4HS4A

Crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
184
structure length
184
Chain Sequence
SPLHFVTLLGSLRKASFNAAVARALPEIAPEGIAITPLGSIGTFPHYSQDVQEEGFPAPVLTMAQQIATADAVVIVTPEYNYSVPGVLKNAIDWLSRVSPQPLAGKPVALVTASPGMIGGARAQNHLRQSLVFLDAYVLNRPEAMIGQVTGKVDAQTLELSDVATREFLARQLDALAALARTLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromate reductase
publication title Mechanistic insights of chromate and uranyl reduction by the NADPH-dependent FMN reductase, ChrR, from Gluconacetobacter hansenii
rcsb
source organism Gluconacetobacter hansenii
molecule tags Oxidoreductase
total genus 60
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hs4A00
2XOEA 1KBQA 2BMVA 4XDHA 1YCHA 5EAIA 1I1OA 4FGKA 1B1CA 2RG1A 1JA0A 3FVWA 1V4BA 3N39C 3OX1A 3EYWA 3NHRA 4GR9A 1SG0A 4BMOB 5EA2A 3UXHA 2QR2A 4CF6A 1FUEA 3NHYA 1AHNA 2XODA 3EDOA 3HA2A 4FX2A 1C7FA 1WSBA 3HR4A 1RLIA 2FVXA 5FA6A 5B3KA 1CZNA 1FVXA 1YRHA 1FLVA 4QODA 4N65A 4PTYA 3LT5A 2KLBA 3TEMA 3OX3A 4YAFA 3S2YA 2D5IA 3QFCA 1ZX1A 2Q62A 4DY4A 3LCMA 1X77A 1TLLA 1ZWLA 3UXEA 4CETA 1T0IA 4C0WA 4ZVLA 2X2PA 2Z9CA 6NULA 2B3DA 3B6IA 1CZKA 3NHLA 2QX4A 3NFRA 1J9ZA 4LTMA 5LBUA 1CZOA 4LTNA 3P0RA 2V9CA 2GSWA 3OX2A 2OHJA 3L9XA 3D7NA 1AKQA 5LLDA 5EMNA 3NHJA 1E5DA 3ESXA 1ZWKA 2Z9BA 2MT9A 2Z98A 4QOJA 1DX9A 1AKTA 3ESZA 4C76A 1XT6A 4GQIA 3ZHOA 2FZ5A 4ZVMA 1D04A 3L9WA 1YOBA 5LVAA 3W79A 3F6RA 3F90A 3K1YA 4H2DA 3HLYA 1AKWA 4DIKA 4N82A 1QHEA 4D02A 5FUQA 2FX2A 4OXXA 1AZLA 1YCGA 4U7GA 2FCRA 1D03A 3GFRA 2F1OA 2HPVA 1GG5A 4PU0A 1H69A 4C0XA 4QOFA 3F2VA 3TE7A 5NLLA 2QMYA 2OYSA 2ZKIA 2W5UA 3SVLA 4YQEA 3F6SA 4Y9UA 5LJIA 3NHFA 5BUCA 3QE2A 3OJWA 2HNAA 2R96A 1FTGA 3JSXA 5F4BA 2V5UA 5ULLA 4YAUA 4LTDA 4LA4A 4NLLA 2Z9DA 1FLDA 3B6MA 5LBTA 1T5BA 1BVYF 3QFRA 4YALA 3OJXA 1JA1A 1J8QA 1NNI1 1F4PA 4FGJA 5LJLA 1RLJA 3W78A 2A5LA 2WC1A 2Q9UA 3GAMA 4ZVNA 3B6JA 1RTTA 2X2OA 4BMPB 2BN4A 4R81A 2FAXA 4HS4A 1DXOA 4S24A 2OHIA 1FX1A 4U7FA 3KLBA 3GFSA 1FLAA 4M0CA 5FX2A 1AMOA 4GI5A 2FZVA 1C7EA 1J9GA 3NHWA 4YAWA 3W7AA 4QOHA 3O73A 3OWXA 4H6PA 2M6SA 2QWXA 2AMJA 5NULA 3O2NA 4ICIA 2KQUA 4ZVKA 2N1MA 2HNBA 3ES9A 1KBOA 4PTZA 2QX8A 1OFVA 2QX6A 1QRDA 3FNIA 1OBOA 1QBGA 2QMZA 1CZLA 3N3AC 2V5VA 4FGLA 2BPOA 2MTBA 1AKVA 3U7IA 1XYYA 4F8YA 3K20A 3FJOA 1YDGA 1CZRA 3R6WA 5F51A 1AKRA 3GFQA 3B6KA 3KEGA 1TIKA 3NHSA 4DILA 3N3BC 3FX2A 5B3LA 3U7RA 1VMEA 4U7HA 3NHKA 1AG9A 3OVMA 2BZSA 3NLLA 1J9EA 4XDGA 5F12A 4LAFA 4N9QA 1XI2A 2MOKA 3KAQA 2BF4A 4YAOA 1YCFA 1RCFA 1QR2A 1FLNA 4QOIA 1H66A 1SQSA 3G5MA 2FLVA 5A4KA 2QX9A 1CZUA 2FDXA 2R97A 1AKUA 2ARKA 3OWHA 1OBVA 3ESYA 3TZBA 3NHUA 4Y7CA 1DXQA 5JROA 5TGZA 4C14A 4HEQA 1WSWA 2FOXA 1D4AA 2OHHA 3FW1A 3NHPA 3KAPA 5LMCA 4J8PA 3W77A 4QOGA 2M6RA 1CZHA 3RPEA 4NULA 1XYVA 1YKGA 4ESEA 2MWMA 4QOEA 4Y9RA 1BU5A
chains in the Genus database with same CATH superfamily
3T52A 1KR5A 1QGYA 4E2FA 1BGVA 1HLGA 5JAPA 2VC2B 4ZO4A 1Y3IA 1Y3BE 3VU9A 2CLCX 2W2TA 1TMOA 3N9IA 3WADA 3MIZA 3LHFA 3MB8A 2FB9A 2OCKA 2C54A 1KYXA 1EBUA 1EDEA 1HEYA 4FD3A 4H4EA 3EPLA 2Z2IA 4NBUA 2FYTA 2HFJA 2Y1LA 3AYZB 1GZ7A 3P4YA 1XFAA 5IBPA 3EUEA 3DNPA 1Y1KE 1JBQA 1YFKA 4WWHA 4PLTA 3FVWA 4DT1B 3BD6A 4G85A 4UDYX 1NA5A 2AOTA 3G1UA 3HCEA 4R2IA 2D8MA 4I1RA 2ZJ1A 1Y9JA 2NZJA 3HHEA 1C14A 1MAWA 1A9OA 2COEA 3A4IA 4MQEB 3EHEA 2ORWA 4J1TC 3ZY5A 1NR1A 1MX9A 1WHTA 3THWB 3H2SA 3K9NA 1PK9A 4G5QA 3EIWA 4S2UA 4HO1X 4CCYB 4EDHA 1B0AA 1LK5A 1FDSA 1XVUA 5BORA 1R0XA 5DLDA 1ZGJA 1RQNA 1W36D 2GZHA 3H3FA 4WA7A 1T3HA 4JN6B 4RHFA 2HLDA 4LF4B 4KWCA 2J7PD 1PG0A 3H4TA 2H4YA 4KQCA 3CO0S 2ACKA 3ZXUB 4UCQA 4BAUA 1RRPA 3CWQA 4GKVA 3CKKA 3K35A 2JLYA 4F7WA 4YVFA 2R00C 3GG2A 4IV5A 3QXHA 4FW8A 8LDHA 4BV3A 2QZZA 1Y48E 3TRHA 3WAJA 5AKXA 1X7GA 5TR9A 3G5UA 1IUPA 3PICA 3R5KA 5C5IA 1IWBB 3KALA 1UK8A 3ZHZA 2C5FA 4YJHB 2NXNA 4W82A 3AK4A 1PWHA 4D4MA 3LUGA 5JZOA 1N5MA 3MJRA 2CB9A 2FRXA 4YAFA 1ZD3A 3OQJA 1PNQA 3NFYA 4UBOA 1EXDA 3CF6R 4RJJA 5I01A 3R4CA 3I92A 4KFUA 2P9TA 1O95A 4CKXA 4FXPA 1G6HA 1HNNA 1NIJA 5MN4A 4U7DA 1CVRA 2XF2A 1Y3CE 1N0IA 1RWMA 3NS7A 4M60A 3L7NA 2W6ID 3UAZA 1C0KA 1FUUA 2O06A 3G6WA 1Z0FA 3UBMA 5BVHB 1KH2A 4YJDA 4FZ5A 4DMFA 1OQAA 4EEXA 1P7WA 2BKXA 3PQ7A 4EM6A 3AP2A 3TSAA 1ESNA 1JZTA 1L8OA 4AJIA 3VBCA 1NFRA 2YV2A 5LL6P 1FJHA 1R4ZA 5E38A 2D0PB 3I3SR 3DG9A 4IVNA 2OR3A 2QIOA 1MO4A 1EKXA 3DGEC 5KI6A 3ULKA 2D1FA 3UQZA 5FUYA 4F4DA 4F6RB 3H4VA 3RBAA 1DGQA 3GJ6A 2X9GA 1LNZA 1XVAA 2UAGA 2QW1A 3QVKA 4ZKEA 4XYLA 2X1MA 2ZI7A 3HBNA 1IN4A 2CLIB 3DTTA 4D3ZA 4RQUA 4HGPA 1DV1A 1VRWA 4ZDWA 3OF3A 1AY0A 1G20B 1PDVA 2R7KA 1IK4A 4OQNA 3G8CA 5THKA 4E09A 3D64A 4MQEA 2FN3A 1KARA 1M2WA 2IYYA 1UOEA 4R1QA 5HUHA 3THWA 3EWSA 4TWZA 3RREA 2CFRA 4RCZA 3HVHA 3T3PB 3TD9A 4EHBA 2C29D 2WFAA 4DBLC 4DLXA 2A14A 5LDDC 3MOGA 4QU0A 4EMSA 3DM5A 3DS8A 1UAGA 2DTDA 2QT0A 3NHJA 2EP7A 3TDMA 1BH2A 2BZ0A 4UXHA 4J76A 1K27A 1HORA 3ZHRA 3LWDA 3RVMA 4UHEA 3RSFA 5KJCA 3WBKA 3IOEA 2OWEA 4J29A 3CEHA 1PR1A 3CCFA 4BQSA 4YJHA 2BRUC 3VKVA 3IKJA 1BD3A 2FSFA 1K7SN 3O26A 4UU0A 2XMBA 3WLLA 2YNMC 4TQUS 1WZCA 1CV2A 2ZBVA 4JOBA 5FWNA 3ZWXA 1X1SA 1E94E 4P5EA 2IU6A 1E2JA 2R4UA 5B1HA 1EBFA 3DPIA 5FADA 5JAUA 2R1UA 2ZYGA 3K1YA 2WV7A 1G3UA 3NHAA 1XCJA 1NBIA 4QHSA 2FN8A 3UJAA 4AJOA 4IGKA 1U2TA 1RM4A 3E5RA 3RODA 3MUEA 4RJKA 1O0CA 5BVHA 1UWLA 3OFVA 4IWYA 2HYDA 3PRKE 3WLSA 1C9NA 1E3IA 3L4BC 4LV8B 1EFHA 4WBNB 5A62A 3T1YB 1DMSA 3K5HA 4U7GA 1I6LA 4B2LA 3HHPA 2N75A 4EW3A 3JS5A 4EG8A 2XUQA 5HKAA 1W5BA 4ERNA 1HG0A 2FCRA 3I8XA 3R3JA 4RADA 5EJEA 4I5EA 5L6LB 1G64A 4F6RA 4EOGA 5C0OE 2IPOA 2V8BA 1CIJA 4QRIA 1MUUA 4WDQA 5FOUA 5GPBA 4C7JA 5IASA 4G0QA 1G20A 1X8KA 3L7BA 1X1AA 4AUKA 4E6EA 4N47A 4V38A 4RDXA 1CQIA 3RHZA 4UDOA 1GPWB 1P3DA 1MX3A 4HLCA 4L3OA 1FYDA 5HKKD 3MTQA 1E2MA 1NXPA 4QUKA 1VPDA 2C5GA 4K9LA 1FYWA 3WNQA 1JPJA 3LHKA 5WRFA 1W7AA 2DBRA 1EE2A 1KRHA 4JR0A 4Y9UA 3SWWA 3QE2A 3BE5A 3RT7A 3UK6A 4P98A 1XD2B 3LT0A 5EIOA 1DC6A 1M1UA 3LBHA 1ZOIA 4YO8A 3KJZA 4I3HA 4D43A 4EFKA 1WBDA 4QKQA 1DKRA 2WSMA 1QMGA 4LI0A 3KWFA 1GGHA 2V5UA 3BGDA 3OUZA 3SD7A 2QPTA 3GO4A 4MKFA 2LIVA 2C59A 2C95A 1CFZA 4N3GA 5DZSA 1U4NA 2C20A 3FR8A 1O96B 4Y9TA 4OCZA 4ZAVA 4BQNA 4TKVB 1UOPA 2V54A 1PZXA 4V0LA 3UK2A 1WD7A 2W70A 2RGEA 4EKDA 4H16A 2NTNA 2QUAA 4JUDX 1SIUA 4BQEA 1SBNE 2VBFA 2Z5FA 2PX6A 5C4IA 3G0BA 2PMEA 2HGSA 5FA8A 1EWRA 2C1ZA 4X9XA 1CNFA 3AKDA 3IBSA 2HJVA 5DTJA 4DCJA 4B74A 4BNMA 3AWIA 3GCDA 1U28A 1H4TA 2ANBA 3EPJA 1H93A 1E6LA 1PE0A 5EIBD 1A2BA 3C8HA 3LFHA 2C5HA 4ZARA 2ZBPA 4A3SA 1OFGA 3KHSA 3KTOA 3VPCA 2VT3A 4JXKA 3G17A 3WGOA 5HIAA 5IKXA 4LV6A 3EN0A 5FOXA 4WBNA 3SX0A 2DZDA 2WLTA 4KR7A 1E2EA 1MPTA 4IX9A 4YUZA 2JRLA 1ZU5A 5AVJA 1HBJA 4FCWA 1DTWB 4K28A 1HDCA 3I6ZA 3OE5A 2XW6A 2CK3A 3UT0A 5DHSA 3W6ZA 3D4OA 5DM4A 3X2FA 5C46F 4FT2A 3CXRA 1Y5IA 1ISIA 3D3JA 5ARBA 4PS0A 3BGWA 4XRRA 1UT8A 4NFHA 4DCSA 4TOIA 1OCEA 3GCWA 1LQ2A 2ICAA 4W5QA 2EAUA 2PX3A 4BLOA 3CS3A 4LBZA 3HFGA 5A02A 3FETA 3NONA 4LJAA 1KSHA 3I6MA 4M7OA 3UO8B 2X0FA 2CNBA 3IMGA 4D92A 5I5EA 3OM8A 3K0HA 2X8JB 3OIWA 1TM7E 2RHGB 1ADYA 1TC1A 1JQ3A 1QFXA 1YJBA 2WT8A 3PD1A 1JL3A 3P9QA 4GI2A 4CMKA 3D8HA 3GX1A 2YC4C 4BNVA 1I3CA 2H5JA 2B5OA 3NHWA 5EE3A 4OIMA 5EQJB 4B46A 4EY3A 3W8NA 5INTA 3MB5A 1LRLA 1U9JA 3M0EA 4HZGA 4E15A 1MO3A 2OCPA 1H5NA 2VDJA 3I12A 2O5CA 1XXHB 1DRKA 4LQCA 1A5SB 1O96A 2E7ZA 2OQRA 5I7UA 5NULA 2YUTA 4FNMA 5EHQA 5CXQA 4JQSA 4P3YA 5GM2A 4N41A 1OIWA 4A23A 1GDTA 3ZV4A 4UPVA 4TXNA 4BZPA 4CDNA 1KJWA 2PA0A 5CDFE 1WUTA 1KP2A 3W2HA 1PU2A 4B7XA 2RH5A 2V3VA 3L1UA 1U6JA 2HNBA 3LLUA 1XEFA 4WQMA 2ACEA 3TFWA 2IIBA 1T8WA 1VPVA 1QOQB 4JLDA 1KBOA 4MSUA 4NHEA 1HDZA 3V1NA 3PIRA 4OP2A 4L50A 2GN0A 3SNHA 1I1NA 3VZCA 5HF6A 2Z83A 3Q7SA 3FOZA 1I3LA 2OGWA 5DB4A 1XRPA 3PI6A 2WG1A 4GYKA 2O4CA 2JIRA 1CEQA 3W2EA 4L8YA 1JI3A 1WIWA 2IHKA 3PBKA 1V1RB 5D5HA 3DNMA 3E2PA 3SQMA 2D59A 2V5VA 1DTWA 4WA8A 4WKOA 5K0TA 2VPIA 2ATVA 3ZWCA 3P0IA 3IEIA 2JCSA 1B15A 4CKCB 1LNQA 2BPOA 4U9UA 2VTKA 4FHCA 2YDXA 1F12A 2CZQA 4ZN6A 2ON6A 3L0ZA 5DXAA 4NE2A 4ZV9A 3FDZB 1XZDA 4MGIR 3PGVA 3X0DA 3ODPA 4BJ6A 5LD2B 3OIVA 5GJBA 4OHMA 4I9NA 2P68A 4P2GA 1VGRA 1LPAB 2X8JA 2PAFA 2YVLA 3NHSA 3RK0A 3RIYA 3ZWPA 5C18A 3WNZA 1DEAA 3AF1A 2P9YA 4XUCA 9LDTA 4L08A 2H85A 3KSBC 2XWQA 3D54D 3FYUC 1EP9A 1TQ6A 2K2WA 3N1UA 4PC7A 3TSCA 1YTUA 4QBTA 2HCBA 3EQ8A 5HS4A 3OEED 4F60A 2F1KA 2FPGA 5CM9C 1UKCA 4QPCA 2WWHA 5E7QA 2E2WA 2C2BA 1TM5E 1F5SA 2JA2A 3HKEA 4HLQB 4QATA 4XSVA 2F67A 3RM3A 3VC3A 2IITA 1J8YF 3WSWA 4K40A 4Y8VA 2DYKA 3R09A 4ZDJA 4RY8A 1XI2A 1UQRA 3GARA 1E2KA 1H0HA 5KKCA 1BD4A 3E0QA 3OURA 4FOLA 3JCZA 2VDPB 2NZUG 3ACDA 3AUAA 1FXWA 3FWNA 3VYSB 4RE6A 3IVCA 5IBRA 1ORDA 4DC1A 3EVTA 3NZEA 2OUIA 5LLSA 2G88A 5EZ5A 3KQHA 2MCFA 1PP4A 3CX6A 1KSJA 2FWAA 3VOBA 3EXHB 1NVFA 3O4IA 2PMKA 2H2AA 4BWYA 2C94A 3AF2A 1SQSA 2GM9A 3BL8A 3G5MA 2VLBA 3ORYA 4NJEB 5AVSA 3EQ6A 1ISGA 1M6HA 2RG7A 3OJEA 4RVUA 1L8LA 2ZSIA 1UIRA 3IAM6 1I7DA 4IHAA 1I13A 2F2TA 2NG1A 4CKCA 2KI5A 3B13B 4NC9A 3UAYA 1TCCA 4JB2A 3C1TA 3X1YA 2GD6A 5EFZA 3ZY6A 2ZRFA 3FZYA 2ECKA 3EF3A 4C7OB 1B26A 3FDZA 3GCGA 4JLJA 3ZBPA 3ZXIA 4XTRA 2QYOA 2VNAA 3A1DA 3DFKA 1S8FA 1WMBA 1DPGA 1FK8A 3Q7TA 4PCLA 5KOYA 3IT0A 2Y9PB 2PBRA 2GI4A 4Y7CA 5DYWA 3BBPA 2C4TA 1PK8A 1X19A 3QHAA 3BF8A 3T1QA 1Z6GA 3DC7A 1YO6A 1PL0A 3VO9A 2HWYA 3R7LA 4F91B 2QI9F 3WMXA 3LKBA 3VHLB 1J39A 1EFVB 2GAFA 3R6DA 4D9JA 2IYFA 5I9TA 2PYZA 1BJKA 2E21A 3WOVA 4AY6A 1KEEA 2PMWB 4DTCA 2VJPA 4M1KA 2XUOA 5JOQA 2PNFA 1T2UA 3T3MB 5IEJA 1LWOA 2JLSA 3K0SA 5DI3B 5HJ5A 3TGLA 1UODA 3BCHA 4O33A 4RSHA 5A7FA 5CYPA 3UA4A 4IDAA 2PT9A 3PA6A 2EW2A 3KL2A 3TTXA 3TH5A 1Y7HA 1BCSB 3BD7A 1U0LA 1YQEA 1JHOA 3JD3A 2DF8A 4IH9A 3C7AA 4KGXA 4MB2A 5AM5A 3UPDA 1HE5A 4F12A 2PE5A 5B6JA 4FFRA 2HMYB 4NZOA 4XVHA 5CPFA 4FINA 1N32B 3LRTA 3O1IC 1GPJA 3RAFC 3ZI7A 1TQ2A 3HO6A 1NF9A 1R4AA 5G41A 3T0FA 3RSSA 1JDBB 2WWIA 3S3TA 3EZ2A 3F6YA 3F96A 4BZQA 2GCNA 2FSVC 3ZD8A 1K3TA 1G4UR 5DIFA 2OILA 3SIWA 4F1JA 1QQBA 4CG0A 1YKGA 1R9MA 1ULBA 2C83A 3QWFA 1NAIA 3QX3A 4HTFA 3O4RA 4JJAA 3RC2A 1VSQA 3ZGVA 4B0PA 1JPUA 1WXWA 1L3IA 4LVNA 3FXAA 4NJEA 1ONNA 2PUBA 3R3UA 3SDSA 1Y6QA 2B8TA 1Z7GA 4IGEA 5IH7A 1Z2EA 3CTMA 3FPGA 1CE8B 3T3EA 3ZW8A 3MIIA 3QV2A 4R40A 5FORA 4HUQB 2P9FA 2ZIWB 3FG9A 1R6AA 4GKJB 4MAAA 1BROA 1NSFA 1N1MA 3EGWA 1SUEA 4ITUA 3UMSA 4Q1VA 3X1MA 4C7OA 4HMQA 4PF1A 1N9GB 4OU5A 1E7YA 2REOA 1VE9A 1UMDB 1QK3A 2JGEA 3VNSA 3JALB 4AF8A 2JHFA 3HDJA 5K3CA 4CEJB 1VE3A 3JYOA 4C5BA 5FA5A 4DCOA 1TJ5A 1BN6A 1CY1A 1I1OA 2MR5A 2QZSA 3DLHA 1EFCA 1QO7A 4NP6A 3EUFA 4RHUA 1EFVA 1MIOB 1Z74A 1HEUA 5JO0A 1OGJA 3KZVA 3H3XA 3N39C 4A2PA 1X1DA 3EDYA 2DSTA 1B7GO 4ZIRA 1QH1B 3BXPA 5DI3A 5DISB 3TD6A 3KUUA 6Q21A 2RCYA 4QGAA 1BDJA 3WGUA 4E31A 4E5SA 1ST3A 4D2IA 3ZHYA 3A9TA 5BWMA 1KYWA 4XQGA 3TIIA 2NZYA 3ILYA 1NR7A 5AJVB 3GJ4A 1H2YA 1KZGB 2W6IA 5AUNB 3M5DA 1CUYA 2BEJA 1G16A 2HPAA 2G9RA 5I5GA 3B6ZA 3HS3A 4V2UA 3DWEX 2A5YB 2R2AA 5F2OA 2RI1A 5KYUA 2WWFA 4WLFA 1KI8A 2ZJ3A 2OENG 2GNAA 1I9CA 1J70A 3ZZUA 4CTNA 3W8EA 3BT7A 3VU3A 1VBMA 3AJDA 4YEDA 1HC7A 3PFFA 3DZHA 3I4FA 4BLQA 2O14A 3EF0A 4L28A 2HBQA 4M1TA 4N65A 2QTTA 1HLPA 4OEHA 5TGDA 2YMLA 3RSZA 3WGKA 2Q3FA 3M3DA 3EGDB 4G4SP 1M7GA 1GAQA 3ITDA 2CLDX 3AR9A 1C4OA 1NXSA 2YOFA 1E4YA 1J1ZA 2H5EA 4FR0A 2HZBA 1MA0A 1L5OA 1E5TA 4JGBA 5AM4A 1E6KA 1CG6A 4NBRA 3GNSA 1RPZA 4J0KA 2BFBA 3UJ6A 2PYIA 2VA8A 4WKNA 1OLSB 4FCVA 3LCMA 4UBKA 1CE8A 4KIGA 2C7RA 1DAOA 1R74A 1OKKD 2L42A 2PZMA 4PCAA 2ORYA 4KYTA 4KOEC 3R7NA 1A7AA 2IE0A 3RSHA 1BS1A 5KZMB 4UAGA 1E99A 4CR7A 2DBQA 2PWAA 2PAAA 3JQAD 1YZKA 3FDJA 4TXHA 1N9GA 3Q3VA 3A3OA 1E3QA 1QWSA 1UMDA 2JJ2A 2Q46A 4YMTA 4EVSA 3JALA 4QBGB 2PZ8A 4P80A 3GZ4A 9LDBA 3GDHA 4CEJA 1YGYA 2ZR8A 4O8ZA 1AGPA 4X64B 3DE0X 4TL9A 4W8GA 1TF7A 1W5FA 1FW8A 3CLTD 3FAZA 4QBKA 3ASZA 5AVOA 5LU9A 1JMVA 1IY2A 2LIPA 5HTOA 3X43A 1MIOA 3TNDA 1E79D 3A6HA 4MARA 5LBUA 5AJXA 2H2DA 4AXXA 4PPYA 2XYQA 4M22A 1QH1A 3KXLA 4FTWA 3RV4A 5C35A 4LWOA 4N0EA 3HCRA 5AW9A 3HJNA 5JTUA 5REQB 3L6EA 3PXCX 2PZJA 2I9PA 2XNHA 4IIYA 3UHOA 2XCTB 2JD0A 4ATNA 4OHRA 3OX2A 1NVTA 3UJPA 3ZJUA 3U3XA 5F33A 2HJHA 2TMKA 1F8YA 4EPTA 4ND6A 4CM7A 3E8MA 4NNPA 4QLBA 2XUHA 3SSOA 2P4UA 1ZVQA 4WTOA 4JWTA 1R5BA 3HDQA 3KSZO 2C58A 3ADDA 2X5OA 3FSRA 3IQWA 3LQRA 3ZCVA 2OAQ1 3GGCA 2LD4A 3MAGA 4CLHA 2ZJ6A 5FH9A 3RU2A 3LVFO 5I4IA 1CQWA 4IHKA 3EBLA 1X1CA 4AWAA 3ZJVA 3I2KA 3NATA 3GHYA 2O3SA 3CHYA 3GJQA 3EGDA 4HNHA 2FFBA 4IDGA 4WKPA 3T0IA 3VV3A 2AZ4A 4NOMA 2UUPA 3ILVA 5KS2A 1DMRA 1L7OA 2GSDA 1PDOA 2Y92A 4Z9BA 1RRKA 5JVDB 3FVQA 4MWTA 3DHWC 3UMFA 1GGEA 1U3GA 2QRPA 2C4HA 4ANFA 1UK6A 4Q02A 3U4MA 5HKKA 5A5FA 2C99A 1OYWA 3JATB 4FK8A 1N6LA 2ZSFA 4H3SA 3IQGX 1C2TA 1LVHA 4ZQHA 1ORVA 5BR1A 1SXQA 3DBVO 1LVGA 3PUHA 3ZWWA 1FQOA 4O4LB 5AIBA 5CFOA 3WL8A 2YVQA 3DXZA 3KJGA 5H5JA 1XQ1A 2KPOA 3H4MA 3O3NB 4Z1MD 2FW8A 3E48A 3OE4A 1F2UA 3AI3A 4V0QA 1Y7LA 3GFRA 3VX3A 2HPVA 3KB1A 1S2NA 2B1QA 5TS3A 3ESRA 1P7PA 3FMVA 2Y1CA 3EAFA 5G0TA 5JISA 4QYXA 4MMYB 4B81A 4XJVA 2BJVA 3RSCA 3AERA 1GRQA 2XMZA 2Z1NA 2VF4X 4DIDA 2V58A 3FRJA 3R0QA 4G0YA 1XEAA 2NU7B 4C04A 1Q1BA 4B17A 4HSEA 1QRAA 2PBLA 5D51S 3EWAA 5REQA 1EK2A 4C89A 2EJTA 4NMMA 1PFQA 1M74A 2GN9A 2NXCA 3IAHA 1WDTA 2BR3A 2AMFA 3D3NA 2RHJA 5LA6B 4X71A 1PWYE 2UYQA 2C0QA 2UZ3A 3QPBA 3RU9A 2J46A 4QGSA 2GEDA 2HNAA 4FFBA 3ZHSA 5IWAB 4WT7A 2IXBA 1R15A 2G9UA 3L6BA 2VF2A 4N12A 1W88B 2A58A 4WH0A 4JGIA 3JQBC 1BXRB 3LFUA 4G8CA 5K20A 1DXHA 3W1VA 1UCFA 4MQFB 1WNFA 2O6HA 2DT8A 1P4HA 2GEVA 3HJRA 4B3DA 3VUFA 4OQEA 2CV1A 1V48A 4LA4A 3WA6A 1NQ5A 4NLLA 4D6XA 2C4UA 1NR5A 1HFJA 4O2AF 5EIXA 4P08A 2AN9A 3HUEA 4L5JA 5IXYA 2ODTX 3NOQA 4X97A 1NMYA 2C9CA 4U9HS 3AFGA 3C1UA 1JG4A 5JASA 2PZKA 2XYVA 5JVDA 4JX9A 1T1GA 3R23A 2X23A 2HHHB 2IU4A 4YRSA 3BRWD 3CUKA 2HMUA 4B3GA 4BVGA 1U8UA 3JATA 3ETEA 3A6PC 4PRKA 4QWMA 1QHIA 4ZO6A 3Q8WA 1P44A 4Y98A 4FFWA 5FBZA 1NXVA 2NW6A 2O0MA 2W2XA 2XA9A 1Y3FE 3FHCB 4KUEA 1F8GA 1K6XA 3ILHA 3V8PA 5H9WA 3CX8A 1IXRC 1SU8A 1VDZA 1PUJA 1ZIOA 2QAJA 2QUJA 3GH3A 3FCCA 3IGFA 4O08A 4RZUA 4DPKA 3F4LA 3HU5A 2IYOA 4NPAA 4XFDA 5IRCD 2QTAA 4E7PA 1D2HA 3EIQA 1X39A 2HUNA 3L02A 2GK7A 1KAGA 1UZMA 2J09A 4UVDA 5BW5A 1DNPA 4PHCA 1WW3A 1PUIA 5CLGA 2ZTLA 5CXXA 3ESBA 2RCNA 2VXBA 2DHCA 1GQOA 2Y1WA 4IOMA 4K3UA 2ROQA 4P54A 2AR9A 221PA 1KEKA 5BN1A 3TZQA 3K70C 4EB8A 4QT0A 4EQ6A 1ZD2P 3V9AA 4P4LA 4WGFA 4R81A 4EW2A 1LX7A 2GVDC 3MS7A 3R76A 5LA6A 1WCIA 1C3XA 1KYYA 2W4QA 3K5WA 3DDOA 4LDZA 5TB5A 4DFDA 2J4DA 1U7UA 1W88A 5EMHA 4AMGA 4L72A 2FOLA 4GPBA 3ZJYA 1BXRA 1JVNA 3KQQA 3PSHA 3HXLA 3R5SA 4FIZA 4MQFA 4NIMA 1GFZA 3BA6A 4B2YA 5JSQA 1WUHS 1VPLA 1TK2A 2GF2A 2G1UA 2GJAA 1YCDA 1SD1A 1OLXB 5ETJA 2O2DA 1NBHA 4G1VA 3IA2A 4IS3A 4EG0A 5ER6A 3CVYA 3IP1A 1TQDA 3P0HA 1ZMOA 4HVCA 2FMTA 1XMXA 4BU0A 4ROTA 3G82C 3L0CA 1LY1A 1O8BA 5EJ9A 3FYHA 3NEAA 1OC2A 2OXCA 1IZYA 1X7WA 2IF0A 2KQUA 3ECAA 5CFZA 4H7EA 3IIKA 1SQGA 3NCHA 1I7LA 1Z4JA 3EEYA 5BWBA 4HB2A 2PJDA 1FC0A 4B82A 2FY8A 4Q9AA 5K9ZA 1XQVA 3BXFA 4DV7B 3BD8A 1SBZA 4HGOA 4L16A 2QQ0A 1ZU4A 3ZI0A 4MGHA 1PDWA 2C42A 1N7HA 3HCBA 4OHVA 4N39A 3VR3A 4JI7B 2JLVA 1TW2A 2W0MA 5AYVA 3G49A 2WUVA 4BCDA 3DDHA 3BWEA 2Y1XA 3EUWA 3WP1B 2B7CA 2QRGA 4RQBA 1QYCA 3OEEA 3K9HA 3PQDA 5JS6A 5AKJA 4MWOA 4QDKA 5MDHA 3IAUA 2JJYA 2F4VB 3L46A 3CM0A 3KSDO 2D13A 2ZFUA 4RNDB 5AM1A 5K05A 2FSIA 3H0EA 4H7KA 4B6GA 4RZHA 1ZAKA 3L49A 5DSXA 3QVOA 3GNLA 3WFZA 2PKEA 3I5XA 4X41A 3C48A 3DEKA 1ESMA 2PUDA 4RETA 1KMMA 1D8AA 3AM1A 2OORA 2I8AA 4UEWA 3HADA 5BPHA 5MF6A 1CY8A 2X8LA 2BC9A 3KEGA 4MWGA 3RBZA 5LXTB 4X94A 1GPDG 3BA1A 1WDWB 4XCXA 4AAYA 4KXUA 5K8JB 2OCDA 5EFOA 3P9RA 3AIOA 3EQ2A 2BGWA 3D5QA 2WYWA 2AOUB 4JVOA 4B80A 1JZQA 4TWIA 1DBVO 4WXRA 2FXIA 1FFHA 5DNWA 1TC2A 1FP7A 4FGZA 3ORRA 5SY9A 4AQDA 2F1RA 1GZHB 1U80A 2R25B 3SZMA 1OLXA 3SP1A 3TK1A 2JHCA 1RP1A 3C5CA 1W75A 1F38A 2RGUA 2XWBF 1UMKA 3CSSA 3LU1A 1SC4A 1UBHS 4R2JA 5G0SA 4YRNA 5JSZA 3CRZA 4QUBA 1XU9A 2HU7A 4XDGA 1HV8A 1K6IA 3G0GA 3QYJA 1MJGA 1Z7EA 4JP1A 3L06A 4ARZA 2EKQA 1J2YA 1QCZA 4UQPA 5GZ1A 4B7UA 5JQWA 1P1HA 3GOHA 2OGUA 4RD1A 4D26A 4ASUA 4HDMB 4RLQA 1RLMA 1JPNA 4EYSA 1W0CA 4YAOA 1Q3KA 4HX9A 4B47A 3ZEAA 1L4NA 4NF2A 1X13A 2SBTA 4Y2YA 3GUVA 1G4HA 2D5BA 3EMVA 3QX7A 4Q1FA 2W6JA 3CR3C 5CTJA 2QUZA 4GC9A 4OK3A 3H1BA 1Q1AA 3PHIA 5FUMA 3RC7A 3WRXC 2PJUA 3DEAA 1NV9A 3KUDA 3QVXA 5KVCA 4KYIB 2FDXA 4JDPA 2DKFA 1KEZA 1H4VB 2WHRA 3AIKA 4ZI7F 4DXHA 4C87A 3G85A 1VCOA 3E9MA 2Q5IA 1OBVA 4DA6A 4HPJB 1DAMA 3VO2A 3K9FC 3B3JA 2BSAA 4UNNA 5H3HA 3MELA 1GZ3A 5A4MS 2HADA 3AR3A 5AKYA 3QYPA 1TEZA 1I10A 1P0QA 2QTGA 1ZM2A 1O6BA 1X1TA 3ANYB 4JEHA 1KY3A 3RF6A 3LTNC 1OYYA 1TM3E 1G38A 1M72A 1QRTA 4TL8A 4U1RA 4DR2B 4UBIA 3ND5A 2RHHA 2UYOA 1BIFA 5TGZA 3ZU6A 3IBTA 4TWRA 3UOGA 5TXGA 4BBPA 2L69A 3H16A 4JYCA 1KZ4A 3I32A 5A0FA 5AO9A 2DAPA 4MUBA 2VNHA 3RKRA 1O9GA 2GA9A 3BQMB 5C8VA 4BFYA 4DLAA 3SEFA 2QD3A 4IXTA 4OFZA 1RQ7A 2H51A 2UXCB 2VAWA 3LPAA 2EFDB 3ET5A 5JMWA 4JP8A 3V7UA 5MN5A 3JR3A 2IHTA 1O0BA 1YZGA 3F6BX 4LXTA 5CMLA 1KZHA 1JKIA 3NHPA 1K2VN 2P4QA 2J9RA 1PSZA 4Z0NA 4DWVA 3FPAA 1L8AA 3JQAB 2LDXA 3D02A 1ZJ4A 3N0WA 2DSNA 3I04A 4D46A 4HUTA 3ZDDA 4LY9A 3O8RA 2XBMA 2Q6IA 4MP8A 3WWEA 4F86A 3PRJA 1XVTA 4HDMA 4R2LA 3QMMA 4EYEA 1ZA2A 5K3OA 2JIZD 1Q1GA 5CPBA 1NW9B 4QOEA 2KBFA 3QKUA 1ST2A 4KR2A 3I9NA 3N0RA 3B70A 3NUQA 1U2DC 1KS2A 1OGYA 1YVEI 4OMDA 3RUFA 1HE2A 3QYAA 5C5EA 5BYJA 1P2SA 4IQ8A 1HG1A 2E0IA 4PZDA 3ANLA 4YY3B 4UZEA 1NBMD 1B0UA 3C15C 3H2HA 4UXIA 4ZOAA 5KTYA 3MAAC 1PGPA 5AP9A 1CR0A 3WL7A 2WQ7A 1C1XA 4R1OA 3VR2D 5B1IA 1S1MA 3QV1A 1TTHA 3LV8A 5DLEA 1U2RA 1CIPA 3TPZA 5DI9A 1BVHA 1Y6ZA 4JVLA 4V1CB 2YHIA 3QPWA 1XCMA 4C7XA 5CIQA 2FOIA 3S1AB 2O2IA 1DCTA 1BU8A 4QG7A 1R0ZA 4CZ2A 1C4KA 4RA9A 1LPPA 3D2LA 3HCPA 3TO5A 4CHTA 2PIDA 3OKAA 2HTFA 5EAIA 3WJ1A 5IULC 3QPVA 2PN1A 3K1TA 5DWVA 3BMNB 2QA5A 5K4GA 4XYMA 4U7WA 1ZLYA 1MH9A 3B2QA 4FGUA 3VNRA 4R0NA 2HD4A 3QVVA 4G41A 5LQCA 2ISCA 5IJXA 3EVFA 2TMGA 1XNRB 2DWUA 4GWLA 3HSSA 4QBFA 2HSJA 3AHGA 1G3RA 3QBJA 1P4GA 4HDSB 3NC0C 1ZHHA 1GHTA 2P2SA 4PBTA 4UNSA 3WB9A 3EQ7A 4EFLA 1L7QA 4EHHA 3W7VA 4DGQA 3LK6A 3JPYA 5L3VA 2ZIXA 3FHLA 4DLPA 4FN4A 4N3AA 5DGCA 1WO8A 3Q3JB 2VYVD 4MVJH 3SFZA 3IUQA 3VPBA 5KDDA 2GYWA 1CJMA 5IVHA 3BWVA 1VL6A 1Z33A 2JGFA 4NVRA 3K05A 4FX2A 3IR5A 3WK5A 4KXVA 3JQAA 1V43A 1HNWB 1FF9A 1Q7CA 1BE6A 4LY6A 3SFVA 3T7KA 2HO4A 1K2WA 4UMFA 4ZREA 3VZQA 3CLVA 1IBKB 3GMTA 2QE7D 4RELA 3L1KA 3NYQA 4GSYA 4LYAA 4IG9A 3DDWA 2AC4A 1PR4A 1T3TA 3MJ4A 3L8ZA 1HI9A 1VI5A 2HX1A 3LOPA 3V55A 4CM1A 5B3JC 5KNCH 2WHYA 3HU1A 4XWKA 3LT5A 4CKBA 5KWEA 1EFAA 1E79A 2R6DA 1MTOA 3B85A 3R1IA 1ABEA 3P2KA 3PNYA 3KP1A 3VR4H 3TEMA 4AYTA 3KJNA 2C2YA 1SR8A 1NVVQ 2QUHA 2FWMX 2G5TA 1JJBA 3PDCA 4S1OA 4BFUA 1ZC4A 2DBVO 1MO5A 1OZAA 3BH6A 3MHPA 4YXWD 5CD9A 2IY7A 5J9FA 2QD1A 3H84A 1L3CA 2ZTMA 3K2QA 4IOKA 2C9ZA 3STVA 4KHZA 1J2TA 1UDRA 4C0WA 1K5HA 1ODKA 2YWXA 1ZIDA 2IUYA 5C7IO 4V1CA 3B7PA 1DOHA 2YHSA 1GUYA 2X2PA 3S1AA 4TRMA 1U3CA 3R3YA 4R01A 5AI6A 4UHHA 3ZHBA 5JEEA 4J1NA 1O2DA 3CH6A 2FW0A 3HWWA 3NHLA 4JBNA 5I9LA 2HREA 5JANA 4KN9S 3BMNA 1VE1A 1Z7YA 4W8HA 3DBOB 5CXSA 4MV6A 2AFHB 3F67A 3AJ8A 3TQFA 3RGWS 1VJTA 3S68A 3T6KA 2ZSUA 4PO9A 4K6CA 2RAFA 4RFLA 2XOKD 2ANCA 5DBOA 5ILGA 1Z6ZA 2AR7A 3MRVA 4IDNA 4JL8A 3CXUA 2QSYA 2D1QA 4B8ZA 4C21A 4UTPA 1RHUA 5L3SB 3W4KA 1HX7A 2CHUA 4J75A 3IUJA 4BKUA 4FDVA 1P1CA 1SHKA 2AX4A 4QPNA 1PR3A 2YV4A 4M1OA 2RSLA 4M38A 5DMXA 2VZ9A 1LC0A 2CLOB 4A1FA 4X95A 3EPHA 3HL4A 4OLBA 4MCJA 2AD1A 2CVFA 2K7ZA 3NXKA 3KWJA 1PD0A 1Z16A 1XKQA 1JJVA 1ZIPA 4YP6A 4OYLA 3ROMA 5SYNA 3PXEA 1CJVC 3KXIA 4YFYA 5CAEB 3VYWA 1KI7A 1RRVA 2F1JA 3H2YA 2C2KA 2V59A 3DKVA 2C57A 5JV5A 1QPBA 1P5JA 2PANA 1T0JB 3VU0A 4GQIA 4I1UA 4PNZA 3MAJA 3G7UA 1XHEA 3UMCA 1E9EA 2F43B 1UH5A 2OESA 1KKUA 1YIDA 4KHPB 2X5NA 1XRSB 4DG5A 3NM5A 2O3JA 1SVKA 1XQ9A 1UBSB 2B8EA 3AU9A 3OY2A 1K7FB 4RGBA 5B1SA 3IT2A 2QS9A 3BJMA 4Z4CA 4G89A 2DFKB 3N6RA 3T5BA 2ID8A 2NSHA 3O94A 3OQPA 4YTEA 2VRNA 3I5MA 1U90A 1NI4A 2EARA 3GIDA 3I6QA 2OM2A 3IXMA 3OBIA 2GBLA 4H2DA 4PO8A 1RZVA 1PJ4A 4R4JA 3SS7X 3WYCA 3WQHA 4YCDA 1BMDA 1JQKA 2ISSD 2GEBA 1T8PA 4U2GA 4D9BA 2JHGA 3OOHA 1EJ0A 1RXUA 2WMYA 3B5JA 3N86A 2YWJA 1XJQA 4ZQEA 2PM8A 3SJZA 3J80A 3FOFC 1Z6PA 4A27A 5F73A 1KO4A 5JDIA 2XIJA 2NU9A 1RHJA 2ECFA 2HPZA 4F3NA 2NV6A 2O20A 2PSHA 2REXB 3KDSE 4PX2A 5JCZA 4ZHQB 2OK7A 3K4HA 2AFHA 2L2QA 1VKJA 2P41A 1VB5A 1T9DA 1NVBA 4BNUA 3WYGA 4UNRA 3QU9A 1FYEA 3UH0A 2VCEA 4YMVA 4LMRA 3TE7A 3WGMA 1DTEA 1K88A 1HQKA 5NLLA 3STHA 5BUSA 1RKBA 1RWNA 1W5SA 4AICA 3SX4A 5L3SA 3ANXA 1O54A 1ZGBA 4HLUC 3QEOA 1ZJWA 4YP9A 3DONA 3ZV3A 3BRWA 3D5TA 5EHGA 1PL6A 3NDIA 3NTQA 2Z1MA 4RO0A 3SYKA 3TDKA 3RYIB 2AFIE 3UC5A 1MX5A 4P6VF 3CNLA 1JS1X 4ZEOA 1USWA 3CG0A 5FL3A 4B84A 4FFNA 2F7SA 4L7QA 2CXUA 3EVBA 4H7IA 4K6MA 1R00A 4EO7A 1U0BB 1XQWA 2G6BA 2GNPA 5F4BA 2NAFA 1EPUA 2ZIZA 4Q4JB 2O2CA 1LZKA 3C3YA 1NLMA 5CAEA 5M34A 3AR7A 1FP1D 3RS7A 5BV2P 1W5AA 3ND6A 3ADPA 3PHHA 1H65A 3K3PA 4CFYA 3MWKA 1R8YA 2GBGA 4ERXA 2YKGA 2QPAA 4IJ5A 1IAQA 3WLTA 4POAA 3JQFA 5EE5B 4I0WB 4Y0VA 3OE1A 4TWJA 5AD1A 2EHJA 5ISMA 5ADVA 3TSZA 4BTLA 1KRWA 4WASA 3B38A 1UPTA 4Y1EA 2NU8B 1RKQA 3EXIB 5EZYA 5G0VA 1JHRA 1JV2B 3B1WA 2AN3A 4LIPD 5DIZA 4EG7A 1Z68A 1CDEA 3DXXA 3WYEA 1JHYA 3G68A 3HTXA 3FWZA 5KAMA 3FTDA 5BSKA 1C3VA 4PYRA 3RC3A 2B9VA 5C8YA 3Q7EA 4OBBA 1W4AA 1RWVA 1SKMA 3CIFA 1M1YE 4Z3DA 1O97D 1SXHA 2VUHB 3NEJA 1A8HA 1UKVY 3VDMA 4P0TA 5DBGA 3MD9A 3OEWA 4PZZA 1FNCA 4ZHQA 4C4RA 4L6CA 5FOSA 3U3KA 5DDIP 3SF0A 1ZEMA 1XK6A 1GZUA 3V6MA 1Z18A 3AUJB 3UAGA 1H5UA 3MS2A 4ALKA 4BFTA 3NJ8A 4DLBA 4MO2A 2X2OA 2NVOA 3H75A 4FQ7A 3OZTA 2V9PA 2JKVA 1KMQA 1FYVA 5MFPA 1RWWA 3DL2A 3LCRA 4GU5A 4UEKA 2VNJA 3ZTYA 4CN9A 4HGYA 3OPQA 1M75A 3ANMA 3AP3A 1YA8A 5SV2A 1I33A 2PU7A 3TF5A 2D5LA 2B82A 4RPJA 3RYIA 3QXCA 5CA1B 4LECA 3DOHA 3IQHX 4J0IA 3E4CA 4MR9B 4PGAA 4URFA 4CUZA 3T3NA 1PZFA 2O07A 4ETMA 2J3JA 2Y66A 3CZPA 3DQZA 3KR2A 4JSTA 4C6HA 2FZVA 3AFMA 3NYIA 4DJ5X 4F7DA 5KUTA 4JBYA 1Z36A 3ODGA 3ACBA 5EHIA 5ALGA 3CNHA 3W7AA 2EIHA 3UAVA 4Q4JA 4TYPA 3OLXA 3D7SA 3TDNA 4MPDA 3HKBB 2OCBA 3HM2A 1XZJA 2FK7A 4XYEA 1GNVA 4HNQA 1RKXA 2E1PA 3VOTA 2DLCX 2NSJA 1RAIA 1Z2OX 2AFRA 4FMCB 4IFIA 5KVAA 1NHGA 1YMQA 4LZLA 1MB0A 4ARVA 1TMYA 1ZOSA 4B6OA 3EC7A 3DF7A 4AUEA 1E1DA 2QRLA 2LWIA 2ZSKA 3A1TA 1TAQA 3M4NA 1JU9A 2A33A 1UBFA 3U7EB 5FL7D 3F47A 2H1FA 1YBVA 1U94A 1OZFA 2NU8A 3DE2X 4CMGA 1BGXT 3AP1A 1QFYA 3EXIA 3PZRA 4Y6OA 4MPJA 4C6RA 4ZYZA 3ND7A 1T29A 3MWJA 4IVQA 1UBLS 4CG1A 5I45A 2IYWA 1EE1A 3P0EA 1ZLXA 4KODA 5M3BA 3TIFA 3E5HA 3OSUA 3TR5A 5E4JA 4CMAA 4B87A 1CBUA 3QSYA 3DE7X 4P82A 2QVBA 2DG2A 5KWSA 4UCWA 5CFLA 3HCWA 3THXA 2QTNA 1S2OA 2PMCA 4JWKA 2X4LA 4ARUA 4OH7A 2RGBA 1DHTA 1ZCBA 1JH9A 5TC4A 1ORRA 4WL0A 1A2OA 3HGQA 4KRGA 5AOCA 3ZNPA 3U09A 5H3CA 2OO5C 4RPCA 4C4YA 3NHMA 3PX2A 3HVKA 1XAIA 4IBOA 1PS0A 4G5RA 1SXJB 2P30A 1CB0A 5L6MB 5DK4A 5ARDA 3SBXA 5K7SA 3PEYA 2XJ9A 3BKXA 2GYVA 2NO9A 1H4QA 2OB2A 2VNSA 1ITZA 2R1ZA 1MQAA 3T99A 2VVTA 1NPYA 2BWJA 1FSGA 3JX9A 2X0EA 1SBIA 3IMCA 4WDRA 4C3VA 5CA1A 3GMSA 4PXAA 5DM70 5SYMA 1SY7A 3QU5A 2G9NA 3TX2A 1KC3A 3SDZA 3NGLA 4X8MA 3FUCA 3N7TA 4Z7NB 2JLWA 4AP5A 3RROA 1UJMA 3LUHA 1GSOA 1PHPA 1Z8NA 4CM9A 2KHZA 2PT6A 2WMOB 4X7MA 3DSRA 1NP6A 1OZGA 2EFEB 2O0KA 3VPSA 3EIUA 1V47A 3HKBA 2EP8A 4DPLA 2ZWAA 2DQ4A 4KR6A 1UZNA 3OZGA 1ELOA 1TECE 1Z12A 2AW3A 1J9EA 4IL5A 1H2EA 4JLSA 2Q27A 2VQEB 2C5EA 4JH0A 2J6CA 3INNA 4JLPA 1L5QA 1QYIA 4V0KA 4UJ3A 1JI0A 4N9QA 2VXYA 3N2NA 5F3RA 4C4AA 3D1JA 5FP0A 4KYUA 3SHOA 3TBKA 1KQGA 1DAPA 1FFXA 2ZG6A 1HE4A 4KQ2A 1P19A 4O4JF 2XNDD 4HDNB 1DKOA 3LZ6A 4B5KA 4OP1A 3FNQA 4JUIA 2BI7A 3L8CA 2OBLA 2VUSA 3ADOA 3OLVA 1YCFA 5CUQA 3IOYA 4IFTA 1WXXA 1KVSA 4RD3A 1EDOA 4GT1A 3QG5A 2EVWX 4RIHA 4Y9DA 2ZULA 3N70A 4YRQA 4BQFA 1RQGA 2Z56A 3ROPA 3OCWA 3EFOB 3QBDA 4G97A 4MAFA 4RE5A 5DGXA 4JJ7A 4IV8A 4ALLA 2VHTA 4H1VA 5LQMA 2BUAA 1YFLA 4ACBA 1PEYA 2UVPB 1OIVA 2G63A 3AOGA 2IXEA 1G8JA 3BILA 1AKUA 1GTZA 3C4JA 3OM1A 4GE3A 3E7DA 3TFQA 4FYPA 1JB1A 2OPBA 2QZ4A 4ISCA 3DNFA 2X77A 3VHXB 5JCOC 3T12A 5K8CA 1RYNA 4YP7A 4C2TA 1SXJA 3AEQB 3TZBA 1G1AA 4TUYF 3TPCA 3S70A 3U7JA 3ZS9A 3ZWQA 4C1BA 2W6NA 2J0QA 1Q0ZA 5CG2A 3A4VA 4NMXB 4HFMA 4Y6SA 5TPWA 4WI1A 3GYBA 1AGNA 1J42A 5EKTA 3AHEA 3PJEA 4RLSA 1XLTA 2PNJA 4EB3A 5CFMA 1XNHA 4A36A 5TY0A 5DCLA 3DZBA 5EGSA 5B64A 4EB0A 2JIZA 5TS2A 2XMCA 4RKRA 2B7LA 3ROEA 3FLAA 4AJ9A 2P9JA 3CPHA 4LXGA 4ENSA 2JI4A 1IN5A 2QDKA 4LF7B 1TRHA 3DUWA 4I5FA 4YGXB 1Q7EA 2I76A 1PJBA 3ETLA 5F2KA 5KOHB 1RZRA 1DELA 3TEFA 3F78A 4G37A 5ESRA 3UJDA 4BKQA 1SKAA 3FGNA 1NBMA 2B6HA 3ZV7A 3LQ4A 5JI3E 2K2QB 4JI4B 1JRLA 4X3PA 2I80A 3L0SA 4LVUA 5EIHA 3PPIA 3VR2A 5GZ6A 5JSYA 4WERA 1Z4LA 2WWTA 5J5CA 5IN4A 1S7CA 3H1FA 4RVGA 1M76A 3AJ9A 2GVZC 3AV0B 2G83A 3DEFA 3PE4A 4IO0A 4KX5A 4TLDA 4XLTA 5HA5A 4C6TB 3QLUA 4RHEA 1EQAA 3ZQJA 1JKXA 3G2OA 2M6RA 4LJLA 3LC7O 4J4BA 4HDNA 1B16A 1OIXA 3RPEA 1EX7A 3TB6A 4Z3KA 3R3VA 3GEMA 1H23A 2WAXA 4D74A 5TVKA 2R6CA 1DHRA 5L3RA 1E1QD 1E7RA 3W90A 4R7GA 5A3SA 3LF2A 2QRVB 2IJGX 5FTMA 4Y9RA 5K09A 2QRKA 2C0CA 1R8SA 2NZ2A 3EFOA 1G20E 3Q0IA 1CW2B 3T9CA 2BF7A 2WYUA 1O89A 4HHEA 5A3VA 3KLNA 4A0SA 4BIIA 4ZYLA 1TNDA 3IBFA 2UVPA 2IQIA 4OP3A 2VYVA 2KLHA 1XJ5A 2HC9A 2R5FA 1M1XB 1XTTA 5LNK6 3GYGA 3GLFB 2H1OA 3VHXA 1NDHA 1XZBA 2X42A 3AI1A 3L93A 4H15A 4LJ5A 1YRYE 2WWGA 3DAFA 3DWFA 3WTBA 3ZU5A 2ZJ2A 3AEQA 2NTVA 4UM7A 4UUMA 5K1ZA 4A26A 3L4KA 1L5VA 2AN5A 2XDWA 4P36A 1O0SA 3L01A 5IX8A 3OT5A 3GI1A 2QE7A 4YONB 5A5DA 2E18A 4BUCA 1EXMA 1XDDA 1Z0AA 2JJ1A 2PRIA 4BFWA 4EGAA 3KEMA 1T1RA 4QFMA 1CUHA 4WZ6A 1JA0A 3OCUA 2Q5EA 1F9AA 3C3JA 4RY0A 4RVCA 1WY7A 3U81A 1HKUA 2ENWA 4D56A 1IK6A 2YYZA 3OX1A 5DHUA 3D6JA 4JUCA 2IOFA 4X00A 4NENA 1E66A 4O0MA 3VAYA 2AEFA 2ZVDA 1X0VA 1L7MA 3M9LA 4C78A 3A4LA 2I91A 2IQ5A 2CLMB 4MVWA 3DLPX 1BS9A 1NHWA 1SKBA 2NVBA 2XSZD 3BK2A 4L85A 4UBNA 3FN4A 3ESAA 4YXWA 2X1LA 3JRXA 1FQJA 1UKAA 1UANA 4YCCA 2C5LA 1KWKA 3JQRA 2P67A 2IYPA 2P6RA 2VJAA 2CNOA 3HA2A 4Q1DA 2JGKA 4X60A 4YN3A 2QP3A 3ROZA 3UV7A 1HDYA 1D2AA 2QRQA 2A78A 4BN4A 2DVMA 3RDPA 1MJHA 3GRZA 5G0WA 4POOA 4GR5A 2XR1A 1SQ6A 2ODQA 4BX2A 1QIHA 3ZBUA 4TV9B 4LN1A 3PHJA 4QUAA 4PZAA 1OSNA 4F96A 1ZUHA 2GZSA 1PV4A 4Y6PA 4FLMA 1UXHA 2IYTA 2OCYC 1XU4A 3L7IA 3NO4A 3ZV5A 4DAOA 1HSZA 1M73E 1GTG1 3NBAA 4TTAA 1E2BA 4M1QA 1JDZA 2XOKA 2QLBA 2QRVA 3BSWA 1N6HA 3HI4A 5E6RB 3TLGA 2H1WA 2D5IA 2GKGA 2Z5GA 3EW7A 3ST7A 2ZRNA 3U4QB 3NTOA 1UAYA 5GONB 1AXEA 1X77A 121PA 1U3DA 1YR1A 2FSSA 3PK0A 4PVCA 3IESA 4NNOA 1UPAA 1IBCA 2Q3MA 4JSYA 5GADl 3AHCA 3E2IA 4YJ3F 1YXMA 2A4MA 1DQYA 1BYIA 1T0IA 3GJ3A 4BQPA 1SUBA 1R9GA 3E9CA 3RRNA 2V03A 5FBHA 4BQIA 6NULA 4HFNA 4TZTA 4NONA 4K1LA 3B6IA 1GL6A 3SSNA 5KQMA 2RAPA 4BKRA 5G4KB 4XWYA 3QX8A 1KEUA 1J8MF 2BLNA 4FKMA 4K86A 3HVRA 2PVSA 1I7PA 2WSYB 3OF5A 1YZ3A 3GHHA 1FFYA 3KKNA 1CZOA 5JH7F 3B60A 3T54A 1ZPDA 3FSGD 1NM5C 2QNIA 1YBFA 1NI3A 4FDLA 3LHSA 2XZTA 2XRYA 4PN7A 1OAAA 2GXAA 1MCZA 1KO7A 2H2GA 1IVNA 3KO8A 5F21A 1TD9A 1RWQA 2BAGA 3UM9A 4E1AA 5KNCA 4C07A 2QNRA 3VR4A 3VYUB 5FNVB 1RHQA 3QKRA 1CP2A 4HQOA 1CUAA 3UK0A 5JJKA 2E6KA 4EKEA 1GILA 2H5IA 5J4YA 4XEHA 2FF5A 3MRXA 4R1PA 4US0R 3NMUF 2E4ZA 3CZ9A 2W2KB 2ZDQA 5FIUA 1OREA 1PR0A 2QI9C 4HEA6 1KS9A 1LI5A 1RXCA 3ICWA 3JU3A 4G9EA 4MV1A 4NCNA 4EG1A 2IEDA 4P3XA 2GHIA 3TLBA 5IJ9B 2PHZA 3CGWA 1LH0A 4BLTA 5LYJF 3L8HA 3PUVA 3UXMA 1V16B 2WZCA 3IAEA 5FTNA 2W8ZA 4BX9A 1DIGA 3ZK9A 1IY9A 1LDBA 2XUJA 3JSAA 4RY9A 3S28A 3Q6NA 5E6RA 1YE8A 1YRWA 5ERXA 3O90A 3RBVA 3ZLBA 3IJRA 1BJRE 4Z7QB 1QHYA 1UMCB 2NZVG 1VTKA 2FZKA 2XHZA 1QRRA 3BRCA 2PGLA 4BWVA 3U4IA 5GONA 3U4QA 3JAWB 2WF6A 3I34X 4ZXPA 2J3EA 1UPCA 4UMEA 3TBFA 4EUSA 3TG2A 2ZI6A 1WV0A 4L0QA 3MT9A 2Q5HA 4GBJA 5BT9A 2GZ3A 1W0JD 4YT8A 2XMPA 1YCGA 4PYNA 1PD1A 2I2AA 2XE7A 4HWRA 3WWDA 4RANA 3LHDA 2RFLA 4BPBA 3LC2O 5AJTA 3NOVA 1PEKE 2Q5CA 1PN3A 4BRUA 4XKJA 1TO6A 5G4KA 3S7TA 4F93B 1NVEA 1ND5A 2C5SA 3CUEF 1C3OB 1I4TD 4GRDA 1BQ3A 1WPXA 4RHTA 2JJ8A 2LZ0A 4J1TA 5HJ2A 2GJ8A 1EUZA 2HN9A 2HT1A 1GIAA 2PT7A 3F2VA 4KUHA 1D9XA 1V5EA 2X5KO 1L4UA 1SZJG 1VJRA 4IW3B 5CT5A 3USZA 4WXYB 5F23A 1MRZA 5JNSA 4QC2A 1W4CA 3M70A 3I6YA 3LLMA 1KDYA 1U1FA 5JMOA 3TR6A 4RYLA 1J5PA 1BOOA 1G5FA 4FFSA 4FFVA 1JBEA 2NIPA 3KR1A 4PC2A 5DRTA 5FNVA 1GM5A 1JG2A 1JGTA 4DIOA 2R00A 4CIWA 2XB6A 4KO2S 4N3BA 4Q00A 4LGVA 3L6DA 4RW0A 5AVKA 3GNQA 5DX0A 3WGQA 4F9GA 2W2KA 5FDFA 4XWWA 2B78A 2P2ZA 4IPTA 3TTVA 3UK1A 4MPPA 4YRMA 1V8ZA 1A9QA 3I4LA 3OZBA 2IVFA 4WVFA 3LBIA 1HUQA 3Q72A 3GUYA 3W2IA 5IJ9A 5C7LO 2PZLA 1EYZA 1IAVA 1NLUA 2BV3A 2D2XA 3VUEA 4D9IA 1I32A 1V16A 4ZAXA 4BO2A 2I33A 1YAJA 4KIWA 4L5YA 3QE9Y 1GTVA 1S0UA 1ZVJA 2ZE6A 4TLMB 5JG7A 3TUJC 4LC9A 5AVXA 1JE0A 1GSAA 2QIPA 3BEOA 1JHVA 4GM1A 1UMCA 2AG0A 2WAOA 2JH8A 3LE8A 4RMJA 4LJRA 3LX5A 2HWKA 2W2LD 3EY4A 1P9OA 2HNKA 3JAWA 5DT9A 2TMYA 5JPDA 1ICEA 1DDOA 4CF4A 2NYVA 2XNSA 4ZYWA 3EG5A 1YZTA 3LAWA 4JC8A 3WNVA 3CC8A 4U00A 1C30A 2CNKA 1XQ6A 2FSGA 3RSGA 1WJGA 4EY5A 4TVBA 4LS3A 1JSRA 4JLKA 3HBMA 1DG1G 2I3ZA 2X9NA 3FTCA 4RVFA 5H0IA 3HXOA 1HZZC 2J8ZA 1P0CA 4RWEA 1HT2E 1G0OA 2ZGVA 4CLDA 2LVBA 1J06A 4PG5A 4B31A 3IS3A 2JB9A 3LK7A 6PFKA 1C3OA 1RFLA 2A0YA 2B99A 2OLEA 4HAXA 4OTZA 2CJPA 5CVEA 1ZKMA 3VGPA 4I08A 4E5VA 1M1NB 1OU4A 2XECA 1T8UA 2BEVB 2DQKA 3Q5DA 2FEOA 3JYQA 2Q1TA 4L4UA 4PFKA 3WB2A 5BW6B 3H2KA 5DHFA 3GP8A 5BNFA 3SKYA 1YV9A 5E8RA 5DU2A 4G0OA 3Q6IA 4HNAA 3IR7A 3M89A 1OLUA 3AU8A 3L92A 3F0TA 3T7AA 1ZN9A 5SZKB 3BZUA 1HNXB 1YB4A 4DDMA 3PNBA 4XM0A 3ZD7A 4QEZA 4AY5A 3JARB 3RS2A 1AMOA 3IPRA 1HURA 2P8JA 1B6GA 4NE9A 3KOMA 2B35A 2CHQA 3QUCA 5JS2A 2PQ0A 2QLLA 3RVRA 2BRUA 3OU2A 3ZIUA 1AE1A 1DUIA 1M2KA 4D82A 4ZCSA 3OWXA 5EWLA 4Q9NA 1PS9A 2B4QA 3RYCB 2YNMA 4IHJA 3K09A 4JEMA 1R88A 4JKYA 4Q24A 4QUDA 1NKSA 2QWXA 1XTVA 2AMJA 4PFSA 4DR4B 1O87A 2BFMA 1XRQA 3ZCXA 4L5AA 4A03A 1NYLA 4XVUA 3DDUA 3AVTA 1GPYA 1ZDMA 4OAPA 4I8IA 4JP3A 1HRDA 1QS0B 2P9HA 1OZ0A 2YMMA 3AOEC 4K9PA 4II2A 3BWBA 3DOFA 1QV9A 2N1MA 5EVJA 1T26A 2AN4A 2CXQA 3AILA 1G8PA 3T9BA 5ALSA 4IH1A 3L4BA 5CJJA 1ESZA 3PQEA 3GY0A 1NATA 5J63A 3RG8A 3LMKA 3K4PA 4Y2VA 5IFKA 3N2EA 4X63A 3IAS1 3MSXA 3REFA 3AW9A 1K8QA 2GGSA 3MINB 4W9RA 3ZWAA 4GMGA 1RRCA 1YRBA 1H2RS 4Q01A 1K08A 3UCEA 4DLZA 4ZFNA 5JFTA 4PHFA 3QUAA 3CKLA 4I1IA 1IPFA 4BLUA 3OT1B 1ZD9A 1HE1C 4IH4A 4GX5A 5JYBA 5E1DA 1UZUA 1A1SA 3W4JA 2D1YA 3CUVA 2V6FA 2RH8A 1T13A 1AKVA 4Q1CA 2NXEA 4OLHA 4KREA 3EZNA 2IZ7A 4I4TB 4L8FA 4ZEXA 4ALIA 4BNLA 1DARA 3PEEA 3Q7IA 2BEVA 1D1SA 3F5DA 5FR2A 2I7CA 3CPJB 3H2JA 3NM6B 2DLNA 1QQAA 4TLEA 1KOJA 2FMHA 1DKMA 3GFQA 1KVQA 4JT4A 1OAOC 3B6KA 5HUQA 5FF9A 4JP5A 3M1IA 3VH3A 2XNDA 1SU6A 4PO1A 4MYCA 4OJTA 3OOEA 3KAJA 1L5GB 3DCNA 4KMSA 3U17A 5FV7A 1ZKDA 3WY9A 3CN9A 3DE6X 3JARA 4P3NA 3FX2A 2O7SA 4FC6A 3IAFA 4N5HX 1ONPA 5DTMA 2XBUA 3M6UA 4KLAA 5ABPA 4IDBA 3IBCA 1ZITA 2BH9A 2VF7A 4K6HA 3NHKA 5EOVA 5FPTA 4CQMD 4ED9A 5AK5A 5B4UA 1ZSYA 1VOTA 1TYZA 2WTEA 1OHHD 3ZW7A 1K3UB 3FFAA 3X1XA 2ZRBA 2QYHA 2FPKA 3S5JA 1W2GA 3W8FA 4AKSA 4DAEA 4AZWA 2VSYA 1JR6A 5FWAA 1ZM7A 2J6IA 1OFTA 3IKLA 4LAFA 4RHXA 5F12A 3UJNA 2Z6UA 3W3ZB 1DBWA 4KUGA 3WRYC 5ITSA 1QS0A 1H2XA 4BP3A 3AJEA 3H1TA 3PEUA 1SUAA 3TL2A 5KPJA 3CB2A 4W1SA 2E5LB 2G8LA 5JALA 3ECSA 1ZK4A 2B2CA 1VE7A 1ZNQO 5BN4B 2O2GA 3FF4A 1PNOA 4B35A 3EXFA 3QWHA 2GYUA 4LK2A 5DT2A 4QM7A 1N9KA 5EKDA 4EL0A 1AF4A 2VAVA 3E3OA 4E88A 4DB4A 2OE2A 2WUWE 1JJ7A 2CCGA 3EDQA 5FPKA 3MINA 3MW8A 1CR1A 4U5XA 3AH8A 3HUTA 3KVVA 4IIEA 4ARCA 2PSDA 3BF7A 5HIIA 4F72A 1XZHA 4G8BA 4B6JA 5DV9A 1AZSC 1WR8A 2C2XA 2NSYA 2Q5QA 2VA9A 9ATCA 1XLWA 1EFRA 2ZSJA 4J6FA 1GA4A 1S89A 4H1WA 4AK9A 2SKEA 4HAIA 3OP1A 1U8AA 4EWLA 1XZ8A 5LQSA 4ZZ0A 1J99A 1LBEA 3AR6A 1I14A 2PKRA 4B3IA 2OGTA 1WZ2A 3N07A 4JJEA 3AINA 2B21A 1TD1A 2J3HA 2FF7A 5F5NA 2ETVA 4L0DA 4NJOA 5IDVA 4WXHA 2H29A 1WULS 2WU8A 3RAJA 3A4MA 3OLZA 1TOAA 4RTSA 5KQSA 1WVMA 4R1LA 3MYRA 3HI6A 4N5MA 1DXQA 2BBWA 4DSAA 3ZLJA 3FYUB 3G2MA 3NBZC 2Q7OE 4YR7A 1BDMA 2Q0XA 2QJOA 3LZCA 4Q3DA 1QXSA 2H11A 3NJRA 1PRYA 1UF9A 4GOXA 3UMRA 3DW1X 3ETDA 1QCCA 3HYLA 3GEIA 1E1QA 3LVQE 4FX5A 4LI3X 3HB0A 4XUEA 5DJ5A 3S2EA 2ZRCA 3T7TA 5DW0A 3W5VA 3U56A 5LWQA 1QG4A 3W4IA 4DR3B 1Y80A 3S40A 3WDKA 3KOOA 2DGDA 1LDMA 1JSZA 3AB7A 3WL3A 2VNIA 2ONCA 1WDMA 4YACA 5EJIA 3PQFA 1EP3B 3MSCA 4U8GA 3FB4A 4TTTS 4YV1A 3PXBA 1QG2A 2M32A 3IVXA 3KE9A 2JW5A 2FH5B 2AYYA 3V4RA 3K70D 4M7RA 2HGZA 1UKBA 1NXOA 1W4LA 3EGCA 1MVOA 3QW2A 4MVJP 1B8VA 1E5QA 3PUJA 4YRFA 5DP1A 3W2TA 2GN8A 4A15A 3VTFA 4C4PA 4A6EA 3O93A 4Q34A 5FBRB 3T38A 2I2XB 4LJ7A 5G02A 3EGEA 4PQRA 4ZHSA 3R7SA 3P9NA 4H77A 2X86A 3HFRA 4FPXA 4RVOA 2H48A 1ZR4A 1Z8DA 1I3KA 3E18A 4AP6A 2X0NA 3DKKA 5B6IA 3L0YA 4J2TA 1VSBA 1NGSA 3DLTA 2NNLD 2GEJA 3Q7RA 4OMUA 3BCUA 3SHQA 1NNSA 2PVPA 2GVNA 5TGTA 4TN5A 3C3MA 2VRBA 4TVOA 2AJCA 4RTOA 3ROTA 4WJKB 5EIEA 4LZAA 1W1WA 3VZRA 5I9MA 3JTMA 1P1IA 1FFWA 4WECA 2R9VA 4KLRA 4GLLA 3C6YA 3TAUA 3W1EA 4LRQA 3ER9A 1RXSA 4A0GA 3UTCA 2GEKA 2NQ8A 2RBKA 4HB4A 4GKKB 1TB4A 2FCAA 3JXEA 5AXDA 1DQZA 5KCZA 1NC3A 1JFTA 2KWIA 1F20A 4WLOA 4AU1A 1SB8A 4MDFA 3FTNA 5EKSA 3I04M 4M0UA 4Q3AA 5IN5A 4DGSA 3C6ZA 4PZLA 3SQDA 3DVAB 1ZVVA 2E5WA 1DIBA 1T8TA 4LSMA 2ZRLA 3P32A 2ZJZA 1IOVA 1GGKA 4X6UA 3FYUA 1NRIA 1QZZA 4CL2A 3L4SO 5GINE 2A9OA 3R9IA 4BFXA 2UUAB 5ILOA 3SS9X 3SE0A 2ZRAA 1Z6TA 3L0IB 1GLNA 4I6EA 2QUIA 3JRNA 2R85A 4JAVC 4BO1A 3CT6A 1K4YA 1IL0A 2PGNA 1T1EA 4PC1A 4BYGA 2P6OA 1SG0A 4RENA 2PKXA 1MHPA 1NUAA 1YS9A 2PL3A 3AR5A 4CF6A 4M3NA 1PFWA 2E82A 1ZN2A 1VCIA 2B20A 1YDHA 2B5VA 3BWYA 3DEYX 4I50A 4MH0R 4ZEVA 1ZP6A 1OXSC 3AKCA 4CMEC 2C92A 2I29A 2QVYX 4C4ZA 4QJBA 5HRAA 3L7YA 4KMMA 5G4LA 1BXZA 2JAPA 1E2HA 1T5OA 2JGNA 3QKTA 4NJMA 2FVXA 2PKQP 5A7HA 2FQWA 5E3HA 3OT4A 4JASB 1ZUNB 5KVQA 4JMLA 3M82A 4C0QC 4EGJA 3HCNA 3I52A 4KNWA 1GNLA 3QLJA 4MV7A 1DTSA 3AUYA 4J7AA 4QXRA 4QWWA 4TLCA 1EVJA 1EWTA 4UMVA 3WLHA 4HVLA 4FGSA 2ACVA 5CLLA 5HBGA 4WBNF 2PSFA 4FWTA 4KR9A 5KNBH 4BPRA 3P9XA 3NETA 4HJXA 3PXGA 4AN0A 5IF3A 3EVGA 3FSGA 4N3CA 1SWWA 2CSUA 2IZZA 3BK7A 1ACLA 3CLSC 1TM1E 3JPWA 1R4MB 4OBXA 4Y2PA 2IHBA 4EGSA 5DGIA 1EVYA 1V8DA 3G2IA 3A26A 5CR9A 2AIRA 3DMGA 3MNFA 1YB7A 1KSFX 2GKOA 1Y4DE 1MJFA 5TE9A 2V3WA 4KE9A 2PR2A 3QG1A 4HWPA 3ZWVA 3GJXC 2NX2A 2ZE8A 3A7DA 1KOFA 3MJHA 4NZMA 5L4LA 3U5ZB 2GMWA 2R66A 3Q8XB 3DB2A 1LI7A 4F92B 5KNDD 2QNBA 3AUTA 4BP9A 3EUAA 4FYJA 1KEVA 4DDKA 1WEKA 2V4ZA 2V7WA 1T4GA 3KQMA 5GQSA 3NKLA 5ALRA 3M2PA 1EK5A 2Z43A 2FWIA 4MJXA 1UMBB 3HUFA 3K0KA 2FMFA 1X74A 2QW8A 2BELA 2XCSB 5AWFC 2P6MA 3C3EA 5EUCA 1P2UA 1SC6A 3AHFA 1FFEA 2W9XA 4CG3A 1QF7A 4QFBA 4FZVA 2JFFA 4BS9A 3DVQX 4U0JA 3ONVA 4IQGA 1J1UA 1WUIS 3TXYA 1QF9A 2A0UA 2GSWA 5KC9A 1X2BA 3GJ5A 4A0QA 5HQTA 5HZGA 5IUJC 2ATIA 2JZNA 3PXUA 1HRKA 1ZXLA 1SCNE 2DT5A 1M0WA 1Q57A 3QVGB 4P7BA 5EMNA 3LUBA 4GZ3A 3RHSA 4HT3B 5BSFA 2FSVA 2IEAA 1H0KA 3OKFA 5EEGA 3AY3A 2JD2A 4YP1A 4Z49A 3GFVA 2I99A 4HOYA 2F8TA 1ZUNA 3L07A 1Z37A 2PD3A 3I5UA 1EVIA 3D3QA 4JI1B 3UJBA 2AK3A 4BB6A 3OZUA 2H54A 2EW8A 5E9QA 3KSMA 4JL6A 4KIJA 3EEIA 4MRSA 1JPVA 3SVTA 1YZUA 4RJ2A 5DTRA 1P81A 3NAQA 1EGVB 3NCTA 4UCXA 4UUQA 4WXEA 5KYGA 3ZQ4A 2C7VA 3WLRA 3DMHA 2N9UA 3BDIA 3IC5A 3AG6A 5T57A 1A7KA 1KFKB 1T0HB 1VFNA 2JFUA 1MEOA 2GYYA 3H04A 3SKVA 4KACA 4F21A 5KDOA 1IN1A 3KOXA 4M49A 1JHXA 4XR9A 1ZGHA 5GP1A 3I37X 2IS2A 2A57A 4N3NA 3C6BA 3NBUA 1F9EA 4BRZA 5I4BA 2YH2A 4BP1A 1AHHA 1IEQA 1Z4KA 2FX2A 1XR3A 2YS6A 3C3AA 4H6VA 3SF8B 3IMEA 5TV2A 3U80A 3WAGA 3G1TA 5CDTA 2RJ3A 2MSCB 3L8YA 1YVPA 4PRYA 4OQQA 3LCUA 3ZY4A 3NH6A 4P2BA 5DNAA 1UL1X 3L7AA 4EY7A 3CVOA 4MUYA 1EUDB 2JD1A 3E3AA 4G86A 1KVUA 2LPMA 4WOKA 4ZVQA 1VXOA 4AX8A 5IT4A 3UGJA 1UMBA 1H69A 3EIXA 4PZUA 3HXMA 1SHJA 2ZROA 3DFMA 3IP6A 3V1YA 4K3VA 4RK0A 1GR0A 4QOFA 3OU6A 2WBLC 3KELA 2V0GA 1VJDA 2IYQA 2PMBA 3ZS8A 2TYSB 4NZYA 1ZIXA 3WWZA 2IHZA 3DV0A 4BECA 1PX0A 2C2WA 4TWAA 3A1VA 4R41A 4EHAA 3KHKA 3L8DA 1W36C 2W2LA 1XF1A 4BRWA 5DVZA 3KQYA 1F0YA 3LY9A 3HEAA 3ANSA 3O95A 2XMSA 5DNUA 1ETHA 3A2MA 4LRTB 4CM5A 3QVGA 5HJEA 2WU4A 1ZM4A 4MS1B 1P75A 3UUFA 3ZZ0A 3HWX1 4XDYA 1NBAA 3ADKA 4D8UA 1FTGA 1U8ZA 4UU1A 1K9VF 3BFPA 1E0AA 2ZRHA 2YQ4A 4FUTA 5J23A 1XTIA 3QVMA 4B3TB 3TJZA 1YZVA 4IYRA 2C2MA 1OPRA 1LEHA 1IIBA 4GIBA 2X9QA 1WXHA 1QVWA 1FBNA 2H17A 5D6NA 3VYVA 4TMXA 2IVZA 2SHKA 1OJLA 4IP0A 1VGQA 5CM2Z 3AETB 1TUBA 1OBCA 2ADFA 2DQYA 3NRBA 1AV7A 3PQ4A 1RFGE 1OVMA 2BHSA 3I9OA 2J32A 4L9RA 1XELA 4BQQA 5BQXA 1GVHA 2GCPA 4UAJA 1WQ1R 3O4JA 1ISRA 4D0RA 4EMTA 5AI0A 2GK3A 4MIOA 4KIUA 2QMUA 3CUYA 3EZXA 1JSLA 1PK7A 2I5PO 3SM3A 3ZDBA 3VKFA 1RHKA 2O5VA 1CF2O 1LNSA 1STOA 1EM6A 4EA9A 4FGJA 4FLEA 4ZOLB 3D59A 4IKEA 2C97A 3SF8A 4BQRA 3BD9A 1KRXA 3LCJA 1VIVA 3DV9A 3PCTA 1QP7A 2F3UA 1AKMA 5CNIA 2Q3LA 3E3MA 2WF7A 4LMBA 3U4GA 5CB4F 3B52X 1RJFA 2F00A 3BGVA 1BDIA 1RACA 1NWHA 2F3TA 1BMFD 1XN4A 3IB6A 5AOBA 1G60A 1THZA 2WFLB 5AUOB 5JHGB 4IEEA 1EFPB 5EKUA 3SBEA 1NUSA 2OHVA 2P0AA 3CO5A 1SKUA 2JFVA 1RTTA 1QIFA 2FUNB 1LWNA 2XTNA 1ZD8A 1KU6A 1ZL0A 2CFIA 2Z5VA 3OJOA 2EQ5A 4GEKA 1O6GA 4KX3A 5COAA 5FTKA 4RNCA 4HDRB 1PJ2A 2J30A 4MV9A 4PLFA 2PL9A 1BVRA 1Q0QA 4KXMA 4PYQA 4WK4B 4HS4A 4HFRA 4EO9A 3DT9A 2XUPA 4IDQA 4TPKA 3QBTA 5AJYA 5I7AA 1WB9A 1DKPA 2PJZA 1X7ZB 3F5SA 3FPBA 3B1VA 5FX2A 3TBHA 4MS1A 1OXKB 3ILSA 4IJUA 3ZEIA 1QCYA 2X3UA 3PB3A 5B57C 5C1BA 4GKBA 3GAFA 2LNDA 2XNCA 2XT0A 4QAJA 3VA7A 1Q0RA 9ABPA 3A2KA 1L5YA 4A0FA 3SS8A 1MEEA 4YMGA 5DYNA 4C0JA 2VPZA 2V6JA 2QTWB 1OW3B 2B9EA 2K87A 1TLTA 2ZAOA 1LA2A 3I9LA 1OWNA 5F5LA 1A96A 2J9XB 3FM9A 2AB0A 1YZLA 4HD8A 1U0EA 5D6OA 4CM6A 1E3MA 4PIPA 1AOXA 1M2NA 4QYIB 3S8YA 5D01A 1CUUA 1KI1A 4DQVA 4PXYA 3PTZA 1JIKA 3UJ7A 1ULTA 4P58A 3NVMB 1Z47A 2BEWA 1V8FA 2A4KA 4ZVKA 2OQ2A 4JB8A 2AE2A 1K7EB 4F97A 3P0JA 1QFMA 2H4WA 3C3KA 4DRZA 1IEWA 4LGMA 4E1VA 3W3AD 1GNSA 3NP7A 2I78A 4CDGA 2OECA 2XZLA 2KB0A 5D1NA 4ZOLA 1JW9B 2RHCA 1CY6A 4MUJA 4X45A 2WHPB 4TV8F 4AB1A 1OFUX 5DWDA 5EWMB 2XEDA 4DCVA 4J7XA 5BXYA 5A06A 4CIAA 2QG9A 4D42A 5DTIA 2VF5X 2Y93A 3ASYA 2J48A 1UOOA 1W46A 1ZQ1A 1EDZA 3OZSA 4ND8B 4QXQA 4TSKA 4PHGA 3S2GA 4AS2A 2JGLA 3ZH9B 1OHHA 1DQSA 4W7HA 2XAUA 4F4IA 2WFLA 3SZLA 2EC5A 4DUYB 3BWDD 1EFPA 2YFHA 1YJAA 5DHTA 4Q9KA 3RC8A 3UZUA 1VA4A 5D1HA 1Q0LA 3VOAA 3ZQUA 4MAMA 2GEFA 1SKYE 4OQPA 4OHKA 1VLLA 2N47A 1Z5NA 2VCYA 2VYQA 3H1AA 2DBYA 4I6JA 5T8KC 3RIXA 4AMYA 1B4DA 1R0LA 1PZMA 4QE3A 1C0LA 4YP5A 1A76A 2IYZA 1LK0A 1LW6E 2I9KA 1SQFA 1KY2A 4OHUA 5F51A 3X1WA 1E18A 4QBHA 1VHQA 1NUHA 4YQZA 1JEYB 1IBLB 2H92A 1H1TA 1XZKA 4LJ8A 4EY8A 2OQIA 1U7PA 4TS1A 3TB4A 5KTMA 1N0VC 3B2NA 3JQBA 4RDHA 2INGX 4Z2YA 1G18A 4AS3A 4O1IA 3NX4A 3QOXA 5CU7A 1X7ZA 4OHBA 4RD6A 1J56A 4DSNA 5FOQA 3GLUA 1ODCA 2DR0A 1LBHA 1VYUA 3H5VA 5EN4A 2IH2A 5JJIA 2O4UX 2UZAA 3CMCO 3FOWA 3W2FA 1OB2A 4C4OA 1USIA 2JKYA 4QRHA 5ARCA 3OTIA 1T5HX 3OVMA 3P27A 3SMQA 1IMJA 2AG8A 3ZHQA 4OI0A 1Z7WA 3F1KA 1NUQA 1PW5A 3WGIA 1HQCA 1B6RA 1XKLA 1EP2B 4U2KA 2JFBA 2PR7A 1OOEA 1V5FA 1E1NA 1IHPA 1PWEA 1YQ9A 2WB4A 2YIVX 3NG1A 4Y2SA 2B69A 3WO1A 5EIBC 2B8WA 2KX7A 5G3YA 3K9QO 3RI3A 4CV2A 3PHLA 4YGYA 4JFRA 1J21A 1TDJA 4M9XA 4P38A 2VP9A 3MMNA 4F8JA 4LYGA 2GK6A 1L9KA 2JIOA 4YDSA 3BFKA 2EL7A 2JEYA 5KTNA 2JFOA 1ODIA 3MTGA 3N87A 3QOFA 3Q5GA 4QA9A 5BVGA 1TTTA 2B6NA 1ZUD1 1I5OA 1N0HA 1NQTA 1WF3A 1U0SY 1YT5A 2G76A 2IA5A 2ZQYA 3HBLA 3PR2B 5ECWA 4IIHA 2OYCA 5JJ5A 5DO9A 1GVNB 1X7HA 5FT9A 1SO8A 4KR3A 1EHCA 1JHPA 1MKYA 2G82A 3DZGA 3KQPA 3ISTA 5DOZA 4KAJA 2EF0A 2ZIUB 5AI5A 4E3WA 2CSXA 1JAYA 5D00A 2VJLA 4O4IF 3PNLA 1Z6XA 1M2HA 1NNLA 2YZGA 2LKCA 5KSYA 1S2DA 5SZIA 1M8FA 3B36A 4HNSA 4P33A 3OD5A 3VM6A 1OXTA 5F7XA 3JWJA 3WBFA 4JU8A 3IHTA 4EHDA 1N8SA 3K4QA 1RZ3A 3RAPR 1O94C 5AW0A 4BNTA 2Q9AA 3WISA 3BRSA 2AK2A 1S8NA 4I55F 3SLGA 4GEGA 2Y67A 2BOVA 4JT8A 3F4KA 1K5DA 1ABFA 1MN6A 1UEJA 1Z62A 3RTEA 4B9AA 3BEDA 3NP9A 4Y1GA 3U9TA 2PZGA 5H9VA 4ETNA 1BHSA 4NZ9A 5A3QA 1MV5A 2ZI5A 2ILVA 1GPLA 3C2QA 1V1JA 3MWGA 5P21A 4EVIA 3D6AA 1FPQA 2JFPA 4KWIA 3G7SA 2POQX 2AEJA 4ZALA 2AXEA 2XI4A 3PR1A 3FW1A 2AQHA 4LPSA 4GWKA 3RUIA 1Q95A 4EIWA 3HB5X 1F2DA 3TW4A 1PO7A 3EGXB 5BR8B 4ZCPA 4G63A 4GPZA 1V7CA 4XOIA 3SR3A 1R6VA 1RLUA 4KXXA 5EHXA 4B7AA 4AO8A 1OWMA 3OG9A 1RYEA 4IKPA 3JVUA 3LPNA 4ZOBA 2PBZA 1U81A 3HGTA 5L7WA 4KE7A 2AFHE 3EOZA 2ZWOA 3ET4A 2YJNA 2X2FA 3LXMA 5EHNA 1QZXA 1EG7A 3EGOA 1VG1A 3D0QA 4TQAA 3RUCA 4ZVSA 3H8VA 4PQFA 2UXBB 1M2OB 3TLXA 5E2BA 2YBEA 1IEXA 3HRHA 1I7NA 1LSJA 3QVJA 4G0PA 1NVDA 4BDSA 1K97A 3Q3GE 2XNJA 4EECA 1ZMBA 2J59A 2FMKA 4LBVA 5COQA 2QN9A 4FHDA 1E4EA 1QGUB 3ICQB 1GCIA 2CVZA 3D3KA 2VCHA 1G8YA 4YJGB 5CJ2A 3NVKI 2FPMA 4E46A 4N0MA 1YDEA 1Y1LA 2EKBA 3SXJA 2AMVA 1XTBA 2I22A 1OV4A 4IXNA 5ER9A 4WNIA 3KUXA 1BGWA 2QKYA 4MROA 2OT3B 3H99A 5B30A 4O3MA 1YCHA 3A3YA 4IMRA 4UZFA 2YCBA 1Y8AA 5BSVA 1ZRHA 1YKFA 4AUNA 5K2MA 4KBFA 5HGJA 3P9CA 1UJNA 1DRVA 4LKRA 4Q4AB 5HQJA 1QE3A 4P86A 2G9VA 2J31A 1QYRA 1DAGA 1HR0B 1VPEA 3MMSA 3GPDG 4PS1A 3SK0A 1ADCA 2IOHA 4HBZA 3AG5A 1VMDA 4QPDA 1VIDA 3RSQA 1H6BA 3FSEA 3VSCA 1ENOA 4ZDIA 2XQGA 4Q3NA 3ZGZA 1G17A 2GOYA 2J9FB 4YBRA 1MPXA 3SHFA 1Y7TA 2GUWA 4JYPA 3MGGA 1MO6A 1UJ6A 1GFSA 3BHMA 1ZCAA 2QT9A 4C9BA 2F8SA 4B45A 2MDTA 3WGLA 4C06A 2HUPA 3EGXA 3HR4A 3ZE8A 4OHFA 3V4ZA 5AVUA 5BV8A 3AVUA 1QH9A 3DEJA 3PQ5A 1FZTA 3WIOA 5JQGF 2Q3BA 2WOJA 5F9HA 1WXIA 3QFSA 2HWWA 4DLNA 4MV5A 4K6GA 2FK8A 5J5AA 3WWPA 3WL5A 3W6NA 4IGAA 1HDXA 4BIMA 2CKMA 3FDFA 1YDFA 3H11B 1H6CA 1R6DA 3LQFA 4IR7A 4O4LF 4V3BA 5TEWA 5UKDA 5L4NA 3WRXA 2ALJA 4W5RA 3MEQA 4GG1A 3ELBA 3BXHA 3Q10A