4HS4A

Crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
184
structure length
184
Chain Sequence
SPLHFVTLLGSLRKASFNAAVARALPEIAPEGIAITPLGSIGTFPHYSQDVQEEGFPAPVLTMAQQIATADAVVIVTPEYNYSVPGVLKNAIDWLSRVSPQPLAGKPVALVTASPGMIGGARAQNHLRQSLVFLDAYVLNRPEAMIGQVTGKVDAQTLELSDVATREFLARQLDALAALARTLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights of chromate and uranyl reduction by the NADPH-dependent FMN reductase, ChrR, from Gluconacetobacter hansenii
rcsb
source organism Gluconacetobacter hansenii
molecule tags Oxidoreductase
molecule keywords Chromate reductase
total genus 60
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hs4A00
3K20A 4ICIA 5LBTA 2BPOA 1JA0A 2FZVA 1FUEA 1D04A 1C7EA 1DX9A 3HA2A 3KLBA 3N3AC 3OWHA 2FLVA 4LTMA 3NHLA 1QHEA 4Y9UA 4U7FA 3ES9A 3OJXA 1AZLA 4YAFA 2AMJA 1J8QA 4HS4A 4HEQA 1YCHA 1NNI1 2Q9UA 4GQIA 4QOJA 4FGLA 2OYSA 1YCFA 4N9QA 3UXHA 4LTNA 2B3DA 3U7RA 1GG5A 4YAWA 4QOIA 1T0IA 1ZWKA 1J9EA 4PU0A 1OFVA 2D5IA 4CF6A 5LJLA 5F12A 5NULA 1X77A 4LAFA 3B6KA 1WSWA 3NHJA 4PTYA 1BVYF 4ZVKA 3W78A 3EYWA 4BMOB 1YDGA 2QX6A 1XYVA 3F2VA 4DILA 1YCGA 4D02A 3GAMA 2FCRA 3FX2A 3NFRA 1DXOA 4FGKA 4U7HA 3G5MA 2F1OA 1FLNA 3OVMA 5F51A 2ZKIA 3W79A 1AG9A 2OHIA 2Z9DA 2W5UA 3JSXA 2MTBA 1AKWA 3QE2A 2MT9A 3ESYA 4C0WA 1VMEA 1CZHA 3O73A 1FLVA 4LTDA 4DIKA 5FUQA 1V4BA 1CZRA 2QX4A 2Z9BA 1CZOA 3KEGA 3NHSA 2FZ5A 3KAQA 1J9ZA 1SG0A 2OHHA 2Z9CA 1DXQA 1FX1A 3ZHOA 2QMZA 3NLLA 4NLLA 3FW1A 1RTTA 1CZNA 3FVWA 2N1MA 3GFSA 1KBOA 3NHUA 5ULLA 3O2NA 2KQUA 2XODA 4N65A 5EMNA 2R96A 3RPEA 3HR4A 4YAUA 4N82A 2XOEA 3OX2A 4LA4A 1YRHA 3L9XA 3SVLA 1F4PA 1ZWLA 2R97A 3F6RA 1WSBA 1D4AA 1XI2A 2QWXA 3OWXA 5A4KA 1CZLA 3L9WA 1RCFA 3N3BC 3F6SA 3NHKA 2QR2A 4XDGA 3R6WA 5FX2A 4PTZA 1RLJA 1FTGA 3GFQA 3W77A 3EDOA 2QX8A 5NLLA 4OXXA 1AKVA 4C14A 4YQEA 1JA1A 2MWMA 4J8PA 1XYYA 3TE7A 3B6MA 1RLIA 3QFCA 3UXEA 3GFRA 4CETA 1C7FA 1OBVA 2ARKA 2KLBA 2RG1A 1AKRA 1AKTA 3B6JA 3B6IA 1AHNA 3LT5A 3OJWA 4NULA 2X2PA 3HLYA 4QOFA 1CZKA 1QR2A 1I1OA 4QOEA 4U7GA 4YAOA 2BF4A 2QMYA 2X2OA 2FVXA 4QOGA 5EA2A 4ESEA 5LBUA 1QBGA 1H69A 4S24A 2FDXA 2QX9A 5LMCA 5LVAA 4ZVNA 3NHPA 1TIKA 3D7NA 4YALA 3NHWA 4M0CA 3P0RA 1YKGA 3S2YA 4H6PA 1AKUA 1B1CA 4GR9A 1FLAA 1T5BA 2M6SA 3N39C 2OHJA 3W7AA 5TGZA 4ZVMA 4BMPB 1ZX1A 5B3KA 3FJOA 5FA6A 4QOHA 3K1YA 3TZBA 1J9GA 1FVXA 3KAPA 3QFRA 2Q62A 5LJIA 2A5LA 3U7IA 4H2DA 5B3LA 1KBQA 2BN4A 2FX2A 2V5VA 1FLDA 2FOXA 3OX3A 4C76A 1H66A 2HPVA 4Y9RA 3OX1A 1OBOA 2V9CA 1SQSA 3NHYA 1AKQA 1BU5A 2GSWA 1E5DA 3FNIA 4XDHA 4Y7CA 5F4BA 2M6RA 5LLDA 1XT6A 4ZVLA 2BMVA 3TEMA 4QODA 1YOBA 1QRDA 3NHRA 4R81A 1CZUA 2HNBA 3F90A 5EAIA 4C0XA 2HNAA 5JROA 4DY4A 4FGJA 1TLLA 2MOKA 3ESXA 2V5UA 3ESZA 5BUCA 1AMOA 2WC1A 3LCMA 2Z98A 2FAXA 6NULA 4FX2A 3NHFA 4F8YA 2BZSA 4GI5A 1D03A
chains in the Genus database with same CATH superfamily
4NY1A 4CMIB 2I55A 2HWKA 1AXEA 2XW6A 3MCVA 2G28A 1HFWA 4WXEA 4ZARA 1CQPA 1QP7A 1E4YA 4RD1A 1Y4ZA 2VK1A 1KDYA 5CA0F 1FXWF 2JJ8A 1MKYA 3R7SA 2P2CA 1NBIA 4QTXA 2HMVA 4I1VA 1ZL0A 2AZXA 3K6SA 5F5NA 5EFZA 3E7PA 4PRLA 1EFRA 5LM3A 3CT6A 4DYHA 4GYYA 3FDZA 3SOZA 1Y7LA 2CXNA 1SUCA 2PTGA 1PL7A 1NOKA 3KEQA 2CW5A 3OTGA 4N3CA 4CL0A 5CFMA 2ZB3A 5JMOA 3K0EA 5CIYA 5JI2E 4L16A 2GK4A 3KKPA 1ZS9A 1X77A 2I22A 4LX8A 2GKGA 2A9RA 1JH9A 5AK5A 3DV0B 2M9MA 2P9BA 1VL8A 4YRPA 1PYOA 2HSZA 4XWOA 4C08A 1M9NA 2JJ1D 3HB1A 4FGZA 1E4VA 4U6QA 1E7YA 1AG9A 1JAZA 1Z5NA 2E49A 3KCQA 5C1OA 2IBMA 1PTJC 2HU7A 4KLNA 3HH8A 1TOAA 3IHWA 4IGKA 1TAGA 2ZYRA 1OIXA 4JJIA 4MRPA 5JD3A 2QX4A 3D8BA 2BGGA 1M1ZA 2QG9A 2BKUA 5HKAA 1YL5A 4AJHA 4RIEA 3DMNA 3KHTA 4BB5A 4KMRA 4FDUA 1YGYA 3H2YA 3K3PA 3OKCA 1VKHA 4ZU6X 1I9GA 1VZ3A 4W5WA 3D3WA 2C04A 1SXJE 3PNBA 1EHIA 4GW3A 3GVHA 5GM2A 3M9LA 1LA2A 2F62A 3GYBA 4KFSA 3AR6A 3Q0TA 4DMLA 1BS9A 4UTNA 4XARA 1P1BA 1NYRA 2R68A 3I52A 4FNAA 1ORHA 4EPWA 3QX9A 2JGKA 2ZSUA 4M38A 2WJVA 3IPCA 2BEVB 1ZKMA 1WXWA 3TL3A 2RHHA 3WK4A 4NZOA 4CTKA 4U7DA 4N41A 1RADA 2Z4SA 3ZJUA 3QOYA 3VC3A 2CHUA 2QVCA 4JGIA 4JN6B 1M33A 2JF0A 2CZCA 4Y6LA 2DPHA 3UMSA 1XZBA 3IP3A 4Q37A 4UKDA 1A04A 4LNUA 3WGJA 2A1UA 1MPXA 2R6HA 5KDDA 1A8PA 2DR0A 1KDRA 3W1EA 2I9KA 2W8BA 1QBGA 1F06A 4TMZA 3VKWA 3IOEA 2RGXA 1PK9A 1PJRA 4BNGA 3U4MA 2I6TA 4TSKA 1Z74A 2NTYC 1I0LA 2ZWVA 1IZ9A 3LLSA 2VI5A 3N59A 2Y1LA 4PSVA 4XLTA 3MRTA 4JC0A 1YU9A 3H05A 4I9GA 2O2JA 1XELA 4D9HA 4FVTA 5K09A 1NG1A 1KHHA 4DARA 2QU8A 3AR8A 3VR5A 4AKSA 3HPRA 3ND9A 4Q7JB 2YHIA 2ZKLA 3P9RA 1NM5A 5HIMA 3R44A 3QLVA 3EEIA 3NNNA 3MWFA 3F1LA 4GM1A 3L02A 1YKFA 2QTMA 4FLMA 1EDOA 2I2CA 1T34A 4OG2A 4E4YA 2F43A 4RHUA 4AY6A 4IZHA 1ZJ6A 2FPLA 1YB5A 3TECE 4FJ2A 1X9HA 3RUHA 1JQBA 4YJGA 4DA7A 2MOKA 4BX3A 4KZKA 4MCIA 1HE8B 3NRCA 16PKA 2GEJA 4OL0A 4UTZA 2RHRA 5JO0A 5FWDA 3RRFA 4B7UA 1Q6YA 5JO9A 4UU8A 2MR6A 4FIDA 2JIOA 5BMOA 1KBZA 2DGDA 1Y0BA 2BEJA 2HJHA 1Z4QA 3QKRB 4ND3A 1PVVA 3IMEA 1B6RA 3RFCA 4DQLA 3HKCA 3LY7A 3UCEA 1T2VA 5FBVB 1U11A 4OK6A 4WZAB 1I3OA 5FO1A 5A1TA 4TKVA 3C43A 1XA4A 4PC7A 1YRLA 3KQNA 3IT0A 1JDZA 1Z17A 3VZBA 2G4VA 1XPJA 3WV5A 1MX9A 5A3RA 3A7EA 4H6XA 4OJNA 3HBFA 3F7TA 4M0EA 4O4LF 2WG2A 4A10A 4AO8A 2RG7A 2FEOA 3K0FA 3N8DA 2X9GA 1YJBA 3CLHA 4IHKA 4EP1A 4R0MA 2QDXA 3DCNA 3VPHA 1HT1E 3DXFA 3A8TA 1CUEA 1FNCA 2JFBA 3QUAA 5CVEA 1BOFA 3F46A 3SYNA 5IAEA 2JJ1A 4PX3A 1SPBS 1US8B 4Y6GB 3GLFB 2XUPA 5IMSA 5A3QA 2WG1A 3DC2A 3EB9A 3ESAA 3M82A 1XZDA 4AM8A 2I54A 2F8TA 4K81B 4E5NA 1RE1A 2HBYA 2YX1A 1EFVA 3BH0A 2O2YA 3U3MA 4TRRA 3PNPA 5F33A 4XWKA 1GYPA 2FWBA 1VG9B 2ABWA 3CLKA 2INGX 5EEGA 4HRVA 4R7GA 3X1KA 1HDGO 4BV3A 3BGWA 3NHUA 1NFQA 3G6KA 1X2BA 2H54A 4LE2A 4OU4A 4WZ6A 3JASB 1GGNA 4HJRA 2VF4X 4I46A 1EKXA 1T5DX 2B3TA 3E2PA 1Q16A 2OECA 3REQA 2Q1TA 1JL3A 3WLJA 4ZEMA 3FYCA 1RAHA 2OCYC 1QTIA 4UMFA 2ZRDA 1Z5UA 1V8OA 2B0CA 1GXSB 2IYFA 4EKDA 1CRZA 4C0JA 4QU8A 4JJ8A 1R4ZA 1SHZA 1GKUB 2IHYA 3GXBA 1QMPA 3VR6H 4RULA 2V65A 3EY9A 3OZFA 2OD7A 2EGUA 4A1OA 1T8TA 4YR9A 5IC6A 1SUDA 1V3TA 3N87A 1J5XA 4QBGB 3WP0A 2CNWA 3E9RA 3INNA 4PNZA 4H1VA 2X2OA 5AICA 5E9AA 5SY9A 4BKOA 4EENA 3JZAA 4AS3A 5HZMA 1G21E 2Q2QA 3JSAA 5G3ZA 4NFLA 3TW8A 1KKMA 3OZIA 4GBJA 4KXQA 4KSCA 4ZVNA 4LNUB 3VR2D 4F2HA 1AN9A 3B3GA 4HNUA 5AI5A 3T5TA 1ZMXA 5CM2Z 2WPDA 1Y5LA 2ZQYA 3OF5A 3RC2A 1W36D 2B1QA 5IBRA 1FXSA 4Q3EA 4D0NA 1GLGA 4IJWA 2ZBUA 5CA0A 4P4TA 1QOZA 4NMWA 1OZGA 2XKAA 1BXRB 2VAMA 3QNWA 5J58A 1GSOA 4GP9A 1X1EA 5BNFA 3DFFA 4K9PA 2XWSA 1LRKA 1MGPA 1RHRA 2DCUA 2IVZA 4KPYA 3OMXA 1KQOA 1RAAA 4JC5A 2X4LA 4UBLA 1U0SY 1WNTA 3HHEA 4K9LA 5EJ2A 4UVIA 5KSZA 5BV8A 3KE9A 2W00A 1LPOA 3AEKB 1XRPA 4G5FA 3OQHA 1YH3A 3F90A 4W1RA 4B82A 3AM1A 3Q7PA 1UAAA 3IAXA 1SZCA 3LPMA 2VNSA 2A0XA 3JQ7B 4GXQA 4KV9A 4L7VA 4WN9A 4CF5A 1V8PA 2G1UA 4AIIA 1JEQA 5BY2A 1U0EA 4ECAA 5ITWA 4MI6A 3WA6A 1ECJA 1MNQA 4U2BA 1EJ6A 1Y5IA 3CEAA 3VU0A 2AFHE 3QX7A 1GXSA 4PFJA 4PZAA 1GRVA 4RY9A 3U3DA 3V48A 3KWMA 3LLMA 2ZLBA 4LRWA 1NR1A 3I4CA 1FP7A 2Q6OA 1U7ZA 3NC0C 4ZPJA 4EW1A 2Q3EA 4URXR 4POOA 4JI2B 3V9AA 3RV3A 1BX1A 1H6AA 2PZBA 2ZJ7A 4FGLA 4H7DA 1U1FA 1VE5A 3B9RA 3ABQB 3EQ7A 4IWYA 4EFDA 3G2OA 1I80A 1XMPA 2X76A 3B2NA 5BSFA 4JYAB 4L6CA 4NYIR 3WQBA 3OA2A 4E1VA 4JLKA 4W9MC 3PEFA 4LNAA 2PRSA 1SXJA 1T3TA 4IFIA 3QNMA 2IY8A 2XMQA 4KQEA 1QUFA 3WZMA 3A1FA 2VHTA 3LY8A 1OFUX 3OKFA 3IUMA 3GG9A 4O5OA 4FGKA 3SN6A 4MRAA 5AVKA 1SCQA 4C3VA 3ONVA 3O8CA 5CK4A 5G2OA 1PWHA 2GRJA 1ABEA 1W88B 4QPCA 4A1FA 3MF4A 5BXYA 2RBGA 3ZHXA 1VGVA 1F8XA 3AXTA 4I99A 7REQB 3OT1A 4JT2A 3QOXA 3UV7A 3ZXXA 4MDEA 3RRMA 3A9RA 2OGZA 3ZVMA 1VB3A 5DK6A 2Q4BA 1Z22A 1Y48E 3L1JA 3VUEA 3AR9A 1E6UA 2P7HA 2V4ZA 4MKRA 3ZK9A 1GZHB 3KSMA 4O4LA 3ZLBA 1UOOA 4BFZA 1IZ0A 1WSBA 5EJIA 3AIMA 4MSUA 1VLQA 2O7NA 1CKEA 1R8XA 2YV1A 3BXEA 2YDXA 1CK4A 1N2JA 3IOBA 3ZCQA 1M1YE 3KT0A 1XWFA 3NBQA 1ULTA 2K5UA 1USWA 2RGDA 3E84A 5IN5A 2ONZA 2Y1KA 2YXLA 4YJ2F 3CT4A 4WKOA 1NLYA 1VPEA 4LFCB 2WG0A 3I45A 1PUXA 4HEA6 1HO3A 3E22A 3ITEA 3JQQA 5CD9A 1U9IC 2WKSA 2E9SA 4YCAA 4S1NA 5DYNA 4IDFA 4DTIA 4M6WA 5DTQA 1I0ZA 3ZWBA 1AB5A 3HU1A 4YRSA 1JXMA 3EJ6A 3GGGA 1XB2A 1PJAA 4HBGA 4MRRA 2EFYA 4BZPA 1DWPA 2B7BA 2W48A 3LHDA 1TEVA 1W44A 4U2CA 4X91A 4YCBA 1OFGA 1H93A 1U31A 1O0CA 2EFEB 3A36A 5T6MA 4QZVA 3OF3A 4ARUA 1A5AB 5JARA 2AB0A 1RPTA 3NBFA 1YQGA 1DPGA 3Q98A 4LHVA 3MJDA 2A4KA 1UBFA 2W22A 2VNHA 3DEHA 5LQDA 5KYYB 5HM8A 1MQSA 1TI7A 5D87A 3HYSA 3T0GA 3AIKA 4AMGA 1IJEA 3PYMA 4EHBA 5BNWA 2VATA 3A1NA 3NOOA 4BASA 4LZJA 1KTIA 4GKKB 1ZN7A 1I32A 2HBZA 1IDOA 1E7SA 3ZE7A 1T43A 2WRZA 3EVEA 1CEQA 3OEHD 4TWBA 1FU8A 5TRTA 3R9XA 4CMEC 1SBHA 4ZYVA 5BQ5A 2MINA 2VJLA 3PR1A 2D1YA 3SZOA 4NV3A 4NIMA 4AJ9A 4Z1MD 1NVGA 3AQ4A 3GEBA 4RTSA 4LF7B 3IFSA 4AO7A 4AKGA 1M7GA 1TUIA 2R7MA 3R77A 3DFKA 4U9HS 1NAIA 3FOBA 5JZVA 2I87A 4OJKA 3UH1A 3D5QA 3V2UA 3OSZA 5ICCA 4II7A 1O54A 4KG7A 1XDUA 4NENB 3DE4X 2AG1A 3GRPA 4JBXA 1R8SA 1T2EA 1KU0A 1XFAA 3HUEA 1HZZC 2ZTVA 3DF7A 4OIFA 2E37A 4HO1X 3UFBA 4INPA 3PDHA 5LUAA 4X41A 5ILGA 4B8ZA 1U04A 2Q9AA 5AOAA 1BYUA 3IAHA 3R20A 3CWQA 1KO7A 2WU3A 1CJUC 3RTDA 3RAFC 1C3JA 5U4QA 3LKBA 3NG1A 2F4VB 2WF6A 3GJ8A 4HBZA 4RELA 3R3HA 1GG8A 4MZXA 1EX7A 1LY1A 3HWSA 3GOHA 3RO7A 2NTVA 4H3HB 4U7JA 1NBOA 2BISA 4EG8A 1JHPA 2WE8A 1IXRC 2FN4A 3K92A 2X3FA 5M34A 2D2EA 2VFAA 1DUSA 3AYZB 1MDBA 3PWKA 3FCAA 4FOPA 5H8WA 4CKEB 5GJCA 1G0NA 5CPFA 5FBRB 3IC5A 1JB1A 1BWPA 4I1RA 1QCDA 5BSTA 4B3BA 2QMZA 4XCVA 1GNVA 1SA0B 3LY9A 2ZWAA 1R6XA 3UAWA 1KBOA 4MW4A 3RYHB 3S2GA 3PBKA 3AR3A 5CMLA 5AFSA 1N2OA 2BGRA 2QTBA 3H18A 1T0BA 3LDUA 1XALA 5AOVA 5BQXA 2X5OA 4L5BA 1E6LA 1DAHA 4BFYA 4OFZA 2MMGA 3ZDCA 2WJYA 3THXB 1JILA 1D7AA 4DT1B 5K3BA 1XVTA 1U9ZA 1H9AA 2J7KA 3GZTB 1XU7A 1JHOA 4NV0A 3X1XA 3Q3JB 4LVNA 3M6XA 4RPIA 4D4KA 5DVZA 1OPRA 2G3YA 1PAUA 2I4NA 2RGWA 1YJQA 4ZMBA 1PQUA 3F98A 1FMFA 3EXIA 3ZVKA 1I13A 2E3JA 2F4NA 4NBLA 4XD7A 4KQMA 4BLTA 1CJVC 3I61A 1CZKA 1JR4A 1GR0A 2LKDA 3WLRA 1NFRA 2ZBVA 1BTOA 1HGXA 4RANA 1SOVA 1FFHA 3QLJA 1DI0A 1BVHA 1P1CA 3L1IA 4HADA 5HRAA 5IT4A 5I9NA 3GFOA 2Z0MA 4H6PA 4AMYA 1YRWA 4CLDA 4Y2VA 1C41A 3B12A 3HVKA 4QJ5A 4EGAA 2WUWE 1K9VF 5ALWA 2XAAA 3LWDA 4KXFB 1T5HX 5ALPA 5B3KA 2PT9A 1NMQA 5I47A 5KZMB 5C32A 3KQUA 3IUEA 3PGJA 4F85A 4MQEA 3EBOA 1OFIA 2IZ0A 1AUOA 3R75A 3SS9X 4A0HA 3LUAA 5LXTB 4S0ZA 1UM9B 5A2GA 1RWOA 3FGNA 1M5TA 1V7ZA 3IGFA 3LY5A 5E6RA 2FW7A 2FPGB 4BLUA 1P45A 3TIGA 1KJ8A 3D3EA 3DLTA 4OLFA 2K87A 1SB9A 4TVOA 3QKTA 1QQ7A 3VR3D 1CUGA 5EIHA 2UVPB 3LXRA 3QU2A 1R18A 1G20A 1C0PA 2IIVA 4G26A 3UC9A 1F7VA 5ALNA 2CCGA 2E4WA 3LWBA 4LXQA 3WLHA 3OT1B 4B34A 3FLAA 3QEMA 1DB3A 1E20A 3O9MA 4L6IA 3A6ZA 4EYGA 3D0KA 2PL3A 3IESA 3KKOA 4IV0A 4NV1A 3C3WA 4JIMA 4XLZA 4NONA 4BDSA 1W36B 1IBLB 4KDEA 1VXRA 5KJEA 2Q5QA 4E2FA 3LVQE 1Y5RA 3BFPA 3S2SA 3IPRA 3NB0A 3WQRA 4ND8A 1Q7TA 3I34X 1B14A 1DADA 3JATB 1N0WA 1TECE 2YYAA 3KJHA 4KC0A 1E0SA 2HA5A 4WW0A 5HGXA 1CY2A 3SIWA 1SHKA 3FNGA 4LMAA 3KSDO 2FHSA 4YUVA 3R4VA 3V6MA 3RYIA 3S2FA 1JYFA 1Y4AE 4MEJA 3GRCA 2W2KA 5ANRB 5HVNA 5K20A 3NOVA 5IG2A 2XRMA 3I01M 3AOEA 3F4BA 3OIUA 3IERA 5TXGA 1L5VA 3AY7A 4C4XA 2E1RA 3W79A 1DKMA 1MJFA 2G1AA 4RJLA 4RZIA 1M5UA 3JWEA 2HKIA 4JB0A 2XNDA 3E48A 1ITZA 3FLMA 2XUDA 4LRUA 3SDZA 4AZWA 3V4RA 4EYQA 1T1JA 2D06A 3P26A 3ASUA 4U00A 4OXYA 3AVVA 3RUIA 1GQYA 3SDSA 4ECEA 1QPZA 3A6FA 3OX4A 1VGRA 1E66A 4DNQA 4CKBB 4WTOA 2RCYA 3SC3A 2V54A 3FVWA 4MUXA 1U28A 3AHCA 3FYUB 1DBSA 2IPLA 3H4TA 4PO9A 3HWWA 3QVVA 1FVHA 4JWTA 2Q99A 4WLUA 2VS1A 3ULKA 4CV0A 2Y9MB 4ODIA 1W4CA 3DFZA 1N4DA 3EXHA 1XTBA 3G59A 3UT5A 4GI3A 3T5CA 2IUTA 1WPGA 3RARA 4G0NA 1Y6JA 4XIFA 4XWGA 1CB7A 5ER9A 3PUVA 3FMFA 3CVWA 3DWIA 1MR3F 2ZJ3A 1C1YA 2WZBA 5DGXA 1MORA 1X80A 3EUAA 1XR3A 3L0BA 4HTFB 1NGSA 1P3DA 2IOHA 1BXZA 2QY6A 2VHUA 2IFTA 2A1IA 3KFVA 4K9QA 2VJBA 4ENSA 1VB5A 4QU5A 1JLLB 5KO2A 1ORVA 1QRSA 5DTRA 4MV6A 4GSKA 4PPQA 3EG5A 3LLUA 5B30A 5B2FA 4HGPA 4ZTBA 2XNDD 4P31A 2YRFA 1NRIA 1QM5A 3RU9A 2EZTA 1MN6A 4JFAA 1K8XB 3D7NA 3HSSA 2I9PA 3DBLB 3QXSA 4ZMSA 3FPEA 4HRAA 3ORFA 3PPYA 3GLIB 4QO7A 1YVRA 4F4FA 1DQRA 2YBEA 1D6NA 3L7BA 1IN4A 3V8VA 4M7PA 1QHFA 1GCIA 1TIBA 2BHSA 4Y2UA 1ZN9A 4TT8A 2CHEA 2O2CA 3UOAB 4F1WA 2OWEA 4W9RA 3DOUA 3F74A 2UAGA 4PZPA 3WO0A 2XUZA 2RDMA 1N2SA 4WERA 1Q3TA 2QL9A 3T3OA 4TQ9A 1AF7A 2V58A 4N0MA 4PW0A 1F2UA 1II0A 3DW3X 4WEOA 2P3QA 4DS3A 1KETA 2HT6A 4TMKA 2P2DA 1FRQA 2AOTB 1N5DA 2C9CA 4YACA 2O8CB 4EF4A 4EW6A 4A8PA 1P5JA 2A14A 3VZPA 4M46A 3WGNA 5BWCA 1QO0D 1OB5A 1KZGB 3WQSB 2H17A 2XUKA 3BB3A 1E8MA 1D03A 1ZMBA 1E2QA 4EY3A 3ZBUA 1CUWA 4F9TA 4G0ZA 4YJKA 5IBCA 4IXNA 1VQ1A 3G7NA 4K9DA 5DLDA 3BMQA 1EP9A 2QS9A 1UT8A 4JI8B 1ORIA 2AOUB 1ZN2A 1KQ3A 2F48A 3G8CA 4X85A 1F2VA 1UMBB 3TBFA 1X3SA 4LE1A 3M3HA 1H42A 2ZBQA 5AJZA 1E79D 2OCDA 5A3VA 1EAYA 4Y2JA 3SBDA 3A4LA 3GPCA 1QVRA 2DQZA 2R65A 3FPFA 1GG5A 4E12A 3S5UA 4AY4A 4BWVA 2VTBA 5IJXA 2OQVA 2P4UA 1X7GA 2J3DA 2CLCX 2NX2A 3A6KA 3OCXA 1AX9A 3ORHA 4F0JA 1YVUA 1IHXA 4WBNF 2H51A 3ZLVA 4B2LA 4ZOCA 4AYTA 1J8VA 5JJCA 1SCUA 2CCKA 3B13B 1CJMA 2WKRA 3EVZA 4PANA 3DZHA 1WDMA 3LWNA 4MV7A 4DR5B 1YB1A 5JQGB 2D1RA 2NU6A 4JR1A 4KVZA 2CNNA 3WYAA 4F3NA 5FUQA 4WNIA 3QWFA 2HDWA 4CE6A 3HXPA 2ZI9A 4M6WB 1KIAA 2PT5A 4OBEA 2TSYB 1DJNA 4CCAA 3SIPA 4KYUA 2OAGA 1DXQA 3MGBA 2O07A 4W7IA 3ZHZA 1PF7E 1OZHA 1CZNA 1T2UA 4HEJA 5CLIA 1KS2A 1U1EA 3IAEA 4HATA 1SC6A 2WV9A 3CNEA 5CEJA 3RVLA 3OFVA 4DRXB 4GVPA 4HC4A 3KQLA 2FQYA 5E4FA 3QG1A 1SVUA 3CR7A 3HKEB 3FRIA 4YP5A 2HREA 1XI2A 2JEZA 3ZW9A 2DYKA 1UFRA 2JH9A 1YF3A 3TTYA 3UQZA 3PC6A 3UM9A 4L5CA 4BJ3A 3PENA 4GOND 2ORIA 2HK7A 5GONB 5SYNA 3Q7QA 4ER0A 3T1YB 3PZBA 4UE2A 4Q05A 5E6RB 2JFNA 1H5NA 1E9DA 1IRXA 1A4UA 4CFYA 1ODTC 2PKQP 2PGIA 2XKJE 3GFRA 4E5UA 1M10A 3ENQA 1JKXA 3E58A 4K6CA 4DSOA 2RI0A 4GVLA 4UPVA 4BMNA 4O4IB 2V7VA 1RD4A 1EFPA 3MUNA 2BJWA 1G5TA 2BF4A 1II8B 2KSQA 4ANFA 1QKJA 1IY8A 1IAQA 2BCEA 4Z8YA 3T1VA 4BKUA 1TYZA 2ASVA 1C8LA 1WULS 1QGYA 1GPYA 1ZLXA 5GV8A 5K3FB 3GRKA 1K3TA 4RS3A 3VH2A 3OE1A 4BP9A 4MVCA 2H9AA 3V6LA 5TGZA 1YI1A 2CYBA 2GO1A 2REOA 4RH0A 5FBQB 3MWKA 1ISJA 3U26A 1XQVA 3H3XA 1H8HA 1N2CA 1PN3A 2WFAA 4BNJA 3E7FA 4DWVA 4OPMA 3HE3A 1KBQA 1CERA 5CYOA 3BCRA 2RJ3A 1LWNA 1M8GA 4QPPA 2YWDA 1XWIA 3WKDA 2WYVA 3G9XA 2GZRA 3AB7A 4J03A 2EX0A 4BXOB 2JFZA 3R7LA 3T1HB 1BGXT 1DV1A 1N57A 3W3AD 1KORA 3MT8A 1MNAA 5LD2C 1GM5A 5DHSA 4BU0A 3FPHA 4KQGA 4RO0A 1LK5A 4QFBA 4G23A 5BT8A 2Y1EA 2Y9PB 3L41A 4I4TF 1VM6A 4MVWA 1P9LA 3CY6A 3ZE6A 3S8EA 1KVUA 1V6CA 2BHTA 5IK2D 4RHXA 1U8YA 3I2JA 4HZUA 4BNMA 4Z0TA 4HWPA 3T35A 2XGJA 3PA8A 1V8ZA 1OTHA 2QD4A 5DCYA 4ZMRA 3U7QA 3Q9LA 2AXQA 2BGUA 3GLSA 3CUKA 2QBYA 3UMRA 1YCFA 3FHTA 2QMHA 2VJPA 1PZNA 3E8MA 3KLNA 2QIOA 4BQIA 1KXJA 5K01A 2GN1A 1UBSB 1GKKA 3G49A 4UPDA 4GU5A 1NVDA 3TF5A 1Z6TA 3AHFA 1FSFA 4U7WA 2AG6A 5AVXA 2X7XA 5LZ5A 4S3MA 4DMKA 1T9HA 2YZNA 1FFXA 2PS9A 2FQ1A 3DTTA 1QOQB 3KXIA 1VP9A 1DXYA 2J30A 1SC4A 3QBDA 1JJVA 3W6NA 1K5HA 2P2GA 4KQ6A 3LUPA 2R6AA 2P4SA 1PL8A 4OP2A 4U3JA 4YI5A 5IP5A 4QJIA 4LVOA 3FRJA 4O1HA 4RZSA 4MPDA 4NU6A 1FFAA 5JANA 1WCYA 2GS9A 1R66A 3OESA 1A97A 5EJFA 3LQYA 2W58A 5FUWA 2Z2XA 2X1HA 2QTVA 1CRPA 1I1QB 1GUAA 3FBTA 3FTQA 4WZBB 2AC4A 1W94A 1MVNA 2VJDA 621PA 5EZQA 4B33A 3MFQA 3DDUA 2IYAA 1BA3A 1JG4A 4YIHA 1LSOA 1YK0A 2ZSFA 4CKCA 5EVJA 2BM8A 3WC4A 4BMYA 1S8AA 2DWUA 2FMIA 3VJRA 4EFMA 2B30A 5DTJA 4DMRA 2FX5A 4ESVA 3H2GA 2B4RO 2E5FA 3HJHA 4PEVA 1ZVVA 1MRNA 1A9XA 3WKCA 1V4VA 4BO0A 4EELA 3LSYA 3SS7X 4P4UA 5AK0A 3RTBA 1WUKS 3T61A 2FR8A 2VXCA 1Q0ZA 2BUAA 3W34A 1MHTA 4YV2A 3IDOA 1H2AS 3QW2A 3GEPA 1ZCJA 4HXGA 3BIJA 4X3PA 2O6HA 5HFAA 3X2EA 2CL0X 3QP9A 4O63O 2OR3A 3IVCA 3DZIA 4UNNA 1P2GA 5AD1A 4KK4A 5L3SB 2VDNB 4UDXX 1N8SA 2CE2X 1RHKA 1UINA 2NNLD 3ZK7A 1KARA 2BMEA 1I1OA 2NVOA 5DU2A 2FWIA 1ZEMA 1Z8NA 2VYND 4FFRA 4BY9E 1E8DA 4OKIA 2OZKA 1TX4B 1Z0DA 5I4IA 2QMQA 2JLSA 3JW8A 3CVJA 3LHSA 4LXYA 1AM4D 4PG4A 2H8KA 5DXFA 3TQHA 1JSRA 3VPBA 3MJRA 5ITSA 3V1KA 3BXGA 1BE1A 1TJ4A 3I62A 1A95A 2ZB8A 4GWKA 3JWGA 5DM2A 1L5SA 4YRIA 2C20A 3O8DA 2HHCA 4LF8B 2PL1A 1XEAA 2OV6A 2A5LA 2GFQA 2Q5JA 1UPTA 3LHFA 4K6HA 3B38A 4HDSA 4M87A 4X54A 1D6SA 2VZEA 3ZGZA 1ZN8A 2VCEA 2AR9A 1ULAA 3BSYA 1DOHA 3H9CA 3P7MA 4IGAA 1WCV1 5GGYA 1A8HA 1DO2A 4IIJA 4O59O 3Q7EA 4EY7A 5B5SA 4ZI7A 1KJNA 2NSHA 2XDQA 4G5RA 2QSUA 4YJHA 2LCFA 1MAUA 1VLJA 5DPMA 3MPOA 4F6RA 2Y1GA 4C0SA 3OIWA 1NY6A 4MWGA 4TWAA 2UYYA 1OR8A 3HKDA 2EKBA 4O1MA 4PYKA 4V38A 5IUKC 3GLHE 1K7SN 4IRUB 1SXJC 1TU4A 3O8BA 2XXAA 3VAAA 3KDSE 5EXDA 3IIMA 3UAVA 1DX9A 2XUIA 4BO1A 2FB9A 2VPQA 4X8HA 4FMCF 3PX2A 1JTFA 2BI7A 2J9FA 2WJ4A 3GGPA 4AY2A 5AKIA 1X38A 1N9ZA 4X5OA 4DCJA 1IZ7A 1K6JA 3FZEA 4BFTA 4X24A 1YB6A 4LVCA 3HGMA 3PE6A 4MIYA 2HRRA 2PV7A 3HR7A 4ZRNA 1OKKD 2ZT6A 3CJRA 1FFDA 3FCEA 4U9UA 2HXGA 4Q9JA 3ROFA 1QCZA 3T7EA 4HWRA 4BQPA 3QX3A 2PO7A 3ZIAA 1K92A 2VUIB 3CLUD 4EQZA 2REQA 3NNSA 4J0GA 3A4IA 3NGXA 1PZGA 2B5VA 2W0MA 3QOWA 4PXYA 1HE2A 2NU8B 4D8TA 3QBVA 4TGLA 2AYXA 2FR8C 2ATCA 4ROTA 1UZNA 4C4PA 2AN1A 1H2RS 3SCZA 4HD8A 2Z9BA 4DUGD 3PQDA 1R0KA 4NEGA 1YTUA 2I2BA 1J99A 3IQDB 4QXQA 4MRSA 1SVSA 3QXXA 4FEGA 1JG6A 4NCJA 2DSTA 1KQNA 1WW2A 2ID4A 4M8IA 1TO6A 1JQKA 4QICA 5FPYA 3OEHA 3W5JA 3LXXA 3IIIA 3ZHRA 1QGUB 3RCBA 4I7EA 3OLXA 4JI5B 4JQZA 2KM1A 1RPJA 4YJHB 5EMLA 9ABPA 1SVOA 3COVA 2IUFA 3C3MA 4S04A 2IOFK 1BGWA 2JGNA 3ZNPA 1NONA 2C7BA 1RYDA 2P9QA 3FTDA 5C34B 1Z2PX 1QSGA 2P2NA 4MWOA 3QKSA 4MR8B 4OA5A 4H6VA 1LK7A 1V45E 4HK4A 2VQ3A 4TRNA 5DXJA 2WSIA 3U62A 3I9NA 2IQIA 2DLCX 3RRYA 1ECGA 4BB9A 4C6RA 5GINE 4X1IB 3ENWA 4DJDC 2IYLD 1JIUA 2JARA 3JQGB 4LCEA 1P3JA 4RD4A 4NHEA 2OHFA 4PZZA 5FNZA 2NAPA 3OPYB 5KYUA 1I5RA 1BKSB 2WB2A 2RMKA 3MIIA 3OLYA 2O8FA 4HQKA 2HXSA 4OA8A 2VSOA 4YAOA 2GD1O 2KHZA 4ZJYA 5FJJA 3LOQA 5IVKA 4MKZA 3KV3O 3N2GB 1BA2A 4URUR 1Q3KA 3ZCXA 1EX9A 4LBVA 2C9OA 3OCYA 4J3NA 3W5AA 4FC6A 1T15A 2BJVA 2J9ZB 2PMKA 3DXZA 4PSKA 4RHYA 2EW8A 4C3ZA 4C07A 4B3MB 3TVTA 1EQAA 2JGEA 3O3MB 3SKVA 3PUIA 4JI3B 4NYMR 2I65A 2YJ3A 5HIKA 5FWXB 5JZMA 3LT4A 3SM9A 1PK7A 3RHFA 4B3SB 5TQ2A 1H66A 3GGDA 3HCCA 3DLHA 4Q1EA 3C98A 3U4HA 4L3VA 1H6DA 4UCQA 1P0CA 1TA0A 2YJ5A 3NATA 5FCDA 1YR3A 1D2CA 3F5DA 4RA6A 4A2QA 1A8IA 3AVYA 4QYMA 1SIUA 2HO5A 3TEMA 4OAPA 1YL6A 3TGWA 1RXWA 4M1TA 5H82A 1U3WA 3WOHA 4ZTZB 1XZNA 4UVGA 1DDIA 4UQOA 1G20B 5FOTA 1R5BA 1ZGZA 3E35A 4G8CA 2Y2VA 4CDMA 2Q9BA 4LBYA 2Q2NA 2ZYHA 4PS0A 1YRQA 3CVXA 2XB4A 3CWZA 3PXBA 4P0PB 1NNEA 2ST1A 3CQ9A 1N33B 3LUBA 4NDAA 3T4UA 2H2FA 1BS2A 2J4CA 3F3YA 3ROTA 5AJWA 5FL3A 4DYVA 1JN0A 4KO3S 2ZJOA 3U17A 3JQBA 4Q19A 1F5NA 3EZYA 4L0QA 2PCLA 1QE3A 2V7TA 4BLWA 4U1RA 3ENZA 3FCUB 4UXJA 2GAJA 4H4DA 2I5PO 4ZEVA 3EPLA 2X58A 4O2BF 3KR1A 4PLZA 1XZ8A 2X0EA 1TKCA 4RM3A 4EVIA 2F3TA 4QO8A 3P0IA 2X6QA 2FZ4A 1ZUNA 3QH4A 1V8FA 3MINA 2FRXA 4R5HA 4QUKA 3JALB 3AFNA 1EUDB 1K6IA 1SVIA 4G8BA 4YXWA 1FTSA 2JFYA 3MOIA 3NJ8A 3U4AA 4BFSA 4CKWB 1XLTA 1R4MB 1U1CA 1YJ5A 1R4NB 1ZI8A 3BCHA 4ZOLB 3ZI7A 3I23A 1QH1A 5T6BA 3O5AA 1VMEA 4KK3A 2V97A 2Y1FA 2MSNA 5JHHB 4WOBA 4B6JA 1JXQA 3S40A 1SCAA 4FLFA 3AY0A 1J9ZA 1E4EB 2VHWA 2VT7A 4HAWA 1KRXA 4EAAA 5BMVA 1AMUA 4CQMB 4WLVA 2HL6A 3TLEA 1E63A 2FUG6 3OHSX 2YVLA 2JK1A 3JQFC 4N65A 3E53A 3LKZA 3ZHYA 3T9EA 2QXYA 3G2PA 3OPVA 4TM8A 4X8MA 5I7OA 1S2LA 4QAQA 2ZIXA 2PDAA 2ZETA 2OEPA 2VYVD 2PYZA 3EA0A 4A8JB 4YR7A 1BE0A 3E0QA 3LV8A 1G8GA 1S0UA 1AHIA 1M6EX 5FIUA 4UAGA 4UUPA 4GBGA 1L4BA 3UT6A 3ONWA 5DN6D 1XMXA 2AUMA 3G5AA 1SKAA 3ND7A 3A04A 1B0UA 2P3OA 2QAGC 1Z4KA 10MHA 2GLTA 2AF4C 1KZYC 4ZP1A 5FAXA 1Z08A 1Y98A 1J42A 4JVOA 5A62A 1G5PA 3OD1A 2QRQA 3BSFA 3HWRA 2I99A 1BW9A 3AHJA 3O7MA 3PNSA 1SKQA 2WMDA 4A5SA 4CEIB 1MGOA 2C2GA 2WSSD 2X4IA 3OY2A 1H5UA 1Z4OA 1WTAA 1WOYA 3LD9A 3FMGA 4QWWA 2P68A 1N78A 3WGMA 3PC7A 5A7FA 3G6WA 4KITB 4B40A 1CUSA 1DQPA 1YR9A 3TTVA 2YWGA 4O25A 1FSZA 2H00A 1YS4A 1G6Q1 3L0PA 2PRYA 1IY0A 3LK6A 2VHJA 1M34E 5J43A 1URPA 3OC6A 3RS5A 3D1VA 4GR9A 3FWKA 5LDHA 3KELA 4D3FA 2OGUA 1X70A 1WMDA 1CYDA 4D25A 1GDDA 1RMQA 1TMGE 3PSAA 1XLTC 4G25A 1YZLA 1O6GA 1ECCA 1U7XA 2HLPA 2MSLA 3P2IA 4IGEA 4ETIA 1BU5A 3AG5A 4R1NA 2GJ8A 2XAUA 1W47A 2JNWA 4Y7CA 5HKLA 1XT6A 1Y42X 2IGTA 3BFXA 4OMDA 3ZY3A 4RTLA 1K68A 9ATCA 5KQRA 4YCJA 1JG1A 4IIUA 5A5GA 3WK8A 5T7BA 1C29B 1KK3A 2FMTA 2D0OB 2NUAB 4LC0A 1FFSA 2C00A 2WINI 1YZVA 4J0HA 3U56A 1JDTA 2ZIXB 1QG2A 1WUYA 3WOVA 4HZGA 5J40A 3T5GA 1VHTA 2YV5A 1Z6AA 1PE0A 4BGDA 2EATA 2H1WA 2V5AA 4ZYLA 3AZOA 1Z2NX 2HH9A 2POCA 1WMAA 3A1VA 2O05A 2VJAA 4E7PA 2EOAA 1ECPA 4JS0A 1Z7YA 4Z49A 1HFKA 5BWOA 3ZTTA 1Z13A 4CFZA 1TVKB 4OXQA 3NTLA 1MRZA 3KZ1E 4LBWA 2Q27A 5B3AA 3ADPA 4RENA 4EUKA 2NV0A 4DR3B 4IUDS 1DBIA 3UTCA 4EVRA 1RZRA 2P4HX 1HMYA 2PX4A 1O97C 2PX2A 1WM1A 3A11A 3F8SA 3HN6A 4GYKA 1G18A 2IHBA 2MJLA 1NC1A 1XXHB 4A73A 3I6IA 1M83A 3CNHA 7ADHA 3HJFA 1EFLA 1HX7A 2IODA 3N5CA 5AOBA 1DAGA 2J3EA 4IRMA 4ZVVA 1C9EA 3BDAA 1MEJA 3O4GA 3P27A 3DBIA 1TLFA 1UMKA 4OJQA 2AHOA 3I2IA 3OVMA 4CJXA 2L19A 1H2YA 3NBUA 4PG7A 1CQJB 4YROA 1WCXA 2HUNA 1EI9A 1TZMA 3KG2A 1NT2A 3SFVA 2VJOA 4H31A 2FI1A 1SD2A 3HFSA 2X41A 4L27A 4F5DA 1PR2A 1BD3A 2N9UA 2R6R1 1GL9B 3OFSA 5JT1A 4JBGA 3FOAA 1U3CA 5H3LA 1P5FA 3WB1A 4NLLA 1N0IA 2CJWA 4S05A 2OBYA 4J0EA 1MB9A 1N6NA 2IT1A 5CR9A 4DFDA 1SCDA 4AXXA 1H4QA 3VKGA 2PGDA 1L8OA 3WISA 1S8FA 4UCWA 1LB1B 1YUNA 3IAM6 4BVBA 1QU3A 2AL7A 2PH7A 3AP1A 3LPCA 4DCPA 1JH8A 2OESA 1ZWLA 1IMOA 3OE5A 1K06A 1K75A 5CAEA 1P6UA 5HCUA 1Z68A 4IUBS 2NVWA 2XMGA 1UF9A 3X1DA 4NTZA 2EGHA 5L4LA 3NW9A 5DNAA 3RYTC 4EBFA 3ZH2A 3RS8A 1UQUA 5SZJA 1OGIA 2V7QA 1G38A 4C14A 1C50A 4QARA 4E88A 5EJ5A 4MGKR 2FWRA 3MD0A 4NNOA 4IS2A 1S2MA 2VL7A 4TMFA 4EA9A 4MMXB 4JI7B 3AOEC 2P5YA 3JAKA 3WHKA 4ZYXA 2JHAA 1KYTA 1QJ4A 2PYIA 3H2ZA 4HDNB 5IVPA 5JCZA 1OLSB 2IYUA 4B6EA 4IKPA 1AGPA 5AW2A 3BGIA 4J3JA 1F3OA 2W6IA 4P92A 4FR5A 3M70A 3W3ZB 2BF7A 3NP7A 1TK2A 1B73A 1P5RA 3MQFA 5EE5B 4HVCA 4RVNA 3M5CA 5BWMA 4L4UA 4NARA 1X7YB 3NDPA 3OZRA 3SQLA 3DHVA 1QIKA 3X1YA 4NU0A 3IV7A 2E6UX 3RHTA 1E5QA 3FCOA 5ALGA 1WXEA 3OI7A 4TS4A 1GZ3A 1MJGM 1XUOA 2BCGY 4RPCA 4TLDA 1E4OA 3DEJA 1RKBA 4Y6QA 3SI7A 5IJWA 1FLDA 3LYLA 3VO8A 1ZHFA 2HQRA 5EXXA 4F11A 4RWZA 5CP8A 2J87A 3UB4A 5BOSB 4B75A 2GR9A 5CVJA 2ATIA 2G77B 1JLRA 2RAFA 2WFLB 4QODA 4K86A 4A16A 5IASA 5L3SA 3GFPA 1CSEE 1HETA 2HNAA 2JD2A 1P80A 2L42A 2WP8J 2QTAA 2XIJA 2I4TA 3QUTA 4TKZA 3VPDA 1VIMA 3CTPA 5D85A 3CFYA 4ISCA 4RL4A 1M75A 2LCQA 1T5IA 1DU4A 4Y1RA 4QVKA 4B79A 2QQFA 5IK2A 1YMQA 4ZWNA 2XYQA 3CR3C 3PSHA 5CVDA 5ALSA 4BLPA 3H5WA 5KJ6A 1IJKA 1NBWB 4CQMD 1V1RB 4PNEA 2WAAA 1PVDA 3JRWA 2J85A 1OSNA 3CIOA 1PCXA 1KFEB 2Z1DA 3F6YA 3U9SA 4L4RA 4FFBB 3K5PA 2QZ9A 5EGSA 5LDGA 2HYDA 4CU5A 4KLAA 2PGOA 3EG9B 1WXGA 3N58A 4MVXA 1IDN1 3LCJA 5CGQB 3STTA 5BQFA 2WUGA 4KIUA 4MJ3A 5HPYB 2Z1MA 1SWWA 4MV1A 1BWSA 3VKUA 3DEZA 3L0OA 3WGUA 4K0KB 4LAFA 1IK6A 1UZLA 2AN9A 2C3MA 2ZVPX 3EWIA 4GEKA 4LEIA 3TZ6A 3RTEA 4D3XA 5C1BA 4KXWA 1RJEA 2OM2A 5E6UB 4EOGA 4WAUA 3C5EA 3M6UA 2W8ZA 3ADOA 3ZQ6A 5H02A 1RJ9B 3ZLUA 4BUJA 3T3DA 2I3GA 4O5AA 4CMGA 1HDZA 5IDYA 4BVHA 1M1YA 1V39A 2BFOA 2R00C 3GEGA 3FG9A 2QQGA 1N0HA 2P9GA 4K2HA 1U8ZA 2JVIA 1U4NA 1ZD3A 1QLHA 4DJ5X 1Z33A 3MXTA 3RQSA 2C9DA 1O77A 1PFYA 2JBWA 3ED1A 3E3NA 4FNGA 1ONPA 2WV7A 2YW2A 3QMWA 5JCJD 1JNYA 3HJBA 3ZVRA 1ZJZA 3I3OA 4O3MA 1J25A 2O8CA 1EAMA 2L69A 3MIZA 3PIRA 4XSHA 4O4JA 5AJXA 2ZSIA 4BCBA 5BWLA 5DNCA 3GARA 2W6JA 4MR9A 4RF2A 2FDRA 4KO4S 3E05A 2OB1A 3QUBA 1R0SA 4YC7A 1XOIA 4RQBA 5JXWA 1M34A 2JFXA 2ZI5A 3Q0IA 4IG9A 5FFMA 4ITUA 3G5TA 4WZZA 2ECPA 5CVVA 3UBMA 3RJTA 3H99A 4E08A 3AVQA 2XYHA 1USKA 1Q0SA 2R7NA 3HCNA 3B7PA 2ZRGA 2FN8A 2RAVA 3FHOA 1WR8A 4QFDA 1EA7A 4R7ZA 1D0VA 1YR8A 4OQZA 5DXAA 1S96A 4R8RA 2JFOA 2K7ZA 2WMYA 1NR7A 1VHQA 3NBXX 2FPSA 1O8CA 4KL8S 1TVCA 1AHNA 5KTRA 3LRPA 4Z9YA 3TK1A 3EDQA 3NPMA 2ZYVX 3M4JA 3GP3A 4TYYA 2EIHA 3P45A 2GK6A 4NBWA 1ZD8A 3D4NA 3REOA 3M1AA 3JQAA 1TU3A 5HM6A 1OLXB 1ZVMA 5D5QA 2IU4A 2HV8A 3GVPA 4XZ3A 1G8AA 4PX9A 1HYHA 2ZUFA 1VKZA 4RV5A 4ZCPA 1JAXA 3M4ZA 3CV3A 1E61A 2OMEA 2Q4TA 2Z8YA 3FXAA 1DL5A 2IC5A 2PMEA 2R60A 4J1NA 1YA4A 3DM5A 2HRBA 5BW5A 2WT9A 2IRWA 2V03A 4ZU1X 3LC1O 2I2XB 3QWBA 1ML4A 4PYOA 3IA2A 4LDJA 1YS6A 2JKYA 1E89A 3ADKA 2DETA 1YHNA 4BPRA 1OIVA 2Q28A 3LKVA 3LWZA 1V11A 3OZEA 4G5OA 2XYPA 3ZZUA 2BMFA 4AUMA 5ED4A 2WM2A 3CVVA 1IHDA 3N07A 2RIPA 4MW0A 2FPIA 3ZWXA 4D4LA 4KREA 5E4JA 3EGDA 2W6OA 3FVRA 1N2GA 4Q4CA 5EL0A 3ZIAD 1V96A 1PJQA 1FJGB 2HQOA 4YJGB 3RK1A 3HBLA 1P74A 3NNDA 4NJMA 5G53C 2BPOA 3GUZA 1VMIA 1J0BA 3HN7A 4PYMA 4CKZA 1R6UA 3H9BA 3LGAA 3QF4B 3T99A 5A06A 1C7EA 1C8VB 4V02A 4D0RA 2VYVA 1WLSA 2HZ7A 4G97A 2V9PA 5CYPA 4ETNA 4R0VA 3VISA 4DV2B 3F7MA 2PZ8A 4LSGA 2UUPA 2ZS7A 1NNI1 4Z3DA 4YBZA 1GUYA 1CRWG 5KWEA 4G37A 3R7WB 4YUZA 1LVHA 1PZEA 4OB6A 2B3DA 1ZAKA 4PLTA 4IIFA 4OSOA 3KM0A 3IT1A 4B44A 2A5JA 2XCRB 4NATA 3MXOA 1CUIA 3C8HA 4MW6A 1LQUA 1E1DA 4KQHA 3FVQA 4BLRA 1YACA 1DELA 2GDJA 3C5VA 1SU8A 3DVSX 3FNRA 4J2TA 4AZ0A 4C01A 5JH7F 1HKHA 2KWIA 1HTBA 3KU4A 2CUZA 4KWIA 4OFBA 1B8UA 2XVXA 2PNJA 2IP1A 3SHVA 4ARZA 3VV2A 4L5IA 2BWJA 2NSYA 5DYYA 3HZZA 1F0KA 3K2BA 3IOYA 4TRJA 3U3OA 1QX3A 2P5TB 4P3PA 3OPXA 5IKOA 4IGFA 3O8OB 4DCOA 3UWOA 4YAKA 3RU2A 4X1KA 3BJMA 3WB0A 3UMVA 4DIUA 3OFJA 2EBWA 4JSTA 3ZV6A 4L4XA 1IB6A 3KOOA 5DBEX 3UW3A 4MROA 4BYMA 3KKQA 1Z39A 3I9V1 1I24A 1I3KA 1W8IA 2YVQA 3GWZA 2GB4A 1IULA 1OF1A 4CM4B 2FZGA 5A04A 3RUAA 3H7IA 1I5OA 2HHJA 1TE2A 2NUPA 2PX5A 1NUQA 3EPPA 4MNTA 1ZC4A 4R1MA 1RHQA 3W5IA 4E2XA 1C7QA 5G1NA 3RG2A 2HJWA 2CT8A 4B8YA 1WHTB 1C0EA 2FSHA 1GTZA 4NZPA 4PBTA 4QX6A 3UWSA 5IABA 3VNRA 2GZAA 2GYUA 4QTTB 3T6KA 1NM5C 3H4IA 4CTMA 5EHGA 4LQLA 3MCUA 3RR2A 2J9XB 4M1QA 3I1JA 5FXMA 5CCDA 3IE1A 1HE3A 2WU8A 4V1CI 2A67A 4DMGA 3BE5A 1Z8FA 1RQLA 4FQ7A 4KQ1A 1H69A 2WJIA 1U2SA 4PTLA 1EFDN 5B1SA 4LBZA 1PDWA 3T4XA 4DIFA 4ZICA 2IS2A 4LYEA 4NJOA 4NK5A 2JZOA 3P0RA 4QGAA 3Q0EA 4HWGA 2H1VA 4AZ0B 3VU8A 2PUBA 5CTAA 2X1LA 5BO5A 3HO1A 1RU3A 3PDIB 2C95A 4A0FA 1SUEA 3EIXA 3H3JA 3R74A 5A2QA 3WIEA 3VZCA 1P1RA 2QW1A 1K66A 3FBGA 4YCSA 1MT0A 3L7MA 4F45A 4LYHA 3HU3A 2ZE7A 5FFFA 3A6LA 5E3IA 4GZLA 1IU9A 3MJVA 3WL5A 5E95A 1KMCA 3BKXA 3DDZX 2RSLA 1E64A 4BNTA 3PD1A 5ER6A 7MHTA 1P7VA 2FZCA 4ARSA 5KNDA 2IYTA 2D7CA 4QTUB 3LQRA 4AW9A 2RB5A 3DV9A 1IB0A 2R1TA 1KFBB 5BUCA 1R9GA 9LDBA 4LRSB 2CDNA 3ETLA 1KGSA 1ZBQA 1BMTA 4GX0A 3DSRA 1A96A 1E32A 4ENRA 3ERCA 2PKWA 2H7VA 1DMRA 2FPIB 4Y9SA 3MLEA 3FIJA 4CYMA 8ATCA 2IOFA 2J5XA 3E61A 3EH2A 1RZ3A 2XRFA 3OEED 3VDMA 3VR1A 1KJZA 2FUNB 3VR3A 4NF2A 4ND1A 3Q8LA 1N6HA 4JXKA 1IN1A 3EISA 1QP4A 5DNWA 4B6OA 4RPHA 1RYZA 1MF7A 4E31A 1G4UR 4OKSA 3QEOA 2X3YA 1NV9A 2O2SA 1Z28A 2OBMA 1TZKA 4I3GA 4R6XA 4WKCA 5M5BA 2QRHA 1R37A 3ZX4A 4XEHA 2QUIA 5AKXA 3RVSA 1QK4A 1RSZA 3OJOA 2COKA 3FDXA 1XYVA 1EIZA 3O9ZA 3AX6A 2IBTA 2PLNA 3O4HA 1U8XX 2VT3A 2X77A 5INTA 3I04M 3GLIE 1FTWA 2VSYA 1ZVKA 4UW9A 2Z5LA 4RETA 1P4SA 2LTAA 3Q3CA 5EUCA 1Y6FA 1V16A 3CF4A 4TVBA 2R8XA 1SOAA 1TUBA 5G0TA 3BN3A 3CXRA 4F2DA 1OKKA 3VNVA 5EQTA 3SKYA 3K53A 3A2LA 1GTMA 4X8LA 3BHJA 2LVBA 4N0DA 3UMCA 1UDAA 2HF8A 5CM8B 2AMVA 3MRVA 3O8QB 4I36A 3S7ZA 3DZCA 4R0NA 1B26A 1RCUA 4EG1A 2A1TR 2MYUA 2C8VA 3FIUA 1NOIA 4YJFB 2DQ4A 1MENA 3TRJA 3WLFA 4ZPXA 2D1TA 1U3GA 5G0WA 5D2CA 4TS9A 3IEXA 3QKSB 1AV6A 2Z4RA 3RGWS 2AFRA 2Q0SA 2DBZA 1GG9A 3DUWA 3E4DA 4JVNA 4LJ5A 2LP4Y 4LQDA 3SZMA 1C3OA 1KDZA 5BYAA 2WHEA 1A5TA 3D3KA 3M6WA 5AJUA 5AMXA 3KS9A 3P4XA 5H81A 5ITZB 5JH7A 1FBTA 5TT1A 121PA 1IONA 2GLUA 2HCJB 1G4AE 2I66A 3WK9A 4YRKA 4JOBA 3RU3A 1QHIA 4OX9Y 3JVEA 2Q1SA 4OGWA 1N3LA 1PLJA 4DNXA 1TMYA 3MZ0A 5AP9A 2M98A 3KQYA 1M2VB 3KYBA 3ZDRA 4ZYTA 1UC4B 3S2ZA 4U5XA 3B6JA 2AT1A 3GV0A 5EY5B 4LYGA 4HCJA 1JRLA 4A6EA 1KKLA 1PS0A 3DBHA 2XZOA 2YWXA 3DQZA 1MZPA 1M72A 3NTVA 4BPBA 4COOA 1PGPA 1I3LA 2EQBA 3DB1A 4P98A 1Z6ZA 2BGNA 2Z5VA 3NQ41 4A6DA 5HTOA 2GPJA 4MPRA 2NU8A 4JOSA 1YV9A 1AUQA 3BE6A 3C8DA 3O6VA 4OBXA 5EJAA 4F38A 4TQAA 1IY2A 3WMFA 4BNKA 1BMFA 4NL4H 4K9KA 4PPYA 1VJDA 5LJIA 3FOZA 3QEAZ 2SBTA 1UJ5A 2G82A 3TQCA 2JAQA 1IBSA 4Y9RA 2WTMA 3FSRA 5YASA 2QL7A 4L3WA 1WXDA 3TSZA 3UJ3X 1HYBA 2ATVA 1X7ZA 1W96A 3AT1A 3MB8A 4XVUA 5CCBA 1T9CA 4D4HA 4GIBA 4RA9B 2O23A 4ABYA 2WYIA 3CH6A 1DIAA 4F5WA 1K1EA 3QLUA 3R3ZA 3I8SA 2AJCA 1DWUA 1Y3DE 4DQXA 4QYTA 1GUBA 1WQ3A 4XSGA 6NULA 5LQAA 3WAKA 3RC8A 2WJGA 2BKVA 4QUEA 3MAJA 5I5EA 4C4RA 1FUEA 4Q93A 1DKLA 1W4ZA 4YRRA 3WWZA 1XPUA 2A7XA 3GNSA 5C52B 2VNAA 2H52A 3L4BA 3H8VA 4HS4A 4JOQA 4H7IA 3W8NA 4IFEA 4F4HA 3HY6A 5B64A 4F60A 3M9XA 2CFSA 4XJSA 5KYYA 1QANA 2DQSA 3T06B 1WTCA 4W1SA 1TM1E 3GJXC 4QOIA 4M1YA 2P9YA 1XV5A 2WD7B 2WZDA 2JGJA 3GPIA 3GA7A 2R2AA 4L8GA 3BQ9A 4XUCA 4YB8A 3V33A 4BV8A 1DXHA 3QYFA 2RH9B 3FFWA 4K0RA 4YEDA 3V4OA 4X62B 2W2MA 2HQBA 2ZSDA 4D02A 3JR3A 3PI6A 3WZ2A 3LVRE 4QPZA 4ARIA 3X44A 2BH2A 3D1JA 4FOOA 2MTBA 2G7ZA 3DFIA 4N5DA 4QD3A 5CX1B 3ZHBA 5JQGF 2PZKA 4BZQA 3NAZA 3KAQA 4ZZ0A 1VRWA 2JCXA 2FP4A 1JDBB 3CVUA 1N9GA 3WKEA 1XZJA 3BCSA 1HORA 1T4BA 5A6VA 4KMMA 4AJIA 1B3BA 4S0XA 1I7DA 2BEKA 1QDEA 4MV4A 3H2KA 5I9TA 4GDFA 4FGUA 1E2BA 1L1QA 3IMFA 1MO2A 4YP9A 2SCUA 5ECDA 3ZXUB 1OAOC 3WRXC 3CXUA 1ESMA 1ODJA 4HDRA 1AVTA 1YRHA 3DEKA 1Z0KA 2RHBA 1HLDA 2ISQA 5ESWA 3Q9NA 3WR5A 4BS9A 4GVXA 2VP6A 2VPYA 4S1WA 4JZKA 5H80A 4BN0A 4J0CA 2RARA 3BA6A 4IH9A 1JGTA 1FFEA 2C5AA 1M1NA 2XHEA 2QPAA 3DL2A 2Q3BA 3C39A 5K0NA 3S1AA 1D1SA 2VDWA 4R9SA 4R1QA 6AT1A 5J47A 4MWEA 1THZA 1RLTA 1Q0UA 1V7PC 2YJ4A 3IRVA 3OFND 4CT5A 4XQ9A 2VP3A 4E94A 2ZJAA 2X23A 3OY7A 4TWRA 3OKPA 2O9JA 2VLIA 3CGGA 5DOZA 2QLBA 2WWTA 3RTGA 1B43A 3MJFA 4LDPA 1UJNA 1CUVA 1VG8A 1LLQA 5K6TA 4HDMA 3UO8B 1MLDA 2AMFA 1PEDA 2C92A 3GVXA 4FONA 2BI4A 1R9NA 4MARA 3QM1A 4U63A 5J2TF 3T7SA 5HR5A 4P54A 2AGVA 4TLEA 1B8VA 2A1UB 5KYXB 5MFZA 4KR0A 3NMUF 5FBWB 3ZDEA 2RHMA 3G1WA 4C0BA 3IVXA 3DMPA 1KAOA 1US8A 4URHA 3GGSA 2JBHA 2IELA 1V3VA 2ZJ8A 3HCRA 3NEAA 4Q9LA 5AKKA 4M7WA 4F86A 1XTKA 4P5DA 2P9TA 2YQZA 5C8YB 4WNYA 5I51A 4O2AF 2O06A 1ZH4A 2UZ1A 3VC2A 5AW1A 2B21A 1OBOA 3OQ1A 4ZGBA 2OGTA 3U39A 1LSUA 3CUEF 3KB6A 4Y0NA 5G40A 1QP8A 1WBDA 4KR3A 1UR5A 3DZ8A 5KPJA 3ICQB 2C07A 1SKYE 1KEVA 3G68A 1SBQA 1GCGA 1W8DA 3W5HA 2GEVA 4JELA 5AVJA 1V9LA 4A82A 4ZK2A 3FDFA 4UQLA 1CY7A 2J31A 5A9TA 4R8VA 3K0KA 1Z34A 2EKQA 3RVOA 1JHYA 2P9HA 4ZRMA 5FF9A 5LYJA 1DQSA 3QWHA 4NH0A 1EUZA 1TJ5A 4W8GA 2VWHA 2HA3A 3VO1A 1FP4A 3CZ5A 3DPSA 5DLQC 4MULA 4CEJB 1C4XA 2ONJA 1LCIA 2ZPUA 4NULA 4DV5B 3UOWA 4J9UE 2JVJA 5TEVA 2EFJA 2G5TA 3NHAA 2PR2A 2V8OA 2FZEA 2QJWA 2DFNA 3O31A 1H2WA 3CUUA 4FE7A 4QPNA 5JG7A 2SHKA 2C0CA 4AY5A 1TD9A 1GQSA 2YFQA 1YKSA 2PZJA 1RFLA 2I8LA 2XE4A 2HFJA 4G1UC 3BGSA 4YHBA 5DNVA 5BYJA 3ZJYA 2I3AA 2ZXEA 1T0IA 5JHGB 2B82A 3C3PA 1LJLA 1SVNA 5JV5A 3KZOA 4ITRC 4RMNA 3V3KA 5HNKA 5T4EA 4A2CA 2G5CA 4QULA 4KTVE 5CB8A 2X2EA 3FOCA 4WDRA 4WV3A 5CT9A 1QGED 2YZ2A 3H9UA 4ZVRA 3G5MA 3EOBI 821PA 4G4SO 3FDZB 5EXTA 1OI3A 4FIZA 4D42A 1JR6A 2P78A 1HFEL 1U7HA 3B1FA 3WYDA 4TTRA 1LU9A 1RKVA 3ZD8A 4DPKA 5CB4B 3L7KA 4BB6A 3EVFA 3HB5X 3C85A 3P9ZA 2C31A 4FNOA 2QTCA 3I32A 2UZ3A 1Z47A 3GVCA 3EE6A 1RYFA 4IVNA 2RC6A 5COAA 5DP1A 1I4DD 3ANXA 1L3CA 2C03A 2UVQA 2XMPA 3CA8A 3CYFA 3ROEA 1BFKA 3F7NA 3UCXA 1CHDA 3KOWA 3CF0A 2VZ0A 3DFUA 4YGYA 3SFTA 5JAPA 4I6EA 3QNUA 3CUYA 1CUBA 3OZVA 5EVCA 2L18A 4EB3A 4UEJA 4R6WA 4YQFA 1QZZA 2VXBA 2VWPA 3NPAA 3LUFA 1WD5A 2AQHA 3G88A 2DFPA 2RCNA 5GZ1A 1RTKA 4HDRB 1YCDA 1YGPA 5BURA 2FR0A 2RHJA 2HF9A 1LX7A 2RB4A 3UYKA 2JAPA 3WRYC 1EINA 2ZIWB 3D3WB 4JLBA 1XGKA 4LK2A 4NFYA 5KB3A 5JVDB 3NHBA 5JQGA 3UAYA 5C4MA 4DA4A 4JYPA 3ZEAA 2QTWB 5KTYA 1Z5OA 4PSDA 3GY0A 4FHEA 4EUFA 5JZSA 3D2BA 1Y7TA 1UFOA 2ECFA 4GZ3A 4GYJA 1V25A 1AY0A 1R10A 3M6IA 2HMYB 1QR2A 3KKMA 2WLSA 4JFRA 1MBZA 4EW2A 3T3NA 1P81A 3CEJA 1D09A 1YR2A 2BDUA 2BFAA 3BMOB 2B83A 2OCKA 3DDWA 3KVRA 3JQGA 1W4LA 4XR9A 5ETJA 3QVGB 5CLLA 4MQFA 3QHQA 1E6KA 4UARA 2JIDA 1TCVA 1DQZA 5I9MA 1SD1A 1T5BA 4UD6A 1J07A 1QHHA 4AJNA 4OHYA 2QJOA 3HDQA 4PCUA 3PUXA 1D6MA 3KC2A 4DDWA 1YZNA 2B4YA 4C04A 1OYOA 3VAYA 3QV2A 4P7JA 4UHBA 2ODEA 3MTEA 3OSUA 4B5KA 1ANKA 2LRHA 5LKAA 3UYLA 4ZC8A 2C54A 5HS6A 1GAXA 1QVAA 1ORWA 1JHMA 1W30A 2D5CA 2G9VA 3NHYA 4LX0A 4RXTA 2GM4A 1J09A 1P7PA 2Y0BA 4EHIA 1ACMA 1DRWA 4BNWA 1JDJA 1Z8DA 3ANNA 4FDLA 2O7QA 3NWBA 4N18A 5KHAA 4LF4B 1DMSA 5AVRA 3ICVA 1U0LA 2Z2YA 4FFMA 4C0XA 1DTEA 3SDBA 1RI5A 2X8BA 4CW7A 5DCLA 5KX5F 1EUCA 4BVGA 4DLRA 3E5RA 4PS1A 2R66A 2VAVA 2ZJZA 2AWNA 4YRFA 5BUSA 3AQIA 2BZSA 1Y3CE 4PHCA 3ROKA 3UANA 2PUGA 4TKLA 3L6OO 1J23A 4JC4A 3ZDAA 1OX6A 4P08A 4JOCA 1Q1NA 1QAMA 1Z07A 3W2GA 4CCSA 4OLAA 3FWNA 3SYTA 3DBOB 4QJ4A 4UM9B 1C9NA 4O2LA 4WECA 5C5CA 1M67A 2O0KA 2JIZD 1VZ2A 5HUHA 2B1GA 3DT8A 2UVDA 4QNRA 2Y2UA 1J9EA 2RIRA 3GFFA 3IR6A 4BC1A 1F9EA 1B3RA 1I4WA 4RGYA 5NULA 1C30A 1CUYA 3QV1A 4Q9AA 4YCDA 5HQJA 4M4SA 4P34A 1I7LA 3ZCVA 4YRZA 4MVJG 5JADA 5BORA 1KK0A 5CDYA 2H29A 5BN3A 1WNFA 1YCGA 2W6ZA 1CETA 3RIGA 3DR5A 4J0JA 2ZI4A 2ZRMA 2P6NA 2I71A 4S2EA 1JHUA 2P0EA 4ZVOA 2I29A 3EHEA 1ODFA 1ATIA 3HNRA 4D56A 3QVKA 4YV1A 1TYBE 1IE3A 2WK1A 4QATA 3VR6D 2H4JA 4Z8XA 4Z9AA 4Z9XA 3VM6A 2MSDB 2CGEA 1XEWX 2IW1A 1KO5A 3D8SA 3PKZA 4FD3A 3HO8A 3C48A 3T5BA 3SQWA 1DPFA 5KOHA 4G4IA 1G2IA 1WVGA 3ONDA 3U7QB 4UNPA 4DM7A 5ES4B 1PGQA 2NXNA 4TQUS 2ZRIA 4JROA 2D1FA 1WBBA 1JALA 1HWYA 2OZVA 3L7LA 2QP9X 2IP4A 2QNIA 2XCQA 3F9RA 3RT7A 2HSWA 5CDTA 2UYGA 4PF1A 4PC1A 2PUAA 1JYEA 1PX2A 1GRCA 1WB4A 2QR2A 1MV8A 2ZITA 4S1PA 4EFKA 4URZR 5CITA 3GRAA 4NHOA 1X8LA 2CE7A 1QHYA 3AM4A 1VXOA 4JBWA 5NLLA 4EF5A 1G41A 5CFNA 1JA1A 2CXQA 4Q3BA 5TMBA 4CMEA 3BKWA 1JW9B 1TM4E 1TMOA 2E1PA 1SELA 5CH3A 3K1AA 3W4KA 4BMXA 1R0ZA 3ELDA 4NBVA 3A31A 5HKOA 1VBMA 1VSVA 2B61A 3CPEA 3AJRA 3NX4A 2OXCA 2A1TS 3WE7A 3OQJA 1KC1A 5BNIA 1EBBA 4G5XA 1Y7HA 2IYQA 1P0FA 5KVQA 2X5NA 2YCLA 1K6XA 2OILA 4MGEA 4R84A 2LKCA 3VTZA 2GYVA 3E70C 4QM7A 3C14C 5IN4A 4BEBA 2Y1CA 1R5NA 2O19A 1Q1GA 3EASA 5A6SA 1WB5A 3DLIA 1QP0A 4BLVA 2A0WA 3AVWA 1XWWA 3GR6A 4NOJA 1UBGA 3HKCB 3BB1A 1ID1A 1ONSA 4ZGGA 3TJRA 3DCIA 1XEXB 4C76A 1JEQB 2XD9A 1S9DA 2BHLA 3GDHA 4TV9B 4WA7A 4LZLA 5JWHA 1AKEA 3ZCSA 1FFBA 4KXNA 2AW3A 5AESA 2Q3FA 1DJMA 2H1SA 2H5JA 3N28A 3V4ZA 3T9FA 3FDJA 2D2IA 4BATA 4WUVA 1XA0A 5J2UF 2PZAA 1A71A 1ZR2A 1OBHA 2GM5A 5H9VA 4QXPA 1NW9B 3RSGA 5I7SA 2O2EA 5A5VA 2P7IA 2PYDA 3EPJA 4P3OA 1R6DA 2ORVA 1MDFA 2ERXA 1IBMB 4IZOA 4K6GA 3ODPA 5IAAA 2NQ2C 1BDHA 1XKTA 5JCOA 3HB9A 3UWDA 1ODLA 1UKCA 1HL7A 1GO2A 3WK6A 6YASA 3G0OA 3CLRC 5CLGA 1IXZA 4ZZIA 3O3NB 2I1WA 3CKYA 4UUNA 5K5EA 4AY3A 5TDHA 3JQ6A 3PG5A 4G67A 4ZC1A 3U3JA 1YVDA 5JDIC 1GUZA 4OUDB 3KB1A 5DRYA 3V4SA 5IDWA 5JNUA 2UZIR 3EVTA 3OMLA 1JQ5A 2IQ5A 2IH2A 1Z6GA 1UKEA 3EC7A 1R0RE 4UBNA 5EQJB 3OOWA 2HHAA 2FF5A 3CRMA 2UUOA 2OQ2A 2QZPA 3G2LA 3JZMA 4NESA 3SLGA 5EPEA 3TYXA 3SQDA 5IJ9A 3OBIA 2HT1A 4YRCA 5ALZA 2F2TA 4P4SB 5IHXA 5KQSA 2RK3A 3QPVA 3DE3X 1H1LA 1KMIY 3KDAA 4WKNA 3W5UA 1YXMA 4RABA 4U7TB 4B2YA 1UK6A 3PRKE 4DCUA 1V48A 4IVQA 4MGYR 4C21A 3T3GA 3Q8KA 1Y1TA 1NI5A 5TS3A 5IZCA 3DMTA 3LP5A 4FOSA 4IIYA 3ECAA 1D2MA 4A6PA 1NASA 1E9AA 3L82B 3BMOA 4AJEA 2DFKB 4PCAA 3VSEA 3PGXA 4L1KA 3LDHA 3RDPA 3IXMA 4DVJA 4WI1A 3FPKA 5J5AA 2XODA 5JWOA 3EXEB 1YIDA 4WUTA 3T52A 3C1AA 2VK4A 5LP6B 1YL7A 4BNYA 4MEAA 2I2WA 3KFLA 5EHXA 4O4HA 3VKHA 1E3MA 3PEVA 5AM1A 3C3CA 1AK2A 4X61A 3QEBZ 1J0CA 1IBRA 1QFJA 2VPZA 5I7EA 4RGQA 1FBNA 3HBAA 3QEMB 1OZFA 3RC9A 1RC0A 1SUSA 2ZRQA 1ZGGA 1DQNA 5CYFA 2D7DA 2HC9A 1QF7A 1LW7A 2VTKA 2A92A 2UUAB 3HZRA 3HFGA 4RA6B 1QU2A 2M2IA 5IMBA 4OFXA 4PYLA 3EDRA 1KOLA 3LLVA 2EARA 3C4VA 3OJWA 3QUQA 4MTLA 4QOFA 3V7YA 8MHTA 1XC7A 1POWA 3ZE1B 2JFQA 2CHQA 3BL6A 1H0HA 3P9KA 3H86A 3VR4A 4DM4A 1WKBA 3DAYA 3ECCA 1N3BA 4JYMA 3ZIDA 1XVVA 5C46F 2FDXA 4D3YA 3QVXA 1JZTA 2C78A 1FS5A 2IXGA 4HGRA 3FOWA 3VDNB 4B0OA 1J20A 3HPQA 2YQ5A 4MP3A 5LQJA 2G07A 1LK0A 5JAZA 3NFYA 2P9CA 5LZ4A 2QZZA 3AHGA 4H4EA 5KTOA 3H1AA 2IEGA 4YRMA 1YB2A 2WZCA 3DGFC 2H57A 1Z06A 2WNIA 2AFIE 3Q2OA 4HJXA 4YPFA 2ZWIA 4KR9A 4A8TA 5FUYA 1QVZA 3ESBA 3OG9A 5KHLB 4EZBA 2G83A 1KI8A 1ZGHA 2HSEA 2ON6A 1PZFA 4FBMA 4G1EB 4O33A 1ZGCA 4RNCA 5SZHB 4B31A 1E79A 2YXNA 5KJ1A 3GA5A 3LP8A 2Y93A 2BE7A 4QT0A 1BYIA 3FI9A 1FDOA 3N6RA 4ACAA 3TOCA 2ZAOA 2FQQA 2MSWA 2Q1UA 3UK6A 4JP1A 4DSUA 3ZDDA 1P8JA 1NU6A 2PIAA 3ESXA 1U4SA 3N7TA 4ER7A 9LDTA 2PL5A 5LP6A 3LT1A 1L5RA 5FHQA 1QIMA 2CHGA 3TM5A 1KAGA 3WLQA 1L7AA 2FCAA 2XRZA 2C2BA 2G40A 3FUXA 4DWJA 3LUJA 4KDFA 1OXTA 1G5FA 1LS6A 5JE8A 5F9HA 3GRUA 4B3GA 4REOA 4DA6A 4CEHA 3G0IA 1ZCAA 5JZ9A 2AE1A 2P69A 1W75A 3IBSA 5EQDA 3UATA 1M7BA 3M1IA 1CR1A 2AMJA 2R4TA 3H8SA 4MV5A 2DH6A 1Q12A 2F3QA 1GGEA 1CX9B 4OAOA 3EGXA 4YN3A 5K8VA 3RWBA 3IR7A 4AG3A 3EA5A 4PU0A 1Z26A 3AV0B 1ZZEA 3BZWA 3K8OE 4TSFD 2VDQB 5H4HA 2EERA 3QMVA 2J3IA 4ZVKA 4K7JA 1U1IA 1YOVA 4PX2A 1WABA 4P53A 1ZR4A 2AEJA 3VMMA 1RXCA 3C6XA 2J4DA 2ZUBA 3BHIA 1ODCA 3FX2A 4Q7LA 3SGLA 3T7RA 3CVOA 5EJ9A 3ZLJA 4P0QB 2ZKIA 3O3CA 4FYJA 3IUPA 4DB2A 3L4SO 4QDTA 5AJHA 1NF9A 1E2EA 3R24A 2R9VA 1G2QA 3BVPA 2AR0A 5CNJA 3ACDA 5ALXA 4C7OA 4XJXA 3K15A 2PUCA 4G3XA 3TMKA 3VV3A 1Q74A 4F3KA 1M2FA 1EDBA 4ID9A 1RWBA 2CV2A 3C4JA 1N2CE 2YY5A 1QH8A 2JZNA 3BBLA 3QU5A 1KY4A 3PXXA 4EA6A 2WFMA 1EEXB 5BR1A 3BUSA 4N39A 2HEGA 6Q21A 3MMZA 3GLVA 1RT9A 4GECA 2BBTA 3K96A 4LA4A 4OHPA 5T8KA 3E3LA 3T7IA 1YAJA 3A4NA 2HWWA 4WOJA 4EYEA 3KUXA 3MWJA 1QAOA 1FMCA 2J07A 3D6HA 4TTVA 3ZWMA 4Q02A 1LPMA 3RSCA 4HYEA 2J0QA 3P9SA 5T8KC 4JHXA 5TQVA 3RUCA 4YX9A 2WT8A 2VYNA 3HWX1 5AR1A 4RKQA 2C2OA 2QX8A 4BBJA 4RH3A 3ZH9B 2I03A 3TCXB 3QE3A 1NJGA 3S1AB 3UUFA 1FE8A 1WX1A 1S5PA 2X0NA 4MA0A 4R2XA 5AVUA 5L6MB 3DOOA 1TLTA 2GF9A 3HU2A 4RTMA 2AX3A 1LLUA 3KVVA 4DSTA 2LV8A 2HJGA 2QMEA 3IH5A 2M6KA 3TIIA 5LU8A 1LLDA 5FI3A 2CMFA 1A7AA 2HTFA 1NURA 1PEAA 3W7AA 1G6KA 1HI9A 2MYNA 5ADVA 1RXUA 2PM8A 3AILA 1RRKA 3AVPA 3D7MA 3JVVA 1UPAA 3AUKA 3NIFB 5DBGA 1U3DA 2FN9A 5ALQA 2W71A 4MAAA 2NO5A 3R41A 5E7IA 3GLGA 3ADDA 2OV3A 2Q3HA 3ETDA 4OCZA 4B7AA 4TWJA 5JJLA 1ADCA 2OP0A 1GZ5A 3QU9A 4B43A 4FXPA 4IYRA 1SIBE 2QLJA 1KU6A 2RHCA 3Q72A 3GI1A 2DFLA 5DEIA 2X0FA 4DEXA 3ZR4B 3B52X 5IHPA 3ISJA 1PWYE 3HVUA 3QVSA 3OX3A 3V8BA 1Y8QA 1L6RA 2E4YA 1V26A 3KWLA 1MOZA 1YK1A 2Y92A 4WDQA 1O95C 3A9WA 4ZQBA 4GX5A 4PHHA 4C78A 1I4EB 1ZQ1A 2C97A 2WABA 3V4PB 2AUTA 3I2HA 4AVYA 2BMVA 2CXSA 3TRIA 4E1AA 5SY4A 5DX0A 3HR8A 3P2MA 2Z2ZA 3AEUB 5IVDA 4YMLA 4NE2A 5JSYA 3DHYA 2QHXA 3DE2X 1IMJA 1CLEA 1QFMA 1T3HA 3GMTA 3H2IA 2ZJFA 4FHDA 4HN9A 4JLAA 4G63A 5CNMA 2XLBA 3UHFA 4KR7A 3D6NB 1AUPA 2FW0A 1Q20A 4NBKA 2XIQA 5KWJA 2VF2A 4DPMA 2DPXA 3KTAA 1B0PA 3DS8A 3VNQA 3K2EA 3QPCA 2AK3A 4O0MA 1BHQ1 4HAIA 1SA0A 4I50B 4R54A 3FGPA 3DM9B 5L3VA 3D8TA 3KZKA 4X7PA 1PQPA 1ILEA 2Y1WA 4CT4B 3L7NA 4XGQA 5CVTA 1N7IA 3WDSA 4AKIA 5E0OA 3U9TA 2V6JA 4D3ZA 2ZE8A 1ZOSA 5BSEA 1POXA 3D7LA 4L4SA 1EFKA 4D5GA 4EDFA 2AIRA 4OQXA 4J3FA 3HKBB 2IYEA 4OXNA 4X84A 3UJBA 1ZUNB 4XEUA 3DE6X 3WB2A 4NICA 2BEWB 2FKAA 4CIDA 2RBKA 3QPWA 4B71A 1G3IA 3OQNA 3DKPA 2ZRCA 3ETGA 2GCOB 4OQFA 1ECBA 2QROA 3LOPA 1NW7A 3DZJA 4JLDA 4QHYA 1QIEA 4AZ3A 1QHNA 2V7GA 4CKYA 6GPBA 5IYZB 3ADCA 1YS2X 2DPLA 3KBOA 2AZTA 1MZVA 1FYVA 1VSQA 2ZTHA 3OZTA 4PFSA 5EERA 3PJFA 1M2NA 2WHQA 3BF7A 4B5LA 2DHCA 4N76A 1TJNA 1ZSYA 4QUBA 3OE7A 4EBBA 1NLZA 2IDMA 1DWQA 1TJPB 4GRAA 1IPFA 3E03A 5CIQA 1R8QA 4EG5A 1BEUB 3WWPA 3DZFA 5G4KB 5K3SA 2DKFA 4QJ3A 1QZ3A 3DVAA 3PLAE 4LIPD 5KINB 5C9ZA 3H1GA 1NX6A 3GCWA 4WINA 1B15A 1PRYA 2PUWA 3KZVA 3LCCA 1DDOA 4XB6B 4RMJA 4TSRA 4ZOEA 4B6PA 2ZAGA 1J0XO 1LBEA 5IM4A 2R751 2XQFA 4UNRA 4QNMA 4NQRA 1GU7A 2XE6A 5B53A 3S2IA 3HS3A 1FDVA 3H65A 3B6IA 1YR1A 2CNBA 3VOAA 5HRUA 4AZ3B 2NPOA 3KPVA 1WB9A 1FUIA 4LECA 2FVXA 1UPXA 2XXBA 4BNZA 1OXSC 4L75A 4EY4A 2D1QA 2GEUA 4UQPA 1MAVA 3EPRA 1LX6A 1KAMA 4ZO9A 1L4EA 5BVHB 1ZJ4A 1SUIA 2ACWA 4M76B 4Z4QA 2PX6A 2FG5A 5BYKA 3P2EA 3NEPX 3KPJA 3TKYA 1ENOA 3X3HA 1PBTA 1E6CA 2B1IA 2V7XA 2X0KA 3H9JA 3HDGA 2ZR0A 5E1OA 2P79A 5BSWA 1Q83A 1WW8A 4Q1DA 4KVAA 1H94A 1JA9A 1Z7BA 3L6EA 4KE6A 4XIGS 2GEKA 3OTIA 4MPPA 4UASA 2QOEA 3IP6A 4BNVA 4WLFA 3R7BA 3M83A 1KEKA 1W7AA 1MIHA 1UKVY 4KWHA 4RKFA 5HE9A 2G0NA 4YJFA 3Q40A 3HBNA 1TCCA 2PMWB 1KPIA 3C7DB 4ZANA 1JLMA 1LI4A 1XCOA 1T5LA 3COZA 2WTUA 3PDWA 4R01A 1QFXA 1TB4A 1UBMS 2XB9A 3RYCB 2O3RA 2XTNA 1ZI6A 4CDNA 4H6WA 2BSXA 2WFZA 3IKTA 1QHEA 1JBKA 4Z1MA 1JSCA 1ZJYA 3NIGB 1W19A 4WKPA 2F55A 2P1RA 1TKRA 2QK4A 5A03A 5HFNA 1I10A 2VSNA 3RK0A 3R3JA 3USCS 4MR7B 4BQOA 2PD3A 1ZUWA 3UN1A 3R40A 4IEEA 3IV6A 4HDMB 2HDOA 4TMYA 4IDDA 4RMHA 4XVRA 4M8SA 5HKKA 4AYWA 1VIYA 4MKGA 1QIJA 3B53X 3JWJA 4NCKA 4BNDA 4DILA 2XCTB 2ZU0C 2ORYA 2OXIA 4BWGA 4OHXA 1P29A 1U1DA 2GJ4A 1BG6A 2GN0A 4OI4A 3QJYA 4P3KA 5B6JA 4TTQA 3PNYA 1FVOA 2JS7A 4Q24A 2RKOA 2BFCB 3LJKA 3OJLA 4U02A 3NKVA 4UNQA 3IOCA 3WSTA 4C0AC 5KSYA 3JASA 4CUKA 1FL9A 2UKDA 4DM3A 4UUOA 3IV9A 3DR3A 4MUIA 2C5GA 3S0JA 3OZWA 4IIDA 4ZCSA 2ZJ2A 3EUFA 4ZOLF 1YZKA 4RVOA 4DTCA 1CS4C 4AWBA 2YICA 4AO6A 1EGAA 2GA9A 3CJQA 5EC8A 1Z5ZA 3CRVA 3IUBA 3L9WA 4G0XA 4F3CA 2OORC 2WT4A 4AXBA 1FP4B 4KUGA 4BO6A 2XZPA 1CT9A 2F64A 2V9ZA 3SHOA 4RYLA 1LXCA 3EIOA 3FYUC 5IAKA 5ADHA 3KZXA 1V5FA 2PJRA 1JPUA 2DTEA 3BL8A 3EYAA 3O94A 4Q1BA 1ZK0A 5ALUA 3N8IA 4EPXA 1AQJA 2OBBA 3AUFA 2DQYA 3WB9A 3SEFA 2X7JA 2IZ6A 4RIIA 4B7XA 4COKA 4ZT3A 3H5OA 2XCUA 1IIRA 2E7ZA 1JS1X 1AKRA 1SUWA 4MQFB 1U2DC 1UKYA 2WJJA 2XE8A 1UC9A 1YA8A 3M7IA 4C7VA 3VOTA 4UVEA 1XFDA 3M6VA 4UM7A 2QE7A 2RONA 4J7UA 3T5PA 4O4JF 3CRZA 1A9PA 3FGOA 3LBFA 4D8XA 2HK6A 2AFIB 4RTPA 4G5SA 1Q1EA 5DGCA 2ZYDA 2PKYX 2QKYA 2ZIUB 3AZPA 5AQ1A 3QUCA 4UEKA 5TQ0B 1Y4DE 2IS1A 3TZQA 1Z4IA 3TMAA 1EVYA 3JYNA 2YMQA 1ZMTA 3I8XA 3R8CA 3R7WA <