3TO5A

High resolution structure of chey3 from vibrio cholerae
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
LNKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords CheY homolog
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae
pubmed doi rcsb
source organism Vibrio cholerae
total genus 40
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3to5A00
4MGEA 2OQRA 3KSMA 1VKRA 5IC5A 4JB2A 3H1EA 4TMYA 2FKAA 3MYYA 5DKFA 3SQNA 3EDCA 4FE7A 2LUOA 3HUTA 5HKOA 3GRCA 4HNQA 4KREA 4RU1A 3I45A 4LZLA 4OTZA 5KQLA 1ZESA 3MF4A 5C5EA 3KLNA 3OO1A 5FBHA 4H3HB 1TMYA 4RS3A 2HQBA 3EAFA 2PUAA 3JTEA 1NXXA 1H9CA 3CZCA 4LX8A 3T95A 3KKEA 4Z9BA 3ROFA 4ETIA 4UHKA 7ABPA 4MAAA 4EVSA 3L49A 2QSJA 2CHFA 3N53A 3N0XA 2KYRA 3IP7A 2FW0A 4IMJB 5JNRA 1RXIA 2CWDA 3QLVC 1JFSA 1BDHA 4DQDA 5BQ3A 3IDOA 3KLOA 5DGCA 4KNYA 2GBPA 2F8SA 1BA2A 3OM1A 1E2BA 3HZHA 4WWHA 4YO7A 3K9CA 3I42A 1NXSA 1APBA 3M9XA 1ISRA 3JY6A 3DGFC 1Z18A 2IYNA 3N6VA 3QELA 2GX6A 3GL9A 3JVIA 3IP6A 1J56A 1YMVA 3C3MA 4MR8A 1GCGA 4NICA 5B3JA 1ISSA 2LPMA 1KRWA 3P9YA 1AB5A 5I4CA 4KV7A 4DN6A 1CEYA 2LIVA 1EWTA 1NXTA 4MS1B 1GUDA 3OLZA 3BILA 4ZJPA 3GBVA 1U2PA 2QXYA 2JVIA 3DLBA 1UDRA 2HPHA 5TE9A 4F11A 4EVRA 1EHCA 1U2QA 3RVLA 2IDMA 1QNLA 3A0RB 3BRQA 1DBPA 3LUAA 3OLYA 5JS1A 2WY2D 3SY8A 1M5TA 1YS7A 4FE4A 1NXPA 4G0OA 3URMA 2IPAB 3HK2A 1JX6A 3DGEC 1DRKA 1C0EA 4MQEB 4F06A 1D1QA 5EWJB 2RJOA 3Q9SA 4MS3B 4W5RA 4W5OA 4TLLB 4Z0NA 4YRZA 2JVKA 2IOYA 4YGXB 4ETNA 3LUDA 5CNKA 4PE5B 3CFYA 1LJUA 4P98A 5HQJA 1BDJA 3OMWA 4EYOA 1JDPA 1M2FA 1Z16A 3H5IA 4RK5A 3QX8A 3T38A 1A04A 2GWRA 1FFSA 1SXIA 3TX6A 3GA5A 3H5WA 2MYUA 1I3CA 3LUGA 1P2FA 1Z13A 2L18A 1ZGGA 2R48A 3CG4A 5DCLA 5PNTA 2PUGA 4YWHA 3HCWA 4EVQA 5HM6A 4F12A 4OG2A 1CYEA 2TMYA 2FVYA 2R47A 1YK1A 3CG0A 3CU5A 2ZWMA 3I5AA 3F73A 1PEYA 3ROTA 4F8JA 3RH0A 4N76A 1FSPA 2CHEA 2FQWA 3QLUA 1URPA 3HVRA 4GPAA 4MS1A 5BR1A 1Z15A 4RXTA 3DZDA 4TLMB 3HXMA 1USKA 4RY9A 4G0ZA 3QEKA 2PE5A 3NHMA 3TMYA 2RJNA 1JFTA 3EJWA 1KGSA 1KRXA 1VRVA 2PMCA 2WJAA 3RVMA 2L2QA 1L5YA 5HSGA 3IP9A 4N03A 5JS2A 3S99A 1FFWA 2JRLA 2HSGA 1P8AA 2JK1A 2FQXA 5EWMB 4MQEA 1FQWA 1PNTA 2M1ZA 3C6QA 5EWJA 4LDAA 4RK6A 1MAVA 2FMKA 2RDMA 3GWGA 1W9HA 3QELB 5ABPA 4L4UA 1ZVVA 3HO1A 5TPWA 4MR8B 4XFKA 5TQJA 4JA2A 2YHAA 2PUEA 1QKKA 2NZUG 1TLFA 2B4AA 4XAQA 3Q7RA 3O1HB 3OLWA 4EUKA 4Z4CA 5KC9A 3KJXA 1M2EA 3Q15C 3NNSA 4Z99A 1D1PA 4XASA 3HS3A 3O75A 4MQFA 4YR7A 2PUFA 2W42A 3LUHA 1QP7A 2PL1A 3FFTA 1QO0A 4EYQA 5FBKA 4CBVA 4Z4HA 5IEJA 3JPYA 1USIA 4QPJC 4O1HA 2PJUA 3BRSA 5IEBA 1SD5A 3HM9A 1NXOA 3FDFA 5IX8A 3O1JC 3H6GA 1ZY2A 1PUXA 1ZHHA 4HNRA 5B3JC 5TPZA 4YS6A 2YHBA 4RWEA 1ABFA 4XARA 3RVNA 3O74A 1XHFA 4PEVA 3QX9A 5EWMA 4W5QA 2FEPA 2MSWA 1B00A 4O1IA 4G0QA 1YTUA 1DCFA 1MIHA 5CNMA 1QP4A 2RGYA 4Z4FA 1WETA 3OMXA 1QO0D 4KMRA 3OM0A 3CLKA 4HYEA 3H1FA 3QLTA 5IUJC 2VYCA 3H5TA 1D5WA 1JYFA 4LE1A 4RZSA 6ABPA 2QW1A 4RKQA 1JHZA 3GT7A 2AYXA 3RVRA 2E4VA 3H5LA 2PLNA 4GNRA 3SM9A 5C5CA 1ZGZA 1TM2A 4FB4A 4NCBA 3QEMB 1S8NA 1DC8A 1BDIA 1JBEA 2GKGA 2OENG 4W5NA 4EYGA 3FFWA 1U0SY 3HV2A 1MB3A 4WUTA 5GOTA 3H6HA 5JNVA 4EY3A 3Q7SA 4RKRA 5TPZD 1VLZA 3EQZA 2FTKE 1NTRA 2XDYA 4G0XA 5GQSA 1RZRA 4EYKA 2WRZA 2QVGA 2IKSA 4QICA 3E61A 4M88A 4TN5A 5FWYB 3RVPA 2JBAB 1DC7A 1GLGA 3SNKA 1JLKA 2WMYA 4MLDA 1TJYA 3F7NA 3O2SB 3G85A 1F51E 4JASB 4KRFA 3UUGA 3LUKA 3OO0A 1R8JA 2PUBA 4MRMB 4YLEA 4MR9B 3NBMA 4Z4EA 5KI6A 3QLVA 2VUIB 2F8TA 4IILA 1XHEA 5DLEA 2PL9A 5TPWB 3EULA 1IIBA 3TO5A 2R4QA 1Z2DA 2QVCA 1W25A 2MYTA 6CHYA 4MLCA 5CNIA 4N0PA 2WWVD 3O2QB 2MSKA 2PKXA 2IPLA 2WJWA 4RY0A 2BGGA 4KPYA 3LOPA 4KK4A 3RVOA 1SRRA 3RVKA 1RZRD 4MQFB 5T3YA 3E3MA 3MQ4A 4IMIB 2AYZA 4LRQA 3OQMA 5IUKC 4W5TA 3EQ2A 2E4WA 1MVOA 2MYNA 3H75A 4IF4A 1A2OA 1CHNA 3ILYA 3GV0A 1QQBA 3QEMA 1RPJA 5IULC 1VPWA 1U04A 4XLTA 2I6FA 4ZMRA 1NXVA 1SXHA 1ABEA 2L19A 3N0RA 4MYRA 1GUBA 3HUUA 3KG2A 5FWYA 3L6UA 1XWWA 2J48A 2JBAA 3DBIA 3OLVA 3T6KA 1LBHA 4WXMA 1JF8A 2NZVG 1JWLA 4YCSA 1DBWA 2R25B 2A9RA 1LJLA 3I09A 2HQOA 1TVMA 3M6MD 1DP4A 3IPCA 4RK7A 4MRMA 4Q7EA 4MR9A 1BVHA 3HDGA 3LFTA 4KZKA 2P9HA 2GI4A 2X7XA 2LP4Y 3N8IA 3C97A 1Z25A 3KHTA 5KQMA 5TQ0B 3RVJA 1E6LA 1F4VA 2ZAYA 4IGAA 1Z2EA 1ZH2A 2M98A 1YVUA 3NNNA 4E7OA 4D6YA 2ID7A 3N0WA 4RXUA 4D6XA 3ILHA 4KQ9A 5TQ2B 4PICA 2QR3A 3BBLA 2JB9A 4L85A 5FWXB 2A9PA 3DLHA 4KFCA 4Q6WA 5EWLB 1ZDMA 4JB0A 1QQAA 1D4ZA 1U8TA 3IP5A 1P6UA 1DRJA 2FN8A 3LUCA 2E4UA 3OQOA 2P4UA 4KK3A 5CNJA 3RVQA 3Q41A 8ABPA 3SG0A 3MA0A 3H1GA 5KQGA 3VNBA 4N47A 4MS4A 1A0OA 1JFVA 1OXBB 3BREA 3D8UA 3TB6A 3UK0A 4NCAA 3F6CA 3LUFA 3MIZA 1EWKA 4LE2A 2L17A 4WXEA 2A9OA 4G97A 3A10A 3G1WA 2FEKA 2MSLA 3JVDA 4RK0A 4G0PA 4JOQA 2ID9A 3LKBA 1LK0A 4S04A 4NV3A 4OLAA 1HEYA 5D2CA 3HEBA 4XXHA 1PEAA 2FLWA 1DZ3A 2QZJA 3CNBA 3M9WA 3MMNA 1C4WA 4WT7A 1JL3A 3KYJB 4KQCA 4G86A 3LUJA 1Y1LA 3SAJA 1YK0A 1ZAYA 2FMIA 2CD7A 5TQ0A 4OBBA 1GCAA 1PNRA 4F3TA 4IRXA 2E4ZA 4QYMA 1JYEA 1OXKB 5TQ2A 4G0MA 2PUCA 3LKVA 1K68A 4RV5A 4ETMA 3OQNA 5FWXA 2JCGA 4S05A 5EWLA 3FGZA 3LMKA 3CKMA 5CHYA 3RQIA 2LBPA 3N75A 4KVFA 3T8YA 4YP9A 1QPZA 3A3KA 3CS3A 3EODA 2E4XA 3JS5A 4MR7A 1DCKA 1RNLA 4D74A 5JNSA 4NQRA 4O5AA 1L5ZA 4N0QA 1SXGA 2FEWB 1E6KA 2V0NA 3IPAA 3NHZA 3O2JA 3FFXA 3H5VA 4ZMSA 4PZ0A 2Q5CA 2MYPA 3CZ5A 2HQRA 2VK2A 1BAPA 2FXIA 3H5OA 3A0UA 5JNTA 4Q6BA 4RY8A 3NNDA 3QLUC 2PUDA 3CRNA 2IPMA 1YS6A 1QMPA 2QU7A 5DTEA 2JVJA 2PAFA 4HNSA 5KWSA 2A9QA 4Z4GA 3CHYA 4N41A 1M5UA 5BRJA 3FMVA 3OLXA 5BRAA 2B1JA 3HJFA 3JPWA 4H3KB 3GYBA 9ABPA 3KYIB 2H3HA 4PYRA 4JAVC 5IBQA 1D2AA 5F64A 4RDCA 2HJ9A 3B2NA 3C3WA 4OLBA 1NY5A 2FLKA 3EGCA 4RK4A 3VNAA 2DRIA 1ZITA 5JNUA 5T7BA 1EWVA 3C3KA 4Y9TA 2NT3A 4LDZA 4MS4B 1YIOA 5KC8A 4QYWA 5JNWA 1AB6A 2N9UA 4G0YA 1JDNA 2FMFA 3K4HA 4YV7A 1DCMA 1P6QA 3HDVA 3LTEA 3O1IC 4WZZA 5E3JA 3KS9A 1Z12A 1FFGA 3O21A 2H0AA 2FN9A 1ZN2A 1Z17A 4EGSA 4RSMA 3KTOA 2NT4A 4P1ZA 4LE0A 1YMUA 1MB0A 3W9SA 4JP1A 3TD9A 4ZYLA 3CTPA 4RXMA 3MM4A 3HSYA 3R0JA 1T34A 2WB4A 3RVSA 3UKJA 1EFAA 2FMHA 3F6PA 4DADA 4B09A 4RK1A 1KMIY 2O20A 3GBPA 3QK7A 3KCNA 4ML3A 2VUHB 1DG9A 1PHRA 2QV0A 2IPNA 1NXWA 1ZH4A 4E7PA 1DBQA 2NUBA 4MPTA 1DJMA 2FSPA 4ZPJA 3D02A 1QP0A 1Z26A 1JH9A 1E6MA 1EAYA 4MS3A 5IUNC 4OATA 4H60A 4Z9AA 5KQPA 4UHJA 1K66A 1LBIA 1NATA 4MR7B 4Z4IA 2FQYA 1USGA 5ED4A 2E4YA 3Q7TA 1RXEA
chains in the Genus database with same CATH superfamily
2HXSA 1WLSA 2C2OA 2UYYA 4TTPA 5DK4A 4CGYA 5CB4A 4RLQA 2Y1GA 3GFTA 3C5WP 1RXVA 1AKYA 1DE0A 3UFXB 2VNKA 1C5KA 4BV8A 4BECA 3EDCA 1XAIA 3HUTA 3R3VA 1T8TA 3HG7A 4FE7A 4ZCLA 3TRFA 2EZ4A 3ZNQA 2YNMA 4I4TF 4DLKA 1CIPA 1F2TA 3ZZNA 2O5EA 4AMGA 1X9HA 3P2EA 4H3HB 1UFOA 4OI4A 2BKXA 2CLFB 4PZAA 1T2CA 2SKEA 2Q0XA 3LXUX 4IQFA 4YFYA 1SOVA 3ANTA 5JAMA 3E6AA 3KPVA 4L5AA 3E2MA 4FMDF 4GLOA 3VU9B 4CEHA 2DWQA 4JT9A 3N53A 4JP5A 3GBSA 3CWZA 4WWHA 3UWDA 1NLYA 3KBBA 5EC8A 2RG1A 5HJ7A 3QLVC 5JE8A 3PHLA 5JAIA 4G5RA 3M2PA 4YI5A 1M9NA 4OP3A 2P1RA 2X22A 2Z83A 5LP6F 2EVWX 3GT4A 1O4WA 2DZDA 1H93A 3ER6A 1H2HA 2R96A 2E48A 2O2CA 3P32A 5B12A 5JW6A 3K7EA 3TG8A 3IURA 3JVIA 1WJGA 4E0BA 3O6VA 4DE5A 1EM8B 1FRVA 1FX1A 3BJMA 3VYUB 4FWIB 2VQ3A 3P9NA 3WI7A 4PGMA 4QDOA 2LIVA 2P79A 3LU1A 4R71A 1EWTA 1NXTA 4CMGA 2XB2A 5H9VA 1DQZA 4PR0A 3VKHA 3N8KA 3EIFA 3TQSA 2WKSA 3OC0A 4GDFA 3RC7A 5G0SA 3KOYA 3I28A 1N2EA 2HRBA 1JLMA 1Y33E 1JSRA 3UAZA 5JS1A 4D1YA 3FUWA 1SHTX 3NEYA 3EDMA 2BZSA 2OKGA 1HPLA 2D5AA 2OM2A 2YIDA 3L0PA 4OMDA 1PQUA 4UBMA 5FUQA 2A67A 2ST1A 2VBCA 4G0OA 2CV1A 1I7NA 1S2OA 4TKUA 4I1SA 1KI3A 3QW2A 1TAQA 3WSTA 1D1QA 2ZIWB 3GDWA 3V8MA 4BJ6A 3T3HA 2JEYA 1RD4A 3QOWA 1NG9A 3KJQA 1W0JA 1PR4A 1IQRA 3TRKA 3H3JA 1I32A 5IAOA 2JCVA 5CNKA 4F97A 3SYRA 2PKRA 4EMUA 4LV5B 2PVSA 3VKVA 1R4NB 3ND8A 3TX6A 1R64A 3AVOA 1FFSA 1PJBA 1PCXA 2B6HA 4YQZA 1VI5A 4C4OA 1XNHA 1X15A 1U3TA 5A4KA 4HJXA 2PUGA 3T3IA 4Y6QA 1L1QA 4M1TA 5ADHA 4EVQA 3PV0A 4BO1A 4B2LA 3AWIA 3MD9A 4MW5A 4IWYA 1HX7A 4JQYA 4PN7A 1DARA 2B7LA 1J1IA 1OIXA 2VNHA 4DLBA 3AI7A 1ZK2A 1TT5A 1I2DA 3HDQA 4MS1A 3UVEA 1UDCA 2X9GA 1CR6A 5FEMA 3LY5A 1Z35A 3TTYA 4ZK6A 4CLOA 5JTUA 4QM7A 4DPMA 1XHLA 2YJNA 3BFKA 4ZOBA 3MG9A 4MWCA 3ZZ1A 1OLUB 1Q91A 2RJNA 2EXXA 4L76A 2SKCA 5HQ3A 3BEOA 2GPSA 3ROXA 2P9YA 5EQDA 5JOQA 4DSAA 4HYTA 1VBFA 5DN6D 1ECPA 1N5DA 3AVPA 3IIKA 3N2IA 3E84A 1MVNA 2M1ZA 4JUDX 5AUQA 3VR5H 4RSRA 4F4DA 2XQVA 2SKDA 2ZVQX 3L8HA 2B5OA 2GUGA 1I94B 4HQ0A 3R24A 4UHCA 1QH1B 2VF2A 4E5NA 2ZYDA 4WLFA 1IZ0A 2OXTA 1PYOA 1GPMA 3N2KB 3NTLA 3RWOA 1PZEA 2GBIA 1ZL0A 2PUEA 1F9AA 4C6RA 1WPQA 2NZUG 1YKSA 3OICA 3CUKA 3NDRA 4Q3EA 4CFZA 2PSJA 2GF9A 1BQEA 3KUKA 3A4MA 2H7YA 4WD3A 5TV2A 2GZSA 2CCJA 2D8AA 3K2EA 4M8LA 2QRHA 3NTQA 2QRGA 3NHJA 2ZRHA 3R0VA 2PMEA 4RZHA 2O6HA 2BRUC 3QKSB 3UAVA 4BNIA 1QGZA 4HEA6 4TTJA 3BICA 2E82A 3MS2A 3U13A 1VE5A 4R41A 2PJZA 4MP3A 1OX6A 4LZWA 4TLEA 4L3VA 4XVHA 3ZY4A 3FFTA 5D00A 5H81A 1CTQA 4NZ9A 4KHPB 1VBKA 3GMIA 3OLQA 3ICQB 3IQGX 3W7VA 3MQ2A 3DAGA 3IUSA 5LB2A 4BFCA 4ZYWA 3N86A 3HDTA 2VR1A 4HFJA 4LGMA 4DHWA 4QPJC 1XRRA 1IZ7A 3EOBI 4H7JA 4F6RB 4WK4B 2JJYA 4X00A 4ACAA 2ZJ2A 4RFSA 4WNYA 5ALQA 4UUMA 5FBRB 2MDTA 4IHAA 1MX1A 2OHJA 2OV4A 4F91B 4FEGA 4FSHA 3T9EA 1BQ4A 3PXDA 1M6EX 2OUKA 4LZOA 2PMFA 4EJFA 1QRUA 1UQRA 2I71A 3B8EA 1YC2A 2YHBA 1P9OA 4BUJA 5IJWA 5DGDA 5MN4A 1QIKA 3GMTA 4XARA 3EG9B 3RVNA 2D1YA 3V2UA 2QDKA 1M76A 4BFVA 3QENA 4EGCB 4DR1B 4Q02A 1KKMA 4KO4S 3LI2A 1L4UA 4XDYA 2YVAA 3OZTA 2B1QA 1T3ZA 3EY4A 3EGOA 1SU6A 4LDJA 3EC2A 2IV7A 1LJ8A 4UJ5A 4D3YA 4KFRA 3DE7X 4Y9DA 1VMDA 1E77A 2X9QA 4G85A 5K8LA 1JE0A 4DEVA 4YLYA 3QJYA 4NCBA 2GZ3A 2R85A 5HDQA 1BFDA 4O3FA 1JG4A 1FFXA 3NM4A 1JBEA 3OETA 2O2SA 3FFWA 4C5BA 1YHNA 5AHRA 3IFSA 4KDEA 4O2BB 2VJDA 1PRYA 4JK3A 2XWJI 1DT3A 1GKKA 1V3UA 2EFYA 2RHWA 1K86A 2OO5C 4P3PA 5JVDA 1EK2A 2DQKA 3OJLA 3A6LA 4J43A 9ATCA 1JXOA 2ATEA 2QIPA 4I6EA 1C30A 1V96A 1WCWA 2DTXA 2FLVA 4OM7A 4Y3UA 1G1AA 1V7ZA 3SLGA 1MO4A 5I7RA 4LJ6A 1NN0A 2DH5A 3TUIC 5B7GA 4Z4EA 2E85A 1KSJA 2I7CA 3G2NA 4NKRA 4ZVVA 2QGNA 3I53A 5KI6A 5JXJA 4ESVA 4JX8A 5E1OA 4HMPA 5DLEA 4RULA 2HRCA 2D13A 3TO5A 3TYXA 4Z4QA 4KN9S 4YV0A 1YONA 3OJ0A 2I91A 2IOFK 3HWX1 3NGXA 4XR4A 1MKYA 3GJXC 2PGJA 2O05A 2YY5A 4C4TA 5LKAA 2IODA 1QZ3A 2WTBA 2Q5HA 3B48A 3W8RA 2IS4A 2H51A 1HDOA 4WVFA 1S02A 2ES4A 1JNYA 2PS9A 3IEXA 3GG2A 5TF0A 2FFRA 1G6OA 5K0SA 3KJIA 1YR7A 1RRCA 2H8GA 1NSTA 2Q7DA 3ZK7A 4IPTA 1FSZA 1M2KA 4LWQA 4C4RA 4EJMA 3AL3A 4H18A 4Y6RA 5FULA 1K1EA 3CE6A 4I2NA 3E48A 5E6SB 1JB1A 1HFEL 2WF9A 4PIPA 1NJFA 3HXTA 2ZVPX 4AY5A 4IL5A 5C8YB 5AVUA 1U04A 2A1UB 4AY6A 4GOJA 4ZMRA 2Q4EA 2G9QA 1EGAA 4TTRA 3TOCA 2O8FB 4CN9A 3PVCA 4BBZA 1E79A 2QVXX 1ZNYA 1SBNE 1P2SA 4PX5A 1ADJA 4EHHA 1H4SA 1ZZGA 1Z4QA 4JI6B 3MJSA 4TZKA 5I7EA 4JLMA 2ZK7A 1GYQA 1ITZA 2V6BA 4BIIA 4BL5A 4X0EA 1RFGE 2EP5A 4BU0A 2ZTMA 2GLXA 1WMAA 2CMKA 3G8CA 3M9LA 3V4RA 4RADA 3CUEF 4YYEA 1E6CA 2DPHA 4NEHB 2IT1A 2GI4A 3LVBA 1JA9A 2DBVO 2D5IA 2XBMA 2WJVA 4MIOA 1P33A 4I1YA 3TWOA 5IM4F 3A4NA 4BQOA 4KR3A 3JQBC 1U5CA 1MAWA 1Z2EA 1FNSA 1ZH2A 1O7JA 2GVZC 5A06A 2ZM6B 4JSTA 4GXQA 1FJXA 3OAAD 1DELA 4O4LF 4TRRA 4X64B 1ATIA 3LX8A 3M6AA 4KQ9A 2R0QC 1VMIA 1YE5A 5AVZA 5FBZA 2BFFB 1TLTA 3CLTD 3ANXA 1E64A 3OT4A 4FNOA 2LVBA 4F8EA 5MFPA 1KQGA 1KF0A 3LS2A 2VNIA 4KBYA 4LK3A 4BEVA 4HAIA 1CUGA 1ZI8A 5KYKA 3Q41A 4XLLA 3VOSA 3UHJA 3ZY3A 2YN4A 3TTVA 1OIVA 1VKNA 4WTOA 1BC5A 1JR3D 2JAOA 2VHVA 2ZAGA 4MARA 3NB0A 2PGAA 1KDRA 1JXQA 1KOGA 1OBOA 4YMWA 1MC5A 3E9DA 1XC7A 5I47A 2A84A 3A10A 2DX7A 5DYGA 2MSLA 3UQYS 4RK0A 4RZ3A 5BVHB 4B5LA 2H9AA 2PH3A 1TUBA 1V3TA 2YJGA 4OLAA 2H52A 4BMDA 4K1XA 4JITA 3HN2A 4D0NA 1BFUA 3O4HA 4C07A 5K3BA 3SX4A 1S01A 2C0CA 1C3OA 3HEBA 4XYMA 2ZI4A 4LDRA 4N7JA 1DZ3A 3IMGA 1UM9A 4FFNA 4F4HA 1C4WA 1C3JA 3GCGA 3M6LA 3W7BA 1NVGA 4US1R 3S27A 3A37A 1HZZA 1XNJA 2RKOA 5E6UA 3QKTA 1RRFA 2Y8EA 2AFHE 2ODBA 3JQ9C 4MP6A 1A4XA 1KI2A 4K05A 1MJ5A 3QUQA 3FCSB 4NMWA 5HYVA 1A8IA 2NTVA 5J4VA 1FP7A 2WABA 4IVRA 1CV2A 1UMDA 3B7GA 4J2HA 1WTCA 4KE9A 2H3EA 3O90A 2ZCVA 1NULA 5FT9A 4LXTA 3U9TA 4UMFA 4YT2A 3THXA 4I3FA 1EUCA 1QOZA 3TI9A 4OI2A 4Y2QA 1Z56C 1TADA 3M4ZA 1U2TA 4J1TC 2CMGA 3T8YA 2FW9A 4FYPA 1SCIA 2I3AA 2HMSA 4G23A 4KQFA 1NRIA 4K87A 3EXG2 1XLWA 3IAEA 3KE9A 2AOVA 3EZ6A 4NCHA 5ALJA 5BW5A 3FAZA 4DV6B 1BXRA 2V5VA 4GVPA 2FR8C 2V0NA 2V6GA 3TL6A 4BFZA 5KWIA 1LPNA 2VYNA 4B8YA 1SAYA 1R4MB 2ZR8A 2PD3A 4FZ3A 1W5SA 3HLKA 1NI5A 4PZ0A 4U2BA 4P3YA 1KBOA 1I4LD 2MYPA 3IJEB 4KQJA 4O02B 1G5IA 4MTCA 1L8QA 3N5CA 5T8KA 2AOUB 5DCWA 4TVBA 1YKFA 3SE7A 3VYTB 3CRNA 3OHPA 1UP4A 2GAJA 1Q22A 1UXOA 4QDJA 1CJCA 2VEOA 5F5NA 3HDYA 3HA3A 2Q6KA 3FJYA 1RQLA 4QBHA 4WOBA 2YYAA 5EI5A 1PLJA 3WV4A 1U8UA 2BYTA 1ZX1A 4QOHA 2ET6A 2BVNA 5EJ9A 1CF2O 2J3MA 3CSUA 4JI4B 4UU1A 5ICEA 4H3KB 4EFDA 1O97C 4DXHA 2RHMA 2QGZA 3K0AB 3WE7A 1B4DA 4RDCA 2QRJA 1GJRA 3P26A 4XD7D 5K3SA 3S70A 4CTKA 2FN4A 3LSTA 4MLPA 3BQNB 3MXOA 1OLOA 5FPYA 1EWVA 1QK5A 1R7RA 2FDRA 3QVUA 3B5EA 4D9BA 2XVYA 1VP3A 2PT6A 2H17A 1M1YB 1KC3A 1RAGA 2PV0A 4U2KA 4W8OA 3W8NA 2Q8PA 3PJDA 4HUJA 5DOZA 4B75A 4C08A 4CM3A 5DN6A 4ZZ0A 1E3MA 1SOUA 1W5TA 1WCXA 1WXXA 4UARA 5SY4A 2WI8A 3O1IC 5ADWA 1DDIA 4Q3NA 4YX9A 3CKLA 4FBGA 4JUFA 1DIAA 4MA4A 4OV6B 2VXCA 1W8DA 4HB4A 5GP1A 5JJCA 1YS4A 4LRXA 3GRFA 4BKUA 4BLOA 1MT3A 4YT8A 1FDRA 3OPQA 5FNZA 3RADC 5K20A 1F20A 1B23P 1KEEB 2IYUA 4EI2A 2WU3A 1T34A 1N77A 3FOCA 1Z0ZA 3OOWA 1P74A 4PTZA 3FGPA 3OUUA 4BZXA 1PJSA 1SQSA 3IMCA 4ND6A 4P4SA 4R9SA 2XYQA 4RZ2A 3ESAA 5KUTA 5AT1A 3GBPA 5C18A 4DLAA 5LIPA 3RUEA 4ENQA 1Z38A 4RFLA 4L08A 4DDUA 1JEQB 4L50A 4ZN6A 2WIKA 3C4JA 1H05A 1VQ1A 4HB3A 3INGA 4A8TA 3DC2A 1DQSA 3G7UA 5FNVF 4ARIA 4C7BA 4E1AA 2CFOA 4DKXA 2B9EA 4L1KA 3ZE7A 1KA9H 1KS2A 3IQDB 2OO3A 4M22A 3DLAA 5CT5A 3OOEA 4IFBA 3HN7A 2JH3A 3QLEA 4XLZA 4YONB 1BW9B 1VLJA 3PJRA 4ABTA 3CT6A 1OT5A 3OTQA 4GRIA 4NJMA 1CQJA 1E9CA 1K75A 3AOEC 1KYWA 1E2JA 1TMOA 4HH1A 4TMFA 4XTRA 4QBGB 2JGRA 2AVDA 1MDBA 1VXOA 3KAJA 3URKA 2I6GA 1ZA2A 3AEQB 5ITVA 5IC5A 5JAPA 1YCGA 2W83A 3PQCA 1H4TA 4M1MA 1AMUA 5CCXA 1M8JA 1P18A 1U7DA 3GOQA 2G77B 3MYYA 5HKOA 2ZE7A 3IAM1 4X6XA 4P8RA 3VJMA 1QIHA 5KQLA 1PZHA 4GL4A 3KLNA 1O5IA 1XZNA 2JAWA 2YJ4A 5SY6A 5CDFE 1SUPA 3AUYA 4PO8A 4HX2A 2HIMA 3N8DA 1Q95A 4RIEA 4ECAA 4W5JA 1E1NA 1UXJA 5JYDA 1MJGA 1PVDA 4HB0A 2BMVA 4QUHA 2I2BA 2EATA 3LPDA 3ZC3A 1NNUA 2WAYA 3NBAA 5K0ZA 1CT9A 1N1GA 1EX9A 2BMJA 4A82A 3NAZA 1GL6A 4HDAA 1DRUA 3ELUA 2PZ8A 1LBEA 2GRAA 3A9UA 3JSAA 4J75A 3VUFA 5EKUA 2WFMA 3QVLA 4B6EA 4F5WA 3MWFA 2I65A 2QTLA 3R0ZA 1NMZA 2R6CA 3KSDO 4K6CA 4FOSA 1X2EA 1WOMA 2D0PB 1KZ7B 5LNK1 2EX0A 5DHAA 4JBIA 3ZWKA 4KN8A 4H6WA 3Q3CA 4PQFA 2Y4NA 3LDAA 4UVHA 4B45A 2LGJA 3CJTA 1RYHA 2IXEA 2VA9A 3H5AA 1OREA 3HKCB 4U7WA 5EIWA 1Y5RA 3GMDA 3Q3EA 4CTOA 1U02A 1PQYA 1UWLA 5AP9A 2O5RA 3L0IB 1ARZA 3PLNA 5FDFA 3K6SB 5JARA 4YAWA 2I2WA 3U7GA 3K0CA 4Y2VA 5JC1A 3DMHA 4WJKB 1WZ2A 3O91A 2I3DA 1KJ8A 4GP7A 1EHCA 4YXWA 2BGLA 1DBPA 3K9NA 2LRHA 1FNNA 2VUSA 4QXQA 3DAHA 4DF3A 1OX4B 3ADDA 3KQVA 3RSLA 2HHHB 2Y0DA 3KU4A 2HAEA 1DDGA 4IQ8A 4A16A 2RB4A 2PEZA 4AW9A 1JX6A 3QBVA 3AJRA 1T1JA 2O23A 1XU7A 5AQEA 5HIMA 1W49A 3VR5A 3FIUA 1ESEA 2R5WA 2R6GA 3MTQA 5EJMA 3V9AA 5HZKA 3GLSA 3NHFA 3AP1A 4KLCA 2JFBA 2OGZA 3SQMA 3H99A 1P0QA 3H2SA 1IB6A 1TC1A 3E22B 3FR7A 4IIYA 3VOAA 1GPUA 3T99A 4K9LA 4CIYA 1CD5A 1JLHA 2R1TB 1ID8A 1FL9A 1UZLA 4DS3A 5FOQA 4M0CA 1DJLA 1HOTA 3GX1A 4ARAA 1JLRA 4RK5A 4GM1A 3KVNA 1EA5A 1O9HA 3JQAB 3F5QA 3FHJA 1SVKA 2FP3A 1U8FO 1CY4A 1E2HA 1EKXA 1ODSA 1ZFNA 2C2ZA 2XB4A 2PFSA 3I05A 4FHFA 3DE3X 4M8KA 4ZI7B 3BXPA 5HUJA 2AN9A 1JDSA 4UVEA 3ZV6A 5C37A 2C2MA 2YVUA 1C9MA 2PM8A 2HA4A 2QPAA 3N39C 2OOKA 4L9WA 4WIAA 3NX4A 2ISCA 4X7BA 4KR7A 4ZDJA 1J2RA 2IP1A 2BKEA 2ZS8A 2FPGA 4GPAA 3PNYA 2C7VA 4GVLA 4JYBA 5DM1A 4X1IB 4ODIA 5G0VA 3G79A 3RRFA 3UJDA 3VC1A 3EZ9A 3LWZA 4LOAA 2PWPA 1TPZA 2F1IA 3SZRA 5KMGA 4EJ6A 2ZR7A 2QQGA 5AI8A 5DWVA 4DWWA 3ASZA 3C5VA 1ZSNA 1D2NA 2II6A 2PMCA 3AWDA 1O3YA 1W1UA 3G49A 4TWBA 4V02A 4COOA 4GKKB 4A1FA 2Q0HA 4B5KA 3O5AA 3RS5A 2Y0EA 5JC8A 2RHOA 2JK1A 4PPNA 5JSHA 5EPUA 4UBOA 2VJNA 4B71A 3CONA 4BVHA 1AKTA 3CW9A 5EXSA 3ZWAA 2GDJA 3WK4A 4ESOA 2Z4SA 4IHJA 1M67A 4NRDA 3RIYA 4FKZA 2CLEB 1ZVVA 3H17A 1LQUA 2EFEB 3ISTA 1CLEA 4L4RA 2FSVC 3ECCA 3L84A 4N40A 1P2GA 5CA1B 2X1MA 4REQA 1M8KA 3BWDD 4B31A 1C8LA 3WOHA 4A2WA 4XAQA 3UH1A 5SICE 3MWYW 1KJJA 3OLWA 1GDHA 2JLAA 3Q1KA 3WIOA 1PFWA 1QOPB 4HNAA 3ETLA 2AFIB 3T7SA 5KYGA 2J87A 3NNSA 4Z99A 2W2NA 3O75A 2XVMA 1TZMA 3CJRA 3PF9A 3K8YA 1M2JA 1RZ3A 2OGWA 2VZEA 1P4JA 4UUOA 2B61A 2P4HX 4LYGA 5EKSA 5L6LB 5AW3A 4J0FA 3ESBA 1JHRA 4LIPD 3TRIA 2CF5A 2ERXA 1Z3CA 2HF2A 4PSCA 1JR4A 1Y9ZA 2VHYA 4X44A 3T1VA 2NW6A 2XWSA 3STXA 2I4LA 1LH0A 1ESNA 1GNQA 1H5QA 3ETNA 5DZSA 5TGZA 4DNPA 3NFYA 2Q1YA 3WDKA 3HTXA 2PN1A 5A6SA 3LE8A 1QFXA 1NSFA 1LBTA 4HRXA 2PD4A 2VN8A 4QIHA 1KMMA 3IT3A 1RWQA 3NFRA 3KD3A 4CF5A 2FWPA 4A92A 3QKIA 2INGX 3BHNA 3KQNA 2WIBA 2XXAB 3PZRA 4L9AA 1RMQA 4E5YA 1PJ3A 1EK6A 1VPLA 1S2MA 4NU0A 5CLIA 2LDXA 1N2CE 1RIFA 2UZ0A 1VCHA 1K4YA 3QX9A 5G4KB 3UG6A 1W36D 1R6TA 3TGLA 4O1IA 3RRXA 4JIGA 2HMAA 3X1YA 5EVCA 5C1IA 7MDHA 2Z6UA 3P9RA 4FGUA 1YFLA 3WRYA 2N0SA 4AJPA 1AKMA 3D6FA 1WXWA 3QIVA 1XDWA 4C4YA 2XGJA 2V54A 3GARA 4HVLA 4IQ4A 4DIUA 3L8ZA 4YO8A 3G8YA 1DFHA 1EP3B 2I7TA 1Z4MA 2PLNA 1WAMA 2OBLA 4GR9A 3SM9A 1A8HA 1NQ5A 1CZLA 1PFKA 3ZE8A 4ND1A 1J99A 1JG3A 2XOKA 4PXYA 1SVIA 1DOAA 1Q1ZA 3SR4A 2CUKA 3WQHA 4QYIB 1P4RA 3BDVA 3HJTA 3RU3A 4XYLA 5I4BA 1NJ6A 3NTOA 4CKCB 5EJ4A 5J2UF 3DDZX 3DTVD 4B4OA 1T8PA 2JC3A 4GH5A 4QODA 4TX1A 2WJ3A 2V0CA 4EJ2A 5F9HA 4NZOA 1SXJB 5EIOA 3HKEA 4TOIA 4Q7MB 4DCOA 1X7YB 2KQUA 3RDPA 1NNSA 4NBTA 1XYVA 1D2RA 4EEZA 2CW5A 2ZBPA 3EXEB 4QDUA 3ZY5A 3DCYA 3EB9A 3MT8A 4Z3DA 4FUQA 2VWGA 1JDUA 3WDSA 5HOEA 1CC1S 2IIVA 1PS9A 3P45A 1IBSA 4LCJA 1H66A 4AUKA 3FBWA 3BIXA 4HPXB 1Z5PA 1ES9A 4NZNA 4F92B 4EVIA 1ISGA 1VM6A 7REQA 3K6KA 1W25A 2FWIA 1UPBA 2IF2A 2X40A 3QPVA 2MINB 1AHHA 2VC2B 4NH0A 4D9JA 4NNJA 2X0EA 2NP6A 4PC2A 3QV2A 2NLOA 1H2FA 4BQFA 4DXAA 4FW9A 4RTRA 5BV2P 3K70B 1TD9A 3MQFA 2IF0A 3M8KA 3AFHA 4GC9A 3UBMA 2A1TS 3AUFA 5HK9A 3EG5A 4KPYA 1EH5A 2PUHA 1EK1A 2G0TA 3SKYA 2EP8A 3OTHA 3JR3A 4PZPA 5BSRA 2JEZA 3TR0A 5IAKA 4ALNA 3NCHA 3IAM6 1RHMA 1UUFA 4Z7NB 1X7ZB 4LXGA 4OJQA 3HL4A 1SKAA 2I7XA 3H2IA 2YHIA 3MWEA 1MVOA 1JHXA 4QHYA 2QV7A 4PNEA 1IMOA 2BP7A 3H2YA 1I3OA 1NHWA 3RYHA 1E2QA 1DO0A 5KOHA 4UDOA 3ANMA 3LC0A 4K9RA 3DUWA 3ILXA 1SCUA 2HWKA 1RJWA 2WTXA 4PZDA 4DR7B 1R6VA 5LXTA 3ABIA 5GJBA 4LBZA 2L19A 3N0RA 3QE9Y 1K3TA 4WDQA 1VJ1A 1DV2A 4AY3A 2WSMA 2GBLC 4HH0A 5JD3A 1UBSB 4MINA 3W6OA 2JBWA 1DFGA 4BVFA 5LQAA 4CODB 2XHEA 4ZCPA 2RH9B 1SG6A 3CNLA 4XCXA 4UU0A 3SC6A 2WNIA 2ZE8A 4IUCS 1UZAA 5ERGB 1RU3A 3Q8LA 2A9RA 3PNBA 4PHHA 4FCCA 4M8NE 3IPCA 5JV5A 2D62A 4I6GA 2F3QA 4G0NA 3OHSX 2RSLA 1O9BA 2D5LA 4B0PA 5LNK6 1WQ3A 1I7QB 3ONDA 2QGFA 1FJ2A 1C3VA 1PK8A 3ASVA 5M7EA 3HBMA 1HDRA 2K5UA 3OCVA 1NUSA 3G6KA 1CRZA 2POQX 4X97A 1UOQA 1OV6A 1LNQA 2OK7A 2FW8A 2W2VA 4RXUA 5ITWA 4HEQA 4QRIA 5IFLA 2ZPAA 2PS1A 3AF6A 3AVWA 5EUQB 3W34A 3WTCA 4AKIA 2WUGA 3QXXA 3RV3A 2HQ1A 4TUYA 3DVAB 4LQCA 1NOKA 2JANA 3I5UA 4IUBS 2W9XA 1TYDE 3PJFA 3MJRA 3PP8A 1PFQA 3LUCA 4PLWA 4Y6LA 1DRJA 4ZU3A 2QLBA 3GPLA 1OLSB 2A5GA 2PO5A 1XXHB 5DNEA 3VR1A 2NVBA 2BKVA 1SC9A 1JU3A 4HTFB 1YRBA 4D45A 1E3EA 3Q2OA 4D82A 5JCJD 3P5SA 5JAZA 3L18A 1U0TA 4WPGA 5J2TF 1KYXA 4BWYA 3B1XA 1TCVA 3I4FA 4EOGA 3NT2A 3NRBA 2WNHA 1N9GA 2HWYA 3SJ7A 5J1SB 1IY9A 4G0PA 5IZCA 4FQ7A 4R9RA 4S35A 4LF8B 1RABA 4XGQA 4XQ0A 2NGRA 3O4VA 5D2CA 4JGIA 3RARA 4B4VA 4CTJA 5KNCH 2O7NA 2G9ZA 3GU3A 1MO2A 2WV7A 3O8OA 4FPXA 5PGMA 2O19A 3HDHA 2JZOA 5BWMA 3UJPA 3QYPA 2UUBB 4EHJA 3WL7A 3VHXA 3BSSA 1A71A 4L0QA 5BO5A 1Y1LA 3FI0A 1A3CA 4WBNF 1T2FA 2FMIA 3BXXA 1CUBA 1M75A 1OZGA 5MGNA 3ESRA 3NPMA 2GPNA 5LU9A 1XJWA 2JJMA 3RQSA 4O0MA 4RPLA 1EZ4A 2Q3MA 3GIDA 4FNAA 5BOVA 2HBQA 1L5NA 5AVVA 4G1MB 4Q9KA 4ZVSA 3K9FC 1L7RA 3U44A 2DFTA 2R6JA 4U4AA 4G0MA 4YCAA 4ZTUB 1T2AA 1OUMA 5DT9A 2NVUB 3JYOA 4GMXA 3I32A 1OXSC 2VF7A 4BMCA 3WSWA 5F78A 3C41J 5CHYA 4D8UA 3ETJA 1T6NA 3UV6A 4DR6B 4FXOA 3GFFA 3V3TA 4BC1A 2O8BB 3X1WA 1Z0JA 3JS5A 3ZCSA 4YV2A 2I62A 1SZDA 4M1SA 2GZDA 4XR9A 4E88A 2GJ8A 1A82A 4O5AA 5K0JA 4I1IA 1IXZA 1BMFA 1JSLA 2ZRFA 1L9KA 1Z6YA 1GR0A 3CMCO 3WMEA 5IHPA 4Y9UA 1PKXA 3C6XA 3M70A 1XTUA 4POAA 3R9WA 3L8DA 2DQSA 5JNTA 3VO9A 1DX4A 1SA0B 1JAYA 1W85A 2QUAA 1YRLA 2W8BA 3O4RA 4KCGA 4AAYA 2BGTA 4FOTA 3FMFA 2ODAA 1UKVY 1LPAB 2C61A 3K5WA 5IJXA 2PL5A 2WU4A 1I33A 4NNPA 4WQMA 4EUEA 2QVLA 2QRPA 1YL5A 4BZPA 2RHGB 4YALA 1AC5A 4PPQA 3WK8A 4U7DA 2BFMA 3CUVA 4UC0A 4ZT6A 2ZUVA 4M9XA 4NJOA 5ALIA 5G4LA 3C87A 5K45A 2A0XA 1PSZA 4ZGWA 3GFSA 4PYRA 3WNBA 3CVYA 1Z37A 4KJXA 2HUPA 1BS1A 4XTCS 4YRTA 4D9FA 2ENUA 5L3QB 5FX2A 3OIYA 5HG0A 2Q49A 3F1LA 4RK4A 1GQQA 2IXFA 3A27A 3HB1A 5CGQB 3B89A 2DRIA 1ZITA 4K6HA 3SS8A 3G2KA 1SK8A 3WGKA 4DQLA 5I7OA 1YIOA 5AJTA 1R5NA 4BB0A 3C8MA 1H3FA 3MT0A 2AFHA 4Z1MA 2OYCA 1FS5A 3PEFA 2V7QD 1COWA 2AUNA 4P82A 1FZQA 3K4HA 2UXBB 1KJYA 4MCIA 3KZMA 5D01A 1N5JA 3HGQA 2G9NA 4QJBA 2HJRA 3B3FA 3NKLA 4MK4A 4MRSA 5LLTA 1QNFA 4AY2A 2XF2A 1BKYA 2W2LD 2ZT6A 1X87A 3GEPA 2FW1A 3KUDA 3RJZA 2FN3A 4ZYLA 1GTSA 2BISA 3TQHA 4MPJA 4ARBA 3A6HA 3FNHA 3NI2A 5ENDA 2O50A 2Q41A 2NU6B 4O4IF 1TM5E 4OMCA 2NNLD 2Y2UA 1AUXA 3W2IA 3PUXA 4EFMA 1U1IA 5KX5F 5JBQA 4D3FA 5EMHA 3E3LA 4WZAE 5FI5A 5AVSA 3C74A 2IFTA 4P34A 1FPQA 4D44A 3HYCA 1G5FA 3RT7A 4RJTA 1QP0A 2ECKA 1JKMA 1Z26A 1RVDA 4LFBB 1UFQA 1LVUA 3PE3A 1CS0A 1OTXA 2FSGA 2OL4A 1RHKA 1WDLA 1R15A 4OATA 4PO3X 4RHYA 4Z9AA 2J59A 3EVNA 3TOXA 4RTSA 3HB9A 2ZIUB 1G7RA 2PEYA 3KJZA 4OHOA 5ALHA 1NW8A 1KAMA 3AO0B 5IH3A 5JZSA 2R1UA 4MWEA 2ZRGA 5JS8A 2LNDA 2QTHA 4B87A 3OZRA 2J7PD 2J9RA 1KIMA 1QPGA 2P91A 4PIMA 1J22A 2GTHA 3ZH2A 1KPIA 2P0YA 3DH0A 2XUAA 1NR1A 1IM5A 3GXOA 3LWNA 4J7CA 4OU4A 3DOIA 3PT9A 4AZWA 3OTOB 3IV6A 3UEOA 1ISIA 4TMYA 2DB3A 4WXYB 1N2SA 2JKZA 1M10A 2ORVA 2FCRA 1P2VA 5DTMA 3VR4A 3QWBA 3C3XA 3F78A 2AG0A 3DO6A 2F3PA 3OO1A 4NESA 1DJNA 3RG2A 1FRFS 1SBZA 2J3JA 2Q3LA 3RB8A 4KAJA 4DCPA 4MUHA 1A5AB 1P0FA 4B3XA 3U7JA 3AERA 3ROPA 1HQDA 3RLIA 5IN4A 1EVIA 3MINB 3S7ZA 3E5HA 3ZWXA 2DQ4A 1XZAA 5CVJA 5FR1A 3D1JA 2GARA 1JWAB 2BFEB 3O84A 3V1NA 1KAGA 4JKOA 4Q37A 1MFPA 3LYHA 2HJWA 3Q0EA 3WQRA 1CWUA 1AV7A 2HLNA 3LFUA 1ZR4A 5JXHA 2EEZA 2OBBA 1W1IA 3AESA 4IJ5A 4WKCA 4KACA 3NDPA 1UZNA 1R6BX 3IMKA 5A05A 4AIRA 4WZBA 4EF6A 5BSFA 5DGIA 2YKGA 1E58A 3K5IA 1FP4B 1GPYA 2WEKA 3MN1A 4OHFA 4WXRA 4YJ3A 5TQVA 2JLSA 2X4LA 3GFBA 4GXTA 2JFWA 4IDHA 2BTQA 3TW8B 1QMGA 2CDBA 2C7RA 1E5TA 4HEHA 4MUXA 3A11A 3OOSA 5A2QA 4CKEA 4LHYA 1WVMA 3GUVA 5B3JA 5D1NA 5C80A 5K6TA 1PTJA 4INPA 1NZDA 2H1CA 1KE1A 4Z7JA 3EVEA 4DLVA 4DR4B 4BV2A 4N7MA 2Q3JA 3EW9A 1WEHA 1K3UB 3BK2A 4HQRA 2LW7A 3WISA 5TE9A 4DR3B 1VCMA 2FF5A 1U2QA 2I3GA 2YV5A 4G1EB 1P1HA 2WIAA 4YCBA 1B76A 2HF8A 2GYWA 3IHWA 4ADSG 4NH4A 1UANA 3VKWA 2GAAA 3L8CA 3CZQA 2OG1A 3O1LA 1MHPA 4I4TA 2GRJA 5IJ0A 3VR6H 1AA9A 4FYWA 1SXQA 1I3MA 1NUQA 2B98A 4MS3B 1NVVQ 3LCRA 4OGKA 1SXJC 4JOBA 3GZNB 5CFNA 5HZGA 4JS0A 1RWMA 1N34B 2JVKA 1R16A 4AZ3B 2YJ5A 2RJ3A 4LTNA 2Y93A 3QUCA 5ALNA 4ZYUA 3EOZA 5BV1A 4OJNA 1KKUA 1EESA 3H5IA 4D57A 1E9SA 3D3WA 5CDFA 4R0MA 2IEBA 5IXJA 4F5DA 1H9AA 5H9WA 3QHQA 2GHTA 1I3CA 3LUGA 4B47A 4CF6A 1RLTA 2Q8QA 1E2DA 1N8KA 1Y98A 4QE3A 5LB4A 1FTWA 3CG4A 4HDKB 4X8HA 3T7TA 2QDXA 3VYRB 5CCDA 4OG2A 3G68A 4AO7A 3IJPA 3EQ6A 2YMLA 5DN9A 4QKQA 3K70C 1O0BA 3G8AA 4YXFA 1AV6A 3CG0A 3GJ8A 1XE3A 2C0QA 2Z43A 3TKLA 4F9EA 2KSQA 1XMPA 5B2FA 4FBMA 2EX1A 3W3AD 3EZLA 2F48A 3IUJA 1A9QA 4HS9A 4IXTA 4Q82A 3WJ7A 3E5RA 2ZIVB 1G5QA 1O94A 1VDMA 3ACDA 4RM3A 4TLMB 3HXMA 1N78A 3FI9A 2Q4TA 4ZT7A 1YNOA 2JCSA 1XJQA 3PS9A 3RBXA 2DJ5A 2ZSDA 1N2IA 1R0BA 2ISQA 2QRNA 3JU3A 4FZVA 3U9LA 1LW6E 3F9CA 3PNMA 2AXEA 3PQ3A 4KE8A 1OH6A 4KR2A 3EMBA 1BE6A 1E4VA 2CYBA 3DFIA 3JWJA 2JFZA 3OSZA 2UZ4A 5FAKA 1HNNA 1BCRB 1DWOA 4YRCA 2V1UA 1B16A 2IHTA 4H7EA 5EWMB 3UM9A 1T4CB 1DRWA 2NYUA 2OORC 2GNPA 2QLNA 1WXQA 4UUBA 2ADOA 4NEGA 5JCJA 1JDBB 3UJ9A 1W88A 3H2ZA 3FGNA 3MFYA 5E6RB 1YOBA 3RFXA 2QPTA 1QLJA 2PSFA 5A5DA 2CLKB 4N9WA 4QUAA 3WRXC 4LVOA 5G0UA 2B69A 3P71T 1Y48E 1X7XB 1V37A 4MR8B 2BEUA 5JI3E 1T43A 2VBGA 4JT8A 4LNUA 4B35A 2VJOA 2QMQA 4C03A 1FFHA 5AW5A 5L8VA 4L9SA 4NULA 3GT0A 4CMEC 4DCGA 4UFPA 2EWMA 1AGYA 1MORA 3CTMA 1H0RA 3Q7RA 5E7JA 5TMEA 6GPBA 4EUKA 2WUWE 3CWQA 2CZGA 5FADA 1QHYA 1RI5A 2R8EA 1XSEA 3U49A 2G09A 4EY8A 1E7WA 1NN1A 1U7UA 3DOUA 4N3GA 4XYBA 3KEOA 5KYXA 1Q0SA 4IDAA 4A8HA 1FP6A 1C7IA 2EKPA 2G7ZA 2VT2A 4FEYA 4IZOA 4ZHQF 2DR2A 1YRHA 3ULKA 2YWHA 3FOBA 4N0MA 3EHEA 3GP5A 3S5UA 3UV3A 3PU6A 3VAYA 2J3LA 4XWTA 1A5SB 4TYWA 1IWPB 3WWEA 4TROA 4XWGA 4XYGA 2A0WA 3RC1A 3BRSA 4X93A 5BV8A 1KFJB 2DPYA 2H8KA 1G8MA 3EXIA 4QOJA 4FMPA 1P1FA 1S2LA 1J8MF 3NONA 1CU1A 1BGVA 1TW2A 4EO4A 1QO7A 1XFAA 2AB0A 4O25A 4C4SA 2PT5A 3K2BA 4GE0A 4KO8A 3EUEA 1SULA 6LDHA 1QANA 4QFDA 2BE9A 3FR8A 1VRWA 4MQMA 2ORIA 1SUDA 2MSNA 4GOLD 4ZYYA 1KQOA 1LK7A 1WV1A 3SHTA 3FD8A 3M4YA 3LFHA 5JY1A 4JXKA 3FH0A 5LC1A 4EPYA 1V95A 1QO0D 1S1CA 2P3SA 2RK6A 1OAOC 4JLJA 2C7QA 5JCXA 3U7HB 3VR6D 2VPQA 4PR3A 3L1KA 4RZSA 5IYZF 3OFVA 3OCZA 4G4SO 5CM2Z 3QA3E 1E3QA 2VHEA 3RVRA 4R69A 3UOGA 5GIOE 3QYFA 4HWOA 5D3QA 1Y8QB 1KDYA 1C3EA 2GZMA 3QEMB 3WNZA 4DV7B 1WHSB 1BDIA 1FP2A 2ZBVA 1S7GA 4AX4A 5DRYA 5IT0A 3KOWA 2OZLB 4CFSA 2F2TA 1AUQA 1A4UA 2NUAB 3VZRA 3EMDA 1L5VA 1GO2A 3RT9A 1C1DA 2A3RA 3G5UA 1AVTA 1NKVA 1A95A 4FHGA 4ZZIA 3WJ1A 3MHTA 5C53B 1PWHA 3FAKA 2EW1A 4WINA 5TNXA 5JFTA 3K53A 2HX1A 4CMIB 3GAMA 2DAPA 3WSVA 4BLVA 3A3NA 4E2YA 4EPVA 3LVRE 5HJ5A 2FU5C 2J3QA 2XODA 1U31A 4Y6GB 3KYDB 4LV8B 2CVFA 3NALA 4WFQA 2BDUA 3HB5X 3QLVA 4NPHA 4LDPA 3JARA 2VP9A 2PL9A 1PGPA 2Q6OA 4CTMA 2ZQYA 5G02A 4TTAA 1FRNA 1H5NA 1VMKA 3R3SA 4ZWNA 6NULA 3TL2A 3ZWCA 3DTYA 4P3KA 1HURA 2DFLA 3VC7A 3ZW7A 4BLPA 3LCVB 4DRZA 1N6LA 9LDBA 4DLYA 5JY6A 1KHTA 2CMHA 1POXA 1FFAA 3F1KA 2AJLI 4TYPA 2QAGC 1TU3A 5FI1B 1B8UA 3SXJA 2BM8A 1GQRA 3W8DA 4JY7A 3KL2A 3F6YA 4NOKA 4Q01A 1HE5A 1Q57A 3LM8A 4KPUA 2Y2VA 4EPTA 4YRKA 3FLAA 3UYLA 1XNQB 2X19A 3E58A 3DMNA 2VK4A 3VGPA 1XLTC 1IRIA 1T5LA 3ILYA 4TGLA 2XGGA 1QHEA 3THSA 3A2KA 1VPWA 5B6IA 4FI3C 3RFTA 4M7WA 4C01A 4F2DA 2F4VB 3FYUB 4F6LA 1B8PA 2W11A 3BMOA 4REMA 2GXAA 1ODFA 5LQSA 2NZYA 2QN3A 2WWIA 4AZSA 2AVNA 2JLWA 1X9GA 3NRJA 4E5UA 5FB3A 1NUAA 4HCJA 1EXVA 5CK5A 1TQHA 5TEVA 3KQYA 1MQSA 1P0PA 1H85A 4A0GA 2YW2A 3IOEA 3U62A 1K97A 3NLLA 4EYEA 3VSDA 2YQ5A 3L8MA 1IEWA 3BGSA 1EQAA 2J7PA 4AKGA 4RQUA 4UFNA 4GDMA 5ECGC 2P8JA 1LI4A 3QPAA 3R3HA 3VA7A 1BE8A 4D3SA 1X0VA 1YR8A 3KHTA 4KN5A 5DP1A 1JXMA 4MYHA 4MCAA 4WN9A 5EKDA 3NOOA 5CITA 1HYQA 2YZGA 1W94A 4RIIA 2BM0A 2J45A 3JYPA 3KQWA 3WP1B 4E7OA 4PICA 2JHFA 2QR3A 4RO0A 3BBLA 3ENQA 4L85A 1DTWB 3I6BA 4LS3A 5TX7A 4YCMA 4ENVA 3DHVA 2C95A 4QDKA 1BCSA 3T52A 2YVLA 4IOKA 3FNQA 3NRCA 3EXHC 4BE7B 1QQAA 1GNVA 3AHGA 1VYVA 2OHIA 4KK3A 4G3XA 2NQ8A 2YWXA 3AEUA 1M2WA 1G0OA 2JJ1D 1P77A 2QW8A 3ZVKA 5DM0A 4JU9A 4QAQA 4BNWA 4HP8A 5KQGA 1NVTA 1X8JA 2HK8A 4UQPA 1ORIA 5ALTA 2EW2A 3QVMA 5IW8A 3WHPA 3UW1A 1P7WA 3KXDA 5AVRA 3U5TA 3QSYA 4CL0A 1U9JA 2UXDB 1F8FA 3E1SA 4MX8A 4NMHA 3RBZA 3WKCA 2X42A 2M6RA 5HK8A 4EGFA 1SUBA 2XB9A 3GLVA 3UMYA 4LXIA 4MW7A 5DFAA 1H8EA 2GR9A 3FZYA 3L7LA 1RC0A 1EVLA 1QK4A 1GV1A 4HAVA 2DC1A 2NO6A 3I30X 2ZATA 3I3OA 5CP8A 1KSGA 2IX9A 2J30A 3RTAA 4DB2A 1F2UA 2OZKA 3HY4A 4X1OA 3FRIA 1HQCA 3LQFA 4H6PA 3BCRA 1ZA1A 2O7QA 4OXRA 5C5IA 4E15A 2CNDA 4QPZA 1QGOA 2APJA 3WS7A 4DM7A 2OWDA 5C7OO 5DSXA 2ZBFA 2C99A 2BRUA 2R6DA 3CIFA 3H11A 3IP3A 4LYFA 2G63A 3V1MA 5IM4A 4JQZA 5AJVB 4GECA 4E22A 4F46A 1JMYA 4BFLA 3TAXA 4IFIA 2BLLA 3HVJA 1K68A 3VHRA 3AP2A 1Z5UA 4NQZA 3BMNA 4BUCA 1F4LA 4HWTA 1GSOA 1ZAKA 1ZMXA 5D7BA 5BSUA 3JASA 3RQIA 1C0PA 2VTBB 1WDMA 3LQ1A 4OLJA 2WT4A 2OPBA 4LHXA 2AEFA 4QOIA 1OHHA 5AHOA 3VNVA 2X86A 3CO0S 3DA8A 2ORYA 1KY5A 1GZ3A 3IVCA 3OEED 2FEWB 1ODKA 2CDRA 3NHZA 4YA6A 1ZIDA 2G3YA 3BSYA 2EWVA 1CXZA 1F1BA 4TL6A 1DBSA 2H1LA 4OAOA 5ALMA 3BTOA 3V3KA 4B74A 3CZ5A 3SSAA 3Q5DA 4QUJA 3R7LA 1KMHA 1TDJA 3DP9A 4G8JA 3T5BA 4M1EA 3VSAA 3S5JA 1EBBA 1M7GA 1ONNA 1P5RA 1S2DA 3GWZA 4PZCA 4AMZA 4EI9A 7AT1A 2HLDD 4R05A 2DHEA 1A9YA 3D2LA 2FFJA 2ONJA 1QQ7A 3KVVA 3REQB 4V0RA 4QWMA 1E7SA 4WOJA 4H3SA 3LT5A 4AJEA 5BRAA 1M1YE 1L7BA 1MH1A 3DUFB 4CL8A 1DBRA 3MK31 5KU1A 1PYGA 3M1IA 5DLDA 3REGA 1Y1QA 1XIVA 5A03A 2C3OA 4H1VA 2QT1A 1T3SA 4NXMB 5GVSA 2TYSB 3VTKA 2G9UA 2FLKA 3K30A 4IKEA 4G0WA 2RIPA 1YHZA 3KOZA 2XKBA 1E4EB 4NK4A 3HMKA 5TT1A 4ERNA 1QCYA 2OO5A 2JFQA 3GLKA 4QYWA 4XH9B 2WZQA 3KZNA 4BNLA 2G06A 4FR2A 5E1DA 5F35A 2XTJA 4OQDA 3UJ7A 4DQUA 2REBA 4DLPA 2WAAA 1G20B 1YBAA 3QXJA 4HQFA 4QD3A 2Z3ZA 3TZEA 4KRGA 3C4QA 3KV1A 3L8YA 3NWEA 4EL0A 4GBED 2E0IA 1BHO1 2KPOA 3CCBA 2FJPA 2B7CA 3D3JA 1NLMA 1H3NA 4CKWB 2OXCA 2UYQA 3AKCA 3PGVA 1ULHA 1IXSB 1RJ9A 2J08A 1MB2A 1S4MA 4RSMA 5CK4A 3ZK9A 4AJ1A 3D1LA 2F1OA 2YV2A 1CR4A 3K31A 1ML4A 2P90A 2O5VA 1AK1A 1JSCA 3R0JA 3SZGA 4AUMA 1A97A 4RVHA 3W3AH 2CXHA 4E21A 2N3ZA 1EMDA 3GG9A 2J0QA 3V1YA 5CD9A 4KREA 4P6VF 1D3AA 3CPSA 4PXAA 4A6DA 4IVPA 2ON6A 3JQFC 5A7FA 4BY9E 1Q7GA 1UPCA 3ODPA 4ECEA 1NJ8A 2YJTD 3CKYA 1ESMA 1SHLA 4HNHA 2R79A 3PFHA 4QREA 2YRXA 1HLPA 3MB5A 1DJMA 2FSPA 2DVMA 4XZ3A 3X2EA 1YRQA 5GONF 4KRFA 4RH3A 4JLVA 3QBEA 1T5OA 2IHVA 5FUYA 1O95D 3I73A 3INYA 3OFND 1XFDA 3C8DA 4Y2RA 5CB0A 8MHTA 3BC1A 2RH5A 1JHDA 2QMEA 1EINA 1X80A 4TV8B 5DPMA 2QMYA 1OZHA 1NPTO 4R1QA 4Q4AA 5ED4A 1AS0A 1RWVA 3Q7TA 2PRJA 3JQDA 1T3TA 4EHLA 5IK2D 1XZDA 3AGPA 1O6BA 1VG0B 1N7HA 4D43A 3DP7A 3KB6A 3GRUA 4LOJA 4E09A 2LIPA 3B2QA 5AKXA 1FIUA 2IELA 2JDIA 1A7JA 5MFZA 2FQ1A 1XTKA 4MA0A 2UYCA 2J5KA 2E6KA 2RBGA 2VG8A 4JKIA 1WBJB 5CFQA 2XUQA 1YGPA 2HT6A 1N2OA 2XW6A 1E8NA 1O1YA 1ZI9A 4RU1A 3LIIA 3NEJA 1Z4NA 4YRIA 3TVYA 2FPLA 2EKLA 2LWIA 4FZRA 5C5EA 4P38A 3A7EA 1T6ZA 2ATCA 4DSUA 5HA5A 3JQBA 5HM8A 2PUAA 1XDGA 2OMKA 4AU1A 1U7PA 4IDFA 1SCQA 2RGCA 3HI6A 1IXRC 1C29B 2RI0A 3DEHA 3RYIA 1JILA 4ETIA 3UT0A 3DBLB 4KWHA 1W5AA 4KMSA 4RZQA 4ZCMA 2QSJA 1XU9A 5T67A 2GF2A 1UPFA 2CXUA 2Q7OE 3GUUA 1RXIA 2ZLBA 1QB7A 4RZIA 1W75A 1CVLA 1JUDA 4DQDA 1QV6A 3UYKA 3DE1X 4EHKA 1ATZA 4NABA 4QO7A 4N8DA 3WKAA 5BQXA 3AH8A 5KYWB 5DNUA 2Q62A 1RRVA 3ZWPA 2XMDA 3WAKA 1PGOA 1Y5MA 5FNVA 4WZAA 3PX7A 1VJDA 1YJQA 1Z18A 2PU7A 3N6VA 4B3BA 4V03A 5AW6A 2HNAA 1XB2A 5HGJA 5LDGA 5TMDA 1T5SA 2ACWA 2C5FA 3BA1A 1YZLA 4DUGA 2XV1A 2Z2KA 3F5FA 1CUVA 4DN6A 3X43A 3ZYCA 2HZ7A 4B84A 4C06A 6REQB 5JFOA 4DV5B 3A6EA 4L2IB 1IPFA 4ZJPA 2BFOA 4YUAA 3DV2A 3SQWA 1QQ6A 3PWTA 1V9LA 2I5PO 2WUVA 3JYNA 4TQ9A 4P58A 3UFXA 5LFAA 2Q50A 5T6MA 3NDJA 3DOOA 3DE5X 1JHYA 3VQTA 2PMDA 2PTGA 3EEQA 3SSOA 1A1VA 3JQ9A 1Z8NA 2EL9A 5EXTA 2YIMA 2OR3A 3QKWA 2YWCA 2JFFA 3W78A 1T9KA 2GEBA 2DMRA 3GXBA 1DRKA 3X0DA 2QAJA 4U6SA 5BY2A 3HUFA 2C4MA 3IERA 1G6Q1 3VYVA 4N3AA 4CV3A 3GGOA 1KDPA 1RP1A 3VU9A 2ACKA 1XZ8A 1XTBA 3PJEA 4MGHA 3ZKAA 1LJUA 2Q2VA 4MI9A 5JDIC 3JYQA 1VL0A 1VG8A 4TV9F 1EFLA 1G3QA 1Z16A 1FXUA 2AG6A 4KQMA 4J1TA 2GWRA 3QBDA 5T64A 5U9CA 1X1RA 3KVYA 1XPUA 3WYEA 3NU1A 1UK9A 2ECOA 4AZTA 2DBZA 3EXAA 3C48A 1N6KA 4KC0A 1G41A 2DY0A 4YP7A 5M34A 2FR8A 1Q44A 5HM6A 1QIJA 4WFIA 3PR1A 4Y18A 5CCBA 3GLTA 3PHBE 4Z8XA 4C3OB 1DKLA 4S12A 2R47A 5JO9A 2A5FA 2CJXA 1MRZA 1EM8A 2YC4C 2ZWMA 4V0KA 4N76A 5EJ6A 5EXPA 1F8YA 1SVNA 3B9RA 1URPA 3GD5A 3K0BA 4PTYA 1TA9A 1EJ0A 1MJFA 1DADA 3PC2A 5ED0A 3UUFA 3UK1A 4CT0A 2JIZD 1MC4A 2X23A 4PAGA 1F8UA 4Z5XA 2NVOA 3NHMA 3UNXA 5BWCA 4YDRA 3NWBA 1LC3A 3KJFA 1H23A 2DOKA 1QLHA 3PGLA 5CM8B 3AUSA 2AMFA 1CQZA 1RDFA 3IULA 4Y2SA 3ZLBA 5BN5A 4J2TA 1ORRA 1DHRA 4PS0A 2PGNA 4AQDA 2XRMA 2YYSA 1FQWA 4OFXA 4R3UC 1N33B 3EVDA 5LCXA 3CVXA 4ZKEA 4S1WA 3I64A 1UDAA 1Q50A 2AFIE 3Q0TA 4PZ9A 5EHNA 1M73E 5JVDF 2XIQA 1W9HA 4HDNB 2P67A 2TMGA 3IEKA 3WR5A 4EH1A 5ABPA 2CV0A 1L6RA 3VNSA 4O4JF 2ZRIA 3USZA 2GEUA 3PHGA 1UXIA 2QRLA 4JA2A 1R4NA 1FW6A 1GL9B 1E2KA 2XVXA 3RR2A 1WW3A 3CH4B 1EPUA 2X5OA 2ZJ1A 3GNSA 2VEDA 3Q0IA 2R6ZA 3C14C 3HM2A 2QF7A 3LZCA 1XRNA 2ZI7A 1N8NA 5C8XA 3OQ6A 1T6XA 1ZHFA 1B0UA 4R1UA 4ZAFA 4W9NC 2PUFA 2I8LA 4A03A 3VH2A 3BE6A 1BOOA 3Q6IA 4H3VA 3R0XA 5EIAA 4DMLA 1L9XA 4U5XA 4BFWA 3KXPA 1NDQA 2ZB7A 5JJLA 4ASUA 2HCBA 2I6QA 3BFXA 5FL3A 4IIVA 5I4KA 3I9NA 1CUUA 5COQA 3OZ7A 1KVTA 2FRXA 5LQKA 4AI6A 1L5QA 1SD5A 3W6PA 2O2YA 1U65A 2Y0BA 2VIIA 1SQ0A 5L4NA 2ZWAA 5AM4A 1DAIA 2M6SA 4MQLA 3VDQA 5B4TA 3EBLA 3KPWA 4ZA2A 5K09A 5KOIA 4WBNB 1OD6A 4Y7DA 2GD6A 4R0VA 4WI1A 2P2YA 4LNHA 1R4ZA 3LRTA 3AF3A 1K89A 3O74A 1XTJA 1TJNA 3FVRA 3TFWA 4HDMB 5C1BA 1J24A 5BV0A 2OLKA 2Q5EA 4H16A 3AOEA 4BWVA 1XAHA 4EX6A 2NXWA 1QP4A 4QM6A 3BJZA 4OHXA 4BVKA 4EATA 1U2SA 1IU9A 1GPH1 1FVOA 4JQCA 4LE1A 1JYFA 3DE6X 1NVDA 4M55A 4ZOLB 2YH2A 2ZUWA 3NTRA 5JYBA 6ABPA 1ZH0A 1SKUA 2KWIA 3S1SA 5C5CA 1SXJE 1UIRA 4K46A 3PB3A 3KQUA 2VPWA 1GXSB 1TMGE 4TS1A 5JYEA 5E7MA 3BL5A 5AD1A 3TZHA 3MTAA 4CLHA 1U0SY 3QKSA 4K5QA 4U6QA 4I55B 4WUTA 3VRHA 2UVQA 4NK5A 3USCS 1RPZA 3T7IA 1JI0A 5K6RA 3K8QA 3NASA 4I9GA 5A9RA 1I14A 1A9XA 1CDOA 1YS9A 3KXLA 5CDSA 3AILA 2WKQA 1TJYA 3F7NA 3G2PA 4M1OA 2DSTA 4F6RA 3EA4A 2GNOA 3A05A 3D2CA 5B55A 4G0VA 2OHGA 4OJYA 1T6BY 5E9AA 1IDOA 3FUVA 1WUYA 3N3AC 3R5HA 2CN1A 2EQAA 2XSZD 1SHZA 2IV2X 4NE7A 2NOAA 3A9WA 3C0KA 4ER7A 1LSOA 1Z2DA 3DO8A 3ZHXA 2XZDA 1BN7A 2REXB 2XZTA 1NBMD 1XCPA 1Z4OA 3G23A 3KKZA 4FFOA 4RV4A 3WGHA 3EG9A 4AG6A 4J7UA 1MNQA 2QRUA 5C1DA 2QQ5A 3AIIA 3O2QB 4N0PA 5FA6A 3UY4A 2V0GA 2CL6X 3VYWA 4PZUA 1Y82A 2CJPA 4KK4A 3ROEA 4WZ6A 3F2IA 4KQKA 4L5YA 3ICWA 4ZCSA 2J0UB 2EJCA 3JVUA 1P91A 3OPXA 4BXOB 4R1PA 2EX4A 3U60B 1FUYB 3FPKA 2E4WA 4TMWA 1RIIA 4IF4A 4YJGB 1RI1A 2PPLA 1P7VA 3LPMA 3U6BA 4KKXB 3K73O 4NBRA 1JT2A 1MN6A 2B4QA 4W5WA 4XQEA 3WYFA 3C2QA 1EFRD 5GOZA 1NXVA 2H08A 4CM6A 2XHZA 3V8BA 1HDZA 4BN5A 5F5XA 3LF1A 5HJEA 1WMFA 4CCWA 1ESZA 2CB9A 1Z4PX 1B2LA 1S89A 1ISHA 1Y8CA 2W00A 3AHHA 3EGDB 2VUUA 3MNFA 3PC6A 1L4GA 1XWWA 3GFQA 3NEAA 4K6FA 1KZYC 4XJXA 2F1RA 4CM9A 4DDHA 5CDTA 4D9IA 5EKTA 3E4CA 3N8GA 1ZG3A 2Y6VA 2AOWA 3SJBA 1EVYA 2IGTA 7ADHA 1NL3A 4S3MA 2QJWA 3IAAA 3NATA 4ZO7A 5F2EA 1AMNA 4KUEA 4AURA 1TJPB 5LYJF 4H7IA 1GUZA 4IF6A 5F1OA 4TXHA 1OR8A 2XNDD 2DFDA 4WLUA 3RVJA 2JGJA 1K7YA 5HIJA 2PHZA 4TMKA 1XXHE 1J0BA 4ZALA 5LUBA 4P4TA 5SV2A 4L8GA 1A69A 4C0QC 1ILWA 1G59A 1K7XB 1PO7A 3DEJA 1OA1A 2REQB 4CLXA 2C5LA 2BFDA 3DM5A 4PC6A 2GYVA 5AKZA 1H8HA 2GCIA 4YN3A 1IJEA 2AG1A 1F6BA 1FRQA 2YHSA 2ZJAA 4LUCA 3ZKWB 4BZQA 1O6GA 3MCUA 4IH4A 2BR4A 4C2BA 4ER0A 4ON9A 5LJLA 2P4UA 4NBVA 4OB6A 5CNJA 3TNJA 1XZPA 1NBAA 1PT9A 4RGQA 2AUMA 821PA 2IYSA 1KI6B 4R2HA 3QG1A 4BKOA 5C8YA 1A0OA 5FR2A 2WTNA 2GCPA 3BWYA 1EE1A 3H13A 5H82A 1BVRA 1HLDA 3FG9A 3FPCA 4UNIA 3AUKA 5AIBA 3W79A 5D3KA 2AJTA 1HE8B 2GILA 2OAGA 2Q7XA 1LY1A 1GN8A 1D2EA 2AMVA 2WSSD 1V35A 3BH6A 4W99A 4WY5A 1R8XA 1C81A 3D7NA 2YZKA 4WSOA 1HRDA 5LDDC 3FVWA 2NWQA 4M37A 2FE4A 3EOAI 1N6HA 1NVBA 5AKEA 1XMVA 4Y2XA 2FSVA 5FI0B 1M2OA 2EIHA 3AY3A 1S1MA 2B92A 3GLIB 1XGKA 4JXZA 1EGHA 1QHXA 2WG1A 1M83A 3DCIA 4I19A 3W2HA 1NYRA 2H9YA 3ZI7A 5HF9A 3H2BA 1E0SA 1AH2A 5HGXA 4G6ZA 1EUZA 1YT5A 1CHDA 3FNGA 3DXYA 4QYMA 4DL9A 3BXGA 4PGFA 3FKSD 2XRYA 2O3JA 5BN3B 3C5CA 4NPCA 1E1YA 4ZOCA 2KX7A 5IANA 2R44A 3IA7A 1KAEA 4OYYA 5FFFA 3ZS9A 4DY6A 1Y4ZA 3HWRA 3WWZA 1TM4E 2GCEA 4IGFA 2WR8A 4DJFC 2I4IA 3HJCA 2FPUA 4Q9JA 2EJUA 3C7KA 4E3ZA 4KVFA 2QSZA 5FPQA 1PKEA 3RHSA 1RQRA 1QPZA 1UBLS 1ZCAA 1QYCA 2XE7A 1QF6A 2GHQA 1LPSA 1SG9A 4LDQA 2Y1KA 1UDWA 4D4MA 3ONEA 3GPIA 5JNSA 4DG5A 2ZZNA 2HHAA 3PDWA 4UZEA 2D5CA 5TC4A 1N32B 1ECBA 2ZRQA 1ICEA 2VL7A 3W5AA 2CFSA 4FS8A 1XNRB 4YK7A 4GT1A 4NAHA 3KPYA 1PE0A 5BVHA 4TKZA 2R87A 4JB8A 2CXRA 3JTMA 4JGGA 3A0UA 3ICPA 3MGBA 2EBFX 4M60A 4H0NA 4YMHA 1RQNA 3FB4A 4P53A 4PO1A 1A27A 1BH2A 1O0CA 3DWIA 3KOOA 1V8BA 4FHDA 1XEWY 4S1PA 2HSZA 5JZOA 1U28C 4CXMA 1M8PA 3W3ZB 4MYUA 1IJFA 5CDHA 4HDQB 1NVFA 1N5IA 3CR3C 2EZ9A 5I48A 4I9NA 3ND9A 4JC0A 4YV1A 5J47A 3ND6A 2O8FA 2V74B 4YAEA 3VPSA 5B7QA 2IZ5A 9ABPA 2W93A 3FSGA 3UUEA 5IG2A 4D25A 2O3RA 4I1OA 2W6JD 4FDTA 2Z0MA 3ENKA 4HDRB 5HQTA 2AEMA 3ORSA 1NRWA 3HR7A 3T0FA 3ICCA 2MMCA 2BFBB 2WIJA 3KQPA 3NC0C 3DLPX 2SECE 3QF4A 4L4XA 5DJ5A 3RK0A 4EQZA 1RRPA 1ZD9A 4MDHA 3G9ZA 4BKPA 3A4VA 1G18A 4X7MA 1B8VA 1YZTA 2FMFA 4YV7A 3CLSC 5LVAA 3TB4A 1DCMA 1P6QA 3KHUA 3MYRA 1CQXA 3ABRB 4PGGA 1FFGA 4P7JA 3EGIA 2PKWA 2ZSAA 4MDEA 1K7SN 3PUWA 1WDTA 3HXOA 4AZ0B 4K28A 5EVJA 4R6WA 3ZV7A 3THYA 1V16B 5LZ8A 5K4AA 5BYAA 3AG6A 4DA9A 5AXCA 1RXCA 3GH3A 4X6LA 4ZV9A 3HSYA 3A3OA 2CNWD 3WGYA 3EDRA 4MVWA 3SQDA 2XQGA 1W4CA 5KNCD 1XWFA 1IPHA 3RVSA 3V7FA 4H1TA 1VPVA 3AHIA 3LNCA 1VL5A 2C5BA 3L7DA 1MLDA 2AOUA 5THKA 1JIKA 3AHEA 1T9ZA 5HE9A 5B5SA 4U2FA 1E1CB 1V8OA 1V8PA 1SCKA 3JWIA 3OUTA 3VHLB 1XPOA 2B25A 2P8SA 4RJKA 4EY7A 2XEXA 4IMRA 2E7ZA 2XGOA 4RWZA 2BHLA 3WMFA 2YXBA 3DBRB 2QN9A 2NUBA 3KR9A 2VJYA 4R5HA 5IWAB 3T12A 2XVAA 1BDMA 2OCIA 2OAEA 2NU8B 1N2GA 4WA7A 3Q3VA 3ZDYB 4NARA 1E5QA 1TOAA 4Y98A 3T5CA 4B9AA 1C3XA 2OFWA 2A35A 3V9PA 4X5OA 5T6BA 3GQVA 3P4UA 1ZK0A 1NNEA 1HA3A 1DFIA 1L7AA 2HI0A 3AUAA 4HRAA 2R5FA 2AN4A 2X3YA 3ACCA 2GBLA 3PXEA 3KSRA 1SKBA 4QPCA 4J4TA 4KSCA 4MGEA 2QTMA 3KU1A 1M1YA 3S2GA 4BQEA 1Q74A 2BEJA 2WINI 3EIWA 3Q9LA 5K9ZA 4KAAA 1JHPA 4QYXA 1R6UA 1U8XX 3IELA 3PC7A 3RG8A 1C8KA 1OE0A 5C4MA 1WB9A 4AMVA 1MXHA 4LMAA 4MWOA 1G9SA 2QUZA 4GSYA 1DQNA 2D2VA 4KBGA 3PZBA 3L1UA 3P27A 2PLWA 4E2XA 1HEUA 2GD1O 1I0IA 2GK3A 4BQIA 1EFKA 4N3BA 3DXZA 3EAFA 3G1UA 1II9A 2IBTA 2HT1A 1M6HA 1JMVA 3K2QA 3JAKB 2O57A 2HGZA 4YRDA 1TECE 4RQTA 2VPXA 5ESRA 4LNAA 1SVUA 1VLHA 4ZRNA 3KALA 1NXQA 2E18A 3RTCA 4O4IA 1VHTA 3AR6A 3NEPX 2AS0A 5CEFA 2PA3A 5BQPA 4RTJA 4C6HA 2CSXA 3G8BA 5FA5A 4P7KA 3O82A 1J0CA 1QFJA 3IDOA 4CLDA 4B3RB 1P45A 1V47A 2XITA 1Q6ZA 4F9TA 4MHTA 2BT4A 1CIVA 3DSRA 3KEMA 3QEOA 3QPUA 1JS1X 2AJBA 1IMJA 4Q4HB 2C7BA 2O52A 4YREA 4BPBA 4BATA 2DHDA 2VJMB 2VHQA 3OZAA 4KIWA 1N6NA 4LJYA 4A0SA 4E6PA 1GVNB 3U4QA 2Y9PB 2XSZA 4PSDA 3WBBA 5AXAA 1ZN8A 4RTOA 1RI2A 2Y76A 4RD4A 3VZSA 4A7PA 1ISSA 4FU0A 1T25A 1I24A 4C4AA 1CNMA 1DXYA 4DRXA 4ETWA 3EGXB 4PX3A 1NBMA 2X14A 2AR7A 1U5BB 3NDIA 4DNFA 4Z9FA 2CEAA 3AEQA 1SWVA 1QCCA 3RC9A 4IWNA 1UDBA 4H7FA 4MJXA 3RHTA 1EFCA 4XB2A 3VU0A 2EU8A 4AJKA 1YFZA 2OY0A 1EVEA 3DF9A 2IDMA 4IY1A 3WC4A 3NOXA 4YJ2B 3SY8A 2P35A 3GDOA 1HWYA 1Z4LA 3DCNA 1E96A 1KJQA 4WL0A 1XRLA 3AKYA 1T36A 1Q2UA 2IPAB 2QIOA 1PF7E 2VZLA 2DLNA 2IHJA 4RMJA 2ZU6A 4AF8A 2RJOA 4GSKA 5F4ZA 2I1QA 4NZZA 2QMUA 1KDOA 4EAQA 1DKOA 4PLPA 3JQEA 2HSWA 1EFRA 5LDHA 1CUZA 4OXYA 1GCOA 5EHQA 3TLAA 3HRIA 4URWR 4G4GA 13PKA 2E5FA 3OMWA 2NU9B 3F4BA 4A10A 1JDPA 1YQGA 4CQMD 5AOCA 4K9QA 1LF0A 3QX8A 7GPBA 1GQSA 1KY2A 4QFBA 3EPLA 2YXLA 2O14A 2C9BA 3IHTA 3LBAA 2Q5JA 3C3EA 5CVEA 4DLWA 2QTCA 1KYYA 4CQJA 2MYUA 1LTKA 2IYVA 2SHKA 3H1AA 1GV0A 3MWJA 1AZWA 1GAQA 3D4NA 3DKRA 3PFKA 5EIHA 5PNTA 5E3HA 1X70A 5EMLA 1VBNA 1JEJA 5BYBA 5G1PA 1EXMA 1XTRA 3SSMA 3HKCA 1WM1A 1IZYA 1GPNA 2YIJA 1N2ZA 1YK1A 1U7XA 4Q19A 3D8RA 1HT2E 5A3VA 4CIBA 2ZXUA 3RH0A 2JJ8A 1WSAA 3IXQA 3ET4A 2WF5A 4XPZA 2FPXA 4O59O 5DNVA 1RKBA 3WKDA 3ZGXA 5KSYA 3K6SA 3C6KA 3HUEA 3ZI4A 1YACA 4D4HA 2Q3HA 2XT9A 2YOFA 4RY9A 1KE2A 4BBPA 2A14A 2FI1A 1UBRS 1VLLA 4ZAYA 3BFJA 3ZU5A 3OWHA 1IN7A 2C9MA 1HDIA 2Y68A 4PF1A 4CM5A 4I5FA 1XVUA 2D4HA 2OCDA 4HV4A 1B0AA 3VZQA 1L4NA 4TQUS 1AZTA 3HCPA 4P4GA 3RS4A 1ZQ9A 5L7WA 1ONPA 3KP1A 3EIXA 5EZQA 3ER9A 1WB4A 2XXJA 3JZAA 3NG1A 2V6JA 2GPYA 4YDHB 3SQLA 1ZUNA 3V42A 4XPIB 4KVZA 3BTSA 1HH4A 1XDUA 2HA3A 1RJEA 1K5DA 4RYDA 4QYSA 4UAUA 3L1JA 3F67A 2JRCA 5HJ2A 3SZOA 3UPTA 3QWFA 1TPYA 1Q19A 4IDBA 1QH8B 3BRWD 4JMLA 4EG6A 3VSBA 4RHTA 2YHAA 4J0IA 1Z8FA 2VATA 4R8VA 2E49A 5JQWA 2ZWVA 4EECA 4QPNA 1C9EA 2GM3A 3FHLA 4LCEA 2P9BA 3PTZA 4WKPA 4ZI7A 1Z7WA 2JLXA 1M2EA 3ZVMA 4IXNA 3K05A 1XALA 5FBVB 5SYMA 2QZ4A 1KZGB 1RTKA 3OPVA 4DY4A 3WGOA 2HWXA 1H69A 3ZBUA 4EKEA 1QU2A 1N0VC 4CG2A 2BUCA 2G25A 3RC8A 3FVTA 5HX7A 2VSOA 1YA8A 4YI3A 3DZ8A 4AJ2A 3VV2A 1RADA 1Z0AA 2FKNA 4BGEA 3CVWA 4BAGA 4EM6A 5JISA 1Y80A 3GAAA 4X1IA 2CBZA 1W59A 2QORA 2YASA 3FKSA 4W1SA 3DPSA 3AVUA 5F3DA 3TZKA 5FFMA 3QOYA 4M54A 1MO3A 4H6VA 2A4MA 2Z6AA 1N5LA 4IJKA 4BRZA 4TQAA 3MUEA 1Q1GA 3E9NA 1DNPA 1FLDA 5B3AA 1QCZA 4IZ6A 3WAGA 4G63A 2Y1FA 2UUCB 4B7ZA 1J42A 1J8YF 2GZHA 4UVDA 121PA 4A27A 1VMAA 1EK5A 1VDZA 5KVCA 4ZOEA 1DAPA 1RKXA 3E8XA 1BHJA 1TX4B 2PBFA 2EQ5A 3D6TB 3QVOA 1KEKA 3U1VA 2MSWA 1VE1A 1TAUA 4PONA 4YJHB 3OIGA 1OAAA 1YGYA 2JHAA 4ZAVA 4KPEC 3GLGB 4YHBA 1C1HA 2ZYTX 3JATA 1DMSA 4AS3A 3OQOA 4F7WA 3GMSA 2V9ZA 1D5WA 4RMGA 3STWA 4IRMA 4IDCA 3EGWA 2EYQA 3CUSA 3D6AA 1OXVA 4WLEA 4C0XA 3CRVA 1WBBA 1PN3A 3K9WA 4OI0A 5A2GA 4RPKA 4ND8B 4JI3B 3IDFA 2XGMA 1GPDG 3GRRA 4R8KA 2AFIA 3LLUA 3OE7D 4J90A 4KYUA 4YEDA 4EP1A 1EDBA 4JENA 5ULLA 3TRJA 4ZO9A 4CEJA 3HEAA 1E9VA 1WEKA 2MWMA 1L7EA 3SF8B 4CM1A 1COZA 2BMEA 1SHUX 4TN5A 2QD5A 5A5GA 1LNZA 3SX2A 3D6MA 5AK4A 2JBAB 5LMZA 4BNDA 3SNKA 3QH4A 2XUDA 4UM5A 1KP2A 4Q7QA 4ZHQA 3IAUA 1X8LA 2JIRA 1X7WB 4E3WA 5AMXA 3VPCA 3BD7A 1ZK3A 1RWNA 4LZAA 4XGKA 3MJEA 2VF5X 1HYBA 4HVAA 1TJ4A 2V7UA 3K96A 1FYDA 2CLIB 4KXUA 4QLOA 3GLHB 1NMXA 4JI7B 1GZUA 2XVZA 3FMPB 3W8FA 4IDEA 3R6WA 2QVCA 4XB6B 4TRNA 3SWWA 2XXAA 1BHQ1 4RY2A