2IV3A

Crystal structure of avigt4, a glycosyltransferase involved in avilamycin a biosynthesis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
340
structure length
337
Chain Sequence
PLKVALVNIPLRVPGSDAWISVPPQGYGGIQWVVANLMDGLLELGHEVFLLGAPGSPAGLTVVPAGEPEEIERWLRTADVDVVHDHSGGVIGPAGLPPGTAFISSHHFTTRPVNPVGCTYSSRAQRAHCGGGDDAPVIPIPVDPARYRSAADQVAKEDFLLFMGRVSPHKGALEAAAFAHACGRRLVLAGPAWEPEYFDEITRRYGSTVEPIGEVGGERRLDLLASAHAVLAMSQAVTGPWGGIWCEPGATVVSEAAVSGTPVVGTGNGCLAEIVPSVGEVVGYGTDFAPDEARRTLAGLPASDEVRRAAVRLWGHVTIAERYVEQYRRLLAGATWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYLTRANSFERASE
publication title Insights Into the Synthesis of Lipopolysaccharide and Antibiotics Through the Structures of Two Retaining Glycosyltransferases from Family Gt4
pubmed doi rcsb
source organism Streptomyces viridochromogenes
molecule tags Transferase
total genus 105
structure length 337
sequence length 340
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2iv3A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2iv3A01
4M83A 3RSCA 3QHPA 4RIHA 1Y6FA 2GEJA 3MRVA 2AZDA 4RBNA 1L5SA 1M5RA 1NZDA 4CDRA 2GM9A 3NP9A 1A8IA 3C4VA 2F3PA 4MI3A 4RELA 2ASVA 3BD6A 4AY5A 3MT7A 2QRMA 3D1JA 3MT9A 3S27A 1AXRA 1FU4A 2SKEA 3OKCA 1WUTA 3TOVA 3H4TA 2X0DA 4BQFA 3BCUA 3E3NA 3VDNB 3HBNA 1Z62A 1L5VA 3G2LA 2QLLA 2XCUA 2VCEA 2R4TA 1B4DA 2ATIA 1GGNA 1P4JA 3VUEA 3ZCTA 3MTAA 5GPBA 3Q3EA 2G9QA 3MTBA 1PYGA 3SYMA 3ZCSA 1P4HA 1V4VA 4LDPA 1NOJA 4RENA 3ZCPA 3DD1A 3FROA 2BFWA 2XGSA 4AMGA 3BDAA 1IXYA 5JTTA 2G9RA 2ZB2A 3BCSA 2QN1A 1K06A 4MI6A 3S28A 4REMA 1IIRA 1LWNA 4Z5XA 2GPAA 4NESA 1P2GA 3CEMA 3HBFA 3C48A 3T3IA 2AV6A 4AMBA 5IKPA 1FU7A 2XGOA 2HY7A 2AMVA 2VSYA 3MTDA 3TAXA 2IEGA 4CTMA 2SKCA 5ENZA 1UQUA 2QNBA 4L22A 4GZ6A 3MBOA 2C1ZA 3OTHA 4N9WA 3BD7A 2R60A 4MRAA 4N39A 2R4UA 4M7PA 3Q3HA 2IEIA 3WADA 2C9ZA 1GG8A 3C4QA 3VDMA 4EL5A 3NC4A 3CEHA 3NB0A 4XI9A 4BFCA 3OKAA 1FTYA 3OTGA 2G9VA 2H1HA 1UZUA 3L7BA 2PRJA 3L01A 4WADA 1E4OA 2H1FA 1P4GA 2KS6A 4YI3A 1E1YA 4X7MA 1GPAA 2BGUA 4MICA 4F96A 3OKPA 2FF5A 1QM5A 3T3HA 7GPBA 3T3EA 1SXQA 4EL0A 3Q3IA 2PRIA 2XA1A 4EKEA 2YJNA 4CTOA 3RT1A 1JIUA 1H5UA 3G2KA 4MHOA 3E3OA 3S2UA 3ZCVA 2QRPA 2PYDA 2IV3A 2PQ6A 3BCRA 1F0KA 4MI9A 1XV5A 2IYFA 3VUFA 1L5QA 2VCHA 9GPBA 5I45A 1C8LA 1WUYA 2F3UA 2QN9A 3BD8A 2GPNA 5TMBA 1HLFA 1NOIA 4X6LA 5BNWA 1JEJA 3GUHA 4N3CA 2X0FA 4XIFA 4F97A 1LWOA 3PE4A 1O6CA 4GZ5A 2IYAA 2XCIA 3G2HA 1L6IA 3UYKA 4KQMA 1Z6PA 4MHSA 2BISA 1FU8A 1SXPA 1EXVA 1XOIA 2X0EA 4GYYA 3OTIA 3MS4A 2FETA 3S29A 4GPBA 3EBPA 3L7CA 3T3GA 3NAZA 1KTIA 4EKYA 3BEOA 4BQIA 2Q6VA 4WACA 1C50A 4PQGA 1JIVA 2QN8A 1L5RA 4RIIA 1NVKA 1XKXA 1RZVA 1L5WA 3GPBA 3CUVA 2GT1A 1JG6A 1UQTA 2JZCA 1XL1A 1C8KA 4GYWA 2QRQA 3CUUA 1PSWA 4CTNA 4KQ1A 3SYRA 1JIXA 3EBOA 3WAGA 4HWGA 2XA2A 5IKOA 1RRVA 2SKDA 4RIGA 1WW2A 3IAAA 2XMPA 2QN3A 3G2JA 2G9UA 1GPBA 1GZ5A 2F9FA 3NPAA 4FKZA 1FTQA 2BGTA 1F6DA 3CUYA 3MS7A 4NEQA 2IUYA 2R68A 2XA9A 2IW1A 1P2BA 2VG8A 2JJMA 4M60A 3E3LA 2X6QA 2C1XA 4LEIA 1WW3A 1NZFA 3L79A 3G2NA 2QN2A 1NLMA 3T3DA 2QN7A 2X6RA 1GPYA 5DU2A 5DLDA 1FS4A 3MRTA 1C3JA 1RZUA 3RHZA 1K08A 3ZCQA 4X7PA 1ABBA 2JLBA 1GFZA 5DXFA 3DDWA 3TSAA 2P6PA 3MSCA 1P29A 3S0JA 6GPBA 2QRGA 5D00A 3HBJA 3T7DA 4RIEA 1Z8DA 5JTUA 1J39A 2FFRA 2QRHA 1P2DA 2GJ4A 1FA9A 1BX3A 2R66A 1L7XA 3QKWA 3DDSA 2PYIA 5C1DA 3AMVA 4X7RA 5TVGA 3IA7A 2F3QA 2F3SA 4QLBA 1YA6A 2GPBA 5TMEA 1Z6QA 5HXAA 3OY7A 4N3BA 1XL0A 2XGMA 4YUAA 3COPA 4GZ3A 4WHMA 4YI5A 3OT5A 5D01A 1WV0A 1WV1A 2C4MA 1NOKA 4HLNA 3CUWA 2QZSA 1FC0A 4G2TA 3NCHA 4RIFA 3D0QA 2ACWA 3CEJA 2VSNA 4N3AA 1JG7A 1Y6GA 4AY6A 3ZCUA 3OY2A 2ACVA 1XC7A 3G2IA 3WC4A 2O6LA 3CX4A 8GPBA 1VGVA 3ZCRA 3O3CA 3MS2A 2QLMA 3CV3A 4NC9A 1Y8ZA 2ECPA 3CUTA 2OFFA 3HBMA 4AN4A 1PN3A 4F9FA 4BQEA 3NP7A 3L7DA 1EM6A 3L7AA 3RSZA 5TMDA 1FTWA 4EJ2A 3MT8A 1PNVA 2IV7A 3DZCA 3T5TA 3MQFA 4KQ2A 3MRXA 3PE3A 5LQDA 1AHPA 2QLNA 2AW3A 3H4IA 2GEKA 3UYLA 4FZRA 2WTXA 3D0RA 1QKJA 4W6QA 1YGPA
chains in the Genus database with same CATH superfamily
1MHTA 4XD7A 1T9GR 4AWAA 2FMTA 4YYZA 1BS1A 2ZUFA 5C81A 5DGDA 1OIXA 2PKXA 3MRVA 1RM0A 3P0HA 4I5DA 2WJVA 4Q7JB 4Z8YA 3VOAA 3ZLBA 2AYXA 2PT7A 3V4PB 5EEGA 1MW8X 3P0IA 3QYPA 2VJBA 1W36C 4JUFA 1JSLA 1RTTA 1ZQ1A 5JWHA 2Y1LA 3EVGA 5B7NA 1ZRSA 3F97A 2FPWA 2W8ZA 5CA1B 4MI3A 2J4CA 3PD0A 5BQ3A 5ALXA 3K32A 3ZVLA 2RCNA 4JB2A 1UXKA 4NIMA 4V0LA 2FR1A 3R9IA 2PVPA 3DOOA 2B3TA 2CDBA 2RONA 2JL1A 3DQQA 3BRQA 3E6AA 3OE5A 4MVJI 5DP1A 3EX7C 1RAHA 2YZNA 4XWTA 3R3UA 1WUTA 2W0SA 5EWMA 4A9AA 3OHMA 2PZAA 5CU7A 4Z1MA 2WB2A 1I2DA 1F20A 1E20A 3G9TA 3I62A 2ZATA 4K88A 1HMYA 1WQ3A 1C9JA 3AZQA 4BMCA 4EMBA 4R9NA 4HFRA 1ZZEA 2W4IA 1MIHA 4PVCA 4HX5A 1N6KA 4D0NA 4MWCA 3BB4A 1KU6A 2OSVA 1JJFA 4EG7A 5KQSA 4B48A 4BKMA 5EEHA 1A2BA 2Y1WA 3CW9A 4BTLA 4OSEA 1ICIA 4KK3A 4HVLA 4XR9A 2DJ5A 3G2LA 1W0JD 4EEZA 2MYPA 3F5FA 3HKCB 1ZISA 3GFPA 3QPDA 4O1MA 3O90A 1M2KA 1IUNA 1UBEA 2WZCA 3EZLA 4II3A 4UAGA 5T3UA 4DCUA 1XMQB 2ATIA 1L5HA 4R71A 2Q3CA 4BTEA 3MTAA 3NM6B 2YINC 3QPWA 2HU8A 2WFAA 4ZALA 4HNSA 4S24A 1Z28A 4HNGA 1K0FA 4YRTA 3BMNB 4D98A 5K0CA 2YIDA 3K0FA 2VXYA 5LKAA 1O08A 2FR8A 1CUDA 1X19A 4U02A 3DD1A 2DT8A 3Q6NA 3TCKA 4Q3AA 1ZVMA 3AF1A 2F67A 4YHBA 3UJPA 5J9FA 3WBKA 5IP5A 2OHFA 4IHJB 3PFKA 2AH5A 4L9WA 3HI4A 1RQXA 1I6MA 4JJIA 5AJHA 1MO6A 1UBCA 4ZJUA 4ZHQF 4PG8A 4COOA 2TSYB 2PY6A 3CVOA 1DBRA 3H9GA 4JY7A 3BMCA 4JUDX 1LDMA 3A1DA 3W1VA 3CEMA 1N8NA 4UNSA 4EJSC 1KI3A 1E7SA 2GZRA 2YWBA 2UZ1A 1P73A 3L2OB 3QRWA 5FO0A 2CXOA 4E5VA 1W30A 3QVTA 1FU7A 3PHBE 2BJVA 2C9OA 2R1ZA 3O2JA 5D1NA 1RBYA 2L18A 1O1YA 4DSZA 5BMOA 3SK0A 3I28A 3QVOA 4BO9A 2WQ6A 4M9QA 3GGCA 2EFJA 4WH0A 1KO8A 1ZNZA 2IHUA 4XASA 1D2RA 4PXYA 4QUGA 5TQ2B 4OMCA 2ZDQA 2BEUB 5CA0A 1ZJ4A 1U28C 1GCOA 4ZJPA 5BN4A 2QLTA 1SBZA 2OD7A 3HA3A 3HA7A 3Q6MA 4D9NA 2L19A 5L4NA 1ULZA 3ILSA 5F1YA 3UMRA 1U7OA 3BD7A 1HZZC 1NN1A 5CB4B 3I9FA 1JSZA 4I1RA 1DQYA 1NBME 1VE5A 2OY0A 3O0TA 1JBKA 3FNHA 3OM0A 4DRXA 4WAUA 2ALJA 4MJ7A 3AM3A 2IHZA 3W8RA 1GGMA 1PR5A 2GN6A 2VI5A 4HMPA 1V5EA 1RJWA 4R2JA 5AXDA 3OD5A 2BMWA 4R05A 4BNJA 4EFDA 3C4QA 4MJ3A 5H3CA 2OQ2A 1LVUA 3C24A 1UKYA 2IGTA 4ESVA 5C8ZA 1EIZA 1JFRA 2G0TA 1S2NA 2SCUA 3KEOA 3TCNA 2K2QB 3DFMA 3L7BA 1E60A 4Z4EA 5L53A 3I30X 3OZCA 3TLJA 2JGMA 3LPLA 1UJ6A 1PKXA 4Y6PA 3VO9A 3U39A 3BHMA 3M33A 4DG5A 5MGNA 3VVCA 5DNCA 1HE8B 3H18A 2CWWA 4BNHA 1XEAA 1RLJA 4C07A 4HZUB 2BMEA 3GEDA 1SD1A 1USWA 3KM0A 3TD6A 2VRBA 3QBJA 1QYRA 1USUA 2XWQA 3AUAA 1FUKA 3NX4A 1XVAA 4Y1RA 5ECWA 4CKCB 4C7OA 1RS0A 2GDJA 2FOLA 4DG8A 5E3JA 3RPEA 1RZ3A 4QVGA 3KJEA 4CLEA 1SXQA 1ZVJA 3K0KA 1IN6A 1ZUWA 4N0PA 1B26A 2XUPA 4RACA 3RVDA 4E88A 1V11B 1DXHA 2YV5A 3GLHB 4UE2A 2HGSA 3CZQA 4EZEA 1U7HA 3H9UA 1A76A 4UJ3A 3GCGA 5ECYA 2Q2QA 3R5XA 5K8VA 1FMJA 2L2QA 1FFHA 3MLAA 2XRFA 4Q7QA 3ES9A 1TL7C 3KKQA 3QV2A 3X1ZA 3ZWBA 4EYKA 2FTKE 1U2GA 4GX1A 4TZ6A 1B8PA 1EDEA 1XDSA 4WNCA 1OA1A 1W6RA 1L5QA 2DSNA 2ZVQX 1AHHA 1P5RA 2O8VA 2VCHA 3BJEA 3HV2A 3LGSA 4KGZA 2WF5A 5I45A 2J31A 2YV1A 1R27A 4P4UA 2V5UA 5SYNA 2F3UA 1UC5B 3E7PA 5L6MB 1Z8NA 4BAGA 3PKIA 4PFJA 4LQDA 1FFWA 1HLFA 4KVZA 3FTCA 2J3MA 5DPMA 1NKTA 3C3EA 3LBIA 4GKKB 5JAUA 3I5MA 3V1LA 5JRJA 2XIQA 2P5TB 3WDLA 2FZCA 4IIUA 1ULTA 2I2WA 1CT9A 2JFFA 1BJRE 4IXWA 1AN9A 4TTPA 5HFAA 2XCIA 3ZE6A 4D9CA 4UOZA 5JADA 3MXTA 1W0KD 1QR6A 3QUQA 1X9GA 1S5PA 3ZVNA 1GV0A 1TU4A 2XY4A 1QHFA 1I1NA 5AW9A 5LA6F 3VR5A 4B3FX 1OGJA 1Z6PA 4TLAA 1D2AA 3T3MB 4DA8A 1TEHA 2CF5A 1Q92A 1HZJA 4RL6A 4BNFA 1UXJA 4HH1A 5BYKA 1U3CA 4CT4B 3OQMA 2JLCA 3MVEA 2A9KA 1MOSA 2DE0X 1NLZA 4Z2YA 3NIBA 1M72A 4QBFA 2OKGA 2BCJQ 4IDCA 5JO0A 1U7UA 1O57A 4YTEA 1KC1A 4GQBA 1RWXA 2EIXA 2ZUVA 3OCJA 4ROSA 1RZRD 3TUJC 3NMUF 1XLUA 4GQAA 1JI3A 4TMFA 1XR3A 3HBAA 2J45A 3P26A 1L5RA 1T8PA 1ZJ6A 4QG7A 2Q7OE 3ZTYA 5I7WA 1E1CB 2EP5A 1AZSC 4BCBA 3B1WA 3D1VA 2B20A 1A7AA 2C8KA 4AX8A 3WMRA 4K6MA 1NBAA 5LBTA 2J3IA 5ALNA 3MYYA 2Q1WA 1CUSA 1AQJA 2ZR7A 3AZOA 3CUVA 4KQKA 1GU0A 2YJGA 3I01M 3S1LA 7REQA 3O8NA 4KR3A 4I1PA 1N8SA 2Y4NA 5TPWB 3AJDA 3ZXYA 4B7UA 2EX4A 3GLFA 1B3RA 3OQNA 2Q07A 1VBNA 2CMGA 5M3BA 5AFSA 4G4JA 2Y6UA 1LVGA 2VP4A 3MELA 3AEUB 1XCJA 4OHXA 5TMPA 1VKRA 3P0JA 4KJZA 3DO6A 1M75A 2QPOA 4QGSA 3CUKA 1C4KA 3FWKA 3HL4A 1GSIA 1XEXB 5DASA 1QF6A 1CUWA 4LOIA 2VAWA 4Q6WA 4HWGA 3J81k 2XMQA 4WLUA 2C58A 2EKPA 1T36B 1V8OA 4LOAA 4CIYA 3P9ZA 1TM4E 1OYOA 3IBFA 1GNLA 3O4GA 3EG9A 1WY5A 2JAQA 2PGXA 2QQGA 2RCYA 5A0TA 5ALFA 3BJIC 2ZPAA 5IVHA 2ZYIA 1P2TA 3FPJA 5JG7A 3DP9A 4BNLA 2P1RA 3Q8XB 4RVOA 1BX0A 2B6NA 3UJHA 1OX6A 3FDJA 1ZQ9A 2QU8A 1O5IA 1T2NA 2RHJA 3PC7A 1OLOA 1PLLA 1W0CA 3CNQS 4LHSA 2XD4A 5KTKA 5EUQB 3NDJA 3ZDBA 4TQ9A 4M1MA 3B38A 3L93A 3II6X 1GFSA 4OHFA 3FM9A 4TLEA 3STXA 4V2UA 1LC0A 5GONF 6YASA 1IB6A 4MOWA 1JKJB 2C31A 4NBLA 1PJLA 4N40A 4NHEA 1SUCA 1JPJA 3SXUA 3STUA 3N8KA 4BC1A 2HSDA 5IBCA 2XMZA 3MWDB 5FL7A 3G9UA 4G1EB 3V2GA 4ENQA 1HDZA 4I7EA 3MEQA 2FI1A 2H2WA 1GN9A 4ER6A 1BXZA 1PL8A 3SZGA 2WTEA 1DG3A 5FOWA 3CUEF 2H0AA 3PI7A 3TM5A 1HFKA 3CEPB 5J40A 2BEVA 5BSVA 3I1FA 3QU2A 3IDFA 3RF6A 3H97A 4AY2A 1NVVR 1GPYA 4XJTA 2X23A 3JV7A 4F4CA 1PKEA 3FGPA 4RJTA 3AWIA 4GYKA 4BFTA 2FWJA 2VNAA 5ES4B 4PCLA 8AT1A 3GGDA 5TLSA 1TJNA 1UM9B 1ILEA 3RUCA 1E2NA 3GFVA 4JQZA 1Y63A 4HDRA 1QPBA 4Q9KA 6AT1A 1THMA 1QOQB 1RZUA 1G0OA 3QBVA 4G26A 3GZ4A 3PHCA 1YJBA 3LI2A 1JDNA 3F7MA 1S1MA 1XDWA 3W9YA 1RPAA 4D4KA 3WLPA 1QZXA 4F2GA 4QJ4A 5JV5A 1H23A 5LQAA 4HDNA 3B12A 3UOAB 1JWAB 3THSA 4DGQA 3NR2A 1KJQA 3L0YA 4WK4B 3UANA 2TRSB 3CQ9A 4OHCA 2PUBA 1J24A 4P8RA 3E1GA 3KT8A 2WJGA 5BOVA 2PBFA 3BXXA 4UTZA 3OLYA 3PNBA 1P29A 4LHXA 4F06A 6GPBA 5FULA 5EKXA 1NQUA 1YTLA 3JWPA 2K2WA 3TRJA 3E9EA 4JC8A 1P4SA 1TEXA 5JCZA 1YE3A 2B98A 2VOJA 3AESA 1UBFA 1Z74A 2OOSA 1Y3HA 2P0YA 1SA0B 1BCSB 1OROA 2NACA 2PKQO 3TLKA 3GA7A 2ZREA 4DG9A 1P9NA 1NULA 1TAUA 4O6VA 5G40A 3Q7RA 3ZI0A 1E2UA 3AVOA 1E7YA 3PDCA 1VE9A 4JYBA 3N74A 3USCS 1I1QB 4ZCTA 1YR3A 4CODB 3QM1A 1CJMA 1JA0A 4N47A 5AOAA 3RBZA 3CVVA 3VOSA 3I8SA 3U7IA 1MTOA 1ZFNA 2AVNA 4M1QA 2ZYDA 3COWA 3VZQA 1GY8A 2N75A 4P53A 1E4VA 4HH4A 5HJ7A 4G1UC 4ZEXA 1IN5A 1JKXA 2IQ5A 1H66A 5GGXA 3ZDAA 1NSYA 4H7IA 4NSNA 1RI4A 2O8DA 4GP7A 5EIHA 1RE1A 2ROQA 2R7AA 3JQ9C 5EIOA 4QTZA 4EJSA 1FY2A 1S02A 2D2XA 2HCTA 3ANXA 2GCIA 5BWOA 1JPVA 4OQFA 3JQEA 3GIDA 2OP1A 4QPDA 3RIHA 3TQFA 1DDOA 1TO1E 1VYHA 4BC0A 4YNBA 1V8DA 2KE5A 1V6SA 1E9FA 1BCRB 1TK3A 1PYDA 2IDKA 1KI2A 2P8JA 3AV0B 5CLQA 1NMEA 2YWFA 3TX6A 3N07A 4UCXA 2XUHA 1U28A 3QNUA 3IPXA 4YJFA 4JKIA 1ST2A 3DA8A 3A1VA 3GQBB 5I7AA 3R7NA 1NTRA 5IS2A 2H00A 1WV1A 1ZOSA 4L9AA 2NPIA 4A5SA 4YR9A 4NZZA 1A71A 1GUFA 1ZMTA 2GZ2A 2IPNA 1JQDA 5TS3A 1HZZA 3PPIA 1YB1A 5CK5A 5GIOE 2JFNA 3VM6A 1B8NA 2FEMA 2MINA 4NOJA 4QLAA 1E8NA 1UM8A 3AR6A 4O08A 5AP9A 4J75A 4CM4B 4RLSA 4JV5B 4AW9A 1V9SA 2PKYX 1OZ0A 1GQQA 1LH0A 1TC1A 4EYSA 3K0EA 3WLOA 4AI6A 4CU2A 1MEEA 2CXNA 4ABYA 4BP9A 4OEHA 4D97A 2CYAA 5F52A 2UYYA 4IH1A 4V0SA 1JDPA 2ILVA 1OBOA 1NFFA 2H1IA 4D9HA 1CZHA 4AXXA 3TZBA 4IIXA 2FN9A 2AOXA 3WC4A 1G8HA 3ADKA 1HWYA 4RJIA 1RQLA 4U7JA 2HJHA 4GSYA 3P32A 4V24A 2XMGA 1B1AA 1YU6A 2CUNA 5KSWB 1F8XA 1S1CA 2WFLA 2EZTA 2AVDA 2M1ZA 1I30A 5BRJA 3C70A 4PNHA 5I8ZA 2PV7A 4WVLA 1Z5UA 4QHSA 4CMEA 2NP7A 1FXUA 1QZUA 1GCIA 1RXUA 3M5WA 3G2MA 2VNSA 3LHIA 4BLPA 5K2OA 3E2IA 1ZN2A 1I3OA 5JDIC 2IJGX 1AZWA 3O8RA 3NPMA 4KUEA 1MJFA 2QE6A 5E4TA 2V7BA 3W4KA 4V3CA 2NYVA 3AW8A 4ZZIA 2GN0A 4B34A 1BKDR 2Z2ZA 1NSTA 4XJVA 3LRTA 3O92A 5CDTA 1W2WB 3DOIA 3BXZA 4RJJA 2CW5A 2OM2A 3O4FA 3D5QA 2VYND 4LY6A 5LQDA 2EF0A 1F7UA 1HFEL 3AEQA 1BRMA 3IQWA 3R40A 3TM4A 3U5TA 1CV2A 1KFBB 1RWKA 1YZKA 4UZSA 3CG0A 4LDRA 1WBDA 3DL2A 2FUG1 3UXMA 4CI9A 4YQFA 4QQRA 2ENWA 2HRCA 5SYMA 2O54A 1L4YA 5B2ZA 1HURA 1ZIPA 1FJHA 1SWWA 3CW2A 1NT4A 4ZK6A 1YR2A 2ZVJA 2XEDA 3V97A 4D8UA 4LYJA 4NZ9A 3F71A 1TCCA 3KB8A 4M89A 1XVUA 4NBUA 1Y6FA 4ENUA 1TVKA 3KQVA 3PQDA 1WP9A 1A4UA 3DOJA 3VPXA 2PGAA 4XEHA 5JSKA 5LUAA 4AP6A 1S8FA 4TVBA 4D6YA 5IF3A 1I3CA 2OFOA 4A36A 5AKYA 4B4UA 3TGPA 2PGJA 3EIEA 2AEMA 3IQHX 3QU9A 2R8OA 4HBZA 4UMVA 1ACMA 4IJKA 4MYUA 4QULA 5T8KC 5HX7A 3H8WA 1XAJA 3JVUA 4EK9A 3CH7A 2BY4A 3DCNA 4MIEA 2PUAA 4EDFA 2H9IA 4Y2TA 3SQOA 2G7MC 1SHKA 1ODFA 3LU1A 3PGLA 4I4LA 3ZR4B 2P1DA 2Y1KA 3R7AA 2Q6TA 2I2BA 4KWTA 3K16A 5CAEB 4N4AA 3CNNA 2A9FA 1NN0A 1J5XA 3IKJA 1I3NA 5FV7A 1C1HA 4DYHA 4RHCA 2AJDA 1U8ZA 1A96A 3VDNB 3V4RA 2GBIA 5IJAA 1A5SB 3GJZA 2RG7A 2C4VA 1VIDA 2X2EA 3TYXA 1U0HC 4ACAA 3W77A 4ZVKA 3MWYW 3ZGLA 3L3BA 3ORHA 5DYTA 1R88A 4YRCA 1Z47A 5BSHA 1LRLA 4B40A 3MWLA 4MWEA 2DF8A 1A2KC 3GJ8A 1JN0A 4AUKA 1IYZA 4MS3B 2FLKA 4PAQA 1GAEO 5F7OA 3MJRA 1KJWA 1HYBA 1HDCA 1V7ZA 2G63A 2NW6A 3D7NA 2PMKA 3OX3A 4B3SB 5BV0A 3SBOA 1A69A 2I3GA 3LTEA 3U80A 2PT9A 4AMVA 3ZS9A 4B71A 2C61A 3FROA 4WGGA 1PK7A 2F59A 1P0FA 3V48A 3VU0A 4AMGA 1M6EX 4PBRA 3SD7A 2OZPA 4XX0A 1IXYA 3AEKA 2CJWA 3JQDA 2W4QA 1JIQA 4U7HA 4L6AA 4C05A 3NOQA 4JBNA 4N5IX 4XA8A 4BNMA 1AK1A 1DT3A 3BE5A 1ZAKA 1B0AA 3LSYA 2GHQA 2WWYA 5FD8A 3NDIA 2J6CA 3SVLA 2B1RA 3ZV3A 4LRUA 3OQOA 3DDUA 3EIXA 3LD9A 3DOFA 4V39A 1R64A 4BMVA 1VL5A 4B6EA 3HBFA 4LDQA 4YWJA 5C4MA 2P9BA 1NJSA 1F14A 2GJSA 1P7YA 2FZKA 4Z9YA 2GZHA 4CPDA 2OR3A 1XF9A 2V6BA 3D2LA 2H51A 1OBHA 4UEOA 2QP3A 2ZB4A 4ZOLB 2Q3LA 1B6TA 1SOUA 2ZYAA 1KJZA 3NHRA 1JEQA 4YJ3F 5J2TF 1VLHA 2FQXA 4CLOB 3HJCA 4RTSA 1MJGA 2Z83A 4P34A 4DBVO 4WFJA 1XZIA 4LYFA 4JI8B 1FLDA 4LBYA 3S7ZA 3V7WA 4TS1A 2UYGA 5B57C 5JQGF 3QQPA 3OQVA 2VT3A 1VOTA 4PBTA 3G9ZA 3LOQA 3PDUA 4H6XA 3AWDA 4HYQA 4EUSA 1CY2A 3A4TA 1VC2A 1VL6A 2B4RO 2ZDGA 4Y9TA 3H5NA 4UHFA 2IVFA 4LXUA 1RLIA 1I14A 3KTAA 3QQ5A 4O0LA 4ARVA 1U0TA 2YJTD 5JROA 4LYGA 2WLTA 3T5PA 2HXSA 1NW3A 1R6TA 3O2SB 1NR7A 1JB1A 3X2EA 1OT3A 4TVOA 1GGEA 2O8BA 2AI3A 2VYVD 3KQQA 4PBSA 4D4MA 2JCSA 4S1OA 1SURA 1IC6A 1KBZA 2A4KA 2IZZA 3TW8B 3DLPX 3ZIDA 4BO3A 4BNUA 1XTPA 3NB0A 1PZEA 5C8YA 5J1SB 2OV4A 3SEFA 3VNSA 3PXGA 4M55A 1C14A 5ALWA 5AUPB 4HSGA 1QLHA 3RVNA 2BEJA 4E3WA 2MDTA 2X7JA 4JB0A 1GUAA 5AI8A 2EW2A 4FUQA 4UJ5A 4J6FA 5K09A 4HX2A 2YWRA 4PSAA 4TWBA 3HN2A 1TLFA 1QPZA 3FZNA 1U1CA 2ID8A 5I4BA 1K3FA 2X5JO 3IPLA 4W5RA 1JAIA 4NBTA 1HE1C 5DISB 1QTQA 1LS1A 4N65A 4OA8A 4K8OA 2PQ2A 2WJYA 3AF5A 2RSLA 1EFRD 3BRWA 1YFZA 3V4ZA 4C0KA 3UBTA 2X0NA 4QREA 5CW2A 1PEYA 2F9MA 2JFUA 4AQYB 4C0SA 4D3ZA 3V9AA 2IY8A 2FW6A 4EKEA 1KYIA 3KSZO 1UPUA 4HRYA 3VR6D 4D99A 4QOGA 4XFJA 3O1IC 2G9ZA 2F7SA 4P84A 3QITA 5A5FA 3F5DA 2QRPA 1NVDA 2FPOA 2QZPA 2VHTA 3KR1A 1ND5A 3H2YA 3LK7A 3V32A 4ALMA 2J9ZB 5COAA 3PTLA 1SUWA 2D00A 2EAUA 3G8CA 5BO5A 1P1FA 4EFNA 4IDNA 5JY1A 2W42A 1K88A 4AROA 4DFDA 2OCPA 3HVKA 2YN4A 1Q1QA 2X0IA 4EENA 3AR8A 5KCZA 3OEYA 4GSLA 2MSCB 4TKMA 3ROZA 2BMDA 5KUTA 1BX1A 2G4CA 1B6GA 5LOVB 4S1NA 4MWOA 1AE1A 3K8YA 4Q4JB 4DV0B 2H63A 2QTBA 2VRCA 2V98A 1XWFA 4M54A 1TD9A 3BD8A 5F2KA 1T1GA 3W7AA 4KB5A 1RP7A 3PLRA 1VECA 3B8EA 1QC5A 3GLQA 5A9RA 3FKQA 5BNWA 2CLLB 2NMVA 3QKSA 4G5OA 1N0IA 3B5EA 1ZK0A 4BNZA 1MH1A 3GJYA 4ARZB 2CBXA 5EE0A 1T9CA 4PG7A 4HLQB 1UBNA 3PNQA 5E6SA 4TRJA 1RJDA 1CY4A 4ZEWA 1GAXA 1N36B 1TM3E 5C1PA 3HADA 3OX4A 3C3YA 3V6LA 1HKUA 3ZZ0A 4OQLA 4NBNA 3I5XA 2ZUUA 4KXVA 4N49A 5FOTA 5H82A 1XOIA 3FGOA 2Y1DA 3JQAD 4ZT2A 2FWBA 3HN6A 1H2XA 3W7VA 2WKWA 4II7A 4BXOA 4YLEA 4CETA 5ICCA 3UAWA 3IC5A 1KEZA 2FETA 2PWPA 1HL7A 3ZIAD 1F9AA 1TFRA 4MV3A 4WBNF 5AK5A 4GOXA 2YVUA 2CD9A 4HNAA 1NG1A 2WMDA 3CRQA 2PUJA 3BEOA 1GVNB 4DCGA 3MWGA 3EDQA 4CUKA 4H4EA 1YIDA 3ZWWA 4XFKA 1V95A 4HWPA 3H9BA 1FFGA 2QPLA 2O48X 2Q99A 1MC4A 2FA9A 1FZQA 1KS9A 3BCHA 3MTIA 5LP6F 1EE2A 1CY0A 2OILA 2EC5A 4D7AA 2BRUA 3IPRA 3PYXA 4EKIA 2JNWA 1E9DA 2RKBA 3EZ2A 3K15A 4YIKA 3SM3A 4C4OA 1UBMS 4ZI5A 4L8LA 2H5LA 4WZ6A 1ZHFA 1MGPA 3EQ8A 4AZWA 1PCXA 2BLLA 4MYRA 1K97A 3LQFA 3PXAA 4WDRA 1GSHA 3EXHA 3NTUA 5HKBA 3LO8A 4COKA 1OPRA 2C2OA 3PWKA 1Z82A 3CWQA 4D46A 2ZEJA 4BKPA 4CTNA 1KYQA 1RQNA 1M1YE 1Y6QA 4MAAA 4BVEA 3MNFA 4DDMA 1OASA 1QR2A 3EF0A 1AF7A 4RULA 2GO1A 4DT1A 3KJNA 4L6IA 1KSJA 3M3PA 1IN1A 3DB1A 1NQ5A 3QVSA 4TPKA 4FOSA 3COJA 4C6HA 4ZYWA 2XECA 2F55A 5JDIA 3K4PA 3G2JA 2AZTA 3KR2A 3ZUPA 5CD9A 4GI7A 1T5DX 1MV5A 4FBMA 1UT8A 1T2AA 4A92A 1MF7A 1H4QA 1T3SA 2CDRA 4LIPD 4M7RA 4ID3A 3FWZA 4IH9A 4F2WA 4N0QA 2R5NA 4OYLA 2IU4A 4N8EA 5J2UA 3LP6A 4LPKA 1X1QA 4S2UA 2BI8A 1B3BA 2X1MA 4RK4A 3WYCA 2DGDA 3FTDA 3R0ZA 1L7AA 3U3MA 2JJMA 4K9MA 3KWLA 1BGXT 1MRNA 5L7TA 1C7FA 1LXCA 2JGLA 4FYKA 3UT5B 5CFOA 3F9IA 1SEPA 4BVLA 4U0KA 4LEIA 1EJ0A 1R9MA 1T1JA 1GR0A 1X7GA 3OG9A 1FUIA 2VT2A 4U6QA 4KACA 1JA1A 1TZMA 2JCXA 2V74B 3TZHA 5IDQA 2SICE 1NNEA 1MFPA 1DIGA 3GHYA 3RVOA 2R7LA 1MG5A 3IAM1 2R6ZA 1H0KA 1YFLA 2X8AA 1HEIA 3C8UA 2OQIA 4V0KA 1OMOA 5EL0A 1NLMA 3DKRA 3DHEA 4HPXB 4OSOA 1JIKA 4E5DA 5IT5A 4JJ4A 4IQGA 1BA3A 2I7XA 4NQRA 4U7TB 5DNAA 5A7HA 3ZWVA 4CMIA 4EB6B 2P90A 2D8AA 2BZ0A 3A7DA 1IG3A 3OT1A 2B4AA 3L6OO 3DL0A 1BXKA 3MRTA 2Y0BA 4RA6A 5T8KA 2BFOA 1NNSA 3FIJA 3H7IA 4HPWA 4YXWA 5AM2A 4OI4A 2WPNA 3A10A 2GZMA 2VJYA 3O9ZA 1DKRA 1J0DA 3GPIA 4RABA 5C32A 1L7RA 4Q4AA 3RTDA 3HKBA 1KBOA 3NTRA 1EB8A 1QG6A 4X92A 8LDHA 1Y7IA 2DEUA 3ASUA 2TECE 4HR7A 4G0XA 5DHFA 4JBWA 4F6RB 2C42A 5IT0A 5LZ2A 1GGHA 1C4XA 3AH8A 3BWDD 5I7HA 1CXZA 1WY7A 3GHHA 1KL7A 3BK1A 4NMMA 4YDRA 4B6FA 4ENTA 2PTHA 4P4GA 3RASA 5DWQA 2YHIA 2UZ3A 1Z3CA 2HD4A 3S0JA 4CKEB 2I34A 2P9TA 5B7QA 3ZJVA 2YQ4A 2ZE8A 3DKVA 4Z0HO 2W00A 1AS2A 2C3OA 1C3OB 4FT2A 4M86A 5JTUA 4UAVA 3KD2A 1J39A 3TO5A 4BBZA 1CUJA 2BZSA 4MRMA 3GLIB 1Z4JA 3A0RB 3D6JA 2ONJA 1NBMA 3OEWA 1CNMA 2VTKA 2YIJA 4RKRA 3OFNA 1F4PA 1R1DA 3NEAA 4L0CA 4D56A 5B1YA 1Z37A 3AI3A 3D7LA 1K86A 3A2MA 3K2QA 5ALGA 2Z57A 2XNDA 3NKLA 4BMSA 1CVRA 1BYUA 2RK3A 2I2AA 5TGDA 1QAMA 3G5LA 4M9CA 5K0ZA 4US1R 3IEXA 1JU3A 221PA 5LZ8A 5E1MA 4CIAA 1C7QA 4EELA 4X6YA 1E8DA 2JHCA 1NP3A 3I4LA 3R6TA 3NI2A 4AURA 4C76A 2ID7A 3V2IA 2JEOA 3EGDA 1K89A 1ZRMA 4GOND 3NEYA 4H3KB 1NRXA 2QL7A 3T34A 3TAUA 1NNUA 2NZYA 4ZP1A 4A23A 1DC7A 2IZ5A 1LDYA 5A4DA 2Y27A 1QIFA 3KEGA 4DJ5X 1LPSA 3IO3A 5EE3A 3AVUA 1EDOA 5CBPA 3L7NA 4H3VA 4KRFA 4C30A 4URFA 1AM4D 3GLRA 4L5BA 1JLLA 2A0YA 2J3QA 2R1VA 4DLZA 4RQAA 1WABA 3ZY5A 2E21A 4LYHA 5ITZA 4K0KB 2ZAGA 1QK4A 5H1YA 4INPA 1LLFA 4PYOA 1SJ9A 1GTL1 5D01A 1WMEA 4KLNA 3UATA 2CSUA 4R7TA 2IP4A 2QUAA 4AT1A 1ULSA 2OZLB 3M4ZA 4XUEA 5GJVC 4AJLA 2ZBEA 4D9EA 2JHGA 3OCVA 1LZLA 4R4JA 4EJMA 3M3HA 1KYWA 5E0KB 4F4UA 1KH1A 3AFNA 4G5SA 3NCHA 5JXJA 4M6WA 4EARA 3D0QA 4Q4HA 1VKJA 1ONPA 1Z29A 4JLBA 3VTZA 3L8ZA 2Z9DA 1AURA 5J47A 2IIPA 2Z09A 5CP8A 1QKKA 5JNWA 1C30B 1D2GA 1TM7E 2WP0A 1JFTA 3GLHE 2GWRA 2HC9A 3RVPA 2XKJE 1M0SA 1XZEA 1DT5A 1JYFA 1ARZA 3BHIA 1X86B 1WDTA 2JASA 3GX1A 3OF5A 3FLMA 2HWUA 1J2RA 1X7ZA 4Z4IA 3DUWA 1CQIA 1EE9A 4L50A 2V9PA 3OZVA 4QARA 4D41A 5C18A 3IUEA 3IURA 2QTNA 1IJBA 5BOSB 1SKAA 4QICA 4BVBA 2HYDA 2HIHA 1U2QA 1Z5ZA 1MB3A 4INOA 4DIMA 3OU6A 3W3ZB 4OHPA 2QD4A 3NHJA 3TDNA 4HVCA 1XPOA 2QIPA 3NATA 4DF3A 1S2IA 3Q2KA 5JBIA 1Z5OA 2RI1A 3LC1O 1OD6A 1V8FA 2X8JA 3OA0A 4LYAA 1S9DA 3KOXA 4DCPA 1R6VA 2KBEA 4MLPA 2GR9A 4BWYA 2W2QA 2AR7A 3MGKA 4NX2A 2P27A 1AB6A 1ADYA 4NTZA 1CUGA 2GBLC 2XKAA 4Q9IA 4DNFA 4ODIA 4Z0PA 4O4HB 5IJ0B 4RJ2A 2X15A 1WXGA 1NVEA 3WGUA 4FFVA 3U61B 3FNIA 2GK6A 3L8EA 1TJ3A 1XQYA 2AW3A 2GAAA 2RMKA 2VNKA 1C29B 1KYTA 1QS0B 3OMLA 1DCFA 3PDHA 1Q16A 3GROA 4OK6A 4TT3A 3TTUA 3ZGVA 1JWBB 2J7KA 3B85A 3CN9A 3DMHA 1PGQA 3D0RA 1OXKB 1QH8A 1P77A 1W73A 1X1RA 2CCGA 1K9VF 2PU7A 3AETB 4I6GA 1UMBA 2IYLD 4E1AA 1E3WB 4LF9B 4QUIA 1DXOA 1QQ5A 1T6BY 2B94A 1K6MA 4CF4A 2ZSUA 1PJAA 1DBSA 1I80A 3EY4A 4A3SA 4UVEA 3KDSE 4PZPA 4RQTA 1R4ZA 1O3YA 1TA4A 1QZTA 4ZZ2A 2VDNB 5BR4A 1GN8A 1WAMA 3M8KA 2G07A 5HDQA 4EG0A 3P2MA 1CUEA 4AMYA 2OORC 4IDQA 4PHTA 2NXNA 4KYIB 1J00A 3JQ8A 2CCKA 3GNSA 1BMQA 3D43A 4R1SA 4WQMA 3R7SA 1NF8A 4O2AA 2GTHA 2YZKA 4IIJB 3QPVA 1D7AA 1G5HA 1DAHA 2HNAA 1Y80A 3ANLA 3CISA 3M9WA 5NLLA 3TCXB 3UMJA 3VI3B 1LPPA 3GG2A 2B4YA 2GJAA 2IZ1A 4AYXA 3HWSA 2PU5A 2WHPB 3LXUX 1EHIA 1TUBB 4NFSA 5FFFA 4KPFC 3VPDA 3B1VA 3LUJA 5HNKA 2YOGA 1PWEA 3IAEA 4RY0A 5G41A 4LI3X 1COWD 1ODSA 5LYJB 3E3NA 3BS4A 5B1DA 4JSTA 5BMVA 1EXMA 2J85A 3JD0A 4PLZA 2PZFA 1P6UA 5P21A 2TMYA 2BGGA 1Z62A 2D06A 2O1EA 1J09A 3IUJA 4U9UA 5EWJB 3ASVA 3T7SA 3B9PA 2H07A 5ED0A 3SS9X 1M83A 1PR3A 2CJFA 3DV0B 1IE3A 2BHRA 1QFZA 3BUSA 3I5UA 4ND2A 5H80A 4B9EA 2B9EA 4M1TA 4MDFA 3EEYA 3ADCA 3NBUA 2FSVC 4G5RA 3ZH2A 5DCYA 1AA9A 5F7ZA 4D2IA 1TF2A 2H11A 4OMUA 1O95C 3D6FA 3Q3EA 4UDYX 3WFZA 3M70A 4RMHA 1INLA 1HO3A 1DAPA 3W1EA 3GAMA 2Q7DA 2BR4A 3P0EA 2C96A 4ZOEA 5DK6A 1NOJA 3EVTA 3NWOA 2JLAA 3WLNA 3ZC3A 1W5BA 1YE8A 4CQLA 2AX3A 2BFWA 3C5WP 4F5DA 2CUTA 3HU5A 2B69A 1WZCA 3F74A 1VLJA 2NAFA 4Z9BA 4I4CA 4NONA 1JYEA 2EBWA 2G9RA 2NO9A 4D74A 4RHUA 1B76A 5SYAA 5CVTA 2CL6X 5CT8A 1I3MA 2OC4A 3VSAA 1YBFA 2GUGA 3KWFA 4GICA 1PLKA 3BF7A 4HBGA 4QVKA 4KO2S 3S28A 5DTQA 2PCJA 1RBZA 3L4BA 4ZREA 4ISBA 4B3BA 4J0JA 2QAJA 2F90A 3ICWA 3UK0A 1JFLA 5FAXA 2NZVG 3AGQA 3MUNA 4KPUA 5E8RA 1UAAA 1TW3A 4X24A 3E5MA 3H13A 4CFZA 5HWSA 4ARBA 1ZUNB 1N4DA 3RK0A 3KUXA 3CZPA 2VJKA 2IWRA 2I55A 3HZRA 1D3AA 3NM4A 1SXJE 3N2ZB 2IEGA 3F6YA 4GC9A 4GC5A 3E5HA 4RK7A 3U7FB 2XRZA 4N6OA 3NIFB 3LZCA 4HI0E 4HV4A 2OOKA 3RIMA 2NTNA 4DXAA 2BFBB 5L3SB 1YDHA 2C1ZA 4OHWA 1P3Y1 1IWPB 4RLQA 3JQQA 3EGXB 3WLJA 3HB5X 1XD8A 3HP1A 3T95A 3H99A 2ZJ7A 4MSUA 5JAPA 3KRTA 4L5IA 3P4YA 4CN8A 1G8MA 2VQ3A 4JR2A 4YQYA 1UBTS 4FYMA 4XQGA 2QMOA 4ZFNA 4Q7EA 5GM2A 1E7QA 4BJHB 4S12A 3LY7A 3ESDA 1AKMA 1NJ8A 2OAP1 3PNLA 1CY1A 3Q3HA 3FN4A 4LISA 3T4PA 4IIVA 2YWJA 5IDWA 4YRLA 2XNCA 3ZE1B 5TRTA 2VSOA 4LQLA 4TYPA 3CEHA 1V43A 3KU1A 4FR2A 2YWGA 3JTEA 3HN7A 4QOSA 2P5UA 4Y9RA 2VK1A 3NOXA 4U2EA 3WL8A 1IM8A 1E9BA 4TS9A 4TV8F 1U99A 4R0VA 1LLUA 2MR5A 4HAIA 2ZWVA 3ND6A 5HQTA 5LFAA 2XXAA 1GZ6A 1XZNA 2XNHA 2XNJA 1OYVA 3IX7A 2NO5A 5JVDB 5K3AA 3V8NA 3X3HA 2QBYA 1QWSA 2HHJA 4DMUB 1FX0A 4ZMSA 3CZCA 4RPJA 5IVPA 2XT0A 3NBFA 4EYEA 3PUYA 1TEZA 3C3DA 3FFTA 3K1JA 3OPQA 4M1YA 4E4TA 3AU9A 5JNSA 1ATZA 1ESCA 1XELA 3UV7A 1GARA 4CKZA 3R44A 3AG5A 3HNRA 3GNQA 4KPEC 3CXUA 3C4JA 1J8QA 3U31A 5CJPA 1POXA 4M9UA 3HDHA 4B82A 3HCNA 1QP4A 4EDHA 5BXYA 1UDRA 3L6EA 5LD2C 3I32A 1DNPA 1G2IA 2B36A 2Z4SA 4HS9A 4PONA 3BHJA 3FWHA 5GV8A 3VR4H 4F4HA 1IM5A 1Y9ZA 3NUGA 2DBYA 2ZIVB 4E03A 3LDHA 2P2DA 5HF9A 2IV3A 3L8FA 1EQUA 4IX9A 3LT0A 1F9EA 4KE6A 3RDPA 2RB4A 1PU2A 1U0GA 3EGIA 1OVMA 4CCSA 1NWHA 2Y93A 1BMTA 2IYFA 3P71T 4I9UA 2BBOA 1PZHA 4YGYA 3BAFA 3VYVA 4FI3C 1KDTA 3FDXA 2XV1A 5EYPB 1EFVA 3ILXA 1PFQA 2FKNA 2H31A 2WUEA 3MIZA 1FDRA 1PJZA 2IIQA 2P9YA 4J0KA 4MWTA 4V0NA 4AAYA 4MQUA 1E2EA 5K01A 1K27A 5REQA 3QUCA 4MITA 1LK5A 2NO4A 1GQOA 3QMMA 3ZEIA 2L0XA 3H5AA 1MLDA 2JFOA 3X1JA 1KIAA 3GMDA 3MLBA 5ITWA 5K4GA 4BHTA 3P94A 1RPNA 4EHLA 2OCIA 3ZX4A 4RTJA 2PD6A 2EZ9A 4U7PB 2QQFA 2C97A 4KE9A 4TN5A 1R0CA 4MUAA 4QYIB 1NNI1 4TWRA 3ZV7A 1QV6A 3NGMA 3ME5A 2VUIB 4K1LA 1IQUA 1N2IA 1BU8A 2B7BA 2GCNA 1HK7A 1KVTA 2TS1A 3AHFA 4I1VA 4M8KA 3IIMA 3ZHVA 5IJZA 5JCPA 5KTYA 3T3OA 1KO7A 2X8BA 3KP1A 3U0BA 3CR8A 1DZIA 3BKWA 3K9BA 4M4SA 1M8KA 1HQCA 1GJRA 3FYDA 2JGNA 2HLNA 4Q48A 2AG6A 1E7MA 1NZJA 1X9IA 3IP9A 4C4RA 3NAZA 1ECLA 1IBSA 2C1EA 2YZGA 1O97D 1JBQA 1FBTA 3ELDA 3KKMA 2YJZA 1UFRA 2VAXA 4OP1A 2B1QA 2KI5A 4WACA 4EEKA 1K66A 5IK2D 2PO7A 4ZDJA 5MN5A 1J9ZA 3JALA 4KR7A 1G5FA 5DGXA 4AJ2A 2HBRA 4HDCA 4JBYA 1VCNA 2BJHA 5AKGA 2UXBB 2B5OA 3NH6A 4G0MA 2I4OA 2QD2A 1PEDA 3MCUA 4FC6A 1C3LA 1MAVA 3MWEB 2PX4A 1N7IA 3ZQ6A 4UXJA 4DR6B 3UWOA 4HEA6 3CRMA 1CJCA 1XTJA 4BBAA 4EG5A 3OIWA 2W6JD 2WNIA 4PV7A 2V7EA 2EFYA 2PCLA 2WT9A 3C39A 3M1YA 4GR5A 3KT0A 4OUDB 3C3XA 4ZCRA 3C8HA 4UDOA 2BIFA 4Q47A 3K0AA 5E95A 5DN6A 3ODGA 5ALPA 1XXHB 1XZJA 2QSZA 3QKRA 5BNFA 4W1RA 1Y1RA 1PEAA 4UBJA 4OG2A 4TXHA 3ZE0B 4XW2A 2J4FA 1CNEA 1P0PA 1G9XA 3ILHA 4HEJA 4MLDA 1FSSA 5JJLA 1D9ZA 5CYOA 4ENRA 3JZFA 3L7MA 5L3QB 2VKQA 1FSPA 3CTMA 2HI0A 2EFEB 3QVWA 2DFKB 4RIGA 4HN9A 2YJ3A 4X8OA 3DYBA 3KOWA 3KXPA 3PXCX 3DMTA 2PUTA 4W7IA 4IOLA 4QPZA 4WD3A 4WJKB 1MQAA 1Y5LA 2WQZA 1C7EA 4C4ZA 1YCDA 2GPSA 3PJFA 1KETA 4YMTA 3M7IA 2C8JA 2A9RA 3L8CA 4LGYA 2DFDA 3ABIA 1TTTA 2AXQA 2GCGA 2GTPA 2JARA 1F6DA 1FXWF 3VJLA 3A6EA 4H1UA 4IVRA 4KSYA 3NUQA 1KHTA 3EIWA 2V9ZA 3M6VA 4Y6QA 2WAMA 3BMQA 2JLRA 3UVEA 1YZHA 1BOOA 1JJBA 2BFFA 4LSGA 5BPHA 1JKIA 3LT2A 4JEHA 4PO9A 5AQ1A 2CV2A 5JFOA 2PZKA 4YRJA 1XTZA 5KKAA 2BTQB 3R76A 1L1QA 4OBEA 2DRIA 3IAXA 3WFIA 3S1SA 2C00A 2X6QA 3PQCA 1JE1A 4LJLA 1YB7A 4H08A 3LLCA 5J2UF 4C4SA 1KRWA 2ODNA 2ZYUX 4BV9A 3RT9A 1HX7A 3H11B 3TOCA 3AHHA 4O4IF 1Q95A 5DTJA 5AW2A 3TE6A 3FTFA 3WL6A 1W59A 4MW2A 2JGDB 4F71A 3RYIA 1X2EA 3HCAA 1AGRA 3BQNB 2R1UA 1DLJA 3EGOA 4ETMA 5A7GA 3NV7A 1KRHA 3AB8A 4EHIA 2AGVA 1TAHA 4MB2A 4NYIR 4NZOA 3DZJA 3RYCB 3PLAE 3MB8A 1YL7A 3FA2A 3OTQA 3P9QA 1Z36A 4QQNA 5THKA 4GKBA 4Y2QA 4LA4A 2YMQA 4MS4A 5TJ9A 4ZAFA 4I66A 4G01B 4GEKA 5BVGB 4E5KA 6CHYA 1C9MA 3RH0A 5DI9A 3C6KA 3EIQA 4X8HA 5E1BA 5J4KA 5TXGA 1CUIA 2XUQA 1L3IA 4KU4A 3RSQA 1NBEA 3BSYA 1MX9A 2VZEA 1Q15A 4RIEA 1G5QA 1Y89A 3FCOA 1TI7A 4X41A 3TVTA 2I6GA 3ECAA 3INRA 4UAJA 3G85A 4P5EA 3CVUA 3Q7PA 1KU0A 2OXEA 4HDSA 4J3NA 1O95A 2ZRMA 3UC9A 5B7GA 5EOVA 3WIBA 4E7OA 1WMAA 2HRDA 3LMKA 4PX3A 4E0BA 2HBYA 2R66A 3QXCA 3PJRA 3HCCA 1YS9A 1Z4PX 3MUFA 1Y6JA 2VAMA 3P52A 4PLGA 3M3DA 1RLTA 1QGDA 3KYCB 3N8GA 1OHHD 4HDOB 1D7OA 3LQQA 1JEOA 3E61A 5JYCA 1C81A 3LP8A 1DXQA 2VJDA 4DQUA 4HFJA 3NDRA 1M2EA 1MN6A 2OHHA 2IE8A 1ZLXA 2JW5A 2WTNA 2XTZA 4EG3A 1KMCA 2GN9A 1HT2E 5FNVF 4GPD1 2C0PA 4DADA 4P86A 1OLUA 4ALJA 5KTTA 4ECEA 1OKKA 5B12A 4TV9B 1J06A 2HJ9A 1O8CA 4MCJA 5LC1A 2UVPA 4MIKA 1LLCA 5A6SA 3CZ5A 2ZTHA 2R6HA 3OX2A 4YP6A 1II8A 1WHTB 3TLCA 4MA0A 5BWLA 2G1AA 5GGYA 1R2QA 3V8EA 1OI4A 3A6JA 4HQ0A 4X94A 1LLDA 5F2EA 2M32A 3DGEC 5FWAA 2E18A 2W43A 4FIZA 4KQ9A 1ISGA 2QUKA 2XGMA 3Q72A 4OJYA 4IGIA 3N76A 3S6JA 1NR1A 3SZLA 1A97A 1YK0A 2A1IA 2OCKA 4JLKA 2CBGA 2AF3C 2W8BB 4URHA 5JU6A 1MAUA 3IKLA 1Y9JA 3PUKA 4R41A 1KZYC 1FRFS 1YZ3A 1DMRA 1GXSB 2YMPA 4X8MA 2VDQB 2H9YA 4WCDA 2G0NA 3F3KA 3N6XA 1U9ZA 1TM5E 3GLGE 3A6DA 1HDIA 2AZMA 2BLNA 3OOHA 3L0IB 2QZJA 5BSGA 4I50F 1V41E 2VQEB 3MUEA 1FOEB 3PFCA 4PRYA 1XMXA 1D8AA 4Q82A 1B00A 3MK31 5EKUA 1F38A 1PT6A 4FD3A 1AMNA 2VDVE 1Y6GA 4AY6A 4EPTA 1UZMA 4BV3A 3EWAA 3H5VA 4WBSA 1N5OX 2O6LA 3P9SA 2G80A 1HL3A 4NBKA 4P38A 2CHEA 3GRFA 3OFVA 1VGVA 2O2CA 2P7HA 5F9MA 1ETHA 4IINA 4OK5A 1OAOC 1JQKA 1WUHS 1KZGB 3AP3A 3P9IA 1U0FA 3B9RA 5CLFA 721PA 1CP2A 1YKSA 3CO5A 1CPYA 1QONA 1TKRA 2EBUA 5I5GA 4OA5A 4L5JA 3RKSA 4N18A 1GCGA 3DZKA 1AKUA 1EB9A 2FE4A 3V6MA 3JD1A 3L7DA 4LMBA 4RD0A 3N6RA 1EWVA 1SCUB 1YZYA 2DKFA 2W6PA 3MGBA 1ESDA 1NXVA 3C1AA 3GFGA 1H9AA 1KAHA 5HTKA 4ZIRA 3I61A 1Y5NA 3ZDXB 1JXOA 1O9HA 1Z0UA 3E03A 1EMDA 1N6IA 3B6JA 4NZNA 4X6XA 3VYRB 1E7RA 1L4HA 3ZDRA 1SY7A 4BXOB 2W90A 5KYWB 4OXNA 1NRIA 3EFBA 4HAXA 1I5RA 2E89A 4RMJA 2MR6A 3PWSA 1P91A 3IXLA 4DNQA 2RC6A 1OV6A 1AJEA 1YJXA 3GRPA 4WT7A 1BE1A 1S8OA 3EXIA 3NC0C 2P68A 3CT6A 5EP4A 5LXTA 5JRZA 4MWBA 3CE9A 1X7WA 2Z8YA 1CR0A 3SZ3A 3H5WA 2JD0A 5JCXA 4F56A 4N6NA 4FMPA 4Q3KA 4RIHA 3U26A 1CFJA 5TPZA 5I9MA 3WNBA 2QE7A 1JWLA 2W37A 5M29A 4IEFB 5EJIA 5CVJA 2I67A 3I6QA 1V16B 5AWFC 4P4SB 1L4UA 4OQYA 3I3SR 1UBHS 3ADPA 1POWA 5CLGA 1M1YA 1VL2A 2IYUA 1YQ9A 1UWKA 1LGYA 4UD2A 4BQOA 1ZM7A 1Q0TA 1OW3B 3UMVA 3PV0A 1KY4A 2HT6A 3JQRA 1E18A 3GF4A 4TL9A 3QX7A 3RABA 4GWLA 3H8SA 3U9TA 2Z3ZA 4L4ZA 1R6AA 3C6QA 5CYFA 4P9NA 3OKCA 3V8QA 2BFAA 4HUJA 3HKDB 2BEWB 3PWZA 3KQWA 4MULA 1ZXXA 5LQNA 1SBYA 1N2GA 1GPJA 1QORA 2V9CA 4V0QA 4DLWA 1QIKA 4CV1A 3ZWOA 3CLSD 3ICPA 4ESEA 3ZKWA 5KOJA 2O7RA 1L5MA 3IEKA 4CGZA 2HU7A 2VTBB 3KL2A 4QSHA 3SC2A 3CBQA 4ZXPA 4C78A 3WY9A 2AYZA 2DQZA 2J1LA 1GPNA 2DY0A 4G8CA 1FLAA 1UK7A 1P1RA 1RHQA 2RBGA 2R4TA 5A03A 2G06A 1L4NA 3MZ0A 4Q3OA 4MKIA 1M74A 3TNYA 4QOFA 3HKEB 3ZIUA 3CLKA 1A9OA 5K3SA 5M34A 5E7QA 2C9BA 1CHDA 1VA4A 2ZE5A 4G1CA 1I51A 1GG9A 3N39C 2CXTA 1DDIA 2XQJA 4AJ4A 1PW5A 4LDPA 3LFUA 1T3LA 4OUKX 2HZBA 3B1XA 4FT4A 4GM0A 1Z33A 2PX8A 4IILA 3ZCPA 3L0PA 1P5JA 3LQ4A 4PLTA 2JFWA 3VTAA 1H42A 2N46A 4DXHA 3TQSA 2D7DA 2RD2A 3PXUA 3FMGA 5LQMA 1OH5A 3OCYA 4PYMA 1O87A 1O4WA 3BMNA 1KXZA 2WB4A 2O07A 1N5KA 2FNAA 3V8MA 3I04A 3CXRA 2YTZA 3DL7A 3QPCA 4GE3A 2PNJA 1OXBB 1QVRA 1L8LA 2H8KA 3C98A 1IDOA 4ON9A 4AMUA 2IP1A 1NVFA 2XW6A 4IIHA 5DK4A 4J16C 4RPKA 1AGNA 1Y37A 3FNRA 4MRSA 3DUFA 2K7FA 2C5SA 2ZAOA 4R16A 1NI4B 2G4VA 4HRAA 1LW7A 2Z9CA 3H9JA 4TYYA 2OV3A 2XGOA 3DNFA 3DSRA 4GXRA 4G25A 4EAAA 4FE3A 1N1DA 1O2DA 3RWMB 5KYUB 4C21A 1FFCA 1I2ZA 4R6WA 2CJYA 1KF0A 1LPNA 5ENZA 3TK1A 3KETA 2UU9B 3GD7A 2PQ0A 1ZESA 1R9JA 2O06A 3ZBUA 4G4SP 1BXGB 1J0BA 5EMNA 2CLOB 4LGVA 3LVRE 2YXPX 1UBOS 4UNRA 2VJMB 3VKWA 5F23A 2NVUB 1WS6A 2QZ9A 4A5OA 2I6SA 3D81A 5MF6A 4FP9A 2RGEA 4M7PA 1CS0A 1UWLA 2CLKB 3DDHA 2BEUA 3RNOA 3VHQA 5I9BA 3EZ7A 3SN6A 4L8GA 4JLOA 4L3VA 4IHQA 4EO9A 2OO5C 2AW5A 4EM6A 5IVKA 2J5QA 1QB8A 2WZDA 1Y5IA 4Z9AA 2DQYA 3N2YA 2DUJA 4MQEB 4TN1A 4ZTBA 4ZMBA 2JFZA 5CB4A 5A02A 5LWHA 1EVZA 1T1RA 4PFKA 2KSQA 2EL9A 3L01A 1ZVVA 2X41A 4EF4A 4PTZA 4KQFA 5DYIA 2PAFA 4CV2A 3OSZA 1FVFA 3FSJX 1N2JA 1UXGA 2WJ6A 4QNNA 4UQLA 1E1YA 5DDIP 2VA8A 3PDIB 1BDBA 4K86A 4Z9FA 4AJHA 1G63A 5EN4A 4PFQA 1VG1A 4V1CB 1LBEA 4FMBB 2HMVA 1PK9A 3LCJA 4E70A 3OKPA 1C80A 1W5EA 1XJQA 5T6MA 3FF4A 2JLQA 1TYDE 2H7VA 4JOCA 4B75A 2ZWOA 4XB1A 4C6SA 4E2YA 3BSSA 5JSHA 4I2NA 3ROGA 4DR5B 4NI5A 1Z38A 1ZOOA 3BT7A 3QXJA 1WQ1R 4JJKA 4KQ6A 1KQOA 4NZYA 1TO6A 1VM6A 3G6KA 4WXRA 2P3SA 2YIMA 2I78A 3DWFA 1R0WA 1XTSA 5E2BA 5LDGA 4FM9A 1NQWA 3G1TA 3K2IA 4JR0A 4WDQA 2B83A 4A91A 3K1YA 3MAAC 4D6XA 4WJLA 3W2GA 1IEQA 1G5RA 4B81A 2ZXUA 1KIMA 1V11A 3DE1X 3GPLA 3GLHA 3URKA 1SPXA 3EB9A 4O5OA 4XAQA 3SXJA 3S1AB 1BHJA 1P7PA 3VFDA 1ZH8A 2ZW9A 3ZXSA 4CLRA 13PKA 1QDUA 1U6IA 5F5LA 3QSYA 4W99A 2Y1FA 3FTNA 3AVYA 1NMYA 3A2KA 4W5NA 2MT9A 2XTNA 4JU8A 2W98A 5E3IA 3EEOA 1DKMA 1ML4A 3OZFA 3GJ7A 4DMHA 2AHRA 5FTLA 2VP9A 2VTEA 2XB6A 1NPYA 2FK7A 5DTMA 4BB9A 1A95A 1G1AA 3HY4A 5IABA 2A0FA 1V8PA 2RKWA 3PEUA 4MAFA 4GLBA 1ZR4A 3O8OB 2GILA 4D6PA 1WX1A 4LZPA 2WA1A 4QECA 3EDRA 5BT9A 3F2IA 3IDSA 5HBGA 3O7MA 3GY0A 1KR5A 2FOIA 8ADHA 1QGZA 2Q0XA 1VHQA 1SHZA 2RKOA 2VPYA 3OEHD 1N6PA 4R40A 2I1LA 3LX6A 2NZXA 1R12A 2P9EA 3OBBA 5KAPA 1V6CA 1HE5A 2ZE6A 1XROA 4KKXB 2P4EA 4YAFA 2JIQA 4C5AA 3A3KA 3IP1A 4M8LA 1AG9A 4AJ1A 1Q57A 4YRZA 5I7SA 2EWWA 1CUFA 2G04A 1OLSB 3FKSA 1ZS9A 3VRHA 4CM7A 2HF2A 5L8VA 2ABWA 1NW9B 3ZQ4A 4C4PA 5LQUA 3SQXA 2VC2B 4J1TA 4YRAA 3DOHA 3DFZA 4N3NA 3N0VA 4NBWA 4GL2A 3F3YA 2PPLA 1KDPA 4AJOA 1Y7PA 3IR7A 4OB7A 1GG2A 2HWKA 3OAAA 5F7XA 4RA9B 3HFGA 2JJ1D 1J90A 4M53A 5GJWC 2RGNA 2QRJA 2G8NA 3LOPA 2V59A 4J9VA 2ZYWX 1P7VA 3WGKA 1OH6A 5L7YA 5EHIA 1YRAA 1ODTC 3GVHA 1NA5A 2G08A 4DMLA 3Q8KA 4R98A 2ZTVA 3CUUA 2G82A 3GEIA 1PSWA 1CDZA 1Z0AA 2NUBA 2VOEA 1OIVA 2ZJBA 2J3JA 2WSSA 2PEYA 3KHUA 4IOMA 4NHOA 4ZA2A 5BXQC 1C0LA 1QDLB 3FI9A 3FMOB 4YN3A 4KPYA 3M5PA 4E15A 4KOEC 3IE2A 1LA2A 1E3MA 1G18A 4IDGA 1ZGHA 1GZ3A 3AEUA 3IVGA 2AN3A 4ZU6X 3ZWKA 2PK3A 4UC0A 5ULLA 3GT3A 1YC2A 3NOVA 1PDVA 2JAWA 4TRNA 5EZQA 1CEXA 2NSDA 3IAAA 2GPTA 1L7BA 1QMGA 1U8TA 2XMPA 4HXFB 1DX9A 1GZ4A 4RC9A 1GPBA 4YYEA 1XEXA 2QG6A 1FJXA 2JFQA 3EVAA 4E08A 4PZDA 3P9RA 1JA9A 1DB3A 2HAEA 2FWRA 3VXKA 1T36A 3B6IA 3WO0A 3FPBA 2HIMA 2NWQA 2ZI5A 3MOSA 1QX3A 1NQOA 2JH3A 4EAQA 2H85A 2IXFA 2PD3A 3UTDA 3M6LA 1Z4NA 2QGFA 2IUYA 3CKLA 3C87A 4UDNA 2IW1A 1VIMA 3W34A 2O3SA 4GGPA 3WGQA 2HPHA 1GPDG 4RV5A 4J03A 3OECA 1FVXA 4M60A 4YBZA 4CQMA 4YS6A 4EI2A 5JHGB 1PDOA 4FHFA 5CNKA 3QTLA 1SCKA 1E61A 1JZQA 1JT9A 1JKJA 4MV0A 5EI5A 2GHRA 1DV1A 1VL1A 2NPOA 1RRKA 1DFIA 1T15A 1WXEA 1ZAYA 2FMXA 2JFGA 3W5DA 1RCUA 2G9NA 3SHWA 3B3QA 3UHOA 1JR3E 2VJPA 2AXNA 1UPXA 1YR1A 3GRYA 4JLUA 3MWDA 4J6EA 2ISQA 9LDBA 4Z4QA 1B23P 2OB1A 2YR0A 1JX6A 1RI1A 3BIWA 2WRZA 3MJEA 1O89A 4U0JA 1O8BA 2GAJA 2GZDA 4YAEA 1M2GA 2HB6A 1SQ6A 4N5DA 1BS2A 1MZVA 1ODJA 3BG5A 3FYUB 3ZGNA 1PFGA 1XRMA 2E1PA 1M7HA 1YRLA 2V7QA 5ETJA 5BN5B 4P2GA 5CPFA 4TXNA 2C4TA 2MHCA 4H27A 3V46A 5B3LA 1KOLA 4I9FA 2FSIA 1WB6A 4RVHA 1FNCA 3QE0A 2BV3A 4QUBA 4L6CA 4LN1A 3GBVA 3ETHA 4BNNA 1UM9A 1L8XA 4O4LB 2G1UA 1X1SA 1T4BA 3A32A 3IJRA 5LNK1 1SXJA 2W71A 2ZUCA 2WM9B 1RRCA 3OLZA 4IWXA 3SF0A 3PC3A 3B13B 5AVJA 2AQ8A 3QYFA 4F2PA 2FKAA 5DW0A 1MB0A 4DLBA 1PFUA 3L43A 1DX6A 1F2UB 1YKFA 1Z0IA 3TXAA 1EA5A 3G8DA 4TKVA 5IDYA 1F8GA 2WYOA 1I2AA 1MOPA 2P30A 2ZIEA 3D5TA 1DBIA 3L6RA 3IMCA 5E2IA 3AKDA 1QP7A 3BPSA 1IY8A 1JPUA 4KO1S 4OU4A 2EQ5A 4CQJA 4RZ3A 5IXYA 3LFTA 1PJRA 2O2SA 4MW6A 3STVA 2GBPA 2DB3A 1J23A 3A36A 1GTJ1 2R85A 1X7XB 2QQ5A 2V97A 3KCQA 3N3BC 4EGSA 3F49S 2WD7B 5TDHA 1U0JA 1SA0A 8OHMA 2BAGA 1W88A 4R9UC 1ISJA 3AJEA 5F5XA 3GDWA 4YT2A 3G79A 4JUBA 1SU6A 2FVXA 5EA2A 1F51E 4IXNA 2UKDA 2DX7A 3E53A 1Q1AA 3I05A 1GU7A 5DYYA 3IA7A 4L4XA 3OO1A 4X64B 4RVGA 3TINA 1LF5A 3ZWMA 4FCWA 1GTSA 4BX3A 3UG6A 4KLCA 1FYWA 2A0WA 3CRNA 3QVLA 3HSYA 1H5QA 4J16A 2V65A 2QT0A 1YONA 3DLIA 3VZBA 4ZPJA 4E1VA 1DEKA 2VP2A 1H5NA 3KV3O 2OBMA 2W9XA 1WU7A 1CUAA 3FMPB 3GU3A 3PHGA 1O6ZA 4N7RA 4Q1EA 1ZD1A 2DQSA 4FDTA 1OXSC 1A7UA 3TLZA 4QGFA 2X3FA 3CVJA 4FFPA 1K4MA 4FEYA 4UEKA 1Q14A 2IOFK 1ISRA 2OECA 3OIVA 4WOCA 3QIAA 5E7IA 1P5HA 2QPTA 5J2TB 4ZAVA 5AO9A 1KO5A 1SNYA 3ABOB 1XL0A 3JD4A 1TOAA 1N1EA 2H65A 2V5AA 1DHTA 3WDKA 3QEAZ 3UAGA 2HADA 1L4EA 4C3UA 2C5LA 4LMPA 1KI9A 3H5OA 2FW0A 4QRHA 4YI5A 4WIAA 3RBXA 1DJPA 1C3EA 3NO4A 2JCGA 2WUFA 4R6XA 4E2FA 1DQZA 2C29D 3MCTA 5BQPA 1D0IA 2FCRA 5D8DA 5K51A 1EGMB 2QW0X 1AKYA 1RAGA 1RFGE 2IXGA 4LNHA 3MWKA 1FE8A 4YJGA 4MB0A 1BH2A 1AX9A 2QGNA 3H4VA 2AN1A 1ADJA 1LY1A 3ZYZA 4CEHB 3QWAA 1H2YA 2FFJA 4OM7A 5I4KA 3ORRA 3C8DA 4RKQA 2MSWA 3JS5A 5JD3A 5KU7A 1R74A 3BZUA 3GQBA 1EUCB 1ZI8A 2CY0A 2GLTA 2WU1A 4QU0A 4XYLA 3MHTA 1QKIA 3PA8A 2HHCA 3WGVA 4EG1A 5JQWA 2OO5A 4FONA 2JGIA 4BO0A 5EHXA 1JEDA 1WDLA 3RT7A 4B17A 3IJEB 4BFYA 4BP8A 5KWIA 4MV1A 1Q2UA 1M0WA 2JK0A 3GGPA 1H0HA 2ZUDA 3OZEA 2CV1A 3AIKA 2GKSA 2W6NA 3MWJA 3IQIX 1GZVA 3O03A 2IWHA 3U4HA 2WG2A 3OM9A 3QHQA 4H1TA 2DQ4A 3ZJ5A 2WIDA 2VHCA 5CVCA 3HYSA 4OQNA 3C3AA 5C34B 3ZVRA 3F8SA 4AU1A 4B85A 4BUCA 4YAIA 3CLSC 1W5TA 2O7QA 3CV3A 4L73A 1J70A 2RHHA 3TL2A 1YDFA 4UAUA 3SLGA 4CGYA 1NHWA 3KKOA 3UPUA 1T43A 2IOQA 4C03A 4E2ZA 1GQ2A 1V25A 2WIKA 2Z95A 2XYRA 4JBGA 2ADMA 2FUEA 1Y9EA 3AHEA 2FRVA 4GVLA 4BWVA 3KOYA 4LSWA 3NIGB 3U40A 5KYGA 4I4TB 2XDQA 2XE7A 2ZYGA 4RH1A 1P44A 1JFFB 4YCJA 1OKKD 1HNZB 4PSVA 1QQBA 5IANA 3GXBA 1YIOA 1KOFA 2CVOA 1S8AA 2ZIUB 3R7WB 1RXYA 1ZKDA 4BB5A 1FDOA 4C6TA 4CKWA 2NIPA 3QJGA 2BOVA 4WL0A 5SY6A 3ND5A 1QRTA 4YUWA 3KQTA 5B1IA 2VYFA 1QVWA 3UNXA 4EHDA 3B3GA 3Q2OA 1FMCA 1M2OB 2Y0PA 2EGGA 1RJEA 2N3ZA 4TKUB 5JNTA 1QOPB 1HQDA 5HHTA 2AQKA 1RM5A 4UHEA 1P31A 1C9DB 5KNCH 4DB2A 3RODA 3TPZA 4B4VA 3C14C 5JZBA 3EZGA 1M5RA 1H6AA 1L4FA 1IRIA 2NQ8A 2RIPA 3OOEA 3W6UA 2WIFA 4FI3F 1ZM9A 1J4AA 1JXAA 2ZB7A 3GRRA 3ELYA 3KXIA 3NHUA 4XLZA 1K8YB 1OU0A 2PEZA 4EFMA 1XG5A 3X44A 3RSHA 2JGAA 2H7YA 3TJRA 3KT6A 1NQXA 1ESEA 3BBPA 3EAQA 3RRNA 2CZCA 4DZRA 1IVSA 1M9NA 4HKTA 4S1WA 3DEZA 1FU4A 3MMXA 5IAKA 3OWOA 1PGJA 4DUGD 1QH1B 3E18A 1EUQA 3IOBA 3B1ZA 4F46A 5B36A 1OB5A 2W70A 4WBNB 2O0HA 4JELA 4RWZA 6Q21A 2IC5A 1XXHE 3GP3A 1USVA 4CCWA 4G2NA 2TMKA 4YV0A 2PMBA 3DMFA 1SXHA 1XQVA 1YI1A 2BL4A 2C77A 1N3IA 3DHVA 3O3OB 2XPCA 4GM1A 4TSFA 4CKBB 3ZY6A 2XUZA 3P27A 5CEFA 3N0WA 2IDJA 4HNHA 5CA1F 2E7ZA 4MUXA 4LZZA 1A2QA 4JLPA 5CAEA 2HSEA 2REBA 4MTCA 4QPJC 1F0PA 5JSYA 4CZ2A 1YMUA 2RJOA 4PG6A 5JAQA 3WHKA 4EHBA 2VCEA 3HDGA 2FJPA 3OBIA 4ZI7A 5BUCA 3U81A 2VLBA 1OXTA 2O6HA 2Z4TA 4GRAA 3ZJTA 1RQPA 4JDUA 1YZUA 2G9QA 2VZLA 4L74A 4I4NA 4UATA 1ITZA 1KI6A 3WTCA 2Z5GA 1IY1A 4CG3A 4E51A 2NOAA 3ZEAA 1G8JA 4Z0NA 2OMKA 4JP8A 2D1SA 2FRXA 1ZOIA 1NKVA 5BORA 2Q0SA 4CM8B 1WBJB 2CHVA 1P80A 2YBEA 3EH1A 4HQRA 5H81A 4I55A 3L1IA 2AFHB 2DTEA 4Q9DA 3EA5A 2IIVA 1AV6A 5AYVA 4WN9A 5L45A 2WT4A 2VJAA 3L7LA 5KDLA 4Q01A 5AJWA 4EVQA 2O3TA 3A9WA 2D0OB 2P7IA 5DNVA 1A0OA 4PZYA 5DBOA 1W47A 4MDYA 4A0SA 3OT4A 2FOXA 1UPAA 1U5BA 1BE0A 1Z7BA 2CCJA 5LIRA 4M38A 3R3VA 2CWDA 3GLTA 3HLKA 2G8LA 3LRXA 3M34A 3SQWA 1OI2A 1V5WA 5EMHA 1L5KA 1M76A 2F8SA 4LYEA 4R8MA 4E09A 4DJAA 1YCHA 2GD2A 4UM9D 1PJTA 4IHJF 1KJ8A 2FQYA 1D2NA 1T9GS 3QFSA 2BTEA 1CRPA 3MAJA 4JA0A 1YRYE 4CLOA 2Y9MB 5JAIA 3LUGA 4KQCA 4AJEA 2P4UA 1DI0A 1ONBA 1UKEA 1I5EA 2R4QA 2VFAA 4NV1A 1JR4A 1KK1A 3WGIA 4A1OA 3R3WA 1XALA 3VX4A 3HEMA 1IJFA 4LWZA 1KMNA 4NULA 4BX8A 1DE0A 2REQB 3C1UA 1OFUA 3G68A 4FWBA 4RM2A 1ZNXA 2OAGA 5I7RA 2FZLA 4DA9A 3IL2A 2AOTA 3S44A 4AP5A 1E5XA 2ZRPA 3ZW8A 1RSZA 4S1PA 1NP7A 2WM8A 1VHTA 5KOJB 1H2RS 1PSZA 1Z4IA 3N3AC 1C9KA 1NU8A 1VRWA 5K05A 2HLHA 3JU3A 4NYJQ 2AK3A 3K09C 5MHTA 4HN2A 1A50B 3R09A 2HV9A 5K0EA 3TW8A 4EMTA 1T4CB 5M04A 2X2FA 4FVTA 2W6ID 2WEKA 5I5EA 4CTJA 4BNKA 1B41A 1V48A 2IYXA 1UBUS 2DPGA 5FBHA 4IWNA 3TLGB 3WRYC 1QU3A 3ETGA 4B8YA 4RXMA 1KP3A 1DV2A 1V5FA 2XI4A 3ZWAA 4DCJA 2DAPA 3D8RA 3PJDA 2OYCA 4RU1A 1BH6A 3BF8A 1KKMA 1FFSA 1SBIA 4Q03A 3T8YA 2JDIA 2IBMA 2ISSD 4NJEB 2I1WA 1P9LA 3Q3IA 4WOKA 3SE0A 3ZQJA 4EL0A 1IWBB 1OJLA 3BXEA 5EIXA 2O14A 4CLXA 2GCOB 1J1UA 4KDEA 3DXFA 4WXHA 1JIUA 4CTOA 2GXAA 3PC8C 4QGBA 5TEVA 3E3OA 2R6FA 3SSMA 5FV4A 4R1NA 2BN4A 4WKNA 1Z2CA 1MG0A 4OI1A 2P9GA 2JRLA 3ZHCA 2DWQA 4DC0A 1DQNA 4W8HA 2PH7A 2V55B 1VHLA 2GCPA 2O1XA 3HB9A 3VUFA 4BVFA 3U3RA 2ZR0A 3MTQA 4PHGA 4UHBA 2O8NA 3WOHA 1GZ7A 1TW2A 3A04A 4OQXA 4CYMA 4NFYA 1ZVQA 5I7VA 4I5FA 1T9AA 2QAGB 3C7DB 4NENA 1TLLA 3VDRA 4DLVA 1IIBA 4JYZA 1M6VA 1K7EB 1P7WA 3E9RA 2WHQA 3DMNA 1JEJA 2NLOA 4HGOA 2X0FA 3K4HA 4EP1A 3ASYA 5GP1A 5LOVA 3PE4A 3E22B 4Q4JA 4TMKA 3D3KA 2WYIA 5BNZA 2A5LA 1IQ0A 1U3TA 2YUTA 3ETJA 3R20A 1KHHA 3BMXA 2QTAA 3F6PA 4G0OA 1EFPB 1E1RA 4R31A 4YCSA 3NHFA 3H9CA 3ITDA 3K70B 4ZEVA 3QXXA 1B73A 4N48A 2ODEA 2XAAA 5AJVB 1EUYA 1RI3A 3CE6A 4BZXA 3M4YA 3Q5GA 1G9TA 4ARZA 1KEEB 1CJSA 5T4HA 3NBYC 5IW8A 3PXDA 4EB8A 2NYUA 3LP5A 1KDVA 4TYMA 2QRVB 4NAHA 4C5CA 3IDZA 4EGAA 2Z5VA 2D1FA 3G59A 3FFBA 2PH3A 4GIBA 2PKWA 2PQMA 3GOQA 4OAPA 5HUHA 1EK5A 2AT1A 4ILKA 4ZO4A 4DCNA 1AUQA 1SZCA 2DHDA 2OYRA 4HTFB 4WOJA 3QBEA 3Q10A 3GRKA 4OFZA 1R8YA 3GZNB 4PYRA 3WJAA 4UHJA 1J20A 1TXGA 4QU8A 4EI9A 1X7YA 2YQ5A 1RYBA 1VBFA 1UPFA 3AV3A 1NJGA 3LKBA 3EA0A 2JIDA 2ZFUA 4NYIQ 3K73O 4QZVA 3PZBA 1YR6A 3Q3CA 3FSGA 4QQ8A 4N03A 4RMIA 4JR1A 4PXAA 3ZJYA 4QBHA 1R16A 2OCGA 1QHXA 2QI9C 2WV7A 3F6EX 1CR6A 1JQ3A 1FW8A 2HRZA 5F1PA 1PD1A 2FPUA 1ZMOA 4NMWA 4GS5A 4RCVA 3KPWA 3OEEA 4X44A 5CVUA 3MMSA 3EBOA 2PGNA 1CZUA 3HJHA 3I6ZA 5GOZA 3AR3A 4UHHA 4AXBA 2MYUA 4DLAA 2PLAA 4N5NA 4O3FA 2SKDA 3N9IA 4ZCIA 4Y1EA 2O1SA 1WW2A 3ZXUB 2AFRA 1D2HA 3EDOA 3F0TA 1TO2E 2B30A 3FPAA 3GZJA 4FNAA 4NCJA 4J49A 4JI4B 4NCBA 4FGLA 5CLIA 2BKXA 1Z34A 2QTWB 2C7QA 4FBLA 2BGTA 3ANYB 3BXOA 4BGIA 4DR2B 2VZ8A 2C7PA 1TFUA 4J3JA 2WFMA 1P62B 3A7EA 1VPTA 3VPSA 4UXIA 3QEJA 4DZTA 2WSBA 1C1XB 1OZGA 3UW3A 3WLAA 4A0RA 2GM4A 5BSWA 2EYUA 5CCEA 1NE2A 2Q1TA 4K9SA 4NATA 2FLVA 1ZINA 2ADOA 3QWBA 4LOHA 3QKIA 1DUSA 1C3XA 4WWHA 3RI3A 2ZBFA 1YVEI 4MVJP 4NU6A 5GM1A 2NU9B 1CYEA 4IV8A 3N0XA 4YMHA 3EGWA 4PE5B 5EHNA 3IGFA 3LRPA 4RPLA 5DM0A 1WTAA 3SPXA 1YHYA 4BNWA 2PKQP 4UBMA 2VF5X 4L28A 3GPDG 2DFNA 2UDPA 3RFFA 3DBLB 1E5LA 3PKJA 2PUWA 5IUJC 4H7FA 2A4MA 4HQ6A 4TTSA 5DLQC 3BVPA 2XZDA 2WUVA 2EP8A 3MJHA 2FZWA 3JQFC 4XARA 1SHLA 1LVHA 1K3TA 3TIXB 1JJ7A 1NSFA 3D2AA 4JXXA 2VHWA 2EG5A 1NM5A 2R8YA 4QEDA 5KJFA 1R9GA 4DWWA 3IELA 3EVEA 1YDEA 3DJYA 1LTHR 3C16C 4F72A 3KLBA 3OAAD 4S1TA 2CYBA 4ZVTA 2B99A 1WR8A 3DZBA 2WM3A 3SEAA 4TMWA 1KQFA 1E3QA 3E9DA 3KS9A 1F2DA 4IDPA 2G72A 2BD0A 2O2ZA 4LMRA 3MUOA 1V8BA 5KYKA 3KQKA 1EJBA 5JAMA 3VR2A 1M10A 2I2FA 2NU7B 2ZB3A 4O0MA 4IICA 4QDKA 2OBLA 5G53C 5I7OA 2YIVX 2PDAA 1QF9A 3EBLA 1DUIA 2EJUA 4LF5B 3GFQA 2GGSA 1CRZA 4IUYA 4XWOA 1RYEA 5J59A 1Z8DA 4N12A 1FVOA 1Q83A 2Q28A 3A4IA 3NHWA 3PFGA 2NU8B 3B51X 2QRHA 4JK3A 4TM8A 1YNSA 4IV5A 4F6RA 5KC9A 4PLPA 1U7ZA 1AUOA 1NF3A 3K6KA 5JXWA 4HG2A 1L1RA 1F5NA 4LE2A 4NY1A 1ML3A 3CLTD 2OHIA 2JAHA 1U2PA 3I4FA 1CW2B 3DZDA 3V1YA 1L7XA 2H2AA 2WDZA 5DNYB 5JPIA 2O4UX 4LHVA 4TVKA 1A9XA 3VNRA 3WQRA 2IH5A 3ZDCA 4CMCA 3HXQA 1I32A 4H59A 1T0JB 2XQGA 4ED9A 3ZQUA 3WGZA 2DLDA 3OJOA 1KMQA 3VNUA 4XVUA 3FPLA 4JQOA 2P69A 4M36A 1KERA 4BIIA 1XVIA 2E2WA 2NSLA 3GMIA 1M6YA 4GRDA 4A10A 1OC2A 3EUFA 5A5GA 1E96A 1G8SA 4YDQA 3GLUA 4BP1A 2V5VA 1CRLA 1DLIA 3IUPA 3NWJA 1B0PA 4J1NA 4OB6A 4XB6B 5AH0A 1DCTA 2DTDA 3IDQA 3U2QA 3UG7A 3QX9A 2O50A 4TKLA 1ATIA 3RKRA 3RIEA 3R5KA 3IODA 1M0TA 4W82A 4NOLA 3ZBPA 1W75A 2ZIWB 2W6CX 3QLVA 3TSWA 2VYQA 3K6RA 1Z6QA 4KODA 4ZN6A 1BVUA 1FVHA 3M83A 4F8JA 2R11A 4KR2A 2D4HA 5HZMA 4PZ9A 2I2DA 2ZPTX 2CK3A 1IK4A 4I9HA 4EMSA 3RG8A 5IHPA 4U3JB 2O3JA 1VA5A 2PL9A 4HDMB 4JMLA 5HBRA 1JH9A 4Y1FA 3A6HA 2M1XA 3DF9A 4MRNA 5CM2Z 1K63A 4OGFA 4ZZ3A 3O74A 5BYBA 2GEBA 5ENDA 2QTGA 1XRRA 3I42A 2Q1UA 1VZ2A 2RHGB 3EQ6A 2JI9A 3KZXA 3IOCA 1ZZGA 1FDIA 3HJAA 3OE7D 4JJ7A 2KX7A 1OILA 1DAGA 2CFOA 1XA0A 3PHIA 1UP7A 3LLMA 1DOHA 3EFHA 1N75A 2FPGB 2AXEA 3KLMX 4KCGA 4RK1A 4E4YA 1YBVA 2QX7A 4LTDA 1RPTA 5I7UA 3WYBA 3WV5A 1ESZA 1RNLA 1Z6XA 1GG5A 1N0VC 1ZIXA 5L7WA 4V02A 3OY2A 4H77A 2AL7A 5HUJA 1EX7A 4O2BA 2ZS8A 3K09A 1NN3A 2HNKA 3C6YA 1G5PA 1PUXA 4C2BA 4FGWA 3OCZA 3O3CA 4JX8A 4TV8B 1SUPA 2YWXA 3U44B 5TQJA 3JSXA 3G0GA 2EARA 3DFIA 3E4DA 4LJ6A 3K70C 4HWTA 1P1IA 5HVNA 2PJUA 1Z0ZA 2R47A 5TEWA 2WJJA 3PPXA 1Z4MA 2ZIZA 4F9FA 5IJ9B 4QOEA 1OTHA 1DELA 1XAHA 4F3TA 3I2JA 3NU1A 2BBWA 3RLFA 3IMEA 4WZAB 3PQ3A 1ZCJA 5D5QA 4C2UA 2JATA 3ELWA 3RSZA 3W0LB 2WV9A 3HZHA 4JT2A 4JXZA 2UUPA 3KZVA 4KFTA 1O0CA 5KB3A 2A0XA 1Q6ZA 1HE2A 2DCMA 5J63A 3T4XA 5BOSA 4TVSA 4KR6A 2WHEA 4LOJA 1NVMB 1TEVA 1PO7A 2FGJA 2FFHA 2FWMX 2VEDA 2I33A 1WDKA 2VRNA 1PZGA 2CXRA 4L9RA 4LGCA 2XADA 4N54A 4C20A 3MJDA 4QO8A 4RGBA 1PT8A 1T2DA 1UJNA 2C99A 1GCUA 1V9LA 5G4KA 4OATA 4FLFA 2OCLA