4HS4A

Crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
184
structure length
184
Chain Sequence
SPLHFVTLLGSLRKASFNAAVARALPEIAPEGIAITPLGSIGTFPHYSQDVQEEGFPAPVLTMAQQIATADAVVIVTPEYNYSVPGVLKNAIDWLSRVSPQPLAGKPVALVTASPGMIGGARAQNHLRQSLVFLDAYVLNRPEAMIGQVTGKVDAQTLELSDVATREFLARQLDALAALARTLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Chromate reductase
publication title Mechanistic insights of chromate and uranyl reduction by the NADPH-dependent FMN reductase, ChrR, from Gluconacetobacter hansenii
rcsb
source organism Gluconacetobacter hansenii
total genus 60
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hs4A00
3U7IA 3NHFA 3OVMA 1AMOA 1FLAA 2N1MA 4NULA 3K1YA 1OFVA 3F90A 2BN4A 3B6KA 3N3AC 2OHIA 3JSXA 4YALA 1V4BA 2RG1A 3OWHA 4QOEA 3KAPA 4QOIA 4YAOA 4YAWA 1DXOA 4U7FA 5JROA 3NHYA 3OX2A 1RLJA 5F12A 2FZVA 3S2YA 5FUQA 2FDXA 5LMCA 1C7EA 4C0WA 3GFSA 4LTNA 4ESEA 2Z98A 2V5UA 3O73A 5LJLA 3SVLA 3ES9A 4XDGA 4LAFA 3QFRA 2AMJA 1AKVA 3HA2A 1FTGA 1QHEA 4U7GA 4PTYA 4OXXA 1BU5A 4U7HA 1ZWLA 2QR2A 1WSWA 1KBQA 5EAIA 3FNIA 3NHKA 3OJWA 1T5BA 2OHHA 1QRDA 2Z9CA 1TLLA 3LCMA 2A5LA 5LBUA 4N82A 5NLLA 2FAXA 1F4PA 1AKQA 1J9EA 3OX1A 5F51A 1YCFA 3HR4A 1AG9A 3GAMA 1CZLA 3GFQA 5EA2A 4CF6A 4N9QA 4YAUA 2M6SA 2R97A 1YCHA 1J9GA 2QMZA 2MOKA 3OJXA 5TGZA 1XYYA 2KLBA 5BUCA 4PTZA 3FX2A 4FGKA 5B3KA 3U7RA 1JA0A 4BMOB 1YKGA 1SQSA 2FCRA 1I1OA 2BPOA 2F1OA 3N3BC 2HPVA 1E5DA 4HEQA 4F8YA 1AZLA 3F6RA 2M6RA 3W78A 1CZHA 4GI5A 4QOHA 1YDGA 4FX2A 1OBVA 1CZOA 2QX9A 1FUEA 1B1CA 4PU0A 4YQEA 3W77A 1YRHA 3ESXA 4ZVLA 2Q9UA 4QODA 2BZSA 2OHJA 1X77A 1DXQA 2QWXA 1KBOA 3NHJA 4Y7CA 1RLIA 3QFCA 4ZVNA 1CZKA 4QOGA 3HLYA 3EYWA 4R81A 1RCFA 3FJOA 5LVAA 3B6IA 4ZVKA 1H66A 3OWXA 4FGJA 3G5MA 4NLLA 1D4AA 3NFRA 2XOEA 2QMYA 3L9XA 1TIKA 4LTDA 2WC1A 1VMEA 2Z9BA 2KQUA 2OYSA 5F4BA 4GR9A 3NHSA 1OBOA 2XODA 4C14A 3L9WA 1YCGA 1CZNA 1RTTA 2X2PA 2MT9A 4C76A 2B3DA 4DY4A 3D7NA 3FVWA 1J9ZA 2V5VA 1FX1A 3K20A 3EDOA 3OX3A 4H6PA 2BMVA 1ZWKA 3KLBA 3NHWA 3P0RA 5FA6A 3QE2A 1J8QA 1QBGA 1CZUA 4LTMA 3TE7A 3B6JA 1FLNA 2ARKA 1NNI1 1CZRA 1GG5A 4DIKA 6NULA 1FVXA 2Q62A 2QX6A 3NHUA 5EMNA 3O2NA 1H69A 1AKTA 1AKRA 2HNBA 4ZVMA 4Y9RA 1WSBA 5B3LA 2W5UA 3F2VA 3N39C 5A4KA 3GFRA 3RPEA 1JA1A 3NHPA 2QX8A 2FZ5A 5FX2A 3FW1A 5NULA 4M0CA 3F6SA 3W7AA 4FGLA 2X2OA 4D02A 1XI2A 2MWMA 2Z9DA 3UXHA 1DX9A 2D5IA 2FVXA 3NLLA 4LA4A 4BMPB 3KEGA 5LLDA 4H2DA 4GQIA 4N65A 3TZBA 1AKWA 1AHNA 2FLVA 5ULLA 1XYVA 4CETA 1ZX1A 3R6WA 3TEMA 1T0IA 1BVYF 4QOFA 1AKUA 4Y9UA 4HS4A 2FX2A 3UXEA 2HNAA 1XT6A 2QX4A 1SG0A 3ZHOA 3B6MA 3KAQA 4J8PA 4S24A 3ESYA 3NHRA 2V9CA 4DILA 1FLVA 5LBTA 4ICIA 1D03A 3LT5A 1YOBA 1D04A 2GSWA 2ZKIA 2R96A 2MTBA 1FLDA 3W79A 3ESZA 4QOJA 2FOXA 4YAFA 3NHLA 1QR2A 4XDHA 1C7FA 4C0XA 5LJIA 2BF4A
chains in the Genus database with same CATH superfamily
1LLCA 1Q14A 5DDIP 2Y1KA 2J6IA 4GICA 4AO8A 3ASVA 4J7UA 3GJ7A 1X92A 5E2AA 3EMDA 2N1MA 5DCWA 1IVNA 5A04A 3X1WA 1PJTA 3LCJA 3UAWA 1V35A 1W2WB 4C4SA 3AUJB 4PRLA 3SHQA 3VSBA 4BLRA 5F98A 3M6MD 2ZSEA 1VJCA 4NV3A 2YXEA 5HK8A 5C4MA 4UBLA 4FFWA 1JMVA 1I4DD 1ZHHA 3PF8A 5EIOA 1LF5A 3EGCA 3DPIA 2OFXA 1NQUA 4TQAA 1MCZA 1WCWA 2OHIA 3QPUA 2WU4A 4A92A 4AURA 2O0MA 5D87A 1K4YA 2R8PA 4RIGA 3OY2A 1AKYA 2H48A 1DG1G 1JTEA 4FOPA 4JR1A 3A3KA 4UVGA 4NZOA 1KAQA 4RGVA 2JEZA 4EKDA 2QZPA 2Z1NA 4PLYA 4F9TA 5KOJB 2JZOA 2ODNA 3G85A 2VDUE 5GONF 1Q92A 4LFCB 2P6UA 1ELOA 2J5QA 3OQJA 5DHPA 3DV2A 4EUFA 2VJLA 1OHHD 1K88A 1CCWA 1IN7A 1S8NA 2RGXA 4JLWA 3TVDA 3ZN2A 5CFMA 1V9LA 3KDPA 1EK6A 2XRFA 2A0WA 2BHRA 1Q3HA 3MCAA 2X0DA 4ZJUA 1CNEA 3CLVA 3KG2A 3LPMA 1YTUA 5BSMA 3OZEA 4X44A 1PNQA 3OH8A 1RRPA 2P8JA 4KXLA 2L19A 4Q48A 3DOCA 2IPMA 1A9PA 4K0KB 4PYQA 2VJKA 1QXSA 3MCUA 5KNCD 2QRJA 5HW0A 1SM4A 2F3SA 2RH5A 5HE9A 5EJ4A 4D80A 3G0HA 3F6PA 5GJWC 1X1AA 4KCGA 3FZYA 3L77A 3BQ9A 2IYOA 4TRNA 3T1YB 2GN4A 4MTCA 1GR1A 1WDTA 3M81A 1YVDA 1NBWB 1VE6A 3FDZA 1WOMA 1YDEA 4RGYA 4LHXA 5IM4F 3R23A 3EDQA 1ADFA 1YBFA 2A9KA 2AWNA 3H11A 5EEHA 3ZWOA 4AMGA 4YGXB 3B1FA 2DECA 3N8KA 2ZU0C 5E4FA 3B36A 1CP2A 1JR3A 1V5WA 5C7LO 2I0FA 4I1RA 1QVAA 3E05A 3M3HA 3VRHA 3NKFA 4EP1A 1RPNA 4CM4A 2GLXA 5IZCA 2AXNA 2DKFA 2PMDA 3DE3X 1QIMA 2CLKB 3IV6A 3RUHA 3GNQA 2OBYA 4BVGA 1QCZA 2QMQA 2VAPA 4PTYA 3HJTA 2FN9A 4U7HA 2AG0A 5IJ0B 1LGYA 3M8KA 3Q98A 1IH8A 3JD3A 4O4JB 3ENZA 4P38A 2RHMA 1G9SA 2JBHA 1A8PA 5JTTA 3HBNA 3RS4A 3KYJB 3S68A 4IIJB 1FRNA 4YAEA 2HKIA 4FFDA 4EY4A 3ZX4A 1IU9A 1ZJJA 5EYPB 2Y1DA 5KEIA 4BV9A 1YO6A 2DJ5A 2JLQA 3TLZA 3K6KA 5IXJA 3DZGA 3GLGA 5AHXA 1T3TA 1YIAA 2D54A 3F0TA 3AVTA 2XJ9A 1U11A 3SJUA 4PXAA 3NUZA 2O2IA 1R88A 3EVDA 3WSWA 1G18A 4Z7QB 1QU2A 2PA3A 2UVPA 1XVLA 3OSZA 3HKCB 3R3WA 3X2EA 5TSDA 1V0JA 3PXDA 3AR4A 3EARA 4OMDA 3KLMX 1G8MA 4QJ5A 1A96A 3IBSA 1CJTC 4RMIA 4MS1B 1N25A 4Y2YA 3FD8A 4BWFB 3JTMA 4WBNF 3BXXA 1E1LA 2FNAA 1PJBA 3BAFA 1V5GA 1UZLA 3S2FA 3Q9SA 5KOHB 4PANA 2HA0A 4RULA 2PDAA 4NBSA 4JC5A 4GKKB 2PV0A 4YJ3F 3T38A 3AZQA 3D4NA 3JATB 2EF1A 1LFAA 1YRLA 4BP1A 1O6GA 2QTWB 4JZYA 3CPJB 4FIDA 1ADGA 3QKSB 4LZNA 5A02A 2IZ6A 5BSTA 3R8CA 4L3WA 3UH0A 1EH5A 1LK7A 4N18A 4UBIA 5PNTA 4LRQA 3DWIA 3PS9A 1U7TA 4MCIA 3LC2O 5DYGA 4XRRA 1GXSB 1RXCA 4HQFA 4TV8A 2C7QA 2PSFA 4RY8A 4W5OA 3NEJA 2GHQA 4KQ1A 1M1NA 2SKCA 3MMXA 1I36A 3BZBA 2XD9A 4FK8A 3TTVA 3J7AC 2PY6A 2RAPA 3RSSA 2GZ1A 1TVCA 2E3JA 4MDYA 1IN6A 1H2RS 3HFSA 4G0VA 4BZZA 1XX6A 2A9QA 5B4TA 5B57C 3TUZC 5CA0A 5LCXA 3H65A 3NTXA 1E63A 3VDMA 4JGGA 3F8WA 1M2NA 5BYAA 4MWTA 4GP7A 4MRAA 4A2WA 2LWIA 1RXUA 4V0OA 5LDGA 1UF9A 2GQ0A 5C7OO 4KL8S 1TA9A 4QAJA 1VFNA 3AP1A 3CQ9A 3E5NA 1ZO8A 1HR0B 5LL6P 1RPZA 2CE2X 4DBLC 3KJQA 1U7OA 4IDFA 5FYDA 5GTDA 1JLSA 3I01M 3WDMA 2W2TA 1TKBA 2HU7A 2XVZA 3KWJA 3CTPA 4G0QA 3WYCA 4BGUA 2RIRA 4J2TA 3E9CA 5TMEA 1R16A 1HYBA 1XALA 3D7RA 1RRFA 3FDIA 4LF5B 3QMPA 2F8LA 1ZMTA 5LBIA 1LV7A 4F4HA 1GKKA 4BMYA 1VCMA 4W5JA 4D3XA 5BN5A 1Y4AE 1ZUHA 1HLDA 3UUEA 4KAAA 3LH5A 2FCRA 4KXWA 3JQEA 3TMYA 3W2IA 1E2UA 1YR1A 2FFAA 3ICPA 2UYGA 2GM3A 3H42B 3GQBB 4IJWA 1XD2A 1C2TA 2IE8A 3MS4A 1FFSA 5DCYA 5WRFA 1D7AA 4OQDA 1IHUA 2FP3A 1ZIOA 4REMA 2PKCA 5C8YA 1E5DA 1RZ3A 1WXQA 2QT0A 3LSYA 1VI5A 2ZVJA 3OUZA 1LF0A 2C2OA 2WUEA 1QB7A 4RKWA 5ESWA 4BNZA 3W78A 4QOHA 5TEWA 4LGYA 3WFIA 3ZNOA 2NZJA 2BMFA 2ZJ0A 5A0TA 5C4GB 2G77B 2IL1A 4RTSA 1I2CA 3PPVA 3G79A 4PU0A 1UKVY 2O2EA 4F2DA 2LW7A 2ETXA 3IUBA 1BN6A 4XKJA 4BFWA 1VHDA 3RM3A 3WLLA 1EX9A 1VPEA 1I3LA 3WRXA 3AU9A 3IAFA 5L95A 2JHFA 4Z7OB 2AJCA 1VYUA 4KQXA 3ULKA 1WF3A 2F3PA 1M73E 4EARA 4QRHA 1I2DA 2E4YA 2CLHB 1IRIA 3DR5A 4LJ5A 3TJRA 4LNUA 3BE6A 4UPVA 1ZK3A 2QN8A 2V7TA 2ERYA 1JG3A 1U90A 3WLMA 3U4QB 1T5LA 2Z2JA 4GBJA 1RLIA 4ZU1X 5E6SA 3CVXA 3I5UA 1CXZA 4ZVNA 2P67A 2PX8A 3IVCA 4M9CA 3TKAA 3ZWKA 1AK1A 5CGZA 1XTUA 2G83A 2BFMA 2R25B 5BWCA 4Q3CA 5BN4B 1RCFA 1ZGAA 4FNOA 4RJIA 4NBWA 1NBEA 4IH1A 3DTVB 4DQVA 4TM7A 3I0ZA 3BQNB 5DHAA 1I80A 4BMSA 4C06A 5JWHA 2JJ2A 2PGOA 1W30A 5IWAB 1E1CA 4YXWA 1MJ5A 2ZSFA 2EEZA 5BN1A 4E88A 1Q1AA 4HLCA 1O97C 2JAXA 5FPSA 4IHJA 1ZK4A 3D0RA 3E9QA 3MPOA 3HACA 1ECGA 1L5WA 4JT2A 3DZCA 3W1VA 3SBEA 2FHSA 5HJEA 1G8HA 4ABTA 1EFAA 1RAEA 2PFKA 5B53A 1CHNA 1F3OA 4DQ0A 4YGYA 1FIUA 5KYUA 2HRDA 3FNQA 3OFND 4DIFA 4PE5B 3BERA 3I5YA 2O14A 1UZAA 3WL3A 3OX4A 1KQGA 1FMFA 5AM4A 1AJEA 4NV1A 2NU7A 4KRXA 1NXSA 4WFIA 1P7CA 1HKHA 3K0AB 4MXDA 2P8SA 5T4HA 4EKEA 1DBPA 2DPHA 5FTJA 4D4GA 2IX3A 4L73A 1GTRA 4OAPA 3UPDA 2VQ3A 3EGVA 4RJ2A 2OV2A 2OYCA 4TVOA 2X0IA 3IP5A 2Q5QA 2ZATA 3I37X 3Q6IA 4DJAA 3IURA 4MVJH 3E9ZA 2CDCA 3GN1A 4B81A 3QBJA 5EI5A 8ABPA 1RJEA 1Z6YA 3W0LB 3HDQA 1G17A 3BXOA 5B1DA 1FE8A 4XYGA 4ZK6A 1JDPA 3GA0A 4RUKA 5EY5B 5HTKA 2VF5X 1X19A 3P0RA 4TX1A 2XDWA 1KQNA 4ESHA 4ZDIA 1A2QA 3AF5A 3HYNA 3I1YA 2JVJA 2ZJOA 4NBRA 1QLHA 3RC7A 4CE6A 3TQFA 3M5DA 3QE2A 3KQUA 1XLWA 2I03A 2J07A 5D7BA 2A86A 1J4AA 1OREA 1MDFA 1USGA 3C16C 3V3TA 3JAKB 2Q5IA 2V7QD 1DKPA 1YA4A 1NVXQ 1ZKDA 2I1LA 3A9WA 4R1UA 4D9GA 1ONBA 3PC2A 1LS6A 2HK8A 2CJFA 2PG3A 1TL7C 2VHTA 4RGQA 4OI1A 1QP0A 2I2BA 2LRHA 5DOZA 2RHGB 3LCRA 2XQGA 4KXFB 5KJEA 1ES9A 1CY2A 2JVIA 1QC5A 2ODPA 4R41A 5ESXA 1RZVA 3TE7A 4Q12A 5K4GA 2WAAA 1YI0A 4TQUS 5ALRA 3SQWA 4JX9A 1K97A 4TZ6A 1RP1A 4GMHA 3RRFA 2ZIAA 1LW7A 4UE2A 4BV8A 1R4MA 3A4NA 4F3CA 2PSJA 1DB3A 2AWOA 3GFOA 2JJ8A 2G6BA 1N2OA 5FI5A 3AY3A 5CJJA 6NULA 4N47A 1O0CA 5KTYA 1EX1A 3IB6A 4NENA 5FWXB 4HZUA 1TA4A 1U7ZA 2VXCA 3K0HA 3FYUA 1DJOA 2FPMA 4G1UC 4ZJZA 1WB5A 5THXA 4KREA 3B51X 3SDSA 3L0ZA 4HH0A 5A0FA 5E7JA 4DR6B 1VCNA 1YA8A 4TLBA 3CM0A 5AT1A 2WTXA 4TLCA 2BSAA 5AH0A 3W2GA 4ENWA 5C46F 5J2UA 4DV6B 2XXAA 4P86A 3TLYA 2ODTX 4PLWA 5I4KA 2YJTD 1XVTA 1WCIA 4DE5A 1EFRD 3FAZA 4HQ6A 4Y0VA 3C3YA 4R51A 2Q2NA 1ZXLA 2JJMA 4W6ZA 2ODBA 1OLUB 2B6NA 4WA8A 1K7FB 3F2VA 4P3PA 5IAKA 4B4UA 2ZRKA 5M29A 4F5DA 5JAPA 3ND6A 1CDZA 2PL9A 3OOJA 2XRZA 1SCBA 3ORYA 1SB8A 2AR0A 3F4LA 1OZFA 1LTQA 2HD4A 1ZCZA 2G63A 3KXDA 5DNEA 2BT4A 4BKRA 4HNVA 1VJ5A 4JP5A 1O58A 5ILGA 4HGZA 3ZHYA 1A0OA 1Z8NA 4US1R 4QO8A 3EEFA 1HH4A 5KHOC 3TNYA 3GRZA 1NOIA 4MP8A 4WNAA 2RHOA 1HDYA 2BONA 2DFVA 2GX6A 5TF0A 4ZI7B 1H8HD 2DY1A 3Q7PA 3DLCA 5E9QA 2ECOA 3BCUA 1WUHS 1KQPA 2MWMA 5FL7D 4XASA 1QIKA 4BC1A 2PQ2A 4LQ4A 1S8OA 2X6TA 5IH7A 4F96A 2BGNA 1XGKA 4ND1A 1RLTA 3FPGA 2RK6A 4KE7A 4KXXA 3ILXA 5REQB 3ZHSA 4IGAA 1BKSB 1ZL0A 3UBTA 3L4JA 3AM4A 1NWCA 3PB3A 2P5YA 4KN8A 5JYCA 1ID8A 5G3ZA 5FHQA 1HYQA 4DOMA 3NEAA 5D5PA 4IWYA 2CXNA 4XQEA 2FY8A 3LX6A 1M0WA 4RU1A 4C22A 2XYRA 5KMGB 2I6GA 2ST1A 2HA2A 2SHKA 3A14A 3KOMA 3WISA 1KEPA 3AEKA 1IWPB 4AXBA 4V0QA 3SSOA 4U39A 2ZUCA 1VTKA 1DC3A 1ESZA 1YFKA 1G42A 2YJ4A 4K6KA 3WK6A 1U9ZA 4QYSA 1OXMA 2FN7A 3EG5A 5B1HA 1B23P 1O9GA 3MLBA 1GUZA 1TT5B 3C3MA 2VLIA 1VKJA 2ZVQX 4GEGA 3LHFA 4FFLA 5ANRB 4D0RA 2I87A 1GD1O 1MHPA 1XDBA 1OZAA 2XA9A 3SR4A 4EG3A 4UEKA 2R00A 3TPFA 3LG2A 4J0CA 4ND4A 2GSDA 4F3YA 4H3HB 1JL3A 5BN3A 2W58A 2R5WA 1EM8A 2M1ZA 3HCAA 3FSEA 4QGBA 5DTMA 3CUSA 2Z57A 4RENA 2W6CX 3O92A 3ZI7A 2FW1A 4ZQEA 5MFZA 1N9KA 4RW0A 2ZBPA 4ATNA 3PXXA 3IPCA 1L7DA 1QIIA 4KP7A 3TOSA 4WLVA 1T4CB 4KR0A 3VHXA 4BFYA 3WDLA 3WGTA 3LY7A 3ANYB 4HH3C 1EI9A 3DV9A 3BIJA 3ZZ1A 1RYYA 3A6KA 2XY4A 1COWD 2PTHA 2DHDA 2BFBA 1D2MA 2I4TA 3NYWA 4JB2A 2FMHA 2GEDA 2H8GA 1JG1A 4F46A 5L6LB 4BFCA 1V8FA 5CLJA 4DCUA 4QDJA 4D42A 3DLPX 4J3FA 2QENA 2PX5A 4ID9A 2XT9A 5CCXA 1YQWA 5IJWA 2QRPA 1ZW6A 2ZJZA 3GDHA 4RXUA 3L0YA 5DISB 2PVPA 3SD7A 4BNFA 1U65A 5CLHA 4K7JA 2R8ZA 3ZQ6A 2ZE6A 1T35A 1RXYA 2QLTA 2C3PA 3NHLA 4BCDA 3HA3A 3D3KA 1TI7A 4L4UA 3QVOA 1US8A 3ZCSA 2IYEA 2C0QA 2PNFA 3KS9A 3WE7A 1V8DA 1WTAA 3F7TA 3GGGA 3O8QA 1NMEA 2ESRA 4GQAA 1CTQA 1LSSA 5F78A 1MV8A 4Z3DA 3ST7A 3LFUA 4DJTA 3GGPA 2ZAOA 4JVNA 4EGAA 3NIFB 4EEXA 2IGTA 2QL7A 4GBED 1L4MA 3MGGA 3H5IA 4QXQA 2XDQA 3JQ9A 2EU8A 2XCQA 4HMPA 2I9KA 2HQBA 3ZV3A 4DJDC 3KAJA 4UATA 1UJ5A 4M1OA 1UC4B 1OYYA 4DBLE 1P4AA 1L6IA 2ZAIA 3EA4A 2DFPA 5ETJA 2GESA 4H1UA 3UAZA 5K8TA 2OMKA 2RAVA 1OMOA 2B35A 3C1AA 4C0QC 1BXZA 2OBFA 1IZZA 5DOVA 2LCFA 1RZRD 4V0SA 3EOZA 4QOEA 1CUSA 2UVQA 2BEKA 3O1IC 5DSTA 3RARA 3CFYA 4FZ5A 1L4UA 2R6R1 4QNRA 3PUJA 2I7VA 4EFMA 1ZJZA 2OCIA 4OLAA 5LPNA 4MV7A 1DOHA 4Z1MA 4ZVOA 3PUYA 3IEKA 2D1SA 1TM4E 3H8SA 1OJ7A 2AHOA 2VXOA 4HX5A 4I0WB 2KW5A 1U6JA 4JJGA 3CIOA 4RACA 3WNDA 5JNSA 2GD2A 2OV4A 5F5LA 2PBZA 4BAUA 3A1CA 4DIUA 2JH9A 5AJWA 2RAFA 3L0IB 4D4JA 3R7WB 3WQRA 4PSKA 5TQVA 4IVPA 5F3DA 4HFMA 1ZZEA 2FTKE 3LHDA 4LTNA 4CTKA 521PA 2DFLA 2BGIA 3BWBA 2BKVA 4AKSA 4ETWA 3CF6R 4NVRA 4X93A 1TEHA 3IAXA 4WXHA 3SNKA 3ZE6A 2Z0MA 5BUSA 1XNRB 3O8RA 3HKDB 3ZCPA 4W5RA 3KLNA 4G0NA 4TS1A 5A1TA 2R6GA 4HEA6 1BD4A 2AF4C 4LYJA 4B6QA 4ZODA 1ML4A 2Q7OE 4BO5A 2PEZA 5FQOA 3ICQB 1POXA 3WHKA 3TOZA 1HM5A 5DKFA 3DBVO 1FTGA 2Z5LA 4DCOA 4CLEA 1Y6FA 2P2LA 4KK4A 4LMAA 3VBEA 2VZ0A 2QAIA 4BGDA 2IXTA 1K7EB 4J16C 2H4FA 3P52A 5JCPA 3IDSA 5JFOA 5L3ZA 1CF4A 1II0A 2VJDA 3CZ4A 4HXFB 3MT9A 5IW8A 3RT9A 4A8HA 4B76A 3U60B 3WXMA 3SF0A 5AXBA 1L9KA 3LOQA 1WBDA 3KYDB 1SUSA 4Z9FA 1SIUA 3A1VA 3WX0A 1RC1A 2E4UA 2CGEA 4ZVVA 1I7SB 3RW9A 3VYUB 4L9AA 4JYZA 4MYRA 1VSQA 1YACA 4PS0A 3WTBA 4ARAA 1Z2OX 2ZBQA 3H8WA 3IODA 4KMOA 3RIEA 1AZTA 5E3HA 3MLEA 3OCCA 4AJLA 3AB3A 5BV7A 5KQSA 5BVHA 5TJHA 3K70B 4ZZIA 2IU0A 3WK5A 2ATIA 4QULA 1WHTA 2ZJFA 1MPXA 3F1KA 2WBLC 3ABQB 4Q3OA 3UTCA 1TO6A 4X8MA 4B7XA 4BMDA 3H1AA 2O1SA 3C6BA 3QVLA 4AUNA 1KQOA 2FOIA 5JEDA 3WJ7A 2ZSAA 3EXEA 3ONFA 1J06A 1N2JA 2Q6OA 3KX2A 1ECCA 3P5BA 4RS4A 4BEJA 1VLMA 4BVKA 4EJMA 4XIFA 1WO8A 3LXRA 3IALA 3L02A 3QI2A 3TZKA 4EY7A 2OG2A 4JOSA 1V1RA 3WBJA 2C59A 4EFLA 3F78A 5JVDA 4EHNA 4AN1A 3HEAA 1NHGA 1SHUX 1OPXA 1EAYA 2G06A 2RJNA 3LUAA 3DPSA 3ER6A 1ZUNA 4UDNA 3C8MA 1G5IA 3LPNA 3JZAA 3R6TA 4IX1A 1GYPA 3GVHA 3PNPA 4GSKA 2BVNA 1GSAA 4EGJA 5KJFA 1P80A 4HWKA 2MU1A 3KQQA 4FFVA 3ANTA 3A6HA 4ZHQB 2SKEA 4RDXA 4DXHA 3SF8A 4IDAA 5F51A 5BWLA 1FUKA 3DMHA 1C14A 4FC6A 1XLUA 3NX4A 4UFPA 4XI9A 1Z2CA 2EXXA 2FZEA 3O4IA 2FWBA 1JQDA 1GL9B 1KNQA 4EA9A 4MR7B 2DUMA 2GF0A 4CKBA 1E3IA 5LN1A 2H07A 4CKCB 1ICIA 1D2EA 4BVLA 1PT8A 1WIWA 1NASA 3WSTA 6ADHA 4JV5B 3FPLA 1QB8A 2LKDA 4JB3A 2Z3ZA 5G53C 4OK5A 4P3NA 4EELA 1P7ZA 1CUJA 3AFIA 3T95A 3TOXA 3REQA 1R5OA 2DWPA 3G5AA 1T5DX 5GY7A 1BDMA 3N8HA 1X1EA 5B58C 1LBEA 2JKVA 4HWTA 2ZRLA 3O4GA 3U1BA 1N9GB 2YWHA 4GR5A 4FGUA 1J2TA 5LKAA 1KPGA 4L85A 5INTA 4RA6B 3ZLVA 5I9TA 4B84A 4B3DA 4DRXA 1XWIA 2YCLA 4DCPA 1QVVA 1JR4A 5F7ZA 4TKZA 5E2BA 5AW8A 4Q9HA 3JZIA 4TVKA 3ZTTA 7MDHA 5DO9A 1QTRA 3MINA 2PRSA 7ADHA 1G5TA 4RYLA 5CIQA 2XNKA 2GCOB 3HR8A 3PUKA 4MWBA 4AKEA 4ACBA 4QQ8A 1DT3A 3EUEA 1U0FA 1YRAA 1SRRA 3H9CA 4HZIA 4DYVA 2QM0A 3CX3A 1WUIS 3G2PA 4NSNA 1KI6A 3FBTA 5JZVA 5K4HA 1PGOA 2VSYA 1LNZA 2XPCA 2F9FA 1M6EX 1OLSB 1NXTA 1J5PA 1GPYA 2ZSIA 1UBMS 1CYDA 2Z1MA 1SUFA 1JQLB 1E66A 4PGMA 1C2YA 3K16A 4EATA 3A9RA 4DT1B 2AZMA 5EXXA 2B2CA 1OFTA 3E35A 2WTEA 3OEWA 2WWWA 1ZESA 2JNWA 3KHTA 4R9VA 4XYEA 4OKNA 1JI3A 3RSZA 4BJ5A 1RPTA 2Z08A 1X1DA 1KKUA 3BKXA 4UJ3A 4YP5A 1OX4B 2PRKA 5LLTA 2J9RA 1CC1S 3Q0IA 4QICA 1Z7GA 4Q4AB 4DVGA 4OYLA 5CFQA 1M2EA 3MJTA 3SR3A 1DUIA 1SXJD 3CV3A 1EQUA 1Z3CA 3DT9A 2ZRNA 1DBWA 4ZO8A 2OV8A 4RFVA 3ZJTA 4NAVA 2C2MA 2Z8ZA 3JVVA 4UUNA 1HRDA 2VRBA 1CKEA 2FI1A 1U2DC 1DBRA 3BC1A 3OLCX 4IXTA 5FEMA 4ZEXA 2PO5A 4CCSA 4MYHA 4EG8A 1L7PA 1RD4A 4XJTA 2IIPA 4Q9DA 1B1CA 3U9SA 1QV6A 4CHTA 3T7SA 1JEOA 4M53A 3OQNA 1ZM7A 1RMQA 4PIMA 3GRPA 1IB6A 2AI1A 3LVFO 5CK4A 2WUFA 2XUHA 4YS6A 2GH1A 3OEEA 4YV7A 3QPAA 4TL8A 2YJ3A 5IC5A 4X1KA 1TW3A 4QLBA 5SYNA 2I78A 3SLRA 3GUHA 4AO6A 1PL7A 5DLYA 3FCAA 3RR2A 3T34A 4UOZA 3RS3A 1L2TA 3OETA 2ZZKA 1OAOC 1P4RA 3KU1A 3QWBA 3GI1A 3IT3A 3UGKA 1RZUA 2IYPA 4HDRA 2A0YA 3CY6A 1WDLA 1QQTA 1SKYB 3GK3A 3LUJA 1KBOA 2IIBA 2OZEA 3T3PB 4MCAA 1MQSA 3ZDCA 1ITZA 1U2EA 4GMKA 1WXDA 1M2OB 1WXHA 2WT9A 1DGQA 1CUAA 5FPTA 4NFHA 1IATA 1L5LA 4DDVA 1YA6A 3JY6A 3W5BA 1IBSA 4CMBA 3ETLA 1RQ7A 5K20A 2CCJA 1K4KA 4BZWA 1YCDA 2W0MA 2Z4SA 1O87A 1GTL1 3QU5A 3SIXA 4EKIA 1FQOA 3CT4A 3NH6A 3O7WA 5K0FA 4FMDF 3DC2A 2WHPA 3ICVA 5FBVB 4M46A 3C4QA 1XCOA 2WIAA 2YWGA 2XGMA 5CX1B 3LHKA 1XMPA 1Y1TA 4YNBA 4WOKA 1UAAA 1BW9A 2QUAA 5CLGA 1R0SA 4HH4A 3G59A 2FPIA 1KDVA 2GO7A 2GYWA 5JCXA 5FTNA 1NRJB 3OCZA 5I3CA 1T3LA 1IEXA 3UGTA 4KDCA 3MVEA 4GXQA 2P79A 5K03A 2Y77A 4LY3A 1IHXA 1GYRA 4JA0A 2F67A 3FNEA 3PUVA 4AY4A 1D1PA 3M33A 3NV9A 2DQYA 3BTVA 5A1JA 2ZOSA 1FNSA 4PFKA 1GOTA 3B3QA 3LT4A 3O7MA 4J0KA 3W5VA 1PUXA 1RWNA 4E03A 1RKVA 1RCTE 4RFSA 3R6DA 1MAHA 2HTFA 4UVHA 5CM9C 5DTRA 4EG4A 4G3XA 4PN7A 3C1UA 4Q7JB 2GLTA 1EBUA 1E60A 3D3WB 3MTJA 1EXWA 1OV6A 2D2VA 3DDUA 4YLGA 4CF5A 5FWDA 1LVHA 2KMLA 4WXPA 3MTDA 4MUBA 1K4MA 2PMKA 3N75A 4CCYA 3CEHA 1OBCA 4PC2A 5HS6A 3K20A 4I1PA 4Y2PA 4N7MA 1JKJB 3D8HA 3DD5A 3JQBC 1Z45A 2PV7A 2XHEA 1E9RA 2ZYAA 4R1SA 1OFIA 3NHWA 3RTGA 2NIPA 3CT6A 4G09A 1P8AA 4TL9A 1NR5A 4U7PB 1HNNA 2BRUC 1G41A 3P9ZA 2QVZX 4MS4A 5TT1A 3VR6A 1Y4ZA 1RHMA 4OJYA 4DQLA 1DBVO 5C18A 2BUCA 3LE8A 1YS4A 3I5XA 5F1YA 4LJKA 5KDDA 1BS9A 3QE3A 1JT9A 1JI0A 3R7DA 3UC5A 5B6JA 3IR6A 1BHJA 1M1YA 3G0CA 3JWEA 5H83A 1A95A 7YASA 3NHBA 4Y1RA 2BFAA 4EMSA 3L6BA 1IY8A 4PAQA 4PAOA 4LTMA 5ABPA 3CRZA 4YHBA 2QP3A 4GYJA 4XEHA 3PFCA 4D0NA 4EOGA 2E4AA 2ORYA 5ENVA 4CIXA 4QU5A 5KWJA 4DCJA 3K4HA 3C6XA 1YK0A 2G76A 2A5YB 2B4TO 1P39A 1EHYA 1W88A 2G9VA 2YFKA 3AUFA 3IAAA 2BH9A 4JS0A 2NXEA 2CNWD 3NANA 4DDMA 3ZXYA 4U1RA 2BFWA 3GJ8A 4MEJA 1NVAA 2I34A 4FGSA 4DN6A 3UMBA 2QX6A 3I0MA 4BAZA 1L5OA 4Z4IA 4PCLA 2AL7A 5EMNA 1C7QA 1UDAA 2FR1A 5CM2Z 3TPCA 3N07A 4WXEA 1IXSB 1E2JA 2YWFA 2Z8XA 3V8BA 3OPYI 4LXTA 4UAUA 3WICA 3OJEA 2QG4A 1DC8A 3AKEA 3LRTA 1AKTA 4WFKA 4PYOA 1NP3A 3RTBA 3VDRA 3DEHA 5I45A 3J81k 1JG4A 3JQRA 3GAAA 4R68A 1IBRA 1NONA 2YDXA 4QYIA 1JJ7A 5HKAA 2P6OA 1JQBA 1SCAA 3THXB 1TQ4A 1JQ5A 1T9GR 3EN0A 4UD6A 2VT3A 1DFGA 4UNIA 3RVKA 4BL5A 3MQ4A 1D5WA 1KY5A 5GAJA 1U7DA 1QBKC 3QWIA 5THKA 4I46A 1H93A 3PSAA 4OHKA 1V47A 2GZHA 3SM3A 1JG2A 5MGBA 3C3PA 2XF2A 2FZLA 1GSIA 4HB0A 3G9UA 2PL5A 1Z75A 2CDBA 2CK3D 1M8JA 3N0VA 3WWZA 4QXOA 4MWEA 2GCEA 2H5LA 3K72B 4AYTA 1C30A 2F90A 4DYDA 1L4KA 4BLPA 2QTBA 5IT4A 1V9SA 5JNVA 3LP5A 1I5OA 1N0WA 4FDLA 3KYCB 1GAQA 2VATA 2XNSA 4AJOA 2VFAA 3ZHUA 3UMFA 2DQSA 3CKMA 1O5OA 2QHXA 4QAQA 4RAOA 1ZR2A 2VDVE 3D0QA 4EG6A 4O63O 5BR1A 1I4LD 1WLSA 2Z9DA 5EWMA 2C3UA 3Q87B 1EP3B 1D0VA 1J0CA 1HL7A 1M8KA 3BL5A 2JGDB 3I4CA 3KBBA 1I51A 1M6YA 1KVTA 3HMKA 3HFGA 4BO4A 2CMKA 2UU9B 1ZCBA 1JHVA 3S99A 4O2AB 5JNWA 4TYYA 2H17A 3SYMA 1SY7A 4GOMD 1HC7A 4P4LA 2C4VA 4KKVA 1SOMA 4OPMA 4DADA 4N41A 1NURA 2D1YA 1A4RA 2YOGA 3HTXA 4BX0A 4BMPB 1K6IA 2PWBA 1F7UA 1DJMA 2AQKA 2C57A 3OBBA 2V3CC 3R3SA 2A5JA 3KKZA 5BSUA 2HLDD 1T6XA 2BP7A 1GDHA 1WUYA 3BF8A 3ZE7A 2YRXA 1WS6A 3U13A 3BYZA 2BEUA 1U1DA 3H18A 3LUCA 2R1TB 3O8OB 4M8KA 1BNCA 2BJWA 2GUGA 2PUAA 1ULBA 3HFJA 2CJWA 2CZCA 1J0BA 1E3SA 1JBKA 1VE1A 4BZXA 1DDGA 1WM1A 2CVOA 3P27A 4G56A 5DHQA 1QVZA 4AIIA 5I7VA 1CSEE 2H2DA 4RK7A 2ZZNA 1NW4A 2XA2A 3GRKA 3ODPA 1B41A 3TRHA 5DI3A 2Q7DA 2C5FA 2EIHA 4M1TA 3BHMA 3TWOA 1EXNA 2ALJA 4JQOA 4MVJM 4NG4A 3X1DA 1X8XA 4B9EA 1WXFA 3BMQA 4IIHA 2MSWA 4C4ZA 5IG2A 1Q1EA 1CDEA 1W46A 4L8YA 5M3BA 4PZUA 4YUZA 4MRMB 3AHGA 2DERA 4AZ0A 1IY0A 2VNJA 1X7HA 2X3FA 5DGDA 2QA5A 3HKEB 4J8PA 3QA3E 3GJYA 3QVMA 1LPSA 5KNDH 5I4BA 2HGSA 1A1VA 3H16A 3E22B 4JASB 1U8YA 1KH3A 3GVXA 1UBGA 3F6YA 3O2SB 2PIDA 5DBGA 1SC6A 2XI4A 1H2AS 2ZVPX 3KSMA 1EINA 1YDFA 1G66A 1L5YA 3ZVRA 3HM9A 4NCAA 3RVDA 2GYUA 2OK8A 1C4KA 5IVPA 3ZQJA 2GTPA 4YBRA 3E0XA 4Q18A 2PT7A 3C4VA 3U3DA 1Q0ZA 4QDXA 2OCXA 3W79A 2VTBA 3KQPA 2ANCA 3PHBE 5KUTA 4XTCS 1WJGA 1KPIA 1NTOA 1MN6A 4EI2A 1LNSA 5GZ6A 1HI9A 3HB4X 4MCJA 4EF4A 2FG7C 2P2NA 1EVJA 4PQRA 4C0XA 2Y1GA 3GRVA 2BFEB 1QUEA 3MM4A 2CXPA 1K8YB 2AFIB 3OVMA 4FFOA 4OMFG 3SYLA 1PZNA 3IMEA 3Q10A 1RAHA 4KB5A 4DPMA 5CT6A 5A7HA 2DCMA 1F12A 3ZTWA 1P4GA 1K3UB 4D81A 1C8BA 5K0EA 5CCBA 1AB5A 5LQSA 1HGXA 1FSZA 1YXMA 1J5XA 2RH4A 4N0EA 3RDPA 2OM6A 1ZD5A 3UMJA 1FDRA 2QD3A 5HDBB 4RM3A 1E94E 5LA6A 1E59A 2QR5A 1ZCJA 1J7JA 4Q1DA 4YDSA 3ZLJA 3M6WA 3E5HA 2C1XA 3QEKA 2G9UA 2REQA 3B9BA 3CR7A 4NYMQ 5IJXA 3VR5H 4B4KA 4DMKA 5F3RA 5BSGA 2P5SA 5DN6D 1KIAA 1UQTA 1JPJA 5K4AA 4D3FA 2ECFA 2XCUA 1ZIDA 3I42A 5G0UA 3EXHC 1GDDA 4WUVA 3R75A 5K5EA 2J59A 2O8CA 3PGLA 1ZIXA 2RBKA 2B6HA 4O2BB 1WZNA 2JLXA 2SNIE 2CKMA 4YQYA 4HHEA 2QN1A 2WT8A 4JUAA 1BCRB 1FMCA 2PRYA 1TCVA 1WNFA 3U17A 2X5XA 3CZQA 2FZVA 3TRJA 1TVEA 4INJA 1VHLA 5FUQA 4I3GA 4D44A 3QF4A 3SJAA 4JN6B 1MFZA 1RHJA 3LOPA 1SCNE 1T0PA 1SUBA 4X8HA 2DWUA 2Q46A 4B8ZA 1WA5A 4RO0A 3TW8B 2YWDA 1UM8A 3NVAA 3T8YA 3OSUA 4D99A 4Q9JA 3ROMA 1XUOA 1FYEA 2H1FA 3LBIA 5LJLA 1I6LA 4F5ZA 2DKOA 1M7GA 4CF4A 2VKQA 2PN1A 4BJHB 3TG2A 1ND5A 2FK8A 2FPUA 2WA1A 2OAEA 3ASZA 4KN5A 4L0QA 1KORA 1N2HA 4OM7A 3KSBC 1FP2A 4NHEA 3BWCA 3W9BA 1JR6A 1DQSA 4H0CA 2VCEA 4QZVA 2VA8A 2GD0A 2XB2A 3HGTA 3EK2A 4XFDA 4US0R 2NO0A 3HU1A 1Z4PX 2BBSA 3FKQA 3I3SR 3MAJA 4JI2B 2BGUA 3G9TA 4US2R 1NYTA 3C3EA 1XF9A 2FSUA 1E6EA 1NYLA 2R87A 3W9UA 1FW6A 3PDCA 2ZRAA 5A9SA 3OTOB 4K9NA 1S6YA 1CUXA 2HDHA 3B70A 4OXXA 3RS5A 1GLGA 1EXMA 4GT1A 2DFKB 1MVLA 3KSRA 4IP0A 3HVKA 4BQQA 4E1AA 3QLUC 1A4UA 1AS2A 3WMWA 1T0HB 1IHOA 2OHGA 1AA6A 2VRCA 4MA4A 4DMRA 4XM2A 2QYTA 1AHIA 3BKWA 4JC8A 4N6GA 4W63A 3V7UA 2AKYA 4ESOA 4OMUA 2PLAA 1IBKB 3U4AA 1OC4A 1ZCAA 5LP6B 1E3MA 4H35A 2OHHA 1H2HA 2EKPA 2X19A 1KEWA 2IYRA 5B55A 4Q34A 2WD9A 2SCUA 1C3VA 4CL2A 4X62B 2DAPA 3UPTA 5JD4A 2HNKA 4ISBA 1FQKA 2OBBA 2JCXA 4MUFA 5IYZA 1RC8A 3LUHA 2WLTA 1X14A 4HGRA 3DDNA 4BUZA 3DKVA 5AK3A 5B37A 2CHEA 2IRWA 3RVNA 4GOXA 4OKIA 1YB7A 2QLNA 5T41A 3ZU3A 1Y3BE 2GA8A 4A23A 4CQLB 4S0XA 4DIEA 5K8IA 4XRGA 2BMEA 1PQWA 3E18A 3HLKA 4PYJA 1BEUB 3IAM1 4UCXA 4YRCA 2GZDA 3W04A 1G9XA 2FPGB 1AHPA 4NOKA 4TTAA 1EVYA 5NLLA 1I33A 2VNIA 3PCRB 3RUFA 3KKMA 4EMBA 1ZJ6A 5C0OE 5F73A 2R62A 5KSWB 3GLFB 2OO5A 2FQWA 3P9NA 3CLUC 3MJHA 5IF9A 2XZOA 3CF4G 3EDRA 3PD1A 4AWAA 1XTZA 1GN9A 3ND7A 2AVDA 3ABZA 4TKLA 1YFLA 2PCJA 4QU0A 2A1IA 4MA0A 1AUXA 3AFMA 3QYFA 2ISSD 4LGVA 1PYOA 1MB9A 1JXAA 1N6HA 1U4OA 5HJ5A 5ICMA 4CMHA 1VIMA 3P0HA 1DRVA 3RYHB 3ZBPA 3GFQA 2E5LB 3JWJA 1LXCA 2PX0A 4KQIA 4XPIA 4KR6A 2J9FB 4HF7A 1W4CA 2XBMA 2FRVA 2A30A 2YFHA 3H9UA 4MUNA 5B1IA 3ZKAA 2I91A 4KI7A 3EPHA 5FUMA 5IM4A 3LO8A 4K1LA 5BY2A 1XHLA 2QG6A 1DZ3A 1Q21A 3CNEA 2F6RA 4UMDA 5IUJC 2WQ6A 1SH7A 2FFJA 1L7OA 5TQ0B 1TK3A 3CH5A 3B3FA 2CV0A 1KP2A 1BD3A 4EYSA 3BHIA 3OE7A 4BX2A 3THRA 4PSCA 3SSAA 1PEAA 4Z9AA 2H92A 1MU0A 1S3IA 4UAGA 5LQRA 4YJ2F 4I8XA 1FP7A 2PT6A 4FYKA 4NCBA 3WV5A 2JA1A 2VDMB 2YVQA 1MG0A 3FYTA 3OJXA 1RRVA 3PC4A 4G41A 1MX3A 3GO4A 4IIDA 4KO4S 5MN6A 1FMTA 1Z16A 4HC4A 3I1FA 2FPPA 4D8VA 3BJMA 4BYGA 1OOEA 4IHKA 3R6LA 3RAPR 2QT9A 4EHJA 4YASA 5DTIA 5DNYB 5IYZF 3QLVA 1QHXA 3PXEA 3LOUA 5FNZA 2GJ9A 1XCJA 3JARA 4PCUA 1V5FA 4G5FA 3ROQA 4CU5A 2YCBA 1PR1A 1Y3FE 1DOZA 1OTYA 1ZEMA 3I4LA 3NAQA 4K40A 4G1MB 1XV5A 3LYLA 3SXUB 1JA0A 1KYZA 3EUFA 3P1JA 2IITA 1MAWA 2EP8A 1CUBA 3QOYA 2BBOA 4RIHA 4XFKA 5D1NA 2QGZA 5CAEA 1JKMA 2PCLA 3FSGD 2CXTA 1GL6A 1SRQA 2PEYA 4X85A 4C87A 2YBEA 3D5TA 3W1WA 3L8YA 4GC5A 1GT91 3GA5A 3MRSA 1SXJC 4CNBA 4YN3A 4BLVA 1A72A 4NIMA 3HYTA 2F1OA 4INAA 3OZCA 4HCJA 1JHXA 1D1TA 1RM0A 3F7NA 1XLVA 3LKDA 3N0TA 4XWAA 1DC4A 3FN4A 1F8XA 5D6NA 4CJXA 4L27A 3N2KA 2IYAA 1AHHA 3KOUA 2J0VA 4H3VA 1UBEA 4H27A 2ZROA 4C7BA 4WBNA 3V00A 1FMJA 1ZQ9A 5IT9A 1CZHA 2GD1O 3GGDA 1H65A 4I5EA 4AZ3B 4YJ3A 3RFCA 5KNCH 1CZOA 2QX9A 2WJ6A 4Q3DA 4YXFA 1P91A 3ILYA 1X6VA 3IO5A 3OM9A 1Z0SA 1ISHA 3LAWA 2HBZA 4PVCA 5E6RB 3DCNA 5FYQA 3QVTA 5DSZA 1K8QA 1YNSA 1T3GA 1W581 1JLLB 2PZAA 3F71A 3HVJA 1OAKA 4TXHA 3WG9A 3KXKA 2WSLA 3MB8A 2JDID 1XAGA 2OORC 3LDAA 1QG2A 1FFGA 1R6UA 1Z5WA 4GRDA 4NJEA 2CFIA 3FFAA 3T7JA 1IJBA 1YUMA 1EHCA 1UZUA 3ELBA 2YUIA 4IG4A 3JQ8B 1DXQA 2FSFA 5JXGA 2NV0A 4HLNA 1MIOA 3HO1A 1MRZA 3JQAB 3KO8A 3QFCA 5CITA 5EG5A 2B7CA 1LDGA 1ONPA 4QOGA 2EBFX 3HLYA 1G0OA 4OHUA 2Y6VA 2HPZA 1N6KA 2H2HA 4F3RA 5LVAA 1EMDA 4ESVA 3KTAA 1NJFA 4Z0PA 3L0CA 5AK6A 5HGXA 2X3YA 1KI2A 1ACLA 1PS8A 1WZCA 2WTMA 1OQAA 3BWMA 1Z4NA 1H66A 3MWDB 2PJUA 3NGXA 3VU0A 1EQ2A 1L3CA 3ETDA 5DXAA 2YIJA 2EOAA 1N8KA 3WYEA 4PHTA 1Z18A 3NFRA 2XOEA 3NWPA 3AL3A 5T6BA 1YGYA 3R7LA 4MRPA 3B7PA 2GPYA 3ML1A 1TIKA 1X1BA 1HOXA 4UHEA 5CNKA 4XGRA 3H84A 1LBSA 3KM0A 3S27A 2UZAA 1NQTA 3U3RA 4ZDKA 1GPJA 4L15A 5I5GA 3EG9A 4DV5B 1G7SA 1P5JA 1UJCA 4CMCA 5JH7F 1H1LB 4YRPA 1A7JA 1XZFA 2OB1A 4S35A 4X84A 4ZT5A 4PZPA 2HJVA 2HWUA 3D43A 5DIFA 1MW9X 3HJBA 3R41A 1PR9A 3N5CA 1LS1A 4PNEA 1KRXA 5SYMA 3BE5A 2MSDB 2PAAA 3M6IA 2PFSA 3PNYA 4BVJA 1V6SA 3C5EA 4TYPA 4UU0A 3SSNA 4CKEB 2NQ8A 4CL8A 2FP4A 2OVBA 4EJSA 4UTPA 4JI4B 1M74A 1LWNA 3WV4A 3KT8A 4IDDA 4BBPA 3B2QA 1BH2A 3FPAA 1WMBA 821PA 1BMFA 2ZIXB 3GP3A 4XWGA 3RWBA 3LBFA 4RL6A 3T61A 4F93B 3WYDA 2W48A 1MNQA 2XOKD 3OX3A 3BEDA 3QEAZ 3ORHA 2HJ9A 1NPTO 5DM0A 3ZJ5A 2MCFA 2R4TA 3I9OA 3WLIA 4MRVA 6LDHA 4NK5A 1CV2A 4MGYR 1Y33E 2D06A 2ZJ7A 4PM4A 1P9OA 2GZRA 5DRYA 3EGIA 4Z9BA 2X5NA 1BOFA 4TLDA 5JLAA 4UOEA 3AERB 4S05A 2D6FA 1IZ8A 1QDUA 3OQBA 4A26A 1WLYA 1MX1A 1UWVA 2G1AA 2Q29A 3OJFA 4KO2S 3AM3A 3GRCA 4QPPA 2C9OA 1O5TA 1Z36A 4W8HA 1YJ8A 3TQHA 5TDHA 4U2EA 2EDAA 4BVFA 2WEKA 3D3EA 2JFBA 2K5UA 3G2KA 3ORQA 3BJRA 2CXHA 4UM9B 4TGLA 2ISQA 4MJLA 2X4DA 3JTEA 3SSMA 5IBRA 2ODAA 1Z88A 1AMUA 3HCPA 4XDZA 2WSYB 3RC3A 5ALTA 3GELA 3N0XA 5UKDA 3MS7A 3DEFA 1X7YB 2B92A 2B4QA 1FMLA 1JEYA 1JMKC 2XWBF 3TCNA 2QTGA 3JAWB 2X8JB 4YROA 4O6VA 4LDZA 3DB2A 3A31A 3DHYA 4D82A 4M38A 3A1UA 1NKTA 1Y9DA 2HBQA 4IMJB 1YR8A 4JVMA 1P73A 4LC0A 4XUGB 2AIRA 5AI9A 3QU2A 3U61B 3HU2A 1MTOA 3EGXB 1UC8A 2EZ9A 3KZVA 4JBLA 1SBHA 4RSRA 4I3HA 2XNDA 3M5WA 5DEIA 2ZUFA 2C7VA 3MNFA 2ZE7A 2X58A 3DEJA 1RWMA 2DJIA 4HQNA 3GRUA 4HI0E 1AMNA 3RO7A 1HT3A 1ZN9A 2DPMA 2XUQA 3BCHA 4AMYA 4BJ3A 2BZ0A 1UBKS 3L8DA 5JANA 1T4DA 2B69A 4AL4A 5LNK1 2HMTA 1Z68A 3GH1A 1ISRA 2XCOA 1M6HA 4BEWA 1YU9A 2ZE5A 4QGFA 4E70A 5LM3A 2XKKA 1X7DA 4JI7B 3UMYA 3QTBA 3T35A 1EVLA 1L5GB 5EQTA 4AXXA 3WDKA 4NBUA 4B6OA 1A9OA 4BRUA 5KYXA 2XH8A 4JP2A 4L5BA 5EHIA 1GTSA 2E0IA 4BNTA 3L8EA 4QX6A 3V7YA 2ZTSA 3IRUA 1PNRA 3IQIX 4EKNB 3WR5A 3HA5A 4M0CA 5H5JA 4Z7NB 4ZZ1A 2KI5A 3AH8A 3LL4A 4UUAA 1XPRA 4Q1FA 4RZIA 1ZICA 3D8UA 4HRYA 3IAHA 3IV7A 2G88A 4D9IA 2VUHB 2V1XA 1XKTA 3S1AB 4L3OA 3VH3A 3F9CA 3DHVA 4E1BA 2VQFB 2CW5A 5CYOA 1PDWA 2BV3A 4YYZA 3TLKA 3WFJA 1M8FA 3FOCA 4P3KA 4HFNA 1XZAA 3QMVA 1UJNA 3CNOA 3CZRA 3HHPA 4LDQA 3R74A 1PLLA 2FVXA 1DVRA 4V2IA 4YRAA 1V8ZA 2JFUA 1DS6A 2OZLB 2C7GA 3FNHA 2GR9A 4I4NA 1DBIA 1JYSA 3O2JA 4NPHA 2HR1A 4ZICA 2QLFA 4S1OA 1RYMA 3OFJA 3ICOA 2J3JA 4G0ZA 5DX0A 1BVRA 1MO4A 1XDWA 1DAIA 4LRTB 3RVRA 1RFGE 4B5KA 3D6AA 2NGRA 3DUFB 4EHBA 1KRWA 5IM5A 2BKEA 2CLDX 4OUDB 5DVZA 5CBPA 2QE6A 1N92A 1WRBA 1KVSA 3A7EA 3OZWA 3P9YA 3PDUA 1HDXA 4QUJA 3X1JA 4ARZA 1WVIA 4JLPA 4DREA 2J7PA 2ILVA 2YXDA 3GLVA 3KTFA 4ONEA 5E7QA 1L0BA 1DO0A 3RAFC 3QPVA 1YB6A 1WXXA 1I0ZA 1R0CA 5JJKA 3AVWA 2VHEA 4HDKA 2B78A 4PWZA 5H3LA 3UT5B 4J7AA 3F46A 4R3UC 3WYNA 3BX1A 4HAUA 2I7DA 2EX0A 5G0VA 1PJ2A 2YMPA 4I1VA 4J0DA 4AP5A 3SQLA 3NKVA 4HEHA 2Z5VA 4CFZA 1CDDA 3MSCA 5C81A 2TS1A 2OHXA 4C78A 5CDUA 3NBQA 3AW9A 1DKMA 4X91A 3I2YX 5CLFA 1XTTA 3CN9A 1N8NA 4ND6A 5AO9A 2HSGA 3B1KA 4MUMA 4HVCA 2HNAA 3T3HA 4LXYA 4BFTA 1EVIA 1VCHA 2NADA 1K89A 1XT6A 3ANMA 3O83A 1KK2A 4I8IA 3S2EA 2OCBA 3RJ5A 1OWLA 1Q91A 1RYBA 3LWZA 5AVVA 4DWWA 1PBNA 3NC1C 2Q2OA 5JG7A 4L74A 1RR6A 4PR0A 4W7IA 5K8JB 1JHAA 3WGIA 3MRVA 3ZOZA 2A5GA 4BRWA 2JFOA 3BH6A 2HK7A 3DMFA 4NRDA 5LBTA 1MV5A 3EEQA 3ZLTA 2DUNA 1Y1QA 1H2BA 4CZ2A 3E2PA 2LD4A 3IKJA 3DM9B 2AFIE 4KMSA 5DTQA 1I2ZA 4MWSA 1E0DA 3H8JA 3ZIDA 3NAGA 2RK3A 4C6HA 5KQPA 1IOZA 1XDDA 2IOFK 3RUPA 1L7XA 2KWIA 5HNKA 3L06A 1HUQA 1EXVA 4R01A 3W6PA 1JHRA 3PA6A 1UMBA 1W7AA 1U6IA 2FMXA 3BB1A 3EIQA 3EMVA 5KX5B 1QIFA 4JGIA 2PKXA 3KNZA 1NQXA 1ZK2A 1M83A 2WWFA 2LV8A 4RQTA 2HJGA 3C8ZA 2B4YA 1E2EA 4LHSA 1OFVA 5CA1F 1TK9A 1ZNXA 2ZU6A 2JGMA 3BRQA 3H4TA 1USVA 4DUGA 4I50F 3W5AA 2PA0A 1FW8A 4B33A 3IBTA 2G82A 1UR5A 3WK4A 3OOWA 1V1JA 4E4TA 2ACVA 2Q4DA 2WSMA 4JKYA 4LS3A 4C7KA 1IUPA 3BD8A 3RK0A 2FUEA 3UH1A 1F1JA 1JX6A 1VJTA 1E8MA 2WMDA 5JW6A 1TU0A 3A11A 2QAJA 2G9QA 1EE9A 4U7FA 5DULA 1V7PC 4JLDA 3FHOA 2AV6A 4RH3A 3DE4X 1FYFA 1I4OA 2F1RA 3IQGX 1E3EA 1T9DA 1USIA 4IQ4A 1WABA 4LQCA 1WU7A 4MLPA 2CLIB 4GPBA 4F92B 3HYSA 1EXDA 4E2XA 5JMTA 3TB4A 5AESA 4M7OA 3D8BA 3OFVA 4MI6A 5BQPA 4RHFA 3VXKA 1H3FA 4MVJD 1U0LA 2NUAA 4BWGA 2DX7A 1N3BA 5JHGB 3N6XA 1QG4A 4BIMA 3S8YA 2A9RA 5KWEA 1ZG3A 3OM1A 3GEMA 3SVLA 2JGJA 4PHCA 3JW8A 4B4DA 3RVPA 1IC6A 1TYAE 3EPRA 4MRNA 3SMQA 4AP6A 3MGCA 1IJKA 4I4LA 1T1IA 1TGYA 1ZOSA 1ZSYA 1P75A 2J09A 2RB4A 4UD2A 1I5RA 1PR6A 1FSGA 1W9HA 4M49A 1PTJC 2BJVA 2MSKA 4PC3A 1SBNE 4JEUA 1A9ZA 4CDRA 4HAWA 1XTPA 1NMXA 3DXZA 4C43A 2O8BB 1Z39A 3M3PA 5DYNA 3EH1A 1KEKA 1YZUA 1OKKA 3LKBA 1DTWA 4NL4H 4RYDA 4QG3A 1T8YA 1XWFA 3NATA 4EA6A 3KXPA 1QE3A 3QK7A 4CM9D 3KR0A 4U7GA 3RRXA 3TKLA 3BTSA 4XFJA 4B6JA 4XB2A 5I8ZA 2CBGA 3LC1O 2A4MA 3OLVA 4FUTA 5FJJA 1GGFA 1XQYA 1E1QD 1ZWLA 2ZR9A 5TQ2A 2WINI 5LDHA 5MGNA 3REFA 1NBHA 3DLAA 4RD1A 2WVGA 4DAEA 3ADKA 1QO9A 1JALA 4ETIA 1R9MA 3WBBA 4LUCA 1B8OA 1FP6A 1G0NA 1P7VA 2VWPA 3FLMA 1X7XA 2YVUA 1N9ZA 4RF4A 4DLVA 3AHIA 1QGAA 3KWFA 2Z9CA 2ZRIA 3QBDA 5CFRA 2ZCUA 3CZAA 4UBJA 1U0BB 1GTMA 4J0QA 4DXAA 4XQGA 5CCDA 3TPZA 4YX9A 1UT6A 4C0SA 2AW5A 3NYQA 3OLYA 1DARA 1ETHA 1PX2A 1JVNA 1WQ3A 2ECKA 2PXHA 2ZSKA 2JRCA 3CPHA 1BHO1 2Q1WA 5FWYA 2AYZA 2O05A 1MTZA 3FNRA 2QRKA 1GPH1 1NUSA 1Q77A 1SZPA 1F6WA 1KC1A 1W0KD 2ZYGA 1F0PA 1Y34E 3C87A 3OTIA 4R0NA 1P2UA 5EXEA 5BQFA 4DB4A 2FAXA 1DIOB 4K9MA 1LVUA 2P9GA 3IIJA 3H4VA 1PVDA 4YK7A 2HQOA 1OIXA 1QUFA 4LRXA 2D8AA 1KETA 4IBOA 4YAJA 4MSUA 421PA 2R11A 4DR4B 1QAQA 2ZQYA 2CD7A 5AKKA 1JDBB 1FFDA 2O3TA 2WM8A 2NVUA 3A2KA 4IH4A 1NI3A 3VTZA 5EKTA 3O3NB 3VDQA 4K8OA 1AG9A 5IJ9B 4Q93A 1FA9A 5HZGA 2OGZA 1PDVA 3BMCA 1K63A 1A76A 1HSZA 2FFQA 3FKSA 1V5EA 2W71A 3I04A 1EZ1A 4U00A 1A7AA 4O08A 4TWJA 4B6GA 1MX9A 3KZMA 2NVBA 5D51S 1O0BA 1K8ZB 3LU1A 2DULA 3EW9A 3FRJA 5EA2A 4HGOA 3SHTA 2QT1A 1E9VA 1F8GA 5AIAA 3R0IA 2AN1A 2WSSA 3DO8A 5J1TB 3ZJVA 2JGLA 2YIDA 3F3SA 4F97A 2IXFA 1DAGA 3ZWCA 1RE1A 1RAGA 3DOOA 3BREA 5LQNA 3SQNA 4E13A 3IP3A 4UTZA 2W8BA 2NN3C 4OGWA 4PGGA 2IGBA 2RC5A 3SS8A 4R1NA 5B64A 4PX2A 1U04A 1KAOA 3RWMB 1E9SA 4CFSA 1Z38A 5LOVA 2ZLBA 1M1ZA 3FFWA 3AMVA 3FYSA 1NXVA 3LY8A 5JJ5A 3IR5A 4KBYA 3ZJYA 4CL3A 4IHAA 4OOEA 3I2JA 2BTQB 4EGCB 3PQ2A 3II6X 1YZYA 5AFSA 3Q0TA 1W34A 2MYNA 3BFVA 3C41J 3ENWA 3JV7A 4FSXA 1U4NA 4IJQA 1N33B 2YX1A 4IO0A 4HUTA 4DIMA 2B1GA 1HL3A 1FJ2A 1V95A 3ISTA 1S8AA 1NBME 4PINA 4RS3A 5HRAA 4F86A 4QT0A 2V6JA 3ETEA 1NXWA 1TJ3A 4ZDJA 1SHKA 1XA0A 2Q8PA 1CB0A 5KC9A 5BOVA 3F2IA 1QHSA 3QVVA 4EG5A 2WJVA 4OY3A 2IDJA 2DCUA 4W99A 2R3SA 4L57A 3KR9A 1XZNA 2G25A 3QG5A 2NWQA 3EC2A 2FXIA 3OT1A 4JP3A 3KJEA 3IIEA 4YAIA 2X0JA 4I1OA 1J6UA 5KIAA 1WMEA 4UHKA 4FN4A 2J3DA 2ZBFA 3OUTA 1J22A 4PZYA 3N0WA 4PRZA 2W6NA 1AZLA 1JTFA 2RKWA 2J6CA 2VLBA 3ZYCA 3V7FA 4MUAA 1YWGO 2GBGA 2GCIA 1TB4A 5ALEA 2WMNB 1JQAA 2D00A 3C3XA 3I23A 3PL1A 3G7SA 3KK0A 3ZCUA 4ZOLF 3HKBA 1Z2DA 2D3WA 1KOGA 4M0DA 1M3SA 1UXHA 3OJOA 1B76A 3UKOA 4ALLA 5EJ7A 4Y2XA 1YJQA 2O48X 1WV0A 1H2EA 4MVWA 2GN0A 5K0CA 3DYIA 4X5OA 2QJTA 3TMKA 4E3ZA 2O1EA 3N05A 5DWQA 3G2IA 4A8PA 4J7CA 5A5DA 3R5SA 1I4TD 3HBFA 3F98A 5JV5A 1VMDA 3QVWA 4QLOA 3NUQA 2XMQA 2DUUA 4IFIA 4QATA 3PR1A 4RNDB 2CLMB 1FTNA 1W36B 4J0IA 1EP9A 5G40A 1P2TA 1R00A 3QUBA 4FDVA 2H1SA 1ISGA 5JARA 1D2GA 1MRSA 2BBTA 1ORRA 2J45A 3UQYS 1GV1A 1XU7A 3O4RA 1U3UA 3H11B 4MVCA 5FFNA 3WQHA 2D2FA 4G1VA 1E7QA 2LGJA 2BMDA 3HDHA 3LX4A 4PZ9A 4ZQIA 3HV0A 1I8TA 3UNXA 1RXWA 4RY0A 4DM4A 3CUYA 1W8IA 2VPIA 1DIHA 3GW8A 1PRYA 3PQEA 3DFUA 1XO1A 4R2WA 4BFZA 4Y6SA 4BRSA 1KO1A 1RC0A 5B1EA 4CM4B 5LZ2A 1H9BA 1P74A 3REGA 1XP5A 1N34B 1AOXA 1JEQA 3G5MA 2J0EA 1E62A 1T0BA 3LVQE 1FDTA 4TYQA 2R1ZA 1PSZA 3R09A 2XAAA 4B74A 3FGNA 4D9FA 1C5KA 4DEYA 2ADOA 1R8XA 1TPYA 4ARUA 3EZ2A 1LY1A 5EWLA 4FDMA 1YKFA 4MITA 2V7VA 4R8VA 4GOKA 3JVDA 1RWPA 1YE8A 5EMKA 4C88A 4Y6RA 1JJVA 4G1FA 4X97A 4DG5A 1TAGA 3FCYA 1NVUQ 2FW7A 2CL7X 3NP7A 2JRLA 2HH9A 3PIDA 4KFTA 2AYXA 4ZT7A 3W8DA 2Q5CA 2CLCX 3LNCA 1KIFA 2BEVA 2CCGA 2FUKA 2P2GA 3G2JA 1QHIA 3HBLA 1NUTA 1D2AA 4Q82A 4UXJA 2EG9A 3G6WA 5CX4A 5MF6A 2C07A 4F4IA 1MO2A 2Q2WA 1LLDA 3E7DA 1AM4D 2VJYA 2Y0BA 3IT2A 5KKNB 3AKZA 3L6RA 4INPA 3FVWA 3GEIA 2C3MA 1J9ZA 1BZYA 2VOJA 2W6PA 3QG1A 4UBMA 4J91A 4WNCA 3OBIA 2BFPA 4XVQA 3VOTA 3DZDA 4YUYA 1A97A 4GVLA 5BWNA 4FC7A 4LZAA 4EVSA 1C7JA 1DX4A 1SPXA 4E4RA 4CBVA 1ZWKA 1A9XA 1OVMA 4K6FA 1F5SA 3ILSA 5DMXA 1IWOA 1J8DA 3PGVA 3PNOA 4F6RA 2XXBA 1V4VA 2YWJA 4GM0A 3ROZA 3ERCA 2G4VA 1CUCA 1GM5A 4RD3A 3ZJ4A 4WOCA 4AZTA 3RODA 2HIHA 2AX3A 1NJ5A 1XKLA 3FMFA 3VVLA 2CL0X 3VYRB 3F49S 7ABPA 5B4VA 4CN9A 2IX9A 3VYVA 1SBQA 4I8DA 2OFPA 4TV8B 4WKBA 1MRNA 2VUTA 1G59A 1M1NB 4BX8A 4FFSA 3IUQA 4D9NA 4ZI2A 2A9OA 1BGVA 3ADPA 4REOA 4TS4A 4QYWA 2E4VA 2ARKA 1RYDA 1F8FA 1O1YA 2WKPA 1KJJA 2YHIA 3L1UA 5AM1A 4JI1B 3TB6A 5IHXA 2QTNA 1Z06A 5ERXA 4MJ3A 1SBTA 2ET6A 5CA0B 3ND8A 4R2MA 1G8GA 2WB4A 3F97A 1UP4A 2K7ZA 3WAKA 2BH2A 1OZHA 4ETMA 2JF0A 4JVLA 5BNWA 3H3JA 1Q11A 3UHOA 4ZYLA 2C0CA 2MSLA 3BK1A 1WU8A 3C97A 3HCFA 1J42A 3IR7A 4AC9A 3W3AA 1QIEA 1O3YA 3GJSA 3KQMA 4V2UA 1QPGA 3LQRA 1UXIA 2ACWA 3KD3A 1UXJA 2GUWA 1MOSA 1E1YA 4JK3A 4BCCA 1E3TA 2EJWA 3MW8A 2H2AA 5DYTA 1EJ2A 1E5VA 2Z30A 1XL1A 4ZYXA 4YRZA 1DWPA 2PBLA 3BXPA 3QY9A 2ZSUA 2M2IA 4GI3A 3GWZA 3DJYA 3K9GA 4V0KA 3FLAA 1ZL2A 4HWPA 4YRIA 2R8XA 2FF5A 1BWQA 5A5GA 2QMHA 5CJPA 5ALSA 3V46A 1D2CA 2PYZA 1A9YA 4KWTA 5K99A 5L7WA 2QX8A 2NZWA 4I9HA 5BN5B 4RZXA 2GZSA 1I3NA 2GM9A 3DKPA 4CDMA 1Z7BA 1X8JA 1JJBA 2B61A 1KGSA 1TVKB 2ZIEA 3EXIA 3FSJX 1L5ZA 3ZYZA 2QRLA 4GOLD 1L1FA 3V80A 2Z6QA 1D8AA 4FW8A 1RRCA 1TUEA 4BNMA 3PD7A 4EPTA 2QM7A 2ZRPA 4IMPA 4BX9A 4DMCA 5E4YA 5KYWB 1VKOA 2H2WA 4Y8VA 1LI7A 4P1ZA 5BUZA 4FD3A 2A0KA 1LI5A 2C9BA 3M5PA 4PY2A 4R8KA 3TH5A 1CE8B 3WVNA 7AT1A 4MEAA 5EHXA 3P2YA 1I30A 2GB4A 2CD9A 2BM9A 1P62B 2WWHA 2H8KA 4IFEA 3Q7QA 1T9AA 4AO7A 3RHFA 3WB1A 2X13A 5A7GA 4FS8A 2OPHA 4F5EA 3L01A 5JSZA 2R66A 1IN8A 3DS8A 1L3IA 4H3KB 3V1KA 2PMEA 3CW2A 5EPEA 4WXMA 1XEWX 3R5HA 1UBJS 3ICWA 5K0LA 4HNUA 2Q6LA 2XWJI 3HWWA 1YBAA 1XMOB 2HEGA 1KOJA 3GZ4A 4E94A 4BNGA 3ZDXB 1C7IA 4YCMA 4WVFA 3RIHA 3T3DA 4QUHA 5I4CA 2QN9A 1JFTA 2AZXA 4UUBA 3K1TA 3W5DA 3AR8A 3Q85A 3TZBA 1G1MA 5E6SB 1VRWA 3BH7A 4F8JA 1VC2A 1QRRA 4OTZA 5ITVA 1XEAA 4CUZA 5IVKA 2XX3A 3GA7A 1KGDA 2DHQA 3QVXA 5U4QA 5JASA 1VYHA 1TJ4A 4G0MA 4D7AA 1IXYA 2ZKLA 4RLHA 3TLBA 3PC7A 2CDRA 5AXDA 2I8CA 4ZZ0A 2PJZA 4MB0A 4MTLA 1F0KA 5GJCA 1E1CB 4XYMA 4RZQA 3PPYA 5C7YA 1NDHA 3G17A 2PT5A 1H0KA 1KA9H 1M34A 1OYVA 2XTZA 2OUIA 3OQIA 4KLZA 1SKBA 4MA5A 4WJKB 4ZAXA 5EGNA 4IHJB 5JYBA 4FEEA 5LWQA 5A3SA 2IEYA 2P30A 3HVHA 5COAA 4O4JF 4Q4DA 1Q74A 1DTSA 3T7IA 3TDNA 3EIFA 3U2QA 2DFDA 3UK0A 3ZZNA 4PN3A 5LNK6 4FHCA 4JAVC 5KYUB 3THWA 3UMGA 1P0IA 3WIVA 1I0LA 3K0FA 3B1VA 1EB8A 3EQ2A 3Q1LA 4ZD6A 4LGCA 2QZ4A 2YV4A 2HCTA 1FFHA 2QLBA 3AXTA 3H4IA 4NMLA 4RPLA 1QOQB 1UFVA 1ZH6A 2ZBEA 2NU7B 1JDZA 2XUFA 3MT8A 4G81A 2GS9A 2XTJA 4Y0NA 3TIFA 2IYFA 3ZLBA 4Z5XA 5TLSA 4Q1VA 2W9XA 3FTPA 3WLFA 5E1OA 2J9YB 3GLHE 4O1HA 3DVQX 3SDBA 1AF4A 2ZE8A 1A82A 1N77A 1G6Q1 3VKGA 1NW3A 4P33A 1AN9A 1G7RA 1D5CA 2H9AA 3QFTA 4N54A 4DV7B 1WB9A 3ESZA 3DNFA 3Q9UA 3LQKA 3OU6A 4UMEA 4C2AA 4L6AA 3PGKA 4XM1A 4BNNA 2TMYA 3PRKE 4DLWA 4AG6A 3D59A 3V8NA 4XEUA 2A9PA 5JY6A 1GA4A 3EQ9A 5J2TA 2FSSA 3EWNA 5CDSA 1OXVA 5HEKA 4KH1A 4ZA2A 1FLAA 3G2HA 3DBLA 1AQUA 3FNGA 1BQEA 4L2IA 4RVGA 3RC9A 4OU5A 2AMLA 5JAHA 4FMBB 4DDHA 1FS6A 2RGDA 2D4HA 2P68A 3F90A 1KDZA 1AKEA 4MPDA 4EHIA 4QFMA 4I14A 5CW1A 3OURA 1XVIA 2TRSB 1KAHA 1NF8A 1MO6A 1XMIA 3GLIA 4FT2A 3J81A 1GILA 1RI2A 1EUZA 4K3VA 1LPOA 1U7PA 3LDGA 3KR1A 5LZ7A 3RRNA 5HYVA 1QC5B 3PGJA 2PUWA 3GX1A 4S2UA 3VO8A 3COZA 1H6DA 1G291 4P5DA 3VA7A 3IUNA 3ANNA 4LF4B 1W29A 3RLFA 1M2GA 1R4MB 4ZVTA 4G1BA 1JPVA 5AI6A 1JZSA 3JD2A 1SCUA 3D2LA 4YDHB 1K6XA 1RMYA 2B83A 3E9YA 3KELA 4FIZA 4X20A 3W6ZA 5JDIA 4YTEA 4BO1A 1EEHA 1IIBA 1VBFA 2Y4OA 4NENB 4M1EA 4HZUB 1ZY2A 1E18A 4FKZA 4Y3UA 1C50A 5ES3A 4UTRA 1OD6A 2FJPA 2OLKA 2IBTA 5FBKA 1S0UA 1OTHA 3MB5A 1BDJA 1QWSA 4C0WA 1JIVA 4EI8A 1XCPA 5IKMA 1VE3A 2NTJA 3PJGA 5J2UB 5KNCA 2ID8A 3PHHA 2XXAB 4ZYZA 5L3VA 2PGLA 1F7VA 4C01A 2XECA 2CUKA 2ECPA 3L3BA 3GJ3A 4Q4HA 4WGFA 4C2BA 2NMVA 5AJTA 1V5IA 1I2AA 3WIDA 2WB2A 3NO4A 4JLMA 2W70A 4XDGA 3K6RA 3ZDRA 1PEKE 2DP4E 1O57A 4JI6B 4LC9A 5L53A 5TY0A 2ZUVA 3Q3EA 1E5QA 2HU2A 1RJGA 3DBHA 4Y1EA 4KW7A 3TIGA 4NATA 4NXMB 3FJ1A 5FPPA 5G1PA 3PJRA 3GG9A 3JSAA 1L4GA 4XSVA 2GYYA 2GJSA 3KE9A 3NTQA 3CONA 4V1CI 4YIHA 4LWQA 3ADDA 5F3WB 3K3PA 3GOQA 4QGHA 2PXAA 3SQDA 3VGPA 1W44A 2ZQ5A 4FFRA 3K0BA 3FPKA 4J16A 4WNAB 5EVJA 3MJSA 3SP1A 4NDNE 3P4YA 1QH1A 4IXMA 1J39A 1KBQA 2RCNA 1Y3CE 2R751 2OLEA 3NHKA 2OOKA 4R1PA 2AC4A 5DP2A 1Y7TA 3KB2A 4MW2A 1NLZA 5JC1A 3AB7A 3BIXA 1QRDA 4Q4JA 3DCJA 3S2ZA 5KQLA 3MGBA 4M0PA 4AAYA 2IEZA 1D8TA 2TMKA 2XCRB 3H83A 3FR8A 1ZGGA 3G8AA 5GGXA 1G5PA 2NUPA 3KR2A 3NCHA 3KUUA 1NW7A 1Y6GA 1QYWA 3CEAA 3A6JA 2VP0A 5ERYA 3WYBA 3KPWA 3AEKB 3IPAA 4C21A 4QPCA 1LH0A 4N12A 3DZ8A 1NR7A 4POOA 2QPAA 1PK9A 3UMVA 3L7JA 5EUQB 1E1MA 3N2NA 1HT0A 1ZH0A 5JFTA 1CQZA 4LRSB 3ESAA 3TEFA 2AMYA 2E48A 4EPWA 1F4PA 2HF8A 4F5WA 4A15A 3P2JA 1CUHA 3ACCA 3Q72A 2JH8A 4R8RA 1BRTA 4WZ6A 2HF2A 2O8NA 2NX2A 4JBIA 2WT4A 5EE0A 4LVUA 1P3JA 3WLNA 4P08A 3G1UA 1Z07A 3H1EA 1RI3A 3E7FA 2YWRA 2ZS9A 1QORA 1HNWB 3CTMA 5JT1A 1RKQA 2RHTA 2SICE 1GNRA 2ORED 2VYNA 4WK6A 3ZHBA 3FVQA 4M0UA 1EM8B 1HFEL 4BDTA 2B99A 3D6VA 1E6UA 3C7AA 4CTNA 4RPKA 1I3CA 4F0JA 3L4EA 1DJNA 1PJ4A 1W19A 2H7CA 3PHCA 3R5FA 4LVNA 4WLOA 5F5XA 3SJ7A 3SYRA 5JFGA 1FZTA 3C4JA 3QQ5A 3U7QA 3D02A 4OLFA 4QFCA 2O6LA 2YZ7A 5EMLA 1T4MA 2PWAA 3PFIA 3GLTA 2Y8EA 4N9QA 5SY4A 4PIPA 1E20A 4O1MA 1J8MF 4BU1A 3FPJA 3ZXUB 2Y68A 2R97A 1U8TA 3DFZA 2WWXA 2IP1A 2QVGA 1JAHA 4P7FA 2VRNA 3PEFA 2ZUBA 4TSFA 3VM6A 4DLKA 1RS0A 5IS2A 5FCDA 1B74A 4ZJPA 2WIBA 5F77A 5FTLA 3T4EA 2R9VA 1GJRA 4QDUA 4XOIA 1R0BA 2R5FA 4IJKA 1E2PA 4R1LA 3FUCA 2Z2ZA 2EW2A 1TQ6A 3AR7A 2WKWA 3OY7A 4PLVA 3GPDG 3VU1A 5LQUA 2REXB 3WWEA 2Y67A 2YTZA 4QUEA 2CMGA 4A0GA 5JJIA 2A84A 3LWDA 3OA0A 3RJZA 3TCKA 1WZEA 4L5CA 3BRSA 4R8SA 4ZK2A 3ICEA 2VBIA 3HP7A 2Z4RA 1US8B 2IF0A 1JHUA 4FGKA 4OV6B 2QGFA 4DA9A 3FYUC 1A9SA 3VGJA 3O8QB 1Q7EA 4CT5A 3GZNB 4MHOA 5EP2A 2CVZA 3BCSA 3FFTA 4B6PA 1TTQB 3AY7A 1T9CA 4F9FA 4I1SA 1QTNA 5D3MA 5E1BA 1GY8A 2IYSA 1ZK0A 3LX8A 4P0QB 2PD4A 2BIFA 1MXHA 4KVAA 2B8NA 4V39A 3H13A 1C1XA 2XDQB 4RPIA 1F2DA 4K03A 3TSAA 1SJ9A 2L17A 3FPEA 5EQFA 3WL7A 2XWPA 2O59A 1HTBA 2QRZA 3N3BC 3TFOA 1YRWA 1PJZA 3EAGA 1JIJA 3MJVA 5ALHA 3T3GA 5KOYA 1PFGA 4ENSA 3A0UA 2WU0A 3SWWA 3CLRD 1CF9A 1SVKA 4H4DA 4F8YA 2C92A 5C8DA 1OX6A 4B83A 1SMKA 2FG5A 2F55A 3EASA 3GEBA 1UM9A 1VBNA 1AV6A 3JQAD 1F2TA 4LCEA 4QBFA 3VMFA 3CVWA 5I9BA 1KY3A 4DSOA 4BOYA 3MCWA 2C97A 4C20A 2VPZA 5KNDD 3UMCA 4OXRA 3VH2A 2J30A 4TKVA 2XEXA 1HY3A 3K31A 3VR6H 3ON5A 2C2WA 5JPIA 2FUG6 4K05A 1XELA 3I5AA 4KR3A 4XVCA 1N5RA 3CZ5A 3E9NA 3SE7A 4Q39A 1U2DA 1L8XA 1E7WA 3WIBA 1AUPA 4MLZA 3H4MA 3H7IA 4J94A 2IXEA 1XOIA 4UU8A 3ROFA 2WWIA 3V4LA 2IPXA 1DHTA 1XKQA 2YR0A 4HAVA 2NW6A 5DBFA 4C5CA 3BIFA 4R9UC 1EE2A 4GECA 4OP1A 1G19A 4JI8B 3WLSA 4HUQA 4L8GA 2RH9B 1E9EA 1N0IA 1P60A 2RJOA 3QM1A 3V2IA 3AJAA 1H1TA 2E4ZA 2QQGA 3WIOA 3R4VA 2X5OA 1F60A 2YHSA 4I36A 1OAOA 1LEHA 3T99A 2P3OA 3AR3A 1YASA 1OXTA 2P2CA 1RAIA 2QJRA 3EYWA 4V0LA 1A9QA 1C9DB 4YJ2A 1SCJA 4YHHB 1LBIA 5IBPA 4KPEC 1I7QB 2HO5A 4AZVA 4I6GA 2P9YA 4E7OA 1II9A 4FE7A 1G2PA 3DBRA 3OUUA 4OQZA 4Y2UA 4CM6A 4Y2VA 1SWVA 3VR5D 2VP5A 3FWNA 1MB0A 1KOLA 3T7RA 4IHQA 4PZZA 4BO0A 4ALKA 1PWYE 1GFIA 4NQZA 4G4SP 3GLGE 2AR9A 4KQKA 4ERNA 3SM9A 2OZPA 2QX7A 1P4HA 2Z9BA 1CJKC 5DN9A 2R7NA 4MGIR 3TOVA 4D8WA 3A05A 1C3OA 3HCOA 1DELA 5C5DA 2ZIUB 5BVHB 1FFYA 3C6MA 3T1QA 4ER0A 3RBXA 4DLLA 3NHSA 1VE9A 5I01A 4EB3A 3EVGA 4FNAA 2EFJA 2GN2A 2HA7A 1KP9A 2L2QA 3HCCA 4F6LA 4YCCA 2QRUA 2XODA 3HC7A 1GQSA 2AN3A 3DMRA 3LPAA 1XROA 4MUIA 2H11A 1T2CA 3EXFA 2HDNB 3JR7A 3WP1B 5HZKA 3MAAC 2O3RA 4KEAA 3EGOA 3EXEB 4UE3S 4XLLA 5AHOA 3VX3A 4X45A 4Q03A 3DKKA 5BXYA 2H4YA 2ID7A 5EMHA 3RRJA 1RYFA 1HG0A 3OOSA 4XB1A 3ETJA 2NPOA 4KODA 4MV3A 5DLEA 2PUBA 1V1RB 4KWEA 5JVDB 4ND2A 3FMOB 2AOWA 1VM6A 2GLUA 3N1UA 1LTKA 4MVYA 3ZBUA 1VYTA 4RVCA 6PFKA 1ZUNB 1KZ1A 1WCXA 2BMVA 2VPYA 3KD2A 1P2FA 5AKLA 1Q20A 1K5DA 5B6IA 4Q9LA 3H2YA 1DCMA 3SF8B 4XLTA 1ZD8A 4O0LA 3FF1A 1J8QA 4XR4A 4HS9A 3ZY2A 3R3ZA 1KI1A 4M87A 1EFHA 3STHA 3JQBA 4KGXA 3M34A 3VR3D 5TB5A 1QX3A 4M60A 5FA5A 4CKBB 5CG1A 3E7PA 4OB8A 4XD7D 1OT3A 2RH8A 1BRMA 1UPUA 2R48A 4HPXB 5IMSA 3Q6NA 2W2LA 3P2MA 2BRUA 1BQ4A 1FFXB 4FWIB 1LDYA 5BURA 1G9TA 5K6TA 3OLQA 4HAYA 1P17A 4HUJA 4BE9A 4BXOA 1YUBA 3B6JA 3KKPA 3REQB 4URZR 3T5MA 3EAQA 4CIYA 5DHSA 5I7FA 1N78A 1T0JB 2R79A 4TZTA 5CLQA 3NIBA 1DQRA 2AF3C 1E2BA 3AEQA 3I05A 3Q3JB 3JRWA 4HP8A 5FT9A 3HVRA 1I94B 3V4SA 3QJ5A 2BFCB 3I9V1 1T8SA 2IWRA 1G2OA 1W0JD 3BOSA 3B3GA 3MWFA 3X2FA 4DRXB 2Q8QA 1O94D 3A4MA 3TI9A 4NE9A 4RFLA 4A6DA 3LUGA 3QJGA 3P0EA 4E1VA 1VFPA 4L1KA 4AN4A 3AW8A 5EWJA 1X9IA 2YNMC 3R3UA 3CVYA 4B3SB 2DQKA 3PYLA 4G24A 3CGGA 1VGRA 1YQDA 3UYLA 3MINB 1KC3A 4IQ8A 3S7ZA 1J8VA 5SZKB 4X41A 3QVJA 2Q5FA 3DYVA 1IXKA 3T4UA 4H1TA 2OLJA 4IJUA 1KXZA 4JJFA 4GRIA 5CXSA 4HFJA 4NNPA 3BK7A 1KI6B 5JH7A 4GLJA 2NNLD 1L5QA 3DOUA 3CRMA 3K2BA 1XZQA 1QYDA 2OENG 3N7AA 4FR2A 4C5BA 3PEYA 1NIPA 2D2IA 4RTQA 4CLRA 1YRBA 1A2BA 3FZNA 5K8LA 1QLWA 4M37A 4JU9A 5FOXA 5K51A 1SD1A 4IQGA 5K3AA 5DX8A 1C1HA 1TEZA 6CHYA 3FCCA 5A4JA 1J2YA 4AS3A 2BJHA 3CHYA 4IS2A 4LK3A 4BNVA 1SHTX 3A32A 5J4VA 1M76A 1E1DA 1UPTA 1YSCA 3C7CB 2GTHA 4FGLA 4DMFA 5H8WA 2GT1A 3P2OA 3T1OA 4G8BA 4PG7A 1H2FA 2R6FA 3RSFA 3WDSA 5CEFA 1JUDA 2QF7A 1H8HA 2PUJA 4JFAA 4IKOA 5FL7A 4ME6A 3EODA 1XD9A 1JHQA 1ESEA 2CMDA 4WTOA 2FOLA 4M7WA 5LIPA 2OWEA 4RLSA 5HG0A 2YC2C 3AJRA 1XZMA 2VK8A 8ATCA 1KZYC 2VYCA 2XW6A 3DTTA 4YJGA 4RA9A 4YYEA 3EGEA 4IDCA 4W1RA 1QPBA 2UYQA 3G9QA 1SU8A 4QWMA 4D9HA 2XUZA 3QFSA 2XNCA 2XZPA 4X1KB 4NMHA 4A2PA 3MTAA 1JKIA 2IZZA 3KL2A 1K7CA 4B79A 2VDJA 3VNBA 5AVSA 4WZBA 5F7OA 1R6TA 2X7JA 4Z0HO 2CLEB 2X9VA 5DV9A 2O3UA 4HDRB 1S9HA 3OFKA 1XXHB 4NAHA 4LX8A 5CVVA 3NBKA 1P4JA 3OHMA 2POCA 1FTWA 1DAEA 1ETUA 1QAOA 2D59A 4R6XA 4GXNA 5DGCA 3M1IA 3STWA 5BV2P 4AM8A 1XYVA 4LY9A 1NG1A 4QBHA