3WA7A

Crystal structure of selenomethionine-labeled tannase from lactobacillus plantarum in the orthorhombic crystal
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
467
structure length
467
Chain Sequence
RLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDTNRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLQLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords tannase
publication title Crystallographic and mutational analyses of tannase from Lactobacillus plantarum.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 154
structure length 467
sequence length 467
ec nomenclature ec 3.1.1.20: Tannase.
pdb deposition date 2013-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wa7A00
5KWIA 1J07A 1DX4A 3FYUB 4G4IA 1VA4A 5LP1A 3AZPA 3D7RA 1EH5A 3L1JA 2H7XA 1ZD5A 3W9BA 3ZWQA 5C8ZA 2GYUA 4NVRA 4CI9A 3TGLA 4KRXA 1QIJA 4AZ3A 5HKAA 3R3XA 1FJ2A 5A6VA 4Y2SA 4C88A 5K3CA 2WJ6A 5HF5A 5I8PA 1XRLA 4ROTA 4BC0A 2WQZA 4QEKA 4YPVA 1TRHA 3F8SA 1FFCA 4OYLA 1SCQA 3B5EA 5ALFA 5BOVA 1CUVA 3K2IA 5FPPA 1ZD2P 2YXPX 4YK7A 4GWLA 4Y2TA 4X85A 4WFIA 5CURA 5D7BA 3X3HA 3BL8A 1CUJA 2XT0A 5JZSA 1QLWA 5LZ4A 5AKJA 4UBNA 4Q3KA 1LZLA 3RKSA 4ZXFA 2O7VA 4F5ZA 2HU5A 2XI4A 5HKBA 3G0BA 1TAHA 5EHNA 1H23A 3UUEA 4M0EA 3QMWA 2WILA 3O4IA 3G0CA 5CRIA 3B12A 4HRXA 1UK7A 2C7BA 3MVEA 1F0NA 4X71A 2Z3ZA 2AJ8A 1W4LA 4I3FA 5AO9A 1LPAB 1K63A 2XUHA 2Z3WA 5AI0A 3QBJA 3QPCA 5AOBA 3WA6A 1X70A 1WHTA 3WWOA 4BRSA 2QVBA 4C4YA 5F4ZA 4BDSA 3WL7A 2G5TA 3ZLTA 5I9IA 5LZ8A 5AICA 1C7JA 1DWPA 1I6WA 4BATA 3D3NA 3ZLVA 1XQYA 5T4BA 4G5XA 3IURA 3BE8A 4HXEB 4BE4A 2PSFA 1CUEA 2HIHA 4X97A 1EHYA 4GW3A 4Y2QA 1ZI6A 4BVJA 4CCYA 3TJMA 4Q3LA 2QUAA 4Y2RA 5BWBA 3FOBA 3DCNA 3H2HA 5AK6A 4CCWA 4QWWA 1XLWA 1QIDA 5DJ5A 3FWHA 3K9BA 4X00A 4C87A 4AN0A 1EDEA 2BGRA 2X5XA 3O9MA 2GBIA 3DL4A 4RE5A 2WHPB 3LLCA 2ZJ6A 2RONA 3IUNA 2JIDA 4MEAA 4X6XA 1C4XA 5ALOA 2OCKA 3DKKA 2ZSIA 1A8SA 1EVEA 3P2MA 1AURA 1W75A 1XRRA 2VJBA 1XZGA 3WK7A 2OCIA 2ZYIA 1ACJA 3D2CA 3WQHA 3M82A 4ARBA 2DQYA 1LLFA 3JYHA 5FP0A 2XDWA 2WFMA 1CUAA 5DTIA 1UKCA 5K3FB 3FCXA 3FSGD 4KRYA 4KE6A 4AO7A 3CN9A 1XZFA 4GHWA 3ILSA 3SC2A 3IUMA 1JU4A 4TVKA 4AO6A 5A7GA 5CT9A 2CZQA 3H2IA 4ITVA 3C5WP 3QZUA 1RWQA 2XQFA 3KSRA 2H9YA 5DYWA 3UUFA 3STUA 1JFRA 1BE0A 2Z8ZA 3D59A 4DMFA 4KE9A 2XB6A 2ROQA 4CFSA 1IZ8A 4DNPA 4OUKX 1XZAA 5FXMA 1DQZA 3WI7A 1VJ5A 5CH8A 1DWOA 4DNQA 5AJHA 3G02A 2QMQA 1VKHA 1CV2A 1R88A 4YASA 5HFNA 3DS8A 1RYYA 4EB0A 4UHDA 2B9VA 1Q0ZA 5AKYA 4G1FA 1O6GA 1D07A 2HA0A 5JATA 2XQKA 4H7JA 4V2IA 1Y7HA 1LPSA 3STVA 1NU6A 1CVLA 2HA4A 3H2GA 2WIFA 4FDMA 4EY8A 2WUFA 5CXXA 5T4HA 2XLBA 1AUOA 3C6ZA 1XZHA 3LS2A 4EZIA 1T4MA 3VKFA 5LZ2A 3G0GA 3O9VA 5DNUA 1U65A 2ZYRA 2B4KA 3C87A 2VEOA 2WU3A 4OB8A 4IO0A 1QTIA 1BROA 4DLNA 2WIGA 3I1IA 1CQZA 1LZKA 2EEPA 5HZGA 1XFDA 3G9ZA 4CIBA 1L7QA 1EDBA 2RAUA 1CUFA 3RM3A 5HFAA 1P0QA 1YB7A 4BAGA 1QIHA 3HSSA 4LIPD 4DIUA 1K6EA 2C5GA 4FHZA 1XRQA 4WJLA 1ZI9A 3MUNA 4KR0A 4AN1A 1G42A 3M81A 2EDAA 3M3DA 3NOXA 5HF6A 2EDCA 3FAKA 3H04A 5AIAA 4LKOA 1GKLA 5C8VA 5FKJA 5K3EA 3RK4A 3C70A 1GPKA 3C6YA 4BCDA 4MYDA 3EIOA 5CT4A 4ZV7A 1E8NA 4FKBA 1WB6A 4WFKA 1TIBA 2XMBA 4EY4A 5ALUA 5E2IA 4EHBA 1QZ3A 5AKEA 1JJBA 2VT6A 4DGQA 4H18A 3AIOA 2ZJ7A 3FYUC 1UK6A 5KBYA 3QPDA 4LYEA 3VJKA 1PJAA 2WFLA 3BIXA 5JZ9A 5ALKA 2Y2UA 1JI3A 2ACKA 2JGMA 3H1BA 2XUKA 3HABA 4GI1A 3VVLA 1AX9A 3QMMA 4UBMA 4IH9A 3I2HA 1YSCA 5HK8A 3ESDA 5ALYA 5JASA 2XUOA 4F21A 1W76A 1QTRA 1N8SA 1Y37A 3PDCA 4HS9A 3QVMA 1QIEA 4J0GA 5AM5A 1XQWA 4G8DA 3WKCA 1GT6A 3K6KA 4Q3OA 4OU5A 2HDWA 3T52A 2VT7A 4RE6A 2WG0A 4BTLA 4UHFA 3E4DA 4B85A 1EXWA 4PSCA 1XZDA 3BDVA 1SC9A 4EBBA 4MJ3A 1YB6A 3NGMA 5FRDA 4NMWA 4H0CA 2ECFA 1A88A 1EDDA 3WKDA 4NZZA 4U2BA 2QT9A 1CUIA 4FNGA 2RHTA 2J4FA 4W1SA 1CUXA 2GBGA 3BIWA 2O2IA 3UMJA 4P92A 1HBJA 4CG3A 4CIAA 2Y1KA 1BRTA 1MTZA 3OPMA 5ALWA 5ISMA 3FLBA 5AM1A 1ISPA 2AJLI 3VDXA 5DYTA 1CIJA 5JYCA 3R3ZA 3F97A 3R3VA 3SK0A 3HJUA 5LZ9A 4MYSA 1MX1A 2WIDA 3DNMA 4MEBA 4DSZA 5SYMA 1PV1A 2AJBA 1Y7IA 1EK2A 1OXMA 4FMPA 4B0OA 4RGYA 3H19A 5A7FA 4W63A 1QO9A 4X3CA 4UBKA 3DYIA 5IVDA 3A2NA 1RP1A 4H7FA 3W04A 3WMRA 3G9UA 3GZJA 1SCKA 4HAIA 5C8XA 1KU0A 1TK3A 1LGYA 1HKHA 1UKBA 2AXEA 3I6ZA 1J06A 2DHDA 2RHWA 4C6HA 3YASA 3I2JA 1U2EA 1A7UA 2WG1A 1FFEA 3ZI7A 4QWMA 4IH1A 4BAUA 5C7YA 2WIKA 3WK6A 5BV7A 1SOMA 3HXKA 4UHCA 1X2EA 1CRLA 1JMKC 5JARA 3HC7A 1KEZA 2NW6A 1QFMA 1XRNA 2QRUA 3I2FA 1MJ5A 2J3QA 1R4ZA 5LIPA 5ALTA 1QIKA 5ALIA 4OPMA 1LBSA 4DM7A 3WYDA 1E8MA 4EY5A 1CLEA 3A6ZA 1AKNA 1QE3A 4B9AA 2HRQA 3AJAA 3C8HA 2OLEA 5HQ3A 5EGNA 4P08A 3IDAA 4TPKA 2C4HA 4DYHA 3PFBA 5LYYA 2GYVA 1BEEA 5AHXA 4B80A 2XQIA 4KYVA 1K5PA 3I2IA 3BF7A 2XUFA 2XQGA 1CUGA 1GKKA 1F8UA 5D3ZA 3OURA 3BJMA 3D4LA 3KD2A 1CUBA 4GLBA 3ESAA 3BXPA 2WM2A 1CUSA 1ETHA 4EA6A 5ALLA 3LP5A 3BF8A 3BWXA 4M0FA 5ALRA 3WKEA 2DQZA 4Y2YA 5AKHA 1L7RA 5K3AA 2WUDA 3MGAA 3PI6A 3KWJA 1SCIA 4G8BA 4UFNA 2CBGA 4FLFA 1P0MA 1LPBB 1XQVA 4K6GA 4J7AA 4K5QA 1XZJA 5CBKA 2XUIA 3H18A 4MWTA 3WJ2A 3WL6A 1LPPA 2PSEA 5D3KA 1TCBA 4QLOA 4A23A 1GQSA 4XIIA 5E4JA 2H7YA 4JYMA 3QITA 4X6UA 1EK1A 3STYA 2CUTA 5H3HA 4B83A 4WFJA 1ZGCA 3AINA 2HHAA 1ZOIA 3FVRA 2PSHA 1K4YA 2I3ZA 5ALXA 3W06A 1XRMA 1UKAA 1JKMA 1UOQA 4UHEA 2DSNA 3WWDA 4B9EA 2HA2A 2WJ3A 3WZMA 2CJPA 2ZVDA 1G5FA 2B61A 3O0DA 2QTBA 2PBLA 3RLIA 1WHSA 5CT6A 3L1IA 1XZMA 4QNNA 4B82A 2IIVA 3I28A 2VSQA 3VVMA 4A16A 4JNCA 4RPCA 4JEIA 2WFZA 4JYPA 5ESRA 3SWWA 1ZIYA 3F98A 4J0IA 3AIKA 5IVKA 2QKYA 5AK5A 4PF1A 5ALGA 3U0VA 2K2QB 1GQRA 3R3UA 4DMCA 4UBOA 1OILA 2HA3A 3QM1A 5ALEA 1U8EA 5ALDA 2VJAA 4L3WA 3H2KA 5CT5A 4F60A 1TCCA 3W05A 4HXFB 1UOPA 1EB9A 4TGLA 5K3BA 2WU4A 2AJDA 4FBLA 5JAUA 4W9RA 3F67A 2XUAA 4KACA 5AOAA 2ES4A 2E3JA 1FFAA 1E89A 4XVCA 2UZ0A 4P9NA 1UOOA 2W6CX 3FCYA 4C89A 4ZI5A 2QJWA 3JW8A 1P0IA 3G0IA 2X8BA 2O2GA 4K2AA 5JD6A 1JU3A 3WWPA 4QDOA 4XWGA 1HLGA 1ZD4A 2JEYA 1AQLA 1R9NA 2I3DA 1ZI8A 2JBWA 4C01A 3DOIA 1NX9A 3ESBA 1MAHA 3WK4A 2OPHA 2OGZA 4JH0A 2XUGA 2ZJFA 3G7NA 1YAHA 4EY7A 1E3QA 3HRHA 4W1RA 2XMRA 3DL7A 3V1NA 3VJMA 1AMNA 2D5LA 5DTJA 2VQ6A 3EQ8A 4B81A 4ZRDA 5DWDA 2ONCA 1QO7A 3V1KA 2D0DA 2PU5A 3DLTA 4UBJA 4ZREA 5T4FA 1N5MA 5AIBA 3WA7A 1GPLA 1G4HA 2FJ0A 3O4JA 4FOLA 4CCYB 3PF8A 1WPRA 4CG2A 5JAHA 4UHHA 4BZZA 1QGED 1W6RA 4WY8A 2VAVA 5AM0A 5ALVA 1H22A 1CUHA 3E3AA 2VATA 4INZA 3C43A 1DX6A 3EBLA 2DCMA 1DU4A 1WB5A 2WUGA 4C4XA 1ZICA 5JALA 5AKIA 3PUHA 2X76A 2YYSA 1W52X 4FWBA 2WTNA 4HTAA 3E1GA 4AMZA 1DINA 2PSDA 1MN6A 1XQXA 3F9CA 2G5PA 4Y2PA 2WHQA 1LPMA 3S2ZA 3OM8A 1NU8A 2XQJA 3OG9A 5LKAA 2XMDA 3ANTA 3HZOA 3BJRA 4PO3X 1WPXA 2FX5A 2BCEA 3EQ9A 2WKWA 1DT3A 6YASA 4BCCA 4X7BA 5AH0A 4PW0A 1LPNA 2BJHA 4B0PA 4KAAA 2P8SA 1MX5A 5CMLA 3O95A 3EQ7A 3U1TA 1BU8A 3JWEA 3I2KA 1Z68A 4Y2XA 1P0PA 4AXBA 4Y7DA 1CPYA 1VZ2A 4N8DA 2HRRA 1H2YA 3C8DA 3PUIA 1AC5A 1EX9A 3STTA 2HU8A 5CTAA 3HLKA 2OAEA 3OOSA 3H2JA 3HYSA 5FLKA 4W1PA 1R3DA 2CMFA 2VA9A 1QONA 3FYUA 3PICA 1YR2A 7YASA 1ZJ5A 2GZRA 4ZGBA 2PVSA 3VISA 1DWQA 1UK8A 3IULA 4QA9A 1UZAA 2VAXA 1IVYA 1THTA 4X6YA 5CW2A 5SYNA 2PM8A 4N5HX 1UT6A 2DHEA 3WYNA 1JMYA 1QIMA 1TQHA 3F96A 5JANA 4H77A 4KEAA 4H7KA 1H2ZA 4U2GA 3QH4A 4UUQA 1CUZA 3AILA 4S0XA 4BCBA 4UFPA 4GECA 2BAGA 5ALJA 2JGKA 2BGNA 3PFCA 1SFRA 5CH3A 1MPXA 1BEZA 2XLCA 2C58A 5D6OA 4J0JA 1BN7A 3GROA 1BS9A 4KE8A 1WM1A 4ZV9A 4GEGA 3FNBA 1EI9A 4DSAA 1R50A 4DTCA 1PFQA 4NS4A 3V1LA 4L0CA 4FLEA 5YASA 2R11A 3V1MA 3SX4A 3NUZA 2VJDA 4BZWA 4B7ZA 5KWJA 2PU7A 1ODSA 4G8CA 4BB0A 1MO2A 3H17A 2RGUA 1UXOA 1QJ4A 2GZSA 5E4YA 3LIIA 3DEAA 3IVMA 2QJRA 2ACEA 3LCRA 2CB9A 2XUPA 5LZ7A 2BUCA 4E14A 1MAAA 2XMQA 3GA7A 4AMYA 1Q0RA 2HADA 5ALQA 3H1AA 3IUJA 3DQZA 5EFZA 3V9AA 1J1IA 1THGA 3WWEA 4G9GA 5AKLA 4X91A 2XMCA 2R8BA 3ZPXA 5A71A 1VXOA 4UHBA 2DFPA 4E46A 5CT8A 5EIHA 2G63A 4MWSA 3WZLA 3TEJA 1KU6A 1MT3A 5I7UA 1H2WA 2J3DA 3R0VA 3WLAA 1XLUA 1CUUA 2QM0A 2WUEA 3HACA 2DHCA 5AI9A 2G4LA 3D2AA 5T4EA 2WLSA 1QIGA 5AOCA 5AI4A 1DTEA 1U4NA 2WFLB 4J03A 3BDIA 3W2TA 2LIPA 2PSJA 3L1HA 2PPLA 3LIPA 4AQDA 4PSUA 2GBFA 2JEZA 1QFSA 2QUBA 1E5TA 2W22A 3D0KA 2WHPA 5AP9A 4Q05A 5FDFA 2VF2A 5JD4A 5AM3A 3H0CA 4BP8A 1IMJA 5JAPA 3WIOA 1GXSA 1GZ7A 1M33A 4J0DA 5K5EA 2J4CA 1USWA 4M0MA 4E15A 4WCVA 2BKLA 2WSLA 2C0PA 4J0KA 2RI6A 3G9XA 2QXUA 1TKRA 1FSSA 1E66A 1XZLA 5K3FA 5KREA 4X90A 4UFOA 2HA5A 3AFIA 4H7IA 4FTWA 2OGTA 3Q8WA 3FSGA 3WIBA 4QDZA 1H2XA 1EA5A 2OGSA 3ICVA 2FUKA 4XJVA 2OG1A 2XUQA 3A2MA 4BVKA 5ALZA 1J2EA 3VXKA 1O6FA 4N8SA 3M83A 5AI6A 1N5RA 4FLMA 3KDAA 1Q83A 1UFOA 4KAJA 4PV7A 5LKRA 1QOZA 5BWCA 1VXRA 2PUHA 4G4JA 4AZ0A 3I2GA 3D2BA 2JGEA 4UPDA 1YA4A 2Q0XA 4QDTA 1VZ3A 1C7IA 1ACLA 4QZVA 1B6GA 3PF9A 4DMHA 1IUNA 4ETWA 1ORVA 2V97A 4RNCA 2Z5GA 4OB7A 4OU4A 1XZIA 4DNFA 1MNQA 3STWA 3WK5A 4Z49A 1ZD3A 4G9EA 3DDUA 4HVTA 2V96A 4X92A 1A8UA 4WDRA 2QOEA 5A2GA 5ALNA 1VA5A 3FLAA 1YASA 2PKYX 4U2CA 3DOHA 3GFFA 1CEXA 2Y6UA 5JZBA 4I19A 1YS1X 3FBWA 1BCSA 5AK4A 2JGJA 5EHXA 4QDUA 1HPLA 3N0TA 5LZ5A 2HL6A 5DNVA 2IITA 1UK9A 2PUJA 1FFBA 2OCLA 2I78A 3IIIA 1ODTC 5AM4A 2QR5A 4X94A 1S8OA 5IVIA 5AKGA 4BBZA 4HXGA 5JAOA 1ZGBA 4GBGA 3ANSA 4FBMA 1G66A 3R3WA 2OCGA 1CUYA 5HF8A 1VOTA 1Q84A 2HA6A 4HRYA 5AI5A 5EIAA 5HQ3B 1EB8A 4X93A 4Y9SA 1QIIA 2HU7A 1IUOA 4UBLA 4LHEA 4Y2VA 1MU0A 3I6YA 5IKXA 3C5VA 1LPOA 1XLVA 4PSDA 3I6MA 2H1IA 4QE3A 3GBSA 3Q0TA 2XE4A 2HFJA 3O4GA 4J3JA 4KJXA 2XUDA 1XZBA 4FFVA 1ZJ4A 2QXTA 5FV4A 1WB4A 3HEAA 3A2LA 2JGIA 4KE7A 1CUCA 5IH7A 3OTQA 5ALSA 3N2ZB 4ZWNA 5FOQA 3ED1A 2C0QA 1CR6A 4B6GA 5JIBA 4BC1A 2OAGA 3MUOA 4GXNA 2BFNA 4H7EA 4JUIA 2Z8XA 5FUMA 4AX4A 4E11A 3ZV7A 4LXHA 2QS9A 4OB6A 4FFWA 4G4GA 1BCRA 1UWCA 1B41A 4BVLA 1QIFA 5LLSA 1MX9A 2GBCA 2XMSA 3FYTA 3QMVA 4WY5A 3V48A 5HF9A 3VJLA 3R3YA 2BUAA 4EUSA 5E4TA 4Q34A 2PX6A 3A70A 1ZIXA 5J3JA 1XRPA 1EINA 4OSEA 3DKRA 2YASA 2B20A 3KXPA 4OD0A 2V9ZA 3S8YA 4LXIA 3B3QA 4U2DA 5DNWA 1JT2A 2JGLA 4MQMA 2HA7A 5DYYA 2WHRA 1XKTA 4H7DA 3T4UA 1AGYA 1FFDA 1CQWA 3CCCA 1IUPA 4MQLA 4U2FA 1ODCA 5CH5A 3EF3A 3DJYA 4N5IX 3PE6A 1HDEA 3C6XA 2V98A 4BRZA 1CUWA 1K8QA 4EY6A 4U2EA 3C6BA 2VJCA 2ZSHA 3CXUA 5HK9A 3R40A 3HI4A 2CKMA 1W1IA 2H7CA 2WIJA 3C45A 5HCUA 5CXUA 1ORWA 1L7AA 2FJPA 4B84A 1A8QA 5FPQA 1HL7A 4W1QA 3QYJA 2JGFA 2WJ4A 4HZGA 4DMKA 3G0DA 4P93A 5IVHA 5EHZA 3CN7A 1IZ7A 3O4HA 1BN6A 4J0CA 5A62A 3ICWA 1F0PA 3WWCA 1XKLA 1XZCA 3R41A 3ZLUA 2XUJA 2OQIA 4IHAA 2GYWA 3G9TA 5JADA 1OCEA 3WK8A 4BAZA 5EIEA 4DNOA 2OXEA 4UBIA 3RARA 4FNMA 3I1YA 3ESCA 3STXA 3WKBA 3WK9A 3QPAA 3AZOA 2DR0A 1MNAA 3AUKA 4QLAA 4N8EA 5C81A 4BTVA 5AKXA 4XX1A 4O08A 5DLPA 3WL8A 4BYMA 1R1DA 1JJFA 5EI5A 4MXDA 3WKAA 3AIMA 4Y2JA 3IA2A 5JD5A 4OYYA 2AJCA 3WJ1A 4F0JA 1DQYA 5ALPA 1F6WA 1T2NA 4OCZA 3NWOA 4X95A 2YH2A 4LYDA 1R9MA 2JF0A 4KAFA 3WL5A 1LBTA 4BDTA 2QZPA 4LXGA 2Y2VA 5A7HA 1JJIA 1VLQA 4YX9A 3CCBA 4H7HA 3GELA 1EVQA 2HM7A 4J0HA 4H35A 4QDXA 3D5EA 4IQ4A 4Y2UA 4K6KA 2RIPA 2PL5A 3GUUA 1CUDA 2VTVA 2C5FA 2HFKA 1X2BA 5AM2A 4PQEA 2ZYSA 3IB3A 4BP9A 5AI8A 3TRDA 2IX9A 3W9UA 2O7RA 3DYVA 4GDMA 1XROA 3E0XA 1N1MA 5ALHA 2ORYA 3OC0A 4AB1A 3DD5A 5EHQA 4C4ZA 4ARAA 1XZEA 2OQVA 4L9AA 1WCYA 3FLEA 1HQDA 4CG1A 1TCAA 3KOOA 1AZWA 3G8YA 3AZQA 4PNZA 4AO8A 4WDQA 5AK3A 1E8DA 1VE6A 2CEKA 3IBTA 1WOMA 4D9JA 2O2HA 1GPNA 1XZKA 2XMGA 2Y6VA 2WTMA 1YAJA 3IUQA 3FVTA 1LNSA 2I03A 4I4CA 2ZYHA 4IH4A 1YA8A 4L72A 1DT5A 2XMZA 1VE7A 5K3DA 4A5SA 5AKZA 5ALMA 4Q82A 4Q1VA 1GGVA 1YCDA 4K6HA 4BE9A 5AKKA 1CFJA 3KWFA 2BUBA 1YS2X 2WG2A
chains in the Genus database with same CATH superfamily
3JVDA 5KWIA 2JFFA 3K0CC 5IM4F 5BWLA 5IK2A 3FYUB 1W4AA 1AHIA 2AFIB 2FK7A 3QVOA 3AZPA 3FMVA 4N47A 3B3JA 3TQRA 4DWOA 3D7RA 1R0RE 2BR5A 2C9OA 5HKLA 2P9BA 2YYAA 3VNQA 5EE9A 3AVVA 3B13B 4HQOA 1K4KA 1UPTA 1E6CA 1QIJA 2QN8A 4YBRA 5BWOA 3UJBA 1GNLA 4OKNA 4ZVNA 3R3XA 1FJ2A 2FGKA 3COZA 3SYNA 2Z2KA 1HZZA 1PR2A 2RHLA 3KDSE 3ZH9B 3GT4A 4YAEA 1Z6TA 1INLA 3NORA 3SX0A 1X19A 3EEQA 2YWHA 2NVOA 3KAQA 4R01A 3BBPA 1OBFO 1UBTS 2J9ZB 2NAFA 1U0SY 2WJ6A 2QTRA 5G0WA 5HF5A 1FRVA 2HOQA 3F9RA 1FTSA 4TYYA 3A3OA 3O2JA 3SEAA 5B3JC 2A0FA 1OFIA 3BIFA 1K5GA 4JJIA 4MS3A 2EFCB 3V8VA 2VWQA 2Z43A 3R0XA 4QEKA 2VDLB 4ACAA 2G07A 4ZV4A 4NJMA 3S6JA 3MJCA 1FFCA 2F8LA 1YZFA 2I2WA 2Y1EA 4MSUA 3ZQKA 3T3DA 5ALFA 2JATA 4BPBA 1AO0A 1NN5A 3PDHA 2OP1A 2XCIA 4BNNA 1T2CA 1E1LA 1I80A 4I9UA 3VR0A 2IHKA 1WF6A 4B7XA 2J6CA 2J3MA 3B6MA 4M2LA 4GWLA 4Y2TA 4WSOA 4WFIA 2D7CA 4LVNA 1X92A 5LR6A 3QU9A 5EUCA 3LY8A 5CURA 2G9UA 1EP3B 4RZHA 1SK9A 2FH5B 3RRFA 1EUYA 4WLOA 8AT1A 2PUVA 3X3HA 5F23A 3SKYA 1CUJA 3KVYA 1K3FA 4XQEA 1N92A 4D9GA 2C7QA 2P2YA 2D2EA 5LZ4A 3ETEA 1VP9A 3IHTA 2DQKA 4G5QA 5TPWA 3HCRA 1P2BA 1XU7A 2Q2WA 2XNDD 1NM5A 1XTTA 5T3YA 1LRKA 3CEAA 4F4CA 3PXDA 3ADBA 5T5QA 3PNSA 2O7VA 5BN5A 4M7RA 1WBBA 1YHNA 2YNMA 3T7SA 2I2CA 3COSA 3UA3A 3EUEA 1R8SA 1BA2A 3KHUA 1U0GA 1EVYA 1FMFA 2EQ5A 5A1JA 3TFOA 3DOOA 3E5HA 3P0EA 3BXGA 4YLYA 5L3QB 1D3AA 3ZI0A 5HKBA 3HCEA 1KO8A 3SBXA 4WVLA 1BZYA 4R8MA 1TAHA 3TKLA 4R1LA 3JS5A 3U26A 4EJSB 4TS3A 2FOIA 5H4GA 2YICA 4US0R 1TUBA 3NAGA 1FDUA 3MFYA 1U6IA 4MI6A 4D98A 5KTNA 4MDHA 3T6KA 1D0SA 1Q0UA 1KDOA 2OPBA 2PGJA 4HH4A 3WV5A 1IAVA 1G9XA 4DVGA 2IYVA 4TTVA 2CNOA 1OBVA 2AN9A 1PS8A 5J23A 3SS9X 1V16B 3ILYA 1USIA 3G7SA 1R15A 4A1FA 5J4HA 3VZQA 1WKVA 2XPCA 4CPDA 5C3MA 4KX3A 1AVTA 3T1TA 1U1GA 3AONB 2FX2A 2NQTA 1EZ4A 3ZS8A 3X1JA 3L7KA 2BF7A 1YJCA 4DL9A 2Z3WA 4H15A 1WX1A 2PX0A 4NQRA 1AF4A 1D1QA 1U3GA 1ZXBA 2LPMA 1O94C 5I5GA 1U99A 4KODA 1HYQA 5AOBA 3WA6A 1JLKA 1WHTA 2EFGA 3K4PA 3OQIB 4IF6A 3OZSA 3MJVA 2QVBA 4DLUA 4ISBA 4OP2A 4JXKA 1P75A 4C4YA 3DMGA 4MOWA 2TMDA 3WHPA 4AUKA 4BBPA 3EZ9A 1W49A 4OOFA 4W82A 2QV0A 3QFFA 2G5TA 1S2GA 3U3JA 4U9UA 1W88A 4FFSA 2AXQA 3JWGA 2PKQP 1JDBB 3A1NA 5IC6A 3ZLTA 1FC0A 4R8SA 1MFPA 3DUFA 5AICA 5L51A 3FYSA 4GP6A 1TFUA 3B1YA 1KQGA 3JQ9A 2JG3A 4RVHA 2G08A 4TTIA 1T5LA 3RSCA 3SHOA 3ADKA 3EXEA 3Q7SA 3ZWOA 2IDMA 2A5FA 3AXTA 4BATA 5T4BA 1PJCA 5FWNA 1WR8A 4G5XA 3BE8A 3NKVA 4YCSA 1VPVA 1KI9A 5ICGA 3TG8A 1YUNA 4ZARA 5IF3A 1UBHS 1AQIA 2HIHA 4G5OA 4MRSA 1DQRA 1Q1QA 1U6JA 2ZWIA 4J0QA 3C24A 4O59O 4YALA 3REGA 1FXWF 1W85B 1IY1A 3X1XA 1ZI6A 3FROA 1VL2A 4CIDA 3ZXIA 4IW3B 1D4FA 1E69A 3MAGA 1J4AA 3AV3A 1IUKA 1DKUA 3TJMA 5KINB 2DFDA 5LLTA 2G0TA 2QUAA 2I29A 1GTMA 3CS3A 1TPZA 3QEBZ 5J47A 1WOYA 4DLPA 4JC8A 1U9JA 3DE5X 3WL3A 2BSAA 4C4OA 4QJBA 4W7IA 4LF4B 4QWWA 2HNAA 3QKTA 5AJZA 5K03A 3PQCA 2X0KA 1UBEA 3BJIC 4B34A 4GEKA 1R5OA 2VSFA 2X19A 3TDMA 4KQMA 2C1XA 4MGIR 3NB0A 1T5SA 2Q4BA 5EIBC 4AN0A 5JSUA 1E2MA 2AG6A 4K87A 1VIAA 2X5XA 4TYPA 1PT6A 4LZAA 2GBIA 3BN3A 3UMGA 2ZS8A 2A35A 3LHFA 3L0SA 3O92A 2PJDA 2C57A 3JCZA 2RONA 3MRXA 3IUNA 4RZQA 3DAOA 3K70D 1BKYA 3EN0A 4M7PA 3GLRA 5E3IA 5IUJC 1C4XA 2OCKA 1NI4A 2B5WA 3SF8B 1QHGA 3JRNA 4QDJA 3QNUA 1PFKA 2OOKA 4FE7A 1Z4IA 4MW6A 5JSFA 1EVEA 1U3TA 2A9PA 2X3FA 1QP7A 1NWCA 1XRRA 1KI6A 4M55A 3VPDA 1L5OA 2IIPA 3M1AA 3MTGA 4NEGA 1IBLB 3R9XA 1I3KA 1IRIA 5DO9A 1SCBA 1JPJA 3VUFA 2GM4A 4IVQA 1H9CA 3ASZA 4ARBA 1FUYB 1TJ4A 5LMUB 2NYRA 3LQYA 4M8KA 4Z53A 1C3OA 4JITA 4QL3A 2A5GA 3QBEA 4XFJA 5H68A 3GN2A 4MHOA 2H07A 4IDNA 1LC3A 2XX3A 2ZBDA 2XQVA 2H51A 4X62B 2B5VA 3ONEA 2GERA 1J8DA 4QNRA 2VNKA 4Y9RA 5K3FB 4R6WA 2AJTA 1M2HA 2X6QA 4IIFA 3PE4A 4FHDA 1UPXA 1X7ZB 4MVJP 3DBOB 4WACA 5CJPA 3IDOA 2EGGA 3DMRA 2PBFA 3CLTD 3FSGD 3KG2A 3KTFA 4KE6A 5ECYA 4OKIA 3CN9A 3CPEA 5ETJA 3F5QA 2PWBA 2BE7A 1CSEE 5A3VA 3HL4A 5B7NA 4ABTA 3OCVA 2NU7B 7REQA 5EZ5A 3I9JA 2R00C 1U3DA 2AGVA 4L0QA 3TNFA 3AWDA 1U2RA 1ISFA 2JB9A 3QLEA 1GSAA 4QUGA 4B3DA 3LNCA 1KZ1A 2SECE 4RIEA 5DM1A 4LFCB 3TEMA 1JG6A 5I01A 2BP7A 4L9RA 4TVKA 4IKOA 4B3CA 4Z4QA 1XD8A 5CT9A 3WDSA 4W5TA 1SZPA 2CZQA 1LCIA 1RPJA 1N6NA 3RUPA 5CYPA 3JZIA 4Q24A 3TNJA 3C3XA 5EWMB 3WGTA 4J0EA 1EYZA 1FTWA 4HNHA 2PBZA 5TPZA 4DQLA 5K8CA 4RTNA 4DJTA 3ND6A 2FJUA 1TA4A 1URPA 2W4MA 4FXPA 4MLCA 3R6WA 3MMSA 2VQ3A 3DLIA 4I0WB 4LMBA 5CW1A 1LBIA 3CWZA 2O9JA 5JXJA 3LL7A 2WNIA 3STUA 2QAIA 2EHJA 2BM1A 5T6MA 5J4KA 3ETHA 2Z8ZA 4YGYA 1XA3A 2RGEA 2QZ4A 1RPZA 3BILA 1ZN2A 3D59A 1M75A 3ZU6A 1HT3A 1ZRHA 4ZJPA 3JU3A 2XB6A 2UKDA 2ROQA 3I01A 1IZ8A 3EA4A 3CNQS 1JDPA 2PEZA 1GO2A 1W4ZA 4XIFA 2I54A 2WWTA 5E6UB 2AWOA 3PIDA 4AURA 1PGPA 2O8BA 3ABOB 4EZEA 1UUFA 2F00A 4ITUA 2GUWA 1U2PA 1ZR4A 4CCAA 3W90A 1YVDA 2X9NA 4ZI3A 2CWWA 3HSYA 4TOIA 4V1CB 1WTAA 2DX7A 5E6RA 4QQNA 4UHJA 4CRWB 2RHDA 3A9RA 2HIAA 1KDZA 4UOEA 1T3LA 1B2LA 1VCIA 2MR6A 4YASA 2NU6B 3GZTB 3IYLW 4P4SA 3TRJA 3F90A 2FEKA 5D85A 5EE1A 5FNVA 3GGSA 3SX2A 4CM6A 2X8LA 2H0AA 1D6NA 3A11A 3FCOA 4WBXC 3K71B 3THWA 3DS8A 3HCNA 1ZH2A 2DB3A 3GCZA 1RYYA 1PWEA 3HKCA 4O4HF 5DN9A 2EVWX 1JLLB 1T2DA 2R6FA 3IBCA 3E7XA 3R5TA 5J2TF 3U09A 3LDFA 1JR4A 2JFVA 2JDID 3KKEA 1TCVA 1Q0ZA 3RR2A 2WF9A 2IE8A 2YWJA 3EGCA 2J31A 1H9BA 1TX4B 3LVFO 4PO1A 1UJMA 2Q2OA 3S2FA 2CNLA 5H3CA 3U60B 4OUDB 4H7JA 1UBOS 4C4AA 1LPSA 1U1FA 4YCAA 2V1UA 1Z8HA 2H5LA 1QC5B 2XCUA 1P1RA 4Q16A 2Q6KA 4XM1A 2HA4A 2I34A 3R76A 5D51S 2NSLA 1MXFA 3FDJA 3CG0A 3CNLA 5THQA 3I12A 5FBZA 3TL3A 4WERA 3OCUA 4EQZA 4BV8A 1HG1A 1V5EA 1AUOA 2P3OA 1R12A 1Z08A 1HFEL 4KO4S 4ENSA 2AOTA 3CW2A 4CV0A 3G88A 3L8YA 3RIMA 3QXHA 4P34A 5LXTF 1JQLB 3FBTA 4BFTA 1Q7TA 1U2ZA 1S3IA 3KB2A 4XGNA 5LA6F 4M76B 4LW8A 3D7NA 3VKFA 1WD5A 2IK8A 1ECCA 3T06B 1EE2A 1VIMA 2GFQA 1X1DA 5GV8A 8ABPA 3LUAA 4KQFA 1U65A 2VBFA 4JBLA 2C4UA 4LA4A 1UXJA 4D9CA 2GZDA 2B4KA 4Z1MA 1DKRA 4MVWA 1NMEA 5LBTA 1YCFA 1E18A 2PZBA 2EKLA 1RI4A 2Y93A 4N12A 1L7EA 1GPBA 3HRKA 1YJAA 2NO7A 2XKJE 2LP4Y 3EF0A 2H63A 3RO7A 3WQQA 1WWKA 1CJUC 1HEUA 4CIWA 5AW1A 1TLFA 4KO2S 5LQJA 2AWNA 1LWNA 1RHRA 1GTG1 3HYNA 1ZL0A 4N48A 2E5FA 2VDOB 4Q6WA 5BV0A 2IXDA 3L0DA 4IDPA 2LUOA 5HZGA 1XFDA 3V8NA 4D4KA 1CJTC 4MQUA 1ISSA 1REQB 2YHBA 1U8UA 3CVXA 3G9ZA 2Q5HA 1L7QA 5A03A 3SQDA 1VL0A 3Q15C 4NULA 5D7NA 3V1TC 1OXXK 5JWRA 3L7YA 4QC2A 3L0BA 1ENZA 4QJ3A 2RAUA 1Q92A 3P26A 1PI3A 5DM2A 2JHAA 1YB7A 4P7BA 4DV0B 2BM9A 1ZWLA 2WBLC 3EVNA 3HSSA 2RH8A 3LL4A 1LF0A 3B7GA 4DR5B 4N5NA 3OFSA 5ENVA 3M4ZA 3ASYA 1S2DA 3CKLA 1DEOA 1TUGA 1NURA 3F6EX 3SC4A 1ZI9A 2IYPA 4KR0A 4AJOA 1G42A 3V3KA 1S2MA 2EDAA 2YVKA 2XAAA 4B3SB 3CG4A 1ZA2A 1DKMA 4DG9A 4N7MA 1CNMA 5F4BA 2EDCA 1T5HX 1GKLA 5FOSA 5C8VA 1ANKA 4C0BA 3VPHA 4GL2A 4FGJA 1A9XB 2WWRA 2ZWPA 1VMEA 2GPAA 3C70A 2JLYA 1NQWA 5G4KB 5TSDA 4BCDA 1X1EA 3EIOA 1W5EA 3I5XA 2OBXA 2QZZA 3EG5A 4PLCA 1U28C 4ZV7A 4QPNA 4MV0A 3V5NA 5I3ZA 3K1TA 2Q9UA 2R65A 4DV5B 2GPNA 1EGMB 1LTQA 3P2JA 4WZBA 1R4MA 1R8JA 2AI3A 4WFKA 5EFOA 4AYWA 2CF6A 1IB6A 3T9AA 3BK7A 2Q3DA 1UIMA 4EHBA 1QZ3A 2VTKA 1BKSB 1Q7RA 4YRSA 1JJBA 2VT6A 2WAMA 4X8HA 3S8EA 1NRJB 1M34A 1HSOA 4QXMA 5BQ5A 1IZ0A 2ZJ7A 1T3GA 5KBYA 5L6LB 4YAWA 3OZXA 1XP5A 2G67A 2XTZA 1OMOA 1PJAA 5F5LA 2OT3B 5DRYA 1OC2A 1T8SA 3RB8A 3A1SA 2ASEA 1Q19A 2JEOA 1JI3A 3SC3A 4RSHA 3KCQA 2C88A 1IOVA 4JDUA 1J6UA 5CA0A 1JHMA 1P1FA 1QGOA 2XUKA 1IDN1 3Q8KA 2I6GA 1I4OA 3QMMA 4JLUA 1B15A 4BNTA 2Q6LA 3THSA 5HQTA 2CFRA 3GRPA 2PT7A 4UBMA 4IH9A 4JWTA 3ZBQA 2YQZA 1BYIA 4EHDA 1AGNA 3PDJA 2C03A 3TBFA 1OV6A 1W5BA 3NM4A 4M49A 4Y6PA 2G9VA 3CPJB 4R83A 1SHZA 2D2FA 5D6NA 1F20A 3DPUA 4IS3A 1KAMA 1UP4A 2Q9CA 3ZBTA 1S9DA 3UXEA 3DUWA 1QTRA 1S1MA 3QJYA 2YV3A 3ZEAA 5K8IA 4DR1B 3PDCA 3R8FA 3LX4A 1Z8FA 3AUYA 2F17A 3IV9A 3NTLA 4JZYA 1QIEA 3PT5A 4EDFA 5JYDA 1XMJA 3PVZA 2YW9A 4J0GA 5A4IS 1EVLA 4JOSA 3FIUA 3PD1A 3P9YA 3WGVA 2NG1A 1SZJG 4FMDB 1JHZA 3SLGA 3WP0A 4KXNA 2NUTA 2XYPA 4RF4A 3BRQA 3WAJA 3A6HA 1FSFA 2J3HA 2HDWA 3NEAA 1W5TA 3QPBA 3T52A 4QYSA 4B45A 4D6PA 4DCCA 4ZMRA 5KNCA 5FEMA 3UB3A 1HE8B 2M32A 2VT7A 1SOVA 4NMLA 3MWGA 4BTLA 2CXOA 3IBYA 1ZUIA 4D5EA 5C7LO 1I1QB 2M98A 1KMNA 2JGRA 2P91A 1APBA 3FUUA 1EHCA 4W8OA 5HE9A 4XGRA 3RC2A 4C2BA 2X3UA 3T99A 3H4MA 3HB0A 5IDQA 2PAAA 1I0LA 1SUPA 2OG2A 4O4LF 4GMXA 2EZ9A 1MB4A 1HNWB 2ENUA 3FNEA 1S8AA 1RM3A 1RYNA 2MINA 3OY2A 4RK7A 3IP5A 1XAJA 4MQ6A 4BMZA 2P9JA 2N46A 3V42A 3NRCA 3CJTA 1YIDA 1WSAA 3AUFA 2X0JA 3PJDA 1VCHA 4P3PA 4RXMA 3UW3A 2ZCUA 2C07A 4ZYLA 3QEMA 1XVTA 1S1CA 4BUZA 3F4KA 4RSRA 1ZW6A 2ZQ5A 1RM0A 1HV8A 2QT9A 1YA6A 3LQFA 1EDOA 1KNXA 2ARKA 2J4FA 2VKTA 3KKKA 1OI4A 2UV8A 5FX2A 1BQ4A 1DG3A 1PJZA 5GOTA 1MX3A 2GBGA 2QX6A 5F77A 3LKDA 5AVYA 4BUCA 3I01M 3JX9A 3FDZB 4F2PA 1IM2A 2I76A 1CS4C 3UMJA 5AVWA 4P92A 5KSYA 4AYTA 2REQB 3C3KA 3DFFA 2PLRA 4JJZA 1Z39A 1QYVA 4IRUB 4IHQA 3T7DA 5J5VA 4BX3A 1BRTA 4KQJA 1NZFA 4P3NA 1SC1A 5FORA 5BP7A 2GLUA 1BIFA 1I1NA 2BZ0A 3INTA 4NESA 4OJNA 1EBUA 4R16A 2JJMA 1PZHA 2X1MA 2BHTA 3RTBA 4DQ0A 5ISMA 3UCEA 3OU7A 4LCBA 4Q1FA 5HBGA 3WYEA 4ZCLA 3HCDA 4DUGD 1KAQA 4P83A 3F97A 3S7TA 5BNZA 1FNMA 1TOAA 3Q72A 4FSHA 4H08A 1KJZA 3LC1O 1UEXC 1MX1A 2OAQ1 3BMQB 2WIDA 1XOIA 2DT8A 4HADA 3ZDYB 3ZXXA 5TMPA 4DSZA 2CVPA 2QJTA 1DPGA 4I4NA 1CP3A 2M2IA 4LTMA 1LBHA 1Y1KE 2JZOA 3NDBB 2V6FA 1EK2A 4M1MA 3BTOA 4FMPA 2IW1A 5CD9A 1Q44A 2VS1A 3AR4A 4HQFA 1Z4LA 3I0NA 1XMXA 1DADA 1UPUA 3MRTA 1ZH8A 1Z4PX 3PFWO 3ZUPA 1QO9A 1YS9A 3K15A 1RMQA 4UBKA 5KYWA 5ESXA 1I13A 4PAWA 1BA3A 2P41A 5FHQA 1H8ED 5CB4A 1OTHA 1PR5A 3ADCA 4CL2A 2P9CA 3UFXB 2JHGA 3A2NA 4AG6A 1RP1A 1RBYA 2CE2X 3W04A 2B9EA 4MIOA 2D59A 3MTBA 5FBRB 1U9ZA 3NT2A 2EXXA 4EM6A 2O2ZA 5H82A 4DKJA 4ZYUA 5CCDA 2X5KO 2ZIAA 4X8LA 2OHFA 3AVUA 2XH8A 4JP1A 3CGGA 3QFRA 2KM1A 5J5CA 3CX3A 4E33A 4MYHA 1LGYA 1KJJA 3IPRA 4YN3A 2YDYA 1UKBA 2N9UA 2VBIA 2YWGA 3BQ9A 3NTXA 4Q4CA 6GPBA 1E7WA 4Y1RA 1M7BA 1J06A 4KXWA 1YJBA 1WXWA 2G77B 2SHKA 4ZC1A 5E1OA 5DM60 2C2BA 5LOVA 3BFJA 5KSWB 4Z6KA 5T8KA 3LWZA 2GVDC 3FFBA 4UXHA 5KSPA 1PTJC 5IMBA 1M8GA 3TLBA 1A7UA 3FSRA 2Q4OA 3BSSA 3VM6A 2O59A 1QYRA 3RAEC 4QWMA 3S2IA 4IH1A 3RYHB 4OJKA 1H8HD 1F17A 2E4AA 5JNWA 4ETNA 5BV7A 2PFSA 2VAPA 3RW9A 4AUNA 2E18A 3HXKA 4HDNA 4KQEA 4P7JA 1QHEA 1XTPA 2XIQA 3U3RA 5JAZA 4KVFA 1JMKC 1T8YA 4JYBA 3W4KA 2JCVA 3KVVA 3S81A 4HH0A 4EARA 1YR1A 2ZI3A 5JZVA 4PRZA 2WKSA 2QSYA 5JSQA 2QRUA 5ERGB 1MJ5A 4KHZA 3L4BC 1PG2A 4C7JA 1QJCA 3H1PA 2OZVA 4LEIA 2VHJA 1EGHA 4I1YA 1XCPA 5IWAB 4ERXA 4ZKDA 4GPAA 2WFAA 4ZQCB 5DGCA 3SLKA 1OLXB 2CCKA 2K4MA 1CRWG 2HSEA 4ONEA 2LIVA 4MKHA 5ALIA 3G2NA 2EJUA 1DCKA 4S35A 3WYDA 4F7DA 3H97A 1XF1A 3K09C 1X0VA 3GLFE 1KP3A 1RM4A 3C5EA 1K89A 3S2EA 1MIHA 4EITA 1D0VA 1OX4A 1AKNA 1C3LA 1H4QA 1Z2NX 4IZIA 4W8GA 2W2VA 5IC4A 2HRQA 4JMPA 1EKXA 3PFIA 2XW6A 2H31A 2R3SA 1FTGA 3A9UA 2D2IA 4CKEA 4EVQA 4LF8B 4NENA 3VJRA 1FQOA 2V58A 4F9FA 1U0HC 3HB1A 2DR3A 3AR3A 2XE8A 4B6EA 4IIJF 4DLVA 4P08A 4JUCA 3ZE6A 5MN5A 2BBTA 4DYHA 2F64A 4I1UA 3WADA 3FTQA 1XA4A 5LYYA 3OJFA 4JLBA 3IP6A 4K46A 1YZYA 1ZU4A 4DC9A 4ZGWA 1M2FA 3K30A 3VRHA 1WZCA 3UWOA 4HGYA 3ZWBA 1EGQA 4HNSA 3SYMA 1ISMA 3A7DA 3SSNA 4B80A 5K0JA 5LWHA 1DX9A 4CV2A 1QB7A 3BF7A 2AH5A 3USZA 2XQGA 3AY7A 3WRYC 3FWKA 3GP5A 5EMHA 1U9CA 5JOQA 2P6NA 3D4LA 1W2HA 2A7XA 3KD2A 1DDGA 2FFAA 4XIGS 3ESAA 1BJRE 1WAMA 2GKOA 4QYIA 5JY6A 3ET5A 1YJ8A 4IMRA 1CUSA 1ETHA 5EZQA 3Q98A 3ZY2A 5AOVA 1P9LA 3PNPA 5EMNA 3S1SA 2EX4A 3BWXA 1CCWA 1E79A 4R68A 1JALA 2VTDA 1TQDA 3O0TA 3OF5A 2VRNA 4PWZA 4XQGA 1HQKA 2N1BA 3ZCVA 4PN3A 4RZ2A 3VR5H 1SKBA 4NH4A 3WKEA 3AHGA 3VI4B 1P7ZA 5AKHA 1JKIA 3ONWA 1G5QA 2QMZA 4RHCA 3PI6A 3KKQA 1SCIA 3K0AB 4HS4A 2PYDA 1T1GA 5L7YA 2ZJZA 1C50A 2XRMA 2X77A 3CNHA 4G84A 5KTTA 2J07A 3GLFB 3W5BA 2G71A 3NHAA 1AV7A 1PGQA 5D86A 2ZUSA 2ISSD 1DC8A 2ERCA 3ED5A 4JFRA 1U7PA 3V3TA 1Z5PA 5HDQA 1XZJA 1A71A 1I5EA 1TD9A 1FP6A 2CL7X 3IEKA 4N03A 4P4GA 2ZAYA 4CQLB 2EBHX 3V2HA 2XUIA 4P7FA 1T10A 1JSZA 4YROA 4LI3X 1Z6AA 3WS7A 3Q2IA 3FDFA 1GKIA 3IR5A 4HWSA 3RYFB 3HUUA 2WQ7A 1T9AA 1ZNZA 5D3KA 3VMFA 4PNPA 2HO5A 4R1SA 3PNVA 4QLOA 1O08A 2PS0A 1PL8A 4IL5A 4BO4A 2OBFA 2H6EA 4MR9B 5B6PA 3H5TA 4YP0A 2ZT6A 1NW4A 3P32A 2NGRA 4CUZA 4ADSG 3P9CA 1W4RA 5EIFA 2V9PA 3TTSA 2PZKA 2IOFA 4GYWA 3WGLA 3WGKA 3ZX5A 5B7QA 1MIOB 1SOUA 2CUTA 1OZAA 3FZEA 1WUJS 2RHMA 3E3MA 2YRWA 4WFJA 4CF6A 2AV6A 5B4VA 4P6VF 1GL6A 3UC5A 4QBKA 2B4AA 4B6QA 3AINA 3WLNA 3U6BA 3BOSA 5CDYA 5DNAA 1M6WA 5ITZB 1FJGB 4F6RA 3QG5A 2OO7A 2PS9A 4AKSA 4EMTA 3T3NA 1KGSA 5B7PA 1RJEA 3BXFA 3OCWA 2VF7A 1YRAA 3IDQA 521PA 2HDOA 4LJKA 3VZBA 3W06A 3CX8A 5KX5B 1O96B 2NVUB 2BFFA 4UHEA 2DSNA 1N8TA 1H3EA 1GZ4A 2HA2A 1IBRA 3EFOA 3VSAA 4YIHA 1X14A 1KJQA 5IK2D 5GZ6A 4URFA 1Z5NA 2G1UA 3AHDA 1UFKA 3NV9A 2CJPA 3H9EO 3I0ZA 3MK31 4TLCA 3UQYS 4ASUA 1NBIA 3PFNA 5JEDA 4YRRA 4JC0A 3OQBA 3EZYA 4L5CA 2XT9A 1MRSA 1DG1G 3A28A 3KXIA 4S1VA 2V7EA 4V02A 3JQGA 2IPXA 3ESQA 5K3OA 1X1AA 3B1JA 4B82A 1QZUA 5AW4A 3MUFA 4GVPA 1MRZA 2EGUA 3B6ZA 1JVSA 3DEKA 3I28A 3OLZA 4B3XA 5MGNA 3N76A 2JLVA 1AZSC 2IKSA 1P9OA 1NI3A 4RVNA 5K2MA 4P98A 1AA6A 4JYZA 3MCVA 2SCUA 1A5AB 1E5LA 1QP8A 1C8BA 3OJCA 4JEIA 2IBTA 4KQ9A 3HGMA 1HR0B 2A5YB 2AR7A 3HA7A 4EEZA 3DTYA 4JYPA 4U6QA 4JP8A 3SWWA 1ZIYA 3VDNB 2IVFA 4J0IA 2FTKE 4LBVA 2FFHA 1ZGHA 2AFIE 3ONNA 4LZPA 1TIKA 1RXUA 3MN1A 2WI8A 3CRQA 4NJMB 1QCDA 1XDBA 7ABPA 2DUUA 3DE7X 5EJ9A 4MA0A 1GQRA 4MO2A 4OGLA 2H3EA 4DARA 1D9XA 2FLKA 4OX9Y 3R3UA 3UEOA 2H2WA 3QHAA 1ENPA 4RHFA 1P2TA 3CIOA 1DIRA 3IT3A 7AT1A 3FRIA 1KHTA 2BZGA 3A1FA 3CNEA 3UK7A 1OOEA 2R7LA 3RV3A 5MN4A 3ASUA 3CSDA 1A5ZA 5ALEA 3ZGYA 2EERA 4HEQA 4J2HA 2XB9A 2VT2A 4L3WA 4ARCA 2WIBA 1ABBA 4PFJA 3W05A 1XV5A 3WB2A 5TPWB 1IN1A 2ZRNA 1OVMA 2FE4A 4QUJA 3QQPA 4WCDA 5JYBA 2IOYA 1CQIB 2CJYA 2O7QA 2NQ8A 2VVTA 5JSYA 3MPUA 2YNMD 3CUUA 5BN5B 4J16C 3LBYA 3TQSA 5JAUA 4W9RA 3KKOA 5DNYB 4G0QA 2PMBA 3D6HA 4XWWA 2UXBB 5AOAA 3IJEB 4CKWA 3EDCA 3HKEA 4DRXA 2WWFA 4B2LA 2VRCA 3VO2A 2Y76A 2NT3A 2E48A 3C3YA 2CLMB 2IXTA 1EUCB 2ZB4A 3LPNA 4PX2A 4ZAGA 1TUBB 1WTCA 3EIUA 3L6RA 3Q2OA 2E3JA 2O7NA 3FOFC 2FPGA 3AEQA 1E89A 3KBBA 3L82B 3OIFA 4JK3A 4UUAA 5L7WA 5K3SA 1ULSA 3L0CA 4W5HA 3M4YA 2PGAA 1DSSG 3AG5A 5DVZA 4FSXA 4RSMA 3ZNNA 3FCYA 2WHEA 1CY2A 4I66A 1BOFA 2QJWA 1AD2A 4LBWA 3GJ8A 1I94B 2O2GA 4K2AA 5JECA 1H42A 3M4NA 4CW7A 2IXAA 2GN6A 3GAMA 4MV8A 3IQZA 2Q5FA 1HLFA 2FXIA 1KC1A 5EUMA 3LPAA 1XFAA 2FWMX 4Q7QA 1KI2A 2J46A 2JEYA 2HCJB 3MIZA 5C0OE 3C3CA 5E2AA 4JFAA 3X1KA 4LDNA 1SBTA 1AQLA 2JFYA 1WHTB 3DWFA 4DA9A 3EVGA 1A2OA 5KYYA 1VLJA 4D5GA 4X8OA 4I1RA 5C34B 3BUSA 4XUGB 1ZI8A 2JBWA 2WM8A 4C01A 2QAGC 2BHLA 3TTTA 4KYUA 1TE2A 3VOBA 1FUEA 2Q4DA 4MQEA 3CR7A 4EG1A 2RKWA 3RU9A 2QD1A 1G1MA 5AJYA 4DSNA 2KLBA 4CV1A 2OXRA 2ZAIA 4CZ2A 3R6TA 5B1EA 1UT5A 1CJBA 2POCA 2R6CA 1W88B 4QELA 2X8AA 2XUGA 4ED9A 4MGHA 1G4UR 1QVAA 2H9AA 3O47A 3EXG2 4MP8A 3DUFB 5GONF 4IQ8A 4A0SA 2WNHA 2IUEA 3AJEA 3G7NA 5KEIA 3PENA 1HNZB 5ES3A 1E3QA 2XMRA 4V0SA 2GM5A 2LKCA 3EXEB 1ECBA 3HUTA 3NI2A 1AMNA 2BJWA 1JX6A 1H3FA 2GM3A 3I04A 4IUCS 1C5KA 4TL6A 3WGZA 5KB3A 4JUFA 3VKUA 4F2GA 3OX2A 3JYNA 3V8PA 2ONCA 2ZYTX 3O8NA 1E7RA 2MSDB 1L3IA 3RFVA 5JZOA 4QHTA 4MDFA 1TQ2A 5I9SA 4Z4GA 1MC5A 4F9EA 4JNKA 1JJ7A 1ZRNA 1GPLA 3ZR4B 1G4HA 1OWLA 2FJ0A 2I2FA 3L0PA 1VJ0A 1WPRA 3L7DA 2CLFB 4YT5A 5JAHA 2Z2IA 4R1PA 1D1SA 3PJGA 5FBKA 2HLPA 3OQMA 3LLVA 5BSMA 4GT1A 4L02A 1T9HA 2OBLA 5EXEA 3U1VA 1IJKA 4D4IA 5DIZA 1DJOA 5AJVB 1W6RA 1T6ZA 1JDNA 2IL1A 2ZBUA 4FX2A 4INZA 3RAFC 2VATA 4NDAA 3PQ5A 1Q2UA 3D6AA 1DX6A 2VBCA 4TM7A 1OFHA 3UMSA 4TS4A 2C4TA 3I8OA 3ZI4A 4D6XA 2HF7A 1WB5A 2BLLA 1ZICA 2OHXA 1OASA 3PUHA 2X76A 1A9RA 4LVOA 4LF7B 2WMDA 4YDSA 1W30A 3UWMA 2D74A 4GP9A 2C3YA 3E1GA 1IHYA 2VUUA 5B5SA 1XJWA 1CZHA 5M34A 2Q0HA 1UDCA 1DMRA 2P77A 1NI4B 3F9CA 3I45A 4PQGA 2F43A 2G5PA 4MCHA 3DPSA 1SUIA 3L3BA 4Y2PA 3S2ZA 3ZVNA 1TK2A 4RKWA 4D45A 4FJ1A 1J99A 2I6TA 1NRXA 4IJQA 1NATA 3ROTA 1ML3A 1KI6B 2WU8A 4Q1EA 1E0DA 4RANA 4YP5A 3R9KA 3SSAA 3AGPA 3R9XB 2FOLA 4BQOA 2RHOA 3LO8A 4EI9A 2WSYB 1A9YA 3ANTA 3UV6A 1WPXA 2FX5A 3TAUA 3BYZA 4FYHA 5JY1A 1WE2A 1Y8CA 1DQNA 4YV7A 1TA9A 1QSGA 1DT3A 2EWWA 5JNUA 2QNIA 2YW2A 3PC8A 3IDFA 3BG5A 3U4GA 3R5HA 2PRZA 3OX1A 5AW3A 3E1SA 2ILTA 1DIOB 2VFAA 2H9IA 2XZTA 3VO9A 4YUWA 4CHTA 1SXQA 3QOWA 2GM9A 3PB3A 1KPHA 3D64A 5CLLA 1RKBA 4IR7A 4YCMA 3DE0X 4C6RA 1SKMA 4A8JC 3EDMA 2EP7A 3D1VA 3LK7A 1JIXA 1N5JA 7REQB 3LYAA 2ID7A 3MBKA 3P4UA 3PC4A 2QU8A 3GGDA 1L3BA 4C0HA 5B57C 1O6BA 1QHNA 1NBAA 1T9BA 1V2HE 4YMWA 3STHA 1A9ZA 4IFEA 3CX7A 3FB1A 2BP7B 4LDZA 1J42A 2ZIFA 3OQHA 3PE3A 3SBDA 4C21A 2BF4A 1NVBA 2ZOSA 1NUAA 2HRRA 3IPLA 3Q3EA 4TS9A 3C8DA 4DXHA 2H29A 3H2ZA 1X42A 1M1NA 3PNQA 4ZO6A 1EX9A 1RADA 3VOSA 4R0NA 1KBQA 2ZI5A 3BMNA 3STTA 5IDXA 4B4WA 2UUAB 1BMQA 4PTLA 5IU6A 2NXEA 2B34A 2HU8A 5CTAA 1C3EA 3IO5A 3EGOA 1VGRA 3C3WA 2JI7A 3COVA 4AQYB 3KEOA 4LVCA 4OXNA 4UM8B 2NYVA 2IZOA 5F1OA 4CBVA 3BJEA 1NMZA 3VR6H 4AJ4A 3IDZA 2I4LA 4FC7A 3QVTA 5LJIA 2P2DA 3BD6A 2FSUA 4NPAA 3R5KA 1GQYA 1MDFA 1RJ9A 1LX7A 2ZBPA 4UC0A 5BRNA 2RB5A 4AFNA 1YR2A 4OOEA 5JRZA 2P1RA 5LQDA 3V2IA 2GMWA 4ZGBA 3JAKA 2QVGA 3RRJA 4WK4B 1UK8A 3VA7A 1UBFA 2GN4A 2JH3A 3LT4A 3OLVA 3OUZA 1UZAA 4FFMA 1MZVA 4GG1A 2O8BB 1XHLA 2O8EA 4JJ7A 1BMDA 5IYZF 5CB0A 3BFVA 4B4KA 5CUQA 3GRCA 1IHXA 1BWQA 4DDWA 3K05A 1C14A 3WLMA 4ZQGA 5LU8A 5LDDC 2CT8A 3DDZX 1FTQA 2Q6OA 5E6RB 4YO7A 2BHSA 4AROA 4E5UA 5IJWA 3T4XA 3WYNA 1M6YA 5BYJA 1ESZA 2COKA 1QIMA 3LQRA 4JIMA 5CX4A 5E7JA 4G1MB 3F96A 4P4SB 5FNVB 4HATA 1BD4A 3H5RA 3FOWA 4KIUA 1R9GA 1KZ6A 4NBLA 4C0KA 4DPKA 3MGGA 4IKPA 4RLFA 1WMAA 4KEAA 2PXCA 1L9XA 3LUHA 3K6RA 4G37A 4HQ0A 4Q4DA 3CM0A 4CV3A 3GRAA 3HKCB 3K35A 3IBGA 1BQ3A 3TCXB 1I10A 1SBCA 2GPYA 3PNMA 5C1PA 2ECQA 421PA 2QUZA 2D8MA 4M99A 3UQZA 1JSXA 3AILA 1Z35A 1N0HA 4NRDA 4KQXA 3HHEA 4S0XA 4C7VA 2ETVA 3WHKA 4UFPA 1E0SA 4ML3A 1T0HB 3ZLBA 1SFRA 1JFLA 1FDRA 2WVGA 4IIYA 3SIWA 2C7VA 5CH3A 1MPXA 2W2QA 4DCUA 1CZOA 1TT5A 4CKCA 2Q1WA 3DWIA 4WRRA 2HU2A 3DDHA 1P4GA 1BN7A 2NWQA 4EABA 4Z5XA 5F9HA 1T8PA 1FNDA 2V7WA 4PANA 1Q11A 2BFEA 1E2QA 2GJ9A 1JTFA 3VR3A 4FB5A 2AT1A 2Q1XA 4LX8A 4DF3A 1LX6A 1WW8A 1EFDN 4GEGA 2AOTB 4BE9A 4JSYA 1EI9A 3WY9A 1T0UA 1BJTA 1RTTA 1P39A 4H59A 1RM5A 1PW7A 5IUNC 5K6AA 4Q7EA 1KOLA 1LXCA 4HGOA 2F1HA 1OH7A 3AYXB 3A58B 2AKEA 4FU0A 3HBFA 1KXJA 1QPBA 1M2OA 2VIIA 3VV3A 1Q7CA 2X2PA 2OE2A 4AIRA 4L0CA 2WJYA 4N76A 4XVRA 1G5PA 2P6OA 3LDUA 4IX9A 4D0GA 4P7KA 1TA0A 3EEOA 4Z1MD 2XUZA 1NXWA 1CY0A 3HZRA 3ME5A 3NUZA 4LCEA 3B9QA 4L8VA 5BUZA 3L7OA 4JLNA 4OIFA 5CBPA 2WWYA 4JJKA 4J4BA 2XWBF 4C4PA 4B7ZA 3EXHA 4TT8A 2VHVA 2UXCB 3EPHA 5KDLA 4UDOA 2HW8A 1RBQA 2R8ZA 2DWQA 2RD2A 1WVMA 3ZNPA 4DADA 1N2BA 4G8CA 4BVBA 4BB0A 2PUGA 3PGMA 2IU0A 2Q62A 1N2CE 1NVFA 2UZ1A 2V7TA 3C7KA 3H17A 3NPMA 2P9QA 4HO1X 2RGUA 4NU6A 4MAFA 3TIVA 1VHWA 2J48A 4HV4A 1KEKA 4XARA 3D8SA 4BB9A 2E6UX 3JALA 4MPJA 1PT7A 2RCNA 2V3VA 4UW9A 3KQLA 3C14C 2OFXA 1V1RA 2RGNA 3AUJB 3RVJA 1MENA 3T3PB 1QP0A 4PYKA 1NN3A 3DTVA 4KK4A 1NF3A 4URWR 2DEUA 4IF4A 2A3RA 3N8IA 3RSLA 4EWLA 2XCOA 3GA7A 2DJIA 5FUBA 1CIVA 1C1DA 1Q0RA 1UAYA 2A0WA 2Q7XA 2W2PA 2W6ID 1JDBC 1SUDA 2CLLB 2PDAA 2J4DA 5HZMA 4JKIA 3FHTA 3N6RA 1R10A 3DQZA 5EFZA 3ZWXA 2AZXA 3P2YA 1ZYUA 3M9LA 3V9AA 3CEHA 2W2XA 4JSRA 1JIIA 1HDRA 3FCEA 1PAUA 2ODTX 1X7WA 3M8KA 1J1IA 4MDYA 3WWEA 4C14A 4PIVA 4JI1B 1P60A 4C0QC 1BX0A 2BBWA 4KBGA 2QORA 1GG2A 1P73A 4HAWA 4RTSA 3ZWVA 3K4HA 1JG3A 1NZJA 3B1WA 2OXIA 3V1UA 1LLCA 4FIDA 3RTEA 4E88A 2HPVA 4HEHA 1DIBA 3QOYA 5LJLA 1LFDB 3DAFA 4BX8A 5EIHA 3Q0IA 2IU4A 1Q6YA 4ZRMA 1QG0A 2QG4A 5DMXA 4AJLA 1N77A 4IXTA 4ZVPA 3N6XA 1RQNA 1L5LA 3INGA 4IDOA 3WWZA 3J7TA 5L4NA 1MT3A 5I7UA 2A9RA 5TV2A 3EBOA 3WB0A 5F7ZA 1AA9A 1TF7A 4RL4A 1EFUA 2AXPA 3O73A 5J59A 4WN3A 4WZBB 1FLNA 1R4MB 1CUUA 4JT8A 1V35A 5MF6A 1GFWA 3A37A 1TYDE 3LG2A 2PWZA 1NPYA 4IJKA 3TZ6A 2VCHA 3ZWCA 3K8YA 4YR9A 3D3WA 4IOJA 4CN8A 3BRWD 2D5AA 3KZCA 3E1KA 2PMKA 2AS0A 2FQYA 5AI9A 4Z4FA 5FT9A 3VPAA 1VHLA 3RJ5A 4D3ZA 3FW1A 4MV4A 1DE0A 5ENZA 1JKXA 1WMFA 1KRWA 3KR1A 3VU3A 5AOCA 3DXZA 3MGBA 3R77A 5AI4A 3A06A 3JD3A 4JLVA 4G56A 4ROSA 1DTEA 1U4NA 4J03A 5TQVA 2FW7A 3SFZA 1JB9A 1KO1A 3KPYA 1Y1LA 2FHSA 2A88A 3QA3E 4Z0HO 2LIPA 3SNHA 1K7CA 5CA0B 1ST2A 3R74A 3LIPA 1A95A 3L8CA 4OO3A 4CVNA 2YRFA 4KWCA 4PGHA 4IHJA 3GPCA 4UE3S 4AP5A 3SEZA 1UBNA 1RAHA 5AP9A 1AY0A 5ICEA 5FDFA 5G3ZA 5DXFA 4HJXA 5JD4A 1H5NA 2PFGA 3GPBA 5H81A 1VKJA 4HAYA 3B2QA 5IFKA 4BP8A 4NBNA 2CE7A 2W93A 3FUWA 3GRZA 2I6UA 3OM1A 4M0LA 1GN8A 2ZUWA 5H70A 4KQIA 1E98A 4OHOA 1ZM9A 4QUAA 5LC1A 3ZWKA 4IJMA 3LTNC 1PDWA 1AIPA 2R79A 4AKHA 3U31A 3PPIA 4F3YA 1M0SA 2B3DA 2V7BA 1N9GA 2O3RA 4NBVA 5CNIA 2XVAA 3AP2A 1YULA 2BKLA 1CZRA 2KQUA 4KU4A 4DLZA 4CTOA 2C0PA 1Y3AA 2GJKA 3U61B 1GYPA 4P22A 3V80A 1WUKS 1XKQA 1P1KA 3G9XA 4YJFA 1XTUA 4CYMA 4DZRA 4MUEA 1JAZA 1TKRA 1ZNYA 3V4RA 3CLTC 3E0QA 2NUTB 3G5AA 1IY2A 3M0EA 4TSFA 2WM9B 3B7PA 4WLFA 1ODLA 3FOEC 1KA9H 1JHAA 4X90A 3AFIA 4HDOB 1SC3A 3W3AA 2BZSA 2RH5A 2OGTA 4NDNE 5KHAA 4FYYA 5JCZA 1XDWA 2M6SA 3QI7A 1XC7A 4CM9D 1EA5A 4QT0A 1XTRA 3FPGA 3UY4A 1VE1A 2NSYA 5EVJA 3V7NA 1MB9A 4CFYA 2GLTA 4EI8A 2XNJA 3ICVA 2ADMA 3JPYA 1G6KA 3O5AA 3TXYA 1AH2A 2FUKA 4XJVA 1WUHS 2BGWA 3GJ3A 1CYEA 3HNRA 1PFYA 4MV6A 1J25A 4NG4A 3SBEA 3ZJ5A 2I67A 3FJYA 1GADO 3GGJA 3OT4A 4N8SA 4KI0A 4MVXA 5CNMA 5H80A 5AI6A 1UEJA 1MVNA 2QN1A 2MINB 3U81A 1W29A 4FLMA 3ZGLA 2AE2A 5A4FS 4QXPA 3KDAA 4UCFA 4BN4A 4Z4EA 1PNQA 1XWFA 3JQ8A 4YECA 1WY7A 2V4UA 5HJ7A 1ZK0A 4IJUA 4D2IA 2UAGA 4PV7A 1ZK1A 2EKZA 2CV1A 3X2EA 4DA7A 4JI4B 1IQUA 2A5JA 3WQBA 3QEMB 3CY6A 3IVXA 2NO6A 4V0RA 5CHYA 1VC2A 3BE5A 6ABPA 4D99A 2RAFA 3NPAA 4PPYA 1JEYA 1SAYA 4BNXA 1RBMA 1ZMBA 4WXYB 3NEYA 2FPKA 2XYGA 4HMPA 3MSXA 3H9BA 4UM7A 1J2UA 2EW1A 3ZEIA 1ZOLA 2E4UA 2L19A 4UPDA 3RRXA 1HF3A 4OQNA 3ZYZA 2QIOA 5JO0A 5EQDA 3P9QA 1PSWA 1JR3A 4GX5A 3FPBA 4UUBA 4EG8A 5KVVA 3ESRA 5J2UB 5E1DA 1PBTA 4QIHA 4PHTA 4HB0A 1AB5A 2RGBA 4N39A 2JLXA 1K7FB 4MUMA 1HXHA 5A5VA 4EKGA 3FNQA 1Q14A 1PR1A 1YZVA 2ZVQX 3RUCA 1BFUA 1IUNA 4DEVA 4YPOA 3FUCA 1GARA 4FFLA 1ORVA 2ZXEA 3O4RA 1HDOA 3DFMA 2ORVA 2QLJA 1LEHA 5JBQA 3OECA 3W6OA 4B43A 1QK3A 1BO6A 1E5QA 3AVQA 4LC9A 2OM6A 4Q1DA 1XZIA 3F5SA 3R8XA 4WBNF 2PWPA 3DHWC 4EPRA 3EIEA 4DNFA 3T7EA 2W43A 5KVQA 2XNHA 1EXNA 1P2VA 2JFGA 3ZGOA 1P5JA 2J9FA 1KARA 1ZJ6A 5TB5A 2HCRA 3PCRB 2RI1A 5DSXA 2VDVE 2B6HA 3WK5A 2QB5A 1NBOA 1KWKA 5GJBA 1KJNA 1PYDA 4IIUA 1JRLA 3NH6A 4RQUA 4CMEA 4YMHA 4MLZA 5GZ1A 2D2XA 1IEXA 1NUQA 2IXGA 3AY3A 1YL7A 2EJTA 5AXBA 4XDHA 3RS2A 5KYWB 3PR1A 3EVZA 4X92A 4DEYA 5CB4B 3MC1A 2QOEA 4WDRA 4F45A 2OCXA 1F60A 5KJ1A 3CYFA 2QUJA 5AJWA 1EU1A 4Q12A 4DSOA 3ITDA 2XBUA 4AJEA 3GVPA 4D0LB 5KDOA 4O5AA 1VA5A 3PCXA 4MKGA 1Y8AA 3FLAA 3U44A 1IXRC 1POWA 1ZKMA 2R1VA 5A5EA 4HDMA 1JH8A 1T43A 2PKYX 1IB0A 1GIAA 2JFNA 3IAAA 1K97A 5LLDA 3KKPA 3PQ6A 4U2CA 1F14A 4EFDA 4TMXA 1XMQB 4A8TA 4OBEA 3TSWA 4DKXA 1QOPB 1SXJA 4OY3A 4TV9A 4Y1RB 2XCLA 3WHIA 1OB5A 1G3UA 2P35A 3OA0A 4ND7A 3UT5A 1CEXA 5BO5A 5UKDA 3SPXA 2ZT5A 2DFKB 3KO8A 4I19A 5DFAA 3FBWA 3ZGVA 5LOVB 2P2GA 4ANFA 4ZFNA 3LHIA 3RVBA 1RP7A 5E95A 1SIWA 5AK4A 4S05A 2WT4A 1HPLA 4MA5A 1A9TA 5LPNA 3ODPA 4KDRA 3RCBA 1QUEA 3AOGA 5LZ5A 3QV1A 2HL6A 5FPTA 5IBCA 4K9SA 4RKFA 3SP1A 3NBZC 5ERXA 1JHOA 2FDCA 2KBFA 2I6SA 4TTRA 2R5NA 1DIAA 2OBNA 3CSSA 2P9EA 1OFGA 5FO0A 4WNYA 3UOWA 4YT2A 3LUKA 4HDNB 1PT8A 4EG6A 4Q9JA 5DXJA 4I14A 5T7BA 2BGIA 3O84A 3QG1A 1UK9A 2PUJA 3K8OE 3KXKA 3VSDA 3PLNA 5K8VA 2IH5A 1ODTC 1BXKA 2BFWA 3AERA 3ZW9A 2PVCA 3ZNOA 2QR5A 3CEPB 3PQ8A 4XEUA 3FKQA 4FIZA 2NO1A 4ND8A 1F6BA 3E7DA 4CG1A 4DC1A 1NHGA 2FFRA 2FW1A 4B6JA 2F48A 1DC4A 4PX3A 4FMCB 2GKGA 3KFLA 1RHUA 5IVIA 4WXRA 2IY8A 4NAUA 5AKGA 4BBZA 1KAHA 3KOYA 4HXGA 1WEKA 2XT6A 3ANSA 3EAGA 4R1NA 4CKBA 1M2NA 3QXCA 1P0CA 1HEYA 4IFTA 4PSKA 5HF8A 1OX4B 1JIUA 3SCZA 1LNZA 3HBLA 5B55A 2J09A 3IP7A 3LRPA 4Q66C 4GZMA 1Q84A 3EPKA 2HA6A 3KALA 3TWOA 2PK3A 1R2QA 4CJXA 3GMTA 4CKEB 1GZ5A 1KI4A 3P2OA 4LX0A 4NENB 1NI5A 3L7IA 3MLBA 3ROMA 1DUIA 4YMVA 4HQ6A 1QIIA 2HU7A 3FY4A 3GL9A 1IY8A 1SZCA 3QU5A 4ZU3A 4P80A 4UBLA 4GDFA 1JFVA 3K6SA 1MU0A 2B8JA 2FPWA 1T13A 5IKXA 4CFZA 2QX4A 4ZI7A 1BX3A 3C5VA 2V0GA 1XLVA 1QX4A 5JCPA 2DY1A 1Y5NA 4NABA 1JVNA 3GDWA 3JVIA 4D0RA 4ZICA 1UWKA 4MCIA 1HO3A 3M6FA 4OGGA 4PSDA 2B0CA 1FU8A 3M89A 4H1HA 1JS1X 3EUWA 3OPNA 4XXHA 3UN1A 1OYOA 3G3EA 5FR1A 2XE4A 3R6DA 3RQSA 5MHTA 4J3JA 1CVRA 3QLJA 3HFJA 1XLTA 3UJ6A 4BKRA 2QJFA 4RZIA 2LTAA 1N2XA 4YB8A 1ZJ4A 3BEOA 4DLKA 1WB4A 3HEAA 3OKPA 1WIWA 3NTRA 5FA8A 4JU9A 1M10A 4DXAA 1LRJA 1XYVA 3LDAA 4KE7A 1D2HA 2H8GA 4BLPA 3ML1A 4MVJA 4Z8XA 2OHGA 3NDRA 2H92A 3KPWA 1RVDA 4G2NA 4J7XA 3F0TA 4UZEA 4C4TA 2CLHB 2XBMA 2ZZMA 1MOQA 3P1JA 2WJWA 5GJVC 3NZEA 4WUVA 1Z6ZA 3N2ZB 3VYTB 4F1WA 5BUQA 2PJZA 4I1VA 3HM2A 3OKCA 5EEGA 3C98A 1SHJA 2D1TA 3DVLA 4L4XA 5E9WA 3CR8A 3ED1A 5EZSA 3WIUA 3OFKA 4BXOA 4RSGA 3WMWA 3PC6A 4LZOA 4QYMA 5ER6A 4D9EA 3UB2A 3GJQA 4C0WA 5CYGA 1FSZA 1PQUA 1L6IA 3BFPA 1V95A 2OAGA 5B3KA 3RV4A 3FFAA 2BFNA 3RH0A 4JUIA 2VN8A 2Z8XA 3TUIC 1NC3A 2ZSBA 2NSHA 4AX4A 2O20A 3MFQA 3NCHA 1UEIA 1BVRA 4QDKA 6NULA 1L4LA 1DFIA 3L8DA 2MDTA 2QS9A 4LXHA 3TSOA 4LHZA 4OB6A 4DHWA 1FX0A 3HADA 5FCDA 2B78A 1MZPA 1KBOA 4X54A 4BE7B 4WKGA 1BCRA 2RGWA 1L1EA 2D1FA 1WUYA 2IZZA 4MB6A 5DI9A 3DL0A 4C7BA 1SC6A 3WXBA 1R37A 2R68A 3JQAD 1FP4A 3W6ZA 2GQ0A 3CKYA 5LLSA 1ZS9A 1U1IA 3TRFA 1Q1AA 4WY5A 4PHGA 4EGFA 3LYHA 4ZVSA 5JH7F 2VP2A 4TWJA 3M1IA 2IIQA 5BQOA 3FNFA 5F2EA 1QPZA 2JS7A 2JLRA 5JEEA 5BMOA 6CHYA 2C82A 2HV9A 4Q34A 5AWFC 2PX6A 1TZ2A 3DGEC 3E03A 3QGMA 1WBJB 1ZIXA 5HFJA 4TZKA 1P9NA 4OI4A 4F6RB 3DKRA 2V74B 3HN7A 2JVJA 1ES9A 4AJJA 1GTZA 4OBBA 3P8ZA 4LXIA 2QGFA 4DIOA 3RI3A 1THZA 4MWDA 1OZGA 2A0XA 4KGZA 4NE2A 2BFFB 2ZIXA 2GK4A 2ZPAA 3TQFA 3LC2O 1EHIA 5I9LA 1NJ6A 3EFOB 4S1TA 1NNEA 4BVGA 1P74A 2VBGA 4KXLA 1P3JA 5A02A 3SQXA 2WSIA 2WHRA 5DYYA 2Z6AA 1N6KA 3WLFA 3HZZA 1VMAA 3OOHA 5JAQA 4IIVA 4L0MA 1X1BA 2WJJA 4D02A 4BOYA 1EFPA 5TMDA 4B32A 4E7PA 1DDIA 3KQKA 3D81A 4JC4A 2IXBA 1DRUA 4OBWA 3WSVA 1I9GA 1TVCA 2GPSA 4OXQA 4MK4A 1CQWA 4RZXA 1TQ4A 3JQGB 1AT1A 2NO4A 3CCCA 1PZGA 1BH6A 3D1LA 3ISVA 2Q3EA 4GL4A 1KSGA 3EYAA 4MQLA 3ZHZA 4U2FA 1ODCA 1XHFA 1UQRA 2XTNA 4G0UA 2CXHA 2OEPA 4N18A 2XMPA 1OXUA 2YV1A 1YE3A 2SCUB 4YJ3A 3UB4A 5CFRA 3DXXA 1XJ5A 4YRLA 3C6XA 3ZKAA 2PS1A 2V98A 3L0YA 4MRNA 3ZCRA 1U8AA 3OQPA 4C07A 5C46F 1R6VA 3NVKI 3M6UA 2ZSEA 4GFDA 1FVHA 1CUWA 3KT6A 2VH1A 3ZIAA 1VCMA 4EY6A 3SYTA 2XOKA 3TR0A 1OI7A 2ZSHA 1NR1A 5EESA 1CY7A 2F9MA 3CO0S 4UMVA 1L9KA 3U7GA 2NIPA 4FFPA 3V46A 1VP3A 2CKMA 4EP1A 3OOWA 2Y9PB 1UM8A 1U11A 2P30A 1TVMA 3DTNA 2RJ3A 1N0WA 2M6RA 3K9WA 5HCUA 1VGVA 3TI9A 4AY6A 1HM5A 4MNTA 5CXUA 4EHIA 2HLHA 4RESA 1R5JA 3S44A 2NMVA 2H2FA 1XL0A 2OK7A 1EG2A 4C30A 1SCDA 3LW7A 4GC9A 4NPHA 3GNSA 1BNCA 4X3OA 5TDHA 4LN1A 4HWKA 4W7HA 2AQKA 5FPQA 1Y5LA 2E85A 3MT7A 2ZTHA 3KJNA 4PQYA 5EQJB 4HZGA 1TAQA 3SJCA 1N78A 4O3MA 4LY3A 3FPKA 3GJ4A 4Q1AA 4JI0B 4XM2A 1J2JA 1Y4UA 2GUGA 1VKOA 2UVDA 3B78A 3PXXA 1N6LA 3SVLA 1W7AA 4J6EA 3A0RB 4TT3A 3O4HA 1BN6A 2KJQA 1KYZA 1PEKE 4J0CA 4O2BA 1K68A 2O2CA 2RK4A 1XKLA 1OXBB 3RUFA 4XWTA 2Q0QA 5JQWA 3IMKA 2OQIA 3PR2B 2Q3CA 2OHIA 1O4VA 4N3NA 2VRCD 3HKEB 4CKWB 1V5GA 2ZR9A 3G9TA 3I9NA 1GNVA 2QMUA 1L7OA 1AK1A 1SUWA 4JVOA 2BMWA 3UH1A 4V0LA 1H2AS 1NVDA 1E1MA 1NA5A 2FPGB 3AEQB 3QW4B 4IKEA 3CPSA 2N47A 4IDCA 4PYQA 2W70A 2OECA 2O54A 1TEVA 4J07A 4NJEA 3GF4A 4EHFA 4QOSA 4DXDA 1E59A 3I1YA 5KKAA 1BDMA 2HF9A 2XIJA 1V1MA 3RRZA 3TSCA 1K7XB 2IH2A 2MR5A 3P9PA 1YMQA 2BONA 4GS5A 1TYEB 1P8AA 4BNDA 4J9VA 2X5JO 2DR0A 1ORTA 3PDIA 2AKAB 4D3DA 5BVGA 2ZRFA 5IBQA 2JC3A 3BULA 4UVEA 1V8PA 2NZ2A 3I9V1 1WBDA 1T36A 1Q0LA 4N8EA 2VHWA 4FGWA 1Z0DA 4O4IF 5KYYB 1DKLA 3PPYA 3WLTA 4FCWA 4LSGA 1CKEA 4O08A 4ZQFA 5DLPA 4GBED 5HIJA 4HNUA 1K66A 3AKYA 4MQEB 1EFLA 2EZTA 1KDRA 3QUSA 3OPQA 1QBGA 3QV2A 1AKWA 2Y1WA 1QGYA 2R5WA 1CQJA 3AIMA 4KXUA 4Y2JA 2UYGA 3UJAA 3HP1A 3WMFA 2QY9A 2NO5A 3ACDA 5FFNA 3ZWMA 5JD5A 4OYYA 5E8JA 4V1CI 1GDHA 1YVPA 1X86B 4LJYA 1J7KA 3EIHA 3PTLA 1GJRA 1XNRB 1Z28A 2JARA 3E9QA 4F0JA 4CN9A 1OU4A 1JDZA 3BXEA 2PMWB 5E9QA 5EA2A 2DKNA 2CHFA 2FSVA 4CLEA 1XYYA 2PV0A 3FE2A 1F6WA 2LW7A 1QHFA 4RTPA 3SQMA 1SD1A 2Q3LA 3RJ9A 3ZGZA 1TJPB 3T5BA 4RTLA 1XVVA 3FMOB 5ABPA 4J1TC 721PA 3PQ4A 3CZCA 4FOOA 1UOEA 1VBFA 1R9MA 1NC1A 3PKZA 2Z2JA 4KAFA 5GY7A 3GLKA 2CNBA 3GW8A 4KSYA 4LAFA 4LPSA 4YWHA 2AG0A 2A0KA 1SIBE 2QW8A 4OMDA 4CQNA 1PEAA 2IZ1A 2PMCA 2JHCA 4F91B 1MW8X 2PUWA 1JHRA 4JHLA 3NBAA 3MOGA 4ER5A 4YRZA 3GELA 3KXLA 2JIQA 4MV5A 1EK0A 4Z9XA 3O4FA 4J0HA 2HQBA 4GP7A 4TXNA 3VR1A 1OGYA 2O14A 3MTAA 4U7HA 4XGQA 1J97A 3TOSA 3BVPA 4IQ4A 2X9QA 3QQ5A 4FN5A 2RIPA 3CFYA 1A4IA 4ABYA 1RC1A 1GQ2A 4TN1A 2A67A 3B51X 1VSUA 4Q48A 2C5FA 3IT1A 3QOFA 3VH4A 4YONB 4K9RA 1V11A 2CDAA 3ZZNA 1JA0A 1X3SA 3MJEA 1YOBA 4EB6A 5B2ZA 4IIHA 2JIRA 3NS7A 5I4IA 4HFRA 5LQRA 3GLIA 1PZNA 1TZCA 3IB3A 3SIRA 1BW9A 5AI8A 3TRDA 5FUYA 3H0EA 3TXXA 2O7RA 4ZU1X 1D7OA 1K1EA 4DA4A 1HEIA 2F43B 3KT3A 3SVTA 3EDQA 3EMBA 3KJZA 4MI1A 4LJRA 3HMKA 4B2IA 4B8YA 3TLJA 1ZLXA 4L8WB 2ORYA 1E1KA 2KE5A 5FL3A 1RLUA 1RSZA 2QYHA 3LUBA 5EMKA 5KQPA 2WT8A 3NATA 4ZHSA 2I2AA 3D2LA 3IP8A 4P36A 3NWEA 4AB1A 2ZDHA 4ESHA 5EHQA 4LF9B 3GFSA 3AUUA 2X15A 5JVDF 5HA5A 3VAAA 4UAVA 3I53A 3LBHA 2F3RA 1Y5IA 1WCYA 3NR2A 3D6UA 1QMGA 3FRHA 1Z0UA 2W37A 4HGPA 4OQ4A 2WU1A 3I9V6 2AA3A 1SQ5A 1ESMA 4N7BA 1VSVA 1HQYE 1K0FA 2FK8A 1LTHR 2EFEB 4MAAA 4YJGA 5TGDA 4F6CA 3AZQA 3BDAA 3MCWA 1Z15A 2AEEA 4E4RA 1TKBA 1WETA 3AW9A 5HRUA 1N7HA 4RGVA 1HY3A 5KUTA 1WOMA 1E1QA 1XYGA 2E87A 2H11A 1NBWB 1WXQA 4RTKA 3LLMA 4KRFA 2RG7A 2Q27A 1LD3A 3WDMA 4M60A 2J45A 1QNFA 1XZKA 5DMHA 2Y6VA 3SDBA 1XNHA 5EY5B 3DBLA 2WTMA 4FXOA 1K7SN 4L2IA 1ZBQA 4S2EA 1B6SA 3GDOA 1S7GA 1U94A 3OZUA 4G86A 4I4CA 4KQHA 3RSZA 4F6LA 5CEFA 4IH4A 1L5VA 4HVLA 5EERA 2J5RA 1ZM4A 3NQ41 2AR9A 4QVIA 5SZHB 4G5SA 8LDHA 4KR7A 1I51A 3GA0A 2AQHA 1I7PA 4JCOA 2YZNA 2ILVA 2M6LA 1M1NB 1Y33E 4H6PA 2LE0A 1JR2A 1T0PA 3BMNB 2GA9A 3NGLA 4K9LA 4TLAA 4AMVA 1QZZA 4YJ2A 3IKTA 4L6IA 4UMFA 5I48A 1DLIA 4LHYA 3RHTA 5TQ0B 4ZDKA 4Q1VA 2NUPA 5K20A 1FDVA 1MFZA 3FN4A 3KEGA 4FJ2A 3ROGA 4K6HA 3TJZA 1TFRA 1X8JA 3UJ3X 4KRGA 3ZJYA 1PW5A 4A6XA