3TO5A

High resolution structure of chey3 from vibrio cholerae
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
LNKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
molecule keywords CheY homolog
total genus 40
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3to5A00
4QYMA 3CLKA 1ISSA 1EHCA 2QR3A 2R47A 1F4VA 1JFVA 2I6FA 1DBPA 3FDFA 4KNYA 3CU5A 1ZN2A 3RVSA 1YVUA 3M9WA 3JVDA 4N47A 3MYYA 3OO1A 4RXTA 2VUIB 1QQBA 4N03A 1M2EA 2FMHA 4IMJB 2WMYA 3EULA 4YWHA 3F6CA 4EVRA 1EWVA 1YS7A 3KS9A 3T6KA 3EJWA 3GL9A 2PL1A 5ED4A 1USGA 3SAJA 1YMVA 3LMKA 2F8SA 3DLBA 5GQSA 1CEYA 2PUEA 3KLNA 4ZMRA 1JLKA 1K68A 4KVFA 4EVQA 1QNLA 1QP7A 3IPCA 5CHYA 3HCWA 2P9HA 3EDCA 3NHMA 3Q9SA 1MVOA 5IEJA 1DCFA 3A0RB 1DRJA 2VYCA 4RKRA 3SM9A 1QP4A 2PLNA 1MB0A 3A3KA 3L6UA 5KC9A 5IX8A 1F51E 5EWMB 4ETIA 2JVIA 5IC5A 3Q7TA 2JK1A 3MMNA 1ABFA 1NXVA 1YK1A 4RSMA 3KCNA 4EYGA 1RPJA 4IF4A 3A10A 5FWYA 4KMRA 3KSMA 2PUCA 4LZLA 3O1IC 4P98A 4Q6WA 2A9OA 4HNQA 4MR9A 2LIVA 3IP9A 3KJXA 3TD9A 3G85A 1GCAA 2IOYA 2Q5CA 1ABEA 1DP4A 3NNDA 3EQ2A 3RVRA 4RK6A 1FSPA 1M5UA 2E4XA 2ID9A 3H6GA 3H1EA 3HSYA 5EWJA 3OLXA 1DZ3A 4RK7A 3GA5A 4WT7A 1AB6A 2HQBA 2QSJA 2LPMA 3KTOA 2V0NA 4OATA 1DC7A 4DN6A 1BVHA 1A2OA 2PKXA 1QO0D 4IGAA 3RVOA 4EYOA 2AYZA 3DGFC 3O2SB 2PE5A 1USKA 4ML3A 3EGCA 1JDNA 2WJAA 4ZYLA 2LBPA 1ZESA 3FGZA 5CNMA 3UK0A 1JHZA 3M9XA 3UKJA 5TQ2B 3CZ5A 3O21A 3KYIB 2FKAA 4RY0A 5KC8A 4JB0A 4LE1A 3HUUA 1JL3A 3RH0A 4XASA 4MQEA 2OENG 3RQIA 1DBWA 4LDAA 2WY2D 1BA2A 3NBMA 3CTPA 1JDPA 1USIA 3HUTA 5T3YA 3E61A 1M5TA 2KYRA 2E4WA 2PMCA 3LUCA 5F64A 3OLYA 5GOTA 1JWLA 2F8TA 1D1PA 4HNSA 2FEWB 1D5WA 3T95A 2IYNA 5HKOA 4D6YA 3RVJA 1PEAA 4WUTA 1UDRA 4F12A 4RZSA 3B2NA 5IUJC 3G1WA 2YHBA 3HK2A 3URMA 3OM1A 2M98A 4XFKA 2RGYA 1OXBB 3O74A 2X7XA 1BDJA 1R8JA 3N8IA 3T8YA 3H5WA 1A04A 4E7PA 3FMVA 3H5IA 3HDVA 3LKBA 3O2JA 4Z4CA 2B4AA 5KQMA 1E6KA 4EVSA 4MRMA 5EWLA 2W42A 1YIOA 2CHEA 4EGSA 5JNTA 2NZVG 3CNBA 1ZY2A 3L49A 4MR9B 3MIZA 5TPWB 1BDIA 5CNKA 3F6PA 3I09A 4OLAA 3GBPA 1QQAA 1LJUA 2QZJA 3N0RA 3SQNA 1QKKA 5HM6A 3QLTA 3MM4A 4QICA 4W5NA 3CZCA 1FFGA 2P4UA 4QYWA 3BBLA 3LTEA 3ILYA 1SXGA 5TQJA 4EY3A 4KRFA 2MYNA 4MR7A 3LUAA 4IILA 2JCGA 1Z15A 3HEBA 3DZDA 3Q7SA 3O2QB 4MAAA 4N0QA 1RXIA 4LE2A 4D6XA 1ZH4A 2CHFA 2FQWA 4D74A 5I4CA 1JFSA 1J56A 2PUDA 1GUBA 4PZ0A 3H5LA 1VLZA 3CHYA 3NNSA 4L85A 2A9QA 4KFCA 3LUGA 4KZKA 4ZPJA 1YS6A 4LE0A 4FE4A 2PUBA 3GBVA 2IDMA 2L17A 1DC8A 4MQEB 5BRJA 1VPWA 2NT4A 3I5AA 1JF8A 3H1GA 1FQWA 7ABPA 1Z25A 2M1ZA 3IP7A 1FFSA 4Z4IA 5B3JC 2E4VA 4QPJC 3OQNA 2LP4Y 3BREA 4W5TA 1P6UA 2E4YA 4MR8A 4PEVA 4OLBA 4Z4HA 4JA2A 5ABPA 3CG4A 3JTEA 2CWDA 4H3HB 5FBHA 1Z13A 4FB4A 2HSGA 1U04A 2MYUA 4H3KB 4B09A 2HQRA 4XAQA 3C97A 3I45A 4XXHA 3K9CA 3D8UA 1BAPA 1D4ZA 4ETNA 3FFWA 3NNNA 2FMFA 3N53A 5TPZA 5IULC 1JYFA 3HJFA 4Y9TA 3H6HA 2RDMA 3JS5A 4O1HA 4TLLB 4KPYA 4TMYA 3QELB 3ROFA 4Z4GA 3N0XA 4GNRA 4G0PA 4EYKA 3HS3A 1MAVA 4KQCA 5BRAA 4YO7A 1Z2DA 2OQRA 1NXOA 3ROTA 3HXMA 1PNTA 4W5QA 1WETA 3I42A 2FEKA 2HJ9A 3DBIA 8ABPA 4OG2A 4WXMA 1C0EA 2HPHA 4W5RA 2VK2A 1S8NA 3QLUC 2QXYA 2FQXA 4W5OA 4YR7A 1C4WA 4ZJPA 5FWXA 2FXIA 1AB5A 3GWGA 2FSPA 2CD7A 4F8JA 1IIBA 1LBHA 1ZAYA 4G97A 3QEKA 5TE9A 1DRKA 2JRLA 1K66A 4N0PA 4MR8B 4S05A 1E2BA 3RVPA 4Z4FA 3GYBA 3CFYA 3BRQA 1PNRA 3QLUA 2FMIA 3FFXA 1TVMA 2LUOA 2DRIA 2GWRA 4IMIB 2GBPA 3N75A 1LK0A 3LUHA 4PE5B 1JYEA 4RS3A 4OTZA 3MA0A 4MR7B 4G0QA 5D2CA 3OMXA 5FBKA 2TMYA 2H3HA 3KKEA 3HV2A 4G0XA 1P8AA 4MS4A 2RJOA 1GUDA 2IPAB 5JNSA 2JBAB 4FE7A 4XARA 3QELA 2A9RA 1NXXA 1YK0A 1Z18A 4HYEA 2FLKA 1EFAA 3E3MA 2FW0A 1Z12A 3QEMB 5CNIA 4EUKA 4JP1A 3OLWA 3Q7RA 2FLWA 4YS6A 2J48A 5KQPA 1U2PA 2IPLA 3TO5A 3F73A 2FEPA 4MS3B 4MRMB 5EWLB 1EWTA 2QVCA 4O5AA 1RZRD 2FTKE 5TPWA 1M2FA 1Z17A 3N0WA 1D2AA 4F3TA 1JBEA 5KQGA 4P1ZA 3HO1A 1YTUA 2IKSA 2L2QA 5JNWA 4UHJA 1OXKB 1DG9A 4YV7A 3DLHA 3IDOA 3OM0A 5TQ0A 1NXPA 5FWXB 5KWSA 3P9YA 5BR1A 1B00A 1U8TA 3HM9A 4G0MA 4TLMB 3EAFA 3RVNA 4RU1A 4S04A 1APBA 4JB2A 4UHKA 4JASB 3H5TA 1MB3A 4YCSA 3OQMA 1L5ZA 4E7OA 5C5CA 4RDCA 4RK4A 5DLEA 5PNTA 1VRVA 1NATA 2JVJA 1W25A 5JS1A 2E4ZA 3ILHA 1TLFA 2AYXA 3QLVA 1EWKA 4N41A 6CHYA 4NCAA 1W9HA 3OQOA 1NTRA 2H0AA 4Z0NA 3Q41A 4KK4A 3BRSA 3GV0A 1KMIY 3C3KA 3KLOA 5TQ0B 4MLCA 1FFWA 4JAVC 1QMPA 4PYRA 3VNBA 5BQ3A 3RVLA 3QX8A 1YMUA 2ZWMA 4MS1B 4WXEA 1DBQA 2NUBA 2WJWA 5EWMA 2RJNA 3JY6A 2MYTA 4GPAA 4WZZA 3H5OA 1DCMA 1GLGA 3OLZA 1RZRA 1SXHA 1NXTA 1ZDMA 4KK3A 2L19A 3SNKA 2JBAA 2O20A 3CS3A 4MS1A 1ZH2A 4M88A 2R25B 1QP0A 3RVKA 3JVIA 4N76A 1LBIA 3EODA 4LDZA 4MGEA 1ISRA 5IUNC 4F11A 4YGXB 5DGCA 1MIHA 2PUAA 3LFTA 3HDGA 5DKFA 5B3JA 1XHEA 4MS3A 4Q6BA 2XDYA 4RK0A 4RK5A 4MYRA 2FQYA 1SXIA 3KG2A 6ABPA 3LUJA 3BILA 3LUDA 2NZUG 1ZGGA 4RXUA 4Z9AA 2VUHB 1SD5A 3T38A 9ABPA 2MSWA 3D02A 4L4UA 1KGSA 5T7BA 1EAYA 1NXWA 4Z4EA 1GCGA 4RK1A 4HNRA 1Z2EA 3CRNA 3RVMA 3TB6A 4IRXA 1ZGZA 3N6VA 3C3WA 4Q7EA 1BDHA 3A0UA 1HEYA 3CKMA 3W9SA 3KYJB 1T34A 3OMWA 1URPA 4MS4B 5FWYB 2QW1A 2YHAA 2IPNA 1Z16A 2MSLA 3MQ4A 5JNUA 2JB9A 1TJYA 5DCLA 5KQLA 2PJUA 4O1IA 4F06A 2QV0A 1KRWA 3UUGA 1CHNA 1NY5A 1P2FA 3HZHA 4TN5A 3CG0A 2GKGA 2JVKA 3LOPA 3M6MD 4RV5A 4EYQA 5HSGA 4NICA 5IEBA 5C5EA 1Z26A 3GRCA 4NCBA 1KRXA 1E6MA 1PHRA 5JNRA 4DQDA 5DTEA 1RXEA 2A9PA 3K4HA 3LUKA 2PUGA 4ZMSA 4NQRA 4H60A 3LKVA 1QPZA 3H75A 5IBQA 1H9CA 2BGGA 1P6QA 3OLVA 1PUXA 3DGEC 1TM2A 2R4QA 2N9UA 3R0JA 1TMYA 5E3JA 3JPYA 4JOQA 1U0SY 3IPAA 4NV3A 2GX6A 5JS2A 3GT7A 1JX6A 1A0OA 1LJLA 2E4UA 3IP5A 3TMYA 1DCKA 2L18A 3OO0A 4MQFA 5IUKC 3SG0A 3H5VA 4RKQA 4G86A 2FVYA 3C6QA 5JNVA 2FMKA 2MYPA 1DJMA 4YLEA 1L5YA 3HVRA 3FFTA 4G0ZA 1JFTA 4CBVA 2QVGA 4ETMA 4MLDA 4G0YA 3QK7A 4RWEA 3O1HB 1I3CA 2ID7A 5CNJA 3NHZA 1PEYA 1ZITA 3RVQA 4RY9A 1NXSA 3KHTA 3TX6A 4WWHA 4DADA 1U2QA 3S99A 1JH9A 2PL9A 2B1JA 3O1JC 1XHFA 4RXMA 4KV7A 1SRRA 1XWWA 4LX8A 2PAFA 2PUFA 4OBBA 3VNAA 1QO0A 1RNLA 2R48A 3MF4A 3QEMA 2QU7A 4MQFB 5TQ2A 1CYEA 2HQOA 4XLTA 4Z9BA 3LUFA 2GI4A 3C3MA 5TPZD 1D1QA 1E6LA 4YP9A 2WB4A 3H1FA 4Z99A 3SY8A 1ZHHA 4G0OA 2IPMA 1VKRA 4MPTA 1ZVVA 2MSKA 3IP6A 5HQJA 4KREA 3Q15C 3QX9A 3O75A 2WRZA 4RY8A 5KI6A 4LRQA 3QLVC 1Y1LA 4YRZA 2NT3A 4PICA 2WWVD 3EQZA 2FN8A 4KQ9A 3F7NA 5EWJB 3JPWA 2ZAYA 2FN9A
chains in the Genus database with same CATH superfamily
3E9NA 2PS9A 3PWTA 4QYMA 2I3DA 3RHTA 3NOXA 4ALKA 4YRLA 1YWGO 4X6LA 1YVUA 2OBYA 3M4NA 3TVYA 2O8FA 4IXNA 4E5KA 3ZKWB 1N5DA 2PSJA 4KYVA 5IT4A 1KYQA 2ZQYA 3DZKA 2I2DA 3OZRA 3WP1B 1Y1KE 3ORYA 4WN9B 4R71A 4YRSA 4IFTA 1J9GA 1P4SA 2VHUA 1CY7A 3F6CA 3LCUA 3FGNA 2FRDC 3Q88A 2B8NA 4IJ6A 1MMFB 4EF4A 5JANA 3ESQA 5I01A 1NYRA 5FWDA 4EGFA 5AK0A 4AJ2A 1UDAA 1KYZA 4KVFA 2ZS7A 1U3VA 4OUKX 3GI1A 1Y63A 1B15A 4O4IA 2DUWA 2D2VA 3SJCA 2F6RA 1CJUC 2FFAA 2J5QA 1W44A 4HQRA 5FWAA 3DL4A 3KZMA 1L5WA 3NKLA 3A0RB 1ULBA 1E60A 4XGKA 3ZYCA 3O8BA 3VDNB 1Y6RA 3VR6H 3HSSA 4UMVA 3X1KA 4A5SA 4E5MA 5A7FA 3EIOA 4GECA 3L06A 3Q7EA 1F51E 2P77A 3ABQB 1PSZA 2YVAA 3NXKA 2FPUA 3WGLA 1FS6A 1K4MA 1RZ3A 4EG6A 3I2JA 3ZVLA 3VZRA 3MUOA 4O25A 1IZ0A 4XJXA 3STUA 4QC2A 3M3PA 1LI7A 3EASA 2GVNA 4HNQA 3ACBA 2COEA 4G5SA 3GN1A 4PCVA 3JWIA 1Z2OX 1V4VA 1EP9A 2Q4RA 3W6ZA 2ZTUA 5AKHA 2FPIB 3LHKA 2GCOA 1CRZA 2IUTA 4W1PA 2IYLD 2ZRBA 2ZVJA 4GRDA 1W88A 1ZS9A 1ISPA 2YJTD 1UZAA 1ZR4A 2QSJA 1XFDA 2C2BA 5CDYA 3BXXA 4RF4A 1XWIA 4W6ZA 4DN6A 1ZEJA 1XMXA 3NHFA 1K7SN 2WYHA 1LH0A 4LY0A 4KXVA 5E3IA 2JHGA 1USKA 3ED5A 1E1CB 3AGQA 3GLGB 5ALNA 2V7VA 1FU4A 3OF3A 3JQGA 4I0WB 3WRYC 3EUWA 4ZU6X 3O8RA 3A6HA 2DOKA 2OEPA 2UZIR 2Z4RA 1GM5A 4JR0A 3DP9A 5B4UA 3R8XA 3K09C 3IOBA 1NVTA 1J21A 1M2NA 5I9IA 3QNWA 1PLKA 3ANMA 1IJKA 4OK5A 1TECE 1AS3A 1E1NA 1SGWA 2OB1A 1FVXA 2APJA 2REBA 4MQEA 4DIEA 2QTBA 3X1XA 4AI6A 4RGVA 3O4GA 3HUTA 1AURA 3A6LA 4HHEA 3KU4A 4I50A 5H3LA 5EHXA 2JLSA 1BWPA 1E7YA 2NZ8A 1NYLA 3QPCA 2JIZD 1JQ3A 4N5LA 3S44A 1D5WA 2C7GA 5JJLA 1LQTA 2DTEA 1YA4A 4RIIA 4CRWB 3JQFA 4GYJA 1P1RA 4DG8A 4F91B 2ZTSA 3RVJA 1UDRA 5JC1A 4YRTA 2ON6A 2CBXA 1CY0A 4GMFA 4OUDB 2X9VA 3HB5X 3AQIA 2E89A 3F6BX 1UPTA 4I3HA 2BFFB 2B61A 1Y5NA 2RH4A 1S96A 3H5WA 2FQQA 1I51A 2IW3A 1N2ZA 4E7PA 4P54A 1ZD4A 5HBGA 1LDMA 3D1VA 3ETDA 3HFSA 2V74B 4BLQA 3GVXA 4LF4B 1H85A 1T4GA 3TZLA 4EGSA 4CR6A 3CVXA 1DXHA 3GH3A 2AMJA 5ALFA 3AR9A 1E9EA 3GT0A 5JTUA 3USCS 3CZ4A 3DAYA 3HKDA 1PKEA 3R3HA 3HXPA 4MQLA 5K4GA 3WQRA 1XVAA 3WLQA 4BZXA 4CODB 3ASVA 3VKWA 4YAEA 2X13A 4ZT7A 1OMOA 1XJQA 4JLVA 1WV1A 4IIEA 2BHLA 3LW7A 1WXIA 4C7KA 4GUDA 1NPYA 4LZPA 4EY3A 1ZR2A 4ARIA 1LFDB 2GPTA 4IILA 2ODAA 1SCNE 1Z15A 4PPFA 3OQPA 3E7FA 1XRRA 1DKPA 1QK4A 3MWFA 1NN1A 1IQPA 4B43A 1FMTA 4G5GA 1G63A 4XGQA 4D9JA 4JC4A 4OP3A 5JPIA 4YCJA 5KU1A 1E1RA 5DBOA 3ANXA 1VLZA 2ZBEA 4JODA 5K3SA 2J7PA 3ZV3A 4YDSA 4R01A 2YQ4A 4UE2A 2QRKA 3O7WA 4YMIA 4EX6A 3W8FA 1EWYA 2SKDA 2GK4A 1NM5C 4H7KA 2Q2NA 4WMLA 1NBWB 2FW7A 2P27A 1KAOA 4EHDA 1G0NA 2IIVA 4WESA 2EW8A 1SWVA 4G4SO 1T5SA 4OQEA 2GEFA 2FSFA 3OTQA 4HRAA 5K3CA 1HUQA 4WNAB 5EE5B 4B6FA 3IEPA 2QMYA 5KZMB 2PJRA 3BMOB 1B76A 2QXUA 4XB6B 3DDHA 3ZZNA 7ABPA 2IL1A 2AD5A 5HIJA 3AI1A 3WADA 5B5SA 2R8OA 1FYFA 2XWJI 2H4YA 1QIDA 2GBLA 2P6PA 3PK0A 4K6FA 4NU0A 4QPJC 3N7AA 4XX0A 4JLKA 2IXBA 3ZEIA 1JDTA 2XZOA 3GFQA 4DCVA 4RNCA 5AR1A 2HA0A 3O84A 3KWMA 4ARSA 2MYUA 1Z8FA 1NKSA 4DIDA 2IH5A 1E5LA 1QLJA 4E32A 4Z9YA 1G19A 2RE8A 1EXVA 4UDOA 2XMSA 2OD7A 2W2PA 4ETNA 3NNNA 4YY3B 2JEOA 2Q8QA 2EX4A 1QCZA 2V8BA 4HFNA 4UU7A 5BMOA 2EWWA 2VPZA 1TADA 2E7ZA 3L0YA 4EJ0A 3O26A 1RE1A 2R60A 4FE3A 4IQ8A 4CM4A 4E5DA 4KPYA 3CPHA 4O4JF 3TW6A 3K9FC 2PMWB 1Z4KA 3AWDA 1QX3A 3EMDA 1N33B 5A5GA 1JEQB 4M2LA 2AEEA 2IPXA 4BN0A 1Q1AA 4NMMA 3MMXA 1DINA 2ZFUA 3A9WA 2DC1A 4J7AA 4Q02A 5SYNA 4G0UA 4M8IA 3S5UA 2XXAA 1HQCA 5JPCA 1Z2DA 3OFNA 4E3WA 2OV8A 5J47A 2GAIA 1YQGA 1R0XA 4N3BA 1RZUA 5AOBA 4Q4CA 1RKVA 1JH8A 3R7LA 1G98A 1LS1A 1UADA 3FHTA 4F2WA 4IJWA 4P9NA 5IARA 4K7JA 2BSQA 2Q3HA 4P36A 4X54A 4G37A 3KYCA 1BE8A 1C2YA 4CNQA 1RPAA 4LTDA 2FQXA 1I9GA 2WFAA 1NOKA 1MDBA 1YZGA 4PPNA 3UMJA 1ATZA 4QU0A 4RKEA 1F0PA 1GUYA 4K8OA 1N2CA 3NWBA 1WCV1 3Q6IA 4KLAA 3RUHA 5JYBA 5A06A 5LP6A 4GR9A 1H8HD 4PGAA 1RWMA 1OXXK 4NEHB 1QC5A 4BB9A 4Z51A 3C7TA 1XC7A 3RR2A 2B37A 3OQHA 3LPDA 4XYBA 2JARA 1GPDG 1CULC 1O57A 1KI7A 1YKFA 2ACWA 2VSXA 2ZIAA 4ZI7F 5FIUA 1KI9A 5FDFA 2N1MA 1MQAA 4EFDA 1DTWA 5J23A 1IAQA 3MBIA 5D2CA 3DXXA 4EI2A 3F5DA 2QUIA 1Q7EA 2G67A 2JFZA 2RHWA 1ZMRA 4MULA 1PT5A 2PX3A 1KI8A 2EJCA 5JMOA 3WC4A 1Z18A 1HQKA 1XZAA 1E2MA 2V7QA 3PC2A 4KAXA 3OIYA 1NHGA 4B3HA 3DOCA 1JR4A 2AQ8A 3EGDA 2VP3A 4MKXA 4QXMA 5KTOA 1U28A 4KFRA 3KSZO 2FJUA 4D9IA 3HNPA 5C1DA 3LW8A 3JZDA 3UKOA 1YQXA 4I6EA 3AUAA 5U4XA 3LKZA 8AT1A 3ZJ4A 5A04A 1I0LA 3MLAA 2WKPA 3H3FA 4X7RA 3OIGA 3PBKA 3KOUA 4C4PA 2O54A 1L7RA 1ZEMA 2CMDA 3T0FA 1H0SA 3AJAA 3B7PA 3RVDA 5IAOA 3IMEA 2NZYA 1QHSA 4O2BF 4TSFA 3TJMA 1GA6A 1JR3A 5H70A 3FI0A 2Q62A 5JO0A 3E9CA 1H2FA 2Q0XA 1JAHA 3BSFA 1VLLA 1UZUA 2H1LA 3AETB 4KN9S 2AFRA 2B21A 3E6AA 2WJ4A 4BQRA 5G3ZA 4EZIA 3I2FA 2H51A 4XIYA 2ZRNA 4JLAA 2OWDA 2HRQA 1T3GA 2VJPA 3ZHYA 4D0SA 4PIMA 5KHLB 5HQTA 1DOHA 4ND5A 4BC1A 5F78A 3DNFA 1P4RA 3TEJA 4E7OA 1ENPA 2BBWA 4DUZB 2ORWA 4HN4B 1GZDA 2VAXA 4FHFA 4UUQA 1CCWA 3K8ZA 2QRQA 2XQKA 4BX8A 4MITA 3KWJA 1JZSA 2J7KA 2C29D 4QRIA 1YJXA 3PQ6A 1J5XA 4Z0NA 3DG9A 3W04A 1GUFA 1EX1A 1Z0KA 2CN1A 1VL8A 1XG5A 1SY7A 1JE1A 2GYVA 1ZSNA 3NJRA 1HO3A 2ORVA 3C4VA 1CUHA 3QKRA 2XCQA 3R6DA 4PAWA 3TZEA 2VQFB 1COWD 2BWJA 3INRA 1YMUA 3QMWA 5GPBA 1I0IA 3K0AA 4UCWA 3WWEA 4HKTA 2WU8A 3KSBC 1BXKA 4GPAA 4NZPA 4CCSA 5F4BA 1RPZA 3BICA 1JDBC 5GJCA 1TT5A 5IM4A 2IE0A 2A58A 4IH1A 3PUKA 3SNKA 4AJEA 3WDLA 2O20A 3T7AA 3CBQA 2H7YA 3TXAA 4FDAA 4BATA 4C2BA 1IULA 1UMCB 2HIGA 1H6DA 3AL2A 3QVJA 2Z8XA 4HOYA 4JLDA 1XZDA 4YP6A 5KOIA 3GELA 4X45A 2B98A 4U7FA 3DZCA 1A5ZA 5HFAA 4B6RA 4OI0A 2WIDA 3D0OA 2JIQA 3LFHA 3AJDA 1VG9B 3QENA 2FQYA 1SXIA 3UAYA 4BFLA 3LUJA 2IPOA 4ZQIA 4TLAA 4XWAA 1OE0A 5FWNA 3PEWA 2Q29A 3ZQKA 4V0MA 3VTAA 4EUSA 4UTVA 4G25A 3QG1A 4OQNA 4JUIA 4W4TA 2BH9A 1XVLA 4BNDB 3MJHA 5HP4A 2WF5A 2FA9A 2X2EA 1T6YA 1GCGA 4MVJF 2ZI5A 5IVIA 3CRNA 3BMCB 4BPRA 1QGDA 1Z75A 2O2XA 4LJ5A 3W4IA 2CLHB 3L4SO 4FLFA 5LP6F 2AUNA 2WJHA 3DMHA 4QYIA 5BVGA 3OMWA 1R6AA 2HRDA 3KQTA 4EKNB 5B6PA 4K40A 2RCYA 3LI2A 4FNMA 5AM1A 2UUBB 3QUBA 4M8LA 5DN9A 3MQ4A 4AN4A 2CZCA 2J46A 5DCLA 3O6VA 2I1LA 4F04A 4AZ3B 1RYBA 2PYDA 3W77A 4PF1A 1A5BB 1CUSA 3HL4A 4YPFA 4D4KA 1K5DA 3DVRX 4EH1A 4YMVA 3PX3A 1CHNA 2I4TA 3GP3A 4OU5A 1M1YA 1R9GA 2WHYA 3N8KA 2X3YA 5E9WA 4RV5A 1G9XA 2AJ8A 3I8SA 5JD4A 4IPTA 1JG3A 3FGPA 4B6SA 4HAYA 3WHKA 4P3YA 3UWOA 3QWHA 1PNOA 2P69A 2AC4A 3NP9A 5J3JA 1GP2A 4YJGB 3NPMA 1YMQA 3SMQA 1A9YA 1GPMA 3DMPA 3T3DA 1UQUA 4ZMSA 2FH5B 2QG4A 4EK9A 5DGHA 1ZMBA 5AKZA 2VR1A 4JVLA 4QBHA 1OIXA 2WHPB 3N6XA 3DOJA 5ICGA 1YTLA 2ZSEA 2A3RA 3MOGA 3SDSA 2BF7A 1QUFA 3QBDA 3DZHA 4PC7A 2V96A 2C0PA 4MZXA 2JLYA 1U0OC 3SYLA 5LDDC 2AUMA 3IA7A 1LBSA 5EYPB 3QVSA 5MFZA 5HGXA 3EXIA 3ZDXB 3AH8A 4WXYB 4CQMD 3RADC 2QYOA 1CW2B 4ZU3A 1T0IA 3NHAA 2Q7DA 2PT5A 4Z49A 2ES4A 4J0FA 2EFYA 5DTIA 5DW0A 2AXNA 3GHYA 4TVKA 5HMLA 1EP2B 1PQWA 4I5EA 4C1BA 4CJXA 4ETMA 3CZQA 4QXRA 4GO1A 3KSAC 3NHBA 3DTTA 1I3CA 2O8EA 2O8BB 1E9CA 4XDZA 4B17A 4TMFA 5LQCA 5LLDA 4LZNA 4EGJA 1G17A 1KY2A 3CUWA 2Z1DA 4FQ7A 4BEJA 3GLIA 2YRFA 2X5OA 3D6JA 1HZZC 4IDPA 5KKNB 2WMDA 2QTGA 4QGBA 3C8HA 3AW9A 4POAA 3ZDRA 4WKGA 1P2TA 3LDFA 3UT5B 4L51A 1NKTA 2BZSA 2IP2A 3QEMA 3N3BC 4JYCA 2P7HA 4TWBA 4BWFB 4DJAA 1VMAA 3BM5A 3FG9A 2OUKA 3W78A 4IZHA 1X86B 4L6AA 1Z2NX 2GI4A 1UKZA 4YP9A 1IY0A 4R9SA 3WGHA 1EM8B 3B8HA 3B1KA 3D2CA 4P3KA 4NYIQ 3WL8A 3K0AB 2PPVA 5FLEX 3AINA 3S2FA 4BLPA 4BWGA 4E46A 4K05A 3VR5D 4EA8A 2EYQA 2QIOA 4QBTA 4Y67A 1IY8A 1KMQA 4HVTA 2JFYA 4ZT5A 1IHUA 1BGWA 1Q0HA 1R3DA 1Y4ZA 1LLQA 2QZPA 3LSTA 4TX1A 2EJBA 4KIJA 4HRVA 1GSAA 1MJNA 4WY2A 1W19A 5THKA 5LWHA 1RC8A 3SFTA 1EHCA 1NF2A 2QUHA 3FPEA 3VNUA 2B9EA 2P78A 3N2KB 2WAXA 4ZVKA 3ZVMA 1NMYA 3MGBA 3N2EA 4JP3A 1M8FA 4H4EA 1GG2A 5BSEA 5MGBA 1FU7A 1TEXA 1UWCA 4C43A 2O59A 4CQMB 1GXSB 4YWHA 3W5VA 4CMCA 2D2FA 2YCLA 2C5LA 3UOGA 3CRZA 4DAEA 1G3RA 1MOPA 3JWPA 3ETLA 5DM0A 3OPYB 4R98A 3SAJA 3NJ8A 1PT8A 1P1FA 3OE4A 4YJ2F 4LRUA 4PY2A 1XAIA 2IZ7A 2DXIA 1J8DA 3KJNA 3P1JA 1Q7CA 5IM5A 3LO5A 1E9RA 1DPFA 4XIIA 4HYQA 1T3SA 1X80A 2ZAMA 3PC4A 3AVOA 1WXFA 1U3CA 1DRWA 1E2UA 4NQZA 4OBXA 1VSQA 3OOEA 4E0BA 3GIDA 2OCGA 2WW8A 1PBNA 2VP0A 2YFQA 4K6KA 5ALIA 5TEWA 2NV0A 2W11A 1ZUNA 4GPIB 2IOHA 2FPIA 3G88A 4QYIB 2WYUA 5BVGB 3ZJYA 4N6OA 4EYGA 1OAKA 3KBBA 2QA5A 4GLLA 4KMRA 2N46A 5T4FA 3EWIA 4E4YA 4Q6WA 5F5XA 4ZVPA 4GX1A 3SLGA 3IP9A 3PNOA 4V03A 1GTRA 4HEJA 4BMXA 2BYTA 3ZHSA 2OGWA 3OEEA 1BDMA 2CFCA 1F9EA 4K3VA 4QVKA 4RK6A 2JGMA 3W5IA 1VKJA 1AH2A 1HNWB 4UAGA 1ZM9A 3OY7A 3DXYA 1SZJG 4KWEA 1PT7A 4E2FA 4PZCA 2C9OA 3KVOA 3NBKA 1IXSB 1AS0A 1IB6A 2C7VA 2OBMA 4LCJA 5DGXA 2WWYA 1M2KA 2ZDHA 2A0FA 1G4UR 1Y7PA 1ZVQA 2GN2A 3OZDA 1O58A 1UDWA 4YX9A 4P2BA 4F1JA 1E77A 3NBUA 4JU8A 1SZCA 2CNKA 3BCRA 3HCBA 3UTDA 5I7VA 1LNSA 3CSDA 2D1FA 4WJZA 1OZFA 3UUFA 4OB8A 5TQVA 5DMHA 4OQ4A 5GJBA 2QMQA 2HCJB 3WRXA 4RMHA 5D3QA 5BSUA 3UKJA 1QV9A 2PWZA 1GQRA 2YUIA 2PX0A 4B32A 3C6XA 2V6JA 3BA6A 4AUMA 1W46A 3A3OA 4B5LA 2LDXA 5CLJA 3RRYA 2CT8A 1NMZA 3OC0A 2CNDA 5T3UA 1OVMA 4UU0A 5FBWB 1NVDA 1USIA 1FTWA 3IILA 1A8HA 1TGVA 3L8DA 1I6KA 4KDEA 4PW0A 4XGIA 3GF4A 5D84A 2WP0A 2GZHA 2VJKA 1J23A 4OGGA 1LTHR 1NIPA 3T95A 5TGTA 2VHXA 1VLVA 1EKXA 1PS0A 2DPMA 2QX9A 2VSNA 3ZY5A 2E4AA 1U2TA 2FW8A 4CN9A 1WF3A 2C99A 3EVFA 3ANTA 1T15A 3WLHA 3U7HB 3ZE9A 4MDEA 5JAPA 1UFVA 3HYSA 1YRHA 3KB1A 5SZHB 4ENRA 4I36A 3G6KA 3SF8A 3AU9A 2HXYA 3RAPR 2EQ5A 5H81A 1Z56C 2PS0A 4QL3A 3L1VA 3K30A 4CLOA 2C88A 2B78A 2VUUA 2CXSA 2YWGA 4GFDA 5KQMA 4PC6A 3TDKA 1I7DA 3R44A 2FMXA 4IYJA 4F6RA 3PFKA 4ZKEA 2OO3A 3FPLA 5G2OA 2BR4A 3JQAA 4CCAA 2XRFA 5D86A 2FPGB 5ISMA 4K9QA 4TT8A 1OH5A 3GBPA 2ZXUA 1XBTA 3B38A 2QZJA 5IT0A 1HDZA 3JQ8B 4WUVA 5HM6A 3F5FA 1PNVA 3U7GA 3O31A 4PGGA 2HMTA 4QNMA 4NS1A 3C4QA 2DAPA 1NONA 3ZGLA 4GM4A 4AM8A 1YOVA 3RDPA 2Z95A 5HILA 3ZU2A 2QAJA 3IVXA 4IDBA 2AH5A 2HHAA 2OD9A 3LLVA 2R1ZA 2VYFA 2RIPA 3CSSA 3IR5A 5EMNA 4BU1A 1TQ2A 2V55B 2QD1A 1FFDA 4TL6A 4ER3A 5J4YA 5C1BA 1OOEA 3AKDA 4PZ0A 5DF1A 2W8ZA 1MN6A 3FPCA 1YA8A 4BNKA 5K0GA 4HDSA 4MQMA 3EQ6A 4D9BA 1X7YB 2CZQA 4LPKA 5HRUA 5CK4A 2HDWA 2QW8A 1GZ6A 3ZDFA 1FDWA 3D81A 2H2FA 2IDMA 1A95A 2PGDA 3IHKA 3VSAA 3IMCA 4I4NA 3PNSA 1EYZA 2PSSA 4FHGA 3L9XA 2R11A 4DA7A 5BSMA 3PEUA 4ZEXA 1C9KA 3ON5A 1RTTA 4NLLA 1JFRA 4RPHA 1S8OA 1VBNA 2OHOA 4W5HA 3K0SA 4LK3A 4GRAA 3I9JA 4XGRA 2P9FA 5CA1A 2J0EA 1H4TA 2AOTB 2DU8A 5F2EA 4E5NA 3AY7A 1CDZA 2H17A 4R0NA 2REXB 5FFNA 2N3ZA 1Y1QA 1A1SA 3O38A 4MVWA 1LD3A 2WLTA 3WK6A 5DE3A 4EITA 1G64A 1RWVA 2I03A 3HJFA 1JYFA 4MRSA 2JGDB 3OF2A 3UMCA 1FDOA 4QQRA 1S7CA 1WW2A 2O9JA 5EKUA 1P7PA 3O3NB 3ZQ4A 4LFBB 2I5PO 4HWPA 4JFAA 2NVBA 4LMPA 5F73A 5FPYA 1C3OA 3UHPA 3BHJA 1ADBA 2XCLA 5DBFA 4UHBA 4CMEC 4Q4HA 3MD0A 4UUPA 1QZ3A 4NI5A 1R8QA 4DZZA 4YRMA 5I9NA 1IK4A 1G7SA 5JFOA 1PNTA 5AXBA 1WETA 8ADHA 2HI0A 2IJGX 2IU6A 2AUTA 3PEYA 1FMFA 2ZZKA 3NGLA 3E4DA 5FA6A 4DV0B 4J3FA 2KBFA 4JIMA 2C3MA 3K9NA 4BNHA 1MAAA 3D4PA 1G3IA 1QORA 1Y82A 2FR0A 3EW7A 3N2LA 1RCTE 1ULAA 1DVRA 3PSAA 4DCNA 1YCHA 3MUEA 2N42A 1N0VC 1X92A 2HCBA 3GJYA 1AB5A 4AF6A 2Y92A 4GOOD 1MZPA 1U1DA 4IRUB 4OQFA 3SHQA 4ZKDA 5KTMA 2CLFB 4HSGA 2PWYA 3RHFA 4Y2TA 1Y9DA 1CC1S 1N6KA 2WWWA 2HEGA 3WYDA 4ER7A 1ZK1A 4EHBA 5GZ3A 5KVSA 4WCFC 3K0FA 3LPCA 2V3WA 4X64B 4OL9A 4G23A 2TRSB 3EFHA 5H16A 3OM8A 1K8RA 3GJ6A 3WGQA 4FSDA 3ANNA 4YDHB 4NMHA 3FBWA 4ZAZA 4BCBA 3Q11A 4F6LA 2Y6UA 4LYYA 2ZUTA 1X1BA 2BF4A 4AJJA 4BQIA 3B60A 1O6FA 1XLVA 3KR2A 3VSEA 4GP6A 2WU3A 4JK3A 5LBUA 2DHCA 1NXXA 4HYEA 1Y7TA 2XUHA 2FK8A 3D43A 4N0EA 3AKCA 3U4IA 1BE0A 4IXTA 4MX8A 3QU4A 3Q7RA 5HM8A 3EGWA 1OKKA 2G0TA 3WK9A 2I6UA 5AOCA 3QKUA 3GLHE 1JPUA 2GB4A 3MMPA 5LB4A 3Q1LA 4F85A 3K9HA 2J5RA 1SUEA 2IHJA 2FTKE 1K6MA 3K71B 1K7YA 1NVAA 3RS0A 4BXOA 2FPGA 3UHOA 2REOA 1Y1SA 2BISA 1S2MA 1N7JA 3BKXA 4IJKA 4RCVA 4RF3A 4MPDA 5J4VA 5AIBA 3TECE 1MOQA 3AF0A 5FLKA 1DELA 4Z53A 4OXNA 3R7DA 1GN9A 4N6NA 3ZDBA 2AJLI 1SQFA 1EDZA 2A0YA 4EY6A 1NI5A 1IDN1 1TYBE 2V7EA 4OLHA 3C6YA 4RTJA 3I73A 3QIVA 3RK1A 1QZTA 5KQRA 4CCYA 3ZYZA 3EYAA 5IN4A 5BW8A 4AZTA 3FTEA 2OG2A 2PT7A 2C2GA 3A14A 1C9EA 3TNFA 5ARBA 3BIXA 1NQUA 4XDHA 1F0NA 3J81A 2C97A 1PWEA 4Z1MA 2OL4A 2NO4A 5DNVA 5FUBA 3O8NA 3NBXX 2UYOA 3E05A 2V7XA 4J7CA 4U3JB 9LDTA 2ZUCA 2VJOA 4QGGA 1QHGA 1W8DA 5J5VA 3MT7A 3P94A 4AVYA 4V24A 4JAVC 3TB4A 3PB3A 1ZOLA 1H6AA 3BFKA 5K8CA 2N47A 2NZXA 4MS1B 1I1OA 2CVFA 2HK7A 3IEIA 2FPOA 1XRPA 2QI9F 3RIMA 1E2HA 2X76A 1BFUA 4YJHA 3A2NA 4MW2A 2ZCVA 1J1ZA 4GP7A 3T3OA 4Z0TA 3EG5A 2I3AA 4QEKA 2OYSA 3K53A 4GDFA 3PA6A 3U3JA 5LZ4A 2OECA 3GAFA 1N8NA 1D04A 4RTLA 1NOJA 1OB5A 3FKSA 3P19A 1QBKC 1LPPA 3HYRA 4KO8A 5CA0A 3TEFA 2GSDA 1Q7TA 5DM70 5IUNC 5LOVB 5EIHA 4YGXB 3D7LA 1FDSA 2FY8A 3KPJA 3MN1A 3P0HA 4KIFA 4PFSA 5CYGA 5DKFA 5EE9A 1TJNA 2RI0A 2ZAOA 2VJMB 3E84A 3NONA 4MJLA 3QXSA 5EJAA 4C0BA 4CEIA 3AVYA 2G36A 2GPBA 4Z3OA 1AKYA 3QE2A 2V59A 1BROA 2QOEA 3AHDA 4AD8A 3AY0A 5D5HA 3SQOA 1ESCA 4DHWA 5LP1A 2RD2A 1NQVA 2W37A 2ZRLA 5BUSA 2YV1A 4D5GA 1KGSA 3DCYA 1PVVA 3BRCA 5G4KB 2AZTA 5BR7A 4QREA 3KOXA 1Q0RA 3U4MA 3HWWA 4JYMA 1ND5A 2HLPA 5CFMA 3G9UA 2NTYC 3M82A 1IHYA 1EK5A 1ZGZA 2O48X 3C3WA 2W22A 4I1SA 3SKVA 3I92A 4IV0A 1TB4A 3PGVA 3VKFA 1ZRNA 4CI9A 2E18A 4IWYA 3GLIB 1N9GB 1QZXA 4L4ZA 2IZ0A 2QMUA 4CL3A 4CQLB 4YLYA 3ZD9A 1MNQA 2R62A 1TZKA 4BVEA 2VN8A 4AY6A 3WGMA 3FMGA 3K6RA 1TPZA 2PGOA 3GJSA 2A1TR 1R8XA 3OTHA 3Q7IA 5DHPA 4YT8A 3L8CA 3D3NA 3HRHA 2BEVB 3B78A 4O1IA 4Z8XA 1ECBA 1R4ZA 3PENA 4EKIA 4Q82A 4QJIA 1ZNZA 4JUCA 2E1RA 2PS3A 4LC0A 1CRQA 5P8WA 3VNSA 3ZE6A 2MSNA 4CMIA 2PH3A 2GMWA 3QPAA 1D4AA 3AFGA 4RIGA 1RHRA 2HMUA 4CM8A 2IF0A 1T0BA 1U99A 4HFJA 5BMVB 4BTLA 1EAMA 5CFNA 2A78A 4V0ME 4QOFA 1BCRA 1GAEO 2CFOA 1J22A 3VAAA 2OWEA 2JRCA 2Q99A 3FWNA 4D8VA 4NBNA 4GOKA 1SBQA 1A82A 1QGUB 5DTEA 5HOQA 2BR3A 4PHHA 3O0TA 1W36C 1ZH6A 1TVKA 4TTTS 2GPNA 2JL1A 2PEYA 4K9KA 4L8LA 3RD5A 1I7SB 4R1SA 1AKVA 1QPZA 1QF9A 1ESDA 2BMJA 4TZKA 5TMPA 1P6QA 1B1CA 5KTTA 5JEEA 1UBEA 4U4AA 4I1RA 3AK4A 3U7QB 3HP7A 4G5RA 1ZSVA 2AFIE 1JSCA 1RPNA 4LXIA 4BU0A 2IUFA 2RCNA 5CDUA 1TMYA 2VYQA 3UV3A 3FDJA 4YUAA 4DM3A 4GNKA 4DL9A 2Y76A 4IX1A 1BA3A 1CS4C 3IP5A 2AI2A 4ARCA 4KPEC 1WCIB 2OAGA 3H9GA 1XLTC 3AUJB 2M6LA 4C0WA 3SWWA 2PD6A 1XU9A 4HGQA 1VIVA 1U94A 1B2RA 3RU3A 2FMKA 3LNCA 1EDDA 3HVRA 2GZAA 4G0ZA 1Y5RA 2YJ4A 4NCXA 4YT5A 3MJRA 2PNJA 5IZCC 2PKCA 1DOZA 1FX1A 3COSA 4KSCA 4IJMA 4Z9XA 3O8LA 4D4LA 4RWEA 3VR3A 5C8ZA 2C5AA 3BD6A 3HGTA 3T41A 3ZWQA 4EY5A 3GDFA 3GR6A 3QBEA 5T57A 4TV8B 1PL6A 2C1ZA 1IHDA 1PJQA 4CUJA 4V0OA 2WJ3A 4PYLA 1II0A 1U2QA 1UBHS 1L4YA 4PHTA 5DYWA 2F9MA 4C9BA 4CKZA 5TF0A 4BJ1A 4E2ZA 4URUR 2VHTA 5JCJD 1Z6QA 3X1YA 2OC4A 2Y27A 3ESDA 1PJRA 3RYTC 3IJ5A 4IF6A 3H9JA 4MQFB 2JLCA 5AWFC 3F6SA 5D1NA 5BNFA 1KVTA 5KHOC 3X43A 2AMFA 2V9CA 1B8UA 4Y6LA 1RXVA 2F62A 1L9KA 4Z7NB 3ADCA 2JCVA 3TLGA 4MVJA 4RV4A 5TMDA 4JNKA 3ZH9B 5AUPB 5E9JA 4U00A 1FTYA 1ZHHA 2NVUA 4L28A 4WDQA 1F06A 2UYQA 2YJGA 1JQLB 1E3IA 5HX7A 4PX3A 1A4XA 2HRZA 4YRZA 1TD9A 2IU3A 3D6TB 4AZWA 3L3BA 4DIOA 1HX7A 5L4LA 1NFRA 3E5RA 3P9NA 5CA0F 5KCMA 1GOTA 4LVNA 1N32B 1GL6A 3KHKA 4UULA 3J81k 3BD7A 5CLIA 4QTXA 2I6FA 3MWKA 4NENB 4Y30A 1HRDA 3CU5A 3ZY6A 5JZBA 1L9XA 3JVDA 4HTFB 1DXQA 3ETEA 1Y37A 2M32A 1RYDA 2RI1A 2VUIB 3OO1A 3QNUA 1TA9A 1LRJA 5DLYA 1FW8A 1G5TA 2RBEA 3L77A 4FGUA 2XVMA 2WR8A 3C70A 3PQ7A 2HWKA 2I4RA 3F0TA 4B0PA 2IYXA 2PL1A 4FYXA 4DNOA 5ED4A 3IAS1 1F4LA 1V16A 1E7WA 4MP3A 1C14A 5K0TA 1NW6A 4HDNA 5GQSA 2Z6QA 1E2GA 1RXSA 2FF5A 4H4DA 4ARAA 1VMDA 1TI7A 3EF3A 1NBAA 4BAUA 3OAAD 5DN6D 4UM5A 3NHMA 3G2IA 4C29A 3Q9SA 1L4FA 3Q9NA 3AYZB 1A9QA 4EUEA 2D1YA 2CZGA 5HK8A 3G68A 1RABA 4YGYA 2XY4A 2WB2A 1SC3A 1KZ4A 1XN1A 2HIHA 4RD1A 2CV0A 2FRDA 3TNJA 1RAEA 2JK1A 2IEDA 3O47A 3DV0A 4NAUA 1YK1A 1IBMB 2QORA 2QTTA 2WAAA 4H15A 1DC3A 5H4GA 2XUGA 3EW9A 2G1KA 4OVKA 2G06A 3VU9B 2CC2A 1U5AA 1HKHA 4E5YA 1DQZA 3K9QO 1XV5A 3ONEA 1GCAA 4F9TA 1UBRS 5J59A 2V7QD 2ZJAA 1DP4A 1ZGJA 3W34A 3HCNA 2YIJA 1M5UA 2JFQA 2GD2A 3Q87B 3SR0A 2OKGA 2P2NA 3A28A 2IGBA 1O95D 3OIFA 3D7MA 1MA0A 1HR0B 1DZ3A 4AECA 4AG5A 4DJFC 2P11A 5J63A 4YI3A 3AESB 1OBHA 3W3AA 2P8JA 5DSTA 2QL6A 1GEGA 1JQ5A 1RFLA 1SIUA 2RIRA 3BZBA 4A16A 1AQNA 3I61A 2ILVA 3NIDB 3HBLA 5CVCA 4YCLA 1Z4IA 4MWSA 5KYGA 2QAIA 2ZYUX 5FLYA 4H1WA 3O2SB 3BSYA 2QB5A 5JOQA 1OUMA 3V4SA 3LQRA 2GXAA 1Z8NA 3IHLA 4LY6A 4FBLA 2AQIA 2YDXA 1M8GA 3FGZA 5GONA 1G2PA 5FX2A 2Y99A 3JQFC 2HF2A 3ZK8A 1OA0A 4Q16A 5TQ2B 4B5KA 4HDSB 2Q0HA 2RHHA 3OT1B 4ZVSA 5LMNB 4DCSA 4D82A 1GGJA 2GN4A 1K7EB 3GEDA 4LE1A 2HLDA 1B0PA 1OT5A 1RM3A 4PXAA 3AVTA 3Q3EA 1DBWA 5IDXA 1RS0A 4DLPA 1ZXLA 1MAWA 4KPUB 4RA6A 4S2UA 4CKBA 1LDGA 4TTPA 4QUEA 4R16A 3DUWA 4LEIA 5FNVB 3RKRA 4HB3A 3OBIA 1D6SA 3A04A 5JMPA 1KPGA 2XNCA 2Z9DA 4BJ6A 2ZYTX 2YMLA 1SCKA 5F2KA 3EZNA 2PJZA 3UA3A 4X3PA 1O97C 3EIWA 5CVVA 4KO2S 2G07A 3JD4A 3L1UA 4UCFA 2X40A 3VH4A 1KAGA 3C41J 4MPPA 2GCGA 5BN4A 1W5FA 4HDCA 3O7MA 5KYKA 1TUEA 3IUQA 3ZN2A 1BDJA 2X0IA 4GU5A 2A9FA 2YJ6A 2RHTA 1NBME 2BP7A 4KYUA 1RWKA 5EWLA 2H2GA 3CINA 3FOAA 3DPUA 5DK6A 5E0OA 2Z3WA 4EHKA 2WWXA 1TM1E 5B64A 2XRZA 3UGJA 1KIMA 3G23A 2QR5A 5G0UA 1OJ7A 3COZA 4WN3A 4RAQA 3F6PA 4C0LA 3I09A 3ZBQA 5IJZA 1FFYA 1GR0A 2H1HA 3H19A 3GJZA 4NG4A 3N0RA 3PNLA 2PZJA 1N6HA 2ZJ0A 2WLSA 2WUGA 4E5UA 4BJHB 1WL8A 2WUWE 1Z29A 3CRW1 3FVTA 3JQ7B 1IAVA 4DLYA 2E82A 3O4RA 3TSAA 1BHQ1 1IC6A 1Q6ZA 3CX8A 2A84A 1H1LA 2RKBA 2MYNA 2Z58A 1LW6E 3OOJA 4D4JA 1Z6ZA 3R23A 1QAQA 1Z74A 4MAAA 2EKZA 4LNAA 5HEKA 4KQKA 3OUZA 5DCYA 4EHLA 1WUJS 4RDXA 2QMZA 3K8OE 3NUQA 4BO6A 1KC1A 4B34A 1SHLA 2BW0A 3U9TA 4B8YA 4QNNA 3GBSA 3TRJA 5L3ZA 2I55A 1AM4D 1MAHA 3R3XA 2ZR0A 3HFRA 3CZPA 1IRIA 1FDRA 3TW0A 3WB2A 2NT4A 1E4OA 4FFSA 1TA0A 1EFVA 4QATA 4NOMA 1T9DA 1GTZA 1QJ4A 1QWSA 2GERA 2PLRA 3NIFB 4Z54A 3DOUA 4R83A 2GFQA 2AC7A 3EG9A 1KSFX 2FR1A 2XMRA 4H3HB 1VP3A 4Q0MA 4EGAA 2XGMA 3HO6A 1XK7A 3H0KA 4JROA 1YAHA 2EC5A 2LCIA 3F9CA 2FW1A 3NR2A 3RUCA 4E4RA 1J2EA 1RIFA 1DAIA 4YRCA 3M83A 1XVIA 3SYMA 3QBTA 1BAPA 2JJ2A 4YRBA 3TZCA 4UPDA 4AS1A 1PP4A 4BIMA 3LU1A 2FMFA 1WZIA 3ZWYA 4R9UC 4MV0A 1HT2E 1SCUA 2PZ8A 3HKEA 4O8CA 3L8EA 1DAPA 4MYDA 3G0HA 2PBFA 2B7BA 4HAWA 2CYAA 1CB7A 4DSAA 3CJRA 4DMGA 2PR7A 2H11A 2Q2QA 3H42B 1YI1A 5CGZA 4ZOBA 3SU8A 4IFIA 1VI5A 2WSSD 1VHTA 1ZC3A 3C45A 2H5LA 3HJAA 2KWIA 2I7CA 2RHGB 4P4GA 4YONB 3M6UA 2NO0A 2AB0A 3BYZA 4BQFA 5GZ1A 4WBNA 4C22A 3HRIA 4ZU1X 2D00A 3PVCA 3CY6A 1ZK0A 4DREA 1I5RA 1T2AA 1XDSA 5INTA 4US1R 2V7UA 4LJ7A 3U3KA 3P0JA 1EIWA 2VPQA 3B6EA 5L4SA 3VO8A 4UPEA 2WQ7A 1L8XA 1QFXA 2QTRA 4YXFA 1LBHA 2I7DA 1SVLA 3KOWA 1KERA 5EPUA 4RO0A 2WM8A 3QEKA 3N6RA 4MR8B 4PGHA 1EQAA 2PO7A 3BB4A 3GEGA 3WHIA 4FI3F 4TQGA 3QLUA 1PTKA 4E88A 1HDEA 3IQEA 3OH8A 3JX9A 1YAJA 2EP7A 2WIGA 3EMVA 5J2UB 2I9KA 1JYEA 4DA4A 1Q74A 4F5ZA 3UN1A 4MR7B 1AN0A 3NYIA 3FI9A 4DXAA 3FJOA 2CDAA 3PKJA 4MK4A 3CUSA 1Z0FA 2EQAA 3FTFA 1SUBA 1NRWA 1D7AA 1V1RB 1W4CA 4OAPA 1AGPA 4NIMA 4X85A 4CM9D 1AKEA 1T1SA 4FE7A 1CR2A 3R5XA 4YPOA 2DLNA 2ZSDA 1DHTA 2HCTA 2HA3A 3QBVA 1A4RA 3G3EA 3L0DA 3QKTA 3EXEA 1XVVA 4H7EA 2FW0A 1OQAA 1HT3A 2QNRA 1E92A 1L5VA 4YS6A 4EO7A 3OOYA 3ELWA 5DTMA 1JFLA 1PIWA 3EDYA 1C3EA 3ZG6A 1XN4A 3TDMA 1RXCA 2CL0X 1SKAA 4CEHB 1EWTA 1XOIA 2AKEA 2O8DA 1U8XX 3DMRA 1PS9A 1DKQA 4TLCA 2HRRA 5C0OE 5TPWA 2AOWA 1T6XA 1K6XA 2WKQA 3GY0A 3O3CA 4R3WA 4GZ5A 4DTIA 1C7EA 1WKVA 3PU6A 4JCCA 4P1ZA 3SEZA 4BLSA 2LKCA 5K0LA 1JA0A 3QV2A 4WLFA 2W6ID 3CB2A 1UINA 1MH9A 3FZQA 3IJRA 4JVMA 5GV7A 4JQCA 1AKTA 4Q3NA 1UOPA 3I28A 4Q12A 1WVMA 5F77A 3L6DA 2QW0X 2XTNA 3CWQA 4BNZA 2PG3A 4I5GA 4JBLA 4FDLA 1FJGB 3VU3A 2B7CA 4Q3BA 5BWBA 5C37A 1ZCZA 5I7EA 3PL1A 2FGKA 1NI4B 4I6GA 5KYVA 3V4VB 1HDYA 4G8DA 4TM7A 4WZAB 1BEEA 4Y9DA 2RH9B 2YASA 1ZWLA 3EXHA 3KDSE 4QRHA 4UOQA 1K63A 3C1UA 5LZ2A 3QU2A 2YIMA 3T1OA 3USES 3V8MA 4AIRA 5K4AA 3LRPA 1NATA 4LC9A 3NVAA 2O50A 1SB9A 3GLKA 1QH1B 1RI2A 5ALTA 3SJ7A 1WCXA 2QK4A 2KJQA 2R6DA 1YDGA 3IPLA 3QUSA 1NTRA 2NZ2A 3B2QA 4N12A 1G3MA 1NV8A 2JI6A 3X1JA 1HTWA 3IBCA 4HUQA 2GXSA 3DBLA 4PFKA 5CK5A 2JJYA 1UC8A 5BY2A 1VHJA 3H9CA 3I4LA 3QYAA 3KEMA 1SK9A 1TGYA 3ZHCA 1OZAA 1LPNA 1UXOA 3AJRA 4HEA1 4B74A 821PA 1G7TA 5IJ0B 1JHMA 1DBRA 1GSOA 1IBSA 1FP4B 4H1HA 2RB4A 1SIBE 5IW8A 1Z68A 2ARKA 3KZKA 5J2UF 1BTOA 1HYEA 1JG4A 4WZZA 5LOVF 1L1EA 3FVWA 2RBGA 2ZT8A 3CN7A 3OLZA 3OJWA 3H04A 3WLLA 4CIDA 3WLFA 3T15A 4E1AA 1Z5NA 3HCFA 4DA8A 2GBLC 1PSWA 1UBFA 2PA3A 1NPTO 1YZVA 5FF9A 1DRVA 3DKRA 4AO7A 1R0KA 1LBIA 2H2DA 2QZSA 1XMJA 3HB4X 5JFTA 1IM8A 1QTIA 2Y0EA 3WGOA 5HNKA 4LX0A 1R37A 4G1EB 4JOBA 4RV9A 5H83A 1AQIA 3FNEA 1I4WA 1XHEA 1QOPB 3P0RA 4J9VA 1FX0B 5JT1A 1BVRA 3W2IA 2NWQA 3L1IA 5CT4A 5L45A 3MRSA 1M2WA 1V3UA 1TF5A 3JVEA 1F3OA 1XDZA 3QE0A 2QYSA 4XJVA 3VM6A 5JSHA 1V5EA 5CIWA 5T7BA 1XRLA 3DNMA 1WCYA 2DWCA 3P0EA 5IVDA 3WA6A 2IOFA 4QECA 3REGA 5AJVB 1HDOA 5JDCA 3NDPA 3D0RA 3W6OA 1AO0A 4LMBA 1H69A 4GDMA 5EPEA 1L5LA 2X8AA 4BO4A 5EJ5A 1ZOSA 4IOLA 3I58A 3GJRA 3TB6A 2JH9A 5LQMA 4BLWA 1SKUA 2M2IA 3M1AA 4KQIA 1P5RA 4XEHA 5B3AA 3E53A 3LCCA 1LPBB 5JDCC 1FMJA 2ZS9A 2MOKA 2A5LA 4GC9A 4AY4A 4D8YA 3UATA 1SZPA 3DHNA 4PYNA 4LJ6A 4Q7KA 1KYVA 3SHTA 5LM3A 3T9FA 3IS3A 4TRNA 3EEIA 5HR5A 2Z3VA 2DCUA 5HF9A 4M1MA 3HLTA 1TJYA 3CF0A 3UW3A 3AFHA 1WABA 2Z8YA 3TM5A 2J4CA 4MW1A 5FXMA 2ETXA 3NAQA 4FOLA 4IM7A 5IF3A 1KY5A 4PBTA 1GRRA 3SOZA 1NX9A 5EKXA 1ZJ5A 5TSDA 2C9MA 1XMQB 3Q9UA 3I8XA 1U3DA 5LB2A 2YKGA 4IIXA 4DCUA 3NM5A 1NVXQ 2QTAA 4URZR 3SP1A 3OZWA 3D7SA 1VPEA 4BUZA 4I5IA 1DAEA 5E6UA 1CQIB 3JYOA 5C8VA 3P7MA 4JHLA 3X1WA 1KKLA 4Z1OA 4BQNA 1SJ9A 2VPIA 3I76A 2XB2A 4KTTE 3NHSA 3NALA 4JQSA 5JIBA 2ST1A 1U98A 2HRBA 4IHJF 2NPFA 4TRMA 1ZBDA 3NIWA 2ZB8A 4MWZA 1M54A 3M3DA 3TYXA 1U6KA 4B6OA 2WKRA 2R4QA 3VO9A 4EARA 1HFWA 2CVHA 2PWAA 3VKUA 2XI4A 1I7NA 3JPYA 4M7WA 2VZEA 1XU7A 3PUXA 4LRYA 2I6GA 3FCSB 1WPGA 3JCZA 4NAVA 3S0JA 1K8YB 4TKZA 4A0GA 4QEDA 4EO9A 3BL5A 1EA7A 2XUIA 1O1YA 1U4OA 4ED9A 1VQ1A 1UBUS 2TSYB 3SS9X 1CUJA 3OO0A 4NARA 1BGVA 4EFKA 5IUKC 2QN8A 1HZZA 1WMAA 2ATEA 2W0SA 3U09A 4R69A 3ZW9A 4OKIA 2ZRHA 2DETA 1TUGA 1Q91A 3G5UA 3KL4A 4H59A 2VNHA 3UNXA 4C78A 4R3NA 2ZJ5A 4HS9A 4MQBA 1QS0B 4YRJA 5KKCA 3DLCA 2BBSA 4I55F 3CNNA 1Y6QA 4KMSA 4GZ6A 2FGJA 2YQZA 1SNYA 3H83A 3K3PA 5FUMA 2WM3A 1ZCBA 2JAQA 2ZATA 4DADA 1UT8A 2GM3A 2OBXA 3G9XA 3W3AD 4BAZA 5FTWA 1U9CA 1KYXA 2QQEA 4CEJB 3FVRA 1XUOA 3JQGB 1TYAE 4QPZA 3GU3A 4PZPA 1ZSYA 2A9VA 4YT4A 4R8VA 1SCQA 3M9LA 1E89A 3N2NA 1A77A 4JITA 4D57A 5KSWB 1DXYA 1KZ7B 3DSRA 1NMXA 1NQWA 4UE3S 3AX6A 2R00A 2WB4A 3L07A 2Q3FA 4ZV4A 4EB0A 4G0OA 4QGAA 3WGVA 1DIAA 1NNLA 1T0JB 1ZMXA 2GH1A 2Z2XA 4PZEA 3ZWXA 4ZGWA 4K2HA 1NNI1 4C3VA 1NQ5A 1GNVA 4ZC8A 3IAEA 4GWLA 3GLSA 3L84A 3QOYA 3EMBA 3HL0A 5JSUA 1UK8A 1KEKA 2PAAA 2ZETA 2B94A 2FN8A 5DISB 3TQOA 3P2JA 2JIMA 1X0VA 3CRRA 3LL7A 1J5PA 4YRQA 4I9HA 4J3NA 4A73A 1P45A 2QR3A 3BH6A 4KLZA 2BFWA 4P4SB 2J3LA 3HXKA 3PS9A 2AOUB 2C2HA 5BXYA 2QSUA 1SUWA 2NQ8A 4L6CA 5CJ2A 1M2EA 5ALMA 3RIHA 3GLHB 3EULA 1G21E 2HMVA 3SJUA 6YASA 3GL9A 3V1MA 1I3NA 2ENUA 1RAIA 3ZK7A 4HG2A 2VRWA 3QW4B 4DWVA 5DDIP 4UU8A 4PQEA 4DLZA 2BRUA 5TV2A 4J1NA 4OCZA 2DKNA 3C1AA 4ATNA 4FXOA 2V7WA 2CVOA 3VZPA 1RW4A 1UAYA 2DQZA 5D87A 1E2NA 1ZN9A 2C2MA 1A3CA 3CLRD 1CETA 3KFLA 4NG5A 1BG6A 4TKMA 3AIIA 4BX9A 4QPDA 3QVKA 3I62A 3T4XA 2IH4A 3SEQA 4BE9A 1G291 4RACA 3MMNA 3WWPA 4YR9A 1IQUA 4IQGA 5F7OA 1RPJA 2G9UA 4IF4A 4LMRA 4UUBA 2BTQB 1TFRA 2P30A 1WLSA 4M6WA 2FFJA 2KBEA 1SG6A 3HRKA 1XQVA 3HY3A 1HDCA 3O1IC 4IDOA 2G9RA 3DAOA 1LC0A 2GBGA 2HSWA 1P81A 3T5MA 2IOYA 1OI2A 1RADA 4V02A 3ZHOA 1OHHD 4DCGA 2OVFA 2V0GA 4XSHA 1FLAA 2AFHE 3H6GA 5TVGA 3RK4A 5BNTA 2ERYA 4L2IB 5AO9A 4IH9A 4XM1A 3MTDA 4RFSA 3E15A 4JI2B 1L7XA 3NYRA 2EWVA 1GARA 2P2ZA 4U0JA 5GONB 4EKDA 2J7PD 1AB6A 2NV2B 3A05A 4DR3B 2DSTA 4JLJA 5JQGF 1RHUA 1RQLA 5ADHA 3SDZA 1G66A 2XHEA 4ZQEA 3PF8A 1FDUA 4IHJA 2ZAGA 3Q8KA 3GQBA 1HC7A 1JA1A 1LKZA 1GV0A 1S2LA 2EKDA 4XQGA 5A6SB 1E3MA 4PO1A 5JXWA 3AC0A 3KZCA 4QASA 2BD0A 1T35A 2I29A 2Q5OA 2QQ0A 3S27A 3SFZA 5LFAA 3GUUA 3OM9A 4YASA 2CL5A 4YROA 2OQVA 2FZ5A 5ITWA 1ZD5A 3AEUB 5H80A 1MB4A 5KC8A 3JVVA 1TKRA 1B74A 2HBZA 3WFJA 4XRRA 3NATA 3WDSA 4E6PA 2R96A 3DWFA 4R7ZA 5K0BA 4YTEA 2OV2A 1NSTA 3OJXA 4KSYA 5BUCA 5FV4A 5L3QB 2KYRA 2Q46A 3N86A 2DR2A 1R5JA 1Q16A 3LXRA 3TI9A 2CLMB 1BKSB 4OQMA 4EUFA 1A4IA 4I55A 2JJ8A 3A2MA 3JR7A 3M6LA 2XVAA 2VDNB 3DAHA 4IICA 1YS2X 4NFLA 1P77A 3E3NA 3FLEA 4E1BA 3A1NA 3DP7A 4UOZA 3CR7A 2H52A 4OX9B 4LRXA 1WM1A 2KM1A 4RETA 1U7XA 3DFIA 1ZK2A 2VDJA 4AQDA 1OXBB 3AR2A 2X7XA 3IE2A 4MYSA 4YIKA 3T8YA 5BSVA 3TMKA 2HTFA 1IPFA 2EZTA 2OOSA 4BGEA 3FMVA 3UK6A 3CCBA 3VMMA 3O8QB 5K8VA 2QQ5A 2W42A 3LJKA 2HV8A 1S1MA 1L4KA 1E0KA 3U26A 3PQDA 1O6ZA 1ISJA 1H1LB 2J3QA 2P4QA 1RP1A 4UBJA 4R41A 1XRJA 1M0EA 5CTAA 4IDHA 3JYLA 4DYHA 2RHOA 2PYZA 4QJ5A 1TMKA 1YONA 4QQ8A 1O9HA 4PC2A 2PRZA 2O7QA 3C43A 1X14A 3CX6A 3FNIA 1B26A 1QIKA 4O02B 4KRFA 1FJ2A 2I34A 3OA0A 2PVCA 4XWWA 4YV1A 4W9MC 2Q7OE 4QU8A 1U63A 4OI4A 1XDBA 4IUYA 3WRWA 4HVAA 3I2HA 3M49A 4D74A 1CPYA 1N2XA 5LQNA 1JFSA 2BFDB 4Q1EA 2IGTA 3H87A 3STTA 1E4VA 2IHBA 1RMYA 2WSSA 3NZEA 1SOAA 1VDMA 2A1UA 1X1RA 3ZVKA 3E7PA 1MX1A 2JH3A 4W82A 1H42A 2FMUA 2Q7XA 4K86A 1ZUNB 2A33A 4OMCA 3UO8B 4F21A 1NJ1A 2M1XA 2YXNA 3GBVA 3NGXA 1SWWA 4D81A 1A2KC 2GCIA 3LWDA 3C24A 1A7JA 4H77A 4W63A 1PJAA 4MYUA 4AKSA 3UBTA 1Z25A 3R4CA 4ZTUB 4KTVE 3VR1A 1JLRA 1KFEB 4BMPB 1KQGA 4ECEA 3C3XA 3WB0A 1IN4A 2DUNA 5JSQA 3VV2A 3V3KA 1V1RA 1NRIA 5DWDA 5HTKA 3CG4A 5ABPA 3VR0A 1GA4A 3V4RA 2II6A 3HEMA 1MRZA 3EZ9A 2ID4A 2V6IA 4OGKA 1F38A 3PIDA 4KKVA 3VR5H 3Q85A 4E2YA 2FYTA 1ZJZA 1IB0A 1RJDA 2HA6A 1GZHB 1N6IA 2I4IA 4GR5A 1MXHA 4QDXA 1W581 3JQ8A 3OECA 1HMPA 2O1WA 3IOMA 1GZ4A 2P9JA 3G5TA 2GVDC 3OE1A 2Z6UA 3RF7A 3F6EX 4TUYB 3OD5A 3VSCA 3GJ0A 3KWFA 4MV1A 1PR0A 2C2YA 5CCXA 3PX7A 3SI7A 5JQGA 1T2DA 4KQCA 2F3TA 3TR0A 4MW7A 1B1AA 3VOAA 3HXMA 4W5WA 3QKRB 1IG0A 4PFQA 3ZLUA 4WXMA 3IMKA 1HDGO 4PSVA 4H31A 2JLQA 3UIEA 4AKHA 3PF9A 2E21A 5KSPA 2WE8A 2BUBA 3THYA 4D46A 4RMNA 1J7KA 1ZO8A 2GBIA 3VVLA 1EK2A 1FPMA 2YOFA 2GKSA 2J3KA 1VHQA 2HU8A 3DZFA 1DDIA 1IBCA 3LECA 4I6JA 1SHJA 4YCCA 5JSZB 3QXJA 4J49A 5IPFA 2AOVA 3RODA 1W4ZA 3QI2A 1PFWA 3VHLB 3S1AA 4PG4A 2WZCA 5ECGC 4JB8A 3M6WA 3DD1A 3RARA 4AXBA 3PUJA 2WWRA 3LDAA 2AQKA 3QJYA 3ZVNA 1YE8A 3ADOA 3DAGA 2YOGA 3C3AA 5EL0A 1OFGA 3FYUC 1JRLA 4RQAA 4AC9A 4QWMA 1SD2A 5EESA 621PA 5ALJA 1NF9A 5L53A 4A8HA 4U9HS 4M9SA 4XKJA 4UHCA 5EUQB 4TS9A 1XPUA 1QRDA 3MA0A 3F5MA 1X1TA 3LLSA 2LE0A 4QHTA 1W9MA 3HV2A 1ULTA 4EJSB 1E9SA 2IPAB 2ZXEA 1XYYA 1DO2A 1QFJA 2Q1UA 3O92A 5KAPA 1FNDA 1EJ6A 2RHCA 4C05A 2GS9A 3R3JA 3MAAC 4OYRA 4WCFA 2OOKA 3NAZA 1W85A 3HP1A 4II7A 4EGQA 2R6FA 3CEHA 2OZEA 2Q6IA 3BVPA 2DX7A 3IQZA 3AJ9A 4J3JA 3GGOA 3QUQA 4ITRC 1RJGA 2Q1SA 3GOQA 3L0OA 3L93A 3QITA 3PDCA 4I2VA 1U2PA 3H97A 1VA4A 3BXHA 4GD3Q 3JWGA 3ONWA 4LVCA 4OHCA 3ZCXA 4V1CI 1L4LA 2FWMX 2V7GA 3ORRA 4J0CA 2NU7A 1L5SA 4JWTA 4LWQA 4X95A 4GUAA 2B0JA 4D7AA 3GDHA 5I45A 3QY0A 5EXPA 2OXFA 3I5MA 4RLHA 4WL0A 2O0MA 5GGXA 2OGSA 3NT2A 1MH1A 1PX2A 1DZIA 1ANKA 3N0WA 1Z8HA 3GPLA 1IU9A 1J0EA 1JBEA 4B9EA 4BQSA 1F1BA 2L2QA 1JTFA 4OM7A 1J2TA 3D5QA 2I2CA 2Q9UA 1CIVA 1D2CA 5HJEA 2WZQA 1MJGA 1SXJE 1R16A 1CZOA 1DAHA 4FYWA 3EAFA 5EUCA 3QF4B 1J97A 3K6SB 1SOWA 2DR0A 2O3JA 2Y4NA 4JASB 4E5PA 2C5GA 4N7MA 1II8B 3S2YA 4CDNA 3E70C 3IBFA 2IEIA 1NMQA 3KT0A 4GPTA 3IIJA 4N49A 5G0TA 3TTSA 3A6FA 3WKCA 1PQYA 1WBJB 4CT5A 5LYJF 1YRWA 1R0SA 3U61B 1RLOA 2DPGA 5JS1A 1FTQA 1V9LA 2A1UB 2YWHA 2WUVA 4C76A 3ADBA 3N87A 1MG0A 2D3WA 1EMDA 2J0VA 4DR6B 2FFBA 4DBLE 1DQYA 3JQDA 2HMSA 3LC1O 2QTLA 3MRTA 2IYSA 4XWOA 4OF4A 2B34A 1P5FA 2X5KO 3BHMA 2ZOSA 1F5SA 1KZ9A 4FWBA 3WTBA 5CDGA 3H11B 4Q48A 2WA2A 3RSZA 2CFIA 4M1OA 3SOPA 1ULSA 2C9DA 1KI6B 3RFTA 2JD1A 3OKAA 4WXEA 1IOVA 5AJUA 2FN7A 2Z5LA 4ZZ1A 5CD9A 3UWDA 5HQ3A 3A4MA 3SFVA 4ZZIA 3KEGA 3SS7X 4DQ0A 4M87A 4NBRA 3ZCSA 1GNPA 2OFXA 3RYFA 3DWIA 1JP7A 2Y0BA 3WGZA 1PZGA 3EWAA 1Z37A 1JI3A 1ZMTA 2DULA 2C2WA 1BVYF 2BN4A 1SZDA 4JHXA 3Q3HA 4D99A 4EL5A 1LZLA 4II2A 1Q1GA 3QXXA 3V34A 2R25B 4DBZA 1RE0A 3GCDA 3JVIA 4HLNA 1J20A 1YR1A 3BXFA 3F46A 2YWJA 3KT8A 2H4ZA 4LV5B 4PGMA 4HF7A 5FL3A 6REQA 4UUOA 1MIHA 1GA1A 4KWIA 3T3EA 1FSSA 2JKYA 2QT0A 4JGBA 4D8XA 5KOHA 2NTVA 4M37A 4CZ2A 3BAFA 2RHJA 1P7WA 1E79D 1AKNA 1Z06A 3T7KA 1RKQA 3PLNA 4QYTA 1VLHA 1OU0A 4KIUA 2V98A 5DBEX 4CV3A 1PZMA 4QYXA 3OE7A 3KB6A 4WESB 3D1JA 4LF8B 2COUA 2EJUA 3LBFA 2W43A 2FPSA 4WVLA 5MDHA 2V7TA 2WU1A 1YNSA 1UMBB 1SBCA 2DFVA 2PT6A 1KJNA 1TIKA 1C1XB 2DH5A 3CLUD 1BMFA 1CZNA 3U44B 4IQ4A 1HT0A 4YUVA 5LC1A 4BP9A 3E7WA 2XZPA 1HLDA 3KYJB 3PXGA 1UC9A 1ONBA 4R54A 1XCPA 1HYQA 4YAGA 2Z2JA 4JYZA 3ONFA 2B1IA 1T8WA 1DWQA 1T2EA 2XYRA 2HGSA 3NVDA 4LG1A 2DFNA 3LM8A 5EQFA 1ENZA 3V33A 1ESNA 4ZYUA 5C4IA 5JTTA 4U2BA 3MWGA 1GAJA 3E2MA 4MCHA 5IVHA 1PFYA 1NZJA 2YW2A 4OKNA 1BN7A 3IDAA 5HBRA 1X77A 4PSAA 3ZU5A 3I2KA 2R6R1 3D2BA 4DLLA 4RFLA 1BZYA 5ULLA 1Z26A 4YMGA 1GFIA 1OWMA 2HWWA 5JNRA 5GIPE 3B1WA 4MPRA 1ILEA 2ASEA 1ORTA 3EDRA 1I3MA 1RXEA 3KUKA 2GLUA 1JWAB 1YE3A 1VGQA 4IS2A 1EGHA 1N7IA 3I3SR 3MWDA 1W73A 1B23P 1ZK4A 1IJFA 2W2MA 2NYUA 5IBQA 4IXDA 3QVWA 1XROA 2MR5A 3ZDDA 1TQ8A 2DY1A 3LY7A 4X8HA 4K0KB 2Q3EA 1JIIA 3B36A 2J9YB 3DGEC 2V8OA 5EJFA 2VP9A 5HFNA 3RG8A 2YZ2A 2PWPA 1QG0A 1G2IA 1S89A 1JEEA 3JD1A 3IPAA 4JOQA 1P9LA 4LCBA 4O6VA 1VE7A 2VYVA 1WUYA 5G4KA 5F7XA 1UOEA 5EFZA 3U17A 4N8DA 4YJ3B 1R0LA 4TL8A 3WL7A 3A6EA 1R0YA 1K6JA 2BJVA 2JFXA 1P4HA 4GMKA 3UXEA 4MUNA 1O5TA 1KSGA 4GSYA 5LQJA 1JDBB 3ET4A 2FVYA 2JPDA 4G41A 1ONPA 1GFZA 4XVQA 2HLNA 4ZAVA 1EE1A 4QGSA 3E9MA 1BW9A 2CVQA 3R5JA 1B6TA 1MT3A 3JQRA 3MUFA 4UATA 3IEMA 4CLRA 2COKA 2A1TS 4KYIB 1R18A 2V7BA 4UTXA 5EFOA 1K8QA 2QTVA 4P2GA 4ZI7A 3L7IA 3HLKA 3OESA 3UPDA 5CNJA 3N2ZB 1KRHA 5IKXA 1C8KA 3KR1A 3ECSA 1FXWA 2ZWPA 4CMKA 1IUPA 2QN2A 5HXAA 2ZRJA 1LFAA 3ELUA 1F2TB 1M2JA 1XSEA 2QY6A 4RC9A 5CDFA 3TX6A 3UT6A 4IIGA 3ZDYB 3ZR4B 7AT1A 4CM8B 3U37A 3IUYA 2QAGB 1KK2A 4JLOA 2QS9A 1KZYC 4P84A 5DX1A 5A5VA 3TBKA 4N3CA 1VZ3A 1ZA2A 1P74A 2O52A 2PAFA 3GLVA 2R48A 1AHIA 1WAMA 5CTJA 4ESEA 3KP1A 1HV8A 2SCUA 3UXHA 1U9ZA 1YR6A 2AK3A 1W87A 2OLJA 3A4NA 3ENVA 1Q3TA 2X9LA 3ENKA 1JV2B 5JECA 2JLUA 3EIFA 3VR4H 1ZHFA 3ZWDA 3KB8A 5AK4A 2R97A 3ZE1B 4BNGA 3QI7A 1FQKA 3PNMA 4REMA 2BZGA 3B7GA 3BWYA 2EFDB 4IGKA 4D43A 3ZU4A 5CD1A 3I9FA 4CQNA 1EVQA 4LRQA 3QLVC 4MRRA 4JT8A 2QEQA 1YH3A 4LC1A 4PZ9A 3GVPA 3P45A 4UZSA 5BSKA 4O2BA 2QENA 1CNEA 4ECAA 1XT6A 3SXUB 2LD4A 3T9BA 2DP4E 5I7RA 4OREX 3NQ41 1IDOA 4KXLA 3M9WA 2UUPA 5EE3A 3HA7A 1QV6A 3FNGA 4HFRA 3LXXA 4P53A 4DXDA 4RXTA 3ZJ5A 2FCRA 1EX7A 3H2KA 4G1BA 2ZKIA 2LRHA 2YV5A 3PYXA 3BEDA 2CCGA 2WG2A 3KJHA 3T6KA 3ZV7A 2VJBA 3WFZA 5A4DA 3DOOA 4ZALA 4Q1AA 3VPFA 2LTAA 3ULKA 4J2HA 3TZ6A 2XBUA 1AKWA 1LW7A 2VKTA 3MB5A 1AC5A 1L7AA 3N5KA 4HWKA 3IBTA 1K68A 3ZX4A 5A5DA 1LF0A 2UZ0A 5IAEA 1R00A 2UUCB 5DM4A 2HZBA 1T29A 2O7NA 5A03A 1H2XA 1FQJA 4N82A 1PAUA 2GJSA 3UV6A 5IEJA 3LOQA 1B8PA 1VYVA 2GN8A 4X6YA 1E4EA 2H1RA 2F7SA 2I4MA 2C4WA 4MGYR 3W79A 1G4HA 3CEJA 1WHTA 4G07A 3GDGA 3L6UA 3UAWA 4BNUA 1YCGA 2CLKB 1XD8A 1QDEA 1XNHA 1YZKA 2EQBA 2J32A 2K5UA 3CLSD 5G1PA 3VC2A 3Q7TA 1SKYE 2ZBUA 5FPHA 2RH8A 5GP1A 5AVXA 4OY3A 1G5QA 2O3TA 1MD9A 2ZIGA 1OPXA 4AMUA 3OIVA 1Z34A 2VSQA 2KSQA 3FDZA 3RUAA 3ZXXA 4DA6A 4Z2AA 2FW9A 1Q95A 1BFDA 1JJAA 4J2OA 4JBYA 1QXSA 3QOXA 3KJXA 4IEIA 5ALUA 1OGYA 1UXHA 2KLHA 4PAOA 5DT2A 5AW3A 8GPBA 3ZGZA 1DEKA 4JL6A 4Q4JA 5ELXA 3Q40A 4JI8B 1KFCB 1R6DA 2FLVA 2VDLB 3BE5A 4O4IB 1V41E 2ODPA 4NCJA 4Z7JA 1U2SA 1MZVA 2W90A 3EGIA 1NUAA 2PBLA 3ME5A 4X1IB 1X6VA 2J9GA 2JLRA 2GN6A 4ZEWA 2GK3A 3L6BA 4NNOA 3C15C 5BT9A 1FB5A 1H9AA 1PR6A 2D0DA 3CF4A 4UNNA 5EUBA 3EBPA 1JEYA 3O0DA 4D3XA 2Q3LA 4AMZA 4AYWA 2W2LA 4M60A 3B6MA 4AJIA 1GN8A 4AICA 3DGFC 5FTJA 2JFGA 1PD0A 2P6OA 3PQ2A 4KWHA 2Q28A 4ML3A 3QP9A 1AQUA 1M0TA 2LBPA 1TCVA 2X5JO 3A9TA 1JIVA 2UXBB 4BFTA 2ECOA 3BORA 1NXQA 3KYIB 3V5NA 4ZD6A 1BRMA 4FWTA 2JA2A 1YB6A 3NV7A 4TV8A 2ZRDA 2BBOA 4PN7A 1E1KA 1CX9B 1V47A 1A9TA 2ZDQA 1HEUA 1E9DA 1UPUA 2CHVA 4P22A 2Y9PB 3OUTA 1JDPA 3DLHA 3E61A 3KJFA 1ZFNA 4NCHA 1TL7C 3OLYA 3PSHA 5JROA 5AKYA 1BS1A 2PUTA 4DMKA 1L4NA 2OCKA 3QVMA 3L7KA 1AGYA 4UTPA 2FZEA 4MDYA 1Z0SA 1KNQA 4OFBA 1P39A 2Q6OA 1HORA 3AFIA 5AT1A 3VR2D 3VKGA 2GJ4A 2ZI9A 1NPDA 2HNKA 3DWEX 2NSJA 4CM5A 4HWRA 3ZV4A 4F1KA 1H2AS 2AEMA 2VDQB 3EC1A 2A4KA 2CLOB 3OM1A 5IWCA 2H00A 1R8JA 3GVHA 2EG5A 2ONCA 2QRLA 3I37X 3N28A 4Q3EA 3QE9Y 1XKTA 2OV1A 1YDWA 4K28A 4PZUA 2PH7A 4XD2A 1J1UA 4G67A 4LHSA 5KS2A 3EPRA 1R8YA 2KPOA 1GGMA 1W5EA 1ZXXA 2OZLA 2WQZA 3QBJA 4HLCA 2NZVG 3H1AA 4QPCA 3ELYA 5EXTA 3VH3A 2IS2A 4MP8A 2NVOA 4LOKA 2FUG6 1TQ4A 1XA4A 4MARA 4PTZA 4DDUA 4NDZA 3MCUA 3P97A 2IZZA 4M9CA 5EP1A 4C14A 2EIXA 1L7NA 3GHHA 4P80A 1E7SA 5JXIA 1QQAA 3FYDA 5EYPA 4YB8A 3E58A 1PG5A 3UTCA 1H2HA 2B6HA 2FHSA 3PDHA 4RY2A 4Z2YA 3CZCA 4QWWA 1JJFA 5FPKA 2PXAA 2QTZA 1QO7A 3LL4A 1XTSA 1H3NA 3OIDA 3RYHA 5BN1A 1HXHA 2BE9A 3COJA 4BEVA 2I7VA 4PLGA 1YJCA 3MEQA 2ZIXA 3LUAA 1XF9A 2J08A 1UFQA 4KXFB 5EEHA 5IF9A 5D3MB 5IZ4A 3ICEA 1T9AA 2O6HA 3GPCA 5E4JA 2R8XA 3A25A 5JQWA 2DJIA 4KPUA 1WHSB 4ZAGA 3R3VA 5ITSA 1YQQA 4LBWA 5L95A 5COAA 1X9GA 1WZCA 2A9QA 1NQXA 2IY8A 1SKYB 4EHAA 3CIOA 5JARA 1SBTA 1O7JA 1U7DA 1VGRA 1WUTA 3C3DA 3HVKA 1U2ZA 4XDGA 2P75A 5F21A 3TINA 1SXJD 3D5TA 4JU9A 2Q3CA 3IERA 4CT0A 2XZLA 3B6KA 2A7XA 4QUKA 4DSUA 3FMPB 5JAUA 2FMTA 1LA2A 2IHKA 3EGVA 5AIAA 1E59A 2O3SA 4XW2A 2F3UA 3H0CA 3DLIA 5HRCA 1EP3B 3G9QA 3GVCA 4IYRA 4KODA 1JEJA 2BTOA 9ATCA 2XXAB 5HZKA 4W5TA 2ILTA 3IJPA 3DE7X 4Z4HA 1YQUA 3I6IA 3L0ZA 1VRWA 3JQAD 3PHHA 3QFTA 1Z13A 3EUFA 5AHKA 4PYIA 5DZSA 3GK3A 4QZVA 4PYOA 3PD7A 3D8UA 4S1NA 3IH5A 4D41A 3AOEA 3CVWA 2PZBA 3N53A 1WY5A 2XJ9A 3NUGA 3NTVA 4DLXA 3ADKA 5IULC 3R9XB 4IDNA 3Q9LA 4ENVA 1XTPA 5KTPA 2FX3A 1TCBA 1SVSA 4L3WA 1BYIA 5GJVC 1OREA 4JMPA 4TMYA 2EKPA 5CVJA 3QELB 3QE3A 1B6SA 5LP6B 2F48A 2QX6A 5A4FS 4YRKA 2A67A 1JGTA 5C34B 4J4HA 4ICIA 1J0AA 3HS3A 4NS4A 5MGNA 3ET5A 3K94A 1P31A 1HURA 4ZZ0A 3V6MA 3GIWA 4BBJA 3K1TA 1RACA 1VB5A 2WOOA 2IIBA 8ABPA 1RYHA 3DBIA 4UTNA 4D3ZA 3ONVA 1QZZA 4PRYA 4A7PA 4YV2A 1RJ9B 5F1PA 1NSYA 4HDAA 3QLUC 4XEUA 2BOVA 2VTDA 5DHAA 4QXAA 2HK9A 4GBMA 1XCOA 2OHVA 4XIJA 5JEDA 3W5HA 4ZK6A 5KSOA 4QTZA 4D9FA 1MW8X 2BBTA 4ZRNA 1L5HA 1UXKA 1KFKB 3A58B 2EJWA 2FSPA 5JR3A 1FVOA 4FGLA 4IUBS 1H1TA 4RIHA 1V4NA 2G4CA 4KZPA 4OJKA 3DONA 3DB1A 3GN2A 2OM6A 2YVQA 1C9DB 3L5OA 4ZQFA 4IO0A 5DSZA 4S05A 4CF3A 3FVQA 4HB0A 1FP6A 3ANSA 4GKVA 3TQQA 4EWLA 4BP3A 2LUOA 1OT3A 4IMIB 4N5NA 2ODEA 2H9YA 4J4BA 6ADHA 3ECAA 1LK0A 1I80A 1A9XB 4Q9HA 1H5QA 1W85B 3SYNA 3WXBA 5AJYA 5A1TA 3WS7A 1WDKA 2BONA 2Q4BA 1ECPA 2CNBA 3WLKX 3GMSA 4EY7A 2C96A 5FA5A 4YCMA 1UK9A 5A5FA 2ZVPX 1GUZA 3D6MA 5JNSA 5EZQA 2FX5A 1EP1B 2JAWA 4FFRA 4NFYA 5EMMA 5FB3A 1GYQA 2HJVA 4BRSA 2ZZNA 1Y9ZA 4D9NA 3AETA 3L8MA 4JJ6A 2RB5A 4TTJA 3U2QA 3RTEA 5AD1A 1KXZA