4HS4A

Crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
184
structure length
184
Chain Sequence
SPLHFVTLLGSLRKASFNAAVARALPEIAPEGIAITPLGSIGTFPHYSQDVQEEGFPAPVLTMAQQIATADAVVIVTPEYNYSVPGVLKNAIDWLSRVSPQPLAGKPVALVTASPGMIGGARAQNHLRQSLVFLDAYVLNRPEAMIGQVTGKVDAQTLELSDVATREFLARQLDALAALARTLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromate reductase
publication title Mechanistic insights of chromate and uranyl reduction by the NADPH-dependent FMN reductase, ChrR, from Gluconacetobacter hansenii
rcsb
source organism Gluconacetobacter hansenii
molecule tags Oxidoreductase
total genus 60
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hs4A00
1XT6A 1WSBA 3U7IA 1RCFA 1DXQA 3KAQA 4DY4A 1TLLA 4Y9UA 2RG1A 3FJOA 2Q9UA 5JROA 5LMCA 2ZKIA 1JA0A 3TZBA 2KQUA 1C7EA 3W7AA 4QODA 3GAMA 4DILA 5B3KA 4FGJA 4U7HA 3NFRA 2BZSA 4N82A 1OFVA 3ES9A 1RLIA 4QOGA 3F6SA 1FLAA 1FLVA 4LTDA 3L9XA 4GR9A 4ZVKA 3W78A 2QX4A 3JSXA 4FX2A 3EDOA 1H69A 2FZ5A 4M0CA 2HPVA 1QR2A 5NLLA 3NHFA 4C76A 2V5VA 5TGZA 5F51A 1ZWLA 4H2DA 2FVXA 3D7NA 2OHJA 1YRHA 2QX8A 2FDXA 4LA4A 4NULA 3N3AC 5F4BA 1AKRA 4PU0A 3OX2A 4QOHA 3SVLA 1FX1A 2QMYA 4YQEA 3B6KA 1GG5A 3NHRA 1AHNA 2QWXA 1CZUA 4GI5A 5B3LA 3K20A 4C0WA 3LCMA 1OBOA 2V9CA 5FA6A 3N3BC 1D4AA 1NNI1 3TE7A 1AKTA 2Z98A 3NHPA 3W79A 3O2NA 2Z9BA 3GFRA 4LTNA 4XDHA 4XDGA 4HS4A 3OVMA 3F6RA 3FX2A 4YAOA 4J8PA 3OJWA 3G5MA 4QOFA 3FNIA 2BN4A 3F2VA 3NHWA 5A4KA 4N9QA 4ESEA 2ARKA 3OJXA 3O73A 4CF6A 1YCFA 2FOXA 1CZHA 1YOBA 2QR2A 1D04A 3OX3A 2D5IA 1CZLA 2AMJA 1XYVA 3P0RA 2BF4A 3HR4A 5EMNA 1AKQA 5FX2A 3KAPA 4PTZA 4QOIA 3K1YA 4Y7CA 3NHYA 2W5UA 4LTMA 4YAWA 2B3DA 2QMZA 3QE2A 1ZWKA 1RLJA 1WSWA 2N1MA 4QOJA 1J9EA 2OHIA 5EAIA 3NLLA 4OXXA 3QFCA 5LVAA 6NULA 4C14A 1QHEA 3F90A 3FW1A 2OHHA 4YAUA 5LJIA 2M6SA 2HNBA 1D03A 1OBVA 1T5BA 4YALA 1J8QA 1KBQA 3UXHA 1T0IA 2M6RA 2GSWA 2OYSA 3EYWA 5F12A 1CZRA 2KLBA 2QX6A 1BU5A 2F1OA 1CZOA 2X2OA 3ESZA 2MOKA 4D02A 5ULLA 3KEGA 1AMOA 5LJLA 4LAFA 4N65A 1YKGA 3HA2A 4GQIA 5NULA 1AKWA 3QFRA 3NHJA 2HNAA 2MTBA 2QX9A 2Z9CA 5LLDA 1FUEA 2FAXA 4PTYA 1C7FA 1I1OA 3NHSA 4BMOB 2XOEA 3NHLA 4NLLA 3GFQA 1VMEA 3L9WA 3B6JA 2Q62A 4Y9RA 1FTGA 2FZVA 4BMPB 3TEMA 1QRDA 3ESYA 1FLDA 1YDGA 1YCGA 4DIKA 2X2PA 2R97A 4CETA 1JA1A 4FGLA 3LT5A 1CZNA 3GFSA 2R96A 3RPEA 1X77A 1SG0A 3FVWA 3W77A 4ZVNA 3B6MA 1DXOA 3B6IA 3OWHA 3HLYA 1SQSA 5EA2A 1AKUA 2V5UA 4U7GA 4F8YA 2MT9A 1E5DA 1TIKA 4HEQA 1YCHA 2FX2A 1F4PA 3ZHOA 1H66A 1AG9A 4ICIA 4S24A 4YAFA 1KBOA 2FCRA 3OWXA 1FVXA 1J9ZA 2FLVA 4QOEA 1DX9A 1ZX1A 2MWMA 5LBTA 3N39C 1B1CA 3NHUA 4H6PA 2XODA 1AKVA 3OX1A 2WC1A 3U7RA 1J9GA 4ZVLA 1XYYA 2A5LA 4R81A 3NHKA 1BVYF 4ZVMA 5LBUA 4FGKA 3R6WA 3S2YA 1CZKA 1FLNA 1V4BA 4U7FA 1AZLA 3UXEA 1XI2A 1RTTA 5FUQA 2BPOA 2Z9DA 5BUCA 4C0XA 2BMVA 3KLBA 1QBGA 3ESXA
chains in the Genus database with same CATH superfamily
2C0QA 3KT0A 1XT6A 4QD3A 4BRZA 1YRBA 1YFLA 2EYQA 3I0NA 4GX5A 4R5MA 5J5AA 4GYKA 3L7KA 1HKUA 1MN6A 2FPSA 2JS7A 1JE1A 2VP6A 4K6MA 2BKVA 3Q1KA 2AKEA 1ADYA 2PA0A 5BOVA 1HLFA 1WO8A 2V6FA 3EGOA 5G41A 3U9TA 3ZGZA 1JG4A 2D62A 4JUFA 4KUHA 4FT4A 4I81A 1KYYA 2P3QA 3RYTC 5JXGA 2DWUA 2ES4A 4ARBA 1K6XA 2REXB 3HU1A 3I2JA 3W7AA 4DBZA 1EBFA 1DRUA 1Y34E 3IVXA 1EZ4A 5TJ9A 3V4LA 4FLMA 1JAYA 4DLVA 2BEJA 4PYKA 2CVPA 4ZZ2A 4IUYA 4I1PA 2YV2A 2ORIA 3IYLW 4MI6A 4B2PA 2ZI7A 3TLGB 5B3KA 1RWXA 2FOLA 2JJ2A 4EUEA 3DR5A 4ZI7A 4CKYA 1IYZA 1WJGA 3LOPA 2ZWMA 1QGUA 3NT2A 4O4IB 1C80A 1Z2CA 3RTBA 3SIRA 3WMEA 4MSUA 5DJ5A 2Q5HA 4CODB 5BWLA 6Q21A 1Z37A 2QZZA 4IZ6A 5T4EA 1Q7RA 2OCIA 1SPBS 3PGXA 3VDNB 1FLAA 2AH5A 1MOPA 1Y8QA 4TMFA 3CVVA 1SVLA 1C4WA 3X1JA 2V98A 5DNVA 2XDYA 2DJ5A 3PNBA 4IDDA 4G2TA 3A8TA 2JL1A 4TRNA 5GQSA 5HW0A 2OSVA 1HFWA 3K9FC 5CXSA 5EXSA 4AUMA 3BWVA 3H3FA 2Q4BA 3ZDYB 1OYWA 2JK0A 3O21A 4W1SA 2XUFA 4IJKA 1YS4A 1E89A 2VKTA 1ZRHA 3FWZA 4OFBA 1OZAA 3BTUA 1R27A 2IITA 4X20B 3T52A 1J5XA 1HOXA 1OXKB 3AKDA 2OD9A 3OPYA 1J2EA 1X9GA 1Q95A 2C3OA 4I1YA 3OU2A 1NJ1A 2A7QA 4YRIA 5E38A 3PGVA 5KYGA 1AVTA 1OFGA 2NAFA 2PXCA 3U4AA 1Q1EA 2PFSA 2R8EA 1GPMA 2IYVA 5C1PA 3WIDA 4DY6A 4QYIA 1RC8A 1XTBA 1J56A 2A30A 2OECA 1YB2A 1NI3A 2WAYA 4DS3A 1P72A 1ESMA 5K03A 3UO8B 1BJKA 3AP1A 1IWOA 4ZHQF 2PIAA 2VJBA 3DMDA 4G0UA 5FI3A 1DWOA 1YRHA 2QX8A 1VPDA 1L6RA 2Q27A 1JEJA 3K2EA 5EXXA 4E4TA 1CFJA 5ILGA 2AQKA 2JFHA 3JQ9A 4Y2TA 1VL1A 1ZMOA 2ZITA 4HAIA 3PC8A 4CUKA 3E82A 3MFYA 5GJBA 4KXQA 1RRPA 1XGKA 5K09A 3RARA 2QU8A 1NP7A 2OHGA 2VRBA 3NWPA 3NYIA 5CT6A 1QKJA 1SQFA 5E2BA 1OH5A 4AULA 4QUEA 5TGTA 2A9PA 1Q2XA 3TI9A 3NRBA 5BWNA 5LDHA 4H18A 2V7XA 4F72A 3DCYA 3NV7A 4RVSA 3T7SA 5KDOA 5C34B 2XZPA 1VKHA 4LXHA 4ZO7A 1NY5A 4Y6RA 5DM4A 2Q50A 3KU4A 1WMDA 3JARB 4B3FX 4LHYA 3TW8B 5JS7A 3BBPA 4WCFA 2NUAA 2ZATA 4MLPA 2J3HA 3VNVA 4RS4A 4RKEA 2R47A 3B6KA 4CM8A 2C5EA 1CNEA 5IJAA 2G83A 3AYXB 2EWMA 3DBLA 2ZJ3A 3LPNA 4MUAA 5JHHB 1ZVQA 4F85A 1TMYA 1BFUA 3MM4A 2E3JA 3JRWA 4HPWA 5JAIA 4I2VA 1YDEA 2JCSA 5CVVA 2QP3A 3DO8A 3A0RB 3E9NA 3NOVA 4JGIA 5BURA 3P5BA 2NUBA 1ENPA 1JFLA 3TE6A 4JIGA 1MW9X 2GCPA 4NOKA 1XWIA 4H7DA 2IEZA 4OXQA 1MG0A 2NYVA 1KIMA 1GDHA 2AJCA 2AFIA 5HX7A 4M46A 2OFFA 3GAFA 2WWXA 3ME5A 1FTQA 4CF7A 1E79D 1PEDA 5F35A 2FE1A 3T99A 2UV8A 5CNIA 3EXHC 3MJEA 5IAGA 3LT0A 2IUEA 2C8VA 4RV4A 1Z62A 1KEEB 2OO7A 2R6DA 5BWOA 4DWOA 3DAFA 4MW7A 2CVOA 2YY7A 1YB4A 3J7AC 1FJXA 1JZQA 4JR2A 1V16A 4YJ3F 2FXIA 2X19A 1UP7A 3PR2B 4A8JC 1TQHA 1TL7C 3LWZA 4UTXA 2QQ0A 4TKUB 1WBJB 2EQBA 3CZ4A 5FI0B 1M6NA 3S7ZA 3EWIA 3LUBA 3MBIA 2BGRA 4EG0A 1Q7CA 5B2EA 5TMDA 4JLMA 5DNYB 5A1JA 4L95C 5L7TA 4WOPA 2BJVA 3KQSA 2CXRA 3AIOA 3EGCA 4AZTA 1ORDA 2H7VA 2D8AA 2GDJA 4M3NA 4OIMA 5J40A 1XDZA 2VT7A 5LL6P 4AF7A 4U8GA 1QP0A 1NUUA 4YJKA 1GNTA 1H2AS 2VRNA 4OV6B 4HPJB 4HUTA 3U6KA 3RVBA 2E89A 4CMIB 2VHYA 2C7RA 4OMFG 1SOWA 5A03A 3GFPA 3F5SA 4P98A 1JJAA 2PMEA 2HO5A 1N2JA 1OZGA 2AHOA 2C2KA 3LQFA 1I4LD 5HQTA 3ZKAA 3EFOB 4M9XA 1Z7GA 1T8TA 5DBOA 1ISMA 2A57A 4MS4B 5CM8B 5DX8A 4CF6A 2XWQA 4DM4A 3VKGA 1IVSA 2R8RA 2OHOA 2C78A 3F3KA 4JODA 1Y3AA 2W11A 1OJ7A 1US8B 1R10A 4OK5A 2QR2A 4LZWA 1QYRA 1KZGB 1DLIA 2PG3A 1D04A 1CX9B 2V9PA 3ACCA 3KP1A 1NDHA 6PFKA 4IJUA 2V7VA 4MR7B 5DBFA 3UG7A 5KSZA 1LDBA 2GXQA 4EY6A 1ULUA 3HYTA 1U6JA 1SMKA 3LGSA 4CMKA 1O54A 1H0RA 1EFHA 4XYMA 3H4IA 1RPTA 2JFPA 1V4VA 1QE5A 5HMLA 3W2HA 5D7NA 4ENRA 3UAZA 1JR3A 2CNLA 4N76A 4O2BB 5DP1A 2QZ9A 3GMTA 3V2IA 4RHCA 2NYAA 4AW9A 1XEXB 3EXIA 3QPUA 2GA9A 4ME6A 3T1VA 3TNLA 3U4QB 2LW7A 3M6XA 4WKPA 1OGIA 1HURA 4XYGA 3WLQA 5B6JA 4DJFC 2PXHA 1RXUA 3IBGA 3V33A 4B6EA 4YUXA 2VJQA 1PJBA 3FDFA 3AFGA 1NOIA 3FYSA 5LU8A 4K9LA 1DOAA 1C30A 2C3UA 4ZYXA 1VIVA 1ZA1A 4DT1B 2VDPB 2JJQA 3U3MA 2B0CA 3CLKA 13PKA 4JJEA 4J2HA 1ZEMA 3K0CA 3QV2A 1UOQA 2Z83A 3E15A 1P44A 1L3IA 4LJAA 1LS1A 1FRZA 5LB4A 2O2SA 4FN4A 4RY2A 2W6NA 3FOFC 1EIWA 3VUEA 3IE2A 3A4VA 3F9IA 1ZONA 3WHPA 1E0DA 3ETEA 2H3HA 1NP3A 4IIEA 4CCYA 1JR4A 1NVXQ 2Q8QA 4GKKB 1G64A 3EMVA 4BNTA 1MOZA 2JI4A 3OJEA 4GU5A 4O2RA 4WUTA 1ESCA 2OKCA 3UB3A 3VNAA 5L40A 3KQKA 3K94A 5ED0A 4CIVA 4PAGA 3U3XA 3RVMA 2G6TA 3IVAA 4LYFA 2CL5A 4RZ3A 4WA7A 3LI2A 2HSJA 3NHMA 3BE4A 3ZK8A 1D2CA 3TSAA 4BFTA 1S3FA 1TKAA 1PG0A 4IYJA 3MRSA 3V4RA 4X24A 4FCWA 4XWKA 1V8PA 1F2DA 5HOQA 3ICQB 3BIFA 1T3SA 2GWHA 4QNNA 1XL1A 2PT5A 5FJIA 4CKEA 2AN5A 2ZE5A 4DR3B 2M6RA 5JSZB 3X1KA 1LKZA 2HOQA 3GRYA 4JL5A 2FLWA 4JC4A 5LP6B 4BASA 5D3KA 1GFZA 3CF0A 2C4HA 2ZRLA 1HNZB 3P32A 2DLDA 2Q07A 3T1NA 3PYMA 4CT0A 1H65A 2Z56A 3ZJTA 1VI5A 2GK7A 4B33A 2WD8A 3VPFA 4B4WA 5H3CA 4Q15A 2W43A 4QELA 3R6DA 1TQ2A 4R1PA 1JU4A 5AUOB 4IIJF 2EKPA 2QN8A 2XEXA 3AFIA 1K8QA 1RIIA 3DZDA 1UJ6A 1VDZA 4OUDA 1X7YA 5ADUS 2G72A 5JC8A 4FR2A 1DC7A 4JJZA 3X2SA 5FPHA 1Q0ZA 4FOSA 2YY6A 2CFTA 1QORA 3P9PA 3FHTA 1XJ0A 3AX6A 5EPEA 5T41A 3CO5A 2PNJA 2AYYA 2Y1WA 4GVPA 1RC1A 1QOPB 2HC9A 9MHTA 2HHAA 5KSYA 1RVDA 5IJZA 4DB4A 2COEA 2PU5A 4WDQA 4CMHA 2OAP1 3CZMA 3ZV5A 2HGZA 1NNSA 2X6QA 4ZTZB 1JMKC 3KRTA 3HJAA 2V59A 4C2BA 2XTJA 3O8QA 4BNDA 4DLYA 1SA0B 2X1VA 3P9KA 2BGJA 3HJBA 5DYNA 3RRBA 3CVXA 4HD8A 2F6RA 4J4TA 4KBYA 4OHXA 4XR4A 5TNXA 5TPZD 1J1ZA 1JEDA 1DAEA 1P77A 2XUKA 1X7HA 3T7CA 3KNZA 4XASA 1DVRA 1QIMA 2FPGB 1GFIA 1HFJA 2HWKA 3O3OB 4ZQFA 5KAPA 4S0ZA 3S2SA 4D9JA 3WFZA 3N07A 2VHXA 2Z9CA 1CUSA 2FMUA 4L5AA 1G8JA 4XI9A 3ZTYA 5HF8A 4LISA 2IHJA 3R2JA 2R87A 3KXKA 2REBA 3ZV4A 1EBUA 4M1KA 5LXTA 2F90A 1T1GA 4UUNA 2G63A 2JFNA 3H65A 4R0NA 5LOVA 2NZXA 3I0MA 4MA4A 5E8RA 3WAJA 3NEPX 1USWA 4HRVA 3MD0A 3B6JA 3ETGA 3VR3A 2EJCA 4JBNA 4P7GA 2PX3A 2J0EA 3FSJX 3TLEA 2HW8A 4QDZA 2HYDA 2WABA 3X43A 1V8ZA 2PNFA 3NBZC 3OQMA 2G1JA 3TEMA 3IT0A 5DM1A 4Q02A 4HTFB 3CXUA 4MS3B 1C9NA 1TB4A 2Z3WA 2H1RA 3SSOA 3WSTA 1EHYA 4HC4A 2I1VB 2W2XA 5JW6A 3AR3A 4NYMR 3AF2A 3E0QA 1CZNA 1XZPA 4L8WB 4OQPA 1YZTA 5GONA 4DDWA 1BCRB 4GXRA 5CW1A 1XNQB 1NV9A 2YIJA 1DG9A 2EQ5A 3SF0A 5FD8A 2X1LA 3ZS9A 1D3AA 2RC6A 1Q20A 2CNOA 3K4QA 3PLRA 3X1XA 5JNLA 5EKSA 3ZDFA 4KWEA 1NVEA 3RAGA 1R4NB 1WU8A 5CLLA 3I5MA 3C8DA 4MV0A 4NXNB 4OGFA 1SCJA 3GQBB 3UAWA 2O2GA 1JPNA 3WIUA 4RYDA 1T4CB 2OLEA 2DTXA 4QFDA 4GW3A 5AKJA 3ZU5A 4B3IA 4KQWA 4MJLA 5DMHA 3IDAA 4HQLA 4FZRA 4TMZA 1UEIA 3GDHA 4C20A 4IRXA 5DCWA 3CHYA 4KNVA 1CDEA 4YECA 4H3SA 2J9XB 2H57A 3MB8A 1ZVJA 2H1FA 3R24A 1BXRA 1JEQA 1BRTA 2Q4RA 4U8HA 5H59A 3ABOB 1SXJA 4BBPA 1DKOA 4MVJG 1KK3A 3I12A 4TX1A 5KWVA 4HNTA 3LVQE 2IS4A 4QSHA 4QULA 3AFOA 5C1OA 2V6MA 3L5KA 2UXBB 1CDZA 2A92A 1L5FA 5F7ZA 5GOTA 1P74A 1QG0A 3H4MA 1CRLA 1J9ZA 2WT8A 1G42A 2HRQA 3IHKA 4L1KA 5TB5A 2AF4C 4AU1A 3HBJA 3OZFA 4W5WA 1S01A 3ZK9A 3WE7A 4YRMA 2C7QA 3H9GA 1EP9A 1B1CA 4CLOA 3L6OO 2QRVA 3M4ZA 2G17A 4M99A 4CI0B 4EYQA 2PKYX 5FADA 4GE3A 5JQWA 1G98A 3M6MD 4AI6A 3NIBA 4KIUA 4GPAA 4DPKA 4Q03A 2WNSA 1KVUA 5CIQA 4B6QA 1NAHA 1E2JA 2E48A 2GWRA 2P78A 2XYQA 4Z4FA 2JAHA 2HAEA 3Q0IA 1ZI6A 2C5BA 3PKZA 1CQIA 4D45A 5IZ4A 3HHEA 4ZPXA 2WD7B 1GT91 3LK7A 5TPWA 2JD2A 4JOQA 4GRIA 3WNDA 5C1BA 1WPQA 3Q7PA 2WHXA 3I05A 3UICA 1J1IA 3D1LA 5L3RA 1JIJA 4JSTA 3UK0A 5GPBA 1AGNA 5BUSA 3ZHZA 3GLIB 3ZE6A 3C45A 3PJDA 4KYUA 5G4LA 5LBUA 2BMEA 2ZWVA 1DUVG 3ODPA 4LVNA 4XB6B 4YQZA 1XPOA 2RGCA 4N9WA 3KYJB 3U7GA 3PVCA 3W5VA 3P26A 4JEUA 1MJFA 4LJ7A 5EJAA 2IH2A 5KWIA 1AM4D 4DV6B 3AR2A 3P9YA 3R76A 4A8JB 4OHZA 5JJIA 3SLRA 2MYTA 3GL9A 1FFGA 1XTQA 3IE0A 5E2IA 2HRRA 2A4MA 4F4UA 3TSYA 4RL6A 1FDIA 4X9XA 3CONA 3EBPA 1S9HA 2DB3A 1T1SA 2OUKA 2Z9DA 3VKFA 1ZU5A 4EMUA 3KJGA 5AK5A 4Q9JA 1THZA 1ZMBA 2H17A 4Y3UA 5EQDA 1T26A 2YXPX 1QBGA 3GGPA 5KVAA 2FEMA 4JX8A 2A1TS 3L41A 3EG5A 5A7FA 3ET4A 1YVDA 4JLNA 2Y6VA 3PDCA 4DDMA 1QGZA 2H8GA 5CURA 5DIFA 1NE7A 1H5NA 4YJHB 3H86A 5K3BA 1RPNA 4MWCA 3FUXA 2HNKA 1Z88A 3FB4A 3DEZA 4R2HA 2IHZA 3WWPA 4Y9SA 3P4YA 1KZ9A 4MDYA 1FP1D 5KTMA 1IHDA 2BSAA 1O0CA 3A0UA 1T5DX 4QYMA 3LY5A 2W22A 5C18A 521PA 3L0IB 5LIRA 3NBMA 1VCHA 3ESRA 3GA0A 1EVEA 3FDXA 2DTEA 5IM5A 3OLWA 4N5HX 4CEIB 1IEVA 1NJ2A 3CNBA 4DILA 3FPLA 5GMOA 2LBPA 1XU7A 4CQMA 4DR6B 3CWCA 3ZLUA 1KA9H 3BKWA 2JLVA 2PUWA 1N9KA 3H5IA 3PFNA 3PSAA 3GEEA 4U2GA 2O2HA 1ZCZA 4PG5A 4PONA 4F9FA 5LPNA 3STYA 1RYMA 3TSCA 1OHHA 1SAYA 3EA5A 1NKSA 1VLVA 3FYUA 1RXIA 2K4MA 1J49A 1OFVA 4AKGA 3L1UA 3EASA 3WGZA 3C4JA 5BYAA 3F96A 1OZ0A 2VS1A 1PFKA 1N3IA 2B7LA 1E63A 2O52A 3BHNA 2HJSA 3ABRB 3M9XA 4Q4LA 5DHRA 1SKMA 1T2NA 2DBVO 3F49S 3KYCA 3LP5A 2HDOA 2PTGA 4FHEA 4DLKA 2H9AA 3BXXA 4Y2RA 3FVVA 3ZDRA 3S2GA 1UBHS 2CT8A 1R0ZA 1WKBA 5IVIA 1WMFA 1QMGA 3GMSA 2G0TA 3JQ9C 4B6JA 1NTOA 3CW9A 1XAIA 4NMXB 2YFQA 3PC8C 2HXYA 3TBFA 3UW3A 1ZM9A 2BTEA 2ROQA 3MJDA 4E5VA 1D2MA 2VTBB 1I3LA 2YV1A 3M7IA 1U94A 3F5QA 4KLCA 2DKFA 3WDSA 5CRIA 4C76A 4CIWA 2CN1A 3S0JA 2Q7OE 1USGA 5EHNA 2V5VA 2ZQZA 3A14A 5BR4A 1N1GA 4DLPA 4BQIA 4QPDA 3AXSA 3HJUA 5TGZA 1Q11A 2D3WA 3N2KA 1P8AA 2Q6VA 4WCFC 4YCBA 2AC2A 3C15C 4ZOCA 4EFKA 1YA4A 4HT3B 3BUSA 4A6PA 3IT1A 4YRBA 1DWQA 1ZQ9A 2JHPA 3C5CA 2C83A 4L78A 4KMOA 3DBRB 3EMBA 2B1RA 1WZEA 2NX2A 5B7GA 1BQ4A 1CG6A 3OI7A 4UDYX 1ZYUA 4BUJA 5JXIA 5ALRA 4MDHA 2OGUA 4QTYA 3VR4D 3WV5A 4D0SA 2RG7A 4IH9A 1ST3A 1SXIA 1JU9A 3KR9A 3A4MA 3EIXA 1YI1A 4LW8A 4MYTA 1SUDA 1YU9A 2F43B 2NPOA 1X0VA 3RB8A 1XCMA 2Y8EA 3C3MA 2P67A 4G26A 4OHCA 4PRYA 4CEHB 1W5TA 2FN8A 1N2BA 1RZ3A 3HXPA 3CF4G 3A1CA 3D02A 3R3XA 3ZHSA 2QVXX 3C3AA 1Y1QA 2FMHA 3WL5A 5DI9A 1QRRA 2XE7A 4HV4A 3BOSA 3GD5A 2MSCB 3SJ7A 2YWJA 2O8BA 3U49A 4EWLA 2OXTA 4IIXA 1DDGA 1NVBA 2YWDA 3FZNA 3QVGA 4DC9A 1HX7A 1JILA 4EVIA 2BFCA 1YRWA 3FY4A 4UE3S 1NMZA 4O5AA 2IHKA 4BLRA 3UOGA 4F3RA 4LQCA 3M0EA 3P27A 4I08A 3IXMA 2PJDA 4MYRA 2H7XA 3PDJA 3QEJA 3ZQ4A 2Q0SA 3EC2A 2P6PA 1FQJA 2GETA 2QLFA 4FHDA 4PQYA 5SYAA 1PK8A 3RVRA 3TLAA 2OGTA 1SCQA 3CW8X 3PWTA 4R2LA 4BQOA 2W2LD 2PZFA 3CSDA 4L3OA 4R2XA 4W5JA 2IZ5A 1XMQB 3KVRA 2Y68A 3DHVA 4KQFA 4Y2XA 1SZDA 3FHOA 3L82B 4LS3A 4DWJA 1X1DA 1X7WB 3DNFA 4WZZA 5IUKC 2IYQA 5L7YA 4C7VA 5ARBA 3A1TA 2BGUA 3EEYA 1SBNE 2WK1A 3NHPA 4WJZA 2OLKA 1SQ5A 2PLNA 3R3WA 3OPVA 5BVHA 4FW8A 2ZM5A 1I4DD 2PS3A 3FGOA 2GK3A 3MJHA 1IMJA 2F55A 4M37A 3EVCA 4YAOA 1KJJA 1E6MA 2EF1A 4OREX 1NYQA 4N18A 3EAGA 4FFBB 1UXKA 3E4DA 2BBTA 3ECCA 5DLEA 1P18A 4ZHQB 9LDTA 1Q0RA 1XD9A 1R8QA 1Y9AA 4ZZ3A 1D0SA 2P7IA 4V0NA 2FMXA 2W98A 2WINI 4KSBA 2F48A 3MTQA 4RMNA 5FO1A 2TRSB 2QIOA 3EGXA 3FBGA 4OHFA 2YMPA 4UHHA 4Z2YA 4QJ3A 1V8DA 3C8UA 2XDAA 1IVNA 4LZLA 1JYFA 2V1UA 3HCBA 3QHQA 4HLDA 4QUAA 1MRNA 5ADHA 1RQ7A 4TYYA 4KXXA 4E2YA 5ALUA 3MMZA 4LY6A 4BECA 4PLVA 2GPBA 3MTGA 4BV9A 1KAOA 1P2TA 2NNLD 2PUGA 2ZCUA 3BX1A 4PX3A 3NHBA 1NN1A 2CGEA 2O3TA 5KTSA 4P8RA 5AVVA 4WWHA 2E4AA 2IXBA 3QPCA 4RZQA 3E53A 1DTWB 4G9EA 4BLWA 4OXYA 2QB5A 3ZVNA 2C82A 4CFSA 2HJVA 2QF7A 1CPYA 3MCTA 2H48A 1T9GR 2QLLA 1GOTA 1HK7A 1M8JA 1KJ9A 2ZUSA 2JFVA 3AWDA 5AO9A 2GEJA 3CX7A 4JBLA 4GL2A 4UDNA 4BWVA 2G40A 1V9CA 2HHLA 3K0CC 3AR4A 4ND8A 4BAUA 3KAPA 3H11A 4YS6A 4RTQA 1AXRA 4QOIA 5JNRA 4RTOA 4AJ2A 4LHWA 3S8EA 2P8SA 1QU2A 1ZNXA 3O2SB 2GAFA 1YTLA 2H16A 2QVZX 1X15A 3RTEA 3F7TA 5U1PA 3JVVA 1HDOA 4QL3A 3OCCA 2P6OA 4YWJA 4LV8B 5I7SA 5LMZA 1J1UA 1I5OA 1T9KA 3GLHA 2FB9A 3ORRA 4N0PA 4DC0A 3EQZA 4L72A 2VSOA 4DF3A 1XQ6A 3GRPA 3KTFA 1CDOA 2HCJB 3LPAA 2IOFA 2DAPA 5T4BA 1G4UR 5JANA 1CRWG 3PLAE 1QFJA 1TFRA 3TX6A 2QAGB 1B42A 4GOJA 3IERA 3V7FA 4AJJA 1JFTA 2IYOA 3ORSA 3IUMA 4Z7NB 3L49A 1FL9A 5JXHA 2P9TA 5C5IA 3BH7A 2ECOA 3C3XA 3LP8A 4B7XA 3CTPA 3OCWA 4KWHA 1RI4A 3LUFA 2BKLA 4LYJA 4PG4A 3HKDB 1M34A 4BATA 1G8MA 3PYXA 4P82A 1KFCB 3IOBA 4R01A 1HE1C 5FL7A 4AICA 5LN1A 1G9XA 1YDHA 3ROFA 4MB0A 5LYJB 1VLMA 3KTAA 3MQFA 1E8NA 1L1EA 1NXSA 4ID3A 4RKRA 4U5QA 3VR6H 1RDFA 3VPAA 4LFBB 2VF7A 2XB4A 3GJ3A 3G8BA 4JP1A 5I51A 1QK5A 4RHUA 4R2IA 2XX3A 3DM5A 4ZJZA 4WXEA 1EGAA 3PGJA 5BPFA 1M75A 4FCTA 3D4NA 3K72B 1BXZA 1T9ZA 2XB2A 3CVUA 2DRIA 5CB4F 1RJFA 3WLSA 5IKMA 3TRDA 2ZJ2A 3V8EA 2OV1A 4C4AA 2D7CA 3R9KA 3TNYA 1ZD9A 1M6VA 3AOGA 3INYA 4GI3A 4TS9A 4EB6A 1D2AA 4KDEA 1EJ6A 3FBWA 4HLNA 5IH7A 1TGYA 2PQ0A 5C8ZA 1A71A 3ABIA 3ASZA 2O3UA 5B55A 3DMHA 4ZHSA 1XU9A 2EKDA 2O7RA 3F4KA 3CB4A 1V2HE 3Q85A 2HF7A 2WJJA 2WYVA 2JBAA 1T5IA 3H2HA 4KG7A 1DC5A 3E7XA 3VH3A 1DHTA 1BDIA 2R48A 1MDBA 5G3YA 1BU5A 3S28A 4KH0A 2QXTA 3VR5H 3VXKA 5ES4B 3A9TA 3T3EA 1Z0SA 4A23A 1GUZA 2P9EA 4QTZA 2E85A 4LSWA 3WDMA 1V43A 2WM2A 2BZ0A 2EKZA 3OHSX 4GPD1 1NBHA 2JCXA 2XTAA 4Q7JB 5HA5A 4ZEOA 5T3YA 4BNMA 2IIBA 3IKTA 1LTQA 3LWBA 3KVOA 4KXYA 3S70A 2CNWD 4J7CA 3WI7A 1KDPA 1Z17A 3FPGA 3QXXA 7REQB 5L51A 3ANLA 3MOIA 4CN8A 1E0JA 2QMQA 4U7JA 5A3JA 1KAQA 3BHIA 1DWPA 3C3KA 1DRJA 1FX0A 4BO4A 4XQ9A 5GV8A 2NU8A 4J1TC 3BIXA 4UAJA 5C8YA 1UJ2A 2J6IA 4NMWA 3X1ZA 3FYDA 4KRYA 1XU4A 4NCHA 2WW8A 3VR1A 4MWEA 4ZI7B 3R7SA 3E3LA 5JZMA 5JH7A 1HDRA 1QGUB 2DQYA 1D1TA 1N9GA 3O26A 1P2FA 5KYVA 3AF6A 3VSCA 1K1EA 3NHAA 5KYKA 1B8PA 4AY5A 1FDRA 3CT4A 3LX5A 1ZK4A 2F1HA 1ZZGA 2ACEA 2B8NA 2V3CC 3R6GA 3Q8MA 2NU6A 4JV5B 4Q39A 4EJFA 3ZH2A 3VU3A 4HLCA 2EL7A 2IYLD 2YJ5A 2VLBA 5EWLA 1S6YA 5FBHA 2O6LA 3NIGB 3B7GA 5IVHA 4LBVA 1P39A 4DQKA 4M7PA 1S7CA 2CHGA 1KI8A 1KFJB 1TYCA 2F8MA 2JLCA 3LH5A 1F2TB 5HE9A 3GJYA 4I9UA 3VDMA 4HFRA 3K3PA 4BX9A 2V03A 4RX1A 1E32A 4BRWA 2ZUVA 4L2IB 4P2GA 2JFYA 4RLHA 4BJ5A 2GYUA 3AQIA 5DPMA 4L02A 1OXVA 3V8RA 2P9YA 2CJWB 3DDHA 3H0CA 4XA8A 5EE3A 5TT1A 5CA1F 4GYYA 3DE1X 3LKBA 4L8FA 3MXTA 4BMPB 4XW2A 2SBTA 4QYIB 1QRTA 1LDGA 2Q2VA 2DU8A 3L7NA 2QTAA 2W2OA 2JVKA 1EP2B 4LSZA 4M8SA 3GJ7A 1PEYA 3BYZA 4HCJA 4KNWA 5HFNA 2RE8A 1GCGA 3BXOA 1RYHA 1VMAA 1YUBA 2H2DA 2X42A 4TS3A 5EWJA 4BNZA 1YFJA 3TR6A 3W7VA 1H22A 3PFGA 2QOEA 1OFUA 4H31A 4BNXA 3GFSA 4ZQEA 2J3JA 2FPLA 3TM5A 1EP3B 4GP6A 1SXJC 3ND5A 5ISMA 1LWNA 3BVPA 2Y0PA 3KJEA 1ES9A 1SG0A 3K96A 2D7DA 2Y67A 4OO3A 3HBMA 4JLKA 4RFSB 4E5SA 5B64A 1TMOA 2X8WA 1DKLA 4M1QA 3HKBA 5JAQA 2X3FA 1TCVA 3B53X 3L01A 4HAYA 2WTEA 4KKVA 5E0KB 3V55A 4EPRA 1P7ZA 3AM1A 4WL0A 2QSZA 4OQZA 4CL0A 1DJNA 3G8AA 3HUEA 2VA8A 1K6EA 1YGYA 5FWDA 2J5XA 5JYEA 1Q0TA 3R5HA 3WLMA 3R6TA 4MIEA 2Q6TA 5GTDA 2NUAB 1SBCA 5REQA 4F8YA 2BFPA 2FMKA 1EMDA 2MT9A 3PFCA 1WL8A 1W87A 1BVHA 3X1WA 2B4KA 3LL7A 3BDIA 4XIYA 2WI8A 4XWAA 3S5UA 1GAWA 3I9JA 2B94A 3EAQA 2NACA 1JV2B 3BZWA 3WMXA 1KOLA 3PIRA 4NFHA 1U31A 3LWNA 2CVHA 1AG9A 2F59A 3B8EA 4ICIA 1DC4A 2ZI5A 3DV0B 3HP7A 2J4CA 3MF4A 4G01B 1KBOA 4GS5A 4JYMA 3PP8A 4QC2A 4YAFA 3TPZA 3V42A 2YHSA 4KMSA 4ZEMA 1KWKA 4MVXA 5CIYA 4NZMA 1X1CA 3L2OB 1GNQA 4HOYA 5P8WA 4MQ5A 1H0HA 1N7HA 1QS0A 4ZT7A 4NXMB 1I0IA 3WAGA 5EMJA 1UQUA 4PWYA 2JGJA 4BAGA 2HCRA 4NECA 2XT0A 1HYQA 1YB6A 3HXKA 3THRA 5L3SA 3WMWA 4A6EA 1SOUA 1RPZA 5DN9A 1GM5A 4KMRA 3AI7A 3D6MA 5CP8A 1F48A 2I03A 3NC1C 3ZDCA 1V16B 3MLBA 1H94A 9LDBA 3S1AA 5JAPA 3SE7A 1LC0A 2OZLB 4I9HA 4LYAA 3KQHA 3NALA 3THYA 1MOSA 1LW7A 5JXJA 1LTHR 3OA0A 3G7UA 4YRNA 1SK9A 4D74A 5BSGA 1G0NA 3HJHA 1VBNA 4DR2B 5BOSB 1L7EA 1Y7LA 4MQUA 3OFSA 4C7KA 3WYNA 5HJ7A 1ZOSA 5K0NA 3LK6A 4QOSA 3S27A 1JR6A 2Z5GA 4KN6A 3GNSA 1NRJB 4X8HA 4YACA 4LHEA 4N7MA 3R0JA 3C6ZA 1UBLS 2RGNA 1XRJA 4LDAA 3BAFA 5FUBA 4I5IA 1BWPA 3RF6A 4MV3A 2CV0A 2I7TA 2H11A 2XMPA 3IAHA 4MEAA 3HABA 1LV7A 4PNEA 2Q4DA 4HAUA 2AS0A 2XMZA 3TQCA 4C01A 1G5TA 4BHTA 1PV2A 5DNAA 4ZJPA 4A73A 3WNBA 4NZ9A 4YHBA 3N6RA 5CCDA 2TECE 1ZM2A 4MLCA 1VMIA 2YWXA 1B43A 3I53A 4WOBA 3LIPA 3R75A 4NKRA 4ZI5A 2Y92A 2CFOA 4X1KA 4D97A 4ZV9A 4RAOA 1U11A 3G0CA 1GGJA 1U2DA 3A05A 5CA0A 3ZHTA 1C0IA 3BZBA 3PC7A 2Z6QA 5HNKA 3H9JA 5EJMA 3GFVA 5E3IA 4BVAA 2Z95A 5DEIA 2RAFA 1RFLA 2OBNA 2J59A 4Y0NA 1IQUA 5CT5A 3VC2A 3IMKA 3VYUB 2H1IA 1CTQA 1WE2A 2FSPA 3A31A 4PQEA 2WTAA 4NENB 1ZK3A 1QK4A 4HUJA 3FYUC 2QJWA 1I01A 1YL5A 1W96A 1TDJA 4OCZA 2JI6A 2O3RA 4PZUA 1L4YA 2I65A 3EXIB 5JV5A 5KNDA 1PS8A 1K3TA 3CX8A 4HYQA 1E2DA 4CM9D 1F3LA 2WE7A 4EFLA 2PH5A 4KWCA 3W2IA 2VOJA 1FNDA 1PLJA 2Y1OA 3JQPA 3L93A 5IRCD 3HCPA 2N9UA 1SHTX 1ZH4A 3N8IA 5ALDA 3GP8A 4WZAB 5D85A 4DRXA 2FQYA 1P29A 4M53A 1JECA 4M0DA 1M2VA 1XTSA 4OXRA 3GLVA 3N9IA 4BN4A 1VIAA 1C30B 1IJBA 3DLAA 2H1WA 1MZPA 1LLCA 4S1VA 4CDNA 1JDSA 4IJ5A 4U7HA 1KSHA 4OQNA 3E5MA 4UD2A 3RUAA 1F0PA 4R8LA 5JH7F 3ACDA 3L02A 2BHLA 3GFFA 3DDUA 3GX1A 1E9FA 1SWWA 4N82A 3RVDA 4IBOA 1OLUA 1P1HA 4F8EA 3RVJA 2HHHB 5E9AA 3TVDA 3REQA 1Y8RA 3VI4B 4EHIA 5E6SA 1HNWB 4K9PA 2WHQA 1NQTA 1HDIA 1IY9A 1GZHB 1UT5A 2GH1A 2O0LA 3A6ZA 3GCDA 4O0LA 2AVDA 5AJYA 2ZUFA 2EJUA 3U56A 2F00A 5U9CA 1HY3A 3SS7X 2C8JA 4KJZA 3G59A 4DUPA 3X1YA 2D2EA 2H0RA 3NKVA 4A8HA 3SBEA 4BMYA 5EZ6B 4J0QA 1IM2A 3EWSA 4FZ3A 4ZDWA 1MLDA 1JXAA 1GGFA 1YU6A 2G4VA 3F78A 3OQIA 4IV5A 2GD0A 4PX9A 1OMOA 5IJXA 1K4MA 2Z3VA 4MMYB 4Q3AA 3SEAA 4D0GA 5BQFA 2N3ZA 4HVCA 1IM5A 1Z7YA 2FFJA 2I5PO 3L8EA 2OFPA 2XWPA 4OATA 1TF2A 1I4EB 1V96A 2A86A 3BWMA 2JH9A 4DCCA 3WB2A 5EJ8A 4TMYA 1E2MA 1L5RA 2PZEA 3T7AA 4GBJA 2LGJA 4IIFA 2C7OA 4CKEB 4FGUA 1F1BA 1J99A 1N2SA 4MVCA 3WLJA 1PBNA 3IUNA 1MAHA 3DSRA 4UU1A 2OC9A 5IG2A 1TQ6A 3C4VA 5KNCD 1IHUA 3C7TA 1QGED 2Q4OA 4JJ6A 1MB3A 5HRUA 4N1AA 1UEXC 4OU5A 1AO0A 2FU5C 1T25A 3IB6A 2QAJA 3ISTA 1TA0A 1GL6A 1PJTA 4JJ7A 3R41A 4MQLA 1W88A 4WT7A 4TMXA 1O1YA 4HF7A 3QVUA 4W7IA 4Y6GB 3G8DA 2IWHA 3RRXA 1D9XA 3N3AC 1JLSA 5L45A 2FPWA 5F4BA 5BVGA 2UKDA 1MIOA 1KH2A 5DBEX 4WEQA 1U0HC 4JBHA 4OLJA 3ZE1B 1OAKA 4HGPA 1X7YB 3QLTA 4DXAA 5JSHA 5FTNA 3I4CA 4URUR 3OJ0A 1RYFA 5KWSA 4R69A 3KDPA 2R6R1 3DPIA 2Y1DA 3M89A 2J7PA 1FC0A 2XGGA 4HDOB 5C52B 5JJ5A 3G5TA 5CDHA 1JFVA 3BDAA 3RS3A 4EBBA 2G9UA 1C3OA 5TMPA 3AILA 4PZCA 2X7JA 2YWRA 3CYFA 1R18A 5JBIA 1P5HA 1J7KA 1T6NA 4C87A 3AESA 1TKBA 4RZUA 4BFLA 4DJEC 1EDOA 1VKOA 2OTCA 1N5OX 2JRLA 4J0IA 4BNDB 4MHSA 3MUNA 4NCIA 4PX2A 1V1RA 3RVNA 2CUTA 3OCYA 4YJ2A 4B71A 1IIRA 4L75A 1C9DB 5JBQA 2Q1XA 3MT8A 2AMLA 2PY6A 1EGMB 3OTWA 1SY7A 1RAGA 3GLGB 2CK3D 4QATA 2I4LA 1L4NA 4O2AF 3TRJA 5ITZB 4O2LA 5HIAA 2BFMA 3K20A 3ZUGA 4Y18A 5TX7A 4XYLA 3DF7A 2WDZA 1F8GA 5DM70 1Z38A 1FQWA 1G21E 5I7UA 1VJGA 2IW1A 2ENUA 1U0BB 2V9CA 3MLAA 4FYXA 1QIFA 2J4FA 4DFDA 3S6JA 2DT8A 3ZBUA 1C7IA 3WBKA 1U5BA 3T3MB 3LYLA 2XNSA 4EO7A 1W8IA 3ZZ1A 2ZUEA 2I6GA 1K9VF 1RLOA 5CTJA 1MQ8B 1PNQA 2NU9B 3M83A 4OQ4A 3U5TA 3M1LA 1U9ZA 2VZ9A 3NRJA 3A32A 1GCUA 3AINA 2J9RA 4DYVA 4C07A 3I72A 4M6WB 4QPJC 4PHGA 3KZNA 5A02A 3ZXSA 5KKNB 1RJ9A 4O29A 5ARDA 1Z4NA 2FR8A 3K2QA 3BKXA 1Y5MA 5ALMA 4CIBA 1O96B 2BELA 2YIDA 1WMBA 2WSIA 3OLCX 3QE9Y 5E6RA 1ZU4A 3NASA 1TZKA 1ECFA 4FYMA 1WXDA 1A9ZA 4QXOA 2V7QA 3TNFA 1B3BA 1ZN2A 2ONYA 4E09A 1BMFA 5CXUA 2QJRA 5D84A 3WKDA 2CLKB 1EEXB 1QH0A 1P9WA 2ZPTX 3U7QA 3AT1A 4EI2A 4A8PA 3HZHA 4QXPA 4V0MA 2JKVA 2QPLA 2FOXA 4DQ0A 2YVQA 1V9LA 1LI7A 2XOKD 3G0BA 3VPSA 2ETXA 3NO4A 4RPLA 5CBPB 2GPYA 2HIHA 2NTNA 4ZVPA 4U2BA 5BN4A 3R9XB 3OX3A 2NZ8A 5HUQA 1WXFA 1E9BA 3IGFA 1NN5A 3WK6A 5CA0F 1L5WA 2BRUA 4P84A 3B1ZA 3FHLA 1IH8A 1LA2A 3KUUA 4OAOA 3EQ8A 4NATA 2CZGA 1GTL1 2P41A 4DA0A 1ZVVA 1L0BA 2O1WA 3I09A 3JQGB 4F0JA 1JEQB 2WJHA 3AEUA 3TVTA 1E1YA 1JQJC 5TRTA 3KUXA 1GR1A 5JAMA 2GASA 5IKOA 1A4IA 4KDFA 3GBSA 4OHPA 2VXBA 1T2CA 3IX7A 3O93A 2IU4A 4FUTA 4JJFA 4V1CA 1MX3A 3WKCA 3GJSA 3OOHA 4IDFA 4OMCA 4IKOA 3CVYA 1JDUA 2QZ4A 4PG7A 4Y6SA 4KFSA 2IIVA 4IOJA 1Y1KE 1JI3A 2JF0A 3IS3A 1H5QA 3PXGA 2JFBA 1KGDA 1LFAA 3CW2A 1W36C 4H1TA 3IH5A 4O0MA 4ZOLF 3SHWA 4AZ0B 1LI4A 1DIGA 2A7XA 3N2NA 1SUSA 1GQYA 1PX0A 3KOXA 5FBKA 3ZU6A 3N74A 3VMMA 2J0UA 1HQKA 4NNJA 1U8TA 1LI5A 4EI8A 3KPVA 3QE2A 2PLWA 3QKRA 2HDNB 4YV7A 4AMBA 3A11A 1CQIB 3U9LA 5H0IA 3F4LA 5F9HA 3N53A 5CM9C 5JS6A 1EFPB 3D4BA 4OLHA 4ZOBA 3W90A 4G9GA 1TO1E 3CMCO 4N0MA 1ZY2A 3QVOA 1XROA 4XVRA 4L15A 2IYUA 2WMNB 3WGKA 5LVAA 3O3CA 4M8KA 3GJZA 4RV5A 1GP2A 2PXXA 2DQKA 4WXHA 1H4QA 3BPSA 1PDWA 2H4ZA 4Z51A 4WY2A 2N42A 2J0SA 5KJ1A 2WTNA 3V32A 4IWXA 4AZSA 1W25A 1FNCA 3L77A 1OCEA 1B93A 4B34A 3F1KA 2H0QA 2Z8XA 4XLTA 3K0EA 3TFQA 5A4MS 2QK4A 2Q7XA 2ZE6A 2X5KO 3CIFA 1CV2A 2LPMA 1N2IA 1P7YA 4WD3A 3UOWA 4B0PA 5KOYA 2ZLBA 4MKGA 5KYYB 2QTWB 3T95A 3TTVA 1XZBA 3NB0A 1BE1A 4RY0A 3PX7A 1J21A 3OFKA 3M9LA 3ZD8A 3GDFA 3T7TA 2Z3ZA 4XUGB 1W6RA 2FR1A 3AEQA 1C1DA 1UAGA 5E2AA 2FP3A 1QYXA 1NBAA 4RGBA 1QC5B 1WSDA 3G0DA 1GSHA 4D57A 4QNRA 2Z8YA 4KPFC 3TW4A 5IU6A 2WYHA 5KSWB 1E7WA 1NW5A 4IICA 4O4HF 5EGNA 1Q74A 2MOKA 4PSUA 1R8YA 3BQ9A 3PGMA 1I3OA 1BNCA 1DB3A 3PPWA 4FINA 3LG2A 3DMPA 4KLNA 5L7WA 3L4EA 2OV4A 3K30A 3NOXA 5DHFA 3E9MA 3EE6A 2XE6A 2XLCA 4FC6A 1T2FA 2OSBA 4RHYA 1GPYA 4DUGD 4G4GA 2NQ2C 1OFIA 3LT1A 3V97A 3WG9A 3SQXA 4IDPA 1G8YA 1RYDA 1XA4A 2I1LA 2NXWA 3DD1A 3DDWA 3LXUX 4LAFA 1Z83A 1BG6A 4DLWA 5C5EA 5JCZA 4OLAA 2XSZD 1TAHA 1EM8A 3IJPA 2AK3A 2CLMB 3HCOA 3PPXA 4IS3A 2JIZD 1IZ0A 2R44A 3CX4A 3GN2A 5FOUA 3SYRA 1O97D 5NULA 1MTOA 3W06A 5IWCA 1KO5A 2VH2A 4QPCA 1UM9B 5DASA 3GEDA 1G20B 1KI4A 1PTKA 2E37A 3O8NA 5KU1A 1NX6A 4KVAA 1J97A 3B52X 3L0PA 4HG2A 1V39A 2PVSA 3GLQA 3EZ2A 3IR7A 3NTOA 1UMCA 1CUGA 1XPRA 4G65A 3PEYA 3KYCB 4KAAA 4X8MA 1X7ZB 2QG9A 3LDUA 4MW1A 2D06A 4XUDA 3DOJA 2WSBA 3L18A 1JG6A 5H80A 2GEBA 4PTYA 1CS0B 1SG6A 1WP4A 2ZYTX 4BFUA 3F4BA 3UH0A 2VSFA 1VLHA 4HZIA 5J2UF 1PIWA 4DKXA 2ZBQA 2Y9PB 2JEYA 2Q9BA 4PGFA 3OOSA 5BQ3A 2IX3A 3LO5A 5CB4B 1PLKA 4GOOD 2I2WA 3B1KA 2GBFA 1Z08A 2ONZA 3B1JA 4HWTA 4XJVA 5AVWA 4B8WA 1QYDA 4M1YA 3RTCA 5B1IA 2B92A 2H1LA 2XVAA 1P1CA 3OEEA 1IDOA 5TDHA 2OV2A 3HBAA 3QFSA 1WF6A 4B3BA 4A1OA 4B9EA 5JALA 3T1HB 2J48A 4YCJA 4ZALA 3HL4A 1RMYA 3ZW9A 4CYMA 4UTRA 1QJ4A 1COZA 4KIFA 2B2CA 1NZDA 1E1DA 3NC0C 4MV8A 4ZJUA 4RQUA 4NU0A 1LPAB 1IQPA 1PR4A 2FX5A 2PWBA 4M7OA 2OY0A 4DXHA 3JASB 4CM6A 2EBUA 4ROSA 5D00A 1XAGA 3DZIA 2RB5A 2VT6A 1OU4A 4RESA 1P1FA 2OAQ1 5HCUA 5B5SA 4HADA 4QUJA 3EIOA 1ZAYA 3NZEA 3TRKA 3ASUA 3IIJA 3NBYC 4CKCA 4QU9A 4EZIA 2JAPA 4G4SP 4EJ6A 3EPRA 1A7AA 4HEJA 4BV3A 4F5YA 4IQGA 3TOVA 1P1BA 4CMBA 5KYNA 3TR0A 1F0KA 2KSQA 4YDSA 2P2DA 4AM8A 2OBYA 4D3ZA 5CPFA 3FTNA 1QZTA 4IXTA 1L8AA 3AZQA 3W2EA 5ALHA 3KSBC 3OURA 5AYVA 4N48A 3MGAA 1R12A 2HK7A 2WD9A 4RQBA 5AOCA 3V34A 3ZE7A 4BV8A 1E77A 4J9UE 4JLUA 5EZYB 2O8BB 2BUAA 3KKEA 1Q2UA 4Y2VA 2H4WA 5H02A 1FMTA 1K2VN 4X65B 2YOFA 4Q3CA 3TH5A 4OLFA 4S35A 3A1WA 4PPNA 2BFCB 4Z7QB 2LZ0A 2PEYA 2Q0QA 3R40A 2Q5QA 4BTVA 2ZT6A 1N2XA 3OUUA 5ICMA 4Q4CA 4IH1A 3H2GA 4FPXA 3E4CA 2XRYA 4D4GA 3EIHA 1KNQA 1U0NA 2FGJA 2FHSA 3CA8A 4HAWA 4MQ4A 4OP2A 1CB0A 3N2IA 1SG9A 4IIVA 1FZQA 2RGNC 4PN7A 1ZC3A 2BVNA 3G2QA 4W7HA 3TCKA 5AKGA 4EF5A 3T1OA 3P2MA 4NDNE 5CA1B 4JUIA 4ZAXA 3HPRA 4YXFA 4WBNA 1YZNA 3FVQA 5AXDA 4BB5A 2JJ1D 3WJ2A 2BJWA 2J45A 4LCEA 4GOKA 5DEOA 1QANA 4IXMA 4RHEA 1ZRSA 3FJYA 4ONEA 5DK4A 2DFTA 4YRKA 4MR8B 1XMSA 1SZCA 4CLDA 4BFSA 1LLQA 1V7ZA 1A77A 3C6KA 2VYND 5BQOA 1XTZA 1KYQA 4R0VA 1LNSA 3GFOA 3LUPA 2R1VA 4P58A 4R81A 2IWRA 3D3WB 2Y66A 3WP0A 1OA1A 4MKFA 3ZV3A 2H54A 2X3UA 3PJEA 1N3BA 1CFZA 1NT2A 3L06A 4ML3A 3EGXB 4MK4A 1CD5A 1LRKA 1CEEA 2FDRA 2PFGA 3QVMA 3THXA 1XNRB 1F9EA 1GSAA 2HQRA 1H6CA 3BMXA 1SURA 5JNWA 4QUIA 5KDDA 4WKNA 2G71A 2WJ4A 1DC8A 1E3WA 1F9AA 2AJDA 3OIGA 5BY2A 1R6BX 4FEEA 3M6FA 4BX0A 1HFEL 3F3MA 4CNQA 4P7KA 3P1JA 3D3QA 1U0GA 2CVQA 1EFRA 3C8ZA 1YJAA 5KIAA 1YXMA 3H0EA 4H4DA 2BFBA 2BPOA 4JKOA 2VTVA 1PX2A 3FPAA 4L51A 4S2UA 3SKVA 5ALVA 4CMEA 5E4JA 3D7MA 3MD9A 2J09A 4P32A 1SHKA 3BGOS 4FBMA 4BWFB 5JZSA 4DWVA 4JB2A 1O77A 3H1PA 3P0FA 2PR7A 5HKBA 5KCZA 1ZM7A 1WB4A 2XQFA 3KYDA 2Q9UA 1XTPA 5JVDF 3SSMA 1U4OA 4Q34A 5JROA 2F8TA 1VXRA 2RHLA 2RHHA 4NJEA 3WZMA 4JU8A 4KTTE 5EFOA 1G7TA 5JLAA 3ZG6A 3JATA 1Y9EA 4QODA 1YSCA 2H08A 2YASA 1YOVB 4GPIB 4B2YA 2E82A 6REQA 1M5RA 4G37A 3QX7A 3P97A 4G5FA 8ATCA 1XVAA 2R8YA 5HEKA 3HFJA 3ROZA 5IJ0B 3GZNB 2J0VA 2O06A 1T3ZA 1FFSA 1GZUA 4Q9HA 1CUYA 4PYMA 4KODA 4X64B 4EJMA 3LDAA 4AKHA 1DC3A 3MT7A 4PYLA 2VJLA 1VYHA 1NVVR 3MSXA 1XZQA 2JIPA 2QW0X 5AJHA 3WDKA 4CFYA 2RAVA 1OX4B 4P4LA 3DNPA 4XSGA 4JLOA 5JZBA 3PNYA 4C3VA 1J07A 5EUMA 1XXHB 3OQJA 1GUFA 1P4SA 3F6SA 4XD7D 3IDZA 5CLHA 1NVFA 4DA7A 5J1SB 3QLVC 1ORHA 1LUAA 1X1EA 4PF1A 4GZMA 2ZJ4A 2WWIA 3TINA 1MT3A 1ZIOA 2XWJI 5K3FB 4C30A 2IS2A 3BJIC 4ENSA 1BHJA 1GLNA 5LM3A 1FIUA 4WNIA 2J6CA 4D79A 3UWOA 4DA6A 2R25B 1W36B 2IYPA 5HS4A 1Y3CE 3ZOZA 2C9BA 5CG1A 1A1SA 4E4YA 1EFTA 1YFKA 2QZSA 3UEOA 4OX9B 2FQ1A 1YE3A 3U2QA 4E5DA 4EITA 4KLRA 4X6LA 4JSRA 3LHSA 3R7LA 4ALLA 4R7ZA 3OPNA 1OC4A 3CKYA 1DAOA 2O1SA 3EEIA 3P96A 3RE1A 5EP1A 3ZTTA 1JDPA 1OV6A 2ZYGA 3AETA 2GEVA 4AAYA 3KSAC 4Y2QA 4ENWA 2CV2A 4HYEA 2IYZA 3OMXA 4A0SA 4G8DA 1JHMA 4WEOA 4D3YA 4NH4A 4DCPA 2H1OA 4TKVA 3KQTA 1FRQA 3WBFA 4RACA 2O8NA 1HG0A 1R4ZA 2ZYUX 2JBAB 1U1FA 5EY5B 1BDMA 4BVBA 4JLWA 3GH3A 1YAJA 1PFUA 2WF7A 3P4UA 2GN4A 4FQ5A 1RWMA 1XX6A 1DNPA 2W6QA 5HUHA 3ROTA 5EEGA 2EKQA 3O8OA 2PGOA 3DMGA 4UCWA 5C5DA 3U3DA 4MVJM 2J3IA 4PZ9A 3UJ8A 1N2OA 3T9FA 3COJA 2R79A 3BIWA 2ST1A 1K66A 2DQ4A 4CQLA 2MDTA 4ARCA 4NESA 3HUUA 1ESZA 4UHBA 4DMRA 5C4MA 1Z29A 2BCJQ 2WF8A 3ELDA 3H3JA 2SNIE 3ZCUA 1ISPA 4HGNA 5BNTA 3GJXC 3FCEA 4ZVSA 3ANXA 2RHBA 1JAIA 4ZZ0A 2D54A 3BMOB 4K03A 4UE2A 5AWFC 2J08A 4EENA 2Z2ZA 4OXIA 4BXOB 3H6GA 4C0SA 1LC3A 5HFJA 1CQZA 2CXXA 5C8YB 1EK5A 1NXQA 2CFSA 3ABSB 3NTLA 5I8WA 3PI7A 4ZYYA 5JH7B 3CRMA 2OFWA 221PA 4JYAB 5DNUA 2JLBA 3R74A 1DFHA 3KEOA 4M22A 2J3QA 1J0BA 5EC8A 5EYPA 1QO7A 1COWA 2OVBA 4GOND 2HJ9A 4Q16A 3EZLA 1NHWA 2WKQA 4PC6A 2GAJA 2YJZA 3GCZA 1AHNA 4BGUA 1EUYA 4MKIA 2VHEA 4HATA 2NU6B 1M2GA 3HHPA 3ID6C 1GXSB 3RDPA 4XVCA 4PZYA 1MAVA 1DIOB 1H8HD 1FNSA 4G4JA 2FR8C 2CNBA 4OAQA 5HBGA 5AVXA 2DWPA 3F8WA 5BW8A 5ITWA 3T8YA 1HUQA 1SO8A 1WOMA 5K8JB 3RWOA 2WWTA 3PDUA 4DQVA 1XCOA 3Q3CA 3Q87B 4RKQA 1P17A 2BI8A 3DDZX 5HZMA 2FSFA 1LX7A 2GHQA 1DCTA 2FTKE 3TE7A 3FUCA 5K45A 4YLYA 3F6EX 2DY0A 3I0ZA 3RBXA 3TJRA 7ADHA 4MVYA 4Y2GA 2J85A 2NW6A 1N2CE 4E6PA 5FYDA 3RIMA 2DLCX 3PNKA 4MX8A 621PA 2CNKA 1Y98A 3DVSX 1A88A 1K7EB 1BGWA 1SD5A 1Y6ZA 2UZ4A 4BGEA 1JG1A 3GFTA 3KKPA 1NQWA 3DVAA 2C96A 1QQ5A 2XQKA 4HDQB 3MUOA 2YVKA 3OJWA 3E3NA 1O95D 4LYYA 4C2AA 3HTXA 2QN7A 1RWVA 2PK3A 4ER7A 5LQKA 4NV1A 5DTMA 1QKIA 2AR7A 2I71A 3LBHA 2BRUC 2FWMX 3C3DA 4GRAA 1XVIA 3LOQA 1C14A 4YAGA 4M86A 4JVSB 3IUQA 2R84A 4BEBA 3KFLA 5K0SA 1BH6A 2P69A 4G4SO 3W3ZB 1C2TA 2O48X 3T34A 3TK1A 1OZHA 3WNZA 1YRAA 2V5AA 1JNXX 3HP1A 2GD2A 4ZJYA 4FE3A 4JCCA 4CCSA 3DZFA 2HN9A 1ZJ5A 3GG2A 4IJMA 5CBKA 4W5NA 3UW1A 5CEEA 4HBGA 4OYYA 3BQNB 3TDMA 4O33A 4QJIA 4AUNA 3AUUA 5F2OA 5IXSA 1KFKB 4IVRA 1U0JA 3FPFA 4NZYA 1G5HA 1C2YA 3QF4A 4M1WA 4KZPA 1SB8A 5AQEA 3RBVA 1E64A 1V2GA 4JI1B 3P9RA 3C87A 3L8FA 721PA 5FPKA 1NNLA 1JDNA 3KYBA 3ETHA 2VK8A 1JQ3A 2DKNA 1SUAA 5REQB 5DOZA 3WQHA 4NG4A 2EBWA 4ZWNA 4UFNA 4TQUS 5F73A 5FHRA 4AZ3A 1QIJA 1AS2A 2P6UA 4HFJA 4I36A 2QIPA 1X14A 2NGRA 5IULC 4Q82A 5BV1A 1V71A 3N0TA 3WK9A 1ODLA 4BBZA 1P45A 3KZCA 4JXZA 4BRSA 1N33B 4PO8A 5D6OA 4ZN6A 1HPLA 2OPHA 1RJDA 3ZUPA 3AG6A 2PUCA 3DP9A 2UZ3A 3NHYA 3PC2A 1EE9A 2R2GA 2TS1A 3A3PA 3IQWA 2WJIA 3M4YA 1BD4A 2EIXA 3RGWS 4CTJA 3CH6A 3ITEA 3A4TA 1GA6A 4A9AA 5FWYA 1EJ2A 2ZAGA 3C7DB 5FNVA 3AVWA 4CLXA 2YC4C 4LDJA 4GEGA 4A7PA 1UBFA 3W9BA 1GAEO 2A4KA 4WFKA 2FZCA 2GCOA 1SXPA 2HJRA 3GF4A 3PITA 1S3GA 2VVTA 5JCXA 4JAVC 3W05A 4M9SA 4D0NA 3GJQA 3C8MA 1FRNA 3L7OA 5FI1B 3QGMA 4RJTA 4XM1A 3J81k 1CJVC 1XHFA 3QKIA 5IHXA 1JAZA 4Z1MD 1ZGBA 1RXSA 2FFAA 3PWKA 3OE4A 1CF9A 3UB4A 1KO1A 5AVSA 3S8MA 2QD5A 5CW2A 2V6GA 5B4UA 3THYB 5KNCA 5DHUA 2OHIA 4MAFA 2Q1UA 4I9GA 4N8SA 5FLEX 4EPTA 4RM2A 3MPOA 4NPAA 2KB0A 1E0SA 3AHCA 4MVJA 5H3LA 2H5EA 2GCIA 4B31A 5L95A 2ZQYA 3V1YA 4BO3A 5BV7A 3L0SA 5CFRA 2FUCA 5FO0A 3DEAA 1XEFA 2IPNA 3ECAA 4BLVA 3TF5A 4D9MA 1VSVA 1XZHA 2E4YA 3TJZA 3RM3A 4LUCA 2NZYA 1XNJA 4QFMA 4YT5A 5F33A 5IVDA 1QCDA 2C84A 5BQXA 3WR5A 1T5BA 4IMPA 3IAM1 3DE3X 1I4TD 3QTLA 1DAHA 4L7QA 1RQ2A 3VPHA 5JARA 4IHJF 3V7WA 4O3FA 2VN8A 4KQCA 4X1KB 3SWWA 3HR7A 5D5HA 2W2MA 5CA0B 4F11A 4YFYA 2CMGA 2JHFA 2PEZA 3L5OA 4UEQA 3EW9A 3H19A 3KKQA 1DTEA 3FWHA 1TXGA 2H0AA 3FNRA 4JENA 5E7QA 1Z16A 5BW6B 4B40A 1HFKA 4DLSA 2JA1A 5EJGA 4GGOA 4KQXA 3DLHA 1BE0A 4C7MA 1P9NA 4W63A 2OXRA 2PZLA 2F1OA 5FOQA 3LC0A 2H92A 2EDAA 5A5FA 1VC2A 3DA8A 5JSQA 1J70A 2CB0A 3T54A 1ZI8A 1SPXA 4BEWA 1P0FA 3B85A 1SELA 4M89A 1W35A 4L4UA 2NO7A 3IAFA 4YRZA 3F2IA 1EPUA 5LZ7A 1D1QA 4YR9A 3U62A 2JJYA 3EH1A 3EH2A 1L5QA 1KDVA 1ZXXA 2OC4A 4JLAA 2XF8A 4UUOA 4DBLC 1SUEA 1T6ZA 2DH6A 2XUHA 4D9NA 4EJ2A 3KKOA 1I0ZA 2IZ0A 1GN9A 2M9MA 2L18A 3UFXA 5HTKA 4YT4A 1O3YA 4C4ZA 4DRXB 1C4KA 2R7MA 3HGTA 4TYPA 3BG5A 4N65A 4NPCA 4E22A 3HJFA 4LF8B 1K75A 2I22A 1O2DA 4GQAA 4Q00A 5BSMA 2WKRA 3QU4A 5HYVA 1N0WA 1AKWA 2PYIA 3EHDA 3KZOA 4MGIR 2HWXA 3GLFE 2P9BA 1NMXA 3L7YA 5E6UA 5A7GA 2C8KA 1NBIA 1ZCBA 1Z4QA 2D2FA 4RHFA 3VGJA 3O0TA 4G86A 3REQB 3KSDO 2X8LA 2IVZA 2NWQA 3WLRA 5IT9A 1HQDA 3I64A 3ZGLA 5ALLA 2Y05A 4DR7B 3WQQA 3EG9A 4PFQA 4BNKA 1O4VA 2C20A 2PPVA 1MJNA 2XUOA 5T4FA 2GM3A 4DWWA 4EB3A 5LLDA 1IBCA 1XAHA 4EJSB 3BB3A 3CKKA 4JL8A 2HZBA 3UWKA 2X0DA 1W5FA 2DJIA 5K5EA 5MDHA 1DEOA 2Z4TA 1L4LA 4Q4JA 1ODSA 1I7SB 4FXOA 4LPSA 4X45A 4LI3X 3K2IA 1PSWA 3NWJA 2VO1A 4B8YA 1IY2A 3IESA 5FUVA 3ZX4A 3M4JA 4L4ZA 3BZUA 5LP6A 4B3XA 4NU6A 3I01A 1V8BA 2X77A 1E4EA 4OL9A 3RWBA 3VYWA 1E2GA 1KFEB 2V45A 1Z0IA 3R7WB 3IB3A 1FSFA 3K9QO 4Y9RA 4CM4B 5LBIA 5HQ3B 2GF2A 1ONSA 1TT5A 4ZMBA 3IC5A 2FZVA 3RGGA 1G7RA 1G18A 1CIVA 3ELWA 2CBZA 2AWNA 4ZXPA 2O3QA 3EZ9A 4MTCA 4JCOA 1S2IA 1ZJ6A 2AE1A 1I94B 4DIKA 4TLCA 1JUDA 3WZ2A 2GESA 3JWHA 2GAOA 1IG3A 2GHRA 3DKPA 3DLPX 3O3MB 4R2WA 5ENZA 4A4DA 4PFKA 2ODWA 4O4HB 3H17A 4PW0A 2K2QB 3ETLA 4XWTA 4EGSA 1W88B 4FJ2A 1JDJA 3CE9A 2OBXA 5BYBA 3O84A 2WWWA 5JO0A 2WP8J 4CL2A 5K01A 1YAHA 3KPJA 3U3JA 4C4SA 2IIPA 3TD6A 5FEMA 2QRGA 5BVGB 4BVGA 1IY0A 2FF5A 2GNOA 3AIMA 1MXFA 1H8EA 3B1FA 1U0EA 1GNSA 2FPIA 2GCEA 4G8BA 2ANCA 3P0IA 1AGRA 2YBDA 3K35A 1EYZA 1B6TA 1AQLA 1ORIA 2Q1TA 1KP9A 1XFAA 3CBQA 4ZV7A 3ONWA 4MXDA 5KTNA 3RYIB 1DO8A 2R8BA 1BVRA 1OGYA 3O82A 3M3PA 3C85A 3EIEA 4OB7A 4D43A 4BLQA 2P4QA 4MQMA 2H2GA 3KXLA 3VX3A 1U63A 1UDAA 1YD7A 2HLDA 3D5QA 1EVQA 1XRRA 2WT9A 4UHEA 3T3OA 4ILEA 3D0RA 4S3MA 2CSXA 4D0RA 1ECGA 3DDSA 3IURA 3Q7RA 3U3OA 4QWMA 1YJBA 2BCGY 4P5EA 4LFAB 3H7IA 4LHVA 2GN6A 2YWGA 4PLZA 1USIA 1H66A 1P2SA 3FZYA 3GLTA 3MJSA 3U4IA 5H68A 2WB2A 1K0UA 5TS2A 2DSTA 4WK2B 1ACLA 1HZZA 2JZCA 1A5ZA 1CUWA 3SXUB 5HGXA 3KHUA 3QELA 3ZD6A 4AWBA 3T5BA 5J2UB 2H4JA 1OH6A 2HA0A 1DV1A 4YIHA 4GZLA 4QGGA 4DZTA 1FFBA 1U5BB 2Y1LA 3CEHA 2YW9A 2O54A 4KAXA 1PGNA 3I9V6 1E3EA 1DEAA 3OX1A 4B75A 1JF8A 3TB4A 3BL6A 3FSGD 4ZYWA 3CF4A 4HHEA 4BVJA 1M5UA 4DV4B 2YYSA 1JDVA 4OHRA 3I42A 4CIAA 2FI1A 4L0MA 5JAUA 3TUZC 1B23P 4FFDA 3CBGA 5IASA 1WUTA 2B83A 3MGKA 3H5NA 3K7EA 1FJGB 2GK6A 4Y2SA 3TQIA 2EYUA 3EODA 5I9TA 2L19A 3S5JA 1YQ9A 4TYWA 3H3XA 2EXXA 2ZJOA 3E70C 2WUGA 3OM8A 2I66A 2VZ8A 2QMOA 3MAAC 4HH1A 5DH9A 5HFAA 1U02A 4JS0A 2IH5A 2VBIA 1PVVA 3WK5A 3WYGA 1S0UA 1DQSA 1B8NA 1SKYE 5EKXA 1E69A 3M4NA 2VNSA 1ADCA 3F97A 1I3MA 1C3VA 2OHVA 3HO8A 7MHTA 2AKAB 1XQVA 4XARA 3UUWA 1N92A 1QRAA 3NFYA 4LXIA 1FVFA 1JQKA 3QIAA 3LW8A 2R1TB 2XKAA 5EJ5A 1PNOA 3LT2A 4K88A 3RFXA 3TLZA 2WMDA 4KH1A 3WDLA 1CB7A 1VFPA 3EY4A 2JIZA 2YUIA 3OICA 2AR0A 2D1YA 1E61A 2B98A 3FZEA 3HJGA 5KS2A 2Y3IA 5JSUA 2G70A 2MYPA 2BMVA 1KEUA 2ZAMA 3JR3A 5BN4B 4GX2A 1EVLA 1CUXA 4J2TA 5K8UA 1JKXA 1LS6A 3DXZA 3FWKA 1KO4A 2ZM6B 3E7PA 1XXLA 3U81A 3KOOA 1SWVA 5C8VA 3KXIA 4EB8A 2RGGA 4X8OA 3HS3A 1CNFA 1GCOA 5KVQA 2VSQA 2NYUA 3BGSA 2H31A 3FJOA 1U80A 4N03A 4MRAA 1WB6A 1II8A 2ERXA 3LY9A 4NU5A 2ZRCA 3HNPA 2OCAA 3PNQA 4UCFA 4ZI3A 2BEVA 4J16A 1PJ3A 3RK0A 4LCBA 1JLLA 1PF7E 3GAMA 1B8VA 1T5OA 3PEUA 4D6YA 4HEA6 1A8PA 5ALSA 1BMQA 4TMWA 5AW7A 3ZX5A 1XZKA 3K6SA 3IIEA 2J0UB 4MJXA 4NU8X 2GPSA 3ROKA 4FI3F 4PPYA 1IE3A 2AI3A 5DHPA 1UXGA 5GJCA 3QKRB 3U1VA 4BWYA 3A2LA 5BNFA 3HM2A 3N2GA 1AQYA 1VSTA 2DWCA 2DKOA 1OLXA 4LWZA 2R1UA 3CUVA 3SSAA 3PPIA 1UMKA 1CEQA 1DQRA 2PBLA 1HI9A 2CW5A 4PRKA 2L42A 4N0DA 5EJ4A 4G0NA 4JC0A 3H2IA 1KI2A 1MA0A 3LVFO 3C74A 4J0JA 2R00A 2XE8A 5DW0A 4U6NA 4YRJA 5E4FA 2HKIA 2YJ4A 1W85A 2AXNA 1FVOA 3T7IA 3W8NA 2EOAA 1SXGA 2JI7A 3A4IA 5M29A 1UFVA 2VPYA 1X8LA 4D81A 3KXDA 3K71B 3QBDA 1SBZA 3MT0A 3RRJA 1Z39A 2AR9A 3EQ2A 1E2LA 3AY7A 4R05A 3LECA 1NJ5A 2H1CA 3PNVA 4G56A 4YONB 1QR2A 1Z0KA 1RP7A 3BMCB 4K0KB 1QLJA 3L1HA 2IHVA 3QUBA 4KWTA 4EMBA 3PF9A 4ISCA 4CE6A 2GZAA 4IMRA 4BZWA 2XZOA 3C7KA 3TTXA 2ZGVA 2I1WA 3AHDA 2G77B 1F2UA 1G1AA 2GK4A 3PD0A 5DGDA 2EBFX 1UMDA 4D4KA 1Z6AA 1FCJA 2ZJAA 1TCCA 4ACAA 2OLJA 5K6AC 2VHUA 3I9FA 4L3WA 1WEKA 3DTVD 4DLXA 3NNNA 2FDXA 3BGIA 2ET6A 4A6DA 3H8WA 2WF9A 3L1IA 4OP1A 1TLTA 4AKTA 4EMSA 4EUNA 1NVVQ 3RSHA 3M2PA 1A96A 5JVDB 4Y2HA 3IEVA 2O2DA 4HUQB 1CUJA 2BHNA 1HNNA 3I6QA 4LJLA 3TTTA 3AC0A 4Z9BA 1D1PA 4H3KB 1R6VA 3PRHA 3SHVA 1EUDB 5BV2P 1NQOA 3SOPA 1L7DA 4RK1A 2AOTA 4QOHA 5AM3A 1NAIA 4IJ6A 1PJRA 1P4JA 2JCBA 2XB9A 2PVCA 2XBLA 4JEHA 4Z86A 3SFTA 2JLYA 3NORA 3FNFA 3KHKA 5A0FA 1Z6TA 2C0PA 1EM8B 2Q5JA 5AD1A 4Z3OA 1AH2A 3TEJA 3RLFA 3ZCTA 4W82A 5DKFA 4FWIB 1Z9BA 2VRWA 4BO6A 4EHBA 3ZOKA 2YMMA 3LA6A 2EW1A 3IQXA 2QBYB 2C5LA 4HQFA 5IT5A 2VYNA 3ZU4A 4URHA 1J8VA 3T9CA 2P5UA 1PE0A 3L7DA 3NHRA 3GJ6A 1CZUA 1KHHA 4D25A 1WKVA 2NSDA 5HK9A 1E2IA 5BWCA 1QCCA 3E5RA 1XCJA 3EIWA 3CNNA 1OWNA 1NXVA 2QN2A 3WIBA 1KQGA 1IRXA 2R6GA 3HY6A 3ND9A 4TPKA 1BWSA 1Q1AA 1XRQA 3VO1A 4REMA 4PHCA 2ZUDA 4HVAA 1P4AA 4L8VA 4D9GA 1HYEA 3AHIA 3Q5EA 3AJAA 2IEIA 1FEZA 1JXQA 1H0KA 2EEZA 3KEMA 4MLDA 1PR6A 5DOVA 2D2XA 2VSXA 1GILA 3BIJA 5DM2A 5CXXA 2YINC 4A8TA 4BCCA 2GZMA 3D4LA 4FQ8A 3KD3A 2Z98A 1LQUA 1K6JA 5A5EA 3DW3X 2DVMA 5TQ0B 4NAUA 4EB0A 3T5CA 4J49A 1JDBB 2YS7A 2C59A 1JFFA 1UKVY 3IOYA 2DWQA 1BQEA 2HMYB 1NY6A 3KBOA 4Z9XA 4CMAA 3K15A 3EZXA 3I2IA 2CD9A 2RMKA 4PM4A 1QYWA 2I7DA 3R3SA 1QVVA 2IY8A 4N5DA 5G40A 3CB2A 2VF5X 3L0BA 1ZGCA 4PQFA 4B74A 3DWFA 2TMGA 3GAZA 5HKAA 3GA7A 4C29A 3NDJA 5JTUA 3VVMA 1SUCA 4R9SA 2AG5A 2ZTSA 3D4PA 3G5MA 4QOFA 4TSFD 3IEUA 3VYRB 2O8DB 2ZTMA 3GV0A 2JCVA 4HXFB 3LGAA 4Q66C 3E5NA 5DN6A 3O4IA 3TLBA 3GVPA 4ER6A 1Y5NA 3HK2A 1ZHOA 1NYTA 2FW7A 3DOIA 1CP2A 3MAJA 3QOXA 3V3KA 4AJKA 4KVZA 4BPRA 3SDZA 3PQEA 2FQQA 4NC9A 1E6LA 3IVMA 1QCYA 1C7RA 4HDNA 2BGWA 1PJLA 1E1RD 4BZPA 3NXKA 1CZHA 3PD1A 1Y6GA 1JJBA 3H4TA 1BYIA 1GL7A 4I7EA 1A7JA 1RRGA 2WTXA 5HRAA 1LQ2A 1QNLA 2SHKA 3MWEB 1BDBA 4MRMA 3V4SA 1L5SA 2BF4A 1RHUA 1CVIA 5KTPA 4OYHA 4Y1RA 2JVIA 2OK8A 2PZMA 2QXYA 2W2QA 3DH0A 3R77A 4L07A 4RA6B 3T9EA 4BMDA 1L6IA 1X70A 2JRCA 4UZFA 1MV5A 1V7PC 4XX1A 5TQ2A 1NPYA 2QN6A 4PCUA 3RROA 3TMAA 4DVJA 1W7AA 2CLEB 4LYGA 3OE7A 3VO9A 2JHCA 4XE5A 4ZEWA 3G13A 2QENA 1UJBA 1KE1A 4LXQA 5F1YA 2EWWA 5J2TA 4D9IA 3BXEA 2V7EA 1EFDN 1KDOA 2B21A 2JGKA 3GJ8A 1QVWA 2MU1A 3VOTA 1TTTA 5CJJA 2B4QA 5MFPA 1ZCAA 4Q3LA 4UW9A 1B0AA 1HH4A 4K3VA 2PSSA 5CB8A 5JDIA 4D26A 5AOVA 3K1AA 1WU7A 1TU4A 4YASA 1GCIA 2YHIA 5LD2C 3NUZA 2GBPA 5T6MA 2FUEA 3WJ1A 1CWUA 1YT5A 4QKQA 2J9ZB 2VG8A 4UMDA 2UU9B 4D6XA 2ZAIA 4BGIA 3PTAA 2CCJA 1VMDA 2WHEA 5EHQA 4AP9A 1EP1B 4P83A 2N1MA 4MI3A 2BEUB 3NBUA 5JHGB 3IAS6 4I14A 1GT6A 3ZY4A 2AFHA 1USUA 4YXWD 3FETA 2FV8A 2J46A 4IH4A 4NJMA 5COBA 4OJQA 1MB0A 2H07A 4UPDA 5H1YA 4IQ4A 1WXIA 4OTZA 2B2XA 3DWIA 2AFIE 4HZUA 1QDEA 2H85A 2IZ7A 1QUEA 1T5LA 1G5QA 3OOJA 3QRWA 3QWFA 4OJKA 4XIIA 3Q3VA 5AM4A 1R1DA 3ZDQA 1JEYA 4OGKA 1ZIDA 3TG8A 2EL9A 3F90A 4WZBA 3A6LA 1HDXA 2OM6A 4X91A 3ROXA 4CV3A 5I7RA 2GMWA 4UEOA 3LRPA 1KJWA 1CE8A 3GZJA 3WL6A 1KI9A 4D1YA 2X8JA 1QAOA 1ZLXA 3ZVMA 5FBWB 5PNTA 1YTUA 1W94A 3RH0A 3DOCA 5B4TA 4FMBB 4KGDA 1TK3A 3HA5A 4ITUA 2NVWA 1FDVA 1DLJA 2BFBB 3TD2A 1SKQA 5E7MA 1NF8A 1F8YA 3R0VA 4P0TA 5A5VA 4TL7A 2AV6A 1EWVA 3CRVA 3R6LA 2X4GA 4A3SA 2Y0DA 2VHJA 3FKSA 4L50A 1PYGA 1MNQA 1UBTS 4KI7A 4NBNA 4F6CA 1X80B 2L69A 3DMTA 2C3YA 1VL8A 3OG9A 2JH3A 3I4LA 5DISB 4L5BA 2I2FA 4JX9A 2X5XA 4KSCA 4D99A 3Q72A 1ZW1A 3A36A 3EZGA 1CF2O 3DBVO 4C6TA 2PA3A 3JTEA 3OQ6A 3LX8A 1GPJA 1M2KA 4D5GA 1UQRA 4O4LF 3GLKA 3C5EA 3STHA 3TOSA 3QX8A 2RD2A 1H6BA 3W2GA 4NJEB 4AECA 4EYSA 1E18A 1Y6RA 3CR7A 4EPYA 5JMTA 2CVFA 1R66A 1YBHA 1TJPB 2JFFA 4HEA1 3JATB 4IQ0A 1Q21A 1L8QA 3L46A 4FQ7A 2NTYC 2KM1A 4Y2JA 3X0DA 4DLNA 2XR1A 1A1VA 2P75A 1D8TA 4X1IA 2PS9A 1E7QA 4DV2B 3BFKA 1UBKS 3A1VA 4N3CA 1BFKA 4OM7A 3A06A 3ZBQA 2K6GA 2KLHA 1QTNA 3N6XA 2UYQA 2PQ2A 5LP6C 1A9TA 2C00A 3T5GA 3U13A 2BGIA 4MS1A 3LLSA 1K8YB 1SGWA 1M0SA 1DEHA 3RSGA 4DDVA 1D4ZA 3K09A 3SLGA 1DWUA 3T1TA 1MP0A 1WUIS 4QTTB 2O0HA 4L16A 4PAQA 5JPIA 3I2KA 3K73O 2H5IA 5EIHA 4CKWA 1XMJA 1U9CA 1RLMA 2CY0A 2I4NA 2DERA 2WAMA 3O1IC 3WV4A 2ZZKA 1SU6A 5E1OA 2YN0A 2ZDQA 4TWJA 5AUNB 2B34A 3ZJ4A 2F9LA 2VYFA 1A8SA 4UEJA 5THKA 3CZQA 4NFYA 4RIHA 4URVR 3VOBA 1YONA 2IXTA 4Q19A 3CURA 4G1MB 3CG0A 2GRUA 3Q88A 2R7AA 1IDN1 2FXVA 4H9GA 2J5KA 3VU9A 2RGUA 4DV1B 1N0IA 3CUUA 1OKKD 2I99A 4FN5A 4FYJA 5K9ZA 1R8XA 3GJ5A 3L9WA 4IGFA 4TV8A 3H2SA 3AETB 1K98A 1M1YA 3NP7A 4IHJB 5IF3A 3I1JA 3I52A 2QRLA 3PK0A 3QFTA 4KGVA 2QX7A 2BHTA 4JVLA 1JIUA 3Q7EA 3TW0A 1T2VA 1QGOA 3KALA 4FOLA 4B4DA 4E88A 1YCGA 3B38A 4GFDA 1YI0A 2HLNA 4AT1A 4O1MA 2J32A 3DKKA 4XSHA 4YUYA 4K2AA 2WJWA 5T4HA 1TF7A 1D4FA 3OH8A 4P1ZA 2FCAA 3DE6X 1TA4A 1HYBA 1V6AA 3W0LB 2WQ6A 2Q6IA 4V03A 3F8TA 2FSVA 3QU5A 5FTJA 2AGVA 2BJHA 4P54A 3ZJ5A 1TZBA 2B78A 5D86A 2WU0A 5I6DA 1KFBB 1GNLA 1F3OA 3OFNA 4J0CA 3T3NA 4J03A 1DDIA 2I54A 2VEDA 4KQEA 4QO8A 1SXHA 4I5FA 4RJIA 3BF8A 3RK4A 3IUEA 5KHOC 4EW3A 2O8CA 1BEZA 3GRZA 1HZZC 3BH6A 4YRQA 3H97A 4FSDA 2AWOA 4LPKA 4HFMA 3HLYA 4JKIA 4WASA 5JD4A 5KTOA 3TPFA 1UBUS 4KI0A 2XA9A 4OGGA 1NATA 4BB6A 1ZR2A 1NXXA 1Z5VA 2V5UA 3STTA 1R5BA 2ZIWB 3U26A 1FQOA 2O2IA 1YQUA 2PM8A 4WAUA 4UTPA 1F7UA 4RY8A 1EX7A 2X0NA 3UMFA 1NMEA 2GEKA 1G59A 1OPXA 1E3DA 1MX9A 1Z82A 4WZ6A 2Q28A 5EYPB 2VHWA 3VHXA 4ZDIA 1GTMA 1X13A 2QI9C 4NQRA 2BW0A 3QZUA 2G9ZA 3O6VA 3R3HA 3SOZA 4FDUA 3VH1A 5AVYA 2FJUA 3C3WA 4BMXA 1DMSA 1MGOA 3ILVA 4YMUA 3TIIA 1CT9A 4JQOA 1XLUA 1ZKMA 1ZMXA 1C4OA 2ID8A 2NLOA 1QBKC 4PNHA 4XLLA 5EOVA 3LHKA 3W6NA 2IPMA 3ZNQA 5J2TF 4BE9A 5AI8A 1UK8A 1CY1A 4P92A 3QOWA 4KQJA 4M9CA 3WYAA 2YHUA 4EHNA 5IM4A 3MINB 3D64A 3G2OA 1DJPA 2AXEA 2FE4A 3O75A 3OD5A 1KYTA 1PI3A 3I62A 4UTOA 4EK9A 5EMKA 1QFYA 1X1RA 1X1SA 4G6ZA 2AG6A 1RM0A 1WB5A 3DPUA 1WHTA 3K5HA 2C5GA 1QF6A 1PQ4A 1Z5WA 3ZZNA 4ILKA 3K6KA 4YC7A 3UMYA 3LF2A 2RHTA 4P81A 1DCKA 3PNOA 2H4YA 2GBLA 2B9EA 2PU7A 3QPAA 4RZIA 3RU9A 1P2GA 3WLTA 3MELA 3NM4A 4FSHA 2XXAA 5LQCA 4F3CA 1H1LB 4XUEA 2YJGA 5MN6A 3FMPB 4I6EA 2OBLA 3PDWA 3PQ8A 2D0IA 1PD0A 3PEFA 1MC4A 1RBZA 2ZTLA 3QWBA 3V8PA 4S04A 4CGYA 3BC1A 1O5TA 2Q5EA 1BEUB 1J25A 4LE2A 1BVYF 4XPIB 4U9UA 2W8BA 4C4PA 3G8CA 5JJLA 3KKKA 2A67A 3B7WA 4LRYA 3BJRA 4WXPA 2FH5B 1H5UA 1DJMA 2AZ4A 5ALXA 3TXAA 4OU4A 2C99A 4GOMD 4RV9A 1J90A 3B3JA 4Z4HA 2Y9MB 2SKDA 3SZMA 3VU8A 1LB1B 1V4BA 4U7FA 4REQA 1VJRA 2EEPA 3D3KA 4J16C 1UKEA 1ADJA 3QF4B 1KC3A 1RTTA 3REGA 1DJOA