1R0YA

Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with adp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
266
Chain Sequence
TGIIMENVTAFWEEGFGELLEKVQSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 86
structure length 266
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r0yA00
2IYUA 4GMDA 2B6HA 4QBFA 2VL7A 2XXAA 2KI5A 2ZRNA 4US1R 5CK5A 4OQXA 1WXQA 4L15A 3A4NA 1VG8A 1CKEA 5M04A 2PJZA 1NSTA 2D7DA 4E07A 4RCYA 1A2KC 2G1KA 5JMTA 1BS1A 2WOJA 2VF8A 3MJHA 4GNKA 5AUQA 4BLPA 3PENA 1SVOA 3RDPA 3OE7D 2A5DA 3W34A 2GBLA 2Z4SA 3BH6A 3OFNA 4IXMA 1SXJE 4ZCIA 1JXOA 1DAEA 3BC1A 1R0ZA 2BC9A 2HV8A 3R9WA 3BWDD 5LB2A 4DCSA 3A8TA 1P73A 3U60B 3TUJC 4O3MA 3GFTA 2B7BA 3WBJA 4TZ6A 4PZLA 5EE9A 3JVVA 4QGGA 1ZRHA 3QKRA 1ZW6A 4C2TA 1RZ3A 4Q4HA 5KPDA 1DG1G 2I1VB 3VR6A 2ZSDA 1XWIA 4TYQA 5E7MA 1E2PA 2IS6A 1LS1A 3B1XA 2WIAA 2ZEJA 2NO0A 3PIRA 1Z08A 5EE1A 3ADKA 3ASYA 2CCGA 1S3SA 4YMVA 3AVQA 2GJKA 2DWOA 1MH1A 1E9RA 4F91B 1SKQA 1HV8A 5J4LA 3RABA 4O2RA 4B2PA 1UDXA 3ZIAD 2F43A 3KB1A 5BYJA 4PAOA 2IUSA 1JR3D 1QDEA 4Q4LA 4E5UA 3KQHA 3PJRA 1P62B 5A0FA 4LPKA 4A0HA 4JLOA 4C2UA 4FCTA 1OKKA 3AVXA 4FIDA 5L3QA 3MWLA 4HB4A 3RWMB 3K0AA 1FUKA 2DWPA 3KZ1E 1KGDA 3NXSA 2QEQA 4PC3A 4RVCA 1FMLA 1KDOA 2R6FA 4LJAA 4OK5A 3LY5A 1U0HC 1E2KA 2DYKA 2G1JA 3R7WA 1J8MF 1KO7A 3W5IA 4B75A 3KJIA 5J4HA 1E2NA 1SVIA 4TYNA 3UG7A 3DMNA 2IF2A 2QAGC 1G18A 3BFVA 3L0OA 4OHZA 3U44A 2D3WA 2J9RA 2PLFA 3GLIA 1F2TA 2QRNA 1NN1A 5J4KA 4W9MC 5HE8A 2GTPA 1QHHB 2H7VA 4GT1A 1MT0A 5DNYB 2O8BA 3SBEA 1E32A 1FQJA 5JS7A 1XTSA 2CL7X 1ZM3A 3VR1A 3K0CC 2O8CA 3U4QA 3GLGA 2N1BA 1CS4C 3CPJB 1W36C 2BMEA 1G7CA 3MCAA 3BB1A 2GJSA 2ZTSA 2BCJQ 4TN1A 5L3SA 4HUTA 3DVLA 5FOSA 2FWRA 3LBIA 3MGCA 4Q9KA 2YOHA 3WNDA 4BLOA 2QM8A 4Y0VA 2GK6A 1Z2AA 1G8PA 2WOOA 1GL7A 2FFBA 3I92A 5FTLA 1SHKA 1Z6TA 1XMSA 4DCUA 3IKJA 3QF4B 3G0HA 3RS7A 2OCAA 3E5HA 1TMKA 4PXAA 3FDIA 3LRPA 5J5CA 4KVAA 2HF9A 2ZI9A 3IIMA 2V6IA 4DLWA 2N46A 1QF9A 1ZD8A 2C95A 1U8ZA 4JJKA 2ZJOA 3DKPA 1VYTA 1PLKA 2WAXA 4IOLA 5GJWC 2PCJA 4QRHA 3SYKA 1E1QA 4QFMA 1I2DA 1KKMA 3PEVA 4D4JA 3B9QA 4PO1A 1CR0A 1IONA 1KDTA 2A5GA 2C96A 2ZUCA 1OPXA 2Q3FA 2X1VA 3I4LA 1U0JA 4EUNA 2FFQA 1II8A 1A82A 4C0BA 1D9ZA 3AF3A 4HDCA 4QC2A 1KZGB 5BN5A 1JEEA 3WHLA 2BBWA 1W36D 1U0LA 2G77B 1XTJA 1SXJA 1W0JA 2VIIA 1AA9A 1OJLA 3GJ5A 4DDTA 1DAFA 3LW7A 2YKGA 4DEYA 4BEJA 2NTYC 3U3RA 4ZDIA 5DN6D 4U7DA 4ITRC 5FUYA 4QNMA 3KXKA 3JZMA 5CITA 4JYBA 3CWZA 2ZJZA 2ZRGA 1VTKA 1G64A 1N2CE 1KSJA 2VH5R 1U9IA 2JIZA 3QXHA 1E2JA 1DTSA 2OEPA 2D74A 2PT5A 2ZPTX 4FMDF 3ZVRA 5DGXA 1NG9A 3I61A 3UANA 1M34E 5CB8A 2Z83A 1G291 3VKGA 4GZLA 1F60A 2GVDC 3IIKA 3O8BA 3AKCA 1NVWQ 1YVDA 4YQFA 3FOZA 1COWD 1WF3A 3TVTA 4MRNA 1NMZA 521PA 2CLSA 1TNDA 4Q21A 1P60A 3QSYA 5FUXA 2BBTA 4EDHA 4R71A 4CEIA 3SQXA 1RKBA 4LWZA 4XSGA 1F48A 4OQLA 4D81A 3GEHA 3ZVLA 2RCNA 4NBSA 1KOFA 1K5DA 4KFUA 1RW4A 3IILA 3CH5A 3QXCA 4M9QA 4G5RA 1DO2A 4XD7A 4MRRA 4TLAA 5KSOA 2REOA 2DFNA 4BGDA 4DHEA 2JDID 5AWFC 3SJBA 3L0SA 1Q1QA 3T5DA 3DPUA 3VU9B 2QT1A 1QVAA 1XZQA 1FW6A 1N6RA 2F7SA 3KJEA 1FZQA 1L7VC 1N6NA 2Z5FA 3CX8A 3QPVA 2F1RA 1L4YA 1VYVA 4P4TA 3VX3A 4BFSA 3ZH9B 2YV5A 4MRVA 4AKHA 4L4UA 4WXPA 4W7SA 5IF9A 3C16C 2A30A 5F98A 4KV9A 3FMPB 1OB2A 2ZJ8A 3QVUA 4TT3D 2XX3A 4Q9LA 1G3RA 1RRCA 2GEVA 3LAWA 3T12A 2BOVA 4C3ZA 4FN5A 2J59A 1OT3A 5BW8A 1YU9A 5LDDC 2JATA 1IAQA 4IEEA 5FBLB 2F1JA 4OL0A 4TYWA 4Q4AB 4DBLC 2W2XA 2QBYA 2OILA 3MWYW 3GPLA 2ZROA 3WBKA 1Q44A 3KQNA 2XOKA 3LBHA 1RFLA 4BQSA 2GCOA 1MOZA 3LQRA 4DIEA 1I2MA 4URVR 1WBBA 2YOGA 4ESVA 5E95A 3LWNA 3GJ7A 4OI2A 1E2HA 2W58A 1GNPA 2WMNB 3LD9A 3IQWA 4PPNA 5KNDA 1M7GA 1RRFA 2ZRFA 1ZNZA 1XEXA 2GKSA 1E3MA 3GJ4A 3B8HA 3VFDA 1DEKA 3RANA 4TSFD 1Z83A 4A9AA 4AG5A 1E4VA 1W1WA 2CK3A 2REBA 5CJ2A 4B74A 5KTYA 3WMGA 4QL3A 4V0NA 1Z2CA 4DEXA 1M1YE 4G5GA 1R2QA 4M53A 3OAAD 4QBIA 4HB3A 5EQTA 4HLQB 1E2QA 4IOKA 2IC5A 5DI9A 1KI7A 1RJ9A 4KODA 3TVDA 1E9DA 1Z0FA 3K09C 3QEJA 4LBYA 4XTCS 5FR1A 1XJQA 3PUWA 4FMCB 4WAUA 3ZJYA 1ZAKA 2EFCB 5G3YA 3EA0A 4EAQA 3NG1A 1MRSA 3UMRA 5EP1A 2FGKA 4FCVA 5DSZA 4F4IA 4G5OA 2YC4C 1ONBA 2C2HA 2QE7A 4XJXA 5E4FA 4DLZA 4DUGD 2HLDA 3CNLA 3OIVA 1KIMA 4NONA 2ZI6A 3H84A 4KBFA 1A2BA 4ZV4A 2GK7A 3CB4A 2MMGA 3DM5A 3ADDA 3LA6A 2OFOA 2WJJA 3HU3A 4B73A 1IXSB 4UJ3A 2R6CA 3VR2A 2NOAA 2ZJ5A 4KAXA 1XMIA 3EIQA 4Q47A 4TMKA 1DO0A 1GWNA 5F9FA 2ZRDA 2FG5A 3EX7C 2GESA 4UXHA 1BKDR 3ZVMA 2O8EA 1DELA 3AF1A 2G83A 4AWXA 4HUQA 1TQ6A 1ZP6A 2P6RA 5AK0A 3ZZUA 2XZPA 4LDJA 4GP7A 2F6RA 4M8NE 3TLXA 3HR8A 2QMOA 1ZUHA 5EXXA 3OIUA 4DWJA 1HH4A 1N6LA 2HEIA 2BEJA 3RS2A 1A1VA 3D8BA 2J46A 3PITA 2CJWA 3I5YA 2QP4A 3QG1A 4MYCA 3H2YA 2AKYA 3W8RA 3U7GA 1YZGA 4KFRA 2IYQA 2VP6A 4FINA 1ZD1A 3THXA 5C2JB 3MSXA 1E2DA 4B2LA 3AVVA 4IVPA 3D6TB 2HT1A 1EG7A 5DI3B 5FI0B 3RYTC 3TE6A 1T3HA 1EWQA 2L0XA 4D82A 4IRUB 1TF7A 1MO4A 4PAMA 2QQEA 1G21E 4D0LB 3P20A 3EW9A 3QKSA 5EXPA 2ATVA 2QTFA 2GXUA 4RD0A 1XF9A 4TTQA 3P4XA 1NBMA 1OIWA 4I4LA 3SFZA 5FI1B 3N2EA 1NJFA 1PLLA 3B9PA 1UKZA 3CRMA 4Z8YA 2H18A 1J8YF 4HEJA 1KY3A 1LV7A 4TMZA 1ZCAA 1NVXQ 3LO5A 5SZKB 4P4SA 4GI7A 4YMSA 1OYYA 1H8EA 5KHOC 3DKVA 3SQWA 1Y63A 2JLXA 2ORWA 1W49A 5FPYA 3VHXA 3BH7A 5LBIA 4A8JA 3KFVA 1PUJA 4LHZA 5DYIA 1R10A 2O8FB 2FEMA 2ZRLA 4LHWA 2JLUA 2ZE7A 1P6XA 1UKEA 1XDBA 2BJVA 1FX0A 2ZRJA 4QGFA 3U3JA 1P7CA 1TQDA 1XJCA 4O2LA 5C1BA 2FH5B 1CR1A 2IF0A 2JJ2D 5LD2C 1E99A 5FOVA 5JJKA 1DAHA 2GBLC 3CIOA 1LW7A 2QORA 3ECCA 2ZJAA 2DBYA 2ORIA 2QY9A 2ZJBA 4ASUD 3RS0A 4EFMA 1RYHA 1VHTA 1N5JA 2ASEA 1BMFD 1D6JA 1UBFA 2HXYA 2R9VA 2YVUA 3BJIC 4AURA 5B30A 5JRZA 3LBNA 1M6NA 2CNWA 1K8RA 3EWAA 2AKAB 3EPHA 4YDSA 4DSOA 1ZC4A 3TJZA 2C98A 1ZM9A 4IVQA 5G3ZA 4NH0A 2CHQA 3OHMA 1P72A 3L0IB 3ND9A 3U3KA 3AKDA 3PEWA 2FFHA 2O0HA 4WZ6A 2AXPA 4M22A 2W83A 3GJXC 3W8NA 3LNCA 3GEIA 4M1YA 4HZUB 2VHCA 4ARZB 4D25A 4D2IA 4BLRA 1F2UA 2CXXA 421PA 1TTTA 4IDPA 3GCGA 1XD2A 1SZPA 4DLRA 3GLFE 5DH9A 1SHZA 3DM9B 1JAIA 1OIVA 3TGPA 3OFND 1Q21A 2HUPA 1BOFA 1ZU5A 4JJZA 1S2MA 4MRSA 2XZOA 4PC6A 1G6OA 4FCWA 4AI6A 5EUMA 5DE3A 1V5WA 1VG1A 4FWTA 2ZVQX 4HLCA 1CP2A 1X1RA 3P4YA 2C9YA 3ADBA 2GDJA 2HCBA 2ZI3A 2FGJA 3DEFA 4U02A 3ND8A 5IRCD 1NSFA 2OCPA 4IHQA 121PA 5F3WB 2AK2A 3IO3A 3CX6A 5B2ZA 2KBEA 4WBSA 4UNNA 1JAHA 3P32A 5P21A 5FOUA 1T0JB 1YE8A 4TMWA 2YNMA 4TL6A 1UBEA 1R0WA 1XEWX 2GEDA 2R6DA 1GVNB 4AG6A 1W44A 2ATXA 3F3YA 2H1LA 2R6AA 5JHGB 4H1UA 4CEHB 3ASZA 1EFCA 1NVUQ 2FMXA 1S96A 3U6BA 3SN6A 1OKKD 3S1AA 3QPWA 3ZYCA 2RMKA 3NWJA 4E09A 2GILA 3M0EA 4V0OA 1AZSC 3FWYA 1D2EA 2BDTA 4Q1CA 3A36A 3D7MA 2FSHA 1Q1ZA 1FNNA 3FHTA 1KK3A 4B6EA 4NYIQ 2QNRA 2WSSA 1SKYE 2J87A 2IEZA 1E96A 1TUIA 3FVQA 1KKLA 4BASA 3FB4A 5KU1A 2OZEA 1O3YA 3D3QA 2VRWA 1NI3A 2KE5A 4CVNA 4BRWA 1SVLA 2O0KA 3JZAA 3RS3A 3QEOA 4DT1B 4NCJA 3SI7A 3SU8A 2P5TB 5JBQA 3KKPA 2FN4A 4CEJB 3LLUA 1KAOA 2WJHA 4C7OA 3B82A 1IY2A 3T1QA 3BB3A 3LV8A 4G01B 4M9XA 4R7ZA 3QNUA 3HP1A 4OHYA 4UNSA 2WWWA 4BFZA 3A1TA 4BWYA 2LWIA 4WVFA 2JLQA 4B33A 4EJSB 1OB5A 2BM1A 1QHYA 2XB4A 3CX7A 4FD2A 3M1IA 4OQNA 3HPRA 4N3NA 5AUOB 5GVRA 1FOEB 3V00A 2LCFA 3MJRA 4AKGA 1Z6YA 4URWR 1M7BA 4YC7A 4P0TA 1OFTA 5A4JA 4CT5A 1OV4A 3RSOA 2ZI5A 1VPLA 2FA9A 3QKUA 3WNCA 3WYFA 3DMDA 2PCLA 4DLUA 4PR0A 3UK6A 1E1QD 1ESNA 3KJHA 1JPJA 1A4RA 1Z06A 5JEDA 4NYJR 2GXQA 3CR7A 4B48A 4Z8XA 1KY2A 2WBLC 3L2OB 5ANRB 4MYHA 2R44A 4NU0A 4UKDA 4QM7A 3GLFA 1YRAA 2A5FA 2JAQA 1HQYE 1OYWA 4BRUA 5DHFA 4ZIRA 2JEOA 4IOJA 4PFSA 2ZSBA 1E9EA 1QG4A 2ZRKA 1SXJD 1W0JD 4CT4B 5JRJA 1KNQA 3TW4A 1ZU4A 4NHOA 4TTRA 3HU1A 1XX6A 2VQSA 4URZR 3NH9A 1Z0DA 2DFKB 4A36A 1LY1A 2QTVB 3R20A 1BIFA 2IWRA 3CF0A 4PHTA 4B3FX 5FTMA 1XMJA 4GOXA 4EPVA 1ELOA 2IX3A 4B76A 4RZXA 1ZM4A 4Z54A 4HAWA 4PPGA 4P3YA 4EPXA 3U7FB 2BVNA 3DL0A 4RD4A 5FUVA 2JIZD 5KNCA 3REFA 2YWGA 2P67A 2CHGA 4LI0A 5H70A 1G7SA 4FMDB 4Q4JB 4PC1A 1G17A 2G0TA 4YLGA 3QJYA 2PMDA 4LJYA 5CIWA 4RD6A 4ACAA 4GOKA 2HYIC 2FV8A 3U5ZB 3I8SA 1NG1A 2LKCA 4MKGA 4BFYA 1XNJA 2OAP1 4HB0A 4H9GA 4RFSA 3VR5A 4Q7MB 1VHLA 2FPLA 4D0GA 4EKDA 4BFTA 4OQFA 1IN6A 4BUJA 4S2EA 1G19A 1MO6A 4W5JA 2IEYA 3ZDQA 4A82A 2ZAMA 2PLRA 5L3RA 1UBCA 1QHNA 2B92A 3RRYA 4JLBA 1WMSA 2PBRA 2QAGB 2BKEA 3Q3JB 2G3YA 5FPSA 1G3MA 2AXNA 4XD7D 1YQTA 5FL3A 4C4PA 4TMTA 2V3CC 3CNOA 2P3SA 3QOFA 1JBKA 3Q85A 5FPTA 5IHPA 3RS5A 3E1SA 3D31A 3SFVA 5FBVB 1SVWA 4V03A 4MDFA 4WIAA 3BFKA 1LF5A 5D3QA 5CYOA 1GUAA 2RGNC 2IYYA 2WMOB 4BFWA 2WKQA 2IYTA 1BYIA 2V54A 3QUSA 5GVSA 2OSBA 2G9NA 1W36B 4L8GA 1FPMA 1W4CA 4EPYA 2IYRA 3WMFA 4LBWA 5HR5A 2YWHA 3RS4A 5TARA 2G0NA 2QPTA 4M1KA 1F6BA 1ZJ6A 4MUAA 1IY1A 3WYAA 5UKDA 1RPZA 1D5CA 2IS1A 2J7PA 2CE7A 1LFDB 3JVUA 4FMBB 2EU8A 4PO9A 3T34A 1KSFX 4KJZA 4QOSA 1JJVA 1JXMA 5JWOA 2JJ1A 2V7QA 4Q9JA 4YXWA 4LBVA 2DB3A 5JJIA 5KYKA 4TMXA 1TF2A 2CL6X 2J3EA 2XOKD 4XTRA 1N0VC 3VX4A 2IYSA 2AFIE 4GDFA 1NY5A 2NZ8A 5EE3A 3BERA 2IHYA 1W5TA 2FOLA 4JVMA 2VO1A 2R2AA 2RGGA 3NIBA 3NBZC 4IFBA 5G53C 5JSZB 2PX3A 1R8SA 4AYWA 1UFQA 4AKEA 1J70A 1QHIA 1VG0B 1XJ0A 3GP8A 4K8OA 3ZZ0A 1NP6A 2QP9X 1ZNWA 3IUYA 2C03A 4L16A 1TQ4A 4QXAA 4DCNA 3KKNA 4BLTA 3THOA 4JMPA 2CK3D 1JJ7A 2QSZA 2KB0A 4JLVA 2QTHA 4B71A 2VHTA 3RRNA 1YR7A 5AUNB 4I1VA 2C8VA 3ZZTA 1R5NA 1LVGA 1Z8FA 2VP5A 4IW3B 1GG2A 5TDHA 3NDBB 3VKHA 1E6CA 2AL7A 4HAVA 4HDOB 5JFGA 5JZVA 3EC2A 1CF4A 1Z6GA 1IXRC 1CR2A 4FXPA 3ICQB 1NNEA 3TW8B 3QE0A 2HXSA 2VHUA 4MGIR 1KSGA 1X8KA 3A1VA 4RKFA 2AWOA 3VR3A 2ZAOA 1EX7A 4L9WA 2ERXA 3LW8A 3LXRA 1AQYA 2VSOA 1N25A 2QAJA 4EQ6A 4OK3A 2QE7D 1DVRA 4URYR 1NN3A 1BO6A 4NPHA 2E1RA 3OIWA 3X1ZA 2ZYTX 2HLDD 3HJNA 4TLEA 2SHKA 2GA8A 5EUQB 3K0FB 2GZDA 3EA5A 4A0GA 1XTKA 5H68A 1F3OA 3K9LA 3LDAA 1S9DA 3T1VA 4RD2A 1Z07A 1OHHA 3AVPA 4KO8A 2VYFA 5EXSA 5JWHA 2BJWA 4B32A 1G5PA 2YWFA 2V1XA 3Q8XB 4NKRA 2VLIA 3QQ5A 1UKYA 2J5XA 4LUCA 1KSHA 2RGXA 3AB3A 4Z51A 2WJVA 3LVQE 5CIQA 2Z43A 1YR6A 4I1SA 4JVLA 3C14C 2GCPA 2OE2A 1YKSA 3ICEA 3X1YA 2A78A 4DZZA 1HUQA 2OO7A 4QGHA 4OKSA 4PHFA 5IT5A 2CL0X 1G8GA 2W2TA 3QY0A 5KDLA 2J41A 3THWA 1US8B 3CZPA 4D80A 4QG7A 5HZKA 2KBFA 4NCIA 2GAAA 1SVSA 2ZSAA 3T1TA 2NO7A 2WZQA 5HKKA 5AJZA 1OH7A 4CW7A 1P9RA 1C9KA 2EYQA 5CB6A 3WRXC 1R5OA 1XCGB 2F3RA 4RD3A 2H8KA 4ZDJA 4KSBA 3AVWA 4KI0A 2Q0HA 3AVYA 1E9SA 3CF6R 3TK1A 1D2MA 5BQ5A 2F55A 3Q7QA 1KO5A 2EQBA 2FSIA 5JECA 2J0UB 5JWRA 4O25A 3OEEA 5E3HA 4XVUA 4DCVA 1K6MA 3T06B 1KHTA 2OAQ1 4P31A 4JIMA 5FFMA 2NMVA 1JQJC 2X2FA 2BMFA 4Q19A 4UJ5A 1E4YA 5KNBA 2D4HA 1GKUB 1NBMD 4POAA 4RZ2A 2ONJA 3H0KA 1X3SA 2W6IA 2XSZA 4B47A 4C0QC 1EK0A 1NRJB 1AS3A 3C41J 3V9PA 4EPWA 1FFHA 1T8UA 3PVSA 1N6HA 3KTAA 4X8OA 1Z0KA 3UKDA 3REGA 1XTIA 1XXHB 2EWWA 3CPHA 5IK2A 5BYKA 1H8ED 4KSCA 1UEIA 2F9MA 1XPUA 4R98A 1LF0A 2NO6A 4HDQB 4TTPA 2C04A 5HTKA 1KI6B 3TAHA 4R2HA 2ORVA 2H16A 4O0MA 3QIAA 3FHOA 2JLWA 1CTQA 4K46A 1TEVA 3ZD6A 1VECA 1XRJA 4KFSA 4B3BA 1X1SA 3WRYC 5D3MB 2D62A 2FNAA 2DHRA 4GOJA 4DSNA 2QPAA 2A7QA 3EARA 2FSFA 3FE2A 4M1OA 4WOPA 3PEUA 2FPMA 3B13B 1E98A 2PZGA 1Z0IA 4LK2A 4M1WA 4C0KA 1MO3A 3CRW1 5JLJA 2I3BA 4JLDA 4PHGA 5CLQA 4B3GA 2FDCA 4LHXA 2IUTA 4OK6A 1XTQA 3SC3A 2Q3MA 1ANKA 2FEOA 1EFRA 1ZC3A 4PQRA 1E9FA 3FKQA 4WW0A 3W90A 3KJGA 4Q03A 4FW9A 2CNWD 3MMPA 3AP3A 1AN0A 5DIFA 4M4SA 4TLCA 3NBFA 1ZUIA 4LV6A 3O8DA 5K8UA 3TKLA 4HZUA 4ARZA 5B57C 5L8VA 4RJLA 4LYAA 1GL6A 4MITA 5KSZA 1CLUA 1I4TD 3PUYA 5EZ6B 4MRPA 4B34A 1KK1A 2VHJA 1XP8A 3EAQA 4M21A 3EXAA 3Q9LA 4W5WA 1ZMXA 3I8XA 3RLFA 1QHSA 5L3VA 1SQ5A 3O47A 1E2FA 3IEUA 1NN5A 1NL3A 1EXMA 1MABB 2VBCA 5CM8B 1P61B 1S9HA 1DS6A 2C78A 2W0SA 3SDZA 2QL6A 4H1VA 4Q9IA 3TIFA 4BZXA 4MKHA 4DXAA 3F8TA 2A2ZA 2VA8A 4KFTA 1T3LA 2IA5A 5F2EA 4HATA 1T0HB 5FH9A 3HU2A 2QZ4A 1IOZA 4LSGA 1Z22A 3GLHB 3NEYA 2JLSA 2BHRA 3G5UA 2J0QA 1U2RA 3THYB 3ZS9A 3QBVA 1ZNYA 4HLUC 4N1AA 721PA 4E22A 1D9XA 2JCSA 1G5RA 3A1SA 1U98A 2F1IA 3B7GA 1WDTA 3CW2A 3UWOA 2WWFA 2H17A 1E2GA 4OQMA 1KMHB 1YR8A 2ODWA 2O8DB 1UBGA 2CE2X 2BMDA 2V55B 2WTUA 3LQQA 3W6OA 4TL8A 2AWNA 3DOFA 4OBEA 4KBGA 4PSVA 3SHFA 2ZU6A 3LLMA 3NVAA 1IHUA 3EASA 3SYLA 4Q5IA 3EZ2A 3VHLB 2XJ9A 4P33A 4LYFA 2QU8A 2XB2A 4KITB 2ZITA 2ZE5A 1TU3A 5EP2A 5CLLA 4AIIA 1KI8A 3CBQA 2QI9C 1S8FA 4JSYA 4JLPA 4LGMA 5KOYA 1XEWY 3DHWC 3I32A 4QJ3A 2E87A 2FX3A 2PL3A 4DC9A 1CRQA 2WSSD 3MUFA 2O52A 2XXAB 1LB1B 3W3ZB 4ABYA 4US2R 1EFHA 1E2EA 1PJRA 2GNOA 2HF8A 1G4AE 4FWIB 4LBZA 2A3RA 1G3QA 1IXZA 2OT3B 1CU1A 2CVHA 4NDZA 1SULA 1CJTC 2A5YB 3NBYC 3W6NA 5LD2B 3NC0C 4LYHA 1NIPA 5EJEA 3R8FA 4I1UA 3NBXX 3OEHA 1YZUA 1QHHA 1UPTA 5LPNA 4C0AC 3ZQJA 4DSTA 1O87A 4UQOA 4IFEA 4YMWA 3MWKA 3IPXA 2ANCA 2X2EA 1LS6A 2ONKA 5FOTA 1N5IA 1NVVQ 2BIFA 4HAUA 2WPDA 3WNBA 3OF5A 4Q4HB 3QG5A 2IYLD 3QI2A 2DWQA 3L8ZA 3FYHA 2FJUA 2NO9A 4PZZA 2XNDD 5GJBA 1T91A 1XD9A 1Q1EA 4TQUS 2OXRA 3QF4A 5EE0A 1DBSA 8OHMA 5DISB 5GJVC 1HT2E 3WMEA 4Q7JB 3PCRB 4CIDA 2JLYA 4D4KA 3U61B 2F43B 1H65A 1XEFA 1DAKA 3E2IA 2VEDA 4RFVA 1F5NA 3F0TA 2HJVA 3BS4A 2QG6A 3CRRA 2LKDA 4R9UC 1E9CA 1FTNA 1MV5A 4RSGA 5L3QB 3FFBA 5FTJA 5E7IA 3UIEA 4V0LA 3K0AB 1E1RA 1QVRA 1YJ5A 2ZR7A 1E0JA 4PQFA 3A58B 4RY2A 1WP9A 2RKOA 4XVQA 4FI3C 1E0KA 4IDOA 3PFIA 1ZYUA 1IJFA 2KJQA 3RRMA 3B1VA 4TZ0A 4R2IA 3R7WB 5ELXA 3X1WA 2BBOA 3W6PA 2QGZA 5JI3E 3E70C 3NKVA 3U44B 2IYXA 3GLIB 1F2TB 2QMHA 5FBWB 1TAGA 1GAJA 4DVGA 1OXTA 4D4LA 2A9KA 2FU5C 4OI0A 4YDHB 2O8BB 3QXSA 4PC2A 4PAQA 3BGWA 3ONWA 3HYRA 4QBGB 1E69A 3U4QB 1UKVY 4GZMA 1V43A 3GLGB 1FMJA 1YRBA 2AD1A 1RC8A 2NPFA 4A92A 1G9XA 4NZYA 1CXZA 4AY2A 1AZTA 4UNPA 1KI9A 3RC3A 5KUTA 2IL1A 5L3SB 3KL4A 2IS4A 5CK4A 1U99A 5FTNA 3UPUA 1J90A 4LJ5A 5J4YA 2CLCX 3IQXA 3BBPA 1E2LA 3SYNA 4IDHA 4LCBA 1FL9A 5EZ5A 4A4DA 5KDOA 2OBLA 1T8TA 2EFGA 4Q9HA 3K8YA 1OSNA 5A5GA 3V4RA 3B1ZA 4UXIA 4DDVA 4Q66C 1GTVA 5HZHA 2ZXUA 3EIEA 1DARA 3T61A 3SEAA 4EPRA 1E0SA 2OBNA 2R8RA 1T5LA 1FQKA 4A6PA 2Q21A 4BE7B 1MRNA 4C0HA 3IHLA 3B78A 3AQ4A 1XB2A 1Q3TA 4GRAA 4V0ME 1II8B 1IM2A 2ZS8A 621PA 2VSFA 2WJYA 3AV0B 1I4DD 2ZUBA 5HCNA 3VU9A 2WJIA 4BLSA 3OIYA 4JVSB 1SXJB 4BLQA 4GBMA 2GRJA 4YMTA 1GP2A 2QP3A 2BMJA 5IDVA 4Q1AA 3PXGA 3I1FA 3U2QA 3AKEA 4A0FA 3I62A 1N6PA 3G82C 2ZYWX 1FNMA 1DAGA 2CEAA 5J40A 4ERNA 1IN5A 2BCGY 2J7PD 4TYPA 3WP0A 4DJTA 4C9BA 4F7WA 2GZHA 2ZE6A 2JJ8A 4M1MA 2JJ1D 2V7QD 5TVKA 2OBMA 3KUCA 4Q02A 3PUXA 4YXWD 4JVNA 3BH0A 1U81A 1FTSA 4Q4AA 3BORA 2H57A 2HDNB 2XTNA 3B85A 3CWQA 1VMAA 4V02A 3X1XA 5LB4A 1SVKA 4C0JA 2RGDA 1DG3A 1TEXA 2RB4A 1B0UA 4JBWA 1VG9B 1KDPA 1TPZA 2ZRPA 5B58C 3DDCA 3IHWA 3NH6A 4URXR 1R8QA 1Z47A 3C5CA 2IT1A 2ZVPX 5AR1A 1P75A 1SXJC 2O5VA 3A37A 5K8TA 2IYVA 4MA4A 1G7TA 4LY6A 4BPBA 4PQYA 1J99A 3Q5DA 2J45A 3AF2A 5E7JA 4AK9A 4CEIB 2G6BA 3K70C 3K1JA 2NGRA 1G3UA 1X6VA 3CRVA 2RGEA 5J47A 4JLJA 1KNXA 1Z6XA 3SBDA 2XNDA 1AKYA 1KZ7B 1KI3A 2G88A 2ZM5A 1G3IA 4TMVA 3TQCA 4MUBA 2QRZA 4URUR 1U9IC 4M9ZA 3ETLA 5G41A 3W5JA 4ZI3A 2CHVA 4DKXA 3TUZC 3RAPR 3ZGXA 2VHQA 3CH4B 1KAGA 4ZCLA 3AVUA 1NLFA 2D2EA 3QXXA 2C5LA 1GKIA 5J4VA 4A2PA 5H8WA 2DCUA 2Q9CA 3IEVA 4JYCA 4A1FA 1HURA 1NF3A 2OV2A 3SJZA 2Y8EA 3Q7PA 1KDRA 2DY1A 1E79A 2V8OA 3EZ9A 3MG9A 4MGKR 4U5XA 4OI1A 4OJQA 4IDNA 2P0EA 3EIHA 4JLKA 1OH8A 3B60A 2XGJA 2BEKA 1OHHD 5BN4A 1KK2A 1Q12A 2GCNA 1H8HA 2IW3A 2YC2C 3OZXA 2OG2A 4AD8A 5KDDA 3K70D 4RKEA 5FBQB 2EFHB 2DR3A 1AJEA 1OH5A 1KJWA 2QBYB 3F5FA 2WJGA 3U3MA 2CDNA 3B5JA 4B3CA 3UMFA 2FPKA 3FMFA 1Z0JA 4RZ3A 3TBKA 1G8FA 3UXMA 1VKJA 4XWKA 3O8RA 2OLJA 2AN9A 2GCOB 3QF7A 4QM6A 1II9A 1OFHA 1GL9B 4XVRA 3QPUA 3BB4A 2BV3A 2VP4A 1UADA 1U90A 2CBZA 3W9YA 221PA 1U8YA 2KWIA 4V0MA 1P2UA 5HKKD 3VNUA 3J81k 2QMUA 2NG1A 2RH5A 2X77A 5CYPA 4ZKEA 1XEXB 2QPOA 3PV0A 1NMYA 4MH0R 5FUWA 2FE4A 3KQLA 3TSOA 4BECA 5EP3A 1X86B 2AK3A 5AJVB 3U3OA 3UWKA 3MWJA 4B43A 4PZYA 3A4MA 3OEED 4X8MA 5TY0A 2RGCA 1OF1A 1RJ9B 2ZS7A 3KB2A 3T15A 3AM1A 3T1OA 1ZIPA 2RGBA 5DI3A 4ACBA 4M9SA 3I5XA 4LV5B 2JA1A 1R4AA 4Q7KA 4A15A 2CMKA 2W6ID 1PUIA 4Z1MA 2XSZD 4EPTA 2CCKA 2WWGA 3LH5A 3RRZA 2ZYVX 4A2WA 3B6EA 1T3SA 4BEBA 1J2JA 2BBSA 3FMIA 2ZU0C 1MKYA 4F38A 1TADA 1GNQA 4RZUA 4XOIA 3RVBA 1P9WA 3Q72A 5FL7A 1P5ZB 5IK2D 2EW1A 2MSCB 2D7CA 1EWRA 1ZUNB 2ZRHA 3QVVA 4NP6A 4QHSA 4IXNA 4BFXA 4LX0A 1NVVR 1GM5A 1CJMA 5H1YA 1GOTA 3AVTA 1HA3A 2F9LA 1UAAA 1AKEA 3SE0A 2H5EA 2PEYA 3DZDA 4Q18A 2ZUDA 1XU4A 2ODEA 3K0SA 5F9HA 2O8FA 2O8EB 3MFYA 4A2QA 1CJKC 4HUQB 2NZJA 4ZO4A 3FGNA 4B3XA 3VTKA 2W0MA 4AYXA 5G40A 4TWZA 4MDEA 1HE8B 3IDQA 3VAAA 1UJ2A 2X19A 2ZI7A 2GJ8A 3MLEA 3L82B 2BKUA 2CCJA 3H1TA 5BXQC 1W0KA 1DADA 2ZSFA 4Q7LA 1S4QA 2CJWB 2PZFA 1EFRD 2BM0A 3VMFA 5JHHB 3O8CA 1ETUA 5HPYB 4NYMQ 3QBTA 4OI4A 3TQFA 2CLDX 3FKSA 3C4JA 2P65A 3MAAC 4NL4H 2QA5A 1FUUA 1Z6AA 1JR6A 3P1JA 3THXB 1KI4A 1HT1E 1VIYA 2EYUA 1OLOA 4HZIA 3K9GA 2HYDA 3ZQ6A 1JEDA 4IEIA 1YZKA 3WY9A 1E2MA 2W6JA 3HWSA 2NIPA 4DLTA 3WYGA 5AUPB 4KU4A 2QGNA 4G0NA 3WP1B 3IO5A 3SJCA 2C9CA 2V6JA 2AFHE 4I99A 3BFXA 3GJ3A 1D8TA 3QKSB 3PUZA 1BYUA 3R9IA 3PR1A 1Z63A 5HE9A 4OHVA 4D6PA 4TQ9A 1JQLB 4CDGA 2OM2A 1JR3E 4DLVA 1S3GA 4N0EA 4OJKA 2Z6VA 4G3XA 1NJGA 5TXGA 4KVGA 5BWMA 3C8UA 2HCJB 4LZZA 4S35A 2ZJ2A 1Z5ZA 5AJYA 2F3TA 2EVWX 2ODNA 3KKOA 4P4SB 5JEEA 1L2TA 1G41A 1AM4D 1L8QA 3NEJA 4QKQA 4TLDA 4M0LA 1TU4A 1T4GA 4ZDWA 1EFUA 4XSHA 4A8JB 3VNVA 1GZSA 3HR7A 2ZRAA 2X8AA 1PV4A 5EE5B 2PMKA 3PEYA 2TMKA 1FP6A 1N0WA 2DPXA 1FX0B 1E9AA 2NO1A 2OLKA 2PT7A 4LV8B 4QGAA 4CGZA 1UF9A 1GRQA 2XTMA 2IXFA 1N6OA 1NKSA 2IYZA 1G1MA 1OXVA 2JLRA 1XTRA 4C0SA 4PC7A 3IGFA 2YHSA 1NY6A 4KYIB 1VCOA 3R8CA 2QENA 4II7A 1IBRA 1MO5A 2ZRCA 2WHXA 1OXUA 1P2SA 2ZIAA 2Q3HA 2WKPA 1N6KA 4CEHA 2XZLA 1W48A 1TF5A 1RYFA 3GQBA 1G6HA 2K5UA 3KXIA 3PUVA 3TH5A 1Z0AA 4WXRA 1OFUX 2Q9AA 2ZANA 4NCHA 3RSLA 1NIJA 3WHKA 3LXXA 5CDFE 1ZVQA 1NMXA 2B8TA 3P27A 4QJ5A 3LX8A 4A8JC 2XJ4A 3ZLJA 1Y3AA 1GDDA 3KXLA 3DOEA 1P2VA 2VSXA 1Q22A 1I4LD 2MSEB 3TR0A 3V4FA 4IJMA 4IOMA 1II0A 1PLJA 1A7JA 1F2UB 4NYIR 1LTQA 2GJ9A 5GJCA 4G5SA 4K81B 1E0AA 3H86A 1XD2B 2GF9A 2OFWA 2C99A 2WM9B 2W00A 2XEXA 1ZD9A 3AUYA 3HDTA 4GPTA 1M74A 1S0UA 3VQTA 3DO6A 2UKDA 1ZNXA 2HT6A 2QQ0A 2EFEB 3OEHD 2FFAA 4MKIA 4KLNA 4JL5A 3OE7A 4DT1A 3RNLA 2GXSA 4M1TA 4CEJA 2J0SA 2QUZA 1YZNA 1GRNA 3SHWA 4DRZA 2JGNA 5TB5A 4P4UA 2WPDD 4ON9A 3X1DA 1RRGA 3CNNA 3K9HA 4EJSA 3GFPA 1CBUA 1BH2A 1TUEA 4IDQA 1IN4A 2I4IA 3NHAA 4DLXA 4US0R 1P2TA 1AS0A 1P3JA 2WWIA 2ZSEA 5JI2E 1QHXA 5C4GB 1YZLA 2GHIA 3EWSA 4HI0E 2D06A 2OESA 2XAUA 4PSAA 3TR5A 4NMMA 2IBMA 3CO5A 3L43A 1X8LA 2A5JA 5JCPA 2FSGA 1QRAA 3A1WA 3AGQA 3EPKA 1W4AA 2B7CA 4JT2A 1B23P 1GFIA 1EX6A 3LFUA 1KO8A 2B8WA 3ZIAA 3S1AB 4L9SA 4DDUA 1JR3A 4IKEA 4PPFA 3C15C 1WRBA 2E9SA 4V0KA 4CZ2A 2V9PA 3NDPA 1CRPA 2YWEA 1E1RD 4A0RA 4WZAE 4QHTA 3BIFA 1RRPA 2J7KA 1OIXA 3NHBA 4LPSA 5TV2A 2AX4A 1VIAA 4RCZA 5CM9C 5EP4A 4B3DA 5K8IA 4DB2A 1KK0A 3SS8A 1LNZA 2QT0A 3B2EA 3AP1A 1NBME 2XNSA 3L0PA 1GSIA 1DOAA 1XD8A 4UNQA 3N2IA 4Y0AA 4Q48A 1YZTA 2QMEA 3RHFA 3TSWA 2ZR0A 3VKWA 4F92B 2WIBA 5FTKA 1MR3F 2C77A 4MGYR 1ZIOA 1Q3HA 3EPLA 4C7OB 2GWHA 4Q4JA 3BD9A 4PTLA 3WXMA 2GJAA 1TQ2A 2C9OA 3M4YA 1GIAA 2RGNA 3MD0A 1IY0A 1GITA 3IBYA 4PSKA 4D26A 4XWOA 2VP0A 3FHCB 4GMXA 4LYJA 4X8HA 3I73A 1X8JA 2Q9BA 2WV9A 1UM8A 3KUDA 1Q0UA 3BK7A 4EIWA 4AC9A 3Q5EA 2IHBA 4TQAA 4CRWB 1E2IA 4F4CA 3UATA 4AKIA 2IYWA 1VCNA 1RIFA 2B21A 4QNRA 5SZJA 3EC1A 1ZINA 3CZQA 3GMTA 5EXTA 5CDFA 2O0JA 4QJ4A 1KJZA 3CUEF 4NYJQ 4B35A 4A6XA 5KO2A 2QAGA 3BE4A 1NKTA 2V4ZA 1HE1C 2OXCA 4JBYA 2WWYA 3AKYA 3R9XA 4JSTA 1C4OA 1Z29A 1HTWA 4C30A 1QZXA 4TLBA 3GLFB 4G1UC 3AF4A 3AP2A 4ZIRB 3BXZA 3K0CA 1CJVC 2MMCA 2JLVA 1T9HA 4MQBA 5SZHB 3PQCA 2IXEA 4JKIA 4DLSA 1CEEA 2OCBA 3QKTA 4P32A 4HB2A 4JL8A 1JNYA 3EZ7A 2P6NA 1KI2A 3GEEA 1GNRA 5DN6A 3GFOA 4AYTA 1KO1A 1XCPA 1FP7A 2GEUA 2HJGA 4LJ9A 4XH9B 1W4BA 1OE0A 1JI0A 1HY3A 4G5QA 4Q1BA 4LJ6A 2ZQ5A 1D2NA 2ERYA 3FPAA 4Q00A 1YR9A 1G8HA 1N5KA 1N5LA 4DCTA 3BRWD 4J0QA 4DSUA 4HSEA 2I1QA 4CF7A 4PX9A 2VP9A 4OHXA 3U7HB 4DIDA 2ZREA 2IXGA 1IN8A 1ZM2A 2F1HA 1UDWA 3TNFA 3UG6A 2MSDB 2WWHA 3K0EA 4BFUA 4RFSB 2ZE8A 5DYGA 3KDSE 1R6BX 1XXHE 3CPEA 4IVRA 2YINC 5JSZA 5KSPA 1COWA 2QROA 2D2FA 4MYTA 2EWVA 4HAXA 4B6FA 4NYMR 3KQUA 3HYTA 2GETA 4B2IA 4PHHA 3QKRB 3AF0A 4BZPA 1W4RA 1M7HA 2QM7A 1NLZA 1VDZA 4PANA 2FZ4A 1R0XA 1S1CA 2PEZA 1EFTA 2VPPA 1IQPA 1SKYB 3P26A 3AGPA 5SZIA 2BWJA 4RD1A 2IUUA 1KYIA 1CJUC 2WVJA 4GL2A 1QG2A 1R0YA 4UXJA 1EESA 6Q21A 3SR0A 3OESA 4YONB 2ZI4A 2FF7A 2JDIA 2RHDA 1Z28A 3ZD7A 4D4MA 4XWAA 1K5GA 1EGAA 3FMOB 5C18A 4TL9A 4Q1DA 1C1YA 1TL7C 1U8AA 1JALA 3BAFA 3KX2A 4NCNA 4JT4A 4YMUA 3TMKA 4JLNA 1E79D 3N5CA 2Q6TA 4ILEA 3K0FA 4TT3A 1GILA 5C4MA 4F4JA 4KXFB 3TAUA 4JZKA 3N70A 1JPNA 1H8HD 3B1WA 1TX4B 1XCMA 2RHMA 3QXJA 2OUKA 2ZRIA 4ESHA 3AEZA 1Q57A 3I3SR 3TSZA 1PZNA 1CIPA 1G5TA 1HQCA 1PVOA 4M2LA 4NCKA 1J7KA 3H4MA 5FOXA 3ZS8A 1WE2A 4LHVA 2VF7A 5K8LA 1XMVA 1VCMA 2ZRMA 3M6AA 5DLQC 1OXSC 3SJAA 3AH8A 4MYUA 4PPQA 3EZFA 2GF0A 2WAYA 2YOFA 4QBHA 1W7AA 2UZIR 4LOAA 3SZRA 2V1UA 2O8CB 1QHGA 2PX0A 3PG5A 1KTVA 1US8A 3HPQA 3GJ8A 1WB9A 1GRRA 4BZQA 4KHZA 3A1UA 3MRSA 5DHAA 2H92A 5JJLA 4U00A 3FTQA 3GLHE 1G4UR 2R6GA 4UNRA 2ODBA 1M8PA 2OCYC 5JCZA 1W5SA 1WQ1R 1KO4A 1RVDA 3KFXA 5FBRB 1P4SA 1HEIA 2FZLA 1R7RA 3FFAA 4TSFA 1VCIA 4ZKDA 2AHOA 3T35A 1XPOA 3OAAA 3A4LA 1Q1BA 4E03A 4DDWA 2ZS9A 2J0UA 1N6IA 5FPHA 1AIPA 5CJPA 1W46A 4LJ8A 4PO8A 1W2HA 3RWOA 3CRQA 3IIJA 4ZCMA 3KQKA 4Z1MD 4JLAA 4FMCF 4EQ6B 4F93B 1OFIA 1QBKC 1P9NA 4BFVA 4M1SA 4JS0A 1YHNA 2W2VA 4MKFA 3NC1C 4N0DA 4QHYA 4DUGA 5FL7D 3UMSA 2J0VA 4LC0A 5FR2A 2QSYA 2YZ2A 4DLYA 4WZBE 1XXHA 2WICA 2N42A 3RC8A 2NPIA 1G8YA 3KKQA 1DAMA 1E9BA 2J1LA 4MGZR 5FOWA 4D0NA 3K70B 3I72A 1KI6A 4GFDA 2GXAA 1OH6A 3AUXA 4JKYA 4TL7A 1S1MA 4Q1FA 3LVRE 2GAOA 4GSYA 4HYYA 5D3MA 4OYHA 1N0UA 2PZEA 3CM0A 3K53A 4ZDKA 5B64A 5HCIA 3GD7A 2DFTA 4JLMA 1NN0A 4LRWA 3THWB 1U94A 3TUIC 4EFNA 3K09A 3AVOA 2ZETA 2RAPA 4LC1A 1W0KD 2ANBA 3EZ6A 4Q01A 2GVZC 3SOPA 3VR4A 3ADCA 2ZR9A 3IBGA 1L4UA 4KYUA 4I1OA 1Z3IX 1T6NA 2P5SA 3FKSD 1AGPA 2VP2A 4XIGS 2CVFA 4JBXA 3A6PC 3CKLA 4HAZA 2OFXA 2P6UA 4HLUA 1M2OB 2ZRBA 4HAYA 5AJXA 5JS8A 4NTZA 2W6JD 2UZ3A 3CR8A 4B44A 4KLZA 2VTKA 1XFAA 2XITA 1IN7A 1GKYA 4WA7A 1KI1A 3X2SA 5KPJA 2XTZA 4OHWA 1XZPA 3IPYA 3U7EB 3KKMA 5GADl 4LJ7A 1KMQA 1ESMA 2KSQA 3T5GA 2R65A 1VYUA 3BOSA 3QENA 1W2GA 4I81A 3TRFA 3NTUA 2EFDB 4CYMA 5FPKA 2IS2A 1HYQA 1DPFA 1AK2A 3SNHA 1MABA 4ZI2A 4DB4A 3KTAB 1AQUA 1G16A 4Q1EA 1W47A 2GZAA 2RGAA 2IK8A 1WCV1 3LX5A 1XBTA 1AS2A 4LHYA 2WSMA 3C5HA 1SGWA 1JECA 4KCGA 5AJWA 1JB1A 3C7KA 2ZYUX 1WBDA 1KJYA 4C0LA 3GLHA 2OHFA 1G20E 2Z4RA 2PH1A 3GJ6A 3CONA 3THYA 4W5HA 2ECKA 1G7RA 1DAIA 2Z0MA 4NE2A 2WWXA 5DO9A 3GLIE 1RE0A 2PJRA 3U6KA 1CULC 1WA5A 1ZM7A 2NQ2C 1R5BA 1SVMA 1T5IA 1XPRA 2WKRA 3W3AA 5C46F 2DFLA 2YYZA 1A5TA 3CLVA 3EPJA 1ODFA 1KMHA 2P2LA 5TMPA 1Q20A 2R62A 2JJ2A 3K9NA 2QN6A 2O8DA 3GLGE 5BN3A 3DZ8A 4TYYA 2JASA 821PA 1N3BA 1OXXK 3B1YA 4GP6A 4EFLA 4JL6A 4X8LA 1ZCBA 2ZJYA 1ZBDA 5KSYA 3ZVNA 4ASUA 2IWHA 3L8YA 3CF2A 2AD5A 1UEJA 1YZQA 2UVQA 1BMFA 1AGRA 1E94E 4EJSC 1NLYA 1CR4A 2AR7A 2REXB 4L5BA 1OW3B 4HLDA 1IJEA 4LJ4A 4ZPXA 2YJTD 3EG5A 3GJ0A 2JLZA 1DE0A
chains in the Genus database with same CATH superfamily
4CKZA 4R8LA 3E84A 2Q6OA 4OSPA 1NVEA 3KETA 4PF1A 2H2GA 4QBFA 4MWDA 5FWAA 3KVOA 2F1OA 3L0ZA 4US1R 3W5HA 5CK5A 3C3WA 3NQ41 2PIDA 3CCCA 5CTAA 4KIWA 4P53A 3A4NA 2Y0PA 3T9DA 2GZMA 4WY5A 1HKHA 4UVIA 5CVEA 5JMTA 2VF8A 1WW2A 3MJHA 5AUQA 2L2QA 1VLQA 2HA6A 2QN2A 4MS3B 1CUWA 3OE7D 1XELA 2GBLA 3BH6A 3OFNA 1O97D 4QLAA 2ZB4A 4O4IF 4EL0A 2BLLA 2MT9A 2HV8A 1XR3A 4CM6A 3R9WA 4FSHA 5NULA 2D54A 3ODPA 1PL6A 1V3VA 3WBJA 1DAOA 4D9CA 3JVVA 4QGGA 4PRLA 3FIUA 4C2TA 4Q4HA 3TG2A 1OWLA 2I1VB 3JAKA 1B00A 1LU9A 2G5GX 1N33B 1M5RA 2C9DA 2CXOA 2RG1A 1Z5UA 1E2PA 2CMHA 2ZBFA 1WMAA 3DOJA 4FC7A 1WCXA 3B1XA 5I7VA 3LWDA 3IUMA 4XUCA 1T0UA 4X1IA 5BN1A 1LNQA 4LF4B 3SK0A 2IE8A 2HRZA 3QUTA 1QC5B 2VK2A 1S3SA 1VKRA 3H0CA 3SQDA 3VPSA 5T4BA 3QYFA 4BGUA 4XR4A 4KXLA 5DU2A 5H4GA 3UQZA 1X1EA 3E9EA 3RABA 4GX1A 4H3KB 1IIBA 1J7JA 3ICVA 1OMOA 1Q7TA 1YB2A 3D8HA 3EGXB 3KB1A 4GPEA 4PAOA 5D5QA 5BYJA 2EV9A 4E5UA 3PJRA 1G60A 4GI5A 4LPKA 1JHUA 3C8ZA 4HFNA 5TGZA 3DXFA 3NPMA 4FCTA 1RWMA 4C07A 1G6Q1 3AVXA 2J07A 2C7RA 3MSCA 1SD2A 5EERA 2AA3A 5FA5A 2VDWA 2PKWA 1E1CB 1MOPA 3RWMB 3KAPA 4HZGA 3B20A 2VATA 1FUKA 3C3EA 3JPYA 3KZ1E 2HJSA 3I5UA 4IEFB 1NX9A 5HG0A 3I9FA 2QEQA 2I78A 2VJCA 1VGRA 4YDRA 5ALLA 4JI0B 1LJ8A 2GM9A 4OK5A 4RETA 1GPH1 1VMKA 3FDFA 1X1TA 3J81A 2XB8A 2G1JA 3WGVA 3KOOA 1KO7A 1O5OA 1VYHA 1NVMB 2A1UA 3DXXA 1AKUA 3UG7A 2QAGC 1YQUA 2G1AA 3BFVA 1TZKA 2YFYA 3HMQA 3PXXA 1DPGA 3NOVA 1IHDA 6REQB 4EATA 4G1MB 4R01A 1XTTA 3OU6A 4D4HA 5AK3A 4AO7A 1FB5A 2HA4A 3AHEA 4GT1A 3KEMA 3HDJA 1K88A 3R7NA 4CMJA 5ALEA 2P5YA 3SBEA 2O8BA 2BEUB 5JS7A 4W5TA 1ZM3A 3K0CC 1LV8A 3EVFA 3CRZA 3VGJA 4NCXA 3CX3A 2SECE 3R5XA 1C9DB 4EI2A 3CPJB 3GLGA 2A8YA 1VE9A 2WFLB 1W36C 3BYZA 5DLYA 3DOUA 3CNBA 3FUWA 1MJGM 2WG2A 3AM5A 5I51A 3OFKA 5FOSA 4PN3A 1XZLA 2XWPA 3ZLVA 1CSEE 1GZHB 2J48A 1M2KA 3GEPA 2I6SA 2OL4A 4Y0VA 2ZLBA 3ZGLA 4C03A 3NZEA 2FFBA 4X44A 3CSUA 2OCXA 2PQ2A 4B83A 1Z6TA 1M2FA 4GR9A 1VFNA 1YVEI 2X14A 4NH4A 3HA2A 1SQFA 2XQJA 3QF4B 3RS7A 3IT0A 1B4DA 4RCVA 3ZJ5A 5EL0A 4IS2A 3I2HA 2IU6A 4R3WA 1T15A 5E9JA 3VO2A 3T3GA 4KVAA 5DOVA 3AHHA 1NQXA 4RGVA 2ZI9A 1XU7A 4Q4DA 3F3MA 1OYVA 1JT2A 1QF9A 4WLFA 2NUPB 2IW1A 3QNMA 4BQPA 1PLKA 3L06A 5FD8A 2PCJA 1H2RS 4CQJA 3ZU4A 5GM2A 3H97A 1ACJA 1I2DA 2H2AA 3BD8A 4CQLA 3PEVA 4D4JA 1NMEA 1JIKA 1OX6A 4JI4B 1CR0A 1IONA 1BXGA 1HGXA 1KDTA 3C1TA 4RTRA 4EUNA 1WMBA 1U0JA 1FNSA 3EK2A 4FFBA 1LVHA 5LQSA 1KJNA 3QX9A 3ITNA 4H7JA 3W8FA 3ZWOA 4OU5A 3P5BA 5BN5A 5BYBA 3WHLA 2IV7A 2OXIA 1JDTA 2J0EA 1SXJA 3KD2A 2OCLA 2VIIA 1MBZA 1AA9A 1Z7GA 1QRSA 4C4RA 3GJ5A 3OZUA 1VSBA 2CHUA 3D3EA 3LW7A 1H4SA 2G72A 2PS1A 3KOWA 1AKRA 5F1PA 1DSSG 4MKRA 1DXOA 1MH9A 4MVJF 4U7DA 1PNRA 4OJMX 1PEKE 3SR3A 1PWYE 4KNYA 4DSAA 4JJIA 4DQDA 5EWLA 3WL3A 5AK6A 2ZRGA 2PYIA 3T5CA 4RLSA 1WCIA 1E5DA 3RVDA 5JNLA 1KSJA 2CLMB 1DOHA 2JAHA 4TM7A 1J0CA 3E7XA 5JV5A 4BP9A 1QGZA 3QXHA 5EJ6A 2Q5EA 1ZW1A 1RZRA 1J07A 4KO4S 2ZPTX 4ZQHA 1RR6A 5AVKA 4H4CA 2H4WA 3RIHA 5AI9A 3WSVA 2H2FA 2JHAA 3OFVA 4TX1A 5BUZA 1G291 1P7YA 2JGMA 2NNLD 4N5IX 1INLA 5J23A 2HNKA 1LK7A 2CKMA 1YR1A 2O2SA 5IUNC 1WF3A 3DZFA 1Z56C 1UIMA 1W34A 1C9JA 1NMZA 2R25B 4L57A 5GAJA 1K7FB 4OGWA 4Q21A 3JQ9A 1ST2A 1DIBA 5EXDA 5I5EA 5CUQA 1GPWB 4EDHA 2Z58A 3I2JA 4CEIA 5DPMA 5A5EA 5REQB 2Q4EA 1F48A 1FTGA 2JGIA 3TWOA 1Z7YA 5T8KC 1L7DA 5EUCA 3ZNPA 4EHKA 2RCNA 4HS9A 4NBSA 4RFLA 3C4QA 4CLHA 4DMGA 3DLIA 1TUBA 4INAA 1RW4A 1SQ6A 2ZW9A 3UJCA 3CH5A 3IJ5A 3NTVA 3ZU2A 4XD7A 4MRRA 3SHQA 2DT8A 5KSOA 1XTZA 2XD4A 2FJ0A 2RI1A 4D3ZA 3BILA 4XPIB 1WL8A 1GPAA 3ENWA 3RIMA 2JDID 4XJTA 5AWFC 4B6RA 5E2IA 1PRYA 1KOGA 3HUFA 1RHQA 1ZRNA 2P68A 2QT1A 2G8NA 3VYWA 1A9OA 4IZHA 5KCZA 1XZQA 2F7SA 3KJEA 3Q3EA 2B20A 1J06A 1NULA 4L0DA 4QODA 3QPVA 4EJMA 1T6YA 1HNWB 3DTNA 4P4TA 5AM2A 3T6KA 3L9XA 3SXPA 4G0ZA 3HVRA 1NMQA 5HRUA 4QVIA 3QKIA 2MDTA 2A9RA 5TQVA 1LWOA 2BEWB 1I30A 2JVIA 3ET5A 3MB5A 3GCXA 4NS4A 3G17A 3SQMA 5BMVA 4XB6B 5C5DA 2QW1A 1C3OB 2NXJA 4IIHA 1XROA 2IP2A 4FOOA 1WB6A 1G9SA 1ZI9A 4I5IA 5T4EA 2AQ8A 3OOWA 2C7QA 2JIBA 2HWKA 2DRIA 4OP2A 5EIBC 3B89A 1L7NA 2BKAA 3IEPA 3NTXA 1IMJA 3FMVA 1YKFA 4LE0A 5E8JA 4EO4A 4RTOA 3T3DA 1PWEA 3E2MA 1OT3A 2FW0A 1YU9A 2H0AA 3IEXA 3WLMA 5LDDC 1TD1A 4YQYA 3RAFC 2F1JA 2IY9A 3D4IA 3OIDA 5DNVA 3ZCQA 4CN8A 2W2XA 1CUVA 4RTLA 2QBYA 2OILA 1H23A 3MWYW 3LC2O 1A2OA 3HCDA 1CYEA 1Q44A 2LVBA 3B6KA 4BVAA 1TYAE 3EIUA 3FGOA 1L5WA 4CKCA 2XBMA 4FE3A 2GCOA 3U7QB 1J21A 2P79A 4DIEA 3NTRA 1X15A 1Q16A 1UZMA 2H07A 3WSTA 3M33A 1TK9A 2OBFA 3B53X 3GJ7A 1UR5A 3A3KA 1CEXA 2WF8A 3O1LA 4PW0A 1MGPA 4RANA 3ZXXA 2W58A 4WLNA 3ZNNA 4PPNA 2FQ1A 3MJVA 3QW4B 1B93A 1R64A 1RRFA 2XUKA 1GY8A 4LAFA 3KU1A 1XEXA 1TLLA 4UTPA 2QVCA 1RYEA 3B8HA 4JBLA 3RANA 1XYGA 4ARIA 2WTNA 1W1WA 3PQ2A 2CK3A 3D43A 4B74A 5KTYA 1JS1X 3K5HA 4DEXA 2VYQA 4I4TA 3TRKA 1D07A 3GYGA 4EHLA 1U7OA 3EYWA 1I6KA 1ZVMA 3ZK7A 2OPBA 1ZOLA 4HLQB 1DZIA 4KN6A 2Z6AA 1T8RA 1RAGA 4EG0A 3BGVA 3ILXA 1N2CA 3QEJA 1A7KA 4X1OA 4PFJA 4XTCS 4OY3A 1C0PA 5FR1A 4EHHA 4EX7A 5LR6A 1I7DA 2C5EA 5EYPA 2VWGA 2EFCB 2FWPA 3EA0A 5GWXA 4GZ5A 3SSOA 4E1AA 2QNIA 1RDFA 3UMRA 5EP1A 1KQPA 1UQUA 3D3WA 2YCLA 5DSZA 5FORA 3WGOA 4YAUA 4DUGD 1X2EA 3BXEA 5A1JA 5A3RA 3DB2A 4ZT5A 2G1PA 4NONA 2PRKA 1U3GA 2ZI6A 4KBFA 3WGYA 1A2BA 4ZGBA 5C8YF 4FOTA 3NHPA 5I9BA 3CB4A 3L07A 3OJWA 3F1LA 3LA6A 5AVQA 2UXCB 3N58A 5K0SA 4RABA 2I4RA 5E4TA 4KMOA 3VR2A 3ZK8A 2X86A 3CF4G 1XMIA 3DHVA 2VXOA 4TMKA 1A9YA 1EA5A 3RTEA 1BMDA 1JKFA 2CD7A 2V74B 4FYXA 2ZRDA 4W6QA 5EJIA 3VM6A 3ZBUA 5FEUA 1AQNA 2FW6A 3URMA 5I7SA 5A7HA 1Y6RA 2RARA 4NBNA 1PJ3A 2EDAA 4RGYA 2XADA 2P6RA 1S6YA 1VI2A 2IZZA 2W6OA 1V8OA 5AK0A 1C80A 5G1OA 1QP0A 3JTMA 4GP7A 2VHWA 2F6RA 3HXKA 4M8NE 2ZTHA 5FJJA 3TLXA 3W9BA 1XZJA 1QTRA 4O1IA 1M8FA 3N6VA 2QRVB 3OP4A 5H9VA 2DUJA 1ZUHA 1WNTA 2QMOA 5DK6A 2BEJA 3ZPXA 1E7QA 3GCZA 2CDCA 3EE6A 4W9RA 4HDSB 2QP4A 3PKIA 3QFHA 3QG1A 4U0KA 1QRUA 2H48A 3TZHA 2X5OA 3S8EA 3K1AB 4WTOA 2JKVA 1RLTA 4KFRA 5LDGA 2IYQA 1MAUA 2X40A 3UUWA 2PVCA 1YI1A 1DV1A 3FGZA 3H8SA 2D1QA 5C2JB 1NPDA 4N47A 4CGYA 5JXJA 4W8GA 4B2LA 1XQXA 4Z4QA 2VSNA 3ADOA 5JCJA 2Q5QA 4C87A 2H1OA 3MN1A 5LIRA 2X8WA 4IRUB 4P38A 2ZCVA 1FFBA 3THRA 3ZX4A 4CM5A 3QPCA 4PPYA 4ER7A 3DYBA 1UK8A 1WZEA 2JAPA 5CPFA 3IR7A 1PD0A 2ATVA 3RUCA 4IWXA 3W2GA 2EZ9A 2C3UA 4L74A 1XF9A 4TTQA 1NBMA 1OIWA 1RQGA 3RU9A 3S28A 4L4SA 3SFZA 3KSZO 4BO2A 1Z8DA 2HK7A 5DM1A 1B6RA 1PGOA 1O6CA 1DBRA 1KFJB 1XJ5A 3GK3A 2ADFA 1R16A 1BHSA 3CE9A 3CUKA 3CRMA 5ALGA 3LPLA 4HEJA 1KY3A 5I48A 1JWBB 1ZCAA 4R41A 4M37A 4N9QA 4XFKA 2P62A 5MGBA 5KHOC 1Y63A 3UK7A 2ORWA 4DYDA 3ETJA 2DFPA 1E64A 4MUNA 2XCOA 3LS2A 4YCLA 3KFVA 1EIZA 4L02A 4M88A 1WABA 4IIBA 3DKIA 4UOQA 4F12A 2VG8A 5DYIA 1YQQA 2FEMA 3HB4X 1YS7A 2C4HA 1VLHA 1X2BA 1K75A 2JLUA 1IXKA 1P6XA 2ZE7A 1XDBA 3RRJA 1AV6A 4J4HA 1F4LA 1QYCA 1TQDA 1XJCA 3SKXA 3TTUA 3TM5A 3VC7A 4FEAA 5D6NA 5HIKA 1ZJZA 3JWHA 4L8FA 5I4BA 1E99A 5LD2C 3PPXA 2A0WA 4PCLA 7AT1A 2GBLC 2Q7DA 1VBNA 4J3NA 2JAXA 4MEAA 3VPDA 4C7KA 4JQSA 1LW7A 2XUZA 2ORIA 2W4IA 1NNI1 3RS0A 4ASUD 4DMKA 2H4JA 1NYLA 4JYAB 1D6JA 4N3GA 3HZHA 2UDPA 1LNSA 4FW8A 2EC5A 4OD0A 3HA5A 2D0OB 4AKTA 3EWAA 1YS2X 1RI2A 2AI2A 4YDSA 2C98A 3RPEA 2AT1A 5KX5F 4HNGA 1LPMA 5L7TA 3TFOA 3GPIA 5G3ZA 5IFKA 1ZNQO 5BR8B 4N0PA 3BWMA 5THKA 1P72A 1QV7A 2Q5JA 2HPZA 1GADO 3HC7A 3ND9A 4JR0A 4LE2A 5TF4A 3PEWA 5CFPA 2HPHA 1A0OA 2W83A 4X94A 4TGLA 5KTSA 3WRYA 3A31A 3K72B 3ZV7A 5FWYA 3EDYA 4HADA 2X9LA 1JDNA 3F6EX 4NX2A 2FWNA 3A26A 3FYUB 4Q9AA 3UK1A 3UJNA 2CXXA 3ND5A 4QOGA 5JBIA 3TQHA 3SSNA 3ANYB 4IDPA 1TKBA 1XD2A 4JJ4A 2X41A 1ULHA 1UZAA 4MP8A 3SE7A 5DH9A 3BSYA 1Y7TA 4NPAA 1SBYA 3MK31 4Q15A 1Y5LA 1EUQA 1OIVA 2NXWA 2WD8A 4O4IB 4G85A 1L1EA 1ZU5A 1DQSA 2QPLA 3GELA 3V5NA 1YFLA 2CF5A 1UC8A 1G6OA 1EE9A 5EUMA 4GBED 1VG1A 2H4XA 5JSQA 2ZVQX 4HLCA 4TZTA 1CP2A 1EWTA 1X1RA 4I1PA 2FLKA 4Y7DA 4N5LA 3ADBA 4DMMA 3W2HA 5EQFA 5IWAB 3LDFA 3DSRA 4RZIA 1U2QA 2FGJA 1V3TA 5K0CA 1TECE 1JH9A 2Y6VA 3KLBA 3E61A 1YOVA 1SN7A 3VR6D 2W42A 3T1HB 1PT6A 1NSFA 2YHIA 4IHQA 4C6HA 2SCUB 2AK2A 4BWFB 3CX6A 4WD3A 4WBSA 5DBFA 4PG6A 2X9GA 2BSAA 2YQZA 1HMPA 4MVWA 5FOUA 5ADHA 1T0JB 4OIMA 4RHEA 3CLHA 3LDUA 2HWXA 4DGQA 4TL6A 2UUCB 3PT9A 16PKA 1EHCA 1UBEA 1MNQA 3A05A 4Y2TA 3GVHA 1WZIA 3MMZA 4L3OA 4CM9A 2QU7A 3N8HA 3WX0A 4AG6A 1W44A 4KQ1A 4XYEA 4D0SA 4BV3A 1K66A 4H1UA 3OZRA 2FFRA 4OH1A 3TTSA 1FSPA 4PG5A 1NVUQ 2ICAA 3BWVA 4NJMA 5AKZA 3U6BA 5JO9A 5ED4A 2DLCX 1SKAA 3PFNA 4ZQIA 2ZUSA 5CYFA 3ZYCA 4DCCA 3SX4A 4BVJA 3BJEA 1FDUA 4UU8A 4V0OA 1QGUA 5T6BA 4B3JA 1M2VA 3OMXA 1YL7A 2BDTA 2HBYA 5K45A 4Q1CA 1X74A 2F17A 3D7MA 1Q1ZA 3HN6A 3MCWA 4REOA 1ICIA 2EEZA 3IE0A 5ITSA 4B6EA 3Q0TA 2JZOA 2QNRA 4TLMB 4OFXA 1CEYA 5AW0A 2O0MA 5BOVA 2ARKA 1T0IA 5DLEA 1CETA 3LC1O 4CKBA 1NHWA 3MGGA 3FVQA 2ETXA 3FB4A 4K6FA 4ZK2A 1Z2NX 4BJ6A 1F8XA 1J9EA 2KE5A 3TW0A 4U7JA 5CBKA 2XCUA 3GRFA 1FCJA 2NU8B 2O0KA 1EP2B 3RUEA 5F2KA 2AC2A 3L6DA 3L8GA 3O95A 1R3UA 1ODLA 5DFAA 1TVKA 1H2YA 1N2HA 1TZMA 4DT1B 3A9WA 3ZWQA 2P5TB 4BCBA 2FN4A 3T3PB 5CDTA 4Y18A 3AY7A 3GVPA 2WJHA 4CEJB 2W22A 3WNVA 2H3HA 4AJPA 2BP7A 3HP1A 4YPVA 3LC0A 1T0PA 3SYRA 3BQNB 5F5LA 3WGHA 3HO1A 1I33A 1SH7A 3PC7A 2HLPA 2JGDB 3N8GA 2GZSA 4B7XA 1SU4A 1KYZA 3WR5A 3M1IA 2FG6C 4I9UA 2Q1WA 3PXBA 5AH0A 4YFVA 3C3CA 1LPPA 4YWHA 1JG3A 1F2VA 1GPYA 1FOEB 1P1CA 1PCXA 3HRKA 3HE3A 5DULA 3V00A 2FZGA 4JNCA 4PS1A 2WD7B 1T3GA 4JUBA 4LJKA 1RZVA 4ZVQA 1RFGE 3F6SA 1NTRA 4MV5A 3UICA 1UWKA 2ZI5A 1CUFA 2FA9A 4GMKA 2EKQA 3DMDA 4QD3A 1GPDG 1MT3A 3E4CA 4DLUA 3ESCA 5ESDA 3UK6A 2FPRA 5E6SA 5KTKA 1E1QD 1Z74A 2WU0A 3DDZX 1AT1A 4G5YA 4ZZ2A 4YRNA 3ADPA 5JEDA 3VVBA 4B48A 1KY2A 2DHQA 4MYHA 3CQ9A 3NIFB 4K6KA 3TL6A 4QM7A 3GLFA 1W6UA 4JU9A 4KE6A 2JAQA 4N7MA 3TBFA 4MYSA 4BRUA 4HNTA 1A7AA 1QOPB 1NKVA 2JEOA 3BRQA 3OT1A 3WIDA 1ABBA 1E9EA 2XKAA 3L49A 3S1LA 1FMCA 1OD6A 1X80A 2PFKA 3TW4A 1NBWB 5FV7A 3AR9A 2YJZA 3C3MA 3HCFA 4OCZA 4OXNA 3FGPA 1J09A 2H11A 1FS4A 3BZWA 4M0FA 1T36A 1EXWA 2DFKB 1GPLA 1UFOA 2H1FA 4XDYA 3GIWA 2XDYA 2ZTUA 2XWBF 3R20A 2PUEA 3IVAA 4OM7A 1VOTA 4ZEOA 1NR7A 4BNUA 4B3FX 1GR1A 1H2XA 2ZDQA 1HI9A 3D6NB 1XMJA 3JQ7A 5EN4A 5B6IA 2IX3A 5BORA 2UZAA 4B76A 1PG2A 1ZM4A 4NV0A 3GAAA 1F7UA 1J2EA 3PQ4A 4G9EA 4P3YA 4EPXA 3GG9A 1TQ8A 4RLQA 1VHQA 2JIZD 3REFA 4LI0A 5EA2A 3OTOB 3QTBA 3G8BA 1PDWA 4L8WB 4WXMA 4MB0A 2JHGA 4Q4JB 4R2KA 5IM5A 3AILA 1QX3A 1JVBA 1RI4A 4Z8YA 4JR2A 1J49A 1COZA 5TQ2B 4NZ9A 1MJFA 1F8UA 4WN9B 4J0FA 5T4FA 2LKCA 4C01A 2VRBA 3MJSA 2VTEA 3RREA 1YFKA 3R3ZA 4LA4A 3EY4A 5DGDA 4LXTA 4R8MA 4D0GA 3LKDA 4ENPA 3FUXA 2PIAA 4LMRA 2YRFA 3CLKA 1DHRA 2JFBA 4IVNA 3C3DA 4Q6WA 4F9FA 1U2EA 3DMYA 4AS3A 5U4QA 6YASA 1G19A 1OU4A 4R1MA 3EVNA 3WADA 1A8QA 5L3RA 1UBCA 2BI8A 2CXPA 1Z0SA 2Z09A 4MV8A 5FYQA 5HW0A 2OGZA 1T4DA 1GTL1 2PBRA 4X85A 2UYCA 1H0KA 2BKEA 9GPBA 3IS3A 4W99A 3GRZA 3PNOA 3FTEA 1NSYA 2ADMA 1PBTA 4IRMA 1YQTA 3EGVA 3W1WA 2VDQB 2V3CC 3AHGA 1N1GA 3CNOA 3UK0A 3QOFA 1JBKA 5IHPA 4NK5A 3W5BA 2WNHA 4MUHA 3O93A 1SVWA 4FYIA 1OFVA 3OTGA 1T8SA 4LFBB 3OX3A 2P1RA 4EGQA 4EGCB 2HX1A 3DT8A 1NLUA 1LF5A 1I0IA 1S2LA 3K92A 5D3QA 1QV6A 2WKQA 3ZWNA 2V54A 3C87A 1TO1E 4Q7QA 2G9NA 4RTNA 3RRFA 4BX9A 3V4VB 2WM8A 2XCIA 2IYRA 3RC9A 2QN7A 3WMFA 3V8EA 2BGRA 4FT2A 3ZCSA 4D9BA 5HYVA 4INPA 4GBJA 1EHYA 1N3IA 1UZLA 1IY1A 3FDZB 3H2KA 4IJ6A 1I01A 4LY3A 3WFIA 1JEJA 3BL8A 3RC1A 3SZOA 2FI1A 1KRXA 2IS1A 3QOXA 1UMCA 4FMBB 4OAQA 5KYYB 4Q3AA 4GXNA 4LZAA 2WQZA 4QOSA 5GIOE 5K4AA 3V97A 5B7PA 3QFRA 1G6KA 2NSLA 2WU1A 2A4MA 2CJPA 2IOFK 5DCWA 1PHPA 3N53A 3WHIA 4X84A 1DKUA 3HCAA 4ZICA 1P31A 3QP9A 2X13A 3PHGA 2DB3A 3VNBA 3CLUD 5LBUA 4YUXA 4XWKA 5K0NA 4DDHA 2OENG 1MU0A 2CL6X 2J3EA 4JWTA 4XTRA 3RF6A 2V65A 3MIIA 3CC8A 2CNKA 2GYUA 3GBSA 2VQ6A 1UZUA 4BBZA 3MWEB 1WUIS 5C51B 1S5PA 3IQDB 4IFBA 3NV9A 2BFEA 5JSZB 1B74A 3HBNA 1UPUA 1C3EA 1BX0A 2O7SA 3AU9A 4H6XA 3SEFA 4ALKA 3GP8A 4HTFA 1LKZA 4I3HA 1E92A 5KNDD 4I8IA 4HKTA 2AEJA 2BEVA 1X14A 3AI2A 2VRCD 4DRXA 4DXHA 3L6BA 3KKNA 1YDMA 4RTKA 1DG9A 4OQEA 4RPIA 1H3FA 3SCZA 2KB0A 1X92A 1ORDA 2V7WA 4JLVA 4MEJA 3ZTWA 4A16A 4ZYXA 5HIJA 1FYDA 1E60A 1MVNA 4I14A 4IGFA 4XQCA 3RRNA 4RJTA 1HG1A 2C8VA 5CXXA 3TD9A 1R5NA 5LZ9A 3ROZA 2VP5A 5BV2P 3K9BA 3TN7A 1U0EA 4HAVA 4BVEA 4HDOB 4N6OA 5THQA 4FFVA 1HPLA 3UQYS 2ZWAA 3L3BA 3W5VA 5JH7A 1FFSA 1SA0A 3FSGD 1SUPA 3ICQB 1M67A 4LDQA 2NX2A 2VHUA 4DR7B 2BFFA 1ZR4A 1EX7A 2Z3WA 3IH5A 3LW8A 1XQYA 1AQYA 2GN9A 1ZO8A 3NWEA 4EQ6A 2JIQA 5FI5A 1TIBA 1DVRA 3ANXA 4URYR 4AJKA 4LVOA 1F0YA 2ZYTX 3QVSA 2YW2A 1B0PA 1ZHFA 3HJNA 3PGVA 4CV1A 1E1MA 2HAEA 3F1KA 2GA8A 4CI0B 2XVYA 5IJAA 3IB6A 5IJZA 2EGUA 2V5AA 1Y4SA 3AT1A 4A0GA 5BWBA 4ZEVA 5H68A 2J5RA 1EKXA 4L50A 5FXMA 5BN3A 1G66A 2LE0A 2R3SA 1QUFA 2POQX 2HRRA 1XQ1A 2VYFA 5EXSA 5LYJF 1GYRA 2QYOA 2EXXA 2BJWA 1BVUA 3LUPA 4ZMRA 2YWFA 3NDRA 4NKRA 5AKEA 2P27A 3WB1A 4WBNF 3R6WA 1VM6A 2J5XA 1PJBA 1EFDN 2QTTA 5H59A 3V9AA 3IR6A 2RGXA 2V7EA 2ZJ6A 1C2YA 3TDKA 1FNBA 1JKJA 3AMVA 2Z43A 1YR6A 4JVLA 3WGGA 1NW7A 5IC4A 4Z0PA 2QD4A 3RI3A 5ABPA 3P97A 1RXVA 2OE2A 4GM1A 4TRJA 3STVA 1XDWA 2GSWA 4CLXA 3FPHA 4OMDA 5B36A 3A2KA 4X20B 2FN7A 4NIMA 4QGHA 2OMEA 3WK7A 5IASA 2CL0X 1G8GA 5KDLA 1Q2UA 3NW9A 3NALA 2BM8A 4R1QA 2SBTA 3ZV3A 3V1NA 4N5NA 1SUWA 3LJKA 1SB9A 3M9WA 5M34A 4QG7A 2XMPA 3RYIB 2GAAA 3T1TA 2OM6A 1IL0A 2NO7A 4CKEA 3SMVA 2WUEA 4MEBA 1P9RA 1C9KA 1QM5A 4P7BA 3UTCA 3HKCB 1WMEA 4E3ZA 1XCGB 2X42A 5KJFA 4RD3A 4ESOA 5JQGA 1RWPA 1U8EA 4LOKA 1Y1TA 3E3OA 4NG4A 4HVLA 2JI4A 4EYEA 4XASA 1Z8HA 2FUNB 5DTEA 3HHEA 3RRXA 4B6GA 4DCMA 5I9TA 1VA5A 1U0OC 2OAEA 4K7JA 1E3SA 4O25A 3OEEA 4XVUA 1FXWF 4KDRA 4LOIA 3GRCA 2AW5A 3R3YA 3PA8A 1KHTA 2OAQ1 1P4RA 3P19A 3T7SA 1IHXA 2V3WA 2NMVA 1E89A 2X2FA 3FRIA 4UJ5A 4WXEA 1JQ5A 4POAA 2J9XB 1E7YA 1TVCA 3BVPA 2ZDGA 3HZOA 3AV3A 2W6IA 2IPLA 3PFWO 1SCUA 2C84A 4NCAA 3U7JA 1OCEA 4PEVA 1MDBA 1EM6A 2AJDA 2XMSA 4G97A 5A7GA 3V9PA 4KR7A 2AFIA 2QUKA 3KTAA 1CJSA 2E1PA 1TC2A 3UKDA 1PJCA 4Q12A 1XTIA 4UREA 1ZICA 3MT9A 4ICIA 5F7OA 5IH7A 1XMOB 2C00A 4DR6B 3FD8A 4I5EA 2F9MA 2ERCA 3QVMA 1LF0A 2NO6A 4HDQB 2VJDA 3X0DA 3E48A 3NNNA 3FX2A 2PK3A 4QOJA 3QIAA 3FHOA 4TS1A 2WRZA 1DTEA 3D8TA 4YS6A 3RJZA 3W5CA 1TEVA 5FWDA 3PUJA 3ZD6A 5TR9A 4KFSA 1SRQA 2VJBA 3WRYC 4B3BA 5JSHA 2E4AA 3E9RA 5KNLA 2D62A 1M0TA 1R0LA 2GO7A 2IHZA 3QVLA 4GOJA 1CC1S 4O33A 2A7QA 2FSFA 4LOLA 2WG1A 4M1OA 4MI6A 4G1CA 3EIOA 1YQEA 2FPMA 1Q7CA 3ZIUA 4JELA 1O4WA 4H6VA 1C9YA 1XHFA 4INJA 4M1WA 4MS4B 4FYKA 2IZ1A 2XCLA 3HZRA 3KT6A 2DM6A 3WBBA 5CLQA 1CZOA 4XX0A 1C9NA 3G9ZA 1FYFA 1S3IA 3NASA 4FFNA 3SC3A 1ANKA 4BFLA 3QUQA 1JSCA 1ZC3A 1E9FA 2NXCA 3FKQA 2H0RA 2HDOA 3R3UA 4X3PA 4A6EA 2F9FA 5ARBA 2XUJA 5IVHA 2CNWD 4BCCA 1JLLA 4KH0A 5KKNB 3OZIA 1AN0A 3QV2A 3GAMA 4L4XA 3QEMB 1RXYA 3AERB 4J0EA 4TLCA 4BQNA 3O8DA 2JCYA 2Z57A 2LP4Y 4UDYX 3TKLA 4HZUA 4R5HA 4ARZA 3SEZA 2O2GA 3R3VA 5FBZA 2FMHA 4EO7A 2GPTA 4Z86A 3PUYA 4ARUA 2W9XA 5IJ0A 3H9GA 3PLAE 2VHJA 3N74A 4Q3LA 1G5IA 3EXAA 3KQWA 4XA8A 4PZDA 3SEQA 1B15A 3ZR4B 3I8XA 3AR8A 2HK8A 3GG2A 3O47A 4N4AA 1WD7A 4P5PA 5DBHX 3EF1A 3OIFA 4XLZA 1EXMA 5AW4A 1S9HA 1NBAA 1MB9A 5DTMA 5ER9A 5I3ZA 4D99A 4ZVKA 2JGLA 4FVTA 4MS3A 2IWHA 2X4IA 5H3LA 1L7QA 1G1AA 2VA8A 4KFTA 1XCJA 4BNJA 2BLNA 1MQAA 1OWMA 1PJSA 1QK3A 1SOWA 2JGAA 3GGPA 1IOZA 3FETA 1VRVA 2CVQA 1BDHA 1HDCA 3G5UA 4ZOAA 3ZS9A 1DBWA 1ZNYA 2ZB7A 4N1AA 1B41A 3VU3A 3PNLA 1EB9A 1BSVA 1C4KA 1K4KA 4G9GA 1U98A 2F1IA 3WLEA 2NLOA 2CUNA 5DIZA 4YH1A 1GCGA 4JCOA 4J1TA 3UWMA 4ZOQI 5K2OA 2H17A 3NWOA 4JJAA 1E2GA 2A5LA 1IWBB 1NZJA 1YR8A 3NAGA 2ZVDA 6AT1A 1GRCA 1QC5A 2PWPA 2QM3A 1GLGA 1LK0A 2XUHA 5IABA 3SVZA 4FR2A 3WE7A 1W8DA 3PHHA 3NC4A 2OCIA 3NORA 4PSVA 3SHFA 1ND6A 5JSKA 3W5UA 4E2FA 3EGXA 3LLMA 3MS4A 3NVAA 4DEVA 1E59A 3MCVA 3EASA 1GV1A 3R2JA 4MO9A 4JI5B 4DA9A 1ULUA 4TVSA 1XWWA 4G0UA 3CS3A 4LYFA 1F4PA 2QU8A 3RG8A 4KITB 1T1GA 1CZHA 4OREX 3GRYA 4CIVA 1E1CA 4CPDA 3JQFA 3DDWA 1S8FA 5DT9A 4JLPA 4LGMA 2W2MA 3A1DA 1GU7A 2E87A 1CE8B 1WY5A 3CEPB 2XHEA 2PQ0A 4DC9A 5BNWA 4HFJA 3EQ9A 1G98A 1BJKA 1LB1B 1NUQA 1OOEA 2ILTA 2Z4TA 3EHEA 3R6GA 1E2EA 1PJRA 4QYWA 5EKTA 4F97A 4O4JB 4JP8A 5A04A 3HVUA 1VRCA 2GNOA 2HF8A 3RS8A 4E5DA 4YT4A 3CW9A 1G3QA 1T9CA 1IXZA 2O1SA 1VHDA 3FVRA 1NDUA 3G89A 4ZAYA 5A5DA 4YCNA 5CJJA 5ALIA 1FBNA 1DJQA 2Q45A 2WTXA 4FJ0A 4KQKA 2J3DA 1SULA 1KQNA 4L4RA 3O7MA 3NC0C 1KE1A 6REQA 4LYHA 4DZRA 3R8FA 2NQ8A 1YZUA 1AV7A 1JFFB 3BG5A 2LW7A 4QUGA 2ZATA 4I5GA 4OMUA 1FQOA 2BEUA 2V0NA 1RJGA 2VAVA 4IFEA 3R23A 4KBYA 3IDSA 4J8PA 4YMWA 3T7KA 5CAEA 3NBQA 1MHTA 3VVLA 2H9AA 1JYFA 2E3JA 4NOLA 2A7XA 5ALMA 4TKVA 1WUJS 2F1KA 2WFLA 2QQGA 1N0HA 4HAUA 3U7RA 3WNBA 5JFOA 2BYTA 2IYLD 3QI2A 1BRMA 3FUUA 2HK6A 4FSDA 1V8BA 4FXOA 3L92A 4I6GA 4E21A 2HBQA 3S2IA 4UU0A 4M6WB 3T7DA 4DLLA 1AKTA 1G2PA 1RP7A 4OB7A 2Y9PB 1X42A 1FDSA 3WGZA 5JAUA 1MZPA 4TQUS 2VHVA 5CLGA 1LD3A 3E0XA 3QF4A 3TQSA 1YK0A 4F3NA 4PLVA 1DBSA 1BJTA 3DMFA 2DHCA 3DNPA 2R11A 3WLFA 1NBEA 3OURA 5GJVC 2D13A 4Q7JB 4CIDA 2R00A 4CF3A 3PXDA 2JLYA 3INYA 1N92A 3N8NA 5JY6A 2VQFB 3PWKA 1D5WA 3K4QA 1H65A 3E2IA 4WSOA 2H1IA 5AM0A 2NUPA 3FCUB 1YB5A 1USIA 4Y6PA 1XXLA 2JLBA 3NOXA 2Z1DA 2LKDA 2O14A 1E9CA 4FD3A 1FTNA 1OI4A 2ZIXB 4F2GA 4S04A 3LIIA 5F4BA 3L7OA 5L3QB 1ETHA 3UIEA 5E7IA 2DQZA 1XZAA 2XMZA 3WLAA 2BTEA 1QVRA 4JYPA 5JPDA 1FMFA 1E0JA 4FB5A 2VF4X 3CH7A 4K05A 1TRHA 1FTWA 3H5TA 4FI3C 1E0KA 2WB2A 1DC3A 4XEHA 2QTLA 2ZBQA 1IJFA 1U9YA 5B1SA 1NU8A 3RRMA 5B55A 2QX6A 2IXBA 3R7WB 3HH8A 1K97A 3V4PB 1SC9A 3HLYA 5CFMA 1CEQA 4D9IA 5B12A 1QP8A 3AXSA 3NKVA 1CY1A 4WY2A 2CJXA 2JFPA 1ZUD1 2XI4A 3E5NA 3GLIB 1F2TB 2BFNA 3TOZA 1G55A 4KUEA 1OXTA 1UPAA 3IQHX 5F33A 4OI0A 3FCCA 3NWBA 2F59A 4MV6A 4XARA 2ZB3A 3CJQA 4U2CA 7ABPA 4PAQA 3ROEA 3CCFA 5CGZA 2K6GA 1O95A 1AK1A 3ZWKA 3U4QB 1UKVY 4GZMA 2AEMA 1YRBA 2HC9A 2QSJA 3WKBA 3ZKWB 4A92A 3LUCA 4AY2A 3IP1A 4UNPA 4Y9UA 4ZCRA 1OWPA 4JJFA 1QUEA 4ZI7F 5BSWA 2Q8PA 1VRWA 2XNJA 3DJYA 5KQGA 5KUTA 5L3SB 2DBRA 3AL0C 3UPUA 3VR5D 4LJ5A 4U9HS 3RROA 3IQXA 3ZY2A 2YY5A 4IDHA 4ZT3A 3RAJA 5A71A 1V8PA 1KOJA 2H54A 3PRYA 5KDOA 3PUIA 5KVAA 1T8TA 4BE4A 3TW6A 2EFGA 3WMRA 4I66A 4Q9HA 1GQFA 2A35A 2K2WA 3PE3A 3LECA 3V4RA 2H9YA 3M89A 4YRTA 1TJPB 2OK7A