3TO5A

High resolution structure of chey3 from vibrio cholerae
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
LNKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CheY homolog
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
total genus 40
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3to5A00
3H5VA 1Z15A 3VNAA 4MAAA 3RVRA 4D6YA 2L17A 5FWXB 1P6UA 3RH0A 4MQFB 2IKSA 1F51E 2W42A 3N0XA 4N76A 3FDFA 2WMYA 3O21A 3HCWA 5KWSA 1JDPA 4MRMB 1JHZA 4WXEA 4ML3A 4ZMSA 1E6LA 3HVRA 1KGSA 4EY3A 2PLNA 2I6FA 3M6MD 2PUBA 2F8SA 4YO7A 4MS1B 3G1WA 2JCGA 3LUCA 2V0NA 2P4UA 3OLWA 3RVSA 3NNDA 4OATA 3N75A 2MYNA 5HM6A 4E7OA 3O1IC 2LIVA 1LJUA 4Z4EA 3EGCA 2QW1A 4LE0A 4W5QA 2KYRA 2FKAA 3JY6A 2A9QA 5TPZD 3T95A 1DP4A 1YK1A 1K68A 4KPYA 4MYRA 2DRIA 3K9CA 4QYMA 4OLAA 4P1ZA 3DGFC 3MQ4A 2PJUA 3H5TA 2PAFA 4N0PA 2AYXA 4EYKA 3F6CA 4G0YA 4TLLB 5CNMA 2JK1A 4WWHA 2FLWA 3I42A 4RXMA 4B09A 5DKFA 2FEWB 3IPAA 4NV3A 5JNVA 1SRRA 3GBVA 1DCKA 1QO0D 1D5WA 3KG2A 2A9RA 2FW0A 2WB4A 4Z4FA 4G97A 4RKQA 4EYGA 3FFWA 3RVMA 1Z26A 2FQXA 3LUHA 4KMRA 4RK5A 3RVJA 1NXOA 3BREA 4F3TA 5BRJA 2JBAA 1QMPA 2FQWA 2MSKA 4OBBA 1PEYA 5FWYB 3F73A 3BRSA 3CLKA 1ISSA 5KQPA 2H0AA 1J56A 4RV5A 1K66A 2YHBA 3N53A 3EQ2A 3LUJA 3QLTA 3QK7A 1DC8A 1P6QA 3IPCA 3K4HA 5IBQA 3EODA 5KQLA 1EWVA 4NCAA 4H60A 4ZYLA 2L2QA 2YHAA 3H75A 1VLZA 3W9SA 1QP4A 4LRQA 1ZVVA 4CBVA 3P9YA 4G0XA 5IEJA 1JBEA 1APBA 3RVNA 4WZZA 4DN6A 3A0UA 4Y9TA 2JVIA 2QZJA 1USIA 4G0PA 3KYIB 4KQ9A 4WT7A 1ZGZA 5IUJC 4WUTA 1TM2A 3BBLA 3RQIA 3M9WA 5GOTA 1D4ZA 3HV2A 3MA0A 1JLKA 4W5NA 1JYEA 3CFYA 2PE5A 3OO1A 3H1GA 4IMIB 5GQSA 4MLDA 3HXMA 5FWXA 3DBIA 5DGCA 1A04A 3MF4A 4MQFA 1QQBA 1FFWA 5JNUA 4OG2A 4DQDA 3QELB 2PUCA 3KHTA 1GUBA 1Z2EA 1NXVA 1A0OA 2FMKA 4UHKA 3TX6A 2PUFA 4KFCA 4YGXB 3O2SB 5JS1A 2HSGA 3GBPA 3Q7TA 1YS7A 4JAVC 4W5RA 2N9UA 2FN9A 1ZGGA 2NUBA 4MPTA 3IP5A 1EFAA 4MS1A 4P98A 4EVRA 5DTEA 3GA5A 3FGZA 3HDGA 3KSMA 3GT7A 3L49A 4ZMRA 1DCMA 1ABFA 1Z12A 5F64A 2E4VA 1EWKA 3JTEA 3HEBA 3OLVA 2ZWMA 2QVCA 5HSGA 1OXBB 3Q41A 4H3KB 3HSYA 4HNQA 5TQJA 1L5ZA 4MR7B 1GCGA 1QP0A 4Q6WA 2B1JA 1GCAA 4MS3A 3MYYA 2ZAYA 6ABPA 3Q15C 1KRWA 2NZVG 1AB5A 3Q9SA 3A3KA 1OXKB 3LUGA 2HQBA 2LPMA 1JFTA 1YVUA 4RU1A 4E7PA 1FQWA 1JL3A 1RPJA 1UDRA 2B4AA 3C3WA 1LBIA 4MR8B 2F8TA 5IC5A 5ED4A 3QLUA 3DLHA 2MYUA 4YWHA 3CZ5A 4EVSA 4HNSA 5EWLA 3H6GA 2E4YA 3OQOA 1JDNA 4KRFA 4XXHA 4Z9BA 2IYNA 4EUKA 4YV7A 3JVDA 2LP4Y 2GI4A 3SAJA 2HJ9A 3CRNA 3N0WA 3KKEA 5EWMB 2XDYA 2FEPA 2GBPA 2QV0A 3N8IA 5FWYA 1ABEA 4GNRA 1YIOA 2FEKA 1PUXA 4RDCA 3A0RB 3I45A 3HS3A 4RK1A 3GL9A 1GLGA 2CD7A 1TVMA 4GPAA 3TO5A 4DADA 4HYEA 1YK0A 3RVOA 5KC9A 1CYEA 1SXIA 4MS3B 3KTOA 4H3HB 1E6MA 2LUOA 3H6HA 2IPNA 4RK7A 1PNTA 3DLBA 1RZRA 4PYRA 5CNJA 1XHFA 5CNIA 2VUHB 3T38A 5ABPA 2RJOA 1JF8A 4OLBA 4JB0A 3DZDA 2AYZA 3NHZA 4G0ZA 4YS6A 5EWLB 1BDHA 4S04A 1JYFA 4D74A 1DCFA 1QNLA 2QSJA 4IMJB 2IPMA 4MR9B 5KQGA 1LBHA 3KCNA 4F12A 4G0QA 3B2NA 1JFVA 4RZSA 3HK2A 4QICA 3LFTA 3CKMA 5IX8A 1QKKA 1FFGA 3QELA 1RNLA 3FFXA 1JWLA 3RVPA 3CNBA 3C97A 5I4CA 4N0QA 2HQRA 3VNBA 1WETA 3H1FA 4F11A 4RS3A 1M5UA 1MIHA 4HNRA 2L19A 2NZUG 4KVFA 3HUUA 5T7BA 5DLEA 2WJWA 1DBWA 3OQMA 3EQZA 2ID7A 3N6VA 3CG0A 2FMFA 1ZN2A 4MLCA 4YR7A 1D2AA 1PHRA 3IP7A 3C3KA 2R48A 2PL1A 3IP6A 2TMYA 3O1HB 3MM4A 3JPWA 2FQYA 3H5WA 1Z13A 3OLYA 3KYJB 3LUFA 4MR7A 5EWJB 2PUGA 4KV7A 6CHYA 5KI6A 5TQ2A 5TPZA 4Z4HA 1D1QA 2NT3A 1MB0A 4RXUA 5T3YA 4KK3A 1BVHA 3F6PA 5PNTA 3C6QA 2VUIB 3GWGA 5JNTA 4PZ0A 3QX9A 4NQRA 3M9XA 5CHYA 4LX8A 4MR8A 3NHMA 5IEBA 4ETIA 4YLEA 2E4UA 4UHJA 3QLUC 1NTRA 1HEYA 4FB4A 5BR1A 1W25A 4KNYA 3D8UA 4WXMA 1U2PA 2PUAA 1KMIY 1ZHHA 4N03A 5BQ3A 3OQNA 3OO0A 1QO0A 4Z4GA 2FSPA 5EWMA 4EVQA 2JVJA 2LBPA 3O74A 2BGGA 5E3JA 3D02A 1USGA 4JB2A 2E4WA 1A2OA 4OTZA 4PICA 2QVGA 1M2EA 1Z18A 2FMIA 2R47A 2WRZA 4LE1A 5IUNC 2FXIA 3BILA 4YRZA 3O1JC 3RVLA 3GYBA 4PE5B 1ZY2A 2MSWA 3A10A 3JVIA 3OM0A 4NICA 5B3JA 5DCLA 3RVKA 1RXEA 4Z99A 3E61A 3UKJA 5TQ2B 3NNNA 3NBMA 3C3MA 2QXYA 1DC7A 1SXGA 3DGEC 4N47A 1YTUA 3ILYA 2JVKA 1MB3A 1ISRA 1ZDMA 3L6UA 2CHEA 1DBQA 3CTPA 1BA2A 1U0SY 1U04A 1VKRA 3KLNA 5TQ0B 4KREA 3QX8A 3Q7RA 4G0OA 3KS9A 1TJYA 3QEMA 3O75A 3CHYA 3H5LA 1JH9A 2FVYA 4FE4A 2GKGA 7ABPA 3MIZA 3OLXA 2WJAA 3OMWA 4G86A 4MR9A 5JNSA 3QLVA 3HM9A 4TMYA 4JP1A 3LMKA 3LUDA 4YP9A 4Z9AA 3SQNA 4XAQA 5BRAA 1E6KA 1EHCA 4JASB 2R4QA 1VPWA 4YCSA 2OENG 4NCBA 2E4XA 2JB9A 1YS6A 2Q5CA 4Z0NA 4W5TA 3HO1A 3LUKA 4M88A 5KQMA 1DRJA 1P8AA 2GX6A 2IPAB 3CS3A 2WWVD 1USKA 4ETNA 3FFTA 2VK2A 4MS4B 1NXWA 5IULC 1XWWA 2ID9A 4RKRA 1JFSA 1IIBA 3OMXA 2CWDA 1CEYA 3CZCA 4MQEB 5JNWA 4O1HA 1LK0A 2MSLA 3EJWA 3JPYA 2PL9A 1ZESA 3GRCA 3FMVA 2IPLA 4XASA 5C5EA 4KK4A 5EWJA 4L85A 4W5OA 4RY8A 1CHNA 1Z25A 3QEMB 1DBPA 1NXPA 4L4UA 3TMYA 1H9CA 2P9HA 3LKVA 3Q7SA 3UUGA 1SXHA 1URPA 4RK6A 4IF4A 3R0JA 1U8TA 1XHEA 5TPWA 4RY9A 3SY8A 3CG4A 5C5CA 2QU7A 3KJXA 3BRQA 2PMCA 1Z17A 1M2FA 4Z4CA 5KC8A 2X7XA 4IRXA 1QPZA 2VYCA 3I5AA 4IGAA 9ABPA 1ZITA 1E2BA 4S05A 1Z16A 4FE7A 2HPHA 1EAYA 3ILHA 4QPJC 5IUKC 1ZH4A 2JRLA 2M98A 4LZLA 3I09A 4G0MA 3ROTA 1L5YA 1S8NA 5CNKA 2MYTA 1Y1LA 2E4ZA 2FN8A 1PNRA 3E3MA 4EGSA 1KRXA 1GUDA 1ZAYA 1NXXA 2J48A 3KLOA 1M5TA 3LKBA 3JS5A 2M1ZA 3RVQA 5B3JC 2RJNA 4MGEA 3OM1A 2RDMA 3T8YA 1NY5A 1QQAA 3S99A 2PUDA 1NXSA 2H3HA 1I3CA 1F4VA 8ABPA 1TMYA 3QEKA 2A9OA 2IOYA 5HKOA 4D6XA 2L18A 1ZH2A 4TN5A 3F7NA 5TQ0A 1AB6A 5TPWB 4KZKA 4N41A 4XFKA 4QYWA 4TLMB 1C0EA 1MAVA 3NNSA 1U2QA 2A9PA 2HQOA 3H5IA 5D2CA 4XARA 2O20A 4Z4IA 1YMUA 1NATA 3QLVC 3OLZA 4LE2A 4LDAA 5FBKA 5HQJA 3SG0A 4RK4A 3IP9A 3LUAA 2R25B 1D1PA 1LJLA 1W9HA 4RK0A 2NT4A 1C4WA 2FLKA 1RXIA 3HDVA 4ZPJA 1SD5A 4JOQA 3N0RA 1TLFA 4ETMA 1QP7A 1FSPA 4RY0A 2MYPA 3O2JA 3SM9A 2CHFA 4KQCA 1MVOA 1JX6A 2JBAB 4MS4A 4RXTA 1BDJA 1P2FA 4O1IA 3TD9A 4MRMA 5TE9A 4LDZA 4MQEA 4EYOA 4JA2A 3G85A 3LOPA 3HZHA 2IDMA 1NXTA 3O2QB 4F8JA 3EDCA 1DJMA 3LTEA 3IDOA 3ROFA 3T6KA 1DZ3A 3SNKA 1RZRD 3MMNA 2FTKE 2FMHA 3H5OA 3HUTA 1FFSA 1BDIA 4EYQA 4PEVA 4XLTA 4ZJPA 1DRKA 1R8JA 1YMVA 1PEAA 2PUEA 2GWRA 4Q6BA 3UK0A 4RWEA 1VRVA 1Z2DA 1BAPA 4IILA 1B00A 3TB6A 4F06A 1DG9A 3EAFA 3GV0A 3EULA 2RGYA 5JNRA 2OQRA 4O5AA 4RSMA 3HJFA 1EWTA 2WY2D 3CU5A 1T34A 2QR3A 3H1EA 5JS2A 2PKXA 3URMA 4Q7EA 5FBHA
chains in the Genus database with same CATH superfamily
1ISGA 5DGDA 1A4UA 5DV9A 2I1VB 3AVOA 4FZ5A 4GHWA 3RRMA 6GPBA 1I7NA 1UKVY 3QFFA 1KOLA 4P2GA 4DBVO 3G59A 1W0KA 1DAGA 2NIPA 3HJBA 2XTZA 5LLDA 2X8BA 1ZK1A 2H92A 3DTVB 2FRVA 4HDSA 2AFIB 3F3KA 2IWRA 4ZHQB 5J9FA 2VYVD 3AGQA 5TARA 4ZANA 1NI4A 3AP1A 1E6LA 4QOEA 4MWTA 5A03A 5JZ9A 4EY3A 4LV5B 4QA9A 4CXMA 4TL7A 3M5PA 5E4YA 4HEHA 4JEUA 4YO7A 4HUJA 3L92A 1XXHB 3G2IA 4FGSA 3LUCA 1BS9A 4X7MA 5B53A 1GPJA 4BBZA 1ZINA 5BQXA 3RRYA 3O9VA 1SBYA 4HZGA 5LQSA 5JO0A 2K7FA 4ITVA 4ZODA 1IY0A 1Z35A 3F67A 3FOWA 4FFBA 2IYTA 1AZLA 3HCNA 4EO7A 1BGVA 1KJ8A 1P0QA 1W4LA 3LECA 2D4HA 3HKCB 4R84A 2QSYA 1HYQA 3KC2A 5JAIA 1YVRA 2EGHA 5FLKA 3CEMA 3MGAA 4Q12A 3Q5DA 2PJZA 1E1CA 1N2OA 3EF3A 4JIGA 2QT0A 5CU7A 1BMDA 3F6CA 3NW9A 2ZB2A 3CO0S 1A8HA 1Q22A 2XX3A 4EG8A 3L1HA 4LHZA 3S1AA 3KEGA 4JKYA 1N3BA 3FOAA 5CT9A 1CS4C 4NV3A 1J7KA 1SRRA 2P0EA 1S3SA 2XHEA 3IBCA 4FBLA 2X0JA 2CLFB 3TDMA 1RBYA 4FC6A 4J4HA 2CNWA 4AZ0A 2QORA 1SBIA 1UP6A 1D5WA 4LZPA 3U7QB 1DIRA 2VF4X 4BMSA 4P4GA 4PPNA 4PX3A 3NCHA 4IINA 4NXMB 2XQVA 2RARA 1JKIA 3M81A 3FFWA 5AXCA 1SVLA 2CLKB 3X1ZA 3I2YX 4KRGA 3QU5A 3BRCA 2X6TA 3V33A 3ND8A 4BP8A 1QLHA 3UT0A 2OESA 2Z9BA 2Z2KA 3C2QA 4FFNA 4JLBA 1KZ6A 2IOHA 4DLBA 1M2WA 2F90A 2JCSA 1HYBA 1TQ4A 3ECSA 4UNRA 1G59A 2JA2A 1SHKA 1UQUA 2QLBA 3Q6MA 5B36A 4YP6A 3HCOA 3DVAA 2C2HA 5G4KB 2IZ5A 1KU6A 3EODA 1TD9A 3SZ3A 1JILA 3PLAE 3GH1A 1L4NA 4PRZA 3AJEA 2YV1A 3PUYA 4I7EA 3R7DA 1ZIYA 1PHPA 4FDAA 2CXQA 4WCFC 3IVMA 1UFRA 3S2GA 3TTSA 3FTNA 4AMVA 2AEJA 3QVSA 1USVA 4AW9A 5LZ4A 3LBYA 5MFZA 1KJQA 3GUCA 2MINA 5DXAA 1INLA 1PGNA 4MROA 5G53C 1ZSYA 2JVIA 2J6BA 3LPCA 1BDBA 3QVKA 4TVKA 3S7ZA 1LEHA 4IGKA 4Q1CA 4N8EA 4D6PA 5LDHA 1ZUHA 1Q2XA 3C5CA 4F86A 4IG4A 4MUYA 4S1OA 3O94A 3QJGA 3ADBA 1X7YA 4AJ9A 2CF5A 2PV0A 4M6WB 1T8WA 1O5IA 3HU3A 4JC8A 4V39A 3T5DA 1QFMA 2P79A 5A4KA 5KSPA 1QC5B 5IBCA 2V8OA 2UYQA 1RSZA 5EZYF 1H8ED 5F35A 4WN9B 3SZLA 4GRIA 2CL6X 3OJFA 4TWRA 4QIHA 1XA0A 1UZLA 1ZMBA 3OC0A 4MS1A 2BSAA 3TS1A 3IQGX 1G7RA 5DTEA 5DRTA 4GM1A 4LXXA 4XQ0A 2FLVA 7GPBA 3UMFA 1VSTA 4IDPA 4HDMA 4PNEA 4WLNA 3FCCA 2V3VA 1YZUA 5H83A 1RYEA 3VTZA 3EOAI 2YZ2A 3D43A 4BO5A 3M49A 5HSGA 1RW4A 2HNAA 1Q7GA 4M0FA 1WUYA 4NAUA 3OUZA 2PEYA 5FV7A 3A3OA 4PQRA 1MDBA 1D9XA 1HE1C 1UIMA 1YASA 2WJVA 2WA2A 3IQFA 4ER3A 3U4DA 3O6VA 3Q15C 3A3KA 3U7EB 1E0JA 2GSWA 2RHHA 2LPMA 1E96A 4KQFA 2Z9CA 1VE6A 4YDRA 4ZN6A 5KTSA 3L84A 4AG3A 3I1JA 4C7MA 1JL3A 5B5SA 3HBAA 3HKBA 3UUWA 3TW4A 2OCDA 4A0RA 4Y7DA 1ODIA 1KZ1A 4M1KA 4PYIA 4L8FA 1FUUA 4K9OA 1KMNA 1VKNA 3ZDCA 1U3DA 2GSDA 4BQOA 1G16A 3AB7A 1FUKA 3JVDA 2IZ6A 3C87A 3M5WA 1V3VA 1PG5A 4F9GA 1BQ3A 3WZ2A 2Q6LA 3PWZA 1GJRA 4INAA 5AHXA 4EHJA 3D7KA 4WRRA 1PV2A 3ADOA 4DMMA 1FL9A 5CITA 2FK7A 4LJ6A 4DC1A 5IYZF 1K3UB 1VKZA 4U6NA 4RDCA 4JBXA 1NKSA 5K4HA 3QE0A 3R2JA 3ER6A 2C2OA 1SUSA 3I45A 1DOAA 4BO7A 1NIPA 5DSZA 4IH1A 2I76A 1FE8A 1RBZA 2O57A 3M89A 3T5BA 1Z5NA 1BGWA 4E51A 5AVKA 1ELOA 1PR0A 1E1LA 3PDUA 5HZGA 2VL7A 1J2TA 2NUAA 5IS2A 5ESXA 2HA6A 1ZLYA 2IIBA 4O2AA 4TMWA 3PEEA 1T2UA 2IPNA 2BM0A 1VGVA 2N47A 4EG7A 3DLBA 2NU6A 4IIHA 2IHUA 2PZLA 4BGDA 4WI1A 5SZHB 2ZTMA 2VPWA 1MB2A 5FPPA 2GYWA 2JH3A 4K3UA 4OHXA 1LVUA 1JWAB 4IKEA 4BTVA 4YYZA 4KR0A 4RE6A 1BXGA 1OWMA 3MWKA 4LXGA 4M0MA 2AOUB 3WK8A 2FWRA 4II3A 1QNLA 2A94A 2PG3A 2P1ZA 1YU9A 4X8HA 5B37A 1JAZA 1LW7A 1IXSB 3WWCA 1F7VA 3HYSA 3K9QO 5KOHB 2XTAA 3QLJA 1Y3CE 1GNPA 5J2TB 2SKDA 1RC0A 4UDYX 2QZ4A 5L7TA 1QH9A 1ZFNA 3UV3A 5IJ0A 3OU6A 3B6ZA 3F3YA 4Y1EA 4U2KA 1OFTA 3OIWA 4WKBA 2C98A 3ZIUA 1N9GA 1NBMA 3E4DA 3HWWA 4XB1A 5KYTA 4OI4A 3UJ3X 1GVNB 3CW2A 4PLPA 5AFSA 3ILXA 5KMGB 3JVVA 2I3GA 2BFCB 3R5FA 4TWJA 5F7ZA 4BWVA 3K5HA 2HJGA 1T9KA 1R16A 4JJEA 2Z5VA 3KHUA 4ND6A 1AHNA 2JLWA 3C6BA 1KI2A 4HDRA 4OYLA 4AO7A 2FPOA 3MCAA 1GN8A 1TPZA 1PHRA 4IH9A 3PU6A 4R6XA 3GT0A 3G0GA 1YB6A 3SXJA 4DL9A 3KKPA 1CFJA 5A9RA 3EPLA 2QR5A 1UINA 4Z86A 3OHSX 4OGFA 3IJ5A 3S2YA 3A2LA 4YJFA 1OLXA 2GZ1A 1ACJA 5EWJB 1COZA 3BXOA 4UHDA 2YJ4A 4D3FA 1CU1A 3B2EA 5DW3A 1CEQA 2I4TA 2VXBA 3QKIA 4HBGA 4IJ5A 1M54A 4TM8A 4UTXA 3M9XA 4OXQA 5B4VA 2PSHA 4KIWA 2B7BA 2Y9MB 5CT6A 2F9LA 3CEJA 3H9BA 3NIBA 3IQEA 4JL6A 4OQ4A 1OWNA 4WFQA 4I1VA 5GP1A 3R9IA 3TE7A 3GCWA 5BN4B 1DLJA 1BFUA 4MEBA 4N39A 1CZOA 2PL5A 1DV2A 2PWZA 3ZHRA 5LP6A 5HMLA 4HN4B 4C3VA 3T3DA 3LGSA 5EIXA 1YB2A 1HDZA 4N03A 4DUGA 2GHQA 3KOWA 5ICEA 1A9QA 4B80A 4G0VA 3DEFA 2W2KB 4P33A 3N9IA 3WLQA 4WXHA 4FSXA 1P4HA 1A2OA 1QJCA 2WSBA 3EDOA 1C8KA 2JDID 4PCLA 2ZYDA 3ENZA 4MKGA 3FG9A 4Y6GB 2L82A 4F3NA 4D46A 1DAIA 1ONOA 4KKVA 4PE5B 5JSFA 5DM1A 4UFPA 2Q2QA 5K8JB 2JKZA 2PNJA 4IV8A 5I9LA 1FNNA 3QEJA 3DO6A 4M76B 2EJWA 1GZ3A 1D8AA 1SUWA 2WQ7A 3U4QA 3PT9A 2BJWA 4K6MA 1ZDMA 3HU2A 3ME5A 4CFYA 4Z51A 1U04A 1VKRA 2XUOA 4ED9A 4YQYA 4KREA 1OI2A 4WESA 2VT3A 3EOZA 4KXFB 3DL0A 4Y2XA 4C21A 4DMCA 5FYDA 1YMQA 3CHYA 1YS9A 1JXMA 5BT9A 3H5LA 4GOLD 3UWDA 1T8PA 4E6EA 5LZ9A 3HKEB 2X4GA 1EM8B 3BZWA 3TX2A 3AI7A 5THXA 3RK0A 4QHYA 1WB4A 4AO6A 5G4LA 1H6AA 3JWGA 4TV8B 3UMMA 2KE5A 3KB8A 2FG7C 3CRZA 1ZI6A 1E6KA 3CGGA 1BW9B 3VO2A 4CKZA 3T9FA 1X7XB 4UBNA 3V7WA 3W1EA 4JGIA 2ZUVA 1EGVB 2ZZKA 4V24A 4LDJA 2A30A 1VG0B 3KUKA 4Y0AA 4ZDKA 1LPBB 2GBIA 3MILA 1H8HA 4WK4B 1P2GA 1IRXA 2GUWA 3BF7A 3NRBA 4ZJZA 4DCOA 3CX7A 1GAJA 2VCHA 3C5EA 1T2DA 3LY9A 1T8TA 1A82A 2DFTA 2OILA 4BEVA 4X3CA 1L8XA 1JFSA 5KHLB 1NVWQ 3SF8B 5DNUA 4MCJA 1E2FA 2QX4A 5BNFA 4J03A 3LQKA 2WAXA 3WMRA 1PKXA 4J1NA 4IUDS 3ZU3A 4CUJA 5AMXA 4DNQA 2A1TR 2H48A 3LDFA 2X0FA 2IF2A 5FOWA 1DBSA 3TN7A 4F04A 1JQDA 1SURA 1JU4A 3N87A 4AQ7A 1NLFA 1Z25A 3ZNNA 2UZ1A 2ZRDA 1N34B 3GCZA 3H99A 1BE1A 1TM4E 3BOSA 3DFUA 1CUGA 3EZFA 4D42A 4P81A 2EERA 3JD0A 5L6MB 2XSZA 5FFMA 3AR9A 1HA3A 2EV9A 1KDRA 3OOWA 3QOXA 4OMDA 1P45A 3SFVA 2P65A 4TWAA 3HADA 5C5CA 4GBMA 1UMDB 3OOHA 3FZQA 1LQ2A 1PS0A 1VG9B 4XDHA 1DQYA 1II9A 5LP6C 1Y4DE 3DTVD 4ZREA 2EEZA 2R65A 2VYCA 1F38A 1S2DA 2GZ2A 1IJKA 1MFZA 3O1LA 3OZGA 2W58A 4UU7A 1LZLA 1TF2A 2QTHA 3HGTA 5I4BA 3I3OA 2PZFA 3DHEA 4KFTA 5F9HA 1L4UA 2Q3JA 4CQMA 4YAOA 2ZS8A 4XA8A 1I4TD 4H7HA 5CTJA 5EXSA 2EG9A 1L4HA 2BEUA 3QTBA 3SHFA 4UE3S 4BRZA 4BY9E 5CFLA 1X80A 2MTBA 2WPDA 8ADHA 1AKQA 3V8MA 1RLIA 1Y63A 2HRRA 4R3WA 4OYRA 1G2IA 4AZ3B 2R79A 4ISCA 1IWPB 3Q5GA 4BE7B 1ZK3A 2H8KA 3EG5A 2V6IA 1C7QA 1BX0A 3V1NA 1UPTA 1DAHA 1QGDA 4PCAA 4C9BA 1IBMB 3QEKA 1OFVA 1GAQA 1G5PA 2E55A 1X15A 4HGOA 3E9YA 1ST3A 1DXOA 4KFRA 2ZRKA 2NU9B 5A5EA 4ZQEA 4DIMA 3GU3A 1Q7EA 1AB6A 4NF2A 3F6EX 3GA0A 3Q3CA 4W5WA 4XJVA 2NLOA 1VG1A 2W90A 3UOAB 4CKCA 5LJIA 1L1QA 4V38A 1I8TA 5DCYA 2IYLD 4A0GA 1TW2A 4YRLA 1NN3A 2WF9A 3AEKB 4KO8A 4KSBA 2BHRA 4J90A 4EABA 5D2CA 4I81A 1QRUA 1Y81A 1CXZA 2A0UA 2B37A 2Y1CA 4F56A 3PNVA 2C58A 1ACLA 2J6IA 1CV2A 3PUZA 3T3HA 3V4RA 2VSYA 2A78A 3FUCA 3PD7A 1P5ZB 4WLFA 2R25B 4YP1A 3HJGA 1ECPA 1KFKB 4LRSB 4PFJA 5HKLA 5KNDD 1QVRA 4YBRA 4MWGA 1WMSA 5T67A 1KAOA 5IJ9A 1UFQA 1KR2A 1ODCA 1BS1A 3P9QA 4M89A 5IM5A 1DRUA 2NQ2C 3GH3A 3ZWMA 5HKAA 2YNMD 3UOGA 3BE4A 2CN1A 3QE4A 5TV2A 1MVOA 2D0OB 4RXTA 2O5CA 1QYDA 1XU4A 3HFJA 3ZCUA 5JY6A 4F93B 2J46A 5KYWA 3ZXUB 2J9YB 1VYVA 2PFKA 4DZTA 1W6RA 4KPUB 4X64B 3A1SA 4TTTS 4LQCA 4EYOA 4R9SA 4S24A 2XOEA 4Z6KA 2WOOA 1L8AA 3GEMA 5SICE 3PXGA 1Q21A 4F8JA 1XPOA 3K70B 3RTBA 1PX2A 4RTPA 3HB1A 5HK9A 3PTZA 5LNK6 5CXQA 1A9SA 3H2KA 4NNOA 2M32A 5GWXA 3H04A 3H5OA 5BSEA 4OUDB 1NE7A 4O1MA 5DLDA 1OB5A 2UUPA 4RHUA 1T8UA 4DDMA 2FPSA 4Q48A 2PU7A 4CQLB 1W4BA 2R1TA 4BVEA 5E0OA 1XNRB 3NH9A 2OBYA 3DXFA 1DXYA 3A04A 3GV0A 3W2FA 3VR5A 3SQWA 1WSWA 3AUXA 1U2EA 4NCIA 2WY2D 3LF1A 3ANNA 4LJRA 4Q7EA 4O4HA 3VRHA 2BGTA 5GTDA 1IAQA 3BXEA 3J81A 2DUJA 1V37A 3HDJA 3RSSA 1C1DA 4LBWA 3RH0A 3VISA 2H8GA 3OEHD 3O8BA 4KMMA 3O8DA 1GZUA 3QUTA 1QKJA 2JJ1A 4DA0A 3LBHA 4F4CA 1F2TA 3L6BA 1DFGA 2WTAA 1M0EA 4CQMD 3GP5A 4M7OA 3WQHA 4AUNA 3HVRA 1NHWA 3K0CA 3SEAA 1RYBA 3TZBA 3MG9A 3UANA 3M6MD 2W6MA 1AIPA 2WUFA 3RJ5A 2JCGA 3U44A 1OV6A 3NHFA 2V0NA 2P4UA 1J0AA 4K9PA 4H08A 3N75A 4ARCA 1N75A 4MXDA 3Q0IA 3VR6D 2QW1A 1TCCA 1WOMA 4K86A 4BVJA 4DLSA 2DCMA 1HXHA 1R4NA 5SZKB 1UDXA 2C7VA 1SKYB 3I0MA 5TS3A 1UT6A 5GJBA 3L6DA 2OLEA 4V0MA 5HZHA 5D3ZA 4R1PA 4OLAA 3VSAA 3BL8A 1RQLA 2PZKA 1VL0A 4LMPA 3WGLA 2Z8XA 4AD8A 4F2HA 3KV3O 5JTUA 3NM5A 1NL3A 3PQ5A 3VPBA 4NMMA 2IU4A 3KDAA 5JBIA 1KOJA 3KR1A 3MINA 3X43A 4B09A 5I7UA 1P9LA 3LQ1A 3I8OA 1XMQB 1Z74A 3GBVA 4Q3DA 3OOSA 3D7MA 1JVNA 4LF6B 3JW8A 4M0LA 2BBWA 4L0QA 3KG2A 4EBBA 3LUBA 1KVSA 3LC0A 4AWAA 5KU1A 3N74A 1N5DA 2IELA 4Q3NA 4EEXA 2NO5A 1PFVA 1UPFA 1N1DA 1V4NA 4V0OA 5HEKA 3ICEA 3OZFA 2FCRA 2ZYAA 3OIDA 2FWNA 3H1TA 1E4VA 3CUTA 3RSLA 3IAUA 5J5VA 1MZVA 4O2RA 4DUPA 2EP8A 5K0BA 3UCFA 2G4LA 2FQWA 4OBBA 2AJDA 1I13A 3PX2A 3KELA 4IS2A 3A9VA 2A5GA 4IKOA 4RNDB 4CGYA 5KYKA 2PD3A 3N53A 3QF7A 3QLTA 4HNAB 2OWDA 3CW9A 4XB6B 1EDOA 1Q16A 2IFTA 1R0WA 4JN6B 1C9DB 3RT1A 3B7GA 1OPXA 1PYGA 3VNUA 4ZKDA 3UMVA 3SR0A 2YW2A 1FNCA 2B8WA 5A4AA 5B6PA 4PFQA 1NQTA 1QP4A 2Q0QA 4LRQA 4W4TA 3A9WA 4W8GA 4Y1RA 4F91B 2BC9A 5GONA 4IFBA 3ANMA 3EXEB 1RXSA 2QX7A 2VNSA 4EX7A 2ZU6A 1ZNYA 2WDPA 1NN0A 1J0CA 1QWSA 2VRCA 3KD3A 1Q7RA 1O58A 3VR5D 4ARZB 5I4IA 1M5RA 4BQQA 2BDUA 2MHCA 2HF7A 1S4MA 2BM1A 2NYAA 3D8RA 1HV8A 3HXMA 3ROGA 1ADCA 5ALIA 2Z8YA 3R3ZA 4Q4AA 3F5FA 3BYZA 4U8HA 4ACBA 2A5DA 2ECPA 4B2LA 4DCSA 4E1AA 3DZGA 1BRMA 1KYQA 1CVLA 1L7RA 4G1UC 5EIWA 5DU2A 2PUCA 3A1UA 3VU0A 2HSEA 2VDKB 3NJ4A 3K09A 1VFNA 3CH4B 1NSTA 3OOJA 4H7KA 4DF3A 4G25A 2FEMA 2QRVA 4J6EA 3K0CC 1DIOB 3QPAA 1E3JA 1XK7A 2HT6A 4H1VA 3GNSA 2W6IA 5IXYA 1F06A 2R751 2ZI5A 2GPYA 3AJDA 3OSZA 4LRWA 5CXUA 5HWSA 3X3HA 5HRCA 1VM6A 1ECLA 3HYRA 4D9BA 1WSBA 1YI1A 3K7EA 4FEAA 5ALMA 4QG7A 4EHKA 4RBNA 1L4MA 5L51A 2ZEJA 5DI3B 2RCNA 1T5OA 1JXAA 1R0SA 2GEUA 4EARA 3TOCA 5LSAA 2JHGA 3ZCQA 1OHHD 2OC9A 3V4PB 1NT2A 2VDJA 4WZAB 1RRVA 2OFXA 3JYLA 1WEHA 4GBJA 4RM3A 2VUTA 4EJSB 1PFQA 4DB2A 5AOAA 4TKMA 4B82A 1RFLA 1QGZA 2C7BA 4FNMA 1MTZA 1S2GA 3BK1A 2HL6A 4IDHA 1HG0A 5A6SA 3UAYA 1QR2A 2D1TA 4XM2A 5CP8A 3D1JA 4F2PA 2GZDA 2FMTA 2JASA 5EWLA 2OXTA 1D2NA 4MQ6A 3C7AA 4A8TA 3ZHTA 4GP7A 4JQYA 4GDFA 1Q1QA 1T0BA 5ESRA 2QAGA 4KXMA 4JBNA 2R5NA 3N6XA 5DN6D 5J58A 2ZUTA 4FEGA 3CRNA 2QXUA 2VDOB 1XRQA 1Y6JA 4JP5A 3MGGA 2QRZA 4UQOA 1KOGA 4TM7A 2GBPA 2VF2A 1M8PA 2BKXA 4FZ3A 3AI3A 4L51A 4Z1MD 3C70A 1T5DX 4PSDA 2ATCA 3L0BA 4LYJA 2GJ9A 3COSA 4JBIA 5ESDA 2B83A 4Y2VA 5CLQA 2WHPA 1V9SA 2IYQA 1CUJA 3VMMA 3OSUA 4P0PB 3WE7A 3LUPA 3B5EA 5E1DA 3IPYA 1BN7A 1H5QA 1GLGA 3DMYA 4BX9A 3AB3A 3WK9A 1JHOA 2D0PB 2WNHA 3DV2A 1C41A 3BK2A 3IIJA 3KKQA 4OGWA 3K4QA 2GYUA 1G3UA 1NJ5A 4BX8A 4DJJA 4JI2B 3OIUA 2W6CX 4MRNA 1GNRA 4B6FA 1VQ1A 4QULA 2ALJA 2F2TA 5CNIA 2B94A 4IBOA 3K1ZA 5ALXA 2JFFA 3AU8A 3ND7A 2GN9A 3WWYA 5JQGB 3PV0A 5JYDA 3LP6A 4JB0A 2UYCA 4BGVA 3OLQA 4OXXA 2PVCA 4UHEA 1IHPA 1J00A 2OBFA 4MJ7A 3Q2KA 1DCFA 1QBGA 3MJ4A 4FQ5A 1NW8A 3BWCA 3W2IA 4EA9A 3WHPA 4AX8A 3PNMA 3TLKA 3P9NA 4IIYA 3WDLA 1JFVA 4C3UA 10MHA 4JXJA 4OP1A 2ZB3A 3VDXA 1N6RA 3EOBI 1QRTA 1WUIS 1SC9A 4ZI7B 4C4SA 4DARA 3B51X 5EFZA 4AMYA 4ZK6A 3R0XA 4OJYA 5KIAA 3K09C 3TUZC 3N07A 2UAGA 4NBKA 2M2IA 1WPRA 5IZCA 2YWCA 4DLYA 2G9ZA 1DBWA 1ZWLA 2A5LA 2W6ID 3GUYA 3MCUA 4XOUA 1OZGA 3CG0A 1N2XA 1PCXA 4N9WA 6REQB 3SQDA 2CUNA 4M1SA 1DOHA 1QCCA 1OGJA 2H1LA 1DWUA 2ODEA 5FO0A 1E4OA 3HO6A 2XZOA 1D4AA 1UKAA 3OESA 5LD2B 4KITB 3C3CA 4JLPA 2R96A 1Z13A 3C8UA 2GN4A 4GKAA 2WAAA 1WY5A 3E2PA 4WLOA 3MS7A 3GJQA 4DMLA 4NONA 1JAIA 3NKLA 5CT5A 5KI6A 3VTKA 4PONA 1NBHA 4P5DA 1T0IA 4HC4A 1IY9A 1MB0A 2FW1A 1XTSA 3HDYA 1EGHA 1LI4A 1RCFA 3QUCA 3JQ7B 4OI0A 4P31A 5JYCA 1WBDA 2XT6A 2HA7A 2YRXA 4QDUA 4D0GA 5CCEA 3JQBA 4CMJA 4IOJA 4CCWA 5DMXA 3U62A 3TSWA 2Z3ZA 3WLJA 1R6DA 1GL7A 4PIPA 4G81A 5GAJA 1SFRA 2IYXA 1Q3KA 2QAGC 3STXA 3I72A 3TZQA 2JLUA 3E84A 1DC3A 3ZGVA 4KXXA 2I62A 5BOVA 3ZHVA 1D1TA 2VK4A 2HPVA 4WADA 3WXBA 1SCUA 1JLRA 1FFBA 2ZDHA 4LSMA 2GPBA 1J49A 3RADC 1OWOA 4HFMA 1XNJA 3B3GA 4NBRA 4I19A 3TIGA 1YA6A 3ZLUA 1Y6FA 1A77A 1J1IA 2GESA 1T6YA 4JZKA 4YRZA 1O95A 3ZX4A 1ZK2A 1XGKA 2B4TO 2BWJA 4MDFA 4WLEA 2NADA 1RXEA 4NARA 3W4JA 1BE8A 1J0EA 2CEKA 1D5CA 2V3WA 2Z2JA 5TQ2B 4Y6PA 1CS0A 4UNNA 3VV3A 3DXZA 3JZIA 2I55A 2OZPA 4CCYB 5HJ7A 4E30A 3K72B 1LX6A 2NSHA 4Q24A 4CM4B 2ZTSA 1BHQ1 1PJSA 3F78A 2FPPB 2QTFA 3A3NA 3L6UA 3NYIA 4R9VA 1EA5A 4CM8B 5K3EA 3R8FA 4PNZA 4KSCA 1I4DD 2BKUA 2R11A 4QUIA 1IHOA 1Y1RA 4FYHA 4UOQA 3T3GA 1HURA 5NULA 3PC7A 4XE5A 1OTYA 5ECWA 2YTZA 4FE4A 4C7OA 1NUTA 1U3TA 1U7WA 4LXQA 5DB4A 4DM4A 4G8DA 1TKBA 1I5OA 1KJ9A 1KJIA 1QX4A 1G8HA 4HTAA 4AZVA 4P5EA 1PJAA 1NNEA 3L82B 5BMOA 4H6PA 2VHXA 1NPYA 3AEUA 4Z9YA 4TYPA 1HYGA 3ROZA 1U3VA 5TIIA 1KIAA 3ID6C 3I2KA 4D4LA 1P8AA 4GX2A 1B0PA 4HB2A 4B4OA 4PQEA 1Q57A 5F7OA 3L9WA 3SHTA 2OHIA 3HYLA 5IZCC 5CIYA 1V8OA 2AN9A 3KJGA 3P94A 2CZCA 1UFOA 4V0QA 4R8MA 3OMXA 3LWNA 3CSSA 3QMWA 1AGYA 1ZQ1A 4BP3A 1UPUA 5E6RA 3L7DA 4ND3A 1I94B 3GRCA 4HLUA 1V8DA 2QG6A 2L42A 3AFGA 1BJKA 3BZUA 3P8ZA 4KK4A 4LMAA 2FWAA 1W581 1J5PA 4L02A 3H6KA 3Q6NA 3D6TB 4J9UE 3K1AB 3WQBA 1CHNA 5ELLA 1LC3A 5FXMA 4A73A 3FHCB 2XZTA 3QTLA 4J0EA 1TTHA 1E6UA 4EUFA 1CY1A 3W5HA 3UAGA 5DWQA 5T8KA 2D2EA 2ZSFA 4XWAA 1T6ZA 1IPFA 1FXWF 3COWA 1VLLA 4XSHA 1G3RA 4JNKA 5TPWA 2ZYIA 3DH0A 5HJ5A 4RCYA 5K0CA 3F5MA 1YUNA 3JQBC 3KYCB 4PHCA 3WLAA 3KO8A 1GTG1 4LZNA 1M2FA 2I6TA 4FDLA 1Q1ZA 2ZXFA 3PUKA 2WHXA 5E1MA 1T1SA 3JD3A 5CFMA 4DSOA 4M1YA 5BUQA 9ABPA 3K5PA 2OUIA 4JDUA 1TT5B 4RJ2A 2QP4A 3JASB 2GPAA 4YALA 3G2PA 4UPDA 2I2BA 1E1RA 1R9NA 2HPHA 2BEWA 4CWAA 3RYIB 2GEVA 3IVCA 2GQ0A 1PNQA 3A1WA 1WF6A 4ZKEA 1BS2A 4ZVRA 1ZL0A 3EW9A 3R5XA 5TVKA 3D6JA 2A5FA 1PZMA 3DE3X 2VQDA 3DAPA 1E5QA 3BSFA 4D79A 4ZFNA 2I4MA 4KPEC 4OKIA 2Y0CA 3IERA 3HLTA 5KKAA 2GJ4A 1O95C 4XM0A 1XVVA 3R7LA 3UXMA 1NVEA 2W43A 2ZR8A 3D0QA 2A14A 4UASA 4TTAA 3RHFA 4ZT3A 3ZCPA 3BKXA 5BN3B 4KWCA 4EGCB 1TEXA 1F1JA 1JBQA 3ABZA 1G8AA 4G1VA 1ZM2A 2DUUA 5EEHA 4TT3D 1ZH2A 4X7RA 4DHWA 1WV0A 5TQ0A 4D5EA 5LUAA 4BC1A 2UUAB 4M83A 1DQSA 4E5MA 4IVQA 3D6HA 3T9AA 4JKIA 1GPYA 1VI2A 2HQOA 2I22A 3WYGA 1AXGA 3PZBA 4OCZA 4JNCA 1XPRA 4XARA 4PYOA 3D5QA 2PT6A 3VR5H 1K7YA 2DWOA 1WCIA 3MD9A 2JKVA 3ZWKA 1NVVR 1OTXA 2JFYA 3D31A 1G20E 1RYFA 2YVQA 2NAFA 3MUOA 4IHJF 4LGMA 1D1PA 3KLBA 4UE6A 4IYJA 2G7MC 1ZK0A 2NT4A 5GADl 4LOAA 3Q2OA 3IURA 1YKSA 2WT9A 3HXLA 1C9YA 1XTVA 5FORA 4YUXA 1B2RA 1JFRA 5JLJA 2R6GA 1BX3A 3W7VA 4V0SA 3O2JA 4HV4A 4PC1A 5JXJA 1ZIDA 3M3PA 2G1UA 1P7ZA 2JBAB 2JH9A 3L0CA 1DRWA 5JAUA 5BSFA 4Q15A 3T7DA 1J8VA 3CZPA 4BYMA 1NY6A 3DOCA 4RIGA 1G8SA 1Z7EA 3DC7A 1EVZA 5IK2A 3P7MA 1CQIA 4LDZA 2YHSA 1M33A 4YMLA 1EE2A 3TRIA 2YOGA 3FSGA 4GRAA 3FWZA 4LHSA 4C87A 4KQGA 1LFAA 1J1UA 4I50A 4KI0A 2ZBQA 5EQFA 1GDTA 3EA4A 4HLUC 5BSWA 1ZYUA 2QTTA 2YV3A 3H9EO 1UPCA 2NU7A 1V45E 2LCFA 3LT0A 5GV8A 1NHGA 1FVOA 2XJ4A 1X0VA 3H42B 4NPHA 1T3LA 3U3OA 4UZSA 2XCUA 3RUPA 2WG1A 1KI8A 3VHLB 2PLWA 5HZMA 1MORA 4ALNA 2NSDA 1YV9A 4ZZIA 3U7GA 5JSUA 2YCBA 2HXYA 5T8KC 4ABTA 3WSTA 1A7AA 5IARA 2PWBA 3THSA 2HFKA 4WFIA 2ZRIA 1JAHA 5DWDA 1B41A 4ZYUA 3TQQA 1JECA 1BXZA 2XUZA 5C37A 1WB9A 1VMIA 4MCAA 3WADA 3VU9B 1G0NA 4JLVA 3AF4A 1PK7A 3IUBA 4P83A 3I64A 2HU8A 2JFBA 5BR4A 9LDBA 1PFWA 2G77B 1V8FA 4AF8A 1IHXA 2DR2A 4D6YA 3WLFA 5JAZA 3KD2A 4AJOA 3EFBA 1VSUA 1H0RA 3FWNA 5EMLA 3ND6A 1E1QA 4LCJA 3GLIA 2GAFA 3FSEA 4KO3S 1FRFS 1E1RD 2NZ2A 4YRCA 3DD5A 4ZTZB 1JDPA 3TD6A 2QM3A 1GKYA 1P75A 2VXOA 3DUWA 5JCJD 4RZ3A 1SOWA 1L3BA 2VPTA 4LC1A 5A3SA 1S2MA 2HO4A 3NP9A 4RUKA 1E99A 2QTWB 2Q1YA 3EVFA 4F46A 2XUDA 3OIGA 1Z0JA 4AJEA 3OZUA 4DZZA 4BKOA 4HWGA 1GTVA 3D2BA 3GP3A 2WF6A 1LPPA 4GS5A 4C6TA 1ORVA 3NHWA 3ZD8A 1T2EA 4E7OA 3ZZMA 3RS0A 3T5MA 3ZIAA 2Q2OA 1AK9A 2N75A 4OF4A 1G8FA 4IDBA 4M87A 5D85A 5TPZD 1GYPA 2VP0A 3AL3A 3ONFA 4EY8A 3R3WA 2G83A 3QVWA 2JLBA 3PDJA 3BXXA 4BMOB 4TQ9A 4E14A 1EFVA 4A03A 3IOEA 1EDDA 2AJBA 4MK4A 1VLVA 2QM7A 4KXYA 5JDCA 1KZ9A 5K3AA 3NZEA 2I3DA 2QE7A 3AKDA 1UXJA 2EDAA 4HLDA 2UYGA 4TWBA 2J30A 3NJ8A 1QSGA 4YJ3A 3NEJA 3IDZA 1X8XA 3R5SA 3TMAA 1VE1A 2EJTA 2D2FA 3ESYA 4G5XA 2EHDA 4KHZA 3A37A 3CUUA 4REQA 1L1FA 1C9NA 1LF5A 1ZK4A 4JEHA 2YBEA 3RWBA 1B15A 3HB5X 2WB4A 2ZSHA 1EGMB 1XDBA 1PIWA 5GJVC 1YZNA 5K3FB 2FSFA 2J9ZB 3VC1A 4EYGA 1LPOA 5G2OA 1Z26A 5E95A 2IXTA 1V2GA 1B0ZA 2EFJA 2BFEA 4X7PA 1H1TA 1X8JA 1Z3IX 1CZHA 5D84A 5LXTB 1TO6A 2DFDA 5IVKA 3SC2B 3U48A 4U3JB 1KEKA 1VTKA 4MQUA 4AY4A 1PKEA 1F60A 1IE3A 5IK2D 1PRYA 1Y4UA 3PFCA 2JLCA 1SBHA 3GELA 1DC8A 1K8XB 4JC4A 2H85A 5IBQA 4EB3A 1O0CA 1Q0LA 3TLEA 3DWEX 5I7FA 3L46A 1N36B 2NTNA 1RVDA 1GZDA 2ZJ8A 2IS1A 1VIMA 2GO1A 3AG5A 1GRRA 3KEMA 1XDZA 1YE8A 5I7AA 2V03A 3H75A 3W9SA 2PD4A 3B6KA 4ID3A 4WEQA 2AOTA 4WASA 5LQCA 3QSYA 1KEPA 2IDJA 4C3OB 1ECFA 2H0RA 2I4OA 2RH5A 2HLNA 4JP8A 4WZZA 2WK1A 4TQAA 2A1IA 1Q1NA 4Y9TA 2BCEA 1R64A 4MWOA 5K20A 3I4CA 4M9XA 2XECA 3F4LA 4OMFG 2HR1A 3Q8MA 3EXFA 3HVHA 1YUBA 3BBLA 3EZLA 4EI9A 1N6HA 5GOTA 1AE1A 1NVUQ 1S6YA 3T1OA 3U17A 5FBWB 1YRQA 1ZJYA 3GEHA 2C07A 8GPBA 5KOJB 3KQLA 3U56A 4D25A 5D3KA 1F2UB 1N5IA 1R9MA 4UM5A 2FX5A 1LVHA 3EYAA 2C4UA 2ADOA 2I7DA 2VLIA 4FLMA 1EVLA 4FS8A 4MWBA 2DBZA 3EIXA 1RWXA 3FA2A 4RZXA 5FWNA 3ESDA 2H51A 1XA3A 4TV9F 4HNUA 4BP1A 1MO3A 2OGUA 3R6LA 1EXMA 1Y5LA 2HSGA 3C3PA 3MBKA 1IAVA 4N5DA 1V6CA 3KSZO 1G4UR 3DVAB 5TF4A 1ZGJA 3CX6A 3IUNA 5C3MA 5AI0A 2YZNA 4AYXA 1VB5A 2FOLA 1L4BA 2XAAA 2RHLA 3GT7A 1K6JA 2O0LA 4M86A 1NOJA 4MB6A 3OJCA 1EESA 3QHAA 1XEFA 3INNA 1EWKA 3GZTB 1QIEA 1Y8QA 3LFUA 2E87A 1W59A 2ZRLA 3NTVA 4QGGA 4L4YA 5COAA 2QVCA 3IEXA 5DFAA 3TRFA 2IX3A 5JDIA 2XXAA 3QM1A 2AI3A 3EZ6A 4LXYA 2ADMA 5TDHA 2OEPA 4U8GA 3V1YA 3JWJA 3U26A 1U3FA 2QQFA 1A9YA 3WYCA 2PY6A 4RETA 3INTA 1EX9A 1CETA 3KJHA 2ZRJA 1GGHA 3K0FB 2H54A 1ECBA 3F90A 1G21E 3Q9SA 1D9ZA 2C3MA 4IPTA 2PUJA 5JDCC 4RA6A 4N7RA 1RABA 3UJBA 2SKEA 2XDQA 4BXOA 2QE7D 3OZCA 1ORDA 5I48A 1X7YB 1E9BA 1UDRA 4X90A 3RBAA 1LBIA 3NM6B 4L4ZA 4PZEA 4YDSA 3SDSA 1U6IA 4KGZA 1NVXQ 4HRXA 3ZDXB 3H6GA 1WG8A 3CF4A 5DBGA 2WHYA 5AKLA 3B7PA 5JVDF 2O4UX 4XWKA 3S2SA 1LPMA 2C9CA 1CFZA 2Q1UA 2X19A 3J7AC 1E3WA 4P86A 4MINA 3ZNPA 4I55B 3AT1A 3EVDA 5F77A 4JYMA 3T61A 2W2OA 1R50A 4JVSB 1Z75A 1P3DA 5KPJA 4EPXA 5ELXA 4K3VA 1TDJA 4ENQA 4HWKA 4ZVOA 3VVCA 4ZZ0A 4JYZA 4TQUS 3GBSA 4Q1VA 1ZKDA 4BO9A 3T0IA 1E3MA 3FWPA 4ZYYA 1V5IA 4LTDA 4CL2A 1N2CE 4UQPA 3GL9A 5EJ4A 2XVZA 1CYEA 1S3GA 3EEFA 3ZYCA 2DCUA 3T5PA 1OROA 3ABSB 4H3HB 2PRSA 3TCNA 1WR8A 1P1BA 3WC4A 2I65A 2FR1A 3PGLA 4H1UA 3EW7A 4RQUA 5C32A 1R18A 3R7SA 5KYXA 1BWQA 1SEVA 3LBIA 4MJLA 4PYRA 5HPYB 1TC2A 5KSWB 3GJZA 1Z8HA 1JWBB 2IUEA 1EVJA 2JFQA 3F0TA 3IILA 4JBWA 4EY5A 5ECGC 1KZ7B 5H8WA 4R1MA 3NAQA 1LPSA 2EXXA 1SVOA 1ZD2P 2HK7A 3AF3A 1JFFA 1KAQA 3GLHA 1BCSA 3Q85A 4N1AA 4TMTA 2VJNA 4G0ZA 2YWJA 5HBRA 2FJUA 2Q7XA 1Y6QA 4GF5A 1LNQA 2D1QA 5C9ZA 2PX4A 3DZHA 3BDIA 4WECA 1TIKA 1JB1A 3M33A 2ECQA 1NJFA 1W1WA 3E9MA 4Q4JA 3GRKA 3BMXA 3NI2A 4X6XA 4H7DA 3I73A 1I51A 1BEUB 1CNFA 1G9SA 1XYYA 2B6NA 2VPIA 2XDWA 5LOVA 2FK8A 3EF1A 1YKGA 1DX4A 3RVPA 4DWWA 1YCGA 5DBHX 5GZ3A 2WOJA 4V0RA 1ETUA 1DKOA 1H1LB 4RPHA 4C43A 1RI4A 3U7IA 2DM6A 3DMDA 5CM2Z 1OR8A 3TJMA 1YHNA 1FSGA 1GR0A 1ZD8A 4CCAA 3KQHA 4G37A 1E60A 4XQEA 2Q5LA 3K30A 3L1VA 2P9BA 4LISA 2ZDQA 3QW4B 2Y1WA 4TRJA 2ID7A 4LX0A 4OB6A 5C1IA 4RVOA 2ZUFA 1OU0A 3IAM6 4O2AB 4CV0A 5BN5A 1GPH1 1LV8A 3DKPA 1Y9JA 1XDDA 3JZMA 1P4AA 3IFSA 2NU6B 3JQFA 3RF7A 5JDIC 1QM5A 4OBXA 3QBJA 4XIJA 2V59A 1WCXA 2PWAA 5DULA 3MAAC 3Q40A 4M7WA 3EZ7A 3A6JA 2BGKA 5B1SA 3PJEA 2CK3A 1YR1A 4X1OA 5GZ6A 5IDYA 1BXGB 3UK2A 5LMZA 1A72A 4RVSA 1XRSB 4HDQB 3GB9A 1JVBA 1JHYA 1YJ8A 4WY2A 4MICA 4PLYA 1A9XB 1DJOA 2IA5A 5ESWA 2ZT7A 1ONPA 3QY0A 1QZXA 4DUYB 3NGLA 2Q8NA 2XH8A 5CYPA 4ETIA 4A26A 2C5FA 1UADA 4EJ0A 1SCBA 2XTJA 3HVKA 3M6UA 1GRNA 3IHTA 1KRHA 4ZT2A 5HF5A 1RHQA 5CEEA 2D5BA 3K1TA 1N9GB 1POXA 2DQ4A 1Y6GA 1CR6A 1ZHHA 1B8PA 3OO0A 4ZOAA 4EM6A 1KETA 4HUTA 2QYHA 4K81B 2OTCA 1EFHA 1N9ZA 4ZAZA 3UW1A 4ZYTA 2JVJA 4TYNA 2C2GA 4LUCA 4NPAA 3E9NA 4HXGA 2HGSA 1HE5A 3HSKA 4LRUA 4B87A 3SGLA 2GNPA 4HDRB 2V7EA 1N4DA 1Q0PA 2F9MA 4AIIA 3NUQA 3FR8A 3UHAA 1WDWB 5DTMA 5FWDA 1EUYA 4LF4B 5ADWA 4D9CA 3FPCA 1F1BA 1K8QA 1YXMA 4G63A 4YJFB 2CXUA 1DKPA 1G6HA 2HTEA 3ESXA 5JD6A 5C0OE 5JROA 1BXRA 4BQIA 4YPVA 1MO4A 2EFEB 4DCJA 7AT1A 1ATIA 1BMTA 4FHGA 2WG2A 3CB4A 4DIOA 4NH0A 3U80A 5KO2A 2EKDA 4EDHA 3CTPA 2BRUC 1CY7A 3MPUA 2QLFA 4ZQCB 1NUSA 3RFCA 1XF9A 4A2WA 4YCAA 4B7CA 2Z56A 5BT8A 3PGKA 3RUEA 4G4GA 3RC8A 4FTWA 2AUMA 2WKPA 1PLLA 3HY3A 1CUYA 4JU8A 4QDXA 5ICMA 4G1MB 1P2VA 1MFPA 3I2IA 4RPGA 2RHRA 4WY5A 4YMIA 4HWRA 4PFSA 1WM1A 2CCJA 3QQ5A 4IX1A 4MKFA 4MMZB 4XAQA 4D4HA 3FOEC 2MCFA 1RWWA 3SYTA 4NU5A 4LYAA 4L3WA 3LZDA 4D0RA 3BMCA 4IUCS 1QGAA 3L0DA 5AK4A 1R0CA 6PFKA 1V4BA 5FPKA 4RZIA 4ON9A 3ZZ0A 4EUHA 1EDZA 3SK0A 4PHGA 1FTWA 3UV6A 1P4JA 3EVGA 2JW5A 3O4GA 3N8NA 4UMVA 3LWZA 3UJDA 2V7TA 1N0VC 3PE6A 4YGYA 2RGDA 3LCUA 4E5YA 1SUAA 1K3TA 2P9TA 1GQQA 2DOKA 3MSCA 4BZPA 2QPAA 3MWGA 3W6OA 4AN0A 5INTA 3D0KA 3GPDG 5K0SA 4XASA 2E4AA 3UJAA 3S8EA 2H17A 3JQFC 3AM4A 1AOXA 4DTIA 1OREA 1ZGHA 2CYCA 4WESB 2PX5A 3RAPR 2IHKA 4DNFA 3PP8A 1V1MA 2RGBA 3BL6A 3KM0A 2XKKA 1UOQA 3IUJA 1B8OA 1U31A 2CMDA 2G5GX 2CK3D 1QS0A 4QLOA 4N49A 2A5YB 4IV0A 4WOCA 4EFMA 3H1BA 5LYJB 4DGQA 1RVV1 4R71A 5F3DA 1PJ3A 2P6UA 3A1EA 3FYUA 2FJ0A 3P5BA 1OI4A 3DONA 4LJYA 4HRAA 4UJ3A 3EIUA 5AHRA 4RACA 3WGQA 1JR3D 5DNEA 5BNWA 1C1YA 2NU8A 5B2EA 4I08A 1K7SN 1I7DA 3WMGA 1U5BB 1WA5A 2YQZA 4MPJA 4G8CA 4OOEA 3ZUGA 4TKZA 1QF6A 1W75A 2Q5QA 3H2HA 2H18A 4KQWA 1MRZA 3FYTA 2OCLA 3G2JA 3Q98A 5EJ8A 2IXBA 2YYZA 3AETB 4S05A 4QTTB 5LLTA 2ZWAA 4KBGA 3EFOA 4X1KA 1XIVA 4HUQA 2GVZC 3B60A 2H4FA 1RPTA 3A6LA 1UDAA 2LD4A 3T12A 3CSUA 1YI8A 4MV0A 3GCDA 1THMA 4X3PA 2NO9A 3W7AA 3A70A 3EGDA 4X65B 3IUPA 2BBSA 2WKRA 4UVHA 2WMDA 2ORWA 2WT4A 1RJ9B 3IELA 1L5LA 1JKJB 3W2EA 3W90A 5JBNA 3GLVA 4C0AC 3HXQA 2UZ1B 4XFDA 1QOQB 1PWEA 3PTLA 4EKEA 1Y3HA 1IONA 4EUSA 2B9EA 4V0LA 2QMZA 2W2XA 4JT2A 1Y80A 3CNQS 4L1KA 5KUTA 1D03A 1U7TA 1ZD1A 1N8TA 1P5HA 3RU9A 1R37A 1V11A 2GNAA 5EXPA 2E85A 3VTAA 4A15A 3LVQE 1RWVA 1N1EA 2ZRGA 3O38A 4A82A 2L0XA 3DF9A 3W6UA 1EK1A 5KWEA 3H5IA 1E2JA 1R88A 4N0EA 5F4BA 5ADVA 4RTMA 4PS0A 1CF9A 1E5LA 2ZVQX 4AP5A 1ML3A 2ZQZA 2XNDD 1D4OA 1QTIA 4G23A 1TUBA 3HCBA 3ND5A 5ARDA 3WGIA 2H2HA 821PA 1NV9A 1TPYA 1QH0A 4WXRA 4HQRA 3EEIA 4RHEA 3AESA 4WOPA 3WL3A 1JKXA 4G9EA 2J33A 3UXYA 5B55A 1KMCA 3AHJA 1SD5A 4FVTA 3N0RA 4JOQA 4TL9A 1DU4A 4MPRA 5CT8A 2WSSA 2BEUB 3IIIA 1RLJA 3VOBA 3TLJA 1QU3A 3G49A 5LLSA 4X6LA 3ZJ5A 3SHWA 2C5HA 1IN5A 1JQ5A 2FDXA 2Y76A 3CLRC 3CLRD 3W5VA 4F4DA 5BORA 4LTNA 3RJZA 2AFHE 2E6KA 1EBUA 3MYRA 4MRMA 2VP6A 1QXSA 1ORIA 1W88A 5F1OA 4KN9S 1FBTA 2V7QA 1SKAA 1UKEA 3JTMA 5F5LA 5G1NA 3WBKA 1AURA 1UFKA 2HSDA 5LP1A 2F59A 1DTEA 4B43A 4X60A 3W2TA 3AHHA 3O4RA 1MQ8B 1D2RA 1X1CA 2NM0A 3OETA 4DRXB 2NSYA 4F2WA 1YIAA 5ICFA 1N2ZA 5CXXA 1H85A 4K9DA 3DJFA 4ARSA 1FUIA 3ZHSA 2BGRA 3RKRA 3JWIA 1DRKA 1HKHA 2HREA 3UJ8A 1Z2DA 2CL7X 2VIIA 3NETA 4LVNA 4F06A 3G0CA 4IDAA 2RGNA 4CI9A 2TRSB 4TVSA 3EULA 3NKFA 3TPCA 1MJ5A 4MVJD 3FYUC 1C3OB 1NVKA 4E07A 3G2LA 1BCRA 3QX7A 3PR2B 4DR2B 4BC0A 1M8KA 2RKOA 5EMMA 3K73O 5JS2A 2XBMA 3DD1A 1CZUA 4I2NA 2R2GA 1WLSA 1P91A 3GC6A 1F2VA 2AOWA 3KT0A 1CLUA 4JFRA 1SCDA 2H4WA 4N6NA 4R5MA 4Y18A 1FTNA 3NGXA 3BC1A 3CR3C 4ND4A 4XB2A 3MJVA 4YJDA 1GPAA 1CVRA 3OPMA 1QYRA 2C1EA 2Z6UA 4PPGA 4DCNA 3ZDFA 4UHCA 2DQYA 2DC1A 4IJVA 3NOQA 1GTRA 1PDVA 3NXSA 4DT1B 1OBVA 2MIIA 3CJTA 1K9VF 1NIJA 3R5TA 1YDWA 2XCLA 2YMPA 3I0ZA 4FZVA 4K1XA 5LA6A 4EA7A 5A06A 2PUBA 1F8FA 1GUFA 1EINA 3JYPA 4ZRDA 1TYAE 3G1WA 3GO4A 1YL6A 1KTVA 2P6PA 3IJEB 3IXMA 4JR2A 5HM6A 4DR1B 4BFZA 3QIVA 3O1IC 2YC4C 2BPOA 3WKBA 4FOSA 4CTOA 3I4LA 4GX1A 2QE6A 3RS4A 4FCTA 4J76A 4O2AF 4PF1A 2A9QA 4LFAB 1BKDR 3HJCA 4MIEA 2ZQ5A 1K6MA 2OMKA 3SXUB 5CEJA 5H3HA 4ZC8A 2P69A 3TNFA 3NDRA 1EQUA 2MSDB 1CIJA 4HXFB 4G0YA 4DLPA 1D4FA 2XOKD 4A6PA 5CJ2A 4H9GA 4O4HB 2X1LA 4WBNF 4GXQA 2HZ7A 4HYYA 4QQFA 3PF8A 3JQQA 1BC5A 4PHTA 2B34A 3SKXA 1XZMA 1GG5A 1TYDE 4RH1A 1YRYE 1CPYA 1IL0A 1ZUNB 1UXGA 4GR5A 1ONBA 2IEGA 1EBBA 1M2VB 3CURA 4O8CA 2XMQA 3KSUA 4WKPA 4RD4A 4Y1FA 3HTXA 4D98A 4LFBB 3UB2A 1ZOSA 1F2TB 1WY7A 4TVOA 1ZIOA 1Z2AA 1I2ZA 2ZE7A 3B1VA 4FHCA 3PQ2A 1JDBC 2B5WA 3R0QA 4RK5A 5SY6A 3SCZA 2QJOA 2UZ3A 4H27A 4Y6RA 1M6EX 2OFWA 1FVHA 5FOVA 3SZUA 4ZDJA 4QJ5A 5JD4A 1HG1A 4R7ZA 2V1XA 5EHZA 1I7PA 2OCYC 2HD4A 2DETA 3G6KA 2ZYSA 2W70A 3BCHA 5L40A 4LKOA 5A2GA 1Y4ZA 4AZSA 4Z7OB 3ZD7A 4YRPA 3IPCA 4FYYA 1IMOA 5LUBA 5DT9A 1C81A 4NENB 1JEAA 4XVUA 2H2WA 1ZD5A 1EWVA 4LJ5A 1YFZA 2YN4A 1NDQA 2LE0A 4RVCA 1XXLA 4X44A 4OYHA 3RU2A 3PFIA 1XX6A 1RYDA 1NF8A 2D5IA 2XUJA 2PSEA 1KSHA 4KWEA 3S68A 3U19A 1QHHA 3TG2A 4F5EA 2JFNA 1X1EA 4CM9A 3MWEB 2GUGA 4XDYA 1Z4QA 3HRIA 4B81A 2RGNC 1L7QA 4TTJA 2W8ZA 3GJ0A 1O96A 1FRQA 4F2GA 1E1YA 2HCBA 3ELBA 3IH5A 3RQIA 1WXHA 3F5QA 4G65A 4B46A 1G41A 4KP7A 4O4LA 5KSZA 5LP6F 1C5KA 1MW9X 4PGGA 4ZAFA 3UWPA 1AF7A 3OZIA 4O29A 5EP1A 5GV7A 2YWRA 2FAXA 4QT0A 5KSYA 4C3ZA 3COYA 3PIRA 1G4HA 3KWFA 4RTKA 4S35A 1XU7A 5FBQB 2CL0X 3AM3A 4UUPA 4ZWNA 2ZT5A 4HB4A 4EPVA 2AN3A 4AX4A 3I5UA 4RDXA 1ZZGA 3BMQA 3RG8A 3GLQA 1QHEA 1IZYA 3PITA 4JAVC 3WSWA 1QP7A 4ZO8A 2GRUA 2KQUA 4ARUA 4C0WA 2I78A 4XIIA 3Q7EA 3RLIA 4DCCA 2F43A 1Z12A 3VZPA 3M9LA 4EFKA 2B30A 4DSNA 5CDSA 2IV2X 1XOIA 3IT0A 5IVDA 2ZWMA 1CP3A 4Y1RB 1RI2A 1N92A 4HNQA 2XWJI 2QN8A 2XDAA 4QOHA 4C14A 1UJ5A 3E0QA 4Q6WA 4U63A 5D7NA 1QHFA 1QZUA 2OD2A 5K1ZA 2OAEA 2H5IA 1S1MA 3F6RA 3I37X 4KYIB 5I8PA 3IUSA 1F9AA 2NZVG 3AVYA 2FN7A 1LU9A 4BNFA 3PLNA 4F71A 3LO8A 3FNGA 4LOKA 2QENA 1A88A 4U7HA 1FQWA 1TUGA 4YFYA 3VJKA 1HYEA 1QAQA 1KVUA 3LDGA 4Q4AB 2X6RA 1Z0KA 1NURA 1QE3A 1CQWA 2QPTA 4K6OA 1TA9A 5FRDA 3TIFA 4RSGA 2AR0A 5DHQA 4LQDA 5T3UA 2IOFK 2ERXA 3JAWA 3NCTA 4QEZA 2QPOA 4RJKA 5U4XA 3KKEA 5C1PA 2D74A 4E08A 3ZWVA 2C04A 3ITKA 4Q7QA 1U1CA 3AF2A 3ENNA 5JATA 3ZI0A 2XVYA 4JCCA 4W9MC 1DAEA 4B3SB 1T0PA 2SNIE 1BTOA 1MB9A 4BL5A 2F3UA 4JVMA 1V5EA 1X38A 3BS4A 3NVDA 2D1RA 3EIEA 1CERA 1AA6A 2FZ5A 3F7TA 3DLTA 4CKWA 5EQJB 2FSIA 5F21A 3QJYA 4PYLA 1UEJA 3DDSA 2JAPA 2OGTA 3DZKA 1L5HA 1FYWA 1DTWB 2DECA 4NAHA 4O4JA 2H31A 5CNJA 4L0DA 1W2HA 5JMTA 3DHWC 2OV8A 4QECA 2PV7A 5ALWA 5IT5A 1UT5A 3RSZA 3ZLBA 3ZCVA 3U3KA 2NAPA 2LCQA 3NQ41 2BM9A 3D7LA 6ADHA 1OI3A 5EWLB 4YS6A 4UBMA 4YCNA 3G0HA 3O4IA 1C0PA 4K03A 4HNTA 3NBZC 5JU6A 2PSDA 1CY2A 1PR5A 2QAGB 3EEQA 3I23A 1O9HA 3T4PA 4G0QA 4EKDA 1T0HB 4PG6A 1VI6A 4RZSA 1ADFA 1JEEA 2Y27A 3ZHCA 1ZNWA 2VHQA 2G5TA 2IEBA 1NJ1A 3E7XA 4PPFA 2H7CA 4KE8A 2B8EA 4MSUA 3S8MA 5LPNA 1YZKA 1CUIA 2O14A 1IHUA 3BWVA 4P7JA 3R74A 1XD2B 1XZGA 1JG3A 3NWBA 2WYIA 4FN5A 4J3FA 4E31A 1XZFA 4PAQA 2F3PA 3DPIA 3NONA 4JX8A 1W0JD 2GM9A 4PSAA 2QJRA 4MQBA 3ORHA 4D8VA 1OYWA 3BCSA 1DBRA 1O6BA 1R0YA 3EE6A 2YZ7A 3OCUA 2N3ZA 3VYRB 4PO8A 1I14A 1AN0A 4W1QA 5KJEA 3MJCA 2FMFA 1I3NA 2VDLB 5C8YB 5JI2E 3W5IA 4GOMD 3IP7A 3CH6A 2YWXA 2B1RA 2WAOA 4JQCA 2OL4A 4B4WA 3FTQA 4E2XA 1JXOA 4BEWA 4WKCA 3BQNB 4NHEA 3U3DA 3LGXA 1H65A 5BOSB 2W4MA 3IQHX 1W46A 1Y5RA 5MDHA 5B3LA 1M1YA 4DYHA 5AJHA 4HQLA 4XTRA 3Q7QA 1DHTA 2ZAIA 3HA2A 5AOVA 3FY4A 4CDNA 1FFXA 3VR3D 5T3YA 2Q6OA 1DCTA 3C6QA 3HI6A 4HGPA 2AOXA 5E4TA 4F60A 5EJFA 1ULTA 1FP4B 2Z2YA 4BFSA 8LDHA 4C7JA 2QW0X 4P4LA 1S02A 2ZROA 5TB5A 1WP9A 3N8GA 2HRZA 1NQOA 3WFJA 4M8NE 4WINA 4IQGA 4P4NA 5FUMA 4PYMA 5AUOB 5JT1A 2FSPA 5EWMA 4U7DA 5BYJA 2NUPA 4HTFB 1KI9A 2JGAA 2XVAA 3D02A 5E3JA 4DLKA 3FUWA 1KSFX 4MTCA 4DRZA 1X19A 3CVUA 4QQNA 1MJFA 1UZAA 1ES9A 4KXVA 4CIAA 1GTJ1 2WRZA 1FUYB 1MOZA 2V6FA 4C2TA 1KC1A 5A3RA 1R4MB 4N6OA 4WK0B 1R9GA 2FFAA 3OP4A 3QUQA 4UD2A 5IMSA 2Q3FA 4B3GA 3GD5A 2NXNA 3CLUC 2X41A 3D3WB 3VU8A 4CQJA 1HT3A 5FOTA 1J21A 4NBNA 4Z7JA 5LN1A 2ZATA 3ESAA 1X74A 3DTNA 3L43A 3ILYA 4KUEA 3HVJA 4R4JA 4KDCA 1B93A 3NWOA 2J3JA 3L5KA 3FYSA 5ALOA 1FY2A 1OBOA 4BUCA 1FYVA 2B2CA 2JJ2A 2RHBA 2OA0A 4P36A 2XCSB 2N46A 2I87A 2VLBA 2Y77A 1XE3A 4EH1A 4QARA 1U99A 4MVJI 4QOGA 1YE5A 3H3JA 2KHZA 3OQ1A 2FZVA 2GKGA 3PENA 2F64A 2OMEA 3CNLA 5J59A 1EUQA 2OT3B 4KUGA 4IEEA 3VZRA 2BCJQ 3GMDA 1FS6A 5CGZA 5EQDA 1U1DA 3TUIC 3NDIA 3MT8A 3AFNA 2B5VA 3DVQX 2AN5A 1FNMA 2V0GA 4YT5A 3EPHA 4H0CA 4NCBA 2R6HA 5C7OO 3IDFA 2WNSA 4P7KA 2CNBA 1BMFA 2R8YA 1CUBA 4KPGA 4NK4A 4PXYA 2PRZA 2Q5CA 1EIZA 3MT7A 4I1SA 3KLMX 5G3YA 3UT6A 3S2EA 5I7SA 5KQMA 2NPOA 1QTRA 1USKA 1JXQA 3FFTA 1K92A 1B16A 2HJVA 1NKTA 1NZFA 3HV0A 4B47A 3ESQA 1J2EA 2OV3A 2O4CA 1XP5A 3RFXA 2F8LA 1Z8NA 4ZEWA 3ZBTA 4EW6A 3CWZA 1W5AA 4QTYA 2IS4A 2G9RA 1IJFA 2VG8A 5BO5A 1E2MA 3MOSA 1JU3A 2M6SA 1WMBA 1RJGA 3R4CA 1Q14A 3AC0A 5FADA 4HL6A 4LI0A 3L4SO 1YL5A 1K7FB 2PBZA 4TRRA 2HLHA 2R85A 3GJYA 4TKVA 4IQ0A 3RBVA 4ID9A 5J2UB 3SPXA 3ZOKA 2QBYA 4FYMA 1H9CA 3GVCA 3UUGA 1K89A 2JIQA 3R0JA 1TB4A 2ZBDA 4IX9A 2V5VA 1FZQA 1S8OA 1VCNA 3I4FA 2W00A 5ITZA 1XPJA 2ORIA 4PG7A 5JAPA 1N6LA 2F1HA 2ZYWX 2Z8YM 4R1LA 3AEUB 1HT0A 5C7LO 3EA0A 2ZJOA 1YBVA 2YN2A 3R77A 2CNDA 5CPFA 2WT8A 3WYEA 4DLNA 5IHPA 1NBOA 3I58A 3UENA 1QPZA 5LB4A 4EAAA 2VNHA 2BEVB 3R6WA 4K6KA 3S28A 3T7TA 4ZI2A 2NQ8A 2QM0A 3O4JA 4QDKA 3ZH2A 4ENTA 2WJYA 3MRTA 1CW2B 5BVGA 1CUDA 1KJYA 4NCJA 3W2HA 4FCWA 3FYHA 3WBBA 3BD6A 5A5VA 3UCEA 1WUHS 1XEXB 2I99A 3PQCA 4LZLA 5D7BA 4BNXA 1TQ8A 4FWIB 5THKA 1G291 3B53X 5AVSA 1KRXA 2VHCA 1E61A 1RCUA 3KLOA 5BNIA 4DSAA 1ZHFA 1HETA 3SVZA 3PPVA 4XWWA 4FEYA 1BO6A 4MGEA 4RW0A 5IT4A 4INJA 3RKUA 1VYTA 8ABPA 1K2WA 4LBVA 3G9XA 2WM2A 1DT5A 1T1RA 2PKYX 3ES9A 3LHIA 4TXJA 2OGZA 3IXLA 1KI6B 2FKNA 4WEOA 3PKJA 4RA9A 2B9VA 4BLPA 3U6KA 1NX9A 5GONF 4F7WA 3FCEA 5TPWB 1I1HA 1L1RA 2I2FA 2OM2A 3IT1A 4JQOA 1T13A 3S4YA 4MUXA 3YASA 4H18A 3NNSA 5D1NA 1U2QA 2A0WA 2QDKA 4QVIA 3CV3A 1H23A 1L5SA 1VMAA 2ILTA 2OB1A 4HX5A 4W7HA 1Q12A 2OV6A 1G42A 4TYYA 5JSZB 4ACAA 1QRAA 3CKKA 4LV8B 2ZCJA 2RHWA 1AF4A 1LDEA 1UDCA 3O4FA 3R4VA 2JJYA 3E15A 3H3XA 3S40A 4BUJA 4URYR 1X13A 1SZJG 1JR2A 1SNYA 2CJWB 4IZIA 3JX9A 4L75A 4W5JA 4WW0A 1KKUA 2I1WA 2ONCA 5IAAA 3G7UA 3VM6A 1OXVA 1VLQA 5B3KA 1GUYA 1JIJA 3ZV4A 2QAIA 2IODA 1WHTB 4YDHB 1IWBB 2CL5A 1JX6A 4NFLA 4MTLA 1G0OA 2BZSA 3TKLA 1RXCA 1HLPA 1GU1A 3CX4A 3OZTA 4KKXB 3PE3A 5B2ZA 4MCIA 1KBOA 2OAP1 4IXDA 1Z88A 1M7BA 2I03A 1NX6A 2GM5A 2PUWA 5L3ZA 2JAOA 2C2YA 3TAUA 2DFKB 3D4BA 3ZH9B 1XCPA 3SNKA 5AW0A 2MSCB 3LXMA 1NJ6A 2AC4A 1SVUA 2YZMA 3V2HA 2M6KA 1HTBA 2C1ZA 2IV3A 3NYQA 3CINA 4TOIA 1XN4A 1FFSA 1I3MA 2X58A 4N7MA 4PQYA 1WF3A 4GWKA 4P3PA 3CRVA 5AI6A 4EYQA 5M5BA 4LSGA 2J3DA 2BCGY 4ZALA 4TKLA 3T3PB 3H9CA 3DBRB 4FGKA 4IILA 1ULAA 4P35A 1OQAA 3ZGLA 2WD8A 4KOEC 3TTYA 1XZ8A 2IQIA 2QL6A 2GPNA 5IF9A 2OQRA 4Z4QA 2HXSA 5G3ZA 2GKOA 3AWIA 4YMSA 3EIOA 3FCAA 2WDZA 1C29B 1A7KA 4RD6A 5KYNA 2I67A 4FD2A 2JBHA 1JEOA 3PZRA 5KAPA 4AB1A 4DWJA 4EJMA 5JCPA 1JNXX 1SA0B 1KP9A 4WK6A 2ZZNA 3GX1A 3G5TA 2G28A 2YN0A 4N0DA 1Z8DA 5BXYA 4FFRA 1E3IA 2FEXA 2RK4A 4N76A 4HQOA 2OHGA 1G6KA 3E3NA 5A9SA 1IXYA 1QE5A 2LVBA 3D8BA 4YRDA 2AGVA 2E82A 2VHUA 1NQXA 1YONA 3BTUA 4Z53A 2WUEA 2UXCB 4HEQA 4RLSA 4YUYA 2QP3A 3L4EA 4XIGS 1OH7A 1XALA 2PM8A 2BFBB 4IQFA 3HDQA 3TQFA 2G06A 3I6MA 3IPLA 1L4LA 2F8SA 1BRTA 2GZAA 5JOQA 3MQFA 2QW8A 1YH3A 3OQPA 1E4EA 1W34A 1VJRA 2BFPA 2ZIUB 1O7JA 2BGLA 2EFDB 3I2GA 3LCCA 4NOLA 1FDOA 5DEIA 4V0NA 2GF2A 4ZV7A 1F7UA 721PA 2QUKA 1NMYA 2Y1GA 2HMWA 3AERA 4YRKA 1DP4A 4B3JA 1A8QA 5CVEA 4FWTA 2AMFA 2ZIVB 5GVSA 5JNLA 2VH1A 4NZYA 4TXNA 1SBQA 3U5TA 1G3QA 2DLNA 3NYWA 4LS3A 2AYXA 4XCQA 5DX1A 3M4JA 4CNBA 3SQXA 1SPXA 3UWMA 4WWHA 4GMGA 3R6GA 3EBLA 4D81A 5L8VA 3PDWA 4US1R 4LNAA 2BHLA 4DQVA 2K6GA 3PE4A 1KJNA 4II2A 1T4GA 2QTVB 2ZUSA 2C9MA 4CTJA 4D97A 4AY5A 1QO0D 2MMGA 2QD4A 4MGHA 3V97A 4RENA 4Y2YA 3FBTA 3WKCA 3UGKA 2DU8A 3P0JA 5IXSA 2IEYA 5KU7A 1G60A 2I7TA 2TSYB 2VA9A 2WPNA 4LECA 2C5GA 4LXUA 4DQUA 3RVJA 3UMRA 4EMBA 3AVQA 3HNPA 1L6IA 4UMEA 1Z45A 4NMWA 2WHRA 1NQVA 3O2NA 3TK1A 2CJYA 5AK3A 4BWYA 3ANXA 2VHJA 5A1TA 1FJHA 3DHVA 4G8JA 5HF8A 2PTHA 3P71T 3AO0B 3FUTA 5AJTA 3GCGA 4ZOLB 1CDDA 5ALRA 3IA7A 3ZU5A 4DV7B 2O6LA 5IJWA 3DHNA 4FOPA 1S3IA 5JIBA 1COWD 1GTMA 3DNPA 3WDSA 4II7A 4LG1A 1P2DA 5CK4A 1YJBA 2GBLA 4JP2A 2L2QA 4ZYLA 4UTVA 4L07A 3EZGA 5C53B 4ZQGA 4MKXA 5IKPA 1P39A 1TK2A 4RVHA 2BLNA 4QGSA 2X77A 3KWLA 1APBA 3PJGA 1II8B 4Y6SA 3IEUA 3MTGA 2WYVA 1KMHA 1T4CA 2R0QC 5AVVA 4REQB 4C4AA 2VN8A 2Z83A 2O8DA 1H3FA 2EGUA 2A5JA 1O94D 1UM9A 3FTEA 1P19A 3QA3E 3WNCA 4ERNA 3KXDA 4ME6A 5CA0A 1KEZA 3I0NA 2ASEA 2J31A 2IE8A 4L72A 1QYIA 3AOEA 3EIQA 1RYYA 5A3JA 2A92A 2XMCA 4BAGA 4FM9A 3RU7A 5AJVB 3D0RA 4OJMX 2GHRA 2GYVA 1TJ3A 2A84A 5ALVA 3QELB 3FZGA 4BNDA 2HA3A 4KIJA 5AWFC 4TLCA 1SZCA 2IY9A 3KQOA 1E89A 1A27A 1WQ3A 1WU7A 2APJA 5FTWA 2ZPAA 4B7XA 2OB2A 3AKCA 1EFAA 3BL5A 4QFCA 3A4IA 5CVVA 4G5SA 2EBWA 3LQRA 3WRYA 4CLRB 3FCOA 4A3SA 3VPSA 1EFPA 5JZVA 2E5FA 4RTQA 2E4VA 3G2HA 4NVRA 2H6EA 4QE3A 3JTEA 1OZAA 4RH3A 5B1HA 3J81k 1RWBA 2XUAA 2JGRA 1UXIA 2PMEA 1G63A 1JNYA 4BGEA 1TCVA 2R68A 1QDLB 2VJMA 4YJHA 4FGWA 1BE0A 3WKAA 1CDEA 4IIGA 1P80A 2RI6A 3ZW9A 2VF8A 3GFQA 4BPBA 3ONVA 2FY8A 2ZW9A 3W79A 3ZCRA 2ZANA 1BU8A 1P0FA 2J0UB 1SHLA 3EXFB 3KKZA 5F1KA 3WBFA 3R5KA 4IDFA 1OXKB 5BMVB 2GPSA 4P4SA 2OHOA 1KZHA 4BQRA 1OWPA 1YVUA 2EW1A 3OZXA 4CKEA 4EPTA 1T9CA 3V7NA 4YRRA 4ZQBA 1QAOA 1OX4B 3PQ4A 3PDIA 4FI3C 2O07A 1OH8A 3PSAA 1IULA 2YDYA 1Q0HA 4YWHA 5KVQA 3WV5A 3X1JA 3FTFA 3SQOA 2W2NA 4LF8B 1OILA 1X14A 1FLNA 3SS7X 4PBSA 4F96A 1L3IA 1YCDA 3NTUA 4IQ4A 3OUUA 4N54A 3W4KA 3ZHOA 1I6WA 4EUKA 2FCAA 3CBGA 5I9BA 5CB4A 5ES4B 5CCDA 3KSBC 4OQNA 5B58C 2FEPA 1H1DA 4HFNA 2ZVPX 4LF9B 2WTUA 3ISTA 1TJPB 4IDDA 4MP6A 3RBXA 1NXQA 3DOHA 1ABEA 3RHTA 3SE7A 2BBTA 5AVQA 1ISIA 2FZCA 1QH8A 4FYVA 4Q19A 2O3JA 3N2YA 4QL3A 5G1PA 4CG3A 2G4CA 2GETA 3SICE 3ORYA 2QVYX 2RG7A 3OZRA 4LQLA 2W2LD 1L5WA 4AULA 4EZEA 2GBLC 5JRDS 1YAJA 1UP4A 4HOYA 5JLAA 4IUBS 1NSYA 2WE8A 3R40A 4BFUA 1RZRA 2C3YA 4Y30A 2II6A 2X5KO 1R0XA 4YP7A 1ID8A 2ODQA 3FZNA 2OR3A 3CNNA 5DX8A 1E18A 2H7VA 3ZVRA 2VJBA 2O2JA 1EGQA 4LA4A 3T9DA 5FEUA 4J2HA 3DZDA 2Q46A 4A10A 1Q7CA 1GU0A 5CLIA 3L2OB 2X3FA 3B8HA 3EXG1 5CFRA 2HRBA 3PNBA 5HIIA 4IHAA 4L6CA 4L3OA 3VOAA 3U0BA 1KYIA 1E3WB 3GZJA 3AOEC 3BRWD 3NFRA 2VAWA 2KS6A 3ONWA 3PXXA 4I36A 3TGPA 3I5XA 4F9TA 5JANA 5CT4A 3EY9A 3CNBA 3C97A 2AEMA 3R9XB 4DCMA 5I7VA 3KAJA 3EWNA 5DHFA 4YMTA 1ETHA 3H9GA 4RAQA 1SVIA 2X5XA 1XDGA 2GN8A 3WLOA 1IN7A 1M8FA 1FYFA 1Z4PX 5AI4A 4LCEA 3IAEA 4QKQA 3ML1A 2ZRPA 5AM1A 2XWBF 5G1OA 2ZSKA 3T3MB 3WRYC 5AM2A 3N6VA 3QXSA 1ZN2A 4YR7A 3R0VA 4ZEMA 4MITA 1IYZA 5FFNA 2NVOA 1H22A 1QGED 4YB8A 3IP6A 1WS6A 1N32B 5LQMA 4H7EA 3RIEA 2YY6A 2WUDA 3PFFA 3SJUA 3NMUF 1GR1A 4CN8A 5U1PA 2A35A 4GSKA 3GD7A 3X2FA 4BTLA 4DV1B 1XTTA 1VHQA 2ACVA 2NUTA 5A7GA 4D80A 3P9RA 3OU7A 3UHFA 4JBLA 4CIWA 3F6PA 2A6PA 4YASA 2VUIB 4O3FA 3AR6A 2F1KA 4LSZA 3B5IA 3A3PA 4DNOA 2FPIB 1C2YA 3R7AA 4DW8A 1OXMA 4LFCB 3WA6A 1U7DA 2BMWA 2E4UA 4J4BA 4PCVA 1IK4A 2B3TA 3GRYA 3Q7PA 1NTRA