3X2SA

Crystal structure of pyrene-conjugated adenylate kinase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDCGKLVTDELVIALVKERIAQEDSRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLCEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Excimer Emission Properties on Pyrene-Labeled Protein Surface: Correlation between Emission Spectra, Ring Stacking Modes, and Flexibilities of Pyrene Probes.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr. mds42
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 73
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x2sA00
4CZ2A 4PAQA 4MH0R 4G5GA 2WJGA 2GAAA 1RJ9A 4Q1CA 3E2IA 2QT1A 5EZ6B 4ARZB 3QKRA 5IT5A 1VHTA 2PEZA 1PZNA 1Q12A 3T12A 2QE7D 1NIJA 2F43B 3THWA 3W9YA 1JPJA 4Q4LA 3ZZUA 1NKSA 1NJGA 4KV9A 4W5WA 2NZJA 2F1RA 4US2R 4BRUA 1VYVA 2FV8A 1XD8A 3D31A 1KI7A 2PLFA 4LV6A 3A4MA 3GJ7A 1QHIA 3HP1A 1CXZA 3MWYW 3NDPA 3QIAA 4FMDB 2PX0A 4J0QA 1ZNYA 4C2TA 1ZIPA 2GVZC 2KE5A 5TB5A 1PV4A 3VNUA 3PCRB 2W2XA 3IO3A 4TMTA 3QVUA 1D2NA 1NY5A 1E6CA 2G0TA 3MWLA 4B2IA 2P6NA 4TYYA 2QMOA 1F6BA 3B85A 4GZLA 2C78A 1P61B 3C5HA 4D2IA 1X3SA 3VU9B 4BFTA 5JRJA 1VG0B 2XOKD 1H8HA 4JLDA 4MITA 2XZPA 3ZQJA 2RGNA 1MRNA 1W44A 4E09A 2PZEA 3VR3A 2AX4A 4DDVA 3RS2A 4L5BA 1R10A 3IGFA 4WBSA 1X8LA 5FL3A 2ZRJA 4E22A 1W0JA 5AK0A 3OEHA 2BDTA 4MRPA 2ERYA 4KO8A 4M1OA 5BXQC 4MQBA 4IKEA 5EE9A 221PA 4KBGA 3FHOA 3AVYA 1YHNA 3QXSA 1CTQA 4EFNA 2IW3A 4C0JA 3U7HB 4OQNA 2A5DA 4RVCA 5E7MA 2OBMA 5F9HA 2NIPA 4PSKA 1SQ5A 3B1XA 1OYYA 4URVR 2P67A 1EG7A 2AFHE 3VX4A 4IXNA 2O0JA 2NO1A 3ZVRA 2ZJBA 1BYIA 2ZYTX 1HQCA 2EU8A 1W5TA 4CRWB 4IFEA 1E4YA 2MMCA 1E2PA 4IJMA 4Q9LA 5H68A 2FMXA 3H4MA 1PLJA 2ZI5A 6Q21A 2CHVA 3CWZA 4Q5IA 2ZSFA 4B48A 2WSSD 3T1TA 3CKLA 1XBTA 1XTJA 3BB4A 5FOUA 1YR6A 3S1AA 1CU1A 2EW1A 4KFUA 4IDNA 4S35A 1XX6A 4LHYA 2GKSA 2CJWB 3WBJA 4X8HA 5L8VA 1EX6A 3THYA 1NSTA 3EA0A 2AN9A 4PFSA 1XJQA 2N46A 3WNBA 3NC0C 1FMJA 3TE6A 1NN0A 3LY5A 2J87A 1JEEA 3DKVA 2OAQ1 3U3MA 1Z47A 2BMEA 4Q9HA 4HI0E 1ZUHA 4MGKR 5G3YA 1OH8A 2BHRA 1G4UR 3EIEA 4P4SB 3CRQA 4G5RA 5A0FA 5C46F 2IT1A 5EZ5A 5CITA 2OHFA 1N5IA 4DSOA 5CLLA 1W5SA 1S4QA 2NOAA 1HT1E 2QNRA 3AB3A 3P26A 2WWXA 3KFXA 3LW8A 1IY1A 4WIAA 4LCBA 2O8DB 4LJ8A 4TMKA 2PT7A 1N6NA 1TU3A 3NDBB 3EARA 4OQFA 3BH6A 3ZIAA 1OXUA 2ODNA 2XOKA 4LJ6A 4R7ZA 2IUSA 4AKGA 1G41A 1T8TA 1X86B 4QXAA 4EKDA 2C96A 3O8BA 2AFIE 4EFLA 1GZSA 1A1VA 4BPBA 2WMOB 4F7WA 1OH6A 5KDOA 1N5LA 1BS1A 1RRGA 1FZQA 2GBLC 1GKIA 3EPHA 1DO2A 2D2FA 5SZKB 3C7KA 1AZSC 1KIMA 1F2UB 1TUIA 2BM0A 3DKPA 1VG9B 4JL8A 3J81k 3D6TB 3OAAD 2J0QA 1NVVR 4C2UA 2GK6A 2WZQA 2WICA 2QMEA 1XB2A 2WAYA 1X1SA 5EXPA 1VPLA 2YOFA 4PSVA 3U60B 1R0XA 2OUKA 1L4UA 4JBYA 2A7QA 2V54A 5AJVB 3FDIA 4DLVA 2QPTA 2NPIA 3THOA 5CJPA 1T0JB 2GK7A 1ZC3A 1ELOA 4F92B 3OZXA 1AA9A 2PCJA 1GDDA 4MGIR 3U4QA 3QKTA 2CNWA 3K0FB 3WYGA 1X6VA 1XXHE 4KJZA 3DMDA 3WNDA 3GLGB 4B3DA 1GITA 4NYJR 3D7MA 4YMVA 1OYWA 3L82B 3W6OA 4TMZA 4NYIQ 4Y0AA 4EQ6A 1CRQA 2D3WA 2BKEA 3FE2A 1HA3A 3FGNA 1II8B 1S3GA 3FMFA 2GEDA 3QXHA 2J0VA 3GCGA 2X77A 3C5CA 1VIAA 3CZQA 3SFZA 4BLRA 2IBMA 2VO1A 1D9XA 3D3QA 3DMNA 1XD2A 2AD1A 4OQXA 1NG9A 3CPJB 3U7FB 4G5SA 1P5ZB 3K9HA 2QQEA 4AYTA 2F3TA 5C18A 1BKDR 2FOLA 3QKSB 1OT3A 1E9FA 4HEJA 3GJ0A 3R8FA 2DFLA 3X1XA 2C8VA 1VDZA 1ZINA 1WF3A 3CF2A 2FSHA 1T3LA 3K0FA 4ZI2A 3LLUA 2OBNA 2RGDA 3JZMA 1KTVA 2QUZA 3TQFA 1CIPA 2D7CA 3VMFA 3CBQA 1YZNA 3FMPB 3OFNA 3I32A 4B3CA 4C0LA 3FPAA 1LY1A 3UMSA 1NN5A 1ZBDA 2HF9A 4DBLC 4JBWA 3ADCA 4UKDA 2IXFA 1YZLA 4LV8B 4YMSA 3NVAA 1QHSA 2A5GA 4LC0A 4QOSA 3GLIB 1G7TA 1W2GA 4KXFB 2C5LA 3AVXA 1KKMA 1NI3A 1S9HA 3QEJA 4BFXA 3U6BA 2BBSA 2RGNC 4HUQA 4G3XA 2QP4A 2GBLA 1SKQA 4XVUA 2ZM5A 2IYQA 1AS0A 4OQLA 2GAOA 1G64A 1E2FA 3CNNA 4GMXA 4QNMA 1OIXA 4DSNA 1Z5ZA 1QHHB 3LQRA 1AKYA 1HTWA 1Z07A 2QRZA 1M2OB 4A2PA 1E94E 2GZHA 5HE9A 1OH7A 2KB0A 1KAOA 2H7VA 1YZKA 4M22A 5DE3A 1KSJA 2FX3A 4Q1DA 2MMGA 3TW4A 3ZJYA 4M1SA 3HYRA 1N2CE 2LWIA 4KYUA 1P2TA 2CVHA 3LWNA 2B7CA 2CK3D 5EUMA 4FI3C 3DL0A 4DLUA 1COWA 3UATA 4EJSB 2ECKA 1E2GA 3QPWA 4HAVA 3CPEA 4ERNA 5FOXA 5F98A 5B58C 2QY9A 4P4UA 4URUR 3V4FA 3O8RA 2TMKA 4XSGA 4N1AA 4JSYA 3IO5A 1ZUIA 1CJMA 2OBLA 3NEYA 3BB3A 3WHKA 4B47A 3LAWA 4GMDA 3QNUA 1MT0A 3BJIC 2ZI7A 4HSEA 4HUTA 2G6BA 1W1WA 2BEJA 2JLVA 1XTSA 2KSQA 4YMUA 4O3MA 2ZS7A 4W5JA 3U44A 2ZJYA 3QXCA 1UFQA 1XMJA 2IYWA 2GCNA 1SVOA 2FJUA 3EWSA 3OFND 3QXJA 2ZREA 3EZ2A 4HZUA 3GLFB 4BECA 2PEYA 1E0AA 3RS4A 1YZTA 4AURA 4GOJA 2ZRGA 1L4YA 2F1JA 2FF7A 4QGAA 2QAGA 1E9CA 2ZE8A 1R5NA 2GXSA 2ZRNA 5FBLB 3W8NA 2IS2A 3N5CA 3HR8A 4U02A 3BK7A 1TTTA 3AVQA 1KZ7B 2ODBA 5KSOA 4GL2A 2OE2A 3A1TA 4XTRA 3HU3A 4BEBA 5FUVA 1U9IA 3DDCA 4NTZA 4Q47A 2J0SA 1EFCA 4BE7B 4GOKA 2CLCX 3ZH9B 2HF8A 3RS0A 4ZCMA 4ESVA 4JLMA 3W6PA 4A82A 4FMCF 4EPWA 2V4ZA 1I4LD 2R6DA 2IUTA 2JIZA 3GPLA 1Q57A 1RC8A 4C0QC 3ZLJA 1KK2A 3UWKA 4EPXA 3H1TA 5G3ZA 1MO5A 1OF1A 1NVXQ 2WWWA 4U00A 5DSZA 2W83A 1XMVA 5K8LA 5FOWA 1S3SA 2WKQA 4I81A 1E1QA 4M8NE 1KO4A 2YWGA 4LJ5A 4AG6A 3UXMA 4W9MC 4FXPA 4RD3A 4POAA 3AKCA 1W36D 2BMFA 2A5JA 5BYKA 4F4CA 5DISB 3TRFA 4UNQA 4BFSA 2GZAA 3UK6A 1ZM2A 1O87A 1ZP6A 2FFAA 3CR8A 3UWOA 4OBEA 1JR3D 1SHZA 2YYZA 3U61B 1XEWY 3I92A 4ASUA 1RE0A 1I2DA 2BBTA 2AWOA 2RMKA 1XJCA 3Q72A 2VHQA 1CEEA 5CK5A 2ORVA 4YMTA 1JXMA 2YOGA 2DWOA 5DIFA 4D4LA 4KCGA 2RHMA 2ZI9A 5EQTA 2RGGA 1R5BA 4PC6A 5CIQA 3RAPR 5EP4A 2KWIA 2FSIA 2VF8A 1NMZA 2XJ4A 3C41J 4PR0A 4NHOA 2OV2A 2YINC 3U4QB 1DPFA 1XPUA 5JJIA 4IVQA 3FFBA 1G5TA 4W7SA 5FOSA 3NBFA 3TMKA 1FNNA 1G8YA 1W47A 5E7JA 4EUNA 3W5JA 3F8TA 4RKEA 1ZU4A 1KI6A 2I4IA 3TK1A 1CKEA 3OIUA 1E99A 1G8PA 4HLCA 4JSTA 3RSLA 3WY9A 1HV8A 4LHZA 4TYNA 2ZRIA 2E9SA 3K70D 1PUIA 2JLXA 3WBKA 4BLTA 3SOPA 3T35A 4C7OA 4TL6A 2IYYA 5EXTA 1E2EA 3W3ZB 3KQKA 4TLEA 5CYOA 2H1LA 1G18A 2WKPA 3B5JA 2J41A 3KJEA 5CDFE 1NN1A 5H1YA 1WRBA 4UNRA 1RW4A 4PAMA 3SQWA 3ZYCA 1R8QA 4GI7A 1HE1C 2NPFA 4BZPA 2F3RA 2Q3MA 1OJLA 3MD0A 5GJCA 1U90A 4RD4A 2VL7A 4BQSA 2ZSBA 4KAXA 4S2EA 2CL0X 2EWVA 1CJKC 4LBYA 2FWRA 2G1JA 4OHZA 1P4SA 2ZUCA 3IQWA 3JZAA 1SVMA 2HV8A 2RH5A 4QJ5A 4BLOA 2KJQA 3KZ1E 2B7BA 1DO0A 1V5WA 2EVWX 3CH4B 3B9PA 5DNYB 4PZZA 2VLIA 1T3HA 4OK5A 5HPYB 1UEIA 4ZO4A 1E96A 4R9UC 4JS0A 3QQ5A 3VKGA 4MGZR 1LNZA 1NVUQ 2FFQA 4Q9KA 3GLIE 3BERA 3NXSA 4HDQB 1U94A 4Y0VA 3FVQA 3MRSA 2I3BA 3HPRA 1IOZA 1R2QA 4UXHA 5KO2A 3CO5A 1W4CA 4TWZA 2GJKA 2RGXA 2IL1A 1JBKA 1JJVA 4G01B 3VFDA 3EPLA 4B33A 2PMDA 3GQBA 3UPUA 2Y8EA 4F4JA 3FOZA 1E2MA 3Q9LA 5DYGA 1G20E 1IN5A 5TV2A 4WZBE 4B6EA 1J8YF 2YKGA 4PPNA 3SE0A 1Q1ZA 2ZU6A 3QOFA 3BE4A 2ZI4A 4Q66C 2QRNA 1PLLA 1B0UA 3FYHA 1ZUNB 4DC9A 1K5DA 2HT6A 3N2EA 4JIMA 3KKOA 1X1RA 4PAOA 5LB2A 3R9WA 4JZKA 4IVPA 1BOFA 4FCTA 5FPYA 2R8RA 2DHRA 1VYUA 4KYIB 1ZD8A 2HJVA 3TBKA 3SEAA 4P4TA 3K0CC 1Z0KA 1NJFA 1XEXB 1J70A 3THWB 1DAKA 4BFYA 5BW8A 2WBLC 4X8OA 3CWQA 1F5NA 3N2IA 5AJZA 3CLVA 5KTYA 1CR1A 4NCIA 1EGAA 2P2LA 4IHQA 3EW9A 3HPQA 4PXAA 2JJ2D 3KFVA 2J3EA 4HAWA 1JECA 1P6XA 1KYIA 2IXGA 3GJ6A 1KDTA 3I73A 1KK3A 4JVMA 2ODEA 1KI1A 1A4RA 2CE2X 2BVNA 2EYQA 5DLQC 2OLKA 2ZETA 3QXXA 2Q3HA 5EP2A 3A37A 2OXCA 1M7BA 4AKIA 4TLCA 1RRFA 1TMKA 4YDHB 4DXAA 3CF6R 2VH5R 3V9PA 3THYB 4RFSA 4HLQB 1JNYA 1OFHA 1IAQA 3Q5DA 4ZIRB 1XEXA 2VHUA 4A8JC 3SDZA 4BFWA 5HR5A 2X8AA 3UMRA 1MO4A 2ZR0A 2NMVA 3GMTA 1ZRHA 2ZS9A 4Q4AB 1J90A 1ZD9A 1C4OA 3DVLA 3LXXA 5C4GB 1SVKA 5AJXA 4LZZA 4DLSA 2MSDB 3CW2A 1Z63A 1Z6YA 4IOKA 5D3MB 1H8EA 1DS6A 4C3ZA 1E9DA 1VTKA 3GEIA 1FQJA 4LV5B 2EFDB 1Z6XA 1YKSA 3BRWD 1OXXK 4RY2A 3F5FA 3TVDA 5JWRA 3WYAA 3W34A 5BWMA 2E87A 2R6AA 1TF2A 2GF0A 1AN0A 3CF0A 4HDOB 2C2HA 4O25A 5DHFA 1ZW6A 3NKVA 4OKSA 3VU9A 3AF4A 1EFRD 1T0HB 4I1OA 1A2KC 1D6JA 2WSMA 4Q4AA 4MRSA 3QENA 1AK2A 1JQLB 1XJ0A 2ZAOA 4AY2A 4XWOA 2GJSA 1N3BA 1K5GA 5CK4A 1G8GA 4D26A 1TQ6A 1DBSA 4GP7A 2KI5A 3PEVA 4QBGB 1PUJA 2Q9BA 4RKFA 4EAQA 2GCOA 1WBDA 3RRMA 4MRRA 1FQKA 2IXEA 3RS5A 4RD1A 4DLZA 4H1VA 1UBFA 5J40A 2D06A 4KITB 1GUAA 1E0JA 5IK2A 3I62A 1U0JA 2CHGA 1U8YA 1E79A 1S2MA 5AJYA 5JHHB 3NHBA 2ZR9A 3M0EA 1GL9B 2DPXA 2XEXA 4LC1A 4QBHA 5FPTA 5JSZA 2XXAA 1CBUA 2QMUA 3FHCB 3RABA 3UANA 3PEUA 5IRCD 2B8TA 4C7OB 4TQUS 3E5HA 2CCJA 2O8FB 1Q3HA 3EAQA 2A3RA 1T91A 1M1YE 4URZR 5GJVC 3ZQ6A 4MGYR 3GFTA 4C0KA 2HEIA 1SXJE 1ZYUA 2D2EA 3DOEA 4KBFA 3WP0A 5L3SB 1XTIA 2DFTA 4WOPA 1JXOA 1KMHA 1UPTA 5AUNB 2G77B 2QQ0A 1U9IC 4TT3A 5EE3A 1G8HA 1KO5A 2AL7A 1QZXA 4WAUA 3K0CA 4M21A 5DHAA 4Q1EA 3RNLA 5K8TA 3ZIAD 4URXR 1I4DD 1LV7A 1XP8A 3EA5A 1SULA 2VQSA 3PUWA 1DAMA 4V0OA 4HAYA 4LOAA 4CVNA 2CK3A 1VYTA 5AUQA 5FPSA 4TTQA 1Q0UA 1AKEA 1LF5A 4GRAA 4JKIA 3B13B 2O8FA 1XEFA 2ZE5A 2MSCB 4RCZA 1XPRA 2QORA 2ZXUA 3RRZA 3CR7A 3X1WA 1RJ9B 3ASZA 1F2TB 3BC1A 4AIIA 2HUPA 2QSYA 1TEVA 5JFGA 4H9GA 1E32A 1ESMA 5JLJA 1S1MA 1GL6A 3PG5A 4KVAA 1ZD1A 4B3XA 4JKYA 2CNWD 3LVQE 1U8ZA 4BZXA 3LA6A 1KO1A 2XGJA 2ZR7A 1F2UA 1G3QA 1FFHA 3HR7A 3WRXC 3MJHA 1E3MA 1AZTA 1FX0A 4E03A 5EE1A 4DB4A 4DSTA 4LK2A 2OCAA 2QMHA 3K0AA 2Z43A 2AK2A 3W6NA 4DJTA 2PH1A 4LRWA 1CR0A 5C2JB 3E70C 1WMSA 1K6MA 4D82A 3B2EA 2QM8A 1AQUA 4LSGA 3FKSA 1TQ2A 2ZRDA 3EZFA 3THXA 4AI6A 1ZU5A 1F2TA 3GJ5A 1E4VA 1Z08A 3SI7A 3Q8XB 4ZPXA 2GHIA 1XXHB 4U5XA 3AEZA 3VQTA 4CT5A 4N0EA 1P9WA 4LHVA 3R7WB 2DY1A 3AV0B 3WP1B 2RAPA 3OEHD 2Z0MA 2AXNA 5FTLA 2EFEB 5J4HA 3MAAC 4B76A 121PA 3W8RA 4E5UA 1VG1A 3QY0A 4DLRA 2BEKA 1YR9A 3C14C 3RRYA 1GWNA 3G0HA 1FX0B 4G0NA 5BN4A 3MMPA 5KUTA 4BWYA 2VEDA 3B9QA 1Q21A 2CJWA 3FKQA 1R6BX 4OQMA 3OHMA 1KSHA 4LYHA 2RB4A 3CNOA 1QHNA 1UKEA 4QBFA 1QHHA 4A0HA 4MYTA 4QM7A 5ELXA 3B1VA 2FPMA 2WPDD 1TUEA 2JA1A 4JYCA 4OI2A 3RRNA 5IF9A 5F3WB 2J59A 2Q9CA 4CGZA 3KXIA 3CRMA 2WSSA 4ASUD 3C16C 2I1VB 3U3OA 4QG7A 2FSFA 1U98A 4TQ9A 1XF9A 2YV5A 1ANKA 1EX7A 4DRZA 1QVRA 1ODFA 2NO0A 3B82A 4CF7A 1KO7A 3SBDA 1NBMD 2JCSA 4DZZA 5DH9A 1L8QA 1M7HA 2VIIA 3WHLA 4CIDA 1TADA 4I4LA 2JDIA 4TZ0A 4D0GA 2ZUBA 3HYTA 4Z8YA 1DTSA 4A9AA 1Z29A 1G7RA 2AD5A 3MWJA 3RC8A 3MFYA 1GRNA 4QGHA 1Z0IA 1JR3E 2ATXA 3RVBA 1NY6A 2IYTA 1FP7A 4V03A 1COWD 4MKIA 4R2IA 5DI3B 1CJUC 3FFAA 1TF5A 2AR7A 4JT2A 1G9XA 2JLYA 4O2LA 2P0EA 2HT1A 1KGDA 3AUYA 2ZAMA 1CS4C 1SGWA 4JLPA 4NYMQ 3TR0A 3R20A 3QE0A 5TVKA 4JLVA 5HZKA 2GJ8A 3KL4A 3L0SA 2BCGY 4TQAA 4EPVA 4KU4A 2P65A 4K81B 1W4AA 3SHWA 2GTPA 2IYUA 3QBTA 2FA9A 5EP3A 3F0TA 3O8DA 5DGXA 1N0UA 2X19A 2W6ID 1KDRA 3KKPA 2IA5A 1LW7A 3CUEF 1E2NA 1N6HA 2XX3A 1Y3AA 4EQ6B 2BBOA 3UMFA 2FZLA 2RGEA 1VKJA 1Q1BA 1JQJC 2VTKA 4AD8A 4B35A 2O8CA 5FI1B 4TT3D 4Z51A 1SZPA 1J7KA 4GSYA 4QKQA 1L7VC 3IBGA 2DB3A 2HCBA 5HCNA 4HB4A 3K9GA 2ZVPX 2GESA 4NYJQ 4QHTA 4XOIA 1GIAA 1PLKA 1QRAA 3EZ7A 2DR3A 2W2TA 2A9KA 3OIVA 4UNSA 3GLFE 3EZ6A 3GLGA 2WJIA 5IHPA 3P20A 1YZUA 4TLDA 1KI3A 4NL4H 3T34A 4OK3A 4B6FA 421PA 5AR1A 1KI4A 1II8A 3EIQA 5E7IA 4AC9A 2VBCA 1U99A 4IEEA 2RGBA 2PL3A 2W6IA 4OHWA 5KDLA 4H1UA 2VHCA 4JBXA 2EFGA 3OESA 4FMBB 1E9EA 3BAFA 5FTMA 1GILA 3FWYA 5LB4A 1XZQA 3AF0A 3B60A 3K9LA 4XVQA 3QKSA 1MABA 3T1VA 2BC9A 2W58A 4D0NA 5JCPA 5SZJA 4L4UA 4LJ9A 1YZGA 2XSZA 3ZZ0A 3LNCA 2W2VA 1JR3A 1YRBA 3MSXA 1VIYA 4DDUA 1XMIA 4G5OA 2IS1A 1ZVQA 1W7AA 4P3YA 2CCKA 2ZJ2A 2O8EB 3D8BA 2QN6A 4MDFA 4AG5A 4KHZA 4NPHA 1RPZA 2JJ2A 1GTVA 2AHOA 5L3RA 1GNRA 3FKSD 3ONWA 3EASA 2CLSA 1VMAA 1Z6TA 1RZ3A 2LCFA 2D62A 2Q0HA 5JEEA 3LD9A 1HY3A 3DO6A 5FUXA 4AYWA 3IHWA 4XWKA 4JVNA 4PHGA 1YR7A 2DBYA 2JAQA 2R44A 3L2OB 1F3OA 2F9MA 3VHXA 3PJRA 2H18A 4FMDF 1KY3A 1QVAA 5GVSA 2FH5B 3TGPA 2J5XA 1U0LA 4KI0A 2BJVA 2EFCB 2XSZD 4Q48A 2YWFA 3GD7A 4L9SA 4QC2A 3KJHA 1DAHA 2Q21A 1YJ5A 1XXHA 5F9FA 3W3AA 4V0NA 3WMEA 3K09C 3NBYC 4IOJA 2PCLA 4DCNA 5K8IA 2O8EA 1UKZA 4KVGA 2NQ2C 4O0MA 4P33A 1ZNWA 4B2LA 4CEJA 2VSOA 1GL7A 4RFSB 2YOHA 2J0UB 2WIAA 1ZM4A 3GLHE 4GT1A 2WPDA 1T4GA 2CL6X 1RYHA 5DI9A 4DVGA 1E9AA 1O3YA 1KJYA 5AUPB 2BMJA 1IXZA 2KBEA 5L3QB 2F1HA 2O8BA 3L8ZA 2VRWA 3VKWA 2UKDA 4NH0A 4JLJA 2VPPA 2A5YB 2YC4C 3RS7A 4B75A 2ZRMA 2ANCA 4US0R 1C9KA 1TPZA 2JLUA 3TVTA 4ABYA 1QDEA 1EESA 5J4LA 2UZIR 2IWRA 2J46A 4XWAA 3U3JA 1N6KA 1N6OA 3BORA 4IDHA 5J5CA 1WQ1R 1E1QD 2NGRA 4NMMA 3NEJA 5P21A 4B73A 1JJ7A 4HZUB 4ZDJA 4B3BA 3IIKA 1I4TD 3SYKA 3P32A 1FPMA 2F9LA 1JPNA 2JJ1A 4ZCIA 2R6CA 2ZVQX 4LBWA 2ZITA 1FTSA 1XWIA 2OT3B 2C03A 3WNCA 1L2TA 1P2SA 3WMFA 2FZ4A 1M7GA 1W46A 3C8UA 3ICEA 5CJ2A 1GNPA 5L3QA 2O8BB 1SXJC 2QENA 2OG2A 3SS8A 1W0KA 3NH9A 5EUQB 5FBQB 3MJRA 3TJZA 2QG6A 1J2JA 5IK2D 2FFBA 3P27A 5E4FA 3X1YA 2ZE7A 3HU2A 2XTMA 3K09A 4TSFD 3TSZA 1KK1A 1VCOA 4QL3A 4RD0A 1N5KA 1IBRA 1ZMXA 1T9HA 3NBXX 3QI2A 4F38A 4AYXA 4HB3A 4LJYA 4TN1A 3QPUA 4TTRA 3PEWA 1G16A 1CR2A 2A30A 2BBWA 1G3RA 1PJRA 2H5EA 3BFVA 3DPUA 4LPSA 2WWYA 1NLYA 2UZ3A 2GEVA 2JJ1D 1E1RA 2OM2A 3QF4B 1W36C 3AF3A 4TZ6A 3GJXC 3A4LA 2GJAA 4BLQA 4WXPA 4Z1MD 2O0KA 1DAGA 4FD2A 3O8CA 5H8WA 4E07A 1AS2A 2QBYA 3DZ8A 3PEYA 1XDBA 1HUQA 2R6GA 1M74A 3I72A 3RHFA 4URWR 1A5TA 2REOA 5M04A 2DWQA 4PC2A 1WBBA 3B1ZA 3BFXA 1J99A 2D4HA 5GVRA 1FP6A 3BH0A 5DYIA 2Z4SA 5SZIA 4ZV4A 2V55B 5FR1A 2CLDX 1ESNA 3SJZA 4DEXA 4JVSB 4HB2A 4A2WA 2VSFA 4URYR 3TAUA 1AJEA 4DCTA 3I5XA 3LX8A 2IK8A 3U3RA 2G83A 1IHUA 4PPFA 5HTKA 1OIWA 1P75A 2QL6A 2LKDA 2A5FA 3K0AB 3QF4A 3OIYA 3ZZTA 4A0RA 1EXMA 3ZVNA 4JLNA 2ZSDA 3V00A 3T61A 3AKYA 1B23P 3TSWA 4CT4B 4BUJA 2PX3A 4MYUA 4PO8A 4XSHA 2FN4A 4XTCS 4YLGA 1OFTA 2VSXA 5FUYA 3TUIC 1OHHD 2D7DA 2H92A 2F1IA 2VP6A 1VHLA 1RRCA 1H8ED 5A4JA 1VCMA 2ATVA 2X2EA 3OEED 5K8UA 2GXAA 4V0ME 3R7WA 1NL3A 3TH5A 2BIFA 2IYZA 1KMQA 1ZJ6A 3ZVLA 2C9YA 3TUJC 521PA 5JI2E 2QROA 4D0LB 2W0MA 4UJ5A 2V6IA 4Q21A 3VAAA 2HJGA 5GJBA 1HURA 3GFPA 5GJWC 1Z0FA 3OE7D 5FOTA 1MV5A 3CRW1 2FE4A 2WV9A 3VR4A 1D9ZA 2Q9AA 4L15A 1G21E 4NYMR 1E0SA 1QG4A 1Z3IX 4GP6A 1EWQA 2ZYUX 4PZYA 1KY2A 4RZXA 1LTQA 1KOFA 4WXRA 3EX7C 1VECA 1X8JA 1N6IA 2O52A 3AGQA 3G82C 4I99A 1D2EA 4R71A 3KQNA 5AUOB 5GADl 5JWHA 1G6HA 1Z0AA 4Q1FA 2GDJA 5DN6A 3KQUA 3BBPA 4IRUB 2ORWA 2R6FA 2BCJQ 1NMXA 2YHSA 3OEEA 1FTNA 3A36A 2IYLD 5JHGB 5KPJA 1SKYB 1KJWA 5L3SA 3KTAB 4ESHA 4QRHA 4A92A 1G5RA 4EPRA 3PQCA 4RD6A 4PQRA 2ZJ8A 3AQ4A 2OAP1 4B3GA 2YZ2A 1JAHA 5E95A 4DT1A 1T8UA 1ZNZA 2C04A 5BN3A 3N70A 5E3HA 1QHYA 2FFHA 1Z8FA 4PPGA 4I1UA 2MSEB 3WRYC 4U7DA 2DCUA 1BO6A 3CONA 4D4JA 2VP5A 3A6PC 2Q6TA 1R8SA 5FUWA 4RCYA 5B30A 2E1RA 3PIRA 3PUYA 1IN6A 2ZSEA 5FPKA 2IEYA 4B43A 4M1WA 4DLYA 1ZAKA 2D74A 2NO7A 4TMXA 1MH1A 1XMSA 2ZYVX 1YZQA 2ZS8A 4I1VA 5KU1A 1LS6A 1WP9A 3I8XA 3KQHA 4EPYA 5FFMA 4UQOA 3RYTC 1UM8A 2WAXA 3IDQA 4A0GA 3K1JA 2IS4A 1Z2AA 2C99A 1VCNA 1R4AA 1UBGA 3TAHA 4TMVA 3SHFA 1LF0A 3TNFA 2Z5FA 4GFDA 4PC3A 1TU4A 2PJRA 4MKGA 2O5VA 2CE7A 3IPYA 4PHHA 5CYPA 5G53C 1CP2A 3CX6A 1IJFA 4ILEA 4B34A 1TQ4A 4HAXA 5KHOC 3L8YA 3AP1A 2P3SA 4US1R 2OCBA 2GA8A 3P4YA 1VCIA 5HE8A 1CRPA 1JR6A 2Q3FA 5KDDA 1U81A 1DOAA 3LBNA 4HLUC 2ZJAA 3AVVA 4BRWA 4BFUA 1R5OA 2ZRAA 4LWZA 1E2JA 2CBZA 2HDNB 2WWHA 2R2AA 1US8B 3GFOA 1W4BA 1T5IA 3BB1A 4ZKDA 1IONA 1RYFA 3HJNA 1IN7A 2VP0A 2YVUA 5J47A 4ZDKA 5LD2C 2O8DA 4Q19A 3KB1A 1FL9A 3RSOA 4LGMA 3HWSA 3SJAA 4QGFA 3Q3JB 3LLMA 4WW0A 4CDGA 3X1ZA 5KOYA 3UG6A 3BFKA 1GAJA 4Q9IA 2V9PA 3B7GA 2IF0A 4LYFA 3IIJA 4A15A 4UNPA 1DAEA 4MKHA 4RZUA 4TTPA 4YQFA 5KYKA 3KX2A 4LJ7A 3RWOA 4PQFA 3LX5A 2CCGA 2WWIA 3LV8A 4XD7A 4JLAA 5CLQA 2QP9X 2P6UA 1SVLA 1BYUA 4A6PA 2F43A 4KFRA 1NIPA 3NH6A 1GG2A 1GFIA 1FW6A 2AKYA 1CJVC 3X2SA 3GEHA 3LO5A 1IQPA 4TMWA 4KSCA 4YXWD 5JECA 5CIWA 1NMYA 3B1WA 2DWPA 2QI9C 2ZRLA 4L8GA 2IYXA 2H8KA 4C0BA 4DDTA 1QHGA 5L3VA 1BMFD 4KFTA 3IEVA 3CH5A 1D8TA 2QU8A 3QJYA 3KUCA 2BOVA 4X8MA 4PPQA 1KO8A 4A36A 2YWHA 4D25A 1XCPA 2YNMA 1FUUA 1G291 3NTUA 4A6XA 4CEHB 1BIFA 4A4DA 2GVDC 4LJAA 2PZGA 4LX0A 1JEDA 3L43A 1K8RA 4IEIA 3QG1A 2WOOA 2ZE6A 4Q4HA 5LBIA 4M53A 4OJKA 1CLUA 1IN8A 3IKJA 1UJ2A 4D80A 3K53A 2ZTSA 4AKEA 4FCWA 2P5SA 3QBVA 4AK9A 2QSZA 1IY2A 2P6RA 1G5PA 4LYJA 3X1DA 2QP3A 3M1IA 2Z4RA 2WOJA 3ZGXA 1SHKA 1P72A 2JLQA 1XEWX 3TUZC 1QF9A 2QGNA 4JLBA 1N5JA 2QA5A 3L0IB 4ZDIA 4OK6A 621PA 1FOEB 1UDWA 2AK3A 1UKYA 1JALA 4O2RA 3H84A 4PO1A 3LFUA 4OI4A 4PO9A 5ANRB 5TARA 3GEEA 1TAGA 1DAFA 4PC1A 1XTKA 1YR8A 2ZJ5A 2V8OA 4BFZA 2XITA 1E69A 3QKUA 1XD9A 5H70A 2B92A 2FGJA 2XB2A 2RCNA 1CULC 1HYQA 3M6AA 4FMCB 1F48A 1R0ZA 5KPDA 2ZIAA 1QG2A 4WZAE 1P62B 2VP9A 2O0HA 3T06B 3LXRA 4PTLA 1R0WA 4HLUA 5FBRB 5TMPA 1OXTA 1NNEA 2C77A 2RGAA 3U5ZB 2ZRBA 1BH2A 3ADKA 1GKUB 2H57A 4GBMA 4IXMA 2H17A 3QPVA 4LYAA 2ZRKA 3EZ9A 1W0JD 3ND8A 4FINA 4AKHA 3ETLA 1UBCA 4NONA 1NLFA 2PZFA 4YONB 5DI3A 4WZ6A 4TYWA 4L9WA 5B57C 3DEFA 4N0DA 3T1OA 3DOFA 4HYYA 1Z6GA 2WJYA 4TLBA 1D5CA 3FMIA 2BWJA 4Z8XA 2OO7A 2OCPA 1IXSB 4NCNA 4QNRA 3S1AB 1G17A 2AWNA 3EC1A 4UXIA 5JMTA 1GP2A 3O47A 2JLRA 5J4YA 1UBEA 5JI3E 4IOMA 2W6JD 4ARZA 3PVSA 3SZRA 3PR1A 4DT1B 3LDAA 2OESA 1RFLA 2C9OA 3BOSA 2QAJA 4NE2A 3VTKA 4ZIRA 5JBQA 1EK0A 3BH7A 3KXKA 4KFSA 2JLWA 2CMKA 1N25A 5FH9A 4EJSC 5FTKA 4M1YA 5LPNA 4ON9A 3GJ4A 4DWJA 1KKLA 1OB5A 4M0LA 5EXSA 1U8AA 1P2UA 3QVVA 4V02A 5TXGA 1Q22A 3TLXA 2WM9B 1G7SA 4LY6A 2X1VA 4PQYA 3VX3A 2VP2A 1Q1QA 2VF7A 2IHYA 4QFMA 5D3MA 3UG7A 2ZUDA 4ZKEA 2GJ9A 1WA5A 4TL7A 5CDFA 4A8JB 1LFDB 3ADDA 5SZHB 8OHMA 5EXXA 3AF1A 3IHLA 5FTNA 1LB1B 3Q5EA 4Q4JA 2ANBA 4LHWA 2XTZA 2XNSA 5J4VA 2N42A 2PT5A 3MGCA 4MDEA 3VR1A 2C98A 4BGDA 2CEAA 1DAIA 1S9DA 5KSZA 2G1KA 4DEYA 1KI8A 1T3SA 1E2DA 3LRPA 4MUBA 2J9RA 1JAIA 3K70C 3TR5A 3ZVMA 4NCKA 4NKRA 1Z2CA 1G3MA 4Q01A 4JL5A 3OF5A 3UIEA 4FWIB 3CX7A 4PC7A 3AKDA 2JATA 3SN6A 3G5UA 3KJIA 4V0KA 3OIWA 2FEMA 1DVRA 3K70B 1IM2A 4Q18A 3IQXA 1XD2B 1Z28A 3M4YA 4ITRC 4DUGD 3SU8A 4QM6A 1WB9A 4HZIA 2JEOA 1H8HD 3CX8A 2AXPA 2FPKA 4IDOA 4HATA 3K0EA 3EC2A 4G5QA 1R0YA 1KDOA 1NBMA 4Q4JB 4BLSA 2WJHA 3A1VA 1SVSA 4NCJA 4KSBA 1GNQA 4JJKA 2JDID 2NO9A 4DLWA 4P32A 1DG3A 2BKUA 2XNDD 3TW8B 3U7GA 1XPOA 1X8KA 3KUDA 4R98A 4Q7JB 3VR5A 4B3FX 1AM4D 1IN4A 2PLRA 1P9NA 3KKQA 1E9RA 1Q1EA 3A1SA 3LVRE 4LI0A 3PFIA 1OH5A 4MA4A 1ZM7A 4Q7LA 3T15A 2ZSAA 2EFHB 1XFAA 4CW7A 1DARA 2F7SA 3B6EA 5C4MA 1OB2A 1KJZA 3AKEA 3NBZC 2C9CA 4XVRA 2ZI6A 1P2VA 3I8SA 4ACAA 4HAZA 1U0HC 1FUKA 3CRVA 2ZI3A 1SXJA 5LDDC 1YVDA 4RZ3A 1G6OA 1A82A 1N6PA 5CM9C 3CRRA 2IYVA 1E0KA 4C9BA 3SBEA 2IYRA 3KB2A 3AH8A 5FPHA 2FEOA 2DFKB 3QF7A 4RD2A 4NYIR 4CEJB 1TEXA 4M9QA 4M1KA 3A4NA 5HCIA 3TIFA 3GLHB 4KLZA 5J4KA 4D81A 2VHJA 5D3QA 1UEJA 1Y63A 1XCGB 2F6RA 2ERXA 4B74A 1AGPA 2QTHA 1S1CA 3E1SA 4G1UC 4EPTA 2J1LA 3PV0A 4LDJA 1XCMA 4GPTA 2J7PD 1NVWQ 2FPLA 1MR3F 2WWFA 1LS1A 2QPOA 4R2HA 3JVVA 4W5HA 2O8CB 1CF4A 2YC2C 4A1FA 3IUYA 2HCJB 4JYBA 4ACBA 1OFUX 2FU5C 4Q00A 4DUGA 2ZRFA 2VYFA 5CM8B 1Z83A 1E2HA 1E2QA 3VR2A 2CL7X 4IDPA 1NG1A 1OXVA 2ZQ5A 3Q85A 2YWEA 2HYDA 3CB4A 2V7QD 1Q44A 4K46A 4QGGA 4DB2A 2V1UA 2V6JA 4B44A 3DM9B 3EXAA 1OIVA 3EWAA 3P1JA 5EE0A 2VP4A 4OI1A 4M9XA 5JWOA 1U2RA 3PUZA 3GLFA 3OAAA 3K0SA 1IY0A 3EPJA 2GETA 2UVQA 1JI0A 4M4SA 1RRPA 2P5TB 1NSFA 2WJVA 4Q7MB 3I1FA 5UKDA 5FBVB 5FOVA 4KODA 4JLOA 2J45A 1P7CA 4GDFA 2QEQA 1Z6AA 2J7KA 1AS3A 1MABB 3Q7QA 4Z1MA 1UDXA 3KJGA 4F93B 1GRQA 2OCYC 1TX4B 3IBYA 2BV3A 3DM5A 1OKKA 2CXXA 4TL8A 1II0A 3SJBA 2WTUA 4LBVA 3IPXA 3RC3A 3SQXA 1ZCAA 4DHEA 2WKRA 5JJLA 1YU9A 3L0PA 3K9NA 5AWFC 1GVNB 4LBZA 3PXGA 3T5GA 2B8WA 4D6PA 5KNDA 2ORIA 1N6LA 2GWHA 5FBWB 2Z83A 3H2YA 2REXB 3H86A 3TQCA 4D4MA 5HKKD 4QJ4A 2IC5A 1ZNXA 2SHKA 3AP3A 3RWMB 4A0FA 2QAGB 2G9NA 1NP6A 2B6HA 2XZOA 2JLSA 2OFWA 3H0KA 4D4KA 4IDQA 3BWDD 3F3YA 1UF9A 2I1QA 3AVTA 3KQLA 3VHLB 1EWRA 2DYKA 3QG5A 2QBYB 2XB4A 1MO3A 1F60A 4JL6A 1ONBA 3GLIA 2F55A 1OFIA 1W2HA 4TL9A 2FDCA 4FW9A 4Z54A 3B8HA 2QTVB 2J7PA 5EP1A 4TLAA 3ZD6A 3I3SR 4HUQB 2ZRPA 3ZD7A 1KSGA 2JJ8A 2H16A 4Q9JA 3SR0A 1Z22A 4JJZA 2JASA 2R62A 1AQYA 1W48A 1WCV1 2HYIC 1HH4A 4OHXA 1WDTA 2V1XA 1R7RA 5HKKA 4M9SA 3GLGE 4NBSA 4F91B 2W00A 2C95A 3GJ3A 3SC3A 2WMNB 1SVWA 1DE0A 4P31A 4PHTA 5FL7A 3FMOB 2A2ZA 2EQBA 2QAGC 2A78A 3AVPA 2ONJA 4DCSA 1Z0JA 3KKMA 1Q3TA 3MLEA 3W5IA 5CB6A 3VKHA 4DLXA 3ICQB 4M9ZA 5FTJA 5LD2B 1W0KD 3P4XA 4TYQA 2V3CC 1NKTA 1ZM3A 1ZCBA 1ZC4A 2ODWA 4OL0A 4CEHA 1DADA 4MYHA 4IFBA 4L16A 1FNMA 4HAUA 3GP8A 2RKOA 3CNLA 3WXMA 2IWHA 1Q20A 4CEIB 2ZU0C 3ZDQA 1XNJA 4A2QA 5B2ZA 4I1SA 1HQYE 3A1UA 3BIFA 2XNDA 5B64A 3RS3A 4EFMA 2R65A 2ONKA 1OKKD 1P9RA 1WXQA 3PUVA 5JS8A 4GNKA 3T1QA 2OFXA 4NU0A 3EIHA 4DDWA 4QBIA 3A58B 3V4RA 1NVVQ 3KXLA 4II7A 4C0HA 1DEKA 1YQTA 2CVFA 4GOXA 3T5DA 3I61A 1SKYE 4DKXA 4P4SA 3ZS8A 1E1RD 3QEOA 1KI6B 2ZJZA 5BN5A 1AGRA 3U44B 5FL7D 1P60A 3AF2A 1CR4A 3U7EB 1WE2A 3AVWA 3QUSA 4QJ3A 2KBFA 1UKVY 1RIFA 3DHWC 2X2FA 4MRVA 4PHFA 3SYLA 1OE0A 1KZGB 3IILA 1IXRC 2AKAB 3K8YA 2REBA 3HDTA 3SJCA 4CEIA 2IEZA 4IVRA 2QGZA 2Z6VA 2WVJA 4B32A 3FB4A 4EJSA 1D2MA 4XH9B 1N0VC 4PSAA 3RLFA 4OHYA 2FG5A 2GNOA 2GCOB 2GF9A 2QT0A 4FWTA 1KK0A 3AVOA 3VR6A 2OZEA 2ZJOA 4RJLA 4RZ2A 1NF3A 4DSUA 1OLOA 2G88A 1EFRA 3W90A 5JEDA 5KNCA 2BMDA 2QTFA 3B1YA 1KSFX 2K5UA 3EG5A 1V43A 3PUXA 3L0OA 5JZVA 1T5LA 1M6NA 1QHXA 1NBME 3MCAA 1MOZA 3AVUA 1E98A 2OEPA 3GLHA 4B2PA 3LBHA 1KNQA 2FNAA 3ASYA 1G19A 2CDNA 2BJWA 1UAAA 1XU4A 2GILA 1PVOA 1E9BA 1H65A 2NZ8A 2ZEJA 2RHDA 1G4AE 1G1MA 1N6RA 1DELA 2WHXA 4DIDA 2QE7A 1JB1A 1S8FA 2YJTD 3SYNA 2GRJA 1E79D 4M1TA 1KI2A 2V7QA 3NHAA 2QM7A 3REGA 4DLTA 3HU1A 1A7JA 4X8LA 3NG1A 3FHTA 1S96A 3AP2A 3WMGA 2ZYWX 4DCVA 2JIZD 1N0WA 3OE7A 4FIDA 1OPXA 5IDVA 1T6NA 2XAUA 1OSNA 1GKYA 2EYUA 4M2LA 3B78A 3R9XA 4UXJA 4C0AC 4YC7A 1KI9A 2OILA 4YMWA 1S0UA 2VA8A 3A8TA 1RKBA 3KDSE 1ETUA 4NZYA 1W4RA 1NN3A 1OXSC 4JVLA 1XTRA 4Q1AA 2FGKA 3EPKA 2IS6A 5TY0A 1G3IA 4IOLA 3C4JA 2IX3A 5KSYA 4AWXA 1FMLA 5G40A 1OV4A 5DN6D 3MUFA 2NO6A 5JRZA 2G3YA 1J8MF 5EE5B 4M1MA 4A8JA 3U6KA 4KLNA 4HDCA 1W49A 3ZS9A 2GEUA 4YXWA 2EWWA 2IYSA 3CPHA 5KNBA 1HT2E 4DIEA 4N3NA 2J0UA 2GZDA 1HE8B 4LUCA 1BMFA 4BZQA 3ADBA 3BXZA 2PBRA 4JMPA 1XTQA 2WWGA 3R9IA 1TF7A 1YRAA 3MWKA 1GRRA 2ZROA 2QZ4A 3LBIA 1TNDA 3BGWA 4OI0A 3R8CA 4NP6A 3KTAA 4NCHA 1M8PA 2HLDA 3LH5A 4ZI3A 2XJ9A 4BLPA 4EDHA 1AIPA 2GCPA 2OXRA 5AJWA 5A5GA 1GOTA 2PJZA 2GXQA 2W0SA 2WJJA 2ZRCA 3A1WA 2NG1A 1C1YA 4QHYA 3KKNA 3THXB 5JS7A 5F2EA 1E9SA 821PA 4IW3B 3IIMA 3CZPA 3JVUA 4FCVA 1DG1G 2XTNA 3ECCA 1I2MA 2OFOA 1OW3B 1SVIA 3GJ8A 2L0XA 1TL7C 4JLKA 3LQQA 1W36B 2XZLA 4MRNA 2PMKA 2WIBA 1GSIA 1MKYA 3AGPA 1ZIOA 4Q1BA 4TSFA 2B21A 4Q7KA 1G7CA 5G41A 2HXSA 3TSOA 4NDZA 4Q4HB 3LW7A 2CHQA 3AM1A 1VG8A 1KNXA 4MUAA 4RSGA 1KDPA 3MG9A 4ZDWA 2OLJA 1KHTA 1P73A 4OJQA 4OYHA 1G3UA 1G8FA 2N1BA 3CM0A 4V0LA 3NWJA 1TQDA 4C30A 1EFTA 3WYFA 5BYJA 1P3JA 1MRSA 4C4PA 2ZRHA 1A2BA 4BFVA 1RVDA 4GZMA 3RDPA 3REFA 3CIOA 3TKLA 3VNVA 4LHXA 4TYPA 3U3KA 3QSYA 2BM1A 2FSGA 1SXJB 4HLDA 1E2IA 1XZPA 1EFUA 3I4LA 4QHSA 5HZHA 4DCUA 1EFHA 3BS4A 1ZM9A 3C15C 1E2KA 5KSPA 5FI0B 3SNHA 2IHBA 5BQ5A 1XRJA 1IJEA 4K8OA 4OHVA 4PANA 1US8A 3Q7PA 2GXUA 4FN5A 4PZLA 4V0MA 4WVFA 2RGCA 1QBKC 4BEJA 5EJEA 1YE8A 4HB0A 2QPAA 3IEUA 4BASA 3BD9A 3FTQA 2HXYA 4XD7D 4LJ4A 4RFVA 2LKCA 1SXJD 1UADA 1Z06A 4UNNA 5CB8A 5JCZA 2JLZA 4MKFA 3ND9A 1Z0DA 5FR2A 1II9A 3SFVA 4XJXA 3QKRB 1KMHB 1CJTC 1NRJB 2HLDD 2ZPTX 4EIWA 4F4IA 3AUXA 1E2LA 3NIBA 4UJ3A 4JT4A 1NLZA 4Q03A 3UKDA 3RANA 2R9VA 2IUUA 2IF2A 4Q02A 2W6JA 4B71A 2NTYC 4MYCA 1MO6A 3PENA 5TDHA 2JGNA 2DFNA 4CYMA 5JSZB 4XIGS 4C0SA 2XXAB 2ASEA 1OHHA 4ZCLA 1GM5A 5JJKA 2OSBA 3NC1C 3U2QA 1KAGA 2ZANA 3PITA 3I5YA 4PX9A 1LVGA 721PA 4WA7A 1HEIA 5C1BA 4P0TA 2G0NA 2VHTA 3DZDA 1M34E 5DO9A 4YDSA 4LPKA
chains in the Genus database with same CATH superfamily
4PLWA 4B6QA 2V7PA 2PRSA 1PR6A 3DZHA 2Q1UA 3REQA 2B2NA 2WJGA 2E48A 1AKRA 1VMDA 2GAAA 1NVMB 4LDQA 3OOYA 4D7AA 1NDHA 3BF7A 3QKRA 5IT5A 5MGBA 2PEZA 4TWIA 1AY0A 4XCXA 1RBYA 1TMOA 1IG3A 1KFEB 4KXWA 4L4XA 1NIJA 2HU5A 2OHXA 1WOYA 2QRJA 3NYIA 5ABPA 1JPJA 3OPXA 1NKSA 3ZZUA 3VNRA 2C82A 1HFKA 5INTA 1NJGA 2DMRA 4HDNA 4CV0A 1O0CA 1J2RA 4CMGA 1NW6A 3MJTA 5DT9A 1RRKA 4AZ0A 4BRUA 1F14A 1XHEA 6REQA 2WTBA 2YR0A 2DTXA 1DU4A 1KI7A 1KXZA 1XKTA 3C85A 4K9KA 2NW6A 1GPMA 4XEUA 3UUWA 4R3WA 1DKOA 1Z5PA 3HP1A 2ICAA 2QN8A 3AC0A 1EHIA 1ZESA 3CLRD 2FZGA 4M38A 3STWA 4PLGA 4C87A 1ZNYA 2QXUA 3LIIA 4II2A 1NF2A 2I66A 4JCOA 5TB5A 1B0PA 1YE3A 3PCRB 4R6XA 1ICEA 1FDIA 2H2GA 5J2UF 1UC4B 3VZDA 3HJUA 1E6CA 4B2IA 3K2IA 3PLNA 5SICE 1F6BA 1RACA 4XIYA 4HD8A 4KX3A 3F3KA 3NASA 3C5HA 3U40A 3KSMA 4AF6A 2XOKD 1H8HA 4B3IA 2F3QA 2WZDA 5JXJA 4W9RA 4BVHA 1W44A 1JEAA 2PGAA 3R74A 2PZEA 1JNXX 2AX4A 3FRJA 3PC7A 3VAYA 3IAUA 4ETMA 4JBGA 5EVCA 2D5BA 1Y34E 3S81A 3HYSA 1FRNA 5GMOA 4FGKA 2FK7A 2IHJA 2PFSA 4KO8A 2VDQB 3WFIA 4IKEA 2WDPA 4BNJA 4OXKA 3OQJA 3D3KA 5CYFA 1XRRA 3IAM1 4CDNA 3EFBA 4EFNA 4DMGA 4G07A 4C0JA 5K3AA 3U7HB 2PYDA 4KXQA 3WGHA 2II6A 2V8BA 3DYIA 4KR7A 2QN9A 3AR4A 2B1IA 4M6WA 3DVSX 2R68A 5C35A 5KX5A 2QL5A 2AFHE 4GOLD 3VX4A 1X38A 5EINA 1WEHA 2O0JA 2NO1A 2VZ0A 3CKMA 2ZYTX 3R5FA 4GZ6A 2GZMA 3LVBA 4IXTA 3ZVRA 2DBVO 1PNRA 4C6TA 3PCXA 2NUBA 1E2PA 4IJMA 4Q9LA 4CM9D 2FMXA 3H4MA 4PLFA 4QTYA 2ZWAA 2ZI5A 3RO7A 4EG1A 4ZK6A 3CWZA 1MOSA 3QUCA 3W78A 1QF7A 4YIHA 1CDEA 1MFZA 3MRTA 4QQKA 4CQLA 4ESOA 1XTJA 1NM5A 3AY6A 3H1FA 3S1AA 3UUGA 1H5UA 2A1TS 1CU1A 2XIQA 1DKPA 2PZ8A 1X7XA 1YULA 1AHIA 3D7RA 3JQQA 2VK2A 2C61A 3E7WA 5D1HA 1KE1A 1MDFA 1NBOA 3SX0A 2CDCA 4XGKA 3IJEB 3QWBA 2B98A 1U9CA 3U4CA 1WDKA 1I5EA 2PBZA 3V2HA 5L8VA 2EJTA 4RCVA 2EIHA 2G1UA 3Q9UA 1YIOA 3HXQA 4K87A 2G4VA 4GI3A 1ZVKA 3NC0C 3VTFA 4C20A 1CJCA 3BFJA 5A3VA 3EXFA 4D99A 5NULA 2PS3A 4I4NA 3TIVA 1Q7BA 1JEEA 5CT6A 1Y7TA 3CSDA 1C7JA 3OD5A 4G6ZA 5G3YA 4MGKR 3V4SA 4F84A 2ACVA 1SY7A 2FFJA 2I2XB 3C3DA 2EBWA 1G4UR 3EIEA 1BN7A 3CRQA 3PFNA 4P4SB 5A0FA 3UKJA 3MTQA 4FNGA 3S5JA 2XOXA 4R01A 3SPXA 5C46F 1Z37A 2OHFA 3OQHA 4DSOA 5CCDA 2VCHA 3FCAA 2NOAA 1HT1E 1IN1A 2XQGA 3P26A 3D0KA 3M6XA 1SU8A 1ID8A 1H6AA 4TMKA 5I9BA 2G08A 2Q41A 2WINI 1YUNA 2XRYA 3N8IA 2HA5A 3BH6A 2N9UA 1OXUA 1ND6A 2XOKA 1KHHA 3K6SB 1T8TA 1X86B 1NQTA 2VCEA 3COYA 3D5TA 2C9DA 4QXAA 3CR3C 3CY6A 2AFIE 4EW6A 3N28A 1YE5A 4ZK2A 4BPBA 4F7WA 1ZR2A 2DFVA 5THQA 1YWGO 2Q5JA 5KDOA 1BS1A 1RRGA 1FZQA 1SCIA 1GKIA 2ZFUA 3UQYS 2R7MA 1BDBA 2WUWE 5EMNA 2D2FA 2D1TA 3C7KA 1KS2A 1S02A 1UKAA 3OPQA 1C7RA 2IHZA 3D6TB 2XB8A 1CY1A 2WV7A 1FVFA 3H04A 2HV9A 4DXHA 2J0QA 3WGNA 4WMLA 2WICA 1L5NA 3UK0A 2WAYA 3I2JA 1Y6GA 1PTKA 2YOFA 4PSVA 1APBA 1R0XA 4ZQIA 1A4IA 2X9NA 3UJDA 1L4UA 4S0XA 2W2QA 4DMUB 1KQGA 1ORVA 1UAYA 2V54A 5AJVB 4DLVA 4RFLA 2VHYA 1VHWA 2P35A 3LCRA 2NPIA 1PTJC 4NAHA 1T0JB 1ZC3A 4NNOA 1E1NA 2G72A 2Y99A 3E3AA 1AA9A 2D2XA 3ZDBA 3H5NA 4D8TA 1W5AA 3N5KA 3WYGA 4DIKA 4MZXA 3DE0X 1ISRA 3DMDA 4N65A 2B4TO 3U48A 5F3DA 3W5SA 5KSWB 5FT9A 4NBRA 5T8KA 2YWCA 3Q7IA 2WIDA 4JZYA 5A9RA 4UEQA 5B3JA 1T1IA 1BHQ1 1MJGA 1O95A 1CRQA 3Q9NA 3PVCA 4ZVPA 5TVGA 3T5AA 4DFDA 3GC6A 3G8DA 4UDYX 5DNUA 3JQGB 2RCYA 4IZ6A 2J0VA 3GCGA 1XYGA 4WLEA 2C7OA 2VK4A 4K1LA 3CZQA 3BFPA 3U1BA 3GR6A 4YMHA 1MG5A 2OBBA 2RFLA 3GGOA 3IA7A 1XD2A 3KEGA 4MCHA 3NDIA 3R6TA 4WLVA 4Z9FA 4ZCSA 4EHLA 1NG9A 3K9HA 4YN3A 2QQEA 4KXLA 2F3TA 1BKDR 3AX6A 3IRVA 3QKSB 5JDIA 2AOUA 1PEAA 3HKBA 1E9FA 3DFFA 1PVVA 3GJ0A 3H2HA 4UD2A 2WTXA 4ND8A 3WIDA 3X1XA 4E4YA 4EZIA 5ICGA 2IU6A 2QVXX 2NNWB 1EUDB 4BNXA 2GBFA 2HA4A 2IIQA 2BI4A 1LC0A 3JQRA 1LVHA 4EZEA 4FC7A 3T7AA 2RGDA 3JZMA 4CFYA 2QUZA 4JQYA 3TQFA 1CIPA 1E6LA 1A9RA 3UMVA 3EF1A 5ALYA 3ZWAA 2HU8A 1Z7YA 3N2ZB 3HCEA 1NPYA 1NN5A 4RV9A 2VJLA 1PX0A 1YCGA 2Q6OA 3IBFA 4PG4A 1TTHA 1SPBS 2IUFA 2IXFA 5KYYB 4L8VA 4OCZA 1FBTA 1QHSA 1OAOC 4QOSA 4EGAA 3V42A 4PNEA 5ALZA 3I37X 2BGIA 2C5GA 3HN7A 4QXRA 1UJ4A 1S9HA 1QZ3A 3P0HA 1PTJA 4BFXA 3JQEA 1GTZA 4MJLA 1KU0A 3HV2A 2QLFA 4RVOA 4KE7A 2RGNC 1AG9A 4JB2A 5LZ4A 4LDRA 1T8YA 1NZDA 2QP4A 3V8QA 2GBLA 3ETGA 4G84A 4UOEA 4EHJA 4XVUA 2IHNA 2V5UA 4XUCA 5D7NA 4EG8A 4BNHA 4NFLA 1I32A 2PMCA 1G64A 4E51A 5KNBH 16PKA 1HTBA 2A14A 4QO7A 1Z5ZA 5F2KA 3LXUX 1HLPA 2HU2A 1QHHB 2AI2A 2X6RA 4D57A 4NWIA 2BGKA 3ESBA 3LGAA 4A2PA 2GZHA 1JHRA 1I2ZA 3LS2A 1T1SA 1XDZA 3D59A 1KAOA 3N2LA 3AJRA 3OX3A 4G4JA 1VLHA 5I01A 1L5GB 3LA8A 4UM5A 3VA7A 3DXYA 2IPAB 2Q6VA 1TVKA 2HJHA 4ZT6A 2DM6A 2CK3D 3C1AA 3CTPA 3GP3A 4DJJA 4EHBA 1CLEA 1A8UA 3K8QA 2GYUA 3GJTA 3BF8A 4EJSB 3QKIA 2ATEA 1S2DA 4HAVA 4ERNA 1JIKA 1Y5LA 3AETB 3GOHA 4PS1A 1FFGA 5DTMA 1MNQA 5FOXA 4EX6A 1C0LA 4NR0A 1HDEA 1GYRA 3V4FA 3O8RA 4U7FA 4JUDX 4Y1EA 1DUVG 1H3EA 2R25B 4EH1A 3HBFA 3PUIA 2V98A 5T5QA 3UT5B 1AVTA 3UA3A 3CHYA 1YBMA 1M6YA 4KL8S 4LEIA 3C6ZA 3KKKA 3LJKA 1LA2A 2PX6A 3BJIC 1T4CB 2Y9PB 3OCVA 2CYCA 3PE3A 1RWQA 4OSEA 1KEUA 3HKCA 3ZJ5A 2ZULA 2WAOA 4OXQA 2OAEA 4NRDA 5KNDH 5L4SA 1WY7A 2KSQA 3MZ0A 3U44A 1SBIA 4IDDA 2QVGA 4UMVA 3MLBA 5D6OA 5JS1A 1RFGE 2IYWA 3GGDA 5E0KB 4FFMA 4RDHA 2ZREA 2C7RA 3E81A 1GG9A 4YNBA 4BECA 2IE8A 4QVIA 3RS4A 2FCAA 1JLLA 4GOJA 2ZRGA 2FF7A 4L02A 1TU0A 4CLRB 2EKBA 2X8WA 2ZE8A 3DEIA 3F67A 1DQSA 4HYQA 3STVA 3KB6A 2V97A 1V71A 4E5NA 3N5CA 3GZ4A 2B37A 1CRZA 3IVMA 1B6TA 4GX2A 5KAPA 4GMGA 3PFCA 4QGSA 1X7DA 1EBBA 3DZGA 1YZHA 4P54A 1X13A 2FN9A 4BO3A 5I7HA 1Y5IA 4GL2A 4IKOA 3ER6A 3GVCA 1YFJA 2WMDA 4MV8A 3OIDA 4RYDA 4IPTA 3QVTA 4TV9F 3SYRA 4HGYA 1RADA 4KIFA 3IC5A 3EZNA 2J0SA 1MIOA 1EXVA 1GRCA 3NHZA 3EBOA 3RS0A 4YYZA 3W6PA 3GRAA 1YT5A 2V7GA 1P19A 4LZPA 4RTQA 3P8ZA 4FQ5A 4REMA 4EMBA 2O8BB 5FUBA 1I4LD 4QDTA 2IUTA 2JIZA 1CZKA 1EBUA 4RSMA 3V4VB 3W8EA 4C0QC 2WJWA 4OP3A 4EGSA 1RC8A 1QIDA 2O05A 4Y6LA 2GM4A 2Y0BA 3V1YA 2W83A 2XTAA 1U02A 2IYOA 2ORED 2I8AA 4OHOA 3F9IA 2O0LA 1S3SA 4KO2S 4WK6A 4EABA 3T38A 3FCEA 1G98A 2YWGA 4LJ5A 3TL3A 4PN3A 5JNRA 1CZUA 4TZTA 1MLDA 4FXPA 4Z4FA 5JY6A 3AKCA 1TIBA 4RMIA 5F52A 1W36D 4RAQA 3DTYA 2OVBA 1UQRA 3VOBA 3WX0A 1QR2A 2PSFA 4TOIA 5DISB 1JHVA 1VPVA 4BFSA 3OE4A 3UK6A 3ZDAA 3J7AC 1LZKA 4AIRA 1ZP6A 3C7CB 3CR8A 2XF8A 1OLXB 2P40A 1XEWY 4ASUA 2BEWB 2BBTA 3AEKA 1NTOA 3Q72A 2RMKA 3TOVA 2W2KA 1OREA 2Q1TA 1H1DA 2VHQA 3DVAB 3O91A 2VPWA 4B4WA 4YMTA 2EF0A 2YOGA 2IZ6A 2C9MA 2XT9A 1ZRNA 3MQFA 3DW3X 1YKGA 1WUTA 3KDPA 4D4LA 2RHMA 3F4BA 5EQTA 2RGGA 4KK3A 1R5BA 4RS3A 5G2OA 3QOXA 5TPWA 2C2YA 3RAPR 4CLOB 3D8TA 3B51X 2AI3A 3FLAA 4PYIA 3L4KA 2XJ4A 4ZVMA 4C2BA 3DMTC 5JJIA 1DPFA 1JYEA 1M76A 4AMBA 1U7UA 3N8DA 2I4RA 1G6KA 2NQ8A 5CPBA 5FOSA 1TEZA 1OAKA 4GYYA 3W5JA 2IU0A 1DJPA 4B4DA 1EI9A 2N47A 4UBKA 5LYJA 4DPMA 2O2JA 1CY6A 1G8PA 3ID6C 3IODA 4JSTA 5DHSA 2ZBEA 4LHZA 4OXYA 3MRVA 1FCJA 3COWA 2EZTA 2WABA 3KNZA 5ALIA 3TLKA 4ZICA 3KKEA 1WXWA 5H3CA 2WRZA 4D9KA 1FYXA 2L17A 3W3ZB 4OM8A 3LK7A 1F0PA 4DRXB 4NJMA 5EIOA 1V5FA 3GPBA 2CBGA 4GUAA 4ZI5A 3RC9A 1WRBA 5JQGA 1J25A 2P5YA 1QIFA 3O0TA 4P6VF 3VZSA 3IKTA 3LKDA 1QAQA 2PN1A 1HE1C 1ABFA 1CZOA 2HK9A 4CM4A 1YS9A 4D9CA 4MVCA 4R1NA 3S27A 3PKJA 3JVEA 4G36A 1GSOA 1OJLA 2J3IA 3MD0A 4RK6A 1U90A 3O92A 4WE3A 4E3ZA 4KAXA 3WA6A 1V26A 1BXZA 4A5OA 3C3JA 3WNQA 4TKLA 4LBYA 1A3CA 1C4KA 3T3DA 4ZZIA 1FTGA 2PLAA 5D1NA 4AQ7A 4P82A 3C0KA 2HV8A 1YS6A 5AHWA 1V5WA 2SBTA 3CH4B 3WLEA 3B9PA 3TQOA 1X7WB 4IQ8A 2Z8YM 1AZLA 1Q1GA 2GRAA 2VKTA 1GZ5A 1ZK3A 5IAEA 4JS0A 3A05A 3QQ5A 5H7XA 3VKGA 5FNZA 4IV8A 2HNBA 3KHUA 2NUPB 3PE6A 2YMMA 1HDIA 3ZXYA 3BERA 4HDQB 1YOVB 4YP5A 4C4TA 3ZHCA 3ZW9A 3A1FA 3OM9A 2HDHA 4II3A 4LF9B 4H6WA 2NZ2A 2HA2A 2I55A 3QLUA 5KO2A 2O5EA 1W4CA 1DRJA 2GJKA 1PEKE 4CNBA 1QO0D 1JBKA 4U2FA 3B6JA 3Q7SA 1KFKB 3EPLA 1IE3A 2PMDA 2J5BA 2Y8EA 3CJTA 5T4HA 1AURA 2YKGA 1G20E 1IN5A 2VYVD 5J59A 3VDQA 2OHHA 1U65A 3GNLA 1DBVO 5LQJA 4C1NA 1VFPA 2ZI4A 4Q66C 1BW9B 4ALIA 4EG5A 3RPEA 1SUFA 3JQ7B 4KO1S 5IABA 1B0UA 1N33B 2HUNA 5E4TA 5BSKA 4RHXA 4RNDB 4H7HA 4DC9A 3FI0A 1FBNA 1K5DA 1LLFA 1RAAA 1ULAA 2ADFA 2HT6A 1EUYA 5HFNA 2PV0A 3KKOA 4O63O 3R2JA 4MR8A 4HQOA 5K03A 4IVPA 3K6SA 3RFTA 1VYUA 5FIUA 5B6JA 1P81A 1UT5A 2X23A 3S7ZA 1LBIA 4G8DA 4P4TA 1NJFA 5AIBA 3WLNA 1XEXB 1JZSA 5KS2A 1H42A 1YJCA 3GF4A 1H2WA 2XGOA 3G2IA 4YRAA 5BR1A 1WW3A 3G9ZA 1NXTA 1F5NA 2AC4A 3D4PA 4R9VA 1CR1A 1AT1A 3PF9A 1EGAA 4C3UA 4RHEA 3BE5A 3BRQA 4G0UA 1U6KA 1DBQA 1ZH6A 4CMJA 1E5VA 3HCBA 3PNPA 1C14A 4XLZA 4U3JA 1UZNA 2QN3A 2D0PB 2X14A 3I73A 3R3VA 4JVMA 2ODEA 3WTBA 1KI1A 3ICWA 5BNIA 4P3NA 2H8GA 5DLQC 3BULA 3RI3A 2BR3A 5IJ0B 2LBPA 2Q3HA 5T4FA 3VI4B 4J0JA 4AKIA 3L93A 1RRFA 1TMKA 4UE3S 2HSDA 4ZYTA 2FETA 4P7FA 2VDPB 1FLNA 2XKJE 4YDHB 3U4AA 4Q05A 4OUKX 5KTNA 2YCLA 1QXSA 4UARA 1CCWA 4X00A 5DCLA 3V9PA 5BSEA 4DCOA 1XHFA 2MYNA 1FP1D 4LW8A 3K2BA 1WLSA 2GBGA 2PZMA 3OCXA 1CP3A 1WM1A 2LZ0A 2WHYA 5IUKC 2H52A 3MN1A 3SDZA 2H5LA 4BFWA 2I4OA 3UOGA 1NQXA 3V32A 1IEVA 3I2KA 5IFLA 4JUAA 1MO4A 2ZR0A 2A0YA 5EHIA 3KEOA 1ZRHA 2ZS9A 3TF5A 3G0BA 1FJ2A 5K0ZA 1TM4E 3P94A 3A14A 3OJEA 1CHDA 3I0NA 4LQ4A 2Q3BA 2X0EA 3U37A 5IVHA 3LXXA 1SVKA 1QO0A 1A5SB 4LZZA 4X91A 2VDLB 3DAHA 2MSDB 4W5OA 5I9LA 3GCZA 4JBHA 5DXAA 1F4PA 1Z63A 2QTGA 4K6CA 1JIVA 5K3SA 4YJ3B 1X1TA 1DOHA 2NSHA 4IGKA 5D3MB 1T4MA 3UO8B 4UCFA 4AMVA 4Y9UA 1DS6A 1VTKA 3GEIA 3HKBB 4AMGA 5K0CA 2EFDB 3BRWD 3W5DA 1HO3A 3LBYA 1NBHA 3TVDA 4AF8A 4IF6A 4B6SA 5D5PA 3ZTTA 3JZFA 3WYAA 1NNLA 3ZE1B 5FHQA 1OZGA 3FETA 5A5DA 5JJ5A 1CUZA 2WHEA 4TKUA 3T1YB 5IARA 4N49A 3TE7A 2VH1A 4O25A 3FDXA 4IEFB 3WSTA 1ITZA 4MVJM 4IR7A 2FJ0A 2FKNA 4G5YA 3BHJA 4UVHA 1EFRD 1T0HB 2GEKA 1A2KC 3ROPA 3VU9A 2I2DA 2WSMA 4MCJA 1UMBA 2QK4A 4QD3A 3V8VA 5KYYA 4YCNA 4NLLA 3RJTA 3HXKA 4ZTBA 5U1PA 1KY5A 1NXXA 1ORWA 3ZV7A 1T9BA 1KQNA 4G09A 3BDAA 2ZR8A 4M60A 4A2CA 3S55A 2IHVA 2P30A 1QAMA 1FQWA 1DBSA 1IL0A 4GP7A 4B8ZA 2I91A 4KMSA 1PS9A 3PA8A 2HOQA 2GCOA 2YN4A 4H1TA 5ESDA 1Z4PX 1IMJA 3W2TA 2D06A 2QD1A 3VNBA 2FXIA 4GR5A 1PWYE 2O06A 3NIGB 1PS8A 4LMAA 1JT9A 3I62A 1U0JA 2CHGA 1XQ1A 2EC5A 3BRSA 3MJFA 1VLZA 4O02B 3OF3A 4JI6B 5JHHB 2NYRA 1GL9B 1EP9A 5FPTA 4EI8A 3LT4A 4XIJA 1Q91A 5FI3A 2NSYA 2VUUA 4G26A 4N82A 4CQJA 4QYIA 3PEUA 3UANA 2B8TA 5IRCD 2LCIA 2VPIA 4QXMA 3D4IA 4WSOA 5TQ2A 4L85A 4LKOA 2ERCA 4BKUA 3D6FA 4GGPA 3ZQ6A 2GK3A 1Y1LA 4C0KA 3NT5A 3O9ZA 1SXJE 4EYQA 3CRNA 1JILA 4WOPA 3FD8A 1G4HA 1KMHA 1DJOA 1UDBA 1Z13A 2A94A 2G77B 1NW8A 2QJTA 2W5UA 3R1IA 4JC5A 4PRLA 4TT3A 5EE3A 2AL7A 1N1EA 1TMGE 2Z5GA 4TWAA 3JYOA 1RI3A 2GD1O 3K0CA 4WACA 1I9GA 1EPUA 5AT1A 4I1PA 5K8TA 3LFTA 3MOSA 4AXXA 1O94C 3F96A 3JWPA 5AYVA 4URXR 1S7CA 4P0QB 3HZZA 2QZ9A 1HDOA 2F8LA 1F4VA 1SULA 2VQSA 3EA5A 1JHUA 3R77A 4IRXA 4V0OA 4G81A 3SDBA 1J56A 3GMIA 3WZMA 3R9XB 2Q45A 1WHSB 1D09A 4PYKA 4O4HB 4AJHA 2QUKA 2I6GA 1Z6ZA 2JFVA 2XCQA 4HXEB 4RA9A 4QPPA 4GOMD 3OHSX 2A84A 4RKWA 1FY2A 2OQIA 1AKEA 3CWCA 4LSMA 2GEFA 2QAIA 5EJ7A 4JKIA 1LI7A 3B13B 3D02A 4JFAA 5HWSA 2ZE5A 1G2QA 5KKCA 1BXRB 1NHGA 3CX4A 3MBKA 2QF7A 3L4BA 4G1EB 4PQEA 3UTCA 3NYQA 4LJRA 1ZCFA 3N2KA 2W71A 4PG8A 4Z53A 2H63A 1J06A 3BAZA 2HD4A 2H59A 4JD5A 1ML4A 1SUAA 1MAVA 2XE6A 1E1CB 4RK0A 3GPCA 4RL4A 3VJLA 3EH1A 1FYWA 1SHUX 1PJLA 1TEVA 3JALA 4B46A 1PRYA 1EK6A 2XRZA 2CNNA 1C8KA 1ESMA 1PN3A 1XZEA 2Q5CA 3FAKA 5JLJA 1R1DA 5ILOA 3PG5A 2HSWA 1ZD1A 1JEJA 4JKYA 5F33A 4EGFA 4IJ5A 3LVQE 4OQPA 5CDSA 1Y89A 2XGJA 1EX9A 1F2UA 1L7QA 3ET5A 1QYDA 4DQLA 3WRXC 1E3MA 3DV9A 2WSIA 1U7WA 2OCAA 2BEVB 1LDEA 2Z43A 3DBLB 1CJSA 4XVHA 4YCLA 3HLYA 3VHXB 3HBMA 1P5FA 2W98A 2ZJ3A 1SIBE 3C1TA 4KMOA 2ATIA 5I4CA 2YJGA 1WMSA 1O5IA 1FZTA 4UVEA 4ZQGA 3B2EA 2QIPA 1XKQA 4ZAVA 1UBHS 1TQ2A 3EZFA 3DE2X 4R5HA 5EGSA 5EIHA 4FKBA 3HRIA 2RBGA 3NHUA 1J0DA 3SI7A 5LSAA 4P2BA 4AY5A 3B52X 4M6WB 3LY8A 3GJYA 2KHZA 3SKVA 4D8XA 1QIEA 1J21A 3SICE 8LDHA 5FYDA 3FJOA 3PNYA 4QUGA 3PXCX 1WB4A 1PJZA 2NTEA 3ENQA 4I1RA 5LBUA 3R76A 2XD4A 1O08A 2R11A 1JX6A 5J4HA 3BXHA 1RI2A 1MORA 1H23A 4EW1A 1I2CA 1OLXA 2YXLA 3E7XA 1MQAA 4BKRA 3C14C 3CSSA 3H8SA 1GWNA 1BQEA 1FX0B 3PDUA 5BN4A 5JFOA 5LMZA 3G0HA 2MINB 4BWYA 3KDAA 3B9QA 3JWEA 2FRXA 2L82A 4F1KA 3I28A 1OLUA 2P5UA 3DEKA 1J09A 4YIKA 1PR2A 5A4KA 1Z68A 3S70A 6NULA 1UKEA 1ADCA 1CFJA 1I3OA 1YFLA 1B15A 1X77A 1RMYA 2E5LB 2FPMA 3AERB 3ZWXA 2JA1A 5F3WB 4IF4A 5J23A 5LDHA 1XTVA 3EGCA 3TPCA 3CRMA 1I1HA 3AESB 5KVAA 1LDYA 3MJDA 3W2FA 1UM9B 3VR4H 3COJA 1DRKA 4BO9A 5BW4A 4FN4A 2ZB7A 1RP1A 5BVGB 3NQ41 3G88A 2BFDA 3DJYA 4UMDA 1KYYA 5I7SA 1KO7A 3C3XA 1NBMD 3CZ5A 2OCLA 2ADOA 2QLJA 1D1SA 4CFSA 3F9CA 3SVLA 5LCXA 2SKCA 3G1UA 3FNHA 3KAPA 4I4LA 4AN4A 4TZ0A 1V8ZA 1E3EA 3JQ9C 2WSBA 2ZUBA 8MHTA 1DIOB 4FGWA 3VHQA 4EBBA 4HX2A 1ZXXA 5HKOA 3DAPA 1JHZA 1X1CA 1Z29A 2HHLA 1MH9A 2LR0A 4KUHA 5DWQA 3MWJA 3R8XA 3SD7A 3U0VA 1EFVA 1RZRA 3E5RA 3QWIA 4I14A 5C4IA 1GRNA 1PWEA 2VQDA 3G2NA 3OFKA 3TS1A 2ATXA 4PY2A 3RVBA 1NY6A 1FP7A 1T43A 5DI3B 3NEPX 3T3GA 1CJUC 1A5BB 1TF5A 3N86A 3K16A 3NRCA 5IAGA 4M83A 1G9XA 1ZPDA 4DGQA 5EKTA 3F78A 2HT1A 1UZMA 1KGDA 2P9ZA 1EVJA 4BLUA 3C2QA 1P31A 3ZK7A 1DV1A 5IAOA 3C6XA 5FNVF 3WK4A 3RRXA 5C5DA 3R20A 3G6KA 3DBVO 1L6RA 4MQLA 4JLVA 4E6PA 3MXTA 4A26A 3ES9A 1AU9A 1OOEA 4DUZB 3EPPA 3EEOA 2BCGY 4TQAA 4P8RA 1W4AA 3QBTA 4KQ1A 4UEKA 1SC1A 5DGXA 5ICCA 4LKRA 3RVPA 1JWLA 2OGSA 2V74B 1E62A 1MHPA 1VZ2A 2Z4TA 4B17A 5IP5A 4GX5A 4PLCA 4MQMA 4B6RA 1U4NA 1Y3AA 4ZAXA 1XJWA 5K3EA 4AQDA 2DULA 1JG1A 3EF3A 3KAQA 2N3ZA 5JALA 1IJBA 1C1XB 1JQJC 2VTKA 4DREA 5FI1B 4Z51A 3R0ZA 1PT5A 4OO3A 1KORA 1L7VC 1NASA 3TB6A 4KTVE 2F1OA 1L7BA 1IZ9A 4M0CA 3AY0A 5G1OA 2ZVPX 3U7RA 3MCTA 1AK9A 3BE6A 4NYJQ 2UUCB 2IW1A 4LZWA 1A95A 1PLKA 3KVNA 4ARVA 5KJCA 3TECE 2W2TA 4S1WA 3RLIA 3L40A 4GKAA 4F5WA 1XA3A 2CYAA 1EUDA 3SVTA 3KP1A 3INTA 3PRKE 4MUJA 1Q7RA 1L5SA 3Q0TA 2BEUA 4YS6A 3NNSA 5AR1A 2B35A 3EIQA 5BRAA 2UXCB 5ALGA 1GHTA 3HTXA 4IEEA 2RGBA 4WUTA 4CMHA 1DT3A 1T5OA 3R75A 1FYFA 4JBXA 3ZDRA 1JKXA 4R0VA 3OESA 1E9EA 4ZQHA 5CLJA 3LKBA 4IFTA 4PZEA 4ZMSA 5K0TA 4A3SA 5F2NA 1Q2UA 4BO0A 3K9LA 1TM2A 3HB1A 1MABA 4PYRA 2BC9A 1DIGA 1Y8CA 3LO8A 3Q98A 3R0XA 4D0NA 4CTMA 3GFRA 2BGNA 3OETA 4L4UA 5SZJA 2ZPAA 3G6WA 2GYVA 2AJDA 1XZCA 4CM9A 4TN5A 3ZZ0A 2BI7A 1QFYA 1JR3A 1VIYA 2XDQB 3M82A 5BSHA 2GCEA 3FZQA 5GM2A 2XGSA 4JH0A 1XNQB 1DCTA 5CJJA 3QHQA 3SJ7A 4W6QA 1EFPA 4C4ZA 1WNTA 5F5LA 1B73A 2W70A 4IIEA 1DXYA 4G0QA 2XVYA 3RC7A 4DCJA 2CCKA 1GGNA 3ZY6A 2QN6A 1PJ2A 1YSCA 4AG5A 4MDFA 4QXQA 4YJ2A 1GTVA 2ZAYA 2AHOA 4R8SA 1PZHA 4D9HA 5K5EA 2W42A 1GNRA 1L3BA 3JQAB 3O73A 3QLVC 4ECEA 1B1CA 5HGJA 1QV7A 2CLSA 2P8JA 2J3LA 3T0GA 3C4QA 2AQKA 2Q8NA 5BSTA 2JKVA 1LPAB 1ZKMA 1JP7A 1HY3A 2YWRA 2P9TA 3IHWA 3X1JA 4EG6A 2B5OA 1KETA 2QUJA 1IB0A 3SSOA 2DBYA 3UAVA 2Z04A 1F3OA 2F9MA 3PJRA 4H77A 2H18A 2X7JA 2WEKA 2YN2A 3UYKA 1XZ8A 4FMDF 1PR5A 4RF5A 4Y9RA 3P2OA 3GV0A 3PD1A 5GVSA 2TSYB 1GUYA 2BJVA 3C3AA 2XSZD 2KQUA 1TCUA 2G9UA 4FR2A 4KI0A 1M34B 4KRXA 2YWFA 1Q11A 1TYBE 3NOVA 3EQ8A 2H2FA 4INJA 2R7NA 3H8JA 4Z0PA 4L9SA 4AKTA 4B6PA 4DR4B 1MQ9A 3KJHA 1DAHA 1XXHA 4RTJA 5F9FA 2VDWB 2UU9B 4V0NA 4LY9A 1KDYA 2A9FA 2NQ2C 1Y9EA 4ICIA 1K6IA 3F3MA 3UC5A 2VSOA 3NHMA 4G8CA 3PD0A 1TFRA 2J0UB 4H16A 5FLYA 4FOSA 3GLHE 2PS9A 4GT1A 5DWVA 5BURA 2DERA 2HQBA 4WKCA 1TD9A 1CY0A 1DC6A 5AVWA 2XWJI 5HSGA 1A7AA 5DBIA 2LUOA 4XYEA 3BSWA 4JBIA 4CI9A 2R8XA 4FX5A 2H65A 4HQFA 4I9GA 2VRWA 3HDVA 2FEKA 2JI9A 1OZHA 3CUYA 3ROEA 3ZHBA 5B12A 4YJFB 5ARCA 2YC4C 2IX9A 1G20B 2VF4X 4B75A 1OA1A 4YWHA 4EM6A 2ANCA 4OV6B 2ADMA 5EHNA 5HFJA 2B94A 3G17A 3TBFA 3P9RA 4EY6A 1O96A 1P1JA 1ZMTA 4H7EA 1D4FA 4BQEA 2O9JA 4AJIA 1E4EA 4ABYA 5JY1A 1JKJB 1XWFA 4CIWA 2O4CA 2NV6A 2J46A 2OD9A 4UM9D 2BI8A 5IJAA 7YASA 3HK2A 3KWFA 3GPDG 2BAGA 1XEAA 3TFWA 4RM3A 2HLHA 3C6BA 5ALEA 4B73A 2BL4A 3FXAA 4KYVA 1FW8A 3VH1A 4IAOA 4AN0A 3IIKA 1I4TD 5FWAA 2OWEA 2F9LA 3VDNB 4ZCIA 1W1UA 1P77A 2BFBA 1NXVA 1PQWA 2ZVQX 2NQTA 3QU5A 5I7AA 3PNBA 1P39A 2PO7A 2ZITA 1FTSA 4YO8A 2G5CA 5K51A 5DV9A 4BUCA 3WNCA 1L2TA 3WMFA 1RYMA 4LF5B 2RI6A 4AJ9A 1F8YA 4OB7A 1SXJC 4ZJUA 3VPBA 2HPAA 5EUQB 3GYGA 2GBPA 2JS7A 4E6EA 4ESEA 1UBSB 2QG6A 5BYAA 5IK2D 1EK1A 2FFBA 3HZOA 5K3FA 1QC5A 2IZ5A 5E4FA 1U1CA 4AY2A 1KOJA 2BR5A 2XUQA 1BE8A 1I4WA 2QYOA 4EW3A 2BFPA 1KK1A 3HNOA 4RZQA 3ZVMA 1ZRMA 4UUOA 2JGJA 3EVAA 2X9GA 3P97A 3V4ZA 4DBLE 2V9CA 4U6SA 5DASA 2YTZA 3QI2A 4GYJA 4JN6B 4DLNA 4ZI7A 3IB3A 3ZHRA 4GLLA 2JIMA 6PFKA 3CN7A 3DS8A 2YMQA 4MDYA 3OTOB 1L4GA 3PEWA 1G16A 3BQNB 3LQ1A 1PJRA 2X0RA 3H5IA 4LPSA 4QUDA 5IAAA 2ZUVA 1CS0B 2OAGA 2UZ3A 2XLCA 4ZV7A 3UJ6A 4CLOA 2JJ1D 4HUJA 3IDOA 1M2KA 4INZA 5HP4A 1N8KA 3AF3A 1O6BA 1BDJA 2XLBA 5CA0B 3CF4A 2O0KA 5LP1A 4FD2A 1L7AA 1G6Q1 4BNDA 5H8WA 1ZAYA 5CBPA 3SIRA 4ZHSA 3S2SA 5ADUS 4Y6RA 2NP6A 5BRNA 1M74A 3RHFA 2AFHB 1A5TA 2REOA 3JQ8A 1NVEA 1DWQA 3MCZA 3TD6A 5BV7A 2COKA 1PGOA 4LXYA 1A69A 4YMIA 3EMDA 3SS9X 3BFXA 4ER7A 2D4HA 3EJWA 5GVRA 1FP6A 3WIOA 2YFKA 3QFHA 4RSHA 3VC2A 3EVZA 2GN1A 4FHFA 4YRKA 4AULA 1PBTA 3V3KA 4UHHA 3NVKI 3RVJA 3TAUA 4I3FA 5CB4F 3BD8A 4L57A 4MKRA 5CURA 2IY7A 3KZXA 4DCTA 1TLLA 8ATCA 3N9IA 3JWHA 3G2JA 3U3RA 3VR0A 1W9HA 1IHUA 5EJ8A 3PRYA 1SHJA 1FNDA 1UAGA 4U2EA 3SEQA 5AM3A 3ZZTA 3OIYA 5AW7A 4FDVA 2IOFK 4RGVA 3T61A 2UUAB 1R4ZA 2DY0A 4MV5A 5EKDA 3UKOA 2PX3A 4NU8X 4PBTA 2Z3VA 4R2WA 4PO8A 3T94A 1PJ8A 2GZRA 3O1JC 4XSHA 5TGZA 4BU1A 4XTCS 1KAHA 1OFTA 3EH2A 3EZGA 3AI7A 3HL0A 4ZGGA 3KT6A 3DP7A 4IGAA 1OHHD 3TUIC 1TUGA 4J1TC 4X63A 4WRRA 1M6WA 1POXA 2ABWA 4A16A 5A4JA 5KWVA 2B4RO 3D1VA 3OEED 2EKPA 4J6FA 3EDOA 4YECA 2O3TA 3USCS 2PGOA 5EWJA 2OFFA 3GFGA 1PJBA 1QP8A 2VDVE 1ZJ6A 3F2VA 1B00A 4X45A 4HDNB 5JI2E 1IWPB 2QROA 2PQ0A 4UJ5A 5F77A 2V6IA 4Q21A 1KJ8A 2CVQA 3VAAA 1BVRA 1HURA 1EAYA 3GEPA 2V5AA 1BAPA 3GFPA 4Q3KA 1XIVA 3ZHVA 4ZU3A 2ZJFA 1BGWA 1D9ZA 5FEMA 3L1VA 4PO3X 5F73A 3W3AH 4ZVUA 1MQSA 3MQ4A 3IR7A 4O2AB 4J1TA 4XGRA 3L7YA 4NYMR 5EZQA 5ALFA 2WQ7A 4O8CA 4WXRA 4L28A 4TRJA 1K92A 2X42A 1TM3E 4JJ6A 4MGHA 1RU3A 4B8YA 1I6KA 2P2GA 3HB7A 2IVZA 1T6BY 1R0LA 3RG8A 2O52A 3AGQA 4I99A 3Q3HA 2YUTA 5ALNA 4ARAA 5BW5A 5AUOB 5GADl 2AEFA 1FSPA 1EWVA 4OQEA 4MUYA 5K0FA 1Z0AA 3LFHA 3S8YA 1I4EB 3IV9