3WA7A

Crystal structure of selenomethionine-labeled tannase from lactobacillus plantarum in the orthorhombic crystal
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
467
structure length
467
Chain Sequence
RLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDTNRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLQLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords tannase
publication title Crystallographic and mutational analyses of tannase from Lactobacillus plantarum.
pubmed doi rcsb
source organism Lactobacillus plantarum
total genus 154
structure length 467
sequence length 467
ec nomenclature ec 3.1.1.20: Tannase.
pdb deposition date 2013-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wa7A00
2O2IA 1K5PA 5DLPA 4DMCA 4MWTA 1D07A 2IITA 3E3AA 2BUAA 2XT0A 1LBSA 1LPAB 5A2GA 3AIMA 2QOEA 3ESDA 5E4TA 5JASA 3IUMA 4X92A 5AO9A 2RI6A 2ACEA 3AIKA 4L72A 3M81A 2DHEA 5ALSA 3I6MA 3BXPA 5JZ9A 4DNFA 1XQWA 5ALLA 1WPRA 5CT9A 3G9TA 3B12A 4U2GA 3HACA 3D4LA 3R41A 1A8UA 4AZ3A 4OB8A 5CT5A 5BV7A 3FVRA 3FYUA 1GPLA 2YH2A 3D0KA 1G5FA 5JADA 4G5XA 1EDEA 4BVLA 4UFPA 4Z49A 3DS8A 4P92A 2WUDA 3H2IA 4OD0A 3QITA 2HIHA 3STXA 4B81A 3O4IA 2ROQA 4G9GA 4TGLA 3WK7A 1GT6A 5K3AA 1FSSA 1VJ5A 1EHYA 3D2AA 5ALDA 3WZMA 3ZLUA 4UBKA 3AINA 3EF3A 4ROTA 5EI5A 3OG9A 1QFSA 1EINA 1CEXA 3VJMA 3DLTA 1UK8A 1CUVA 3C45A 4QDXA 1LPBB 2J4FA 4RE6A 2LIPA 4UBOA 1MNQA 4C88A 4IH4A 1BS9A 1CVLA 5IVDA 4AX4A 3T52A 1GPKA 1SCKA 3WKDA 4HRXA 3OC0A 3KWJA 1XRNA 4UHHA 2QZPA 5CMLA 3N0TA 1PV1A 1X2EA 5LZ4A 4LIPD 4BRSA 3Q8WA 2V98A 2D0DA 4B6GA 3AILA 1TIBA 1ZI9A 4F60A 2XMQA 1ODSA 2HADA 3R3VA 5FDFA 2QVBA 5J3JA 4FKBA 1JU4A 1EX9A 2BFNA 3HSSA 2XQGA 3I2JA 2NW6A 3GA7A 1CUGA 4MXDA 5JAUA 3BDIA 1NU8A 3H2HA 2QJRA 1QO7A 1KU0A 3KOOA 1QO9A 4OUKX 3DCNA 3G9UA 1CV2A 3LCRA 4DLNA 1GXSA 4HZGA 3ESCA 3GROA 2AJDA 1MT3A 1SFRA 2OGTA 2GZRA 2XUAA 4J0DA 2QT9A 4K6HA 2C0QA 5AJHA 5T4EA 4Q82A 2XUOA 2WUGA 4G4IA 5K3FB 3ZWQA 4X97A 3A6ZA 5CH3A 5ALIA 3PFCA 4DIUA 4LYDA 1IMJA 2RHWA 3BIXA 4DSAA 5LIPA 3AZPA 4BTLA 1JJFA 4OYLA 2RHTA 2J3QA 3AIOA 1S8OA 4X6XA 5SYMA 5ALGA 1ZJ5A 3P2MA 3W05A 3U1TA 3UUFA 4BZZA 1H22A 4B80A 5AKGA 2Y1KA 1OILA 5ALNA 2XMBA 5EHZA 1E66A 3WJ2A 5CH8A 2WFLA 4MEBA 4GLBA 4DNOA 2WHPA 3BE8A 1P0IA 2GYWA 1FFEA 5I9IA 2Z3WA 3LIIA 5A7GA 3V1LA 5D3KA 3FYUB 5CT4A 4K6GA 4Y2TA 3YASA 1DQYA 5CXUA 1RYYA 1LZLA 3STVA 5JARA 4U2FA 3WWPA 2BAGA 4UPDA 4DGQA 3C6YA 2PL5A 4W1SA 5EHNA 1R1DA 2QTBA 1K6EA 4MJ3A 1P0PA 4E14A 4FLEA 3FLBA 4KACA 4TVKA 1A8QA 3RKSA 1BE0A 3G8YA 3H17A 2AJCA 4DMKA 3DD5A 3GUUA 3WWOA 5FRDA 1XLWA 3C5WP 3KXPA 3I28A 5AK6A 4K6KA 1DQZA 1XZEA 1UKBA 3C87A 3BDVA 4X6YA 1IVYA 1DTEA 2CJPA 3I1YA 3WMRA 5HF6A 4G1FA 1HBJA 1KU6A 2HDWA 3IDAA 1AURA 1YB7A 4AO7A 2JBWA 1Q83A 5AI5A 3DKRA 1LPMA 1U65A 1MAHA 4PSDA 4EY8A 1JFRA 1ODTC 1CUEA 1ORWA 1DU4A 4QLAA 5AK3A 3G0GA 4Y2YA 1MNAA 2OCLA 1A8SA 4MYDA 1AQLA 5JAHA 2P8SA 1QIGA 1MN6A 5JZBA 4N8SA 5DNVA 1OCEA 1A88A 3A2LA 1UKAA 2XMGA 2BJHA 3VXKA 4UHEA 1E5TA 1QJ4A 3U0VA 5CBKA 1MJ5A 4BZWA 3WK9A 1Y37A 2K2QB 4P08A 2OPHA 4G9EA 1GQSA 2HA3A 1QIMA 3I2IA 3WKCA 1JMKC 1C4XA 4GW3A 4JNCA 5SYNA 2XE4A 4EY6A 1AGYA 1QIDA 3O4HA 4OB6A 2WUFA 3QYJA 2Z8ZA 3AUKA 4N8DA 1Q0ZA 1VZ3A 2W22A 5CTAA 1XZHA 2X76A 1R9MA 4DMFA 1GKLA 1UZAA 4BC1A 4EY5A 2EDCA 1BRTA 1MX1A 4F5ZA 2JEZA 1U8EA 2X8BA 3HABA 2PSHA 4OYYA 4Y2RA 3HXKA 2C4HA 4KAFA 2YXPX 4PQEA 1MX9A 5D6OA 5HQ3A 4QEKA 1TK3A 2HA6A 1LPNA 1VLQA 3W9BA 4B82A 2QRUA 2WIDA 1G66A 1F0PA 2WILA 3M3DA 3FOBA 2DCMA 4RPCA 2DR0A 1X70A 2ZJ7A 3HJUA 1LPSA 1ACLA 5T4BA 3QBJA 1HPLA 1VE6A 4KYVA 2J4CA 1A7UA 2GBFA 2J3DA 3BWXA 3C70A 4BDSA 1IZ7A 3K6KA 2FUKA 4A5SA 1B6GA 3AFIA 5JATA 1ZGCA 2CEKA 4FBMA 4QNNA 5AP9A 4LXGA 2WJ6A 3R3UA 4EUSA 3GBSA 4WDQA 4GI1A 4ZREA 4B9EA 2WHRA 2XDWA 1YCDA 1VXOA 5ALYA 2JGJA 4A16A 1L7RA 4OSEA 4XIIA 2OGSA 4H7HA 2ZVDA 1MPXA 2HL6A 4ETWA 1XKLA 1O6FA 3VVLA 3ZI7A 4FTWA 2JF0A 2PVSA 4DSZA 4B0OA 1IZ8A 1QIJA 2VA9A 1WCYA 1XKTA 4BB0A 2WM2A 4DMHA 2H7XA 3ZPXA 1XRLA 4ITVA 2XUIA 3HYSA 3KSRA 1UK6A 5CH5A 5AM1A 3H2GA 4FNGA 1JI3A 2I03A 7YASA 3DQZA 4ZV9A 3T4UA 1BU8A 2WIFA 4V2IA 2XMDA 2GYVA 4BCCA 5JAOA 3R3YA 4GXNA 4Q3OA 4ZI5A 5AM3A 4HTAA 1IUPA 2WU4A 4XX1A 1R9NA 3G9ZA 1E3QA 2CBGA 3W06A 2WG1A 4I4CA 1JU3A 4H18A 5T4HA 4M0MA 3QPCA 3IURA 2PSFA 1FJ2A 4X90A 5AM5A 1TCAA 4B9AA 2PX6A 4LKOA 1ZD4A 1Y7IA 2PSEA 4Y2JA 3RM3A 4Y2SA 1QIKA 1EA5A 3WK8A 3C8HA 2RAUA 1EDBA 2PUHA 2IIVA 1E8DA 1BEZA 2G5PA 3MGAA 4FDMA 3EQ8A 1MO2A 3W04A 2C0PA 3E1GA 4CG1A 3G0DA 3GZJA 2XUGA 4PSCA 3QMMA 3SC2A 5ALVA 1WB4A 1CUBA 1XRPA 1CUHA 3IUJA 1UWCA 4N5HX 1EVEA 3VDXA 3C43A 5HK9A 3FYUC 1QGED 3I2KA 3AZQA 2V97A 4MEAA 2XMSA 1EK1A 3O4JA 2G5TA 3PF9A 1IUOA 1G4HA 3KWFA 3FWHA 4C6HA 3WK4A 4K2AA 4MYSA 2WU3A 3K9BA 5AKXA 3BJMA 3DNMA 3O9VA 3GELA 4CG3A 1QTIA 3FSGA 2YYSA 2WQZA 3DL7A 3MUNA 3V9AA 4GHWA 5AM2A 5DTIA 5C8XA 4B7ZA 5JD4A 1SCIA 1CUWA 1K63A 3LIPA 4KE6A 1FFDA 1UFOA 1H23A 5FPQA 5K3CA 1LPOA 1CUIA 4CCYA 1AUOA 4U2DA 1FFBA 4WFKA 2WFZA 1CFJA 1H2YA 1CUZA 4PF1A 2UZ0A 4MWSA 4L0CA 5ALHA 3CCBA 4X6UA 3DYVA 1WOMA 2ZSIA 5I7UA 5LZ7A 2Z5GA 4QDUA 5ALTA 2C58A 3E4DA 4KRXA 4X94A 5CXXA 1N5RA 4CIAA 4Y2XA 5EHXA 1QIEA 4U2CA 4IQ4A 2XI4A 2WHQA 1AKNA 4MQMA 5DTJA 1LBTA 2H1IA 1YA4A 2XQFA 4Y7DA 3IA2A 4Q3KA 5DYYA 1QONA 5D7BA 4FHZA 5A7HA 2QKYA 1BN7A 4FNMA 5CT6A 5HF8A 3WA7A 2C7BA 3WL8A 1XZJA 4G4JA 1QLWA 3G0BA 1UXOA 1W6RA 2HRRA 1ZJ4A 4EY4A 1TCCA 5KBYA 3TRDA 1N8SA 3C6BA 4ZV7A 1GQRA 2O7RA 5AOBA 2XQKA 3H1BA 1YA8A 3PDCA 4BVJA 3C5VA 4XJVA 1EVQA 2WG2A 3WKAA 4J0KA 3WWEA 4B0PA 5CURA 3FAKA 5FLKA 1UOOA 5FP0A 4WY8A 2BUCA 1WB5A 4G4GA 4KRYA 2VF2A 4BBZA 1VZ2A 1NU6A 3UMJA 2R11A 4BVKA 4UFOA 1E8NA 3DEAA 1QFMA 1Q84A 4KE7A 4DTCA 1TQHA 5ALQA 3L1HA 2PU5A 1JJIA 3CN9A 1BCSA 1H2WA 4ZGBA 4N8EA 3H2KA 2OCIA 4CFSA 1AC5A 3D3NA 3DJYA 2RGUA 1SCQA 1LLFA 3IVMA 2V96A 4CG2A 2JGEA 3MUOA 1R4ZA 4EHBA 1BN6A 2PBLA 2WKWA 5IVIA 2ZYSA 2VJAA 3R3WA 2WIKA 3UUEA 2DFPA 1EI9A 3DYIA 1L7QA 4WFJA 3HZOA 4J0JA 2WTMA 1DT3A 3LP5A 1ORVA 1UKCA 4W1RA 5ISMA 4J7AA 2HU8A 1DX6A 4MQLA 4DYHA 5FKJA 4BRZA 2CMFA 3HI4A 4Y2VA 1WPXA 5AK4A 1XQYA 4RE5A 1XZIA 3VJLA 5IVKA 5AI8A 5AKIA 2ACKA 5ALUA 1LPPA 4UHFA 1F8UA 3O4GA 2AXEA 1GPNA 1ISPA 2JGKA 4P9NA 4AQDA 4UBMA 2OXEA 4C4YA 5ALMA 2XUFA 2QM0A 3PFBA 1PFQA 4BC0A 2G4LA 3WIBA 4YK7A 3BIWA 2VJCA 1XRQA 3MVEA 1T2NA 2Q0XA 5AK5A 5AKEA 5A62A 3RARA 2BCEA 5I8PA 5JANA 4IH1A 1CUXA 4RNCA 2JGMA 2QR5A 1W75A 4HXFB 1EB8A 5CRIA 4EA6A 3H19A 3I2FA 1LNSA 1M33A 3NUZA 2WLSA 5A7FA 5AH0A 5EFZA 1XQVA 3QVMA 2C5FA 3QPAA 4AO6A 4UBIA 2D5LA 4X71A 5K3DA 4FFVA 2ZJFA 4BAGA 4QDOA 3WJ1A 4BCBA 2VQ6A 4M0EA 4JH0A 1DT5A 1Z68A 4WY5A 5HK8A 2RIPA 4QWMA 1EK2A 3ED1A 4CIBA 4NZZA 5H3HA 2DHCA 3ESAA 1Q0RA 1F0NA 5D3ZA 4H7KA 4OPMA 5CT8A 1XZDA 1J06A 1CRLA 5FXMA 1QOZA 4F0JA 1W4LA 1YS1X 2GYUA 1XLUA 1TCBA 3STTA 4IO0A 3IUNA 4TPKA 1DWPA 4A23A 2HA4A 2XQIA 4BDTA 4WFIA 2Z3ZA 1YAJA 4J0HA 3WK5A 1WM1A 2O7VA 4YX9A 4BCDA 1CUCA 3WWDA 3SX4A 4WJLA 4H7FA 2HM7A 1CUSA 1QIIA 2WFLB 4UBNA 4D9JA 4Q3LA 1P0MA 5AM0A 2WHPB 4Q34A 3Q0TA 1GZ7A 4W9RA 4Y2QA 4LXHA 2PSJA 3M83A 3TJMA 4DNPA 4ZRDA 2VAXA 1DX4A 1AX9A 5DYTA 3C8DA 2PM8A 3R3XA 4JYMA 4W63A 1GGVA 5EIAA 1UK9A 1E89A 4KE9A 4P93A 4W1QA 5FPPA 4H7EA 2OQIA 4HAIA 2V9ZA 3WKBA 3HRHA 3FBWA 2DQYA 1CLEA 1JT2A 4GWLA 4KJXA 2CB9A 5HKBA 3IBTA 3RLIA 1WHTA 1JMYA 3C6XA 2CKMA 2FX5A 2QJWA 1ACJA 4BAZA 1NX9A 1UOPA 5JAPA 3D7RA 3O95A 2I3DA 3NGMA 3CN7A 1G42A 2O2GA 2OG1A 1ZI8A 3DKKA 4AB1A 2JIDA 5AI9A 2R8BA 1MTZA 4C4XA 4UUQA 2HFJA 1LGYA 4NS4A 4JEIA 3R0VA 1J1IA 2ZYRA 5C7YA 4XVCA 3D2CA 5FOQA 1XZMA 3OPMA 5ALFA 2VJBA 3PICA 5JD5A 3EQ9A 2HU7A 5IH7A 4HXEB 4ZXFA 1AZWA 1CUDA 5ALKA 4S0XA 3G7NA 4BP9A 3V1KA 4J0IA 4B84A 1ZGBA 1CR6A 2ZYIA 5HF9A 1CUAA 2XUQA 1T4MA 3JW8A 3QPDA 3TGLA 1HKHA 2QXTA 4N5IX 3V1MA 4OB7A 1VOTA 4Q05A 4QDZA 3VISA 3F96A 1XZFA 2OQVA 2HA0A 2XUDA 5K3FA 5LLSA 3M82A 3IIIA 4KEAA 3OOSA 3VJKA 2PU7A 1J07A 2H7CA 5JYCA 2OAEA 2HU5A 3G0IA 2QS9A 4M0FA 3SWWA 1ZICA 3AZOA 2WIGA 1K8QA 4Q1VA 3WA6A 3LLCA 1PJAA 5KWJA 2RONA 1AMNA 1FFAA 2WG0A 3I2HA 1ODCA 2AJ8A 5AM4A 3JYHA 4J3JA 2VT6A 3STWA 4ARAA 3R40A 2VATA 1UK7A 4H77A 4FWBA 2ORYA 3FSGD 2BUBA 3DDUA 5BOVA 3F67A 3WL6A 1XRMA 1QTRA 4G8BA 2XMZA 3NOXA 1H2ZA 5DWDA 3WL5A 3DOIA 1P0QA 5DNWA 4E11A 2QUAA 1ZIXA 2B9VA 1CQZA 1QIHA 3NWOA 5AHXA 1WHSA 1ETHA 3H0CA 5CW2A 4C89A 1YR2A 4X91A 5JIBA 4XWGA 5DJ5A 3VVMA 2XLCA 3ZLTA 3FNBA 5E4YA 3H1AA 1C7IA 1ZD5A 3G9XA 4OCZA 3DOHA 4LXIA 1CUJA 1QZ3A 2HFKA 4ARBA 3BL8A 5HQ3B 6YASA 1BCRA 4B83A 4FLMA 2B4KA 4JUIA 4PSUA 3ZLVA 4G8CA 4QZVA 3EBLA 2IX9A 4O08A 5K3EA 1VA4A 4X3CA 2GBCA 4OU5A 2Y2VA 2XMRA 1GKKA 5AOAA 4BE9A 5AICA 3X3HA 1ZD3A 1OXMA 2ZJ6A 4WCVA 5AKKA 1XROA 5AI0A 3ESBA 4E46A 3PI6A 3L1JA 3GFFA 4H7IA 3I2GA 2QMQA 4QDTA 2WJ3A 5DNUA 1UOQA 4J0GA 4EBBA 5YASA 5ALZA 3I6YA 1U4NA 1XZBA 3N2ZB 2WUEA 1TAHA 3RK4A 1XZAA 4H0CA 4HVTA 2BKLA 5EIEA 1XZGA 3FLAA 5IVHA 4QWWA 3PUIA 4W1PA 4AMYA 2XUKA 3L1IA 4NVRA 4WDRA 4UHBA 5AI6A 3BF7A 4K5QA 5T4FA 1EH5A 5BWBA 5ALPA 3TEJA 1QE3A 4FLFA 1VE7A 3A2NA 5AKHA 1R88A 2XMCA 3LS2A 4Y9SA 3IUQA 4GBGA 3FVTA 1SC9A 3SK0A 5A71A 2ZSHA 5KWIA 4J0CA 2OLEA 1N1MA 1DWOA 3QMWA 2PSDA 3STYA 2JGIA 3K2IA 2I3ZA 1Y7HA 5HCUA 4B85A 3WK6A 1XLVA 5C8ZA 1VA5A 4NMWA 4JYPA 2XB6A 5JALA 5FUMA 2VTVA 2WSLA 3PF8A 1ZI6A 4BAUA 4FBLA 2FJPA 4Y2UA 1WB6A 5AOCA 2GBGA 3W2TA 2CUTA 5C8VA 1F6WA 4AN0A 3ANSA 3F98A 5AKJA 1YB6A 2ECFA 3WZLA 4HRYA 2FJ0A 2XUPA 4BP8A 2QUBA 3EIOA 2I78A 3CXUA 3ZV7A 1DWQA 5ALOA 5AI4A 5JZSA 3H18A 5AIAA 5A6VA 3I1IA 2Y6VA 1HLGA 5K3BA 1ZIYA 5ALRA 1K4YA 4X85A 5E4JA 2B61A 3W9UA 4CI9A 1KEZA 4EB0A 1YAHA 4KE8A 3IB3A 3WWCA 3WI7A 1XZLA 2HA5A 4AXBA 3OM8A 2HA7A 1DINA 3KDAA 3AJAA 2PUJA 2PPLA 4C87A 3D59A 2VSQA 4C4ZA 4BTVA 3WYDA 3FCYA 1CUUA 3OTQA 3S8YA 2ZYHA 2CZQA 5EHQA 1XFDA 4Y2PA 4LYEA 1THGA 1O6GA 4AZ0A 1CUFA 3CCCA 2E3JA 3F97A 2VT7A 3EQ7A 3HLKA 2XLBA 3H2JA 2HRQA 1IUNA 5F4ZA 3QH4A 2JGFA 2C5GA 1JJBA 2W6CX 2DQZA 5IKXA 4AO8A 1CPYA 1BROA 2HHAA 2VAVA 4CCYB 2OCKA 5LZ9A 5AKLA 1H2XA 4X93A 2JEYA 5AKYA 3IULA 3B3QA 3D2BA 3QMVA 5LZ5A 5ESRA 4BYMA 1JKMA 4AN1A 5AKZA 4U2EA 1L7AA 1EXWA 2DHDA 1VKHA 2AJBA 1J2EA 4OU4A 4H35A 2ES4A 5DYWA 4U2BA 2BGNA 1XQXA 4HS9A 5LYYA 2EDAA 3STUA 4UFNA 1MAAA 3WLAA 4IHAA 5FV4A 1C7JA 3O9MA 2H7YA 2XUJA 4IH9A 2YASA 4GDMA 1I6WA 4H7JA 1W76A 4UHCA 3QZUA 4H7DA 1FFCA 1CUYA 5HFAA 4C01A 1QIFA 1XRRA 4F21A 5E2IA 3BJRA 4FFWA 2OGZA 3WYNA 1USWA 3ANTA 4UHDA 2Y2UA 4I3FA 4EZIA 4HXGA 4G8DA 2XUHA 4L9AA 3FLEA 4EY7A 2JGLA 5ALWA 1CQWA 4CCWA 4X7BA 4PW0A 1W1IA 4KR0A 5BWCA 3JWEA 3S2ZA 5ALXA 5EGNA 4PO3X 5LP1A 4UBLA 4ZWNA 2WTNA 3HC7A 3WL7A 4BE4A 1YSCA 3C6ZA 1N5MA 4LHEA 2Y6UA 5JD6A 2AJLI 1TRHA 2XQJA 1XZKA 4DM7A 1B41A 4RGYA 4AMZA 3PUHA 2ONCA 2HA2A 5HFNA 5AIBA 1EDDA 1YASA 1YS2X 2B20A 4KAAA 3BF8A 1X2BA 1XZCA 1SOMA 4YASA 2VJDA 2OAGA 1CIJA 1R3DA 2G63A 4KAJA 2WIJA 2BGRA 3G02A 4J03A 3ILSA 5LKAA 1MX5A 2QXUA 4FMPA 3FCXA 2GBIA 2X5XA 4PNZA 5LKRA 5ALEA 3O0DA 2O2HA 2WFMA 1R50A 3OURA 4I19A 1UT6A 1BEEA 5LZ8A 3H04A 2PKYX 3F9CA 4L3WA 3WKEA 4GEGA 4E15A 1ZOIA 3B5EA 2WJ4A 3ICVA 3F8SA 1W52X 3KD2A 3WIOA 3FYTA 1HDEA 3PE6A 3E0XA 3DL4A 1ZD2P 2VEOA 1HL7A 1MU0A 4QA9A 5HKAA 3G0CA 1E8MA 1HQDA 4BATA 2H9YA 5KREA 4GECA 4YPVA 5HF5A 5K5EA 3HEAA 4PV7A 1THTA 3A2MA 1RWQA 1TKRA 3QM1A 2EEPA 1VXRA 4INZA 3WQHA 3A70A 5LZ2A 4QE3A 1RP1A 2Z8XA 3ICWA 5C81A 5HZGA 1LZKA 5ALJA 2OCGA 3D5EA 4DNQA 4FOLA 3V1NA 5EIHA 2DSNA 3R3ZA 4UBJA 3I6ZA 3V48A 4X95A 1EB9A 2GZSA 4QLOA 4X00A 3VKFA 1U2EA
chains in the Genus database with same CATH superfamily
1U9IA 1QZXA 2J6BA 1ZCFA 3A36A 4Q3EA 1V8ZA 2OB1A 2J9RA 1GL7A 5BNTA 1OPRA 1Z2CA 1FRFS 1QG6A 2IZ5A 4YFVA 2QVCA 1T36A 4JI7B 5JJLA 4L8YA 3DMNA 3AM4A 3DPIA 1T5DX 3DEFA 3KNZA 2XT0A 4M9QA 3L6EA 3EMBA 3DTVB 4JK3A 1U6JA 3ASYA 4GWGA 4Y6QA 4C43A 5B2EA 1G9SA 3UMVA 4OFZA 3A9UA 3DE7X 3G7SA 2ZBQA 4WOKA 1XYVA 2QZZA 3IUMA 4C0AC 1LWOA 5DTEA 4L72A 4EG1A 4W9MC 1JEAA 4NSNA 2OVBA 1BFUA 5DM70 3AWDA 3BMQA 5CVTA 4ND1A 1RJFA 4DPLA 4Y1RA 2J08A 1A4RA 3N86A 4RVNA 1WSAA 1T9AA 4O63O 4B6JA 2UXDB 3T7DA 5I5EA 1DL5A 1WPRA 3KZXA 1FPQA 2JBHA 1FMTA 1DC7A 1XTRA 5DHAA 2DTXA 2EX4A 2PAFA 4A8JB 1C8VB 3LUCA 1NXWA 1TZKA 4GOOD 4ZAGA 2TMKA 3HACA 3HVKA 1T3TA 2LR0A 3I0MA 3FTFA 1FSPA 4GOJA 5CA0A 1RYBA 1HRDA 5BV7A 1OH8A 2CVZA 2DH6A 4LRUA 4Z0HO 4IIEA 1OAOC 2HPZA 1TGYA 4KIGA 4PBSA 3TNDA 3TRKA 2R2AA 3AEKA 1L5NA 3TFWA 1IM2A 3GC6A 3LUDA 2CNDA 2QK4A 2KE5A 4JJ4A 3K5PA 3RIHA 3H2ZA 4ACAA 1SBCA 3FTNA 3DMHA 3WQSB 1NXSA 5A3SA 4UTXA 3O75A 4P58A 3HJNA 4A0QA 4BVLA 3LC0A 1FMLA 5B2FA 1YUNA 4P92A 1ZONA 2C9ZA 3ZV5A 3S2SA 3BMOB 1Y9JA 4FC7A 1R5NA 2QJFA 3CX7A 3IE0A 2OBFA 1GPUA 2GPTA 4V0OA 4YO8A 3VR6H 1TQ8A 1VPLA 4KIWA 1EWYA 2B4TO 5BNFA 3HP4A 4C6TA 2ZRKA 2RGYA 2I4OA 3OFND 2PWYA 1SD5A 1TXGA 4G9GA 1RKBA 1JIXA 3B1XA 4R3UC 1FUUA 1N75A 1SBYA 1GT6A 2ZUSA 2PH1A 4JENA 3HYTA 4L95C 3K1ZA 4V3BA 1JFLA 3KTAB 5IUNC 3PNVA 4CMGA 1M8FA 2QRPA 4YDSA 4YIHA 4YAKA 2H1HA 4I50B 5IG2A 2VQDA 4EY3A 4MULA 3OZRA 1DCMA 4IY1A 3Q7PA 1GFIA 2LZ0A 1YR1A 3D2AA 1UOEA 3CINA 2BFFA 1Y3AA 4KQ9A 3WHLA 3WSWA 4CV0A 5I01A 2FP4B 4YJ3F 1F3LA 3QA9A 4MVJM 1JAYA 3EF3A 3IRUA 1SUAA 4OVKA 4OUDB 5IEJA 4KIJA 4ROTA 1WW3A 2OZKA 4FNAA 5EUQB 1G3MA 3AJ8A 4UJ5A 3R0QA 3FNQA 1QFSA 3GRCA 3B1WA 4G1VA 1CTQA 5JV5A 1ZUHA 1JZTA 3D3QA 1IBMB 1IN1A 2NACA 3KQTA 4LNHA 2JDID 2RC6A 3QE4A 5DSTA 5GJBA 3H75A 1MC5A 2Y1WA 3EXHC 2QRVA 1W85B 1PSZA 5JQGA 5DPMA 4YWJA 1Z5GA 4B40A 5A4KA 1RRFA 1LPBB 1VL2A 2G7ZA 1LV7A 1N5KA 2J4FA 3BB1A 3FPGA 4JP3A 3AR4A 4DIFA 5F7OA 2OCXA 3KQHA 1HXHA 2FW7A 3O92A 1YI8A 4UBOA 1MNQA 1SGWA 2IUFA 3IPLA 2FPPB 3TSZA 4C5AA 2ZWIA 4FZJA 4BU0A 4IBOA 1GTVA 1BS9A 3HA3A 1N5OX 4RVDA 1JKJA 1HDZA 1NJ6A 2QSZA 2ZT7A 1GPKA 4Y9UA 3SYLA 1FFYA 1BQEA 3DZ8A 3MMPA 4MUJA 3CNLA 2FH5B 2QLBA 3AUJB 5C2JB 4HRXA 2C9MA 3LNCA 4NZOA 1JRLA 2HCTA 1YQ9A 4U0KA 1J33A 5IDYA 2VDUE 5F98A 3IQDB 4YR7A 1QKJA 1S3SA 1SK8A 1WHTB 2WWXA 4PX3A 3L8ZA 4ZD6A 1PGJA 2YV5A 1R2QA 1U7HA 3DULA 4YJ2B 4E94A 3IHKA 2QI9F 1PV1A 2PYIA 2BKEA 3PRKE 1K4MA 1NQAO 3Q10A 4R0NA 4ABYA 3R1IA 3GLKA 4MR8B 4LIPD 4TRRA 1KE1A 3OMWA 2RC5A 4Y2HA 1KEEA 3MOIA 4H6VA 1O54A 5CA1A 1ZI9A 4NNJA 4CFYA 2QMHA 4IYRA 2A5GA 4Z2YA 3OCVA 3GRUA 3Q3VA 4AKEA 4UAGA 1K06A 2DWPA 3RYCA 3SN6A 2D0OB 2LD4A 3H5RA 3V8QA 5J3JA 1KR2A 4FKBA 5KYYA 3DH0A 4YV0A 2JCSA 5DNYB 1M8JA 1JDBC 2O9JA 1I0IA 1P0FA 2V6GA 3HFRA 1W9HA 5B1HA 3VNQA 2A5LA 3PQ7A 1ONPA 1W6UA 4WBSA 3LX5A 1NN0A 2YN4A 1O96B 2AOVA 4Q9HA 4RD2A 3RG2A 3ZE9A 1LA2A 4KQ6A 3ETGA 2Y66A 3PXAA 5HCIA 3I2JA 4NI5A 3W7VA 3U4DA 2ZULA 1EXVA 1TK2A 3DCIA 4J9UE 1T0PA 5F7ZA 5JAUA 1QKIA 3BDIA 1QGAA 3AHGA 1ST2A 1P1JA 4QGGA 1IY9A 1EUYA 1Y89A 4FDAA 2C42A 4B45A 2XB2A 2QN6A 3HKDB 4AIIA 2UYGA 5KTKA 1VYHA 4C2AA 2ZZNA 2O1XA 1R3UA 2VXBA 1TUIA 3O83A 3ODGA 2W9XA 3C7TA 4G5OA 2ZR8A 3G9UA 1HDXA 3OTWA 5FNVB 2C77A 2FXIA 3O93A 1LX6A 4KU4A 4Q9JA 2XB9A 3TVTA 1G8YA 4P4LA 1AHPA 1JDUA 3AF0A 3CY6A 3NBMA 2BGLA 2AJDA 4L73A 2B2XA 2LW7A 1SFRA 1VRWA 1DIRA 3U4HA 4Q4LA 1A50B 1XU7A 3AERB 4OBEA 4PLZA 2FSIA 2ZE8A 1PVVA 1HK7A 4QVIA 3EGVA 4GMKA 1KXZA 2FMHA 3RYFB 2NZ2A 5K0SA 3KPYA 3B7PA 1L7VC 3MIZA 4J0DA 3PCXA 4I1YA 4CHTA 4E5PA 5BSEA 2C0QA 2YVAA 3W1EA 4A1OA 1WLSA 3V8BA 4F7DA 3DVAA 3RHSA 4BPBA 4BKQA 4RGBA 4Q82A 4BFLA 2WVGA 1JG6A 1F9EA 3BJEA 3NM4A 2G9UA 4I08A 2Q41A 3LY5A 1SVUA 1DTWA 3IUBA 3PA8A 4DYDA 1DIGA 1Z0JA 2NU7A 4G23A 4REMA 4R71A 4YXWD 2VTDA 5KNDH 3ZHXA 2OO5A 4YMSA 1IMJA 4KG7A 2G76A 2RJOA 4YJFA 4RSRA 3D8TA 1MXFA 3AV0B 4AJ1A 4E1BA 5CLLA 5E1OA 2XRFA 2H29A 1SOAA 1QRTA 4EEXA 5FWYA 1V1RB 5B55A 2PXXA 2QTTA 2AWOA 2C4TA 1JT9A 2BTOA 3JRNA 1GG5A 3UUFA 1FCJA 4NICA 3RS0A 1AUXA 1IATA 2CLLB 2H1SA 2OL4A 3GXOA 3QSGA 4KDCA 4R5HA 1UWKA 4TL6A 3TTTA 3PQFA 1FUYB 3FF4A 2PPVA 4HNAA 4YUVA 3OFVA 5EHZA 1E66A 1IEQA 5CLJA 5LXTB 3WJ2A 5AVJA 3L05A 3NU1A 1SZJG 1S4MA 1YJBA 2NUTB 1LKZA 2C2ZA 5GINE 1F6BA 2V5AA 3ED5A 2DUJA 4NFHA 3QEMB 1EA7A 1VCNA 3FVVA 4LX0A 2CT8A 2OY0A 4R7TA 4B17A 4LNUB 1K1EA 3ZYCA 1WG8A 3K5IA 3UB2A 3EAGA 2JHPA 2AVNA 4N3BA 2JIBA 1T91A 3NVAA 3V1LA 5EJEA 5D51S 1TF7A 5CT4A 2PMEA 5A5GA 3DFUA 5E6UB 3WGIA 2D13A 3DKPA 3KXIA 4K6GA 4EEKA 5A4FS 3YASA 1DQYA 4BLUA 3FMFA 5CXUA 4OL9A 3U44A 1IQRA 1L1QA 4U7DA 1YC5A 4EJSC 5DYNA 3WLJA 4X1KA 4L0MA 1ZQ9A 5D01A 3PEUA 5IKPA 1IY0A 3BHJA 3WWPA 4A5OA 2Z3VA 3H2SA 4NOLA 1XN4A 3ABSB 4TQAA 5E7QA 2J3HA 2OAQ1 3DL0A 2MR5A 1VHJA 3GEEA 3PGJA 4G09A 1P2VA 3Q3HA 2NM0A 4FYPA 1D1TA 4W1SA 2NPIA 1F2TB 1HF3A 1K6EA 1Q7EA 2OTCA 3MRVA 4RMHA 4FLEA 5BW4A 3MD0A 5GZ1A 5L4NA 4KACA 5KYGA 1TLFA 3OBBA 4M9XA 4RCZA 3I1JA 4YHBA 4XX0B 2CV1A 5ECDA 3DV0A 4FX5A 2GA8A 3OCXA 1OA0A 4EH1A 3VR2A 1I0LA 2F9LA 3FDXA 3MN1A 1XPOA 1BVHA 1V96A 1B0PA 4BHTA 2AJCA 5EPOA 4PTZA 3QFSA 3ABZA 1BHSA 4X54A 4B4KA 4XRRA 1LLQA 2DP4E 4HDQB 3T7AA 1TADA 4LI3X 4NE2A 1SQFA 2OXIA 1JSXA 1VC2A 3WGLA 3OT1B 5KC9A 2PX5A 3CVVA 4L0DA 4I9NA 2XGSA 1WKCA 5AW8A 1LSJA 4JLVA 1NYLA 4ZKDA 4WN3A 1Y5IA 4Y0NA 3R5SA 2Q5HA 4TROA 1D2CA 3K53A 3PEEA 2YJ4A 1SBNE 1CD5A 1BCRB 3MTGA 4AICA 2KYRA 4JJIA 2WYOA 3W4KA 3RNLA 5LWHA 2QL7A 3R7WB 1IVYA 2UYQA 3D1VA 3F8WA 3IBYA 1E0DA 4UNPA 5H9VA 5BT9A 2WYIA 5KYKA 3BD6A 2F8LA 1GARA 1DTEA 2C4MA 1MX3A 2NO5A 3BYZA 4HH4A 2CDBA 3F8TA 3WMRA 4G6ZA 5HF6A 4TQGA 1TIPA 2CJFA 5GAJA 2WHEA 2PX8A 5AW1A 1VBKA 2JJMA 3HFJA 5CA0F 3RTCA 1P60A 1SU4A 2HW8A 1Q20A 2D00A 2R87A 4PFQA 3EXIB 3VC3A 1Q83A 3SKYA 5CXQA 4ARVA 2C2HA 1RXVA 3CJQA 5EWMB 4RH1A 4P6VF 1PKXA 1QOQB 1PQ4A 1XTSA 2P78A 2EKQA 4KSCA 4EY8A 2ZITA 3HUEA 1JFRA 3EPPA 3ROKA 5HE8A 2YY5A 4MVJA 5IHXA 2A0YA 1QS0A 3Q2KA 4MQBA 3JQ9A 4R8LA 1AKTA 1ORWA 1ZRHA 1Y4DE 2VZ9A 1M2JA 4ZZ1A 2FEXA 2YNMA 4CIWA 3EJWA 2BE7A 4HN9A 1HI9A 1TMOA 3K9FC 1E79A 2OCLA 3M1AA 1ZP6A 4KL8S 1JHPA 1XEWX 3R74A 1V8OA 4NG4A 3LTEA 2XNDA 4XPZA 3LBNA 2I67A 4RAQA 2QTHA 2H4YA 4MYDA 3IVCA 1S2NA 5JAQA 2IDMA 1IULA 4OREX 4F5EA 1AQLA 4K3VA 2QR2A 3HKBB 5FFNA 3EWSA 4PBTA 5CR9A 5A5EA 2ZWVA 4C76A 1N32B 4XWYA 3A9TA 3TYXA 3BD9A 3UHOA 4TWZA 1MN6A 4ND6A 2NU8A 1SCJA 1I3CA 5JZBA 1OZGA 1ZK1A 1SVIA 4RQTA 2FEKA 1SXGA 1FDSA 1TJ4A 1XWWA 1WCIA 2YICA 4KO2S 4UNQA 5DNVA 3TGPA 2O8FA 1F5NA 1A88A 1JYSA 3A3OA 3A2LA 1DEAA 1LVUA 1H8ED 1H9BA 1P80A 2BJHA 2AV6A 4DIDA 4OV6B 5KEIA 1H3FA 1MV8A 4P54A 4PAGA 3AESB 1R5BA 1UANA 1VGRA 1PZXA 2BJWA 1RJDA 2FPXA 3KS9A 4FDTA 4AT1A 1R6TA 2B99A 3IVAA 2DPMA 4G5YA 1Y37A 1PT9A 3FKJA 1XVVA 2K2QB 1P17A 3NUQA 4YP7A 3SFVA 3E35A 5JQGF 4P08A 2QLLA 3U4IA 4UUBA 1PJBA 2FEWB 4M76B 4US1R 1A2QA 1PUXA 2YV4A 4ATNA 2WQ6A 1QH8B 1QHSA 2BOVA 1RDFA 1I0ZA 5JSHA 2WZCA 2IYWA 2HA3A 2NSLA 2GSDA 4ERXA 4NJOA 4BFZA 1R0WA 2OBXA 5ERGB 3PNKA 4Z7NB 4WOPA 2ZDQA 2ZI6A 4O5AA 1RXSA 2DT8A 4HTFB 3WKCA 5J43A 1JSRA 3QVUA 4N3CA 4GQIA 5BNZA 4RZ2A 5HXAA 4KQXA 4E08A 1C4XA 4BFCA 4GW3A 5WRFA 4KBFA 1BWRA 2XWQA 3ZCRA 1SG0A 3KAQA 2FEMA 3DO8A 3V8MA 1K88A 3ZY6A 4MW1A 1PNRA 2X19A 5SYNA 4PO1A 1GAQA 3OWOA 1PG0A 1DQNA 3R6TA 1QIDA 4RPKA 4EA7A 1RE0A 1D8TA 4EY6A 4BQFA 3V7NA 1E5DA 4DPKA 2X8AA 1WV1A 2WVHA 3O4HA 5D5QA 2OD2A 2XGOA 2ENUA 2YFQA 4Y1FA 1FUEA 3QYJA 3TN7A 4PPQA 1YJ8A 5B4TA 2SNIE 4AF7A 2NV2B 1VZ3A 4P5PA 2FAXA 1E4OA 5CTAA 4YJDA 3NIGB 2QPLA 3EQ2A 1NYRA 3AKYA 3COZA 1R9MA 3VNVA 3LM8A 3TSCA 4HD8A 1C2TA 3OOYA 3KAKA 4HYQA 4WERA 5CVJA 5C52B 3NP9A 4X7MA 5LLDA 3EZ2A 1YR7A 3PWZA 2GTPA 2W42A 4RV4A 3ZNOA 2OGWA 4CKBB 3KIPA 3I04M 4OHCA 4RWZA 1T8WA 4MKXA 3LVBA 3FMVA 3QLEA 4BC1A 5NLLA 4UUPA 1LNQA 1Y4SA 3PR3A 3ZK9A 4BMOB 5I8WA 5AW2A 1W7AA 2AIRA 1THZA 1D1QA 2KBEA 1JTVA 5CDFE 3RTAA 1FP1D 1BTOA 2PWBA 3V80A 4DA6A 1QP7A 5KOJA 2ADMA 3ZWBA 2JD0A 2P6MA 3O26A 5FWDA 1T5SA 4BVFA 3U5TA 2R60A 3HUFA 3IAAA 3SI7A 4F1KA 4IJWA 3HKEB 3G5LA 4AFNA 3K32A 5KOHA 1YL7A 2O5RA 3EBPA 3TJRA 4FE4A 3NEJA 2BMJA 4MW7A 2YXPX 5HYVA 1TI7A 1TVMA 1TM3E 4LQCA 4OHWA 1MX9A 2ODAA 4LZJA 5HQ3A 1TK3A 2ZYVX 2JGNA 1TVKA 2VH5R 3LY7A 5AUQA 3W9BA 4DV7B 3QKSA 1BOFA 4QC2A 5LQNA 4PG7A 3HBJA 2HYDA 4B82A 3BEOA 1SA0A 4RPIA 3ENZA 4YS6A 4QUDA 5HWSA 3K73O 2JGDA 4S2UA 4EPXA 5SZJA 4B6PA 2IXTA 1BXGA 4F4FA 4B3GA 1H42A 4JT8A 4WXHA 4ZYLA 1X80A 1ZGGA 4RD0A 3M3DA 5B4UA 1Q77A 4HVCA 5F2KA 4WASA 2AQHA 2PXHA 2QU7A 2YOHA 2DR0A 4RPCA 1XMJA 2LKCA 3IPXA 1E5XA 2OHIA 4D3ZA 5CCEA 3LOQA 5EXSA 1HE2A 4QSHA 3IKLA 4WKGA 3PI7A 3KJGA 2R1TB 3X1WA 3CUYA 4MV8A 4CMEC 1F2UB 4H3HB 1SZDA 2GBFA 3K5WA 1J24A 3VR4H 4DEYA 4KXQA 1IDN1 3DFZA 1IZ7A 2Z2JA 3ECSA 4KXYA 3JQQA 4AJ4A 4LF7B 1UDXA 2VRCD 4TMFA 1A97A 3DOUA 5H80A 1BXRB 2FYTA 1N7JA 3B60A 3LHFA 3PSAA 2BH9A 3MEQA 4FFSA 2EFJA 5DT9A 2BF4A 4B3DA 4LSZA 3C6QA 1T3LA 4AJLA 2G4VA 2TECE 4YCJA 5JXGA 4L5YA 1YZGA 4E09A 3RV4A 1M67A 4DLXA 1AHHA 3EN0A 3RFXA 4BLRA 5JYDA 2JRCA 1C8BA 4NESA 2VBCA 4P3YA 1U0OC 3LXMA 3ZV6A 3K6SA 5UKDA 2ECKA 3CE6A 2CXUA 1UBCA 4XLTA 1M2KA 1S2GA 3UAGA 2HIMA 3UK1A 1WCXA 2C2XA 4QRHA 2EXXA 2RI0A 2QTGA 3UAYA 4U7PB 4QLBA 4EI8A 1OT3A 1U2TA 2DHQA 4DLSA 1Z63A 5GGXA 4OIMA 2EKLA 4M8IA 5ALYA 3RWBA 4D46A 1KYQA 1KEUA 2PUEA 2RK4A 1GTZA 4HAZA 3RS8A 1NVFA 3VOBA 4OSEA 1RYHA 2OCBA 4XIIA 2EGHA 3U4QB 2OGSA 4H7HA 4N7JA 2OT3B 3E7DA 3OU7A 3NO4A 1MPXA 3K9CA 3AW9A 2IYYA 1U28C 3DHWC 1NKVA 3WL4A 4DHEA 2ENWA 1X7DA 4L9WA 4YP9A 4Q66C 4U5QA 3VVLA 2XCUA 4AZ0B 2DQSA 1AS3A 3VYVA 4EPTA 3CF4G 4F5WA 3ZJTA 1D7AA 3H9GA 2C5SA 5CK5A 1F06A 2J7KA 4QGBA 5CDFA 2JASA 3HEBA 2IWRA 4IXWA 4B0OA 4YRMA 3KALA 1A4IA 3JQ7A 4IFEA 2AK2A 2Q5QA 4IQFA 1XKTA 3O2QB 2IV7A 1NXTA 3GLHE 3ZTTA 2ONYA 4BB0A 5A5DA 1IWOA 2AZDA 4FFLA 4OLJA 1ZEJA 2BF7A 2GR9A 3P2OA 3RSZA 3DBRB 1AKWA 1EJ2A 4UTRA 1NVBA 4DFDA 1M34B 2J6CA 5CFZA 1LW6E 3D6VA 3I53A 5K8JB 5CPFA 4YNBA 3CV3A 1H66A 3SHFA 4LJKA 3M70A 4ZV9A 3ZZTA 1ZOPA 3C1TA 3RS9A 3T4UA 4MO9A 1KMQA 2RG7A 5H59A 5FPSA 1YGYA 4V2IA 1U7OA 3C8UA 1SUPA 4RH0A 1DKRA 4MRAA 1NF3A 2DECA 5AXCA 5I9TA 2Y0PA 5K4HA 4ZI5A 2BHNA 1IUPA 1BXZA 4LY3A 1PR1A 4A0SA 2O57A 3ZVMA 1R9NA 1MG5A 1CIPA 3KOMA 2CBGA 2BEUA 3EISA 4K81B 4URFA 3W06A 4OQNA 3ROEA 4BNLA 1GLGA 1VP9A 2QYSA 3F47A 3EH1A 1GDDA 4EFMA 4MUIA 2DOKA 4H18A 1BDIA 4QXAA 1M6EX 2FX2A 1ECGA 1QCCA 2K4MA 5CGZA 3TR6A 4KO4S 4Y30A 1TA0A 5I8ZA 3WICA 1EESA 2E1PA 1TAQA 4IHJB 2GX6A 4M0MA 4ZZIA 1M10A 1FJ2A 3LH5A 4TWRA 4ZP1A 1X1BA 4HV4A 4B9AA 4PU0A 1RM5A 4ZJZA 1QGDA 3RVOA 3OX1A 4CM4A 5JY6A 1SUFA 4LKOA 3UWSA 2OBBA 3UENA 4Y2SA 5CIYA 1M0WA 3FRIA 2XDYA 3I8SA 1VG1A 4WLVA 2HX1A 5AR1A 4K46A 5B64A 4K9OA 2RAPA 3A1CA 1KZ1A 3HWWA 4LYYA 3UAOA 1V47A 4QUKA 5HDBB 2G36A 2IPXA 1M0SA 1BO6A 3D8BA 1E1NA 3E58A 3NTQA 2PUHA 4L8FA 4X9XA 1CEYA 4EB3A 1E8DA 4BO6A 3KZ1E 3SF8A 4KN9S 4QPCA 1I5EA 4B6SA 3MGAA 3ZZNA 2K5UA 1WF6A 2OYSA 2YHAA 4FW9A 4YT2A 3H4MA 2YJNA 2R97A 3CKYA 1XKXA 2C0PA 2X1HA 4UVGA 1KI7A 2X2PA 1LDEA 1DJQA 5ITWA 3X2FA 4CG1A 1C9YA 1XAHA 3GW8A 3HUUA 3QYPA 3P19A 1KJZA 4F6RA 3P5BA 2VDRB 5K0JA 2JATA 5A2QA 4FX2A 1OWPA 4PSCA 5IBPA 5TARA 2C4WA 2Q3MA 3X1ZA 1HA3A 3TTYA 4MVJF 5JAZA 3ONDA 2CZCA 2WWHA 2QORA 3SHWA 4EJ2A 1E2EA 3VAZA 5MDHA 1HYHA 2JKVA 5ED0A 2H2DA 3RSSA 4BUZA 2Q5LA 1CUBA 3DZIA 3RROA 4ZAWA 1E2GA 1Z3CA 2CXXA 1HKUA 2ZRDA 1NW5A 5TQVA 4MP3A 3UT6A 4R69A 4BEBA 5KYTA 2QB5A 2I33A 5F7XA 3FF1A 1NPDA 3I01M 4GGPA 5BNWA 1KXJA 3LBAA 1P18A 4ZT2A 5JDCC 2GLXA 3CF4A 4C3OB 1U8AA 4P3XA 3VDXA 2FMTA 4BO5A 4EKIA 5H82A 1OX4B 4OGKA 2IYVA 3EXFA 3PDIA 2ZS7A 2FVYA 4RW0A 2HOQA 3AWIA 1U1DA 3HDGA 3I2KA 4HCJA 4XD2A 4W5OA 1N4DA 4E51A 2BMEA 4M0CA 1MJGM 4MVXA 2DWOA 4Q18A 5D1NA 3SDZA 3AVTA 1BS2A 4DWJA 2SKDA 2CUZA 4TLAA 3IEVA 2G5TA 2A1TR 4DYVA 1G2PA 3GCZA 2UZ4A 5K9ZA 1AK1A 1QYIA 3M2PA 3BBPA 1X19A 1EIZA 2WMDA 4X7PA 1CETA 4Z86A 2J0EA 4P0PB 3K96A 1HSZA 1LBEA 1DKLA 4DR5B 1LS6A 4X5OA 1AQJA 3W7AA 3RGGA 3EGCA 2B1JA 3L8CA 4D0GA 1Y3IA 3TUZC 2FPWA 1EFDN 3L0IB 4PNHA 5CB0A 4PO9A 3K9BA 5TDHA 2HN9A 1EGAA 4LPSA 4UCWA 4G1BA 3GJZA 2WINI 4EMBA 2XSZA 3HU5A 2GTIA 4MROA 4EHFA 5D8DA 3BH7A 3DNMA 3G6WA 3UCXA 4S04A 4KNYA 2FMIA 5JD3A 3I0ZA 5IAJA 3OZAA 1L4FA 2P3SA 1AGXA 3VZDA 1U2PA 1B8UA 1QTIA 2OCPA 5BSUA 3E81A 1OWOA 1S0UA 3JZAA 3L4BC 3SEQA 2XR1A 4GVPA 2XYPA 4Q7KA 4QU8A 3T0IA 3D0QA 3U3ZA 3FDZA 5E7JA 2DMRA 1P1FA 3UTCA 2EFEB 3M5PA 3ZXSA 3CHYA 4HPXB 3CW8X 3ZKWB 2BZ1A 4BLTA 4BMCA 1F7UA 4FIZA 4D79A 1AKVA 4NS1A 1M74A 3DL7A 1IJFA 1SCUB 1XWIA 2EQ5A 2QT1A 4RABA 3I04A 3KV3O 1LSUA 3Q7SA 3FGZA 4MGKR 3W8NA 1Z7EA 1XD9A 4HQOA 2JVKA 3T6KA 4GHWA 4O59O 5DTIA 1MVNA 3CEAA 3ZDYB 3HR7A 5LP6A 1CUWA 2GK7A 3DBHB 3EVCA 4HX9A 4JQCA 5SZHB 1QK4A 4TLDA 3P9KA 4WK0B 3TLCA 5ESDA 1POWA 1KK1A 5FPQA 1JECA 1TYAE 1BX0A 4RIEA 1LPOA 5K3CA 1PFUA 1NVMB 3V2IA 3TB6A 3TW4A 1CUIA 1NBMA 1V0JA 2PKRA 4CCYA 1FVXA 4EUEA 1YKGA 1PX0A 2COKA 3AYZB 4U2DA 1FFBA 2DLCX 4WFKA 1S96A 2D3TA 4S1PA 4PF1A 3USES 1UAAA 3ICQB 2C3UA 1EG7A 4K26A 1K6MA 1ZNQO 1O9HA 1LJLA 4KQFA 3RUCA 2QX8A 4L0CA 4DEVA 5ALHA 2PS9A 3CCBA 4X6UA 4AS3A 2GKOA 2PUAA 1GAJA 3RV3A 4P4TA 3JVDA 5IEBA 1OLXA 4TSFD 1NLZA 1KTVA 1P3JA 4KTTE 2C58A 4O25A 3WGMA 5IZCC 3E4DA 5E7IA 2W4MA 5G53C 3LVRE 5CXXA 5I7SA 2D2FA 1V11B 2W93A 4HATA 3W77A 4DWOA 4W5RA 2H2FA 1IHXA 2F4VB 2NAPA 1RZRD 1E61A 1VLMA 2I1WA 4H1HA 1WMDA 1AKQA 1N2OA 3Q6NA 3VPXA 1O97D 3KB2A 4UNSA 2Q9AA 5KX5F 1DCTA 2Q3EA 3HA7A 4OP1A 4QXRA 4DE5A 1PP4A 3M0EA 4M6WA 3GT0A 3CF2A 5DDIP 3G5AA 3K2BA 1QH1B 4Q4HB 2WHQA 4DV6B 2W11A 1E6CA 1LBTA 5AJVB 4HAYA 2GAJA 1YZUA 2IH2A 4QYIA 2OENG 1PAUA 1BQ3A 1YA4A 3Q9UA 1ADYA 5B1SA 4B3XA 3BAFA 4KWIA 2YBDA 2FN7A 5CYFA 5TVGA 5D7BA 5A0VA 2VHJA 2RK6A 3RQIA 1Z6XA 4O4JA 4AI6A 4M1YA 4F2PA 3H0EA 3KO8A 5D3MA 2QKYA 4AWBA 5ICGA 4FNMA 4JSYA 5CT6A 4ZARA 4L8LA 5KTMA 1PL6A 5D85A 5HF8A 1WNTA 3SSOA 1K7YA 2C7BA 4I14A 4BZXA 4CLEA 1UP4A 2YHIA 2YWBA 3DGFC 4QO7A 3HU3A 5LJLA 4YFYA 3PIIA 3SZOA 1VDMA 1T35A 1XZJA 2HIGA 2W2KA 4G4JA 1QLWA 3Q9LA 4JHLA 4KXXA 4OQPA 2IU0A 2R1VA 3GA0A 1W6RA 1XXLA 4ITUA 4DLWA 3SM9A 2ZVQX 4IQ0A 5BNIA 5HUJA 1L4HA 4BKMA 5K8CA 3KQPA 2X23A 3C6BA 1IY1A 3DJFA 3N7TA 5AOBA 5HW0A 4GLJA 4DDUA 4FZVA 1Z56C 4FN5A 1ATZA 1C9EA 2VQFB 4HNTA 2Q6VA 3P0FA 2IVFA 1Y3FE 2I3BA 3MMZA 1JBKA 1PJCA 4NPHA 1BZYA 1UBKS 3HHEA 1TT5A 5KCZA 1JIKA 4REQB 1QRRA 2WG2A 4WKOA 2BEWA 3LYLA 5C34B 3S68A 2EJWA 4WIAA 1I4EB 3DLHA 3WKAA 4DBZA 1GAXA 3L0BA 3L0SA 4JB3A 2CJXA 3EZYA 1U6IA 3HCRA 3DMPA 3T5TA 5HMMA 1OX5A 1YB1A 1FLNA 2A3RA 4YWHA 1G6Q1 1TYDE 3KG2A 3DE4X 3HUTA 1XN1A 2O3JA 3FI9A 3BXOA 4V1CB 4Q12A 1S5PA 5IC4A 3FZEA 2JHAA 4WY8A 1B73A 3BT7A 3FHCB 1G8KA 4G4GA 1UMBB 4UDXX 2IUTA 2N42A 5DHSA 2PFSA 1QRSA 4MI6A 2PFGA 3GUYA 3LT4A 4KRFA 2NGRA 4R2XA 3MLAA 1VLLA 4F9GA 1MB3A 3ER8A 2IODA 3ZUGA 4DJJA 1KMHB 1OT5A 3D4OA 1T8RA 5DBHX 3NC1C 1V39A 3CN9A 3ELWA 3P0RA 5EJGA 1BCSA 3IFSA 5EESA 1JHRA 2QYTA 4TTVA 3DOJA 4A8TA 3ROFA 4ZGBA 2C03A 3H2KA 1OKKD 1Q3HA 4JYCA 4P4NA 4QBIA 2J5XA 2ISQA 3E1KA 1LY1A 3GD7A 4CFSA 1C7FA 4CIYA 5ADHA 1ABBA 1MFPA 1YR6A 2AFVA 4S0ZA 3ZOZA 4CW7A 3HDJA 4PG6A 4EKNB 1SQ6A 4ZYWA 5JZ9A 2IPAB 3ZK8A 4DCMA 1J9ZA 2RGUA 1UPBA 2VHXA 3COPA 1KJ8A 3KEQA 1SBZA 2I6UA 2IYTA 2UVDA 2XZTA 3OQ1A 1WSWA 4QGFA 3DDHA 1GFSA 3F0TA 2IOFA 3JASB 5C5DA 3NCTA 4WTOA 1BH2A 4MW5A 4I4TA 1QRDA 4RKYA 1F5SA 2NPOA 1DPGA 1KBZA 2WKWA 3O5AA 1HX7A 4RTJA 4FMBB 3A1EA 1VE5A 5IVIA 1OYVA 1XQ6A 1AJEA 4BNZA 4UAUA 1BX3A 5ES3A 2VJAA 5TQ0A 2GEJA 5EP1A 2V9PA 3MWDA 3NTXA 1EI9A 3LC7O 3ZQKA 3Q11A 1TJPB 3DYIA 2H57A 1FP4A 1ZKDA 1Y98A 3E5NA 3KOZA 3QV2A 2BFBB 1L7QA 1Z7WA 5AVKA 7REQA 1OQAA 4WFJA 1XOIA 1Q1GA 2XB4A 1KF0A 4CTOA 5FH9A 3U5ZB 4KJZA 2B6HA 2OV3A 4B8WA 2AFIB 5KHLB 5ISMA 1VLVA 2Y9MB 4CV1A 4DYHA 1DV2A 3RAEC 2AN3A 4RETA 3FUTA 5BN3B 1YACA 5JEEA 3G23A 2E7ZA 4CR8A 4BFYA 2CMFA 2PGJA 3LZCA 1I5RA 5NULA 3W6NA 2X0FA 1JA0A 1E98A 4INJA 3PE3A 4YCDA 2G5GX 5T5QA 5B12A 2HUNA 2WAYA 1WPXA 2ZAIA 3QKWA 2I4RA 4JB8A 4KSYA 1XZIA 4GX1A 3F6CA 5KNBH 5IVKA 3AM1A 5E6RB 2P0YA 3IEMA 4OOEA 3QKTA 4LDJA 3M1YA 3GLIE 2E0IA 2W6ID 4TXNA 3HJCA 4RJ2A 3TD2A 3O8RA 3F3MA 3RAPR 1PV4A 4WADA 2X15A 4QUEA 1GYPA 1HG1A 1N0WA 2ZSJA 1ULUA 2V45A 4P9NA 1Q0LA 3RSFA 5C3MA 1EKXA 2G8LA 2O0KA 3I01A 3GDFA 4RY9A 2YXLA 3RRJA 3D8SA 4AQDA 6PFKA 2VP2A 2O48X 1KMMA 3C3WA 3GCDA 4HB3A 4NBLA 4BL5A 2PKQO 4UHJA 5ALMA 4F5YA 3R3SA 1O8BA 3B2NA 3IP7A 4ZQIA 3OZEA 3JY6A 4ODIA 5DLYA 2QM0A 1Z29A 2DRIA 3HGQA 1H4TA 1SHLA 5K0EA 1I3NA 4G26A 5FHQA 1WE2A 1K0UA 3U3OA 1FPMA 5E2BA 1Z0AA 5K6RA 4B75A 1QYVA 2IOHA 2G4LA 3BCUA 1J22A 1Z07A 2X8JA 2ZS9A 3FFAA 3HN7A 2CHUA 2EWVA 1EFVB 4O0LA 3E3LA 4X20A 1EM8B 2DPGA 4XKJA 4R3NA 3EGDB 2RHBA 3IXMA 2WYVA 1N0UA 3T9DA 3AP3A 2EATA 4J07A 1EVIA 3MVEA 4LVUA 4O1MA 3IEUA 1WO8A 4Z9XA 1FRNA 3LCCA 1AKUA 4M98A 5CHYA 3CZAA 5I8PA 2UU9B 1C9KA 1CRWG 1CUXA 1GRQA 4XOUA 4DR2B 3E0QA 2JGMA 1KI9A 2QR5A 3FNEA 4LMPA 1W75A 5DYIA 4YN3A 1JDZA 3G0HA 4M37A 3E15A 1X1TA 2IZ6A 3RKUA 1V2GA 4HDSB 4H1VA 5CRIA 3QVKA 3DDSA 3GNSA 1AZSC 3HDQA 2HU2A 3MCZA 1X7ZB 5FUVA 3RSCA 3TKAA 3NUZA 2WLSA 1H3EA 2Q3LA 1GL6A 3GFPA 3NAZA 3OZSA 3TZBA 1PNOA 1A7KA 2BE9A 3DTVA 3PPIA 5AH0A 3BORA 5EFZA 4EG5A 4DMGA 2CVHA 3QVMA 2BP7A 2FW8A 5EG5A 2AMJA 2C5FA 3UOAB 4KPEC 4UBIA 3WLPA 4C04A 1E5LA 1UJ2A 1Z5WA 3B3JA 5K3DA 4EG0A 4BAGA 4YRSA 1JV2B 1N8NA 1JP7A 3IP9A 4Z9FA 3L4JA 2JIPA 4M0EA 4EJFA 2DERA 2BYTA 3IQWA 3MJHA 2ZBEA 1GUFA 2VO1A 1B00A 4FINA 2NUBA 4BZQA 2XA1A 4WY5A 1IHYA 2C4UA 3T3NA 1FTWA 1ZCZA 5HK8A 3TCXB 4QWMA 3F6BX 4QPPA 3ED1A 3U62A 3UJCA 2WWGA 4HNUA 5LQUA 2B35A 4P83A 1CR4A 4DW8A 2DHCA 5AXBA 1YC2A 2VAPA 1YCHA 4TV8F 1KIMA 3A6GA 3DDZX 4E21A 4NJEB 2F90A 3BD8A 1QYRA 4NMHA 3S2FA 5J4VA 2X14A 1YUMA 4TUYB 2VBIA 5D3ZA 4H7KA 1M73E 1CK4A 3WMXA 5I6DA 3FKSD 4HYYA 1R18A 2WMOB 1U2QA 3DKIA 3GJ7A 1P7PA 2PEYA 4L5CA 1J06A 1W36B 4W6QA 2PK3A 4LBZA 1CIVA 1PJRA 4PPFA 3HDVA 1C3JA 1XAGA 1VL0A 4AWAA 3DWIA 4C0LA 5C5EA 5K0ZA 1GTL1 1W4LA 5KJ1A 2PT6A 1YS1X 2QTAA 3E48A 3MGCA 4GIBA 4FHFA 4PE5B 1JZQA 1EVLA 3FMPB 3M49A 2OYCA 1WW8A 1M2WA 2DT5A 3F49S 5TPWA 3TVYA 1SOUA 4FZ5A 2EGGA 3STTA 2B1RA 1TU3A 4OXYA 3BMOA 4LHVA 3TJZA 2PQ2A 2YFHA 2VDVE 3MMSA 3OP4A 4DDMA 4NP6A 2GM9A 1QU2A 3E61A 2ZBDA 4J0HA 1YRWA 4R1OA 3VPGA 1BMDA 2WD8A 1ISFA 3PXBA 2A0UA 5EKDA 1QK3A 5TGDA 4BCDA 3LQKA 1OR8A 4Y6LA 1NLYA 3KTAA 1VG0B 4I50A 5ICSA 2Q8PA 3HNPA 4ROSA 3OZIA 1U6KA 3L6DA 5HKLA 3UC9A 1WS6A 2OM6A 2HM7A 2C2YA 3GBPA 3O47A 5EMMA 5KYNA 1CUSA 2ZI3A 2QRGA 1F20A 3EXAA 1NKTA 3K35A 4PYMA 1F6DA 4UBNA 3VAYA 4D9JA 4ESVA 1G21B 2HQBA 2Q99A 1RXIA 2K87A 5AJZA 4OUDA 2PMKA 3LPCA 4QECA 1ZUD1 4XJTA 2OWDA 5FJIA 2WSMA 4CU5A 3VR5H 1GZ7A 2R0QC 2RHOA 1IHPA 4MJXA 4LXHA 4RZQA 4QJ4A 4MGHA 3W6UA 4C06A 2PSJA 1BG6A 3T54A 4ZK2A 4F04A 4J1SA 4JIMA 2BGJA 4J6FA 5FADA 1SCBA 3JQAB 2UXCB 4CHGA 5LB2A 1W85A 3R3XA 1FLAA 3R44A 4RQBA 3WRXC 1UK9A 1WR8A 4AJEA 4DQDA 2NMVA 5F77A 4O4JF 2VLIA 1Z17A 5KPDA 1R9GA 4W1QA 1DIBA 1T13A 5KTOA 5FPPA 4H7EA 2FPPA 1J2JA 1Q92A 2R6ZA 4E1VA 4AY6A 2PQ6A 2V9ZA 2HCBA 4JBHA 1I14A 1KVQA 1UKVY 1CR1A 1K0FA 3KD3A 1WQ3A 1P4SA 2F7SA 3PFFA 4GPEA 5TEVA 1EFPB 5HRAA 3R9KA 1CLEA 2ZSEA 1JT2A 5JS8A 4TXLA 3UAWA 1D2MA 4KWTA 1CRQA 3GMIA 2EG5A 1YHNA 3I9V6 5HS4A 3U81A 1UMCB 4V0RA 5FR2A 2VDNB 3RLIA 3E53A 1MB4A 1HLDA 2G70A 1WHTA 3KHSA 3L7OA 5KYVA 4YJ2A 1P44A 2ASEA 1P4AA 2CUNA 4YRZA 4BQPA 5JC8A 1H4QA 4PX2A 1XMPA 1RWKA 4H3VA 4E6EA 2QJWA 4HFMA 3S1SA 5LLTA 3KOYA 3IO3A 1DAEA 5JYBA 5A04A 5EYPA 3WHKA 2OBMA 5KWSA 4I7EA 1Q6YA 4ER6A 1TO2E 3R9IA 2QM8A 2QMEA 3KSAC 3SOZA 1CJUC 5FQNA 3O95A 5CM9C 3KSBC 4RMIA 1ZG3A 4L4YA 1D03A 5JJ5A 5C1PA 5HJ2A 1XELA 2F00A 4IIVA 3CN7A 4R9SA 4O33A 4OXQA 2O2GA 2OG1A 4PGFA 4LK2A 3DKKA 2OKGA 3KX2A 5CFMA 1L5OA 3D3WA 2XRYA 3CR3C 1MTZA 1Y7PA 1SBTA 3MM4A 4UUQA 3DQQA 2HFJA 3TECE 1VBNA 3Q12A 1REQA 4RK0A 2R7LA 3JU3A 3M1LA 4N3AA 5IN5A 1J1IA 1G3UA 2H1RA 2ZYRA 3ZH9B 5CEEA 2L17A 5C7YA 1A7AA 4ZT3A 1QDEA 3L0OA 4II2A 3D2CA 1WIWA 2A84A 4EGCB 2PGNA 5BSTA 5JCXA 4UTZA 4OHPA 4XSHA 3E2PA 4M55A 1SQSA 3M6WA 3WSTA 3UHPA 3GX1A 1KH3A 3G82C 3N8KA 2JZOA 2PANA 3B1KA 1J00A 2AKYA 2VJBA 3G88A 3QLVA 3IV6A 4GOMD 5JEDA 1P9OA 3JWPA 1OSNA 2G0AA 3PICA 2J33A 4KMSA 3HKDA 8LDHA 5AVQA 1SB8A 1MUUA 3WSVA 4MUNA 5DM2A 5IH7A 4HXEB 4RAOA 1AZWA 3Q7RA 3ZKAA 1CUDA 3GI1A 4W9NA 3L9XA 3CB4A 2J3KA 3BL6A 2JIRA 4RXTA 3ZZMA 4CNBA 4EMUA 2GEUA 1JI0A 2P9QA 2Z6VA 5FNVA 2BHRA 3QIAA 4MS1B 1OXUA 3G7NA 1N92A 4BP9A 5JZVA 1ZHOA 2HR1A 4U9UA 2Y76A 3U61B 4DMUB 3ZHZA 2QN1A 4G5QA 4B84A 2DTEA 1IK6A 2YN2A 1HM5A 1EGQA 4MKHA 1RHQA 2R6CA 3CZCA 5EL0A 5BUQA 2IEIA 3IHTA 4BJ1A 2B83A 3AERA 4ZVNA 1CR6A 4DUGD 5HF9A 4I4TF 2VSNA 1NRJB 2XUQA 1T4MA 5CP8A 1YZHA 3RYFA 1TA9A 4MVWA 3TGLA 2ZWPA 1J21A 3A3NA 3DO6A 3VBEA 3NVKI 4E3ZA 1JQJC 2QXTA 3SPXA 1SXQA 3DC7A 4KLRA 3V1MA 3DM9B 2GVZC 4B2IA 4AXXA 4QDZA 1E1YA 5BW5A 1P5FA 4P31A 3F96A 4DZRA 3K0HA 4EW1A 1XZFA 3UV7A 3QFCA 5DB4A 8AT1A 2VF5X 4LSGA 1RRPA 3CEJA 3P71T 1EVJA 1RYFA 2WV7A 1RXEA 1UEXC 3MPOA 8ADHA 4B7UA 1EP2B 3PUWA 1RLJA 3T7SA 3UQYS 1H0RA 3X1YA 3KYDB 3QV1A 1R8QA 2PU7A 1I7QB 1J07A 2ZWMA 1FYEA 2PR2A 3GL9A 4JA0A 2IF0A 1MJFA 4L4RA 3DVLA 4Q4JA 4XAQA 3DR5A 2XCSB 2BGKA 2OAEA 2XGGA 3TAHA 4B3HA 3F74A 4M0FA 3SWWA 1Z06A 2JIQA 1TF5A 4JUBA 3WLSA 3B51X 1ZICA 1V1RA 3LOUA 1EJ0A 4NBSA 4RVHA 2WIGA 3VNBA 1NP7A 3L4EA 4GG1A 5FPTA 1WULS 2C31A 3NJ4A 3PX2A 5EUCA 1JHZA 3WIEA 2AVDA 4BMSA 1RPAA 1EFRA 5JMPA 4L27A 2ZREA 3RSLA 2Q2OA 2AZ4A 3W8EA 4X1IB 1RE1A 3LC1O 1L5FA 5LXTA 2Y1EA 1KVSA 2VWHA 4RK7A 3W3AA 5EWJB 3RIYA 2NUTA 2J3IA 4F2HA 3PA6A 2VPZA 4OQYA 5LOVB 4M1SA 4HQ0A 3FFXA 4PBRA 5H83A 4JI6B 3QEMA 1ZEMA 4EECA 3HR4A 1D3AA 2LBPA 2NN3C 1BAPA 1NW6A 1UBEA 3KYIB 4LNUA 3STWA 1QB7A 1RWNA 5K8TA 2NTEA 4B4WA 1O89A 4WXYB 4ARAA 5FBVB 3Q3EA 4MS4B 5J63A 5K0CA 4PZAA 1LSOA 2VATA 2A58A 4BNFA 2CJWB 1RIIA 3NW9A 4LV5B 4PXAA 5E6UA 3GFGA 5FOSA 3FSGD 2BUBA 1E1LA 5EGSA 1E6KA 1FS5A 3DDUA 4DY4A 4KK3A 2ZKIA 3BWVA 3WL6A 3SR0A 1FXWA 2YY6A 3ITEA 3NOXA 2B78A 3ZGOA 4KVFA 2P3OA 4IRUB 4WCFB 3DOIA 5DNWA 1HT2E 3RKRA 4E11A 1GKYA 1NNLA 1EQ2A 2YWDA 1BSVA 5F12A 3UWPA 5HX7A 2CL6X 3P2YA 2WMYA 2EP8A 3GZNB 3RUDA 1M0EA 4BGDA 1NSFA 1F2TA 1MVLA 2FA9A 1FS4A 1TPZA 1P75A 2V7TA 2ZRNA 2VP9A 2IBMA 4V1CI 3EDYA 5AHXA 4FR5A 1F0KA 1W2GA 1ULSA 4UVDA 3HN6A 4XX0A 1YZLA 2CFTA 3REQB 6GPBA 4LY0A 4X91A 5CXSA 2CB0A 5JIBA 2V0CA 4NLLA 4B2LA 4OGFA 3GLUA 3ZHYA 4ZCTA 2QX9A 3U60B 1W4BA 3VVMA 2QSUA 2IEAA 2XLCA 5ERXA 3S29A 3WGOA 1KYYA 3ZLTA 3FNBA 3H1AA 1C7IA 3E5HA 3G9XA 3GR6A 1R5JA 1TO1E 3P4YA 3WFIA 4E22A 3FSEA 1L1FA 2KHZA 2QENA 3UG6A 4DOMA 1VIVA 5BN5B 1VGQA 1XVUA 2BGUA 2C04A 3DHEA 3P9CA 1O9GA 3S5JA 4ARBA 1J8VA 4ER5A 1PVOA 1XDUA 1N2HA 1J56A 5ESXA 3VBCA 2H1OA 1RYEA 1ZXLA 4R41A 3RBZA 4C2TA 1BCRA 1UWVA 1EQUA 2GBLC 2NZJA 4Y0AA 2VHUA 4AJPA 4QQNA 3UJAA 5CU7A 4FLMA 4K3UA 4XB6B 3R7WA 4ZT6A 2CE2X 3GUHA 1U3FA 3N6VA 4QG3A 4DRXA 2B21A 3EIHA 4PSUA 4QZVA 3ROPA 4Q3CA 4HLNA 3MWFA 5DF1A 3MQ2A 3E05A 1HDGO 3E7FA 4HFNA 5K3EA 1JLRA 1Z4QA 1YU6A 5E95A 1Z62A 2G0TA 2ZP1A 1KERA 2OZEA 2Y2VA 1X3LA 2XMRA 3OFNA 1KY5A 3DMTA 4ZGGA 3EXIA 1SKBA 3DFKA 2JVJA 4M9SA 4TMKA 1NWCA 4QVGA 2FG5A 4RDCA 5AOAA 2D5AA 5EWMA 5FOWA 5KC8A 4ZC8A 2YOFA 3BK7A 4BV9A 2AG8A 2GKGA 4G0YA 2O06A 4WCVA 1GRNA 2G1PA 1XROA 4Z1MD 3OZTA 3DO5A 3EARA 2H9IA 1SKYB 2OFFA 3UH1A 3ZLJA 5FBRB 1CWUA 3MMNA 2RGBA 1YVDA 2AUNA 2WYHA 5HZHA 3QE9Y 1FQKA 2YIMA 3A4VA 4A2PA 5EOVA 4YMUA 2QD2A 1WMBA 2HRDA 1I7NA 2FB9A 2ZR0A 3G2JA 3VR6D 1KC3A 2ZUEA 2NPFA 3IKVA 1Z15A 2IEYA 4YLGA 3S2UA 1R4NB 4YQZA 4RACA 2ZJ1A 3O7WA 4JT4A 4E88A 3IA7A 3LDHA 5JG7A 2ZYAA 1UOQA 1NN3A 2JDIA 3SS7X 2G82A 4J7UA 3DKVA 4YH1A 3HKBA 3OY7A 5LP6C 4BNNA 3A31A 1OXTA 1DGQA 1WQ1R 3MJVA 3GT3A 3QTBA 1XZBA 4UXHA 2QRZA 1WZUA 2WD9A 2L0XA 2ZTSA 5DM0A 2AD5A 1JDPA 1R0CA 1RCFA 1WU7A 4H0CA 1C7EA 3PQ5A 2BKLA 1TKBA 4XGQA 4YTEA 2E49A 1WZIA 4DXHA 1XRSB 1XZGA 3DMDA 1D1SA 5C51B 2E37A 3N1UA 3PUIA 3AESA 4XUEA 1NGSA 3GD5A 5KVAA 1YQXA 1NOIA 2GHQA 4FCCA 1FMCA 4GVXA 4GYYA 4PFSA 4PGMA 2ZRMA 1CULC 2LV8A 4JZKA 1XJCA 3HLYA 4KXVA 4O5OA 5KJFA 3O90A 4LDNA 4UHBA 5HPYB 5AI6A 1VYTA 3BF7A 1JQ3A 1H5NA 5BWBA 5FULA 4XR9A 4ARIA 5KCMA 1QH8A 3F5QA 1J1UA 2ATEA 1HTBA 1TMGE 3UT0A 1TD1A 5AKHA 1JTEA 1KBOA 1R88A 3NPMA 2BIFA 4Y9SA 1TEXA 2VHQA 3IUQA 4MO2A 1HWYA 3BMNB 1QQ6A 2EZ4A 4I1IA 4V0KA 1PGOA 4V38A 1SC9A 3KB6A 5DT2A 3SK0A 4PQYA 1F8FA 4HTFA 2Z6UA 1PT6A 2ATVA 5B3JA 2ZSHA 2HSJA 4ZVVA 2JNWA 5BYAA 5EIBC 5IXJA 4NBUA 4UU8A 4WH0A 5I7HA 3AFOA 1DWOA 2L42A 1GLVA 1GT91 2WWWA 2G80A 1NG1A 3M3PA 8MHTA 1PZEA 4LJSA 3CRRA 2H5IA 3IDZA 4M46A 1SHKA 1NASA 3MT9A 3K2IA 2F8MA 3LUKA 3QPUA 2NVOA 4IILA 3BG5A 3N8IA 4M8KA 3NT2A 1CDZA 1I30A 3EULA 4CCSA 1CCWA 4IX9A 4K9LA 4ZCIA 1VA5A 5C8ZA 2B37A 4NMWA 621PA 3Q8LA 4JYPA 4I1PA 1JA9A 4FYMA 4IKOA 4F3KA 4D92A 2WSYB 3CQ9A 3CJRA 2B4QA 5SV2A 3SFTA 3CLUC 1N5IA 2WSLA 3PF8A 5DSXA 3CLRC 3WGGA 1C9DB 2B3DA 3PXUA 3BXHA 3S1AB 3SBEA 4CKBA 4YMLA 4FYJA 2EYQA 3JWJA 5ER6A 1X86B 2QIPA 3FNFA 5AOCA 4MZXA 4DA4A 1E9BA 1NQUA 1TM4E 1VIMA 2DQKA 3LX6A 4WPGA 2CUTA 3S28A 3L49A 3ZJUA 4MDHA 4V0QA 2OA0A 3KUDA 5IMSA 1TEZA 1F6WA 5AVYA 3W6PA 3F98A 4DCNA 2X0KA 1U7XA 3EYWA 1G3QA 2DGDA 2JLAA 3TQFA 2CCJA 4Q19A 1QVAA 1JVBA 2P6UA 4PNEA 3CX3A 2B94A 4JIGA 3B9QA 5JE8A 3IQFA 4BP8A 3L04A 1KJ9A 1M34E 3IAHA 4JC0A 4B7CA 2BHTA 3EA0A 1XDZA 1NOJA 3CXRA 4U8HA 4ZMSA 2FN9A 1NUQA 1UL1X 3PJGA 2EERA 4F12A 3QBEA 3OECA 4Q47A 3RS2A 2YMMA 3HJAA 1YCGA 3KUCA 3AONB 1XV5A 5AI4A 4ZI7F 2VHYA 1R64A 1VYUA 2A78A 3NNNA 4GUAA 4MRNA 4PTLA 4B44A 5JS7A 3R20A 2F62A 1Z8NA 3K9WA 3V7UA 3K70C 3EE6A 3H99A 1NDUA 4J6EA 5TV2A 3I5XA 3S55A 3DAYA 3SC6A 5AW6A 2PT7A 2EW2A 1MQ8B 2IH5A 3NWEA 2HLDD 4YXWA 4B43A 4C1BA 4LRSB 4CMKA 1DARA 1JLLB 2O0LA 1JIJA 4KQMA 4OQFA 4WZAE 3BILA 1T25A 5ALRA 4IV8A 1V8PA 3FTCA 1WUKS 3MMXA 2R1TA 3EVBA 1K4YA 3L02A 5HCNA 3OLQA 4X85A 5B37A 1ESZA 1MCZA 2W7TA 3EXHB 4AM8A 1F2UA 2AC4A 4MCJA 4KXFB 3T12A 1NUUA 1BGVA 5IRCD 1ZH2A 2R85A 3PB3A 4C0JA 4DCJA 3UH0A 1IN7A 1BXRA 2ODNA 3FHJA 2QEQA 1M76A 4IV5A 4E5YA 2C20A 2A57A 2H5JA 1CB0A 4L5AA 3RFUA 3AJRA 3PEYA 4Z0TA 1DO8A 4FJ1A 5DRYA 4PWZA 2HA5A 1VKJA 2J3LA 2WICA 4JJGA 2BM0A 2HA7A 4QHTA 5DO9A 4URVR 4EQ6B 5B36A 3NHUA 4QTZA 4JQYA 1PJ8A 3VUEA 3QVOA 1FB5A 1PR4A 3PWTA 5KNDD 2DETA 4LKRA 2F1OA 1O3YA 4KR6A 1ECLA 3I1FA 3IH5A 3M9LA 3NHSA 3D59A 5JCOC 1QYCA 2B82A 5TEWA 3IQGX 1YNSA 4C4ZA 4ARUA 2BEJA 3AY0A 4HMOA 4Z2AA 2RH5A 2RIRA 3GOQA 2V8OA 1Y4UA 1XPJA 1PVDA 3C3YA 1PGPA 3FTDA 3LKDA 4I5FA 4NQZA 4B4UA 4DCCA 3S8YA 4JELA 2ZYHA 3U4QA 1A1VA 1WZ2A 1XFDA 721PA 4K88A 1RJ9B 3H11A 1JXOA 5ENVA 5LXTF 1IN8A 1SN7A 2IJGX 2P9CA 2OD9A 3O03A 3TMYA 3QY9A 4XB2A 4AF6A 2FU5C 4MWZA 1RC1A 1O6GA 1XLTC 2PRJA 4AZ0A 1D6MA 5I5GA 1L5RA 5ELLA 1EE1A 1E1KA 5IF9A 3CCCA 3DP7A 1PSDA 5CDYA 1LI5A 2QSJA 2GK3A 2OKCA 3F97A 2VT7A 2YS7A 4HUTA 2RI1A 1E2PA 1V6CA 1H8HD 1K98A 4P4GA 1ZITA 1RABA 3X0DA 3A2KA 3IV9A 3QH4A 2JGFA 3DWEX 1JDBB 3IODA 5F9FA 4AO8A 1VPEA 1DJLA 1XTVA 1E3DA 2NNWB 2ZJ8A 3NFRA 3JPYA 3OJFA 4Q6WA 1TPYA 2OCKA 3FR7A 2IXAA 1SD2A 1J5EB 1H2XA 3DBRA 4PZUA 4L50A 1Z8HA 4EHLA 2JEYA 3P0HA 3R7DA 1ORDA 3I4LA 4GP7A 3PX7A 5LM3A 1U2ZA 3IXLA 3F7OA 4J0EA 3P9YA 5ESRA 3WDSA 1MC1A 1VDZA 2Y0EA 2HSEA 3ZJ4A 3SDBA 4KWCA 4P22A 1EAMA 4ZVLA 3VU9B 3H9JA 4AN1A 1NJ1A 4NFLA 2ZBGA 2IIPA 2CNLA 1L7AA 3BS4A 3LHDA 2IYFA 4XRGA 1I2AA 3HHPA 2WZDA 3TI7A 4QT4A 5L40A 1GVNB 2GWHA 3A4LA 1ONBA 5JXJA 3HV2A 2D3WA 3G8DA 1H4VB 1SUDA 4OU4A 1KOGA 4DIEA 4H35A 4TTRA 4BEJA 4EEZA 3LUAA 5JSFA 4FZRA 1R6BX 4U7JA 2P4QA 3RE1A 5EHGA 3AI2A 1WA5A 3S7TA 4X66B 2EKPA 4LXTA 2J5QA 1XQXA 2DFDA 4WLOA 5H3LA 4IFIA 5K0GA 1DDOA 1YCFA 4IIFA 3BA1A 3II6X 1UPFA 1XVTA 1PUJA 4PGAA 4EJ6A 5KNCH 5IM4F 3SEFA 1MAAA 4IHJA 3WLAA 3GWGA 4IHAA 5JOQA 2CHFA 1C7JA 1FDIA 4BV2A 4ZZ3A 3GF4A 4UE3S 3KEOA 1V5IA 3UC5A 3I39X 3MQ4A 2ANCA 1E3WB 4BFUA 5FBQB 4UVHA 2H4XA 3FWNA 1MFZA 1UZMA 4PLGA 3KJFA 3GO4A 2FZLA 4N40A 5DP1A 3JXEA 3JVEA 1D0IA 1E9EA 1Q3TA 2N75A 1FOEB 2O14A 4HMQA 1G4AE 1SO8A 1ZUNA 3FGOA 3HNRA 3EGOA 3GEMA 3RK0A 1Q7RA 3EZGA 4OP2A 2C8JA 2FZCA 3B82A 3RVJA 1Q74A 1V16B 4FQ7A 4BBAA 4YV7A 4B7AA 3KQWA 2LRHA 1OE0A 3DXYA 4UU7A 1FP6A 4PTYA 1XDWA 3UHAA 1P72A 4H7DA 3F71A 3GCXA 3OJXA 1QBKC 4C01A 3A1UA 2C59A 4F21A 1QMPA 4FFPA 2X0JA 1Q0UA 4BB6A 3L7AA 3WP1B 1USWA 1EIWA 5F33A 1H9AA 1YDEA 1P1KA 2WOOA 4G8DA 4PC1A 2R6AA 1F2DA 1S89A 2X9VA 3EIWA 1G7TA 2OAP1 2YXBA 4ZT5A 3T9AA 1I94B 2ZUCA 1NLMA 3GYGA 3N3AC 1Y8CA 2VA8A 3OZ7A 1CC1S 1M83A 4WK4B 2HTFA 5L9AA 1ZOOA 1CQWA 4O02B 5DKFA 1YR9A 4CCWA 4DIOA 5TMPA 3EMDA 1QYWA 2MWMA 2FSVC 4FFOA 3NOOA 4R8VA 4CWAA 2A1IA 3RS3A 4PW0A 3PFGA 4HAOA 1H8EA 1TT7A 2QLMA 3REGA 3IEPA 3GMTA 1MDFA 4EYSA 5ALXA 2WNHA 2VJQA 3WDLA 4POAA 4GL2A 4I5DA 1OX4A 4PO8A 5F7JA 1KVUA 2DUMA 1N5MA 3AI1A 4LJRA 1VMDA 2VJLA 4CETA 3VUFA 2ILTA 2AXNA 2OSVA 3LP8A 4KQKA 4A6PA 2WVJA 4EJSB 3D4BA 1IOZA 1B8OA 1XZKA 4P8RA 3BFJA 3PUHA 2A1UB 2ONCA 4JBGA 5AIBA 3AM5A 4YRQA 4RHUA 1ZY2A 1LX7A 3PPXA 4JDPA 4LRYA 3H87A 3MJTA 1WJGA 4Q9NA 2B20A 3O3MB 5KSYA 2HJSA 4XZ3A 3KDSE 1MENA 4EYQA 1PDVA 4FE3A 3LYHA 1DC5A 4WD3A 5KKCA 3TDNA 4D2IA 3DT6A 4GBJA 3BEDA 1UJ4A 3MTEA 5FTNA 4PM4A 1PTJA 2JI7A 5ITZB 1ZC4A 2Y0BA 3IX7A 2VJOA 3EOAI 4YASA 1BS1A 3SVLA 1UC4B 2G63A 3IP5A 1ZRNA 3DNFA 2QUHA 4G1MB 1Z4OA 1X8XA 1Z88A 5BXYA 1TFRA 3ILSA 1RQXA 3N5CA 2VS1A 1QHHA 3U09A 3NKFA 4LJAA 1WCWA 1FLDA 5HEKA 2R7KA 3P2JA 4K9NA 1B8PA 2YWFA 4MQEB 4EATA 2HI0A 2P90A 5A5FA 4I9GA 3ZKWA 3O0DA 3TLYA 1SCUA 1VIDA 2B6NA 3VGPA 2OP1A 3WYEA 1WBBA 1U2DA 3OURA 5K1ZA 3Q6IA 1AZTA 3H9EO 2R5NA 3AUTA 4I19A 1AN0A 3AMVA 1P4JA 1ESNA 1T2VA 3L8EA 4NIMA 5KVVA 1DMSA 3NANA 4GQAA 4FI3C 5JVDB 5IBCA 4EVRA 3ICOA 1AXEA 2V4MA 2PKYX 3F9CA 3HCAA 1P7YA 3NHWA 2FDRA 3O8LA 3Q5GA 2VSXA 3RUAA 2ZCVA 4HNVA 3JPWA 4BKOA 1HH4A 3GXBA 2GN9A 4MV9A 2PGAA 1IHOA 3WKEA 4PSKA 3KPUA 1JR6A 4E15A 3WTCA 3BZWA 1G2QA 1ODJA 3KZNA 5JTTA 3B5EA 3BCHA 4WMLA 4BXOB 1M6WA 1XIVA 3F8SA 3AJ9A 3K9NA 1W52X 2MHCA 4Z3DA 2O8EB 1XL0A 4J1NA 1ZGJA 4Q5IA 5H81A 3QP9A 4DB2A 2BBTA 1YZYA 3K2QA 4TOIA 1PJTA 1N9KA 5DSZA 1FDUA 3K0BA 3WY9A 4OHVA 1MP0A 1IOLA 2X4DA 1C3VA 3GGDA 5B7NA 5DX0A 2XKKA 1EGHA 4BO4A 1LFDB 4CQLB 4D8XA 2PLNA 2XVYA 3B5JA 1BDJA 3KHKA 4RGVA 1NY6A 3CMMA 1V11A 1MU0A 2KSQA 3I76A 3LC2O 1R0RE 2DPHA 1KHTA 4G0ZA </