K06A 3IQZA 1I5EA 4RS3A 3HKBA 5HA5A 4YLYA 3BK7A 3K8OE 4TSFD 4DGQA 3MRXA 3NOXA 2OYRA 2D1TA 1KQNA 1RADA 3RSZA 9LDBA 5B12A 5CCEA 1D0VA 4FC6A 3I6ZA 1U3GA 3CJTA 4LWPA 5HDBB 4A9AA 4IJQA 3T99A 5FPHA 2NO9A 2FZVA 3V7UA 1A9YA 1XQYA 3PPIA 4XGQA 2EZ8A 1I9GA 1ZI8A 3OZIA 3PGA1 4WNAB 1GDTA 5I8PA 1TLFA 1HYQA 2W11A 1SA0A 2X4IA 3WL7A 4PHCA 4QATA 3ZHQA 4H60A 5COQA 4H3KB 3ZE8A 3ZEAA 2BLLA 4OLHA 2JFWA 3OICA 2XUAA 2D62A 1HDZA 4OHCA 1D1SA 3U3XA 3WIBA 1MB2A 1V7ZA 5K3CA 2DQSA 3L0DA 3O74A 1ISFA 5HQ3A 2PWAA 4NE2A 4N6NA 4XM0A 4KN8A 4MS3A 3WWPA 1QPBA 1N7HA 3EQ6A 4ZQEA 1Q57A 1K92A 2LPMA 3EMVA 5I9BA 1KKLA 5A03A 3LFHA 5M3BA 3DWEX 2FCAA 1S2GA 1ZUHA 3MHPA 1E2KA 1D0SA 1KARA 4EPTA 5TPWB 2PQMA 1Z06A 1IOVA 3CRQA 3DZDA 4ITUA 2ZR9A 3Q8KA 1I2CA 4LMRA 4TZ6A 3OO1A 3DPIA 4NEGA 3EH1A 4H7FA 4CMIB 4EHIA 3Q7TA 4GIBA 3QTLA 5JG7A 3CVWA 1VSBA 1S2OA 2L42A 2N42A 1CC1S 3BHIA 1A8SA 1ESDA 1JJVA 2H6EA 2HQSA 1Z74A 3Q85A 3Q9SA 2SCUB 4MV7A 1CG6A 4BB6A 1ABBA 4GKKB 1E1RA 2W71A 5B2EA 3NDJA 2EW1A 3OM9A 4JXKA 2B3TA 2VZ9A 3ZHOA 3L7KA 3S2UA 3ML1A 3WRXA 4A10A 4LF8B 4LRWA 3DNFA 5E1OA 2X1LA 2D4AA 2DGDA 2QYTA 2OGZA 4HX2A 5FF9A 2ZRFA 2Q5QA 3KB1A 4KXUA 1UK7A 1QP8A 2ODPA 1SKUA 5KSWB 1Z0ZA 2AN3A 2AK2A 2GBGA 3O2JA 1FNCA 4G24A 4O33A 3L7OA 3MS7A 4PCUA 1SHJA 5CG1A 2ERXA 4RV5A 5FJIA 4CV1A 1JTEA 4EY5A 4XVHA 4W5NA 3I01A 3K2IA 5ILQA 4US1R 5LR6A 4G4SP 5A71A 3VAAA 7REQB 3PB3A 5EIEA 2OQIA 1AQYA 4M1MA 4TTTS 1NF3A 3MWEB 3BL8A 4NY1A 1JR3A 3QWHA 4DLWA 3U3RA 3MQ2A 1OAKA 3OZBA 3SEQA 1FJGB 1YQTA 3K9LA 1QQTA 1N75A 4IEIA 4LVOA 1DELA 1KK2A 2Q50A 2X0IA 3TTSA 1ONPA 1JFFB 1RZRD 1J24A 1PSZA 2EJVA 3HEMA 5TPZA 4DJFC 2G82A 4RX1A 1RPTA 1VIAA 2NQ8A 2P65A 5IN4A 3ACDA 3OA0A 1M75A 4CEJB 4RZSA 2IELA 3VR1A 1OV6A 4JJ4A 4QHTA 4KV9A 2GZ1A 3D4OA 4AY3A 4ETWA 1QVRA 1KI7A 1RTKA 3ILVA 2FSIA 4MV0A 5BP7A 3ZDYB 5MN6A 1UOOA 4B4KA 2VLBA 4CMGA 4Z53A 3VA7A 3ZBQA 4XB2A 3GLGA 2WIBA 4XAQA 4K9QA 4XDZA 4YCBA 1UXGA 3IHWA 2O0LA 2EBFX 5GJVC 4N0QA 4DAOA 1AV6A 4JLAA 1P4SA 4LRYA 2HNAA 1OMOA 2O8NA 3CWQA 3LOQA 3JAMA 2O8CB 1U2ZA 1TRKA 1MO2A 3QPAA 4CFSA 3VXKA 2HLDD 3TL3A 1X0XA 1RHQA 2OGTA 4TXLA 1X39A 5E3IA 5JY6A 3GJTA 1A9QA 1OKKD 3JQFC 3L9XA 3M6LA 4H1HA 5EWMB 1E6WA 4XWAA 3EY4A 4ZGBA 1RCFA 5M04A 1YJCA 2DOKA 2VHCA 1YRAA 2FWBA 3NG1A 4WKOA 4WK4B 3PI6A 3KTFA 3L8ZA 1D3AA 2JA2A 4N4AA 1BVRA 4NOLA 1OAOC 4ZDKA 2P77A 4DFDA 2VNKA 3EZ9A 3RREA 2ZYVX 1NZDA 3KVYA 1JGTA 1H8EA 2OAGA 4H35A 3P7MA 3QLUC 4XASA 3HZRA 3OJCA 3FCYA 2P67A 1X1RA 2GRUA 2C42A 3AR6A 4KQ1A 3L43A 1FYXA 3PC7A 4LPSA 2J3HA 3I4FA 2X19A 2BZSA 4ZEXA 2QZPA 3M9LA 1O5OA 1T1JA 3EPRA 1L5SA 4KO3S 3I9V1 2B4KA 2P7HA 3EDQA 3KL4A 1UBEA 3EXEA 4JLMA 1OFHA 1RKUA 4WKNA 4M1YA 1A5SB 1QO0D 4QU0A 3Q4GA 4GW3A 4C4YA 3QVWA 1XVTA 1RI3A 5A1JA 2IZ6A 3SHTA 1XU4A 3C3XA 4I55A 4TWAA 2AG0A 3WHKA 5JARA 4MS4B 2QB5A 1C3XA 1JLRA 2E6UX 3J81A 1HE4A 3AP2A 2B1GA 4Q0MA 3X1ZA 1C0IA 2IQIA 3MCUA 1DIAA 5EMHA 1JYSA 2IX9A 4AP9A 3UUEA 4AG6A 4F6RB 3K32A 3KXDA 2C4TA 3DDWA 2VWPA 5ERXA 1VLMA 4OG2A 4AJ9A 4JBLA 3HPRA 3PGVA 1KVTA 3GJQA 4G37A 3RVMA 1O9BA 5M5BA 1YF3A 2A0WA 3IODA 2QPTA 5G40A 1ULHA 2V5UA 3ENVA 2HU8A 3AVOA 4OK3A 1RWKA 4C0BA 1U2RA 1TQ2A 3WK6A 1WU7A 1YSCA 2R6ZA 3V8VA 5AW8A 1PDVA 5DFAA 1SIWA 2R8PA 3V1KA 2FRVA 4CUJA 2GYWA 1VLVA 4QTTB 8OHMA 4ID3A 2Q41A 1NG9A 1PFKA 3DE7X 4UD6A 4DR4B 3VQTA 4RTLA 2P27A 3MB8A 1H5NA 4FMDB 3T15A 2EC5A 2Y6UA 4DKJA 4OX9B 4INAA 9MHTA 5A0VA 5H3HA 3O8LA 4MUMA 1ZVQA 2Q2VA 3MJ4A 4JBGA 4QTZA 3ZJ5A 4NV1A 4Q3LA 2D1RA 2MR5A 4M9XA 3VR4A 3WYBA 3BXGA 2YZNA 3F97A 3PFIA 5FTMA 4XQ0A 1MMFB 1BKYA 3G9XA 3IPXA 1SHKA 4M9CA 4ALNA 4B71A 4ZTUB 5ANRB 1E0DA 4HFMA 1TA4A 1E6UA 3ZEIA 1IWBB 1JQKA 3R41A 4RTQA 2K4MA 5LIRA 3T1HB 3KHSA 2HMTA 1KZ4A 2OZKA 3V4OA 4HNSA 2XHZA 3OEHA 4AJIA 1M83A 1S01A 2BFEB 3EZ7A 4XI9A 2FUKA 3DMRA 2C1XA 3RVNA 2WLSA 3TIFA 3FMOB 4ZI7B 2AE2A 1J42A 2GERA 1CIJA 2HHJA 4XM2A 3RHFA 2UZAA 2IUTA 2JBWA 4FYYA 4DMFA 2IYVA 3NAGA 3PFBA 1G5HA 4RV9A 4D3SA 2HRRA 3H2ZA 1VJDA 1KWKA 4YAJA 5K2MA 1YZVA 3KUXA 1JA1A 1ZOPA 2GXSA 4FJ0A 3BE5A 4KLNA 3VPCA 3VR3D 4WK2B 1W29A 1QIGA 4DNQA 3IUYA 3AVTA 1NMXA 2W83A 4ZARA 2PX0A 2QLJA 2WSIA 1WLYA 4FNMA 3AB7A 4YRIA 2X8JA 4CKYA 5KX5F 3QQPA 2W2NA 3BS4A 2OFWA 3MTAA 1PS0A 4K3UA 4A8TA 4Q93A 3R77A 5JJ5A 1UDBA 4J2HA 3VKGA 1XF1A 5EIWA 5IU6A 1HLFA 1T0HB 2O6HA 4DEVA 3QNUA 4K9RA 3R9XB 2E49A 3KJZA 5J1SB 4NOKA 4I50B 1U5BA 2NV2B 3DDSA 2V3WA 3C5VA 3JWJA 3R20A 4OUKX 5AKYA 4UMFA 5JH7F 1V45E 3EULA 2MMCA 3OC6A 4G1BA 4A3SA 4TTSA 2P35A 2OR3A 1E6MA 5B5SA 3LUBA 1TJ4A 4KGZA 5BOSA 1A8PA 2PUBA 1BJKA 1JSCA 5KYWA 1P1RA 2PGJA 4MRMA 2O54A 3SR0A 2IS4A 2W2LD 2HF9A 5IDWA 3RS7A 2R96A 1CNEA 4I5GA 2VCHA 5DSXA 4CEIA 4C4TA 3B8EA 1OLOA 1DFIA 2WIGA 2NVBA 4LXYA 4WY8A 2GNAA 1U2QA 3CEJA 3T3GA 3VPGA 1XMJA 3GHHA 1NP7A 1E6LA 2F1KA 2VJCA 4KQMA 4GS5A 1RM5A 3EXG1 4F5ZA 1KMIY 2ZZMA 4NQRA 4RHCA 1K6XA 1NJFA 2I62A 2Z4SA 3E0XA 3L0OA 5DE3A 3ZDEA 4EHJA 1MEOA 2HA5A 3LHDA 4BE7B 1J0CA 1W96A 3GJ0A 1XAJA 2B8EA 3PX3A 2WYUA 4IUDS 1GITA 4MS1B 2ZITA 5C5EA 3I0ZA 1Y9DA 3KZNA 3O1LA 4HDSA 4MV1A 4DSUA 1DQZA 3IEPA 4BNIA 1N5LA 1NXTA 2IBSA 2ZB7A 1E7YA 1DCKA 1SQ0A 2VCYA 3HLYA 2EV9A 2R65A 1OT5A 3R6DA 1NW4A 1RDFA 4MW5A 1DOHA 3C97A 3PRHA 1Z8HA 1L4KA 1PJ4A 4TLCA 3T61A 1KOGA 4YJ3B 2GZMA 3E18A 3GLKA 1TZBA 2ATCA 3RWBA 3GDWA 2R8ZA 5TC4A 1L8AA 2AW5A 3BD8A 2RGRA 1EUDA 3L1KA 5TGDA 3OQJA 1HGXA 1YUNA 3RVSA 3QXXA 1Z5WA 1PRYA 2NU9A 4JA2A 5DHQA 2P4HX 1H5UA 3I9NA 2SHKA 2ZR0A 3AUSA 4MWBA 3FE2A 3K5HA 3M34A 3IR5A 3WB0A 2C84A 3N0XA 3EXHA 4EVIA 5IKMA 3KR9A 5AICA 5JYCA 3HR7A 5I6DA 5I7UA 1CHNA 4MRNA 1OX4B 1Y7PA 2YNMC 1J7JA 2QDXA 1F3OA 3C3BA 5TNXA 3TB4A 4C7MA 3OTWA 4FYMA 3GA5A 2ZYUX 5D00A 3T1NA 3LU1A 2XKKA 5LA6B 3AEUA 3IRUA 2GRAA 4DGSA 1H42A 1L5VA 4S1PA 4XDHA 2UUOA 4WXHA 3ZQ6A 4C4PA 4PRYA 4RGQA 1H2WA 3JASA 4RZQA 4TUYF 4EYQA 2OFXA 3DVRX 3MPUA 2NACA 4HQKA 3EDYA 3FYUC 2J3KA 3E84A 9GPBA 4BKUA 3HK2A 2BF7A 1YK0A 3AVWA 3W7AA 1M5UA 1LFAA 1A5ZA 3IPLA 1JS1X 3IT2A 5T64A 2CF6A 1II0A 4RPKA 3AIMA 1XEXA 4FSHA 1BQEA 2Q28A 5CVCA 3ZUGA 4J0CA 1W2WB 4A0QA 4F3YA 1GAJA 3DWIA 5LLSA 4FXOA 5F3DA 3C85A 1XKQA 1EDOA 3GZ4A 2DBVO 5BUCA 4F96A 3AM5A 3HQ4O 2DBYA 2PKYX 3HGQA 5JBQA 1A9XA 4JY7A 1ZW1A 2EJUA 2R1ZA 3WA7A 3D7SA 1N34B 2EFDB 1WSDA 2P1RA 3WQQA 2X40A 3BB4A 1FJXA 4QYIB 3UHOA 3BULA 2IHJA 5T57A 5EJEA 1DX9A 3ZGXA 2FPSA 4O2RA 5F78A 4DKXA 5KWIA 2JFFA 3LCVB 3RS0A 4DWVA 4AUMA 4WAUA 5DGCA 3TM4A 1WUKS 4LXHA 2IUUA 2FSVA 3I8OA 1U8XX 2WWVD 2G6BA 3OZUA 3W78A 3HKBB 3EVEA 1E9EA 3EXHC 3JR7A 3BMOB 3KFVA 4MEJA 4GOXA 4MR9A 3UV3A 1OTXA 2QP4A 5HIAA 2P6RA 4G1MB 5IT5A 1UEXC 5DV9A 5EIBD 1VE5A 2PV0A 1Q0TA 4LF9B 3HJFA 1PBNA 3AEUB 4FYHA 3DHNA 1CY6A 1X2EA 1IXKA 1DV2A 3CSUA 1DKPA 2GI4A 2H1IA 2OGWA 1AGNA 3TTUA 4EB6B 1I32A 4M4SA 5CVTA 2IGTA 3U17A 3A6KA 1P2BA 3U3KA 4JNKA 3TLBA 1K3FA 1WOYA 2PUHA 2P7IA 3HWSA 2C8LA 4JROA 3KYCA 3RPEA 4DMHA 3SQWA 2Q5CA 4RDXA 3KSAC 3QVSA 1J8YF 5FDFA 1ISSA 2QTCA 1TCCA 1PJ2A 3M0EA 3O4FA 1L5GB 2Q62A 5FO0A 3WMXA 1CJMA 1WUJS 1OVMA 3HKEB 1KO1A 3MM4A 1ZX1A 2FDRA 4QICA 2XGSA 2C9ZA 1W88A 1UMCB 3GRKA 5ALPA 1GXSA 4CF6A 1Z6AA 3N2ZB 2FEKA 3DV2A 1XFAA 5TARA 2FK7A 4KR0A 5AQ1A 4YRPA 3HJUA 4JKIA 4U6QA 1SZCA 1WUHS 4XOIA 3H84A 3JZAA 4QPZA 1I4OA 1R74A 4HQOA 1XMSA 3DE1X 3GPIA 2H4WA 4IOKA 3ZBTA 3ZWWA 1JLSA 1DAHA 1QFJA 3IDFA 4IZHA 3RCBA 4DIKA 1G7RA 1WHSB 3LJKA 1MC5A 4IOMA 1GQ2A 3RS8A 3GP3A 4IFIA 2AUTA 2WYOA 4WN3A 1R15A 3IOMA 5HTOA 4ZOLA 1NY6A 3OT4A 4MQFB 5LYJB 3GJZA 1OBVA 2ZFUA 4LIPD 1E59A 3IP9A 1UXIA 2AYYA 3H86A 2O0HA 4M9ZA 4NZOA 1U1GA 3EW9A 2FMUA 3BK1A 4U1RA 4GRAA 3H4VA 3TNDA 3WFIA 2JJ2A 4ASUA 3F8WA 4MYRA 4E5PA 2NWQA 4EZBA 2IP4A 3WB1A 3HG7A 4QBTA 5C18A 3D2AA 2ZPUA 1CQJA 4BFTA 3V2HA 1GCOA 2WM2A 3W3AD 2YZKA 4YJ2B 3BIOA 1ZU4A 1BW9A 4FB4A 1NDHA 3CQ9A 2VYCA 4MVJA 1NC3A 1ZNWA 4OGKA 5JAHA 5CFOA 4X20A 3TQRA 5CCBA 1QYCA 4ZOAA 1PQYA 1VP3A 3KQYA 4CIVA 5MN4A 1Y1TA 1Z15A 1Y4SA 2R1TA 4UATA 3DGFC 1FDUA 2ECQA 2P9YA 1ZGGA 5HCUA 4NECA 4Y30A 3T3NA 1GT91 4M1WA 4Y2JA 3L06A 1E1QA 1JNXX 5EQTA 5F1KA 5JXIA 2YVKA 1L5WA 4WUVA 1O2DA 1M8FA 2QN8A 3P0EA 3N2KB 1J8MF 4D1YA 3A3NA 4MQBA 5IS2A 1R8XA 1YB7A 4US2R 3VYVA 1QWOA 1ADFA 5BN5B 4ZC1A 1E3JA 3DDOA 3NGXA 4CV3A 2YMMA 1OZHA 3CPHA 4RJKA 3EEYA 1SUIA 2WTMA 4OTZA 3RASA 1TYBE 1RLOA 3F8TA 1Y9EA 4Y1RB 1TT7A 3T1QA 4R8LA 3JYHA 3T4XA 1OFGA 2N46A 4M54A 2FPUA 4XWYA 1JJFA 3C3DA 3PSAA 3MS4A 1E1KA 5E1DA 2GPSA 3LOPA 4Y6LA 4AJOA 4DCPA 3R23A 3TQCA 1D8AA 4DCNA 1UJBA 4DA8A 3TNLA 3V2UA 4C89A 1YVRA 5JI3E 3OWOA 4HPWA 3RTEA 2PYIA 2ZI4A 1Q19A 1A5AB 5ELLA 1ZNZA 4CKEA 4QVIA 1NZFA 1O97D 2XLBA 4Y9DA 2Q2WA 2NXCA 5CFQA 2UVQA 4Y98A 2Z2ZA 3I6BA 1ZKDA 3E22A 2DU8A 4LEIA 4UVIA 5J43A 2BP7A 2FDXA 2I1WA 3OVMA 4P33A 1Z4OA 3JWIA 4WERA 1NL3A 4DNXA 4RS4A 3TQTA 4RW0A 1XK7A 2DLDA 1RJWA 4LI3X 3WNDA 5C80A 2JCGA 1MAUA 1T2AA 3B5IA 2JGNA 3AG6A 3FIUA 2A5GA 3NETA 4H1VA 2NSDA 4QO8A 1HH4A 5HMMA 3RIHA 2EZ4A 2MT9A 1FFHA 1ZN2A 1FFEA 1J06A 3VR5H 4DJDC 2ZSBA 1I33A 5AK5A 2IZ0A 3UOAB 4IQ8A 5BSTA 4URVR 5F52A 2W2PA 3SVTA 1W85A 4HWPA 4TVBA 2X8AA 3IQIX 1XNHA 1QQAA 1N36B 2ES4A 3FGPA 3GR6A 2B36A 2NYAA 2XUGA 3DAHA 2NO7A 2WU3A 3IBGA 1Y6QA 4JUIA 5G0WA 2VQ3A 1U3UA 3UZUA 1Y7LA 4MYHA 2JIQA 3VOAA 1F6BA 2AQKA 4JXXA 2FTKE 1EUDB 4P3KA 1XMXA 4JI7B 3ZIAD 3W2EA 4AJEA 2XWJI 3R5XA 4MIOA 1QDUA 3OCWA 3H9EO 3QVLA 2J7KA 1GPDG 4Q3KA 3JVVA 1N5IA 4WCVA 3GG9A 3SOPA 2HQOA 3PHIA 1RI4A 5E95A 2ZJAA 4NAUA 4M46A 3NGMA 4RQUA 4LGVA 4MVJD 3MSXA 3O1HB 1CUJA 5ADWA 4CU2A 2KW5A 2F3RA 4KPUA 1HG1A 2GN8A 3QYPA 1EBUA 1V5WA 4QUBA 4HZGA 1RM3A 2FPPA 2QRHA 1KFJB 5IZCA 3HA3A 1LWNA 4N03A 4WZAE 2FH5B 1K5DA 3LK6A 5LNK1 1ZH4A 3I9JA 4I4LA 1HOTA 4OXQA 2CZGA 1WXFA 1H93A 2LV8A 4GBJA 4GXRA 3PYMA 1FYEA 3ZDZB 2KBEA 1ORVA 2VFAA 1C1YA 1RQRA 4RTRA 4IIJA 3MYYA 1JLKA 3PZBA 4MJ7A 4MQEA 4RCZA 3WYGA 4UFPA 5JHGB 2GN2A 3LBAA 1UAAA 5AVWA 1JHPA 4ZO4A 4B84A 1PK7A 2PCLA 4IM7A 5TX7A 3ROMA 2PX6A 3EIFA 2H11A 4C6SA 1E8DA 2YASA 4IJVA 4ZTBA 5IF3A 2AG5A 2J48A 1WMDA 5AK6A 3TLZA 3GLHA 2PWYA 5JSUA 5JMWA 1O89A 2CE2X 4XQCA 4LYHA 3O6VA 4NR0A 2AC7A 1SK8A 1ZC3A 3C43A 4GMKA 4DIUA 2IDJA 2AJTA 4JLSA 4TKLA 2C2HA 2YIJA 3COWA 4CIBA 1RPZA 1QG2A 4K6OA 2O8EB 4JLKA 4QOEA 1W9MA 2IWHA 3HADA 3I3SR 2VH1A 5BNZA 3QPVA 1AGPA 1OBCA 2FXVA 4BC0A 3AKZA 3ZTWA 2H7CA 3IV7A 3AHHA 4ZMRA 2DSTA 2PSSA 4JWKA 2Q6VA 3FWKA 4GU5A 2NV0A 4D9GA 3IVCA 4RIIA 2Q8QA 3OE1A 4LYYA 1E4VA 1X7GA 3DTTA 1BYIA 2D06A 3IKVA 1EFVB 1YFKA 5D87A 4C6RA 1EFTA 2BM0A 1RKQA 5E2IA 5KAPA 4GE3A 3NP9A 4IDDA 4BU1A 3ITEA 5AW3A 2CJYA 1GGNA 5FOWA 2YV3A 5K8TA 2O4CA 1PL7A 5EHGA 1E3IA 2PZJA 4NFSA 2BEWA 1OWOA 3IUMA 1EP9A 1IUPA 2W37A 3QX8A 4DTIA 2XQGA 2J3DA 4UMEA 4ZICA 4PLFA 1UZNA 4JD5A 5FPTA 5K0GA 2MSLA 2FKAA 1KL7A 1QYRA 2W22A 1Z8FA 1JPVA 2JI4A 2F43B 2YHIB 1FXWA 4G5OA 4MR8B 2NUAB 3FUTA 1HM5A 4HD8A 1S3GA 1JIXA 3DZKA 3OPYA 3H9BA 3DXYA 3RROA 3ZU6A 4C0HA 4BYMA 2CLFB 4M7RA 5IBCA 2JIBA 3W6OA 1RJDA 4NKRA 3MUNA 1DOAA 1U28C 1ZS9A 4H7HA 3R7FA 1P81A 4EPWA 5DM70 3O4HA 2VPWA 1U3WA 2XUOA 1BU8A 3OOWA 4JIMA 3WK9A 5JZVA 2OV6A 4ES6A 2R6FA 3ITKA 2RJ3A 5FHQA 1HKUA 2XTNA 4IPTA 2ZIEA 3AUUA 1KRWA 3QUQA 3VJMA 2ZSJA 4K2HA 2C7GA 1GV0A 1RC0A 2AG6A 3IEXA 4PFQA 2PG3A 5EIOA 3TEJA 4F2DA 2A1IA 2CVOA 1Y0BA 1IHYA 1Q7BA 3N0WA 3CZCA 2WJPA 1C3LA 1YQEA 5CFPA 4QG7A 1OH6A 1NOIA 4S35A 4G56A 4U5XA 1F2DA 3RGWS 2FRDA 2RBKA 5IKXA 3ZS8A 3ZCPA 4J49A 1BAPA 3TEFA 4D9CA 1Z2NX 3B6EA 3PVZA 1K6IA 2E4WA 1ZIYA 1QFSA 1OWLA 4IDHA 3RU2A 3WJ2A 2HZBA 4LRQA 2DSNA 1QP4A 1HNWB 1IN6A 1E62A 3D3KA 4FKZA 4PX9A 2H65A 2R79A 2ZOSA 5FQOA 4EY3A 1CUGA 1CZUA 3OO0A 2BSAA 2J3EA 3CR7A 3G5MA 4JFAA 3S4YA 3K9WA 1SXJC 4YAIA 4JEUA 4P80A 5DI3B 2ACEA 2JI9A 1KFBB 1JR6A 1FCJA 1G17A 1WZEA 3PYLA 4FFWA 4ZAGA 5I9SA 4BBPA 5K45A 3PC2A 5CNMA 1MPXA 1RHMA 1YJBA 5ALIA 5BN3A 4RMHA 1UAYA 1OLXB 4RVSA 5DLDA 3OF5A 2B30A 3NWJA 5CNIA 2GEDA 2C57A 1V7PC 1NNUA 4BVBA 3KAPA 4CMEA 1YWGO 3AI7A 5EVCA 1QIIA 3N2LA 3VDQA 1PTJC 1QH0A 3JYOA 4J0IA 1ZKMA 1JZTA 2WUDA 3N7AA 4C06A 4S0XA 3R3UA 3Q3JB 1QTQA 1YB5A 1S2MA 2RK6A 3QG5A 4D5GA 1XPUA 1VGRA 1KJ9A 2J59A 2R8RA 3B6ZA 1CCWA 4YJDA 3OFND 1KETA 3ZZNA 2H18A 4MYSA 2OD2A 4KQ2A 3IA7A 1ND5A 4RGBA 2WF9A 3T7EA 2X6RA 5AD1A 3BXFA 3ZZMA 3WL4A 1QRUA 1S8FA 1VG1A 3FF4A 4PBRA 3RH0A 3Q7PA 4GO1A 4YJFB 4CQNA 3HL4A 1Q20A 2GD2A 4PLCA 5EJ2A 2BUCA 5ALLA 3PL5A 2LVBA 4J4HA 3OQIB 2EATA 2H2WA 5IYZB 3DLBA 1I51A 2V3VA 3F6BX 4ED9A 2A7QA 1NLYA 3BSSA 1UP6A 4B32A 4FBGA 3I39X 1JIIA 4R54A 1Z2DA 4O3FA 4C3OB 4BB9A 2C00A 2G9VA 3M9XA 2ZYWX 4TV9A 3DHEA 4OGLA 1NI5A 2QM3A 2W5UA 3P71T 4I5IA 4JT8A 5LBUA 2YRXA 3UATA 5L7WA 4IRUB 4BV3A 4C0XA 1N9KA 4EENA 2WRZA 5I01A 1P1IA 4Q82A 3ZQUA 5EXXA 3L6DA 3O5AA 5BW8A 4C0SA 3W1EA 5C32A 3Q5EA 5F7JA 4R2WA 4X93A 4P0QB 4PLTA 3T5PA 4YGXB 3RTDA 3UNXA 1J0EA 4QSMA 4EMTA 4YR9A 1W35A 4F8YA 1M10A 4TLAA 4IF4A 2HQ1A 4R2HA 2D2XA 4ZRNA 4YIKA 2EWWA 4BZQA 2W93A 4MIYA 2EOAA 1F4VA 4ZI3A 3OM1A 2VKQA 3CF4A 3FGNA 4NG4A 4RVCA 4JLUA 5DYYA 1U3TA 3AI1A 3DONA 5BQ5A 5TPZD 1Z4IA 3IR6A 1E18A 4RKWA 4INJA 2OMEA 1R0RE 2QX4A 1CY8A 5DP1A 1NXOA 3IPRA 3WIDA 3TKAA 4OQDA 5TQVA 1HFJA 1YCGA 1A50B 4RH0A 1UKEA 1Z18A 1GKIA 2BY4A 4G63A 3FRHA 4HN2A 2C3UA 5BN5A 5HIKA 3V5NA 1UEIA 1O94D 3QMMA 4L16A 3S2GA 1JJAA 1HE8B 1R3UA 1TL7C 4ZVTA 4MDEA 5AW5A 5HCIA 1Z29A 1SHUX 2E1PA 1NUTA 1DQPA 3JQAB 4L8YA 3REQA 1TIKA 4L73A 4MR9B 3EIUA 3TRKA 5L7TA 3DL4A 1IVYA 1DKRA 1TAQA 1T1EA 1V16A 5KYUB 1TF7A 2GN9A 2ZRCA 2C2MA 1GA4A 2O20A 3DL7A 3HU1A 1AGXA 5AWFC 1IWPB 3G89A 4GWLA 1ICIA 1IL0A 1YL7A 2NAFA 2NUPA 2ZIGA 4K9KA 4ZYUA 1XTQA 5B3JA 5A3JA 3G1TA 3NALA 3I6IA 4NE7A 1MORA 1UMCA 2BVNA 4C3UA 5K6AC 1AN9A 4GQIA 5DNYB 2XRZA 1EXWA 2D7CA 3AINA 5JANA 2B34A 1FK8A 1H2YA 4YASA 4DL9A 1IEWA 2JFBA 5JU6A 4CIYA 1B1AA 3M1AA 4WH0A 4E6PA 1ODJA 2RCNA 1GPJA 1QVVA 2XTZA 2OHOA 3I28A 1I01A 1Z0KA 3FOBA 4PTYA 4AXBA 1PT6A 4O4LB 3MZ0A 3RKRA 2KHZA 1GYQA 3L6OO 3C5WP 2X0FA 1IULA 4HAUA 1R10A 3OWHA 5IARA 3GMTA 1SZDA 4WBSA 4Q7KA 2XZDA 1ZXBA 1YCHA 5HF5A 3ESRA 1DWQA 1UMDA 4AYXA 2ID4A 4M49A 2YMLA 1TQ8A 1XCGB 3VSEA 4UHFA 4ENTA 5EE9A 1EFUA 3HXMA 3LS2A 1VJCA 5EYPB 3ZHYA 1A8UA 1XZBA 3CH7A 1UADA 3WV4A 4GICA 5K4GA 3W2TA 2KYRA 4EHDA 5CIWA 4GGOA 3BJEA 1EZ4A 1T4CA 4YCJA 5HGJA 2H9YA 5IJ9B 2DHEA 2W2MA 2Z83A 4QAQA 3HYSA 4HDKB 3KG2A 5J2TF 1J5PA 5JNRA 1JFTA 1UH5A 2G3YA 3N7TA 3CG4A 2IYSA 2PT5A 1EXVA 2FMTA 2GQ0A 2DB3A 1RMTA 3C5EA 3TH5A 3G0BA 1RRGA 1E79D 4R5MA 4X92A 4LDAA 4WLFA 2EQ5A 4FOTA 2A14A 5F1YA 3SKVA 1LEHA 2FPIB 2GUGA 2WDPA 1EM6A 3HUFA 2I2WA 3TOZA 5L3ZA 2PUDA 4A27A 3FR8A 4GOOD 2DBRA 4CF5A 2Y71A 4OCZA 1VMAA 4D81A 1YULA 3OIDA 1NN5A 1ITZA 2DULA 1AKQA 2C3YA 2WE7A 4KXLA 4TTVA 2ZRAA 2X4DA 4QRHA 5H83A 4A0HA 1ESZA 4M7PA 3UOWA 3AC0A 1JQDA 1QZTA 4KWEA 1A9ZA 1NQXA 3IEUA 2AI3A 3L1HA 3PQ7A 2Q0HA 3OU6A 3PWZA 1NTRA 1SUCA 3LDAA 1SZJG 4FHCA 4NZ9A 3RUAA 4NXMB 1LBTA 2NUBA 2HFJA 3FJOA 4EDFA 5KWEA 4LOLA 4HQNA 4UOEA 4D45A 3TZHA 2PT9A 4FFMA 5KSZA 4I5FA 3DOHA 3UMCA 4F6LA 1TW2A 3NKFA 2EWVA 2D5AA 3BCRA 3C3JA 4MTLA 1L5ZA 2GA8A 5ETJA 4WNIA 3NHLA 1IBRA 3RRFA 1DEAA 5JXJA 1M34B 3QTBA 3STXA 1RWXA 2IY9A 2Z09A 4DEXA 4J7AA 1S4MA 3ZNPA 1C8BA 3LBYA 3T52A 3LNCA 4MV4A 3EZXA 5T3YA 3NYRA 2IEIA 3RNOA 3TX6A 3AILA 3DBHA 2WIJA 1LRJA 4OQMA 1V2HE 2AR9A 4MAAA 4NL4H 4C0AC 1YRQA 1BEEA 1X9GA 2COKA 4BZPA 4U2GA 2P4EA 4CLOA 3W8EA 2OM6A 1YJ5A 3OKCA 2K2QB 1PS9A 2RKWA 4HDMB 4UCQA 4NS4A 5FBLB 1VECA 2PMFA 2VDPB 3OLZA 4OLFA 2XWPA 3HB7A 2OQVA 2JHFA 1MOQA 4KSYA 1CUXA 3ANLA 3EWNA 1TQHA 4KZPA 3L0BA 4PTZA 4Y6GB 3WLAA 3AZOA 1JDJA 4WFQA 4QUHA 4C20A 3S3TA 1ONOA 2PA0A 2VK1A 3BQMB 1JEQB 3QUBA 1I3KA 1KEUA 2HJHA 4PW0A 5E6SA 5JSKA 3SF8A 1ZM2A 1EXDA 1N5MA 4PHTA 1LB1B 3O3CA 5A7GA 3GRZA 3HNOA 1P91A 3IPYA 4PAWA 3EGXB 1TYCA 4KFSA 1QH8B 1E5XA 3EF0A 1NF2A 2DY0A 1VBKA 1KMNA 1N4DA 4JC4A 1YJ8A 5T6MA 1RLTA 2FEMA 2WQ7A 4N54A 4Z0TA 3TKYA 3CB2A 4U9IS 2IXFA 3QV2A 5E7QA 2K5UA 3OZEA 1NT4A 1XT6A 3GHYA 3PWTA 2R8YA 2EFHB 2I7CA 5B7GA 1EX6A 3D8BA 5M29A 1RXWA 5BYKA 1BWRA 4J2OA 3VX3A 1ZCZA 3K20A 3ZNQA 4EA6A 2HQRA 4P32A 4DSNA 4R9UC 2IXAA 3ANXA 5KHOC 3KYDA 5J2TA 2XE8A 2GEKA 3K6SB 1O0BA 4Q9AA 3VR2A 4QGBA 1M6EX 1OTYA 1E9CA 4UTXA 1JH9A 1A1VA 5B3JC 2CJWA 1QU2A 4KQEA 2H4XA 2RB4A 3LKDA 4Y6RA 1QGAA 2BL4A 1Z0DA 5EMNA 5LLTA 5CCXA 3P9QA 1HX7A 3PLRA 4OGWA 5KDOA 4CN9A 2G1JA 1M33A 1JDBC 1TU3A 3I6MA 2GR9A 4B2LA 3DV0A 5EEGA 1RRFA 4UVHA 3HDTA 1N6RA 2V4UA 5COAA 2YZ2A 3FPHA 4IJKA 4LRXA 5JE8A 1PI3A 1X7ZA 2ZDGA 1R50A 1Z6YA 2IXTA 3B9BA 4JYMA 1WMAA 3ICCA 3PEWA 4IJUA 2XXAA 1MA0A 2FUG6 2XSZD 4YXWD 1KVQA 1RYYA 3AF5A 3I64A 4FWBA 3MRSA 3MELA 3ZCUA 3J80A 3QLUA 821PA 3W2HA 1QQ5A 2BHTA 1N6KA 2W8BA 2WP0A 3DBLB 2WYHA 4CGYA 5JNUA 1S2DA 4I8XA 4UU7A 5K51A 4A5OA 1GQYA 4IRMA 1V39A 1M2OA 1NNLA 2HSEA 3ODPA 4I4NA 2Q9CA 3ONVA 5ICCA 1GSOA 2PZAA 1ODIA 4XGKA 4GF5A 1X7YA 4XPZA 3FLAA 1N0VC 3FNEA 4GNKA 5G4KB 4QYMA 2B8JA 4KN6A 2VTKA 4HLCA 3VO2A 4M1EA 3HCFA 3JW8A 2NZUG 4MCJA 4AYWA 4XWKA 5EUCA 3UJHA 1NXWA 3A6HA 4FCCA 2LIPA 4EPVA 3AR4A 4ZIRA 1PLLA 3HYRA 4IQFA 5AVOA 5KDDA 1QIJA 1N2SA 2Z8XA 3AHEA 3U48A 2C2WA 1JA0A 5JYEA 3LF2A 4BFYA 3D5TA 4DR1B 1W8DA 5LJIA 2Q6TA 1CXZA 4LE1A 1PR6A 1U0BB 2YQZA 4OP2A 1O58A 4RD2A 5J5VA 2NSHA 4OYHA 1FQOA 1TIBA 2WYVA 3PT9A 2WF7A 3MB5A 1HYEA 4PQFA 1HTBA 1ZISA 2N75A 4I9NA 1QC5B 4RVGA 2G0TA 3QXJA 4DYDA 3DUFB 2VAWA 2IY7A 5FUMA 3NGLA 4DUGD 5I3CA 2PZKA 3C7CB 2H48A 4PX2A 1FP7A 1H6CA 1XDDA 2NT4A 1DV1A 1KJ8A 2P2NA 4C88A 3S0JA 3ZG6A 4JEIA 3SC2A 1CQJB 3IUPA 1DG3A 1JWBB 5KNCD 1KJWA 2XF2A 3EFHA 3E70C 3FROA 2GYVA 2QD3A 1V5EA 3LDHA 4BNZA 1CF4A 3T3HA 1HT1E 2X0KA 3FRIA 2TSYB 2WAXA 4YDQA 5EXPA 2YXNA 2IC5A 4KREA 4F4CA 5HR5A 2GTPA 4O4JB 4BO7A 4C08A 3PUJA 1LV8A 2N1MA 4P8RA 2PGNA 3ASYA 4MW9A 2XGGA 4LV6A 5K0EA 2MSEB 5DM1A 3ZWXA 2WF6A 5D2CA 4AN1A 3AVYA 3SP1A 2NO4A 2VEOA 4KXXA 1DRKA 5CVJA 4P0PB 4X94A 1GUFA 2OD9A 4Y2QA 3ROZA 3EE6A 9LDTA 1MX9A 5L4NA 2PCJA 4ZYLA 2HA2A 1L7BA 3DLHA 1CR1A 1GUDA 3I92A 4LSZA 5K7SA 2YQ4A 2PAAA 5FTNA 2IPLA 4GMHA 2EDAA 2P9JA 2HPZA 2ZDHA 3KJXA 1R0WA 3PVCA 3Q2IA 2C9BA 2EJBA 2O2ZA 1T34A 5EQDA 3WAGA 3Q0TA 1XD2B 1C9JA 3BXPA 1MX3A 3H1PA 5B1HA 4IS2A 1XCJA 3I04A 4G9GA 1OLUB 2DLNA 5FEUA 4CIAA 5JVDA 1NBHA 2LUOA 5ALTA 4HNRA 5IM5A 4HMOA 3PUVA 4PYIA 3PGMA 3JQCA 3I52A 5KNBD 4EJ6A 1SZPA 2YIMA 5K3OA 2ZUFA 2HA4A 3Q5DA 3SK0A 5KEIA 2GYUA 1SGWA 1XEWY 3EF1A 3E2IA 3QKIA 1R0CA 3G5UA 4WXRA 1KI2A 2V54A 1YA8A 1CP3A 2IIVA 3TSAA 2AEEA 1MN6A 5EXDA 1YZQA 3M5WA 3W9UA 5LMNB 1KBOA 1IRXA 2JBAB 2QQ0A 1J5XA 3G23A 4NJEA 1LS1A 1XPOA 1T10A 2XEXA 3W8DA 3TXAA 1BE1A 3C98A 1T5DX 2YJTD 2Q9BA 4O2AA 3OTHA 121PA 4UKDA 4IL5A 2YDYA 4CM6A 1P62B 2O2SA 5PGMA 4OHXA 2WB2A 3CCFA 2I7DA 4DQDA 3ORSA 3TUZC 1I7SB 2BHRA 3QVMA 4GLOA 3ZU2A 3Q10A 2GEUA 3KEMA 4XD7A 3CRNA 3ZGVA 4V1CI 3WNVA 4FBLA 1SVUA 2DJIA 3KSDO 1STOA 4NYMQ 4UEWA 1HZJA 1ZJ4A 2PEZA 2PZBA 1AS2A 1KTVA 5F2OA 5HF8A 4BVHA 4Z1MD 4YCNA 1WETA 4HB0A 1I36A 5EJ5A 3L0ZA 3OIGA 2YMQA 4O1MA 2FFJA 2ZSDA 2XE7A 2QVCA 5KNCA 1ZGJA 1CY2A 1NV9A 1OA1A 3Q3EA 4AZ0A 4MUNA 1V11A 3DKRA 4FFBA 4AM8A 4LXUA 3KDAA 4OYRA 4Z8YA 3ZJ4A 4EWLA 1L3IA 1Y89A 3X1MA 1HYGA 3HXTA 3OCZA 5IT4A 2GBLC 1IU9A 1G41A 2I7TA 1G3RA 4BMOB 2G4LA 4Q24A 2R68A 4OHUA 5BSKA 2C94A 1YRWA 1EUQA 1RD4A 1F7UA 2RHJA 3PUZA 2XDYA 1S89A 3H2YA 2IV3A 3VC2A 1ISHA 5T5QA 3ZNOA 2ZIAA 5REQB 1EP1B 3GPDG 3VZDA 3UJDA 4FK8A 4QYTA 2PZEA 5JISA 3SZOA 3DB1A 4FPXA 1P2UA 2JLZA 4BO2A 4GMGA 4IIJB 1QGOA 4DIMA 1YI8A 2D0IA 2R6JA 2N3ZA 3PIIA 1QRRA 1VXRA 1IOWA 4Y2RA 5AKHA 4KOEC 1J9GA 3VJKA 4ZV4A 5IAAA 3T1TA 1I1QB 1S8OA 2BMFA 4R31A 4H17A 2NU9B 2YOGA 4ARIA 2ZBQA 3AEQB 4P3XA 3VR6D 5C34B 1U8AA 3RKSA 1EDBA 4FBMA 1Y9ZA 4DA4A 3EFOB 4F4UA 1P5RA 3IIMA 4D3FA 5HKLA 3IBYA 4C2AA 4UZSA 4ZQHA 3A11A 3IJ5A 3FCAA 1JI3A 3JZDA 2WKSA 3KX2A 3OZSA 4CM8B 2ZM5A 3B3AA 4P81A 1GNLA 2JLYA 3ZGNA 3F49S 4D9FA 3CISA 1U2SA 1U4OA 1U80A 2GD6A 3AR3A 1D4AA 4G4JA 3B6JA 1FNBA 5JNWA 1SXHA 1Y6RA 3DT6A 4FX5A 4QHSA 1EFRA 1K2VN 7YASA 5JR3A 4PXSA 2QTAA 1UQUA 4C9BA 3JQ8B 3HHPA 2KS6A 3NC4A 3PDCA 1MIOA 3PFCA 3QELA 4UCFA 4BPRA 1ATZA 4ZAYA 3PNKA 2P30A 3P2EA 2R62A 3TL6A 4ZHQF 1RQNA 3NHMA 3RHSA 3KALA 4EI9A 4RXTA 4IKEA 1AHPA 2BTEA 1A4UA 4JA0A 1QSGA 1GTSA 1WW2A 1NM5A 3RLFA 3SX4A 4DRZA 4W5WA 4CLOB 2X9LA 1G3IA 2VDKB 1T36B 4TOIA 5T4EA 3TZLA 4RJIA 4MNTA 2N9UA 4YYEA 1T5HX 1TKAA 1B8PA 1ZSNA 1A2BA 1RKBA 1VB3A 2Z4RA 3PQ5A 3JVIA 4OBEA 4YAFA 4LY0A 5D5HA 2WV9A 4RELA 3H7IA 1FVOA 4E4TA 4YIHA 1NKSA 4JJ6A 2HHLA 3DH0A 3EDCA 2XT6A 3V1NA 2NX2A 1ZRNA 3V4SA 4TS1A 4JS0A 2DWCA 4YDRA 2YY7A 1VPDA 5EUMA 2ONJA 3UGJA 4OSOA 4C4RA 4PQYA 1IZ8A 3GJ7A 1EBFA 2FP4A 4MYUA 4NBSA 2HA7A 2XB9A 3ESDA 4D3DA 1T9AA 2W2XA 2ODNA 1ZEJA 1JXQA 2JRCA 2QEQA 5C52B 1MDFA 1XPJA 5HS6A 4ACBA 5C4MA 3EUEA 5EIFA 4ZV7A 2Q4RA 2W0SA 4L3WA 3DP7A 2J0EA 1UXKA 1X1SA 1P17A 2VP5A 2ZBRA 4RD4A 2D6FA 2O2GA 3HPQA 5K3FB 4AUKA 1DXYA 4RTNA 5K0BA 4YT5A 1YS9A 1N5DA 1P45A 4IIHA 3E5MA 1ZWKA 1E3WA 2ID8A 1VLJA 2JLQA 1UJ6A 3BFXA 3CZ4A 1NW8A 2PWPA 4RK6A 4URWR 2VDQB 4X1KA 5CPBA 1SA0B 3NT5A 2WUWE 1GQQA 3AKDA 1SU8A 3I04M 5D1NA 1N6PA 1KMHB 3SOZA 4B2YA 5CDTA 5KVSA 5IUJC 5CK4A 3LT4A 1RKVA 4I8IA 4EKEA 1Z0UA 4GXTA 4R9SA 5HRCA 5HP4A 1IIBA 2QNBA 4RJLA 3ZWPA 3P2IA 4L75A 1N2CA 4XCVA 3NHPA 1KYIA 1KO8A 3NXSA 5A05A 2Q3LA 4TVOA 3LRXA 3UFBA 3MTBA 2CBGA 2ADFA 2FX5A 2H3EA 1XTIA 1U2DA 3BJRA 3GAZA 2CMFA 3JD0A 3U0VA 1WMSA 3NVMB 3FFBA 5DTJA 2X7JA 2ST1A 5JS6A 3FJYA 1Y3CE 2J5KA 3DSRA 3LLMA 1DQYA 1KQGA 1FNSA 3D0QA 4YAKA 3SJBA 1DC6A 4W1PA 2FFRA 1KVSA 2PSFA 3CVJA 3T41A 3QWFA 4UM7A 1XQXA 1Q2UA 3MTQA 4ALLA 1BEZA 1W5EA 3FBWA 3LYUA 3P2YA 4K0KB 4JWTA 4F21A 5J4LA 4E88A 4WZ6A 1EUCB 2XXBA 4RCVA 3KWLA 2I1VB 1I2BA 1T1GA 4B6JA 3U6BA 1XKTA 3UM9A 1O08A 2WK1A 3DDCA 1ESNA 3ESAA 5DHAA 2IHBA 2ZYHA 4ER6A 3HI4A 2J0SA 7GPBA 4E2ZA 4R68A 4ZCTA 1HDYA 2X7HA 4KIGA 2CZCA 5F51A 5EL0A 4FDTA 1GKUB 1P75A 1G5IA 5I7SA 2BE7A 5KTTA 3AHGA 4LNUB 3V3TA 1Z7GA 3EUAA 1AKRA 2VPYA 3ZZTA 2D0OB 3HACA 5BN1A 1NBOA 1XZGA 5CH8A 3CXRA 3UPTA 2AX4A 3D8UA 4QA9A 5EKUA 3PHBE 1MX1A 1F4LA 4LXGA 4W7HA 3RWOA 4OJKA 1QHFA 2ZWMA 3EZNA 1UMDB 5ES3A 3KSRA 1XVVA 2Q1SA 1EGAA 4XD7D 2GF9A 3ONNA 2G4CA 1MAVA 5HTKA 4N5IX 3FFWA 2TMKA 3PXAA 4LZWA 1U94A 4YO8A 4AY5A 4D0NA 1XA3A 5FWDA 5EFZA 5AP9A 2NM0A 4WBNA 3TIGA 1G2IA 1WNFA 3EMDA 2PL5A 2RG1A 1HQKA 3UT5A 3BXOA 3ZD8A 3HP4A 1XPRA 1HZZC 2YN2A 4G5SA 1E1YA 4HBGA 4UMDA 3ZBPA 4A92A 3T4UA 4KHPB 4BMVA 1QVAA 4QLOA 3LE8A 4HKTA 4DB4A 3H1BA 4HP8A 1TTQB 2TS1A 5J59A 3PFNA 4NWIA 4Q3CA 3KQNA 3RRYA 1FDOA 1QOQB 3U3JA 3OMWA 4MP6A 1X38A 2QNIA 2XY4A 4HTFA 1RMQA 2CL7X 1ENPA 3LT1A 4LS3A 4MIKA 3TJRA 3FSJX 4JHLA 4OXRA 5DGTA 3C87A 4PSAA 2JLBA 5AOCA 5G3YA 1R8JA 2ISCA 3BZBA 3K1ZA 4W5TA 4CMAA 5MDHA 5E9AA 4DADA 4JI3B 4EAAA 1NXPA 4BO9A 4MWSA 4R1OA 4A16A 3NTLA 4LNUA 1LQTA 4C7OA 1U3VA 2J4FA 4N3CA 1VPVA 3QKSA 3ENZA 4BMNA 4KEAA 3AHDA 3C6MA 4R1MA 2EJWA 4EFKA 3DOEA 3VKHA 4ZEWA 1OYWA 3M2TA 5LZ2A 1G21B 1ZFNA 2JGRA 3KOMA 4FLEA 1U0SY 2Z1NA 4YI3A 2P2YA 4M83A 4M8LA 4HB3A 2LGJA 4OUDB 3U44B 1B1CA 4CM4B 4Y2XA 3IPAA 2H17A 5BR4A 3ICQB 2PXAA 1VPEA 1WCWA 3CH6A 1W76A 5CH5A 5G0VA 1Z6XA 4JVMA 1IB6A 5HIJA 1UK9A 3G02A 3AHIA 3DOCA 3C3PA 3CURA 5ALYA 1PT7A 1ZINA 4TWRA 2O1SA 1NI4B 3IEIA 1UBNA 5I9MA 4NYMR 4YRGA 1QMGA 3KP1A 4MSUA 2BTQA 3LKBA 2FEPA 2PR7A 3UMYA 1G5PA 1AZSC 1Q1GA 1QGDA 2AX3A 2H29A 5LP6F 4LWQA 4MQ5A 2CCGA 1J2UA 1PFVA 4H3VA 4PGFA 1C2TA 3HB5X 3LZDA 2FVXA 1ZN7A 1JDVA 1P9OA 4XOUA 1X92A 3GT4A 2Y1GA 4IHAA 3SE7A 3E8XA 1WB4A 2XV1A 1M8JA 1TM1E 4AJ1A 4V3BA 3GLIB 5JW6A 1XEWX 1GG8A 4NOMA 1V48A 5ALZA 1LH0A 1PK8A 2X41A 3IKTA 2IOFK 4PNEA 2ZRHA 2RE8A 2V3CC 5KTOA 1A8HA 2VRBA 5FWYB 2WD7A 2E3JA 4KQIA 5F23A 2XF8A 1D7OA 4OFBA 3ZJTA 4HSEA 1QG6A 3P0HA 2WA2A 1VJRA 2UUCB 2CXUA 2HF7A 1CEEA 1XYVA 1MZPA 1D2MA 1ZLXA 3RU9A 2IU4A 1P8JA 3HYTA 4IIGA 4KU4A 5JWHA 2GPBA 1OCEA 2C3PA 3COSA 3DM5A 4JQZA 1Y8AA 5GWXA 5KWSA 2FDCA 4RORA 5DI3A 2YBEA 1DTWB 1ULUA 2HLHA 3HLKA 2H06A 4HGRA 1E4EA 1QKKA 2NYRA 1CFZA 5DW3A 3DZGA 3JQRA 4EK9A 4EJSA 1WXQA 3AYZB 1KR5A 4H4DA 1PL0A 5ELXA 3KOZA 3P9RA 1FQJA 1TCVA 1JDSA 1U4NA 2XA9A 4MK4A 2XOEA 4Z54A 3H16A 4OQXA 5AJTA 2YWHA 3PX7A 5D6NA 4MDYA 4B6OA 4JYAB 1UBUS 3WK8A 1AKWA 2SICE 1ENZA 2BFOA 4JSRA 1UCFA 1BWSA 3ZDDA 3AVVA 4NSNA 2A0KA 4N7RA 4DG9A 1G59A 1J8VA 1FTWA 3CUSA 4GZLA 3VHRA 1G8JA 3VC3A 3U5ZB 3KM0A 2BM1A 3NJ4A 3N05A 2WMDA 3HSSA 4QYSA 4V24A 4BCDA 3NLLA 5I47A 2C7RA 1EWRA 1V3QE 4TUYA 2Q5EA 1GLVA 2GO7A 2M6SA 2XQFA 4RK7A 1Z0SA 2HCRA 4DT1A 5KYGA 1XNRB 4P5DA 2O52A 5T4FA 2GAJA 3SLGA 3QEOA 1XA4A 4MVJP 5IW8A 1NKTA 2A1UB 4HVCA 1YUMA 4I3FA 3FDIA 1EFLA 3HR4A 4MHTA 2C2OA 3D4LA 2RSLA 4H7PA 3TSYA 1FUUA 4KO1S 1PLJA 4YUVA 5ADUS 1VJ0A 1P44A 2QS9A 1JQBA 4X3OA 2H7XA 1YS2X 1P2FA 2ZUEA 4S1WA 1DS6A 1BHSA 2ZT7A 3EFOA 3SI7A 4JB8A 5FOQA 2IA5A 2WG1A 1D0IA 5JFTA 2B20A 2ZIVB 4UDOA 4LCEA 3OBIA 3FLMA 3Q3IA 1IZYA 4ZO6A 1TT5B 1LPNA 5ALXA 5KQRA 1C14A 5AUPB 1L5HB 1NT2A 3RB8A 1FFSA 1KSGA 5F35A 2RGUA 3DYBA 4BLRA 3KQQA 4Z9YA 2CL6X 5A4FS 1NUUA 2HF2A 2JZCA 1HRKA 5IJAA 3ZNNA 2IP2A 2OP0A 2UZIR 4YUZA 5I7FA 4FMCB 3GZTB 3HP1A 1T24A 1Y5NA 4PGMA 1LZLA 1JEOA 2QM8A 2CJPA 3HKDB 2VXOA 1JR3D 1YDGA 1YTLA 1IQUA 1ZQ1A 2FN7A 3AY6A 3P32A 4Q7LA 4Y9SA 3W2FA 3GJRA 4Q4DA 3EA0A 4MMXB 3SY8A 1IBMB 2QV0A 2PS9A 1YD7A 1Z5VA 3G8CA 4UAVA 1CQXA 3UJAA 2E85A 3UGKA 3TGPA 1S0UA 3GROA 3WX0A 1LRKA 4XYMA 4WE3A 4IDGA 5FJJA 4ZYZA 3FHJA 4J4BA 4CUZA 1LKZA 3KR1A 4K6KA 1E77A 2I6FA 1M2EA 1QAMA 5KSOA 1M0EA 2WSMA 2VL7A 2YRFA 3IAEA 3LIPA 1A96A 4XSGA 3KB6A 3ZKWA 2FFHA 1JW9B 1UDCA 2E4ZA 1WPQA 1Y8CA 3LHSA 4RU1A 4XCXA 3T9EA 4NBKA 3WDKA 4LNHA 4PN3A 3ZHZA 4RY9A 2ZQYA 4K6FA 4G8DA 5IK2A 1IOLA 1R5BA 2DCMA 1WXIA 1MP0A 3BB1A 5JXHA 3HJTA 3TQHA 3U3MA 2QLNA 5I7EA 4F97A 1E2GA 4KQ6A 2PGLA 5ED0A 1U1DA 3L7YA 1AMUA 2C3OA 2GAOA 2IRWA 5AHKA 4URXR 5J58A 4G5FA 2XCUA 4GD3Q 4P4LA 1ZCBA 4EZEA 2J9GA 5H3LA 4BFWA 2ZU6A 4HZUA 5K0ZA 1K4YA 2HBYA 4FC7A 2OWEA 1WCYA 3H05A 2X6TA 1UQRA 3PXDA 1SG6A 4GZ5A 4HH4A 4NDAA 4R1TA 4E5DA 2NMVA 3VPBA 1P2GA 2UXCB 4BWGA 3RABA 2DFVA 3K6JA 5ES4B 3SFZA 3TI7A 1LRLA 1V6AA 2IITA 1ZM9A 4NVRA 5DGDA 1SPXA 5ECDA 5JS1A 2HCJB 1PV4A 3B8HA 4S0ZA 1P3JA 1KC3A 3C0KA 1RCTE 5CJJA 2X0NA 1BKSB 1FSGA 1SAYA 4MUGA 4WKPA 4BGEA 4KBGA 4YRFA 1GGHA 3KAJA 3WRXC 2P2GA 1T2DA 1KVUA 2H8KA 1ZRSA 2DM6A 4L22A 2HOQA 1X2BA 3WS7A 1GNQA 3IMGA 3ND6A 1XTUA 3RQIA 5A7HA 4OKIA 2FN8A 4RQBA 4MRRA 4CQMA 4RWEA 3BFKA 1Z0JA 5HF9A 5CAEB 1ECPA 4F85A 3COJA 3B36A 1ZGAA 1VOTA 2R11A 2ONYA 3CJRA 1NW3A 4X1OA 4X54A 4W7SA 3T3OA 1PJ8A 1QV6A 1ZOIA 5GM2A 5IH7A 5ICEA 5IFKA 2E48A 4JH0A 4XVRA 3SE0A 2EP7A 3PE6A 1VB5A 3K92A 3ZLBA 3P4UA 1HMPA 2Z1DA 2BP7B 4YY3B 1C1HA 1FUKA 5CX4A 3M5CA 3HVKA 3I62A 1V4BA 3GIDA 2OHXA 2VS1A 4UNPA 1DAFA 1IATA 2BEJA 3EXEB 4HJRA 1V96A 4FOSA 1Z5GA 2GCPA 2DCUA 2ZXEA 1PGOA 3IVXA 1Z2OX 1F12A 3IIKA 2AE1A 4MLCA 4FHFA 4RAQA 3NTRA 1F2UA 3T5BA 3DBIA 2H1LA 3WRYA 1ZY2A 3IIJA 4FFVA 4NU5A 4FS3A 1WPRA 1ULAA 4DLNA 1PWHA 3D2LA 4E11A 1TYDE 4OHMA 2BFCA 3EXAA 3JARB 1ZMTA 4MVXA 5KKAA 3S2YA 1Z5NA 3F6RA 3UMVA 1KRHA 4PHFA 4HAOA 3DQZA 4KE6A 3K0CA 4YAEA 4LBVA 2IX3A 5CD1A 1QC5A 1M76A 2HCBA 3ANSA 4ZOLB 1YRYE 3F4BA 4JVSB 4GQBA 1KNXA 3G2PA 4M88A 3TZQA 2WV7A 5KYVA 4MS4A 1CULC 5K20A 3LX6A 5CA1F 1P2DA 2BMWA 1BXGA 4N6GA 2JLUA 3WHPA 3DE3X 4OHFA 4L07A 2VNHA 4GH5A 3I1JA 4J9UE 4DWJA 4YRNA 2ZI5A 4QBIA 4RK4A 1RYHA 1RRPA 1WCXA 2PS0A 4GZ3A 3IAM6 2BPOA 4V0SA 4W9NA 3TLEA 1GT6A 4BBAA 3E05A 4JLDA 2ZCUA 3AR2A 4RBNA 2QVZX 2VPIA 3HWX1 1NX6A 3KL2A 4QGAA 4CL3A 5K0NA 3CEAA 3RK4A 3CW8X 3WP1B 3ROFA 4KK3A 4CEHA 2YZMA 1Q0PA 1JP7A 5EJMA 2VEDA 1E3SA 3QF7A 2V03A 3BDIA 4CDGA 2DHQA 4ABYA 3MJTA <