3WA7A

Crystal structure of selenomethionine-labeled tannase from lactobacillus plantarum in the orthorhombic crystal
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
467
structure length
467
Chain Sequence
RLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDTNRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLQLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and mutational analyses of tannase from Lactobacillus plantarum.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords tannase
total genus 154
structure length 467
sequence length 467
ec nomenclature ec 3.1.1.20: Tannase.
pdb deposition date 2013-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wa7A00
2VJAA 2VT7A 5FXMA 5DNUA 1JU4A 1CIJA 4BBZA 5JD5A 1VLQA 1A8UA 1BCSA 5T4FA 3QMVA 1R3DA 4RGYA 5ALEA 1FJ2A 4WY5A 3ZLVA 1U8EA 2I03A 4FNMA 1JMYA 1LLFA 2PUHA 5LZ2A 2Z3ZA 3DL7A 4WDRA 4X85A 3WYNA 2G4LA 2WILA 4C88A 5JASA 2WFZA 4X97A 1E3QA 4PQEA 4C4YA 1XLWA 4WFKA 1EA5A 5JANA 3UMJA 1QIFA 4UHCA 3WL5A 1PV1A 2WIKA 4MYDA 1IUPA 3BIWA 4DLNA 1CUIA 3FLAA 4S0XA 1SOMA 4J0DA 2FJPA 2VQ6A 2QVBA 1XZJA 5HF8A 4J0GA 1XZHA 4Q05A 2NW6A 4FHZA 5ALKA 2V98A 3GA7A 1ZIXA 1K4YA 4YASA 5FLKA 3D7RA 1UT6A 2HL6A 5DJ5A 1WB6A 2H7XA 4UFNA 1GGVA 1XZLA 2BUBA 4H7EA 1LNSA 3R0VA 1FFDA 4FTWA 2G63A 1CQWA 1QIJA 1W52X 3GZJA 4I19A 4MQLA 1QTRA 1ZI8A 1FFAA 1JJFA 2QUBA 4U2GA 5KBYA 4C4ZA 2H7YA 3C45A 1QJ4A 3VISA 4OB6A 2H7CA 2HA0A 3W06A 2XE4A 1AX9A 4OSEA 5FKJA 1XZCA 5SYMA 4N8DA 1T2NA 3SC2A 2VTVA 4UHHA 4UHDA 4J3JA 4HRXA 1DWOA 5ALHA 1YA4A 1VZ2A 3I6YA 3L1IA 3WK7A 1TK3A 2PSJA 2ZYSA 4X7BA 1XRQA 3C6ZA 3LP5A 3I2HA 2Y2VA 1MU0A 2E3JA 4QDTA 5E4JA 2HADA 3ANTA 2J4CA 5KREA 3AIOA 4X91A 4L3WA 5IVIA 5E4YA 3TEJA 3W9UA 2OCKA 1THGA 3FOBA 2QJWA 3DDUA 3H1BA 1W6RA 1LPNA 2ORYA 1CFJA 1XZFA 4JEIA 1BN7A 5DTIA 1CUXA 1ZGCA 3W04A 5HKAA 2D5LA 4B84A 2EDAA 2HA3A 1QOZA 1LBSA 3QPDA 2XUKA 4HRYA 4MYSA 1SC9A 3WWDA 3EQ8A 4D9JA 2DR0A 3E3AA 4G8BA 4CIBA 3D4LA 5D7BA 4BRSA 4N8EA 1H2XA 2J3QA 4W1SA 3G0GA 4GLBA 5FPQA 2YH2A 4KYVA 2O2HA 1XKLA 4JYPA 2I3ZA 5AKHA 1UK6A 1AURA 2XQKA 3BWXA 3PF8A 3D59A 3WK4A 4DNQA 5AO9A 5ALWA 3G0DA 1W75A 2VJDA 4YPVA 1GXSA 3F8SA 1CUYA 5A7FA 1QZ3A 1X70A 5T4EA 1C4XA 2GBCA 5AKLA 5FPPA 5I9IA 4C01A 4XX1A 4DYHA 5AI6A 2C0QA 1HLGA 4WY8A 2QOEA 4K6HA 4OPMA 1R50A 3E1GA 1PFQA 3T4UA 1ODTC 5AI5A 2DSNA 1CUCA 3KOOA 1ZI9A 1DQYA 5D3KA 1Q0RA 1UKAA 1F0NA 3BIXA 4INZA 2VAVA 3VKFA 3IUQA 2WJ3A 1K63A 1MX1A 3BDVA 4WFJA 5K3AA 3H1AA 4C89A 3C70A 4X3CA 2XLBA 1YR2A 1CRLA 2QXTA 3FBWA 5CT5A 3WK8A 4CG2A 2X76A 2OQVA 4DSZA 1R1DA 3IUNA 1WOMA 3KXPA 4Y2XA 4DMKA 3V1NA 2CKMA 3SK0A 1CUJA 3V1LA 1QIDA 4FKBA 4OYLA 2W22A 2OCGA 5IVDA 1GKKA 4CCWA 2ACKA 3L1JA 4QNNA 4CI9A 3O4GA 1WPRA 4UBKA 2HHAA 2BKLA 5AI0A 1CUWA 3EBLA 3RLIA 2C5GA 4WJLA 1F6WA 1ZICA 5E2IA 1TCCA 2BFNA 2HA6A 3AIKA 3FYUC 2HRQA 4LKOA 3QMWA 4FFVA 3PICA 3F97A 4RE5A 1MNQA 3NGMA 5KWIA 1J2EA 1UKBA 2FJ0A 4WFIA 5JADA 3IBTA 1XLUA 3PI6A 4JYMA 1XZMA 1YS1X 5LIPA 4IO0A 3SX4A 2OGSA 4FBMA 2DFPA 4GW3A 5AM3A 3BDIA 5EHZA 4IH9A 4W9RA 2BCEA 2X5XA 2ZYHA 2PBLA 2X8BA 3AZOA 4IHAA 3FYUA 1U2EA 5AHXA 4J7AA 1VA4A 3WQHA 5ALXA 3WK6A 1C7IA 1TIBA 2WG1A 4E11A 4MQMA 4BVKA 3MUNA 5CXXA 5AKIA 5HF6A 3D3NA 3STXA 4G9EA 1SCIA 2AJDA 1GPLA 4L0CA 5JD4A 1XFDA 4EBBA 4PF1A 4MEBA 2HDWA 1R9MA 2QKYA 3OPMA 3WMRA 1ORVA 2C58A 1ETHA 3VXKA 5JZ9A 3CCBA 2ZJFA 2OPHA 3I6ZA 3W2TA 1LPSA 4XVCA 1FFEA 3F96A 3QH4A 3C87A 3KDAA 2QXUA 5A71A 2QUAA 3OC0A 1ODCA 1JT2A 5ALOA 2JGIA 2GBFA 4PSCA 1QIHA 5HQ3B 4F0JA 1N5MA 2BUAA 1AGYA 4DNFA 1CUSA 3G0IA 3UUFA 4HTAA 5AK6A 4EA6A 5CT4A 4DSAA 1AC5A 1RP1A 2WIGA 3ZWQA 1J06A 5K5EA 1XZKA 2ZJ7A 3BJMA 3QPAA 5IVHA 1AQLA 5HZGA 2O2GA 3X3HA 4B0PA 1QIMA 4B80A 1R4ZA 3S8YA 2QT9A 4W63A 2BAGA 3FYTA 2AJBA 4EY6A 3G7NA 5JYCA 5EHXA 4ETWA 4KRXA 3BL8A 2C4HA 1SCKA 4KE9A 1W1IA 1MPXA 2IITA 4A16A 1E8NA 2WFLB 3H0CA 2R11A 4P08A 1CUEA 2ZVDA 2WIJA 4QDZA 5HQ3A 2J4FA 5DYTA 1JU3A 1CUAA 3QZUA 3H19A 2XMDA 2J3DA 5ALDA 1ODSA 2VA9A 3F98A 4Q1VA 2HA7A 4AN1A 1ZIYA 3DLTA 6YASA 5ALZA 2QRUA 2YXPX 2PM8A 1LPAB 3AZPA 5I7UA 4K5QA 2XUHA 3FAKA 2WM2A 4LIPD 3NWOA 2OAEA 4PW0A 3I28A 2VATA 5EIEA 1U4NA 1ZOIA 4AQDA 5LKAA 5F4ZA 5LP1A 3AINA 1H23A 4N5IX 1L7AA 4BDTA 3RKSA 1JJIA 4BATA 2QS9A 2WHPA 2B61A 5CT8A 1A7UA 1OXMA 4H7FA 3O9MA 5AICA 4DIUA 2XMQA 1XQXA 1BE0A 1LZKA 1SCQA 1DT5A 1VA5A 1TKRA 4Y2PA 4BCBA 2ES4A 3R3XA 4IQ4A 4XJVA 5AJHA 1WM1A 4G9GA 1QIKA 4BZWA 4C4XA 2HFKA 4OYYA 4CG1A 2XMCA 3E0XA 4U2DA 1UZAA 1HBJA 5C8ZA 4AO6A 4X94A 1UK9A 4H7DA 1EK1A 1S8OA 4U2CA 4ZV7A 3C6YA 4MJ3A 1E8DA 5EHQA 4BRZA 3ZV7A 4JNCA 2ONCA 3O4JA 3H2KA 5DNWA 4P92A 4G8DA 3WZLA 2XQJA 4PSDA 4B81A 4B83A 3R3WA 5BWCA 3E4DA 5FRDA 1VKHA 2FX5A 1X2BA 5T4HA 3PUIA 3V9AA 5HKBA 3G9XA 4ROTA 2GBGA 4UHBA 4FLMA 4QE3A 1TAHA 1FFCA 5JZSA 2WIDA 3WWCA 1YASA 2XUAA 5AH0A 4H7HA 1Z68A 1MT3A 2JBWA 3WKBA 2HA2A 5ISMA 5AM5A 3AJAA 1YSCA 3QM1A 1MTZA 3B12A 5AIBA 5A7HA 3ZLTA 1H2WA 5EGNA 4GEGA 1XZGA 2WQZA 2JF0A 5HFAA 4EY4A 1DQZA 4G4JA 4B9EA 2PSDA 3ESCA 2QZPA 2VSQA 3M83A 1G4HA 5CH5A 2G5PA 1ORWA 1FFBA 2P8SA 1D07A 3RARA 3QMMA 4P93A 1THTA 3HJUA 5LLSA 2Z8ZA 5EFZA 1GZ7A 1UWCA 4NVRA 1O6FA 4J0JA 4Y2VA 1DX6A 1IUNA 1CR6A 2V9ZA 2RAUA 2OAGA 4NMWA 1O6GA 5DYWA 4J03A 2EEPA 2ZSIA 3M82A 3TJMA 2RHWA 2EDCA 3K9BA 3VDXA 4L72A 4B9AA 4TVKA 4H77A 5FP0A 5CH8A 5ALIA 3RK4A 3BJRA 3ICVA 1UKCA 1USWA 1WHTA 2RONA 3D2BA 4AO7A 3F9CA 4LYDA 2Y6VA 3HABA 5C81A 5IKXA 2DQYA 1QO7A 3FYUB 3PUHA 3I2GA 4FLFA 3R40A 4OU5A 3U0VA 1ZD2P 4AX4A 5IVKA 1AMNA 5FDFA 2Y1KA 5D3ZA 3H2HA 3WYDA 2JIDA 4N5HX 4KRYA 3WL7A 2XUDA 7YASA 3WKCA 1HPLA 5EI5A 5JARA 2JGJA 1BCRA 2XDWA 4BTVA 4X71A 3JW8A 3BF8A 4O08A 1YA8A 5AKEA 2XLCA 1VE7A 1G42A 2AJLI 1CV2A 1CUUA 5BV7A 2WKWA 3WWEA 3C6XA 1W76A 5H3HA 4X90A 3HXKA 4KAFA 3KSRA 3LCRA 2WUEA 1LPBB 1FSSA 3KD2A 5JATA 3R3ZA 4Y2TA 4Y9SA 4UPDA 1Y37A 5LZ5A 2W6CX 3A2NA 1EK2A 3DYIA 1DINA 2C7BA 1AKNA 2XQIA 3I2FA 1LBTA 4PSUA 2O2IA 4Y2UA 3I2IA 2HA5A 1RWQA 4BCDA 4FMPA 4QEKA 2B4KA 1N5RA 2GYUA 1E66A 2G5TA 4QLAA 5AKZA 1P0IA 5EIHA 1IVYA 3ZI7A 3QVMA 1CEXA 2DCMA 2OXEA 3WIOA 1E8MA 3G0BA 3W9BA 2PPLA 4G8CA 3FLBA 3ESDA 1QIGA 2BJHA 1TCAA 5AM1A 2XUIA 1DU4A 1VJ5A 4Q82A 2GZSA 3VVMA 4XIIA 4QA9A 1ACJA 1XZDA 5HFNA 1NU6A 5E4TA 1CUGA 1LPMA 3I2JA 4AMYA 4HXFB 1KU6A 4KAAA 3G8YA 5ALGA 1OCEA 1XZIA 2BGNA 4LYEA 2C5FA 3FSGA 4ZI5A 4F60A 1VXOA 3GROA 2VT6A 3IIIA 5AOAA 4BZZA 2B20A 5ALQA 4E46A 2ZYIA 3OURA 2PSEA 1ACLA 5AM4A 2RIPA 4MWSA 5CURA 1TRHA 2ECFA 3Q0TA 4GBGA 1L7QA 1N8SA 2B9VA 5K3FB 4BP9A 3DQZA 3MVEA 4M0FA 2PUJA 2XMSA 3DYVA 4AZ0A 2O7RA 1A88A 3R3VA 2WLSA 4F21A 5I8PA 2WFLA 3FCYA 4NS4A 1K8QA 4X6YA 5ALSA 1SFRA 3NOXA 1HQDA 4IH1A 1X2EA 3R3YA 4G4IA 1QONA 1XROA 5CW2A 3FWHA 3AIMA 5IH7A 4FBLA 1H22A 2DHEA 1EDDA 3IULA 4X6UA 5DTJA 3HACA 1XRLA 2WFMA 1A8SA 1EB9A 4UBNA 3A2LA 2PVSA 3M81A 2BUCA 1YS2X 3Q8WA 2OG1A 2GZRA 4EY7A 2WSLA 1UOPA 4FFWA 1QIEA 3CXUA 3TRDA 4OB8A 3WKEA 3MUOA 2Y6UA 4BVLA 5K3FA 1MX9A 4HS9A 3G02A 3KWFA 3S2ZA 3STTA 1Q83A 2IX9A 4H35A 3STUA 2WIFA 3PDCA 4YK7A 4L9AA 5CBKA 3G9ZA 5LZ7A 4GI1A 4BP8A 4E14A 5JD6A 4I3FA 2VJCA 3OTQA 4UBMA 1EX9A 4EB0A 5JALA 2HM7A 1VE6A 5D6OA 3D2AA 5LKRA 1GPNA 4N8SA 1WPXA 3W05A 3G9TA 4BCCA 1XQYA 2D0DA 2WG0A 5ESRA 5HCUA 4QZVA 2VF2A 3DL4A 3C6BA 5DLPA 5K3EA 2XMBA 3WIBA 1BS9A 2XUJA 5DNVA 3I6MA 1F0PA 1EB8A 1JMKC 5JIBA 2LIPA 1UOOA 3FNBA 5KWJA 3GBSA 1IZ7A 1NU8A 4X95A 3HSSA 4PNZA 2CJPA 4FLEA 1WB4A 3STWA 4XWGA 2WU4A 3H2JA 1JI3A 3BXPA 2HU7A 4ZGBA 4X6XA 4MWTA 1CQZA 1MAHA 1ISPA 2AJ8A 5FOQA 1BROA 4BAGA 4QWWA 4Y7DA 4GXNA 3AILA 3IA2A 1XZBA 3IUJA 4Q34A 3EF3A 3K6KA 2PU7A 2K2QB 1MX5A 3PFBA 3C5WP 4C87A 1P0MA 1QFMA 1B6GA 4HXGA 5FUMA 4KR0A 5AM0A 4MXDA 2Y2UA 4Y2RA 1ZD5A 2XUFA 4ZRDA 4CCYB 3IUMA 1MNAA 1P0QA 3H2GA 3F67A 4PV7A 2PL5A 5JAHA 1Q84A 1XRRA 2OCIA 4KE6A 1J1IA 4NZZA 3H2IA 3GELA 1K6EA 3ESAA 1WB5A 4Y2YA 4AZ3A 5AKJA 1QIIA 4DNOA 4KAJA 1BU8A 5K3BA 3ICWA 2UZ0A 1EVEA 3T52A 4ZWNA 1G5FA 1YAHA 1IUOA 3ZPXA 3QPCA 1EDEA 2GBIA 1XZEA 2ZYRA 1EINA 4RE6A 4DMFA 1ZJ5A 4I4CA 4OCZA 1IMJA 2ACEA 4U2EA 1QTIA 2HFJA 4QDOA 4A23A 2I3DA 3DKKA 2PSFA 3DCNA 2C0PA 5ALRA 4UBOA 4EY8A 1QO9A 3V1MA 3IURA 2CB9A 2DQZA 5AI9A 1KEZA 3DS8A 3WJ1A 3WKAA 4K6KA 3WZMA 4U2BA 3WKDA 3LIPA 5ALJA 4Q3KA 1XRPA 5HK8A 2HRRA 4HZGA 1Y7IA 2XUOA 5AOCA 2OCLA 1XQVA 1XKTA 4CCYA 4E15A 1ZD3A 5A6VA 2QJRA 2HU8A 1BEEA 1LPOA 3FLEA 3WL8A 4P9NA 2QMQA 4LHEA 1XRNA 1R9NA 4Y2JA 4QDXA 5ALVA 4J0CA 1DX4A 4A5SA 3PE6A 4KE8A 4HVTA 4ZV9A 3KWJA 1CUHA 5CT9A 3JYHA 1E89A 1YB7A 3ILSA 1PJAA 5AKYA 1GKLA 3HZOA 5JAUA 4K2AA 1Y7HA 3EQ9A 4YX9A 3ANSA 5ALMA 3O9VA 4ARBA 4UFOA 4AN0A 1EH5A 1R88A 4DNPA 2JEZA 3O4IA 2PU5A 4OD0A 1UFOA 2QR5A 4AB1A 3HYSA 4GECA 4UHEA 4GDMA 1N1MA 3PF9A 3V1KA 3WWPA 2CEKA 3OOSA 4X93A 3OG9A 3CN7A 2OGTA 4HAIA 4OUKX 5K3CA 3WL6A 1ZD4A 2RGUA 4BC0A 4DTCA 3O0DA 1CPYA 2AJCA 1EXWA 4BAUA 4Y2SA 2XQGA 4LXHA 1UOQA 1K5PA 2JGLA 3JWEA 5ALTA 4DM7A 5CRIA 2GYWA 3DD5A 2WU3A 1CUZA 2H9YA 5FV4A 2YASA 3D0KA 4B6GA 1DWQA 3QITA 4EZIA 3WLAA 1T4MA 3PFCA 2ZSHA 4X92A 4FOLA 3QYJA 2ROQA 3P2MA 4EUSA 4QWMA 4KE7A 1QFSA 4KACA 4CIAA 1JFRA 5LZ8A 4FNGA 2BGRA 1WCYA 3AFIA 5LYYA 1EVQA 4H7IA 3LIIA 4UUQA 3DEAA 3N2ZB 2VJBA 2WG2A 1UXOA 4TGLA 4BYMA 1VXRA 2I78A 1DWPA 2WUDA 2PSHA 3C8HA 4EHBA 4Y2QA 3I1YA 1VZ3A 3VVLA 4BAZA 1VOTA 4UBJA 3D2CA 4QDUA 4H7JA 1U65A 4ITVA 2JGFA 4H0CA 3STYA 4BE9A 3WA7A 3HC7A 4BTLA 3B5EA 4GHWA 2QM0A 2OQIA 4AO8A 3FVTA 3STVA 3WJ2A 1L7RA 5DYYA 3IB3A 3GUUA 1CLEA 3M3DA 5AK4A 1LPPA 5AM2A 2HIHA 3I1IA 2XMZA 5AKKA 5YASA 1G66A 2XQFA 1DT3A 1GQSA 5EHNA 4UBIA 4BDSA 5JZBA 4BVJA 2V97A 3U1TA 1YB6A 1BN6A 2JGKA 3OM8A 2XUQA 4KJXA 1OILA 5AI8A 2OLEA 4J0IA 2WUGA 2DHDA 4ZXFA 5AP9A 3ZLUA 4V2IA 4F5ZA 4JH0A 3DOHA 4MEAA 3G0CA 3R3UA 3LS2A 3FCXA 4UHFA 4H7KA 4LXIA 3VJKA 5LZ4A 3A6ZA 2Z5GA 4G5XA 3CCCA 5HK9A 1GT6A 4QLOA 3UUEA 3EIOA 1XLVA 1WHSA 1CUFA 1MN6A 3BF7A 4B85A 3D5EA 2JEYA 3LLCA 4JUIA 4DMHA 1JJBA 2OGZA 5AKGA 2JGMA 3HRHA 4BE4A 4W1RA 1DTEA 4OU4A 5JAPA 1XZAA 3ESBA 2H1IA 2IIVA 4Q3OA 3VJMA 5BOVA 3IDAA 3C5VA 4WDQA 4FDMA 4CG3A 5ALLA 1QE3A 3BE8A 4J0KA 4UFPA 1XRMA 2HA4A 4IH4A 3EQ7A 4AXBA 1XQWA 2WHPB 1E5TA 1CVLA 5AK5A 3A70A 3G9UA 5AK3A 1EDBA 4AMZA 3O95A 1TCBA 1GQRA 2HU5A 1C7JA 3WA6A 3IVMA 2WJ4A 5CH3A 3AZQA 3H18A 4X00A 1ZJ4A 3VJLA 1HDEA 1UK7A 5T4BA 1W4LA 2AXEA 2CZQA 3QBJA 2XMGA 1M33A 4Q3LA 4EY5A 5C7YA 4M0MA 4K6GA 2DHCA 3I2KA 2XUPA 1A8QA 4Z49A 2RI6A 1YAJA 3NUZA 3H04A 4H18A 5CXUA 4B82A 4B0OA 1LGYA 2XI4A 3C8DA 3N0TA 2QTBA 3DOIA 4BB0A 4DMCA 2WUFA 2Q0XA 1BEZA 2CMFA 5DWDA 4OB7A 4CFSA 1NX9A 3GFFA 5AIAA 4C6HA 1AZWA 5C8VA 3TGLA 5ALFA 5C8XA 2XUGA 3WK5A 5ALPA 1MO2A 4TPKA 4ARAA 5K3DA 3ED1A 1F8UA 3AUKA 4J0HA 1ZI6A 5BWBA 1AUOA 4PO3X 3CN9A 5ALUA 2VEOA 5CMLA 1HKHA 1UK8A 3HI4A 1GPKA 3R41A 3V48A 3C43A 5EIAA 2CUTA 4G4GA 4G1FA 1MJ5A 5JAOA 2Z3WA 2FUKA 1CUVA 1Q0ZA 1QLWA 2RHTA 5J3JA 4ZREA 1H2YA 5AKXA 3WWOA 2WTNA 5CTAA 3WI7A 3K2IA 4W1PA 2Z8XA 4KEAA 4LXGA 4U2FA 2VAXA 3L1HA 5A2GA 5ALYA 5HF5A 1HL7A 3DKRA 5ALNA 1RYYA 4M0EA 4BC1A 1JKMA 2PX6A 3HLKA 3YASA 5A7GA 3A2MA 1CUBA 5CT6A 2PKYX 2O7VA 1EHYA 3RM3A 2GYVA 2ZJ6A 5AOBA 3H17A 2XT0A 1CUDA 1EI9A 5LZ9A 5A62A 2XMRA 2JGEA 4FWBA 1YCDA 4RNCA 5SYNA 1LZLA 3DJYA 1TQHA 2WJ6A 1J07A 2YYSA 1I6WA 1MAAA 2XB6A 3HEAA 1ZGBA 4UBLA 4W1QA 4HXEB 2WTMA 2CBGA 3O4HA 4DGQA 1P0PA 5AI4A 1B41A 1KU0A 4WCVA 2R8BA 5HF9A 1H2ZA 3FSGD 4GWLA 3WK9A 2WHRA 4B7ZA 3MGAA 3SWWA 4RPCA 1IZ8A 3B3QA 1QGED 3FVRA 2WHQA 3DNMA 2V96A 1BRTA
chains in the Genus database with same CATH superfamily
3G7UA 3HPRA 4HATA 4LXQA 1K7XB 4FC6A 3T9CA 4D44A 1BD3A 1JIKA 3SLRA 1X1AA 1G19A 1YS4A 4INPA 2E55A 1SEVA 1I0ZA 1JU4A 3OICA 3SD7A 3GGOA 3HR4A 3VYRB 4BBZA 4DCJA 4IIYA 5CVUA 1G8JA 1RWMA 2DT8A 3JRXA 1M2OB 3TJZA 3AB8A 3CUUA 4TZ0A 3QGMA 2QLNA 4US0R 1ADJA 4HC4A 2J7PA 3AG5A 3E22A 1EE1A 4WXPA 2AE2A 4XGRA 5DM1A 1CEYA 1RR6A 3I8SA 4JJZA 4KL8S 2DUMA 2H1LA 1R3DA 3QMVA 4CPDA 3TX2A 3KHSA 2HW8A 2IYVA 5ALEA 1QH8A 1OIVA 1FJ2A 1ZC3A 1JNXX 3G89A 3J81k 1DELA 3NR2A 4TX1A 3SI7A 5D87A 1JMYA 4W5HA 2HJHA 4L50A 4DEXA 5J47A 4L0MA 3RVMA 2ZJ5A 1EDZA 5CB0A 3W4JA 1C0IA 1G5HA 4QQNA 3DPIA 4Y9DA 1ZJJA 2QSJA 1XMVA 2WHEA 4F46A 3I04M 2WSBA 1Y48E 4TYMA 1HSOA 3TLAA 3SJUA 4A27A 4DDTA 3IE1A 2YY6A 2WILA 4DR1B 1W4BA 3ZI0A 1Q20A 3B9BA 3RV4A 5JASA 1FDTA 4OREX 1I7DA 5H5JA 1G4AE 2CLIB 3K6RA 1UC8A 4C4YA 1XC7A 3QXGA 4Q5IA 3CT6A 3P52A 4WFKA 1DKMA 1X7YB 1IOWA 5L45A 3HZRA 3P9SA 5G0SA 4I1VA 2FMFA 1NR7A 1ULAA 3K2EA 1B7GO 4ZAXA 4HVCA 1CUIA 2VO1A 2IYFA 4KQIA 4ZVNA 3OOWA 2IOFA 4BMZA 4NE7A 3V55A 3AVXA 1G8FA 1OAAA 3OECA 3KWLA 4YJGB 3JQ9C 3W34A 3ZV5A 5CVCA 3KFXA 1I9GA 2D54A 3UGTA 4LE1A 5LQJA 1KMMA 2L2QA 4JFRA 4NBSA 3WY9A 1RI5A 5L40A 1IATA 2FH5B 5EUCA 1D2CA 3I5AA 3VI3B 2ZBDA 5ALKA 3GA7A 1QHIA 1OBFO 2WUWE 5G1NA 3S40A 3KKMA 4O6VA 3PSAA 1D5CA 3C3WA 4FCWA 4LZPA 3WLPA 4AICA 4EY3A 4K40A 3PWZA 3NBMA 4N18A 1UT6A 4TQUS 4KBYA 4OXXA 1B0AA 4OGWA 1ZH2A 3QFRA 4OFWA 5DJ5A 4JLBA 1MAVA 1A1VA 4X1IB 5B6JA 2QL9A 1OC4A 1T3ZA 2C4TA 1JAYA 4EHKA 1HI9A 1FMCA 2COKA 1Z36A 2X13A 3T0FA 4I8DA 5IG2A 4YRCA 1C0PA 1CQWA 5J2UF 3GZJA 4PQRA 1JZSA 3QKSA 4UDXX 3EPRA 1I5EA 3O1JC 4J9UE 5KYYB 4MW5A 4OX9B 4M1SA 1FFAA 1S4MA 1YQDA 1C4KA 3HCPA 2QUBA 5C9ZA 2IIPA 1R5NA 1HA3A 3DDZX 2ZRAA 1P91A 5KBYA 3BCHA 5K8IA 2WF7A 1JQLB 2CKDA 1FVXA 4C4ZA 2H7YA 2QJTA 1QJ4A 3R24A 1TZ2A 3GLGE 4OB6A 2GRUA 1MO4A 1VPDA 2X2FA 3WGKA 4D96A 1AHIA 3DLBA 1D4AA 3AESB 4BNHA 2PXXA 2Y93A 3FIUA 3HO6A 1JT9A 2O54A 1QFYA 3O94A 4P5PA 1DDIA 1U5CA 1T2NA 2H1SA 4KNWA 3UC5A 5FQNA 4AECA 1DC4A 1G3UA 2VTVA 5CITA 1RAIA 1Z06A 1H42A 1LQ2A 1MQAA 3C16C 3Q3IA 4OSOA 3LLMA 2PN1A 3HR7A 2E5LB 1L7EA 2IHNA 3GRCA 2RGCA 2VAPA 4QJ5A 4A03A 2WD9A 1CZNA 5BSHA 3F5MA 3U19A 2FFRA 3M0EA 2RH4A 1VZ2A 3D4IA 2ID9A 3PNSA 4MWCA 4MQ4A 3VR2D 3THYA 2O8CB 2V0NA 4LJ5A 1ONPA 1FYEA 4TMFA 2W7TA 1TK3A 1UBEA 2RG7A 4MRAA 5JJ5A 3BRCA 3U7QB 1WLSA 2QD2A 4NQZA 3JTMA 1K08A 2JJ1D 2IOFK 4PIMA 3I2HA 2GLXA 1T2FA 4RS3A 3A1SA 5ITSA 1GRVA 1SU4A 1R8XA 3VR4H 2YKGA 1ZD8A 4NPHA 4BJ3A 1DKPA 1KVUA 3W6NA 1OAKA 5A4MS 2OCYC 1KMNA 4ZCRA 2XRZA 1JBQA 1GFWA 1CB7A 2HI0A 4X91A 2PRKA 3JZMA 4WFQA 3BE6A 2YWFA 7ABPA 5COBA 3W9UA 3N5KA 2OCKA 1THGA 3FOBA 1O7JA 1YR1A 2PBFA 4EQZA 4D5GA 2QVGA 1FSPA 4P7KA 4HTFA 4LQLA 1R4NA 4RF5A 1N2XA 4LSWA 1SVNA 4V0LA 4RIHA 1TO1E 1G8YA 2ZLBA 1GNPA 4UMVA 2Z95A 3HJHA 4KSBA 5DHFA 2J3LA 1WR8A 3GFTA 1W36C 3GFPA 5JLJA 1G7CA 1CRQA 1FXWF 3DBHA 4TV9F 4JEIA 5DTIA 4NS1A 1CUXA 1VG1A 4QGHA 1ZGCA 1RKVA 3BB4A 4FYMA 3BH7A 1EBFA 3ASZA 3OM9A 4GKAA 4L4SA 4OXRA 1J9GA 2VPQA 3O8RA 3EBPA 4IXMA 2AI1A 4QOSA 1L5VA 1Z0FA 4DRXA 1P7YA 1TGVA 4PZEA 2R68A 4RO0A 2F3UA 4C3OB 3OPXA 5C35A 5JQGB 2NPFA 5DGCA 1X0VA 3I0ZA 3WWDA 2LXNA 3RJ5A 1EX7A 3EQ8A 3LRPA 3TN7A 4D9JA 4D8VA 4KUGA 2IU0A 4DLVA 5HIKA 5ILGA 1B93A 4HFMA 4IXDA 2Y4NA 5LA6B 1E7YA 4MR7B 4Z7NB 4CHTA 4B6FA 1DKOA 4R2LA 1OBVA 5D7BA 2DFLA 3U7QA 3EIUA 1DO8A 2PTGA 1HDGO 4NCHA 3G2NA 4MIKA 3MSXA 4UMEA 1H2XA 4H3SA 2RB5A 2IY9A 3G0GA 1G5QA 2A5FA 3T3MB 1E32A 3IQHX 3RSGA 1T3HA 2CLCX 4J6EA 4MVJM 1FQJA 5E3IA 2JFYA 2BFEB 2GPTA 5AKHA 1OROA 2PIDA 1KR2A 2B4AA 4P53A 5J5VA 4IVRA 3RIHA 3UOAB 1JAZA 5KHOC 1SPXA 2HLNA 3V6LA 1L9KA 1R8QA 3IXMA 3L4BA 4CTJA 4DJFC 3HEBA 2A1IA 4L3OA 2ZULA 5AO9A 1JA0A 1Z0AA 4WH0A 1DC7A 4KIFA 1KP3A 1O94C 2VJDA 4EECA 1N5IA 1XTIA 2E37A 4YPVA 1O5OA 5DM70 3T7AA 3TGPA 2B8WA 2SCUB 1KRWA 3Q41A 3H1FA 1GXSA 1JEEA 2NU7A 3L2OB 1EVLA 4FGKA 4N3CA 4GD3Q 1FYVA 3DULA 3AR7A 7GPBA 4WA8A 2GD6A 5DWVA 4OBWA 1C4XA 5BSEA 4HLDA 1IJBA 4QGGA 1LUAA 5FI5A 5BNWA 1P18A 1G8HA 3VZQA 5AKLA 5FPPA 5I9IA 2HDHA 4BEBA 3LW7A 1S3GA 4C01A 4D98A 6NULA 3AJRA 4DYHA 5WRFA 5JVDB 2QYHA 1UP6A 4KQWA 2BZ0A 2C0QA 2I4RA 2V7BA 2FWNA 2X77A 5FV7A 1Z2OX 5M3BA 4YT8A 1H3NA 1W6UA 4S1OA 2VH1A 1V3TA 1QBKC 4WY8A 1SOVA 3J7TA 3M9XA 4MUXA 1YQXA 5DLQC 4ZZIA 2P5SA 4GXTA 5MN6A 3TKAA 4FEEA 4QGBA 3PFFA 5ULLA 2PZ8A 4OPMA 5EAIA 4E6PA 2GJSA 4Q6WA 3HLTA 4BJ6A 1PFQA 2FWJA 3OIYA 3INGA 2HYIC 3T4UA 3GWZA 4XFDA 5CM9C 5AESA 4D4HA 1OBCA 5F1PA 2DSNA 2HN9A 3BWBA 4LI0A 3L9WA 3VYWA 5HQTA 1KKLA 1H1DA 5D3KA 1AKYA 2E4YA 1GGMA 3PQ6A 3IBFA 5AVRA 721PA 5AJWA 3H2SA 5K6TA 1Q1AA 2R8OA 1RRGA 4NYMR 2P2YA 1Q0RA 4BMOB 4LN1A 4KPYA 3JV7A 2NUTB 4HQ0A 4QUDA 4R6XA 1I2MA 3DW3X 4RIGA 3P9PA 3BIXA 1Z4JA 2VAVA 4PSKA 1CETA 1OE0A 1K63A 3HKDB 2IY7A 2QTGA 3QF4A 4GLJA 1WZIA 5EMMA 3BDVA 4R8MA 3H9CA 4YRTA 4C89A 3HJCA 3BEDA 1Y81A 1QO0A 3B70A 3OIDA 3ZZTA 5L8VA 3FBWA 1V7QA 2SBTA 5FD8A 4RTRA 1UAAA 2X4IA 4R8VA 4CG2A 5F7OA 5BW5A 2KJQA 1R1DA 2VP3A 3F7NA 3MUEA 1QK3A 4YMWA 1AMOA 1UP4A 1MG0A 4GMDA 2OYRA 2W4IA 3U1BA 3I5MA 4DUZB 4OHVA 3RS4A 5BN5A 4R1NA 4QOEA 5E9AA 1OU0A 2EARA 3IV9A 4LJ9A 5KNCD 2JLVA 2IYPA 1PT9A 4FKBA 3E9EA 5C1BA 3RWOA 1N5OX 4OYLA 1CZLA 3K6JA 2W22A 2AG1A 3PUKA 4UD2A 4IIFA 3SXUA 2C7RA 3OP4A 1Q1BA 2ACKA 3HKEB 4C0WA 4PN3A 3AVWA 3MN1A 3L1JA 5FLXA 3G0HA 3KB2A 2BELA 3TZQA 2Q8QA 1KDPA 1XKQA 2A9OA 2Z2KA 5PNTA 1PQWA 1CSEE 3GZTB 4MO2A 3CLTD 4RJKA 2RG1A 5EIFA 1CUWA 1Z0KA 2R7NA 5KOHA 2DWOA 3WGJA 2NMVA 1NASA 2EJVA 3P0HA 1W5AA 5FL7D 4OYRA 3S70A 3KQNA 3NALA 4PGAA 2QUZA 4C03A 4IQFA 5TQVA 1TCCA 1DBVO 1GEGA 5DO9A 4D6YA 1JBKA 1WW3A 1QVRA 2H8GA 3OZRA 3QMWA 4LKOA 5EMLA 4E12A 2VHVA 4BNUA 3HLYA 3KQVA 5GPBA 1YXMA 1MNQA 3OQIB 2YFHA 3FTNA 1HG1A 1SVKA 3RUFA 3H4TA 1MENA 1TAGA 5CYPA 4IIVA 5C5IA 3COWA 4BLUA 2AT1A 3IBTA 3WLSA 4AIRA 1QGOA 4OJKA 4JVSB 5A4KA 3KKLA 3EDOA 1XZMA 1YS1X 1ZH4A 2CW5A 3KEMA 4PFJA 4RKEA 1DAHA 3AJDA 3ESRA 1SQFA 3EIEA 3G2LA 5GONA 3SX4A 2SKCA 1M34B 1L7DA 3QW2A 4IJ6A 2OGSA 4P34A 5LWQA 3EG9A 4EJSA 4GW3A 1Z83A 2D4AA 5F77A 4EQ6A 1XB2A 3COZA 2QPOA 2ZUEA 3QI2A 2B99A 4KLRA 4W9RA 5SZKB 2X5XA 4GDFA 5C32A 3K9GA 3IBSA 3Q7PA 3QUTA 4Q4AA 3K0SA 3OFND 4XR9A 3AZOA 3FR8A 2OLJA 1ZKMA 3IS3A 3LW8A 4JGBA 1EM6A 4GOXA 4BQPA 3PHGA 3QV2A 1GAEO 1XVAA 2AG6A 3BMQA 4HGQA 4ESEA 2LKCA 4LFCB 2VP2A 1ORRA 1G5RA 3MJSA 3NANA 3JR3A 3OZGA 4HMOA 1C7IA 1EXDA 1Z0ZA 1HX7A 2CYAA 3O0TA 4J07A 4W82A 3Q8MA 2PH3A 2QG6A 1W5FA 4ZARA 2JFUA 5F12A 1XLTC 1LW6E 3D0QA 4YRPA 2F00A 2W2KA 4Q19A 2HRBA 3MUNA 1TKBA 4NBUA 4R1LA 3SEFA 2AF4C 4C3ZA 1QYCA 5HF6A 3AOEC 2BHRA 2DBRA 3VUEA 3FUVA 3WLNA 1ECBA 1NT4A 2RKOA 2D5IA 4CDGA 4ARVA 1P74A 1MO6A 2WEKA 1L3IA 3H11B 3HO8A 2XOKD 4MGHA 5K6AA 3DPUA 1NSTA 2AEMA 3FGPA 3L6EA 4L0CA 4Z9AA 3PS9A 3ISJA 3JAKA 3KYDA 1EJ6A 4GC5A 4M0KA 4ME6A 4RTKA 1RXVA 4OTZA 4TS3A 4PF1A 4MEBA 1GGFA 1OZGA 3JSXA 3L82B 3UTCA 3OO1A 1RE1A 4DE5A 2HDWA 3UXMA 3INYA 2F64A 2QKYA 1QYXA 3CRZA 3OPMA 4GQAA 5EJMA 1P6XA 2EGGA 2I2BA 2JIRA 3NM6B 1E7RA 2J3HA 2VHUA 1H6BA 5HBRA 4FS8A 6PFKA 3GT4A 3OMXA 1OGIA 3KE9A 3R09A 1DAGA 4ND4A 3ZWWA 5KYWA 1GR0A 5IM5A 3HK2A 1R0WA 2GAAA 3OT1A 4NIMA 3DZFA 3BREA 2Z3VA 5JMOA 5AW9A 2RHJA 4G5SA 2GN4A 4RZ2A 2CFOA 5DFAA 5IT9A 2Y0CA 1QDLB 5UKDA 4LG1A 3C7TA 2IOQA 1XA3A 1NVGA 3GFVA 5EZSA 2PGLA 4CMCA 5EJAA 2FETA 2I1WA 3C8MA 5TMDA 1WKCA 5A71A 5TQ2A 2QUAA 2XWPA 1NUQA 1YOVB 1GVNB 1JDUA 1X87A 2YV1A 2PGJA 1ODCA 4MIYA 4ENPA 3K92A 1JT2A 1BH6A 1H2BA 2JGIA 5DSTA 4ZOEA 5C18A 1OVMA 2ZRFA 2OILA 5HKKD 1G5IA 3AHJA 1OT3A 5BYKA 1XRSB 2ZITA 4BNMA 5HQ3B 4KX5A 5IDXA 1MAUA 3R6DA 1N5MA 4Z7JA 2WF5A 1AGYA 4EUHA 4UNQA 4BB5A 3TRHA 4MULA 4Y7CA 3WBKA 1N7GA 1T5OA 3CKLA 3Q3GE 3Q6NA 1GM5A 1NVAA 1PV2A 3X43A 4LSMA 3O6VA 4K9QA 4UCFA 4F2GA 5MF6A 4Q3EA 2TYSB 5JISA 1S2MA 4JLMA 1Z9BA 4QBKA 5CR9A 5IJ9B 2WIGA 1FS4A 4ENWA 1CB0A 2HD4A 1VGQA 2FG5A 4DHEA 3F49S 4V03A 3PRKE 1KIFA 3LQ4A 5K5EA 4Z1MD 1XZKA 4BNFA 3BJMA 3H9EO 1XR3A 4WKOA 3FOZA 3WGYA 4OOFA 4MRNA 2W2MA 3FUXA 3LLSA 1WDKA 4XA8A 5IVHA 1X74A 3GVIA 5H82A 5A3SA 3NVMB 2P6PA 2W2XA 3X3HA 1B4DA 5IZCA 1F9EA 2LW7A 5KTPA 2HIMA 2FHPA 1UXIA 2J5BA 4B0PA 4NJEB 1QIMA 3EEQA 4NV1A 1EM8B 1KPHA 1E3SA 1JLLA 1PGJA 5HBGA 4RV9A 1GQYA 4KXLA 4PZYA 1JGTA 1H2FA 5FL3A 1RXYA 3CX7A 3TW8A 2BAGA 1Q7EA 3FYTA 4NAHA 3LKDA 3G7NA 4NR0A 3VNQA 4C6TB 4CKCB 4XD7A 4C2UA 3OCZA 3FTPA 1LX6A 3B38A 4EZEA 2ZRBA 3CBGA 3ZU4A 1F6BA 3BL8A 1HG0A 3L01A 3H2BA 3HBFA 4C7XA 4KQ6A 3GGJA 2C4HA 3K2QA 2VWQA 1SCKA 1FSFA 4GPIB 1RWKA 4KE9A 4YGYA 3QXSA 3ZYZA 3D1LA 3GJXC 3HHEA 5L3SB 1YCGA 2VI5A 2VCHA 4D8UA 4MVYA 1JVSA 1E9FA 1ZAKA 4KDFA 3I9MA 2V6JA 4NMXB 3OQPA 4I9UA 1GSOA 2OL4A 1CUEA 3G5UA 3TRJA 3ET5A 1TJ4A 1K0UA 3ILYA 4J1QA 3R9KA 4QDZA 4Z0TA 1S0UA 5HQ3A 4IMJB 3VO1A 3WHIA 5BWNA 1JHUA 1CUAA 1KY3A 3FPHA 4EF6A 4CQMB 5IPFA 3VOBA 1YZFA 1W88A 5ALDA 2EFHB 3TCXB 2FUCA 4XSGA 1U2SA 5J9FA 1BOOA 2VPIA 4YCAA 1ODSA 4RJTA 3CUEF 4Q1VA 2WJAA 3MBIA 2C98A 1UZLA 5J2TF 1LA2A 4RCVA 4DZTA 2PS1A 4PLHA 2YXPX 2GI4A 3WSVA 3HJAA 2IRWA 3GJ4A 5HUHA 5I7UA 2J48A 4DANA 1Y1KE 2MSCB 1YJQA 2B9EA 2EJWA 2XUHA 1JPUA 2WM2A 3EYWA 4BKMA 4F2HA 2OAEA 1AXRA 5KJCA 1WVGA 1OWOA 1SQ5A 1Y8RB 4WEOA 1GNQA 1O9HA 1DX9A 1HWYA 1TVCA 1U31A 1ZRMA 1SG9A 4A15A 3H83A 2Y68A 4LV6A 4FN5A 4RV4A 5D5PA 3EEFA 4ZO8A 3TAUA 3E27A 3F5QA 2QGFA 5LP1A 4DV2B 2X6QA 1H23A 3OLZA 3GFOA 2I4NA 1SO8A 3GH3A 4HG2A 2A9QA 1L7AA 4FJ0A 4HYEA 1JJIA 2P9TA 3RKSA 4CV1A 1YZUA 3OI7A 4FHDA 4JEMA 2W2LA 5CFQA 1GTRA 1QR6A 1YKFA 3QSYA 1OXMA 1KRHA 1EVJA 3JQ6A 4ZEMA 2FR0A 4ENSA 1PEYA 3OETA 2PT9A 3G2KA 2IP1A 4GM1A 1K66A 4ZC8A 3USZA 4GF5A 4Z5XA 4PU0A 1KZ7B 3BD8A 3D6TB 2A0XA 2VS1A 3GJ6A 3G6KA 4HP8A 3WX0A 2AEJA 4E2FA 1E7MA 2Q3DA 3TX6A 2ZIWB 3PYLA 3QPUA 5F2OA 4BCBA 4EPYA 3VDNB 3F6EX 4HNRA 3R3XA 5FQOA 1M0EA 4XJVA 4AZ3B 2NO7A 3JQFA 1PF7E 3MHTA 3UBTA 2RHDA 3KQQA 1ISIA 4POAA 1V3QE 5AHWA 3VDMA 4N12A 3RT7A 1SPBS 4H6XA 1ODLA 1PD0A 1WM1A 2J9GA 3R4VA 2PUVA 3SJAA 1AA9A 3SQNA 4BFYA 4TWJA 3PYMA 4XI9A 1NUPA 3ZIAD 2H3EA 3C5HA 1SQ6A 1OAOA 2J4DA 2HFKA 2I87A 4BZWA 4HTFB 1N5KA 2C8KA 4IV5A 2BDUA 4IUBS 1BJKA 4U2DA 1DJMA 4FT4A 4J0QA 2JFGA 1ICIA 4LWQA 1UK9A 3RYHA 7REQB 4H7DA 4F92B 1WZ2A 4QJIA 4M54A 1N0IA 2ERXA 2P6UA 3TUJC 1EK1A 1S8OA 4B8ZA 3MBOA 2GUWA 3EQ6A 2ISQA 4MJ3A 4OG2A 3PIRA 5EE1A 4DPMA 3QWHA 4CT0A 4E22A 1FIUA 5FWXA 4MNTA 4JJ8A 1NGSA 4JNCA 1IRXA 4LECA 4DRXB 1IN1A 1X8JA 3O4JA 3EARA 1A7AA 4JKOA 3H2KA 4MW0A 2ZIAA 2A67A 2Q0SA 4LMPA 5D01A 5DNWA 4MGKR 4EPRA 1AUPA 2DQSA 2AB0A 2XQJA 2O2EA 4N6GA 2FE4A 1NZJA 5FWDA 3SAJA 5KDLA 3MT8A 3QXHA 4NH4A 2FXVA 3SS7X 1TJNA 3T7EA 1I4DD 3PQ5A 4C6RA 3HDQA 5BWCA 4BFXA 3T1QA 3E4DA 3TNYA 4F9FA 1KAGA 4GLLA 3L0IB 4I4TA 3P19A 4O4IB 1S2GA 2Z56A 5LN1A 2WT9A 3FJ1A 1TMKA 3K3PA 3A4MA 4P3KA 2J59A 4YRNA 1ML3A 1DIBA 5JRDS 1OX4B 2VC2B 1NW7A 2Q6TA 1E5LA 2RIRA 2QRKA 1BX0A 4P80A 3QWBA 3WLRA 4NWIA 1VE5A 2A0WA 2QTHA 1IVSA 1Z7YA 1TTTA 1AUVA 1JR3E 4G67A 4JBYA 1YBMA 2ZRLA 1U11A 3NP7A 4G36A 4GMHA 4TLLB 4TMZA 5D1HA 3M4ZA 3C98A 1WSWA 5DHUA 4UHBA 4ERNA 3G2JA 4FLMA 3EVCA 4UNPA 5TLSA 1O96A 4E33A 1KKUA 2GEJA 2GK3A 4JBXA 2WIDA 3RYIB 2XUAA 5CM2Z 3MGKA 3LDHA 3UJNA 2PZLA 4I8IA 5U9CA 1II8A 2BP7A 5BW4A 1MT3A 4DR7B 4KPEC 3PG5A 1ZOSA 2BEUA 1D2AA 3OEWA 3MSCA 5IBPA 5ISMA 1ZZGA 5G0VA 1P2UA 3GY0A 1JFFA 3RRXA 4NMMA 3RFTA 5AUNB 3CZ9A 4MV7A 3IOMA 1XDZA 3E7FA 2IUTA 3B6IA 4H15A 2P68A 2Y27A 9LDTA 3DZJA 1HTTA 1H94A 4ZMBA 1LCIA 3INRA 2XB8A 2JCSA 1T4CA 1XEXA 4RF3A 5AHKA 5LDHA 1U1GA 1PEDA 1P1BA 1UPCA 1OWPA 4LCJA 3K05A 4TWZA 5EJIA 5FR1A 3ND7A 5HFAA 1USKA 2FTKE 2W6QA 4UCQA 4B9EA 4RVHA 4HLUA 1ATIA 2HHJA 4XVRA 3WJAA 4O2BA 1OWMA 1X7HA 2HWKA 3IAS6 4G01B 2AMVA 2FPXA 2VHXA 4LDZA 3M83A 4UUOA 3UFBA 1A7JA 1G4HA 5CH5A 2PKCA 4YJ3B 1VSBA 3WZ2A 1B76A 1ORWA 2CLDX 4IIXA 5I7EA 2P8SA 4MP3A 5EMJA 5C0OE 2J9FB 1PJZA 3QVSA 4FDAA 2G82A 4XRGA 5HS4A 3SG0A 1RNLA 2OD9A 2PX3A 3GCDA 5I5EA 3T3IA 3ROQA 3GGSA 1ZVKA 4HT3B 4Q00A 1GV0A 2Q0QA 1EUDA 4GS5A 4QGFA 4C7MA 3SXPA 1Z4PX 2HH9A 3AVOA 4IDPA 2FEMA 4BECA 1I7SB 1RKUA 1GNTA 3LHFA 4D9KA 5L6MB 2O2CA 4NJMB 3U9LA 3EGOA 5CNIA 1RIIA 2QDKA 2X14A 5FUVA 3LTNC 3RBAA 4U5XA 1Z5WA 3NI2A 3JCZA 5D85A 3EOAI 1Y80A 2QRMA 3R0IA 1M2EA 4J0JA 4U7GA 3RREA 2N1MA 1IUNA 1CR6A 4UKDA 5AVQA 4OLAA 1IOVA 1JR3A 1OASA 3ANXA 3LCUA 3Q1LA 3VPGA 4NMWA 2Q8PA 2A7QA 4B3IA 2OMKA 4J03A 5JWOA 1LTKA 3V8EA 3BJEA 2O1EA 3DQPA 2RHWA 1JFFB 2C82A 3MCTA 3R3JA 1O87A 4ML3A 4IV0A 5LQNA 1RKBA 5KI6A 2II6A 3LWDA 1XA0A 2BTQA 4PO9A 4F8YA 1DJQA 4IILA 2FPPA 2HT6A 4PPYA 4EW1A 4B9AA 1V8PA 4H77A 3IPAA 3RS3A 4FI3F 1GTG1 4G1MB 1A5SB 1ORHA 2EQ5A 4DY6A 4G25A 1RTKA 5KYKA 3DD1A 1AKMA 3D6FA 2J6HA 1I1HA 2BFMA 2YIVX 4R2JA 3CO5A 4U9UA 3SBXA 4DCNA 3ABZA 5KHLB 2AJTA 1BH2A 1O1YA 1WCIA 4CM6A 3ICVA 1G20B 1RYEA 4ZU3A 1T3LA 1GYQA 4DV1B 2RONA 4CM4B 1P5ZB 3JD3A 3SIWA 4F9TA 1KPIA 3OF2A 2HUPA 2IU3A 5CK5A 1TM3E 2XF8A 4IGKA 1YDMA 9LDBA 4TLBA 3AF4A 2BFWA 3TQTA 3Q3HA 3DMYA 2FGKA 2JFVA 2C5LA 2MWMA 2X0NA 3GX1A 1PV4A 1PJCA 2FW6A 4ARZA 4KFSA 1TX4B 3D1VA 3FPGA 3MTAA 5A3QA 1BRMA 3KZCA 3PUHA 1JLRA 3GJYA 3FH0A 2QTRA 1ZYUA 4P35A 4MVJA 4R8SA 1M1YE 1VCIA 4CLEA 4UVIA 3RAEC 4DV5B 1K3UB 3DCJA 5IKOA 3VHXB 3IOCA 3FUTA 4HWKA 4L08A 4MV6A 2QWXA 4AX4A 1JYSA 4YUVA 4WBXC 4TS1A 5J1TB 5LR6A 1AMNA 5IVKA 2QXYA 2Y1KA 2P79A 5D3ZA 2ZI7A 3O2SB 3NWBA 5F9HA 2IZ1A 3MIZA 5CB4A 1FP4B 1HE3A 1O95D 4N6NA 4CV2A 7YASA 2WA2A 3U80A 2ALJA 3MTGA 3ETCA 1DDGA 2CZCA 4QUAA 3VR4A 1PJRA 3Q72A 3ZU6A 1QU3A 3ROEA 4KYIB 4XW2A 4D3XA 4X71A 3BUSA 1Q2XA 3JW8A 5T3UA 3RVKA 4XRRA 4O08A 2B94A 4MWBA 3RWMB 5AKEA 1Q15A 1GUYA 3AL2A 5GQSA 2A4KA 3C3PA 3I9NA 1XD2B 1CV2A 3MS7A 3OZUA 4O4JF 1CUUA 5BV7A 1H9BA 4AWXA 1IB0A 2ZDQA 1GYPA 4L2IA 1WW2A 3U17A 3IBCA 3N76A 1U2RA 1W76A 2R6JA 4FJ1A 5H3HA 3KSUA 3LCRA 3JARB 2WUEA 1ECPA 1TMGE 3UAVA 1JG6A 1KYIA 1P62B 5JATA 3F7MA 2GNAA 3DE6X 3GB9A 1WCIB 2KWIA 2MT9A 1GL3A 3G8AA 3R3ZA 4UPDA 1MFZA 4Y9SA 2F55A 4IX9A 1IPHA 1GLNA 4B6JA 1V2HE 2B34A 2V7XA 4TL7A 3W6UA 4CMAA 2L0XA 2WRZA 4LCEA 4C7KA 1OOEA 1T1GA 3GLKA 3NT4A 4OQPA 2NU9B 3Q3VA 3DYIA 3SQXA 3C2QA 5DOVA 4IOKA 2A5GA 4FYXA 1LBTA 2P6RA 2IWHA 3ZE2B 3PKJA 2Z83A 2JAUA 4M8KA 4ZVSA 5C34B 1R15A 4PS0A 3DAOA 2PD6A 3K8OE 2GLTA 3NUQA 3PPIA 3QFFA 4CM8A 4COOA 1I3OA 4OHUA 5K20A 2O2ZA 2AC2A 4QEKA 4EG3A 1XCBA 2BEJA 3R23A 2GYUA 2G5TA 2W6NA 4QLAA 3CB2A 1W4AA 2HC9A 2VKTA 4Z8YA 3MWEB 1T2UA 2GD0A 3IESA 3V8PA 2IEDA 3L93A 3VPHA 2CXNA 1IVYA 3O1HB 3ZI7A 2BISA 3ZDEA 4RTPA 2ZDGA 2UDPA 2NACA 2CDCA 4KXFB 2WWVD 2OB1A 1WUKS 3W9BA 1N9GA 4BNIA 1JLHA 4EPWA 1OH6A 3LTEA 2DM6A 3ESDA 3RYCB 2WA1A 1EFAA 2G09A 1Q3HA 2QRQA 3GJ5A 3QKIA 4ISBA 5KNDH 2XTJA 1QIGA 4UNSA 4OHXA 4F6CA 2A33A 1SWVA 1US8A 3W5HA 1R0CA 2XUIA 2ZE7A 1DU4A 3FOFC 2ZE8A 3DP9A 4IZIA 2GZSA 1QQTA 2CNKA 1Z0UA 1ACJA 3BGWA 4NFLA 2J0UB 4XIIA 1ZM2A 2WIAA 3ECCA 5TGDA 1N75A 4KFRA 5HFNA 1NU6A 1X3LA 1A9TA 1YNSA 1MDBA 1ZS9A 1E0DA 1SD5A 2VDKB 4HQ6A 2DFKB 3KTDA 3MWDB 4JJAA 1JYEA 4JVMA 1IOLA 4LPKA 4TVOA 3RBZA 5JNLA 2RAPA 2AWNA 3TW6A 3DA8A 1Y6ZA 4U7PB 1RJEA 3MRVA 3ZHVA 1M2HA 3KL2A 1R16A 4UM5A 2HK9A 2XXAA 1WBJB 4GKKB 3H8WA 3U7GA 2EKDA 3E61A 1NG1A 5DF1A 3C7DB 4E07A 1J2TA 5B4UA 1KJWA 4RXMA 1DXHA 1PNTA 5FLEX 2VRBA 1SXJD 3IILA 5FBWB 5MGBA 1KAQA 4MJLA 3PPVA 4X7RA 5F98A 2COEA 4FFDA 3IVGA 4NY1A 3RUIA 3FBTA 2HMAA 3K70B 3EIXA 2QN1A 4URHA 1SC4A 1VXOA 3GROA 2O7QA 1R0YA 2IHYA 4KQ1A 3ILVA 3I42A 4FW8A 1VJ0A 2CXXA 3UAGA 4MAFA 3OQIA 4ZO9A 1PWYE 4RAOA 1BFDA 4D1YA 3F6CA 4RD0A 1U2TA 3WV4A 5LWHA 2VN8A 1LDBA 3NUGA 3UMVA 2OT3B 2PLNA 5EHIA 4JI2B 1FMFA 1ES9A 1K6IA 2C1XA 3OURA 4LGVA 4EPVA 1KI7A 1UR5A 1KAMA 3EXHB 2QU7A 4Y0AA 5FPHA 2X6TA 3O1LA 1DJOA 4OQ4A 4YUWA 1TLFA 2C2BA 3H6HA 3ONWA 1JSRA 3U7RA 2E87A 4A26A 1YVDA 1D6MA 3U3DA 2RGXA 2DR2A 5CURA 1JLLB 2FVYA 5K0TA 1QC5B 4N7JA 2IVZA 2J3JA 3BSYA 5K8LA 1EU1A 4C29A 2V7PA 5ELXA 2O5RA 1F7VA 4RV5A 5KSYA 1UFRA 5KHAA 2DPYA 1JJ7A 2BSXA 1T1EA 3MVEA 3KKEA 2BDEA 1MEJA 5DVZA 3RSSA 3QYPA 3SOPA 3DYVA 4R5HA 4D57A 1UJBA 4BOYA 3RUCA 1ISJA 3R3VA 5K05A 3GMTA 1YZYA 4KVGA 4EMSA 4FUTA 5KDOA 2G72A 5L4NA 1YZGA 3MLAA 4IJQA 1KS9A 1AQIA 4AP9A 2JHFA 3CZCA 4NX2A 2PCJA 3FCYA 2ORVA 1ZH6A 1TK2A 3W5AA 1SC6A 3ENVA 3R0JA 5TVKA 1SFRA 3ABQB 4FIDA 1GTMA 1HQDA 2WPNA 1X94A 3U60B 3BA6A 4QVKA 1X2EA 1E2MA 3R3YA 5NLLA 2ZSUA 4BFWA 3EE6A 4FMDB 1UC4B 5E1DA 5B1YA 1TQ4A 1QONA 3OVMA 4RWZA 2G67A 3BWYA 3B6KA 4KRFA 5EVJA 5LCXA 2Y99A 1T2CA 5G4KB 4D9CA 4WLOA 4M83A 3FFXA 3CBQA 4JP2A 4LX0A 5TRTA 3FWHA 4WXMA 2AG5A 1C2TA 4FBLA 3MJEA 2DHEA 3AONB 4FBGA 1WNTA 4HPXB 1CHNA 4J8PA 4X6UA 1GNVA 2X0FA 3SJZA 3GFRA 2BWJA 2KB0A 3BK7A 4FE4A 4WOBA 2QVZX 5BQOA 3O8OB 3QLVC 1GV1A 2PRYA 3TCNA 4R1PA 1KYWA 4ZKEA 4M1MA 1A8SA 2H1HA 3GRUA 3MMSA 1GTSA 3Q9SA 3IH5A 3KR2A 2PVSA 3M81A 4NE2A 2FPIA 4N9WA 4DR5B 4EHNA 2QL7A 1YS2X 4A8JC 4RTLA 3PQFA 1OF1A 5K8TA 1XMPA 5FL7A 4EY7A 2C4KA 3SFVA 1H2RS 3FRJA 2DKNA 1E58A 2H07A 4LVCA 4D9GA 3TK1A 1B00A 3W78A 4LJKA 1MP0A 5JQGA 2FE1A 2FMUA 4OB8A 5GONB 2RBKA 2EWMA 2XTMA 1CNEA 3ABRB 3PL1A 3KJHA 4WEQA 4RW0A 3IDQA 5BY2A 3TRKA 3W8EA 5K3FA 1MX9A 2LCFA 2Q3BA 2ZUSA 3K4QA 3PL5A 4OV6B 3UWDA 2W6JD 4A6XA 3G02A 5LC1A 2AE1A 1J0XO 3N5CA 3KPYA 3ZVRA 2ZT6A 1X42A 4BKRA 9MHTA 1Q74A 5TQJA 2OBMA 3STTA 1ZBDA 2DLDA 1VTKA 3D4BA 2ZUWA 5FHQA 4PZAA 3QTBA 2PT5A 4GBMA 1R0XA 3PDCA 4YK7A 1OFGA 5JU6A 4N48A 5CBKA 4LYYA 1O6ZA 5HILA 1JS1X 4L4UA 2CHVA 3IJEB 3MMZA 1VM6A 4NNPA 4P83A 3NTOA 3LUFA 4E14A 1QH1B 2A30A 2WIBA 1EFKA 1V5EA 1ISMA 4OVKA 1P31A 1VL1A 3FPSA 3OTIA 4GL4A 3AF0A 3SQDA 4FWTA 1EX9A 3S0JA 2YRFA 3E1SA 4RLHA 3T1OA 2IL1A 4GL2A 4IR7A 4O29A 1VE6A 3HCRA 3L8MA 1RC1A 4KV9A 4EW2A 3KJNA 4N03A 1G6KA 4G5GA 4JS0A 1E0KA 2DG2A 5CEEA 1BJRE 2GX6A 3AG6A 1K3FA 2NUAB 1UIMA 2VF2A 1IY8A 3DL4A 3HBAA 4WESB 1YU6A 3PKIA 5BT8A 1RI4A 2ZB8A 3I76A 3UJ6A 3A9CA 1P17A 2HF7A 5BNTA 4HDNB 2XMBA 4IDOA 1TU4A 3GH1A 4R8KA 1XVLA 3WIBA 2XUJA 4A82A 1L5QA 1IWPB 2XTAA 4LE2A 3LBAA 4HQRA 2OCPA 4Z3DA 1GA4A 1OR8A 4DEYA 4LYGA 2R0QC 1F0PA 2Z58A 2Q2NA 1VSTA 1EB8A 1VLJA 4GFDA 2OPBA 5EP3A 5JIBA 1R2QA 5JBNA 2JJ1A 1GNRA 5AVUA 3OT1B 5KWJA 1EFPB 4B6PA 1R64A 4OGFA 1PTKA 3HSSA 2AQIA 4RANA 3ME5A 3R5TA 4BQNA 2F9MA 2PKEA 2AUMA 2E49A 3H5VA 1L7BA 3STWA 4XWGA 4NBTA 4I4TB 4XUCA 2IHVA 4D4JA 4E5NA 2FHSA 2WK1A 1I0IA 3H2JA 4DTIA 2IDMA 2NUPA 1KYVA 5JNRA 2GAIA 3BXPA 3PFWO 5EG5A 3E81A 1JSCA 3N2GA 5K2OA 5AVSA 4H1WA 1NWCA 1CDEA 2VHYA 1CQZA 1Y3BE 3MTDA 1ISPA 5I9MA 2NUTA 4BJ5A 4DC9A 5KVCA 1TXGA 5DBEX 1QHGA 4BAGA 2XGMA 3MAJA 1T4GA 2IEIA 3C1TA 3GLTA 3TLKA 2C0CA 3ZH9B 1EXNA 5CHYA 4EYKA 3IA2A 3CH4B 3DBRB 4UU0A 4RF4A 3U48A 2X40A 3PXAA 2VBCA 1TVKA 2V3WA 5IAKA 2XNCA 3JALB 2FDXA 4G41A 1V48A 3IUJA 1V47A 2FUG1 4ZJYA 4Q34A 3OKPA 1T13A 1I3MA 2BPOA 1EJ2A 3A9RA 1SD1A 3KYIB 2X8WA 4BQIA 5JFTA 1NQTA 4M21A 3W5IA 4BYGA 3IQGX 2CT8A 1RHJA 2CLKB 1LJLA 1QFMA 2H4FA 3OCYA 3RIXA 4F96A 4ZDIA 3JQGB 4HQNA 2R8XA 4N01A 5FUMA 1BQ3A 1A96A 3AEZA 3U4AA 3KR0A 4NHOA 1PVOA 1RAHA 1XQ6A 1DQNA 4LVOA 2XUZA 3W5UA 2C9OA 2XZPA 2CD7A 5IDYA 3BE4A 4PPQA 1E59A 1Z16A 1RABA 2PQ6A 5T57A 4BTEA 4YAOA 1JQJC 5EJ2A 1E5QA 3A6KA 3B82A 3P9YA 3U6BA 2RH5A 2PY6A 4PV7A 5HIAA 1JDNA 1NNLA 4D2IA 1T0JB 4PAQA 3VHRA 4C0XA 1YT5A 4YJ3F 5EN4A 1Q84A 2I6UA 1GD1O 3L7IA 4GGOA 1XRRA 2H5JA 2BEKA 4Z1MA 1NATA 2DAPA 4AMVA 4KE6A 1CY4A 3I12A 2QYOA 3WS7A 8ABPA 4RL6A 2GAOA 4EOGA 3UAXA 521PA 3IO5A 3L8CA 2WM9B 1ZZEA 3C3BA 5A4IS 2O8EB 3LI2A 1KO1A 2BI4A 3MFQA 3FOEC 3EQZA 3N2KB 3Q11A 4YRFA 3BWMA 1ZK1A 3FJOA 1L7VC 2OGUA 1HY3A 5FI3A 4JLWA 3KZNA 4AQ7A 3E4CA 4Y2YA 5IWAB 4DNOA 4KAJA 3E22B 1FX1A 1AO0A 1BU8A 3JQBC 4S1TA 1TQ8A 1PTJC 4UUAA 5ELMA 2HU2A 2BH9A 1DCMA 2OA0A 1EVKA 2V4UA 3OCUA 4X7PA 1UOEA 2G1JA 4R6WA 2BHLA 4AMBA 4YY3B 1G5FA 1DG1G 1YAHA 4QRIA 2WTXA 1FDIA 4UCXA 4E31A 4BY9E 1V26A 4D02A 3FWYA 4O5AA 3DMFA 1JHMA 1PWHA 2FWMX 4TQ9A 4F12A 2QQEA 1SUSA 3LNCA 3TXXA 3LYHA 4S1PA 1WDMA 1I51A 2NU7B 2OENG 5KB3A 1UF9A 3N0XA 4EF5A 3U9SA 2CBZA 3G49A 1L6RA 1L0BA 1SUAA 1OZFA 3NBZC 4DMFA 3PRHA 2ICAA 2ZYWX 3ORRA 3TBKA 1ZJ5A 2PGAA 3OE4A 3MJDA 1IMJA 2PXHA 1O2DA 3LBNA 4G97A 4HQKA 4FGLA 4RKWA 4RYDA 1CE8A 3O4RA 2X2OA 5DCYA 4EHDA 2JHGA 5JXWA 2XNKA 1QTIA 1EMDA 1W8DA 2O2DA 4IX1A 2J07A 3DXFA 1E4YA 4A23A 1O94D 4J49A 2W2KB 1J56A 3DKKA 3UJDA 1R18A 5CLJA 3T9EA 2OWDA 2I1QA 2JGDA 1VB5A 3S68A 3UENA 3OZDA 5ALRA 5B1EA 5IM4F 2FQXA 4EY8A 1VG9B 4EYQA 4JUCA 3ZU5A 1WG8A 2BR3A 1MB0A 3HBMA 3PNVA 4V24A 3GARA 3K9HA 4ZD6A 4RFSA 3DS8A 3WKAA 2O2JA 2QI9F 4EG6A 5G3ZA 3DO8A 2QE7D 3E84A 3WKDA 3N8GA 2JDIA 4TWBA 4YN3A 5FCDA 3VO8A 3AVTA 3PQCA 4OLFA 1UXJA 2GF2A 2QD3A 3DHVA 1SBYA 3F7OA 3PLRA 4D4GA 2FEOA 1P0CA 1QV7A 5A3VA 5AOCA 3ELBA 1L1RA 1JWAB 2WMDA 1FXSA 1W96A 2FWPA 2V7VA 3CUWA 2ZRGA 4UTOA 5DMHA 4LE0A 2H7VA 2CLLB 4ZALA 3EF0A 3ZD9A 1Q17A 3ZCQA 1BEEA 5AUPB 2XYHA 3KT0A 4CCAA 1S7GA 1D1TA 1UBTS 3CUKA 2D0PB 4PCLA 3ZBQA 2P5YA 1JIJA 1XP8A 5E6RA 3T0GA 1CHDA 3ZIDA 4AM8A 4LHEA 4EFDA 3JQDA 5IC5A 5FOWA 1J23A 1FK8A 1A4UA 3RADC 1GL9B 3FDJA 3B52X 4IW3B 3WV5A 3HNRA 2F8LA 2IYYA 4A5SA 5KNCA 3OUZA 2Z98A 3PE6A 2BYTA 4KE8A 2BP7B 1BDIA 4LXUA 1EE9A 1YQWA 2P3OA 3MS2A 2VOEA 1Q0LA 2BEUB 4JR0A 1QNFA 1ISGA 3NHYA 4JC0A 1V1RB 3ROMA 3UV3A 3IHWA 3JYHA 5IUKC 3JVVA 1XTUA 2H51A 2ETVA 3HZZA 4YBZA 3SGLA 3SICE 4N0EA 3ZK9A 2R84A 2B5OA 2E6UX 2Y1CA 1IWBB 3I64A 5EXXA 2NQ8A 3AR6A 4PPFA 4WOCA 1DFHA 3GG9A 1VMDA 1BS1A 3WAKA 4F3NA 4INAA 4PQYA 5L3QA 2HHCA 3A6DA 3DZBA 4K2AA 3HXMA 2BFBA 4OFZA 2EATA 3AJEA 3B5IA 3TTYA 3AOGA 2B7CA 1ZIDA 3O9VA 3PJFA 2VZ0A 2OHJA 4Z4CA 3QELA 4PGFA 4G86A 1XJ5A 4YCSA 3HUDA 2R2AA 4D26A 1NKSA 4PXSA 1SC1A 3G13A 2C3UA 2VHZA 4G2TA 2H0AA 2GNOA 2JGRA 1E3WB 4BNNA 3ZDCA 2O3JA 1UFOA 2CB0A 3DE1X 2J9FA 3O4VA 4LMAA 1VFPA 2Q3JA 3HYSA 3LA6A 3I9V6 4R2KA 1KC3A 3IEXA 2HWYA 3R7FA 1ZCJA 3WXMA 2QQFA 1L5SA 3U5TA 4GDMA 5C8YA 1GPAA 2C9ZA 3O8QA 1N1MA 1J8DA 1K7YA 3ZEAA 2JA2A 3R0XA 4GEKA 1GJRA 4LDQA 2I7DA 4YLEA 1DIGA 5D51S 3IKJA 1QORA 3OG9A 2AS0A 3DEHA 5FNVF 1B8OA 2HPVA 2IU6A 2OGTA 3UKJA 2GBLC 4PSVA 4HX9A 3JQQA 1E99A 3VDQA 1MUUA 2V1UA 4NXMB 5FIUA 4UEOA 5K3CA 2H2FA 1RYMA 4EUKA 2C54A 4HWGA 5JY1A 3GDWA 3RU2A 1C8VB 1ZD4A 2HNKA 1M8JA 2RGUA 4DTCA 1YS9A 4BNTA 3FFTA 1NW9B 2W4QA 2GESA 3H7IA 3C3DA 2P1DA 3N0RA 1LDNA 4GM4A 2AJCA 2WMOB 5HE9A 2XGGA 1TOAA 3GLIB 1Z6ZA 4ZVTA 2PZBA 4MV9A 5F9MA 5TQ0B 1HE5A 4BNDB 2PS3A 3AV3A 3H1EA 1UPTA 4Q4AB 4LKRA 4DA9A 2EBFX 3JWEA 3CWQA 4YP9A 3WNQA 5B30A 4DM7A 1E63A 2H16A 2G1KA 5EC8A 4QFDA 3DD5A 4H2DA 8ADHA 1I5RA 1JEOA 221PA 1Y6RA 2HMYB 2WWFA 3V4VB 4LK3A 1NXOA 1E6WA 2F9FA 4FDLA 4Y1FA 3DLIA 5FV4A 5HDBB 3ZGZA 1BHJA 2J0QA 3TLJA 2VJMB 5AVJA 1ZXXA 2G40A 4B6GA 2C3PA 4O1IA 3QITA 4DT1A 2BGKA 4HNQA 3HDGA 3BXGA 2CL5A 2JFZA 1AKQA 1M6HA 2INGX 4KFUA 1Y8CA 1L7NA 2ZSHA 3UV6A 4X92A 4B3TB 4MUMA 4DN6A 3PEVA 3SNKA 2YJZA 3CEJA 3E35A 2GA9A 5H8WA 1JG7A 3OIWA 2WDPA 1YB4A 1QHXA 4JLDA 5HKLA 1Y6GA 1V4VA 3PT5A 1I9CA 1NJ2A 2ZSKA 4KLNA 2I6GA 4KE7A 2YW2A 3ZZMA 5LA6A 1P2BA 5B5SA 4ACAA 4EPTA 4MS1B 4HNGA 3EXEA 2VWPA 3OPQA 2D2IA 2GCOB 3TLXA 2F8MA 5EEGA 2UZ1A 2BGRA 4KI0A 3OJOA 3PDIB 4HDMA 4I4CA 4M86A 4E7PA 1H0RA 3F5DA 3OAAD 4UVDA 3N2ZB 2VJBA 3L7MA 1XU4A 1M3SA 2DFVA 2GCNA 2J85A 1GUZA 1UXOA 1ZVMA 3KQPA 4GOLD 4NOKA 3WLLA 2YWGA 3IXLA 4JQZA 4TGLA 2OXCA 1XJ0A 5I7SA 3H0EA 2I78A 2X4LA 2BFEA 3UAWA 4EKDA 5A5FA 4EHBA 2ZWIA 3K0AB 3GRYA 3LRXA 2P8JA 3I37X 3FYHA 2DP4E 2G70A 2GTIA 2OBLA 3BHNA 3PXCX 4V0SA 4YDRA 2I4OA 3DZGA 4KOEC 3ON5A 4PC6A 3U4CA 3VVLA 2VZEA 4NLLA 1EG2A 4BAZA 2ZTLA 5A6SB 2HJ9A 4BFTA 3EXIA 2AN1A 5DBHX 3JR7A 3BKWA 4H7JA 1U65A 1AKRA 1F2UB 4HDSA 4NBVA 1Z2CA 4TLDA 3ADBA 3FA2A 3MILA 2W2TA 4H0CA 4Q1DA 3FHLA 1L8AA 3WGLA 4TXMA 4EJFA 4MARA 2BGMA 1XZNA 5JCOA 3HC7A 2ZIXA 2HAEA 2QVCA 3L92A 4L2IB 1ADBA 3W7BA 2A9VA 4GX5A 4YMTA 1H3FA 1MABB 3AUSA 2W2PA 3LF2A 4BO5A 2H92A 3O8DA 2DPLA 2ZVJA 4U4AA 3WJ2A 3K73O 1LU9A 3M5PA 1TLTA 1T9AA 2G76A 3JZFA 3RCBA 5IAAA 3IB3A 3TECE 1E2GA 4QVIA 4FYPA 1CLEA 4DLSA 1LK0A 2VJLA 2OE2A 1GKIA 4O4IF 1Y63A 1ULZA 5THQA 4UE6A 2X2PA 5B57C 2QPAA 5DTEA 3TZLA 1IBLB 2FRVA 1KARA 2IYEA 2OESA 1L6IA 2CD9A 3Q3JB 1P3JA 5F3RA 4B40A 5JTTA 2NU9A 3M1YA 2B25A 2VFAA 4LX8A 3GOHA 4L73A 1NE2A 2ECPA 2ZJOA 4QECA 5J4YA 5M5BA 2WDZA 3DBOB 2AOUB 4KXNA 3A4YA 1Y3IA 4WZAE 4YJ2A 3EIWA 1HYQA 1TPYA 1G66A 2B0CA 3SX2A 2JD0A 1DT3A 2KPOA 2PUWA 3RVPA 1R0RE 1CZRA 4JC4A 4JSTA 4ARZB 1T5HX 2H17A 5JZBA 2GZHA 2XNJA 1YGPA 3KTAA 3VYSB 4DSOA 2YJ6A 3VU1A 4BB6A 1BEUB 4JX8A 1XNGA 2GXSA 2Q5CA 1QQAA 4FOSA 1YB6A 2WNSA 3NHJA 1I7LA 3DMHA 5FADA 2IT1A 5TS2A 2AFIE 5KU7A 1NJFA 1PR4A 2JGKA 1Z74A 3EUFA 4KK3A 2ZCUA 2H1WA 4J1TC 4KJXA 1WUTA 3AWIA 3QY9A 1GPJA 3AXTA 3C3CA 2Q4OA 1E9CA 2DHDA 1ZHHA 4P3XA 3ZLUA 1P61B 2PTHA 5MN4A 3SR4A 5KSPA 1EUQA 2IPLA 4ZYWA 4MVJD 3RF6A 4JH0A 1K1EA 3FJYA 1MD9A 2PZKA 2M1XA 1KFKB 3OZXA 1NOIA 3HE3A 2NU6B 2OLKA 3T7SA 4MUGA 2V6FA 4L76A 4PG6A 5G1OA 5L3SA 1Z75A 4IM7A 5BT9A 4IDDA 4ABTA 2J9ZB 4UMFA 3IRUA 3KQSA 4QTYA 5IAJA 3LSTA 4EFLA 1YE5A 1O95A 1CG6A 1Q3KA 5AMXA 2P6MA 4M7RA 4HO1X 1P2TA 1FNDA 1X7DA 3QFCA 3T06B 4ZHQF 1NFRA 3CCCA 2I71A 4REMA 3OY7A 4L0QA 2CHEA 2CK3A 2RGDA 3LKVA 4Q03A 3HKEA 3O2QB 4RD6A 1BDMA 1Q0PA 2QX4A 3JARA 1NR5A 2E5FA 2MSEB 2AOTA 4ZZ3A 1FNCA 1MEEA 2YN0A 4XYEA 1CUFA 1NE7A 2ECKA 4HZUA 2VUSA 3HFSA 4LWPA 1P7ZA 3HI6A 1G4UR 3AEUA 1VKNA 2YIDA 2FRDC 1Z2DA 3FZNA 5TSDA 4RTJA 1YIAA 1L5GB 5CDSA 4OQNA 2ZCJA 2XW6A 1KMHB 5AKGA 4O2AA 1T6YA 4EGCB 4TN1A 4GYWA 3DFZA 2XNDA 2JGMA 4LTDA 4W1RA 3R6TA 1DTEA 3HB0A 2FZEA 4JYAB 1R37A 1JV2B 3L05A 3UHOA 1W85A 1XIVA 1P1KA 2H1IA 1Z4OA 3K2BA 3QSGA 2IIVA 3OPVA 4UM7A 3SZOA 2I34A 1T4DA 3BB1A 2XT6A 5BOVA 3RVNA 1QLHA 4MR9A 1V8ZA 3FWZA 1D8AA 1GRQA 5B2FA 4PYOA 4CG3A 1WEKA 1HDZA 3PHLA 4WLUA 3ZJ5A 2LDBA 3BE8A 3C1AA 4J0KA 1DAFA 3GCXA 4MGYR 4NZPA 1T2DA 2XAUA 2HA4A 4L6AA 3PXDA 5E0OA 1XHFA 2EIXA 4J0FA 1DC5A 5EPUA 1WV1A 5D6NA 4PR3A 1IULA 3ZCTA 2I99A 2CVFA 4GNRA 5M04A 2N75A 2WWXA 4HH0A 4B44A 2VBIA 1D0IA 4IZ6A 2B4YA 3SHFA 4MP8A 5AK5A 5TPZA 1N6LA 1I4EB 1WSBA 2M9MA 2CSXA 2H54A 4L0DA 4RK5A 5B3AA 3TW0A 3X1MA 1DPFA 1JXAA 3AR2A 3IJRA 2NVUB 1SK9A 3VDRA 4D3FA 4UM9B 5HZHA 4U2KA 4MVJI 2C4VA 4MW9A 1I6KA 1TCBA 2A57A 3L84A 5LP6B 1HR0B 1GQRA 4X9XA 5KAPA 1WF6A 1W48A 3JYNA 2HU5A 4Z9YA 2GN6A 3WB0A 1EBBA 2JIZA 3CLUC 1SCJA 3FF1A 4KN8A 3IVMA 4TKZA 4JLOA 3AZQA 2P9ZA 1PQYA 4LMRA 4KCGA 3KLBA 4YAJA 2IF2A 2Y8EA 5JI2E 4CIVA 3JYLA 4QHYA 2V74B 2MU1A 2OXRA 2AV6A 2PR2A 4NV0A 2Q3EA 2PFGA 5CBPB 3GUVA 2YDXA 2RC6A 3IIJA 3O82A 5C4IA 3DBLB 4ZYYA 1HDEA 2EU8A 3FB4A 2WTUA 4JQOA 3ER8A 2ATEA 2Q5FA 4IZOA 3CTPA 4B3FX 3L18A 4E4YA 5HDQA 4EY5A 1P75A 1EIZA 5F76A 4DBLC 4OJMX 3AY6A 4HRVA 1KAHA 2NSDA 2VNIA 1KH2A 1IBRA 3WG9A 4RL4A 5TMEA 4GT1A 3DSRA 3ZQ6A 4XB6B 3V1YA 2CGEA 3OU7A 2LCIA 4DR4B 4H18A 1WNFA 5CXUA 1CS0A 2A5LA 5FOTA 2A94A 3CZRA 3OX1A 1QV6A 3ZVMA 2E48A 1WD7A 2QTTA 3W8RA 4KR2A 4ZOLB 1RHUA 1P2VA 2AFIB 4CLHA 3UPTA 4Z3OA 1HDCA 4YHBA 2PBZA 2P4HX 3EXHA 4YV0A 5M29A 3DZHA 4WXRA 5JH7A 4MKFA 1CTQA 4GIBA 2HCFA 2XRFA 2X7XA 4G5OA 4EB8A 1LDEA 2XSZA 4V0NA 4XCXA 1G20A 1QWOA 3OKAA 1K5GA 5A5GA 3R5FA 1Y1SA 3LL4A 4D3ZA 3GXOA 5BQ3A 4XQCA 5JS7A 5TMPA 4TWIA 3SZ3A 1JFSA 4LRYA 4KTTE 3OY2A 1YB5A 4RLSA 1XK7A 1HV8A 4ZI7B 3UPUA 2OR3A 3DE3X 4LRTB 3TLCA 2C8VA 4D9BA 1LQUA 1V11B 4RS4A 4IP0A 1YJCA 4PICA 3QTLA 4I7EA 5EZ6B 3H5TA 4C6HA 4F86A 5LQMA 1Y82A 3GDFA 3LDUA 1IM5A 3O8LA 1Z8HA 3BFVA 4C4SA 2VP0A 3BZUA 3L49A 1WD5A 2ST1A 2C4WA 3A14A 3RF7A 2XUGA 2F1IA 1MO2A 2QRPA 1GITA 2E2WA 4ARAA 2O05A 2QTCA 3P2OA 1QH1A 3HY4A 1UFKA 2AOXA 1E7QA 1P6UA 1R6AA 2D5AA 2F3RA 2P4UA 5F2KA 3X44A 4LNAA 1ZI6A 1C30B 3T4XA 5EOVA 1V16B 1VDMA 3IIMA 4C3UA 5KO2A 2OZVA 3E3MA 3VR5D 2UVDA 1PBTA 3G1TA 4WK6A 4JVNA 1YD7A 3DF9A 4IKEA 4K6CA 3TEFA 5C8DA 5TT1A 1FUKA 2D1QA 4K9PA 5IKEA 1WBBA 4ND1A 2YZNA 3U7JA 5K0JA 3RRYA 2NVOA 4NTZA 5ALUA 3S1LA 2VEOA 2BMFA 2Q1UA 3R7SA 1Z4IA 5HCIA 4TRNA 4NU6A 1R0SA 3PWTA 4MV8A 1QG4A 1Q12A 4B46A 1UMCB 3B7PA 5IU6A 1EGAA 1WLYA 4PZ0A 3R9XB 3GLQA 3LHSA 4I4TF 1GPKA 4JB0A 4ECEA 5COAA 3GI1A 2XTZA 1JU9A 1R0LA 3T1VA 1U0GA 4QFMA 2YMQA 2ODBA 3OJXA 2OK7A 3NV7A 3OPYB 4G4GA 4P0QB 1O54A 2QB5A 3TPCA 4L5BA 4X60A 4EEXA 1S7CA 4WUVA 1AS2A 4TMYA 4REQB 2Z3WA 3SP1A 5AUQA 4NOLA 1OPRA 1VYUA 5L3RA 2HNBA 2PMDA 1Q0ZA 1E79D 3LX4A 1U99A 1ZVVA 4ZREA 3V32A 1H2YA 3SC3A 5CTAA 1A72A 1SKQA 3K2IA 1ZL0A 4I2NA 3WI7A 1E2IA 3AL0C 5LUAA 3A6HA 3ZS8A 1HYEA 3KQTA 1GGKA 1M0SA 2XOEA 1G5TA 5AW7A 4K9NA 4GUDA 1TO2E 2V7WA 4U2FA 1U9IC 1V11A 5JCPA 2J41A 1Z56C 3E5MA 3PHCA 3MYYA 5ALYA 1TZMA 2IF0A 4IV8A 5E3HA 4YRZA 1HL7A 5F64A 1BDHA 1RYYA 2EG9A 4ZGGA 2JI7A 2WNHA 3D7LA 2QTVA 1H4SA 1JHAA 3H8JA 4HAOA 4LSZA 3V2IA 4CKEA 2OXFA 1NVXQ 3IVRA 3ZZ0A 4K0KB 2LRHA 2C29D 2D1TA 1SUBA 3A1CA 1B2LA 3WO1A 2JVKA 3ZN2A 1JR3D 3A2MA 3K4PA 4QLBA 5CT6A 3EFOA 4JOSA 2W6MA 3I4CA 1A0OA 1U9CA 2JEOA 1WV0A 2PKYX 3WICA 1V16A 2A3RA 1N9GB 3W5SA 4TRMA 2KI5A 4A91A 2COUA 1QH8B 3GMDA 1Y1TA 1RZUA 2WJGA 3SF8B 3JY6A 3H17A 1GG8A 3HM9A 2GD1O 2JAPA 1EI9A 1ZNYA 5GV7A 2O57A 1FTYA 4ANFA 4EG7A 1QANA 1G7SA 3USES 4HXYA 3WWZA 3PGMA 2YWXA 2QW0X 4AJKA 1KH1A 2GAJA 2AC4A 3OLQA 4QUJA 4RNCA 3BQNB 2O8NA 9ABPA 3RJMA 3PUZA 1R6DA 3OZCA 4H3KB 2FEPA 4QXRA 2BTQB 3CUTA 4GQBA 2WD8A 4OBEA 3MWDA 2ZW9A 3KTFA 5DULA 5BRAA 5CCDA 2O14A 2WB4A 1VMEA 3WAGA 3U7IA 1Y3AA 2H4ZA 4NZOA 1V7ZA 4U3JB 4DVGA 3LK6A 3IKTA 1UMKA 2ZJBA 3GFSA 3JQ8A 1K9SA 3LUPA 1NL3A 3EN0A 3CNLA 1X7YA 4CQJA 2WWWA 4YQZA 4JB3A 1BQ4A 4AFNA 1FPMA 1KVTA 3M6UA 2O23A 1DRWA 4JKIA 4UBLA 1UQRA 3DMNA 3HDJA 4W1QA 2AG8A 5ECWA 2Q45A 4A7PA 1PGOA 4J0EA 3GPLA 1U7UA 2UUBB 2B8NA 1RCFA 2NN3C 1JQAA 2D00A 3CUYA 1PW7A 1WZUA 2GCPA 2I1LA 1U0OC 2ACVA 4EL0A 2QYSA 4NDAA 2PXCA 1I1QB 1UPUA 3UYLA 4YAKA 1VKOA 4J2OA 3FZQA 1IEXA 1ZJYA 4CKEB 1NMZA 4Q12A 2PZEA 2ORWA 3EC7A 3KRTA 3WK9A 4LBWA 3W3AA 2OD2A 4O02B 1BFUA 3DXYA 3VX4A 1L9XA 2IE8A 3H8SA 3ML1A 4C05A 1QHHB 3JWIA 2KYRA 3DC7A 1ETUA 1Q0UA 3B7WA 3W6PA 4ZOCA 1K6JA 4B7ZA 1RAAA 5F35A 3ZWCA 5KYWB 4LFAB 1ZY2A 4KVFA 1ZM7A 3EAGA 2HCTA 2O8FA 1HXHA 1VHTA 2E4UA 3ROGA 3CMCO 1J09A 1H8EA 1ESDA 1UBRS 3H4VA 4ZHSA 1IZ8A 3QFTA 3SYRA 3A36A 4ND6A 1VSQA 2GTPA 1K4KA 3FZYA 3GLFB 1SHLA 2B6HA 2NXWA 1KS2A 3FVRA 1SVLA 3HCNA 4G1EB 4J6FA 4O25A 3FCUB 4XYBA 4BUJA 2Q5HA 1V5IA 2TMYA 3DDHA 3L0BA 3LZ6A 4U6QA 1BRTA 2VJAA 3HWX1 3JQAD 4ICIA 3UB4A 4C07A 1QP0A 1A4IA 1GPWB 4PC7A 4OHKA 4ZEWA 3KEGA 4L28A 2I7XA