1S2LA

Purine 2'deoxyribosyltransferase native structure
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
167
structure length
165
Chain Sequence
MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFEIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine trans deoxyribosylase
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
total genus 49
structure length 165
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s2lA00
4WL0A 2KHZA 1S2IA 1T35A 3U39A 1YDHA 4PFKA 2IZ6A 3GH1A 4LJLA 1WEHA 2F62A 2F64A 4LJKA 4HX9A 4FYHA 3F5MA 4U1RA 2IZ7A 1RCUA 2PMBA 1KZHA 4KXLA 4I7EA 1PFKA 4OHRA 4JEMA 3OPYB 1S3FA 2F48A 1WEKA 3SBXA 4A3SA 2HIGA 1F8XA 2NX2A 2F67A 3BQ9A 3HNOA 2F2TA 1S2GA 4KXNA 4FYKA 2Q4DA 3OPYA 2Q4OA 5AJTA 3K2QA 3PFKA 4RH3A 2A33A 5ITSA 4P5DA 2KLHA 4I4IA 3O8OB 4JELA 6PFKA 3UQZA 3O8LA 4KXMA 5AJUA 3IMKA 3O8NA 3EHDA 4I36A 4MCJA 4NPAA 1MTOA 1F8YA 2A0KA 4P5EA 2IZ5A 1S2DA 4OHBA 3O8OA 2PFKA 4FYIA 4LJRA 3MAJA 1S2LA 1ZXXA 4MEJA 3QUAA 4JENA
chains in the Genus database with same CATH superfamily
3CLTD 2W0SA 1UAAA 1TVMA 1NYRA 4OI2A 1JG3A 2JI7A 3PHHA 2P9ZA 1M6HA 3AUJB 4GXQA 4U7GA 3WQSB 1A96A 3L1KA 5KTPA 2OE2A 3CR8A 2P8SA 3ESCA 1C8BA 1PBNA 2Z3VA 4QPCA 3HI6A 2CVHA 1JKXA 1XWFA 4RCZA 3EXAA 2BKEA 4BCBA 2AR9A 3PUZA 3QJ5A 4HWKA 3RQIA 4MITA 4DMMA 4Z4QA 1TKRA 4X24A 2ZXUA 5C1PA 4BNNA 2LUOA 1AKQA 1SG9A 4IEIA 1K4KA 4UNNA 4C01A 5B1YA 3RVMA 4TV9A 2VRCA 3E18A 3I2GA 3E03A 1O3YA 1GZVA 3KZ1E 1Q0PA 2ANCA 3TI9A 2CVOA 3FFWA 3WMEA 2WUWE 4HZUB 6ADHA 1AGRA 1W76A 3KQMA 2GJSA 5CNMA 3KOOA 3R5JA 2QR5A 2EBUA 4B6GA 3COVA 4D9EA 1VJGA 4PNEA 3RU3A 3VX4A 1FX0A 4XVHA 4CMCA 3L0YA 3ND9A 3OJ0A 4JCCA 3K1AA 4NCXA 3TZLA 3HFJA 5CVUA 4K0KB 3EK2A 3FRJA 4QPJC 3IL2A 2K6GA 1UJCA 3VXKA 4EPRA 4EO7A 2JASA 1W48A 5T4FA 3CVUA 2RONA 3QH4A 1A9XB 3RTCA 4D79A 1Z7YA 1K8YB 3CCFA 4TPKA 2LCQA 4MRPA 3VPGA 5BSEA 2DULA 2HLPA 4TGLA 2QRGA 4M4SA 4US1R 2ZB7A 5C7YA 1LB1B 2ZBDA 1GPJA 3JQAB 4JHLA 2AR0A 1KY2A 1M2NA 4ZFNA 3D0OA 1E2BA 1PX0A 4OYLA 1KYVA 3M1IA 3DLTA 2O2XA 2I2FA 3DKVA 3DT9A 2NU8A 1SRQA 1P4GA 1RBYA 3MGAA 3TDMA 4AKHA 1KI7A 1FUUA 4K9MA 3KPYA 4FI3F 4ZCRA 3T06B 2RH4A 2V3VA 2RGYA 3EMBA 4F45A 1J0CA 4N41A 4P4GA 3H5NA 1W75A 4JJ7A 1E92A 1SCBA 1FQKA 3OZIA 4P92A 4ZZ2A 5JFOA 4EHNA 4W1SA 1QR2A 4ZQIA 5IDQA 4OD0A 1T3TA 5AW1A 4IHJA 1YBHA 2X5KO 1HQDA 1IN6A 2YZMA 4J9UE 3VSAA 3WHPA 4KGDA 2RJNA 2JI4A 1W46A 1UXKA 3GNQA 5GONB 5BRNA 3L5KA 3PR2B 3IB3A 1EK6A 3MW8A 3BMCB 3UN1A 4DPKA 4HYEA 4DQ0A 1K86A 2F1HA 3FBGA 4G81A 3VNUA 5CGQB 4ARUA 3IJ5A 3C3EA 1ODIA 4KQFA 1JIJA 2XWSA 4XEUA 1NDQA 3H8SA 3I53A 4KBYA 1G8JA 4QAQA 5HZHA 2G28A 3GGGA 3QXGA 4TWBA 3R3SA 4ZVOA 4EUSA 1DAOA 2FZLA 1TAGA 3R5TA 4D4IA 4RNDB 2FOXA 3CRW1 1E9EA 3T54A 3TW8A 4X9XA 3A6PC 3CXUA 2BY4A 5BNTA 3D43A 3L9WA 4GL2A 5KWSA 2PSFA 2PL9A 4YQYA 5EKDA 4MO2A 2X2PA 421PA 4YREA 1KIFA 1FNBA 3IE0A 4OHVA 1IN5A 4PO3X 4UMVA 5E4YA 3CVOA 1AK2A 4WD3A 1ENYA 1PWEA 4KXVA 2W71A 3UFXB 2HYDA 2OD7A 4MDHA 1KERA 2FK7A 4DRYA 3AY0A 4KYVA 4ZZ1A 2IU3A 3IKLA 4N6GA 4ZCSA 1T8UA 5IT4A 1PGJA 4RM2A 1XP5A 3IEKA 2BV3A 1TMKA 3N05A 2IGBA 1K3UB 1X19A 4PFKA 2V3CC 4KDEA 2BBTA 1I2MA 1W7AA 3GT0A 4H4CA 1EEHA 4MWGA 4Q47A 4I8IA 4QDJA 3LQQA 2CXHA 4KDCA 3H87A 3EWAA 1LLUA 4U0KA 4JXZA 2O5RA 2CL0X 3GJXC 1U6IA 3K2EA 1FNDA 3VC2A 4TTSA 5C8YF 3EXHB 4BQQA 1TZ2A 4Z2YA 2HXSA 2C1ZA 5EJ7A 3NJ4A 4LX8A 4IDOA 2WA2A 1OU0A 1E6LA 1G6KA 3DAPA 4M9ZA 1KO8A 4L6AA 3HUEA 2FFQA 2XECA 3CNOA 1TJ5A 3AR5A 3BXZA 1SXJE 3B2EA 3NRBA 4FX5A 5J9FA 1IZ7A 1BE8A 4HEQA 3WIEA 4EM6A 4DQVA 1HETA 2V65A 3IRVA 1KRXA 1LJUA 3EA4A 4RUKA 2OHGA 1XXHE 3WL5A 2UVPB 4FQ7A 5BSWA 2QT1A 3OT5A 1YA8A 3CRQA 5IS2A 1K97A 5CM9C 4KWHA 4D96A 1GKUB 3BDIA 1N6OA 4B6OA 4MHTA 1B8NA 3ZWOA 1AK1A 1RP7A 4TVBA 4ZU3A 3OE1A 3D1LA 3ZCXA 5HR5A 3QNWA 2P0YA 2R1VA 4GVXA 3IBYA 3VO9A 1JJ7A 4CUZA 1R0LA 1ZD1A 3JZAA 1OFIA 2IYSA 3K8ZA 3V1YA 2ZWMA 5REQB 1DIBA 1DBSA 7REQA 3LKDA 2G88A 1Y3IA 9ABPA 1AD2A 5ITVA 5ICMA 4ETNA 2ZB2A 1A7AA 4W5OA 2H1VA 1X7YA 3IELA 5CJJA 3IAXA 3LVFO 4TT3D 4M7RA 3S8EA 1TA0A 4PWYA 2VJPA 1N92A 4O2AF 4JP8A 1NNUA 5F1PA 2AG8A 3JQRA 4KOEC 4ZI7F 4L8FA 2PUBA 5BUSA 2G6TA 2IZOA 1P6XA 1R0KA 2CLIB 1AA6A 3EQ2A 1C4OA 3JVDA 3COYA 1OOEA 2FLKA 2YVKA 4O1HA 4IJMA 5SYAA 4BV9A 4CHGA 2VHXA 4B6SA 3CB4A 3F67A 5AI8A 3N39C 2B9VA 1JQDA 5DLEA 5CBPB 2QM8A 2W48A 2Q7XA 4R2LA 4UZSA 1WETA 4G1CA 2I3DA 3IOYA 5IKMA 1E8NA 1IJBA 2AOXA 4NH0A 1J39A 2FVXA 1P9RA 1RI4A 2QXUA 4BLWA 3W8FA 1XCGB 1XRQA 2AYYA 1EBFA 1ZCBA 5ALRA 1X8JA 2I6TA 2W2KB 3KSUA 2W83A 4GOXA 1CF4A 1JHYA 4DLSA 2H1LA 4OB8A 5HJ5A 4MGEA 4E7OA 1JQLB 2FMHA 1VJ0A 3BPSA 3DEAA 2GCNA 1AXRA 3AF4A 3T5MA 4DBLE 3EQ9A 1L5HA 2J31A 3G0GA 3KWJA 2DT5A 4DVGA 4Y7DA 2Z9CA 1X3LA 2IGTA 5FORA 1QHNA 1LDNA 5BSTA 3RRBA 1H65A 3EF3A 3LO5A 2WWWA 4KRXA 1MB2A 3KNZA 1RHRA 4UE2A 1ZZGA 1EHCA 3C8DA 3T4UA 3L4SO 1T5OA 4XGIA 1AB6A 4MGIR 3S8MA 3NATA 2Q5LA 3M2TA 4L02A 2PYZA 4QG7A 3WAJA 1DSSG 2WVGA 4ZAXA 4ZCLA 3AHGA 3HDHA 3DYIA 2R8XA 2GPSA 2ENUA 2HHAA 1YQXA 3NJRA 5T5QA 3WZ2A 3FRHA 3G5AA 3PUJA 2XTZA 4BDTA 4KZPA 4GOLD 2R85A 4C6HA 1Y4UA 3NXKA 2XUFA 4IS3A 4CTMA 1E63A 5KDOA 2AR7A 3N7UA 2BGMA 1QV6A 4I5GA 4PSCA 3OQJA 2ZCJA 1RYDA 2A88A 2CJPA 4PPYA 5EJIA 1GR1A 3G9UA 3WJAA 4AP9A 5L3QA 4DYVA 3FCXA 3SVTA 5JCXA 3M5DA 3ONVA 4C20A 2BGRA 1FUKA 3Q5EA 4M1EA 3MVEA 3HVJA 3EQZA 3OC0A 2FW8A 3FAZA 5A04A 3JR7A 5EPUA 1UPFA 4WESA 5AH0A 4B5LA 1RXSA 2CK3A 5C8XA 3R74A 1VL6A 4CTJA 1DEKA 1IN8A 2ZRGA 3Q9SA 3H19A 1A7KA 2GOYA 1W1IA 3DYVA 1A76A 1QP7A 2XXAB 4YACA 4QKQA 1FUYB 2ZJZA 2F7SA 4QVGA 2GN2A 2RAVA 3EEOA 1G63A 3EQ8A 2W8BB 4MEBA 5DBEX 5AVUA 5C8YA 5CDUA 3VU9A 2WF7A 1TC1A 4EZEA 4JA0A 4MQLA 1QIMA 4KXUA 3IQIX 2Q6KA 3JQEA 2NGRA 5SV2A 5I9NA 1DWUA 1EVLA 1LI5A 3FD8A 3EX7C 3VJRA 1FTWA 3EGWA 4K40A 4EYQA 3FTFA 3UA3A 4NEQA 1PUIA 3HWWA 1QH9A 3NDJA 4UMFA 3SE7A 4YJHA 2N46A 4P83A 2HGZA 1N3LA 1RHUA 4KLAA 4ND6A 5DWQA 1ZM2A 2D3TA 2YQ5A 3MWKA 3AETA 2WG0A 3DOOA 4GPBA 5FA8A 2Q5QA 4TWRA 2JBAB 2PWZA 4OHMA 4C2BA 4K2HA 1Z9BA 4TWIA 1KVRA 1U0EA 2YYZA 4FNOA 4J07A 4RH0A 4WH0A 5DLYA 4P82A 4L8VA 1E32A 1X77A 3N5KA 1M9NA 4ZYUA 1ENZA 3FX2A 1Q7BA 4TN1A 1FB5A 2VDWB 1B43A 1NXPA 2C78A 2B4RO 3IIIA 3K9HA 1KBOA 3GMDA 1RJ9B 3DLAA 3Q4GA 5KTRA 3IRUA 1JI0A 4F4DA 4TYMA 3RUCA 3QHPA 3ELWA 1ULHA 3ZLTA 1SCNE 1QNFA 4MVJH 4AJNA 4EDFA 1SZPA 2C9ZA 2W9XA 3HL0A 3SZGA 1TUBA 5BV2P 1W0KD 2CZGA 4QATA 2VDMB 3PUYA 4XD7D 3DE5X 4O2AA 4TTTS 3PYMA 4ZOQI 4KI7A 1USKA 4BN0A 1WZNA 4CM3A 4DXHA 1AKMA 3E9RA 3UXMA 1NUAA 4OBBA 1XIVA 1Z75A 2RK6A 3I6ZA 4FYVA 1G3QA 5CB6A 1XI2A 4WUTA 1CDDA 2VQ6A 3CWCA 3PNSA 4Q7MB 1DLIA 4D80A 1QMPA 1TTPB 4AROA 5KBYA 2COUA 1JKJA 1T8RA 1I6KA 2ECFA 4XLTA 4PSVA 3ZCPA 4TKVA 3FWNA 4MWEA 1IY2A 1CETA 5FPHA 2QMYA 2V59A 1BXRA 2FSVA 3GK3A 4L8WB 4X6UA 3ZE6A 3A36A 1ISFA 4ZI3A 4JP3A 3VPSA 5EZ5A 1Q6ZA 1H1TA 2SKCA 1J2YA 1FYDA 1YA6A 1TUGA 2R5FA 2UKDA 3AU9A 5TS3A 5F9HA 1DT5A 4CNQA 4HAXA 1K9VF 2CE7A 2JJ1D 4OL9A 4CQJA 3FOAA 3IURA 4YMVA 2KS6A 1CJVC 2EGHA 2D5BA 4WFKA 3SS7X 4I1OA 2P67A 5COQA 3GJQA 3C7AA 4BO5A 2IIBA 2C9BA 1M6WA 2OCAA 3A28A 5C1DA 3T3NA 5DK6A 2PKYX 2JHFA 1M73E 3SWWA 3JASB 3LHKA 2SKDA 2CLKB 3OOJA 1P1CA 4ZGBA 1TVKA 4DB2A 1V7PC 3EUWA 3RVBA 1PR3A 1ZJ6A 4DV5B 3BCHA 2WM8A 3GC6A 4OBEA 4V0KA 3SSAA 4F1JA 3RIEA 5EWLB 4KEAA 1XV5A 1YE3A 2DHEA 2GILA 1N2SA 3VJKA 2H11A 1KQOA 3EGXB 4E5PA 2JD1A 3GLTA 1OLOA 4HN2A 4JBHA 4P58A 3ZQ6A 5H70A 2DP4E 4ARIA 3R3VA 2BEVB 3FVRA 2ZRMA 4GGOA 2NYAA 3TECE 1Q77A 2JDID 1RKBA 4F71A 1OA1A 4OJKA 4BJ1A 2PRYA 2XMPA 3B3QA 3GDFA 3PUHA 5CDFE 3T7JA 3GRZA 4EGQA 2CLOB 3DEFA 2VPIA 4FT4A 2LR0A 2Q3FA 4MUNA 5FWXA 1L4KA 3L6RA 2A0YA 2QQ5A 3G1UA 2IXEA 4FDVA 4URYR 4Y9DA 4CEIB 3FOBA 1TYAE 3ASVA 3HDQA 2WVHA 3INGA 3JZIA 4Q01A 4DR1B 2HJSA 3AVYA 4YJ3B 1AHIA 3U26A 2JRLA 2JANA 1Z2NX 1ACMA 1GAJA 3CE9A 5DLDA 1T26A 3N3AC 4D0SA 4IV0A 2BFBA 3KU1A 3QIAA 3GLUA 3ZWDA 4ZXPA 1SKAA 4BFSA 2Z5FA 4ENSA 1N1DA 2JD2A 1ZIOA 2W2PA 3NGXA 3QMWA 2WSSD 4L7QA 4LTNA 5CH5A 2QOEA 2YBDA 5BSUA 4DSAA 5J2TB 10MHA 1U8UA 4P5EA 5L7YA 3WKCA 1TUIA 1LSSA 4XJTA 3VMFA 3WDMA 5KNDA 4NQRA 3V8MA 3DMYA 3P27A 2H16A 2UZ1A 5THKA 3R7BA 4BECA 4DA7A 2WJ3A 3P52A 4JN6B 4N12A 1IXKA 3IAM1 4AG5A 3HWRA 3NHAA 4DM3A 2JIQA 4NMLA 3A6KA 2P2DA 4Q12A 4Y67A 5SY9A 3KSDO 5BPHA 4G5QA 3WLLA 1HX7A 4H31A 1SFRA 4HRYA 4MVCA 1R12A 1C9YA 1QNLA 1I1HA 1G0NA 1RE1A 2GPAA 1KH2A 2XOXA 3IKVA 4D2IA 3KYBA 2Q99A 2QPOA 1QONA 2HHLA 3AOEA 4H6WA 2G5GX 1BCRB 1XC7A 1A4UA 1U04A 1W59A 2Q6LA 2ZRBA 1QANA 4KPFC 1RHMA 2IK8A 2JLQA 2P90A 3CFYA 3NQ41 1SM4A 4TTRA 2VSYA 3PHLA 4WLUA 3BAZA 3UMCA 3B52X 1E58A 5IDYA 2ZYHA 3CTMA 4HB3A 3R3HA 1JIKA 1PAUA 4PC2A 4G07A 2J6HA 4B34A 1CNEA 3M3PA 2MR6A 5DDIP 3VR3A 2UUPA 4GEKA 5CX1B 3TIGA 1HT0A 2X0JA 4JYCA 4OUDA 2XVAA 1G17A 1M72A 1U5BB 3CBQA 4BZPA 3G8DA 4Z7NB 1F7UA 2OFOA 3CY6A 4WBNF 1ULTA 1GQSA 3PX2A 4WFQA 1ZA2A 3LFTA 2ZRHA 1SK9A 3BK2A 4NV1A 5B53A 2NW6A 2DPXA 2JA2A 4LUCA 5AKXA 4BASA 1VQ1A 4TZ6A 5FL7A 3FB1A 5JZVA 3QWFA 1JSLA 3D6VA 2QE7A 3RU7A 3VH2A 1UQUA 3CZ4A 4OGWA 1PEKE 5K8LA 3SI7A 3Q15C 3FI9A 1H69A 1Y1TA 1UMCA 2REQB 4CUKA 3EXFA 3OWXA 4E94A 5HS4A 4XDYA 3HA3A 3W2HA 3WXMA 1CULC 1VE7A 4I99A 2CFRA 1G5RA 4IFEA 2B83A 2PTHA 4F1KA 4A0FA 1W52X 2X0RA 1YB7A 4PGMA 2XT0A 1NN3A 1ZGCA 4RSMA 1E9RA 2OCBA 2PRIA 2PXCA 4YXWA 1FP1D 4NBTA 1HDZA 2QXTA 4PX2A 4BTVA 1A04A 1CQZA 3A1SA 3GFQA 3MD9A 3CW9A 1YULA 2V7QD 4IVPA 2O5VA 2G8NA 1OBFO 4XGNA 2Y67A 3OCCA 3L6DA 4Z99A 1EA5A 3ZDFA 3CEPB 1G9TA 3HKBB 3PC8C 1LBHA 4LIPD 1JU9A 1X8LA 1QVVA 3SX0A 5C3MA 1GNPA 3RFVA 5CU7A 3S2IA 3OTIA 3TQFA 4REMA 3PD0A 3T12A 2I2XB 5CIYA 2BKVA 4RTJA 3EPRA 2N47A 1HDYA 3WKAA 3I4FA 5DSXA 2BF4A 4JH0A 3N7TA 4AKIA 1BYUA 3N2EA 4ZYZA 5BRJA 1KZ9A 1ZRSA 2PGJA 3DTNA 4IXNA 4TRRA 5DM70 1PN3A 3NNNA 4R1OA 4I1VA 4PLFA 5DX1A 1VRVA 4Y2QA 2WY2D 1TZKA 4UEOA 3C3MA 3C3WA 1YHNA 1YONA 1HDOA 3CNHA 2P6RA 3PIIA 4RZSA 1GCIA 1BAPA 2FG6C 3MJVA 2B82A 1QDEA 3HCBA 3ASYA 3FXAA 4LCEA 1OC4A 3MOIA 1RCFA 3CW8X 1IAQA 2B0JA 1FDTA 4UFOA 4WXHA 1KZGB 4IUDS 3E2PA 3FLEA 2CSUA 5DWVA 3STUA 3NBXX 3OH8A 3KJGA 2J3LA 1ZD9A 5LLTA 3ZK9A 1DBQA 1U5AA 2QHXA 4G5RA 5AW0A 3K0FA 4C4XA 5JANA 2VS1A 1WB4A 2FP4B 2VF7A 2WYHA 1T2UA 2FRDA 1MAHA 2Q5IA 3LPCA 1S8NA 4FEGA 1SU7A 2YYYA 1ZBQA 3WBFA 1QLHA 4BQIA 1ILEA 1VKHA 5EQJB 1QGAA 1K89A 4N5HX 4KPEC 3CEJA 5AK0A 4DCMA 4MWOA 4V0LA 3GU3A 1GN9A 5DV9A 3UAYA 3VPHA 5DHAA 4H7HA 5U4QA 3IPYA 3JATA 5K9ZA 3LQYA 2DPMA 3IEXA 4DJEC 4IIUA 2IOYA 3WLNA 2QNIA 4HSEA 1AUPA 1CF9A 3NH9A 4WOJA 1NM5A 3E4CA 4JVOA 3NORA 2AGVA 4KO3S 4QHYA 3JD3A 2QB5A 4FE3A 4RH1A 1QO0A 1GM5A 4LF6B 2R96A 3E2IA 5JAQA 4KXYA 5FUVA 1UDWA 2GYYA 3DWEX 3IVMA 1ZGBA 2GAFA 1ZK2A 4MUYA 4Y3UA 2H5EA 4OMCA 4U5XA 4UCFA 3T95A 3W6OA 2TMYA 3GUHA 4LFBB 1Z8FA 3MGBA 2IS2A 1I2DA 2DJIA 3C3DA 3K6SA 1NUSA 1P0FA 4NULA 4CIXA 5IJWA 4YT8A 1WP9A 4EJ2A 1GNQA 2VXBA 3M9LA 2XOKA 3JD2A 5JH7F 3LTEA 3F9RA 3UAGA 4GBED 4F60A 4Q0MA 5HP4A 3TR6A 3V6LA 1FDRA 3PLRA 4XH9B 2R4QA 3QUBA 4I08A 4D9NA 5J5CA 2P5SA 5TX7A 1T0JB 1XRSB 4DCSA 1E3QA 5A4FS 5JD5A 3EXIB 3KBOA 1EINA 2ES4A 4KWCA 1MB3A 5L6MB 1FUEA 3TF5A 3E0QA 3O8CA 3PEEA 5CAEB 1E89A 2OO5C 3AJDA 1GVNB 2NZWA 1ZIYA 2A3NA 2V9ZA 3H1BA 3I5AA 3K92A 4TQGA 5FRDA 3ZWPA 1QCDA 4MR9B 4WBNA 1DTSA 4Z4HA 1ORDA 2GK6A 1JAYA 1FYFA 3QKIA 2YWFA 1D1QA 1ORWA 2UZAA 2HNKA 3C3KA 4ANFA 4RHTA 5TF4A 1Y48E 2RGNA 1JHAA 4H6VA 4Y6GB 3GIWA 4ZYVA 1U81A 3PB3A 5BUCA 2GRJA 2Q62A 4IFBA 3T4PA 4NENA 1ECCA 3TVTA 3RUFA 2FWBA 4G8JA 2BP7B 3P2EA 1XMPA 4KAAA 1LF0A 3ZNOA 2X0NA 1AN9A 1GWNA 1QV7A 1CUXA 1ZLXA 4UTRA 2ZSJA 4OPMA 5TXGA 2Y9MB 3MCAA 1M2JA 1Z5PA 1MV8A 1NI3A 2BGIA 4I4CA 4RFSB 4S1OA 3VU8A 1SVWA 4WNIA 1QDLB 3ACCA 3ZZUA 3K71B 1J2UA 1P1JA 2QQEA 5C1OA 1NP7A 3PXGA 3GARA 4WZAB 3INNA 4P5PA 1V16B 5CXUA 4IIXA 5AESA 1SUEA 4ZJZA 1JXQA 1C7IA 3BB1A 1ZOPA 4ZQGA 3OY7A 1G9SA 3AIIA 2FR0A 1VPDA 1RWMA 3W6PA 1YCGA 2WYIA 3G85A 4DM4A 4LJRA 1JE1A 3D6UA 1Z29A 3JARA 4KFCA 3QLTA 2QAJA 2QMOA 4PLZA 2VJBA 1EBBA 1KARA 3G5UA 3PC4A 3CJTA 4P08A 3MELA 3E9DA 3IX7A 2HKIA 2OXRA 4OHCA 5BN3A 3KFLA 2HSEA 3I0NA 4NRDA 1MGOA 1WMBA 4IJ6A 3UMVA 2OAP1 1OBVA 2E4XA 2EDAA 1X8XA 2D00A 4JR2A 3LX4A 1JL3A 1LCIA 2NG1A 1I6MA 4R1UA 2WKQA 1UXOA 2XR1A 4IGIA 2C92A 4O8ZA 1EFPA 1DRKA 3RTAA 3SFTA 2JJ2D 4JQZA 5JJIA 4HRXA 4PO9A 5BV0A 1QHSA 2OC4A 2X1MA 1XG5A 1QXSA 4R2WA 2R1TA 3G2HA 5B1HA 5LZ2A 4LDPA 1ORRA 3QEOA 4BC1A 5D8DA 5IZCA 2RH9B 4AXBA 1SCQA 3HG7A 4IM7A 1KK1A 1AU9A 3EWSA 2WTXA 3QYFA 4NR0A 3H9CA 2Q9CA 4OLHA 4WASA 3ZTWA 1ZNYA 1AF7A 1UM8A 2ZYRA 1Z4PX 1U28A 1B8PA 3BSSA 3IA7A 1RQPA 4XKJA 4BKMA 5IASA 2JLYA 1K6EA 2BLNA 2JGAA 2BWJA 1HK7A 3DEHA 5G53C 3U4GA 4TZ0A 1THTA 3M5WA 4B4VA 2ZS8A 3ZXXA 4HD8A 4NYIQ 4D4GA 3CNBA 1AO3A 4U2GA 1O6FA 1Z0FA 3NC4A 3I4LA 4XRGA 4B3XA 3QKWA 4DC0A 1GG5A 5HXAA 1Z0UA 3BH7A 4ZCIA 3IVAA 3EVCA 1YI0A 2ZEJA 4YJFB 3E0XA 4BGDA 2R44A 3JU3A 1U65A 1RVV1 4EFDA 2RKWA 1KP3A 2F2TA 2GPWA 2R9VA 2UYGA 4MW4A 3TH5A 2CUZA 4PCAA 4XDGA 3S44A 4LZOA 4FEYA 4FWBA 4W7HA 5IMBA 1YBVA 2WMDA 5ESXA 3S1AB 4KL8S 4DNQA 2H0AA 4A0RA 3A58B 1FFCA 5DP2A 3TIIA 3V9AA 4WN9B 3L8DA 4TVKA 4WVFA 9ATCA 3BZBA 4RHYA 1EWKA 1P73A 3T8YA 5EJ2A 1Q7RA 3FFXA 1T4CA 3KVOA 2ZYAA 3CEHA 1XQ1A 2HJWA 2J0UA 3FWPA 2RI1A 3MFQA 3N2GB 3OESA 1K9SA 4OP3A 2Q5CA 3V34A 1JHQA 5GOZA 4D9MA 2ZQYA 4WUVA 2M1ZA 4QGBA 3KSMA 3W0LB 3EPKA 4DV1B 4J0GA 4LDJA 4QJ3A 2IYUA 3IT2A 3CN9A 3GJ6A 4N3GA 4ZOLB 5HFJA 2L0XA 2UXCB 1GEGA 1C1DB 1KETA 2KLHA 1ZNWA 5F2KA 2NIPA 3K15A 5JH7A 2BIFA 3DBVO 4U4AA 2EHDA 2VNSA 5FOUA 1DE0A 1IJEA 2GEBA 3LXXA 3V1KA 1XZLA 3QX7A 1WCWA 2GBFA 2RHWA 3OOWA 3QM1A 1DRWA 2NNWB 1ZW1A 3BTOA 4QU8A 1ZQ1A 5F7OA 1JYSA 2QORA 4LJ7A 2QUJA 5KPDA 1PTJC 4FZ3A 2HCBA 5KAPA 4KXWA 1E2HA 2HN9A 3NGLA 3O1JC 1P18A 5IYZF 3TBFA 1EGAA 2EERA 3ELYA 4JVSB 4BL5A 5J3JA 1QQAA 5D3MB 5KMGB 1Z4KA 1TRKA 1DINA 2IEIA 3KOWA 4JGIA 2XCTB 5KTTA 1TT5A 3JSXA 1ECJA 1M6VA 1UJNA 1MOZA 4JLUA 1TM5E 1U8ZA 4PCLA 2HA3A 5HRCA 2JGIA 2AKYA 2NZUG 4D8TA 4E46A 2MWMA 3B9BA 5J4LA 2H7CA 1RZ3A 1VIAA 1I3NA 5I7RA 2GKGA 1CSEE 2AJ8A 3P96A 3QTLA 2XE6A 1UKEA 3D4PA 4K9RA 1W1WA 4J3NA 4O3MA 3O0TA 3U3KA 4H0NA 2IYXA 4DR6B 1HA3A 2QTBA 2VN8A 3UAXA 1CUEA 4E88A 1QV9A 1JWLA 3GD7A 1PWXA 1DC4A 1WZEA 5HQ3A 1XO1A 3IUMA 4WXRA 1OWLA 3VX3A 3CRVA 1ESMA 3BJIC 3ZIAA 3LPNA 3VV2A 2L69A 3OT1A 1YR3A 1X1TA 4CR6A 3WLOA 3HTXA 1C3LA 1JQJC 2DQSA 2OC9A 2R3SA 3X1JA 1EFRA 1E2LA 3BSFA 2NV2B 3T7TA 4ZEOA 4IXDA 5M2QA 3SQNA 2QTTA 4ZYTA 3CNLA 2YJTD 4RW0A 4P1ZA 3UK2A 3IFSA 2P91A 1LJ8A 1PUJA 3P26A 1VPVA 4NMHA 1ZICA 3TIFA 5LQMA 2AA3A 4F4UA 4NV0A 1UH5A 1YZFA 2BFEB 5ERYA 3Q9UA 5ICSA 2PGIA 3BX1A 4Q1DA 4V03A 3W5DA 2D0PB 2EJCA 2JIOA 3EZFA 1CJKC 1PV2A 1XB2A 1TM3E 4QRDA 2EKPA 3ABIA 4GPIB 4XX1A 4Y6PA 5HGJA 3W06A 4A6XA 4URXR 5KNCD 4EYKA 4F72A 1NIJA 2IYLD 2ZYVX 3W2GA 3OF2A 2ENWA 3C7CB 2J87A 3PJRA 4ZQHA 1WZIA 4WDRA 1YDWA 5EFOA 1MH9A 1NUHA 1KXZA 1L5OA 3EEQA 1FDSA 3IB6A 3ZKWB 4A26A 1EFVB 2O2ZA 3TEJA 3TLYA 1R0YA 3VV3A 2DTEA 1MT3A 2PRSA 2ZI3A 2FH5B 4PLVA 4D5GA 3ZKAA 4C5BA 2HTEA 3H5OA 3LFUA 4ES6A 5BWNA 4XASA 4FQ8A 4H77A 1LSOA 3MEQA 4JD5A 5DHFA 5ICEA 3BGWA 4WNCA 4A23A 4B3HA 1ZDMA 1JPJA 1SO8A 1SOWA 5ALSA 2Y3IA 3R7NA 4BFTA 4CG1A 2CV0A 5A1TA 1CR4A 2A1UB 3AT1A 1RR6A 4H7IA 3VAAA 2HK7A 4CGZA 2PYDA 1JLMA 3OPYA 1KRHA 4O08A 1GDTA 2IS1A 4CEJA 1NSYA 2A57A 4C04A 3K0CC 2BZSA 2ZROA 3B6IA 3IERA 4DVJA 4XOIA 1KEEA 1XLWA 2ZYWX 3U16A 4Y98A 4L1KA 5FO1A 4HBGA 4KJXA 1QBGA 3W9SA 1PEYA 1Z88A 2AF4C 5ALYA 1E5QA 3S2UA 3W77A 4YJDA 2QLTA 1Y3DE 1ZU5A 3I92A 1G21B 4P33A 4QUHA 4O4IF 4EJMA 2GHQA 1QHYA 1H6BA 1SPXA 1X1DA 2ALJA 2R6GA 2X40A 3C1UA 2DFDA 3O2JA 4W8OA 1EQ2A 5BQXA 1SVNA 5JEEA 4IDCA 1QS0A 4P7GA 3D2AA 2A9QA 5FPTA 1T8YA 1M0WA 3IJEB 1HZZC 2NXNA 1DDOA 3KAJA 5TMPA 1QGUB 2O7NA 5TQ2A 1IWPB 4X3OA 4MB0A 3UM9A 1XF9A 4IH4A 4OHWA 3N8KA 2QD2A 4UCWA 4TTJA 4Y9SA 1E94E 3LOPA 3HEBA 4NZOA 2AQ8A 4BB0A 2PUCA 3FNFA 4UXJA 4JJ8A 3L84A 2P9GA 1YRWA 2H1SA 2HEGA 2R7NA 2YIDA 4UOQA 2Q1SA 3KP1A 2OBLA 3OOSA 4N8SA 4LN1A 3OLXA 2XQJA 4JC0A 2IEAA 4C1NA 1ECFA 1V5IA 3IOMA 5FTLA 2OENG 2FG5A 4JUAA 4YCLA 1PF7E 4XCXA 3SHFA 4O1MA 3VR5H 4AT1A 3UG6A 2AFIA 2YCBA 3TTUA 2BMAA 2VAVA 1KI8A 3EZXA 1Y5MA 1UMBA 2IW1A 4P9NA 1MO2A 1TFUA 1U8YA 1FW8A 2Q6IA 3PSHA 4G56A 4IJWA 3G0BA 3KUCA 2DE0X 5HOEA 1BDHA 3ET5A 4GUAA 3LP6A 2NUPB 5IJZA 1IMOA 1CFZA 1QPGA 5IYZA 3ESZA 2ACWA 3AFMA 3FTCA 1PJLA 2W6IA 1TA9A 4HH0A 3RUDA 2VKQA 4AJ2A 2GTIA 3NIBA 1W29A 2W6ZA 3GFBA 3C6QA 2HA7A 2WRZA 3JYQA 3HV2A 1Y82A 4UPVA 1Z4OA 4EARA 1CJUC 3O2NA 4J7CA 3D6MA 4MYUA 4OJNA 7YASA 4JLJA 4BMXA 2A3RA 5CDSA 2I0FA 1JBKA 1ANKA 1PJAA 1YIDA 3D2CA 4X6XA 3QBEA 3FDXA 4IV5A 1CLUA 4L22A 5F51A 3BL6A 3FNRA 5ECDA 1G8YA 1XSEA 3QNUA 4IDBA 2YHIA 3CEAA 3E8MA 3ZHVA 4YB8A 1VMDA 2HBQA 4GOOD 4J9VA 4WECA 3SHWA 3QVGA 5FQOA 5AJWA 4C4TA 4F21A 1NA5A 2JCXA 3M6WA 1UODA 3Q0EA 4B9AA 4YRSA 2GHIA 2Y1WA 4BMNA 3SPXA 2QDKA 4P34A 1X7WA 2WWTA 3S2GA 2YWJA 1U7XA 3SVLA 2PEYA 4NSNA 2HSGA 4ZAGA 4UD6A 2DFVA 5DMXA 5LLSA 3K4HA 2AI2A 3CLKA 1PQUA 2YY7A 4DCTA 4NJOA 4GF5A 3SC2B 2BM0A 5HIKA 1RTTA 1ZRHA 1E2JA 2BMDA 3H9EO 3ICCA 4HGPA 4IAOA 5JCOC 2LCIA 4HDAA 1U4NA 1NBMA 2QL9A 1TTQB 4NBNA 4OXRA 4EAAA 4GLJA 1VMKA 4DIUA 4Y1FA 1VJ5A 3ODPA 3L1VA 4LE2A 1GPNA 2D8AA 1PGPA 4FK8A 4RPKA 5MFPA 1IL0A 2GBLC 3N0XA 4G5YA 1CEQA 3KVRA 5TQ0B 1I7NA 4IKOA 1WB9A 3MMZA 1KPHA 1SHTX 1U5CA 1KMQA 1JHRA 5TGZA 5AM5A 3ZHBA 2A14A 2DRIA 2NXWA 4AYXA 3TXAA 5EKXA 1FP4B 3DSRA 4FDLA 5YASA 4QNNA 1S3GA 1V6CA 3FWKA 1L3CA 2AE1A 4RMJA 3X43A 1NX9A 3TSCA 5I3ZA 1EG7A 4NJMB 5JC8A 5FLXA 2GB4A 3EGDA 4I1IA 2ZSDA 4RLSA 1EVYA 1VMAA 2WTNA 2Z8ZA 3X1DA 3ZCVA 4D1YA 3KQVA 2Z6AA 3SCZA 2DLNA 1NN5A 1E2PA 4DRXB 5LDGA 2E82A 2FETA 1Q0HA 4MV7A 4PQRA 1DV1A 4MX8A 3WLIA 3THWA 4N7BA 3C8UA 3GRPA 4QDUA 1Q7TA 1BMFA 1XZDA 1W0CA 2PN1A 5BN4B 3V4PB 3BAFA 2QTLA 4NL4H 4EBFA 1VB3A 3VR1A 1HNNA 1I0IA 1P17A 2R47A 1ZC3A 4DQLA 3HCRA 5IULC 2XQIA 5K20A 3LTNC 3PBKA 1NE7A 3IP1A 3OKFA 1RRKA 3DV0A 3OKAA 5CCBA 1VIYA 4HG2A 1HC7A 3GLKA 5E7IA 4CM8B 5K1ZA 3ZVRA 4O4IA 5CH8A 1YJ5A 1MJGM 3ILHA 3FH0A 3RS0A 3JALA 1W8DA 1H4QA 3AI7A 3JYPA 5JIBA 4A5OA 4JI4B 1CRPA 4MV4A 1ZW6A 5K51A 2H4HA 3AU8A 3QUAA 4ARZB 4DUZB 1J1ZA 3OFVA 1Z7EA 3JRWA 4ENPA 3K09A 4M1QA 3C15C 3RVJA 3FUVA 1ESZA 1K4YA 3DP7A 3V4ZA 4W9MC 3ISVA 3RVPA 3A2NA 1EVJA 1W25A 1Y80A 4U39A 3U7IA 1UEXC 5KQGA 2GI4A 5EJ4A 1ZP6A 4A8JB 1WIWA 3HGMA 2MMGA 1T8PA 3D3WB 1YQEA 3QKRB 2O50A 1THGA 4HAIA 2WTEA 4BDSA 3FR8A 1W5SA 3DVAB 2A9JA 1HT3A 3IR5A 4FNAA 4JX8A 5EZ6B 4QLBA 3ZY5A 1TUEA 4QODA 1W49A 2GO7A 4WIAA 3ADBA 3PPWA 1PNOA 1MVLA 2QN2A 1SXJD 1UKCA 3A05A 4QQKA 3RQSA 2XUPA 3KELA 4H3KB 1WXIA 2OXFA 2BR5A 2IZ7A 2LDBA 4HY3A 2IITA 2XYQA 4Q4JA 4JI5B 3QZUA 3WBKA 3R77A 5JHGB 4L0QA 4NJEB 4ETMA 3Q7SA 3AWIA 1GQ2A 1Z5OA 4O29A 3MSCA 2HWXA 4YDRA 4AD8A 1MEOA 2DTDA 4EGFA 2E4WA 2JIMA 4HAYA 3U37A 3JWPA 3SU8A 1KMMA 4MWDA 1GL6A 2H5JA 4YPOA 2RC6A 4KSBA 1G8SA 1RIIA 4K6CA 4WY2A 4XOUA 1BA3A 5T6BA 4EKGA 4DT1B 4IH9A 1FFBA 4EL0A 1QYDA 2X19A 3RG2A 2V9CA 4BEVA 4DMLA 2C3UA 1GPBA 1MX9A 5K4GA 3DH0A 5JZOA 3JPWA 4F46A 4ACAA 3GYGA 3N28A 4QELA 4ZYYA 1WL8A 1UXHA 5EJ5A 1OZHA 3A1UA 3LUCA 4KAJA 4K9NA 3RI3A 5IEJA 2G17A 4AJEA 1VJ1A 2FPPA 4IY1A 4MJXA 3S28A 3W2IA 2J59A 2P30A 4XB1A 5KYTA 3AYZB 4MH0R 5F4BA 1ADBA 1O2DA 2VCEA 3DDSA 4U7HA 2PX8A 1II8B 3UC5A 3RS3A 3F47A 2NU9A 2P2NA 3JQQA 4JJKA 1GAWA 2JIZD 1X14A 4EWLA 4IDAA 1ZXLA 3T9FA 4BFCA 3RAPR 3OLWA 2GD1O 4RH3A 1LQUA 1PE0A 3AJRA 1KOJA 4DQXA 3GNTA 2O3QA 4Z3KA 3BH6A 5IVIA 3A9CA 2BHTA 5JDCC 4LRUA 2D0IA 3IMFA 3GXBA 4FUTA 3LQFA 4YBZA 1R5OA 3UYKA 1U2SA 2EP5A 1GD1O 3CUUA 2BISA 3NLLA 3ND5A 2PZ8A 2F3TA 5F9MA 4BNHA 3WLFA 4QIHA 5HTKA 3KQLA 2XGOA 3QU2A 2VTVA 3B3AA 2RGUA 3AMVA 4EITA 4UTXA 1PWHA 1OLUB 1WNFA 1E8MA 1Z0JA 2YJ6A 1CRQA 1CVRA 2B1IA 3CKKA 3E3LA 4GPZA 4S0ZA 3KKPA 5EJ6A 5D6NA 3DKKA 1ZUNA 4MKZA 2JLBA 1YK0A 3NH6A 1YDMA 3DE7X 1VC2A 2FWAA 4WI1A 4MQFB 4OYHA 4GE3A 2YJZA 4OHBA 5HM8A 3V8EA 4ENRA 1L1RA 4M9SA 3SX2A 4IXTA 1JHXA 4CTKA 1FLVA 1Z74A 4M76B 1SHLA 4CDMA 1WVMA 5IAEA 1N2EA 2PH5A 2OFPA 1F4PA 2WC1A 4WK4B 1ZM4A 4RVSA 3TSYA 1NVFA 4ND5A 1QPBA 2E4UA 3W5SA 3PP8A 1AJEA 1Y9JA 2I6QA 2MYTA 1QU2A 2W11A 3LSTA 5T4EA 3VH3A 3D4LA 4UHJA 4QDKA 2EQAA 1TJ4A 3JS5A 4MPPA 4PRYA 4LRWA 2O0JA 2FG7C 4O4LB 1R9JA 1VFNA 3PXEA 3PVZA 4EY8A 3M5CA 2JH3A 2B6HA 2I22A 2YRWA 4Q4HB 3SKXA 3PJDA 3PNOA 2XNHA 3QG1A 3UT5A 3GPDG 3DZIA 3RSZA 4G5XA 1B0UA 3AVXA 1L4LA 1P5FA 1QCZA 2ISCA 4DY6A 4GX5A 2P2LA 2OBFA 4REQA 3DP9A 2I66A 1QM5A 4PRKA 3UAZA 3DKRA 4HK4A 2IDKA 3AEQB 3HUDA 1D2NA 5GGYA 1NQ5A 3ZX5A 4WZ6A 3R8CA 1BW9A 1E4VA 1WM1A 4JBWA 1GRCA 1OW3B 4TV8B 1VSBA 1P72A 4MQEA 3B1ZA 5DBFA 2XQGA 1Z08A 2XUAA 4JYZA 1KKMA 5K3CA 1PR2A 4TLLB 5C1BA 5KI6A 4FZJA 3DEYX 3Q11A 4LYAA 1JEAA 2NADA 5F52A 4BLOA 3IQEA 4MV0A 4PC1A 1NUQA 3TG8A 1US8A 3CX8A 4G23A 1QIFA 4KQKA 2IUUA 2H65A 2WF5A 1U2RA 4N9WA 4JJFA 4PHHA 3K70C 3OWHA 2ZJ8A 4QE3A 3NVKI 1TKAA 4L85A 3OQPA 3GZ4A 1Z5VA 1IB6A 5D1NA 3GLQA 5AOCA 8AT1A 1OVGA 2JFGA 3H2JA 4V0SA 4BO1A 4ZJUA 4RZHA 2E0IA 1MD9A 2KI5A 3K2BA 1YMUA 5EI5A 4FGWA 3HXMA 3IT0A 4WFIA 3TDNA 3KBBA 3GRCA 2OOKA 4KXNA 3WNDA 1YB1A 1GU7A 2CNWD 5BPFA 2FSFA 2ID8A 4JJIA 1AO0A 1DTWB 3WK8A 3L0SA 4YUAA 1TOAA 3LUKA 3OQBA 1CFJA 5E2BA 4XPZA 4ZA2A 3Q0IA 5LNK1 3QU7A 4LRSB 3U81A 3BE4A 2GFHA 4N3BA 5FIUA 2NU7B 2X6RA 3PUIA 4RKEA 1V95A 3G5TA 4C7JA 4DFDA 4K28A 3UTCA 2G4VA 4BO2A 1KL7A 3ZWXA 2V7WA 4DLXA 1YOVB 1WSAA 3UBMA 1V8PA 1DCTA 3PHCA 2JRCA 5KQLA 2H3HA 1MUUA 3TZ6A 5L4SA 1OA0A 1HKUA 5BR1A 5AHXA 2BCEA 1Y8QA 3M6IA 1G2IA 1FTSA 3C5HA 4FINA 5JS2A 4BX2A 2EKQA 2KX7A 2H63A 1UK7A 3HKEA 3CT4A 4Y2HA 4UAJA 1ZNQO 2OKGA 2QD1A 1ZH2A 3QWBA 1UJ6A 5KYNA 1E5VA 3GA7A 3HLKA 3FUWA 1K27A 4UXHA 3VZDA 3DMNA 1JV2B 3ZV4A 1EFHA 2IV3A 3ZHXA 4X41A 1D4ZA 4GI7A 1KZ4A 3H42B 3DM5A 3NAGA 3ZY6A 1UBMS 1W1UA 4DUGD 1Z8NA 5KOIA 4C7OA 1JR3A 4TKMA 4B0PA 5CDHA 4GICA 4Y7CA 4ZVVA 3DOJA 5K7SA 2A9RA 3DNFA 3FKSD 4FDAA 1ZGAA 4BB5A 2FW0A 3PE3A 3P2KA 1APBA 5DXJA 1LLQA 4EGAA 5HE8A 1T1JA 3N59A 2ZULA 1ICIA 3EBPA 4FXOA 2F59A 4X65B 1X6VA 2D0DA 2ZI7A 2A7QA 1M76A 1K5GA 2GDZA 3MT8A 1NV8A 4RFLA 2QVLA 3RJZA 3W8NA 1SURA 2SCUA 4R16A 1LV7A 4KQMA 2YW2A 3FW1A 4BNXA 1SXJB 4C4AA 1VG0B 3WK4A 1G38A 1R18A 1EKXA 4RPJA 3HPQA 3NNDA 4FCCA 3MHTA 3H65A 3NT2A 2J5BA 4NNPA 1XXHB 2QIPA 3DWIA 4HDRB 1UUFA 4KO1S 4M88A 4X8OA 4B4KA 2WQZA 4E21A 4LNHA 4B33A 3DZKA 3ZD6A 1Q0SA 4ITUA 3VOBA 4ZPXA 3U3ZA 3AK4A 1WPQA 4HFJA 3HJTA 4O6VA 2IYYA 1VKZA 3SZLA 4JGGA 3T94A 1YE5A 2BELA 4MV8A 4I7EA 1UAYA 2RJ3A 1ZIDA 3HXLA 3KS9A 3TRKA 5JBNA 4WXPA 3DEKA 1JEYB 3EDYA 4IUYA 2AK3A 2YOFA 3P9NA 2AH5A 4E3WA 1IEXA 2CDNA 1GPDG 1VFPA 2CMGA 2IOFK 1KE2A 5F78A 3BFVA 2XJ4A 5DK4A 3DZ8A 1Y6RA 1MOQA 3H1FA 3TEFA 3ZCQA 4F85A 1GPAA 1EX7A 4DN6A 2AB0A 4HMQA 1OZGA 3RYIA 4EB6A 5AVSA 2BBSA 3PC8A 1RYMA 1A2BA 2FZCA 2GCIA 3M8KA 2X4IA 3MS4A 3NGMA 4L16A 4W1PA 1NNLA 4FDTA 3RC7A 3SDBA 6GPBA 1AZLA 3BWEA 3LDFA 2XT9A 2ADFA 4KACA 1XUOA 3GVPA 3VR6H 4DDTA 2QD4A 3RE1A 5B7GA 3CA8A 5DCYA 4XM0A 2FPOA 3NOQA 5DM60 2AWNA 2W00A 4B0OA 3LPLA 4JC5A 3OZRA 1F2UB 4AZVA 2JGDB 3BA6A 2CNBA 3Q5DA 1FJHA 4DJJA 2MIIA 3CH7A 4IDNA 3PQ6A 1RI2A 2XHEA 5EE9A 1TQ8A 4M55A 3ISJA 5HEKA 2WEKA 1SUAA 1I2CA 2PL3A 4EHLA 5HK9A 1KI4A 2HWUA 4YCBA 2C5SA 3A6FA 1CERA 2C04A 4AWXA 1VI2A 1OXUA 2JL1A 3N2ZB 4YO8A 3DVQX 1JA1A 4FGZA 3P9XA 2B5WA 5T3YA 1D2GA 3LF2A 4JV5B 2QK4A 4XSGA 2HU8A 1Z45A 1F20A 1K6IA 1WXDA 3T1OA 3ZCSA 2X2FA 3I28A 1Q2UA 3F90A 4RM3A 5H1YA 3E8SA 2HQBA 3HSYA 3INTA 1RMYA 3LXUX 3WNZA 3ZX4A 1V71A 2RGRA 1IBKB 4R3UC 1L7NA 4I1SA 5BW4A 4MAMA 2WNSA 4F3RA 1SULA 5JQGB 4ML3A 2JGKA 4L73A 4X54A 3PJGA 4N65A 5EA2A 7ABPA 3R6DA 4I5FA 1EA7A 3C97A 3ROPA 4HC4A 1Y7PA 1EBUA 4UKDA 3CIOA 2Y2UA 2H0QA 3OZFA 5ESWA 3IHKA 3AVPA 4LEIA 4ZZIA 4ER5A 3PITA 5K0NA 3TM5A 1GPYA 5ALJA 4IO1A 1F12A 1RIFA 1Z0AA 2PT7A 2M98A 4G24A 4G89A 1ID8A 4HLUC 4IWXA 1W87A 1ZC4A 3IDFA 4KQWA 4KZKA 1KK3A 3R7SA 4PG6A 2IHTA 2W8ZA 1UJ5A 1MVNA 4LZNA 4NH4A 3A6LA 5G0VA 3HN7A 4QXAA 5LA6B 3TNFA 2PEZA 4W9NA 3TRHA 4B3GA 1A8UA 3B1XA 3U7GA 4EW1A 3GBPA 4ILKA 4UHCA 4XX0B 1ECBA 4YAGA 3BL5A 2NTJA 4FW8A 4K81B 4M46A 1YBMA 5FPSA 1OXKB 1XR3A 4J0DA 3UV3A 5I01A 5C53B 4B3MB 4OX9Y 2WNIA 3BFKA 4I9GA 1QKJA 2K4MA 3M4YA 1TEZA 2J0EA 2CV2A 1ZIPA 2BFMA 3HP7A 5HZMA 4YJGB 3PWSA 1QG6A 2C3OA 5DBIA 3OE7A 1I4TD 2R60A 3LLVA 1ZYUA 1CD5A 2PXHA 4BNUA 4DEYA 1ZKDA 1ZXBA 2Q6VA 1BHQ1 1ZITA 3FMPB 3CV3A 2I2DA 2YWEA 4MRAA 2VWHA 1TTHA 1VIMA 4I4LA 3L5OA 3AR6A 3PWTA 3WOVA 1P5ZB 1V8FA 2QD3A 2PWBA 1Q0TA 1QHIA 1TIBA 4LSMA 4WOKA 4Z7QB 2WT8A 3OO0A 4MQMA 1BQEA 4RK1A 2I65A 3UK7A 2BEUB 5L3SA 4Y1GA 4HNVA 3KWLA 3JQ6A 4EA7A 1KDPA 4QTTB 4N40A 1UJ4A 5H59A 3F1KA 4Z1MD 4Z8XA 4FE4A 2HMTA 3G17A 3ZDCA 5IJ9B 5AW9A 1G16A 2GHRA 1O94A 1JSZA 5H82A 3CU5A 1JHVA 1YDGA 4R6XA 3C0KA 3OHPA 4WVLA 2WHXA 521PA 1OLXA 1I33A 2IKSA 2WAAA 3QYPA 3UMGA 1W36D 4RFVA 2OECA 5EZSA 2FZWA 2J4FA 5ECYA 3WLQA 1OTYA 2E6KA 4GMHA 4DR7B 1P2UA 3KXLA 4Q1EA 4F6RA 3AEZA 2HK6A 4GAEA 4GP7A 4Q9AA 5EXTA 2GJKA 4DDVA 4OLFA 2PZKA 3AFGA 3QX3A 1EIZA 1WXEA 3ICPA 3PU6A 3GJYA 3EZ6A 2UAGA 3IUSA 5TQJA 1AMOA 1T1EA 4N5DA 2HB6A 3LG2A 1Q0QA 2E4AA 4IFTA 3CBGA 3Q6IA 5IM5A 3ZVNA 1G8AA 4BPBA 1Q19A 3OEWA 3QVKA 2H2GA 4AS1A 1ZJWA 1CR2A 1XZBA 1NX6A 2F1RA 5T3UA 1EPUA 4OIMA 4B32A 4XFKA 1XDBA 1N0HA 1T6NA 1X7DA 2VHYA 3IHTA 3IPXA 4CMGA 4GKBA 3ICWA 3K0KA 5CA1F 1F4LA 2EOAA 3KVVA 1Y34E 4NABA 2GVDC 4CMIA 2PGNA 3RS2A 5JYBA 1U90A 4G5HA 4B2LA 1UZMA 2FYTA 2HMUA 4UDNA 1RZRD 4K7JA 1DC5A 3KALA 3QG5A 1EZ1A 3RTGA 2GRAA 1Z0ZA 4ONEA 1SQ0A 4I50B 3G1TA 4QOJA 5IW8A 1MHPA 1Q11A 3NHLA 4GD3Q 1MW9X 4HQRA 3TBKA 1GKLA 4A6EA 2I34A 5FUXA 2LKDA 1P5RA 4L0MA 3AG5A 4RZUA 1DFHA 3CPHA 2HM7A 1ZKMA 1J49A 3V2GA 3ZUPA 2IHYA 4CYMA 1ZX1A 1H9BA 8ABPA 4XB2A 3OZSA 3RYHB 3LDGA 3GFRA 3FF1A 1QOPB 1OSNA 1M2GA 4G25A 5TRTA 1A9PA 2PMEA 2QXYA 1GNSA 1WQ4A 5I4CA 4RVFA 1VGQA 2QP4A 3G8BA 4CIVA 1BVUA 4CT4B 2DLDA 3A1FA 1HYEA 4PBRA 4CM4B 4PQEA 1JHUA 1PTKA 2DXIA 5HDBB 2LIPA 2AFRA 3QUSA 2HK8A 1XYGA 3QV2A 2CJWB 3HKDA 5DHRA 1RBQA 3QENA 2V6IA 2VRCD 3G8YA 3OIYA 1VL8A 4Q7LA 4ZEXA 4UHHA 2WIDA 1HTBA 2Q9UA 4F2HA 1R7RA 2Q50A 1Y8AA 5DYTA 3D7LA 3ID6C 1T9BA 1J9ZA 1Q0RA 3I0ZA 4PHTA 2P9JA 1Q1QA 2FUG6 4Q1AA 4RXUA 3QLUA 1YACA 2HU5A 3N0RA 1VE6A 1M1XB 2VTKA 2XODA 5HKAA 5K0LA 2DFNA 3GFFA 1U1IA 3Q8LA 1Q7EA 2GK3A 4R2MA 3ANLA 4NCHA 4IQ4A 3PXCX 4P4TA 4U2FA 2PKRA 1UOQA 5K0ZA 4BVEA 2J5QA 4O25A 5EJFA 4ENWA 1QTIA 3PA8A 3WNQA 3EZ7A 5AR1A 3PCRB 3R9KA 1Z33A 4QQFA 2Q3JA 1POWA 1S1MA 4KODA 4NXMB 2HHHB 1GQOA 2RHHA 1OFGA 1QIHA 1Y3AA 3V48A 3RYTC 1PCXA 1SU8A 1RPTA 3K16A 2XE8A 3OJLA 1E9CA 3QFFA 4G67A 5EXPA 1U1FA 2XLCA 1HE3A 2RHGB 3QLJA 3BK7A 3LLMA 1LH0A 3FRIA 1N2CA 1OZAA 5HIAA 2UUAB 1DHTA 1F06A 3EEFA 3K5HA 4GQBA 3LLSA 1E1LA 1Y6QA 1A8HA 4CQLA 1UC5B 5A6SA 1NI5A 3WLRA 3AKCA 1B42A 3MQ2A 1EHIA 4KP7A 1JXAA 4JWTA 3UG7A 2VQSA 4K03A 2ZETA 4YBRA 3LHIA 1C4KA 2H9AA 3ZJVA 3DOEA 4D02A 2PWYA 3FF4A 3QFSA 2WFZA 4UQLA 2OZVA 1B6GA 2HNBA 1JFVA 5BOSB 1CUHA 4PC7A 3G68A 5HCNA 3U4MA 4EDHA 1PT9A 2QR2A 3H75A 3OC6A 1E7WA 3TTTA 1KZYC 1MC8A 4WXMA 2V7EA 5AUQA 3VDMA 3WMWA 1KO7A 4FONA 2PU5A 4MCJA 4DA0A 3OP1A 1KNXA 2HF8A 3DAOA 2CW5A 1LX7A 1XK7A 1XHEA 2BFCB 3QVOA 2JFPA 3VSBA 3C6ZA 1Y6FA 1IE3A 1MKYA 1H0HA 5JISA 2V7XA 4AMGA 4QDZA 3ETCA 2TECE 2FEXA 3AQ4A 3M9XA 5E2IA 5U4XA 2Q4BA 1ULZA 1V96A 2QF7A 1G291 3GCDA 3VKUA 4BN4A 4WQMA 4MTCA 4MYHA 5FV7A 2IYOA 4FYIA 1Y4DE 3D5TA 5DIFA 4FHDA 2FQ1A 1YUNA 1RLUA 3RWMB 4E14A 2QX9A 3U44A 1ZLYA 4QUJA 2N42A 4DSOA 1AMNA 1C3JA 1LPOA 2B61A 3DUFB 3FKJA 3DC7A 1UBRS 2AEEA 3ZJTA 1HWYA 3IDOA 3WK9A 1W6UA 2I55A 1FUIA 1FDIA 2QX8A 3H5IA 1GTZA 4DV3B 1AK9A 1Y6GA 5CA1A 3PDHA 1BGWA 5LP6C 1QC5A 3KPUA 4GX2A 4P4NA 3SHTA 3ESXA 2C8LA 2HDHA 5K8IA 1W5BA 1Z37A 2F8SA 3DDCA 4D25A 1WDWB 1UPXA 3E9MA 1JWAB 3GT4A 1XZNA 3LOUA 1ZHHA 4RMHA 3T0IA 2E55A 4AU1A 2QRPA 3R20A 4IH1A 3OPXA 4HZIA 2F4VB 1QGOA 1U4SA 3CKLA 3PQ4A 2QYHA 1GUDA 1ORTA 4UTZA 2NZ8A 1FFYA 1O95C 5KOHB 4XWGA 2CDRA 3FHJA 1U9YA 3LUPA 4GH5A 3SMVA 2RJOA 2HWWA 4M2LA 5EKTA 1NKVA 2Z56A 1H66A 1ECPA 3WJ1A 4MK4A 1OE0A 2ZBGA 1ZGJA 1QK4A 2Y77A 4TROA 3JQFC 3UJBA 1KFEB 5ADVA 4HFRA 3K05A 4EI8A 1PBTA 1JDPA 1USGA 2ZRNA 4IMRA 3NX4A 2AN1A 4Z9YA 1E9BA 5EIWA 5JVDB 2ACVA 4RGBA 4O4JB 4ZARA 1UKAA 1TQ2A 3VO8A 2H5IA 4LCBA 5HPYB 4KNVA 3HUFA 3IP7A 4MVJG 1UZUA 1XFDA 3UCEA 5LU8A 1W36B 3R9XA 1ZD8A 5B6JA 3K0CA 5BN5A 3KLBA 3TMKA 1LNQA 4JFAA 4K9PA 3TLKA 4BKRA 2DCMA 3MAGA 3PNPA 5IMSA 4CU2A 4WOBA 4JEHA 3TLZA 5AXAA 5ALEA 3KZNA 3W6ZA 2RB5A 4ASUA 5CVDA 2Y05A 5A0TA 1CDEA 2NU6B 2HO5A 1RKQA 5DHTA 4AN1A 4I1PA 1PJTA 1LFDB 4WCFB 1ZN2A 3F4LA 3KETA 3GJSA 3OETA 5EYPA 2PNFA 3DDWA 2QQGA 1JAIA 3E22A 4YRBA 1GTJ1 4JDUA 5LB4A 5C3UA 3ZIDA 3FNGA 4JJ4A 3PTAA 1HZZA 4L9AA 3ZNPA 3GCGA 2VF4X 2VT6A 4K26A 5TY0A 1CUBA 4FZVA 4JB3A 2QN9A 2QVYX 5A2QA 2IHNA 3KL2A 4IIJB 1JFFB 2ZJ0A 4YAWA 3UB2A 2CVQA 3FETA 1FDOA 1VJRA 4CIBA 1P6UA 3MF4A 1LLDA 2Y0PA 3GOQA 2COKA 2IWRA 3CZRA 4C6TA 3O82A 3CX3A 5L53A 1N7HA 2O7SA 1CQWA 1P91A 2VJLA 3HA7A 3IAS1 1N8NA 4NLLA 1DAIA 3PDIB 1DBRA 2K2QB 1N9GA 4G4SO 1XU9A 5DYWA 1ZCJA 4CTNA 4LJSA 1Y1PA 4JQSA 4KPUB 1VRWA 1AS3A 1D0IA 1FP6A 1GCAA 5TGTA 2XDQA 1U7HA 3GRYA 2IDMA 4EF4A 2ZCVA 5HJEA 4MUGA 2IF2A 2ZI4A 3T3EA 3UXHA 1SCAA 1SQFA 2IU0A 3ZJUA 4KXXA 2XNSA 3IEIA 4IBOA 1I9CA 2I7CA 4G36A 1QQTA 4JYBA 4LRXA 5KJEA 5G0TA 5THQA 2BKLA 1I6LA 3FMFA 1G5FA 2WJIA 3LPDA 5LZ9A 4GNRA 2EJWA 2Z09A 5ILQA 1W2WB 3G0IA 3GLSA 1QTNA 3UJ8A 2X9VA 1WQ3A 4B7ZA 3PFBA 3Q1LA 4GOKA 4V1CA 1SBHA 3H6GA 2JFOA 2BEJA 4QXQA 2C2WA 1I1QB 1U9IC 4G0PA 4YRQA 2ON6A 3RUEA 2R66A 4UBKA 3TS1A 3GRUA 1U4OA 2QSUA 3RK4A 1SIWA 4M6WB 2Y6UA 1GSAA 4KV7A 2R87A 3IXQA 3ZU4A 4B87A 3C8ZA 4YPFA 3VGPA 5JNUA 3GFPA 2CLFB 3HUUA 4FMDF 4EGJA 2D5AA 2CFCA 3SZMA 1XNHA 1W96A 5AHOA 2Q2NA 3OU2A 5JS8A 1FX0B 5E3JA 5A4IS 2IPLA 5K0CA 3BRSA 2E37A 4ZQBA 1XA0A 2ZPAA 3K1AB 3TAXA 3UNXA 1P81A 1QE3A 2DWQA 3PUKA 5BNIA 6REQA 4TZTA 3BH0A 1WUJS 3PLNA 3GRRA 2PUDA 3AJAA 4TUYF 3UQYS 5KYKA 1GL3A 4Z2AA 4RVHA 1MOPA 4YYZA 1GSIA 1NLMA 2BDEA 1AQ6A 4ZREA 5L3VA 1CTQA 1KAOA 3SEAA 2Q3CA 4OVKA 1X8KA 3X1ZA 3FSRA 3NYRA 2CK3D 2DY0A 5AM4A 3ER9A 1T9AA 1V9CA 2FCAA 2VYCA 3EGXA 5JCOA 2G07A 5LQUA 3ML1A 1GL9B 3HACA 2NU8B 3O8RA 1NF3A 1UXJA 2CXTA 2RGXA 3L7OA 1WHTA 1I7SB 5HKLA 1RYEA 3Q3HA 4UU0A 3RS5A 1T3SA 3G2JA 4RHCA 4AK9A 4EVSA 3DL2A 3AIMA 3U9TA 1G64A 6NULA 3EF0A 5CT8A 3SIXA 1YL6A 4U7PB 1MIHA 2NZVG 2H1RA 3LHFA 1ZWLA 5EWMA 5FOVA 3RASA 1PV4A 5KHAA 3TQRA 4Q05A 3PRHA 4OA8A 3M83A 4QFDA 5E1DA 3TGLA 1I3KA 3LCCA 4IHJB 3T1NA 1X92A 2IW3A 3WGKA 3D31A 3L8HA 3A4LA 3BIXA 4U8GA 1H3EA 4ND2A 3FMVA 4D3SA 4CLDA 4A5SA 3F7OA 4JLSA 3PQ2A 3V4FA 3R3JA 4G5OA 1ADJA 4AM8A 2WWIA 5JRZA 2LXNA 1N2GA 2ZRAA 1L0BA 4UE3S 3TZBA 1MT0A 4DCVA 3ZCUA 1H8EA 1K3FA 3JQPA 2NSJA 5GM1A 3OWOA 3RSHA 4XFJA 1SHKA 2QY6A 2ZZNA 4OATA 3KQOA 5BVHA 4W63A 2B25A 1UMDA 4O8CA 1MQAA 3TW8B 3L93A 1A9SA 1Y1SA 4YRLA 4KW7A 1TIPA 2BJHA 2ZWVA 2QSZA 4FGSA 2WLTA 4TXNA 5I9SA 5E0OA 2B4QA 2HR1A 3HM2A 3A2LA 2R7KA 3OJXA 4B8YA 4HB2A 2FQQA 5AXCA 3R5FA 2DU8A 1FNMA 1XT6A 1RI5A 1DBPA 2QTVA 1AHPA 5KEIA 4C6RA 3BHNA 3ILXA 5DHPA 5JBIA 3THRA 1P5HA 3IVCA 4KQ1A 5EOVA 2OXCA 4BO8A 3K72B 1YS2X 1E2NA 1RRMA 1XALA 2DF8A 2GETA 5IVKA 2B92A 1PNRA 4JX9A 3DCIA 2XCIA 5ENDA 1JR3E 3ZWVA 3BERA 5JPDA 1OWMA 2ODNA 2H2IA 3DV2A 2PSHA 1VLLA 2WUGA 3TNLA 1QIGA 1C2YA 3HDGA 3LZCA 5AKJA 4PIVA 4YGYA 4UNRA 1HT2E 3F6EX 2WJ6A 3WXBA 4M1ZA 2ZUSA 1N2ZA 1A2KC 3MTGA 1O96A 4O0MA 1YRAA 1T8TA 4FU0A 5HFNA 1I32A 1UZAA 1JWBB 4RHFA 5KC9A 2DPHA 3H5VA 2V0GA 4BU1A 4FLMA 4GHWA 5IEBA 2BDTA 1QYCA 3L6CA 4K3UA 3OKPA 3EY4A 3I2YX 3IEUA 3K53A 4WK2B 3UA4A 2P2CA 3L0OA 3I2IA 2W4QA 4J16A 5EMJA 3H2GA 3RLIA 1NMQA 2CXOA 4MKHA 4QXOA 4YRAA 3KSBC 4F3TA 2D2VA 5JAOA 1DP4A 2LDXA 1Y4SA 3OLCX 5CJPA 4R71A 2A2ZA 2NXJA 4YY3B 2GJAA 4ZZ0A 1BYIA 1D2AA 2DQ4A 4PLWA 2O8BB 5DM0A 4E5UA 4L5BA 4G8BA 2OP1A 4X6YA 5DKFA 1RM5A 3RSLA 5LSAA 3CO5A 1JQEA 2P9YA 4EP1A 1KGSA 3BN3A 1QK5A 3OAAA 1XLUA 2UXDB 1QYVA 2R1VB 3BXXA 4QFMA 4MMZB 4NICA 4R1PA 3FPEA 3RV4A 5FA6A 4LNUA 2R7AA 3ZWMA 7REQB 2JEYA 3ANSA 1J8YF 1X7GA 3C5EA 3Q7QA 4XQGA 5CEFA 4CL2A 1NAHA 1X7YB 1N5DA 3QE9Y 2C1EA 2JAPA 4RVUA 5TEWA 1ZG3A 3UH1A 3C85A 4KIWA 3ROKA 2VDLB 3JWIA 4ID3A 1A9YA 1E4YA 1ACJA 2CFSA 3V1LA 3DJYA 1K7CA 3EFHA 6ABPA 2ZFUA 3RS8A 4TUYA 3AG6A 5JDCA 1YZ3A 1YZNA 1OJLA 3LXRA 2DB3A 4H3VA 3SD7A 1KR2A 5E6SA 3MGKA 5KVAA 2W6QA 1RP1A 1NR1A 2X4DA 2XPCA 2Q41A 4N8EA 1N2OA 3DMRA 2E4YA 2Q0HA 1OGIA 4JSRA 4K6OA 2OZEA 3WRXA 2ONZA 3Q88A 2VF8A 3GJ0A 1ODLA 4TWJA 2IYWA 1HNWB 2NP6A 4UHKA 3HB0A 4ZK6A 5IJXA 1TQHA 1L8QA 2ZG6A 4AECA 2W2QA 1EB8A 4H17A 4QXMA 4DB4A 1ES9A 3MINA 4IV8A 1ZA1A 1CUYA 3DWFA 5KNDD 1CEYA 5D7BA 3CVWA 2AG0A 1SEVA 1VKOA 2G7ZA 2L18A 3H4MA 4DR3B 3RAFC 1GJRA 3FBTA 1L5HB 3IE2A 2P79A 1EXWA 3L07A 4Z0PA 1IHPA 5C4MA 1P0MA 1GNRA 1NI4A 2DVMA 3PPXA 4H15A 4JIGA 4XYLA 3Q98A 5FTKA 3QOYA 3L1JA 4K46A 4QD3A 2W4IA 3NBUA 2M1XA 4GE0A 3JPYA 1DARA 3Q2KA 4BPRA 2CV1A 1VCNA 2ZUCA 5AK4A 4KHPB 1HDXA 1CWUA 2VXCA 3AUAA 3BCSA 4ZVPA 3IUYA 1MA0A 4L72A 2CXQA 3GGDA 3UGJA 3GPBA 3I6MA 3GPIA 3UKDA 2NWQA 3FNHA 4IIBA 4RYDA 4GG1A 1JDZA 5E7QA 1H6CA 2IUYA 1ETUA 1SUSA 1FEZA 1N2HA 2R68A 3HA5A 1J0XO 1XN1A 3KZKA 3CLRC 3R3YA 4PZCA 5GP1A 3SJZA 4GT1A 3EDOA 3WMFA 4KO4S 4PG8A 4HBZA 1WKBA 3R6GA 1NXQA 1BS1A 5KSOA 1NVGA 3UKOA 4UD2A 3SNKA 2P65A 4QXPA 1OB2A 3VR3D 3OZWA 4FR2A 4UDXX 3Q7IA 5C34B 5CFNA 2HDOA 3IYLW 3BIWA 4XQEA 5L3QB 2Z5GA 3A9VA 1U7TA 1SOMA 3O8BA 3PSAA 2R97A 4OKIA 5JSFA 4AZSA 1MIOB 3EVFA 1H94A 4IDDA 4TKUA 3FMGA 4WESB 5FL7D 2VT3A 2FEKA 4G37A 1P1FA 5C1IA 4OI1A 2QE7D 5DBGA 1O7JA 1H05A 4U6NA 4Z0HO 3TZEA 1R5NA 4YK7A 3SVZA 4Q4AB 3OCYA 4AFNA 1MFPA 2I99A 1K5PA 1DAKA 2RHBA 1KP2A 1RPZA 1JIXA 1FRVA 2GZ3A 3L43A 1NZJA 3DO5A 3C24A 2JB9A 1QLJA 3KYCA 3LRXA 4FGJA 3WGMA 3ZJYA 2OVFA 3VM6A 1SD2A 3W5CA 3KLNA 5C8YB 1CUVA 3VU9B 4JB2A 2C0PA 2P9TA 5I7OA 4NEHB 3GT3A 2XE7A 4NK5A 1G8KA 2ZT7A 4ZT5A 4N7MA 3EOZA 3CVYA 3MSXA 4OKSA 5JPIA 3L9XA 1EUDA 3OIVA 3AL0C 3LLUA 4X7PA 1DV2A 1WXQA 2JVIA 2ZT5A 4YJHB 1J5PA 3PUWA 3W78A 2X6QA 2YINC 3F71A 5CM2Z 1K5DA 4I8DA 4P3OA 1TAUA 3PEFA 4LAFA 2PA3A 4AO7A 5JCPA 3EZGA 3VZPA 1GPMA 1Z2AA 2QG6A 4YFYA 3I01M 1TADA 2X9QA 4G9EA 2AMYA 2FQXA 4MV1A 3AETB 1W8IA 2PZGA 4KQ9A 5CEEA 1CQPA 2VHWA 2VP0A 3RR2A 3P9ZA 2WKPA 3E3OA 1I10A 4G9BA 2BP7A 3MA0A 4BX8A 2XB2A 3A26A 3QOWA 4RIGA 5LU9A 3CUEF 1FQWA 2O0HA 3L05A 2YDYA 1D8TA 2EV9A 2JJMA 2XUGA 1S7CA 3EXEA 3OZGA 1XA4A 1QAMA 4DLUA 1P61B 4GSYA 1JHZA 2C5EA 5ADHA 3IV6A 3NASA 4C29A 2ZUBA 2Z98A 5JDIA 1IIRA 5D87A 2VP6A 3RC8A 3VR5A 1P7PA 4X91A 1H0KA 3HJRA 2F9FA 5TIIA 1TUBB 2VUIB 3NZEA 1P45A 1N2XA 1XRLA 1ZBDA 2QRVA 2VH1A 4O2AB 1NYLA 5J2UF 3ETNA 3E5NA 4ZI7B 3AH8A 1QP8A 1J24A 4GIBA 5ANRB 1F0PA 3KSZO 3QHAA 1LS6A 4ZC1A 4F96A 3C7KA 3DT8A 3HADA 2JIDA 3PWKA 1GVHA 1R0WA 3NTVA 5CD1A 3HXOA 1YVRA 1CHDA 5FOQA 2V3WA 2GARA 1KI2A 1JKJB 1LEHA 1ULAA 3KQKA 1JDVA 2OO7A 3D8UA 4HVAA 4FT2A 5K4AA 3P2YA 4TKVB 5KYWA 1XAIA 1UBTS 4AJJA 5KB3A 1BXRB 1NW7A 3FVTA 4JT9A 2GT1A 4BN5A 2R5WA 4QBFA 3F98A 5J4KA 3L8CA 2KW5A 4H0CA 4OHKA 4LJ8A 5EPOA 3AEXA 1ZXXA 2KWIA 6CHYA 3RC1A 5ICGA 2XQKA 3VZCA 3ETJA 1VHWA 3CUKA 4ERNA 2I6XA 4NWIA 2PO5A 2F3SA 1DCMA 1LLCA 4H18A 1ZJJA 1HFWA 4M60A 5LOVF 2AMFA 3A6ZA 3DW3X 4MUBA 5D00A 5BSMA 4Y6OA 1QO0D 3GVCA 4LHVA 4LNAA 2IZ6A 3RVSA 1TVKB 2NM0A 3EY9A 4QPPA 1H2ZA 3F46A 4JUDX 4LJLA 2MR5A 3VZQA 2Z8XA 3HYSA 4DV7B 4U63A 4I8XA 1X0VA 3TDKA 1HYBA 5KYYA 5K0EA 3WRYA 2ZIVB 2VSFA 1WPRA 2Z5LA 1NVMB 1PKXA 4QAJA 1Z2CA 3LGSA 4CN9A 2J45A 1GFWA 3WSTA 4ZT3A 2W43A 2C9DA 4QQNA 2HRRA 1SUWA 2JZCA 1EVEA 2XOKD 3OZ7A 4H7EA 4LKRA 3W3AA 1B00A 4ZWNA 3N58A 5I9IA 4ICIA 3E7FA 3L7JA 2EW8A 4ZU6X 3WIOA 3GPLA 3TOVA 1N0IA 2YY6A 3CINA 3FCEA 4CM6A 2AOWA 2IHKA 2VHUA 2PR7A 4RXTA 1Q2XA 1FVXA 2B8TA 2FEAA 4ZDJA 4LV5B 3K6SB 2FPUA 2P6UA 5FWXB 2HIGA 3AF5A 1MAVA 4DIFA 2AJTA 4KWIA 1TIKA 1P75A 5DOVA 2QZSA 4O0LA 1SELA 3EBOA 4D98A 1H9AA 3B7PA 4EHFA 2GN4A 2EZ9A 3BYZA 2FB9A 2D1RA 2PJDA 3AW8A 5KTKA 3KUUA 4Q66C 3T1TA 2PX3A 2X5NA 3THXB 4QEZA 1Z25A 4AKTA 2BFBB 1N2CE 2CXUA 4LGYA 1JZSA 3NP9A 5BO5A 4XUDA 4YCNA 1M83A 1UK6A 2VPXA 2Q1TA 2P40A 2P11A 4NZMA 4WKGA 3D8RA 3IPCA 5EQDA 2O2CA 1NLUA 4IGFA 1FS5A 4PZZA 4W7SA 2D74A 2CXRA 2J6IA 2BJVA 2BUCA 3D8BA 3L7IA 3NCTA 4US0R 2FTKE 2VYVA 4UU1A 4K1XA 4E5MA 2WICA 5JASA 1ZAYA 1SVUA 1XQXA 2X3YA 3JW8A 3T35A 3TOSA 2HPZA 1PLLA 1X15A 1C7JA 2HLHA 5AK5A 5KCZA 2BM1A 4YALA 2C8JA 2YV1A 3UAWA 3UQZA 2CMDA 3BIJA 4HQKA 4YUWA 1L8XA 3IMKA 3IEMA 5J47A 2QGFA 4Z4FA 3MMXA 1A82A 1Q5PA 1F2DA 3UUGA 3WKBA 5FH9A 2ZR9A 3IJRA 1AQIA 3JZMA 3KCNA 2ZJFA 4LDZA 1KDVA 2X8AA 2CL7X 5TT1A 2WPDA 5KQMA 1EX6A 1U0TA 2X42A 4RF5A 2ZJ4A 1LK0A 3TSAA 4EB0A 1LV8A 1O6CA 1AXGA 3AOGA 3F6BX 4LRTB 5GJWC 4MP8A 1QVZA 2IHUA 2ZZMA 5H3HA 4LVCA 4UCQA 2VJYA 4HNAA 5CLHA 5IWCA 1KU0A 1S2LA 4ZDKA 4TS4A 5I8WA 4OL0A 4KR6A 2GKSA 4YT5A 1I3CA 4IUCS 1E1CB 1VE5A 4OUDB 4RQAA 1DKOA 4NZZA 2BMVA 2WM9B 1E62A 2J3KA 2OGWA 3SR4A 1KJJA 1FP2A 4B7AA 5J2UA 3T3GA 3KVYA 4YUZA 2C4NA 1JG1A 3OCJA 1XJ0A 2QVGA 4M9QA 5SY6A 1JP7A 1UXGA 1JPNA 4MINA 5CDYA 1U80A 5AW6A 4OREX 1TJYA 4XD2A 2H2HA 5BN1A 1KBZA 1X7ZA 1UMCB 1Z73A 2PGOA 1W34A 2VP3A 2YFQA 3EXFB 3QUTA 4I9NA 4X1YB 4CMJA 2OR3A 1U7PA 3L6OO 3N2KA 3VUFA 3ONFA 3H8JA 3R5SA 4RMIA 2LV8A 4W9RA 3K6KA 5LMZA 4M9CA 5FWDA 1CPYA 1Z2EA 3PQ7A 3WL6A 1F38A 3U7QA 3FUTA 3O91A 1KZHA 1FU7A 5EEGA 1WUHS 3V8PA 1DO2A 1GUAA 5FWYA 2XSZA 1PYGA 1NTRA 2WHYA 3RSQA 3UGQA 5HBGA 3I61A 1IOWA 1EDEA 2ZSUA 5AKKA 4WOPA 3GLGA 1MC1A 2PUVA 5K6AA 2YZNA 4UUNA 5JQWA 4YP0A 3DE1X 3V33A 2JAQA 2Q3LA 3EPPA 2XYVA 3SIWA 4WDQA 4JR0A 1JFRA 1G5QA 2YXPX 4TL7A 1G7SA 4CLRA 1VHQA 2O1EA 2OB1A 2YWRA 5F2EA 4C76A 4EG3A 5IU6A 1PL8A 4M49A 3UJ6A 1CY2A 1H1LA 2LKCA 2PUWA 2HK9A 3OCWA 1O9GA 4BKOA 3G0OA 3V00A 3CM0A 2AHRA 1PZNA 1V2GA 3I73A 3L7YA 3FYCA 1XP8A 1R0ZA 4O4HF 1MG5A 4GQAA 4Q9DA 3SJ7A 1XVUA 3TYXA 4MVJA 2X23A 1EGQA 5A7GA 3RB8A 2G4LA 4JLDA 5F21A 4EEKA 5ES4B 1KYQA 4QEDA 3MTIA 4YLGA 1DCKA 1JLLA 3RVDA 3Q3EA 2AZMA 3R3ZA 3HCNA 1YVDA 4Z7OB 4WKBA 4KWTA 1JPUA 3Q1KA 3D1JA 3DLHA 3D8NA 1GT91 1E9FA 3AHDA 4POAA 5FO0A 3DMFA 2QRKA 4JLVA 4UULA 1E9DA 4LHYA 1T6XA 2Q1UA 4RXMA 2O6HA 5KKAA 3RFCA 5LP6F 3KE9A 2REBA 3WO0A 4KTTE 1TPYA 2O0LA 2P5UA 4G1UC 3QK7A 4X8LA 3EDMA 5DNVA 5SZKB 3NANA 3WNBA 1IUPA 4BU0A 3VNQA 1CUZA 1WE2A 2C2OA 1J0DA 2EW2A 4X97A 3NONA 1LLFA 1YQGA 5KYVA 3D3EA 3K0FB 2NAFA 5E4TA 5CCEA 1MTOA 1MO6A 5K8VA 3GVXA 2XAAA 2GN0A 4OQYA 5KKCA 4UUMA 2BTEA 2XD9A 3MCZA 2AJLI 2ISQA 2IYZA 1KI3A 3N9IA 1VLMA 2WAYA 3IBTA 2IYVA 1T9KA 5I7EA 1IWOA 2C96A 1AXEA 2AEJA 3Q41A 2WTAA 1FFSA 2FMIA 2GSWA 3O7MA 4YQZA 5I7SA 4ZDWA 1I3OA 3JATB 4M99A 3RNLA 3OIGA 4CV3A 4BIMA 5HF6A 5AVOA 4OY3A 3NW9A 1K7EB 1PVDA 3PGMA 3ZIAD 2P6PA 4FFDA 3EG5A 5HCIA 3TW4A 2HF9A 2GDJA 3N6RA 1TU4A 1XPUA 5DNCA 1PW5A 1EFRD 4JENA 2EDCA 2CWWA 3ICOA 5DM2A 3EVDA 5EIXA 3TNYA 1ZCAA 1ZL0A 4B3FX 1B8OA 3KDPA 3X1KA 1KFBB 2C1XA 3CZMA 2O0MA 4KI0A 2GD2A 3LRTA 3EAFA 1TTTA 5BW5A 4COKA 5J4YA 3RWBA 4HDKA 1TF5A 1SXQA 1HOXA 2EIXA 5MHTA 4JKOA 4EW2A 3SXPA 2AE2A 3LK7A 4TS1A 4WAUA 1RYNA 4M8LA 2CLSA 3HBAA 3N1UA 2YXLA 4Y9TA 1JGTA 1T4DA 4NCNA 4AJ1A 3FFTA 1BRTA 1GQRA 3S27A 3CWZA 3D7MA 5IFLA 1J4AA 4UJ5A 1W581 4C0LA 2FX2A 1HE1C 3HUTA 5B2EA 1RHJA 1LDYA 5EHNA 1XMXA 3WIDA 1YDFA 5HDQA 4EOGA 4QTXA 4GKKB 1G8MA 1WY7A 2VNJA 2CL5A 1WHSA 4C5CA 2VXYA 3AO0B 1WXXA 2F17A 2JLRA 1XMIA 3MXTA 3OT4A 2AD5A 1GUYA 2Y68A 4FYYA 1XQYA 4L5CA 4EMTA 5ABPA 1NXSA 2X0DA 4WBNB 5FI5A 2C9MA 3EFOA 1UADA 4G85A 4LGMA 1FVOA 2WQ6A 1KHHA 1A9ZA 3B6KA 4DEXA 3LQKA 1CY7A 4QZVA 1YJXA 2HA4A 2XKKA 1UM9A 1GTMA 1EGVB 4O2BF 4ALKA 5B4VA 2J07A 2O8CA 1X7HA 4FCTA 4RENA 4NENB 3V3KA 1BE6A 2I80A 4E32A 2YZGA 1ZJZA 1VSUA 1ESDA 2QWXA 2DT8A 1TMGE 3A06A 2YYAA 4QOHA 4B2PA 4Y18A 1XVIA 4KH0A 2ACEA 1TYBE 4E1BA 3OLQA 1H2HA 4J1QA 1DQYA 4G0ZA 4R3NA 1B0AA 1DXHA 2R00C 5JNVA 1VDZA 2WF8A 2M32A 2OK8A 3S0JA 8LDHA 3AB7A 1CR1A 5C7LO 1A98A 1SIUA 2HWKA 4H7PA 3OECA 1NP3A 3CG0A 3RSFA 5LWQA 3HDYA 4LRYA 3IAAA 4MMYB 5AKYA 5SYMA 4QOIA 4G09A 4PEVA 2X58A 4JU8A 1E3SA 4K3VA 3FY4A 2JGFA 3ZDRA 4L4ZA 3WGNA 4LF7B 3RHZA 4QUIA 1OFUA 3JARB 2QAGA 2GVZC 3L18A 1H8HA 1KDRA 1PG5A 1ZSYA 4I36A 4BMVA 5B57C 2YFYA 3HXPA 3TG2A 2AN3A 4HNSA 3D3JA 3KYJB 4O4HA 5BN3B 1RXWA 2PZEA 1QF6A 4FFLA 4LY6A 4FUQA 3TX2A 3FUUA 4YRIA 2HQOA 5KJ1A 3V8QA 1WZCA 5B7PA 1BFUA 5E0KB 1URPA 3GGSA 4M1SA 1EFPB 5A3RA 2CUTA 1UJBA 3DFMA 3HYLA 2I2AA 4EMUA 2B36A 4M37A 4J49A 5KYXA 3BQNB 2G5CA 3A6JA 5DCLA 3SEQA 1OXXK 3WYBA 4F9GA 3WRVA 2V7BA 2QTHA 4Q19A 4FFPA 5FR2A 2P9FA 1H2RS 3CGGA 5LP6A 5A6VA 4GSLA 4GYJA 1JH8A 1L3BA 3HBFA 4B2IA 3LDHA 3RV3A 2Z08A 2H1HA 2W6ID 4LISA 4ALIA 1OYOA 1WMEA 3BMQA 4B79A 4JBLA 1LTKA 3GEPA 4M9XA 1Y8ZA 4UOZA 3H5LA 1NLZA 1IPEA 1EGHA 3EYWA 5ALTA 2QT0A 3ZQKA 2JCSA 4KIGA 1TO1E 4YJKA 3TPFA 4G01B 4MDEA 4W6ZA 4HQOA 1XNQB 1KO5A 1A9RA 4RMNA 2Q28A 1YZVA 1LDMA 1CY0A 1R8SA 3D8TA 4YRDA 5T64A 4AMZA 4YRMA 1B8VA 5DASA 3DTVD 1EJBA 3KT0A 2ZP1A 4EYGA 2AG1A 3C3XA 2APJA 1A7JA 1BZYA 1OI4A 1O95A 4FBGA 3SSOA 4GPEA 2BN4A 2EF1A 2VWQA 3U1VA 3N8NA 4AZ0A 1KF0A 5F23A 4ZHSA 1ODKA 3BB4A 3FI0A 1DJQA 1WDTA 1DS6A 1KI6A 2DC1A 2GF9A 5JEDA 4C1BA 3O47A 2XDAA 5FDFA 1UWVA 2PKQO 2VO1A 3RRZA 2VOJA 1KMNA 1YB6A 4IHQA 3TSOA 2EWMA 2ZIXA 1SQ5A 1Q1EA 5TPWA 2NUTA 4EMBA 1BEEA 1L1FA 1R6XA 2WT4A 2IXFA 4XJXA 3H2YA 2ZYIA 2V9PA 3IOEA 2PUEA 4DMCA 2J3HA 2PXXA 1T4CB 3H6HA 5ICFA 1BO6A 1C14A 1NUPA 3MYRA