3WA7A

Crystal structure of selenomethionine-labeled tannase from lactobacillus plantarum in the orthorhombic crystal
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
467
structure length
467
Chain Sequence
b'RLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDTNRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLQLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords tannase
publication title Crystallographic and mutational analyses of tannase from Lactobacillus plantarum.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 154
structure length 467
sequence length 467
ec nomenclature ec 3.1.1.20: Tannase.
pdb deposition date 2013-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wa7A00
4K6GA 3H1BA 4BE9A 1GT6A 5AICA 4DMCA 4H7EA 1WB6A 2RHTA 1F6WA 4QNNA 4P92A 2JGLA 5T4BA 1DQZA 4K6KA 1ZD5A 3PE6A 2DQYA 3HSSA 2BUAA 4X90A 5HFAA 4DSAA 1WHTA 2DCMA 1E5TA 2BGRA 2G5PA 4C4ZA 1JMYA 1THGA 5YASA 1XRNA 2Z8ZA 1MPXA 6YASA 2G4LA 4FHZA 4X85A 1X2EA 2WIFA 3VVLA 2GZSA 4X7BA 3PUIA 2Y1KA 4A23A 2QKYA 2OLEA 4DM7A 1CUFA 3V1NA 2ZJ6A 2J3DA 1MJ5A 2JBWA 4BAUA 1ZD3A 4RPCA 4CIBA 1VJ5A 3X3HA 2YH2A 3ANSA 1C7JA 5HKBA 4X00A 3G8YA 5LZ7A 1L7QA 3WL6A 5AKIA 5ALDA 4UHHA 5AM1A 3STVA 3STTA 2CZQA 1FFDA 1EVEA 2HL6A 2YYSA 3GA7A 3H18A 2AXEA 5ALFA 2PSJA 4UHDA 4MYDA 4KYVA 3ZPXA 5ESRA 4HTAA 1Q0ZA 2VT6A 2OAEA 4OYYA 1EDEA 5JADA 2E3JA 4FLMA 1QO7A 2BUCA 1TIBA 1ZI8A 3BJRA 1EK2A 1JJFA 2V9ZA 2OXEA 1UK7A 5T4EA 3FYUC 4MWTA 3QPDA 2WQZA 1ZOIA 2JGKA 4GXNA 4ZV9A 4ARAA 1MO2A 3HRHA 5ALYA 3H0CA 2H1IA 2ACEA 4Y2UA 3MGAA 1SFRA 4H7JA 3LS2A 1CUDA 1L7AA 3HEAA 2WHPB 3FWHA 2HU7A 2ZSIA 5LZ4A 1A8QA 2XUDA 4EY4A 3OG9A 1PFQA 1ZICA 2OAGA 2VJBA 5JANA 1M33A 1LGYA 5IVHA 3VJKA 1EH5A 5AP9A 4UHCA 5FXMA 5AI6A 3DL4A 3IB3A 1LPBB 5HKAA 2EDAA 3JYHA 2V98A 1F8UA 1UKAA 2FUKA 3I1IA 1XQYA 2WLSA 4K5QA 2VATA 5H3HA 4BRZA 1VZ3A 1XRRA 2DHCA 4NS4A 1BS9A 4FMPA 2PX6A 3WKEA 4QZVA 5FUMA 4B0OA 4GBGA 1THTA 2JGMA 5K3BA 3F8SA 5DLPA 3PICA 3AUKA 1K6EA 1BCSA 1ODSA 5DNUA 3LP5A 3R40A 3AIMA 4AO6A 1R4ZA 2C5FA 2ZYSA 4I4CA 3V1KA 4EUSA 1CUXA 5D7BA 5T4HA 4JUIA 4J7AA 3WK8A 1XLWA 5SYNA 4E14A 5EIAA 3MVEA 2IITA 2QVBA 4PO3X 1SC9A 3EQ9A 1B41A 3E3AA 2WHRA 2G63A 3PDCA 2HA5A 3KD2A 2B4KA 1ORVA 4QDUA 4B82A 1ODTC 2PU7A 4WY8A 3CN7A 1T4MA 1UZAA 1XQWA 3DL7A 2Z3WA 5AHXA 5AKXA 1CQZA 1IMJA 1FFAA 1JU4A 5FV4A 3HI4A 1AZWA 4MQLA 3BDIA 2ES4A 2YXPX 1CIJA 3QH4A 1R3DA 1W75A 1P0PA 3WZLA 2OCLA 2WIGA 5JASA 4C6HA 4RGYA 2OG1A 3T52A 4G9GA 3V9AA 1CUUA 1MAHA 2Y2UA 1EB9A 4EY6A 2HA3A 4U2DA 4P93A 2Y6UA 4H7FA 1H2YA 4G4JA 5ALIA 1LPPA 3RKSA 3DLTA 1E89A 2HA6A 4BTVA 3WK9A 4BDSA 1HQDA 4N8SA 1QTIA 2WG2A 5LYYA 3FVRA 1XQXA 5K3CA 1LZLA 1W1IA 1WCYA 2Z8XA 3STWA 1N5MA 2QXUA 2XDWA 4HRXA 4BCBA 4FOLA 5LZ2A 1A8UA 2XQKA 4G4IA 4WJLA 3FNBA 5FOQA 1QGED 3IUJA 4B0PA 3BF7A 4UFPA 1WB4A 1JJIA 4PSCA 4U2CA 3D0KA 3HABA 2QUBA 5HFNA 4BC0A 5I7UA 3T4UA 5IVKA 2GYVA 4UBOA 5AK6A 5BOVA 3C6YA 2HFJA 1DWOA 2ORYA 4K6HA 5DWDA 4NMWA 5LZ8A 4I3FA 4JYPA 5ALKA 2VJDA 3G0IA 1KU0A 4EZIA 5K3FA 3B3QA 3DDUA 4OUKX 4XIIA 1UWCA 3S8YA 1BN6A 5K3EA 1H2ZA 5FPQA 4KE8A 4UBIA 4UUQA 1QIFA 5JD4A 2GYWA 5I9IA 2ZYHA 2WUEA 3OTQA 3G9UA 2GZRA 5EIEA 5LP1A 3PFBA 2XUKA 1CR6A 4WDQA 3Q0TA 4N8EA 2WJ6A 3AZPA 2FJ0A 1HPLA 2XLBA 3EBLA 4C89A 3K6KA 2IX9A 2QR5A 2WTMA 4K2AA 5JZ9A 1MX1A 3G9XA 3OURA 2WU3A 1EDDA 1QE3A 4F21A 1XZJA 2RHWA 2XMBA 4RE6A 4Y2VA 4QE3A 3I2KA 1GQRA 2J3QA 1BE0A 4KR0A 1I6WA 4YASA 4BZWA 2HA7A 1N1MA 4HXFB 4DIUA 2XUHA 4CG2A 5C8XA 3F9CA 3WK6A 5JZSA 4BBZA 4HVTA 3QPCA 1C4XA 3WKBA 3D5EA 2PUJA 3DNMA 1CUGA 2B20A 2V96A 4PSDA 4Y2XA 1JI3A 3A6ZA 4ZXFA 4JEIA 4Q3LA 5FRDA 3DOIA 2HRQA 4H7DA 2HM7A 1CEXA 2CKMA 4L0CA 4H77A 3BDVA 1ZD4A 1YASA 5ALGA 3LIIA 3QZUA 1QIDA 3WJ2A 3AFIA 4OU4A 5A62A 2GBFA 1KU6A 4DGQA 2QM0A 2Q0XA 5BV7A 4QDTA 4BVKA 1Q0RA 5DNVA 5LZ9A 1AX9A 2WSLA 3STXA 1B6GA 1XRLA 2NW6A 1QONA 3AIKA 2XUJA 1QIGA 1RWQA 3H2GA 5DTIA 3I6ZA 5DYTA 5AM5A 4MQMA 4A5SA 5AM4A 1G66A 4FFVA 4CCYA 4GWLA 1R88A 4BE4A 2QOEA 1UK9A 3AINA 3JWEA 2I3DA 4UFOA 4J0CA 2JGJA 3DKKA 4IHAA 2XQIA 4J3JA 1QIJA 4AB1A 1VOTA 4FWBA 4QEKA 1J07A 3DKRA 4X6YA 4FKBA 3M83A 4Y2JA 4ARBA 4KAFA 5EI5A 2ZYIA 4B80A 2DHEA 4PW0A 3HZOA 2FJPA 1CLEA 5AI8A 1UOPA 5EIHA 4C88A 4YX9A 1QIIA 3STUA 5ALXA 4LHEA 2P8SA 3A70A 1RP1A 4OB7A 3TJMA 1WB5A 3WMRA 2ONCA 1VXOA 4ROTA 1ZJ5A 3ESBA 4UFNA 3G0BA 3RK4A 1L7RA 5AI4A 4AMYA 1G42A 3TGLA 2WHQA 3DOHA 4Y2TA 5E2IA 1UKBA 4WDRA 1VXRA 2XLCA 2K2QB 3D2CA 4C01A 1BRTA 3BE8A 5HF5A 1IUOA 2HU5A 2VSQA 3LIPA 5AKLA 4HZGA 2ACKA 3H17A 1G4HA 4AMZA 4S0XA 3OC0A 2C0PA 3BXPA 4M0FA 5JD5A 5HQ3A 3FYTA 1TCAA 3C5VA 4CI9A 4B81A 1CUEA 5CH5A 4BCCA 1LBSA 3R3WA 5DYWA 2VT7A 3D4LA 3K9BA 1LLFA 2XMSA 1CRLA 2DR0A 3ESAA 5ALHA 3G9ZA 4GECA 3FAKA 4DMHA 4KE6A 5ALZA 3CCBA 5T4FA 1IZ8A 1W4LA 3IBTA 4L3WA 2VAVA 5AK5A 1QTRA 2X76A 5CURA 4Y7DA 1A8SA 3KWJA 1EK1A 4Q3KA 4UHBA 5I8PA 1IVYA 4Q1VA 1GKKA 1BN7A 1UK6A 1WHSA 1T2NA 3ESCA 5CBKA 1DX6A 2H9YA 1XZFA 1ZGCA 1E66A 1K8QA 5AKGA 2PKYX 1ZIYA 3EIOA 4X6UA 5ALSA 2WFLA 2B61A 4CIAA 4BVLA 2PBLA 4MJ3A 1MU0A 2WIDA 2D0DA 2WTNA 1JMKC 2XUOA 1YS2X 4F60A 1XKTA 4UBMA 1ZI6A 1LPMA 1YSCA 3K2IA 4LYEA 1K4YA 4W1SA 1W52X 2ECFA 4J03A 1YAJA 3U0VA 4J0KA 3WWOA 4DNQA 2XQJA 4LKOA 2ZVDA 5JYCA 3ICWA 5IH7A 2QS9A 4FNGA 3C45A 3N2ZB 4C87A 5EHNA 4LYDA 2HDWA 2WFZA 5CXUA 3DCNA 4BC1A 1USWA 4WFKA 5EHXA 4U2EA 1E8NA 4J0JA 4E15A 2BAGA 1DWQA 1FFEA 4J0GA 2EDCA 3PI6A 1JU3A 1CUAA 2JIDA 3ZWQA 4IH9A 4Q05A 3D7RA 1VA4A 4FBMA 4X94A 1LPSA 4OU5A 4ZREA 1AKNA 1FFCA 1VKHA 3BF8A 4KJXA 2OGSA 2EEPA 1A7UA 4N5IX 4AN0A 4Z49A 2IIVA 1G5FA 4QWMA 1O6GA 3KOOA 2GYUA 4HXEB 2QJWA 4X3CA 3VKFA 3WWEA 1MTZA 1XQVA 1JJBA 1SCIA 3L1IA 4GW3A 1IZ7A 1UT6A 5JD6A 3I2FA 2XUQA 1GQSA 5JIBA 1QFSA 4ITVA 3NOXA 5ALNA 4UBKA 3SWWA 3WWDA 4BRSA 4DMKA 4BP9A 1UK8A 3KDAA 1AURA 1MNAA 4UBNA 1AQLA 1FJ2A 2AJCA 4JH0A 1QIHA 2VQ6A 3A2LA 3BIWA 4LXHA 1QOZA 1GKLA 1S8OA 1MX9A 2HADA 5HF8A 3M82A 2CBGA 3MUOA 5ALOA 1YS1X 5LZ5A 2XMDA 1W6RA 3R41A 1H2XA 5AI5A 3VISA 2RI6A 4UBJA 5IVDA 1XZEA 4G8CA 2XE4A 3IUMA 1XZHA 3GELA 3ZI7A 2CEKA 4QA9A 3EQ8A 4WFJA 3BL8A 4H0CA 3IUNA 1J1IA 2R8BA 1E3QA 1WPRA 3C6ZA 3HYSA 2JGFA 5AM2A 4GEGA 2ROQA 3WKCA 5AKEA 3FCXA 3EQ7A 3IDAA 1XKLA 4KE9A 5DJ5A 2O7RA 1TKRA 1GPLA 1ZIXA 5KREA 3I6MA 3FVTA 3D2BA 3DEAA 2OCKA 4CCYB 4TPKA 4B85A 3O4JA 1JT2A 1K63A 4W1RA 3WJ1A 1EINA 3I2HA 4X93A 1ODCA 2CB9A 4X95A 4EY5A 1CUHA 1MN6A 4MEBA 2XB6A 3FYUB 5E4TA 4H18A 3L1JA 4CCWA 3VXKA 2XMZA 4G1FA 4IH4A 4HRYA 2XMCA 2BKLA 2CUTA 3O4HA 5D3ZA 3WLAA 1R9NA 4OCZA 3O9VA 3H19A 1EXWA 4B6GA 2WHPA 5K5EA 5D6OA 2WU4A 1XRMA 3HC7A 2VEOA 4IH1A 3BIXA 4L9AA 1MT3A 1H23A 5FDFA 2QRUA 5HK8A 3G9TA 3B12A 2V97A 2VJCA 1VLQA 1CUJA 3QITA 3WZMA 1XFDA 3GROA 2WKWA 2Y2VA 3W9UA 1PV1A 3WQHA 2DHDA 5LKRA 1N8SA 1DU4A 4JNCA 4PQEA 4WCVA 2Z5GA 5A2GA 1P0IA 3ESDA 3L1HA 4E46A 4Y2PA 3O9MA 4FNMA 1W76A 2PSHA 3ANTA 2J4FA 4F5ZA 2WUGA 1OCEA 4EBBA 5ALQA 5CT8A 5CH8A 2XT0A 5AKYA 2WG0A 3S2ZA 4QLAA 1XZMA 5HQ3B 3DJYA 3I2GA 3ILSA 1MNQA 3WA6A 1ZD2P 3W04A 1E8MA 1TK3A 1YB6A 2AJDA 1U8EA 1VE7A 3WK7A 5AKHA 4BB0A 5AIAA 3ZV7A 1AGYA 3M3DA 4LXGA 3WL5A 2C5GA 4YPVA 2I03A 2PUHA 4DSZA 5A6VA 4P08A 3R3YA 4INZA 4AZ0A 5DNWA 3V1MA 1DTEA 3GBSA 2HHAA 3IURA 3ZLTA 2OQIA 1NU6A 4DTCA 1GXSA 1EI9A 1DT5A 4BP8A 5LLSA 2XUPA 3LCRA 3CXUA 3C87A 4J0DA 3SK0A 2JF0A 1BROA 5CMLA 5AK4A 3G0CA 3C5WP 5JAHA 3EF3A 2WFLB 3OM8A 1DT3A 1H2WA 3G7NA 3W9BA 3PF8A 4MYSA 5JZBA 4GLBA 4H7IA 2PPLA 3H2KA 4DLNA 4G8BA 3I1YA 2Z3ZA 3P2MA 4G4GA 4OB8A 2O7VA 2D5LA 3FLAA 2VA9A 5ALWA 4BYMA 2UZ0A 1CUCA 4IO0A 5AO9A 3R3ZA 3WIOA 1E8DA 3AIOA 4RE5A 4UPDA 4OD0A 4AN1A 4X92A 1JFRA 3N0TA 1CFJA 3O0DA 3WK4A 1QO9A 4UBLA 4ZRDA 3UMJA 3E1GA 3CCCA 4XX1A 2LIPA 5CTAA 4Y2RA 5ISMA 3R0VA 4MWSA 4WY5A 3WWPA 2OGZA 4B7ZA 1CPYA 2OGTA 5AM3A 4O08A 1OXMA 4G9EA 2J4CA 5CT6A 3QMWA 3WL8A 1CVLA 2XQGA 5EGNA 5BWBA 4FFWA 5LIPA 1HL7A 3ZLVA 2HRRA 5J3JA 3QYJA 5D3KA 1R1DA 4Y9SA 3ZLUA 4HS9A 2O2IA 1ZGBA 1J06A 3H2IA 4B84A 2W6CX 3AILA 4JYMA 1GGVA 4HAIA 4BAZA 4G5XA 3U1TA 3GFFA 1XZLA 1J2EA 1AMNA 3RARA 3QMMA 2ZJFA 2C58A 2AJ8A 2PSEA 3KWFA 1UOOA 4Y2YA 1WPXA 3WIBA 2GBGA 2AJLI 2YASA 3H2HA 3R3UA 4XWGA 1XRPA 4AX4A 5LKAA 2VF2A 1AC5A 2I3ZA 1OILA 2XUIA 5ALUA 4OPMA 1ISPA 2C4HA 3OOSA 1SOMA 1MX5A 3DYIA 4C4YA 1LNSA 1XZDA 2C7BA 1N5RA 4MXDA 3F67A 3R3XA 3IVMA 2RAUA 3GZJA 1BU8A 1QJ4A 1YB7A 3H04A 4GI1A 3DD5A 5CH3A 3UUEA 3C8DA 3E4DA 3OPMA 1Y37A 5ALEA 4W63A 1MAAA 2WILA 4QDZA 5FPPA 3FLEA 5HK9A 1HBJA 4GDMA 5AKJA 1DQYA 1U65A 1EX9A 4G8DA 5CT5A 5C8VA 5JAPA 3I2JA 1VA5A 3D3NA 1BCRA 4DMFA 1QLWA 4YK7A 1XZKA 4OYLA 2XUFA 3HXKA 2WUDA 1UXOA 3V1LA 5A7FA 4WFIA 1NU8A 1UOQA 1U2EA 3SX4A 4I19A 4X6XA 4DYHA 1TCBA 4TVKA 3O4GA 1EHYA 5AI0A 5C7YA 3AZQA 5E4YA 1QFMA 2RGUA 1Q84A 1IUNA 5FP0A 4CFSA 3KXPA 4Y2QA 3QPAA 5JATA 3AJAA 4EB0A 3KSRA 4PSUA 1ORWA 2DQZA 3RLIA 1VE6A 4H7KA 5JAOA 3SC2A 4BDTA 4NZZA 4ZGBA 3FLBA 5K3FB 3HLKA 1XZIA 4U2FA 1XZBA 3AZOA 4DNPA 3WYNA 2XUGA 4ETWA 3PF9A 3NGMA 2BJHA 4N8DA 5DTJA 1RYYA 1YA8A 2JEZA 4EY8A 4DNOA 4Y2SA 5KWJA 2XUAA 1ZJ4A 3D2AA 5HF9A 4B9EA 2DSNA 5JARA 1FSSA 5FLKA 1IUPA 1QIKA 1SCQA 1CQWA 2WFMA 5SYMA 3W2TA 2H7XA 3G0DA 1ACJA 4V2IA 3I2IA 1CUBA 1R9MA 2QUAA 1EVQA 5BWCA 3QM1A 5AKKA 4U2GA 4AZ3A 1XLUA 3C43A 1LBTA 5CT4A 4D9JA 7YASA 2ZSHA 2H7YA 1BEEA 1P0MA 3F96A 4H35A 1EA5A 1CUIA 5ALMA 4W1QA 3IUQA 4PV7A 5ALVA 2VTVA 1TAHA 4ZV7A 2WIKA 1EDBA 4OSEA 1CUYA 4H7HA 2I78A 3C6XA 1GPNA 3DS8A 2FX5A 1ETHA 2GBCA 1YCDA 4RNCA 3TRDA 5A7GA 3C8HA 4ZI5A 1DINA 5DYYA 3WKAA 4AXBA 3A2NA 5AM0A 2PSDA 1A88A 3H1AA 5ALTA 2QJRA 2CMFA 3WL7A 2XMRA 1HKHA 4CG1A 1WOMA 2G5TA 4XJVA 2GBIA 2WJ3A 1R50A 1TQHA 1D07A 1XZCA 4QWWA 4UHFA 2C0QA 3A2MA 1P0QA 5CT9A 1XRQA 1CUVA 1CUWA 3C6BA 5F4ZA 3G02A 3YASA 1XZAA 5CXXA 4FBLA 5ALJA 4FLFA 4EA6A 1U4NA 3F97A 2BCEA 3WYDA 2W22A 1XLVA 4P9NA 3HJUA 3Q8WA 2HFKA 2OCIA 4FDMA 1JKMA 2HA0A 2HA4A 2RIPA 2BFNA 1CV2A 1XZGA 3WKDA 1C7IA 2ZYRA 2PSFA 3FBWA 1F0PA 3NWOA 2HU8A 3B5EA 3WK5A 4Q82A 2PU5A 5FKJA 5EHZA 2JGEA 4TGLA 4M0EA 4DNFA 4F0JA 1YAHA 5AOAA 4KACA 3VDXA 5ALPA 4W1PA 4QDXA 2XMGA 2OCGA 5ALLA 1X70A 4X97A 2O2GA 3W06A 4AO8A 4A16A 4J0IA 2RONA 3E0XA 3M81A 3MUNA 1DWPA 3PUHA 3I6YA 4L72A 4MEAA 1KEZA 4FLEA 5CW2A 4QLOA 5AKZA 4BVJA 3D59A 3BWXA 4PF1A 2VJAA 3I28A 5IKXA 4BATA 5ALRA 4Q34A 3JW8A 3DQZA 1LZKA 3DYVA 3STYA 3LLCA 4XVCA 4KRXA 2WUFA 3WI7A 4W9RA 1QZ3A 1CUSA 4LIPD 4KAAA 1GPKA 5K3AA 1QIEA 4NVRA 1YR2A 4X71A 2DFPA 4OB6A 5AK3A 2AJBA 5C81A 3WWCA 3BJMA 1LPNA 2QXTA 2XMQA 3PFCA 4E11A 5KBYA 1X2BA 4B83A 1NX9A 2H7CA 2WG1A 5AI9A 4N5HX 1H22A 4AQDA 5EFZA 4LXIA 1ZI9A 2X8BA 1UFOA 5AH0A 1QIMA 3V48A 5AIBA 1LPOA 2BUBA 5IVIA 5JAUA 4C4XA 5HF6A 2OPHA 1EB8A 3R3VA 2O2HA 3NUZA 3ICVA 2WIJA 4KE7A 3UUFA 4Q3OA 3QMVA 2BGNA 3O4IA 1HDEA 3RM3A 1K5PA 4X91A 2PVSA 2WJ4A 3FOBA 4M0MA 3IULA 2QZPA 1XROA 5A71A 1CUZA 2PM8A 5C8ZA 4U2BA 2XI4A 1TCCA 5KWIA 1F0NA 3GUUA 3IIIA 5AOCA 3C70A 3QVMA 4AO7A 3ED1A 4KAJA 2OQVA 4J0HA 3VVMA 1Y7HA 1PJAA 2ZJ7A 5AJHA 4BCDA 1Y7IA 4HXGA 4UHEA 4CG3A 4BZZA 3FSGA 2CJPA 1TRHA 2R11A 5HZGA 1DX4A 3HACA 5CRIA 2HIHA 3W05A 3TEJA 1GZ7A 1AUOA 5E4JA 1HLGA 1WM1A 2XQFA 4BTLA 1SCKA 2X5XA 3G0GA 4IQ4A 4BAGA 3IA2A 5HCUA 4KRYA 2JEYA 3CN9A 4FTWA 2Y6VA 2PL5A 5K3DA 4GHWA 2JGIA 3VJMA 3VJLA 1VZ2A 2QMQA 2QT9A 1LPAB 1O6FA 3WA7A 5AOBA 1BEZA 1YA4A 3F98A 4EY7A 2HA2A 4B9AA 2VAXA 3QBJA 1Z68A 3FYUA 4EHBA 5A7HA 2QTBA 3FSGD 1FFBA 5EHQA 5JALA 1Q83A 4PNZA 4KEAA 1UKCA 4QDOA 1ACLA 2WM2A 3H2JA 2B9VA 3FCYA 4ZWNA 3O95A
chains in the Genus database with same CATH superfamily
1IN5A 4XWYA 3S29A 3Q0IA 5FPHA 1NYQA 1Q0UA 3H1BA 5HTKA 4H59A 4BE9A 2Z5LA 1LVHA 2I87A 2R4TA 2X3UA 4NCAA 1Z82A 4B6EA 1CJKC 2RHTA 1KYTA 5JLAA 4K81B 2EERA 1F6WA 4FR0A 4D99A 1RQ2A 2BT4A 4D3DA 2DPHA 4ZYLA 2HF8A 1IVNA 2A0YA 1T6ZA 4MYHA 4P92A 3IX7A 3U4CA 4X60A 4EQ6A 5FBVB 4HH0A 4K6KA 4PG4A 2QLMA 1IMOA 1OD6A 3GBPA 1U8FO 1ZMBA 4O5OA 5TS2A 2NU8A 2PWPA 4LX8A 1Y48E 4XGIA 4HR7A 1RXIA 3ENZA 3DMTA 5CYFA 3ZCQA 2E85A 1ADBA 4I4TB 3ZHVA 1IN4A 2YQZA 1Q2XA 2BMEA 1C7EA 3SSOA 4BEWA 4ENSA 3T54A 2R87A 3LFTA 4JC5A 4DSAA 4CBVA 4HWSA 5FQNA 1U0SY 2D00A 4YCLA 3QU2A 4LY9A 3CLRD 2HJRA 3OPXA 4S3MA 1YJXA 3CKYA 3MG9A 1X7WB 1RQRA 1EFLA 2BGRA 3FGOA 4OP2A 3R0IA 4RD0A 5GADl 1TU0A 3G7UA 5J4KA 4AQ7A 4ABTA 2IS1A 1DRKA 5F5XA 1N6LA 1Q15A 1THGA 2IHVA 3EVCA 2FQYA 3UJ8A 1WMBA 4M99A 5DM4A 5YASA 2F1OA 4DEVA 2V8OA 1FYVA 2SBTA 2YWRA 1IK6A 1NUSA 2XGGA 4L2IB 1R6AA 5KHAA 3NHAA 4M1YA 3AT1A 3IUBA 3RYCB 1QVWA 1J56A 1RJDA 1NA5A 3NHKA 1G4UR 5K0FA 1JB1A 4DQDA 5JI3E 3QIAA 2PZMA 4X7BA 3OQNA 5T7BA 1NWCA 2Q3LA 1FRVA 4OAPA 1Y3BE 4LWZA 3UH0A 4DPKA 5JC1A 3C3KA 4IGAA 2R84A 4CV2A 1OKKA 2I7CA 1IU9A 1H42A 1MV5A 2QKYA 4QUHA 3SIPA 2Q3HA 1OLSA 2O0MA 2R8EA 3FHOA 3L8GA 2H0QA 2VF7A 3IOYA 4NRDA 4DM7A 1D5CA 4XD2A 1SNYA 2ERXA 1FZQA 2E0IA 1VC2A 1G98A 1MF7A 2QPOA 3FTCA 2BJWA 2H11A 1ENYA 3PRKE 4IVRA 4PU0A 4BU0A 4EM6A 2JBWA 4EZEA 1PGNA 3I61A 1OGJA 2FDRA 3OTOB 4D92A 1ENZA 4BAUA 1ZD3A 1GPBA 1S2NA 3DHEA 2P4SA 1E5XA 5L3QB 3JPYA 4I9NA 4OH1A 3X3HA 4TS1A 5BSMA 2YH2A 2O05A 3ANSA 4B7UA 5HKBA 3EFBA 2A4KA 4FNAA 8ABPA 5KOJB 1RRFA 4KYTA 2E4YA 5EJFA 5CB6A 1L7QA 3CWCA 3U7IA 2B7LA 3VHLB 3I0MA 2P30A 1FF9A 4NH4A 1Y9AA 1V5FA 3CH7A 3ECAA 4PRYA 2G7ZA 3LT5A 4TKUB 4C4PA 1W36B 1PP4A 1DEAA 3QIVA 4QAQA 3FTDA 5FBZA 1H1TA 2EKDA 3NGLA 2YWFA 2ZE6A 3I34X 1T0UA 3VPSA 4RWEA 1FFDA 4ZU6X 2HL6A 3OWHA 4MYTA 4K6CA 1P4JA 2HCRA 2FNAA 2UVQA 4LRYA 4MUNA 2I2XB 2FWMX 4IHJB 5ALFA 3RYHA 5TMDA 2PSJA 4RLQA 5FTJA 1N2OA 2HDOA 2KWIA 1PHPA 2NT3A 2P9QA 2Q2WA 3JRWA 3K8YA 3KQWA 1VP3A 4MYDA 1XMPA 4I5DA 4KYVA 3WSVA 1O94A 3IAXA 2H7VA 3PVCA 4DYDA 3UB2A 2J9RA 2PXHA 2KJQA 4HLUA 4GMGA 1YJBA 1E7WA 1ZSNA 2WHEA 2L2QA 5KNCH 4M9RA 2ECOA 2CSXA 1OGYA 1N34B 2G17A 1BHJA 3VHRA 4L5CA 2VRBA 3UB4A 1EWYA 4MGKR 4C2TA 2JVIA 4CMHA 4LY6A 1UJNA 5D7NA 3R9KA 3RVBA 2R0QC 4Q3DA 1CP2A 1ZK4A 4PAGA 1TIBA 4G5YA 1ZYUA 5SY6A 4B75A 2ZPAA 3SLRA 1FZTA 2XCIA 3ED5A 5I9LA 2O5EA 4UTNA 4LF7B 2QG4A 4F2WA 2YQ5A 2REBA 3N75A 1KO7A 2P0EA 3I42A 4JVSB 4COKA 2XNCA 4CETA 1GIAA 5KHLB 2H2WA 3NPMA 3JQRA 4XGQA 3H83A 1C3EA 3DZGA 3PQFA 2O52A 3V8QA 2RGWA 1YDMA 4L5JA 3DAFA 3JQAB 4HYEA 4IYJA 4BQRA 5K8TA 4OHYA 4IXMA 1UK7A 3V8MA 1HRKA 3HKBA 2NM0A 3EZNA 3PUWA 1R6VA 5FUYA 5AYVA 4HMOA 4M49A 4MR8B 5DLQC 2FPPB 2PIDA 1JI0A 3QPDA 1DCTA 9ABPA 1ZOIA 2JGKA 3UPTA 3WJAA 4CF5A 1V8PA 5BPHA 4D0NA 3DXXA 3OQBA 5JPCA 4OL9A 4WLNA 5ALYA 3R8XA 4DB4A 1J6UA 3A9VA 2QUJA 4QREA 2O8CA 2AN9A 2JZOA 3MGAA 5ETJA 2HK6A 3NIFB 1KI6B 3H5NA 1NMEA 5EKTA 3LS2A 4WJKB 5EHGA 4KH0A 4NE2A 4C76A 1L7AA 3I73A 3NEAA 4BQOA 1YDWA 3OKPA 3ROXA 4NXNB 3RTGA 1CULC 4L3VA 4F8YA 4YRBA 2OESA 1NBMA 4W8GA 1JXOA 4HPWA 3C41J 1UXJA 3D4BA 4QXAA 2POCA 3X43A 2IGTA 1ZICA 2GM9A 2OAGA 3AQ4A 4PGAA 4WN9A 1WX1A 5FADA 4OSOA 1LGYA 3OX2A 3GJ0A 5REQA 5G41A 2J0UA 5AP9A 1G18A 1T34A 1KH2A 5AI6A 1NRIA 3OX4A 3C3MA 3C97A 2X41A 3DPUA 3MZ0A 3KV1A 4P58A 1KBQA 5I9MA 1QB8A 4GG1A 2DGDA 2JCGA 5DB4A 4ZZ3A 5HKAA 1TLTA 3QLEA 3QUBA 4GRDA 3EBPA 1V45E 3DEFA 4JVOA 4YP9A 3WV4A 5KCZA 3FI9A 5KTOA 3TZQA 1M76A 1W4CA 1M2WA 2FUKA 1XK6A 3JY6A 1XHEA 1PT7A 2Q1XA 3CSSA 2WLSA 1IWBB 3UZUA 5KUTA 1EXDA 4BRZA 1FJXA 2P5UA 4GZMA 1RSZA 3SY8A 3LQRA 2H1FA 3MQ2A 4CR7A 3HU3A 3TQFA 2C96A 4MQ6A 3F74A 1HMPA 1QO0A 1BS9A 4KWIA 5MHTA 2PX6A 3TLBA 1O0SA 3WKEA 3Q98A 3BB1A 5BW4A 1THTA 3C1UA 4E03A 4F8EA 3MWDA 2WYHA 5DBGA 1QQAA 5K3BA 2XNKA 4JD5A 2WYWA 1W5SA 5EMMA 2ZJ4A 1GA6A 3BMXA 4PRKA 2LR0A 4KLCA 3KVVA 3ZLBA 1BCSA 2FXVA 2BJVA 1ISIA 2VHYA 3LT4A 1XWIA 3OIGA 5DTQA 3LP5A 4I3GA 1GZ4A 4LK2A 4BFLA 5DIFA 2HN9A 3R40A 4HDAA 3C6KA 4AO6A 2X2OA 5DFAA 7ABPA 3WRWA 3EC2A 1U0TA 5J2TF 1UBMS 3VTFA 3OLCX 2Y1LA 2ZPTX 5P21A 3UCEA 3V1KA 4DR3B 1ESMA 1W1UA 1CUXA 2ZI6A 3EGCA 1K2VN 4HX9A 4WVFA 1E99A 5D7BA 5CDSA 3HNOA 5TV2A 4U5XA 1QQ5A 5KYNA 3LO5A 1MQ9A 3BE4A 3C74A 3EMDA 4J7AA 1VM6A 5K0TA 2IS4A 4AJ2A 1J0XO 2VK8A 3IJEB 4ETNA 4C20A 2BFFA 3THYA 1CZUA 1N0HA 4YT5A 3B3JA 3TG2A 3FDXA 2GN0A 2QVBA 2C5EA 4EB8A 4I99A 2SCUB 1ZHFA 4DREA 1B41A 3CRW1 3M6IA 4KDFA 2A5JA 2B36A 3GRKA 3KJIA 4G1UC 3KD2A 4M9UA 2PMEA 2B4TO 1EFUA 1HNXB 2FR8C 3QSYA 4L95C 3DOFA 4CEHA 2CK3D 5MFPA 4B82A 4H0FA 4KX3A 4LMBA 1CRWG 1LY1A 2P35A 3CN7A 1LNQA 4MW7A 3RF6A 1IM2A 3HKDA 3NC4A 4A0QA 2ZRQA 1TZKA 3UMSA 2ZJYA 3DXZA 2VKTA 2Z3WA 2ODPA 2E5WA 3EC7A 4HATA 3BRWA 1JA0A 4FI3C 4MAAA 3RYIB 4DXDA 5MF6A 3DZKA 2ZKIA 4X54A 4V1CA 3V2HA 3PD0A 1FVOA 2B6NA 2G8LA 3HSKA 4KIJA 4PLCA 3TW4A 3ETEA 1P44A 3EUWA 4Q3EA 4EFKA 4MV9A 1XO1A 3QWBA 1V39A 4MQLA 1LK7A 1V4VA 1V96A 3O8NA 2LKCA 1C3JA 1QCDA 2ES4A 3BJEA 2X8AA 1R3DA 5M3BA 3VPAA 1OI3A 4JSYA 2GRJA 1PVVA 3PPWA 3QLUC 5B30A 1P0PA 1U9CA 1XWWA 3D4OA 4PAWA 2GN1A 2OCLA 3ENQA 1GD1O 3PQ6A 5DRTA 2WIGA 3ETLA 5ENZA 3WBBA 1Z18A 5LQMA 5JASA 2HTFA 3MCVA 2G28A 5IM5A 4C6HA 1E61A 3FLMA 5KWEA 4RVFA 3HV0A 2A14A 2Z56A 4IINA 2GRAA 4MGHA 4EL0A 4CLDA 2OFXA 3QF7A 1HM5A 3FIUA 3DSRA 3G1UA 3NRBA 4N3AA 4P8RA 2X4GA 5L4LA 3ZHZA 1HLPA 2HA3A 4MR9A 1HL3A 4L6AA 4B8YA 4C0JA 4B87A 2G70A 2PS1A 2YV1A 3H6HA 4PO9A 3OCVA 5K8IA 1ORIA 4P93A 2Y6UA 3DH0A 1CZOA 3GLIA 2P3LA 4H7FA 3AJ8A 3PRJA 4IQGA 2E87A 3DKPA 3TIGA 1V9CA 1LPPA 4KSYA 1P4RA 3RSFA 3WGQA 2XX3A 1NUAA 2OTCA 4V38A 3WNZA 3RKSA 5SZIA 2JLUA 5B6PA 2B1QA 3GGOA 3PQ7A 1VJDA 3D1LA 3DLTA 1Y9ZA 5LLTA 4I5IA 4GKVA 2C84A 1ULAA 2HA6A 4HKTA 1KR2A 4ZQFA 2XTJA 5DDIP 4YALA 4MVJF 2DUMA 2IV3A 5I8WA 1SOWA 1CF9A 4GP9A 3FPEA 5BQ5A 1Q1EA 1U2RA 4BDSA 5B1SA 1Z6ZA 3R5XA 2L42A 1KAOA 4HS4A 4I7EA 2WC1A 4N8SA 4DLTA 1XOIA 1JFTA 3PCTA 4GXQA 4NMXB 4B6OA 4ZEVA 4MVYA 3BL6A 4ZI7B 2IYLD 5T57A 4BX3A 3KL4A 3O8BA 1E64A 3WLLA 4C7VA 1T9DA 3B8HA 5C1BA 1LZLA 2RHBA 4DKXA 3ORSA 1T2VA 1WCYA 4QYTA 4N5MA 1WMEA 3QWIA 3K4PA 2KW5A 1PCXA 2XF2A 4OGFA 4DSTA 5HM8A 2EWWA 4JZYA 1LDEA 3EE6A 3QLVA 4MQ4A 2QSYA 3T15A 4UM7A 2JCVA 4UHJA 4FOLA 2BP7A 4B6FA 3E84A 1MTOA 4G4IA 4B3JA 4KDRA 3S5UA 3FNBA 1H9BA 4OBBA 5K0LA 4D9BA 3MYYA 4DPLA 4ZDIA 1UWLA 3OFKA 3MAAC 1TEVA 2KPOA 1UAGA 4UFPA 3BF7A 5JWOA 4FEAA 1BS1A 5KC8A 1JJIA 4U2CA 3HABA 4DZTA 5A3JA 1OLXA 1Y8RA 4FE7A 3ZGLA 2GF0A 2QY9A 4YN3A 3RVSA 2QUBA 5HFNA 3Q2KA 4GBJA 2GK6A 1P5RA 4O2AB 3T4UA 5IVKA 4LF6B 1QZUA 1WPQA 2B37A 3EZYA 4FZRA 3T99A 4HAUA 4LDAA 4N0MA 4F91B 1ICIA 1Z25A 1ZD8A 5CYOA 3TQCA 4Q4CA 1ATIA 1ZOLA 3RASA 5BOVA 5IDYA 1GVNB 1VMAA 2K7FA 2UXDB 2HFJA 4TXLA 1ONPA 4K6HA 3LSTA 1EK6A 3B1ZA 4ZYYA 2C61A 3PJDA 5LZ8A 2IDZA 2HBZA 5GV7A 1JLSA 1YIDA 2JARA 2XNDA 3NNSA 5KMGA 3VQTA 5AHOA 1TD1A 4J1SA 3DDUA 1RU3A 4TWJA 5C9ZA 4OUKX 3PNVA 1E0AA 4MI6A 3N86A 2DBQA 1U04A 3N87A 3TTXA 1MB3A 3OQ6A 4F3YA 5K3EA 2EJWA 5FPQA 4QPDA 1DIOB 1ZS9A 4UBIA 1OT3A 4NYMR 2XT9A 4M3NA 3ZR4B 4KH1A 3JTEA 2GJKA 5JD4A 2AKAB 1GUBA 4I1UA 3HCEA 1TKAA 3QPWA 4JYZA 4XYEA 3OESA 3G9UA 2GZRA 5K1ZA 1G59A 4M1KA 3NVKI 5KX5F 1HEYA 4M89A 3PFBA 1ZNQO 2XUKA 1EE1A 1CR6A 2C2ZA 1A9PA 2E6UX 1UBEA 3LA6A 4WDQA 2NPFA 1AK2A 3AZPA 1V6AA 3FDZB 5AQ1A 3K72B 3N0XA 1R4NA 3R20A 3THSA 3U09A 3FJ1A 1E9EA 5DW3A 3O90A 1D6SA 1HOXA 2W4IA 2IX9A 1L1FA 4NF2A 2YR0A 3A3YA 1ZKMA 3W0LB 2Q8PA 2A0UA 1HC7A 4PQYA 1GGMA 3G9XA 5A06A 3JQ8B 4A1FA 2FPOA 3CUSA 3D5QA 1QR2A 4D4IA 3L7KA 4GYJA 1YCGA 4LJYA 4ZFNA 3EIXA 3P26A 4CMBA 4IUCS 3I4CA 2FW7A 3GLIE 4NE9A 1M67A 1E1RA 1LV8A 2JA2A 1S0UA 1GQRA 2LDBA 4WLEA 2DTEA 1BE0A 3A9CA 3ROKA 1IM5A 1Y3CE 1TYZA 1YVRA 3II6X 4YMWA 4UUOA 4NOJA 2PD3A 1YS7A 4JJ4A 4BZWA 2Q4EA 1K7SN 3V8PA 1FYFA 3RS3A 3CM0A 4XIJA 3VO2A 3C7TA 3H3FA 1EBBA 2UZ3A 4DUGD 3AVYA 5CA1A 3G6KA 3ISJA 3IBSA 1GU0A 1RYEA 2XUHA 3IO5A 4FEYA 4FSXA 4OK6A 2Y4NA 2H1SA 4R2HA 1E9BA 2R6AA 3I45A 3ROTA 3TRFA 1HKUA 1R16A 2A0WA 3HCDA 2ATVA 3PC4A 3PS9A 1W85A 2V0NA 4ZALA 4EHLA 1ZVKA 1IATA 4N0QA 3DLIA 4IXTA 4C7OA 3BFKA 3AR6A 3AEQA 1DAOA 1JAYA 4UNPA 4K7JA 5C1OA 2JGDA 4D3SA 1I3KA 4KO1S 4M8NE 2Y9PB 3A0RB 4JUDX 4DMGA 5HPYB 1XMVA 4EFLA 2VYNA 4XM0A 5F7ZA 3BB3A 1C4XA 4RZXA 1R37A 3L7CA 3IFSA 3ZV6A 1ZXXA 1CE8A 2B20A 4EAAA 3M3HA 3B51X 1SUFA 2FVXA 5E7MA 4TYNA 1P4AA 4FILA 4GO1A 5HMMA 2X0JA 4UMFA 4G0XA 4ZVLA 3VI3B 3ZE2B 3E0QA 3G2MA 5FRDA 4DXAA 1AQIA 3DOIA 3AF5A 1TK9A 1IB6A 1UR5A 3OC6A 1BQEA 3ASVA 1JHYA 3TFQA 1XQ9A 3A4IA 2CFCA 2WJZB 3SZGA 3WHIA 2ADFA 4G09A 1N2HA 4L0CA 3B9RA 5AHKA 2CJYA 1P60A 1CSEE 4H77A 1KZYC 1JYSA 2R6FA 2B94A 3EA4A 1P1IA 1GCAA 3A8TA 4RA9B 2NAFA 4CKWB 3D3WA 3GEBA 4WSOA 4G65A 4AECA 1QIDA 2R4UA 1O7JA 2HMAA 3AFIA 4OU4A 3GZ4A 3L6EA 1G38A 2Q8NA 3AR5A 4E3ZA 2GBFA 4Q7QA 3RSQA 2G36A 1N0VC 1TJNA 2VPXA 2Q0XA 2Q5CA 4RSRA 3NYIA 4QDTA 1OYOA 3A6DA 5HKLA 3WX0A 1L9XA 3I5UA 4BVKA 1MB9A 1XKXA 1Q0RA 2P79A 1D4ZA 3ETDA 4QFBA 4Y9RA 5DNVA 1JS1X 2DFTA 3F7TA 4IG9A 4M87A 3HL4A 1YFLA 5CG1A 1RBQA 1AX9A 1RLTA 2GF9A 2W43A 1B6GA 3UGTA 1JLLB 2I0FA 4WINA 4Z51A 2RI0A 2XWJI 3AIKA 4NCKA 2XUJA 5CX1A 3TINA 2WF5A 5JMPA 3HKCA 3SZUA 3VZDA 3I6ZA 1NSYA 4JHXA 2BFEA 1X1EA 5DMXA 5HIMA 4YQZA 3OOJA 4YWJA 4LZAA 1W4ZA 3TZBA 5KYGA 3I0NA 5IN5A 5K20A 4IGFA 4A5SA 2IYRA 3B6EA 1GTSA 1E59A 5E9JA 3N8KA 4FE4A 2HMUA 2AV6A 3C16C 3FFAA 2I7DA 1PJRA 2AG8A 3K9WA 1R88A 3USCS 3WLTA 4BE4A 2HMTA 2QOEA 2HIGA 1DI0A 1RQXA 3JWEA 4EKNB 5KNCA 2X4LA 1SUBA 1G20E 5MN5A 2BYTA 4LJ9A 4NARA 3JZMA 1PG5A 1NN3A 2XQIA 3DBRB 3AVTA 1ZM3A 3H4TA 4RSMA 1UJMA 4A4DA 2CXHA 3A0UA 4I9FA 2HDHA 4PS1A 5C5EA 1ZWLA 2B83A 1EXMA 1T1GA 4F38A 2VPWA 4CM8A 4WQMA 3WRXC 4R0NA 3AW8A 4P0PB 2CLIB 3NBAA 1IZ9A 1E6KA 1RI2A 3M33A 1P6UA 4QOJA 3VSDA 4YJ2A 3TW8A 1S3SA 1NVBA 5B6IA 3AVXA 3LVQE 3M83A 3WFIA 5TMBA 1E60A 2C07A 2ASVA 3EASA 5EI5A 2Z6QA 2ZYIA 2D1RA 2GDZA 1EZ1A 2NUPA 2XJ9A 2LIVA 4MCAA 3VH4A 1VYTA 5HMLA 2A86A 1YQEA 3ITKA 4ACAA 3CVWA 2Q3EA 3PTZA 2R47A 1UOPA 2PEYA 1MKYA 3KFVA 5AI8A 5EIHA 4TYMA 4YPFA 5LFAA 4RK6A 1M1YA 2RGDA 3N70A 3C8MA 5CPBA 4LHEA 3OBIA 4UTRA 4UCXA 1F2UA 4Q48A 2V6MA 4DB2A 3LTEA 3V8EA 5BSFA 4KLNA 1G5TA 3BWCA 2CMGA 5JQGF 4YLYA 4NZPA 4WTOA 3FZQA 4BV8A 4CHGA 2J8ZA 2QNBA 3A3NA 4ZRMA 4JU9A 3NV9A 1F9AA 4WCFA 3TJMA 2PUEA 3K6RA 1GP2A 3EQ6A 4ROTA 1Z5WA 1E1MA 4TXJA 3WGNA 5IASA 3PGA1 3KLNA 3VR4H 3DT6A 5DASA 3DDOA 2ZB3A 3ROQA 2WABA 4BKPA 5EMKA 5GAJA 1L7RA 3NAMA 1OPRA 5CR9A 3CWZA 2COKA 1D1QA 2CDRA 1RW4A 4AMYA 4EL5A 2JNWA 3EVDA 3SHFA 2WHQA 5SZKB 1QQTA 3EJWA 4DJAA 3BWBA 4F71A 1KIAA 1WAMA 1KWKA 2IZ5A 3INNA 4LCEA 5BR1A 3AXTA 2G5CA 4M1TA 2C2KA 2F1IA 4ERNA 3PTAA 5F1PA 1FSFA 3DNFA 4WNYA 2EBWA 2OEPA 2AG0A 2K2QB 4UOQA 4JI3B 4EG0A 3B2EA 1A9OA 5TEVA 3SKYA 4C01A 1BRTA 1Z2CA 1NXOA 2FCRA 2J7PA 2O8VA 2WWTA 3IESA 3A6LA 1IUOA 3RS8A 5CPFA 3UYLA 2WD7A 4TRMA 2ABWA 3X1YA 1KSFX 5DH9A 3SDBA 4NBRA 3TG8A 1FEZA 2V8BA 3A1WA 5TF4A 3OM0A 3LAWA 1F0YA 1EP2B 1DC6A 1QC5A 3H11A 3BXPA 3KE9A 3TUZC 1UMCA 3NBFA 3HTXA 3IDOA 2RHMA 3AGQA 3M0EA 4IX1A 2R1VB 3OU7A 4GT1A 4URHA 1VIVA 4AKSA 4CKEA 1E9SA 5HCNA 3WB9A 4OOFA 4RFLA 4WNCA 4ZV4A 1YQDA 5JD5A 3EXIA 3BFJA 3L3BA 5HQ3A 5L6MB 2FOIA 2FRDC 3PQ5A 1EUCA 1TCAA 2BGTA 3C5VA 4CMIB 2I6XA 4CI9A 4YAKA 1QVRA 3TLCA 1X1BA 1A69A 1CIVA 1SCAA 4H17A 4YB8A 4BCCA 3L7LA 1LBSA 5DYWA 1MLDA 1CP3A 3DV9A 3R3HA 5I7SA 4F2DA 1H05A 2JGRA 2AGVA 1O9HA 4JLKA 4PBRA 4B3GA 1M7BA 1P1FA 3Q3HA 2AEEA 1EWRA 4ZTUB 2W42A 4YYZA 2DFNA 5TX7A 2VTKA 2ARKA 2JFHA 2IXDA 3GLUA 4HLCA 4TWBA 5JT1A 2QNIA 3Q15C 2RGBA 3A10A 1E2PA 5JUWA 1SQ6A 1GPYA 2B2CA 2FXIA 1TQDA 1JEQA 3FAKA 2CFIA 2QAGA 4DMHA 1AQYA 4YRJA 4MQFB 3AY0A 3ZZMA 3RODA 1JHQA 3U49A 5T4FA 1AKRA 1I3MA 1OI4A 3COWA 1X1SA 4ID9A 4X7PA 4OI0A 3WB0A 3QF4A 1MAWA 1ZH2A 4L3WA 4X6LA 1NLYA 2YRFA 4FMCF 2MIIA 2OV3A 1B3RA 1P61B 2B9EA 2QSZA 2RGAA 1KC1A 2X19A 2X76A 1J23A 2XY4A 2FZWA 2JA1A 4TMXA 1OZ0A 1OC4A 2RC6A 3WDSA 5CJPA 2MSKA 3WLSA 1ZC3A 4TLEA 4ZOQI 2QM8A 1ZA1A 4UXHA 3K0AB 4GMFA 4P4GA 1KJQA 1S2IA 2JLSA 2IUEA 4X24A 2H0AA 4M1SA 1V95A 1I3NA 2DYKA 2JBAB 1VPLA 2VEDA 1E3WB 3L0ZA 1RAEA 3E5NA 3HU1A 4GIBA 4M8IA 5LA6F 6REQA 5DO9A 1W73A 2EP8A 5CBKA 2F4VB 1DX6A 3AR8A 1NT4A 1Z35A 2EBHX 1SAYA 3IEXA 2JAHA 1A4XA 1XZFA 2A35A 2CHUA 1VHTA 2LKDA 1VE3A 4M53A 3ZBUA 1X3LA 2Z95A 4Q3NA 3C24A 2IPNA 2O3RA 3EDYA 4FEGA 3N2KB 1N6HA 4I81A 3OQ1A 4KW7A 4NYIR 3OM1A 5C5DA 1QVZA 2XRMA 1Q5PA 4PQFA 5IWCA 2XNJA 4QBTA 4GOND 4Q03A 4X6UA 2OL4A 1FUYB 3VU9B 3MXTA 4ITUA 1RKBA 4QUKA 2Q5EA 1TI7A 3CUUA 3IDZA 4C2UA 2KBFA 2ZRCA 3X1ZA 1JG1A 4BVLA 3U60B 1RJ9A 2WWGA 4KRGA 4ZO7A 1YQ9A 3Q4GA 4ZQCB 4Z3DA 5IJ0A 4NYJQ 1SIUA 1TLLA 4RHXA 1JMKC 2PQ2A 1YS2X 2PXAA 3NC0C 4MRVA 4II2A 2QLBA 1USKA 1ZI6A 1Q7GA 4U00A 3RYTC 1LPMA 1YSCA 4QT4A 5BVGB 4J16A 2JW5A 4BTEA 1U0HC 4EW6A 1N6KA 4Q93A 1PK7A 3WGZA 4NV1A 1OXUA 4YNBA 4YJ3F 2P9ZA 1YAJA 3VI4B 5A9RA 2VQDA 3IT1A 3I01M 4M1WA 5FI5A 4Z9AA 4Z5XA 3EQZA 1L5RA 1WJGA 4NU5A 3WWOA 1T3HA 4L7QA 3LJKA 3UFBA 2P9GA 3PSHA 1A2QA 1F9EA 2B7BA 1NZJA 2OP1A 3DV0A 1QH8B 3ICWA 4JENA 5D2CA 1PW5A 3AWDA 3N53A 3ORFA 4NCXA 4R6XA 3T9CA 5C8DA 3IUEA 1XI2A 1Z2AA 4ND3A 3C45A 1X7GA 3N2ZB 1FRQA 5EHNA 3RG8A 4UQLA 1V7QA 1JXAA 1I0IA 1AE1A 1BXRA 1AZTA 3K9GA 1XN4A 2HDWA 4YUXA 3DCNA 2ZWIA 3E05A 4WFKA 2ZSUA 1GN9A 1PZHA 2ZWAA 1H8EA 4ZU3A 2AF4C 4ZT3A 4Z8YA 1ABFA 1W34A 3DR5A 4TTTS 5B58T 4CKBB 4R01A 3ZNOA 1JBEA 1QNFA 5IJ9A 2YIJA 3RSZA 2C8KA 4N0PA 1JJ7A 5JCZA 3U61B 4NEHB 3CFYA 1PT6A 3I9FA 4DJFC 5JADA 1I24A 4A3SA 2BAGA 1DWQA 2X1VA 1ZQ1A 5DM70 2JK0A 3CW2A 1JU3A 4HAYA 5FHQA 1JEAA 3G2JA 1L3CA 3DR3A 3N59A 2ATCA 2EU8A 3D7RA 4IH9A 5K09A 1L7XA 1BMFA 1PTJA 5HBRA 5ENDA 2VA8A 1PYDA 4LC9A 3UNXA 4X94A 3BT7A 4OU5A 3UMYA 4F3CA 1VIMA 1Z8NA 2B8JA 4PYIA 2B69A 1FFCA 2WKPA 3QPVA 1Z7YA 2P2GA 3MHTA 2J3IA 1TO6A 3D1JA 4K03A 5AR1A 4GWKA 2FW0A 1OA1A 1LBIA 4YCDA 2FRVA 4KYUA 4G0NA 4CQMD 3KT6A 1D2RA 4ZKEA 3ESQA 4R83A 4F1WA 1YO6A 3GGGA 5JFOA 3GJ3A 1V11B 3L0SA 4L51A 1H4QA 2IIVA 4A6EA 2WJGA 3PC3A 1KO1A 3HUDA 5KVQA 3R7WB 3SBDA 3KJNA 2O2EA 4JQZA 5JYDA 2BGGA 1C2TA 1PSDA 3LLUA 1ZLYA 4DDTA 2VO1A 3F7MA 1JKXA 2I2WA 1MIOB 1PRYA 2ZRJA 5FUXA 4CT0A 2CXOA 3L9WA 2O5VA 1M1NB 4EIWA 1RYHA 5FA8A 2C4TA 4ER6A 1ZL0A 4HXEB 4KN5A 5CXQA 5A0FA 4K9MA 3DDHA 1XEXB 3LM8A 3WWZA 3OM9A 3QEMB 3CURA 2W2VA 3WAKA 3MHPA 3OJEA 4LHZA 1KQFA 1XR3A 4TMWA 2R4QA 4F45A 2PT6A 1QRDA 1YZNA 5KTTA 1BMTA 3L1IA 2FUNB 3JSAA 1FRZA 1SQFA 3IYLW 4H3KB 2LCIA 1XTQA 2OUIA 2BTEA 3EQ2A 4MS3B 1XQ1A 2EIHA 4KVFA 3HA7A 4O5AA 1TC1A 2XUQA 3SM9A 1R5NA 3L7OA 2HGZA 4I08A 4W9NC 1RPJA 5ALNA 1WF6A 3BEDA 2W48A 1S2DA 1ML4A 2C83A 2FPLA 3WWDA 1R9JA 1J97A 1HZZA 2O7QA 3BD9A 2ZIGA 4JJGA 4QQNA 1FFYA 1MNAA 4L9SA 4N82A 1XJ5A 3WQSB 2FN4A 4C43A 5BMVF 4UCFA 1BE6A 1CS0B 4I50F 2HWUA 3NALA 1A9RA 2P27A 1W5AA 1DDIA 4M8KA 3THXB 4UTZA 2F8SA 3EDQA 4DR4B 1JG7A 3BG5A 2VXBA 2CN1A 3ZCTA 4I9GA 4CMEA 2HSWA 4ZOAA 5CA0A 4L50A 4D56A 3PL5A 2B2XA 2JIMA 2IP1A 2HSGA 3NTUA 2WNIA 4RY9A 5L3RA 1QFXA 1YBVA 3VTAA 5A5DA 4AJPA 5LP6F 2HADA 1L7EA 2OXFA 1G16A 2Q3MA 2R2GA 1FDIA 3H9QA 5H4HA 2FP3A 3CB2A 1SBNE 4MWEA 4PXAA 1MA3A 2VDKB 3F5SA 2NP7A 3EA5A 3KU4A 1JR4A 2QU8A 4MKIA 5I3CA 5JSZB 5E1MA 4L3OA 5F23A 1IRXA 2MSWA 5CDFA 2NO1A 2V7VA 1SN7A 1E6LA 1H2XA 3PXBA 2BGLA 4M0KA 5JE8A 3RJ5A 4YACA 3TTYA 4CNBA 2DAPA 3A3KA 1I30A 4PRLA 1AG9A 2ET6A 1Z4LA 4NE7A 5BORA 3TUIC 1T6YA 2PZJA 2XE4A 3DF7A 3IUMA 3KR0A 3EWIA 4HZUA 4IIFA 4QBKA 4DG9A 3U6KA 2YX1A 3B6ZA 1FS4A 3IEPA 1VI6A 3RVLA 4MA0A 4WFJA 1GFZA 4KHPB 3BL8A 4HK4A 2MYTA 1A5AB 2HLDD 4RZ2A 5HS4A 1QQBA 3IO3A 1ZL2A 5FAXA 3EIFA 3NM6B 1GGJA 1XFAA 3WISA 2JLXA 2CVHA 2UYCA 2CVOA 2FN8A 4RL6A 4NG4A 3DW3X 4JOCA 4BVFA 2XE8A 2LXNA 4XVUA 1K7EB 4C1NA 1HDXA 4TWAA 4WCDA 5HIJA 1XMOB 2OZEA 3NBZC 2FSGA 3G8AA 2I4TA 1NXSA 4TQGA 4JROA 4OMDA 4BVBA 5AKEA 3HXLA 1ZN9A 2CXSA 4HFNA 4I8DA 1BXKA 2FVYA 5L53A 2D06A 4EI7A 1IRIA 1DAGA 2O7RA 4M21A 5BY2A 3GJ7A 1PR4A 2BM1A 4QPZA 5IK2D 1GU7A 1TTHA 1R0LA 3EZFA 3GG9A 2ZTMA 3MTDA 4G24A 1R74A 3NJRA 4YGXB 5IBQA 3CXRA 1G3UA 2OCKA 3LU1A 1M74A 1SZJG 4P4LA 3QUAA 4YRRA 2WWFA 4JOBA 1JT2A 3BSSA 1NVXQ 3MQ4A 2OZKA 2QXYA 2W6JA 4MQUA 4PLGA 4GI2A 1GA4A 2AW3A 2GCEA 4JQYA 5IX8A 3Q2IA 2ZFUA 1N2CA 5FORA 1C0KA 1UXHA 4XIGS 5K4AA 1E3IA 3I2HA 1SWVA 1O95A 4CL0A 2WV7A 5SICE 3AR2A 3QSGA 2BISA 4FGZA 5ITZB 2Z5FA 4O2LA 3I1FA 2CE7A 2JI6A 4X95A 1JNYA 1MN6A 1TGYA 4H18A 5I45A 4RKEA 4BNMA 2A7QA 5TMEA 5BVHB 1I2ZA 2GXUA 1QZTA 4K9LA 2J48A 2EF1A 5EJAA 1ZMXA 3DYBA 1NURA 5C0OE 2VFAA 1TUBB 3K1ZA 1C29B 3NH9A 4JT2A 4TL6A 4HRYA 1BWPA 3NM4A 4IIJB 3RTAA 1PL8A 2Z9DA 2FF5A 3BMCB 3H2ZA 2YV4A 4ZVRA 4FHCA 4F7WA 1IY1A 4KDEA 4ZHQB 3DM5A 2GF2A 1DLJA 2Q3JA 2JJQA 2VNJA 1POXA 4ARVA 3RSSA 4LRWA 2FPMA 3RKUA 1T43A 4L8FA 3FJOA 2W6MA 5J2UF 2I6UA 2CV0A 4D0SA 3F5QA 3NHLA 4FQ8A 5DXJA 1R9NA 4OCZA 1QYIA 2WAOA 4EQ6B 4M1QA 1AKUA 3TMAA 3N8HA 2NU8B 4KGXA 2PYZA 4ZANA 1MGPA 3SJZA 4A6XA 3CZPA 2Q62A 5I4BA 4E3WA 3C7DB 1A98A 3GA5A 4MVJM 1U7PA 5D6OA 5E6SB 1XRMA 4JT4A 3HC7A 3M6AA 2O8FA 2ZWVA 4C0SA 1JVBA 2VEOA 3LBFA 4BFCA 3BIXA 5DHTA 4PLHA 1EAYA 1H8HD 2PNFA 3HUTA 1KVTA 4R8RA 1DEHA 4O4HA 3FRHA 1LRLA 2V5AA 1KHTA 1BHSA 3O3OB 1B8OA 3G9TA 1QHEA 4UAGA 4O29A 3PC6A 1ZVQA 2ZU0C 3H5AA 3FI0A 3O73A 3B12A 1EQ2A 1QG0A 2H06A 3NYQA 1C9KA 2C2GA 4Z9YA 1L5MA 5B3KA 2V6BA 4YJDA 3DLPX 5F98A 3QITA 5F12A 2VHVA 3JQAD 2V1XA 1U5AA 3MT8A 5B37A 1KKLA 2UYYA 3NR2A 2HWXA 3W9UA 1V8OA 2EKPA 1YH3A 4Y3UA 3FNRA 1R5BA 1DJQA 2N47A 3CUWA 3ICCA 1L8QA 4PQEA 3T0FA 3RDPA 3SOPA 2EFYA 4NBKA 1E9AA 4MCJA 4Y2PA 1EJBA 1MBZA 4P4TA 4D9NA 4KQEA 1VL0A 2JJ2A 4FNMA 4O63O 3L02A 2YN0A 3QE4A 4ALKA 5C7IO 1MOQA 5AJWA 1J9GA 3OAAD 1FP1D 4KPFC 1UF9A 1SIOA 2JI7A 1V41E 1E98A 1ZCJA 4KXVA 4L07A 4A6DA 5IBCA 1YHYA 1P0FA 2IUTA 1OCEA 4EBBA 5CVVA 1BX1A 1Z0ZA 1FE8A 4I6JA 1KFEB 2ZRMA 3D0RA 1HYQA 4G63A 1S3GA 5CT8A 3VR4A 2XT0A 3E15A 5M5BA 1NBAA 3K70B 3JQ9A 3PSAA 2O8BA 1RBZA 3L05A 3OQHA 4KB5A 4QLAA 1XZMA 2Q6KA 1YB4A 2AVDA 4OQXA 4IDFA 3VSCA 2VRCA 3ICPA 2P40A 3OJCA 3F5FA 3ILSA 3WS7A 4GBED 1MNQA 3ZWKA 3WA6A 3PX2A 3WFJA 4GZ5A 1RWNA 1X3SA 1ZD2P 4RH3A 4CMAA 4X66B 4D3FA 5A3QA 4RTRA 3SQLA 2O19A 3LE8A 1NUQA 4X1OA 1P3Y1 4P7KA 3SSMA 2VPPA 4ZYTA 1GN8A 2EW8A 4MGYR 4KIUA 3WMWA 1VE7A 2IPXA 3C3DA 4HLQB 3KOWA 4D9HA 5AKHA 1YBMA 1QQ7A 4BWVA 5AIAA 5LMNB 3TD2A 1O3YA 4YT2A 4EMUA 2VUIB 1UIRA 4IFTA 4O8ZA 4PAMA 4BP1A 1UMDA 4YPVA 2QN1A 4DSZA 3A1EA 3JD1A 1Z2NX 1E2QA 1QQ6A 1NBEA 3DFFA 4QGBA 2C9YA 4Y6LA 5I7AA 1Y6ZA 3O0TA 1OAAA 3OJFA 4LI0A 4PSVA 3ZDEA 3WLOA 3SC6A 3KYBA 3FW1A 1ABBA 4JLBA 4JI8B 4RD2A 3BJIC 2P9FA 4KXLA 3U4HA 4E13A 5KI6A 4BO0A 2C77A 3F6BX 1QV6A 3LP8A 5JEDA 4FC6A 3IOBA 3OLQA 2OKGA 2VSFA 5CCBA 3AF1A 3QYPA 3BDAA 4ESOA 1E2JA 4KBFA 3R9WA 2JIZA 8ATCA 3R76A 4B3IA 5BW5A 621PA 1NU6A 1A96A 4PVDA 1SOAA 5HJ7A 1CQPA 1GXSA 4NCNA 4NI5A 3QNUA 3MOSA 1RWWA 2O1WA 4P3OA 3OPYA 1YQTA 4X5OA 5FEMA 1ESEA 2XVXA 1S4QA 4Q39A 5BQOA 1DADA 2XUPA 3BSYA 3T8YA 3GW8A 2PKQO 1Q1QA 1B14A 4DOMA 2OORC 3NRJA 4ZQIA 3CCFA 1YDHA 4KU4A 1E1NA 1C7RA 3BXOA 3GFBA 1MABA 2YVKA 4P32A 1YMUA 2GS9A 4JB3A 2YNMC 3JVDA 5CMLA 3E9RA 3L7DA 5KCMA 4ER7A 3CNEA 2YS6A 2W6OA 3JYPA 4OUDA 4CV0A 1C1YA 4QOIA 1D8TA 3OM8A 1RLOA 1DT3A 1SC1A 2FH5B 2M6KA 3PF8A 1O03A 1NJ2A 3ZJVA 3QLVC 2ZI9A 2QQEA 4AULA 2QTGA 3DZJA 5JZOA 4GLBA 3RRZA 1AUQA 5DTRA 3HKBB 3U17A 4FIZA 3G2HA 1J8MF 2ZQ5A 2XCLA 3LX5A 3ZGXA 3LWDA 4JP3A 4ZK6A 5J1SB 1LU9A 2H51A 2WU1A 4YLEA 5A4JA 5TQ0A 4LA4A 4DIOA 4YY3B 4QULA 4KXXA 2VA9A 2ZAIA 1AZSC 2JFZA 2XGJA 3GMTA 2GERA 3HB7A 3MCTA 4OXIA 5KAPA 3UH1A 3U9SA 3ZI4A 4J0QA 4W7SA 2O8CB 1HV8A 1D3AA 2NGRA 4Q4LA 1VCNA 1TCVA 4OFWA 5JECA 4N76A 3R3ZA 1E8DA 1E2KA 2R6JA 4JBXA 4RE5A 5K0CA 4L85A 4OD0A 3R0QA 4MV6A 4J2TA 2X0EA 1QPBA 821PA 2I3AA 3QPBA 1D0SA 4Z7JA 2VYQA 1YBAA 2Y99A 1LRJA 1LLCA 2O48X 2ZSBA 1TMKA 3GFQA 5A3RA 1HMYA 2VUSA 1Y4ZA 5DBHX 2W2LD 5DHUA 4WN9B 4LQDA 3WK4A 1K89A 3LDUA 1ORRA 2WMYA 4F6RB 5INTA 2ZK7A 4Q1BA 5REQB 2J0UB 2ZRIA 3GGPA 1Z73A 2R7KA 5FB3A 4CU2A 1ZAKA 2P6MA 4C07A 1OAOA 1DELA 1K27A 3E1GA 4BB6A 2ZRHA 3P19A 3D4NA 4IS2A 5DIZA 4DLWA 5KQPA 4XX1A 1QGUB 3MYRA 3QKRB 4YI5A 1Z6AA 5KNDD 1QVAA 4PO8A 1T2DA 3ZUGA 3JVUA 3A4MA 3H1EA 4WXEA 2O0LA 2Z57A 1KORA 2A67A 1BRMA 1LJ8A 3K4QA 2O5CA 3WDLA 3AF3A 3ER6A 4MVJE 1BC5A 4DDMA 5AVXA 1NF3A 2GPWA 1P4HA 3DFZA 2XDQA 3BD7A 4WZAA 3OZXA 5AFSA 2YJ6A 2EOAA 1OXMA 4MDFA 2YW9A 2F3TA 2QL6A 2QE7A 4G9EA 3BN3A 3DBHA 4RTKA 3T5DA 2R96A 5EHIA 2NUTA 1U1IA 3WL8A 1CVLA 1C4OA 2XQGA 3DQPA 3KXIA 3PNQA 3TCKA 3JRNA 2QLLA 5LR6A 2IQ5A 4R68A 5BWBA 3HQ4O 2IW3A 1GJRA 1FB5A 3KAQA 5CIQA 1IQ0A 3KSZO 2ZT7A 4IMIB 4GR9A 4MMXB 4AZTA 4ZKDA 5CVCA 3VMFA 4LUCA 3R5KA 1X87A 2HD4A 5A9SA 5KTYA 1TW3A 1BCSB 3EMVA 4HGRA 4C5BA 1WW2A 4TLMB 1I7LA 3CQ9A 4BLUA 1E18A 2O3QA 2X40A 4LGVA 1MVOA 3EBOA 2H2DA 3WYGA 4BPRA 2EQAA 2Q7OE 3W5CA 3GGDA 1RRPA 1X1QA 4Y9SA 1X14A 3ZLUA 4HS9A 1VCMA 2O2IA 3K7EA 2M98A 4C9BA 1J06A 1G5QA 1LW7A 3H4IA 5I4CA 3H2IA 2PH3A 3OIFA 4B84A 4CV1A 4Z0HO 4DILA 2PD4A 1CERA 4UASA 5ARCA 2MR5A 5B7PA 1YJ8A 3ZWBA 4NKRA 2GETA 2FEOA 5BSTA 1EP1B 2I7TA 3CRNA 1ADCA 3GH1A 3V00A 4GVLA 2HT1A 3KAKA 1PK9A 3OEED 4G5XA 1C80A 2BFFB 2QD2A 3T7AA 3UK1A 5JOQA 5CG2A 1FQJA 2IV2X 5AJUA 3UJCA 1L9KA 1Z7GA 1NW5A 4CIYA 3U44A 2JAWA 2V7QD 4H1VA 2PWYA 3FMVA 1J2EA 3WL3A 5JVDF 3UWPA 5LLDA 3WAJA 5AVKA 1AMNA 1N6RA 5BSHA 3WHLA 3NWJA 2PAFA 1HG1A 3CUYA 2IYXA 5TEWA 3IVXA 4UEOA 4HH1A 1TZMA 1Y6JA 3G8CA 3K0HA 3M5CA 5EJ4A 3CX3A 2P4EA 4OQFA 2AJ8A 2NNWB 5BYBA 5ELXA 2VJQA 1XDWA 4RAQA 2PS9A 4TTSA 3LX8A 2V58A 2QD5A 2Z2IA 1O0CA 3KVOA 1UOOA 4Y2YA 1X42A 1K6IA 2BMDA 1G5PA 3QBVA 2GVZC 4EG7A 1JDVA 1KH3A 3FXAA 4TT3D 1H6AA 4XWGA 16PKA 5I5EA 1K92A 2Y92A 3SLKA 4V1CB 4D6XA 2IVFA 3EHDA 5LKAA 4OXQA 2V7PA 2ZCUA 3KYJB 1NW7A 3HUUA 1T35A 3PPXA 1TO2E 4OPMA 1ISPA 1CDDA 1Q7BA 4OQLA 4PLTA 2ZT8A 1UBTS 1Y98A 3DYIA 3UV3A 1LNSA 1HTWA 5IAJA 1DJOA 3AB7A 3L7AA 4HYYA 2A59A 1A9XA 2ISQA 5CTJA 2Y77A 3WE7A 4HEQA 4NTZA 5IRCD 1GL6A 3QE0A 3QGMA 3R3XA 2EL9A 2VN8A 4KOAA 2IHNA 1GZUA 2FW6A 1OFTA 4HQ6A 5E3HA 5B1IA 4CN8A 4G0UA 5KWVA 2F8MA 1YB7A 4LWOA 3DD5A 3GQBA 2OV1A 1SRRA 3E4DA 2M32A 2W8BB 5EE1A 1BYIA 2P5YA 5BN1A 4FONA 3R5HA 1S2OA 2FFBA 3IODA 2HRDA 4R3UC 2IHJA 3REOA 1IAQA 1MAAA 3REQA 2IBSA 1T3LA 4PVCA 2B6HA 1KMMA 3D8RA 4QDZA 1OZHA 4MR9B 3ZHUA 4C29A 3PGMA 4YFYA 2C9OA 3LFUA 4HGOA 5LJIA 2QZ9A 3L84A 2BF7A 1C8BA 1V1RA 4OLJA 5E0OA 3SP1A 3W2FA 5C53B 3QKTA 3GLIB 4TSRA 3CF6R 3RIEA 1YGPA 4IJMA 3EODA 5I7OA 5PGMA 2OAQ1 4HOYA 2JLAA 3L46A 1A5SB 1VJ0A 1O08A 4D8YA 1E4VA 3KHTA 1ODFA 4I4TF 1JEJA 2DWOA 1U65A 3VNRA 2PS3A 4PHTA 1LJLA 1E2FA 2PRZA 3E8SA 1J5XA 4G8DA 1PWZA 1TM4E 1D0VA 1CG6A 1KK1A 2G71A 4HDCA 2D3WA 4OSPA 4QUBA 3TTTA 2QK4A 4QEDA 4QX6A 4EPWA 3D3NA 3GYGA 5I47A 1WXGA 2UZIR 2P67A 4RIHA 4ND8B 3OMLA 4Q15A 4TYQA 4YK7A 2WVGA 1ZUWA 5E7JA 3NB0A 4QSHA 4ZQBA 5HIKA 1HO3A 3GVIA 2XUFA 3A1DA 5ICSA 5M29A 1G8PA 2VPZA 4D0GA 2AW5A 4WFIA 5BV2P 4Q4JA 3TAUA 1HI9A 4PNHA 5DCYA 2POQX 4RIGA 4X6XA 2A92A 1HWYA 1Y8AA 4QYIA 3WO1A 4M1OA 5K0NA 2BGUA 4MNTA 2BP7B 2JLQA 1RZRD 1NLMA 1KEUA 1VKJA 3L0YA 2OBBA 3ZEIA 3ZX5A 1I2AA 3D31A 3FTQA 1WNFA 1U3DA 3O4GA 4XTRA 5AI0A 2JJ8A 4YAJA 1W9MA 3T7TA 4E7OA 5B5SA 3NVAA 5E4YA 4PQRA 1M2HA 1QFMA 4JZKA 2ZUBA 4UCQA 4QJ4A 5IARA 4CI0B 4U3JA 2WSMA 1L4MA 1NJFA 1Y8RB 5FP0A 4Z4QA 3ZWPA 4RZ3A 3OUTA 2PRJA 1NIJA 3B1YA 5JATA 3ZU4A 1Y42X 1QOQB 3AJAA 3B13B 1TC2A 3NWEA 3OIVA 4G89A 1LBQA 4P22A 1BD3A 1FTSA 4U0JA 2FLVA 5KSZA 1FMLA 4UVGA 3TOXA 2OLKA 3GLTA 1U0EA 1ZGGA 1VL2A 5FFNA 3RFUA 4M0CA 1V3UA 1XNJA 2JFWA 3RLIA 4RTMA 1B8UA 3I52A 4Q9LA 1QCYA 5E3IA 2WE8A 4JP2A 1SXHA 3BAZA 4HJRA 1AKTA 5KVAA 1EMDA 3P0JA 3QLTA 4BZQA 1ZU4A 3OZDA 4NZZA 1J2JA 4AP5A 3EXG2 4LNUA 5KMGB 3SE7A 3LSYA 5C18A 3MINA 1S5PA 4O4IF 4RANA 4BUZA 4HB4A 4F97A 2HRBA 5FUWA 1J90A 2DUJA 2PZAA 3INGA 3NTRA 2CHQA 3E7PA 4DNPA 5EQTA 1XJWA 3AKZA 3LCCA 4GZ3A 2XUGA 3R23A 2D13A 3GD7A 1QGAA 3PF9A 3NGMA 4EHDA 2QMOA 1SBTA 1Y0BA 2H17A 3B36A 2P7IA 3CIFA 3VU8A 1L7BA 3PFGA 1JFLA 4PONA 4DC9A 1OASA 2QUIA 4MEJA 1UPBA 2QIPA 1XQ6A 5BYJA 1EX6A 4Q9JA 5HUJA 2FKAA 5FYQA 3PDUA 2CXRA 4IHJF 1PR6A 1R4NB 3LVRE 1GRRA 1KXJA 4DNOA 1TJ5A 3Q5DA 1RHUA 1Z17A 2ODNA 4BXOB 3KZKA 1S7CA 3LUKA 2GCIA 5ED4A 1TXGA 1E3TA 2XWPA 1AXRA 2ZDHA 2D0PB 1NXVA 5SV2A 4DFDA 5JARA 4RULA 3NGXA 1IUPA 4MOWA 2AR9A 4MUIA 4QTUB 5ERXA 5JCJA 5TPZD 4D8UA 3VA7A 2AN4A 3TTUA 3VJRA 2APJA 1ZCZA 1ACJA 1KY3A 2XOEA 3L0DA 5LCXA 4U9UA 5IS2A 1QPZA 3GNSA 3RTBA 5KNBH 1UM8A 1W48A 3QA3E 3PUXA 1SBYA 1UBSB 2BWJA 2QB5A 2CXUA 4AZ3A 5LQKA 1YFZA 3L6CA 4LWQA 1WWKA 4LJ7A 5H7XA 1IXRC 1W8DA 4PLVA 1C50A 3BHMA 4NCIA 1ZW6A 2WZCA 1KYXA 2GLUA 1U5CA 2EQ5A 3F7OA 1BNCA 3AWIA 3IMGA 4K9PA 4TTVA 2I91A 5EIXA 1I1NA 1FJHA 3WHKA 2WQ6A 1J24A 1W85B 3GJ6A 4L4YA 3KCNA 4N49A 3LVBA 7YASA 2X14A 1T8TA 4JBNA 4TTJA 3IR6A 3T7IA 3TOVA 3AEQB 3BZUA 3K1JA 3OZGA 1S02A 2K6GA 5IC4A 4EFDA 3IUQA 3O7WA 3R6GA 1NVVQ 5EXPA 3RADC 1T8UA 4I9HA 1GAXA 3L77A 1BDJA 1V1MA 4L4SA 3CUEF 3C3XA 1FOEB 3A9WA 4C0BA 2O7NA 4A7PA 4RIEA 4BFYA 1Q1NA 2FR1A 2YJ5A 1WDKA 3KFXA 4JP5A 4YCJA 2WIKA 5KJEA 5TPWA 2IH5A 3QVKA 4PYRA 1DUVG 4Z8XA 4OSEA 2AFHE 1CUYA 4IVQA 4AICA 2I78A 3HM9A 1YUMA 4JLAA 4BKMA 1XDUA 1N8TA 1IQPA 1R5OA 2GVNA 1ZONA 1ESCA 4YIHA 2X9GA 4DLRA 5KYYA 5G53C 1D9XA 2DR3A 5CFMA 3DS8A 4QODA 5BV1A 2C54A 1OBOA 4HGPA 3TTWA 3ZBPA 2P2NA 3K6JA 4QGAA 2VNAA 4ARCA 2PL9A 1ETHA 1Q0QA 3FNHA 4GH5A 3UMFA 5CB4B 4NHOA 1KJIA 1YCDA 2ODBA 4EPYA 1KJ9A 2GCOA 3L8MA 4BECA 4BLQA 3ONNA 3WL4A 1DX9A 5JPIA 3SYKA 3D3WB 2NIPA 5FWDA 2XITA 5G1NA 1SZPA 2GM5A 2W0MA 1PR0A 5DYYA 3MELA 2P9HA 2MCFA 2VNIA 4AXBA 4KR9A 3K9QO 5HKKA 2PSDA 5FJIA 3FZGA 5ALTA 5ER6A 2Z6AA 2QJRA 3GLVA 1JV2B 2GK7A 3HCRA 3V6LA 4G0WA 1DEXA 1BJTA 2JH9A 4KWEA 5IFKA 3WL7A 1UP7A 3DFKA 3KALA 3G5TA 1NUPA 1Q7RA 1T8PA 3X1WA 1DXYA 3HCPA 2CNBA 5JO0A 1Y6FA 4TZTA 2YMPA 5G0UA 3ZG6A 1TJ4A 2J3MA 4KNVA 4UHFA 2C2YA 2FOXA 4LRUA 4UM8B 3AHFA 3SJUA 3WGJA 4D4KA 2XOXA 2ZIAA 3WQRA 4HFMA 3H4VA 4IQ8A 1U7XA 2WA2A 4J16C 2ZYDA 4YRDA 1T0PA 3T3DA 1GUYA 3HKCB 1XRQA 3ORHA 3HDGA 2P75A 3C6BA 3PGVA 5F4ZA 4JWKA 1VMEA 3UB3A 2DUNA 1Y5RA 2IYVA 1D2GA 1H66A 1K7YA 1XZAA 1PVDA 1SQGA 1X7HA 1Y80A 1XPJA 3A1TA 4MLDA 5ECGC 1KDVA 2I2CA 2PH1A 1AMOA 2BBSA 3H6KA 1U6JA 4UE6A 4FW8A 2QL7A 4MDHA 1P4SA 4FZ3A 1GUFA 1XXHA 2BCEA 3WYDA 1D7AA 4I5EA 5JSFA 1OJLA 2W22A 3AHHA 3S2YA 4P9NA 3VHQA 3HJUA 4ZHSA 1TYCA 4B4UA 3U37A 2FZLA 2KLHA 2DERA 1XDGA 1XC7A 2OCIA 2B2NA 3GCZA 2XA9A 2QHXA 3IUPA 3TD9A 1Y8QA 3O1JC 3U3XA 2GA9A 1XJ0A 3ZZNA 1U0GA 5FUVA 2WSSA 4BYGA 5EPEA 3WYFA 1VB5A 3H8SA 3K5IA 2FK8A 3H5TA 3TQIA 1MJGA 1NW8A 2BFNA 5GPBA 4PX2A 4TTPA 4CM8B 4CF7A 4KCGA 1XZGA 3KKKA 1QCCA 1VKOA 3PVSA 4CR8A 1T2UA 1O0BA 3EDOA 1A97A 1MEEA 2ZTSA 1C7IA 3ZCRA 3PJRA 2PO7A 1T10A 1QUEA 3QU9A 2ZYRA 3LT0A 4GX5A 1ZK3A 4IWNA 3RUCA 4UZEA 2WAMA 4Q3CA 4HGYA 4R7GA 3ZHRA 1IBKB 2Q1UA 1PDWA 1PL6A 2DRIA 3ZGYA 2Z43A 5EHZA 2JGEA 3VDNB 1SQ0A 1CEYA 3I9V1 4YMIA 3NWPA 1MB4A 2J0VA 4L76A 5AOAA 5F52A 3ZDBA 2TSYB 1COZA 2F8TA 1SVWA 2SHKA 3PWKA 4JJ8A 5B4TA 3JAMA 1T5DX 4XQCA 2W5UA 1TL7C 3B1VA 1QFYA 3AEYA 1NRWA 4RZIA 4LDNA 1HYEA 4WOPA 1GZHB 2JAQA 3G8BA 5ALLA 5HTOA 5U9CA 4CLOA 3UJNA 2A9OA 2O2GA 5F1YA 4JL8A 1XTRA 3W06A 2UU9B 4E33A 2EZ4A 3AOEA 4WCFB 1HE2A 3PE3A 2XGSA 3K3PA 2QW0X 2WJAA 2XSZA 5FOVA 2FQQA 2EP7A 3MWGA 4L72A 1PHRA 1TO1E 1XTIA 2G04A 2I2FA 1JG2A 3IP1A 1NULA 1FDUA 2CGEA 4FLEA 2KYRA 3TB6A 5IEBA 3ZDCA 4JL6A 4HGZA 4NESA 2GZ2A 1QDEA 3VKGA 2RB5A 1N2ZA 4LSWA 4C0HA 4MDEA 1N32B 3UQZA 3O8RA 3H5RA 3UFXB 3ZVRA 3JWPA 4LHYA 5EZYF 1U6KA 1TVEA 1ZOOA 2NN3C 1LDBA 4REMA 4XRRA 5GJVC 3ZWAA 2HLNA 4IJUA 4XZ3A 3GLGE 2J32A 2QV0A 3BWXA 4AJNA 5JRZA 2VJPA 4Z9XA 2B98A 3FGZA 4ZYZA 1W93A 5I7EA 3ZUPA 5LOVA 4BATA 4YXWD 1I36A 3KWLA 3QEOA 2X4IA 4FJ2A 2VUHB 4QVKA 3JW8A 1N5DA 1LZKA 1V2HE 3DQZA 3DYVA 5FFMA 2FFAA 1F6BA 5JS6A 1XYYA 1RHMA 3LLCA 2I22A 4DV4B 1I51A 1HOTA 5BWOA 2WUFA 1N7HA 3A11A 1KA9H 3MS7A 1Y4SA 2D1SA 4OMFG 3OP1A 2C03A 2H85A 4ZAYA 3VAZA 1OFVA 1NN5A 2QVGA 1QC5B 1KI2A 1VLJA 2Z4RA 4HWKA 4KAAA 4M0PA 4PLYA 4WA7A 2GPSA 1UMCB 3MCZA 5K3AA 1DIRA 1YIAA 4RJKA 4PN3A 5LMCA 5CDUA 2C82A 1YR2A 3D0QA 4X71A 4CFYA 2G9ZA 1L3BA 3UMRA 1QP7A 1P2TA 4MV4A 4CKEB 2QEQA 4IQFA 1YNOA 3NZEA 5F51A 5TARA 5B12A 1OXKB 3EXIB 4CUKA 2AQ8A 1EUCB 2CNKA 2VDRB 2WNSA 1NTRA 4BN0A 3C4QA 4ZI7F 1H6BA 2R8XA 2HQBA 1UC8A 3CZMA 4HWOA 4Q7LA 5LDHA 1R5JA 1EFPA 3ZQ4A 2JK1A 2REOA 3NW9A 1EM8A 4NK5A 5DNDA 4JVLA 4QQ8A 2OBNA 1WETA 5JRDS 1QOPB 4EOGA 2A84A 2H7CA 3ACCA 2N0SA 4BMZA 2WG1A 1DRWA 1AS3A 2FSFA 2JHFA 2DXIA 4PS0A 4AQDA 3KK0A 3ADKA 1PNVA 5FCDA 2R8OA 2AJTA 4IDEA 1LVUA 5LNK1 3PLAE 4L0QA 5FWYA 1VI5A 2EAUA 2WVJA 3LZ6A 4JR2A 2FF7A 5AH0A 3H8WA 4WZBA 2EFDB 5C4GB 1IN8A 1O8BA 3OI7A 3V4LA 3V48A 4ZCTA 5ADHA 4QGSA 2HRCA 5AIBA 2R7LA 4AAYA 1LPOA 1AKYA 3RS4A 4CMJA 1UFQA 2JFYA 2OILA 3KQTA 3VR5D 4J2HA 2O8DA 2ATEA 3MMSA 7GPBA 4CYMA 1WA5A 3H4MA 4XD7D 4YMHA 5JAUA 1JEDA 5KYWB 1NF9A 4YUYA 1NL3A 3RFTA 2E48A 1GYPA 1N0UA 4W8OA 4LW8A 1P81A 4WACA 3CX7A 4DZRA 1UUFA 2OPHA 5BRJA 2VDWA 3KC2A 1JILA 3B3GA 2YFQA 4PHFA 4GX2A 3PEVA 3RABA 3ICVA 3UUFA 4EBFA 2ZIEA 1MOSA 1XU7A 2K2WA 2PUWA 3QVGA 5DMHA 2ZREA 5DULA 1IHXA 4LCBA 2B3DA 1I1HA 1DPFA 1R6UA 1X15A 2VSYA 1SUDA 4IICA 5IJZA 5EVCA 5MN4A 4ZVUA 3UKOA 1BIFA 3IULA 3TR0A 4LVNA 3N9IA 6REQB 1CUZA 4FCVA 5C8ZA 2CVQA 4R1TA 2GAOA 3TLAA 4U2BA 2UYQA 4ASUD 5JV5A 3VNQA 1TCCA 3KBBA 4OV6B 1GUZA 3S3TA 3T3MB 4O02B 4R1OA 2J9ZB 2PMFA 4ZO9A 3RWOA 5AOCA 1P2SA 2FX3A 2J5XA 1QX4A 3EZXA 3HDJA 5J9FA 3KPJA 5TQVA 4FFBB 1JIXA 3RHFA 4KV7A 4EJFA 3KP1A 2OQVA 4CUZA 4ITRC 1IOZA 3C3JA 3LG2A 4GPTA 3GJTA 4TLBA 4N6NA 4ESEA 5IF3A 2GSWA 2QQ5A 4BNVA 1NAHA 3OPQA 2J31A 1BXZA 1J5PA 3LZCA 1RJ9B 2CKDA 1Y7IA 2GHIA 3X2EA 3ETHA 1WBDA 1Y1KE 4H1TA 5B58C 4I0WB 5AVVA 5FI3A 4CG3A 1E62A 4JEHA 3CZ5A 1LX7A 2CJPA 4C3UA 4ENVA 4DRYA 1TRHA 1LDGA 2GD0A 3MD9A 3SGLA 4PANA 1AUVA 3BTUA 3TR6A 4EGCB 5ILQA 1ZJ6A 1DX4A 1H2EA 4KG7A 1D4OA 4F96A 1E2DA 2HIHA 4UCWA 3KLMX 2AOWA 3TKAA 2K4MA 3ER8A 5KC9A 3TEJA 4HMPA 3NBKA 3JQFC 1MO6A 3FG9A 5H5JA 4FGUA 1VBKA 4BNGA 1SUCA 1XL1A 4TRJA 1WM1A 2UZ1B 1YDEA 4KODA 2JH3A 4TV8A 4EYKA 4RV4A 3ZJUA 3DV0B 4BTLA 3WAGA 4DV3B 2PKQP 1R18A 2X5XA 3R5JA 4IQ4A 3UUGA 3B6KA 5T64A 1J8DA 3LXMA 5EYPB 5HCUA 5J5VA