2IV3A

Crystal structure of avigt4, a glycosyltransferase involved in avilamycin a biosynthesis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
340
structure length
337
Chain Sequence
b'PLKVALVNIPLRVPGSDAWISVPPQGYGGIQWVVANLMDGLLELGHEVFLLGAPGSPAGLTVVPAGEPEEIERWLRTADVDVVHDHSGGVIGPAGLPPGTAFISSHHFTTRPVNPVGCTYSSRAQRAHCGGGDDAPVIPIPVDPARYRSAADQVAKEDFLLFMGRVSPHKGALEAAAFAHACGRRLVLAGPAWEPEYFDEITRRYGSTVEPIGEVGGERRLDLLASAHAVLAMSQAVTGPWGGIWCEPGATVVSEAAVSGTPVVGTGNGCLAEIVPSVGEVVGYGTDFAPDEARRTLAGLPASDEVRRAAVRLWGHVTIAERYVEQYRRLLAGATWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYLTRANSFERASE
publication title Insights Into the Synthesis of Lipopolysaccharide and Antibiotics Through the Structures of Two Retaining Glycosyltransferases from Family Gt4
pubmed doi rcsb
source organism Streptomyces viridochromogenes
molecule tags Transferase
total genus 105
structure length 337
sequence length 340
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2iv3A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2iv3A01
1XKXA 2G9RA 2FF5A 4YI5A 2QRQA 3CEMA 4CTOA 2GPNA 3DZCA 2GM9A 3L7AA 3OKAA 2AMVA 3OTIA 2QRHA 4AMGA 4L22A 4MHSA 3S2UA 1VGVA 2ZB2A 3QHPA 4YI3A 3Q3IA 4MI6A 4KQMA 2JZCA 1WUTA 4HLNA 3QKWA 2GPAA 4F9FA 1JEJA 4MICA 4XI9A 2PRJA 3S27A 5TVGA 1FTWA 1QKJA 2F3PA 4N3BA 3DDWA 1NOJA 3GUHA 2GJ4A 3ZCVA 2C9ZA 1PN3A 4LEIA 3G2KA 3O3CA 2XCUA 3D1JA 1IIRA 2R66A 3TSAA 3CEHA 1XL1A 2VG8A 4N9WA 4RIEA 3ZCSA 1EM6A 3T7DA 2C4MA 2ACVA 1P4GA 3HBMA 1K08A 1FS4A 2R60A 4CTMA 2AW3A 3ZCRA 3H4IA 3VUEA 2ACWA 4X7MA 2PYDA 4RBNA 1P2DA 3RT1A 2JLBA 3TOVA 3MRTA 4GZ5A 3OY7A 3AMVA 2IV7A 3SYRA 4REMA 3COPA 3NB0A 1IXYA 2X6QA 4GZ3A 3MTAA 2SKEA 3MRVA 2QN7A 3CUWA 1QM5A 2XA2A 2YJNA 4X7PA 2QN9A 2O6LA 2X0EA 3ZCTA 3BD8A 3MS2A 1WV1A 1WW3A 5TMDA 2HY7A 1SXPA 2SKDA 4F97A 4EL5A 3DD1A 2X6RA 2QRPA 2AV6A 4HWGA 3BD6A 4BQIA 1EXVA 2GPBA 4WHMA 3E3OA 1L5WA 3G2NA 3G2IA 5IKOA 1C3JA 2P6PA 5I45A 3C48A 3CUVA 2BGTA 5ENZA 4AY5A 2VCHA 1Y8ZA 3VDNB 2H1HA 3WC4A 3MS7A 4RIFA 4KQ1A 1LWOA 1AXRA 3FROA 3Q3EA 2XCIA 1YGPA 1GFZA 2VSNA 2FFRA 4AY6A 3HBNA 1NZFA 1F6DA 1XC7A 3CUYA 2SKCA 3C4QA 1PSWA 2X0DA 3DDSA 2IW1A 3BD7A 1SXQA 3MTBA 3OKCA 3L01A 1FU8A 4CTNA 1UZUA 1E4OA 2X0FA 2R4TA 1B4DA 3T3IA 2IYAA 5LQDA 1Y6GA 5JTUA 1E1YA 1GPYA 3MQFA 1Z6PA 3VUFA 2R4UA 4X6LA 4EJ2A 1AHPA 2F3QA 3OT5A 3SYMA 3WAGA 2PYIA 4GYYA 3RHZA 4NESA 9GPBA 1L5VA 3L7CA 3CEJA 4KQ2A 1FC0A 2GEKA 1GPAA 3RSZA 1Z6QA 5BNWA 3IAAA 1KTIA 3L7DA 4W6QA 3OY2A 6GPBA 3H4TA 2QN2A 3L7BA 4X7RA 3CUTA 3T3DA 4AN4A 5DXFA 3MT8A 4WACA 1L7XA 1O6CA 2VCEA 2C1ZA 3T3EA 3WADA 1Z62A 4N3CA 1M5RA 1NLMA 7GPBA 2FETA 1JIUA 1HLFA 2F3SA 2JJMA 2PQ6A 4RENA 2QNBA 2XA1A 3BCUA 4QLBA 3C4VA 1WUYA 3CUUA 2QLLA 5IKPA 2IV3A 1JIVA 1P29A 3S0JA 1UQUA 4M60A 1NVKA 1RZVA 3NC4A 5D00A 4GPBA 2XA9A 1Y6FA 2QLMA 1JIXA 3HBFA 1XL0A 2IYFA 1FU7A 1XOIA 5HXAA 4Z5XA 1YA6A 4NC9A 2BISA 3G2JA 2IUYA 1GPBA 2KS6A 3GPBA 2QN8A 1NOIA 2QN3A 4LDPA 2BGUA 2XGMA 2H1FA 4EKYA 1JG6A 1C8LA 3EBPA 3VDMA 1WW2A 2QZSA 1L5QA 1PNVA 1GG8A 4NEQA 4MHOA 4MRAA 4EKEA 1Z8DA 3CV3A 1GZ5A 3BEOA 2XGOA 1H5UA 3EBOA 5GPBA 1RRVA 3E3LA 2G9VA 4M83A 3OTHA 2ASVA 4XIFA 1FA9A 2VSYA 2BFWA 3CX4A 2F9FA 2IEGA 3TAXA 1K06A 1FTQA 1A8IA 3T3GA 2OFFA 5C1DA 1XV5A 3ZCQA 1GGNA 3NPAA 3HBJA 1L5SA 2QRGA 1V4VA 1P2BA 4N39A 4N3AA 3PE4A 1RZUA 2XMPA 1L6IA 1BX3A 2QN1A 8GPBA 3NP9A 4PQGA 4RIHA 4BFCA 3OTGA 4M7PA 3NCHA 4GZ6A 3IA7A 2GT1A 5DU2A 1NOKA 3S29A 2G9QA 2AZDA 4RIGA 5TMBA 2GEJA 4BQEA 3Q3HA 3RSCA 1P4HA 1UQTA 1P2GA 1PYGA 1P4JA 2Q6VA 3G2LA 5JTTA 1C50A 2F3UA 1WV0A 3L79A 3MT7A 1FTYA 3NAZA 3UYKA 3NP7A 4FZRA 3MRXA 4MI9A 3MSCA 2R68A 3S28A 2IEIA 2XGSA 3MTDA 4GYWA 3D0RA 2G9UA 3G2HA 2ECPA 3MS4A 3MBOA 1NZDA 4RIIA 4FKZA 3E3NA 2QLNA 4G2TA 4RELA 4MI3A 3OKPA 3BDAA 1LWNA 4AMBA 3UYLA 4EL0A 3BCRA 2PRIA 2WTXA 4CDRA 1FU4A 2ATIA 3BCSA 5DLDA 1ABBA 5TMEA 5D01A 3PE3A 4WADA 3MT9A 1J39A 1C8KA 3T5TA 4BQFA 3D0QA 4YUAA 2C1XA 3ZCPA 4F96A 1L5RA 1F0KA 1JG7A 2QRMA 3T3HA 3ZCUA
chains in the Genus database with same CATH superfamily
1ZXLA 1XKXA 4NG4A 5EWLB 5K3DA 3ITNA 1GT91 1KP3A 4BO8A 4KW7A 1MB9A 2DR2A 3SE7A 1A9PA 3MM4A 1TF5A 1EHYA 4HGNA 5DSTA 3WFJA 3FAKA 3FZEA 3FFBA 3L4EA 4CCYA 1ZD3A 5CA0A 5F3RA 2JVKA 4BQNA 4DMRA 3FTEA 1BXRB 1PGQA 3KOOA 4J1TA 4KXFB 5CBPA 4GRDA 4BECA 2FXVA 3EYAA 4PR3A 1MOQA 3SEZA 3GJ4A 5IH7A 4OAOA 1VI2A 4OB8A 3EVCA 4HDCA 3LZ6A 4IAOA 3ZEIA 2YHBA 2YWEA 2WG0A 5BN3B 1ZS9A 2FPOA 4Z99A 4XX0B 5ALUA 3V7UA 3QHPA 3AR5A 1QGAA 3K92A 3TKYA 3NETA 5MFPA 2HU8A 3O8RA 2Q5OA 2HSDA 1LPNA 4JX8A 4C7JA 1GGFA 3OETA 5MDHA 2YN0A 2QQGA 1UPXA 2Q4RA 4GEGA 5JD6A 5ADUS 3DHVA 2E5LB 3H18A 4NYJR 1KH1A 5DXAA 1CR2A 3UAOA 2CW5A 2POQX 2GAJA 4IIDA 2CEKA 5T41A 1W36C 3BWEA 4HDRA 3H9EO 4P4SA 1LTKA 4BDTA 4OQDA 3DJYA 1V9LA 1VA5A 4XSVA 2BP7A 2HSZA 3WAJA 4UU8A 1C0LA 4E70A 4IQ4A 3Q6NA 1W7AA 4CYMA 2BR4A 4KKXB 3KSMA 3U7QA 4FWTA 1BQ4A 3SSNA 1DJPA 2YQZA 1B15A 4NJEB 4EA8A 4F4UA 4X6UA 4F56A 1UBHS 3HGTA 3NGLA 1M2FA 5SV2A 4XLZA 2P3LA 2I8AA 2YZ7A 3C6QA 1C0IA 3P27A 1GNQA 1EI9A 1KYIA 4D02A 1X9IA 1YR1A 3NUZA 3CVWA 3QUQA 1S2NA 1ZWKA 3JWGA 3HBMA 1L4HA 5EUCA 4AQYB 4RPJA 4MWSA 1V4BA 2CVFA 1ANKA 2NAPA 3ZU5A 2Y0PA 4D2IA 1PWXA 1ACLA 2AW3A 3BRWD 3BTUA 2WUVA 2HMYB 3NYRA 1C1XB 1UZNA 3K8OE 4X7MA 1IWOA 2AXNA 1OLSB 2HZBA 5KYXB 4IDDA 3J81k 5KQSA 1KI1A 1ISFA 5KNCD 4N0DA 1KI6A 4LDZA 3MWGA 1CWUA 3UJ9A 1N5KA 4N8DA 4DARA 3LL4A 3AZPA 4IUCS 5AI5A 3K09A 2A0KA 2ANCA 3BB1A 1CD5A 4GBMA 4J94A 1XZFA 3RT7A 3WFZA 3L8ZA 3MWDA 1CDZA 5I5GA 3GWZA 3ASZA 5HBGA 4GZ3A 1QOQB 1ZGAA 2FMXA 4FYWA 3UANA 1A4XA 2SKEA 2IZ5A 4KWEA 4Q9LA 5F5NA 2QJOA 2O1SA 3KKEA 3D43A 1A4UA 1RW4A 2R7NA 2QN7A 1KFCB 3DZFA 1HG1A 2A0WA 3E8SA 1RJ9B 2QN9A 3Q7PA 2JI8A 5CX4A 2W6NA 1M75A 5CM9C 2AJLI 2CV2A 1Z0IA 3KS9A 3TFOA 4B6PA 1QHYA 5ECWA 4EX7A 3DONA 1JMKC 3GGOA 5C4MA 1CNMA 3O2NA 4K46A 2WSBA 3RWOA 3GDWA 4RFLA 3H4MA 2FZVA 4BNVA 4JU8A 3BIWA 3QLTA 2PSEA 3ZBPA 1EU1A 1LSSA 3T9DA 3GFVA 2AFIB 3ZWDA 4BU0A 1R0SA 3A04A 4M8KA 4FOSA 4ZRDA 3TRHA 4DG8A 1CUIA 1XMIA 4NOLA 1LDNA 1ZEMA 3DMPA 4WY8A 1ZSYA 1C3JA 1MH9A 1FDUA 2G5CA 2OQIA 5DYIA 4CLEA 4DKJA 1FOEB 2GR9A 2P9JA 2Z2YA 3CRVA 3SHTA 3SC4A 1CVRA 3KXIA 3N8DA 4MJXA 5JZBA 2FW1A 4UDOA 4M6WB 4IW3B 1G9TA 1E5QA 3A32A 3AUTA 2RAVA 5DFAA 4U8HA 4Q12A 1QHIA 4B75A 2GQ0A 3B3QA 4GI5A 4JLJA 4KZKA 5AI0A 2IV2X 1ZN9A 1P81A 3KZXA 1UBOS 4PGFA 3WGQA 1BROA 3JASB 2NADA 3HYNA 4HDAA 1QGZA 2GJAA 1UBGA 3DAPA 4LJLA 1NM5A 4FDAA 4FGKA 3OZRA 3UWMA 3KB1A 1YHZA 2B4YA 1B26A 4RA9A 3WB9A 4R7TA 2MSCB 4LJSA 3EG5A 2F7SA 1JPVA 2PLNA 5EHXA 2C1EA 4IF4A 3I6QA 4PIVA 4YO7A 4TRJA 1E6WA 4BO2A 5LWHA 4ENVA 1LEHA 3DDSA 3MELA 2I91A 2ZRNA 2O8EA 1Y5LA 4RNDB 1GQ2A 1M67A 2G9NA 5LU8A 2P40A 1JHVA 4CU2A 3OKCA 5AYVA 1XUOA 2DWOA 1DBIA 4DV2B 4OMCA 2VZ0A 1FTSA 2CKMA 4L50A 4X90A 4H7DA 1C3OB 2X0FA 3A4MA 3D4PA 2MINA 3JW8A 2WMYA 2QM7A 2FH5B 3BA1A 5L4NA 1ZK2A 4V3CA 1L4FA 1WPRA 1GPYA 2QV0A 2IHBA 3CNBA 3SD7A 5F98A 2AKYA 2FA9A 1W87A 2IZ0A 2WNHA 3IL2A 1LB1B 2HSWA 1PTJA 4U0JA 3RTGA 2JLCA 3W4IA 1E3TA 5MN5A 2OD2A 3I5YA 3VHRA 4HXEB 2FW7A 1UPBA 1VMDA 4F12A 1DPGA 4CM3A 3ROMA 1I9CA 5J2TB 3BQNB 2KM1A 3JYQA 3OQNA 4BOYA 3HWWA 4IIXA 4M36A 4ZJUA 2BGGA 4BEWA 3O03A 1EBUA 1L4YA 4K9OA 3TUZC 5CVTA 5E6UA 2CJPA 2C8JA 4IDEA 2YL2A 2O54A 3K9QO 2LCFA 2ODNA 1U0SY 1WLSA 1H2WA 3JTEA 3EHDA 1XTQA 4KQ2A 4U3JA 5AM0A 4CIVA 3AL3A 1FQWA 2AOXA 3BK1A 3CUSA 1R9JA 3BL6A 2FR1A 4HRXA 1P5RA 1T25A 2HRZA 2CUZA 1PEKE 4INJA 3K5IA 3E0XA 4URYR 3WLOA 5DHUA 5AKZA 4YRMA 1YFJA 2VKTA 3K2BA 3JQEA 1FYWA 4QQ8A 4FU0A 3QVJA 1XPJA 3G8AA 4IUYA 3H4TA 1EIZA 5DRTA 4HFMA 3C5EA 4RORA 2VTBB 1U8EA 5KYUA 3I1FA 3HYLA 3AEQA 1NLFA 3LNTA 1RC8A 4OHWA 1VSTA 2EJWA 1ZIXA 2GNOA 1U2PA 2IUTA 2PWBA 1HO3A 3YASA 2B83A 1R4NB 2YYAA 4MO2A 4IHJB 3L8YA 4H31A 4EQ6B 4DC0A 2I71A 1NMEA 2C78A 3ROZA 4RTSA 3THOA 2CLEB 3CMMA 4NJOA 3GJ7A 2XW6A 4R1TA 2XH8A 2IDZA 3IXLA 1XXHE 3E7WA 1A8QA 3K0FB 4ZU3A 2QNBA 1L5KA 2GX6A 4R0MA 1TZKA 2CNLA 3OUZA 1E9BA 1JJVA 2W2LA 4Z0HO 4QO8A 4CN8A 4WLNA 5A5GA 1E1CA 4OH1A 5IKPA 3P2YA 3PKIA 4P0QB 5KYWA 1P29A 5HCNA 1HWYA 3KSUA 3RVMA 3EF3A 2EV9A 2FMKA 1XEFA 3L04A 3SC6A 2HSEA 3LHSA 1M2EA 1ZONA 4QULA 1HZZC 1XD9A 4NNOA 3KIPA 3COJA 1P1IA 3LY5A 4EVQA 2RC6A 3SDZA 2XTMA 4GPBA 5TLSA 1ECJA 2PUVA 1ZPDA 2Z9CA 3P45A 4OB6A 4HPWA 1H5QA 3W2EA 2PCLA 1KK2A 2RH4A 5FTNA 4MVJM 1YB5A 2VP3A 1MQ9A 3N8IA 2R7LA 5BYAA 5LOVA 1JEQB 5DHFA 1XOIA 2KB0A 1DDGA 4YJFA 1DV1A 2RKWA 5LP6C 3HYCA 3B6KA 4NK4A 5EQDA 4A23A 2IHJA 4J1TC 3IUNA 4AJ2A 1H69A 1ADYA 1U2TA 3L5OA 1XCBA 3WYAA 2KYRA 1YI8A 5EQTA 1VHDA 5JMTA 1A9XA 3MPOA 3TZQA 4FBLA 2H1FA 4OIFA 3ILYA 4D8WA 4LI0A 5JWHA 1LW7A 2OXRA 1WHTA 4IOKA 2GPYA 3PA8A 4G8CA 4CEHB 1EAMA 4EJSA 1BAPA 3QX9A 1C30A 3WB2A 4D25A 6REQB 1QQ5A 3DMGA 4AG5A 1E3WB 1EE1A 3K4QA 4K6OA 5K3OA 4I5GA 3VHLB 1SKYB 3FHTA 4NCNA 3VR6A 1NFFA 2C7OA 3FUXA 5IJ0B 2D54A 4ETIA 1U8YA 1CU1A 1DIBA 3TS1A 3HWRA 3FLMA 2HPAA 3H65A 3H2JA 4EIWA 3NVKI 2VJCA 3V5NA 3RREA 5LQAA 3GGJA 3ND5A 4F4DA 2QBYB 4G09A 2IHTA 4GMDA 3WBKA 2IEAA 3C7DB 2Q1TA 3ZU6A 5DBOA 2WI8A 5GM2A 1N2CE 2N1BA 3EGOA 3QIAA 2ONZA 4HDKB 1REQA 1W2WB 4F04A 3P97A 3DP9A 3O94A 5DNDA 3IIEA 1CZNA 2ZE8A 3NTLA 2Q9AA 3RU2A 3RYCA 2VK2A 4IV8A 1YDWA 3HCFA 1YBAA 4JBIA 3SDSA 3GLFA 1YE8A 1I5RA 2BFPA 3BMCA 1A97A 2BL4A 2D62A 2FEOA 2I6QA 4DN6A 1L5MA 3MGKA 3BWBA 3HFRA 5TT1A 3STXA 3K1JA 5ILQA 1OT5A 4EUHA 4MGIR 2UXCB 4MA4A 4RMJA 3SC3A 2LIPA 2R6JA 1YV9A 2IJGX 4A7PA 4D3YA 5K0JA 4D56A 1PUIA 1CRWG 5A6VA 3UMBA 1NW4A 5AK6A 1NC3A 1SOMA 3O4GA 4U9UA 3ZEAA 1DKPA 3UUWA 3IE0A 4HUQB 3TL3A 1KIMA 1E9SA 2NO0A 2FHPA 4I1VA 3K09C 2IP4A 3H11A 3J7TA 3Q3JB 4XWAA 3IT0A 3FPBA 2VKQA 2OG1A 2ZI9A 2MR6A 4CLXA 4BNMA 4V0NA 2PJDA 3F5SA 1M74A 3KD2A 3OM9A 1U1DA 3QVOA 4YASA 3RIYA 4Z54A 1IN1A 2PD3A 3PL1A 1PD1A 4BU1A 5B6PA 4MQEB 1Y8RA 4CQLB 4HHEA 2CHFA 4KLCA 1LBQA 1NOKA 4HAOA 1GKIA 4TKVA 3L6UA 3PEFA 2QYSA 5E0KB 2GZMA 4A6XA 3PHJA 3RADC 2PAFA 5EJ8A 2FUKA 2AZTA 4OK6A 4Z7NB 1UOOA 3IKVA 4UTXA 5J3JA 1HG0A 4QT4A 1YB7A 5IU6A 1UFKA 4ND1A 2OAQ1 4GXNA 2H08A 1XRQA 5AXAA 1E3IA 3NCTA 4RVHA 5BSWA 3GCXA 2DUWA 1U7HA 3QTTA 2H85A 2CBXA 3BGVA 1F0YA 4Y2PA 3T7EA 1YFLA 1MO6A 2WHQA 2GA8A 5KKCA 2NP7A 1QZZA 1RWMA 5H7XA 1UBUS 2JH3A 3NHFA 1BQEA 3REFA 4II7A 2P90A 4D92A 3PLNA 3HKBA 1ZLYA 5FPTA 4R1NA 1KVQA 3VU9B 3T1YB 1G6KA 1D6SA 1JR3A 1P1BA 1YI0A 2B1IA 1V7CA 2ET6A 3AB3A 1GQFA 3DC2A 4YN3A 1K4KA 4A0RA 5HKKD 4BFLA 2O1XA 4B84A 3EWIA 2ILTA 4IIYA 2VP5A 3ZZNA 4ALIA 1C1DA 2J32A 4I8IA 4D4LA 1KA9H 3EZ9A 3NTVA 4CM5A 3G0GA 3G2HA 1ZHOA 4BV9A 5AK0A 4GG1A 1NX6A 1E20A 3QXXA 1ULBA 4IOJA 4MI1A 5EYPA 3WQRA 4QAJA 3HZHA 4CMGA 3P1JA 1NM5C 2GXAA 1N1DA 3AR3A 3PCTA 4WE3A 2FXIA 2I5PO 5ALWA 5JY1A 2ZUCA 4RMNA 1SBCA 1W35A 1WKVA 2RGCA 3UMJA 3WMGA 3BAFA 1DDIA 3QSGA 1VE7A 2QY9A 2P2ZA 2WYOA 4KAAA 4LXGA 1UDBA 3GT0A 1Z39A 5EP1A 5KWSA 2NU6A 1FRQA 2CNKA 3TGWA 4EJFA 5EEHA 1W29A 2B61A 2VHZA 4GR5A 3WLJA 2XAUA 2YN4A 4KYVA 5ITVA 3F9CA 2PMWB 1GGKA 2HBYA 2V7QD 4KDFA 3LXRA 3DE1X 3VO1A 1P5HA 3B12A 4WBNF 1SCUB 4FHZA 4QTZA 3STYA 2ATIA 2VHTA 3IEUA 3P9YA 4M22A 3TD2A 1F3LA 4TVBA 5K8TA 1E0JA 4C76A 4RETA 1KHHA 1NLUA 2OP0A 3G0HA 3GD5A 3S44A 2P75A 5DCWA 2RK4A 1PTJC 3U9TA 4D98A 2HMAA 1DJOA 1OMOA 3ZV4A 1UINA 3T1VA 5ICMA 1ZBDA 5JSQA 4LQDA 4ZHSA 5JWRA 1M34E 2J7PD 3NJRA 4UKDA 3CVYA 2GAAA 1P45A 4LXIA 3ZDDA 2VPWA 4GZMA 1ZVMA 3PUVA 3ZU3A 3HXOA 3DA8A 3DKVA 3GLUA 5G3ZA 2N3ZA 1B6TA 1T1RA 4H7EA 1G4AE 2B98A 1NBAA 3FKSA 3A0UA 5AH0A 2PD6A 3AKCA 1NUPA 3U3JA 1ICEA 2G1KA 2VXOA 3UQZA 2GYVA 4NMMA 2YXBA 1UP7A 4UBJA 3ZJ5A 2G9RA 3I6YA 4HZIA 2GDZA 4R1MA 1U9ZA 4YRDA 1NYQA 2G4VA 1H4TA 4UPVA 2YW9A 3SDBA 3DZCA 5ENDA 1GKKA 2A0UA 3VJKA 4AS2A 4WERA 2FPGA 5EKTA 1D6JA 4J2OA 3VSAA 4K0KB 5TIIA 4YUVA 3BSSA 4B9AA 1KI8A 1TKBA 3W8NA 4TWZA 1FZQA 2QZ9A 4D0NA 4WFQA 1R3UA 3EJ6A 3IHTA 2Q3MA 3M6UA 2GHIA 2IQ5A 1C0EA 4NRDA 5CJPA 1XP5A 4BY9E 1XKQA 3H75A 4MS3B 7ABPA 2GAOA 1TYCA 3ENKA 2ZB2A 3B1FA 4FX2A 5IHXA 3QLUA 2BMFA 3R0VA 3KE8A 4X92A 1EESA 4WXRA 1U6JA 1T4CB 3IAM1 3QIVA 1QIMA 4PZZA 5CNKA 1FDSA 2LNDA 3RT9A 3Q6IA 4OQPA 1HH4A 2WIBA 3H5LA 1JEJA 1Q3HA 4XI9A 5TS2A 1S2MA 1EQAA 2NXJA 3R9IA 2FLVA 2OFWA 1DC3A 4FYIA 5T4HA 3BGDA 4FINA 3UJHA 2OD7A 3N6RA 3ZCVA 1IRXA 4NWIA 4KCGA 1WB4A 3H2GA 4NMXB 4DJFC 1JHAA 3MPUA 5AM2A 1V8BA 2IZ1A 1I6MA 3HN2A 1ZJJA 4AUEA 4EO9A 2CDRA 5JH7B 1L1RA 3V8QA 3CJRA 3QNUA 4P58A 4QYSA 2REQA 1NIJA 2DHRA 1PT7A 3BRSA 3GCWA 3ZCSA 2E21A 1JSRA 4Y6RA 5K51A 5WRFA 3WBBA 5AKEA 4DLLA 1FDIA 1P4GA 5F64A 4J1NA 4HL6A 2Z8YM 1A77A 1A8HA 1R4MA 2E1PA 1DOZA 3AF1A 3L9XA 1Q7TA 3FPLA 1CYDA 3D6UA 5HUQA 2V0CA 4N1AA 1KQFA 1A0OA 5CGQB 4G0ZA 2AOTA 4NKRA 3CO0S 4QDOA 2R25B 2CCGA 2IPLA 4TV9F 1NY6A 2DVMA 4L7VA 4Y6OA 5AM4A 4YAGA 5BP7A 1W36B 3KKPA 1GL7A 1QB8A 4ZVKA 4JYAB 3GBSA 3GVCA 5IVIA 1WMFA 4GF5A 2Z0MA 2ECOA 3H1FA 2PNFA 5JYEA 1W85A 1VJGA 1ZCBA 2BEVA 3SYRA 3UAZA 4EJSC 1X1QA 4QTTB 3NB0A 2C00A 1K63A 2BSXA 5FPQA 5JLAA 1NKTA 4G1VA 1A2BA 1GZUA 1R0ZA 3C0KA 3LCJA 1AXGA 3FI0A 1YRQA 4Y6LA 1RZRA 4ZOCA 4CQMA 4I7EA 1K0FA 3R6GA 4MTCA 3U1TA 2I87A 3JVIA 2JIOA 2O6LA 3KNZA 4CXMA 4FEYA 5BMVB 1YJBA 1PV4A 2PD4A 4RTPA 3KOMA 3I73A 3C4JA 1LPMA 3G9TA 4OM7A 5E6SA 3CY6A 4GFDA 3T4UA 3A0RB 3NBUA 3OQIA 5DGCA 4NS4A 2NTNA 1F9AA 1M6WA 1BH2A 2OK7A 3QY0A 4KXYA 3KL2A 4FTWA 4ZCSA 5EJ5A 3ORRA 1J5EB 1EXVA 3OJWA 3EPPA 3T06B 1CFZA 2VSFA 3CC8A 3I0NA 4FB5A 3QKRB 1YI1A 4XFKA 1VFPA 4XUEA 4M1QA 1HE1C 2Y6UA 2BMJA 2LUOA 2Z1NA 3KKQA 3KWFA 3WA7A 4IMIB 2EWVA 1AS3A 8ADHA 1JQKA 3RDPA 4INAA 3RRYA 3L1VA 4Z49A 3Q1LA 3A4VA 3FVVA 5F35A 3FFTA 1IZ9A 2Q5IA 2VH1A 4RK6A 1DG9A 3L1IA 4GMHA 5CCEA 1BGXT 5DULA 1ENOA 1M6VA 4XRRA 5JCOA 4G67A 1C7IA 1ISGA 1K0UA 3TSCA 4DSUA 5JFGA 3E9YA 3VPBA 4KR3A 4R9NA 1H2ZA 4O08A 3ZXXA 1UXGA 2XZOA 2B2CA 3Q3EA 5CEEA 2OD9A 1IH8A 2VJAA 2H0AA 5HX7A 4DR3B 3TSZA 4J07A 1A2KC 2X2PA 3Q72A 1MKYA 1X7XB 5TX7A 5IUNC 3KK0A 2PBZA 4CFSA 2BLLA 1Z7YA 2LCIA 1XELA 4B3XA 3ANYB 4PAMA 5DM0A 5A1TA 5JNLA 1GCOA 3INYA 1J56A 2RGNA 3CX6A 4G0VA 4KPYA 1H4QA 1IJBA 3G3EA 3B52X 5DCYA 4L27A 2K7ZA 2PS9A 3NHWA 5DIFA 1SXQA 1HXHA 1KJWA 1UMDB 1ZIOA 1J4AA 1SOWA 2M1ZA 3ESAA 1RLUA 2WM9B 3FTDA 3KZOA 3QU5A 4X7BA 5A1JA 5KMGA 2IZ7A 2JFGA 3E6AA 3I42A 5FHRA 3UW3A 5ADWA 3PU6A 5CB4A 3GUZA 3AIIA 1VJ1A 1W5AA 1OXKB 4QGBA 2WD7A 4S24A 5EFZA 3PDIB 4L5IA 2C98A 5IN5A 2IITA 3BWXA 3QPAA 4LZNA 4RH1A 3A3NA 5CEFA 4L9WA 4O4JB 3G5UA 4MV0A 5FWXA 4DIDA 4DXAA 2PS1A 1WULS 2M32A 4H08A 2R4UA 4M38A 4Y1FA 3W9SA 3E9QA 3U16A 2ZIVB 1AG9A 1ZGBA 3BORA 4XB2A 5BSFA 1G8YA 4UCQA 2CE2X 5F7OA 1G20A 4PU0A 3IAXA 1UDWA 3EVBA 4A0SA 4MUMA 4TTQA 4A2WA 1D4OA 1PQUA 3F46A 3R5KA 1W9HA 1A71A 5T5QA 5LM3A 2UYOA 2AG5A 1XZNA 4YRLA 3BERA 1YUNA 3AIMA 1CUBA 4XCQA 3IHWA 1JLSA 4KQGA 3D64A 4PCAA 4TROA 4XJXA 4V0KA 3T0GA 3U4MA 5HQJA 5JD4A 3M3DA 4AURA 3RK1A 2V6JA 4GKBA 2WKSA 1WUHS 4P3KA 2UZIR 2VJNA 3IO3A 4CKWA 1NC1A 4BNNA 1KEEA 2QAJA 5KC9A 2Y1EA 2ATCA 2WWRA 3TKAA 1M1NA 3RUHA 1JIQA 3QE0A 1GAJA 4DEYA 1E2KA 5AIAA 3Q1KA 1J8MF 3UW1A 1E0DA 1NGSA 2OXCA 5FQOA 3IMGA 5L6MB 3GFFA 5AI8A 1P72A 1ZUNA 1F8UA 3OJLA 3C16C 3U80A 1VPLA 4JLNA 1P91A 1UJ5A 3CURA 2H9AA 1I4DD 1Y5NA 4L6IA 4PZ9A 5EJGA 2J85A 4NE9A 1OILA 3T3DA 4AN4A 4D0RA 5B7PA 1PO7A 1J21A 2DCUA 4FZ3A 4GUDA 3T4PA 4Q6WA 4N4AA 2QG4A 3DMHA 1O6CA 3KTOA 3QE9Y 5EZ6B 3ISJA 5BUZA 5JCJD 1BTOA 5IHPA 2J31A 2YIDA 4NJMA 1DBSA 2AMFA 4MWOA 3DF7A 1CQIB 1VECA 1WHSB 3ABOB 4CTKA 3W5UA 3BILA 2PZJA 3HP4A 1J8VA 4MJ3A 5E9AA 4XVRA 2B25A 4RHXA 3N0TA 4TMFA 2O2XA 1EEHA 2RHLA 4FYYA 4Q7QA 2VUHB 3TIIA 3AJ8A 2DH6A 4CV3A 4R54A 3TTSA 1T4MA 1HEYA 1TYZA 4G1BA 1Y33E 2P79A 1OTYA 4Z7JA 1L8LA 1SBZA 3D3QA 4TMWA 3THRA 1VXRA 3BMNA 4LNAA 3R3YA 4DC1A 1B0AA 3TKLA 4RUKA 1TQHA 3V4RA 1TM2A 2XA9A 2Y8EA 3LQRA 1JQBA 4D8YA 1GXSB 4D97A 1L2TA 1WZ2A 4DA6A 1XZLA 1MABB 3WNBA 3P0EA 1B2RA 2ZPTX 1X7WB 1JNXX 1M1YE 3MA0A 3ZLUA 3OZCA 3NTOA 3OF3A 5BWOA 4JX9A 1APBA 3OZWA 2QRZA 2C94A 1ISPA 1EG2A 2HEIA 1MCZA 2VVTA 2W2KA 3QF7A 5H59A 4UNIA 3FHOA 1GCUA 3UHPA 1ZR4A 2B0JA 2GO7A 4QRHA 3K0AB 2BGUA 1AD2A 1XZDA 5LLDA 4Z51A 1AM4D 4JNCA 3H42B 3TOXA 2N42A 2H3EA 2CSXA 3K8YA 4LK3A 2XUKA 5DK6A 1KOLA 1Z22A 5A02A 1RJFA 2A1IA 2VPYA 4M76B 5I4BA 3W7AA 5FLYA 3ZBUA 3QLUC 4W5JA 5E4FA 5IJWA 1MN6A 1PNVA 1MX5A 3THWA 3TM5A 1P2SA 1QF6A 3P4XA 4OBEA 1K7XB 2BGRA 3QZUA 3JAMA 1SURA 2W5UA 4Z9FA 1B73A 1X7HA 3U3DA 2OCLA 3G02A 4BGVA 5LP6B 3OQMA 1XRRA 3V7NA 4CCYB 3AV3A 5CA0B 1N1MA 4US2R 1U0BB 1VRWA 3RRXA 5CBPB 1JR4A 3OM0A 4HF7A 3X1MA 4M83A 3H0KA 1LY1A 3EQ7A 1UKCA 4O2AA 5KQGA 1HT3A 3LRXA 4IBOA 3O8CA 4MAFA 1XYGA 1MRSA 1YQGA 4MS4A 4XGKA 4RHCA 3KWJA 2VSYA 1AZTA 4TTJA 3B51X 4P54A 1U8CB 4O0MA 2BM0A 4E4YA 1YRHA 1HSOA 1FNBA 1Z2AA 2IEGA 1Z8NA 2PN1A 4RAQA 1RC0A 2VQDA 4B45A 4UHJA 3FYSA 4GE0A 1JJ7A 3OFNA 1GZSA 4OSEA 4Y7DA 4DJDC 3H2IA 2JNWA 4C20A 1JXQA 1YCGA 2O0KA 2VUUA 4P38A 1IFXA 2CXTA 1QOZA 3RC8A 2ZIEA 2VL7A 2Y27A 1ZIDA 1TEXA 1O4WA 4AS3A 4S05A 3L92A 4HDRB 4PLPA 3HBJA 4P4SB 4YRJA 1EDBA 2P4EA 4KNWA 3N7UA 3B3GA 4KITB 1PR9A 2BP7B 3A6HA 3G9XA 1ZNQO 4B35A 4ZV4A 2HV9A 1FNSA 2HXGA 1CDEA 5TT0A 3U7QB 5CJ2A 1EUYA 4DSNA 3PA6A 1H3FA 3PE4A 4GX2A 4UAVA 1XDWA 1LDBA 4YRTA 5KSPA 3I09A 2WT9A 1U3GA 1DIGA 4LGCA 1N0IA 3SLKA 4C0WA 3ADKA 3FFWA 4ND4A 4DEVA 4RVUA 4AKIA 1JBKA 4N40A 4M21A 1P44A 3ANTA 5BY2A 1GO2A 1HLDA 3UXMA 3WIVA 4E5NA 3F6CA 4WT7A 4YB8A 5LA6F 5CJJA 4Y18A 3VX3A 1JG4A 2PZGA 3K0EA 1NN3A 5BVHA 1U1CA 3AKZA 2GFIA 3CBGA 2J6BA 1T4BA 4B7ZA 2OO7A 2RARA 2J5KA 3RSCA 1SA0B 1EXMA 1E3QA 1KI6B 4EG1A 1T2CA 2XUJA 1NJSA 4DCPA 2WIDA 3ICPA 4F4IA 4TS1A 4A92A 4S0XA 4JL5A 4MVJE 1H0KA 2FWBA 3UT5A 1SWWA 2QU8A 3FLBA 4M0UA 4H9GA 1QTNA 2WOJA 2I2AA 5AHOA 2FZKA 4IH1A 1V8OA 4C0JA 4BRSA 4BJ1A 4RPKA 4NYIR 3MWDB 4GYJA 5KOYA 1UKEA 3WQQA 3C14C 4OQMA 3ZIAA 2OOKA 5F51A 4RHYA 3NJ8A 4QXPA 4XKJA 4OHBA 4RVNA 2YASA 1E7MA 2DGDA 2R5WA 1H8EA 2E4XA 1VHJA 3RVJA 3SZUA 3CH4B 2R68A 2Y1GA 3AVOA 3H17A 3S28A 2I3ZA 4DRYA 4IFTA 4S1NA 2P3SA 1QAQA 2CWDA 1SUSA 1K88A 1J09A 2JFBA 4N5MA 3BGWA 3Q5EA 4HT3B 3ESYA 5EJ7A 5JCOC 4FM9A 3ND6A 5FR1A 4XWTA 4Z0NA 3WWCA 3R76A 2IXAA 2XGGA 3KTAA 3MLAA 4XFDA 3T5GA 1NZDA 4XW2A 4UCWA 4TYMA 1Y89A 1VJDA 1GFSA 2Q1YA 2HOQA 5LQNA 1YE5A 5EIOA 4YUZA 1V7ZA 2XHEA 2CYCA 3I9KA 2LKDA 4QUGA 4GX5A 2WFMA 1BCRA 2C31A 3DSRA 4Q93A 1WCWA 2R6ZA 2P6OA 3B89A 2JASA 1TXGA 3RK4A 4EG5A 2C7GA 1AB6A 3BHNA 3U17A 4IR7A 1EUZA 3WE7A 2RGNC 3MGGA 1QYIA 2VSQA 1MGOA 4DCCA 4G26A 4GE3A 1OLXA 1SBYA 3ONWA 4HZGA 3KUDA 3ZV3A 2Z4TA 3ETNA 3L93A 3UBMA 4LJ5A 2O6HA 1KVTA 3AY3A 3DEHA 3WDSA 4CODB 3GGPA 4KSBA 2JDIA 1FU4A 4EHDA 2OTCA 3FIUA 4JA0A 3WK9A 3AW8A 5JATA 4UHFA 1CS4C 2BE7A 2GYYA 3IP8A 4A2PA 3NMUF 5JS2A 2GHRA 4DDWA 3BMQA 3Q3GE 1T2AA 4WKGA 5TQ0A 3QYPA 5AKJA 2V5VA 3FCUB 3S1LA 1W36D 1DKLA 3AUSA 3NQ41 3BL5A 4ZK2A 2Z98A 1E2EA 2GZHA 2IELA 2PIAA 1Z68A 3DEKA 3EVEA 4RA9B 3BYZA 2X7XA 5EHZA 4C6TA 4LYAA 4XCVA 4L4ZA 1QR6A 4YUAA 1O6ZA 3MXTA 2PRSA 4GP7A 3VRHA 3Q4GA 2O8EB 2HH9A 4IIJA 3I5XA 4JZYA 2KMLA 2XMQA 4MMZB 3NWOA 4PIPA 1CHNA 4K9SA 2O3JA 3EPHA 3ZW7A 5EOVA 1GUBA 2R3SA 2XUHA 3FPFA 4N0QA 2V65A 2HWKA 2QRMA 2YV4A 3EVNA 3LYLA 3TB4A 1K9SA 4RD0A 4ZJPA 1E1MA 3LDAA 5TF0A 1WD5A 1U1FA 5E3IA 2AB0A 2MINB 2H2FA 2RHOA 4OSOA 3UPTA 3EE6A 5JEDA 1W30A 3E9DA 3GXBA 4TVKA 2QAIA 1KI4A 3D31A 3UJCA 5FUQA 3NHSA 2IYQA 4B3SB 2V4UA 1QO0A 2WVAA 3EMKA 3P0FA 4I3FA 2JLAA 4L78A 2CXQA 3ZU2A 3PNMA 1ULHA 2RH8A 3EEOA 3GJ3A 5D5PA 2WKRA 3M83A 4I99A 1U63A 2YYYA 3G49A 1FUKA 2DQ4A 3AONB 3KD3A 2JK0A 1R88A 3WBFA 1PGPA 1KRWA 3QVWA 4LFCB 4PQYA 2FW8A 3GRVA 1AE1A 1OI7A 1F7UA 1GYQA 3BRQA 5KYTA 4B3RB 2C4WA 4KTVE 1EH5A 3REOA 2JZCA 4W82A 1QTIA 2HGSA 3U7RA 3TOCA 4YQEA 3U4AA 1WCIA 1J8FA 5E6UB 1UQRA 3V7FA 2HA0A 3BJRA 3TLBA 4BFWA 5F33A 4QSMA 4HMQA 4RSRA 5GINE 5HGXA 1T9KA 1UXOA 3D4LA 3FHLA 3O3NB 4EFDA 3FNGA 4U3JB 3WIBA 2PRJA 2C88A 5F7XA 3E8XA 4JJAA 2XNJA 3HRHA 3K16A 2ZQYA 1CIPA 1BS9A 1NF9A 2VHVA 4HN4B 2NVUA 3G1TA 5B55A 3M8KA 3QE4A 1QBGA 3AF2A 3FRIA 1E9RA 5TDHA 2ACKA 3DMFA 4TL9A 3LK7A 3AOGA 1URPA 4LEIA 4G24A 2G63A 5KYUB 2C42A 2ZAIA 3AEQB 5I48A 3H8SA 4NBRA 4DHEA 1N4DA 2PX4A 1JVNA 4G0OA 1DXHA 3VR4H 3ZDXB 1B0PA 1TZBA 1BVYF 1LSOA 4IO0A 1UPUA 4X93A 4AK9A 4F7DA 1OBCA 1ZICA 1PFGA 1X1BA 4G1EB 4HRVA 4NNPA 2HCFA 2ERCA 1ZGCA 4J3FA 1EB9A 4MX8A 4UBNA 5F76A 3UENA 4DLTA 1W8IA 4KQ6A 1IWPB 1CEQA 2R60A 1YK0A 2HMVA 4HFRA 4ND5A 3MB8A 4YRPA 1KQPA 4JP2A 4S04A 1E1CB 3PNBA 3ICCA 1ODLA 2CFOA 3H5IA 3ND7A 2P67A 4IV5A 1YDFA 4P5PA 4R9VA 3NVDA 4R2IA 1OV4A 5KYWB 2PYDA 4GIBA 5CDFA 3LPCA 4LY3A 1PFQA 2VYQA 2QTAA 3QM1A 3VAZA 4PX5A 4FZJA 1TZMA 1Y4AE 1KK3A 2J5BA 4IIFA 3ZDYB 3ZQ6A 1BEZA 2V6MA 3WHLA 3FTFA 2O2GA 4AULA 2W4QA 1U7TA 5MFZA 5F73A 1XKTA 3GEGA 1Z2DA 2DFPA 3ZVNA 1WW8A 3MK31 2M1XA 5LOVB 1TVMA 5JJLA 3DKRA 2F8TA 1WY7A 4YJFB 2O05A 2OZVA 4UCFA 2OMKA 1JEOA 1QZUA 1H5NA 3K9NA 2R6AA 4HMPA 1YZQA 2HL6A 3L0PA 4OOFA 3ZXIA 2BELA 4A2CA 1QZ3A 1GTVA 3GAFA 3GK3A 1WZCA 3RIGA 3TPCA 1ZUWA 3WLMA 4AICA 3IAFA 1JSXA 3TXYA 3LAWA 4Z3DA 3D8TA 4CV1A 5JAPA 4O4HF 2OV3A 2R5FA 5JMPA 3PNKA 2MSKA 2W9XA 4JGIA 3GNTA 4YVFA 4WPGA 1WHTB 3ZWVA 4GECA 4AKEA 2W83A 2EYUA 1DKRA 3PJEA 3GVHA 1O8BA 1UPAA 1VCNA 2DTDA 3BD6A 3KCNA 3M6MD 3UKDA 4EJSB 2IEBA 2EP5A 2X8LA 2FRVA 1C30B 2QI9F 4MJ7A 1NBOA 4PLFA 2Q8NA 3G5LA 1HOXA 3RU3A 1QVAA 4CMAA 5C9ZA 2I03A 3HKCA 4JB0A 3TRIA 5GTDA 5LBTA 1RWNA 1C14A 1Y63A 3TNDA 2YWRA 3IAUA 4QYWA 2CVHA 2XYGA 3AZOA 1YJXA 3MSXA 3M6AA 2C3OA 2BGTA 3FCCA 3HLKA 1U3VA 3CLHA 3QKSA 4KVGA 3QPCA 2H07A 4K0RA 2P1ZA 5JZ9A 3OFSA 5FPYA 2EL9A 1EDDA 1QFYA 4G0YA 2APJA 1REQB 1BC5A 4TWRA 1QE3A 2JAXA 221PA 2EIXA 5MHTA 4LK2A 1GRQA 3VR4D 1DELA 1GNTA 2ECKA 3CG4A 4I66A 5KNDA 1A4RA 2YS7A 2H3HA 3KZ1E 4MRMA 3RYCB 4DDTA 3GLFB 2CK3D 2ZWPA 3LJKA 1NRJB 1PR6A 2FWPA 3KV3O 4KDRA 2GLTA 3BMCB 1O5IA 5HILA 4AKSA 2QTLA 1WOMA 1ZIPA 2WJ4A 3LX4A 5AHRA 2QPTA 2YDYA 1FP1D 1FSZA 2AF3C 3D7LA 5AUNB 2J48A 1CNEA 3BRCA 4C5CA 3ZWYA 3ADBA 1DNPA 1C81A 2LZ0A 3PK0A 4IJWA 1QIIA 4INZA 1GGMA 3MN1A 2DHQA 4FXOA 3C3XA 4J1SA 3DE3X 1AKTA 3QUCA 3K5WA 4IS2A 2JHGA 4OKNA 5IEBA 3PXXA 4JLSA 3ROPA 2BFCA 3H11B 3HXTA 4PPNA 3T3IA 5B3LA 1UP4A 3A9CA 1NQOA 2IHVA 3V6LA 2ORVA 5DN6A 2CJWA 2QX9A 3MQFA 1CDDA 5BMOA 4C4YA 8LDHA 1XLUA 3EB9A 3T9AA 1O0BA 2NN3C 4W5OA 4GI2A 2WDZA 2DUMA 1Y8RB 5BSGA 2X19A 4JJZA 7MHTA 3WKEA 5MF6A 2GBIA 3DDNA 3UTCA 4TKVB 2FLWA 4IEIA 3OCYA 1Y1TA 4ENUA 2VQSA 3GJ5A 3CO5A 3FZYA 3WLLA 2G06A 3PUWA 4LF8B 3JWPA 2A14A 3TFQA 4QT0A 4C43A 3AL0C 1DG3A 5BV8A 2B78A 1BKSB 4EUFA 4HGRA 3TCXB 1AKVA 2PUBA 3ENNA 4ETWA 1YIAA 2BHNA 2IYOA 2AEEA 3O9VA 1HE2A 1XB2A 2E4ZA 1L5VA 1V48A 4OFWA 4I4NA 3IIKA 2WJ6A 3S2ZA 2JVIA 3DNPA 3LM8A 1AUOA 4GKVA 3M4YA 2AN5A 1TW2A 3IULA 4CF6A 3LIIA 1DBPA 2FOXA 3OAAA 1GKYA 4FLEA 2SICE 4TVSA 1VHWA 2CCJA 5KU7A 2XOKA 5LIPA 2OT3B 1KAEA 2NOAA 3IAAA 3JZMA 4R51A 1EE9A 3DE5X 3WWPA 4CGYA 1U5CA 2JATA 3H6GA 3HKBB 2B7BA 5C3MA 3DE4X 2HPVA 1I7PA 1DEAA 2I8LA 2QN2A 4G0MA 4J0KA 2JF0A 4DJAA 3MYYA 4EF5A 3DLCA 2XYVA 2R9VA 3IP7A 5LN1A 5JBQA 4HAZA 1C1DB 2WLTA 3I9OA 3P8ZA 5KSYA 3K4PA 2H9IA 3Q88A 4ZAGA 1QVZA 1NHWA 1T6ZA 2XV1A 3M6VA 3KXKA 4L1KA 4UATA 1QX4A 5EYPB 1L8AA 1NKVA 1G5RA 2FPKA 1LRKA 2QAGA 3KCQA 4UM7A 4IZHA 3T7IA 1LLCA 2QSYA 4B0OA 4PFJA 4ZKDA 1E18A 3ZWNA 3JRWA 4BTVA 4YHBA 2HA2A 4PLYA 4Q9KA 1PFUA 3LUDA 4H1UA 4HGPA 5CA1F 4Y98A 2NU6B 5CDSA 4M0KA 4R0NA 3HDHA 1PG2A 3UFBA 1TA4A 3RTEA 2NSJA 3M34A 4MW6A 3QEBZ 4LBVA 5FI1B 3QW4B 4O4LA 3TZ6A 3LGXA 4ECEA 1DMSA 1S0UA 4XQ9A 2KLBA 3WSTA 4BUZA 4TZ6A 1EFDN 2G80A 4URHA 5AJHA 1J5PA 1JQEA 2J9FA 3IBFA 4PICA 4KGXA 1OY1A 1SCBA 2ZIGA 3W04A 5HS4A 2I7DA 5C80A 4L4SA 9ATCA 1RAGA 3KX2A 2X77A 4Y2SA 2ON6A 1WMBA 2MYTA 2ZFUA 3QYAA 4JSTA 3USZA 3JQDA 2Q6KA 2VEDA 4JUBA 1YKSA 4H15A 5C8YF 5CIQA 1BKDR 2P68A 2XGMA 1Q3KA 2JLQA 4U6SA 1KPIA 2FPLA 4LDQA 3ZW9A 1XTBA 3IQGX 2GN6A 3SXUA 1K5DA 2GAFA 1VIDA 2C4VA 3DLHA 2QTGA 4NBTA 3OCXA 1ECPA 2DUNA 2PZEA 1WSBA 1ZSVA 5BQOA 4RTKA 3B85A 5EIAA 2WIKA 3B9BA 2JIBA 3GRKA 1ZJ6A 2GJKA 2GXUA 5EJ9A 2YXDA 1J90A 1GZ5A 1WDLA 1YONA 2X3FA 2XGOA 1Z82A 4EFMA 3LA6A 4ES6A 4RXTA 1ZK4A 3QI7A 1YF3A 2FWRA 4QPPA 3ZI4A 4MRPA 2Y66A 4HAXA 4BNDA 1WXIA 3GWGA 2CMFA 4RE6A 2FPGB 2Q9UA 1TB4A 3O83A 3FFAA 1P7YA 1IEQA 1PR2A 3DZBA 2HREA 2GN0A 3U26A 3E3LA 3GL9A 5JAMA 1PJCA 1ZJ4A 1IB0A 1T9GS 5NLLA 3OTHA 5FJIA 1HGXA 1VJ5A 4Q01A 5L4SA 1FA9A 1OTHA 4B2LA 1VPEA 4KO1S 4DQKA 4E1AA 5DB4A 4K9PA 4D9GA 5F9HA 5IANA 1XZCA 4R40A 3GQBA 2JD1A 4QUJA 3UN1A 3PG5A 1ODIA 2GEFA 4ICIA 4XEHA 4LMAA 4NCJA 4UMVA 1W6RA 5L3ZA 3H87A 2OFFA 5C1DA 4IH9A 1LPAB 1H2EA 1XVIA 1RE0A 2GF9A 2E4UA 1EP1B 3KC2A 3FFXA 3KU4A 3MMZA 4H35A 4A8JA 4BRWA 2ZR8A 4BAGA 2GM3A 4BE7B 4EB6A 3GGDA 4P1ZA 4O8CA 3W6ZA 2I3AA 2WBLC 1JFFA 3M4ZA 3R0IA 5CT6A 3H1BA 5DW3A 3R7WB 1HTWA 3TM4A 3EUAA 2FDCA 1ZMRA 3DKPA 1OUMA 3RFCA 2QRGA 2ADFA 5SYAA 3CNHA 1AO0A 1X80A 5KVVA 1ZC3A 3UTDA 2R86A 1G3IA 2BI4A 4BFSA 1G7RA 4DSAA 4WKBA 1IBMB 2QR5A 2JAOA 1M2VA 3F5FA 4N3AA 2FMUA 3K2QA 3JPYA 4JUAA 1KQ3A 3EUEA 4ZI5A 3SQMA 1TF7A 1GL6A 2QLFA 5THQA 5K45A 4GVPA 1N78A 2Y4NA 2FPIA 2C5HA 2FOIA 2REQB 2F64A 3EVDA 3LRTA 4XCXA 3LVFO 1N5JA 2G40A 2HJRA 5FUBA 2V7XA 4L16A 1EWYA 1QE0A 3T52A 4HDMA 1H23A 3IDAA 4P6VF 4XA8A 3PEEA 3X2EA 3U3OA 2I6UA 1R4MB 2CKDA 2I4RA 1MJGA 1D0IA 4MIYA 3A1TA 4RK0A 4UHKA 5KTPA 1P2VA 2ENWA 2AOTB 3COYA 4WBXC 4K03A 3JTMA 4B6GA 4ITVA 1R6VA 1VP3A 1XDSA 3STTA 2CHGA 4IPTA 4YRRA 2H2IA 1P4HA 4IF6A 1UQTA 3ZK7A 5K5EA 2D5AA 5TQ2A 3TW6A 1W85B 2A86A 4BNXA 2BEVB 2CZQA 2ZOSA 1SVLA 1Y80A 4O8ZA 5IDXA 2HJ9A 4UEWA 4PSUA 2EF1A 4HWRA 2EOAA 2QW1A 1IZZA 1QB7A 2CHUA 2EFCB 2RHTA 1EB8A 1OBHA 1LPOA 3G17A 4PO8A 4CQMB 1N32B 3LQKA 5BSEA 1L3BA 1KS9A 4DQLA 1QP4A 1QVRA 1JX6A 2LW7A 2HQOA 3HR8A 4YYEA 2I6TA 1E2HA 1UBEA 1QQBA 3BVPA 1JPNA 2FTKE 3TWOA 5GADl 2V5UA 1I0ZA 4GYWA 4Z2YA 5K0BA 4YJGA 1HYEA 1JBEA 1WNTA 5E6SB 4PXSA 3MJHA 1JIKA 2AFIE 2BFMA 1AKWA 1RLIA 3IQDB 2H63A 3LUHA 3MS4A 3OQIB 2XUZA 2CLLB 3ZWOA 1Z7EA 2QP4A 1GG9A 1SUCA 1JYEA 1UPTA 2IZZA 4KC0A 4PLCA 2ZEJA 5IF9A 4D41A 3THSA 2I66A 3C15C 4MI3A 4XDHA 5K8VA 5I9NA 4X95A 1R8QA 2FGKA 4ON9A 1AKYA 1ZL2A 2ZYAA 1JGTA 1DAEA 4DS3A 4PG8A 1SVSA 1P5JA 1FS6A 2WU0A 3I53A 4GLLA 1ORWA 3E9ZA 4YCMA 3PDWA 1VI5A 5ESWA 1C7RA 1VTKA 1YRBA 2JD2A 3I2GA 1B74A 5EESA 5FI5A 1XZMA 1DWQA 1KEVA 4AAYA 4GXQA 4EF6A 5C5EA 2JLXA 1Z6TA 2IW3A 2A33A 2ZRDA 1P75A 2P9QA 3EWAA 4DIMA 2OY0A 5EGNA 4J2HA 3U4CA 1M6VB 1T0HB 2HJWA 3RVBA 4ADSG 3DBHA 3TLYA 4WASA 2QGZA 4R0VA 4AP9A 1O6GA 3AVVA 3GT4A 1AUPA 1PZXA 4FCTA 2JJ8A 2W2LD 3AY0A 3D7NA 1VFNA 2FFBA 3F8WA 3M82A 4DLUA 3VV2A 3WOHA 1FYFA 1E5VA 2JCYA 3KEGA 4XB6B 1EZ1A 1ACJA 1PW5A 3HJBA 5KWEA 2HIMA 1NR7A 4YCNA 1NV8A 2WTEA 4EY4A 2CB9A 3Q87B 3AR2A 1M6EX 3NFRA 4Y30A 3M1YA 3RSOA 3EZGA 1TJ4A 4BASA 1THZA 2QSJA 2IP2A 2AN3A 1FTNA 1JECA 3KP1A 3NGMA 4RU1A 2WSMA 5DI9A 4EM6A 4Q03A 2GN4A 3AFHA 2F9LA 1WP4A 2ZT5A 2ZSUA 3N58A 4ZV7A 4DCVA 3OLQA 5ALLA 3BHIA 3JQBA 1OHHA 5DNVA 2NNWB 5KMGB 1UMKA 2VPTA 1YE3A 1ZMBA 3OX1A 1Z6GA 2PUTA 4GWKA 2WD7B 2OXIA 5JAHA 2PV7A 4XGRA 2FF5A 3TNYA 3HCRA 3HXQA 4HTAA 1PX0A 1PR0A 3E2PA 4CTOA 4M9SA 5FWXB 3N8GA 2BUCA 1PZFA 1XGKA 5FJJA 3D8UA 4NZNA 4GM1A 1IHXA 1E0AA 1G60A 2GM9A 2OWEA 4IGAA 4N49A 1A95A 3RKUA 3L7JA 1G20B 1X1AA 4Y2QA 1G17A 4B5KA 4DNXA 1HDRA 1ZHFA 4WK4B 4B6JA 5IRCD 3WK8A 1YQWA 4WAUA 1R0XA 2ZITA 4B71A 4YPVA 5LJLA 3A9WA 1C29B 4EMTA 2VWGA 5FWYA 2NXWA 1OFVA 3KLOA 4QL3A 4TYPA 1Z2EA 2NYUA 4K9KA 3WISA 5CB0A 2YWCA 2XUAA 3R9KA 3T99A 4DCGA 2B99A 1RKXA 1Z0UA 2KI5A 4AZWA 4CKWB 1C3EA 3GJSA 3VR6D 4ZJZA 1VBKA 1KEEB 1IM5A 1QFSA 3F7NA 1T5DX 1SG6A 2WYVA 3WB0A 1WD7A 1Z4PX 2QAGC 3CCCA 3U7FB 2H92A 2IY9A 4RY9A 1P3JA 2PSSA 3KVYA 4MICA 4PN7A 5EPUA 4KR6A 5BV0A 4EF4A 3AQ4A 4L7QA 3H5AA 4B2PA 1HE8B 6NULA 3NM4A 3B6MA 5DTRA 4FFSA 3GUHA 1ZUNB 2IRWA 1Y7HA 1OAOA 2YIMA 3U3XA 4ETNA 5IJZA 3GFTA 3RAGA 2ZRBA 1BOOA 1Y8AA 4WOKA 3CM0A 2QVLA 3LL7A 1Z9BA 2AUMA 3UUEA 4YJ2A 4KHZA 4BV8A 1W93A 4AJIA 2XUGA 5KZMB 2GK3A 3D1JA 1TPZA 3SU8A 5L51A 1YL6A 4AY4A 3GHYA 1BXGB 3DTNA 1P0QA 2O52A 4Z0TA 2NYAA 4A0QA 4M2LA 4CM6A 2OBYA 5AW4A 3CF4A 2OGUA 2WM2A 1YJCA 5FO1A 1AO3A 3CZ5A 4NJMB 4RD3A 2ACVA 1UBMS 4II2A 4L73A 4JXZA 5D84A 1IOWA 3PENA 4MVJI 2GARA 3K6SA 4C6HA 4DR7B 4WGGA 1Y9AA 4E6EA 2O0LA 2OKCA 1JVBA 3FW1A 1D2RA 5K8IA 4ECAA 1GCGA 4Q34A 3MLEA 1L7MA 1KI3A 2M6LA 3AVTA 1JHZA 1G0OA 2UZ4A 1U4SA 1GTJ1 3JARA 4F6CA 2V7VA 2FLKA 4M0FA 4ZT7A 3VZCA 3BMNB 1UK7A 4L0MA 5B3JA 1EGMB 2PVCA 1JALA 4XVHA 2ZTLA 4US0R 4MQLA 1NU8A 1OX4A 2EP7A 3P9PA 3PXCX 2B92A 4NYIQ 3BULA 2YVAA 2PGJA 4XQEA 1J0CA 2IYXA 2QPAA 4NU8X 3JVDA 1KRHA 1CUXA 4JI7B 2X14A 3ENWA 4GPEA 4TXMA 5DTEA 4WWHA 5FUYA 1RXIA 2YJ6A 3OMLA 4RZHA 4AB1A 4CL0A 2VBCA 1CW2B 4DLYA 2QYOA 5M2QA 3KJNA 5AWFC 1Y3BE 3AL2A 3HZZA 4XYBA 2XA2A 3KPYA 4DG5A 4W6ZA 1UBCA 2W2KB 3G0OA 4KP7A 3HGQA 1AQJA 2FEAA 3BD8A 3C6BA 3PCRB 1N6IA 2J3QA 4R81A 3ZTWA 4YHHB 4EUNA 1SXPA 4OYHA 1K66A 2FN3A 4LG1A 4RJTA 4JLUA 3NOXA 1Q0ZA 5LXTF 5B2ZA 2GVDC 2W6IA 3GLVA 4QJ5A 3RC3A 1PR5A 1SKYE 1U0OC 3KPVA 3QY9A 4Y2JA 3ZJ4A 1RU3A 2NUAA 4NVRA 1JPJA 2VP0A 4JU9A 3THWB 1EFCA 4XQCA 1UCFA 2HW8A 2Q9CA 2JG3A 3GLKA 3JZDA 3SKXA 1J00A 2PUGA 1JR3D 1OI4A 1ORVA 3E3OA 4FUQA 4OJNA 5I8ZA 5BSUA 4A8JC 5ADVA 2I1LA 4O6VA 1ZM9A 4D4IA 1EWRA 4BLUA 5EAIA 2P6PA 3FF4A 5GY7A 3KXDA 4LYFA 1AH2A 4J7XA 4YMLA 2BFNA 4PZPA 1P9OA 3JQ9A 2J5QA 4LYGA 4O2AB 1UKZA 1P73A 2ESRA 2WMOB 3EFBA 3H9QA 4GQIA 4HX5A 5AVTA 2W2XA 2VHYA 4MS4B 4PIMA 3KTDA 2IE0A 2VP2A 2WF9A 3UAWA 1SHKA 2AZXA 4BATA 1LS1A 3B82A 2FZWA 1LC0A 4IICA 3DBOB 3D59A 1OZFA 3PI7A 2AIRA 2Y68A 3WKAA 4BNTA 1JSCA 1K92A 3I2YX 3NV7A 3O91A 1Z0FA 3SS7X 3P5BA 1JH9A 3ZTYA 3MUEA 1T24A 3KB8A 4YMWA 3M5CA 2BDTA 2EGHA 3EZFA 3IESA 3IOYA 3MF4A 3RRBA 4LMPA 2DBZA 1LBSA 3IV6A 4RMHA 4UQLA 3GLIE 4N03A 3COVA 2LD4A 4P98A 4R68A 5JC1A 2ZTUA 1EGHA 1U3DA 4Y0NA 4JVSB 3HR4A 3JQCA 4B79A 1UJ6A 3P5SA 3KJEA 4I6JA 3IPYA 2J33A 1LUAA 1NNSA 2OV1A 2WAYA 3KFXA 3RSHA 2PU7A 1E4OA 4K81B 1CVIA 4RANA 1RDFA 1GPKA 1WMSA 2Q1SA 3AJDA 3QKUA 2V3CC 1P9WA 4JLOA 2YFYA 3FR7A 4KFCA 4JSRA 3PEUA 3UMMA 4TKLA 1E59A 1Z6PA 3C24A 1UBLS 1C0KA 1SCIA 1SIBE 3WICA 5GAJA 2ZAMA 1B8OA 1SUFA 2RCNA 2VAXA 4RQTA 4YWJA 1AHPA 5EQFA 2XI4A 3CVUA 2PZ8A 1RLJA 3SYMA 3I37X 3QA9A 4D8VA 3FKSD 3U7IA 2AXPA 2ZUDA 2A5LA 2PWYA 3X1WA 4BLQA 4Q00A 2PR7A 3UGKA 4DY4A 3CSUA 5BVHB 3DZDA 4WH0A 2QUKA 3RSFA 2ICAA 2YRWA 1HDOA 4TQGA 1LPSA 4JEUA 3X2FA 5A4FS 1DUSA 3UT5B 2O20A 1OZHA 3FBWA 2C5GA 1K2WA 3PRHA 2JARA 1Y7PA 2A35A 2FI1A 3ZBTA 1VGQA 1O03A 4KRGA 4U4AA 4DHWA 4BNUA 5KS2A 2ZROA 5CPBA 5DHTA 3PL5A 1L1EA 2PWAA 2XE7A 1F5SA 2BBWA 1SK8A 2WF8A 4RXMA 5CLLA 7YASA 1Y3DE 2J5RA 3KYJB 3V8EA 3NTRA 1PGNA 4D9JA 4ESHA 5K4GA 1GIAA 2GJ9A 3RYIA 3OY2A 3SNHA 3VJLA 4U7DA 3L7BA 2XDYA 1XA3A 4URFA 1DLIA 1Z5UA 1SHUX 1Q2UA 2IUUA 2JHAA 5B6IA 4AZ3A 3RC2A 3CLUC 3EG9A 4YQYA 1KAQA 1R8YA 3S81A 2HQSA 4WA8A 3ERCA 4HGZA 3ER6A 2NV6A 1SC9A 4L8GA 4PXYA 4QRDA 3KLNA 3KTAB 4KQEA 1ZGZA 5TSDA 3ZV6A 4WXPA 1PJRA 1RM0A 4AU1A 1JDNA 1N2ZA 2PKRA 4AXBA 1HE5A 2PQ6A 5IM5A 3ACBA 4LKOA 4W9MC 3TCKA 3MCAA 4YR9A 2ZWIA 3KSBC 1BCRB 1WUYA 5JSUA 1TU3A 2C2WA 5C7YA 5REQA 1CYEA 2WIAA 1G8AA 4KOAA 5GGYA 2XZDA 5CPFA 3S0JA 3TVTA 4ZCTA 3IMCA 4ZWNA 4R2HA 1OLXB 3EA5A 4GLFA 3A9VA 1NMSA 1ZOSA 4GU5A 3V55A 2MSLA 3T6KA 4F8JA 1KO7A 2OESA 3QFTA 3RJTA 3I0MA 2ZJ6A 2ZIAA 4TKZA 5AVSA 2A78A 2OAP1 3UC9A 3SWWA 4JBGA 4C1BA 1CKEA 1WMEA 2MSEB 1XL0A 2J09A 2ZLBA 2VF4X 4P4GA 1QIJA 4WX2B 1XU9A 2PJZA 3THYA 1MHTA 1SCNE 3BMQB 3BA6A 4YFYA 1EFKA 5TQ0B 3TR5A 1WXHA 5FNVF 4HGYA 4BCDA 3PFBA 4ZT5A 2PXHA 3JALA 1X70A 1DBVO 4HLQB 5F5LA 1U7ZA 2HUPA 3IJEB 3P0RA 3VYUB 1BJTA 1TKAA 2WVJA 1RAEA 1B16A 1ZYUA 2VOJA 2C9MA 2QSZA 4C6TB 5JHGB 1LDGA 1XZIA 4FE4A 2GM4A 1DAGA 1T5IA 4ALJA 4BP1A 1BNCA 1EK0A 2HDNB 2ABWA 1LW6E 2EQAA 2OM6A 2FEXA 3UWPA 3C7TA 3IR7A 2AH5A 4FILA 1PVVA 4IIJB 4KNVA 4LE2A 1UADA 5JASA 5DEIA 2CXSA 4KQXA 4E94A 2VDUE 5C1IA 2PX6A 4MHOA 1TVKA 1YT5A 1Z8DA 3EN0A 1NBMA 3CV3A 4O2BF 4PGAA 1UEJA 5IAJA 1NJ6A 1WL8A 4CQMD 2A84A 1RZRD 1HC7A 2ZTVA 4UBOA 3AZQA 2CNOA 4HOYA 5K0NA 2WJYA 3BE5A 3TF5A 2B5OA 4LBZA 3AHHA 2QY6A 2Z5VA 4R4JA 5H68A 5GPBA 1OAOC 2JCBA 1G98A 1QIHA 3IB6A 4L85A 5EIWA 3SCZA 5JI3E 2VNAA 2C7VA 1F14A 1NI5A 1W0CA 2ERXA 1WQ4A 4KIGA 4RDXA 2ZBPA 4IDGA 1SKAA 2FWAA 2IUSA 3B1KA 3WAKA 4Y1EA 1QWOA 4P4NA 1TCUA 2QYHA 1ULSA 2AEFA 4S12A 1D5WA 4TTPA 5E95A 4E30A 4ARIA 1OXTA 1E69A 2XNSA 5GZ1A 3ZD8A 4E14A 5ADHA 4PNEA 5JNWA 4LYHA 4UVIA 3SJZA 1SUWA 1W48A 1OYYA 1YZUA 2JEYA 1Q11A 3LO5A 4BVKA 1LBEA 2UU9B 1CV2A 1WCIB 2XCTB 2OP1A 1BGVA 3EDRA 4P5DA 3PFFA 4LFAB 1JZQA 3PF8A 4M9ZA 4B3JA 4GRAA 4QFBA 5B58C 4WEOA 2G5TA 4B9EA 1VRCA 4DV6B 2I4OA 3UC5A 4H3KB 5BVGA 3A2LA 4OFXA 2NVUB 5IAAA 3GEMA 2RHRA 1AK1A 3DQPA 3PGJA 3V8RA 2PUDA 2QT0A 2E4YA 3H2KA 2FCRA 4C07A 4RMGA 3SPXA 1P2BA 2RE8A 5BPFA 1D8TA 2QX4A 1N2EA 4C3OB 3VTKA 1J06A 4WTOA 5B3JC 5C35A 1IAQA 3P2OA 5EJEA 4BN5A 2O5CA 3D8SA 4HH3C 4TZTA 2W93A 4JLBA 1C9MA 2WU4A 1IJEA 2F4NA 5TEVA 5LNK6 1VE9A 3HTXA 2EAUA 1KQGA 1UANA 2ZUVA 4GZ6A 3M7IA 3ETHA 1L7NA 4C3VA 2PJRA 5I7HA 4XVUA 2DC1A 4GOJA 2IZOA 4JYPA 1D4AA 1E66A 5ALTA 3FVTA 1UDCA 1U8TA 4XGQA 5BRNA 1JE1A 1LJLA 5IC5A 2XKKA 2IS6A 4XFJA 3FOZA 2HHJA 1A4IA 3ESXA 1A76A 4YP5A 5J4HA 3Q12A 1UPFA 4J0JA 4KAXA 1KKUA 2IY7A 2OB2A 3ZDAA 1S3SA 5E3JA 5H16A 1PYGA 3M33A 3DG9A 1FW8A 2AFRA 4J4TA 4REOA 3A37A 3QBJA 1OCEA 1KNXA 3LWZA 2X2EA 1H93A 1NE2A 2QJWA 2WJ3A 4K05A 4KZPA 4R3UC 2OBNA 4UUAA 3RC7A 1TPYA 4E51A 4IY1A 3HJFA 2E5WA 5FBWB 2XXAA 5BWNA 2O8CA 1FTYA 3U4HA 5EKUA 1AQUA 3X1XA 4H0CA 4PZDA 4IV0A 4O29A 4AYXA 1MF7A 1NUSA 3MRXA 4MI9A 2QM0A 4NSNA 4DLRA 1A7UA 5TE9A 4D9BA 4FX5A 3ECSA 1TJ3A 2IEIA 2H0QA 3UKJA 1E9CA 3QU7A 3MTDA 1MC1A 3FD8A 4R9RA 2JD0A 2VHUA 2IPOA 2JAHA 3JQ9C 2IC5A 2GSDA 4NQRA 1LRLA 2CJXA 2WDPA 2CVZA 3OP4A 3PXAA 1EEXB 1WTCA 1TW3A 2ZRLA 1DC4A 3CKLA 3D0RA 3WYEA 1ZITA 3ZE0B 4CLDA 4PCLA 3FOAA 4TTIA 3WLQA 4BMXA 5JR3A 4BHTA 4BAZA 2ECPA 2GPSA 1VLVA 1NJ8A 3LUPA 1QRDA 1ZSNA 2HFJA 3MOIA 1W25A 4JJIA 3AETA 2OECA 5AOCA 5ALIA 4BMZA 4XIIA 2EFGA 1ZLXA 4XGNA 3PR1A 2WA1A 2WYWA 3IUQA 3KFVA 3AGPA 3VC1A 1NT4A 1J22A 3CF0A 2XXBA 5B5SA 5EJ6A 3HKCB 1I2MA 5KKAA 3UYLA 2ZJOA 4PLGA 1Q0TA 4YFVA 4FDVA 3TR6A 3ELBA 4DR4B 4HWSA 4G0WA 2PRIA 3FMPB 1EWTA 1Q74A 3AJEA 1SG9A 3OX4A 4U1RA 5G0TA 4A8HA 1IOZA 3LWNA 4OX9Y 1JHRA 1GLNA 3TLCA 4BO5A 5CD9A 4P33A 1SIWA 3QKSB 3LFHA 2WWGA 3CWCA 3H16A 3IDZA 5CFQA 5CFRA 3EGDA 1PR4A 4RPIA 5GONA 1K3TA 1NXTA 1R5JA 1OWPA 4N5DA 4WI1A 5FTMA 2OYCA 2W48A 3WV5A 3MILA 3ELDA 3WS7A 4M54A 1B8PA 1Y8QA 1OYWA 1QGED 1MOZA 2WZCA 2Q3LA 3K35A 3QELA 2VYFA 4I50F 4OGWA 1QP7A 4DABA 2RHBA 3IT1A 4MRMB 1MU0A 2ZSEA 1KMIY 1G8SA 4G23A 1GPDG 4FWIB 3K6RA 4BNJA 5COQA 1IMJA 2DQKA 3S55A 2GN2A 2JHPA 3V2IA 4CKBA 3WGJA 5CITA 4NQZA 3PZBA 1X87A 2EJTA 2GTIA 4Z9YA 2R4QA 3KT0A 5AO9A 3ZCPA 2FMIA 4Q18A 1TD1A 4GLJA 5CLGA 3W3AH 1D7AA 3VO8A 4B4UA 4HB2A 4NAHA 1E7QA 3W7VA 5F1KA 4J3NA 2G08A 2DPYA 2I7TA 3RC1A 1UJNA 1HQCA 4YIHA 5K99A 2HU2A 3UB2A 2HK9A 5JSFA 1O0CA 2BFCB 3JV7A 4DIFA 1M73E 5ERGB 1O08A 5F78A 1VLLA 2AG1A 5CMLA 5JJ5A 2CJWB 4QPZA 1PZGA 5UKDA 3R7SA 1T0JB 1KAOA 3RBZA 3TW8B 4H6XA 5C8VA 4ZXFA 5DYTA 2MSNA 4Q4HA 3ANLA 4G6ZA 3IPXA 4RO0A 4UE3S 5CNMA 4RHUA 1HL7A 1B14A 1B43A 1DKMA 2V7BA 3T35A 4DFDA 1ABFA 1FFDA 4KJXA 3VA7A 3BS4A 1YCFA 2FZGA 2NU8A 2AOWA 4WXHA 4BTEA 4S2UA 2OQVA 2ZBRA 2O2EA 3AT1A 5D7NA 3EZ7A 2YHAA 1SU7A 3Q2KA 5JPDA 5BWCA 1EVLA 4O02B 4XVQA 5AVUA 4AF7A 3GROA 2AK2A 1CF2O 5A5EA 1W46A 3ZWCA 2DB3A 4L9SA 5AHWA 1Q0QA 4GPTA 3NC1C 2IYEA 1EA7A 3NRCA 3AO0B 3TLAA 4COOA 4XDGA 1KL7A 4L3WA 3G9QA 3HI6A 1H6AA 1EMDA 5FUXA 4N3BA 3HV0A 3DDWA 2D7JA 2OBLA 4LGYA 1CJSA 1W5FA 3VYRB 3SZOA 4TN1A 3MJVA 2GF2A 2C97A 1I7NA 4KQWA 1FLVA 1TC2A 1UKYA 1N6PA 4BFTA 1QFJA 3OJOA 2H1WA 2V96A 1N2OA 3PUHA 3LGAA 5HZMA 4UBKA 5E9JA 1E6KA 5CFMA 3OFND 3ZWWA 3ZQJA 5AW2A 3V1LA 3AK4A 4LJ9A 5JSYA 2IBSA 1T1SA 1R18A 4OAQA 3CWQA 4JUDX 1QJCA 5G4KA 4P92A 2O8VA 4JI1B 3LYHA 2AE2A 1NUHA 3L0SA 2GO1A 3V4FA 4LISA 2QAGB 1XP8A 1LSUA 3GRZA 3ZZUA 5CNJA 1ZN7A 4DR5B 4WUTA 4YV1A 1T36A 1CIJA 3S99A 1WZEA 2D3TA 4YTEA 1BWRA 1TFRA 3RROA 1PEDA 2COEA 3N3AC 4ZCMA 4FN4A 4GS5A 3ZE9A 1MC8A 1PNQA 2WSSA 4OFZA 1EFHA 2FQWA 1DVRA 1RYFA 4JSYA 4XPZA 4KVZA 4ZZ2A 3RYTC 4BZPA 4RBNA 5JSHA 1K8XB 3DB1A 5LSAA 2HWYA 2YMMA 1EUDA 1SPBS 3G85A 4QDKA 4AY2A 2W6JA 4X61A 3T54A 5F1YA 4QJBA 4BMPB 1MOSA 3OY7A 4O4LB 2Y1LA 4LVNA 3RV4A 1Z5WA 4JNKA 3D3JA 1RBQA 2EBUA 2ZYDA 5EJAA 1JQJC 4MQ4A 3OMWA 3DLAA 4DLAA 2J9FB 4MWEA 1U1EA 4RTMA 3MTAA 4OA8A 5KQMA 1LQ2A 3W1WA 4HRYA 3QEAZ 5EUMA 2JA2A 2WFLA 1E2FA 1QM5A 1ZD5A 2CXUA 1JLKA 2X8JA 3KOXA 4IEFB 2ID8A 3GZ4A 4X7PA 3ZWPA 3DAGA 1W4CA 2X0EA 2GF0A 4BKOA 2Y93A 4P36A 3JR3A 3ET4A 4EW3A 2VK1A 1EM8A 2VHEA 3PCXA 5EJMA 2YV2A 3A3KA 1KWKA 1C2YA 2IYSA 1ZU5A 5FKJA 4XDZA 5E6RA 1Q16A 4NS1A 3HDJA 1Z2NX 4PPQA 3SXUB 5KQPA 4X5OA 3EMVA 1BQ3A 1H2FA 2DTXA 1UBKS 2RGDA 3KQQA 4HPXB 4DQUA 1OGIA 2VWQA 4PONA 3ZIAD 3MMSA 4ZZ3A 4LSWA 3VI3B 5D86A 2Z5LA 3UO8B 2VJLA 3BJEA 2C61A 2I6FA 2GPBA 3IAS1 4AIIA 3G5MA 1JFRA 1H8ED 2AR0A 3HP7A 2CLIB 2Q62A 3U19A 1V8DA 2X8AA 3AF6A 5SYMA 2X0RA 2XQGA 4BNDB 3ADCA 2KHZA 1J7KA 4EZBA 1PP4A 4ENSA 2MHCA 5LLTA 3CB2A 5J43A 3RRMA 3J81A 5GVRA 3V8VA 1V9CA 2I9KA 2BKAA 1G0NA 2O06A 4O4IF 3RRJA 3G13A 3QFCA 4JR0A 4JWKA 4B6SA 4AY5A 2O7QA 1Y8ZA 5BUQA 1WBBA 1IM2A 1Z4NA 2EJVA 2QLBA 3CBQA 1KSHA 4XH9B 3ER9A 2AL7A 4X71A 1NFRA 1ENPA 1SELA 2QMOA 4AP5A 4B76A 4UOEA 2OHJA 4F38A 2X3UA 3KT6A 1HDYA 2VHJA 3IFSA 1TTTA 2PDAA 1Q7CA 3AEYA 4BIIA 3V4VB 3GQBB 3EA0A 5HK8A 1AV7A 3LY9A 2XBUA 3QHAA 3EXFA 3VDQA 1E2NA 3R6DA 2J9YB 5BO5A 1XC7A 3N3BC 3N87A 3C3AA 4N3GA 4A8JB 4ZYWA 1FTGA 3AHEA 3B6IA 1MC5A 4LSZA 5HBRA 4EB6B 5CK4A 1GEEA 3K20A 4KN6A 4MUXA 3NTXA 2JDID 4NEHB 1I30A 2DQYA 1JFFB 2VJDA 2PFGA 3HEMA 4TL8A 3HB5X 4F92B 3K70C 4H1HA 2ZCJA 1GA6A 2CBGA 1X80B 3AUAA 1TUGA 1SQSA 1OGYA 1C9EA 1BMQA 3BTSA 1M2VB 4QYXA 1J0BA 3PD7A 2OHGA 2XDQA 5KAMA 1MEOA 2IIPA 2ZSAA 3DXFA 3KPUA 1RR6A 4KBFA 2WUWE 3VPSA 3ZHXA 1RP7A 1X9GA 3AHFA 4MAMA 5E4JA 2FPIB 3EIXA 3TSOA 3VUFA 3TG8A 2PUCA 5ICGA 3CW8X 1DJLA 4A36A 2QXYA 3MHTA 1A9RA 2I1WA 4IKPA 1R0KA 4YUWA 1JB9A 1XRSB 2J67A 4HDMB 3SHFA 2QG6A 1YRLA 3ID6C 1OSNA 4X6YA 3UHFA 1DADA 1DO0A 1B1CA 1OW3B 3CR8A 3H8VA 3UK0A 2BCGY 2F1IA 3UAVA 5CB4F 1L5HB 1QZXA 2QORA 2RHCA 2XE8A 3RIHA 3O4JA 5EJIA 4K6MA 2UZ0A 4MSUA 3OUTA 2FZLA 1C9NA 2VFAA 5G1PA 1O9GA 1SUPA 3NHPA 4WRRA 4U5XA 4BP8A 2HDHA 4FEGA 4CDNA 1MEJA 2GM5A 4N5LA 1EP2B 2QRVA 1M2OA 3K73O 2D59A 1QO0D 2BZ1A 4RVSA 4Q4AA 4ZAFA 5TQ2B 3WIDA 4F2DA 2XGJA 1DZIA 4H7HA 4M1WA 4HK4A 3MCUA 4WBSA 4RZXA 1T29A 4XYGA 1TLFA 2ZS7A 4B48A 5KQLA 3EFEA 4EA6A 2HWUA 3NYIA 2Q5JA 2N9UA 3KKOA 4JEIA 1VSBA 4URVR 2I99A 3SZRA 4YP7A 4WCDA 3RBXA 1G3MA 4DIKA 3DWGA 2WWYA 3CVXA 1Z8FA 2Y99A 3WMRA 5HKAA 1MZPA 3EW9A 3Q0TA 3EGWA 2IGTA 2NZYA 1XCGB 1MQ8B 2PWZA 4MVJF 4U5QA 3HA3A 4H1TA 3GA5A 2G9ZA 2WE7A 1EBFA 5BW8A 1W0JA 1SC3A 3KO8A 4YAWA 3CZMA 3FR8A 4KACA 4YJGB 5EKDA 2ALJA 5EZYA 1NVGA 5JY6A 3IEPA 3QELB 5K3FA 4N3CA 5JC8A 2AT1A 3FTQA 1V3VA 3UOAB 4EAQA 2EKZA 2QUHA 1Z3IX 1SEPA 5DNWA 4DW8A 2FFHA 1HDXA 2VA9A 1AF7A 5T7BA 3CKMA 2IZ6A 1SRQA 1NXXA 3C4VA 2Y1CA 3CT4A 3NAQA 4GT1A 4JJKA 2AE1A 4MTLA 5K3BA 1HY3A 1XN1A 3JSAA 1JHYA 4R3NA 4R1UA 4J9UE 4UASA 5ARBA 4I1SA 1VPDA 3ZK9A 1XTPA 1ADGA 4OGGA 5B4UA 5KNDH 3F5DA 5K6AA 4DDMA 5BT8A 1CR1A 1N5IA 1GCAA 3LQ4A 3SBXA 2D2FA 3JD4A 5HE9A 1NJGA 3C8UA 3DBHB 4BMVA 4ZEMA 2R5NA 1WE2A 4OL0A 1DRVA 3QEJA 1USIA 4IXDA 4OGFA 4R41A 3SLGA 4EHJA 1IYZA 2OL4A 3GA0A 4FI3F 5AD1A 1XQ1A 3L8CA 3JAKA 1EX1A 1TCBA 4FMCB 1UJMA 4ZPXA 4K1XA 2JL1A 2A5GA 4FQ8A 3T5PA 3P19A 4U2KA 3VKVA 2WAXA 4KSYA 5CVUA 1I1OA 1ECGA 3B7PA 1DB3A 1U3TA 1Z4KA 1BH6A 2YUTA 4CRWB 2A1TR 2OAEA 3IPLA 1ATIA 1OZAA 2HA7A 1S3IA 2CY0A 1JKFA 1RXUA 1T0BA 3A1EA 3GFOA 3L0BA 4LY0A 4MUBA 1RAIA 4TTAA 5I9TA 1RXEA 4ZOLF 3ZVRA 1FP7A 1KO4A 4GSKA 4JT4A 3U4QA 4I9HA 1ZVVA 2ZSDA 1RJDA 3CF4G 2IH2A 5AFSA 2NUPA 4Z53A 3PKJA 4PWYA 4O4HA 3ZZ0A 5AUOB 1IPFA 3UOWA 4QG7A 2O4UX 2CNBA 1PR3A 4JI6B 4YRKA 3QG1A 1J23A 3DVAA 3L4BA 1NN1A 2W22A 3RASA 3J80A 2XJ9A 4O0LA 4EPXA 1XVTA 1NONA 1U81A 1D4ZA 3CH7A 2Q2VA 4UE6A 4C22A 3TG2A 3Q2IA 3TQHA 5L7TA 1FDVA 1XG5A 2AI3A 5FWYB 2J0EA 2ZU0C 4AUKA 2JFOA 1O9HA 1W581 2D5CA 3O92A 1AKQA 5G0VA 1DIOB 2O50A 1MRZA 3GX1A 4QPJC 3ME5A 3RS2A 1OAAA 1PQYA 1BYUA 2RGWA 5T8KA 3PUIA 1PT6A 3MUFA 1QP0A 1RP1A 5C5DA 3PVSA 3FGNA 2GYUA 4KBYA 2WF5A 1QSGA 4PQEA 1NSYA 1G2PA 3KKKA 5FUMA 1I2CA 4LZJA 2AGVA 1JKXA 5P8WA 4UQPA 1A8UA 1C4KA 1NYLA 3H5TA 1GDTA 4JL8A 3A26A 3C3YA 1NJ5A 4PFSA 4QEKA 1IK4A 2Q5HA 4C6RA 1GAXA 2IEDA 2PA0A 3NORA 2H7YA 4YJ2B 2RI6A 1DKOA 2FKNA 2RGXA 1FB5A 1PSZA 4KDEA 1TL7C 2V98A 4ZOAA 2ZREA 1GVHA 2C2BA 2VI5A 4GC9A 4L5CA 4EYSA 4Q4CA 5KNDD 5LWQA 1E5XA 4FOTA 1E9FA 4D26A 3CX8A 3BICA 1V8FA 4NCBA 1DIAA 2QKYA 1BX3A 4HBZA 1V8PA 4TQAA 1QH9A 3PI6A 4JCOA 2ZZNA 1PFWA 1HDZA 3FBGA 2JFYA 1SN7A 4RL6A 4RZ2A 3FGOA 1QCDA 3N76A 4AN0A 4KN8A 5CX1A 2HRBA 4AP6A 3K6SB 3NT5A 3CLRC 3RVQA 5CCDA 2CDCA 3ZWMA 4MEJA 2EKLA 3T7TA 3A2NA 4AI6A 4QQFA 4ZHQF 1CF4A 4PQRA 4FIZA 3KKMA 4FR2A 2ASEA 2DFDA 2Q28A 4K2AA 4QNNA 4E5PA 2RC5A 1VSQA 1EFAA 3JARB 3IEXA 1SQ0A 2JIPA 1Y6ZA 2OCPA 1VL5A 3IVCA 4UUBA 4DMCA 5DN6D 7ADHA 4DBLC 3FH0A 1N5RA 4DJ5X 1LK0A 4YMGA 1P4RA 3LP5A 5AKYA 1KARA 4H6VA 4IX9A 4BO4A 4ZGBA 3GDOA 3AILA 3DAHA 3D3WA 3ZWAA 2IUFA 5AKXA 4F1KA 1HYGA 1C50A 1OX4B 1XTKA 2F3UA 5BNZA 3CTPA 5K0CA 3L79A 3RVRA 4OJMX 1XE3A 3EOBI 4ISBA 4KEAA 1XI2A 3WYFA 4QZVA 2QMUA 1Z18A 4KRXA 3NP7A 1J8DA 4B3FX 2GCNA 3MSCA 5H82A 2K5UA 2AOUA 5IUJC 1KEWA 3GY0A 1L7VC 3DO8A 4MWDA 4RH0A 1Q15A 1SQFA 3MQ4A 2OORA 4ZVMA 2Z6VA 2JFXA 3EDQA 2XLCA 3R7FA 3G7UA 2NXEA 1E5LA 5EXXA 5FA6A 2JCVA 3DLTA 3AYXB 2VP9A 1NNEA 3FJ1A 1RFGE 3ONNA 4IVRA 4WIAA 3P20A 3BH7A 3L5KA 2E7ZA 1YJ8A 1ZD4A 3E5NA 3EGXA 3VTZA 2BW0A 3OAAD 5LVAA 1J9ZA 3BQMB 4GOLD 5JNUA 2Y71A 2NUAB 3QWIA 3SFVA 1ZISA 2PX5A 2XOKD 3E3NA 4NG5A 1BYIA 4TV8F 2QLNA 5C31A 3N2NA 4TL6A 4YIKA 3VR0A 4ZK6A 2FR0A 3K9CA 1OYVA 1U02A 1LBIA 3CRNA 5TC4A 3BAZA 1W1WA