1S2LA

Purine 2'deoxyribosyltransferase native structure
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
167
structure length
165
Chain Sequence
b'MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFEIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine trans deoxyribosylase
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
total genus 49
structure length 165
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s2lA00
4LJLA 4HX9A 4PFKA 2F67A 3O8NA 1S2LA 4I36A 5AJTA 4OHBA 3BQ9A 3OPYB 2IZ5A 2F48A 4I7EA 4LJKA 2NX2A 2HIGA 3GH1A 1YDHA 2PMBA 2KLHA 4JELA 3U39A 4WL0A 1S2IA 3EHDA 2F64A 4FYHA 4A3SA 2Q4DA 3QUAA 1WEKA 4JEMA 2A33A 1S2DA 1F8YA 3IMKA 3PFKA 3SBXA 3OPYA 4LJRA 2IZ6A 3O8LA 6PFKA 2F2TA 3O8OB 1ZXXA 1KZHA 2A0KA 1PFKA 1F8XA 4NPAA 4MCJA 4JENA 4RH3A 3K2QA 4KXLA 4P5DA 1S3FA 3MAJA 3F5MA 5ITSA 4U1RA 3HNOA 2KHZA 4MEJA 2PFKA 4P5EA 1WEHA 5AJUA 4I4IA 4FYKA 1T35A 2Q4OA 3UQZA 3O8OA 1MTOA 2F62A 1S2GA 1RCUA 4FYIA 2IZ7A 4KXMA 4KXNA 4OHRA
chains in the Genus database with same CATH superfamily
4ZQEA 1ZCAA 2H9AA 1AGNA 1X7YA 2ONCA 2ZT6A 3AEKB 2PS1A 3CFYA 2BHNA 2H92A 3TB4A 1QP7A 3PRKE 2B4QA 2YV4A 1Q3HA 4RCYA 4Z99A 1WSWA 3FFWA 2V98A 3MRXA 3IBCA 4ND2A 3UK6A 4G86A 1EFHA 4CEHA 1JR6A 4FGJA 1QOPB 3RHTA 1NW5A 1A71A 1CEEA 4DLTA 4JJIA 5CDGA 3HFSA 3CBGA 1Z0IA 3G89A 2J33A 1OYYA 2PT5A 4QNMA 5IJXA 4MR9A 3PJFA 1W19A 2GD6A 3IDOA 4YR9A 1EWKA 4CM6A 3LOUA 1UBHS 3UPUA 2OVFA 3L7OA 1X42A 3IAAA 3WL5A 5E6RA 1F4VA 1ZOSA 3AOEC 2A58A 3HP7A 2WJAA 1EFRD 1ISMA 3O38A 5GY7A 5F21A 4OXKA 3L40A 3NX4A 2HU5A 3DOUA 5ADVA 3VZRA 5JCXA 3ODGA 5HILA 4ER3A 2HXGA 3KQYA 2R2AA 1V4NA 4L8GA 4D96A 1JEQA 4R6XA 1WD7A 5HKKD 1QG4A 1I7SB 3KKEA 4UXJA 2PXCA 2EATA 2GXUA 2Z95A 3VPGA 4OG2A 2RJNA 2AKEA 2CLKB 1V7PC 5EOVA 3MJDA 3PT5A 4RXTA 4UBLA 4DR7B 2NXWA 2WYUA 4KQCA 4DC1A 5HYVA 1Z47A 3AM1A 3VX4A 2XCRB 4OSEA 2GKOA 1WCWA 3DMDA 1RTTA 1R0BA 1JRLA 3HBLA 2CJPA 2OB1A 4BVJA 1RI1A 4QYSA 3MFQA 1RC0A 1RI4A 4UAUA 4XIGS 5CM9C 4QUEA 2A30A 1EFDN 4ZV4A 4HDQB 3ZXYA 2PBRA 3H1PA 1W34A 1SBCA 4R31A 3CF0A 2GPJA 3RVDA 3HM2A 4N0QA 2DHRA 2HRZA 4IDHA 3UFXA 4D43A 3D1JA 4J9UE 3VPSA 1Q11A 2X1LA 4O2AB 3JAKA 1XD2B 4BP8A 3DZ8A 4KPEC 4AJ9A 1ZZEA 4CLXA 1FFXA 1LDEA 4B6PA 1CUJA 2C07A 4C89A 2XT9A 2AYXA 3NBYC 1T4DA 3W6OA 4AQYB 3Q8KA 1OXKB 1YTUA 5DXAA 3L0CA 2IYLD 4X1IA 2Q6VA 4U2GA 5LA6A 4OPMA 1KI7A 1ISSA 2H9IA 1B0ZA 2I4RA 2OKCA 2OQ2A 5FFFA 3IH5A 2WWGA 3R5HA 2VXYA 3B36A 2P2LA 2C5HA 2JL1A 3GPCA 2GSDA 5JTUA 1RKXA 1Y4UA 3LKBA 3TLMA 3PGVA 1W75A 1ZN9A 4NF2A 5F78A 5IHPA 4BNMA 1FDIA 1NPTO 4PSDA 3R0XA 2JLVA 4N7JA 3OCJA 1A2BA 2BF7A 1KYIA 4OQNA 1VL5A 2D4AA 4LWPA 1K9SA 2QYSA 3F6BX 2OMEA 2AC2A 3FPBA 1FDUA 1U0OC 3RG8A 4QDOA 4CM7A 1Z9BA 3HXQA 2CDRA 4OI2A 4ENQA 3CUKA 2EFYA 3EZLA 3CLUC 5KWJA 2JANA 1BJTA 3N2ZB 3FMVA 2Q6LA 4DQVA 2OLKA 1K1EA 3PF9A 1LB1B 2C5GA 1V8OA 2WY2D 4E0BA 3TWOA 2OBFA 3H3XA 4MP6A 4P3OA 3M4ZA 3MB8A 5E8JA 4JI8B 3M0EA 3ZVNA 4WKNA 3P27A 3PHLA 1R5JA 4DWVA 2NG1A 4QRHA 5BSEA 1A0OA 2WWYA 2A35A 3WAGA 3QVGB 2CKDA 1XJWA 3ZBQA 1W48A 2VJBA 3FBGA 3HWRA 3CH7A 1CG6A 3RHFA 3SZGA 4KHPB 1ENZA 1U90A 1GP2A 5JCJA 3V80A 3ES9A 1Z4OA 1FYEA 1GPAA 5FBRB 2ZZKA 2WQ7A 3L07A 4UBIA 4GOLD 3OOEA 4BDTA 2O7QA 5DXFA 1K0FA 2NYRA 3GJ6A 4EL5A 3UIEA 1YJAA 1ZUHA 3NEAA 2R6R1 4B6OA 3PVSA 5AM5A 1MX5A 3UAWA 1T0HB 2O07A 4AS1A 4RVUA 5DB4A 1Z17A 1ZJ4A 3MEQA 1D7OA 4KU4A 4UW9A 4R5HA 1V1MA 1NN1A 2GZMA 4F5EA 3IIJA 3NBZC 5DNWA 2FEAA 3L04A 3OCVA 1NGSA 1UZAA 2F64A 2VF7A 1Y3CE 1Y8RA 2XNDD 1J6UA 3RU9A 4BO9A 1R0YA 2VT7A 4IDCA 4BZQA 4C5AA 1WO8A 4MV7A 1QO0D 2ZSUA 4ZCMA 1KI6B 1G6OA 1X86B 3VSDA 1D1PA 1FC0A 1SIWA 3R0ZA 2ZJ8A 3OM8A 4ZIRB 3OFJA 3BCRA 5FOSA 5H0IA 3ZCQA 4J0EA 2YY7A 3G5UA 5LZ9A 3UXEA 3FB1A 4UTRA 1PR6A 2HLNA 2ZI6A 2WI8A 4FFWA 5BV8A 2ZM6B 1J7JA 2P41A 3RGWS 4IWNA 4ESVA 1AO0A 1BXGB 5A04A 2O2JA 4GNRA 2P2YA 3ENKA 5K0CA 3K9GA 4HB3A 3EVFA 2VNJA 1RJGA 1T3HA 2EKLA 1QG2A 3C48A 1W2GA 2ISCA 2XUZA 3N05A 4YACA 2XUAA 4EPRA 1IM2A 1ZEMA 1QBGA 2AFIA 3ETLA 4FC7A 4MR7B 4YH1A 3C4QA 4Q1AA 3USCS 1IZYA 1US8A 4IHJB 3WB1A 2M6SA 4NMLA 1OAAA 3NDRA 4RXUA 5LC1A 3X1DA 4RTQA 3ISJA 1FP1D 1C9EA 1SC1A 1OVGA 1YIDA 1NJFA 2C61A 3A4TA 4PYNA 3FMOB 5EFOA 5TGZA 1HFJA 1MZVA 4PZCA 1SK8A 1YVUA 1M2NA 1SQ5A 3BTOA 2GESA 2YCLA 4BJ6A 4L4RA 2V5AA 5KYXB 4JU8A 4NDZA 1E9CA 3B2EA 5EE9A 2NV2B 4OFZA 3B20A 4QREA 1E69A 3TZKA 4OHYA 1KZ4A 3ROMA 2EARA 2R65A 2R7MA 4WH0A 4MICA 4DZZA 4YR7A 3KQUA 1XLVA 4NFSA 3CXUA 4JGIA 3FYUC 1B4DA 1N6NA 4OQMA 3GQBA 4BJHB 4P08A 4B40A 4XSVA 4EEKA 5KSOA 3OT5A 3JS5A 2B30A 2C1EA 1ZL0A 1GQQA 2RGCA 4KXYA 1XELA 1L5QA 1BRMA 2AL7A 3MRTA 5E1BA 3IFSA 4HYYA 4OLFA 5LLDA 4YUYA 3EEOA 2ZI7A 5EWMB 3UJCA 5F5NA 4EECA 3VYWA 4N18A 3RAGA 4JUAA 4EYEA 4PCLA 1E7WA 1T3ZA 2YJGA 4LGVA 3JVUA 4ONEA 3IB3A 5E2AA 2ES4A 3ZGYA 2ST1A 3L6EA 3R0JA 4KSYA 4LRQA 1GDHA 4AX8A 2O57A 2FJ0A 1FP7A 1ZU4A 5ARBA 1OFTA 5FOWA 1QRAA 3REFA 1ODLA 1LTQA 5IM4F 4MVJI 3IMGA 4CTMA 5HKLA 3H5OA 3KR1A 4ZQHA 2B69A 4HVCA 5LQKA 1T1SA 4WOPA 1P77A 1WUYA 1I13A 1SRQA 4LYAA 3UC9A 3OJEA 1ZD1A 1SC6A 4FFSA 4LDNA 4B3IA 4D41A 2GPNA 3QEKA 4IKPA 2V0NA 3L1KA 4NATA 4REQA 5ICFA 2PG3A 1BSVA 3BG5A 1Q0HA 4HATA 3MGBA 1KARA 2C9ZA 1XYYA 4OU5A 2BGLA 2JIQA 2VJLA 4OHCA 3GT3A 4MWBA 1KJQA 1VMAA 1LK7A 1YO6A 2GNOA 2RGAA 4FFRA 3K9NA 2GRUA 3K0HA 3GDFA 4PRKA 2FR1A 1ZOLA 4E1AA 3QELA 2BONA 4IZIA 3N2EA 4MVYA 1NVMB 4O4IB 4XYLA 5KQGA 4QUDA 1Z25A 3E9DA 1UMCB 1WWKA 1Y48E 4GR5A 4MYUA 4QU8A 4Q1VA 3FVRA 3RC9A 5CVEA 5ECGC 1VPLA 1ZR2A 2HA3A 3K0FA 5TVKA 2YZ2A 1PEKE 2D0IA 1QVWA 1Z5OA 1R6AA 3QYFA 2BMEA 2HN9A 2F00A 4LZLA 3IOMA 5EWJA 5AT1A 3K5IA 3OM9A 2AEFA 3WLLA 1ZEJA 3CVYA 5FAXA 1E3MA 1HUQA 1OWOA 3L7MA 3RIEA 1N5OX 5KS2A 1E4VA 1SD2A 2D2FA 2OORC 2WWIA 3BZBA 4Z9YA 1BFKA 1U3GA 2G6TA 4WZ6A 3LUBA 3S2IA 3AH8A 2GLTA 3AV3A 5SYNA 4QLAA 2D2VA 2Y1WA 5AHOA 2PZMA 2HK9A 5KNBA 2OCYC 4C29A 1H3FA 1IHYA 2XVAA 2YWXA 3AI7A 3H8WA 3N3AC 2G9UA 1T1RA 2MWMA 3UA3A 2GN9A 1EMDA 3NCHA 1X9GA 1I7QB 4LRYA 3NP7A 2CW5A 4NU8X 1JDNA 4LI0A 1T8PA 4G4GA 1YE3A 3O4RA 2QJTA 2COKA 2AKAB 4AULA 5M7EA 4ZYXA 3C8UA 1WABA 1A8UA 1A9XB 1D8TA 4A7PA 1QF9A 3GJQA 1FL9A 1N7IA 4P7KA 3S29A 3W4JA 4KQKA 1COWA 1L4EA 4W9NA 3CX7A 3MCAA 1QGZA 1U7PA 3L7DA 4NOMA 1JMVA 1OWNA 2PFKA 2L42A 3JAWA 4IYRA 4QGHA 2O7NA 5F5XA 3S8MA 4LXXA 4CIYA 4OQ4A 5ELLA 6Q21A 2HQSA 5FPSA 3RTAA 4JV5B 4L22A 2FZEA 4FYXA 1XLWA 4S04A 4TOIA 2H51A 4B3RB 3FD8A 4E4YA 4H15A 5JE8A 2C94A 3EFBA 3UJ7A 2W7TA 3W90A 3ILXA 2F62A 2I1QA 2W2QA 3BAZA 5AQEA 1G17A 2PCLA 4IIYA 1LSJA 3KXDA 4UUOA 2EC5A 2ZJBA 4HNUA 2E5LB 1JAYA 2PKXA 1K6JA 4KLNA 4DQXA 3Q9SA 2OBMA 2J32A 3MMNA 1SUAA 5CXUA 1MFZA 3LCUA 3T7JA 3THOA 3D7KA 3D6UA 4PG4A 1NKSA 4KLAA 1MAVA 2Z43A 3R77A 3FHOA 4RD1A 1Z5PA 3ZE1B 4BZZA 4FN4A 3LLVA 3A4NA 2QAGC 3CEAA 5A9SA 3CR3C 2P4HX 5EL0A 4RAQA 3B52X 3KOXA 2ZTSA 3D3WA 5KJ1A 4PQRA 5D51S 1U3WA 4GEGA 3LU1A 4E7OA 2IBTA 1YRBA 2RCYA 3CSDA 1VCNA 3IA2A 4G0ZA 2NXJA 3SFVA 1ORRA 4CKWB 3TGLA 2B61A 5JSFA 5J5VA 4LF7B 2F43B 5JAOA 1U8FO 1QANA 1N5JA 4Q4LA 3I2KA 1XQYA 4PX5A 9ABPA 4CCSA 4BN5A 1EXDA 3WTCA 3ZQKA 3ZHVA 1G42A 4A6XA 3CLUD 3V7NA 1GGMA 4JSYA 2HWUA 1RM4A 4HDMA 2I99A 3WIEA 4BQNA 5KNDA 1OV6A 1JHZA 1V3QE 3UPDA 4IQ4A 4UPEA 2HXYA 2IZOA 3NXKA 4JJEA 4GH5A 2HRDA 3KYBA 1QJ4A 1NW3A 3H4MA 2DPLA 1R9GA 2YFKA 4TVSA 3KWFA 3IUEA 5AJXA 3Q8LA 1TECE 2HD4A 5JZSA 4B3SB 3MCTA 4QU0A 3DHWC 3YASA 3DL0A 3IV9A 2MSDB 1FBNA 2O7VA 1UADA 4B3CA 5IT9A 3KT3A 4X97A 2A33A 2PPVA 3TMKA 3NDPA 4RGYA 1J97A 5ILOA 2GBGA 3IR7A 3OT4A 4FCCA 4NJEA 3FOFC 3KQKA 1TIKA 1RHKA 1RP1A 3PYXA 2I1LA 2YWDA 3IURA 1M75A 3CYFA 4W9RA 5CFMA 4M0MA 1U1IA 1HYBA 3UMBA 3AKZA 2Z98A 1UMDB 2QV0A 4M36A 5GGYA 2ZCJA 2JGDB 2G4VA 2XCLA 3OZWA 2P90A 1J8VA 3P19A 3JZDA 4OQZA 3RK1A 3QF4B 4AJPA 3HFJA 4OL0A 1SVKA 2FETA 2NYUA 2WWXA 1V5FA 2M1XA 1XVAA 2X2EA 2HNBA 3HWX1 3NO4A 1DRUA 2X0KA 3HKEA 4Y9SA 5K0NA 3T3HA 4EJSA 4ND1A 3TTTA 1KYZA 2BFOA 3IQEA 4TL8A 4ZVLA 5YASA 1A50B 1YL6A 5I4KA 2CNWD 2R7KA 2WRZA 3NC4A 3TW8B 4W5QA 3H04A 1MG5A 1SKQA 4ITRC 5B4TA 5JZMA 4YP9A 4LF8B 1I80A 3SYMA 4K0KB 1GGHA 3QSYA 4Z1OA 3DDOA 4JOQA 4WD3A 1V9SA 4BX9A 4NFHA 5B36A 2Z2JA 3FUTA 3ZV3A 3WZMA 5CX1B 5AM3A 2ZJ3A 3O74A 3P52A 4IHKA 3MSCA 2QX6A 1MENA 1UC8A 2H2FA 2QV7A 4ZO4A 4CT0A 4MP8A 3RVBA 4BNDB 2F1OA 2W6CX 1KC3A 1D2NA 2EYUA 5DHTA 3CLHA 5KO2A 1RBZA 4R9RA 3BE6A 3QFRA 2O5VA 4FI3F 4FU0A 3EF0A 1RPNA 4QULA 4NJMB 4PC3A 2W6PA 2OYRA 5B7GA 1SKMA 1I2DA 3BWYA 1BMFA 2GILA 4B5LA 1M6VB 3LUCA 3Q3JB 4NHEA 2Q5HA 3FUCA 2J0SA 1N5MA 3T5TA 3R24A 4M8SA 4F7DA 5KB3A 5IU6A 4NYJR 5BSFA 1RXVA 1FZTA 1G64A 2J30A 1RRFA 2GXSA 4DKJA 1WF6A 2XE7A 5E6SB 3ETJA 4KYVA 3RUHA 5HS4A 5C9ZA 4L08A 2G63A 3KYDB 1S4QA 4K9NA 1ADJA 5HJ5A 1UPTA 4BXOB 3ZIDA 3BXEA 3VDMA 3VGPA 4RSGA 2R68A 5EXDA 4CN8A 4M1KA 2BEVA 2ETVA 3G79A 5GVRA 3GJSA 1FNCA 2QNRA 5BV7A 3DOEA 4RELA 3M5DA 1Z5VA 4D57A 1ULUA 1Y8CA 1P5ZB 3COYA 5EVJA 1MVNA 2ZSFA 1KEUA 1NA5A 1SWWA 2XSZA 2QE6A 3G7NA 5DSXA 4EYSA 2NZJA 3AP3A 2PL1A 3VPHA 2FPGA 4IH1A 4WECA 4C7KA 4DV0B 4QBFA 1A9YA 4YUZA 1U2GC 3THYB 4DGSA 2GPSA 3ZJ4A 4NLLA 2C78A 4MPRA 1NC1A 3RSLA 4LVCA 2ONYA 1MIOB 2ATXA 4FYWA 1J42A 4H7FA 4BAUA 1J2TA 4ZCRA 1YQEA 4GLFA 5E1OA 4PHTA 2ZCVA 4DEVA 4EUNA 3OCCA 3GPBA 1R27A 5MFZA 5JU6A 4ZODA 1A95A 1EBUA 1G9XA 2DPHA 1A8HA 2ZIZA 4O4JA 4REMA 4OAQA 4CXMA 3HCRA 4UHFA 4YIHA 1BN7A 1OKKA 2RAVA 3VOTA 3WNQA 2XTZA 3CRQA 3LPLA 2Z04A 3LOPA 3QVTA 1OA1A 3OP1A 4G4JA 2BGWA 1JBEA 2F9FA 2RC6A 3G8AA 5CK4A 3EFOB 1WOYA 1W4AA 2R60A 5DX1A 3FPLA 4DAOA 4QU5A 3A1VA 5KYGA 1FXWF 2O8FB 1BD4A 1JILA 5EZYF 2V3VA 1LI4A 4DJ5X 1PR5A 3NBAA 3AKCA 4BKUA 3W2TA 5TSDA 5CCDA 2ONKA 4QPCA 1A5TA 4TMWA 1U8CB 1Z5GA 2W2XA 3IKJA 1KH2A 4HAZA 1G98A 1PUXA 3KAQA 1ZHFA 2X4IA 4DCMA 1MJFA 4L50A 1GZHB 3WLFA 2VG8A 4R2LA 3M5PA 3VR2A 4H7EA 4U7DA 5D1NA 1W46A 2XAUA 2XJ4A 4WVFA 3WNCA 4CM4B 2ZS7A 3VH3A 1XNHA 2GMWA 2XPCA 4HWRA 3M6WA 3RAEC 4F71A 3IAEA 1MQ8B 5EE3A 3HJGA 2R0QC 4WK2B 3D8UA 2VN8A 1MNAA 2I34A 2N47A 1UKZA 4MS3A 3NRJA 1KIFA 4C4TA 4CF5A 4XJXA 5I6DA 2WT9A 4V0ME 2GPBA 4OIMA 2P9QA 2BKLA 5BPHA 1T10A 2NXCA 3U2QA 3O95A 1PR1A 3JQDA 3PNPA 4BGDA 4U2KA 5TS3A 2GCPA 1CF9A 3HA3A 3U13A 3VU1A 5HKOA 1WY7A 4HXEB 4QEKA 5JNWA 4CMAA 1CJCA 2HT1A 3FSJX 3GO4A 3OKPA 3T9FA 3K6KA 3H8JA 1E2QA 1PGOA 1R8XA 3AKYA 2CC2A 2QAJA 3ZWCA 2DFPA 1V45E 4N5HX 4BX3A 3B7GA 4XEUA 5TQJA 4AY2A 4C06A 2ZAGA 5DV9A 3LBAA 3LO8A 3LVBA 4CIDA 1EP9A 1AA6A 2FPOA 5ALEA 4LOLA 1ZJYA 1HEIA 1DC5A 3HB1A 4YAIA 4N41A 2MINB 2A94A 3C45A 2JNWA 3PNBA 3HN2A 3OESA 1JU9A 2BHRA 4Q3BA 1XDBA 3CVVA 2G67A 5FB3A 4FS8A 1AKMA 4CJXA 2WA1A 2HV8A 1YI8A 3PB3A 3E9QA 5ALTA 1PYOA 2GCOB 1HYEA 1GCGA 2W6IA 2Y0CA 3H2YA 4ALNA 4F2WA 3PGLA 4BKMA 1NFFA 3DAGA 3AL3A 4US1R 3JRXA 3EUWA 4A15A 3REQA 3IPYA 3PEVA 1RMTA 5JDCA 3X1KA 1PFQA 2ECFA 4BLRA 2G36A 3AZPA 4FFVA 4DUPA 4L8WB 3STXA 4ESHA 1E58A 1U7WA 2JFGA 1JLMA 1VP3A 3OZGA 4RA6A 1EVEA 4QT4A 5IWAB 4M9UA 2CJWB 4MS4A 4BBZA 5K4AA 5F1OA 2XUPA 3F8SA 3NC0C 1RNLA 6GPBA 4RADA 1I14A 2FMHA 3EXHA 5JG7A 2XKJE 2XDQA 1OZAA 4ICIA 1TW3A 4MYSA 3MVEA 1KBZA 1NC3A 2XV1A 3P2KA 5CD1A 5CM8B 4NSNA 3H2JA 2Y6VA 2O0JA 4CR7A 4D5EA 3ADKA 1A9PA 2QOEA 8AT1A 1OH5A 4JEUA 3CIOA 3ZE6A 3ZHZA 2DWCA 3E0XA 1AHNA 3HA7A 3W06A 3FHTA 3RIYA 2RBGA 4LJ5A 1G8JA 1C7EA 5FTKA 1RXWA 3NDIA 4MJLA 1F2TA 1PGNA 3FDJA 1XDWA 3LX4A 4KC0A 2GBPA 1WZEA 4Q48A 4PXYA 4JBHA 4Y6SA 4YROA 2P69A 5TF4A 4YRGA 2CVOA 1H2RS 3Q98A 4CF3A 2QXUA 2X9NA 3D0RA 4O2LA 1HMYA 2EKBA 3VNRA 1YVPA 4EUHA 2VTEA 1RZUA 3L1JA 3ONDA 1YMUA 5LN1A 3NWPA 3E7PA 4DCPA 4M46A 4KI0A 1CQJA 3W7BA 1QPGA 1RKQA 3WNVA 4CFSA 4NCAA 4N0EA 1XYVA 2B2XA 2NO7A 2ZBQA 3U3ZA 5HMLA 3AGPA 4BATA 3IAM1 3NTUA 1E2IA 3GLGA 1MORA 3EMKA 3B38A 4JJGA 4O5OA 3K09A 3G0OA 1IEXA 4O4LB 4D9CA 3OICA 2WOJA 3K5HA 1Z22A 1M2OA 3ASYA 3GMIA 2LGJA 4PQGA 3UBMA 1ADCA 1EK5A 4UFPA 4YRKA 4GXQA 3WMXA 1MGPA 1CRLA 3N39C 1UQUA 1TO1E 4LZAA 4JP1A 2XTAA 5CLJA 2AC7A 1NN3A 2YIJA 3JZIA 2A7XA 2Q9CA 4JCOA 4O2BB 4QO7A 2A84A 4EF4A 1C1YA 4FEYA 4EB3A 4IFEA 1QGUA 4ZOLB 2BM1A 1WCIB 2VHZA 3MIIA 4RTOA 1O97D 1PVVA 2NNLD 2NQ2C 4RF5A 4YNBA 1JVSA 5EE5B 3KZXA 4WA7A 2AH5A 3A6DA 4KN5A 3HY4A 1M3SA 1NOIA 1PHPA 3OJOA 2C7RA 1SVOA 3A4MA 1NR1A 4XOUA 4HYQA 4W5NA 3LUGA 3OQPA 2IEDA 5LU9A 1S2NA 4LF4B 3MG9A 4JXZA 1QVRA 4K2HA 4I50B 4X91A 3J80A 4BZXA 1GSOA 1MW8X 3HTXA 2YYSA 2AOUB 4WCDA 1CUHA 2Q5CA 1RZ3A 3WGQA 1FY2A 3ZNQA 3OU2A 2RGWA 1N5DA 1SHJA 4RTLA 1USWA 2PN1A 5DO9A 2PY6A 3NKLA 1AQYA 1N3IA 1Q7RA 3B6EA 3JALB 3MINA 2R6CA 4R8VA 4ROSA 1N57A 2D1YA 2ZETA 4R81A 3WGOA 3THWA 1ZJWA 3EIUA 2O8EA 3T06B 2WTMA 5JCJD 1JAZA 5JNVA 4BMPB 4C20A 1DRJA 2HLHA 2VJAA 3IQZA 4WKBA 3PXDA 2BTQA 1P4RA 4A8JA 2XWQA 1RSZA 3V7FA 2O6HA 2QRNA 1GTG1 1JIXA 4HYTA 2BELA 2XUGA 4KAXA 3ACDA 4HLUA 4KWTA 3UJBA 1ZAYA 3B60A 3OC0A 3DTYA 5AUOB 3HVIA 4RS4A 5ERYA 4ABYA 2XY4A 5KZMB 4OQEA 5EP4A 3AWIA 1YDHA 2IXFA 1VDZA 3INTA 1BWPA 1N4AA 4TLBA 2DR2A 1JA1A 4TTIA 5ALLA 4C4AA 1TAGA 4MV0A 3KB2A 4BB9A 4C7OB 2GO7A 5FBQB 1O8CA 4MOWA 4RFSB 3R3VA 4TYWA 4GKBA 4CEIB 1XTBA 4XR4A 2P62A 3WG9A 3SXUA 10MHA 2X2OA 1V4BA 1XROA 4AT1A 1WSAA 4ZXPA 3KOOA 5KNCD 4H6WA 2PR2A 4S1PA 3KAPA 3WL6A 1EFVA 2V3WA 4JJ6A 3X1JA 3SWWA 1OHHA 4E88A 3NTRA 4WK6A 1KYXA 3PD7A 3N8GA 2IS6A 4TLLB 1QCDA 5K9ZA 1Y7LA 2WSSA 3L84A 1THGA 4G65A 2IHBA 2SCUA 4DGQA 2RH8A 1GCUA 2R8OA 1B6GA 2P2DA 4UMDA 1DFHA 2RIPA 5CJJA 3RFVA 4NAUA 3CZ4A 3MJVA 4HQ0A 4MP3A 4NR0A 2O3RA 3IALA 3W5UA 2RHWA 3U61B 4MQFA 4KFUA 1FDTA 1AZLA 1IB0A 1YZNA 3I5XA 3INNA 1RVV1 1L7XA 2G07A 3GXBA 1CPYA 5BWLA 5C1PA 4E07A 1ILEA 2D1SA 4RTPA 2R66A 2BJVA 4TT3A 1IYZA 5F77A 1MC1A 1PEDA 1UBGA 4WCFB 3IR6A 5FUQA 4H7JA 4GX0A 3OFNA 3K70B 3AEXA 2O3TA 4NAVA 4BO2A 2QNIA 4BVBA 1P39A 5HZHA 2PK3A 1TEVA 2V7PA 3R3ZA 4IWYA 4MUKA 3ZS9A 2BN4A 3TDKA 2J5QA 1NJ6A 1PTJA 1G20E 4HMPA 4B76A 3DCJA 1KAGA 4Q47A 3JQEA 3DMNA 1SEPA 1GITA 4YCJA 5DSZA 3Q7EA 4OA8A 4J1QA 2FHPA 4EDHA 3PFCA 3GJ5A 1QIGA 4BU1A 3GEPA 3DPUA 1BCRA 2R87A 1DWUA 4FSHA 2DVMA 3E0QA 3GGGA 1VLZA 4PF1A 3R8CA 3RVMA 1XEFA 4PS0A 3W1EA 4JI4B 4ZRDA 2JBAA 2J0UB 3IKLA 1TMYA 3ESQA 1RJ9A 4CQLB 4URXR 3GLUA 3C24A 1UBOS 1K7CA 4TKMA 4A0SA 2Y8EA 3PQCA 1I4EB 1CCWA 3B53X 2O1SA 3OU6A 3O47A 4HWKA 4BZWA 2JFOA 4JJKA 1EB8A 1ZGJA 3OOJA 4DLUA 8MHTA 3TRJA 4CV1A 1CZLA 3ISTA 2WUFA 2HY7A 3GNQA 4IFTA 3CX3A 4P4UA 4TXHA 4XJVA 5EIFA 4AUNA 2VLIA 2XQFA 1MPXA 5JPDA 2GUWA 3E9NA 1YZVA 3DV0A 3HKBA 3CJRA 5EC8A 1NJ1A 4EL0A 1DFGA 1GA6A 2IU6A 3GLRA 1ZW1A 3M4XA 1DARA 1AMUA 3IJEB 3EGXB 1BZYA 1FXUA 3W5VA 1Q1GA 3ZLBA 1Q7BA 4Q4AA 4B8ZA 1N2SA 3I6QA 3K1YA 3KQWA 5KEIA 4G8JA 3MIZA 3I72A 1USKA 1QHXA 4P8RA 4Q9IA 3DM5A 4ZVMA 3BIJA 4MMYB 1XA3A 2WMDA 4I99A 1ISPA 3K0SA 2ZJ6A 1GZ5A 1DEAA 3NTQA 4WY2A 1SOAA 2AFRA 1MTZA 1LV8A 2O8VA 1QGYA 4LJ9A 3RHSA 3D1LA 4U6QA 3UWSA 1GT6A 1RHMA 4L95C 4C3UA 4Y1RB 4Q02A 5C5DA 5BO5A 4CV3A 2P9JA 2I7VA 4UOEA 3AJDA 3P9YA 1JMYA 1OXSC 2ZIVB 3KYCA 4JELA 1NQVA 4BFVA 3LL4A 4D74A 1HT2E 3F3YA 3KAKA 3Q15C 4WFJA 721PA 2NO4A 2X7JA 3KVYA 3F9CA 4BYMA 3MBKA 2ZK7A 4CKCA 4PONA 1VA5A 3GCZA 4W5HA 4Q24A 1UDCA 5F2KA 4QKQA 1GRNA 1H2HA 4FNMA 2PX2A 2GN4A 2HRBA 4OL9A 4C03A 4KR6A 1N32B 5H3HA 3M2TA 3HZHA 1IUNA 1E4YA 5EWLB 4MKIA 4K40A 3TQQA 2QLFA 1HOXA 2WICA 3D5QA 4DXAA 4YT8A 3IKTA 2RBEA 4IIVA 3S1SA 5IKPA 3C6BA 3ILVA 1C0IA 4B6JA 3PE6A 2Y05A 4LDZA 4UVHA 3TKAA 4DG8A 1UKYA 1YMVA 4LHYA 1JKJB 3GUUA 4G4IA 4MUJA 5DMHA 1IAVA 3AMVA 2R8ZA 5CB8A 2RGGA 5ALNA 1G7TA 2J5RA 4C0LA 1RWNA 5HXAA 1SC3A 3RVLA 6AT1A 1WKVA 1VFNA 1I3CA 4GSKA 4DG9A 4N7RA 1YWGO 3HCPA 4N8DA 2UUPA 3H7AA 4TTQA 5JSHA 4GM4A 3VNUA 2DUNA 1LVHA 1HSOA 5KKCA 1NF3A 2CNDA 4F2PA 3O8QB 1I0ZA 2C1XA 3VOBA 4D26A 4OLAA 1NUHA 1DOAA 1VYTA 2CL6X 1KVUA 2AZ4A 3A9CA 3FJYA 3HDQA 4LQLA 5BN4A 2I3BA 3N8KA 3SSNA 1G5IA 3K15A 3ZCSA 4CGYA 2BGMA 4F9TA 4X60A 1ENOA 1COWD 1E2HA 2P6PA 1EUZA 3MCUA 3EXG1 4Z9BA 1XWWA 4HNAB 4GL4A 2Q4EA 1CY6A 1K6IA 2ZW9A 4X6YA 3VHRA 2O06A 1YZHA 4ZT3A 3TQRA 3HUEA 3LE8A 3LT0A 4WOJA 2SECE 1YRQA 4GYYA 4EPYA 5MGNA 4M0LA 1UPUA 1Z7EA 2YN2A 1I3MA 3ZVKA 5B4UA 1NY5A 3RQIA 2XRZA 2A2ZA 1AQLA 2ZG6A 3BSYA 4IJQA 5K20A 2ZAIA 4E32A 3UGQA 1CVRA 1JG4A 3EASA 4LE1A 3U3DA 3T7CA 1ORVA 4Q9JA 3OEHD 3FJOA 5BMVB 4IGIA 4OCZA 3L92A 1M9NA 1QGAA 1KBQA 3OM1A 1C29B 3PHBE 5HIIA 1TK3A 3RC3A 2J3DA 2BI8A 2WJGA 3DDZX 3R2JA 4IRMA 3PNMA 4ZICA 3R7SA 1I5OA 1ODFA 4NQZA 1IK6A 1TT7A 3RD5A 3GJTA 3OZRA 1OC2A 1RWQA 3AUTA 3GCWA 4JT8A 1KO5A 1MX1A 2C59A 4OHRA 4TMFA 1HT1E 3KCQA 4MHOA 5D3MA 5L3SB 4ZZ3A 1HNWB 1VRWA 3KKKA 4D4LA 2EHJA 1SCQA 1DQRA 2C9OA 4IF4A 3L4BA 4WGGA 4TZTA 5DYTA 4B3DA 4M7PA 2VYQA 3A3YA 1VJ1A 4WGFA 3K8ZA 5IM4A 1HNXB 2A5LA 1TFUA 5IMBA 4RLHA 2NXEA 2DHEA 3DJYA 2A5FA 2DCUA 2IXEA 2PZKA 3AOGA 5AKXA 3TTYA 3QHPA 3USZA 2JFNA 4MEBA 2G3YA 4R3WA 1GDTA 3VVCA 3RM3A 1D4AA 4OQLA 5CT6A 2CSXA 3JRNA 1NRXA 2LCFA 1CIJA 3A0RB 1XFDA 2C3OA 4ZO7A 4NCNA 1OUMA 3IUBA 3EDCA 4LYEA 4MUIA 2JHFA 3U16A 4X71A 4GP7A 4WNAA 4TXNA 1R1DA 1H66A 4D9IA 3R5FA 3ABOB 3NWJA 1XVTA 3S2EA 4CLDA 5DNUA 4RKQA 4WBNF 4UVIA 4EW1A 1E0DA 1OAOA 4KBYA 3ZDRA 1T2AA 3EARA 3E3MA 5ES4B 1SB9A 5FULA 2JVJA 1FFEA 5FAKA 2C9BA 4F2HA 1E1YA 3W8FA 1OWPA 2JATA 2VUHB 1GAXA 2PXXA 3DAFA 3JU3A 3LQ2A 5EPUA 1NMZA 5DEOA 3O7WA 4C7JA 4J49A 1S6YA 3ADDA 2PL9A 2PH1A 3CH4B 4WACA 4UBJA 4BUJA 3LUKA 2JK0A 2VF2A 3NTLA 1LQTA 1W2WB 2QVZX 3NZEA 2JI7A 1UIMA 4EUSA 2Z6QA 1EWRA 3BSFA 1Y4DE 2IIBA 4EP1A 3N8NA 4XWAA 2YZNA 1O95A 2ZYHA 3ZE2B 5A2GA 4JAVC 2RGYA 4LXIA 4AD8A 4EG7A 2RE8A 3WSTA 1A2OA 2CYAA 3U6BA 4R8MA 4DMFA 2XUQA 1E59A 4FZVA 1KYWA 3T9AA 1TKRA 2A4KA 4BFWA 5GPBA 3AI1A 4R8KA 3JD0A 1J0CA 4WDRA 5C0OE 1NDHA 3RYTC 3MAAC 3H2ZA 1M73E 2RIRA 4G41A 1P8JA 3FYHA 3QY0A 4HPJB 3CB4A 4US0R 3RVOA 3CNEA 3JQFA 1PTKA 4ZCTA 1UK9A 3O4JA 3OIDA 4L57A 1VRVA 1WXQA 5H02A 3TRFA 1T5SA 4LCBA 4LTDA 5DGXA 1YL7A 2X0DA 4XRRA 4ZT4A 1IDOA 2P5SA 1KMHB 4JBWA 4HH4A 4YDQA 4HTAA 4ZOAA 5EFZA 1V1JA 4CZ2A 4P7JA 4UNIA 3ZGVA 1E8DA 3K2BA 4GZ3A 3GH3A 3WJAA 2VI5A 4RJLA 2PZGA 1G6HA 2Q9UA 1CUUA 4CKYA 2RGRA 1T4CA 4F97A 2D7DA 1P2UA 1T35A 4QXQA 4YT2A 1V5IA 2XX3A 1N2OA 4X54A 3WGIA 3K8YA 1YCFA 2D5CA 3GK3A 1HYHA 2UXDB 1P2TA 2P3OA 1JR4A 4KYTA 4EABA 1AUVA 3IESA 2IXTA 2FWIA 5CT4A 2H1CA 4MI6A 2GNPA 4MGHA 4GRDA 1Q1ZA 3CPSA 3ET4A 4PBTA 4RYDA 1UPBA 4IIXA 4CKEB 3W5BA 5I7VA 2G88A 3VVLA 4R7TA 4ZPJA 2HLDA 4RF2A 3ZOKA 3BWDD 4V0OA 1Y1LA 1C8VB 2FOLA 3NH6A 3AETA 5BVHB 5T57A 1JLRA 4B0OA 1CF4A 3BQNB 1KVRA 4GQBA 3HQ4O 1R8YA 3FGZA 4IQ8A 1BXRB 4YMWA 5DBIA 3W3AH 4P4SA 3KSAC 3P2IA 5FWDA 4L74A 4ZAGA 1YA4A 5J58A 1ABEA 4FX5A 1RWKA 5L3QA 3ZHQA 2O8BA 1DTWA 3GJ3A 3VR1A 1NI4B 3TI9A 3BFPA 2WIKA 2INGX 1QDLB 3QJ5A 4L5JA 4WBSA 3RUAA 4CODB 1NNSA 1YJBA 2PMBA 1ZRSA 4ZAYA 4DRYA 3P0IA 2C7PA 1JHVA 3QVJA 2V55B 1VCIA 2ZJ5A 2JVIA 1QUEA 4JLVA 2GCGA 4KO1S 1EP3B 1NUAA 2QRMA 1MABB 2XBLA 2YC2C 3KR9A 3QWIA 3HR7A 4KVZA 1ESEA 3O90A 4BO5A 1ZK0A 4YYZA 1CP3A 1V5WA 3TEFA 1II0A 3L43A 2FWNA 3DFKA 2RK6A 3GVHA 4HN9A 4HWGA 2VDPB 4LNUA 4ZT7A 5EIXA 1JJ7A 1SBYA 3CU5A 1OKKD 2IE0A 4HDSB 3SPXA 3A1NA 3QXJA 4YPVA 5H3LA 4KNWA 3DZFA 4MGIR 4QSMA 5I9IA 1WEKA 3SDBA 4LRXA 1RWVA 2P35A 4M6WA 4Y6LA 4F5YA 1P1IA 2G9VA 4KLRA 2RKWA 2V1UA 1CJBA 3E1GA 1Z4JA 1PE0A 5EXPA 3ZU2A 2QTNA 3MZ0A 4AJEA 4ESOA 3AF6A 1M2VA 3R8FA 3KYIB 1E2EA 4QG7A 1MJGM 4EI2A 3JR3A 2Q2OA 5E3IA 2QUHA 3WK5A 2F2TA 1G4HA 3EIOA 4I3FA 1LX7A 3GRAA 5LYJF 3NGMA 5BV1A 3TIIA 2BH2A 1NNEA 4C0SA 2H29A 3MQ2A 1A4RA 2C4MA 1HORA 5K6AA 5HDBB 3HU3A 5FR2A 3HRHA 5K03A 1YS6A 4ZOQI 1LSOA 3VR2D 1N8NA 1XEXB 3IV7A 1GCIA 2VNAA 1O57A 3JZMA 3N2LA 1CZOA 2I33A 4N65A 2G9NA 5JFOA 3C6YA 3ZWOA 2JLYA 3A36A 3U48A 4QOSA 3EY4A 3EDRA 3GEBA 3IC5A 1PQWA 1WE2A 1FP6A 3OQVA 2BP7A 4G0NA 4NULA 5TLSA 1TNDA 2Q2QA 4XJTA 1IEWA 3JWEA 2E4XA 1ISHA 2I3DA 4EMTA 2WYHA 3DUFA 4HO1X 4URVR 2QUBA 4W9MC 2G9ZA 2RMKA 4RD0A 4RNCA 3QVWA 1Y8ZA 1TMGE 4QO8A 4AM8A 1DXHA 1KVSA 1ZKMA 5DN6D 4Q37A 1WBDA 1A5SB 4KJXA 2QY6A 1SR8A 1Y6JA 2FUCA 1YDWA 1ZK2A 4H0NA 2V7TA 4N1AA 5C31A 4C2BA 4E51A 1T5IA 5KTRA 3FRHA 2RJ3A 2VQDA 4Z7JA 2IEGA 5GJWC 4YLEA 2NWQA 5JQWA 1NUPA 3OF2A 1FQWA 2CLDX 3ICWA 5KUTA 2ZIUB 3LQ1A 1PJCA 3KALA 5TQVA 2C9DA 4N0DA 1LJ8A 2W6ID 2HMAA 3AY3A 3G68A 1P7VA 2HK7A 1GD1O 3MFYA 3ZHCA 4ISCA 5TDHA 1BX0A 1UK6A 4BX8A 2QD1A 3VKUA 4Z0HO 4G5QA 3GOHA 1C1HA 3HXTA 2J9YB 3QE0A 1H23A 3I6BA 4HXGA 4EG3A 1F1BA 3RKSA 1ZH0A 2FWBA 3UWDA 4QLOA 3LNCA 5AKLA 2GVZC 2I62A 1V95A 4DR3B 1CUVA 2IPAB 1PJSA 3EVCA 3K16A 3WMWA 1CQXA 3FWHA 1YBAA 3DOFA 3SR0A 1MB3A 5KQRA 2LCQA 5IF9A 1QPBA 2PJZA 2YQ4A 3BIFA 2VJNA 4FEGA 5HKAA 4GPAA 4K1XA 1NNUA 5KCZA 4L75A 1JEYA 2DH5A 2LRHA 1D2GA 2R62A 3ST7A 5FBKA 4YAKA 3PI6A 1Z5ZA 1JB1A 2NO0A 4Z4CA 5FHQA 4BB0A 2X9QA 4GYJA 2JHCA 5H5JA 4UEWA 1JSXA 3GBVA 4G2NA 1P9NA 4HOYA 3OQBA 4JXXA 3P9NA 3QW2A 1W5FA 5JIBA 3H0CA 1AMOA 2UXCB 4PHCA 1OGJA 3LVRE 2XB9A 3F5QA 4H7IA 3QTTA 4G0OA 4QTTB 3RUEA 1YACA 2ZUDA 3NWBA 4C7XA 3RFUA 3G13A 4IG4A 1N75A 4II2A 3RSHA 4L2IB 4WNYA 4XGIA 1D9XA 1OFUX 1SM4A 1VB5A 1VTKA 2FK7A 3NASA 2HTEA 4MRMA 1IN1A 2VO1A 5CMLA 4G0YA 2YBEA 4HQOA 3K0CC 4AYXA 4MVJA 4URHA 4F56A 2PUVA 1TE2A 2GEDA 2VA9A 3OIVA 2XUHA 3HA5A 3ONWA 4WZAB 3M4NA 3VPAA 1JYSA 4IIJB 1WQ4A 4NCIA 4K6HA 3UMFA 2R6GA 2AXQA 1NZDA 1O96B 2OECA 4Q12A 3RWBA 3DW1X 3K1AA 4GOND 1FXWA 4G4SO 1DC7A 4GI7A 2YXLA 4AICA 2JKYA 2D3WA 1HRKA 2I0FA 4MVCA 3TLYA 4CDRA 5DF1A 3Q5GA 1RXEA 4ZVOA 4W5OA 1VLHA 1JV2B 1YS4A 4L5IA 4PICA 2MOKA 4HYEA 4BLOA 4IUDS 4P1ZA 3ANMA 4AMGA 3AJEA 3HKDA 3A9WA 1FUYB 3FUWA 3TIVA 1OLXB 2RHBA 3NT2A 4UPDA 2X9LA 8ATCA 3CEPB 1OROA 4RXMA 1RWWA 4NBLA 1J0XO 3TSCA 2PNFA 1YA6A 4XLLA 2EFEB 1VA4A 2C5SA 4HGPA 2YWJA 5HQJA 2Y1DA 1ZK3A 2AFHB 4BX2A 2B3DA 3I4FA 4ILKA 1ZNQO 2HMTA 2OVBA 2XNCA 3B1JA 3IDZA 1SUIA 5C4GB 4O8CA 3DBHA 1FW6A 3C7AA 3RRYA 5ERXA 1R4MB 4PSAA 1W59A 5J47A 1OFHA 4I2NA 3JQCA 3C3YA 1E6LA 4HQ6A 1A27A 4ZDIA 4ZU3A 4Q4JA 3SLRA 1F0YA 4JLOA 3UMGA 2C4WA 1N1MA 4Y30A 1NTRA 4YRDA 1CNMA 1I94B 1XLTA 3EZGA 1U7DA 1PUIA 1LJLA 1VMKA 2WF5A 4RJIA 5FI5A 4UTNA 4GPBA 5L4LA 4R3NA 5LZ2A 1YB1A 2B7CA 1DO0A 3C14C 3OWHA 2R8BA 3TPFA 5ALJA 2LCIA 5KVSA 2AG0A 1Z34A 2B2CA 2C8LA 4QTXA 1OWMA 3RIMA 1IZ0A 4EMSA 4QELA 2WAYA 1V1RA 1RHUA 2V6BA 3DMPA 5AW4A 5L3ZA 2DBZA 3L93A 4PC2A 1WMDA 5IBQA 3CNNA 2C77A 3AEKA 5A1TA 1NASA 1KQNA 1EGVB 2JZOA 3KM0A 1UXHA 4GRIA 4KITB 2Q5LA 4BO7A 2R7LA 2YWFA 4FNAA 4GM0A 2OQIA 2JIRA 3B78A 3DJFA 4LZWA 1B6RA 4Q7MB 5C8ZA 5CPBA 1Y5MA 1T5DX 2QW0X 3F71A 3L4KA 3IVMA 1DGQA 4XCVA 2CFIA 1Y89A 4D81A 3FUXA 1E2GA 2EG9A 4BWVA 3OD1A 3DD1A 1RI2A 5G0TA 1DUSA 4QJ3A 5CFNA 2YMQA 4WFIA 3N59A 4IO1A 4JITA 3EHDA 2OAP1 3DBIA 4DABA 1OHHD 4EVRA 1EK1A 1OLSB 2BEKA 4IUCS 1VHTA 2C5LA 4FYHA 3NC1C 2WF6A 4B6FA 1FVFA 3ESAA 4JQZA 4DXHA 3FF1A 2RAFA 3T99A 4QPJC 1U65A 4FHDA 3F8TA 3N8IA 1VL0A 4QJ5A 2QVXX 3H5LA 3M6VA 1KIMA 4H6XA 1STOA 3KDSE 4ZK2A 3SVLA 4MINA 1SZPA 3C8DA 1ZPDA 1Q6YA 5JAPA 1LZKA 3HGTA 2PKCA 1XG5A 3KJGA 3PUZA 4RPJA 4KOEC 5B57C 4P6VF 2O0KA 3DLPX 3B7WA 2QLLA 3LJKA 2HA7A 3BVPA 3SJ7A 2PR7A 3DKPA 4BQFA 3KB1A 3OFND 4RPKA 1GG8A 3UMMA 4BNIA 3E8MA 3PXEA 1GQFA 2BR3A 1UANA 1KSJA 2JIOA 2QA5A 2QW1A 3HLYA 1OXBB 4U02A 5TRTA 4R2HA 3SHVA 3AESB 5I7UA 3FOEC 1X8XA 2A9KA 1S8FA 3AO0B 3G1UA 3IRVA 1NAHA 2VQSA 1P60A 4ZFNA 2CXSA 4B6SA 5FPKA 1YZLA 4NPAA 1Z0SA 2QLNA 2ZKIA 3BCHA 4Y2XA 2LDXA 5I9BA 4NWIA 3SZ3A 4M22A 3ZGLA 1ZCBA 4QPNA 1RJDA 3AJRA 4RWZA 4KQEA 1X0VA 5BSUA 2CLMB 3PUYA 4B4KA 1DX6A 1FQKA 1V11B 4JWTA 4PHGA 4BQRA 4O2AA 3AF4A 2HBZA 4BVGA 1H0KA 4LKOA 3BJZA 3ESDA 4K9QA 3AG5A 4O5AA 4E13A 5AICA 3GDHA 1JWBB 2FCRA 1A9OA 2YIVX 4FNGA 1ESNA 4DARA 4D8YA 1GM5A 4F9GA 4R7GA 1LS6A 3T35A 3KVRA 4JASB 1UAAA 1DQZA 2FQYA 3HYLA 1P18A 4JQCA 4DMGA 3LAWA 4U39A 1EXMA 1Z2OX 1UJNA 2L2QA 1XZBA 2NZYA 1LDGA 2XKBA 1MNQA 3H18A 2HPAA 5EXEA 1SKYB 2FTKE 1PO7A 1DBVO 1QG6A 1IY2A 1RYYA 4IDPA 4LZPA 4OHVA 2BR4A 4U7FA 3E70C 3QVUA 3L2OB 3LY8A 1TM2A 2H1VA 1PP4A 3W2HA 2DMRA 3GCGA 1J25A 2J7PD 3HYSA 2J09A 1KYTA 2OGWA 4D9JA 3A6FA 2F1HA 3F3MA 3SHOA 2IIQA 3SX0A 2VNKA 3LG2A 3VOAA 3DE1X 3EDQA 3GG2A 2LE0A 1E79D 2Z8ZA 2GT1A 1JUDA 1TKAA 5KVCA 3HU2A 1D8AA 1BNCA 1XMOB 3OPYI 4IH9A 2FRXA 3KQPA 4XIJA 3FCSB 5AW9A 3SZMA 3U9TA 3VPCA 4BUZA 1U11A 3OT1B 2VAMA 2FLKA 4FHZA 5AVTA 5KWVA 1IHXA 4JB8A 4EGSA 1ADYA 1U4NA 3TINA 1V37A 2YV5A 1XP5A 3QFHA 2WABA 1E20A 1XRPA 4PYIA 4QQNA 1WMAA 3UY4A 4I7EA 1A4XA 4C22A 4M21A 2W4QA 9MHTA 3VR3A 1IUPA 3VNSA 3MPUA 4RCZA 4AMUA 5C80A 3NVKI 2J4FA 3QVGA 1WCV1 3B1VA 1KO8A 2JCSA 1WXGA 2OCAA 3ZZUA 3FGPA 3HB9A 1DMSA 4OJTA 2IYXA 1SQ0A 1Y3FE 2GD2A 4QOGA 1P4AA 1OWLA 3GU3A 5EMNA 4ZVUA 4CTNA 1EVZA 1FBTA 1FA9A 3T7RA 2JFZA 3DUWA 4F45A 2Y0DA 3HB0A 2NTEA 1B1CA 2VZ8A 2QN6A 5ARDA 1NBMD 1SBHA 2ZRIA 2OR3A 3H1BA 2GBLC 2WU0A 1YCDA 2EU8A 1RAEA 3DMTA 1K08A 2B4KA 4FYVA 4YAGA 1E3EA 4A1OA 3VZCA 4C2AA 2VHYA 4O1HA 3V6MA 4Z7NB 3ER8A 3FKJA 3N8DA 4MHTA 1CW2B 4FDMA 2Z1MA 3O1HB 4YT5A 3TNDA 4FMDF 3V1NA 3B9BA 2V6GA 1ODIA 2NZWA 4OMFG 4TYQA 3GP8A 3ZHBA 3JYLA 1VLMA 3AIKA 1RQNA 5TMBA 3WL8A 3EPJA 2V45A 4BUCA 5DGHA 5NLLA 4P82A 1PG0A 3M81A 1U2PA 1KI6A 2R86A 4MTCA 3JWJA 1I51A 4C7MA 4OI1A 1EI9A 4PLHA 4ZIRA 3VSCA 5CXXA 4B48A 2JJYA 5C4IA 4JI0B 2XD9A 5TMPA 2IU3A 2C9YA 4GKVA 4ER7A 2P2SA 2VVTA 3N0WA 2F8TA 1EP1B 1BXGA 3ESCA 3TRKA 4F2GA 2IKQA 2QU8A 1EGQA 3NYRA 4LJSA 4KE8A 1ORDA 5ICEA 5H4HA 3O21A 3ZDBA 2IX3A 4C88A 1V8BA 4KPYA 1DRKA 2QJOA 4MR7A 5FD8A 2B0CA 4C0WA 4ENWA 3W7AA 3V4FA 5CAEB 4IHJA 3KETA 3KRTA 5F1KA 1XZPA 4AL4A 2RAUA 3A1FA 3TRDA 3E2PA 1ICIA 2V5UA 3R3WA 4RZSA 2WU3A 3L7CA 3N2GA 2ZQ5A 1WAMA 3C1OA 4ZCLA 5ANRB 2ZRPA 1HKUA 4XQEA 4DF3A 2OLJA 5H59A 2ZTMA 1YGPA 3A9UA 4TMVA 5KYXA 1GL9B 4QQRA 3AONB 4UKDA 4MLDA 1CUBA 1FDOA 5IUNC 4QJIA 5JYBA 5JSZA 1TM1E 5CT8A 1HC7A 4G9EA 1AMNA 3ZBPA 3QU7A 4M98A 2WYOA 5EUCA 4EO7A 1ACMA 1YQUA 5KYNA 1SVIA 5FI0B 3KZ1E 3L6BA 1ZVVA 1AQJA 1ADGA 1H2BA 3QVKA 4G5SA 4R9SA 4OJYA 1QQ6A 2A1UB 3R44A 4I14A 1CZNA 1ITZA 2GJAA 1KSGA 3UCFA 4E14A 3WGLA 2O2EA 1T15A 4D0GA 1R9NA 2X0NA 3QWBA 3QQ5A 2I4LA 4Y2VA 5EWMA 3A32A 5A7HA 3AEQB 1QHHB 5WRFA 4AECA 1CK4A 3G02A 1WOMA 1FSSA 5LQUA 2CBXA 2P2NA 1M72A 2GN6A 2OK7A 4L85A 1KA9H 1IIRA 5EG5A 5A9RA 2WHXA 3VR4A 1XL0A 1GFZA 3AHHA 2N1BA 3EXG2 1J2JA 4PWYA 4UE2A 5EESA 1QB7A 2ILTA 1W44A 4DSAA 4YX9A 2IEZA 2WDZA 2EIXA 3KEMA 4KNVA 4Q01A 1DIBA 2I2BA 1R6VA 4QNNA 1QM5A 4KSCA 2YY6A 1ZDMA 4ZCSA 1JALA 3CRRA 1RPZA 3JV7A 1M2EA 2D6FA 2J3QA 3VDQA 2AMJA 2ORIA 2BLLA 2AR9A 3BGOS 4B3XA 4EOGA 3F4BA 1IBKB 4DIUA 1RXIA 2OHGA 4POOA 5A5EA 2RHLA 3PXAA 4XLZA 5JBNA 2G70A 1QYDA 3IP8A 1JHUA 1FMJA 5FEMA 1WDLA 2DBYA 3RS4A 3BN3A 4LHXA 3BH7A 3D6NB 4JU9A 3BFKA 1GKUB 2NM0A 4QRDA 4TQAA 5LDHA 3NIBA 4Q1CA 4YECA 2JJ1A 4D2IA 3B9QA 3KHKA 4DTIA 1CQPA 2CZGA 4FKZA 1DKRA 2RGEA 4FYMA 1DJNA 4R9VA 2VAXA 1CRQA 2DBQA 3LX8A 3R20A 4IIUA 3TM5A 4O4IA 3ADBA 5KDOA 2IL1A 4CYMA 1KFEB 3MQ4A 1JIJA 4BC0A 5U4QA 1VECA 3PNQA 1UMCA 4LHEA 5IPFA 5JPCA 4OHXA 3M6AA 2A5YB 4K7JA 1OI2A 1GEGA 2YYAA 3PC2A 1CUZA 2PU7A 2Z8XA 5C52B 4BMSA 3ZY3A 2TSYB 4KXWA 4ZC1A 4DLZA 2O19A 2BM8A 3TIXB 5B3KA 2RAPA 2O7RA 2Z1NA 2Q1XA 2HPVA 1TM5E 2H4JA 2QU7A 3DE4X 3KXIA 4IVPA 4KEAA 3NH9A 5LD2B 3KEGA 3EZ2A 2HQBA 1FRZA 3ELBA 3STYA 1W6UA 4C7BA 3HV2A 3EUFA 1Y80A 4YJHB 3Q1LA 1K5GA 1NVKA 4FYYA 4U1RA 4WINA 1Q2XA 1IVNA 1Z0UA 4MQBA 4R51A 3FFBA 2XGOA 1YS7A 2LXNA 1NWCA 1Y9DA 4RVCA 3A1DA 1GL3A 3U40A 5EHXA 4N6NA 6NULA 1PT9A 4BHTA 1QRUA 4HGYA 1E0JA 4OBEA 3UKJA 3REGA 1XQXA 4M9SA 5IZCC 3WGJA 1N2BA 2ZYAA 4HRXA 4JX9A 5KI6A 4ZEMA 1A9XA 2QX9A 1DFIA 1I6WA 1OD6A 2W11A 2ZVJA 3AU8A 4N0MA 3EPPA 2BOVA 4NEHB 4A36A 4LUCA 4FCTA 1EDOA 2F9LA 1GG2A 2J08A 3CTMA 3N2IA 4X85A 3W5CA 3ORQA 5H83A 4GBJA 3OE5A 1VL6A 3WYNA 2VPIA 1WMBA 1I10A 2BSXA 1B76A 2HLDD 3BGVA 3ZZNA 2RI1A 1U2QA 4LPKA 4EFDA 3E9YA 4EGFA 1DKOA 1XZMA 4CUZA 4ZHQF 1TQ6A 5CPFA 3CGWA 2OD2A 3MYYA 2P4SA 1G5QA 1CP2A 3NT5A 5EMLA 3IDFA 3SDSA 8ABPA 4ETMA 3L7YA 4EJ2A 2VRWA 1R0ZA 1NJGA 1V2GA 1DWOA 2A0YA 3M5WA 1HURA 4CCYA 3ORHA 4W7SA 4C4SA 1S5PA 3ZI4A 4DOMA 2LKCA 4BNGA 1KQ3A 2HHLA 2CXHA 1FFHA 1T8YA 2CDBA 3AEYA 1UJ6A 3WRXA 2QSZA 3B12A 3B6IA 1FUEA 1L5YA 3B1WA 3IOCA 3KTOA 3PDWA 3PJGA 4GOMD 1CQWA 4GXTA 4KH0A 1U0SY 3EG9B 3CUSA 2C4TA 2GFIA 2IYZA 4B7UA 1Z2CA 3AM5A 3EXEB 3NIDB 2E5WA 4ANFA 4B32A 1NDQA 1G59A 3ME5A 4DA9A 3E61A 1LC3A 1ZHOA 2OCPA 3VVMA 1Z0KA 3JX9A 4PN3A 1BG6A 3H9QA 4CKWA 3WK4A 3OUTA 4YUWA 1ZIYA 2F43A 1EX1A 5K0JA 3TSAA 1D2AA 1B43A 4KIGA 5GOZA 3RUFA 1HXHA 2ZT5A 3OZDA 2ZQZA 3LF1A 1MG0A 1SOWA 1W5AA 3ORFA 3FWNA 4PRLA 4A8PA 3U5ZB 1KRWA 3JWHA 1DC6A 4A0GA 2R97A 1YJCA 1E5XA 1E8MA 1KEKA 4DNQA 1CRZA 1O6GA 5C7LO 3I6YA 1O0BA 3ZHUA 1PS0A 3RYIB 4MROA 4CMEA 4AUKA 4TVKA 2B4YA 1CULC 3A1TA 2XOEA 1JF8A 3LW8A 2A1TR 4I46A 4QHSA 1BDJA 2Y92A 3D3EA 4EDFA 4H1WA 5AD1A 1G5HA 2VEOA 1C41A 2EKQA 5BT8A 5AVOA 4YMGA 4GXNA 4WJZA 3OJWA 2HRCA 4JEIA 2YXPX 4ZQCB 3TOVA 1XPUA 2JB9A 3G9UA 4J0HA 4E2ZA 1RCFA 3H9JA 3M1AA 3ZYCA 3O8CA 1IY9A 1OVMA 4ZYUA 3FCOA 2QPTA 4KFRA 5EJ8A 3PR1A 2JH8A 3OLCX 4Q0MA 1UMDA 4BQSA 4LMPA 4K9SA 1XTUA 1YNSA 2JGDA 3G9ZA 1ESMA 3DBLB 3ETEA 3KKMA 4ZOBA 2MU1A 3OE4A 2V65A 1DG9A 1WDWB 1SBTA 1PJ8A 3GRYA 5HJ7A 2CF6A 5ESWA 2NO9A 4WEQA 4A0HA 4LECA 4JBNA 1BEZA 2OZEA 3JWGA 3KZCA 3H5TA 4R68A 2B78A 3TW8A 1QUFA 1Y4SA 4DVGA 1GQOA 1P5RA 1T43A 3NTVA 4QUJA 5K6RA 1FK8A 1MJGA 2O0MA 5BUSA 3HLKA 3DMGA 3IVRA 1M8GA 3H2BA 5HJEA 4UTOA 1FP4B 3UAGA 5SZJA 1JXAA 2ZJZA 3RQSA 2PBFA 3U3RA 5TS2A 5CGZA 3OJLA 3Q3GE 1L1FA 1RRPA 4NESA 4AROA 1J99A 1WSBA 3AXSA 3K0KA 5AK3A 4Z0PA 4ZI7F 2OM6A 3CR7A 3BWCA 3PR3A 4EGQA 4LXGA 2EX1A 2Q3FA 2W93A 3JZFA 4HGZA 2X23A 1NLMA 3LLCA 1C7RA 3OG9A 2AE2A 2W98A 3HU1A 4R1MA 5ALQA 1D6JA 1Z5UA 2HSDA 4UCQA 5FXMA 1QRSA 2E4VA 3L41A 2R1ZA 1MEJA 3E58A 4NJMA 2G71A 4ZOEA 5CH5A 5H9WA 5CB4F 1M6VA 2HADA 1I4WA 5DNYB 2HHHB 1K6MA 3M70A 3RI3A 1SXGA 1TC1A 3SNKA 3LY7A 3WO0A 2EFCB 1IG0A 2VHXA 1C9NA 3MWDA 2X0FA 4C78A 4M1YA 4CCWA 2NTJA 3VUEA 4E6EA 4OVKA 4UTVA 3L7KA 4HB4A 1U3VA 5AJTA 1R0WA 4KIJA 2QMZA 4TYMA 1WVMA 2ZU0C 3L77A 4ZT6A 4FOOA 1U63A 1JPVA 1TYZA 3DCNA 3KYDA 4H7KA 1U28C 2D1FA 1CKEA 2NXNA 2DWPA 1EH5A 3PWZA 4R2IA 3MUOA 1RYHA 3UG7A 4EO4A 2NADA 1XMPA 2EP7A 1UBCA 1NU6A 3EZYA 3GH1A 1UJBA 4AS3A 1F2DA 2WNIA 2L17A 1D4FA 1CLEA 4HQFA 4S1TA 1U1CA 3O7MA 2XDWA 4QD3A 2CFRA 3KS9A 3KL4A 5LUAA 3T5CA 4BQOA 4C6RA 5E0OA 4M60A 1X92A 2KI5A 1FTQA 2R6AA 3P20A 4RHXA 5ER9A 5EVCA 4O1MA 5FHRA 5JZVA 3DDUA 4E5SA 4YRZA 3KXPA 2FFAA 4G5FA 3TN7A 1X94A 2ZAOA 2EERA 2HWWA 4QRIA 4F4FA 3GDGA 1I5EA 4D1YA 1X1TA 3Q10A 3PCTA 2H5LA 4KK4A 4XWWA 4OAPA 3THYA 1JBQA 4RJKA 3GGSA 1Q0TA 2X41A 4KCGA 1MIOA 4MVJD 3WB2A 1SA0A 2XUOA 5M04A 1KFKB 1IN6A 1U8EA 1NMQA 2D54A 2XEDA 3QKRB 5AVRA 4HBGA 1LPBB 3FZNA 4QFCA 4FM9A 4YVFA 1XCGB 3BB4A 3HJAA 5FWYB 3BEOA 1JBKA 3H5VA 3PQEA 3RASA 4HNGA 1IH8A 4ALMA 2WAAA 4D02A 1M6YA 3ONEA 3IHKA 3FNEA 3MOIA 3ONFA 1EZZA 1FMLA 4JROA 3P9PA 4IMPA 2FN9A 5FDFA 1B3RA 2O5CA 2PZAA 4V0SA 3LY9A 4JP3A 3IQWA 2I6SA 2P2CA 1FSGA 1UOOA 5DTIA 3EFOA 2QLBA 5BYJA 1E2DA 5A4AA 1ZM4A 3SC3A 1T0PA 3R3UA 1E98A 3DXFA 4NYIR 2VDRB 2O8FA 1O94C 3CX4A 5HFNA 4A1FA 3CVWA 3JRWA 3LIIA 4IWXA 3E3AA 2QVLA 4UUMA 1B74A 2B8NA 4MMXB 4R41A 2CUKA 4EJ6A 5BOSB 2FR0A 5CDHA 1SHKA 5ED0A 3NOOA 5DNDA 3SQOA 3ZQ6A 2J46A 1T2CA 3MXTA 1IHUA 4LBWA 3DEHA 3T5BA 1LSSA 2HU2A 4IS3A 3QE4A 3QEMB 1SHTX 1HMPA 5MDHA 3I9MA 1E5QA 1RYZA 3N7AA 3T1TA 1LDBA 2HJVA 4K3UA 3I5AA 1OFUA 2P6MA 1R6XA 3ZZ0A 4KNYA 2PJDA 1UFRA 2GF0A 2UZIR 1WEHA 4CM4A 1YC5A 1X70A 4MXDA 1AOXA 1K7YA 4FXPA 1B15A 1P3DA 2VT3A 3SR3A 1H65A 3U4DA 1EFTA 2YIMA 2PUBA 2B4RO 3E5NA 2Q4OA 1LWNA 3OVMA 1KOLA 4H4CA 3FX2A 3WGGA 4D4HA 1Y8AA 4D9GA 1ZRHA 3HV0A 2P4UA 4HKTA 3T15A 4OBXA 1BCSB 3R7BA 2C2ZA 3C6MA 4EW6A 1D6MA 1F0KA 4GE3A 2XMCA 3FI9A 4TMKA 1GUZA 3QU9A 4J7UA 1QFXA 3PX2A 4FYIA 2FV8A 3ZLJA 1EB9A 1JEQB 2I2XB 2OFPA 2CL5A 5HS6A 3UWKA 3IAFA 4H7PA 5LQRA 3STHA 1Y3BE 2BVNA 1EFKA 1IN5A 3QJGA 4OSOA 2RG7A 1VJTA 2V1XA 4Q15A 1VL8A 5E38A 3DR3A 2YNMA 4UUBA 3IA7A 3NHJA 2DP4E 2FRDA 3KX2A 1E5DA 4BNKA 1H1LB 1MO3A 2MMGA 4U3JB 3T9DA 4DLAA 3IPXA 1P3Y1 1HDIA 2B5OA 2EP8A 2H31A 3C1TA 4XXHA 1B26A 4XD7A 3BX1A 1TJ3A 4YRCA 1HDXA 3HY6A 2GEVA 1X3SA 2O3SA 3DP9A 1FDWA 1MJHA 2RGNC 3U7HB 1XR3A 2DWOA 2W2KB 3FDFA 4ZAFA 2GCOA 1CT9A 2O3UA 3JVIA 3LLMA 3WMFA 2KLHA 2WMNB 1UIRA 3EZXA 3VR5H 2CFCA 3WXMA 8ADHA 2GN8A 3JAKB 4NK4A 1NZJA 1PG5A 1YOVB 1Y98A 2DQYA 4GT1A 2CV2A 4UM7A 1U7XA 4EFLA 5FNZA 2V74B 3G0BA 4FOPA 4HRYA 3EW9A 3EAGA 4ZTBA 4Q7QA 2GZHA 3O3OB 3UO8B 1XQWA 4WXPA 3DD5A 1B0AA 2X4LA 4H0CA 5B55A 4EPXA 1POXA 4P7BA 3OIWA 2CJWA 5DMXA 3F74A 3VMMA 4AG3A 1KDVA 2HU8A 2QLTA 3H84A 4PO8A 5JEDA 3HXOA 3D59A 3MWKA 3N76A 1OLOA 3W79A 1J23A 2A9RA 1JFLA 2V59A 4LZZA 1EYZA 1W5BA 5LBTA 1YIOA 3JATB 4ZP1A 3KOZA 5CM2Z 2QI9F 4O08A 5BRNA 2F55A 1HDGO 5LB4A 1SBNE 5KVQA 2HBRA 3ZEIA 2VTBB 3MD9A 1VPVA 3OTQA 3D8BA 3K6JA 4MW2A 4HAWA 3MT8A 4OJKA 1Q0LA 3FNQA 4GXRA 4ZKEA 2ZYGA 3SC4A 2I9KA 2SHKA 4ARZB 1L3IA 2SNIE 3FOWA 3BQMB 1I7DA 4LNAA 4IIFA 3T3MB 4KUEA 4B6RA 2GEKA 3ND9A 4WLVA 1PT7A 4KO8A 5BN3A 5C3MA 3TMAA 1DAOA 4R8SA 4QFDA 5LR6A 3VTKA 2EL9A 2VC2B 4ZQBA 1QQ7A 2ETXA 5CH8A 5GONF 2ZSAA 4PZUA 2XT0A 5KOIA 2TMGA 5I51A 5KSYA 4AWAA 4M1SA 3B7PA 4KFTA 4PYQA 1GKLA 3RUIA 4MS1B 5F98A 3A3PA 4B80A 1ZMXA 2ID9A 3PX3A 4XUGB 1SZCA 2OD9A 2VP6A 4KTTE 4O4LA 4TKUB 2JC3A 1PKEA 4JMPA 5GP1A 4N76A 4DNOA 3RLIA 4W8GA 1OYOA 1W4CA 4L28A 3HCFA 1AVTA 4AYTA 4KX3A 2JG3A 3BDIA 1O2DA 1PK8A 3KVVA 3LI2A 4O2BA 1L5NA 3VVBA 4H60A 2COUA 2CVFA 4K9PA 1TPYA 2TMYA 4URWR 5F7ZA 4ZOLA 2XNHA 3AVWA 4ZVSA 2HMVA 2E37A 2TS1A 2WUWE 3GQVA 3ACCA 4K9KA 5JRZA 3T3EA 4Q3LA 1QFJA 3AC0A 5KQSA 4FR2A 3O4FA 4M99A 4E7PA 2IITA 3AF2A 2NZ2A 3Q11A 4LHSA 3UJAA 4DV4B 1TQHA 1Z6AA 5GV7A 1T5TA 2DQKA 2RG1A 3G7UA 3PHHA 3RB8A 3WLKX 4BBJA 4NU5A 3EUAA 4I50A 4KHZA 4PVDA 4DLPA 1OBVA 2X2PA 4U6NA 821PA 3DP7A 2AOUA 4IJUA 2GAIA 1YZYA 3ETNA 1E0KA 4N54A 4YMSA 2XNSA 2QX7A 4GBMA 2PMCA 4U0KA 3L7AA 1UFKA 1TMOA 4CR8A 5F64A 1L7NA 5P21A 3QWAA 4ID3A 4NXNB 3ZWQA 1DNPA 1TC2A 3WYEA 4Y67A 2Q1WA 3JALA 2F48A 2A88A 4YRIA 3UATA 3NI2A 4R01A 4FMCB 4CLEA 4TTSA 4BMOB 4UCWA 1R4ZA 4YRJA 1SH7A 2CSUA 5DHRA 2C1ZA 3UAXA 8GPBA 3GVCA 1NXTA 3WA6A 1UMBB 2QMHA 1SC4A 1IQPA 1TJ5A 1UZMA 2ON6A 3U4AA 3OHSX 5DM0A 2FW7A 5MN6A 4LSWA 2R4TA 3VYUB 1ZQ1A 2DKOA 2FB9A 1P9RA 3CZQA 4JT4A 4S1VA 4ZI2A 2Q2NA 4LVOA 2C5AA 1ZUIA 3A1UA 3CWCA 4JQOA 4QC2A 1E7YA 1ULTA 1Z26A 1XZ8A 2FPUA 4Q19A 5TB5A 1OJ7A 4C7OA 2GEFA 1KGDA 4NE7A 1OZGA 4RFSA 3QKWA 2VNHA 2ZR0A 4GI2A 4LHWA 3I58A 3LWDA 4PRYA 4CEIA 1BW9B 2B25A 2UZ4A 1ZH4A 3GGJA 2Q1TA 1V8FA 3ET5A 3IPCA 4M49A 5J4HA 3GT7A 4M1OA 2VK4A 3DEJA 1LCIA 1EDDA 2FY8A 2ID4A 4N3NA 4QGFA 3ABIA 3DT6A 4DQLA 4D0NA 5BN1A 1U9ZA 1UBNA 2Z0MA 1W47A 4YK7A 3CS3A 1CUFA 1XCBA 4L6IA 1O9BA 4Y2SA 3GLQA 2IDJA 3I2GA 4RK7A 1G66A 1KMNA 3EISA 4PZDA 3FFAA 1WXEA 2RGUA 4RANA 4N0PA 1G8KA 1N3YA 4RD3A 4CMCA 1YK0A 3RHZA 1P7WA 4IZHA 2HHAA 2FHSA 2B21A 2UYGA 1SUEA 4V0MA 3B5JA 3RFCA 5BR8B 3UUWA 4AUMA 2IYEA 5FO1A 1E1RA 1TQ8A 4A82A 4YIKA 4WCFA 1QYVA 2WAOA 3QXXA 4FLEA 1KP2A 1Z56C 2W6JA 5CK5A 2PE5A 1FLAA 1PK9A 3TB6A 3NJ8A 5FUVA 1BX3A 3NHRA 3FOAA 1IEQA 3DXXA 4DM7A 4FOSA 4L0QA 4N3GA 3NUGA 1VE3A 4HFJA 4KDCA 4TTTS 2QGFA 2XOKA 5LLSA 1GQSA 2OP0A 1ZMBA 4GX2A 3A27A 2OCXA 3RTEA 5LP6B 3ROZA 1X1DA 4LDRA 4CG3A 3D8RA 1OU0A 1W2HA 1VFPA 3BCSA 3KSDO 2JI6A 2VYNA 4D3SA 1BVHA 3SFZA 3B8HA 4MEJA 2ZRBA 2ZUCA 4Z6KA 5JCZA 1VI6A 2PNJA 5JQGF 1LPOA 3KOUA 3DLTA 3AX6A 3KQTA 2CLLB 1BKYA 1YSCA 5HIJA 1S02A 1FMFA 1GOTA 2QX8A 3GJYA 1G2QA 1NM5A 1NVEA 1TZJA 2AVNA 3BMNB 1SVNA 3JQ9A 3F7MA 3KUCA 3IQDB 3QXHA 4Q3NA 2NAPA 3SKXA 4B09A 5LXTB 4JQSA 3DBVO 2J0UA 4BWYA 1GVHA 1CEQA 3MHPA 4ZVPA 3W05A 4CQLA 4EJSC 4Y6OA 2MCFA 4J1SA 5KU1A 1N5LA 2D5AA 2TMKA 4LG1A 4MZXA 1L9KA 4XFKA 1R8QA 1LQUA 2ONZA 4NC9A 2X3YA 3L3BA 1PI3A 4J1TA 1E2LA 1P1JA 1B42A 2FUG6 3DZKA 5J43A 1USVA 4NONA 5CFRA 4A9AA 5JROA 3U3XA 5DEIA 1IVSA 2PGAA 2V7QA 3FOZA 1U8XX 2H1HA 4GVPA 3M49A 3VR4D 2GRAA 3LL7A 4D97A 5DXJA 5DM4A 3E22B 2VSQA 1E3SA 1IMOA 1KIAA 2E9SA 2NLOA 3I6MA 3EGXA 3O26A 1M33A 4IXTA 1U81A 2R2GA 2V4MA 3PVZA 3QLVC 2VRBA 5D1HA 2AN1A 2H7VA 4ALLA 1J7KA 2FA9A 5FO0A 1U3FA 2E4WA 2WTEA 3AT1A 4X24A 2AA3A 3TM4A 1SXJB 3RFFA 2DPMA 4MJ3A 3UAOA 4D0SA 5JOQA 3BT7A 3DNPA 4QFMA 1SY7A 3TE7A 3U31A 3EVEA 1P72A 3C43A 1AK2A 3RJZA 4KIUA 3BHNA 3FHJA 1PGPA 4MI9A 5LIRA 3G5TA 4Z0NA 4C5CA 1K6XA 1XJCA 4Y1RA 1GR1A 4TV8B 4HNRA 1AQUA 1JDPA 5I7EA 3I34X 1MQ9A 4FLMA 5KTKA 1JH8A 1CR2A 1XAIA 3TEJA 3HB5X 3NORA 3LP5A 4IMIB 1Z4KA 4P92A 4TTVA 2Q50A 4TKVB 5CLHA 4JLNA 4D92A 1EESA 2YDYA 1TUIA 4JOCA 1F7VA 1UBLS 2A14A 5EPOA 4EYQA 1E9VA 3E03A 3PNLA 4JY7A 1DBRA 4DR5B 1X77A 4B0PA 1DJOA 3PEYA 2ACEA 5EMJA 4EFMA 4HR7A 3F5DA 1G38A 3CZ9A 1R6TA 1H6CA 3DE6X 4J7AA 3CV3A 1UR5A 1IXSB 1YKFA 2B7BA 2EJTA 4Y2UA 4NBRA 5DWQA 5EWLA 4CGZA 4HWTA 4RQUA 5J4KA 1F06A 1NKTA 1B8NA 1QSGA 1RT9A 1SOVA 1DWPA 1VGRA 3DZJA 3U7FB 1I7LA 4OX9Y 4MLPA 1CR6A 2A5GA 2VRCA 1JT9A 1RYDA 5DHQA 1UXOA 1ZM7A 1T9CA 1UM8A 2D7JA 2PIAA 4QVGA 3C3JA 3SYRA 4C6SA 3HA2A 1Z5WA 2ZLBA 4WWHA 1OW3B 2PUWA 3PLAE 2O4UX 1CJSA 1JKJA 4JLWA 5EJ7A 5JV5A 1ZN8A 2D2IA 4FR0A 1KEVA 2NO6A 5AK4A 4P22A 4LJ6A 3TE6A 1O6ZA 2PLAA 3EC2A 2D5IA 3FMPB 3PQ7A 4MUNA 3S5JA 3QQPA 1EK0A 2VJMB 3WKDA 3M3HA 1XWIA 4XTRA 2ZYDA 4K5QA 5AI5A 3O8QA 4PFQA 4QG3A 5AW7A 2BR5A 1NJ5A 4F04A 3F5MA 4I0WB 4P80A 4TN5A 5JD3A 4TS9A 2XVXA 1L0BA 4KZPA 4QA9A 3UXHA 3WJ7A 4BVEA 2XCTB 3KKQA 3V1TC 4B3MB 5AXCA 2YJNA 4XZ3A 1Z12A 4EFKA 1KEZA 1YDGA 2W00A 1JLSA 2CB9A 2OKGA 3ESBA 3EGVA 4HNAA 4G63A 3W8EA 2WMOB 3F47A 4G0XA 1JU4A 3OTOB 3ZVMA 4YRMA 2VOEA 2IH2A 1KZ7B 4JDPA 2HDHA 1Y1TA 2YXBA 3BSWA 3TVDA 1Q7EA 2YVQA 1X38A 3BGDA 3H0EA 4BCDA 4IGFA 3D3QA 2D1RA 4UUQA 1Y8QB 1EA7A 1ZD8A 3LV8A 4K05A 4HDMB 4Q66C 5LMZA 5DGDA 1O6CA 3NHWA 3TR5A 1Q20A 5A5GA 3CUWA 4H3VA 1W36B 5L7TA 5JSKA 4KFSA 1UQRA 5BMVA 4OB7A 4YCNA 4MUYA 1KY5A 2BWJA 2WF8A 1JAXA 4A2PA 2H65A 4BLTA 621PA 2UUCB 4HQKA 5AOCA 3NEJA 1WKBA 4E5NA 1K89A 3GB9A 2H2WA 3R5XA 5HZMA 2PEZA 4PZAA 4RIHA 4ALIA 3WGMA 4HS9A 5L3SA 3F4LA 1IRIA 4DILA 2JFXA 2XZDA 2I6QA 3B5IA 3QRWA 1E18A 5CEEA 1JIUA 1EX6A 1T2VA 4ZT2A 3I0NA 2IUYA 3ZE0B 5B58C 3RC8A 3PITA 3W4KA 4RDIA 4NFYA 1EQAA 4U7PB 2C3UA 4ZVTA 2DSNA 2AMFA 4AJ2A 1VHWA 2AS0A 3GLIB 4I55B 1WS6A 1UOPA 1C0EA 2IF0A 2TYSB 4MQ5A 1E1DA 1L4HA 1USUA 4Q03A 4TMYA 3ZWXA 4PR3A 1J5EB 2QJFA 4M7RA 3FDZA 5JJLA 1UF9A 3E1SA 2VDQB 4OYRA 4QGSA 1ZVQA 1TQ2A 5F9FA 3RRNA 4ZZ0A 1Z7WA 4ZO8A 2EFDB 1RTKA 1EXVA 2YHAA 4C4OA 4ZZ1A 3G2IA 4INPA 1JVBA 4U9HS 3MPOA 1BHJA 2VSYA 2Q07A 2V7EA 1ISGA 3N3BC 3TCXB 3KG2A 2D13A 2O48X 5E4JA 3CIFA 4RD6A 3BMXA 4CIWA 4JFAA 1WX1A 4LOHA 5DTRA 3UHJA 2ZSEA 4YAOA 3HEAA 1C30B 4NQRA 2V6FA 1LX6A 3Q3CA 2QXYA 2EQ5A 5DGTA 1G8AA 3WDMA 3DULA 1FYDA 4QWMA 2SKDA 5FI3A 4DFDA 1RXYA 2FGJA 1SHZA 3BZWA 3DW3X 1Q83A 3EMVA 4DJTA 1W1IA 5BWOA 5HR5A 1I4DD 1QF7A 2EG5A 3LIPA 3HPQA 3GLSA 4QBGB 5G4KB 1JWLA 2I7CA 1PV2A 2ESRA 5ADHA 3IXLA 3JD1A 2IHVA 1JIKA 5ILGA 1NLFA 4NYMQ 1JPUA 3S55A 4EQZA 3P94A 1A1SA 2MR5A 1ZSYA 3GRUA 4WESA 2J9ZB 3UK2A 2WV7A 3ZN2A 4D99A 4HRVA 1Y5NA 1R64A 1XSEA 2EZ9A 5J1TB 5KDLA 5JLJA 1ZS9A 1FYFA 3UM9A 2R8YA 2XT6A 3LXUX 4JKYA 4YY3B 1QVZA 1QRTA 1HDCA 3CUTA 4C0KA 3THXB 4IAOA 4R2JA 1GAJA 2O3QA 5P8WA 3MT0A 4D9KA 1VL2A 4WZBB 5JXWA 2JLWA 1QV7A 1W1UA 5LBIA 2Q6KA 5ESXA 3CRVA 4V03A 2BCGY 1T8TA 2BGJA 3DZIA 2LIPA 5AESA 5B7PA 1BE0A 1E1CB 3A28A 3P32A 3UMYA 3KKPA 1AT1A 1KQPA 3D6JA 3E9RA 1AZWA 4X1OA 5T8KA 5CB4B 4HB0A 1DUVG 1YJQA 1DHTA 2J31A 3SJCA 2OXIA 3NUZA 1KMHA 5K0TA 1VYHA 2QF7A 1UT8A 1XZGA 5K0SA 3GPIA 2NU9B 5JH7F 2H06A 3PC8A 2VR1A 3WWOA 3A05A 1G8GA 4JBIA 3EG5A 5F76A 5BWMA 3EULA 3GGDA 3O8OA 2QZJA 3RJ5A 3EF3A 1TCUA 4XVHA 1IZ8A 5DBOA 1NXOA 3G88A 1FSZA 2QRPA 2E55A 2WJPA 3HJHA 2IUTA 1QWSA 5TMDA 2M98A 1DINA 3A6PC 2O8NA 4CV0A 5FBZA 2FW6A 3B48A 1EHYA 3KQOA 5SZHB 4F60A 3HSSA 1X7WB 2QSJA 1FNBA 2GK7A 2HCFA 3NBQA 4JC4A 1DO8A 2OAEA 4EUEA 3IXMA 2ZKLA 3TAHA 3M9XA 5DHAA 3U4CA 3HBFA 5IYZF 3W5SA 1L1QA 3W3ZB 4CKEA 2GKSA 5A3SA 3EXFB 3FJ1A 3RT9A 3BSSA 1QRRA 1BQ4A 4UD6A 2IPNA 1SB8A 3GRCA 3MUFA 5JCOA 5BVHA 3I5MA 1A8PA 1Z2EA 3H5NA 3WLNA 2DGDA 4RVOA 1E6CA 3GEGA 1BXRA 2A9JA 2FDXA 4LK2A 4UM9D 1QGOA 1MVOA 5BUQA 2FR8C 2F4VB 2BDUA 3F73A 1HZZC 1TT5B 4FP9A 3SE0A 1NI4A 3AERB 3GJXC 2PL5A 2IH5A 3K70C 2J8ZA 3IQGX 1KP9A 4UUPA 3RJMA 3LX6A 3N28A 4NEQA 1IJEA 4XM0A 1T29A 1R4NA 1ZN2A 5CT5A 2Q4DA 2J3HA 3IHTA 1MABA 5I9SA 3J7AC 2H59A 2ECQA 5L53A 4RKEA 1JZSA 3QU2A 4HMQA 1EG7A 4NZNA 3QV1A 3RIXA 3W0LB 1P7PA 4HDNB 3CCCA 1PW7A 3HN7A 3RAPR 4AJOA 1LGYA 1FCJA 1E99A 4RUKA 1UJ2A 2W22A 3OPYA 4HDSA 3D3KA 3EJ6A 1SVLA 2FN3A 5A6SB 4LWZA 1LKZA 3RBVA 3HSYA 3QA9A 4HAIA 5DU2A 1T8WA 2YICA 3VJMA 4AK9A 1EHIA 4BBAA 3ZQJA 4F4UA 1NURA 1S9HA 2ZRDA 1ZKDA 5I8PA 5LFAA 1I9CA 4QGBA 3NANA 1V5EA 1W25A 1OU4A 1KDPA 1Q1AA 2JAWA 3G9QA 1S8AA 4L5BA 4E1VA 3TDMA 2VTKA 2XF2A 1X8JA 4GI5A 5J2TF 2VUIB 3N86A 5FOXA 4XVCA 3ZW9A 2GK3A 5JMTA 3QY9A 2P7HA 2XMRA 3F4KA 4JMLA 5E6UB 3B1ZA 3HXMA 2UVPB 3T1QA 1RQPA 2PUTA 2EBFX 5G02A 2I4OA 121PA 3UWPA 4FILA 1QK3A 4UD2A 2YJ6A 3JTEA 3UFBA 3OQNA 2H2DA 2W0MA 1Y3DE 1XEXA 4BE4A 4PX2A 1AU9A 1NPYA 1DIGA 1QHNA 3IMCA 3W8DA 3G5LA 1AURA 2J9GA 3EVTA 4GI1A 4Y2QA 1SU4A 4H31A 3DEIA 4LKRA 1TXGA 3FPCA 1QHGA 2KW5A 3OZAA 4KW7A 4XDGA 1T2UA 2WWVD 3QUBA 3CPJB 1MZPA 1YT5A 1M67A 2JA1A 3RVKA 2ZI4A 1PSZA 1UBMS 1EHCA 2B5VA 1GZ6A 3NBXX 4IIBA 2NTVA 4D3YA 1C4XA 1VL1A 3OLZA 2Z5GA 3UW1A 3VO9A 4ADSG 3VYTB 2I6FA 4OB6A 4L7VA 2JEYA 3S2SA 4Q3CA 2O54A 1FFWA 3BXPA