2IV3A

Crystal structure of avigt4, a glycosyltransferase involved in avilamycin a biosynthesis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
340
structure length
337
Chain Sequence
PLKVALVNIPLRVPGSDAWISVPPQGYGGIQWVVANLMDGLLELGHEVFLLGAPGSPAGLTVVPAGEPEEIERWLRTADVDVVHDHSGGVIGPAGLPPGTAFISSHHFTTRPVNPVGCTYSSRAQRAHCGGGDDAPVIPIPVDPARYRSAADQVAKEDFLLFMGRVSPHKGALEAAAFAHACGRRLVLAGPAWEPEYFDEITRRYGSTVEPIGEVGGERRLDLLASAHAVLAMSQAVTGPWGGIWCEPGATVVSEAAVSGTPVVGTGNGCLAEIVPSVGEVVGYGTDFAPDEARRTLAGLPASDEVRRAAVRLWGHVTIAERYVEQYRRLLAGATWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCOSYLTRANSFERASE
publication title Insights Into the Synthesis of Lipopolysaccharide and Antibiotics Through the Structures of Two Retaining Glycosyltransferases from Family Gt4
pubmed doi rcsb
source organism Streptomyces viridochromogenes
total genus 105
structure length 337
sequence length 340
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2iv3A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2iv3A01
2XGMA 3H4TA 3SYRA 3CUUA 3S27A 5DU2A 2BGUA 3ZCTA 1NLMA 1XOIA 3AMVA 1F0KA 1FTYA 1FA9A 3ZCPA 3OY2A 1F6DA 1Z62A 2IV7A 3OT5A 2BFWA 3NPAA 3TOVA 3MRVA 1UQUA 3G2NA 1NZFA 3WADA 3EBOA 2XA1A 4MRAA 1XKXA 3L79A 2QRGA 3ZCVA 2QRPA 2AV6A 2F9FA 2VG8A 4CDRA 3C4VA 1C8KA 1GPAA 3GUHA 3CUWA 1Z6QA 1FU4A 1E4OA 3QHPA 1P2GA 1JG6A 4X7RA 3CEMA 2KS6A 4GYWA 4CTMA 1WW2A 3MT7A 2H1HA 3MRTA 1PSWA 3Q3EA 2O6LA 4BQIA 1GG8A 2IEGA 2X0EA 3BEOA 3S28A 4XI9A 2SKDA 3OTHA 3BCSA 2FF5A 4REMA 3RT1A 2ZB2A 2BISA 3D1JA 3MRXA 4LEIA 3T7DA 4RIIA 2GJ4A 4GZ6A 1PNVA 3RHZA 4F97A 2Q6VA 1WV1A 1SXQA 5TMDA 1O6CA 3MS2A 3MS4A 4WADA 3CV3A 2GPNA 2XA9A 1L5WA 3E3OA 4M60A 3G2IA 3MSCA 3ZCRA 1L5QA 1FTWA 4RIFA 1YA6A 1AHPA 5ENZA 2XGOA 1QM5A 2G9QA 3VUFA 4N3CA 1FTQA 1P2BA 1C8LA 1FU8A 2QRQA 3G2JA 1Y6GA 3CUVA 4G2TA 4KQ2A 1E1YA 1GPYA 1VGVA 2C4MA 1C3JA 2SKCA 2F3QA 2ATIA 2P6PA 2GEKA 4GZ5A 1NOIA 3EBPA 1L6IA 3T3HA 5TMBA 1P29A 4L22A 1IXYA 2WTXA 1M5RA 4Z5XA 1L7XA 2VCHA 2FFRA 4N3AA 1HLFA 2XCIA 1XC7A 1JIXA 3HBJA 3Q3IA 2QN1A 2JJMA 2QLMA 3MTBA 3L01A 3GPBA 1WUYA 3NP7A 1JEJA 4RIGA 1RZVA 1UZUA 4AMBA 2R68A 3UYKA 1FU7A 5I45A 2QN2A 3E3NA 4KQMA 3BCRA 1RRVA 1Y6FA 2C1XA 3S0JA 2AZDA 3Q3HA 3S2UA 4EL5A 3L7AA 4YI3A 2VSYA 1EM6A 2QLNA 4AN4A 4NESA 3VDNB 3OKCA 1V4VA 2PYIA 1P4JA 3UYLA 4HWGA 3T3GA 3DDSA 2QZSA 2IEIA 2JLBA 2R4TA 2XA2A 5GPBA 2R66A 6GPBA 1ABBA 4X7MA 3S29A 1LWOA 3H4IA 2XMPA 1Y8ZA 5D01A 2GT1A 1GPBA 1XL0A 3MT9A 4BQEA 1PN3A 1Z6PA 1WV0A 3BDAA 5DXFA 3E3LA 2QNBA 3T3DA 3L7CA 2AW3A 4N9WA 4RIEA 1NOKA 2QRHA 3HBFA 4RIHA 3L7DA 2IYFA 2ACWA 2PQ6A 9GPBA 2X0FA 5DLDA 4CTOA 5BNWA 1WW3A 3ZCSA 1K08A 1XL1A 3OTGA 4XIFA 3SYMA 1P2DA 1FC0A 3IAAA 2QN7A 3MBOA 4MHOA 2X6QA 5D00A 5LQDA 4N3BA 3VDMA 2XGSA 3MS7A 1IIRA 2F3SA 2R60A 1L5VA 3G2LA 3OKPA 2R4UA 4AMGA 1BX3A 3CX4A 4KQ1A 1B4DA 2F3UA 2X6RA 4X7PA 3DD1A 4WACA 3COPA 4EKEA 2C9ZA 2H1FA 3NB0A 3IA7A 4FKZA 4LDPA 2X0DA 1KTIA 3WAGA 3OTIA 4PQGA 4X6LA 8GPBA 1J39A 5C1DA 2QN3A 2AMVA 3G2HA 1GZ5A 2ASVA 1P4HA 1LWNA 2SKEA 5HXAA 1L5RA 3TSAA 3PE3A 4RELA 5JTUA 1AXRA 3RSCA 1JG7A 1UQTA 2ACVA 4RENA 2FETA 4F9FA 2GEJA 4CTNA 3MTDA 2IYAA 4MI9A 3ZCQA 1NVKA 2XCUA 4EJ2A 1YGPA 4M7PA 5JTTA 2QLLA 1A8IA 3NC4A 2VSNA 3MQFA 4GPBA 4GYYA 3OKAA 2G9RA 2JZCA 2QN9A 3HBMA 4BFCA 3VUEA 4F96A 3NP9A 5IKPA 3NAZA 4BQFA 3CEJA 4YI5A 1C50A 4MI3A 4MI6A 1Z8DA 3BD6A 1RZUA 1XV5A 3DZCA 3HBNA 1GFZA 3FROA 2PRJA 4EKYA 2GPAA 2OFFA 3ZCUA 3C4QA 4M83A 4N39A 3NCHA 2IV3A 4MHSA 3CUTA 4W6QA 1P4GA 1EXVA 3C48A 1WUTA 3RSZA 4AY5A 1JIVA 2IUYA 3MTAA 2G9VA 4NEQA 3D0RA 4RBNA 2PYDA 3DDWA 3PE4A 4NC9A 3G2KA 2F3PA 1FS4A 4HLNA 3O3CA 3L7BA 4MICA 1JIUA 1SXPA 2HY7A 2YJNA 1PYGA 3OY7A 5TVGA 4WHMA 3TAXA 1H5UA 2C1ZA 2G9UA 2GPBA 2ECPA 3CUYA 1L5SA 3D0QA 5TMEA 3MT8A 4EL0A 3BD8A 3BCUA 4FZRA 1GGNA 2GM9A 5IKOA 3BD7A 3T5TA 3T3EA 2VCEA 3CEHA 3T3IA 2IW1A 4QLBA 2QRMA 1K06A 1NOJA 3WC4A 4YUAA 4AY6A 2PRIA 1NZDA 3QKWA 4GZ3A 1QKJA 2BGTA 7GPBA 2QN8A
chains in the Genus database with same CATH superfamily
4WNCA 1IONA 3ENVA 3OEED 4F0JA 4OOEA 4BMCA 3L6CA 1FPQA 4KQXA 4EB6B 1FTYA 3MTQA 4R8MA 5ERYA 3TLXA 3VR4D 1ZITA 1UK6A 1H2RS 1OR8A 2AN3A 2WHEA 2IUFA 3TECE 3BD9A 4BKRA 2ZWAA 1ML4A 2J7KA 1HDEA 2HIHA 4J90A 2F00A 3IIMA 4V1CA 4EA7A 4GI1A 1H8ED 1E0SA 2AG6A 1NUHA 2J31A 4PM4A 1K6XA 5JVDF 1FJXA 1T1SA 5JH7A 1JX6A 4MV7A 1AK2A 1ZMBA 5CCDA 2EKLA 1PS9A 3JD1A 2JLQA 3OUUA 3RRFA 1P8JA 3GJTA 1E3EA 4QHTA 4R68A 5DWQA 3Q0EA 3S70A 1E3QA 2CVZA 2GHTA 2R6ZA 3CS3A 2CUNA 3IJRA 3WRWA 3O73A 4HLUA 1BFKA 1C7QA 2H06A 3C5VA 1B0PA 1YL5A 4MDEA 2C5AA 2DKOA 1X39A 4IVRA 4H1HA 3VU9B 1T6ZA 2QDKA 4UQPA 3NEAA 1U7UA 3FSRA 3TX2A 3E7DA 2PV7A 3CZ5A 3NNNA 4LXXA 1K6EA 1E5QA 4Q48A 3A37A 4BECA 5C7OO 3THWB 4G0WA 3SEQA 4KAAA 2IE8A 1NHWA 2JANA 4QDJA 3U7QB 1E4OA 1L4MA 3IVGA 2YXLA 4A0QA 3GRZA 3UJAA 1WAMA 3CR3C 3RS8A 1CUFA 1U7ZA 1P1RA 3INYA 3ZWPA 4P4UA 4DUGA 2PZJA 4GYWA 1KEEA 3L46A 4PQYA 4JV5B 3A6GA 3I42A 3K0EA 5FA8A 2G40A 2P2DA 3VC3A 4X1KA 1AXGA 1TLFA 3X2FA 4QU9A 1Z17A 5CB0A 4X60A 3JWPA 1F5NA 3S99A 5H3HA 3S2YA 2MSNA 2Z2YA 3C1TA 4L4XA 3TMYA 1DO8A 2SKDA 3VNUA 3GMTA 2WJZB 4NQZA 5JYBA 1KJZA 1J5PA 1TEVA 1PF7E 2GXQA 5EZYA 1C7IA 5LBTA 1R0SA 3ZTWA 2G9ZA 4MWCA 1R4NA 4X84A 1PDVA 2X5OA 1S6YA 4K8OA 4OHBA 4BLRA 2KMLA 1ZOIA 2OCYC 4FGKA 6YASA 4L8FA 3E9EA 5DE3A 3HO8A 2ATCA 1XXLA 4TYWA 1QGAA 2R65A 3NAGA 1Y5RA 4KWHA 4CMEA 4UEQA 5CDFA 2I3ZA 4RIIA 1QF6A 1D4AA 3OOHA 1LPPA 4XWWA 3ANSA 1Q77A 3JD2A 1J33A 1J07A 3DT6A 3IQGX 3PF9A 4LZNA 4W9NC 2HBQA 5KPJA 1IZZA 3DJFA 5HF5A 1DXHA 4YQYA 5IXJA 1VPWA 5IT4A 3N28A 1Q22A 1N1EA 1KE1A 4TL9A 3F97A 1C7EA 1CUXA 2ZDGA 3K0FB 1WP9A 3AHHA 2Q4DA 5KREA 2HK7A 3RAFC 1J6UA 1JDNA 3QZUA 5EWJA 4BEWA 2BPOA 2HJWA 3L7YA 3ZCXA 1RXIA 4ECEA 3E9YA 4HXGA 1VLLA 3OU6A 4GR5A 5LOVB 3W4IA 4GU5A 1L8AA 2WB2A 1IRIA 1XNRB 1P2FA 1T9HA 2C0CA 1WKBA 3MJRA 4QBTA 2JCSA 2XD4A 5K0BA 2F17A 3C8UA 4D4GA 2BM0A 1CVRA 1Y6GA 2FW1A 3Q4GA 3W8DA 2X9VA 3GRUA 4QA9A 1Z5ZA 2NPIA 3MWYW 2BGIA 4QJIA 4RAOA 4YMSA 1J00A 3KLNA 1GPYA 2HEIA 2ZUVA 5DHQA 1JEYA 2JGKA 1FJGB 1IM8A 3BA6A 4OKNA 5E3HA 2CYBA 2V6MA 1WG8A 2X0KA 5EXEA 1SBYA 1QGUA 3NRBA 4HRAA 4LHZA 4ZYVA 2RGAA 3MVEA 3R5JA 2GA8A 3MJSA 3QBVA 3E2PA 4MVJH 5FQOA 3ROZA 3CZ9A 1UJNA 2C5EA 2L18A 1ZIOA 2ZR0A 1J9ZA 3Q6IA 4NONA 4YCBA 4JJ8A 3C8MA 3GRVA 1Q20A 1M10A 3GP5A 4Q4HA 4LHEA 4Q47A 4ID9A 4DQKA 1W87A 3I9KA 3OP1A 3D43A 4JBXA 1UBEA 1WS6A 3KWMA 1L4UA 4XB6B 3J81A 1ONBA 1TTTA 2FMTA 1JMVA 4MKZA 1HZZC 1CZNA 1JR3D 2DKNA 3DUFB 3K0HA 2ZQYA 2IPLA 1JN0A 5TPZD 3T0FA 1VPDA 3N2NA 3MBKA 1YZVA 4CUZA 4KWCA 3WKEA 2ADFA 2BCEA 4CIDA 3EMKA 2XHZA 2AMLA 1Y3AA 3KYCB 1RABA 3OQHA 5DIZA 3K0KA 3HRKA 3AEQB 1PVOA 5D3KA 2O0LA 1GNPA 4H1VA 2KLBA 2VPQA 4J0QA 4P31A 1YQWA 3F0TA 1U5BA 2C03A 1DEAA 4M7RA 4PZUA 3JQ9A 3MTBA 4AG5A 4CEHB 4NX2A 2P5SA 2OLEA 2FPIA 4G1UC 4PTYA 5LQRA 1FYFA 1GGEA 4OH1A 1JEJA 2R5FA 3P45A 1VJDA 4RIGA 2PH3A 1I2DA 3TRKA 1TJ3A 3RRYA 4NCKA 1M1NA 5A1TA 4A2WA 1G1AA 1W36C 1P6XA 2R2GA 4NSNA 4FLMA 4O5OA 3S8MA 3LY8A 1J7KA 5K6RA 1XMVA 2IELA 3N75A 3REQA 3MTIA 2ZWMA 4DV0B 3R9XB 1CY7A 4OTZA 4QQFA 3FA2A 1RRVA 3AJAA 3LP6A 1IUOA 4ENSA 4A3SA 3C7CB 1NDQA 3C1OA 4GECA 1WSWA 3RSHA 1V4BA 1YA4A 2O9JA 1QANA 1AGNA 3Q3HA 4WV3A 4X8OA 4D8WA 4M1ZA 1O4VA 3TLGA 2Q8PA 3RLFA 5BN1A 3QIAA 4X20A 2CXHA 2JJ2D 3OCYA 3KWFA 1G8JA 1E92A 1TAHA 4OX9B 1TE2A 2XMCA 1VCOA 3TJMA 1OPRA 4B4OA 1YJQA 3G88A 2AG0A 3DSRA 1XVUA 3DOHA 3FDXA 2YVAA 2ZSEA 1RXVA 1ECCA 3UFBA 4FNOA 4I2VA 4HB3A 1ISGA 4XPIB 4KEAA 1PQ4A 4MW6A 5KNDD 2C20A 1EGAA 4FOPA 1EX9A 5ADWA 3HJAA 1O94A 1L7VC 1Q1NA 2XNCA 4P0QB 3VAAA 4B48A 4OXYA 2VF2A 1G8FA 2Z3VA 3KVRA 1MKYA 3AFNA 5BN3A 3WV5A 3O91A 3HUUA 4K1XA 4MITA 3CZMA 3N2IA 1D4FA 3ESQA 1XVAA 1KVQA 3E84A 3E8MA 1VFPA 2C4TA 2PKXA 3M9WA 1TTHA 4E46A 2D13A 2KBFA 2UZ1B 2BHRA 4DM7A 4HGOA 4ZXFA 3C5CA 2OD7A 4O4IA 3CGWA 3THSA 2A7QA 4NYJR 1LNZA 3T3OA 2AFHE 1E79A 4J1TA 2ZTUA 1T8WA 2BCJQ 3KEFA 3THOA 3UO8B 3DZ8A 4X8LA 2QQ5A 1AUQA 3BICA 2QRKA 3NOOA 1NRJB 1UP7A 2VJAA 3F5FA 3UNXA 3WLEA 1KI4A 3CUEF 2VRCA 4CEIB 5L40A 3M3PA 1YZYA 1J56A 2JIDA 2AMFA 1MB4A 3KB6A 3FLMA 3I2JA 4L4ZA 5AI5A 3WKBA 2BYTA 2FFAA 4XGNA 4QDTA 3R3ZA 4B3JA 4L5BA 4XLZA 1CRWG 1NQUA 2EC5A 1T5LA 1WUHS 3LSYA 1BGWA 4DW8A 2F3RA 1E1QA 3U5TA 2Y27A 5FWYB 4NZNA 2F43B 2AXNA 1LI5A 1K9SA 4YACA 4M22A 3DKPA 3NOXA 3ZX4A 4KYUA 4G85A 4ARIA 1A9XA 3U4HA 1TVKA 1NN0A 1GPUA 3MB5A 4EGQA 2O8EA 2O52A 4QYWA 1YR3A 4B6SA 1GPNA 2HDWA 1BX1A 3DBRA 3HJBA 3W2EA 1P0CA 3VDRA 3MUFA 3AIOA 4MVJF 3TDNA 1R0RE 3G6KA 1DINA 4X3CA 1C0KA 4GSLA 4XIFA 1EWYA 1I3CA 3HP1A 4YR9A 1JDBC 3SBDA 3FPSA 1PZFA 2HZBA 4KRGA 4BVLA 4BJHB 1RYMA 3GGDA 2X8WA 2Y68A 1WUJS 4NEHB 1GZ4A 3VOSA 4F93B 5CU7A 1IM2A 4O0MA 5JH7B 1VJCA 1DAHA 3GT3A 1N3IA 1L5VA 1IY0A 5K6AA 4HEQA 5BXQC 3INGA 1DWQA 1NM5A 4KVGA 1BX3A 2BRUC 4X93A 2WJ6A 5B4VA 3CKMA 4EHDA 4HDSB 2E1PA 3QPAA 5ED0A 1MJFA 1DRVA 4BMZA 2DT8A 4LAFA 4PX9A 4Q19A 2BDEA 3EGOA 4GLOA 1BW9A 1UJ2A 2Y1EA 4PHFA 4M46A 4PX2A 1H6DA 1ZUWA 4EI8A 2R751 4CIAA 1KO4A 4ZAVA 2X9QA 4B2PA 5HK9A 2EFEB 1NWCA 2GRUA 3KHUA 5NLLA 4JT4A 1TXGA 4IM7A 3EEOA 1CUDA 5C18A 3BE6A 1W5BA 3A1VA 1GPLA 3EQ6A 5LSAA 5CIYA 1JWAB 3HPRA 1AQLA 1VKOA 2X4IA 1XPJA 4L9RA 1MPXA 2Q50A 2V4ZA 5TQ0A 4X1KB 2OCXA 3WFJA 3ZYCA 5JAUA 3ELBA 1F06A 5EC8A 2P2ZA 4WK4B 4A7PA 5LQMA 2K6GA 4FSDA 4R7ZA 2IYPA 4A82A 1JG7A 2OHVA 3W2FA 4ND4A 4LRSB 4NZMA 4LF6B 5A5EA 3Q12A 3BREA 1XZJA 2ZRMA 2CCGA 2ETVA 4DLUA 1ZNZA 1N1MA 4P3PA 4PICA 5EZYB 1PJ3A 2KI5A 2WA2A 1A8QA 3IO3A 1R4NB 2O20A 3SNKA 4RY2A 3PGKA 4JOSA 2ODQA 3V4SA 4BO0A 3X1MA 2QTHA 4DILA 1LBSA 4FU0A 4GLFA 2UVPA 4K9RA 4I4LA 3GJ4A 2DPHA 2P90A 4LG1A 3SMQA 3P2YA 4FYIA 1FFHA 3MTDA 1X7XA 1THGA 4JKYA 3TIFA 2JBWA 2XJ4A 3AVXA 1UXJA 1B14A 2F1HA 4R9UC 1WX1A 5CDYA 4KREA 2ZJOA 3C3XA 2BR4A 4M0PA 4DDMA 1USUA 2VT2A 1L7MA 3GOQA 2HCJB 4LE2A 4IIGA 2Z8YM 5EWJB 3MPUA 3OETA 3I2KA 4Q02A 3TJRA 1QIMA 1RXWA 2AN9A 3GT4A 4JCCA 3SK0A 1I4DD 4G5FA 2VNAA 4CKXA 5JAOA 1YR7A 2KSQA 5BWCA 2ZSIA 1DFGA 4M9SA 4DC0A 3LBIA 3NP9A 4Y7CA 1M2VA 1C0LA 3IEUA 5K0JA 1QE3A 4OGGA 4RMHA 2B83A 5JCPA 5EQDA 1C3XA 2XDYA 1OV4A 3DPUA 4MI3A 4WNYA 1ZNXA 2XSZD 3OCUA 4Y2TA 1WBJB 4DSOA 3QBJA 3A6LA 2AVDA 1KGSA 4DF3A 3LA6A 4BMYA 2GD2A 2VLIA 3FCOA 1ORHA 3WLHA 2RGNA 1JEYB 2Y76A 3AF0A 4HN9A 4HYYA 4PSKA 1L1FA 2CWWA 4S1OA 3SLGA 3T7TA 4DUZB 3QEJA 4U7TB 1QGUB 2OQIA 3GVPA 3QWAA 5BT9A 4KZKA 4LBYA 1R2QA 2W2LD 2Z5LA 3ZTTA 3HACA 3NJ4A 4FMCF 5J63A 1D6MA 3GVIA 2R44A 1N5DA 3D8HA 1WUTA 2IIVA 4Q4HB 4UUNA 1EQUA 3BXGA 4J6EA 3WNDA 1C30A 1E0KA 1JE0A 4Q01A 1M6EX 2Q0HA 4ZTBA 3E48A 2CVHA 2X0IA 3B12A 4JQYA 4BNHA 3AV3A 1GCOA 3DBVO 3GGCA 3I1IA 3TXAA 3T9BA 1FW8A 1E6CA 3GYBA 3VR2D 4EUSA 3O1IC 3U3MA 1NVVQ 3D6VA 1GEEA 2B94A 4JY7A 3VR6H 1G20A 2OBMA 4TV9A 2PEYA 1UAYA 2JKZA 4IPTA 1PYGA 3OY7A 4M6WA 4M0MA 4AJ1A 2FE1A 1KWKA 3R3JA 2VUHB 1ZJYA 3H2JA 1U9IC 3L04A 3L4EA 1U5BB 3CPEA 2O2XA 5LDHA 1WOYA 3H6HA 4G8DA 2NZVG 5K20A 1O0SA 1BU8A 1Q0QA 2FPIB 2QORA 3PF8A 4HDQB 4JEHA 5F2NA 2GM5A 2C9YA 2OCKA 1CHDA 3AH8A 4GC5A 4Q3AA 1ACMA 3ZE1B 2GF0A 1TEZA 2ZITA 1MENA 1M1NB 4JH0A 3ZNNA 1C7FA 2V7VA 1X7WA 4QUGA 1JEAA 1DBRA 1GL7A 4UHCA 2BD0A 5DCLA 4QLBA 3ET5A 4V0LA 3REQB 3OF5A 1L8OA 1GNQA 2ORVA 3A4NA 2HPAA 3FVTA 5E1BA 2QAIA 3DE5X 1JR4A 3N6VA 5CHEA 1CRQA 3TLGB 4Z6KA 1V1RA 3VH4A 4X20B 5M7EA 3G2PA 1X14A 2ZCVA 4BP3A 2TMKA 4C7OA 2WJYA 2Q7DA 3I61A 4K9NA 1G6HA 4ISCA 1WXFA 2UZ3A 3ICEA 3ELUA 4UDOA 3H4TA 1UBTS 4B3BA 1DWUA 1A9OA 3AGPA 4OLHA 5HE8A 2OR3A 2A5LA 3CKYA 3HYLA 3FYSA 1NKVA 3M2TA 2IDMA 1QTRA 4JIGA 1CD5A 2NOAA 3AM5A 1TC1A 4DJJA 4UW9A 4WEQA 3TI7A 3UHOA 1N6OA 3W5DA 3QVSA 1RWPA 4KMRA 4UDYX 1SVNA 5AHRA 3ZV7A 3BXOA 2XTJA 2HMUA 5EN4A 3WNZA 1I13A 3IQDB 5B3LA 5BN3B 2IH5A 2C7VA 1F8FA 1PJ4A 2QT1A 4U7WA 3Q3CA 3UG6A 1MT0A 3SS8A 4E88A 4LRYA 3OBBA 4PC1A 4TSKA 4X6UA 2IHBA 5ARDA 1D9XA 1MLDA 5FFMA 1UBOS 4LWQA 4E1AA 3L0YA 3TW8B 3PXBA 1SBCA 5D87A 1N2XA 2FLKA 4O4IB 1P1HA 2B3DA 4B6GA 3AR4A 5LFAA 1U8XX 1EA5A 1GPAA 1HETA 3C7DB 2VZ0A 4GI7A 4DSUA 5CFNA 3BA1A 4DPKA 4B6OA 5HIMA 3WGTA 4ETWA 2PSHA 2RGGA 3I3OA 3ZGXA 2P4HX 4ARCA 2R84A 4C2BA 1PCXA 4X6YA 2TSYB 1EVKA 1O9GA 3FMFA 3OM1A 4B3CA 5HJ7A 1VE5A 2HWYA 5HK8A 2OQVA 4CLRB 4TMTA 2DQ4A 1VG9B 3OKFA 1QU3A 3QJGA 2AZTA 1NLZA 4DVJA 1OREA 1RMQA 4PNHA 5DTRA 3K35A 3CEMA 1PFQA 4YFVA 3IJEB 3L0DA 2R8ZA 1N6LA 4NE9A 4BV8A 4EPRA 5KQPA 3AFOA 3DZGA 5DM1A 4L4YA 3B1XA 1G5FA 3KE9A 4BO9A 1DZ3A 4KFTA 1B15A 1JAZA 1TK9A 2SCUA 5HEKA 3QOFA 1JXMA 3DHVA 3VPFA 4F9GA 3BJZA 5JASA 2G7MC 3ID6C 5DTEA 2PGAA 2VOEA 5H70A 3DCYA 4EDHA 1A9XB 4Z7QB 1A7JA 2FF5A 3DEFA 4R84A 2O8EB 2UZAA 4FYVA 4YCSA 3DMTC 4ZYUA 4DDHA 3M33A 2YFQA 1M6VA 3DBRB 1N5LA 2GK6A 2M1XA 3F73A 4B3TB 1NT4A 1PWYE 1Y7PA 1XCPA 2DAPA 1GQ2A 2EFJA 4OG2A 1I30A 3FTNA 1QIHA 2IF0A 4WZBA 4DT1A 4Q1FA 4A36A 1VL1A 1UKYA 3A4IA 3UY4A 2XAUA 1DX9A 1I6LA 1H22A 3FKSD 2GJ4A 1SHLA 1YB1A 1CZUA 3KUCA 3KJEA 1D1PA 3L43A 2HJ9A 4KQGA 3TZLA 3CISA 5JD3A 1TO2E 3FPHA 1YNOA 1UBMS 4B09A 4DWOA 1W5FA 3LUKA 2JLCA 2ZKLA 2Z30A 3C3EA 5F23A 3VBCA 4YHHB 4JWKA 4TQ9A 3AESB 3TM4A 2BONA 3B70A 4OGKA 5JY6A 4FVTA 1DXQA 4DY6A 5IT9A 3H2GA 3DPSA 4UTVA 4A6DA 4DRXA 1EMDA 4P98A 3Q7QA 3IUBA 5E38A 1BW9B 1MVNA 2DFNA 4Y0NA 1R27A 1UKBA 1AO3A 4HEJA 4F84A 1WU8A 4E5MA 1G6OA 2RE8A 4IG9A 5BW6B 2PUAA 2QQFA 3GX1A 4RIFA 3WL5A 3SDSA 4MYRA 4FQ8A 4Q3LA 3I5XA 1FNMA 3ZGZA 3PRKE 5JQGB 2C3OA 1FTQA 4II3A 1X7YB 1A9SA 1DEOA 3KDPA 5BXYA 3D02A 4P2GA 3MB8A 4TKZA 2YW9A 1ZSYA 3GNLA 3G2JA 2RDMA 3B6KA 2H2DA 3CW8X 3L8ZA 1RQRA 3RBZA 2QLFA 4XYGA 1MRZA 3UOGA 2J1LA 5KQRA 3ADDA 3PVCA 4DNXA 4XRGA 3A36A 4D4JA 1N8KA 2B2NA 5CYPA 1UXHA 1PT8A 2HU8A 2YR0A 3PEFA 1DAPA 3R5FA 1ODTC 1ULSA 4W7SA 1KAOA 4CNQA 4I4TA 5HHTA 1M7GA 1GPWB 4JKOA 1Y7IA 1IAVA 3HUDA 5T64A 4C3UA 1RQNA 5BN5A 1GRVA 3R24A 3UK6A 2KWIA 1XJCA 4AQDA 2ODWA 1NOIA 2WUWE 3NKLA 4EH1A 4I1OA 2QT0A 5CEFA 1JLLA 2UVPB 5EKXA 3CZAA 1IIBA 1OROA 2OV6A 4G4SP 1TM1E 4MIEA 3K9BA 2H11A 1NW7A 1KDPA 4ROTA 2QENA 5EHXA 3IJPA 3KPYA 2R7AA 4I1VA 1U99A 1BHQ1 5JY1A 3NEPX 5JAQA 2NZYA 1DO0A 2O57A 2WWXA 4J94A 3TLEA 1ZKMA 4AUKA 1LSJA 2CXNA 4D9KA 1AKWA 3NMUF 1DGQA 5HMLA 1JIXA 3MILA 1JV2B 1BS9A 1PU2A 1UWVA 3EVZA 5EJIA 4NBNA 2FV8A 3WGUA 4NJEA 2ZUWA 3WLLA 3F9IA 2QLTA 3O8CA 3KKPA 4NU0A 1JLRA 5KHLB 1A76A 3OWOA 2CB9A 3T35A 1J2UA 2IKSA 4C0QC 3SBXA 4TWIA 1XI2A 3FCXA 4ZI3A 2ZRFA 4K6OA 1I3MA 3H3JA 2VP6A 1XT6A 2J0EA 3OJWA 1AZLA 3CNOA 3C3BA 2PTHA 1HBJA 2QB5A 3H1GA 1A8PA 3QMWA 4I36A 2R68A 1O95C 4XJVA 3UYKA 3ZE2B 1NP3A 2XZPA 2AUTA 1T10A 1NUTA 1E2QA 2VTEA 3GZ4A 4MAAA 2VSFA 4FYHA 2P6OA 3T3NA 4EHNA 4QAQA 3SGLA 3W8RA 3TLKA 4EY6A 4X85A 3GV0A 4S1TA 4FD3A 4BAGA 1Y3FE 2Q99A 3FSJX 4MROA 2JL1A 1MTZA 2EGGA 1ZH2A 1J2RA 4NAHA 4DIKA 3SVTA 4MVJD 5IBCA 4ZQGA 3LX6A 4EAAA 3O5AA 1KBOA 3BTVA 4XDYA 4NESA 3LBFA 1ST3A 1YC5A 1XJQA 4W4TA 1CJSA 4Y6OA 1KI3A 1C30B 2BMAA 2YYSA 1E8NA 2VWHA 1R0YA 3ONWA 5ALUA 5TX7A 3IRVA 1JRLA 1C0EA 1L7RA 2EFHB 4MW2A 2BC9A 4D4IA 4P4TA 2UXCB 2V7BA 2VI5A 2XNJA 3JD4A 4ODIA 1ZH6A 3G9ZA 3WKDA 4AZ3B 4BOYA 5I48A 1Z7GA 3FZGA 1N2CE 4FBLA 3H1PA 3KVYA 4DM3A 1E1KA 2EWVA 3WGJA 3KOOA 1P4AA 1RVV1 1G20B 4N0EA 3QKIA 3V7UA 2IPMA 2W6OA 4BKUA 4IFTA 4FN5A 2YVUA 4M6WB 4BUCA 1EFLA 2OCGA 5H0IA 4N0MA 2X1VA 3S4YA 2V0GA 2BFBA 3KQQA 1N6PA 2CHFA 2D1FA 2X5XA 1DAEA 2PFGA 3DV2A 4LA4A 3VKVA 3WL8A 5F3WB 1VL6A 1WPGA 1FFYA 2VR1A 4JL5A 3S29A 1JKMA 1YB6A 1ZLXA 1L5LA 2NUPA 3VC7A 3DLTA 1XZKA 4CDNA 4JVSB 1ZGHA 1HORA 2QYSA 1O2DA 2GF9A 4IKEA 4G5YA 3H2KA 5K3CA 1IN6A 4X90A 2YW2A 1IRXA 1BQ4A 1X7WB 2BZ0A 1OAOA 2B0CA 4J2HA 3SHFA 2CSUA 4MQEA 5DCUA 2FZWA 4CU5A 3PJDA 1ZPDA 1LC0A 3HNRA 3X0DA 4TQGA 3Q41A 4BQEA 2C7PA 4CUJA 4Z4IA 1NXWA 1Q7RA 2QDXA 5HIIA 3TZCA 3VZCA 1CRLA 4AP9A 4B8WA 5J4YA 3IOEA 1KRXA 1U5CA 1XAJA 2ZUSA 3DOIA 5CTAA 3TRHA 3WWEA 1PQUA 1V1RB 5JZBA 4N7RA 5U9CA 1H85A 4L72A 4P9NA 1AHHA 3RROA 4CMBA 4JYAB 4C7OB 1VC2A 2PY6A 4LXQA 1K4YA 1Y6JA 4C7VA 1ZWKA 1W5AA 2WF7A 2HRDA 4XVCA 2FHSA 3FHOA 4DV3B 1KOGA 2ZR9A 3SN6A 2VK2A 1UMCA 3L6OO 1V43A 1JG3A 1PGJA 3W3AA 4TM7A 4YAKA 1WDKA 4BAUA 3OLCX 1ESCA 1KP3A 2NQ2C 3GGPA 2GPJA 1UM9A 4DJFC 2GD6A 1DQNA 1JQLB 3E9MA 3FPFA 5IN4A 2DXIA 1P74A 1AURA 4RD6A 1SUFA 2W2XA 3PFGA 3QRWA 4P4SA 3STYA 5HTOA 3FPGA 4DAOA 1KRWA 1KDRA 3JQDA 3M6MD 3ZDZB 3MWFA 4NJMA 4PAOA 4Y67A 3E2MA 5HMMA 1GZHB 3E58A 4NCAA 1S8NA 2Z8ZA 3EULA 1CFJA 4G24A 3AUXA 4GEKA 3ZHXA 1YL6A 4DLTA 4IXTA 1C29B 1BJKA 1JG4A 2BF7A 1PS0A 3G2OA 3GB9A 3QE2A 4O1MA 4PSDA 4LZAA 5J4KA 1U2GA 4PINA 4TXNA 3E9CA 1H0HA 3LK7A 4INZA 1SUSA 4NZYA 3RD5A 1Y48E 4YRIA 3IA7A 3OFND 3WVNA 1IWPB 3AUAA 4QSMA 1QHHA 5CGZA 2D7CA 1ILEA 3AR5A 4RPLA 4IZIA 2D7DA 2D62A 4X6LA 3U3XA 4MKIA 2ZZKA 1JIQA 2KLHA 3II6X 1YB5A 3GJ8A 4LVOA 1XYVA 4A1FA 4S05A 4DIUA 1WZCA 3ELWA 3QVJA 1Y9ZA 1MCZA 4FEGA 2Q62A 1I0ZA 1M2NA 3KT3A 5AKEA 5FTKA 3SYLA 2ZVDA 4EKIA 4F4CA 1XRSB 3NGLA 5JNVA 3HTXA 2YWJA 1YZGA 1B3BA 1XDGA 2JAPA 2SCUB 1QIFA 2GCEA 1J8FA 4QGGA 1U0BB 3PQ5A 1YH3A 4I46A 3AVQA 4BZWA 1OWLA 1KVRA 4YRFA 2YH2A 3HB1A 3AHCA 1OLOA 3ML1A 1E8MA 2GBLA 2ORWA 3W2TA 3CLVA 4YT4A 4NPCA 5AKJA 1M6VB 1H23A 2Z43A 5ABPA 3MT0A 2ZM5A 1USKA 4YV1A 5AJYA 4Q9NA 1X1SA 4RVNA 2WHQA 1MUUA 1Z36A 3GK3A 1A5ZA 5EZQA 4EVRA 1PYDA 4WZBB 4DT1B 3C7TA 4QDOA 3P0HA 3H97A 2NNWB 1JG2A 5G0WA 5B3JC 4BGDA 4M9ZA 1A5SB 2WVHA 2OV1A 3IURA 3CO0S 3F3SA 4CE6A 2DC1A 3QPVA 5L4LA 2PCJA 3ZD8A 4DCOA 2QAJA 3QKUA 4J3FA 1UDWA 3AONB 3BIFA 1E59A 2O19A 1RYNA 2FUKA 4FKMA 4KR0A 1W9HA 2JH3A 4M7PA 5JTTA 2PAAA 3AY0A 4FBGA 1PEYA 4HXYA 2RGUA 2ZQ5A 1X74A 2NVOA 5FPQA 1DIOB 2D06A 3NH6A 4RSMA 3ROFA 1XGKA 2P75A 4DRXB 2QUIA 1ZK3A 1KERA 4HI0E 1BMFA 3LPMA 3E27A 2HIMA 2XVXA 5MFZA 2IX9A 2NSHA 5E8RA 4QWMA 4DHEA 1F2UA 3E7FA 5BR1A 2QM8A 2A35A 3S3TA 3ZZ0A 1HE3A 4B6RA 1QAOA 1QVRA 3PC7A 3PEUA 5DIFA 4UHJA 3CW2A 4MVJP 1F20A 3V8EA 1JHMA 4QYSA 5BWMA 4WMLA 4OHZA 3ZDDA 2DR0A 1HNWB 1VCNA 1YRQA 4Z3DA 4OU5A 4YN3A 3GLIE 2PK3A 2PRJA 3HR8A 3FWZA 3Q72A 4NBSA 5AJXA 3TZQA 1TPYA 4ZVSA 1ORWA 4AZSA 1DG9A 1JILA 3ICVA 4I4TB 1COWD 1NLFA 2ORED 4INOA 1TM4E 1N5IA 5BN5B 1U2EA 3A4MA 3B38A 3JD0A 4GIBA 3B3AA 5EVJA 4NF2A 3RK1A 1U65A 2C99A 4DSTA 1JLLB 1JPNA 1U0HC 4TQAA 3OZXA 4QODA 2VT6A 4GUAA 3KFLA 4BMPB 4D9CA 4AY5A 1C7JA 1XYGA 4LRXA 1KJ8A 3IL2A 4QXOA 1UPFA 4QPJC 3NS7A 2ZT5A 1T6BY 5F2OA 1IOLA 3FWNA 1W48A 1BE8A 1U0OC 4YPVA 1KL7A 2Q8QA 1REQA 2F8TA 3KQHA 3FZYA 1X1CA 1SXPA 1Q11A 1Y1QA 3URKA 3THYA 1R9GA 1U8AA 2Q3BA 3CVJA 3DO6A 3L1IA 2C1ZA 2ZWVA 1LBIA 4WWHA 4Y1GA 2E4VA 2ONYA 1L5SA 2HWKA 3HS3A 3KB2A 2FW6A 4AUMA 3OLVA 1XP8A 3GXOA 1RCTE 2CLMB 1SBHA 2O06A 3LWDA 3MT8A 3PK0A 4J6FA 3OESA 4MPDA 5E4TA 4BB9A 1W94A 4FZRA 4QFMA 3Q8MA 4FYWA 1G8SA 1GRRA 1HDCA 2XRYA 2QAGA 4W9MC 1DCTA 3FTPA 2Y1OA 3D8TA 1ULHA 4XQCA 2AJTA 1LA2A 1VMIA 1QO7A 4ZOAA 4EX7A 4BNIA 4P93A 4L16A 3TK1A 1MW8X 3AT1A 2PUEA 1QQ7A 2P41A 2P8JA 4LGVA 4Z9BA 1G3QA 4MMZB 4G5HA 3TG8A 2UUCB 2PRIA 5FUMA 2CJPA 3G23A 2GBFA 1H94A 3OICA 1GHTA 2PMFA 2WZCA 4LVUA 3EGCA 2Q1XA 2QD3A 3VH2A 1EE2A 2HT6A 5F9HA 4AUNA 2V9CA 1KEKA 4JI5B 4UU1A 3QVLA 1WCXA 2IYTA 3NHYA 4L74A 2NO0A 4PG5A 4WW0A 2Z1MA 2I1QA 1PEDA 2ZRBA 4NG4A 3P0RA 3ETNA 2GERA 5T7BA 2BKVA 2F64A 1GKIA 1XZNA 2BGUA 1UC5B 2Z8YA 3M1IA 5EJ9A 1FXWF 4CGZA 1U2PA 4Y8VA 3ZK8A 1W2HA 1DQPA 2A7XA 5EE1A 5IJAA 4LC1A 1N6RA 3RIEA 2CK3D 1SRQA 3IVMA 1OH8A 5FWAA 2QIPA 5DNVA 4Z1MA 5TE9A 2I6UA 3L7OA 3UJ9A 3VR6D 4JQCA 4RTJA 2J3JA 1T9AA 4Y6GB 4LHVA 1RKVA 4LOAA 4NFLA 3ITNA 4FE7A 4WINA 1O6FA 2Q5JA 5KKNB 5LXTA 3CHYA 2ZJ7A 3DAGA 2BFBB 5C1IA 2ZSKA 5ERGB 4X45A 1Z06A 4GI3A 1IBCA 4LJ7A 3ELYA 2AMYA 3KXIA 3USZA 4TTSA 1XWWA 2CNLA 2L2QA 4FI3F 2XCSB 3LT4A 2NUPB 5HIJA 4L6CA 5AOCA 2FEMA 3VAYA 2FE4A 5EEGA 4UULA 3L7LA 2GO7A 5CFQA 3IBFA 1KJIA 1E58A 1PJQA 4PCAA 4RQBA 5J5VA 2YVLA 4UVIA 2IUUA 5JD4A 2P6RA 4MQEB 1FU4A 3VPCA 5IANA 5K8LA 4DGQA 3K53A 4E5NA 1JR6A 4E6EA 2ZXUA 1OXTA 2QTTA 4N40A 3EPPA 4CF6A 4DR4B 1JG6A 5JS7A 3QWFA 4GOJA 1VSUA 1JKXA 5DNDA 1Q6ZA 1XZIA 2F8SA 1KDZA 3DM9B 2BAGA 2QVZX 3LF2A 4P3NA 5L7WA 3RVSA 4XGQA 1MIHA 1KQFA 3SS9X 2WT4A 1TIKA 3DWIA 5FPTA 1TA0A 3WLJA 5LBIA 4PNZA 3K70B 1CERA 3L2OB 1A2KC 2JFXA 3A1CA 4RJIA 3DCNA 4OHVA 4TROA 4TLLB 1W4CA 4NV0A 4OJQA 1Y4ZA 4PQFA 4RLFA 2ALJA 4EO4A 2AUNA 1DLJA 2F4VB 1XXHE 4KPFC 4D9BA 3E53A 3G49A 4P80A 4RA9A 3NTOA 1KZ1A 2XE6A 3BMCA 4YROA 2EL9A 3LVBA 3WQHA 1ANKA 4U6NA 1BEZA 5GJBA 5IDQA 1ORVA 1FNDA 2YRFA 4KYVA 2OO5C 1UM9B 4GS5A 3AHFA 1DCFA 5C5EA 1P6QA 5EI5A 1CIVA 1S3FA 2MOKA 4R3WA 3QFTA 2QW1A 2Y92A 3KPJA 4P4SB 4TKMA 3FAKA 4P0TA 4G23A 4DJDC 3NC0C 2F67A 4Z0PA 4NJMB 1BDJA 3AYZB 3I6QA 4XPZA 2IQIA 4FGLA 3R3WA 2G06A 3OOSA 2Q6VA 4K9QA 3AI2A 3AGQA 4OXRA 3HVIA 1NBHA 1ZK0A 2IYLD 3OO1A 4G67A 3JWIA 4ABTA 1P3DA 5K0CA 2W37A 2X2PA 3MS2A 4DRZA 2FMFA 1D4OA 1NN5A 2GB4A 3Q7TA 2ZIVB 3PKZA 4KVFA 2JEOA 4CYMA 3CV3A 3W1EA 2GPNA 2UXBB 2BTQA 3NIWA 4D9MA 1IEQA 2XKKA 1Q16A 1O97D 1FRZA 1QHHB 1NNI1 1KO1A 4RX1A 1M67A 2I65A 4FFWA 2X8BA 1CDDA 1D0VA 2RBGA 2WF8A 1JFFA 4ZCRA 2GTHA 2H16A 3CCFA 1AGRA 1LK7A 1ZRMA 1TUBA 3GJRA 4WJKB 4XDHA 3K1TA 4BNZA 5B55A 4HH4A 3IV7A 1GU1A 5M3BA 4QUIA 3B8HA 1C41A 2CW5A 4AMYA 2BLNA 3A1NA 3KKOA 4K6GA 4Q0MA 3HQ4O 3AFGA 4IOMA 3T54A 4URHA 5WRFA 4Q9JA 2IOQA 1ECGA 2R9VA 1SBZA 1VG0B 1Z22A 3SE7A 4ZCPA 3T1OA 4ZZ2A 3S1AA 4E12A 3UIEA 5BNZA 1KC1A 2LZ0A 1C3JA 4JNKA 4YREA 1QF7A 3F5SA 1Y34E 1JF8A 1D6JA 1C4OA 1XZGA 5I9IA 1XYYA 1UJMA 3GHYA 2YUTA 4U2FA 5CH5A 5M29A 3A9VA 1NYRA 1RC8A 1Z7EA 2VRNA 3GBVA 3K6RA 5CT8A 2ZJ5A 1U02A 5HZHA 4IYRA 2BVNA 3QVOA 1NQXA 4Y6QA 1MN6A 1V16A 1VSBA 3ZWNA 4HYEA 2JASA 4J91A 1M6HA 3WNCA 4IFEA 1G7RA 1CDZA 1PL6A 1Y1PA 1YQQA 3WGNA 4EZIA 4ZICA 2QUJA 4A6EA 1QLHA 1FDUA 2NXWA 3TE7A 1JFVA 1LX6A 4HT3B 3R9KA 4IHJB 3E0XA 4HO1X 4PV7A 1QDLB 2OXFA 3RU9A 5FLYA 2XCIA 1ZMRA 3KT6A 1GYQA 1HE2A 2F1JA 2YHUA 4CT0A 5B36A 1A97A 3TBKA 4FDVA 3RRBA 4UBKA 4PFJA 1LDYA 1TMKA 1B16A 2AOXA 4XYBA 1ZCBA 4R2WA 1EUCA 2CFIA 4LXUA 1A98A 1AUOA 4LCBA 4A0GA 1H66A 4Y6SA 3JYHA 1ISIA 4RL6A 5IM5A 3PHCA 4MB0A 5DBOA 5DHPA 1F2UB 4PU0A 5TV2A 2HBYA 3CVXA 1YZHA 4O33A 2P2NA 3KPWA 1PWEA 1WVMA 1S0UA 1SU8A 4OBEA 4YXWA 3LA8A 5DN9A 1SCJA 3FOFC 5C8YB 3KJZA 3W5BA 1QLJA 4A8HA 4JX8A 1PSZA 4Y30A 4IJWA 1X80A 3QMPA 3LT5A 1R8JA 1Z0AA 4XIJA 2R48A 3O4VA 3WISA 3IPLA 1RHQA 5TJHA 4YAUA 2D5LA 3S2UA 3JAMA 2BKLA 1F6BA 3NDIA 2H7XA 2WSMA 4JX9A 4OXKA 1ZMOA 5C34B 2VSYA 4DR7B 1NQ5A 3DULA 2CMGA 1DJPA 1EM6A 3EY4A 4OK5A 3QVGA 3G79A 4PRYA 5BR8B 1ONPA 2V98A 3AIMA 4J0IA 3VSBA 4A0FA 2B5VA 2DBQA 4PNEA 2C4HA 3FNHA 2HCBA 1KQNA 1Z15A 2NZWA 3IX7A 1J25A 1K7SN 1N8SA 4HCJA 3ROMA 1F0NA 4R1MA 3TRFA 2QRNA 4QZVA 1WP4A 2DLCX 3JZIA 3N59A 5JOQA 2AQKA 1QRTA 3T5CA 1VI5A 3RYTC 4YRBA 5B7GA 3KXDA 5MGNA 1PJAA 1J5XA 3KEMA 3DR3A 4PGFA 2IJGX 4F6LA 5KNCA 2IH4A 1JSXA 3K0CA 1KP9A 2IOFK 1REQB 3M49A 4KRYA 4NYJQ 3O7MA 1OA0A 2H1IA 4PPYA 3UM9A 5LP6A 4IS3A 3A14A 3THYB 3VSAA 5I7WA 2HLDA 3D7MA 3RVPA 3T4EA 3KJHA 3A9TA 3OZBA 4A10A 3H5LA 2HLHA 1FB5A 3OIGA 2WTEA 3ONEA 4FYKA 1N0WA 3KQPA 2QKYA 3VC2A 5A62A 2AG1A 2MYUA 4IX9A 5LVAA 4DEXA 3LGAA 4BZQA 2W8ZA 3I73A 1NBME 4MQFA 1AK1A 1O03A 1Y80A 3WMWA 3P0EA 4EPVA 2WZBA 2YIDA 3WB2A 2XCQA 1QIGA 2QAGB 2QT9A 2ZJ0A 5CK4A 2WZQA 4NV3A 1K75A 1YZQA 3HXOA 5AO9A 3RC7A 4CF5A 3KR1A 1J70A 1V39A 4DA0A 5LKRA 2JLUA 1LI4A 4OA8A 4NMXB 3EH2A 3N5CA 3U9LA 1E3LA 4QDZA 4L95C 1O1YA 5A9TA 4XM2A 2BP7A 1TUGA 2OT3B 1L4YA 5EIWA 4OB7A 4BMXA 1GUDA 1VGQA 5E9WA 3BGOS 1P19A 2HSWA 3K92A 3O4FA 3CC8A 4Q3EA 4EMTA 5HRCA 2ZI5A 3IQXA 1JLKA 3I30X 4EQ6A 4MA4A 1FFXA 2YC4C 5I9MA 2AFRA 1MX3A 1ISMA 3HP7A 5LCXA 1QYXA 4XGIA 3NI2A 2QQGA 4RIHA 2Y99A 1WR8A 4EVQA 2EHDA 3RRMA 3FGZA 3N8DA 1WW3A 2IXTA 1UMDA 1IDN1 1OWNA 1T4BA 4V3BA 1U8UA 1F0PA 4CN8A 1FRQA 2JDID 3EOBI 4LYEA 4I50A 2WWVD 2YBDA 4D9EA 5SY9A 4EYEA 1IAQA 2SECE 4ZU1X 1G5QA 4HTAA 5CB4A 5HW0A 2FSUA 5CM9C 1C3OA 4RVOA 4N3BA 5ANRB 2GFQA 3GCWA 1OSNA 3NWOA 2QMEA 5J2UF 1U3FA 2DFLA 1WMFA 2AC2A 2J7PA 1MBZA 1PT7A 5LXTB 3OX3A 2DF8A 2PZ8A 1WEKA 2GJKA 4DLVA 3AKZA 5KBYA 1B8OA 3RC8A 3O94A 2NXJA 3BILA 3VFDA 1OI2A 2XNSA 3GQVA 3Q15C 2VPTA 2P7HA 1RAIA 1EVZA 2ZE7A 2XTMA 2WWGA 1PL8A 3O83A 4ZCSA 4Z4HA 4LXHA 1CE8A 3PGMA 3VR5H 2RFLA 1RM4A 1Z0FA 4JJIA 2YCBA 1X70A 1X87A 5CVUA 1DQZA 4YIKA 2Z09A 2EBUA 2YV5A 4AM8A 2Z9DA 5CHYA 1YQXA 2GWHA 2ZM6B 4FSHA 1J0XO 4EMSA 5JG7A 2WICA 2COKA 4HWOA 2ASVA 3JXEA 2WNSA 1PDOA 3P9NA 1JHUA 4GGPA 5CCBA 2B21A 4RU1A 3BWBA 4C88A 1WVGA 4OFZA 4M89A 1ECJA 2EBWA 5IMSA 2VWPA 1GT91 3QE3A 4ME6A 1ADBA 2VOJA 2DBZA 3MD0A 3N2EA 3PE3A 4MCHA 4RELA 4UKDA 5JTUA 5FTWA 1FDSA 1DELA 2NSJA 2OM2A 3CB2A 4JIMA 4QBKA 3MTEA 4YJFA 3KUKA 2B25A 1CUUA 2H8GA 4BTVA 3BZBA 4RA9B 4C4OA 3BMCB 4EEXA 3B53X 2B4KA 3EAGA 2R11A 2R8OA 3PT5A 2F90A 4P32A 4ZT4A 4L15A 1C4XA 5HGJA 4WN9A 5B6PA 1Z8HA 5ALOA 2WF5A 2OZKA 4B9AA 3ZKAA 4KO1S 2JGMA 3JZMA 3EE6A 1ENZA 1KDOA 1NQVA 2XMBA 5K8IA 1KAGA 1Q7GA 5IAKA 2XI4A 4BIMA 1CUJA 4YP6A 3HHPA 5AM4A 5F9FA 1IN5A 5FBHA 3ZWAA 3F7NA 1Q1ZA 3QUAA 1NBEA 3JD3A 1OXVA 3F6BX 4R9VA 2HEGA 4GM0A 1Z2CA 5TEVA 2B7BA 3COJA 4DR1B 1U9JA 4BFLA 4Z54A 3EEBA 3A3PA 3PUHA 3U3DA 2ETXA 3IOBA 4OB6A 1HDIA 2DY1A 3DQQA 4HOYA 4QRIA 4A8JA 5GINE 4ND2A 4CIVA 5T6BA 2BTQB 4GPEA 2E0IA 4AY2A 3PUVA 4N0QA 1W0JD 3R2JA 5HSGA 1OGIA 2EZ4A 1PBNA 4LOIA 4G9GA 2CMHA 2Q1WA 3HCDA 3HBMA 2O5CA 5HOEA 4ZN6A 2C2ZA 1JFFB 3C6BA 2P4QA 1TUBB 4ARAA 1ND5A 4OP2A 4URUR 2DYKA 4XSVA 4BQFA 4EZEA 4YRSA 2OMEA 2FN9A 2PRKA 3LK6A 4U0JA 2Y4OA 4OQ4A 2LIPA 1VMKA 5LMCA 5IZCC 3IDQA 4YUXA 2D4HA 1Z8DA 3B36A 3G8YA 5DNCA 1AQUA 3HBNA 4OLFA 3O8LA 3NHRA 1QRSA 2EKDA 4K3UA 2NSLA 3EH1A 3HWSA 1CV2A 3S1AB 3V1YA 3GEBA 3U60B 4EA6A 3I34X 1OCEA 1PWHA 5DNWA 1ZC4A 3WMGA 4Q21A 4UBMA 3GT7A 4WXRA 3N0VA 2ZW9A 3GLFE 3FLAA 1FSZA 1Y3BE 2IBMA 1IL0A 3M3HA 1G0OA 4PYJA 1R88A 2JGDA 3UKDA 5KWSA 1WBDA 2ZI4A 3R7LA 3NBQA 2FSVA 1V16B 1DLIA 3L6EA 4NXNB 1CTQA 2RC5A 4W82A 4FZJA 5KAMA 4JLVA 1Z2NX 5GADl 2F3PA 2X8JA 4IRXA 4RZHA 3L8EA 2I6FA 2OCLA 4J1SA 3R09A 2JGRA 2I29A 4RC9A 1G0NA 2I3BA 3DL7A 2VHJA 1GPJA 2VK1A 3ZWBA 5JMTA 4IWYA 1IY8A 2IL1A 3I5UA 2Q3DA 4TWBA 5K8TA 4OL0A 1Q3HA 5FBWB 5KYNA 3BDVA 4LXGA 4R0VA 2I7CA 3CCBA 1EUCB 3O26A 3I5MA 4G5QA 1A2OA 4MYCA 2JJQA 1G4HA 5HS6A 2BUCA 4FFNA 3LNCA 2OWEA 4CBVA 2F1IA 2AZMA 3B9RA 2FRVA 2IS2A 1OZHA 1VRWA 4P4NA 1OXXK 2Y9PB 2PIDA 1TYDE 3DW3X 4RJLA 4N76A 3OOYA 3K2BA 1GP2A 2JCXA 1EJ0A 4LYAA 3V7FA 3T3IA 4KFUA 3AC0A 6ABPA 3BTUA 4M1KA 1NOJA 1X80B 2C2YA 2YXPX 2V7UA 4BVAA 3KL2A 3G9UA 4HH3C 4QELA 1SXGA 3LDFA 1L5HB 3VDXA 1LV7A 5A02A 1FX1A 1R5BA 2XOKA 3AP1A 3EGEA 4PTZA 4Y6PA 3WL3A 3HDJA 5CA0F 4NZZA 2CVPA 3JASA 4Z8YA 4MWTA 3FOEC 1RQXA 2JA1A 3HXPA 3QVGB 4WDQA 1HG1A 3LECA 4N5HX 4BN5A 5LYJF 5CFRA 4IJMA 4R5MA 1H2HA 2O3QA 1ZI8A 2CLOB 2WV9A 4MV6A 1FSSA 4KPGA 4RK0A 1I4TD 5J47A 3U1BA 3SYRA 1Y7HA 2C4NA 1PJBA 4OIMA 5LA6F 1EQAA 3SS7X 2DJIA 2IEBA 1QE5A 2FR8A 2R62A 3CIOA 4LC9A 4OUKX 2HFJA 3UWSA 4CDGA 1KR2A 2IGBA 4RLHA 4RD2A 5ALDA 3ZCPA 1G38A 1HH4A 2PXHA 1OHHD 1ZD8A 2WKSA 3TNFA 1XG5A 1ORIA 4JFAA 2XUOA 2Y1CA 1R9NA 3HJUA 1JH9A 3QBDA 2SBTA 5ESRA 4C4XA 3V33A 1UPBA 3HNPA 1AS3A 1RCUA 4G1CA 1M66A 3G2NA 4K87A 2XE4A 2I03A 2P78A 4MB6A 2Q9CA 4U2BA 1NGSA 1TZ2A 1XFDA 3RFUA 3UOWA 5KQSA 4D9FA 1TK2A 4MINA 4C20A 4DXDA 1P39A 3R75A 3MQ4A 3QXCA 1RAEA 3VYRB 4ESHA 2VBIA 4MQFB 1TT7A 3PG5A 4CR6A 4MWSA 2R85A 1O89A 3BSYA 3RTEA 2NAFA 4R05A 4A16A 3RADC 4EDFA 4IF4A 4NH4A 3IVXA 2ODBA 3QPDA 3CJQA 1V8BA 1U1FA 4DY4A 5LD2B 1OXUA 5TPWA 1KEWA 2A5FA 2WJ4A 4GR4A 4E33A 1VE3A 3LIIA 1E6LA 2BKEA 3IJ5A 5F7ZA 3A3NA 2E18A 4YCNA 3JYNA 1JHQA 2BKXA 2N42A 2IGTA 3KAPA 3KCQA 3MXTA 3PWKA 2BP7B 1L3IA 4K26A 4QJBA 4MLCA 3LQYA 1RLIA 4V39A 3M3DA 5FNZA 4DGSA 1ZJJA 2CL6X 3SAJA 4EQ6B 1P75A 2VP9A 3T5DA 1BHJA 1FFXB 3OPQA 1ULUA 3CSSA 1QR6A 5ALIA 1Q14A 5F77A 2RHHA 5IXSA 3S28A 3S8EA 3IPAA 1LY1A 2OHXA 1HFJA 1IHDA 3BL5A 3CW9A 2C57A 3KSRA 2PMBA 1T2CA 3BCSA 3LX4A 4FOOA 2OCIA 2PA0A 4JLUA 5GQSA 3BB4A 3AHEA 3A6EA 3NYQA 4AJIA 1SUDA 3CEPB 1EFRD 3I01M 3LX8A 1I4WA 2W70A 4WUVA 1GKYA 2W6JD 2WTAA 4PXSA 1ND6A 2QL7A 3RBAA 1UMDB 4XIYA 3RHFA 4TTJA 3EZFA 2VDNB 3NBAA 2ZB2A 4FMPA 4FWBA 3R7WA 1EX6A 1ZC3A 2C94A 5CB4B 2NU9A 1BU5A 1V2HE 1C3OB 1PNQA 1ZM7A 1P6UA 3SX4A 3NRJA 4QSHA 4FOLA 2Q2WA 3RU2A 3UC5A 2GCIA 2FSFA 2VAWA 3C8HA 1JECA 4MWEA 3U7JA 4ZT2A 5EKTA 3FBTA 1NVDA 2PUVA 2PJUA 1QGZA 5JYEA 1SXQA 2D3WA 1TZKA 3EA0A 4QUHA 2ZIEA 3GLQA 3EPLA 2CL5A 4NMMA 4BQPA 4YAJA 4OQZA 2Y8EA 3PSHA 5F1KA 3ORSA 4H27A 5JQGF 4I1IA 1CE8B 1AKNA 2L69A 1GN9A 3A58B 5D84A 2IP1A 4AX8A 4ER6A 3WYFA 1F51E 5EIHA 4BQNA 2QQEA 1OXKB 5C7LO 3C1UA 3DL0A 4MR7A 4E09A 5JADA 5M5BA 1ECFA 3WIOA 3PQ7A 4LSZA 4MPRA 4AG3A 3N86A 1AHPA 3HGTA 5I3CA 1W36D 3VUFA 3P1JA 3DR5A 3KG2A 1GDDA 1JAHA 1Z2AA 1NRWA 1G5RA 3WYCA 5E3JA 4MKFA 3WL6A 2IBTA 2HCFA 4YJ3F 3QNWA 2ZJFA 2R2AA 3VPSA 1YZ3A 1CY8A 3V8RA 4BN4A 5KUTA 3KSAC 1WB5A 1PD0A 3HY4A 3IDZA 5F2EA 5FR1A 2IRWA 4CVNA 3OURA 4YJFB 4YPFA 3VX4A 5I7HA 1CJCA 1V7QA 1YASA 3IHKA 4RF3A 4WA8A 3WWCA 1AX9A 2F55A 3HY6A 4YT8A 3Q1LA 5DM2A 3UBMA 4LY9A 4NOKA 4XCVA 5DBEX 2XVYA 1G2IA 4TM8A 1U3VA 5B53A 2GEKA 2OHIA 4PAQA 1DXYA 4YA6A 3IEPA 3P5BA 4O2AF 2IOYA 5AJVB 5DTQA 4PYRA 5B1SA 5TLSA 4UUOA 1KFKB 3TLYA 5GGXA 2DH5A 2QZ9A 2RCNA 3GRRA 1Y5IA 4EKNB 3V3TA 5CVTA 2K2QB 3GFBA 2Q5EA 5IAGA 3IOCA 3DV9A 1K8YB 3ISJA 2A1TR 3VSEA 4CMEC 2WTXA 2A9VA 3KU1A 4BVKA 4AN1A 5FPYA 3H1EA 3OEEA 3U17A 4FYMA 5IJWA 1VIAA 1HQYE 3WJAA 1DJNA 3QFSA 3TGLA 3V8VA 3C45A 1I5OA 3UZUA 4R8RA 3SHTA 4K9LA 5B57C 2PUBA 2J5QA 3V1MA 3VR4A 1R0CA 1KETA 1Z4JA 3MCZA 4Z51A 5L95A 4R31A 1JQEA 2HIAA 4R2LA 4YJKA 4A8JB 3UV7A 1RC0A 3QITA 3V1TC 5HRAA 5EP1A 1Q1QA 3OX4A 5JDIA 4BFTA 1E9SA 1GQSA 4WVLA 4PY2A 1FTNA 3I8XA 1CS0A 4KV9A 5JPCA 2VJCA 2AOTA 1YE8A 1J20A 2ZRCA 2MDTA 4RGYA 3IE2A 3LW8A 1A4XA 1CPYA 3WB0A 1GL9B 1D7AA 3IB6A 4LWPA 1E64A 1NNSA 4QDKA 3QV1A 5D3MA 2I2CA 1Q1GA 2QN2A 2O4UX 3AJDA 4GWGA 3M5WA 3G5TA 1NPTO 5B58T 4J3NA 1ZJZA 2WKWA 4KLZA 4JI4B 3C3YA 1EDOA 4BWGA 2AZDA 1IVYA 1FUYB 3IAS6 2E4YA 4MZDA 1MORA 5FL3A 1OFVA 3A1SA 5EPEA 4CFSA 3VPBA 3RIMA 1T4MA 4MEJA 4XFDA 4YRQA 4KO4S 1JMYA 2A1TS 2R00A 1QHXA 1VMAA 4MOWA 4HUQA 1SZJG 1NYLA 2JGDB 1R64A 4H7IA 1IZ7A 4ER7A 1U8CB 1ZZGA 4LYJA 3UAVA 3ZWYA 2QX9A 4OHWA 1CJUC 1UODA 3HE3A 4NL4H 4QQKA 4DDWA 4YMGA 1Z68A 1RE1A 4QYXA 1D7OA 4V0NA 4TT8A 4YP0A 3ZY3A 2C2BA 2JJ8A 4KPEC 4DSNA 1YE3A 3RIYA 3U7GA 2DUWA 4KO3S 4PSAA 4HDMB 4BQOA 2CZQA 4NY1A 2I3GA 5I3ZA 1YBFA 2X8JB 5DNEA 4AW9A 4FHDA 2XWQA 4XJXA 2CXPA 1OYWA 5KJCA 1I5RA 2IEIA 5DT2A 1OFGA 4GHWA 4L4SA 1M0EA 3TDKA 3OTWA 3RUIA 1CQXA 2G08A 1XA3A 2QUHA 3R4CA 1F8YA 4IJ6A 3RV4A 3O2JA 5FOTA 2JLXA 4FDAA 4QVIA 3NTVA 4FFOA 3WRXA 5JJBA 4WGGA 1QV9A 4LVNA 4DA9A 3IA2A 1E9DA 1ZH0A 3CFYA 4YBRA 5ALJA 3S6JA 4TLDA 3JQ9C 3JSAA 4JBNA 5D85A 5E4YA 4M8LA 2INGX 4YR7A 4MVJM 5JNWA 4LZJA 5LYJB 1OH5A 1T9BA 1VJGA 4ZDKA 4I8IA 4R40A 2EP5A 1C2TA 1CJKC 1GPMA 1W96A 1FRVA 4KN9S 5CXQA 1O96A 4HLQB 1I7LA 1LPBB 3OAAD 3NEYA 2VP2A 5BMVF 1I7QB 3WIBA 1Z83A 4O8ZA 3IILA 2IT1A 1ZHOA 4GKJB 4B4UA 2RGCA 4D43A 3G1UA 4XKJA 4IZHA 3F7OA 4AX4A 4UUPA 1KJ9A 2W43A 1YD7A 2IPNA 3JASB 4RV4A 4NARA 4TTQA 5F51A 1DB3A 2NZUG 1PWZA 2P40A 3GP8A 1ZGCA 2CJWA 3KDSE 2G1KA 1E6MA 4G4JA 1ADJA 1P1IA 1UFQA 1ZBDA 3G5MA 2CNKA 3R6TA 4FCWA 4FE3A 3I8SA 4IDDA 3UMBA 5AH0A 3HB5X 1O5OA 3L7DA 4P7FA 3ONVA 4RQAA 1JYSA 5JBNA 4TLAA 1UPTA 1OJ7A 2GCGA 3TEMA 2ZTMA 3NBXX 1F8GA 3QW2A 3RO7A 2NT3A 2GA9A 4MQLA 2O8VA 1LGYA 2Q2QA 3PR2B 4RACA 1R6XA 2C7BA 1TDJA 2GN2A 3EZ2A 2PBFA 4KXNA 2HQRA 3EVBA 4WOKA 2O7VA 1XN1A 4FZ3A 3R74A 1V48A 4NABA 3QHAA 3OZ7A 1DJMA 2F9LA 2H3HA 2WYHA 3QHQA 4RSHA 4KR7A 2XXAA 1FP7A 1UXGA 3W9BA 1LFDB 3VISA 4ZT7A 1DQSA 1S5PA 3I3SR 4CCYA 2J6BA 1NURA 1ZVKA 2H4JA 2ZWPA 4C7BA 1JR3A 4DA4A 1JIJA 4FYXA 5K03A 1QG6A 3NTRA 2WOOA 2KJQA 1UADA 3QG5A 4WACA 3HXQA 4NPAA 2P1RA 2BFAA 2C9ZA 4KMMA 5HF6A 3VO1A 3ICOA 4J1TC 3OOJA 4F4FA 3NDBB 4MEAA 1LJLA 4BU0A 3B3JA 3L0PA 1RMTA 2I6SA 1GTVA 4LJ9A 5AOAA 4EJFA 3HO1A 1YQ9A 1HL3A 2A88A 2BEWA 2X9LA 5TPWB 3W1VA 4D6XA 4EX6A 4Y1RA 3KZ1E 2VO1A 4ZANA 1WQ4A 2AEJA 3GRKA 4ZODA 1W9MA 3W5JA 1WWKA 4Y2SA 4TSRA 3E4CA 4EO7A 2ZRLA 2FN8A 4LKRA 3ZV6A 1PE0A 1TA4A 2Q5IA 5ALZA 4QRHA 3TSAA 4UTRA 4LI3X 4LDZA 4JB3A 1V41E 3EF3A 5FUVA 2QV0A 5EIBC 4IQFA 5C1PA 1LC3A 2C8KA 2H9YA 4A4DA 4IFBA 3PBKA 2ZROA 1MJGM 4GAEA 1IB0A 1NF8A 2WI8A 4WEOA 3WICA 2GEFA 3GNQA 1LVHA 2XJ9A 2IEZA 1E89A 3OFKA 4IDEA 4TMXA 2I71A 2NVWA 4ZU3A 3ZZ1A 5BSEA 3GH1A 1CUEA 1XF9A 4QU8A 1MJHA 4DMGA 3QF7A 2GEJA 1LK5A 3CT4A 3P2MA 1G8KA 1Z2OX 1CUHA 5F78A 4R1QA 1IG3A 1TQHA 1WUKS 3DUWA 3R7WB 4BNWA 2VJOA 3G82C 1CY6A 2NU9B 3ETGA 4AICA 3ZHTA 5AWFC 1AV6A 3N70A 1RRGA 4TTRA 3PQEA 4XJTA 4N01A 1EYZA 4B3HA 3U4AA 4AWXA 1TYAE 1N3BA 2CXTA 2EG5A 4MCAA 1S1MA 1KOFA 2AJBA 3ESYA 4GLBA 4IXDA 5DW3A 4QDXA 1XROA 3ZE9A 4DIEA 2TMYA 4YEDA 2OAGA 3A28A 3PGXA 5K6AC 4Q9HA 1JBEA 1PAUA 2XCUA 3QI7A 4FSXA 2FPUA 4RMGA 5EESA 3DS8A 3SJZA 1PJSA 3UHPA 1RJFA 4WZAE 4WK0B 1QSGA 5D8DA 1XMOB 1JXOA 1RYYA 5JRDS 4QTUB 4LI0A 5G2OA 5EGNA 3VR5D 2VHUA 3KZXA 3MGAA 3OJXA 3HXKA 3QKSA 1N0UA 4RF5A 5E2BA 2X0NA 1A7UA 5J43A 2WKRA 3WYDA 1L4GA 2DPYA 3TTSA 3UHFA 1IXKA 1ISRA 1IHXA 4QJ5A 4MR7B 5ITSA 4C4RA 1W44A 1R1DA 3E03A 3U7HB 3HMQA 3GEPA 4Y2GA 5IKPA 1E5LA 2AN5A 3TIIA 5KMGA 4HNRA 2C3YA 2YOFA 3AEZA 2WP8J 4JP3A 1US8A 1F7VA 2N3ZA 4GLJA 4OQMA 4MI6A 3IV9A 3H6KA 3VKWA 4B8ZA 3LC1O 4B7ZA 3IAEA 2LP4Y 3O2QB 1SC3A 2FEPA 2GPAA 3T94A 5AUOB 3KT8A 3JVVA 4YP9A 2AHRA 2JIRA 2ILVA 2VRWA 4BDTA 1BDHA 5LQNA 4K9MA 3V2UA 2GK3A 1EDEA 3ZZUA 4ARVA 1E9AA 5CLHA 4RUKA 1G7CA 3G9XA 3HJRA 1GUAA 2H4XA 2CUZA 4D3XA 3GGSA 2VF7A 1LRKA 4KYIB 1KBQA 1TVCA 1QVVA 1VJ5A 1YCDA 3EVFA 1JJ7A 1RWQA 4LTNA 4RY0A 4D92A 4E5YA 1O5TA 3D4LA 2WINI 2ZJ1A 4D98A 1PR0A 1Z26A 5TDHA 3S2FA 1JIVA 2QVYX 2P9FA 3OMLA 2HDNB 4AZTA 4EJSA 2VPPA 2N0SA 5LQSA 4WCVA 4LNHA 3D0RA 4ZKDA 2Z95A 3T9FA 3P2OA 3V1KA 4BMVA 2DR2A 2BFMA 3F5MA 4RHXA 4XWTA 1ZM2A 3K9QO 3MCAA 5LMNB 4TYMA 5K45A 1YUMA 1AF7A 2W98A 3DW1X 3ESZA 3JAKB 1FDWA 4FJ2A 5C7YA 2QROA 3ER8A 4FS8A 4PZCA 4TSFA 3TAXA 4L4RA 1T34A 3BMXA 5C1OA 3ZKWA 2AFIA 3E1SA 3QPWA 4O25A 3U56A 1OTXA 2NTNA 1EVYA 4OSEA 3KLMX 2VDWA 2Z2ZA 4LWZA 2J87A 4RVDA 1K98A 5GGYA 2JFWA 3PQDA 1CS0B 3LDHA 2PU7A 3ZLBA 2AOTB 3ZBPA 2VJLA 4ZA2A 1EWRA 2VLBA 4R69A 2ZP1A 5EUMA 3IB3A 4GOOD 1E7WA 5IKOA 5IM4A 4UREA 3WGLA 1PZNA 4YGXB 3W5VA 3A9SA 1QRUA 5D3MB 1JKJA 2YN2A 3OCCA 4GBJA 4JEMA 4D3ZA 4YAGA 1OFTA 2AF4C 2O1XA 1H5NA 1XRNA 1LEHA 2JBAA 3OTOB 4HNVA 1AQJA 3AZOA 3IYLW 1Z45A 3OBIA 3ND7A 2RGNC 4ZCMA 4LHXA 4OGLA 4ZYXA 1KI7A 3SXUA 4EARA 3VAZA 5LQAA 1W4RA 2HXSA 3TB4A 2Q0SA 3KOXA 1YQTA 4RFSA 4UVDA 1PTKA 4BLTA 5JCJD 5KZMB 3FF1A 3B1FA 3G0IA 4NBKA 3SICE 1KO7A 2RHDA 4V0RA 3X1KA 4HUQB 2R8EA 2BEKA 3QU5A 4A8PA 4L9SA 1PVVA 3D7RA 4ARUA 2DULA 2LGJA 3OX1A 1XVIA 2G1AA 1VLZA 4S12A 4EA8A 2VJNA 1NLMA 1TQ6A 4P36A 1SOMA 2JFPA 4INAA 4HJXA 5LZ9A 4DR3B 2NPFA 1PQYA 2G0TA 1ZUNA 4G4GA 1CJBA 3TOVA 3MFYA 4PLCA 1KNQA 2JLSA 2B4QA 2XT0A 3IAM6 3MRVA 3NHBA 1UQUA 4Y2XA 4CT5A 3BX1A 3BXHA 2GZAA 3E5MA 4X5OA 4XM1A 3GJYA 3F8WA 3P9KA 3WRVA 4NKRA 3JPWA 1GLVA 3UHJA 1XTSA 2XA1A 1W8DA 1EIWA 2Y1LA 5KTRA 1IY2A 1FQWA 1U6JA 1Q74A 1QUFA 4AF8A 2ZFUA 1T3SA 5D5QA 1VHLA 4PFKA 16PKA 3T7SA 1C1HA 4CIXA 3AYXB 4PZZA 2VXYA 2YFHA 3F6RA 4WCFA 1YV9A 2AS0A 5EL0A 1P5JA 1GITA 5K9ZA 5IS2A 2B5OA 4OQPA 1J90A 2QD5A 4JHXA 4OSPA 4YMVA 3OO0A 1AU9A 1O96B 4QATA 2JLYA 5KSPA 1A7AA 4X95A 1G3MA 3X44A 5FLKA 2QSJA 4P7KA 4D81A 5K0EA 1QVZA 3GRFA 1VP9A 1BWPA 2FDXA 4BVFA 5KTNA 1P2GA 4HZGA 2RK6A 2Z4RA 3QVTA 5ER6A 4BXOA 4QQNA 1NVUQ 1V25A 3AUKA 2B1GA 1M73E 4AY3A 3MRTA 3OIFA 4PZEA 5CITA 3K1JA 3Q3EA 1A4UA 1XTZA 2WG2A 3K09A 2CJWB 4KRFA 4PPQA 1E3TA 2PT9A 4JYCA 5COBA 2JI9A 3PUWA 1HNNA 4MIYA 1C9EA 2QZZA 1EXDA 1O0CA 1X3SA 4FYJA 3TVDA 1RBYA 2W2KA 4GLLA 1P1KA 1BO6A 2YJTD 3QNMA 3CF4A 4UM8B 1Q0UA 4DQ0A 1NBOA 4LQDA 4WXPA 4ZC1A 5J9FA 2HF2A 1I2CA 1KVSA 1RKBA 5JU6A 1SUEA 3HN7A 3LPNA 5D6OA 1CC1S 1HLDA 4HAIA 4ZQCB 5B6IA 2IHZA 4LEIA 1V35A 3VGPA 1Q19A 4HAUA 3VOAA 1O6BA 2IYVA 4M49A 1HY3A 5FB3A 3PXDA 3CZQA 2FG6C 1NVEA 4DR6B 4DLNA 2EJVA 3FTDA 2VDOB 2XXAB 2H3EA 5AK3A 2XIQA 3CH4B 1RAGA 2H4FA 2IOHA 3ECCA 4XLLA 4C0WA 1JB1A 4NR0A 3N07A 5EJ6A 3SD7A 5JVDA 1QP0A 3E61A 3HEAA 4CCYB 3AM1A 1T26A 1NUAA 1U3WA 1AB5A 1JZSA 1TGYA 1UBRS 2C4KA 1Z2DA 2NO7A 3VR2A 3W8NA 3PR1A 3TL3A 1RAFA 1BVYF 2ICAA 2Q5QA 1BXGA 1EGVB 3EXG1 2WMYA 4KO8A 1S1CA 2B8JA 4DCCA 3K9HA 3FIJA 3H65A 3C15C 4FGWA 2BEWB 1RQ7A 5EJ4A 2YJGA 2F6RA 1Y4DE 4J1QA 3OE7D 4G6ZA 2W4MA 4Y1RB 4MGIR 1HE1C 1L4KA 1TF5A 4PLHA 5FUYA 4BRWA 4CT4B 2YHBA 3HYRA 4D74A 4QG7A 1E3MA 5B64A 5HQTA 2VDMB 5EIOA 4AAYA 5FUWA 2VDLB 5DYNA 3P52A 4ESVA 4CHGA 3HUFA 4YGYA 2AD1A 3OIDA 4A15A 1MW9X 4O4LB 3EHEA 1D4ZA 1QB7A 1MVLA 2PYZA 3EXHB 4ZO9A 2DFKB 5EMMA 1ZU5A 3TSYA 2JGLA 2QTCA 5IEJA 1SEPA 1YZFA 3LUBA 5T4BA 4WKCA 1YQUA 3EFOA 4AZVA 4YRGA 1K7EB 4W5WA 2IBSA 2LCFA 2C4MA 1FLNA 2OILA 2QEQA 5BW8A 1HSOA 2K5UA 3BTSA 3Q9NA 3FPKA 4PE5B 4ND6A 4YNBA 1ZIPA 3QVWA 4TOIA 4DCVA 3WP0A 1XEXB 1QWOA 2DWQA 4OXQA 3D7LA 4UMEA 4ZHQB 4QYMA 3TZBA 2VDKB 3PPYA 1HI9A 3HYCA 4KKXB 2W6CX 4IHJF 1CYEA 2FSHA 4PS0A 4HF7A 5G3YA 1XNQB 5IUKC 4C3OB 4QREA 1P29A 3DEYX 3KTAA 3GAMA 3AG6A 3D6JA 3QF4A 4PC2A 5GV7A 1PI3A 1NJ8A 3SOPA 4TVKA 2QP4A 1L7XA 4MUHA 4WZBE 3FYUA 4WKGA 4KIWA 2HNBA 1ULBA 3GFOA 3OEHD 2CZGA 5FF9A 1U2TA 2QJFA 5F76A 4IXNA 2P62A 3BAZA 4HNQA 3O31A 5LMUB 2MR5A 3LCMA 3H3XA 3HBJA 3P32A 4O4HF 4H1UA 4CODB 3TRJA 3UN1A 1KO5A 1V47A 4NFHA 2JD1A 3QKSB 2RHLA 5C8YF 5AKIA 1B23P 4CU2A 1PV2A 1NXQA 4GKVA 1UFOA 3L82B 3IDOA 5HKLA 2PR7A 1JI0A 3K72B 3R3UA 3U19A 2A86A 2MSCB 3NP7A 3V00A 4CTJA 3PLRA 3B3FA 1UZUA 1Q2XA 3HWWA 1E32A 5BT8A 4F9EA 1YBVA 5KMGB 1GKKA 3I01A 1UAAA 3ZHOA 1US8B 1BH2A 2EP8A 4AF6A 1WDWB 1EP3B 2RGBA 3C7AA 4H0FA 1J8QA 4HWSA 1WBBA 2JAWA 2X15A 4K88A 4ER5A 4EO9A 4M8NE 3EW9A 3ZHUA 3IDAA 4OATA 4LXTA 2ON6A 4F5WA 3HJHA 1TRHA 3GLRA 5DHRA 2X86A 5E6RA 5C4MA 5E4FA 3PA6A 3L7AA 1MAUA 1CQPA 4K2HA 5DYGA 4AQYB 1H65A 1QNFA 2HI0A 3B2QA 4FB4A 3H18A 1M7HA 2P67A 1AKVA 1XMJA 2QLNA 1D07A 2WUEA 1B74A 3P0FA 1COZA 3DGFC 4LFCB 1NIPA 3CONA 5B1EA 1V95A 3DT8A 3JTMA 1AZSC 3ZU3A 4P81A 4DTCA 1L7EA 2VP4A 4A03A 2DRIA 3CE6A 4O2LA 2EP7A 1F2DA 1MX5A 2JVJA 1GLNA 2FCAA 3H7IA 3VNAA 4EJSB 2Z04A 3V8MA 1V9CA 2ZAYA 3IIJA 3SYKA 4W5OA 4CMGA 3ZY4A 1VDZA 1DKPA 1MX1A 3SBOA 2I2BA 2A5GA 4BC0A 4I8DA 4II2A 1OGJA 1PD1A 4RVFA 4EMBA 3KUDA 3ZS9A 1JS1X 3QPCA 3R77A 4QTTB 1PQWA 4D1YA 3BE4A 2XW6A 3QIVA 3ZKWB 2AFIB 3EISA 4XLTA 2PLAA 1WIWA 2GO1A 2H5EA 1M3SA 2V97A 3M6FA 4UXHA 4EY7A 5AVQA 4MVCA 4M1WA 3FKSA 1T1GA 2Z6AA 7REQB 3Q87B 3I45A 1YRHA 4PANA 2FEKA 1KH2A 3EWNA 3ZGLA 2QX4A 1SIWA 2DBVO 5HF8A 1U98A 1PKXA 4AKHA 5MGBA 3MA0A 4XZ3A 1QWSA 4POAA 5FA6A 3U2QA 2HM7A 1BMQA 3RVMA 1XZPA 1O87A 1YR6A 1CP2A 4M4SA 4RFVA 3VGJA 3NBZC 3ELDA 5LQKA 1B0AA 1JSRA 1KR5A 1YTUA 3L7KA 4JENA 2BGGA 3IKMB 1QOQB 2FPWA 3DKKA 1PN3A 1R8QA 1P1FA 4KLNA 2JD2A 3LO8A 1K3TA 2JBAB 5DXFA 3T34A 4Q1BA 1ITZA 3OJEA 5A2GA 1KS2A 2BSQA 4JUCA 2XYGA 1XCOA 3KE8A 2MINA 4N9WA 1UM8A 2GZHA 5G4LA 3H42B 1SC6A 1EGQA 4B3FX 1VLHA 4RFSB 2O6HA 4I2NA 5I8PA 2EBHX 2OV3A 3PC2A 2G1UA 3ZEIA 2PNFA 4WPGA 3DNMA 3ZZNA 1OH7A 2QRHA 3I2GA 2BE9A 5ECGC 2YQ5A 1R8SA 1FZTA 4CIBA 1B26A 4PNPA 2J4DA 2X22A 1XU4A 4C0LA 1NVTA 2BI8A 5KDDA 1DRUA 3A4YA 1ZN7A 2GPSA 2V5UA 3OTGA 4O1IA 2RI1A 4V0KA 1VYVA 3SJBA 3NGXA 1ZUNB 1GNRA 2PGLA 3BK2A 3I6YA 4HGPA 4NLLA 1QIKA 3WGIA 2BI7A 1NUUA 2JFZA 3EIOA 4RGVA 3WIEA 4KNYA 2HZ7A 2WD8A 1G7SA 5ALEA 3HXLA 1Y4AE 4BRZA 5IDWA 1DBVO 1ZFNA 2OZEA 3LGSA 3EQ8A 3ZDQA 3OKPA 1W5EA 3TOSA 1RBZA 5BWLA 5CT4A 2IU3A 5EKDA 5HBRA 3RR2A 1WXQA 2ZVPX 1DQYA 3NT5A 4IQ4A 3CX4A 2D0OB 1B4DA 2GMWA 3DDHA 3U4IA 3TQHA 3K0AA 3GR6A 5J5AA 1DUIA 2ANBA 2EBFX 2F3UA 5F73A 3A06A 3EDQA 4WCFB 2CC2A 3LF1A 5BQXA 3IT3A 1GVHA 2V58A 2EZTA 1W59A 4WLEA 3K5PA 4B4VA 1CQJA 2O0KA 2PKWA 1JDUA 2QUKA 2MSKA 5SV2A 1OAOC 3MHPA 3A2LA 5ALKA 1WTCA 2FSSA 1ECPA 1HMPA 1VJTA 3GW8A 1JDZA 1VHTA 2BKAA 1NW6A 2Z4SA 1JHDA 5U4XA 3U3JA 2MCFA 4PLPA 4XAQA 2PJRA 2JIZD 1K92A 1S9HA 1LRJA 2O2GA 4XASA 3FD8A 5CNKA 3AU8A 5LNK6 1OZGA 1W0KD 1ODFA 2SKEA 3K0BA 4BNDA 2A9QA 2DVMA 4M8IA 5BUCA 4I9GA 1W30A 1U1GA 2AOUA 2HF9A 4U7JA 5ARCA 1XD9A 3RARA 1CKEA 1K3FA 1FEZA 3RQSA 3K70C 3A11A 3IXMA 4OFWA 3CF2A 1PV1A 3RSCA 1NKTA 1GKUB 3LQQA 5AJHA 5ADVA 3FI0A 2W2KB 1U1DA 3BN3A 3K1AA 5LYYA 3NIBA 5JSFA 1R0ZA 1IY9A 4BBJA 3TSOA 4MP8A 2N46A 2DETA 3M9LA 4XFKA 4CTNA 3QU7A 5L6MB 3LCRA 4MVJA 1OASA 2TYSB 3H9GA 5KJEA 1P44A 1W25A 2V7QA 4JP8A 1YAHA 5IT5A 2IX3A 3CR8A 4NHEA 4C6SA 1PG5A 3R6DA 5KC9A 5AM3A 2W6QA 4N49A 5BNFA 2QTVA 1Z3IX 4XEUA 4F3KA 1PVDA 1KIFA 1UIRA 1XJ0A 4IUDS 4W63A 1LF5A 5JVDB 4DLRA 2OORA 1JJFA 1M1UA 4M1OA 4NWIA 1CIJA 1N2JA 2WVAA 5T3YA 3U40A 2VHYA 1A8IA 2OWDA 4ENPA 4NCXA 1U2GC 2CFOA 1BXGB 1FVXA 2QE7D 3L8MA 3R8CA 1S3IA 1KF0A 3A1WA 2YNMC 2ZLBA 3PPWA 4GPBA 1GL6A 3ZE7A 2CLCX 1DJOA 3DBIA 4P86A 3N2ZB 1KKMA 1W5TA 4XW2A 5D1NA 4OHMA 3JQBA 2FQXA 3MJEA 4YMWA 4BLWA 1R15A 1Y5MA 1I6KA 3NIDB 5LQJA 1V5IA 3P2KA 5C8VA 1C50A 2A1UA 1FFEA 1RI4A 3EN0A 1FDTA 2HLNA 4ID3A 3TVTA 3K8QA 3FROA 3ZY6A 3TB6A 3EFOB 1KDTA 4YUZA 1QDUA 2HF8A 2Q3HA 5HA5A 2VYND 2QSYA 3C4QA 3K7EA 4YAOA 5AUPB 1D5CA 1VHDA 1SIBE 2IODA 5DYTA 1E2UA 2E4XA 1DT5A 2GBLC 3EZ9A 3NCHA 4KHZA 3UHAA 4AUEA 4F2DA 4IDNA 3GUYA 4DQDA 4EB3A 1YBAA 5CNJA 3C48A 3SG0A 3PDHA 4ETMA 2VHEA 5H1YA 2H4HA 5G4KA 1U04A 1CETA 3QF4B 1FXUA 5HRUA 4JKIA 4YUVA 1U9ZA 3PTAA 4ZRNA 3VBEA 3Q6NA 4P5DA 1KJYA 3CJTA 1PDWA 2YXBA 4BWFB 2I4TA 3T1YB 3CH7A 3FYUB 2A92A 4B35A 3PICA 1XMQB 2DUMA 1JHXA 1A8SA 4EHIA 4AL4A 1RTTA 3AUJB 3DQZA 1E9VA 1L4LA 3T9EA 5K8UA 4L6IA 4JJ4A 5GMOA 4GRIA 2XGGA 3LWBA 4RDIA 1C0IA 4RKRA 5TSDA 5SYMA 3ZU4A 5FOSA 3IKTA 2NSDA 4WXMA 3TQCA 1D2RA 4KWEA 5AOBA 2FX5A 3PEYA 3CE9A 3D0QA 1MAHA 3L92A 4D97A 2F48A 2NYAA 4TLEA 1OX4A 4B7AA 4EL0A 3IAXA 4FN4A 5ETJA 3BD8A 4EITA 1ZW1A 2H52A 1DTEA 4C4YA 3SX2A 5JXIA 1MJGA 2ZPTX 3BB3A 4DLZA 4CQNA 4JJ7A 3COZA 4ZD6A 3ROTA 1H4VB 3S7ZA 3CUSA 2PSDA 3RABA 5C5CA 1K7FB 3BRQA