3TO5A

High resolution structure of chey3 from vibrio cholerae
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
b'LNKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CheY homolog
molecule tags Signaling protein
source organism Vibrio cholerae
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae
pubmed doi rcsb
total genus 40
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3to5A00
1DP4A 1BDHA 2P9HA 3NNNA 3OLZA 4CBVA 3D02A 1U04A 1GCAA 2HSGA 3KYIB 3BBLA 4P1ZA 2YHAA 5D2CA 3SQNA 3OMWA 4RS3A 4ETIA 4EVRA 1SXIA 4S05A 1Z17A 2VYCA 2IPAB 4JP1A 4G97A 5C5CA 3QEMB 5CNKA 3F6PA 2QR3A 4W5OA 1M2FA 5KC8A 3BRSA 4W5TA 2NUBA 3HDVA 3ROTA 2MYUA 3JVDA 4IF4A 1JBEA 1P8AA 3HK2A 4JASB 4YCSA 2N9UA 1T34A 3M9XA 2JBAB 1JDNA 2F8SA 3OMXA 2MYPA 2PUEA 1J56A 1QO0A 3B2NA 3MYYA 5EWJB 3IP9A 4DADA 5HKOA 2KYRA 3ROFA 3OM1A 3FFXA 5CNJA 3QLVC 3N6VA 4RKQA 3KG2A 4UHKA 4PE5B 2JVJA 4N03A 4ETNA 1RNLA 1Z13A 4E7PA 2FMIA 3GRCA 4WXEA 4RK0A 1PEAA 2A9QA 1VKRA 3H6GA 3C97A 5HM6A 1ZVVA 5IUNC 5EWMB 5TPWB 3JY6A 3E3MA 5BRJA 4M88A 1LJUA 1ZH2A 4XAQA 4ETMA 4F8JA 5IUJC 2P4UA 1JFVA 3K9CA 4L4UA 2FMKA 3N0WA 4MAAA 4NICA 1Z2EA 4EVSA 1DZ3A 1GLGA 1YMVA 1QP7A 2PUBA 3VNBA 2FEPA 3RVKA 2HQRA 4QYMA 3QX8A 3SG0A 3CHYA 3T8YA 4OBBA 2B4AA 3LKBA 1CYEA 3Q7TA 1P6UA 1RPJA 3A3KA 1WETA 2R47A 2JK1A 4E7OA 5JNSA 3HEBA 2PL9A 3HZHA 2GBPA 4MRMA 4MRMB 4IMJB 4OLBA 5KQMA 4G0XA 4YR7A 1TVMA 3HV2A 3H75A 3OLYA 2A9OA 3JPWA 3HUUA 3LOPA 4MS1B 5C5EA 1M2EA 1JYEA 1TLFA 1C4WA 3CFYA 5IEJA 3E61A 3EULA 4RZSA 1CEYA 4W5QA 4RK7A 4N0PA 1JYFA 2MYNA 4S04A 2O20A 1EHCA 2QW1A 3KTOA 4JB0A 4LDZA 2LBPA 1B00A 1S8NA 3O1HB 3CTPA 4PICA 3MF4A 4O5AA 4GPAA 1NXPA 3Q9SA 4XLTA 2V0NA 3MIZA 5ABPA 3P9YA 3OQNA 4Q6BA 5JNRA 1DBPA 3OO0A 3DGEC 3SY8A 3O74A 5KI6A 1YK1A 2GI4A 1LBIA 4KNYA 1DC8A 3HM9A 2LIVA 4H3KB 1YVUA 5DLEA 1EWTA 4G0OA 1APBA 1LJLA 1ZH4A 1MB0A 4Z4IA 4YP9A 2W42A 4OLAA 2GX6A 1IIBA 4F06A 5KWSA 2FXIA 2RGYA 5CHYA 4EYQA 3QX9A 1Z26A 3CNBA 4RSMA 2F8TA 4W5RA 1NTRA 1DCFA 3NHMA 3RVPA 1ZHHA 4KVFA 2WJWA 1EAYA 3A10A 3Q7SA 3CG0A 3F7NA 5KQPA 3DBIA 3HS3A 4IMIB 2R48A 2NZVG 2FN9A 5B3JA 5CNIA 1Z18A 3HCWA 2JRLA 4QPJC 1Z15A 1XWWA 4MGEA 1F51E 1Z2DA 3IPCA 3H5WA 1XHFA 5JNUA 1ISSA 6ABPA 5DTEA 2RJOA 1QO0D 1D4ZA 1RXIA 1CHNA 4KQ9A 4RK5A 2BGGA 2QZJA 2QXYA 4G0YA 3QELB 1GUDA 1SXGA 3BRQA 3MA0A 4MQEA 3G1WA 2RDMA 3A0UA 4MQFB 1BVHA 3N0XA 4KQCA 2FW0A 3KKEA 1JWLA 4EYOA 5IEBA 5TQ2B 4ZYLA 1AB5A 2WY2D 4YO7A 4H60A 3UKJA 2NZUG 4DQDA 1Y1LA 1VLZA 1NXOA 1L5YA 3CZ5A 3BREA 4YRZA 1LK0A 3FFTA 1QNLA 3LMKA 4HNRA 3G85A 4ZMRA 1YIOA 4RU1A 4YLEA 4YGXB 3TO5A 2GWRA 5DGCA 3C6QA 1QP0A 3DZDA 2B1JA 2OENG 2CD7A 1JHZA 3QK7A 3L6UA 2FLWA 2LP4Y 4RK4A 3GV0A 1DRKA 2LUOA 2ZWMA 4G0QA 4WWHA 5TE9A 5TQ2A 2PUAA 4XXHA 3C3MA 1YTUA 3OQMA 1YS7A 1SD5A 1USGA 3SNKA 5B3JC 4LX8A 3UUGA 4UHJA 4GNRA 4IGAA 4NQRA 5T3YA 1YS6A 2FMFA 3IP5A 5TPZA 3TMYA 2FKAA 3LUCA 5CNMA 4ZMSA 4W5NA 3KLNA 4XARA 2WJAA 3QLUA 3F73A 1QPZA 8ABPA 3IP6A 2FQWA 2MSLA 4NCBA 3CG4A 2PLNA 5IULC 1NXTA 3ILHA 3JPYA 5EWMA 2WRZA 4JOQA 1ZDMA 2JCGA 4PZ0A 5GOTA 2HQOA 4LZLA 3O75A 1A04A 2FLKA 3EQZA 2FEKA 5DCLA 3QLVA 3H5VA 4LRQA 3M9WA 3OLWA 1FFSA 1BA2A 1HEYA 3S99A 4G86A 1U2QA 4OATA 1C0EA 3DLHA 2PAFA 3GA5A 3RQIA 4DN6A 3FFWA 1UDRA 3O1IC 3N8IA 3I42A 1JDPA 3QLUC 9ABPA 1QMPA 1JFTA 1BDJA 1ZGGA 3Q15C 4Q6WA 4RK6A 4D6XA 5JNTA 3T38A 1VPWA 1W9HA 2L2QA 1JFSA 1BAPA 1KMIY 2IPLA 1MB3A 1DRJA 2AYZA 4LE2A 2IOYA 4F3TA 1ABEA 4G0PA 4KZKA 4XFKA 2HJ9A 1DG9A 3KSMA 1Z25A 2QVGA 2CHEA 3FDFA 3CZCA 3H1FA 3NNSA 4HYEA 3GWGA 3LUKA 1USKA 1MAVA 4WXMA 4Q7EA 1NY5A 2JBAA 2E4XA 4XASA 4Z4GA 3GBVA 2NT4A 3EJWA 4MS4A 4RK1A 5IX8A 1OXKB 3CRNA 4ZJPA 5JNVA 5KC9A 2E4WA 2PL1A 1L5ZA 2QU7A 1ZN2A 2YHBA 2MSWA 3H6HA 3MM4A 4KV7A 5IC5A 4RY8A 1DBWA 2VUHB 4EYGA 4KREA 1YK0A 4RXUA 3KYJB 3DLBA 1U0SY 4RWEA 1NXVA 4H3HB 3EDCA 1ZY2A 4KMRA 3KHTA 5FBKA 3K4HA 3MMNA 2J48A 3A0RB 3TD9A 3KJXA 4MR8B 4YS6A 4JA2A 2HPHA 1QP4A 4YV7A 3LFTA 2E4VA 4Z9BA 4O1IA 2IPMA 1TJYA 2Q5CA 4EY3A 3W9SA 3MQ4A 2FQXA 2WB4A 5FWYA 4LE0A 3LUDA 2E4ZA 4MS1A 4Z9AA 5FBHA 4G0MA 3HUTA 4EUKA 3URMA 3LUGA 2X7XA 1DBQA 5HQJA 5IUKC 1P2FA 1NXWA 2A9PA 3SM9A 5TPWA 3H5IA 1KRXA 2QVCA 1DC7A 3CU5A 4WZZA 3I45A 2PE5A 4EYKA 1NXXA 2IYNA 2MYTA 3R0JA 4MS3A 1D1QA 1KGSA 2R4QA 1D1PA 2ID9A 1QQBA 2PUGA 3O2SB 1AB6A 5JS2A 3FMVA 3EGCA 1Z12A 3HO1A 1FSPA 3RVJA 5FWYB 3ILYA 1A0OA 3L49A 4MPTA 3IP7A 4HNQA 1PUXA 6CHYA 4JAVC 5TQ0A 1DCKA 4PEVA 3IDOA 4KFCA 4MR8A 3C3WA 1PNRA 1GCGA 1I3CA 4ZPJA 5ED4A 1JF8A 3HVRA 3RVLA 1JH9A 3D8UA 4MQFA 4O1HA 4PYRA 2JB9A 2JVIA 3JS5A 3N0RA 4MQEB 1A2OA 3OM0A 2IKSA 4MR9A 4MYRA 3QELA 2FSPA 4TLMB 3RVRA 1DJMA 1URPA 4D74A 3T6KA 2OQRA 3I5AA 3H1GA 1K66A 2PMCA 3BILA 3GL9A 3NBMA 5EWJA 5EWLB 2VK2A 1QQAA 4N47A 3KLOA 3QLTA 1NXSA 1VRVA 2ZAYA 1GUBA 4G0ZA 4LE1A 4F11A 2L19A 5HSGA 1FFWA 5GQSA 2PUDA 2IDMA 1EFAA 2NT3A 1OXBB 1D2AA 5F64A 4Z4EA 1JLKA 3QEMA 4HNSA 3H5OA 3M6MD 4MR9B 2MSKA 2FN8A 3EQ2A 5KQGA 3CLKA 3F6CA 3HXMA 5KQLA 2CHFA 5BRAA 4TN5A 2H0AA 4F12A 3IPAA 1E6MA 5JNWA 2FQYA 4L85A 2R25B 2TMYA 1F4VA 2FVYA 4FB4A 1U2PA 4QYWA 3DGFC 1MVOA 1ZGZA 4KK3A 5I4CA 1QKKA 1YMUA 4Z0NA 5BQ3A 2M1ZA 1K68A 4Z4HA 2XDYA 3Q7RA 4MLCA 1M5TA 5PNTA 3RVNA 4WUTA 1E6KA 2WMYA 1M5UA 5E3JA 4EVQA 2PUCA 1EWVA 1ISRA 3KS9A 3LUJA 5FWXA 1MIHA 2QSJA 3RVSA 3CKMA 4FE4A 4OTZA 4Y9TA 3GBPA 4RXTA 3H1EA 2WWVD 2L18A 4NV3A 3OQOA 2M98A 3N75A 4JB2A 4RY9A 1LBHA 3O2QB 3N53A 3Q41A 4EGSA 2CWDA 4RKRA 3JVIA 7ABPA 4N76A 2JVKA 1U8TA 4MLDA 1TMYA 3QEKA 3H5LA 1FFGA 1PHRA 2L17A 3OLVA 1ZESA 3OLXA 5EWLA 2PJUA 3LUAA 3O1JC 2DRIA 2E4UA 4B09A 1JL3A 2HQBA 1W25A 2RJNA 4RDCA 2VUIB 3TX6A 4FE7A 3EODA 4TMYA 4Z4CA 2AYXA 2FMHA 1Z16A 5T7BA 4RXMA 1H9CA 3LUHA 2LPMA 3SAJA 3GYBA 4P98A 2GKGA 3HSYA 1NATA 3O21A 3RVQA 1PNTA 2FTKE 4KK4A 1E2BA 3FGZA 4RY0A 4N41A 1TM2A 3O2JA 4QICA 4LDAA 3C3KA 2QV0A 3KCNA 4N0QA 5DKFA 5TQ0B 3RH0A 2FEWB 4MR7B 4MR7A 1PEYA 2A9RA 2PKXA 3NHZA 4IRXA 1R8JA 1ZAYA 3HDGA 2I6FA 3NNDA 3RVOA 5TPZD 3VNAA 4D6YA 4YWHA 1EWKA 4KRFA 3HJFA 3EAFA 1BDIA 2PUFA 1JX6A 2IPNA 4ML3A 3I09A 4MS3B 5TQJA 3CS3A 3T95A 1KRWA 1SXHA 2E4YA 1XHEA 3UK0A 2H3HA 1SRRA 1RXEA 3OO1A 1ZITA 3LKVA 1ABFA 4IILA 1D5WA 4RV5A 2ID7A 3LTEA 4Z99A 3LUFA 1DCMA 3JTEA 5BR1A 3H5TA 4NCAA 5FWXB 1RZRA 4TLLB 5JS1A 4WT7A 3GT7A 4OG2A 3TB6A 3RVMA 1USIA 4Z4FA 4MS4B 1FQWA 1P6QA 5IBQA 4KPYA 1RZRD 1E6LA
chains in the Genus database with same CATH superfamily
4RZIA 4C0SA 4FKMA 4QTZA 2RAUA 3D6FA 3K0CC 4ZRDA 2QN3A 4I0WB 1LB1B 5CDHA 4GZ3A 1L2TA 2IP4A 3W7VA 3TQQA 2HSGA 3IVGA 3WNZA 1SAYA 4CN9A 4OHBA 4UU1A 4BKRA 2J0VA 4FZ3A 3QEMB 3UAGA 3E4CA 4L16A 5AQEA 3MT7A 1UMCA 2YJTD 4KJZA 1JG6A 1ZNYA 1VYUA 2W2TA 1TK9A 3K0CA 3KWJA 1X80A 4NBSA 4PAWA 3I2IA 5IANA 4IQ4A 2CD9A 1HTBA 2HJWA 3PHIA 1RI3A 2W2LA 3UYKA 1C4OA 1SUFA 3DE5X 1UL1X 1KZ1A 2QMOA 3TUZC 2OM2A 4CL0A 5KWIA 2JIQA 2FPOA 2P6OA 1TA0A 2C4HA 1RM3A 1ZSYA 1OYVA 3NTVA 3QUSA 5F4BA 4C6TB 4HYTA 4UUOA 3PJRA 4DJEC 4C01A 1QGED 1N6NA 1AKUA 1KA9H 5GJWC 4OO3A 1RNLA 3B70A 2YJ3A 3SQOA 1NI3A 2FMIA 1SBQA 3VR5H 3R3WA 1QJCA 5E9QA 2Q0HA 4TWRA 3I5YA 2YHIA 2OZLB 2BI8A 1RRKA 3ZR4B 3GLIB 4GOMD 4KQWA 5BRJA 2XYGA 3V1UA 1ODKA 2I6TA 3DOEA 2G0TA 4L4UA 4LSWA 4CM1A 2YV4A 1U7HA 3O8CA 2OBYA 5A9RA 3TDNA 1L4MA 1U11A 3EOZA 2EX1A 3N2KB 4XQEA 4DLPA 3TINA 3MJHA 5JO0A 5K0CA 4PFJA 4KLZA 2LZ0A 3PXGA 2VJNA 4PINA 1UZLA 1F8YA 3ZQKA 3QYPA 1Q77A 3P32A 3HU3A 2J3JA 3LYAA 5GWXA 4ZCMA 1IXYA 5FA5A 3L07A 2CBXA 3MFYA 4B43A 2G7MC 3BHIA 2C7GA 3TFWA 1UDBA 4UTPA 2PLAA 3WSVA 1ILWA 4KO1S 3AVVA 5JCOC 4V0LA 1KVRA 3N3BC 1P1JA 2O7SA 4GBED 4IGFA 1G5TA 2QLLA 3MRTA 3H4MA 3IILA 3FTFA 1EBFA 3IVXA 1E6EA 3CVYA 4EYSA 3KOWA 3OOYA 4HRYA 4LNUB 4BKQA 1EE9A 5C8YA 1L8QA 3JD3A 3HUUA 1JXQA 1JYEA 3O93A 3B1WA 1F17A 2A88A 2ANBA 1OC2A 4N7RA 2XWBF 4R8KA 4ACAA 4ZGBA 4LRSB 2CWWA 4URWR 4RZSA 1DKUA 5FIUA 1TF5A 2QF7A 1W88B 4G67A 4QSMA 1KJQA 4F4CA 1XA3A 5BN4B 4XE5A 3KTOA 3ZTTA 4FUTA 4FYYA 2QVLA 4OJQA 2NTEA 1XTVA 1T36A 2NP7A 3O1HB 3HA5A 1K6JA 3MF4A 5EHNA 2WPNA 4HX2A 4LJ6A 4DA9A 1KYWA 4DWVA 3S1AB 4QARA 1Y34E 1ZH6A 1HDCA 4X61A 1EHYA 4I4LA 5JNRA 2X3FA 4JC0A 1QE0A 4M1KA 3C3BA 1K6XA 3DD5A 1YK1A 2HSEA 3AEKA 1LBIA 4LBYA 1U9JA 4ALLA 1BW9B 1D0VA 1P0FA 3FSRA 4OHXA 3QU7A 3T9BA 2FOIA 2PUHA 1F8GA 4G0OA 4IFBA 5ALDA 4DZRA 4G5HA 1RKQA 2Q4DA 3AMVA 3HM2A 3OZXA 3R6WA 1XRMA 2XITA 2LRHA 4L4SA 2XE4A 1UWLA 2FV8A 3UGTA 3ZIAD 3CEHA 3NQ41 4TM8A 5KNDH 2A8YA 1LSUA 2VJMB 2ZG6A 3R4VA 3TI9A 1E3EA 4I36A 2OHGA 3AEQB 3T3OA 5ALQA 4GR4A 1K0FA 2HLNA 1F60A 1KHTA 2M6KA 2IZOA 3BK1A 4QAQA 1T9AA 3O94A 4B6PA 3A10A 4DIBA 1U8YA 4QOHA 4CR7A 5FPHA 4M60A 3QY0A 5KQPA 4LMBA 3ISVA 3PIRA 4FX2A 4L6IA 3JD2A 3VSAA 1HUQA 5KSOA 3KZOA 1WD5A 2R8ZA 2Y66A 3AB7A 1KS9A 2BKAA 3NW9A 3IPCA 4TTAA 5A04A 4TYYA 4JKYA 4EY5A 1U2GC 1SU4A 3VPGA 4FGLA 3AH8A 4RVHA 1EX6A 1U3WA 1EFDN 2QD2A 1SIWA 1YQTA 3GDFA 4IMRA 3S5UA 4DV0B 1BE0A 1ZBQA 4DV3B 4KFUA 2CUTA 1ACMA 2DBYA 5SYMA 2W2LD 3TOXA 1WUIS 2OHJA 2H2HA 3DVAA 1JHVA 1OWOA 4RJJA 2HF7A 3AEZA 3D4PA 1UKEA 3ELWA 3PHCA 2R1TA 1JKJB 2PPLA 4G23A 2RGGA 4Y7DA 3V4SA 1Q20A 3VNSA 4MHTA 4RA9A 1ODTC 4EG1A 5KYUA 3LNCA 1T9BA 4Y2RA 1AB5A 2XDAA 2AFRA 3AP1A 1E1CB 3K9GA 3HMKA 1R5BA 4DQDA 2EU8A 4Y6GB 5AUPB 4JBXA 1KYXA 2EFJA 2VWPA 2SECE 3ROXA 3V4OA 2CVOA 3N7UA 2IIVA 1DVRA 5C37A 4R40A 3W7AA 3ETNA 4FD3A 3Q8LA 4LF4B 3ZWDA 4DQKA 2WSBA 4HNGA 1CQIB 3DLAA 4IV5A 1U0HC 2Y3IA 3AUJB 1ICIA 3G85A 1HT1E 3IODA 3GVXA 3GQBB 4IQGA 5M29A 5KO2A 4IWNA 1ULUA 2A4MA 2I6XA 3PSHA 1FVFA 3ASUA 1QVAA 1GPMA 2VZ9A 4OH1A 4OIMA 2QVYX 5B7NA 1KO8A 2EOAA 2VK8A 4MHSA 5EIFA 2PRIA 3PFHA 1K7CA 1KYZA 2JAOA 2WILA 3K8QA 2H2GA 5E6UB 5JROA 3GGCA 5DX8A 5NULA 4OREX 3R7WB 4B2YA 3R5TA 4QREA 4XR4A 3KQHA 1CSEE 5JQGB 3WYDA 3QFRA 1Z5OA 4LHXA 4LX8A 4WESA 1HLGA 1Y1QA 3VU9A 1BXRA 2HO4A 2X3UA 3LVBA 4O3MA 1S2MA 3PPWA 3FCUB 2PZ8A 1O4VA 3G2OA 3EVGA 4HSEA 5KREA 4YUZA 1H6CA 4ZOLB 3KKOA 2YYYA 1BH6A 5CM2Z 2R66A 4EPXA 3RTBA 2OP0A 3UHPA 2RBEA 3WLOA 1FMLA 2J9RA 2VXOA 2R6JA 3H16A 3OCYA 1TA9A 3OTQA 5AXAA 3WL4A 4AJKA 5EHQA 2V96A 3WIVA 3FCOA 3CG4A 1G1AA 2GRAA 3L3BA 3BJEA 2O1SA 4M46A 3EXFB 1QH9A 5DW0A 3MJSA 4M53A 5EKSA 1P7YA 4YCAA 1RAGA 2J7KA 2IITA 3IPXA 3ZE0B 1A04A 1II0A 4PC7A 3SOZA 2YTZA 1L7BA 4C7JA 4CZ2A 2YOFA 1ZJWA 1MB2A 1RQLA 1E79A 2GEJA 4HL6A 2C5BA 3PX3A 5CFMA 4I4IA 1FS5A 4TKZA 4HFRA 4M2LA 2PGDA 1GKIA 5K7SA 2JATA 1UBSB 3FNRA 3AB8A 1CJTC 1F6WA 1ZGBA 3J7TA 4NZMA 5FFNA 3FFWA 3QLUC 1H9AA 3WO1A 3I37X 3FR8A 1ZHOA 4XM2A 1BDJA 4OK6A 1DRWA 1WDTA 2HRBA 5HG0A 2SCUB 5JNTA 2QD4A 5EMNA 4X91A 2EP5A 1R0YA 1DBRA 1ODLA 3OIFA 5H3HA 1PF7E 2O8NA 3IPLA 2C9YA 3OOSA 1PZXA 4S1NA 2IX9A 4Z3DA 3DH0A 4C4PA 4AI6A 1ISIA 3B6MA 2EZ4A 5J4VA 4M0FA 4XFKA 1K63A 3PT9A 1L4KA 1N2CA 2ZI7A 3IXMA 4BLTA 1DG9A 1VJ5A 3RYIA 3UKOA 3FDFA 4AXBA 1I7LA 4CCYB 4JL8A 1GOTA 4HH0A 2RAFA 4Z4EA 3L1JA 4E2YA 4NMLA 3RUCA 4TXHA 2AOVA 3GBVA 1XDSA 3BGWA 1GQRA 5HFJA 1VM6A 2IF2A 5BSUA 1KBZA 1XAJA 5P8WA 1A98A 1RHJA 2G5GX 3ZX4A 4Q9DA 4ZJPA 1W2WB 2ZM6B 4YPFA 4PLCA 6GPBA 1MJHA 2P9EA 3FGOA 5C52B 2VDUE 5IC5A 3K0EA 2XJ9A 2ZTHA 1X6VA 1QVVA 4R1MA 2C7BA 3L05A 4OP3A 3HXLA 3L0CA 4QDTA 2CZGA 5THQA 2RHMA 3BEOA 4EHAA 2F3RA 4TSFD 4K6FA 4XWAA 5IVDA 3V7UA 2R5NA 5GP1A 3ED5A 3L1KA 3OX4A 4MV0A 4MRSA 3C4JA 5DULA 4A26A 4ZT4A 1UMKA 3PCXA 1WVMA 4J0DA 4J8PA 2WF8A 4JA2A 2HPHA 3TBFA 1KMMA 2P6NA 2X2EA 3U81A 3PA8A 2VUUA 5CVUA 1MB4A 3KKZA 5I4BA 3WP0A 1P9WA 1GIAA 1NDHA 3WLLA 4H6XA 2GEUA 4Z1MD 2X19A 4QG7A 5I8PA 3UUWA 1M2NA 2RONA 3HUTA 1IBLB 1G6Q1 2JFBA 2O2YA 2P8JA 2BOVA 3O82A 4BJ6A 2XODA 2DBRA 3QEOA 3K2EA 1JDBC 2NX2A 3NM4A 4BFVA 4MW0A 1YJAA 3SM9A 1X3LA 2DPYA 4BQIA 4Q7JB 4RPLA 2CVFA 1EXWA 1V6AA 2CLKB 1G21A 1VIDA 3QP9A 4JVOA 4MV4A 3T61A 2OV8A 2MYTA 2OZPA 2TS1A 2BMFA 2VJCA 4MDEA 5IYZB 4YBZA 1GQQA 3SC2A 3I1JA 4KQIA 3UMMA 4R41A 2TSYB 4C06A 3AVOA 1MB9A 1DXOA 2F43B 4AECA 1NYLA 3OECA 3QU9A 4BC0A 4ZYTA 1HQYE 2BFMA 5H9WA 3FMVA 5I47A 2DLNA 3DL2A 4GYWA 3RAEC 1KVQA 4QRIA 4BVFA 1WZ2A 1U2ZA 2ERCA 4JZYA 3VR2A 1VJCA 2NU6A 1TECE 5JH7F 1CZKA 4WFIA 2H1CA 3LT5A 4WUVA 1U02A 3ZCSA 1ZOSA 4YJHA 1VDZA 4DMMA 5EJ7A 1K1EA 3KOUA 3R44A 2YC2C 1LDEA 3SGLA 3QNMA 1W94A 2Q1SA 4M1SA 3LVFO 1YQ9A 4AMBA 1WP9A 4EQ6B 1A71A 2QP4A 2JLBA 4G4SO 4XW2A 3OM0A 1O58A 1RE0A 4UAGA 3V4VB 2AT1A 3CO5A 2EYUA 2II6A 4Q19A 2YBDA 4J2OA 1DNPA 4YFVA 1ZUHA 5ALSA 1AU9A 3QXXA 4PS0A 5MN6A 1V8ZA 1XPRA 2O57A 2IW1A 4KXMA 2YS7A 1GU1A 2XLBA 3KQOA 5EWJA 4Q9LA 1JU9A 1D07A 1Z39A 1MTOA 2OM6A 4ZCLA 4BVGA 4F4FA 2JFQA 1JH8A 3E9DA 1VRVA 1Z2OX 1CQXA 2ZAYA 1X7WB 3IVCA 3DE1X 4UAUA 3RUPA 1E9BA 3RC9A 3L6DA 2IDMA 4CDNA 3QJ5A 2KBEA 3DE7X 1FLVA 1T2AA 1T2NA 4O2BA 1WF3A 3UJPA 3PUIA 1KETA 2GDJA 1X7ZA 4EAQA 5IMSA 4OI0A 2D13A 1G20B 3HFGA 3NALA 4PNHA 1H0SA 1E5QA 2MSNA 3E58A 3NBXX 1R6BX 3WZ2A 1OH7A 4RMJA 1UXHA 3SDSA 3DFIA 4P31A 3TX2A 3ANNA 1E1MA 1M67A 1V4NA 2VJMA 3L0SA 3CNLA 4RTQA 2BGTA 2P2DA 1IQUA 2VEOA 2XB8A 4X5OA 4Z49A 4NL4H 4WCFB 4Z7NB 1MVOA 4BO9A 3F6YA 1JPNA 2NO6A 1OGIA 1IJBA 1UJ4A 4N6GA 1ZEJA 1VSVA 1YSCA 2OGSA 4RLFA 2QX9A 2ZT7A 3HSSA 4E15A 2IIPA 3ORHA 1QR6A 2VHCA 4P4TA 5TMBA 5FWXA 2AHRA 5BW6B 2J09A 5AM0A 5LUAA 3LWNA 3CKMA 4YGYA 4JX9A 5FQOA 4R84A 2OGUA 2BGLA 4AJLA 1Y82A 3V00A 3E9RA 1COWD 4JY7A 3OQOA 5JQWA 3RAFC 4JUDX 4RPJA 4RKRA 2IHNA 3PHHA 1TCUA 2ZXEA 1IJEA 4Q15A 3IGFA 4FYMA 1U9IC 4GM4A 2PHZA 1ADGA 1P77A 2I3GA 2QVBA 2IS4A 1FFGA 1JR3A 5LJLA 1P6XA 3UOWA 2W6JA 3GGJA 3L7NA 4OXQA 4FLEA 3P9KA 4N7MA 2XKKA 4X1OA 3AFIA 4LFAB 4COKA 1BXRB 2Q5LA 4IV0A 4O4HB 2G9NA 3H2IA 4U3JA 2IXDA 3E2MA 3E9EA 3CKKA 1Q22A 2B3DA 4TYNA 1SH7A 1A5TA 2O2ZA 1KU6A 3KE8A 3KPJA 4GX1A 1KK2A 4JDUA 2XUJA 1FFDA 1UBTS 4BEJA 3G3EA 1T0UA 5EHGA 1ATZA 2CY0A 4RE6A 4RA6B 4U0JA 1AZLA 2PZJA 2P0AA 4U4AA 4OAPA 1MC4A 2PR2A 1TM2A 3SZRA 1E58A 1OZ0A 3N70A 3IJRA 1LF5A 3OG9A 2ZRQA 5BVHA 2CLFB 1XFAA 5ALJA 5H68A 5CVTA 2UZ4A 3G8DA 3N2KA 2HJSA 3P2JA 2X8JA 5AICA 5BN3B 1EWKA 2H51A 2X0IA 3R3HA 2BFAA 3EAFA 3F97A 3FHJA 5JSFA 1JX6A 3HJFA 4C7MA 1U6JA 2C04A 2MIIA 3WYFA 2AJLI 4EELA 4ETWA 5BSGA 2EW8A 3I28A 4OEHA 3B52X 1M1ZA 1DKQA 2DFTA 1G6HA 4HFMA 4AUKA 4ZVRA 2O5CA 2HL6A 4ENQA 4HMPA 3THRA 1QFMA 1Z34A 1N2ZA 4AG3A 4WFJA 5DYTA 2B4TO 2CBGA 2FN7A 3LTEA 4BE7B 5KX5F 3HDJA 3IQHX 3U62A 3C1TA 4Y2QA 3X44A 4OA8A 3HV0A 1F2UB 4TLLB 3SQLA 4ERXA 2SICE 3DS8A 2G63A 2DC1A 4XVQA 2WU3A 3A2KA 3V8MA 3KD2A 4FM9A 4D8TA 4B83A 3ACBA 3Q87B 1MZPA 4LX0A 2WSSA 1U94A 3KKLA 3NNNA 2O8CA 4ARVA 1FUYB 2DOKA 1LDBA 4MUBA 1U04A 1C7EA 2FUNB 1JA0A 3IDQA 3K8OE 3FHCB 4OHRA 4I81A 3WHPA 3O4GA 2PSEA 1KAQA 1UBJS 1QWOA 1IHUA 1TTQB 2XMGA 3FM9A 2VZLA 1AHNA 1GGKA 2QRUA 4JI3B 2ID8A 4WCVA 3ROTA 3LLSA 4PHTA 3H97A 1DHTA 1EXMA 1RQRA 3M9XA 3IIIA 2JBAB 2W6IA 3UWKA 1PWYE 4O25A 2WJVA 1P3JA 4NCXA 2P4QA 1A7AA 5A3SA 4X65B 5BW5A 4Q00A 5AUOB 4ZZ3A 3EGXB 3L7DA 3I0NA 5E4TA 1G4UR 1OI7A 2C5EA 1X77A 2NPOA 2PU7A 1G5PA 4GYYA 1RABA 3X1JA 3R5SA 3ZHRA 1PEAA 3GG9A 3JQPA 3I3SR 5K05A 1K92A 1N1DA 1SZPA 2QPTA 1M2HA 3DXZA 2OEPA 4P34A 3VDRA 1NDQA 4QHSA 4AJIA 1ORHA 3LZDA 4BBPA 4ETMA 3L4SO 4XOIA 2CFOA 4ODIA 1WPRA 2PUBA 5CFNA 1F0PA 4QOJA 1UBFA 4K9QA 5IKOA 3M2TA 1NAIA 1GUAA 4KIFA 1T8WA 4FS3A 5BSRA 3EA5A 3OURA 4OBBA 2HJGA 5EQFA 2OV4A 1Q7BA 2WPDD 3W8NA 1F7UA 4QBTA 3VH4A 2ZCUA 3KXLA 4LNUA 4EKEA 4PQGA 3VNVA 1OF1A 2HWUA 2QRLA 1XKQA 4DCPA 4IVNA 2OCKA 4ZCIA 2PWBA 2YW9A 4RGBA 2IL1A 2EBWA 1R74A 2IK8A 4W5JA 4F6CA 1NU6A 4HF7A 2I8CA 3L7CA 4Y6LA 5G0TA 4FINA 4HPJB 2ZSBA 4U7DA 3JAMA 5BRNA 4JI8B 4LHEA 5GADl 3MWDA 4RESA 3JPWA 2XMCA 3NTQA 3DE3X 1C1HA 3DEAA 3L92A 2VTBA 1TLFA 4I4TB 1M3SA 4OKSA 3IE2A 1CZOA 3P96A 4IS3A 4B33A 4QGAA 4KVAA 3UIEA 3GRRA 3F5SA 2P4EA 2D5AA 4EJFA 2CL5A 2WSLA 4GEGA 1JB9A 1XTTA 3N5KA 3GEHA 1CR2A 4KPEC 4U02A 4TV8A 1R0XA 1R9NA 5BSVA 5TJHA 1MRSA 3TECE 3C41J 2BWJA 2VP0A 4UHDA 5IRCD 2Q9UA 2JLVA 1YQUA 3WLQA 2ASEA 1Y8AA 1N8KA 3JQFA 4FNMA 4OXYA 4Q6BA 3DYBA 1YCGA 4TXLA 2QA5A 4O02B 4B3CA 4Y9DA 1NJ1A 3BE5A 1J0CA 3KUXA 2Q50A 3G1TA 2QR5A 1SQSA 1WPXA 4EJSB 4PVCA 4L8LA 4UUNA 5EGSA 4DLLA 3KZVA 5GM2A 2GAAA 1WE2A 3MMZA 2WVGA 4NJEB 4FR0A 4TS1A 4LHSA 4RTSA 3UMFA 3JVVA 1TNDA 3HFSA 5CHYA 3AI1A 3OWHA 1QIFA 4WFKA 5C2JB 5K0EA 4I8XA 3EWIA 3QHQA 4PHGA 3EN0A 4D9MA 3RFVA 5K8LA 2AG0A 4DDTA 1SVKA 4KDRA 3RVPA 3GT3A 4D0NA 2OAP1 4LKRA 1WCIB 2B7LA 2GXUA 3EVTA 3RRMA 3TZLA 1T5LA 1UBGA 4S1TA 5KTPA 2FN9A 3D4IA 3U4HA 3G0DA 4D9IA 1TQHA 1Q1AA 4WDRA 3D1VA 2JRLA 5I7SA 3FCCA 4IDGA 3E1SA 3OOEA 1F4PA 1TLLA 5EIBD 4EW6A 4ZI2A 3OI7A 2IF0A 3ABOB 4N5DA 4A7PA 2XD9A 2FUG1 2NYRA 3MLAA 3B5EA 2ES4A 5KVSA 3ORSA 1A4XA 3CWZA 4AX4A 3WP1B 4CM9D 1XL1A 2F1JA 4RK5A 1E18A 3RJZA 3UICA 2BGGA 4NEQA 5AKEA 1FCJA 5K0BA 2QD3A 2AW3A 1C29B 3HY4A 4UBLA 3BAZA 3QWIA 3S68A 3C6ZA 4GU5A 2NU8B 3TLYA 3ZHCA 1JQAA 3PLAE 1N2HA 4JODA 3T94A 1NNSA 4RFVA 2I62A 1DAKA 4ZYLA 1Q92A 4UMVA 2IHZA 4ZXPA 1TCCA 1UKCA 3U4DA 1UC5B 2B1RA 5KOJB 2QNIA 4YRTA 1RRMA 1SNYA 1UFRA 1UJ2A 3DR5A 3MNFA 4JYAB 4AULA 1PLKA 2V45A 5KVAA 1NXOA 1U31A 2JNWA 1QU2A 3BREA 3ABQB 4DWWA 2XXJA 4L72A 3N0VA 1PX2A 3LIPA 4DYVA 6LDHA 5LP1A 4P0PB 3KDPA 1XEXA 1H2ZA 3H11A 1BXGB 4LJ8A 2EGHA 3G2PA 4QU0A 2V7TA 4RLQA 1TI7A 2OFWA 1G5HA 1YR1A 4FIZA 3TXXA 3IEKA 2VH1A 3U13A 1CD5A 1CP2A 2X77A 1AS0A 5E7JA 3R23A 4G0QA 4WWHA 3MTIA 3B7PA 3UB4A 3KSUA 4BNJA 4D3DA 5DX1A 4C7BA 5FUMA 3AVYA 2QQ5A 4PNPA 1X1DA 1MGPA 2ECKA 4DABA 5JBNA 1MQ8B 4KP7A 2H2IA 3V4PB 3V1LA 1ONOA 3NEJA 5B3JC 3B6ZA 4GNRA 1JI0A 5F77A 1CQIA 2FWIA 3OKPA 2GZRA 3FCXA 3UVEA 1EQ2A 2NV2B 2IHBA 2WTNA 4XUGB 4ZVMA 4WBXC 4BBAA 3RIEA 3QUCA 4Z6KA 5IN4A 5T4BA 2O3UA 2QLFA 5DM1A 4OYRA 4MGHA 5T57A 1SGWA 3W8FA 3AHGA 3T3MB 1I7DA 4LYHA 1GUFA 5AK0A 1PVVA 2C9OA 3WQRA 3TZBA 3EWSA 1Z7YA 1LK7A 2G82A 4K6HA 4ZEWA 2R6DA 4RFSB 2WRZA 4Q4HB 1JLMA 2HJRA 1P4HA 1ZDMA 3L7LA 2DULA 3L4JA 1LNQA 4FFOA 4FZJA 4ZQHA 5FOXA 4JLSA 3HUDA 1OA1A 4B7UA 4MW6A 5T41A 3AR7A 3W9YA 1B1AA 1IZ9A 4I19A 2NO4A 2R5WA 2JAPA 2BZGA 1R5JA 3CV3A 4A0SA 4BVAA 2ZK7A 4G4SP 3IR7A 4TZ0A 4I5IA 1GPBA 2HLDA 3I30X 4ENTA 5B57C 3H9BA 3LYHA 1Z6AA 4E14A 1T5IA 1UDRA 2HHCA 2BUAA 5DO9A 4CEHA 1O9BA 1JBQA 1ZUNB 3RHZA 2C29D 3KSZO 5CB4B 1OLUA 3FLBA 1X8KA 5FPKA 3JD1A 1SHLA 4U7HA 1V26A 1PZMA 2Q1UA 1MABA 3C3DA 2WFAA 3DWIA 4IDQA 1OVGA 3VC7A 3QF4B 4KZPA 1ABEA 4IGKA 4MZDA 1YKSA 2TMGA 4B71A 3KXPA 4JVLA 2ZGVA 3IBYA 5LIRA 3QU4A 4CKCA 1XPJA 5L3QA 3SK0A 2F00A 1D0IA 1W52X 4YP5A 1GO2A 1JHAA 1L3IA 1CY0A 1USKA 2OV2A 2WHEA 2Y9PB 2B8NA 4Y2HA 4ZGWA 4Y2YA 5EIEA 3I53A 5F12A 5IX8A 4C6RA 2O4UX 4B9EA 4BLUA 4A0RA 5ICEA 4XEUA 3G0GA 2HC9A 4KREA 4HO1X 2Q4OA 4R2KA 2O7NA 4U2KA 2BELA 1FP2A 1ZGCA 1YK0A 3C3AA 3GUYA 1QZ3A 4M0CA 4XDYA 2I7TA 1FS4A 5BMVF 3VJRA 3GW8A 1TD1A 4ND3A 1K3UB 3ZJUA 1EDEA 2PKRA 3I9LA 3JALA 3JYHA 1OVMA 4JUFA 4LOKA 3FXAA 1VP3A 1FLAA 1Q21A 3PBKA 3SXUA 1GKKA 1V43A 1QAQA 2YWGA 2J48A 3EZGA 3K4HA 3NX4A 3AGPA 3PRJA 4E2WA 1FFXB 1MLDA 1O94D 2QEQA 4MR8B 3DTYA 4QUEA 1ESZA 3BE8A 3II6X 4QWWA 2J9FB 5EE5B 4YV7A 5L4NA 3KJGA 4YROA 2G1PA 5CG1A 2HSJA 5CBPA 3HYRA 4GBMA 2E4ZA 3BMQB 4Z9AA 4HTFB 1B2LA 4BFTA 2OBMA 3MCAA 1V1RA 1L8LA 2CNOA 5DIZA 1OWMA 3W05A 1VJGA 4DXDA 4EUKA 1QGUB 4FR2A 5ER6A 4E51A 5HF6A 4TTTS 2HCFA 2Y9MB 3G5MA 4OGWA 2ZYRA 1F4LA 1I1NA 4LYJA 4MNTA 4JHLA 3JAWB 2XQVA 2X15A 1HQDA 3GCWA 3UATA 4D4JA 1XAHA 3PFWO 3IBGA 4AL4A 1R6VA 2CHUA 3DBHB 1UBMS 1PYGA 1NURA 3AM1A 3W5AA 4YRIA 1IULA 4IEEA 1DFGA 1GD1O 3KPVA 3LHKA 5AIBA 4F2PA 4URHA 1N34B 2H1FA 2JBHA 2Z8ZA 5FWYB 4DFDA 3IQIX 1G3UA 3CVWA 1I2DA 3NPAA 3OICA 3IT2A 3KJFA 4INOA 3EVNA 4DBZA 1W5EA 4ZCQA 2F67A 1VJRA 2AE2A 2BC9A 4KFSA 3ZVMA 4G0UA 4CGZA 1HX7A 4N3CA 2NU9A 2JGNA 1YTLA 2BFDB 2QMYA 3D2CA 3R5KA 5IS2A 3S44A 2WICA 4BWVA 5AKXA 1ZA2A 3LZCA 1U8UA 4ZDJA 1VI5A 4BEBA 3QELA 3OMLA 3IV6A 3P27A 1PNQA 1URPA 3MS4A 3CR7A 3DTVB 3T6KA 1AXRA 1SVSA 4D42A 1YA8A 2R4TA 3MRSA 2YXBA 2Z1NA 4FMDF 2ORYA 1K7XB 1KS2A 1CLUA 2B4RO 5F7JA 4L0CA 4B6RA 3IRVA 4E11A 2FZKA 1JQLB 2MDTA 3NT2A 2HPAA 3BIFA 3RS8A 1AHPA 1LS6A 1C81A 2B36A 4C0QC 4O6VA 2NVBA 4XD7D 1PUIA 3WYGA 4E70A 1FFWA 4QJ3A 5EIXA 1S4QA 3ZDQA 3ECCA 3KZKA 2OB1A 1G6KA 2QV7A 3TQIA 3GRAA 3BRWD 3WGOA 4MVXA 4X44A 2N42A 2R87A 3BM5A 3EG9B 3H5OA 3LHFA 4FN5A 2A3RA 2I5PO 1G8YA 4OHPA 1X87A 2CXQA 2LD4A 1ORTA 4H35A 3CY6A 1CYDA 3LVQE 3A9CA 4YRSA 3VV2A 5IJ0B 4W5HA 2FMUA 4E5KA 1RHUA 1GDDA 4L85A 3AL2A 1F4VA 2Y0PA 3GJRA 4HEHA 1HE4A 2I33A 4LCEA 4HVCA 1ZX1A 2EV9A 1CUCA 3OZGA 3RYTC 5ARBA 3KKPA 4OI1A 1YMUA 4ZVSA 4MUFA 3FSJX 5U1PA 4K8OA 4IJ6A 2AK3A 3UAWA 1MJGA 4ALIA 3KWFA 1A4RA 4RM3A 5A5DA 2DHEA 2HZ7A 2BJHA 3IV7A 3AF2A 1YBMA 4NYMQ 4RXTA 5L7TA 2XUDA 4HUJA 1KL7A 5GAJA 2M98A 3CLSD 4CKBB 4GO1A 2JIZA 1QV7A 3RANA 1EU1A 1FSZA 1UBHS 1WBJB 3AUTA 1XD2B 2YMPA 3E22A 1MN6A 4MK4A 1I5RA 3ZEAA 5ADUS 1SUWA 5FDFA 3HNOA 1SXQA 4LVUA 4OQMA 3PIIA 1RBMA 3KV3O 1NN3A 3E9ZA 2PYDA 4FOOA 1NONA 2OYCA 4MEAA 2HT1A 4I50A 3ANTA 4V3CA 4BATA 3JYQA 5KYXA 5J9FA 4W9MC 4CLDA 1UMDB 1B8OA 5GGXA 1KE2A 2DUMA 3N8KA 3RF6A 5JH7A 1A8IA 1AGRA 2YUTA 4TWIA 5C8XA 4HGPA 2F55A 1VMKA 2GBFA 3CPSA 1XCOA 3TX6A 2GN2A 2WABA 3PGKA 1TVKB 3PQCA 4PCLA 3AG5A 1B74A 2O5EA 3NIGB 2GBIA 3W2IA 1Z0FA 1P5HA 1X3SA 2PT9A 2Q3CA 4Q3OA 1SVOA 2JFWA 3GEBA 3WAGA 1ZCBA 1C7ZA 1M6EX 1PDWA 1Y89A 2HADA 3PHJA 4HATA 4B6QA 4EEXA 3O21A 1NU8A 2R1ZA 5AJVB 5TS3A 3C3JA 5FJIA 2C8LA 3FGZA 3GFFA 3K92A 1GQSA 4P6VF 3HLYA 4WINA 5WRFA 1I51A 3C3KA 2OCYC 5E2BA 4PHCA 4ZVVA 1GZDA 1CCWA 1OPXA 4N0QA 3R9XB 4D5EA 2JKZA 3JRNA 4ZEOA 4MR7B 3ZJYA 2PKXA 5FR1A 3AERA 3X1YA 2D7DA 2F8LA 2WVAA 2J9FA 3R09A 4PYJA 3KVRA 2EF0A 4Q9HA 1I6WA 1QIHA 2XGSA 4CR8A 2IPNA 3A3OA 4HDAA 5J5CA 1Q91A 3I09A 4E6EA 1USUA 4I50F 3FUVA 1T3ZA 3QI7A 4Q4LA 3QTLA 2ZS9A 2BM1A 4HVLA 3U1TA 3VU8A 1XA0A 1HOXA 4BQNA 2C99A 1OX4B 1E3TA 1C30A 4A2QA 5A4IS 1EVQA 5KVQA 1YWGO 4RV5A 3TXAA 2D1RA 5AI4A 5IVHA 5D1NA 1RYYA 3JTEA 3RGWS 3M6FA 4RCZA 2DUJA 1NBMA 5BV2P 4BNHA 3PUXA 3IEXA 1V96A 4U6NA 1GILA 4QYTA 4OCZA 3RVMA 3W0LB 2ZE5A 4IDNA 4DE5A 2V4MA 4MCAA 4Y2VA 2BGRA 2FUKA 3G2KA 2F4NA 4G1MB 2A0YA 2G07A 3ADOA 1BOFA 1C7JA 4XGRA 5CRIA 4U2GA 3OLZA 1JIQA 2OZEA 3W5JA 1Z73A 2W58A 3M6XA 1Q15A 5AKIA 1W35A 4WLOA 3QEBZ 5D2CA 4UZSA 1MABB 1B0PA 2XYPA 3PGLA 4ISBA 3HXOA 1NQ5A 1Z5WA 4K9RA 2BM8A 4HV4A 4W5OA 1NVGA 1M2FA 3H42B 4JIMA 3VKWA 1I4DD 5JJLA 4WOBA 4V02A 1A50B 3GMSA 1M8KA 3E70C 4K1XA 4JX8A 4F4JA 3SHQA 2HREA 2XI4A 2I4NA 1JW9B 4DLTA 4UARA 4EA9A 1H3NA 4MB6A 2PUEA 1EZZA 3U5TA 3IUBA 5FUYA 4UCQA 3FCYA 3W8RA 3Q4GA 2J5KA 4KO4S 5AVOA 5KPJA 4P53A 5DM4A 1L5HA 2OGZA 3OZAA 1JV2B 2YWXA 4CM7A 3BMNB 4I2VA 4U7PB 3B3JA 4ZVPA 4ETNA 1HLDA 4U00A 2D1SA 3MSCA 2H1IA 5DHUA 2D74A 1IEVA 4NFLA 1G20A 4GP7A 4AF6A 5THKA 4Q1AA 2Y0CA 2GZ2A 1E3WB 3UH1A 4XCVA 3PNOA 5HQ3B 5FP0A 4RGYA 2ZJ1A 1QP7A 4XJVA 3N76A 1X7HA 2VWQA 1IOZA 4EATA 4WPGA 5JXGA 4M8KA 4CV2A 3BTUA 3HACA 1MC5A 3I01M 3QX8A 4QYMA 3G68A 2JDIA 4J4HA 3URKA 2AN4A 3JV7A 2JAHA 1TOAA 4LQCA 4OB7A 1G3IA 4YCBA 4ZT6A 4B84A 2FR8A 5E7QA 1QIDA 2PSFA 3KTDA 2GHTA 2QE7D 1CB7A 2HRCA 2X8WA 4X7MA 1AQJA 1WXHA 3RFUA 3D54D 2P5YA 2HA6A 3OT4A 3AVTA 2DUWA 1BU5A 1J70A 1ZCZA 2D0DA 2QRZA 3HEBA 3VKFA 2ZB7A 4Q1EA 2G4VA 3FJOA 1L5MA 3GNTA 5JNSA 4Q4CA 2IU4A 1DTWA 2FETA 4MRMB 4XGKA 5H0IA 5H4HA 2W48A 3IR6A 3FYDA 4BGVA 3GRZA 3AY0A 2CZCA 4MPDA 3RT1A 1EXDA 2AFHA 2HU2A 3R5FA 4CW7A 3CX8A 5UKDA 2PBLA 1A7KA 1XG5A 3GZNA 1E5TA 3P0HA 4D79A 5AR1A 1TUBA 5JCZA 1AUQA 3KEGA 1AS2A 2M32A 1NLUA 2AR0A 3EULA 1LXCA 2Z3ZA 2R84A 3K72B 3QFCA 5DXJA 3SSAA 1CEYA 4Y3UA 1H2WA 2O3JA 1T29A 2WF9A 3UHAA 3D6HA 3E8MA 4KLCA 2CCJA 4IP0A 4XGNA 4ZVOA 5E7MA 4DRXA 5ALHA 4EBFA 4GH5A 5IK2D 2FSUA 2QRQA 3ZDAA 3GCZA 4YCNA 4E3WA 2IEIA 3KYDA 3TG8A 2I78A 4F2WA 1PSDA 4WOPA 4AY3A 5JMTA 3A6LA 1W44A 1Y7PA 2MOKA 4NCIA 4LGYA 3RF7A 1EK1A 1VOTA 1DS6A 1X1RA 1X7XA 5E7IA 4ESOA 1G8AA 3TLJA 4ARSA 4JLOA 4EGFA 3EE6A 5TGDA 1R3UA 1GQOA 3OO0A 5KJCA 5LYJF 1FW8A 1W1UA 1W8DA 4YPOA 5HIAA 4MA0A 4OHMA 1EXVA 1E2FA 2H54A 1X8XA 1W36D 4H3KB 1ZD9A 2C2BA 1YVUA 1DUVG 1CQJB 1M2OB 1JHUA 1TCVA 1X0XA 4BPRA 1A2QA 5A5GA 1LJLA 3U80A 1GQFA 1RLIA 1S2LA 1ZH4A 4M1WA 3TTUA 4X66B 1AZSC 4NZNA 5DISB 1GYPA 4H7EA 1EFRD 2HIAA 2I2AA 1OWNA 1J07A 1RMYA 4G09A 1UWVA 5K2MA 2VYQA 3V2UA 1CR0A 3VR5A 5BYJA 3BJIC 4R8RA 4F3NA 5ESWA 1PYOA 3DMPA 2OBXA 3HN7A 2VSYA 4KACA 3WB1A 2PRJA 1QX4A 1T2FA 3NHFA 3BD9A 2XCOA 4LSMA 5A05A 1YB5A 1MX5A 4WERA 5CIQA 4EHJA 1X86B 1ECBA 4FYVA 1H22A 3FVWA 1E9VA 3QZUA 5B3JA 4FYHA 3LPLA 4LJYA 3TIVA 2JA2A 1P44A 3GLFA 4U2CA 4MGEA 1IY2A 2JAUA 1Z2DA 4QXRA 5LYJB 1W88A 2C42A 1XHFA 3A4MA 2IODA 2VPXA 1MAUA 1WSBA 2GPSA 1QO0D 5CLGA 2Q7OE 1E3QA 3S2IA 2OXTA 3DO5A 1FVXA 4AS1A 3REQA 4ZYXA 1CLEA 4BQOA 4C0AC 5LBTA 1B23P 3F4LA 2IXTA 1US8B 1JSXA 1NF9A 3WHIA 5JRZA 2ZIAA 1W4ZA 4KBFA 1TZBA 1K4MA 4N40A 1WY5A 3TB4A 5JHGB 1RKXA 3GJ6A 3OE5A 5TF0A 4ZTUB 3QJYA 5HKKD 1SUDA 3PPIA 5HNKA 1M6VA 3VH2A 1VRCA 5FYQA 1XKXA 4DUZB 1JP7A 4H60A 4UE6A 1BIFA 2RI0A 1QH1A 5LWQA 1JG1A 4KQ6A 4MW4A 1GNTA 4GOXA 3QG1A 3WDKA 1PS0A 1KYVA 4EUNA 5KHLB 1IXZA 2GLXA 3CMMA 1NVXQ 3DOIA 4G9EA 3VKUA 3ZZ1A 1E20A 1LK0A 3MYRA 3GDOA 3ZGNA 1QNLA 1T35A 2ZRHA 1S2OA 2RMKA 2CNKA 2R6AA 3QXSA 2X2PA 3GNQA 1ZNQO 4BZWA 5IT0A 1S6YA 1UWKA 2CMKA 2BFCA 2IOQA 2PJDA 3OE4A 4PWZA 3C5WP 4P38A 4Q3DA 2ISQA 4LC0A 1TJ3A 2RHTA 3TLGB 3W5SA 1ZWLA 3DZDA 1F0YA 1ZP6A 3GYGA 5DYNA 5A0TA 2ZRFA 1CUGA 2FLWA 3QMMA 2HB6A 4B6SA 1EM8A 1B1CA 2WTBA 2HMSA 2XGOA 2PUAA 1WXQA 4L9AA 4YAOA 5D5PA 3IFSA 3LP6A 5BP7A 4EPYA 3F49S 1NTOA 1E9DA 3F6EX 5AW9A 4JLBA 5B5SA 2F3TA 2ZBUA 3KR0A 2VF4X 4AO7A 3EX7C 5EKUA 4B81A 3ASVA 3WK6A 4UPDA 2JASA 1Z35A 5TPZA 3WQHA 2BGJA 3SR3A 1RTTA 1LTQA 2JK0A 1T3LA 2IUYA 4UNIA 1O96A 3FSGD 3HBLA 2HU8A 3I92A 3ESQA 4AUEA 2Y0BA 2RGAA 2IOFK 2F4VB 1B3RA 2XIJA 1DAEA 2UZ1A 4BO7A 2YJ5A 4C0JA 4CE6A 5BR8B 4NPHA 2FRXA 4DMFA 2A84A 5EWMA 4E1VA 1QBKC 4IJWA 3ZTYA 3AUXA 3O73A 3OU7A 5B2EA 1AF7A 1TPZA 5DCLA 3LQKA 4UXIA 1US8A 2IIQA 5EZYA 1EIWA 1EFVA 1NULA 4Q47A 1SJ9A 3REQB 3KDSE 4F56A 3K3PA 1HO3A 2DECA 1MRZA 2HT6A 3GAFA 4GX2A 3I9V1 1N5OX 5B37A 4RTPA 1DEAA 2GESA 3GA5A 2QMHA 3LQ1A 5HXAA 5HTOA 4PZAA 4PQFA 4B6EA 1QOPB 2WYIA 4BKOA 4IW3B 4X7PA 1UOPA 1JJBA 2Z43A 3M0EA 2YFQA 2PDAA 4FFPA 3I61A 1KAOA 3TCXB 2ABWA 4DSNA 2OHXA 4I14A 3SF8B 5JDIA 5KYYA 5TVGA 4FQ8A 3J80A 4HXGA 1CEQA 1OC4A 3BA1A 3C98A 2DUNA 4TWBA 2IH5A 2HA0A 4GSKA 4A91A 1KFJB 4D9NA 2WYHA 1XK7A 3D7NA 3N8NA 1JQEA 2J67A 1QX3A 1ZUNA 2P9BA 1D09A 2B3TA 2CHGA 4WA7A 3UHJA 1L7MA 2CGEA 1OFGA 1M73E 1QPGA 1GUYA 2H7VA 4N8SA 1IN8A 1O97C 2I2WA 3A1DA 5KU1A 3CH4B 2PX0A 4Q7EA 2JBAA 2ZDGA 2E4XA 2XMBA 3EXEA 1J20A 1Y8QB 2YIMA 4ZAGA 1Y9EA 2XNKA 2PUVA 2FZGA 3IALA 3H6HA 1DIHA 3HU2A 3AIKA 3TF5A 2BCEA 2Q46A 1UKVY 1VQ1A 2V59A 3A3YA 2XE8A 3Q0EA 4R69A 4P83A 5J63A 2X42A 1JQ3A 4BO3A 3DEFA 3GLIE 2R1VB 4B1FA 1E6CA 2ZRIA 5LP6A 1VHQA 4IGEA 3WZLA 1IOWA 2C2YA 5FX2A 1X7GA 4CM4A 1K8YB 1RHQA 3DTVD 3ZKWB 5BWMA 2ZJ4A 1K5GA 1JEAA 2VR1A 2GTHA 4XWOA 4MWSA 4E2XA 3BXOA 2EJCA 2GASA 3OTWA 4YRKA 2C5SA 2IPMA 3ONFA 2IUEA 2A6PA 3ECSA 2OG2A 4LWPA 4J7CA 4NG4A 2A86A 2B7BA 4R7ZA 2XJ4A 4G0MA 3C1OA 2MR6A 2NSLA 3AR2A 3IAEA 3JQRA 1Y7LA 4V1CI 2ONZA 2BFFB 1ZSVA 4OJNA 3KQPA 3DEYX 1EP2B 3AHIA 1E62A 2QP3A 3VYRB 4P5DA 5K8CA 2BI7A 3PI7A 2DYKA 4J0GA 4HFNA 1CZNA 1J00A 2YJ4A 4DSZA 3D6TB 1XNGA 1QGUA 5I7EA 4OM8A 1D1PA 3GIDA 3W6OA 3HMQA 3GP8A 2H59A 3C6BA 1PGNA 2F48A 2R8XA 3MBIA 4HDCA 1N8NA 3DPIA 3AB3A 4XCQA 4M9QA 3SHOA 1FU4A 4M0UA 3D7MA 5DGTA 3K30A 3GRVA 4HPWA 5D6OA 4KQ2A 2I22A 1C1DB 5FD8A 2BBOA 1V6CA 5NLLA 5KOJA 3TSWA 1RWBA 3UCXA 1NSFA 2XKJE 1RI2A 2O7QA 1J24A 1J90A 1XVTA 3SXUB 2ZJ0A 3TOSA 2ZULA 3EIXA 1SHJA 3CBQA 3S7TA 4QRHA 1PG5A 4MAMA 4DJAA 2FW1A 3GR6A 3HQ4O 1EFRA 5LC1A 1RWOA 2OQRA 1KZ4A 3A6JA 2ON6A 4WLNA 3CNNA 3AHEA 1ZW6A 4XPZA 4E12A 3TUIC 1HYEA 5FBZA 5CPBA 4IUDS 1QSGA 4AJ4A 5B2FA 1GGJA 2X13A 1X74A 3EH2A 3IQEA 3SX0A 2A9FA 1PK7A 1OXMA 1RLMA 3ZHOA 1QQAA 2XSZD 2ZJ8A 3SHTA 3DUFA 1L4UA 2I7VA 2JEOA 4F11A 3AI7A 4FW8A 2PUDA 3CW8X 3IAFA 4CM6A 5B12A 3SX4A 1XTZA 2ZRJA 1J06A 1ISPA 5A4DA 3TIFA 1GAQA 5F7OA 2PKEA 4MAFA 3M6MD 1KF0A 1WOYA 1YHZA 4KXUA 4R4JA 5I9LA 4S1OA 3KXKA 2W93A 1EG2A 3CLKA 4A36A 1Z2AA 1DMSA 3V9AA 3ZWMA 2FI1A 4A82A 2NZJA 4UUMA 3BT7A 3SKXA 1E61A 1L7EA 4FB4A 3NETA 1JN0A 3Q5EA 4RH1A 4BMVA 5A7GA 3FKJA 4C7OB 3LZ6A 4LISA 4IIJA 4P58A 3D8RA 2M1ZA 4ZQCB 1MG0A 5PNTA 4C0WA 4GWLA 3PR2B 3IXQA 5E3JA 1BCSB 3BXPA 1E1QD 4Y0VA 5E1BA 3VI4B 1P3Y1 3LUJA 3ZHUA 2QTRA 3ZGLA 1NQWA 2ZB2A 3IA7A 2G09A 3D8NA 4J90A 4DZTA 3ZH2A 4FE4A 5E4JA 1ULZA 2CXOA 4HBGA 3CH7A 1YRQA 3F98A 3JQGB 3O31A 4P4SA 4UDOA 2R6ZA 3OCZA 5AW6A 2NG1A 1P5FA 4DMHA 2YICA 1JVBA 1JALA 2QSZA 3LW8A 2DLDA 5T64A 4EB6B 1N78A 1OLSB 5CTJA 5EGNA 2EHDA 5JYDA 1K27A 3HKBA 1CUUA 2B2NA 1CT9A 4O0LA 4RF3A 3RABA 1A5SB 4TTIA 4PIVA 4X8OA 1HNWB 1YR7A 4WECA 5GV8A 3K1AB 5CURA 2Q2NA 3R40A 1GLNA 2PR7A 1RCFA 1NUUA 1XX6A 3DEIA 1H23A 3O91A 4R1TA 1CKEA 2HWKA 4UVIA 3RUHA 1QOQB 1P9RA 3IKMB 3RSCA 3ZGVA 4BJHB 2DRIA 4BIIA 3OTIA 1NRXA 3U49A 3IQWA 4IX9A 3IOCA 1I2MA 4N39A 1FTNA 3T7DA 3VUEA 1CFZA 4RDCA 5E8RA 2VRCD 3JASA 4TMYA 1ISHA 2FSIA 1GG5A 1PQYA 3RD5A 4BCCA 1M66A 3K16A 3K6JA 4MKGA 2XYVA 1YE8A 2LPMA 3KOOA 3L1UA 2BFEB 3CX7A 1DZIA 3GLHB 4RPGA 3RWOA 4RCVA 2I55A 3KEQA 3AXSA 1KARA 4H1HA 4I9UA 2EFEB 1XLUA 3WKCA 4G5XA 1NFQA 3RH0A 1G7TA 1XL0A 1CBUA 1TU3A 2A1TS 3KQQA 3ONDA 3QKIA 4FFBB 3PNBA 1R8JA 2XR1A 1JZTA 2XY4A 3VNAA 5JSYA 2HH9A 4B46A 1VHLA 2PUFA 2UZ3A 3TW8B 5CG2A 2PJRA 3LU1A 4XYGA 4A8JA 1TXGA 1DRVA 1WMEA 2HNBA 4Z7OB 5J5AA 4QYIA 3DEHA 5J43A 2WQ7A 4XTRA 1R27A 1XHEA 3K6SA 1BFUA 1UK6A 4Z8YA 2XVZA 1IE3A 3TW0A 4Q7QA 1K75A 1R5OA 3LKVA 3UF0A 1HBJA 3SZOA 1UF9A 1Z7EA 3ZUGA 1DCMA 1KFBB 3FOCA 1PZNA 5AOBA 3VSCA 4BFWA 3P9CA 3GPIA 4LQ4A 1NA5A 2ODPA 2P3SA 1D2NA 4IKPA 1SIUA 1WL8A 1YE3A 5EUCA 4URZR 1RW4A 4EKNB 2NP6A 3ESXA 1KK0A 2VP6A 5A06A 3CJQA 5H02A 4KDEA 1G59A 2AC2A 1TQ8A 1FXWF 2QN9A 3ML1A 5HTKA 4FFMA 4PIMA 5KOHA 1G42A 4CMAA 4IUCS 1YZLA 4HQNA 5DXAA 1P81A 2E6UX 2MR5A 4MDFA 1EVJA 5DDIP 3TLAA 4UNRA 2ZE6A 3OMWA 4ETIA 4F7WA 1D2CA 4BQFA 3U09A 4B82A 5CCEA 5CVJA 4D1YA 2IP2A 1T2EA 2AOUA 3GO4A 2QR3A 1IEQA 3QENA 2B8WA 3KKQA 3L4BA 3HDVA 1BQ4A 2WJHA 4JU9A 3JVDA 2HA3A 4C3OB 3FYUC 2FDRA 2DGDA 4C6HA 4TYQA 2IZ7A 3QPAA 4KU4A 4M9UA 3K9NA 4ZRMA 4B9AA 5CLFA 2WJ6A 3IQZA 2XUGA 3TCKA 1LPBB 2GJSA 4OQPA 5F3RA 1A72A 1N2BA 5D7NA 4FHDA 3FOZA 4F2GA 5LA6B 4YH1A 4EFKA 5IFKA 4JI0B 3NM5A 3R41A 4AJJA 4YAKA 2X1VA 3CRMA 3RTCA 2VJLA 1S7CA 4AZWA 2J5BA 3JY6A 1UADA 2C9BA 3KJIA 4UD2A 1XEFA 2FWBA 1VMIA 1MZVA 1C2TA 4HQ6A 4IUBS 4ALKA 1YUMA 3THOA 5DSTA 4BV8A 4FGSA 4HQ0A 3CR8A 3RKUA 4R7GA 5JVDA 1J0XO 4LOHA 4KIGA 3OKAA 5MGBA 1W36B 2GCIA 4NPCA 4GPTA 3MQ2A 3SYNA 5CDGA 2P4SA 2FP3A 3E3OA 1YRWA 4WBNB 3FDZB 5DBFA 2GXAA 1KKMA 1ZM4A 1VG1A 3JR3A 1SO8A 1EM6A 2PXHA 3BBPA 3LC0A 4LZJA 5JU6A 4KUEA 2NXWA 1JTFA 4TLCA 2EL9A 1H2AS 1M2WA 1TMKA 4OUDB 1NOJA 4NMHA 4IV8A 3MWGA 3ICOA 4BMNA 1FMFA 2JIZD 1Q3KA 4J6FA 2PQ6A 4I9NA 1AVTA 1W30A 5BUCA 1AGXA 2GK4A 1Z0JA 3U6BA 5BORA 2O7VA 4KDCA 3CEPB 1DIBA 2WAOA 1L7VC 2H52A 2NN3C 3CIOA 4KR2A 2B2CA 1ZCFA 3OLYA 2AOXA 2A9OA 1S2NA 2DPHA 2R65A 2AMYA 2VHZA 2ZJ6A 3BMQA 3F5FA 1EWRA 3PQ6A 1OU4A 5AVKA 4O4LB 1L5KA 5LSAA 4K6CA 3PCTA 2RGUA 3MQFA 1THTA 4R0NA 4CDRA 2PBFA 1E7MA 1OR8A 3H2KA 3MWLA 4YYZA 3I62A 1QIIA 1KYYA 4L15A 2O0LA 2OP1A 3EGWA 3N2YA 2QW1A 4YCCA 3OZTA 1DG3A 4JJAA 3GOQA 3GGDA 2IYVA 1M1UA 4EUFA 1BNCA 2NTYC 3FVRA 4P81A 3G0BA 1VXOA 1OASA 3BDIA 4GI7A 4P22A 1E8NA 3B3AA 3DMHA 3KWMA 1R0LA 4LHZA 4MARA 5SZIA 4DIMA 1YXMA 2QTNA 3JVUA 4HKTA 1A9TA 5KHAA 2YY6A 4LK3A 3SOPA 4DS3A 2V6JA 2E18A 5BO5A 2V98A 1CE8A 1KAMA 3DC7A 1F2TB 2JA1A 2WOJA 3AF4A 2GD6A 3LYLA 4R9UC 3ZHTA 2Z1DA 3N2IA 1GAJA 2AE1A 1GL3A 1W47A 3DEKA 3H2ZA 2ZOSA 1QDEA 3JYOA 2P67A 1E2MA 4XX1A 3R74A 3TE6A 4BV9A 4YAUA 4FC7A 1C9MA 4Z4IA 1XXHB 4OLAA 4TQUS 1H1TA 1VYTA 1AKTA 2WV7A 1VKOA 3QKRA 4F06A 2W6MA 3ST7A 1QG6A 4LTDA 2QJOA 2ATCA 1EA5A 2W2QA 2HQSA 3A36A 3QX9A 4NE2A 3SIXA 5C7YA 4RH3A 3SM3A 3RLFA 4KNVA 1FLNA 1K8RA 1OIXA 3NHMA 4TRNA 4BLPA 2NUPB 3IOYA 4PSCA 1U9YA 5I8WA 3IIKA 1GRQA 4PLWA 4FI3F 2DTEA 1LDYA 1IU9A 1N1EA 2GZAA 2O0MA 3A32A 4MWTA 4PQEA 3NYIA 1T9CA 5A62A 4YAEA 2QXTA 3U7QA 4D98A 1PGQA 1ADCA 4DV5B 5LMNB 1KBOA 1UOEA 4G9GA 2OSBA 3A4TA 4X84A 2QQGA 3INTA 1BJRE 2P79A 3H9QA 4FTWA 5CYPA 1H8HD 1Z3IX 4GXRA 3ICVA 2MMCA 5BQFA 3WMFA 3ETJA 1GRRA 1N92A 1ZUIA 2QL7A 3L8GA 4RUKA 5FWAA 3OF5A 4S2UA 3BD8A 4EQ6A 2E6KA 3VUFA 3I6IA 1RRGA 1ONNA 1DIRA 1TTTA 1OFUX 4IIGA 3A8TA 1L4LA 2WE7A 5TQ2B 3ZHYA 5LQAA 5G53C 4RD2A 3FUCA 1BFKA 3DVSX 1J97A 4YO7A 4QPZA 5H83A 2XVAA 2DWOA 3CRVA 5BMVB 2GCOB 2UUOA 4MRNA 4J94A 2DERA 5TV2A 4CDMA 1QUFA 4GOOD 3O8NA 4MI3A 4XB1A 1YDMA 3SHFA 4PG8A 3C3EA 4I5FA 1V8PA 2I71A 3TLXA 3CZ5A 2AV6A 1YZTA 3EXAA 2XMSA 4PRLA 1M72A 4QFCA 4C4XA 3TTTA 1OSNA 4GXQA 4ZJYA 3WOHA 1U4OA 4IIDA 3R8FA 1QB8A 5EFZA 2RC6A 3CVJA 5JPDA 1IJKA 5LU8A 3ZY2A 3D3JA 1D2HA 2Q4RA 3QBVA 4O8ZA 3MCWA 2B8EA 2ZBQA 3KJEA 1PQUA 4UEJA 3VR4A 2JHFA 3JVEA 2QX4A 4UNSA 4NXMB 1XIVA 4AJ1A 2RH8A 2ZSIA 3T9CA 2VAPA 4CYMA 5BUQA 1QRUA 2DTDA 1DDOA 1WDWB 4HWSA 5ADVA 5AHRA 4C4AA 4W9NA 1I32A 5AW8A 1YS6A 1MFZA 1YNOA 3MHPA 5DV9A 4UOEA 3GJ5A 4WSOA 1GWNA 2EJWA 1TM4E 3CWQA 2EDCA 2GQ0A 3KLNA 1CC1S 2I65A 3L7MA 3PQ4A 1DIGA 2VPZA 1PS8A 1V5GA 2HEIA 1KO1A 3U4MA 3OWXA 1GA4A 1SC9A 4CMGA 4OMCA 5JIBA 1VE3A 1ENZA 1X19A 1M8FA 1TEXA 1A9XB 2AOWA 2H7YA 3IVMA 4DR4B 1XDGA 1O03A 4PZ0A 1BS1A 1X8JA 3M4XA 3PFBA 2ZVJA 3EQZA 3F5QA 1PJRA 3OUTA 4GDFA 1BMFA 2VAVA 1T0IA 4MCJA 4B0OA 3BJZA 3EC7A 4BAGA 1Z63A 3UG7A 1Y9JA 3O8RA 3DFUA 1DT3A 1JVNA 3EFOA 3RKRA 4NF2A 1XDUA 2O3QA 4ZOCA 4UQPA 1DAIA 3ZD8A 4C30A 1WRBA 2PEYA 2IEGA 2ZI4A 3EOBI 3TAUA 1U2DC 1LA2A 4CT5A 3MCZA 4LOJA 5KNCD 1JG3A 2AHOA 2BMVA 3JQAD 4IH9A 1TZKA 5M04A 1IOVA 1J8DA 2G80A 3QOFA 3AK4A 3N9IA 3DR3A 3WIDA 1CY4A 1DQPA 1LLUA 1X80B 3BL5A 3BA6A 4BX0A 3R77A 4H7KA 3EZLA 3KB8A 4OAQA 2Q5JA 2FWNA 1TQ2A 1V39A 3BF7A 3QFTA 4II3A 4KO8A 4CKXA 1Q0RA 2ZIZA 3DDSA 2AI2A 4I3FA 4TXNA 3HB9A 5T6BA 3TQFA 4O2BB 4J6EA 2OUKA 5EYPB 3KSMA 4F91B 5I7UA 4RKEA 3NNSA 1KZHA 2IH2A 3BWMA 3TEMA 2VSFA 1E2UA 4KKXB 1BO6A 3PE3A 1FBNA 2JI6A 2FCRA 4HVTA 4RK1A 3W5HA 3Q7QA 2IDZA 3PNPA 5LZ9A 2NQ2C 3SLGA 3OOJA 5TQJA 2VG8A 4BLRA 3ZWXA 2OBFA 1T1SA 4L3OA 2XF2A 3IEUA 2WHYA 1XF1A 3ISTA 2CYAA 4PLZA 3RC1A 1YUBA 1Z0SA 1ZXLA 3LBHA 4L3WA 5G3YA 3TNYA 1AMNA 4YXWD 1DQSA 3LDUA 4B7AA 4CI0B 3K9HA 5K3SA 4X6UA 2CSUA 2WP0A 1E9SA 3FZQA 4Q4DA 1TPYA 1S2DA 2EWWA 3TFOA 2ZSUA 4NBNA 1RVV1 3UYLA 3DZKA 4A0HA 2P68A 3TH5A 2D2VA 5JY6A 2B6HA 5F2EA 1HK7A 1UJBA 2FB9A 2G40A 2I29A 3A1WA 4HAZA 4Z9BA 1U7ZA 5CA0A 3I76A 3A1SA 3HY6A 3M82A 2Y67A 2I4LA 4B2PA 1YS4A 2J9YB 1XU9A 5I7RA 3JQBC 3V1MA 3NORA 1RKUA 2UYYA 5CPFA 4WZBB 5IUKC 4YRDA 4YUVA 2ZYVX 5IYZA 3U7HB 2NM0A 4U7WA 2V7GA 4TLAA 5TRTA 4INAA 1XJ5A 3GEEA 3TRKA 4E13A 2V7EA 1ODSA 1IY9A 3U3DA 4K3VA 4Y8VA 4J3FA 2Q1YA 5ALPA 1KEVA 4YRMA 3TBKA 3WNVA 1XKTA 1TL7C 1FDUA 3BSWA 3D6UA 3EXG1 4DLZA 1W581 4OQ4A 3U56A 4MP8A 2C3MA 1YB7A 2TECE 3WMWA 2UYCA 3PKJA 4MW1A 5JS2A 1YBHA 4RF5A 3V8VA 2Q27A 1LI5A 5DT9A 5JYBA 4HNQA 1XTQA 3JXEA 4KR6A 3QKUA 1CRWG 4Q18A 4ZAXA 5L7YA 3TIIA 4E2ZA 1Z6XA 1Z9BA 1HI9A 4DIUA 4E1BA 4HVAA 1W73A 5IPFA 1MOSA 3SVTA 2J6BA 4MUIA 4DCOA 1CP3A 5GIOE 1PGJA 1AV6A 1RCTE 3B53X 3BHNA 3SQDA 2BAGA 3O1LA 1XB2A 2A0KA 3TAHA 2FW8A 3ADPA 3DVAB 2XWSA 1MH9A 2K7ZA 2UVQA 1VIAA 5FNVF 3ZI7A 1JE1A 3A3PA 3VJLA 5AW0A 5JISA 4L9WA 4BMOB 2NXCA 2EKDA 3DLPX 1RAFA 1LRLA 2JKYA 5I8ZA 4ER7A 4GYKA 1H3FA 5EJ6A 1X2EA 3K0KA 4ZAWA 5GJVC 1B15A 4UNPA 1KO4A 4EEKA 3LIIA 1GUBA 2UV8A 3HJGA 3EHEA 4K88A 4X7BA 4WGFA 3LDAA 3GLRA 1IN4A 1CUFA 3M1LA 3RYIB 1GRVA 3MUOA 2AUMA 4JVSB 4R5MA 3CF6R 1C4KA 3T7RA 3ZXSA 4H18A 2WU8A 1RMTA 4N5IX 3RK0A 1ABBA 4C76A 1ISMA 5JSUA 3ANYB 2VUTA 1RYFA 1CJCA 3BOSA 5CYGA 2UZAA 3A06A 1O95A 3E82A 4PBRA 5D51S 3S5JA 2XMPA 3LC1O 4A8JB 2QYOA 3HPRA 4JLNA 3ZX5A 2BKXA 5H70A 6Q21A 4V2UA 4ZCPA 2HNAA 1H0KA 3PJDA 5JRDS 4O4HF 4NZZA 3DMTC 3TSYA 2OGTA 1EUZA 4D3YA 1NQTA 2WUEA 4GLBA 1FNMA 3RVSA 3R5HA 2TMDA 2RGEA 4Y9TA 1BEUB 4D4HA 1W0JD 3WV5A 1PJ3A 1XMIA 1VBFA 4B7CA 3LT1A 4KR7A 1X1QA 3MMXA 2ZI6A 3AFOA 3NYRA 3P2YA 3G6KA 4KXXA 5TMPA 2P4HX 3A4NA 1ID1A 2RKBA 3LBNA 5KNDA 2JGDB 4K9OA 4I8DA 1X9HA 3U7RA 4ISCA 3BB1A 4Y2GA 1VL1A 2YKGA 3VC3A 4H16A 2P27A 2PX2A 2VYFA 1DIOB 3LDGA 4M83A 2QY6A 2VNSA 2YQ4A 3DUFB 1EP9A 4K05A 3FCAA 1CJBA 4KWHA 3ZS8A 2JLCA 2Z6QA 4CEJB 1L5LA 1YV9A 2QORA 1KSGA 3ETCA 1OV4A 1FNSA 1Q14A 1BD3A 1RS0A 2BF4A 2PJUA 3D8HA 1DT5A 3HCAA 4FR5A 5F23A 3MS7A 1E0KA 1IHOA 2F6RA 3ACDA 1NHWA 2W2MA 3HE3A 4IIHA 2L69A 3HKBB 4AQ7A 1Q84A 2J9ZB 3PSAA 3MSXA 1QRSA 4EA8A 2PH1A 1T4GA 5AVZA 3I04M 1X1SA 1VPVA 3BGSA 4L08A 2NYVA 2QM8A 3GFGA 1U2RA 2QS9A 4MMYB 2K7FA 1U5BA 3R7LA 3V4FA 2ZQ5A 5AT1A 4AYXA 5IT5A 4KSBA 1RJGA 2NO7A 2F3QA 1EVLA 1S5PA 2QNBA 2YRWA 3OP1A 1VLQA 4RY0A 2CDAA 2VHQA 1T25A 4I08A 4QICA 1AQNA 1CRZA 3JWHA 4OK3A 2JFNA 1GGMA 3ITNA 3N59A 3AYXB 4DJ5X 1KXZA 3GEPA 4LJ5A 1HH4A 4UQOA 5G4LA 2RGNC 2XEXA 1P75A 4HR7A 1L4GA 1ML4A 3TR6A 4I1IA 1YDHA 4QPCA 3JYPA 3CZ9A 3PQ5A 1UKAA 5H59A 2I2BA 3RVOA 3ZWNA 4PM4A 5A3JA 4YIHA 1C50A 4PR0A 3NAQA 1N6IA 2WMNB 1OI4A 1ZK3A 1MA3A 2A94A 1ZC3A 1ZEMA 2ZANA 1HYGA 1QFZA 2WINI 3LC7O 4LIPD 4WFQA 4XIIA 5EE1A 5AW1A 5K99A 1Z6QA 1AMUA 2H92A 5TR9A 2H3HA 1H0RA 4IIUA 4R8MA 1XCLA 2IHUA 2HTFA 2C54A 4PNZA 2E55A 4U2EA 3IUNA 1HETA 3DAOA 2G0NA 2XNDD 3GPCA 1Y7IA 3TZ6A 5FWXB 1E69A 3BKWA 5KYGA 3OKCA 4R1SA 1NPYA 1ZN9A 4WK4B 1M7HA 1S02A 4B74A 1AUXA 1C9JA 3NAGA 1FNNA 4UFOA 4OQDA 3I6QA 4MVJD 4F1KA 3TM5A 2OXCA 3BFJA 3LECA 4DL9A 3ET5A 1E2EA 2P9HA 1D7AA 2ZI5A 3FGPA 4JH0A 3TNDA 4X6YA 4BXOB 2BMJA 4OK5A 3IMCA 3ROEA 2QMEA 4DBLC 1NOKA 4BGIA 4LXYA 2BHRA 1ONBA 3CVOA 1PIWA 4OFWA 3GG2A 3WDMA 1R66A 5DVZA 3JRXA 1J23A 2WNSA 3GX1A 3Q7EA 3SJZA 3ORQA 1X7ZB 2EC5A 1G5QA 2RBKA 4JP8A 3G2MA 5FHRA 3G2NA 5KC8A 3BQ9A 4NU6A 2QX8A 2O8EA 1AN0A 3V55A 3WK8A 3WLIA 3ZLBA 1QCZA 5JXWA 1UKBA 1E99A 1HDGO 3IT0A 2ATEA 4Y98A 2ZIXB 3QU2A 1HNNA 3HK2A 2N9UA 1RT9A 1E0DA 4BE9A 5C7IO 2PGNA 3I9OA 2D3WA 1FDIA 3KB6A 4TZ6A 1S8AA 2JLYA 3R8CA 4UBOA 3H9EO 3N6VA 4JGIA 1VIYA 4N0MA 1E7SA 2BHSA 2FZLA 2Q5HA 2WMDA 3LC2O 1WUHS 2CJWB 3CNQS 3X1KA 1Z68A 5D00A 2A78A 2AB0A 2X9GA 2VQ6A 2A9QA 3DZBA 3KUKA 4FLMA 4UBIA 4XQ9A 2AEJA 5FA8A 1PV1A 4CEIB 2OXIA 2XCSB 3ZKAA 1LJUA 2GD0A 4EZBA 3PFFA 2HAEA 3PWSA 4NICA 3WICA 3HJTA 4TKLA 5DGDA 1D5CA 3UJ8A 1SBTA 4G2NA 5ELLA 4YHBA 1EB8A 1RJEA 3KOXA 3PT5A 5ENVA 4ZHQA 3PWTA 4I9FA 2W0MA 2E37A 2FEPA 3KV1A 2GFIA 4K9SA 1E1LA 2OCGA 3MBOA 2QRPA 2HX1A 4WN9A 4BRWA 4INPA 2ECQA 4L95C 4WMLA 2CVHA 4L0DA 3R0ZA 2A7XA 4H59A 4ZEMA 3HP4A 3GFOA 3HCOA 1CUIA 4R1NA 4PGHA 1SFRA 1Z47A 3OQBA 3FUUA 2OKGA 2DQ4A 2ZBEA 2BMWA 4DLYA 5L51A 1FB5A 2QLTA 1QG2A 3K09C 3V32A 4KTVE 3S29A 1GDTA 3MD9A 1WZEA 3AR9A 3C5EA 1B93A 1OFIA 1BYUA 2A5DA 3MOSA 4G0XA 3TIXB 4DSTA 2IS2A 3S2EA 1YL7A 1ZRHA 4NYJQ 4HEQA 3UN1A 4RPKA 2DR2A 3IX7A 4V0OA 5F7ZA 3TE7A 1C4WA 1KVTA 1VJTA 1W4CA 1OWLA 2JARA 2QLJA 2JAXA 2QMUA 2ZJZA 5D3QA 5THXA 3KQMA 2QRJA 3ZYZA 3T1HB 2OOKA 3DV9A 1M2GA 4ZCRA 4J1QA 3EXG2 1V7ZA 3NTUA 1GZ3A 2H4XA 2JI9A 4ARZA 4OHOA 1VL8A 4GT1A 3CCCA 2UYHA 4BJ1A 3PGA1 1A9PA 4M1YA 1HFEL 5E9WA 5TMDA 1A9OA 3QNWA 4GVPA 2HLPA 2WSYB 1N0WA 3O9VA 5ED0A 3UT6A 4EO9A 3EPHA 3JQDA 1ML3A 1ITZA 4F72A 2ILVA 3MIZA 5JPIA 1N1GA 1HZZA 2YHUA 3TLGA 2V5VA 2HRZA 1ECGA 3PXUA 3VSBA 4B5KA 3O74A 5KI6A 4H6PA 4ZI7A 5CIYA 2H85A 4BNFA 3MLEA 4B35A 4BMXA 1MT0A 2NVUB 2LIVA 2AZTA 1E0JA 2KW5A 3QPBA 4RZUA 1EJ0A 4V03A 2G8LA 3INGA 3V5NA 1TM5E 3MK31 4CWAA 1ZWKA 2K4MA 1T2CA 1OLXB 2DJIA 2X5OA 3PX2A 5T3UA 1II8B 5IXSA 5CJPA 2DWCA 3C8MA 3E7DA 3LGAA 4NOLA 1T24A 1DAFA 3H2SA 2F8TA 3AFMA 2BMEA 1D9XA 2VRNA 2GM3A 3OX3A 4XEHA 1NZFA 3JX9A 1NLMA 4B4KA 3DV0B 4R68A 3M5PA 4RSRA 3FPEA 1YS2X 1MAAA 1WUYA 2WJWA 3BPSA 4G5OA 3WMEA 2WA1A 3V1NA 5B1IA 5EP1A 4TMWA 5TT1A 3PNVA 2GETA 2O07A 2R48A 2X2OA 4E88A 3ZGZA 1JILA 2W98A 5CNIA 1Z18A 1GA1A 4IXMA 3M89A 4ESHA 1Z15A 1CUZA 2FPXA 1PT5A 4HX9A 4DDKA 4G1VA 5C32A 3WLFA 4JQSA 3R2JA 4IIEA 5LA6F 4FJ0A 5ENZA 4W1RA 3ZBTA 3KQSA 2JFUA 1RXIA 1WNTA 5F78A 1OBFO 8OHMA 3IR5A 5H82A 2GZ1A 5EAIA 4TSKA 1K06A 4MA4A 3CLHA 1EXNA 3FWYA 3UPUA 3VAYA 3D7KA 4G0YA 4C05A 3ND5A 5K8JB 1M2VB 4HGOA 3MA0A 4N5NA 2WT9A 2RDMA 3ZS9A 3SYRA 1HC7A 1XCGB 2A33A 1TM1E 1WXWA 3E03A 4ONEA 5CK5A 4W8HA 4A6PA 1N5JA 2GPYA 3EF0A 1SUCA 1NLZA 3F7TA 4CMJA 1VKJA 3NV7A 2YMQA 3L4BC 3UK7A 1N9KA 2YXEA 1QDUA 3NJRA 3KZCA 3A1NA 1LLFA 1QOZA 3HR4A 4MMZB 3P19A 5B6IA 3ZY3A 4MUGA 4DV6B 4YRZA 1WCYA 2ZR7A 1LPNA 1RYBA 1T1RA 2CMFA 2H48A 3RIGA 4MVJA 3A37A 1HNZB 4OXRA 4TV9B 2EYQA 3DT6A 5JW6A 1DKMA 1UXKA 3KZXA 2HO5A 3KU4A 3T1TA 4DR5B 5C1DA 5D3ZA 1B8UA 2B8TA 3E35A 4YMSA 3GJQA 4TSFA 5EJGA 2WTAA 5CLHA 5DGCA 2PK3A 1QP0A 3IDZA 3P94A 1ZJYA 3LAWA 3KTFA 3NV9A 5E6UA 3ROQA 3VDQA 5AUNB 4Y6SA 4ZN6A 1Q2XA 2LP4Y 1WU8A 2OXRA 3K8ZA 5EERA 4EMUA 4R1PA 2CVZA 3C3MA 2HMAA 1M6YA 3U0VA 1NVFA 1BQ3A 4FZRA 3UUGA 4FBMA 3WDSA 1CRPA 1EFKA 2J0UB 3UGQA 1AKRA 1L8AA 1ZLYA 2Q6VA 3RJTA 1P1RA 2F9FA 3KEMA 4D41A 1DO0A 1ULTA 4NCJA 4AU1A 3VYTB 4W5NA 3DYIA 3UJAA 1ZMOA 3VHXB 5L7WA 3R6GA 4MGYR 3QBEA 1D1TA 1DBIA 1OFHA 1U5AA 1MORA 5A9SA 1YR2A 2IP1A 1KAEA 2PSSA 2FE1A 3KQLA 1Z08A 5TDHA 4N3NA 4J75A 5I5EA 4HDQB 3HYTA 2QJTA 1FTWA 1OAKA 2H65A 2QW8A 3KNZA 4DLSA 1KO5A 1NVBA 2HBQA 2RHJA 2GB4A 1N57A 1OJLA 4NBVA 3V9PA 2P5UA 3DLCA 1PFUA 5C8ZA 3S2YA 3RC3A 1EUDA 2PNFA 3MXTA 4BMZA 3FOFC 4FFVA 2IC5A 2WKSA 3UXMA 1V3UA 3AT1A 1DTSA