1R0YA

Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with adp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
266
Chain Sequence
TGIIMENVTAFWEEGFGELLEKVQSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
total genus 86
structure length 266
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r0yA00
1OKKD 2QM7A 2ECKA 3QJYA 3CR8A 4PPQA 4WA7A 4DLRA 3D31A 4A6PA 2J0UB 3ZGXA 1YU9A 2ZSAA 3BK7A 1M74A 1LF0A 4CEHB 2VYFA 2E9SA 1MO3A 5LD2B 3BWDD 5EP1A 1TL7C 4M1KA 4DDWA 3LW8A 2AXNA 2BJWA 2JJ2A 3DDCA 1S1CA 3DVLA 4PC3A 4Z8XA 2J7PA 1PLJA 4Q5IA 3TSZA 1CR4A 4M22A 1AQUA 1Q12A 2ZRIA 1IXRC 1PJRA 4PHGA 4CEHA 3L8YA 1A82A 5HPYB 2ZE7A 4RJLA 3UK6A 4OL0A 4WZ6A 4KBGA 3P26A 1XJ0A 5AJVB 1W4BA 3Q9LA 3NXSA 5IK2D 3W5JA 3WXMA 2ZSDA 1KSGA 4RCZA 2XZOA 3NWJA 4G5QA 1WA5A 4LHXA 5EP2A 1U0HC 1R8SA 4Q9LA 4TLEA 2FSHA 3NEJA 2HLDD 1D6JA 5IT5A 3T06B 3BORA 3LLUA 2ZI5A 3K70D 3C14C 4KFUA 1NBME 4WBSA 2BOVA 3DKPA 4WAUA 3BH7A 1GZSA 3WP1B 1ESNA 1OXVA 4C3ZA 2QSYA 2XJ9A 3TUIC 1Q0UA 4X8HA 4EFMA 2O8DA 1DAMA 2B6HA 4YC7A 4BLSA 2A5DA 3R8FA 2O8CB 4DC9A 3RRNA 4BRUA 2PCLA 4ZKEA 4EFNA 1Q21A 2Q3FA 2QNRA 3AKEA 3X1DA 4B3GA 3CRMA 2GK6A 1B23P 3L0SA 5FBRB 4POAA 1XXHB 2J9RA 3DZ8A 2LKDA 3M1IA 2IS2A 2JLQA 3KQLA 2VQSA 3Q7PA 3AP1A 1P6XA 2AN9A 2EFHB 3EC1A 3OESA 2O8CA 1DAEA 3AP3A 2ATVA 3H4MA 5LB4A 4TL6A 4MKIA 4XVUA 4QBGB 4NCKA 4R7ZA 3SBEA 4C0LA 3IIJA 4RVCA 3RC8A 4LJYA 5KYKA 4YXWD 1J8YF 1ZU5A 1GSIA 4HAYA 1OV4A 5E7JA 2VF7A 3AVPA 4DDUA 2QU8A 1CS4C 4RCYA 4C9BA 1ANKA 2PX0A 3L82B 5TDHA 4YMSA 4GOXA 1N3BA 1QRAA 1W48A 5CJ2A 4B33A 3TQCA 2N46A 2F1JA 3SN6A 1RFLA 2FSFA 4LJ8A 3PEUA 3A4NA 4C0KA 2JJ8A 4RKFA 3SOPA 4TYWA 5EQTA 4M8NE 2Q9CA 1G21E 3ZVNA 3CKLA 2QMUA 2F3RA 4I1SA 3T1TA 2XXAA 4X8MA 3UG6A 3THYB 4TTQA 3X1WA 1KGDA 3NH6A 3L0PA 4BLPA 1U81A 2CL7X 2VTKA 3W8NA 3KFXA 4BZPA 1OB2A 3NBXX 2B92A 1Q3HA 1DE0A 1E2PA 5HR5A 4Q7JB 4IOLA 2W6JD 1U8ZA 2ZE8A 3OAAA 3I4LA 4RFVA 5TB5A 3GEHA 2RHDA 4TQAA 2QQ0A 1U90A 1HYQA 1N6RA 1R7RA 2IYQA 4TLAA 1JJ7A 5FPKA 4QJ4A 1RJ9B 3AF3A 1DAHA 1OYWA 1G3IA 4O25A 4YDSA 3ZJYA 3JVVA 1FOEB 4IW3B 4D0LB 4YMVA 3VNUA 1JB1A 5FUXA 1RRGA 4ABYA 1BOFA 1M1YE 1T3LA 2L0XA 3G0HA 1NVWQ 2A5FA 1QHIA 2QP4A 1IONA 2ZTSA 3OEHA 1FUKA 5GJBA 1GKIA 1H8ED 1OE0A 4NYIR 2ZSEA 4NZYA 5GVRA 3T1QA 3B8HA 1OPXA 2GXSA 4I1VA 2CHQA 3EAQA 1CXZA 4LV5B 4URWR 4GZMA 3JVUA 4Q4AB 3EX7C 5FTKA 3BB3A 4MRVA 1CEEA 3UPUA 3K0SA 4MQBA 1X1SA 2GJSA 2Z83A 1ZUIA 2ZU6A 2Q6TA 2Z6VA 2B7BA 1G4UR 2GVDC 2ZYWX 4GOKA 3AVQA 4ACBA 4B75A 1AS2A 2QBYB 3QY0A 1OIVA 1DPFA 4Q1EA 3Q3JB 3W9YA 4DCSA 5IHPA 3TVTA 1AK2A 1E96A 4UXJA 2LCFA 4NCNA 1UF9A 1DEKA 4TMXA 4A1FA 4FCTA 4FXPA 4Q00A 4B2IA 1FX0B 3MWYW 4MRSA 3NH9A 4HLCA 4EPXA 4QL3A 3LV8A 1JALA 3I32A 3HWSA 3TK1A 1F2TA 1IN7A 1LS1A 3W6PA 1SGWA 1AM4D 3FTQA 1IY1A 3B6EA 4PQRA 2X2FA 4RZUA 2GZDA 1Z6AA 4GNKA 3T61A 2C8VA 1XP8A 3KKPA 1XTSA 2IYYA 2EWWA 3I8XA 3QG5A 4N3NA 4YMWA 1E1RA 4B43A 5KSOA 2PLFA 1BKDR 4U7DA 4YLGA 3X1ZA 3U44A 3GEIA 3U7FB 1S4QA 1E4VA 2OM2A 2Z43A 2WKPA 3B9PA 1G19A 5KNDA 3EPLA 2XNDD 1XTKA 2XTNA 4QGAA 4URUR 1GRRA 1UKVY 2WKRA 1ZM3A 5E7MA 4KITB 3U6BA 1G20E 1E9EA 4EFLA 1WQ1R 2P0EA 4US1R 2ZJZA 2BWJA 3RNLA 1R10A 2YKGA 4JIMA 2JLYA 4WW0A 2GA8A 2WSSA 1JR3A 2CBZA 1EFHA 3CWQA 5KSZA 1D9XA 1G17A 4M1WA 2I4IA 4W5HA 4Y0VA 2GCOB 1W36D 2JATA 3K70C 5B64A 2VP4A 1II8B 4TQUS 3U61B 2CDNA 2H18A 4PXAA 4QM6A 1ZBDA 2GRJA 3GJ3A 4M9XA 1PUIA 1HQCA 4JLKA 2NPFA 2J7PD 5G53C 3P1JA 4DZZA 5EXTA 2GCOA 1QVRA 2JEOA 4LHWA 2VP2A 2RGGA 1G8YA 5ELXA 2UVQA 2DFTA 1HA3A 3P20A 1C1YA 3BGWA 3LWNA 3EW9A 3EPKA 2J7KA 1WBDA 4C0HA 4QGGA 4GRAA 4FN5A 1QBKC 1GL6A 3WYGA 4BFZA 4O3MA 4PO1A 4ITRC 1GNQA 4WXRA 3CX8A 4RD3A 1XCGB 4D4JA 1XMIA 3WRXC 3P27A 3H1TA 2MSEB 1NLYA 3MJRA 2O8FB 1VCNA 1E9FA 4PZLA 1XEXA 2ZUDA 1ZNWA 3K1JA 2P3SA 3LXXA 1Z28A 4N0EA 1DAGA 5G3ZA 3W6OA 1RIFA 5FL7A 3U5ZB 1CP2A 2OFXA 2QP3A 3BFXA 3MJHA 1Q57A 1YR9A 4NDZA 4ESVA 1F3OA 2O8FA 1P61B 3DMNA 2FMXA 2DFKB 1ZM9A 4A15A 1GIAA 2V6IA 4QBIA 2KE5A 5SZKB 1YJ5A 5KHOC 4AKGA 1JJVA 4AURA 2DY1A 3FPAA 4MRPA 2DHRA 3FMFA 1GRNA 4ARZB 1ZM7A 4IKEA 2FU5C 1J7KA 2ZRMA 4WOPA 2XB4A 1F2UA 2DWQA 3MCAA 4D0GA 3T12A 6Q21A 1KO5A 2WKQA 4TLDA 2X1VA 1RZ3A 4F92B 1IBRA 2GWHA 1XTRA 3OEEA 2BMDA 2WVJA 4ZIRA 2FE4A 3L0OA 4AKHA 1TU4A 2GAOA 4JMPA 5A0FA 2ZJ2A 4P3YA 5DHFA 3TIFA 3A8TA 2FFQA 3KKOA 3U6KA 4M1YA 5J5CA 2LWIA 3CF0A 3THOA 4U00A 1LTQA 2WJYA 1J90A 3QE0A 1NMXA 1N6NA 2GNOA 3QBTA 4DLUA 4YDHB 4PPFA 4XWKA 1G1MA 3NKVA 4FD2A 1G16A 1IQPA 4KFSA 3Q85A 1WB9A 3BJIC 1GAJA 4CEJA 3MSXA 3K09A 1ZIOA 5JHGB 4AG5A 3RS3A 2CXXA 3AUYA 2WHXA 3C16C 3E70C 4NE2A 4TMZA 5FI0B 2D7DA 4JL5A 3ZYCA 3TH5A 5JCPA 3DO6A 1VG9B 4AWXA 1QVAA 2FGJA 2RGXA 2YC4C 2QAGC 4NYMR 4TN1A 4C0JA 2A9KA 2OAP1 1NN0A 5EXXA 1JAHA 2A5GA 1XCPA 1Z22A 3WY9A 1KJWA 4IXMA 3DMDA 1X8LA 1SKQA 3GLHA 5BQ5A 3SHWA 4HEJA 5KUTA 4TZ6A 5D3MA 3UMRA 4AK9A 4QM7A 3QNUA 4OHYA 1P4SA 3KUCA 3NBYC 1R2QA 2OLJA 4B3CA 1OIWA 2AWNA 3OAAD 1OXXK 3KXIA 2GF9A 3NEYA 1SHKA 3LBHA 4TLBA 3IIKA 1TF2A 3SYLA 2F43B 2O8BA 1DBSA 4JL6A 4IDOA 2WOOA 3QKTA 2XOKA 4ON9A 4WZBE 2JIZA 4FWTA 2ZR7A 1W0KA 4QRHA 4A9AA 5FR1A 2IUUA 1Z2AA 3NG1A 1G64A 4FINA 2H5EA 1S8FA 1E9RA 4PTLA 5ANRB 821PA 8OHMA 5L3RA 1J2JA 1XEWX 4HAVA 3U4QB 3GJ8A 3REFA 2VSXA 3SS8A 2ZQ5A 3FHOA 1JPJA 2XJ4A 3CH4B 3UANA 1CR0A 4JLNA 3UMFA 2IX3A 5AJYA 3VX3A 3MAAC 1O3YA 3BFKA 3N70A 1Z0KA 3RHFA 3SJBA 4CRWB 3PJRA 3FE2A 4M1MA 1XB2A 1Z07A 2YHSA 1OHHD 5AR1A 1NMZA 2GESA 4Q4HB 3W90A 4PZYA 1QHGA 2WMNB 4Q4JB 5HCIA 4UNPA 2WV9A 2G0TA 4KYUA 3HR7A 4URYR 5JJLA 3B60A 4LHVA 4LOAA 1KMQA 1KAOA 2YVUA 1W4CA 2ZRJA 1UADA 4XTRA 1IJEA 3TE6A 2J0SA 2ZANA 1UAAA 4L16A 4CT4B 3FKSA 3ICQB 4R2HA 2PL3A 3M0EA 5IF9A 3PQCA 2JASA 1W36C 3QPVA 4G5SA 2FDCA 3LAWA 3GLIA 3QPWA 2V54A 4HAWA 1Z2CA 3IDQA 3QSYA 4BLOA 5J40A 1R5OA 1KZGB 1Z0DA 2IEYA 3LBNA 2FX3A 5E7IA 3QXXA 1VECA 4RD0A 1CJKC 1NVVQ 4CYMA 3DOFA 4Z54A 3PEVA 4ESHA 1IAQA 3QF4B 5CK5A 2W2XA 1NRJB 5EE5B 1AS0A 3CRVA 1T6NA 2ZROA 1FL9A 2QAJA 3FMIA 3Q7QA 4HLQB 4HDQB 4P31A 4XSHA 3B7GA 4RZ2A 1P60A 2VHTA 3VKHA 1SVOA 1X6VA 4LJ6A 2ZIAA 4D25A 3QKRB 3RS4A 5D3QA 2W6IA 3FHTA 3MRSA 1KNXA 1W1WA 3CX7A 2QEQA 4Z8YA 1E2QA 3IHLA 4G5OA 2WSSD 4LBWA 4KXFB 1GVNB 1JR3D 4B44A 3FVQA 2NO1A 3HU2A 3KB2A 4MH0R 4EAQA 3BXZA 4QJ3A 1EESA 4P0TA 4MYTA 4DT1B 1JEDA 2WIBA 3I61A 2NZ8A 1JI0A 2PX3A 1WRBA 2HT1A 2OILA 4DLYA 3LH5A 4OI2A 5C18A 3EC2A 1M2OB 2YV5A 3B1WA 2AL7A 1UBGA 2OFOA 2V9PA 4MKFA 5KU1A 3VU9A 4EJSA 1J8MF 3LDAA 2FPLA 4Q7KA 2X2EA 2Z4RA 2YOFA 1RC8A 4Q9HA 4JVSB 2XGJA 5KPJA 2C9OA 3PR1A 1IOZA 1QHHA 3AKCA 1TPZA 1BIFA 2KBFA 4TL8A 1KYIA 2OHFA 2H1LA 1TF5A 1KI9A 1TADA 2BCJQ 1LW7A 2VHJA 1WE2A 4MYHA 1VCIA 4XD7D 5AK0A 4K8OA 1S2MA 4NU0A 1OJLA 4JJZA 1AA9A 3LO5A 5DN6A 1G18A 5K8UA 1IM2A 2GAAA 2QROA 4QHYA 3T35A 1BYUA 3KJEA 3AF2A 4LX0A 2NMVA 1ZU4A 2CHGA 3JZAA 3LD9A 4K46A 3QVUA 3KDSE 2DFLA 3K53A 2EVWX 1TUIA 3B9QA 1EFTA 1XD2B 1GILA 2VSFA 4M2LA 4TT3A 4F93B 3KQHA 1EWRA 3QF7A 2O8EB 3ZQJA 3GFOA 4OI1A 3TGPA 2G3YA 1SHZA 3OE7A 1YZNA 2REBA 5FL7D 1G7TA 4LYFA 4XVRA 2J46A 1U0JA 2ASEA 4OQMA 1X1RA 1UBCA 1ZCAA 3D6TB 3U3MA 3ZD6A 2NQ2C 2O8EA 1MABA 5EZ5A 1QHNA 3CF2A 3SJZA 2IXGA 1LB1B 1MRSA 1U9IA 1HT2E 1IJFA 3TKLA 5IRCD 3OEED 3QBVA 1SKYE 3NDPA 4PPNA 2GJ8A 1WCV1 2N42A 4QHTA 1KDRA 4C0SA 3ZH9B 5J47A 2F7SA 4V0OA 3BH0A 5J4YA 4JLAA 1N25A 4FI3C 3TLXA 3K9LA 2G1KA 2ZJOA 3AVWA 4LI0A 4NYJQ 3WNCA 1E94E 1E2NA 2UKDA 4BWYA 4NH0A 5CM9C 2RGDA 3BBPA 1ZAKA 1VIAA 3PUXA 2AD5A 3HJNA 1GP2A 4OJKA 3VKGA 3L43A 4RD4A 3RRYA 3HPRA 2GETA 4JT4A 1XPRA 2EFEB 1VYUA 2PZFA 2O0JA 3GLGA 4HLUA 4F4JA 1SVSA 4KVGA 1EFUA 2ZJAA 3H84A 4KSBA 5E3HA 2GJ9A 2V1UA 2GCNA 3SYNA 2WWFA 5TMPA 1ZD1A 2C77A 3CNLA 4DKXA 1N5JA 2J41A 2P6UA 4H1VA 1GNPA 5GJVC 1XD9A 4OJQA 4BEJA 2A5YB 3ZLJA 4D82A 5DI3A 2VF8A 1XRJA 1EX7A 3AP2A 1TQDA 4JBXA 2ZRKA 2LKCA 5CYPA 4TL9A 2WWHA 4JLVA 4LJAA 1EWQA 3F5FA 1AGPA 3MWLA 1ESMA 2ZR0A 2RMKA 5TVKA 4HB0A 1S3SA 3FB4A 1NBMD 2XOKD 2ZI6A 4RZXA 2FA9A 4TMKA 1MOZA 3ECCA 1R0YA 2AFIE 4PQYA 4CDGA 2J0UA 3O8BA 2R65A 1W46A 1KDOA 2IEZA 4WXPA 2AR7A 3TNFA 1T91A 2ZAOA 5EZ6B 1YZGA 4UKDA 2GHIA 2GZAA 4CW7A 4LC0A 4PPGA 1GWNA 3DPUA 3KL4A 4DBLC 4DSOA 1W4AA 2R62A 2V4ZA 2ZSFA 5CIWA 2YZ2A 2ZJYA 3S1AB 3EASA 1XWIA 5LPNA 3NBZC 3GLHE 1AN0A 1MH1A 2FJUA 4G5RA 1DG1G 4A36A 4PX9A 4L8GA 3EA0A 2ZETA 1II9A 4JLOA 1YVDA 2W83A 1G8FA 3SU8A 4EIWA 4JKYA 3LX8A 1CKEA 1XDBA 4NBSA 1HEIA 4OQFA 3UIEA 1YE8A 3IPYA 1Z0IA 4KAXA 3R9IA 1KKLA 3IQXA 2ANBA 4C0BA 1T3SA 3K0EA 3BS4A 3FKSD 1YHNA 4PSVA 4C0QC 4IOJA 1X8KA 1Z6TA 5DE3A 3GJXC 4F38A 3HP1A 5A4JA 1N5LA 2V6JA 2ZRBA 1Q1QA 4I4LA 1TX4B 4G5GA 1SXJB 4B76A 3SHFA 1DTSA 5AJZA 4ZCLA 2FOLA 1H8HA 1YZUA 1X8JA 3IKJA 3KX2A 4US0R 3RRMA 2ZYTX 4AKEA 3GEEA 4A2WA 4D80A 2IYVA 1US8B 1FZQA 3RVBA 5G41A 2WPDD 3E2IA 1X3SA 1XJQA 2ONKA 1ZJ6A 2QA5A 4IVQA 4LZZA 5A5GA 1SXJA 2DFNA 2VP5A 1QG2A 4JT2A 1XXHA 1E2LA 2OSBA 2WWWA 1XPUA 1TQ6A 2IWHA 1FQJA 2I1QA 2R2AA 4AYXA 4DHEA 2ZEJA 1F48A 4E22A 2XNSA 3O47A 4DUGA 3UATA 1EFRD 1E79A 3CM0A 4W9MC 3UKDA 3M6AA 1S9HA 3PG5A 2QPOA 2OV2A 1SQ5A 2RKOA 3SNHA 4AYTA 1Z5ZA 1R8QA 3TR0A 2CHVA 2ORIA 5JHHB 2IXEA 3CF6R 3QXCA 1E98A 3E1SA 3RS5A 2J0QA 4I1OA 3D3QA 4EQ6B 3GLIE 2CCGA 2XITA 2H17A 1L2TA 4F7WA 1KK3A 3EG5A 4OKSA 1N0UA 3A4MA 1KSFX 1FP7A 4Q66C 4KSCA 3N5CA 1E2GA 4QNRA 1VHLA 4GL2A 2RGNA 1OYYA 1SVLA 2GBLA 3B1YA 2RAPA 2NTYC 2Z4SA 1NMYA 2EFGA 4JLJA 5FTMA 1QDEA 1E2JA 2WJGA 4LRWA 3RSOA 2MSCB 4TMVA 2EYUA 5AJWA 1J70A 1I2MA 2RHMA 5FPSA 4DCNA 1H65A 2IS6A 5F3WB 4QGFA 4QKQA 3THYA 1TTTA 3W34A 1XF9A 4HB3A 4NCIA 3AVVA 3MWJA 2YOGA 4M0LA 3T5DA 1GL9B 2FSGA 5J4VA 4M1TA 5E95A 3RYTC 5JSZB 2P6RA 2IS1A 4OK5A 4OK3A 4U5XA 2A78A 1AKYA 4KYIB 3IGFA 2VA8A 2ZRGA 3QG1A 4O2LA 4A82A 4Q21A 2WOJA 2ZRPA 5FOVA 5KDOA 4NCJA 4Z1MA 1FMJA 1FUUA 2QMHA 3LW7A 5JSZA 2G0NA 5DO9A 1RJ9A 1KO4A 4IFEA 3SJAA 4F91B 3AEZA 4TT3D 2E87A 2CJWB 1N0WA 3BFVA 3UWOA 3C5CA 3OE7D 2CLSA 4LYHA 5DYGA 3BH6A 1EXMA 1GRQA 2IHBA 1T9HA 4LYJA 1CJTC 3GCGA 4TYPA 1JQJC 4KI0A 4Q4AA 3E5HA 3K9GA 3Q8XB 2IS4A 3R8CA 2BMEA 5F9HA 2EQBA 3MFYA 3W6NA 1I2DA 1XD8A 1C4OA 1P72A 2QBYA 4PSAA 4A8JC 1TQ2A 3FKQA 1JPNA 2JDIA 2QY9A 3U60B 2C95A 3KZ1E 4HB2A 3GQBA 3ZZUA 1KHTA 2CK3A 3OIWA 3GLFB 3GD7A 1FX0A 3NC1C 1BO6A 5TXGA 3EIQA 5JS7A 2PEZA 5HKKD 3EIEA 4Q1AA 2JA1A 4N1AA 5L8VA 4MKGA 1VYVA 1Z0JA 3O8CA 1SVMA 2OG2A 1E2DA 2ZAMA 3GLFA 1T8TA 5AJXA 1P2VA 4LC1A 3WMGA 1MKYA 2HDNB 1BMFA 2OCBA 3I62A 1E1QA 1M34E 4QXAA 1UEIA 1OB5A 1S96A 2YJTD 1ZNYA 2BV3A 3CH5A 4XVQA 3GPLA 2G83A 1MT0A 1KY2A 2CL0X 1I4LD 2HEIA 3K0FB 4NKRA 4UNRA 4M9ZA 3GMTA 221PA 2WZQA 2NZJA 2A30A 3SZRA 4PC6A 2OE2A 2ODBA 3MUFA 5E4FA 5HE9A 3TVDA 1RKBA 2V55B 2ERXA 2ZVQX 4KLZA 2JLUA 1DS6A 4MITA 1W0JA 1XBTA 2RGEA 2W00A 4AYWA 4TSFA 2OXCA 4X8LA 1CRQA 1HY3A 2QL6A 3GJ4A 3Q72A 5K8IA 4F4IA 1KDTA 2F6RA 2R6DA 5KDDA 2P2LA 3FFBA 1WMSA 2FG5A 2VP9A 4PHTA 1ZM2A 1D2EA 1CIPA 2IYRA 4Q48A 2PT5A 1U0LA 2JJ2D 3TSOA 1TU3A 521PA 4E09A 5AUNB 3GLGE 1GKYA 4IDQA 5C46F 4MDEA 2C03A 4P4TA 3ZZTA 1N5IA 4FMDF 1S0UA 3W3AA 2OZEA 4TLCA 1OH6A 3C4JA 2EWVA 1PVOA 1II8A 3TSWA 3RWMB 4AIIA 1A7JA 4PFSA 1E69A 2K5UA 4EUNA 4MRRA 1NF3A 4CIDA 1ZD8A 2VH5R 4JVLA 5BYKA 2GJKA 1N0VC 2DR3A 2BBWA 5JEDA 2EFCB 3T5GA 1NVVR 4D26A 2IBMA 1E6CA 2Y8EA 4HDCA 4MGKR 1GL7A 2OCAA 3RLFA 2J1LA 5H70A 2F9LA 1JEEA 5FPHA 3FFAA 3EPHA 1OXSC 2IUSA 4PHHA 4MGYR 5CJPA 2F1RA 2CNWA 2B7CA 2AWOA 2FNAA 2ODNA 2JJ1A 1W49A 3LQQA 2ORVA 4IXNA 2VSOA 1FMLA 2WJJA 5FUVA 1BH2A 1ETUA 5LDDC 3MWKA 2P5SA 1OW3B 2ZM5A 2ZJ5A 1KJZA 1TQ4A 5M04A 5C1BA 1SVWA 1JXOA 3CIOA 3I1FA 3R9XA 4LPSA 1G9XA 3RS7A 4X8OA 4IEEA 2C99A 4V03A 3PITA 1NG1A 3ZDQA 4L4UA 1DADA 3DHWC 4RD6A 5BW8A 3NTUA 2AXPA 3KTAB 1O87A 1H8HD 1R0WA 5P21A 2HYIC 1TMKA 2I1VB 1G7SA 3HYTA 2PLRA 4LY6A 4URZR 1L4UA 4EPRA 4YQFA 2JLSA 4HAUA 4EKDA 4MGIR 5CK4A 3KUDA 3EA5A 1ZC4A 4B3XA 4XTCS 5FOWA 2XTMA 4UXIA 1ZRHA 4ARZA 1NLZA 2D74A 3KTAA 4FCVA 1NKSA 121PA 3NVAA 4GBMA 5KNCA 4PSKA 4RFSB 1N5KA 3NBFA 4DUGD 1W44A 1E79D 1TAGA 2DYKA 3NIBA 4LJ7A 2R6CA 4P4SB 1E0SA 5EXSA 4BECA 4KHZA 3A1VA 1DAIA 1KO1A 2HF9A 5DYIA 2G1JA 2XSZA 1VKJA 3CBQA 3QKUA 2EU8A 3I8SA 2G77B 4FMCB 5FUYA 4JYCA 4NHOA 3BRWD 1PZNA 4MYUA 4LJ5A 1RRCA 3NDBB 4EPYA 1KO7A 1E2KA 3T34A 2G6BA 1OLOA 5FPTA 3CR7A 3CLVA 1LNZA 4M21A 4LHYA 1GDDA 3RS0A 2GILA 4NYIQ 1WDTA 4JL8A 4LK2A 5CLQA 2FWRA 3SE0A 1M7BA 2A2ZA 3AQ4A 5JZVA 2PMKA 2Q3MA 4V0ME 3RANA 5B57C 1A5TA 1D2NA 1SXJE 5CM8B 4II7A 1XXHE 4OHWA 4ZO4A 1KI6B 2Z0MA 1YKSA 2D2EA 2EYQA 4KFRA 4D81A 3CPHA 1N6KA 5L3SB 2BMFA 5JRZA 2WWIA 1KK0A 3NHAA 1NJFA 2FFHA 1G5TA 1U9IC 2D06A 3QPUA 4ASUA 1VYTA 2I3BA 1XJCA 1N6HA 3QXHA 1P9NA 3OF5A 1DAKA 3H0KA 4DDTA 2GEUA 4DCVA 4OI0A 1KI6A 1OKKA 2RGCA 3OFNA 4Y0AA 3A1SA 1IHUA 5DSZA 3OEHD 1TEVA 4JSYA 3A1UA 3B5JA 4ERNA 1P62B 1XTIA 2F43A 3EARA 3L0IB 4Q1DA 4Z1MD 3IO5A 1KKMA 3OIYA 3SYKA 4DRZA 2WM9B 2DCUA 5EUMA 3WRYC 4IJMA 4P32A 3WHLA 3EWAA 1PUJA 2HCBA 5GADl 1V43A 1W2GA 3OIUA 4GI7A 3PENA 2CE2X 2OXRA 3SEAA 4B3DA 4QHSA 3GP8A 3WYAA 3I72A 3IBYA 3MLEA 4RSGA 3IBGA 2GCPA 3U4QA 5JWRA 1NKTA 4KJZA 2WJVA 3QKSB 3AV0B 1NJGA 3T15A 2QTHA 4V02A 1NIPA 4P33A 4WVFA 5IK2A 3K70B 2WIAA 2XAUA 1E99A 1ZUHA 2OUKA 3PXGA 2CK3D 3OIVA 1CBUA 2ZPTX 4EPWA 2XEXA 1EG7A 3VHXA 4PAOA 2HLDA 3QKSA 4Q01A 1QZXA 4Q4HA 3VR1A 4Q4JA 4B47A 4Q7LA 1OH8A 4B6EA 4LGMA 2NO6A 4HAXA 4CEIB 1M6NA 1KI1A 4JLBA 3VR6A 1E1RD 1E2IA 2DB3A 3G82C 3LNCA 1F5NA 4ACAA 4XH9B 1KAGA 3BAFA 1G8PA 2R6GA 2CCJA 2IC5A 2QE7A 2NO0A 2Q0HA 3ADDA 4BQSA 5FTLA 4CEIA 4QBFA 1E1QD 3WMFA 1HV8A 2OT3B 1P3JA 3RAPR 1P2SA 2ZJ8A 1QG4A 1KSHA 3LLMA 2QQEA 2AFHE 2Q9BA 4DVGA 1IXSB 2XTZA 5LD2C 3NC0C 3AM1A 4C7OB 2FPMA 2F3TA 4PQFA 3C8UA 4W5WA 3H86A 2AK2A 1TEXA 4LV6A 2HXYA 1E9DA 3JZMA 1ZW6A 1VDZA 3M4YA 3OZXA 3LBIA 3WMEA 4MRNA 3B78A 4AC9A 2DWPA 3V4RA 1Z6XA 3QF4A 3VX4A 4LV8B 1W0JD 2ODEA 1KMHB 4LUCA 1ZINA 4GMXA 3VTKA 2BHRA 3QKRA 2ZRFA 3KQKA 2FH5B 1CR2A 1P9RA 1D5CA 2GEDA 2IUTA 3K0CA 4FCWA 2ZYUX 2EFDB 4PC1A 5EE9A 4BEBA 5J4LA 3GLFE 4OHZA 4D4LA 2O0HA 3BB1A 2P6NA 2HCJB 1CTQA 4FW9A 5EXPA 4DT1A 2KWIA 3TAHA 1PLKA 4B71A 3A58B 4DSNA 4TTPA 5KPDA 3LY5A 1W4RA 1EX6A 2BBTA 1UM8A 3EPJA 5BN3A 1XZPA 3AGQA 4JBWA 1JQLB 2CE7A 2IF0A 3BERA 3O8DA 3ND8A 1T5LA 2BKUA 3QXJA 2HYDA 3NHBA 1HE8B 2J45A 5UKDA 3AVTA 2BJVA 2W6JA 1G3RA 1IN6A 1M7HA 1Y3AA 4FMCF 4G0NA 4FMBB 1FFHA 1CF4A 2W58A 4UNNA 3ZZ0A 1K5GA 2JJ1D 4HYYA 1CJVC 4V0LA 4YMTA 2HF8A 1TNDA 2RH5A 3MMPA 2GVZC 2VHQA 3FMPB 5FBVB 2ATXA 4QFMA 1G3MA 1YRBA 3CNOA 5JEEA 1JBKA 2QAGB 4HDOB 4ZCIA 3TW8B 4DCTA 4S2EA 4KODA 3SI7A 4BFUA 5J4HA 4MKHA 1H8EA 1XD2A 3A37A 4H1UA 2CVHA 1WP9A 3Q5DA 4B6FA 5CDFE 2AD1A 3P4XA 5AUQA 3WNBA 1I4DD 3THXB 1E9BA 2ZRAA 3SR0A 4PR0A 2YWFA 5KSYA 3L8ZA 2QAGA 4Q1FA 1NG9A 2MSDB 1AZSC 4TMWA 1R5NA 2GBLC 2J0VA 5H68A 3T1VA 1T3HA 4NYMQ 5CB8A 1FPMA 4DLXA 2RGAA 1KI3A 4KU4A 4NCHA 3THXA 4OK6A 4XSGA 4HZIA 1OF1A 4E07A 4Q02A 1U94A 2YOHA 1YZLA 2V1XA 5LB2A 1S9DA 1QHYA 1T0HB 1ZM4A 3QEOA 2H16A 3CB4A 3T1OA 4AG6A 4BZXA 2OEPA 4BGDA 4LPKA 1GNRA 3I5XA 1Z3IX 2BVNA 4DB2A 4L9SA 1DAFA 2EW1A 2VHCA 4RKEA 4ZV4A 5KTYA 2WAXA 3ICEA 1R6BX 2ZJBA 4Q47A 4B48A 2JLVA 3KFVA 4DEXA 2ZI7A 4P4UA 2CVFA 2QGNA 4GFDA 2WTUA 4OHXA 1RRPA 5CLLA 1FW6A 2SHKA 3QQ5A 5C4GB 1UKYA 3K9NA 1TF7A 1ZD9A 4M9SA 1VPLA 3IQWA 4Q19A 4BLTA 4G3XA 2ZXUA 3K0AB 2OBMA 2CCKA 5BWMA 3R7WB 1JR6A 2OAQ1 2C5LA 5FTJA 1G8HA 1RYHA 4JBYA 3DM5A 5JMTA 1SVIA 2ZR9A 1LS6A 1G6HA 4JKIA 4XIGS 4DIDA 3U7GA 2GZHA 2Q21A 4JSTA 4UJ5A 4GT1A 3U3RA 2OCYC 3ETLA 1ZCBA 1UJ2A 5K8TA 1FP6A 1RRFA 5JS8A 3R7WA 1W36B 5TY0A 3GJ6A 1P5ZB 2J87A 4GPTA 1NLFA 3VKWA 3IPXA 1C9KA 1E2MA 3ND9A 1G6OA 1XTQA 3GFTA 4HAZA 2JIZD 5KSPA 3PUWA 4ASUD 1E2HA 2IYTA 1W0KD 2PZGA 4ZDIA 2QMOA 2ZUBA 4CVNA 3OFND 3EZ2A 2CL6X 3I3SR 3THWB 2DBYA 4LJ9A 4BASA 1AGRA 1ZNXA 2C2HA 2WAYA 1OXUA 5FBWB 4C4PA 4TZ0A 3CRW1 2BC9A 2HT6A 2NOAA 2KB0A 1UKZA 5EJEA 2GK7A 4Q7MB 1JAIA 1U2RA 2QT1A 1VCMA 4GOJA 5H8WA 1E2EA 1G7RA 2CLCX 5JLJA 1OH5A 3FDIA 3THWA 4IOMA 4UXHA 4EPTA 2E1RA 1NY5A 1HUQA 1SVKA 1DARA 2VBCA 1XFAA 1W2HA 4NTZA 3PV0A 2BMJA 3S1AA 3FWYA 2O52A 2GF0A 3EXAA 3VR2A 1ZC3A 2C78A 2D7CA 3B1ZA 2PT7A 1N6PA 4BRWA 3GJ5A 1RYFA 1QF9A 4JYBA 2VLIA 3CW2A 2HJGA 3LVQE 2G9NA 2ZITA 4ILEA 2C9YA 1P9WA 2W0MA 3IIMA 3N2IA 4L5BA 3TUJC 3QI2A 1U99A 3D8BA 1W5SA 2O8DB 3B2EA 1IN5A 2OCPA 4Q1BA 1XU4A 4IOKA 3LA6A 2JLWA 2D62A 3AF1A 4DJTA 2FZ4A 3DZDA 2HV8A 1XEWY 2YWEA 1AZTA 4IVRA 2H8KA 1XEFA 3H2YA 4MUAA 5SZJA 3KKNA 3ONWA 4FMDB 3DEFA 4O0MA 3CNNA 5DH9A 3VHLB 2QE7D 4OI4A 1XCMA 1Z83A 4V0MA 2J59A 4ZDKA 3BD9A 4KBFA 4A92A 2C98A 4HUQB 1DO0A 4I81A 2V8OA 4NMMA 2YC2C 4Q4LA 2C96A 4ZCMA 2GXQA 2IF2A 3VR4A 1ZUNB 2ZS9A 1E0JA 1US8A 4QJ5A 3CWZA 3P4YA 4OYHA 5JI3E 1HE1C 2WICA 1XMSA 5DHAA 2X77A 3FHCB 4OQXA 2W6ID 3BC1A 4DLVA 4ZI2A 4HUQA 2REOA 4MUBA 2JAQA 5L3VA 1IN8A 4E5UA 3QVVA 4KFTA 3UWKA 5FL3A 2FZLA 5B58C 4Q03A 2WBLC 3KXKA 2PJZA 3I73A 2IL1A 1KSJA 4TMTA 3SFZA 2P67A 1Z8FA 1Z47A 4CF7A 2HXSA 4PC2A 5JI2E 3SJCA 4D4MA 4AY2A 3A1TA 1F60A 1ZVQA 3PFIA 3QOFA 1MO4A 1A2BA 1JNYA 3MGCA 3F0TA 1COWA 2PBRA 4B2PA 3RRZA 2XXAB 5BN5A 3RWOA 4EQ6A 5H1YA 1R0XA 4MA4A 1E2FA 2QMEA 5KOYA 4M9QA 1G8GA 4A0HA 2ZRHA 3UMSA 2RCNA 4IDHA 1KTVA 2PEYA 721PA 4GSYA 1GM5A 2GXUA 5FH9A 1VG1A 2ZS7A 4WIAA 4Q9JA 2FN4A 1LVGA 4PANA 4HATA 4KV9A 1KI2A 2KBEA 4B35A 3HR8A 3RABA 1P73A 3ZVRA 5DN6D 1E0KA 2MMCA 1F6BA 421PA 4CT5A 4Q1CA 1M7GA 2PMDA 3F8TA 3KKQA 2MMGA 4Z51A 2NO9A 4D0NA 2BCGY 1Q44A 2FV8A 2IT1A 3EZ6A 1T8UA 1G3QA 3QENA 2QORA 2QZ4A 4BPBA 3U3JA 1LY1A 1XTJA 1NY6A 4UNSA 1UDWA 2WJHA 3SQXA 2BDTA 3C7KA 2C04A 1E0AA 5F2EA 1N6IA 4JVNA 4K81B 5FBQB 5B30A 3MG9A 5HCNA 2ZRCA 4BFYA 3PEWA 3K09C 1AJEA 4JS0A 1DO2A 2QSZA 1Z0AA 3LVRE 4TYNA 3KJHA 1XNJA 3AKYA 2CJWA 2O0KA 4JZKA 3VNVA 5FR2A 2IYLD 4BFWA 1GG2A 5C4MA 1NSFA 2PCJA 3ZVMA 3PUVA 2PZEA 4TWZA 1GKUB 1UKEA 4WZAE 2VL7A 4FWIB 3TMKA 5DLQC 4DLSA 2VPPA 3AF0A 1ELOA 2D2FA 1F2TB 2ONJA 4B73A 4A6XA 2AKAB 1LF5A 1NN3A 1OHHA 2HUPA 1WF3A 2IYXA 3VMFA 1U8AA 2F1IA 2XZLA 4ZDWA 3X2SA 4OHVA 4BLQA 5C2JB 5CB6A 3QIAA 3R20A 1LV7A 3AH8A 5LBIA 4L15A 5JFGA 3U44B 2J3EA 1N2CE 2VIIA 3MD0A 3P32A 4DEYA 1DELA 3GJ7A 2UZ3A 3VQTA 4PAMA 4RZ3A 5DIFA 1N6OA 2F9MA 4QGHA 4A2PA 1GUAA 1KOFA 1CJMA 2IYUA 4AKIA 4UNQA 5JCZA 4A0RA 1KZ7B 1GOTA 3B82A 4TTRA 2H57A 2QTVB 4ZI3A 4OQNA 2W0SA 1E9SA 2AK3A 4B32A 2KI5A 3K0FA 2VHUA 3I92A 5FOSA 3CRQA 1ONBA 3PUZA 5DI9A 4R9UC 1TUEA 3K9HA 2Q3HA 1OT3A 3D7MA 4KVAA 5EE3A 1OH7A 1WXQA 4HSEA 2QT0A 1VCOA 2H7VA 4ZPXA 4U02A 4RD2A 5K8LA 1ZNZA 2WWYA 4US2R 1VIYA 4BFSA 4DB4A 3WNDA 1QHSA 2GJAA 3LXRA 3UXMA 5EP4A 5FUWA 1V5WA 2IW3A 4JLMA 4A2QA 3ZD7A 5F98A 4D2IA 4HZUB 3PUYA 5L3QB 4S35A 2YYZA 2H92A 5CDFA 3PIRA 2IYWA 3KB1A 3A4LA 3RC3A 4NONA 3ZQ6A 4M53A 1D9ZA 1Q22A 3ZS9A 4LBZA 4QBHA 2REXB 2FFAA 1GTVA 4IDPA 3SC3A 5G40A 3ADBA 2BIFA 2ZS8A 1NVXQ 5AUOB 3W3ZB 4URXR 4HZUA 1DOAA 3KJGA 1G291 4LWZA 5CITA 1MV5A 5L3QA 2F55A 3CZPA 1SKYB 1X86B 5DNYB 4TYQA 2BBOA 4XD7A 4A0FA 4KCGA 1Y63A 4HI0E 1UDXA 3TRFA 1VG8A 5KDLA 2FSIA 1P7CA 1LFDB 4B2LA 1G5PA 4B3BA 4V0NA 1E3MA 3DOEA 1XEXB 1NI3A 2D3WA 5G3YA 5JJKA 4PO9A 1W7AA 5EE1A 2P65A 3TUZC 2OO7A 5J4KA 4ZDJA 1SZPA 3O8RA 2Z5FA 1FTSA 1KJYA 1KO8A 1ZP6A 5HZHA 1Z08A 1D2MA 2ZI3A 4URVR 1YR6A 2GDJA 3ZVLA 1DG3A 3K0CC 4V0KA 2BEJA 1Z06A 3CZQA 3V9PA 3A1WA 1FNNA 4EJSC 3KXLA 3A6PC 1CRPA 3C15C 1F2UB 1A4RA 1YRAA 4LBYA 4XWOA 5FTNA 5HTKA 1G4AE 3KKMA 3F3YA 1NN1A 1SXJD 3EZ9A 2V7QA 1UEJA 1T0JB 4ZIRB 1UBEA 1QHXA 4B3FX 2RGBA 1A1VA 3ASZA 4W7SA 4PO8A 1NN5A 1Q1EA 1KK2A 2JLRA 2UZIR 2A5JA 2G88A 3BE4A 2JLZA 1ZMXA 4A4DA 2QP9X 4F4CA 4GDFA 5AUPB 1RW4A 4YMUA 3LRPA 1P2UA 1XX6A 4BFTA 1AS3A 3CPEA 4M1SA 3HU3A 4LBVA 4C0AC 3VFDA 4RFSA 1BS1A 4CEJB 2AHOA 3IHWA 2QI9C 2ZUCA 4P4SA 5SZHB 2FEOA 3A36A 2HJVA 4GMDA 3U2QA 2FPKA 5GVSA 1U8YA 3DM9B 2TMKA 2ZRLA 4E03A 3KQUA 3SQWA 1UFQA 1MO6A 2QTFA 1P75A 1K6MA 1GITA 1COWD 1R5BA 5FBLB 4A8JB 4HLDA 1N6LA 2BKEA 3AVUA 4IVPA 1EFCA 1OFUX 2XX3A 2YWHA 2ZSBA 3UG7A 1E4YA 1CJUC 3EWSA 4PHFA 3GLHB 3AVOA 4KO8A 5D3MB 5FOUA 5BXQC 3U7HB 1FQKA 3WBJA 2DWOA 2OBLA 3ZIAA 4LCBA 1R4AA 4TL7A 4A8JA 1OSNA 3SFVA 2VEDA 4XOIA 2GEVA 2AKYA 2O8BB 3EZ7A 1T4GA 1II0A 4R98A 2IA5A 4AI6A 2NPIA 3TQFA 3TBKA 1GFIA 1OXTA 1XPOA 4DWJA 3IUYA 5L3SA 4R2IA 2CMKA 1IY2A 4G1UC 3TJZA 2O5VA 3K8YA 4NYJR 2D4HA 2BM1A 4IFBA 4CZ2A 3V00A 3I5YA 4JLPA 4AD8A 4JJKA 1NBMA 4DIEA 5TARA 2QG6A 1G41A 5JBQA 1CLUA 3U3OA 1VHTA 2NG1A 3IO3A 1BYIA 1VG0B 2QGZA 3X1XA 3RSLA 2JLXA 3EZFA 2W2TA 3EIHA 3GFPA 2B21A 2FEMA 3ADKA 1Z0FA 4FIDA 4IRUB 4L9WA 3SBDA 3KQNA 5CYOA 4HUTA 1ZYUA 4RD1A 4HLUC 1MO5A 5JRJA 2KSQA 1NL3A 4EPVA 2FF7A 4CGZA 1RE0A 4O2RA 5FFMA 1J99A 4IDNA 2R8RA 3PCRB 4XWAA 1VMAA 2OLKA 1WBBA 1KI7A 4H9GA 4YONB 3TAUA 2JDID 2Q9AA 1S1MA 3RDPA 3QEJA 4DCUA 3AKDA 1IN4A 5F9FA 2ORWA 1NNEA 3TR5A 2VP0A 4B34A 1OFHA 2GKSA 4LHZA 2X19A 4DSUA 1ZIPA 4N0DA 2ZI9A 1NSTA 1NP6A 3DL0A 1ODFA 2XB2A 5EP3A 1HT1E 2C9CA 2OBNA 4UQOA 5IDVA 4LYAA 1MR3F 4EJSB 3FYHA 5DGXA 3RS2A 3GLIB 4DLTA 3J81k 3FOZA 4I1UA 5KO2A 5HE8A 4BFXA 1BMFD 2ODWA 3IILA 2F1HA 4IHQA 1CU1A 3LFUA 3QUSA 3TW4A 621PA 5KNBA 2CLDX 4MDFA 1L4YA 1HTWA 2A7QA 4DDVA 2DPXA 3IEVA 4BZQA 1R0ZA 3CPJB 3FGNA 1Q1BA 3GJ0A 5JJIA 2WMOB 2QM8A 2N1BA 1MRNA 4GP6A 4PAQA 2WPDA 4C30A 1KI8A 2R44A 3CONA 2QUZA 3KJIA 4G01B 4C7OA 4TSFD 2YNMA 3U3KA 1OFIA 2QPAA 2QENA 4DLWA 5EUQB 3G5UA 4UJ3A 1VTKA 2IYSA 3CUEF 3OHMA 4JVMA 4YXWA 3AGPA 4BLRA 1EFRA 2NO7A 3VR3A 4QNMA 2P5TB 1E9AA 3LX5A 5GJCA 1KMHA 4J0QA 4MGZR 4W5JA 1Z6YA 3CO5A 3B85A 2BEKA 3AVXA 3V4FA 3VU9B 1XMVA 2ZVPX 3CX6A 4NP6A 1D8TA 1W5TA 1QHHB 4R71A 1IY0A 4OQLA 3HU1A 1E9CA 1B0UA 1G5RA 2WJIA 2ZRNA 2BBSA 2QRZA 4BFVA 1YR8A 4QOSA 2JGNA 1CULC 4NL4H 4QC2A 2IHYA 5JWHA 3VAAA 4EDHA 3W8RA 2XZPA 3QXSA 5CIQA 5JECA 5FI1B 2OFWA 2QN6A 3AVYA 3HPQA 2IWRA 4ZKDA 1SXJC 5GJWC 3C41J 1Z63A 1T5IA 2ZRDA 5FOXA 1RVDA 4D4KA 1U98A 2CNWD 3ADCA 3PEYA 2KJQA 3B13B 2A3RA 1P2TA 4GZLA 2ANCA 2GTPA 3U7EB 2IYZA 1YZTA 1Z29A 1JXMA 1PLLA 2ZI4A 1CR1A 2PH1A 1KI4A 3ASYA 1A2KC 3Q5EA 3REGA 4B74A 5DISB 1KK1A 4TYYA 1JR3E 1DVRA 1NVUQ 4C2UA 4IEIA 4PC7A 1EGAA 5AWFC 1EK0A 2V3CC 1XZQA 2AX4A 3IEUA 4LJ4A 4KLNA 5SZIA 1E32A 3ZS8A 1G3UA 1XMJA 5HZKA 3HYRA 1RPZA 2ZE5A 1YZQA 4Q18A 2B8TA 3SDZA 2VO1A 4JLDA 1IXZA 1KNQA 1YR7A 3HDTA 2WWXA 4TQ9A 3WHKA 2OESA 1L7VC 2PJRA 1MABB 4Q9IA 2IXFA 2RGNC 2WSMA 2YWGA 5EE0A 5BN4A 3N2EA 3WP0A 5B2ZA 3DKVA 1HQYE 4LDJA 2CEAA 4PZZA 4D6PA 2V7QD 1G7CA 2X8AA 2FFBA 1FTNA 1OFTA 4M4SA 4A0GA 2YINC 3B1XA 1YQTA 2FGKA 1K5DA 3BIFA 2VRWA 2GXAA 4GP7A 4BE7B 3VR5A 2ZU0C 1KY3A 4MYCA 2J5XA 2RB4A 3FMOB 4DXAA 4Q9KA 4BUJA 2XSZD 1JECA 3L2OB 2ERYA 4C2TA 2R9VA 1M8PA 1SULA 1HH4A 4NPHA 3CRRA 1KDPA 1YZKA 4QG7A 1L8QA 2ZYVX 1Q20A 1W47A 2JCSA 4XJXA 4DLZA 5HKKA 2ZREA 5FOTA 3GLGB 2QRNA 1Q1ZA 2IK8A 5JWOA 4LSGA 3X1YA 1S3GA 1UPTA 2NGRA 1Q3TA 2B8WA 3BOSA 2VP6A 3WYFA 3AF4A 3PVSA 1K8RA 4RY2A 5BYJA 1OIXA 1KIMA 2XNDA 2W2VA 1AIPA 2NIPA 3W5IA 3R9WA 4M1OA 1Z6GA 4DSTA 2WWGA 1PV4A 3WBKA 3AUXA 2R6AA 1NIJA 5FPYA 4OBEA 5DI3B 4HB4A 3BB4A 2ZE6A 3B1VA 3K0AA 1I4TD 4I99A 2QPTA 5TV2A 1FNMA 3AB3A 3C5HA 2BM0A 1AQYA 2R6FA 3ZIAD 1AKEA 3LQRA 1HURA 1UBFA
chains in the Genus database with same CATH superfamily
3DAYA 3FWZA 2VAWA 2Q7DA 3CR8A 3GBPA 4UCWA 3U80A 4DLRA 5LDGA 2AG1A 4MUEA 3X0DA 2J0UB 1DFGA 2P79A 5AVKA 4A6PA 3AXSA 4XVCA 3F5MA 5B2FA 3F71A 4CEHB 3LI2A 5CIYA 2CNBA 1BMDA 4DKXA 5I9NA 1QVWA 2HWYA 3NTOA 4XE5A 5AVZA 3INNA 5EP1A 3SDBA 5BUSA 4X7RA 1HDCA 1PCXA 1JG4A 1E1MA 4HK4A 3DDCA 3IXMA 2PWBA 4M22A 1AQUA 1Q12A 1YIOA 1IXRC 1PJRA 3L1IA 4PHGA 1I30A 1SIWA 3L8YA 4XDHA 4AX4A 1GD1O 1A82A 2ISQA 3HGQA 4M0EA 4M9UA 5HPYB 1BDMA 1M2JA 1P1BA 3IMFA 5A4AA 4OL0A 2OYSA 3O8NA 2HRCA 4KBGA 5JS6A 1VXRA 3PRJA 2VZ0A 2EDAA 2Z5VA 5DBHX 3SZ3A 1U8FO 1XJ0A 4MV9A 4DRYA 2O2XA 3ZCQA 3Q9LA 5DWQA 1JGTA 1NX6A 3WWPA 1JR4A 5G1NA 1OYVA 3DE1X 4L28A 4EELA 4MWDA 1JBEA 5AI9A 4F04A 2COEA 2W2LD 3TCXB 4EHLA 3BWYA 3TAXA 1WP4A 4HFRA 3BTVA 4IWYA 3NEJA 2BEWA 5IC6A 3CVYA 4QQKA 3DVQX 2AOWA 1U2TA 1QQ5A 3UMGA 3BORA 3LLUA 3H1FA 2QRVB 3VR6D 1CQIA 3NBAA 3UJDA 4LCJA 4WBSA 1NATA 2BOVA 4JB0A 4WCFB 4LJRA 2D1QA 5C5CA 5C7YA 5IULC 3GCXA 3WX0A 3W8DA 2PIAA 3BH7A 3WP1B 1ESNA 1EB9A 3M7IA 4C3ZA 3W5AA 3LKDA 3GLKA 4WECA 2O8DA 5IMSA 1OI4A 5CR9A 5DIZA 2L42A 4BLSA 2AEEA 4NBWA 2FI1A 2Q27A 4F2WA 3R8FA 5KNBD 4ZD6A 3GZJA 3RRNA 4BRUA 1JG1A 3GPBA 4GR9A 1I5EA 1OV6A 4ZKEA 1W73A 4WDRA 2QNRA 3TM4A 3UT5A 1Z36A 3R5XA 2GK6A 1NRIA 4MKRA 4X63A 3L0SA 1Q15A 4HQ0A 1JKFA 1PEYA 1A3CA 1XXHB 3M1IA 1XMOB 1TO1E 2BFOA 3LKVA 4NH4A 2ZT7A 1U0SY 1JDZA 4UVHA 4HPJB 4LY0A 4FX2A 4RV9A 3VO8A 2I7VA 4OM8A 3D5EA 2ATVA 2D0OB 5E9WA 3HCRA 1ZUNA 4G07A 4P86A 1FRVA 1DJPA 3KYDB 1A72A 4R7ZA 4CQMA 1TZKA 2D0DA 5E4YA 4HNVA 4LJYA 3AHGA 1Z2OX 4WUVA 2H07A 4LZNA 4YXWD 1HKHA 1ZU5A 4HAYA 4MVJF 4EG8A 5D5HA 3LT4A 5JARA 1CS4C 1U2SA 4UHHA 3Q7EA 4BGVA 3HE3A 2IX9A 1XL1A 1I33A 4GOXA 3ISJA 4X66B 5CJ2A 2OQ2A 5DSTA 2B6NA 2N46A 3EUEA 3GRYA 2Z08A 1GGHA 2FSFA 2YWBA 3BRWA 3PEUA 3A4NA 5HFNA 1RKVA 5C8ZA 2LDXA 2ZPUA 5D5PA 1RQ7A 1TK9A 4M8NE 2Q9CA 4AJIA 1U8TA 4HVAA 2VJDA 2W6QA 2HBRA 5JCJA 1RQXA 2F3RA 4JBLA 4UUBA 3CW8X 4TYMA 4D8WA 4X8MA 2XXAA 4O0LA 3GWGA 2PBLA 4KPUB 3UG6A 1KGDA 3NH6A 3RT7A 3HVUA 1S4MA 2OB1A 3L0PA 4BLPA 5BYAA 2ZZMA 2GTIA 4Y98A 1U1GA 1U81A 1CZNA 1KVSA 3W8NA 2NU6B 4QYTA 3BL5A 3NBXX 2B92A 3H2BA 3JR7A 1Q3HA 4ZOCA 4BZPA 4DBVO 1E2PA 2PZ8A 3FLMA 1W94A 2CHUA 2W6JD 1U8ZA 3GRZA 2DU8A 3OAAA 3I4LA 5LMUB 4AJPA 2RHDA 1KQOA 4TQAA 1NULA 5L7TA 2HV9A 1T6XA 1HK7A 3LUJA 4ZAZA 4GX2A 4YEDA 1NBIA 4I9HA 1J23A 2FKNA 5AK6A 1IY8A 3AF3A 4YDSA 3RVNA 2AEJA 5CT9A 3ZJYA 5CFRA 3VNUA 4QUKA 1BOFA 2W37A 2W8ZA 4YCNA 3CRZA 2XQFA 2OGSA 3OJCA 1QHIA 1V37A 2CUZA 1IONA 1MU0A 3F90A 3NX4A 4URHA 1V1MA 1ZK2A 4X1YA 1VHQA 1EDZA 2PKXA 1I2CA 3EXHA 3OCCA 5DFAA 1UFOA 2Q4TA 3B8HA 2GXSA 4I1VA 5CCDA 1L5YA 2AYYA 2BI4A 4URWR 2HU7A 5EGNA 3ZEIA 3JVUA 3FUXA 3K16A 5FTKA 1YNSA 2O7RA 3IOCA 1CEEA 4J16A 4UUOA 3K0SA 4BXOA 1X1SA 2I2DA 2Z83A 3CEPB 5E1BA 4EDFA 1YS4A 2P9ZA 2B3TA 2Q6TA 5DOVA 4EG5A 2B7BA 1G4UR 2GVDC 1IRXA 1IIRA 4KREA 2WK1A 1SOAA 1AS2A 5DJ5A 5DHUA 5EMJA 4U9HS 5BQFA 1H94A 3BZWA 2V7BA 5CBPB 1PAUA 3OT5A 4Y2RA 1ONPA 5DGDA 1B1CA 2GS9A 3Q3JB 3V2GA 5I01A 2O07A 1CS0A 3QU7A 3NR2A 2LCFA 1VBMA 1UF9A 3DH0A 3LDFA 3DV0A 4TMXA 5AM1A 5EIWA 4FCTA 3RSCA 1QWSA 4A1FA 4B2IA 1L5HB 1QFXA 4RKQA 4AJ9A 4U2KA 2AE2A 1FDOA 3JQPA 4HLCA 3PXBA 1SU4A 1Z7EA 3FZGA 1HZZC 3I32A 3HWSA 4WOCA 3VR5D 1QGUB 4JQSA 1VSVA 3VDQA 3ND7A 4D44A 2OK8A 6NULA 3N05A 1JEYB 3UMJA 3JQGB 3FTQA 3SZOA 5LA6F 3O03A 3CA8A 3K0KA 2GPAA 5A5DA 1O08A 1JFSA 2X2FA 1SC1A 4X41A 4WKGA 4OBWA 2WDPA 3A3KA 1NZJA 4BWGA 4FX5A 1CFJA 4MCAA 3I8XA 1PNOA 4Y2TA 1E1RA 2CNKA 3V8EA 1BKDR 5KOIA 2PWZA 4YLGA 5ENDA 5F1PA 4BIMA 5HF9A 3PDWA 4ARBA 4PNEA 3U44A 3IAEA 2HMSA 1S4QA 1F2DA 1Z15A 4RAQA 4BMSA 2AVNA 3B9PA 1G19A 5K3OA 5KNDA 5IXSA 5JPCA 2QNBA 3A2NA 3DBIA 5ADHA 1U3TA 1NPDA 3FOWA 4JFRA 2WKRA 1ZM3A 4RYLA 1VYHA 3GIDA 2W70A 4BQIA 4H08A 4L3WA 5A7FA 4E2XA 1JI3A 3A9CA 2ZJ6A 4KITB 2HPHA 2B4KA 5KB3A 4F11A 1DG9A 3MC1A 1ZIYA 4GO1A 4US1R 3OCXA 4CI9A 1ML3A 1ESDA 1X1QA 1T9BA 2EDCA 3UTCA 4WESA 4X7PA 1IBLB 4E5KA 2YKGA 2JLYA 1T36B 4WW0A 5CX1A 5F4ZA 2NUPA 3BCUA 3E5NA 3O4JA 1R5JA 4KQKA 3IBFA 3C45A 1L4BA 1JIXA 3KHSA 5EIAA 5HK8A 4EH1A 2FR1A 3G1UA 1RYYA 4GXNA 2F64A 3A28A 5DXAA 4ATNA 1G17A 5A7HA 1PX2A 1R9MA 1KQGA 3O4HA 4HX9A 2I4IA 4W5HA 2GYVA 3VYTB 4C06A 2YJ5A 5JJCA 4XEHA 1FJHA 1IMOA 1SPXA 2QIPA 3CVJA 1W76A 3KHKA 4G24A 4I4IA 4MWZA 3S2EA 5JDIC 2P4UA 2WFLA 1NOIA 4QM6A 3MPOA 4NU8X 5KNLA 1OBOA 4MROA 3LUDA 1WMFA 1YIDA 4UUPA 2FN7A 5FJJA 1UT8A 3L6BA 1K2WA 4X54A 2GCOA 1KY5A 1QVRA 2JEOA 4KDCA 5EXTA 4DIBA 4KO1S 3DZKA 1N7HA 2D4AA 3EIWA 4H3KB 2NO5A 4FYKA 2UVQA 2DFTA 3S5JA 2Q1WA 4OSOA 4EKGA 1J97A 2BKVA 3EPKA 2I2FA 2I4MA 3MUOA 1AUVA 4QGGA 4CKBB 4FN5A 4PO3X 3SF8A 5JSHA 1KL7A 3FUWA 2QTNA 3I23A 1GNQA 2DLNA 2FW1A 4I46A 2JLXA 4D4JA 1XMIA 2JVIA 3NCTA 1NVAA 1XZMA 2YWJA 3H1TA 4G23A 3KBOA 3AY6A 4PGMA 3PEFA 5IN5A 1FSFA 1PYGA 1RHUA 4K9RA 3ZDXB 3AOEC 1TT5A 2X9QA 2I3DA 2MWMA 4S05A 1BDBA 2AI2A 4GC5A 4PZLA 1XEXA 2C07A 1RP7A 2BFCB 2GZMA 3C3YA 3ID6C 4J1QA 1CUDA 3E61A 2YXLA 1DAGA 3JQAB 3UMBA 1OCEA 1E5XA 2GO7A 4YCDA 1SBCA 3UW3A 5COBA 3MJHA 2C5EA 2QTZA 2VHYA 4FFLA 4JR2A 1GZ7A 4UPDA 1FTGA 2I78A 5ETJA 2O8FA 1GLGA 4D92A 4ENQA 3DMNA 1M66A 3FAZA 3RVLA 1NM5C 4QBIA 5KHOC 1PKEA 1U8EA 1C29B 3JQ9A 1E5QA 4N6OA 4BTVA 3EGEA 4PYMA 5AK5A 3EHDA 3FPAA 4QWWA 5T8KC 4FD3A 5KWEA 1GRNA 5DEOA 1ZM7A 4RVFA 2FU5C 5JAHA 4WOPA 3ABIA 1F51E 3EXFB 3F3MA 4ESEA 2X1VA 1IEVA 4YMIA 3I04A 3HCBA 3OEEA 1VBNA 4I8IA 3L0OA 5D86A 1TU4A 3LJKA 3MTDA 3RU3A 5A0FA 2ZJ2A 5DHFA 4FNGA 1KZ4A 1Y82A 3PLRA 2FFQA 3KKOA 2B4YA 5K0BA 2XYRA 5JUWA 1T2FA 1VJCA 2QU7A 1EWKA 2C5FA 1EH5A 4RF5A 5T3YA 4CR8A 4LDRA 1F3LA 2G5CA 5KCMA 2A9QA 1E5DA 2GNOA 2R2GA 2CHEA 1V8ZA 2HXGA 2RJNA 3AL3A 2OO5C 1G2QA 1PJ4A 2Y0CA 3DBHA 3TQTA 1V2HE 1VL8A 3Q85A 3I6ZA 3TD6A 2Y76A 2ONCA 3STUA 3ZW7A 3K09A 4DDHA 2E5LB 4WADA 3WTBA 4HVLA 3W5BA 3RS3A 4GPEA 2CXXA 4WV3A 3ZHOA 2WHXA 3E70C 1OR8A 4NE2A 5ALMA 3ZYCA 1NP7A 4LYGA 3TH5A 1O95C 3DO6A 4NSNA 1EFLA 2Y99A 1H5UA 4RS4A 1PQPA 5JCJD 1OX4B 4DN6A 2ZJ0A 2VUHB 1QKKA 2FGJA 2RGXA 2A3NA 2R1UA 1S8OA 3KYJB 3NOQA 5BW4A 1Y7HA 1PNTA 1UWVA 2DVMA 5EHIA 2Q2VA 1NVBA 3DMDA 5GOTA 3GLHA 5BQ5A 3GXBA 2BZ0A 1LTHR 3QNUA 1OXBB 1SK9A 2NLOA 3CJRA 2J3MA 2OLJA 2XE4A 1OIWA 3OAAD 4P1ZA 4QDKA 1OXXK 1EKXA 4B8WA 1C3XA 3T7SA 4HEQA 2ZP1A 1MW8X 3IIKA 1P2FA 1TF2A 2P41A 1L3IA 4HXGA 1PS9A 3GK3A 3SYLA 4F2HA 4R1QA 2POCA 5I9IA 5F7ZA 1ODKA 2FEWB 1F2VA 4J9UE 5K3AA 2JRCA 2YWXA 1WU8A 4WZBE 1BHSA 2HWWA 4FWTA 1TT7A 4CT0A 4QRHA 4EO9A 4JNKA 2XYQA 2VJCA 3GH3A 3SS9X 2BFAA 3QHAA 3N8IA 4F97A 3EVDA 1Y33E 2VXCA 2X3UA 3R7FA 3PFFA 1Z2AA 1G64A 1O4WA 4IRXA 4KR7A 4PTLA 1OX5A 2Y6VA 4WVLA 5L3RA 3RHZA 4HAVA 5AW6A 3NVKI 2RHJA 2Y9PB 3ZWQA 3REFA 4QYWA 5ITSA 5IXYA 2VSXA 3N6XA 4HYEA 1ZMTA 5REQB 4P54A 3CUUA 5HHTA 1FNDA 3NXKA 5CMLA 4QATA 1DOZA 4CKWA 3VX3A 3WIVA 2IX3A 3GMSA 3A70A 5HUHA 1C9DB 2OHIA 1NR7A 2R751 3VXKA 3VKUA 2QSJA 3RHFA 4YTEA 1Y4UA 3DOJA 1YQQA 2K87A 1XZKA 2XCOA 3DF9A 2WHPA 4ALIA 2FUCA 4ZEWA 3UHFA 4JBGA 4EYEA 3ZWDA 1Z07A 3Q4GA 1NMZA 2GESA 5ADWA 5SY9A 3H3FA 1XXLA 5C5IA 4Q4JB 2WMNB 4WHMA 4X91A 3STYA 2VQEB 1E66A 3M9LA 5EI5A 2R97A 4Y9UA 4AJLA 1CDEA 3TPFA 1AHNA 4N7JA 2GPSA 5ENVA 3SX0A 2IFTA 2YUIA 1BKYA 1RHRA 1W4CA 3NONA 2ZRJA 4CHTA 4Z0HO 4RLHA 3K35A 4RW0A 3FCEA 1U65A 3TE6A 1Q77A 3OEYA 3GW8A 4WLFA 3DGFC 1P39A 3KYIB 4R2HA 5DT2A 1E3QA 3M0EA 3AEYA 4Y8VA 5DM4A 4BVGA 2DXIA 1WU7A 2XDYA 5MN4A 1W36C 4BE4A 3A1CA 3LAWA 3GLIA 4HAWA 4JEUA 1G38A 2PX2A 1O0BA 1P0QA 3MWGA 4HJRA 1P6QA 1R5OA 3EPRA 2HNBA 2Q8NA 2P1RA 3IERA 1FS4A 3N76A 1GGVA 3NHLA 3CSDA 4K88A 3E8XA 1CUEA 4PV7A 3SM9A 4OX9Y 1X92A 2CNDA 3QXXA 1PJTA 4QGSA 3I09A 4Z54A 5I8WA 2NAPA 4QQ8A 5B7QA 3QF4B 5EE5B 2X4DA 3CRVA 1VHWA 3IC5A 1SCJA 3CNHA 1RRMA 2IP1A 2ZROA 3LGAA 3M5CA 3Q7QA 1R88A 4P31A 4Q82A 2BY4A 3B7GA 3QP9A 1W9MA 4S2UA 1P29A 5A6SB 5JH7F 1SVOA 1MHTA 1X6VA 3ME5A 1C9YA 3H75A 1A8HA 1MV8A 5HIJA 1R1DA 4BCBA 3MRSA 1KNXA 1W1WA 2HQRA 2EBWA 1E2QA 4I8XA 4DV6B 4LEIA 3LXUX 1L7BA 4KXFB 1EUDA 1SURA 4ZYUA 4QJ3A 3HU2A 3ZWCA 1I6MA 1XQVA 3H0EA 1J0EA 2YVLA 1W0CA 5LQJA 1JEDA 1I1NA 2X1HA 1JI0A 4PLHA 1WRBA 1PD1A 3DV2A 2BZ1A 4DQDA 1IUKA 1QPBA 2B9VA 3P0FA 1ZH2A 3VO2A 2ACVA 3COVA 4R01A 1YJXA 1L7MA 4ZOAA 1UBGA 2OFOA 3DL4A 2FZGA 1L7EA 3VU9A 1J8MF 2FPLA 3CPSA 4PM4A 2JC3A 3AEUB 3M6LA 4ZVVA 3UY4A 1JLHA 3CZRA 3OICA 4Z3KA 3PR1A 4XPZA 5KTMA 3ZZNA 4DMMA 1YCHA 4F5DA 4ZN6A 3R3VA 4YQEA 4S3MA 4TL8A 2BFBA 1M2OA 2FRDC 5JVDA 2BCJQ 1TADA 2VHJA 3PIIA 4XD7D 3SP1A 4BNUA 4P36A 3OQMA 2BKAA 3LBFA 3WNQA 4JI7B 1M73E 4DA8A 3OX4A 1KPHA 5ADVA 1JMVA 1VJDA 4NU0A 1Q11A 3RTDA 2VHWA 3ZCSA 1ZVMA 4JDUA 3L7MA 2C2WA 1IHXA 3KR0A 4IHJF 2C9ZA 5DN6A 5FULA 1TA4A 2FW8A 3B7PA 4ARIA 5B3LA 3GRKA 4FR2A 2YFKA 1WIWA 1EFPB 4LRTB 3N6VA 4LX0A 2NMVA 2TECE 3IT0A 4OHRA 2CV1A 2JGJA 3JZAA 3VOTA 5JC1A 3AESA 4LDPA 1TKRA 2QTWB 3OOJA 4F5YA 4O1HA 4RC9A 1UBUS 1PWZA 1F1BA 3DOUA 1GILA 4HFMA 2VF2A 4M2LA 4TT3A 5F64A 4Z4FA 1KBQA 2Y1DA 2RC5A 3GJQA 4PGAA 2NPOA 4RA9B 1SHZA 3V8QA 1YZNA 1YE3A 2IY7A 2REBA 2VDVE 2FLKA 2O2GA 4JC0A 1RU3A 2A9RA 1G7TA 4W5OA 4BKRA 4HVCA 5B4VA 3EQZA 5AVUA 1K6XA 3JSAA 1RWPA 4P4NA 1M34A 3F47A 3I6MA 3D6TB 1W19A 3GT4A 4TVKA 1JQBA 3QBEA 2NQ2C 1IG3A 1KR2A 5E6UA 3CF2A 4HQKA 1E3DA 1CD5A 4LVCA 1ZK4A 4Y67A 2JFNA 1O6BA 2B69A 2JANA 4LYYA 1H1DA 4FYVA 3KELA 1IJFA 2WHRA 3ZHCA 3OEED 3E03A 2AZXA 2W71A 1OBHA 1Y48E 3NDPA 2C88A 2IODA 3WQQA 1C3OA 2IVFA 5ICGA 3OJ0A 1PO7A 5A4MS 1DINA 4C14A 4CIVA 4HNQA 4DC1A 2F7SA 3G0DA 4ENSA 4DLKA 4Q9NA 3K96A 4V0OA 5A3SA 2FMTA 2D6FA 3F97A 4R1SA 5CEFA 1ZGBA 4FHCA 1N25A 3ZU2A 2BFEB 4FI3C 1VGVA 1ESZA 2QN2A 4P7JA 3D6JA 2ZJOA 3PXCX 1YZVA 3PQEA 5IABA 4UU7A 2P5YA 1E94E 2VH2A 4IDFA 3WLTA 5CM9C 4ZO8A 1WQ3A 1ZAKA 3BBPA 2AD5A 1H9CA 1Z12A 1LEHA 1RWXA 3L43A 4H27A 1A8QA 2OC4A 3RRYA 3UK1A 1QGDA 4JT4A 2GETA 2P4EA 4REMA 2EFEB 1TIBA 2Q3JA 2RHOA 2XUDA 1LRKA 3LRXA 4RXMA 4UU8A 3SYTA 2O59A 2OBBA 4QBKA 2WHQA 5AI6A 1YACA 2GCNA 1Y1PA 4LXQA 5DT9A 5AXAA 1NNUA 1ZD1A 1E1CA 2EZUA 1BEZA 4PVDA 4YJGA 5CUQA 2AUMA 2J41A 2V45A 3BM5A 3FZEA 2P6UA 3SNKA 1VBFA 4HRVA 1D8AA 3ZXIA 2BGGA 2H5IA 3GU3A 2CWWA 1E1KA 1Y3IA 3ESAA 4II2A 2ECQA 1XAJA 3R5SA 5IG2A 1T29A 2VF8A 1XRJA 2OUIA 1EX7A 1PJ3A 2Z5GA 3LYLA 1TQDA 2IXTA 3EXEA 4NCXA 4QICA 1LJLA 1RWKA 1E2UA 1BFUA 4M0CA 2ATEA 2YY5A 3D8TA 1Q0ZA 3BD6A 2WSBA 3OUUA 3JCZA 2GN9A 3N0TA 1M2GA 1YL6A 4DF3A 3RC9A 1DZIA 3RUEA 1U9JA 5TPWB 5TVKA 4HB0A 4RTKA 1T0BA 5C52B 5LM3A 1X7ZA 4PCUA 3H5RA 5B6IA 1SHLA 2VTEA 4TMKA 1MOZA 4MJXA 2H59A 2B7LA 5DHRA 5JD4A 3ZOZA 2P11A 4JHLA 2R65A 1XJ5A 3OCZA 3UTDA 3VPBA 2I3GA 1PR3A 2QPLA 1WMDA 3LL7A 1T91A 1PL7A 2ZAOA 3AETB 2HBQA 2NX2A 3HKBA 3MT0A 1YZGA 3FY4A 3HEBA 4D4GA 1LK0A 5T6MA 2YS6A 2HJHA 2DBRA 3O2JA 1GWNA 3AERA 3IQGX 1QK5A 1YBMA 3QPCA 1W4AA 1RP1A 2ZSFA 1RJEA 3K1YA 5AVTA 2YZ2A 2ZJYA 1G1AA 5JAOA 4ID9A 3A11A 3WKEA 5LPNA 3GLHE 1Y3FE 1HDOA 1TK2A 2ABWA 3HBFA 3HNOA 1BCSA 2P77A 3DMPA 1FFAA 4MR9A 1K8QA 3BE6A 4YAOA 5HBGA 3EA0A 4TS3A 2LCIA 1RXSA 1TM2A 3ROZA 2QAIA 2O5RA 1YVDA 2O1XA 4JLOA 2KHZA 1BKSB 1P2BA 3KT3A 4EIWA 4MR8A 5ALLA 1C9NA 2A1TR 5AVOA 1RM4A 3DOCA 4D9KA 1HEIA 1OI7A 1Y6QA 2BFMA 5G0UA 4DA4A 3RYIB 4F85A 1Z0IA 4KAXA 3KOUA 3SVTA 3TS1A 1J20A 3PE6A 3R9IA 5EZYB 1KKLA 3R1IA 2ANBA 2CNNA 1MO2A 3RAFC 3K0EA 3IB3A 3SYMA 4CM3A 4PSVA 3SCZA 4YNBA 1X8KA 4AKSA 5A4JA 2GN8A 3HP1A 4DR4B 2V6JA 2XYHA 4HRXA 2I2AA 3UJBA 3FIUA 4DMFA 1UBJS 2B83A 4B40A 1V26A 2JGDA 1DTSA 1QGYA 3LQ4A 3IKJA 1H8HA 1X8JA 3DD5A 2M6SA 2X1LA 3RVOA 4F84A 1GCIA 4O4JF 3C4QA 3FBTA 4AKEA 3GEEA 4A2WA 4D80A 5I45A 2W43A 1US8B 2Q5CA 5K6AC 2I2WA 1QORA 1XJQA 1ZJ6A 3HFSA 4LZZA 5A5GA 2X14A 5CFPA 3RSFA 1GPNA 1SXJA 4WLNA 2VP5A 1XEAA 3WIBA 3EULA 1WG8A 3VTZA 1J22A 2VNKA 2K2WA 2HPAA 1E2LA 1M6VB 3I34X 4O1MA 4RV4A 1PJZA 2ZEJA 2ET6A 1NA5A 4DLAA 1N92A 3SQDA 5C1OA 2VJBA 3O2SB 4DOMA 1RQRA 1TO2E 3CM0A 3VR3D 4V1CB 2FRVA 4OG2A 5HKLA 3UKDA 3Q40A 5KWVA 2H4JA 2WI8A 4O2AF 3WLHA 4BFCA 2BMAA 4AYTA 4A26A 1Z5ZA 3TR0A 1JLLB 5LUBA 3AHFA 1ZW1A 2E89A 2WNHA 3U9SA 2XVYA 1WY7A 2B4AA 2P6MA 3DC2A 4I1OA 3KKKA 1HT0A 5DX0A 3GLIE 2F3UA 2FUNB 2H17A 4NEGA 1L2TA 1YC5A 4U7FA 4TROA 4QPZA 3S81A 3A4MA 2Q0SA 1I2BA 4GL2A 5IZCC 3G49A 2PANA 2GBLA 1N8KA 3L8DA 3WYBA 4MW0A 3R4CA 5FTMA 2BE9A 3SMQA 1AUQA 1QDEA 4RZSA 1FIUA 1E2JA 2WJGA 1L5WA 3PNYA 4LRWA 4LSZA 3RT9A 4EGFA 2MSCB 2X6QA 1Y4ZA 1ZS9A 4TMVA 2BONA 5AJWA 2UYCA 3A6HA 2RHMA 5K4GA 4N5IX 1LXCA 5K0NA 5T3UA 4DCNA 4B7XA 3RBXA 3THYA 3LTNC 4KYTA 2QLMA 2PZMA 3AVVA 5K3CA 2WUEA 3I05A 1ADYA 4G0MA 4M0LA 3ZDFA 5BR1A 5J4VA 2RBGA 2XCTB 1QU3A 2PMEA 5KOHB 1KETA 4JLWA 4K26A 9LDTA 2G28A 3I9MA 2VA8A 4O2LA 4A82A 3QM1A 3ZY4A 3H83A 3SX4A 1E4OA 1UPCA 2QTMA 2WU3A 2HRDA 4DJ5X 2F1OA 5JSZA 1BJTA 1PDWA 4HQRA 1BXZA 2PN1A 1PVVA 2IYFA 4F91B 1OLSB 2FG6C 4TT3D 4ZEVA 2E87A 2O57A 3O4IA 2XODA 4WI1A 2CJWB 1N0WA 3AFMA 4YRBA 4KTTE 5J3JA 3UWOA 5J5AA 4E5SA 5DYGA 1ZOPA 1EXMA 1SD1A 2ZYRA 3GCGA 1I14A 2REQA 3QH4A 4ID3A 4YRIA 3AINA 4Q4AA 1QGAA 3HRIA 3Q8XB 1H23A 4HH3C 1Z7GA 2I5PO 1QOQB 1JT9A 2V9ZA 5F9HA 2EQBA 2WPNA 3IJEB 2B9EA 2YW2A 2ZBGA 3MFYA 3W6NA 1XD8A 3OZBA 1GTSA 5GVRA 2ACKA 2P2ZA 4PSAA 4PTYA 3LA8A 3GJZA 2I71A 2XB8A 4RL4A 2X2OA 4BQNA 5BURA 3OIWA 4PLZA 3GJRA 1NDQA 1PF7E 2C54A 3GD7A 5E6SB 3WWEA 4EO4A 3FR7A 2I2BA 3NC1C 1YVUA 1HNWB 1YE5A 5EL0A 3VU8A 2ZYGA 3EIEA 1G66A 3OIDA 4GRIA 4N1AA 2R4TA 4BUZA 3I9NA 1INLA 3G1WA 3MELA 4YJHA 3L84A 3PWKA 1JF8A 4P3OA 4NZOA 4UE6A 1UEXC 3Q2IA 2ZAMA 3QX3A 1P0IA 3LP6A 2RB5A 4J0JA 4UD6A 3GLFA 3NGLA 5ALQA 2CMGA 1VBKA 1I4WA 1MKYA 1GQRA 3PNQA 3I62A 1VZ2A 3FTFA 1SUEA 1M34E 2VDNB 3AF5A 1OA1A 3M2PA 4MAAA 4ZQIA 4XM1A 2XQIA 3MJSA 4Y6RA 4NESA 4REOA 3UJCA 5K0CA 1MT0A 1I4LD 2A88A 3IALA 2L2QA 2WZQA 1OBFO 1EBFA 2A30A 3LC7O 4M76B 1YVEI 2EFJA 2IP2A 2ODBA 2OE2A 13PKA 4PC6A 4RSMA 5EJ2A 4JEIA 3TVDA 2I2CA 2ERXA 5JZMA 3HRKA 1ICEA 3KLNA 2JI7A 4KLZA 4Y6QA 1MBZA 3KU4A 1JPVA 5LYJB 1NVFA 3DUFB 4L85A 2VTVA 4O4HA 4MITA 4P58A 1XBTA 1AMNA 3EY9A 2PGXA 1YQDA 1AVTA 3AW8A 4GP9A 1ISJA 4TSFA 2OXCA 1CRQA 4QQRA 3T0FA 3DEZA 3GJ4A 4F4IA 2LCQA 1NXVA 3CFYA 2HFJA 5KDDA 2WSLA 5LNK6 2OGUA 4X0EA 2R5WA 1ODLA 3OPMA 3HDYA 2XCLA 3BRSA 4G8JA 4EL5A 1ZM2A 1YIAA 4JC4A 1VJGA 3GRCA 2QZPA 3N87A 4Q48A 2VC2B 2WILA 2I99A 3MWEB 3DLPX 4HBZA 3ONVA 3PJFA 3PNVA 3GUVA 5AVSA 4IRMA 521PA 2HW8A 5AUNB 4MYDA 4MO2A 3OQIA 5JD5A 1NW8A 3GLUA 2C03A 5J2TB 3MCUA 4FMDF 3OFSA 3O82A 2L82A 3HDJA 4EHKA 2BUCA 1QK4A 2EWVA 4GZ5A 5E38A 2M6KA 1II8A 2WMDA 3HL0A 1CUXA 4PFSA 3WR5A 4I50B 4EUNA 2DQKA 4NG5A 3BMNA 3V46A 1U1FA 1NF3A 2DGDA 5D8DA 4CIDA 3W5CA 1NJ8A 2VH5R 4J0IA 4L76A 4RJJA 2GGSA 5DK6A 3UK0A 3T5GA 1NVVR 4YQZA 2IBMA 2HRZA 2PS9A 1QF7A 2OCAA 4AW9A 5K99A 3AWDA 3DB1A 3HJRA 3P5BA 2NXJA 3O9MA 5K8JB 1XNGA 3EPHA 4ZT2A 4FGJA 3KAPA 2HO5A 2W6NA 5LLSA 4PHHA 2PBZA 4P81A 4UCXA 2CNWA 5IC5A 2AWOA 2VJPA 3C74A 2FNAA 5BQXA 1Q84A 1BHQ1 2VSOA 4ZQCB 2Z2XA 2YJNA 1J5EB 4XCVA 2ZM5A 1B2RA 4BQEA 4C7VA 3D4NA 4Q3BA 3HYCA 1SVWA 5ENZA 1MZPA 3Q0EA 5NULA 2A0KA 3C3MA 3FPJA 3V42A 3VSCA 3L7LA 1BWPA 3NOVA 4IEEA 2JFYA 5H81A 1MP0A 2H1VA 2XZTA 3BCRA 2FWBA 3B6JA 4FGWA 1DADA 4L4UA 3DHWC 1C8BA 4ND2A 1UT6A 2VYVD 4LY9A 4WX2B 1JPUA 1QGOA 5P21A 1H8HD 2HLPA 2IHNA 2HADA 1KAMA 3KYCB 1L4UA 2O7SA 1TUBB 2FFRA 4EPRA 1RTTA 2MR5A 4MGIR 5IUKC 5CK4A 2XV1A 3DD1A 3EA5A 2B4QA 5CLGA 2WQ6A 2KM1A 1YH3A 1R9NA 3OKAA 4UXIA 4YYZA 5A04A 2WV7A 3IPAA 1XRNA 1Y7PA 4QYSA 121PA 4XRRA 4JYZA 1DIAA 4H1HA 4KAAA 4RY8A 1VDMA 1EP1B 2RH9B 1M2VA 3LDHA 3G1TA 4L02A 4RFSB 1M6HA 2CFSA 2Q99A 3NBFA 4JA2A 4G97A 4QYIB 4KO4S 3ZOKA 5HSGA 4OQ4A 4J75A 5EJGA 2HK6A 3VTAA 4BECA 5DYIA 2HF9A 4HBGA 1AHHA 2G1JA 2X0IA 2RK4A 2WVAA 2C2XA 2EP5A 3F98A 4I1PA 1PHRA 4LF7B 1MOSA 2DPHA 2NZYA 4ZQEA 3NDBB 1X87A 4ZOLA 1SCNE 3W77A 5T4FA 2QQFA 2A1IA 3N7UA 5FPTA 4M21A 4ZMBA 2I6UA 2JFBA 4BQQA 5CXQA 2VDWB 1Q95A 2GILA 4HGOA 5CCEA 1UAYA 4JL8A 5J1TB 4RULA 3HWRA 3QHQA 3M3HA 1SK8A 2FSUA 4LK2A 4EFKA 2FWRA 2XF2A 3PPXA 4CV1A 3JVEA 1LSOA 1JIVA 4OXXA 2A2ZA 1PR4A 3AQ4A 1UAGA 2Q3MA 3JVIA 1TECE 4MEJA 1UXIA 3RANA 4BNWA 1NVGA 3FR8A 1SXJE 3D1VA 3UJ6A 4II7A 1FLNA 1JYSA 5DW3A 1ND5A 2WJ3A 1FYXA 3AWIA 2Z0MA 2D2EA 1NJ5A 4DRXB 5CDHA 1I80A 1ZSVA 4ALJA 3S2FA 3NBKA 5L3SB 2ILVA 1H85A 4RJKA 4DV2B 2C5SA 2WWIA 3RVKA 3C3XA 1M8FA 3E0XA 3QW4B 3ZZ1A 4RPGA 2WB2A 1VYTA 2GD0A 1ZOLA 2YRWA 1XJCA 3ZV7A 3QXHA 4C08A 1ZR2A 1NVEA 3H0KA 3H2SA 4LJLA 2NAFA 4OJNA 1T9ZA 1KI6A 1OKKA 2IPOA 4UULA 5HKAA 1VL2A 2GASA 4C2BA 4DL9A 4EW3A 1JFFB 2ZSUA 4KP7A 3ETEA 4MGEA 3B5JA 4AJ2A 1XTIA 2D0IA 2HOQA 4F7DA 1UJ6A 3TO5A 2VHXA 1Y5RA 3IO5A 4EB6A 4TM7A 2WM9B 3O8OB 4TTIA 2B2NA 4URFA 4LFBB 3G8BA 4FHDA 3UAWA 2HCBA 3ASUA 2FWPA 1SRRA 5BMVF 3M8KA 4W8OA 1DMRA 1V39A 3QLJA 3PENA 4RQAA 4TWAA 3EOBI 3SEAA 3RARA 2OVBA 4F86A 2FHPA 3WYAA 3MLEA 3I8OA 3HP7A 1DQPA 4FGKA 2OV1A 3P9NA 4R2MA 4E3ZA 1NKTA 5D6OA 1U0TA 5CPBA 3U1TA 4CCYB 5CXSA 1O6GA 2Q6IA 1A2QA 1ZPDA 3PI7A 1CB7A 3DKRA 4IJWA 1HORA 3L40A 3R7AA 1N36B 4ZALA 1F8FA 2PX5A 1E6WA 2JIPA 2QTHA 3HVKA 4M7RA 4TRJA 1UBTS 1EGQA 5DXFA 3F5DA 4IUDS 5IK2A 2PUGA 2XAUA 5DYYA 3L7IA 4IGEA 4KK4A 1NW7A 2DR0A 2PL9A 2B20A 3MB8A 5JSUA 1EG7A 3OE1A 2VF5X 2X7HA 3LGXA 4KRXA 4PAOA 4OXKA 5FBZA 1MXHA 4Q01A 4ZYXA 5C51B 3ACBA 2AA3A 4HPWA 1I3NA 1Y8ZA 1HTBA 1UJ5A 3DTVA 5JASA 2NO6A 2Z2KA 1FFCA 2H9YA 4CIAA 1M6NA 4JLBA 1B00A 1LFAA 1RBZA 1D1SA 3FYTA 1PGPA 3BWBA 2PUHA 2C5BA 3EBPA 3WK8A 1Y1KE 1X7HA 2R6GA 4UPEA 4R1PA 1EQAA 3OZGA 3E3AA 1SOUA 4P38A 5AW9A 1KVUA 3WMFA 3O4GA 1RXVA 1JDPA 3KLOA 2ZJ8A 1QG4A 4G2TA 3LLMA 3IA7A 4LMBA 4M8LA 3K31A 1DIHA 3DAGA 2HA7A 1IXSB 4DADA 4Q7QA 5LD2C 3QEMB 3QA3E 3SGLA 4C7OB 3RRJA 4Q7EA 1TXGA 4JQYA 4PQFA 3ZXXA 2GFHA 1GVHA 2J5QA 4LOKA 1E9DA 3R6WA 4V0SA 2A14A 3L8HA 3PQ6A 2Q3BA 5ALFA 3OOWA 3BK1A 4KNWA 1WKBA 1PUXA 4YRZA 2DWPA 1MTOA 2P9CA 3AY0A 5CH5A 3VX4A 4QT0A 2HR1A 2FXIA 2JG3A 3QPBA 3ZDBA 1QE3A 3WAGA 1XC7A 4QODA 1Z6ZA 3LOQA 3BGSA 4UBNA 4IHAA 3MS2A 4QX6A 3MUNA 1SHTX 1C3EA 5E2AA 3VISA 2OXFA 1ICIA 2P3OA 2FH5B 1XRPA 2ZJ4A 5J59A 2GNPA 2CN1A 3GN2A 5F2KA 4PC1A 4PYRA 2CVPA 4FCWA 3UVEA 5EKTA 3GLFE 2IBSA 1TMYA 5J4LA 1E3TA 1QCDA 5ALOA 1V7PC 3AJEA 4IFTA 2HCJB 3V1UA 3CW9A 2WEKA 3AJ8A 2F9FA 1ZRSA 2VBFA 3KQOA 1PLKA 2QRMA 3D4IA 3FDXA 2I66A 4B71A 5H3LA 3A58B 3OWXA 5KYVA 5JCOC 5KPDA 2W98A 1