3X2SA

Crystal structure of pyrene-conjugated adenylate kinase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDCGKLVTDELVIALVKERIAQEDSRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLCEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Excimer Emission Properties on Pyrene-Labeled Protein Surface: Correlation between Emission Spectra, Ring Stacking Modes, and Flexibilities of Pyrene Probes.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr. mds42
molecule tags Transferase
total genus 73
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x2sA00
2O8FB 3GEIA 4C0KA 2F9LA 2B21A 4PC7A 1G21E 1N2CE 1X86B 1XCGB 4YLGA 4H9GA 3WXMA 1N6KA 2CVFA 2OCYC 8OHMA 2G1JA 4XH9B 1KY2A 3UXMA 3GFOA 3N5CA 4JBYA 1XEWX 3ZDQA 4BRUA 1AQYA 2C95A 4L4UA 1NRJB 3L8ZA 1S96A 4P4UA 5A5GA 1ODFA 1RPZA 3AQ4A 4LK2A 1G5PA 2IWRA 4LV5B 1DEKA 2PEZA 4DRZA 3QQ5A 1E2DA 4QHSA 4PO1A 2RKOA 2F55A 6Q21A 3CR8A 1Z0AA 2A5YB 1Q22A 2O52A 1E9BA 1LV7A 3SYKA 1DO0A 4MITA 3S1AA 1EX6A 2EFEB 3CNOA 1CR2A 3OIUA 1EK0A 1X8JA 1W5SA 2QN6A 4N0DA 4JVMA 1F2UB 2P2LA 1VCNA 4D26A 1E2JA 1K8RA 5DIFA 1PLLA 4A2QA 2ZJ8A 3GJ8A 3W6PA 4NCIA 3CRW1 3B1VA 1Q57A 2CLCX 2YC4C 1ZM3A 2ZSFA 2QBYB 1TL7C 2H16A 2QE7A 5AJZA 1Z8FA 2QE7D 3KFVA 4M8NE 1KJYA 4TL9A 2Q9AA 1G7CA 4DIEA 1XPRA 3MFYA 3Q3JB 1P9WA 2PH1A 4WZ6A 2ZRNA 4LHYA 2J3EA 1XD2A 4RFSA 4QFMA 2ZJOA 4I4LA 2ZQ5A 1IXRC 1KSGA 4HUQB 1OFIA 1CRQA 3LDAA 1KDPA 3QKRB 1ZIOA 1NVUQ 1ZRHA 1IY2A 3TQCA 2GEUA 5KPJA 1YZNA 2ZE8A 3NC1C 1GFIA 2R6GA 3NXSA 2ZIAA 3Q9LA 4P0TA 3VHXA 4CDGA 2DWPA 2VBCA 2QY9A 3AV0B 3GEEA 4LV8B 1MH1A 2YV5A 3B9QA 2REBA 4QM6A 1E2QA 2CVHA 1MABB 4C2UA 2GILA 3VKWA 3OZXA 1NJFA 1KI7A 3AH8A 1NL3A 5LBIA 3IO3A 3O47A 5IK2A 3U7FB 5A0FA 5IK2D 2BCGY 1SHKA 4XVRA 3AUXA 3W6OA 3I5XA 2C03A 421PA 4RJLA 3ND8A 4KSCA 3BWDD 4B44A 1F2TA 3SHFA 4URVR 1MOZA 1M2OB 4OYHA 1RW4A 4JSYA 2CBZA 4EFNA 1R7RA 3U2QA 2KB0A 1EWRA 2ZRFA 2ZRKA 3A1VA 1UKEA 2OT3B 3SBEA 5TXGA 3B82A 2ZRDA 721PA 5JBQA 1W2HA 1CS4C 1T3HA 5H1YA 4BFTA 4NE2A 3K0SA 1F60A 4XWKA 1G291 3QE0A 3F0TA 1UAAA 3QENA 2DFLA 1TX4B 5KNDA 5DN6A 5DN6D 1YE8A 4N0EA 2CHGA 4M1YA 1X3SA 4EPRA 1FX0A 2EFCB 4Q1BA 3E5HA 4NYMQ 2JLWA 2ATXA 5BYKA 4URUR 4U7DA 1NVVQ 2WKPA 2WWIA 3K9GA 3NTUA 3EIHA 1UBGA 2PLRA 4PC3A 5EE0A 1MT0A 2YZ2A 5AJXA 2J41A 3THOA 4TL8A 5DNYB 2GXUA 5G41A 3T12A 1KO1A 1EWQA 4PAMA 4F4JA 2OAQ1 3W5IA 3QF4B 1U90A 1W48A 1E2IA 3UMSA 3HU1A 1G8PA 3MD0A 2BKEA 4NYJQ 1KKLA 2OSBA 4F4IA 1CF4A 4DB2A 4PHHA 1A1VA 3RC8A 3JVVA 2JIZA 3L8YA 4I1UA 3WRYC 2RGCA 5TMPA 2JIZD 4ZI3A 1N5LA 2VP2A 2JDIA 2BDTA 2VTKA 1CR1A 1WQ1R 4R9UC 4BFWA 1NF3A 2WHXA 3LW8A 2XGJA 3W8RA 2BMDA 3T1VA 1FNNA 3FMOB 3LBHA 3PUWA 3X2SA 2BEKA 4G5SA 1KYIA 1DTSA 5G40A 4TYWA 1PV4A 3KZ1E 2IF0A 4TMTA 1W5TA 4D80A 3T34A 3DEFA 3C14C 1DAIA 1TQ2A 1XRJA 4HB3A 3EIQA 3S1AB 2QP9X 5HE8A 5HCIA 2O8CA 4ZDWA 3T15A 4DLWA 3B78A 2B7BA 4TLEA 4UJ5A 2V6IA 1ZUHA 2NO7A 1E3MA 1N0WA 5FUVA 3QXXA 1KO8A 1JALA 3MWLA 4JL8A 3LX5A 2IEYA 2ZI4A 2KJQA 3LAWA 5LD2C 2BBTA 1ZVQA 1AS0A 1J90A 1AGRA 1E9RA 1G20E 2JGNA 3GQBA 2PMKA 2SHKA 3P1JA 2YINC 2H57A 4C0SA 3MWJA 1UKVY 3GLIB 1NBME 1G8HA 4PQFA 5KU1A 3TUIC 1SQ5A 5FR2A 3UATA 5JMTA 2A5JA 2GBLA 4AKEA 4Q47A 3ZZ0A 2G0TA 1S3GA 3A1WA 1PLKA 2O0HA 2HV8A 3HPRA 3NBXX 1RJ9A 4M1MA 1DAHA 1SZPA 3PFIA 5KPDA 2ZVPX 4H1VA 5E95A 2WZQA 4A0HA 3G5UA 3UMRA 2YKGA 2VP6A 3I1FA 5J47A 3GLGB 1RYFA 2BC9A 2QI9C 4NU0A 4FWIB 4B73A 3IIMA 3CW2A 4PO9A 1NLZA 1E79D 2ODNA 1D5CA 1Z83A 2IYVA 3EC2A 5JHGB 2V54A 3PEUA 4BE7B 1NY5A 4JLJA 5L3SA 2AFHE 2BWJA 4Y0VA 3PIRA 1WA5A 2P6NA 3KXKA 2HJGA 1ZUNB 3R9XA 1T5IA 4RD6A 4GFDA 4US1R 3IBYA 4AKGA 4IFEA 1R0WA 2CCKA 3BOSA 3LXXA 4HSEA 4IEEA 2BOVA 4LBYA 1SVSA 3IHWA 3SJZA 2GEDA 1COWD 2GRJA 4WAUA 2R65A 5BQ5A 1TF7A 4U02A 3ZVNA 4Z8XA 2MSCB 1PZNA 4Q66C 3SYLA 3TAHA 2NMVA 4ZCIA 4LC0A 5FPYA 3WHKA 3QVUA 1E99A 1KMHB 5JJKA 1U9IC 3QSYA 1XXHA 5AUNB 3AVTA 4Z54A 5DYGA 1QHNA 1OH8A 4DCTA 1NN3A 3L0IB 2QG6A 4AWXA 1KHTA 3UWKA 4MH0R 2ZAMA 4JVNA 2FSFA 5C18A 1LF0A 4PHTA 2OHFA 1JPNA 4GMDA 3TH5A 2OESA 5TARA 1II8A 2PL3A 2WICA 4WZBE 4IDQA 4LOAA 3X1XA 3GLIE 2FOLA 1G17A 1KIMA 4S35A 3DMNA 3GLFB 4QBFA 2ZANA 3M4YA 2ZU6A 4KLNA 3CZPA 3T5GA 5J4HA 2LKCA 1H65A 3EARA 2D74A 2QA5A 3KKMA 5LB4A 3U5ZB 1QG2A 1N25A 2GF9A 2JJ8A 1T0JB 3FPAA 3QG1A 4WZAE 3U3JA 2N1BA 2AXPA 4DJTA 1EFCA 3B5JA 1LS1A 2VSXA 3REFA 1E69A 4FD2A 1R0XA 2ANBA 2ZPTX 3U3OA 1U0LA 2FJUA 2C98A 4ASUA 4B74A 3NG1A 5FBWB 4ASUD 4XVUA 4OI2A 3GLGE 2O8DB 3K0CA 4YONB 4EFMA 3ICQB 3OFNA 1HV8A 1P5ZB 3TK1A 1XD9A 1QHYA 2ZJ2A 5BW8A 4OKSA 2FSHA 3BB1A 1G7RA 2GF0A 5IDVA 1MO4A 3WRXC 4OI0A 3D7MA 3X1WA 1VIAA 1E2LA 4E22A 4GP6A 4TTQA 4CIDA 1Z22A 2HDNB 1NVWQ 3MGCA 4Q48A 4WA7A 2YWHA 2NO6A 3U3RA 4EPTA 4OHXA 1Y3AA 2VHTA 5JJIA 2EW1A 4RZ3A 4P31A 4TMKA 3NHBA 1M7BA 4AG5A 4D4JA 4Q4LA 3VKGA 4L16A 4AKHA 1KDOA 1KK1A 3PJRA 3IGFA 3K9LA 4ZDKA 3FYHA 3U60B 2YWEA 2NPFA 4Q03A 2RGNA 5JI3E 4D25A 4NZYA 2F3TA 2XSZD 3WYGA 3ICEA 4B47A 2W2VA 3GFPA 4PXAA 3BE4A 4PAOA 5DLQC 5HTKA 1JJVA 1NG1A 4U00A 1H8EA 1CJUC 1G9XA 3OIVA 4A0FA 4M9ZA 1H8ED 4LY6A 4TT3D 4XWOA 2X2EA 2CE7A 3BFXA 4C2TA 1ZCAA 3V4FA 4BEBA 4LHXA 2JLQA 3BFKA 3HP1A 4JVSB 3GLFE 3CPHA 3A4NA 2IYSA 4Q02A 1JAHA 3QEJA 2BMJA 1LY1A 1YR7A 2WIBA 3CRVA 2ZRCA 3DDCA 4D4LA 2YJTD 1Z3IX 5JCPA 5G3YA 2O5VA 1P62B 1T4GA 2GXQA 3GJ4A 4MKFA 3VX4A 4D4MA 2ZE5A 3LH5A 2P6UA 3FKSD 4B6FA 3KQHA 1Z0IA 3P26A 5C1BA 1DE0A 2XXAB 1OE0A 3V00A 2VL7A 5IRCD 1BOFA 1US8B 4PPNA 3TE6A 4CVNA 5JEDA 4HAVA 5KUTA 2JAQA 1G6HA 4E03A 2KWIA 1DPFA 1XCMA 4HZUB 4NYIQ 1GITA 2VLIA 3IHLA 2Q21A 4MYHA 1Q44A 2MSDB 3C5CA 3F5FA 3ZJYA 1G8FA 3K9NA 2VHCA 1UEIA 3C5HA 4K81B 2L0XA 5JFGA 3N70A 1VPLA 3GJ5A 3LRPA 4Q4AB 4PZLA 1KO4A 1XTJA 3B8HA 4WIAA 1EFRA 1S2MA 1UDXA 4ZIRA 2IF2A 2WAYA 4FCVA 2Z0MA 4BRWA 2AKAB 4QHTA 1T3LA 2KBFA 2Z5FA 2PZGA 3ZZTA 4URYR 2NGRA 2FFHA 5HPYB 4J0QA 1FNMA 5J40A 5AUQA 2H17A 2I1VB 1XD8A 1JB1A 3EZFA 5AUOB 2J0QA 2LWIA 1IONA 1JR3A 4HUTA 2F9MA 3Q5DA 4EJSA 1JR3D 1AKYA 3SHWA 3FTQA 1FFHA 1H8HA 5C2JB 4PQYA 1H8HD 1XBTA 2DYKA 3K0AB 1GWNA 3HU2A 4TQUS 1W1WA 1W4RA 4LJ8A 1QF9A 4QJ4A 1W49A 1WF3A 4EPYA 4WXRA 1VHTA 3GCGA 1Z6TA 3DL0A 1E2HA 1GRRA 2QZ4A 3IPYA 1W0KA 2YHSA 2WMNB 1W0KD 1VCOA 1NVVR 1F3OA 4MA4A 4Q7JB 4TMZA 4A8JA 3GLHB 2ZSAA 1ELOA 1N6NA 1G8YA 1GVNB 2VYFA 2WOOA 3QBTA 1KTVA 1D6JA 2QEQA 3IQWA 2CCJA 4Q7LA 3BXZA 4FINA 4NL4H 1ZM4A 1LB1B 4XOIA 5CYPA 2GAAA 2ZVQX 4TTPA 1ZM7A 1MR3F 4ARZB 4KV9A 2G77B 4NYJR 2IUUA 1DS6A 1EXMA 4QHYA 4EFLA 3ZYCA 5DI3B 1JECA 2FFBA 4G5OA 4OQFA 4P4SB 4A2PA 5L3RA 4DEYA 3FDIA 4HDOB 3IIJA 3PVSA 3CWZA 3L0PA 2FA9A 3PENA 4NCJA 1V43A 5E4FA 3CF6R 1EFUA 2IC5A 4DSOA 1VG0B 1IQPA 1R5OA 3ADBA 1HEIA 3THXB 4JT2A 5FPSA 1GUAA 4QBHA 3QG5A 4ZO4A 1LF5A 1SVMA 1L2TA 5HKKA 3E1SA 1QHXA 2QPAA 1I2MA 2OLJA 5FL7A 221PA 3OE7A 4BECA 5FL7D 3A8TA 2ZR0A 5DHFA 2QL6A 1XZPA 3AP1A 4PHFA 2YOHA 1WCV1 4X8MA 1KAGA 2JJ1A 2ZRIA 1KGDA 2DR3A 1N6HA 1P3JA 2FWRA 4DSUA 3LWNA 5GJCA 2EFDB 1FMLA 2FN4A 1E32A 1NIPA 5FOTA 1QBKC 2QORA 4Q1CA 1JR6A 3FWYA 1KAOA 1KO7A 2RHDA 1WXQA 1KMQA 3CRMA 2LCFA 4FMCF 3X1DA 1QHHB 3SS8A 1JEDA 4DLXA 4KU4A 2VQSA 1OSNA 3C8UA 3KKQA 2JEOA 1ONBA 5BYJA 4DUGA 3GLHE 3AVYA 4WXPA 4KFSA 1DAGA 4DUGD 5HR5A 1N6LA 4DCSA 3VU9A 4DDUA 4V02A 2JCSA 1NN5A 4OQNA 1Q3TA 1YR9A 3NH6A 3KUCA 5CB8A 3TUZC 2QP4A 2AD1A 2F6RA 2VF8A 3A1TA 3NH9A 2CJWA 4I1OA 2PX0A 5FTMA 2QENA 3Q5EA 2QSYA 1JPJA 4Q1EA 1UBFA 1HE1C 2DWQA 4OBEA 3LVQE 2WSSA 2CEAA 1KI4A 2WSSD 3MWKA 4LJ6A 4DLSA 1KK2A 3RDPA 2HF9A 1V5WA 2GVDC 4QJ3A 3BGWA 4UJ3A 2OCAA 4HDQB 1VYVA 3SR0A 1G7SA 3NEJA 3GMTA 2QPTA 1VMAA 2QRZA 1XZQA 2J5XA 1NI3A 2UKDA 3C41J 3QNUA 1ESMA 4FMCB 3VQTA 4B34A 5IF9A 1W36B 3R9WA 4JKYA 1S1MA 3SOPA 4Q19A 3SE0A 1S0UA 1GP2A 2IT1A 1YR8A 1AM4D 2IUTA 5D3MA 1GL7A 3AVQA 1UFQA 2YOFA 1FMJA 1E0KA 2AR7A 5DH9A 3I72A 4PR0A 3C16C 1HTWA 5EP4A 4BLQA 4YMVA 5IHPA 3RYTC 1YZUA 4K8OA 1AKEA 1U8AA 4V0ME 2HJVA 4DCNA 1R4AA 1UBCA 4ABYA 5K8UA 3HU3A 3KTAB 3K70D 5CDFA 4AC9A 3ZGXA 3MJHA 4A8JB 1FZQA 1HQCA 1ZINA 2XJ4A 5JEEA 1N5IA 4A6XA 2OM2A 2QTFA 4TMXA 3AGQA 2G9NA 1II0A 3HJNA 3T5DA 4JKIA 1W4BA 4CZ2A 3W3AA 2WWXA 1OH6A 1P2UA 1TF2A 4O2RA 4L8GA 4HB4A 4WW0A 2X8AA 3KJEA 5FL3A 4PC1A 1U99A 3WY9A 4LCBA 2ZJAA 2CL6X 2JLVA 2PBRA 5JJLA 1GDDA 5JECA 3B6EA 3LA6A 3HWSA 4LWZA 1OF1A 2YNMA 4ACBA 3FHTA 4AK9A 3EPLA 4X8OA 4FN5A 4HB2A 5JI2E 1SVLA 2QRNA 1LFDB 1KK0A 4IDPA 4GT1A 1JI0A 4MKHA 1OV4A 4PTLA 2QAGB 2MSEB 1NVXQ 1OYYA 2OE2A 1DO2A 5B57C 2F43B 4CEIB 2MMCA 4ZCMA 4M1WA 4BLRA 3GJ6A 1HUQA 1TAGA 4DHEA 2PLFA 4LYAA 3U4QB 4MRRA 4KVAA 1RKBA 2A7QA 2HT1A 2JA1A 2R62A 2J0VA 2IYYA 2ZEJA 4Q1AA 1E94E 2XB4A 2WJJA 4HAWA 4C0HA 3O8CA 4TLDA 3U61B 2Z4RA 1GL9B 1G16A 4LJ9A 2DWOA 1HYQA 1A5TA 1VECA 2XX3A 3FHCB 5GADl 1EG7A 1P7CA 2XZOA 1Y63A 3BAFA 3RLFA 1ZMXA 3VX3A 3I73A 1TQDA 4YXWA 2O8EA 2A5DA 4B48A 3WMFA 2VHJA 4LSGA 4YXWD 1N5KA 3T35A 3QXHA 2ZRAA 3DO6A 3KJIA 4B2IA 1QG4A 3BB4A 3NBZC 4IXMA 1P2VA 3U7EB 4Z1MD 1DADA 1WBBA 4QJ5A 1CULC 3A1SA 1B0UA 2GETA 3L82B 5EUQB 2ZYWX 3VU9B 5JWHA 4V03A 2ZE7A 4FWTA 4LJAA 4DC9A 5EXPA 1P6XA 3TSWA 5L8VA 4URZR 1O3YA 2CJWB 3VMFA 2LKDA 3RAPR 4LJ7A 4M1KA 1YRBA 4UXHA 4B43A 4EQ6A 1QVRA 3UANA 5J4YA 3Q7PA 1XU4A 2HT6A 3CO5A 3PR1A 2V7QD 3CX8A 4FIDA 4PX9A 1AS2A 2DY1A 2CNWA 2WOJA 2FSGA 4JLBA 3M1IA 5AUPB 5KSPA 1KI3A 1XDBA 2CNWD 3D8BA 1KNQA 4XVQA 3A4LA 4NYIR 4PZYA 1HY3A 2RCNA 2VRWA 1E9FA 2ZUBA 2R6FA 2BBOA 3KKPA 5EE3A 1EFTA 1SVKA 2NTYC 1VYUA 4Z8YA 1IN4A 3KL4A 3K70C 3KFXA 5F3WB 1Z6AA 1QHGA 4DDTA 3PUYA 4ESVA 1ZIPA 2EWVA 2DB3A 2D7DA 4RD4A 2C9YA 2QGNA 2GK6A 2A78A 4M9XA 5EUMA 4RVCA 1NLYA 2AXNA 5CM9C 1SXJB 1DG1G 3RS0A 4Q9JA 2EU8A 2FX3A 4M9SA 1E2FA 2RGDA 2ZROA 1FQJA 4FXPA 5B30A 3WNBA 5ANRB 1S3SA 4LYFA 1N6PA 1WRBA 3ZLJA 1C4OA 2PJZA 3UG7A 1SKYB 1TQ6A 5F98A 4L9SA 2GZHA 1E0JA 5H70A 2JLSA 1GKUB 2OFXA 2FEOA 1W2GA 1E2PA 1JAIA 1F48A 4NH0A 2JLRA 2HXSA 1U9IA 4NMMA 2GWHA 3R20A 4HAZA 3QKSA 3QI2A 1MO5A 2J7PD 3I4LA 5E7MA 2DFTA 2PT7A 1ZC3A 2UZIR 1G18A 2EYQA 3PUZA 3MWYW 3OF5A 4CYMA 4G5GA 4YQFA 3A6PC 5FH9A 4OHYA 1NKSA 2IYLD 821PA 4ZKDA 5FTJA 4DBLC 1KK3A 621PA 3CPJB 2PT5A 2WWYA 2JLZA 1CJKC 2P0EA 3CH5A 2PEYA 4DXAA 5H8WA 1HQYE 4YMUA 3IKJA 1XCPA 2FF7A 3SYNA 1G8GA 2WM9B 4ZV4A 3WYFA 1G7TA 5DI9A 3QPVA 2RGGA 2BIFA 2H7VA 5HE9A 1N5JA 3CH4B 2GKSA 1U81A 2VP5A 5EXSA 2GA8A 1E9CA 3PUXA 2ZRJA 3HR8A 2PX3A 3B7GA 4KJZA 1GIAA 3K09C 3ND9A 5EXXA 2XZLA 4P4TA 5GJBA 5IT5A 4KLZA 3BC1A 2IYWA 5SZIA 1T6NA 4YC7A 2AFIE 3C4JA 1ZUIA 2ZREA 3TIFA 2V8OA 4DSNA 1VCMA 5JS7A 5L3QA 2HYIC 3NKVA 4JL5A 3D3QA 1ZCBA 3AVUA 1GNQA 1DG3A 5K8IA 1SXJE 4BFXA 1KJWA 2H92A 4MKIA 1KI6A 2Q0HA 3MLEA 4IOMA 2IYXA 3SFZA 5KSOA 1ZD9A 1ZNWA 4I1SA 1XD2B 4RFSB 4V0LA 1SKYE 5CDFE 2YOGA 4A15A 3ZVLA 1Z5ZA 3RRYA 1ZJ6A 5LD2B 4GOKA 3A1UA 3DZ8A 1TQ4A 4KAXA 1Z6YA 3VR1A 4MYCA 2ZJ5A 1P75A 2IYUA 4F91B 1FP6A 1CU1A 4MRSA 2NO1A 1Z0JA 2NQ2C 4JLVA 4OJKA 4RD0A 3TJZA 1RFLA 5BN3A 1YVDA 4PO8A 3PQCA 4N3NA 5CJ2A 4EQ6B 4XTRA 3M0EA 3CPEA 3THWA 3MSXA 3RSLA 1QHIA 2OO7A 1OFHA 4OK3A 1E79A 4MUBA 5C4MA 4QGGA 3P4XA 4TL6A 3SDZA 1TEVA 4QBIA 2ONKA 1X8KA 4HLCA 2B8WA 4C4PA 3B1ZA 3QBVA 4GPTA 1NLFA 5FOVA 4US2R 1PUIA 1F2TB 2BM1A 3ZS9A 1NMYA 1QDEA 1COWA 3WP0A 3KX2A 3GFTA 1VG9B 3TKLA 4G0NA 3I3SR 2J7KA 1GRQA 1ZD8A 4N1AA 4BLPA 1IN7A 1XPUA 1NJGA 3V4RA 1QRAA 1GZSA 2WAXA 3OIYA 2OFOA 1AZSC 3FGNA 5LDDC 1E6CA 4NDZA 3OIWA 1TUEA 3H0KA 1EX7A 2JLUA 3EPKA 4UNPA 2CCGA 3VTKA 1K5DA 4KFRA 1Z47A 2CK3D 1NN0A 2OBMA 2H5EA 4F93B 1W46A 2WV9A 3AKCA 1DARA 3U44A 2Q3FA 3J81k 2C78A 2EVWX 1UJ2A 3KQKA 1FX0B 3VKHA 2FU5C 2WJYA 2EFHB 4RSGA 4GNKA 4JLAA 4BFUA 5JRJA 3Q72A 4ILEA 5JSZA 1JBKA 3NEYA 3R7WA 3QKSB 4YDHB 4POAA 2V4ZA 2RGAA 1G19A 2W6ID 3SQXA 2ZYTX 1Z63A 2ZSEA 4MGIR 4MGYR 2PCLA 4W5JA 5EP2A 3GJ7A 5DO9A 3IEUA 4QXAA 4EPWA 2WSMA 3U7HB 3CX7A 4B33A 1OXTA 1HURA 4TQAA 3TNFA 4ZDIA 2KSQA 2UVQA 3A4MA 3O8DA 3AF4A 3ZVMA 4Q4JA 2C8VA 2XTNA 1GG2A 3H1TA 4PSAA 5GJWC 3PUVA 1RRPA 3I61A 2Q6TA 1U98A 3RS4A 4KFTA 2KI5A 1X8LA 3F3YA 4AYXA 3ZD7A 3K0EA 1E0AA 4Q00A 4TLCA 2WWHA 2V55B 2GEVA 2Q3HA 2W6JD 5FPTA 1GM5A 4CEHA 4URXR 1ZM9A 4F92B 3ZVRA 3TSOA 4B75A 2GJSA 2XTZA 1CJTC 3CRRA 2O8CB 2C9OA 2H8KA 4FMDF 4OQXA 1EFHA 2HCJB 4II7A 1CR0A 2G3YA 2I4IA 3KB2A 3RABA 3VHLB 2ZRBA 4WOPA 5EXTA 5L3QB 2J0SA 4LC1A 1OH7A 1ZBDA 4OQLA 4MKGA 1O87A 4Q9LA 4V0KA 5AWFC 3CF0A 4V0NA 1T8TA 2J59A 1YU9A 4DT1A 2GJ8A 3AVVA 2DFKB 4L15A 1R10A 2ZR7A 2ZTSA 3BRWD 1YJ5A 4DLTA 5JWRA 2B92A 3AVXA 4PSVA 5DSZA 2XSZA 4LYJA 1ZC4A 3WNCA 1NKTA 1AA9A 2FEMA 4S2EA 3CKLA 2NZJA 1NG9A 2FGKA 4D6PA 2BM0A 1W0JA 4KHZA 1OW3B 4BZQA 1W0JD 5HZHA 1U0JA 3VR6A 3MJRA 3P27A 4TT3A 1VG8A 3EPJA 1RJ9B 4E5UA 1WE2A 2WBLC 5KTYA 2O8BA 2IYRA 3TBKA 5C46F 3AP2A 1NP6A 4TYQA 4IRUB 4FW9A 1T0HB 4Q4HA 3U3KA 2F1JA 3TW4A 3IIKA 3THWB 3KQLA 4Q9IA 3TRFA 2DCUA 5JCZA 1MV5A 3KQNA 2QTVB 2VIIA 3FMIA 2RGBA 2JJ2A 4FMDB 4RCYA 3OEHD 1PUJA 2JJ2D 4C0AC 3LBIA 4DCVA 3FKSA 5L3SB 4Q7MB 4DEXA 2ZM5A 2IBMA 3IUYA 4C30A 1KO5A 1L4UA 3IPXA 5HCNA 1UDWA 1G1MA 4MGZR 2REOA 2ECKA 2QGZA 2XB2A 1LS6A 4GL2A 1IN6A 3BJIC 2X1VA 3CNNA 3H2YA 4XJXA 2BJVA 3QY0A 3JVUA 4TZ6A 4IDNA 1EGAA 4JLDA 1CR4A 2WTUA 1ZYUA 2Z4SA 1KSHA 1VYTA 2R2AA 1XTSA 3QKUA 4M9QA 1DOAA 3RHFA 4B71A 3CF2A 3MCAA 1XXHB 1G64A 3B13B 3R9IA 3RRMA 1TNDA 3QOFA 3P4YA 4W9MC 1OXXK 1MO3A 1YZGA 1XEXA 3U44B 1M1YE 4D82A 5LB2A 1XEFA 1UEJA 2VHQA 1E2MA 4O2LA 4CEJA 1XJ0A 4M22A 3D31A 2XAUA 4L5BA 1E2NA 5EE9A 1II8B 4V0OA 4Q9KA 3KXLA 1N6IA 2AWNA 2MMGA 3R7WB 4XD7A 4BZXA 3JZAA 4DWJA 3NBFA 5FOXA 4XD7D 5E7IA 4OI1A 2IS2A 4GZLA 3EZ9A 1LTQA 2NO9A 3CRQA 5DE3A 4AY2A 2YWFA 3ONWA 3TUJC 3CLVA 1L7VC 4LPKA 1Z0FA 5FOSA 3W9YA 4NYMR 1OPXA 2DBYA 2GCOA 2BEJA 3WMEA 2ANCA 4ESHA 3BH0A 2GZDA 4YMSA 3QIAA 4JBWA 1W36D 2KE5A 3BORA 4LX0A 4B35A 3K8YA 1ZNZA 2GESA 3MUFA 4C3ZA 2FE4A 4IOJA 2AK3A 3HPQA 2FDCA 3LQQA 3K9HA 5FOUA 2OFWA 3B9PA 1II9A 5HZKA 4F4CA 1ZW6A 5E7JA 2HEIA 2AK2A 2X19A 3LQRA 4OHZA 3EA0A 2QSZA 4TSFA 2WWGA 4TSFD 521PA 2NOAA 4CEHB 1L4YA 1PLJA 4LJYA 1YQTA 1LVGA 4PAQA 3AGPA 3G82C 1G3IA 5FI0B 4PANA 3HDTA 3UK6A 1TU3A 4YDSA 1JNYA 2ZYVX 2A5FA 4LGMA 1ANKA 2QQ0A 4QNRA 2VP0A 4URWR 3RS5A 2XTMA 4JYBA 4Q1FA 3T06B 3R8CA 4D81A 2WVJA 1VDZA 1YZTA 2D2FA 1J99A 1ZNYA 5AJYA 1FL9A 3SJAA 4XSGA 2P3SA 4EPXA 2P6RA 3RSOA 2VA8A 1XXHE 4DSTA 4CW7A 1UPTA 3AF0A 2YC2C 2V9PA 4GOJA 5JRZA 1OXSC 4B6EA 2FFAA 3OEEA 3QJYA 3OEED 1OB5A 1JEEA 4GI7A 1FP7A 3AF2A 1KI2A 4HLUC 4UXJA 4Q21A 1GNPA 1M7GA 5EP1A 2Q9BA 3AKEA 2X77A 3RVBA 1CTQA 3PEVA 2DFNA 4G1UC 5FBRB 1OKKA 1Q21A 1CLUA 4A9AA 1OKKD 3RC3A 1DAMA 3EAQA 1Z0KA 3ZIAD 2R6DA 5TVKA 1A2BA 1XX6A 2ATVA 1RC8A 1BS1A 4KI0A 4AI6A 1EESA 4JVLA 5M04A 1P61B 4XSHA 2ZU0C 4IHQA 3RNLA 1KNXA 1Z06A 3N2EA 4HAXA 3WMGA 1XEWY 2GDJA 1F2UA 4EUNA 5AK0A 3DOFA 2IS4A 2XEXA 1TF5A 2ZYUX 5KHOC 1BYIA 1P4SA 2IL1A 3BS4A 2HF8A 4D2IA 4IEIA 1E1RD 4K46A 2NPIA 4BWYA 2ZRMA 4BPBA 2YWGA 2QBYA 2VO1A 2YYZA 1KZGB 2OZEA 4F7WA 3LFUA 3PITA 2CLSA 4OJQA 4IJMA 2ZUCA 3SJBA 5E3HA 3NHAA 1W47A 3FHOA 2ZJYA 3CUEF 5CB6A 1A7JA 3L0OA 2V1XA 4W5HA 3NDBB 4Q9HA 3AVWA 1ZU5A 3SC3A 4ZIRB 4NCNA 4AYWA 4OHVA 2QROA 3QKRA 1GL6A 4NPHA 4C7OA 1T9HA 3WBJA 4JS0A 3SN6A 3CM0A 3Q7QA 1IM2A 3I92A 4E07A 1W36C 4EJSB 3KQUA 1MABA 2AL7A 5B64A 2ODEA 1GNRA 1TEXA 3TR0A 2Z83A 2WMOB 2WJGA 4RY2A 1ZP6A 1KJZA 1P9NA 2PCJA 4LHWA 3RS3A 4AURA 5TDHA 3C7KA 4MDEA 4ZCLA 1GILA 2VPPA 4JJZA 3A36A 4UKDA 1G3RA 2I1QA 3IILA 4HAUA 4BUJA 4FI3C 2P65A 4UNNA 1UBEA 1KI8A 2WPDA 4QGAA 1UKYA 2WPDD 4IDOA 1XTIA 5EZ5A 1CBUA 1WBDA 1Z2CA 4PQRA 4IVPA 4QC2A 2B7CA 4DDWA 1BIFA 3EZ2A 1Z6XA 5H68A 2ORIA 2E9SA 4JBXA 1WMSA 4IW3B 3RS2A 3SQWA 2RMKA 1AJEA 1ESNA 4M1SA 3SBDA 1VG1A 4P32A 1WB9A 1NBMA 2W0MA 2Y8EA 1LW7A 2XZPA 1NBMD 1X1SA 2CL7X 2WWWA 5FBLB 4DVGA 4ZDJA 5CITA 3LX8A 1NY6A 2ZI9A 5EP3A 4BLOA 2ODBA 2AKYA 1DBSA 4LRWA 2NO0A 4HB0A 1G41A 3AKYA 4NTZA 5FR1A 1GTVA 4R7ZA 4B3GA 5J4LA 2D3WA 4HEJA 1OJLA 3TAUA 5DHAA 4C0LA 5BN5A 2D7CA 3LY5A 5KYKA 2ZI3A 1QVAA 3KUDA 1C1YA 2QAGC 1M34E 3EIEA 1G6OA 1M7HA 4MDFA 2QMOA 1CRPA 3W90A 5J4KA 2EWWA 4ACAA 3QF4A 2P67A 3IDQA 3PV0A 3TW8B 4PPFA 1S8FA 2JASA 1HT2E 2UZ3A 2HUPA 3MAAC 1Z0DA 3VAAA 5P21A 3MG9A 5ELXA 5AR1A 4R2HA 3IQXA 4PC2A 1TPZA 1OIXA 3EX7C 2W58A 2P5TB 2V6JA 2VHUA 3LVRE 4IXNA 2WKQA 2VEDA 3L43A 5KNBA 3I62A 1JR3E 2Q9CA 3NDPA 3QXCA 2CXXA 4BQSA 4HLQB 3K09A 2FPLA 2GJKA 3ZQ6A 1KI1A 1D8TA 2O0JA 3IO5A 4L9WA 2OEPA 1XJCA 4ZI2A 1OH5A 1Z07A 2C96A 2R6AA 1KY3A 3U3MA 2BMFA 4JSTA 2F3RA 4A4DA 3BIFA 4Z1MA 5SZKB 4KBGA 4A36A 4LZZA 4CGZA 2BVNA 4UQOA 4Q1DA 3E2IA 1CP2A 3TVDA 4OQMA 2W00A 1GSIA 4CF7A 1M74A 3GJ3A 2P5SA 4DB4A 4IVQA 1YHNA 4Q18A 4A82A 1GRNA 1UKZA 3ZZUA 1XJQA 5CK4A 4JIMA 3REGA 1Z6GA 2RAPA 2AHOA 4KFUA 3GLIA 3EPHA 3GD7A 4JLOA 4M53A 4M0LA 1YZKA 2V7QA 4KCGA 3HYTA 4BZPA 3FMPB 1OHHA 2DHRA 1E9DA 4AKIA 1OHHD 4JLNA 4QGFA 3L2OB 1LNZA 1U94A 3LBNA 5KDDA 1J2JA 1RE0A 1SVOA 2WIAA 3FMFA 3RRNA 4KYUA 3KB1A 3NC0C 3N2IA 5LPNA 5KDOA 2V1UA 4C7OB 2EQBA 3KKNA 4O0MA 5FI1B 3ZD6A 1XNJA 4GP7A 4NKRA 2BBSA 3W34A 5KO2A 2IEZA 2R44A 4LHZA 4M1TA 3ZQJA 3QF7A 3GLGA 2G6BA 4B3BA 4LBVA 4JLMA 4IOKA 4RD1A 4TZ0A 3FB4A 5D3MB 1G5RA 2CHVA 2H1LA 1FUUA 3FFAA 1C9KA 1FOEB 4EAQA 3VR5A 3DOEA 1SXJC 4QRHA 1WDTA 4QL3A 5FOWA 1I4TD 1VCIA 3KJGA 4HAYA 2GCNA 5CJPA 3K70B 2YVUA 4R98A 3DMDA 5KDLA 3JZMA 2RB4A 1N6OA 4FCWA 1AGPA 2WJIA 1OLOA 2A9KA 2Z43A 4GZMA 1Z29A 1Q1BA 1ZU4A 2IA5A 4M4SA 2GHIA 4QNMA 4ON9A 4TMVA 3IEVA 2J7PA 1BH2A 1XPOA 1KMHA 1CJVC 3TLXA 1UF9A 3BB3A 5DISB 2QNRA 2G1KA 4AG6A 1JJ7A 3B1WA 4LYHA 3ECCA 3BH6A 5EE1A 1GAJA 4W5WA 4D0GA 3QXSA 5EJEA 2CE2X 2X2FA 5BXQC 4QM7A 4A0GA 3DM9B 4GSYA 4EKDA 4NCKA 2PZEA 2VF7A 4M21A 1X6VA 2W0SA 1E9EA 3KJHA 4JL6A 1M8PA 4TTRA 2OXCA 1P9RA 4X8LA 1P2SA 1XMIA 4E09A 4GBMA 2GNOA 2ZRHA 1OXUA 3GLFA 2R6CA 4KXFB 1F6BA 4A1FA 5DGXA 3K53A 3VR4A 1G4UR 1TUIA 1N6RA 4MQBA 1JQJC 1K6MA 4TLAA 1NMZA 3GEHA 4IVRA 4PFSA 4CRWB 1N0UA 1R0YA 1XMJA 3G0HA 2CMKA 2F1RA 3U6KA 3NVAA 1E0SA 2BHRA 2JDID 2N42A 2O8DA 3B2EA 2XJ9A 3OHMA 1KSFX 3RANA 2GJ9A 4ITRC 5C4GB 3LLUA 4RKEA 2IUSA 3CBQA 2E87A 1OYWA 2C04A 4Q01A 3FE2A 1RYHA 2BBWA 1IOZA 2O8EB 1D2EA 1T5LA 4IOLA 5FPKA 4DCUA 1Q1EA 3PEYA 3EWSA 2GZAA 1J7KA 2GVZC 2VSFA 3AP3A 1G5TA 5JZVA 5SZJA 4KO8A 2ZS9A 3LNCA 4LHVA 4A0RA 4WVFA 1R8SA 4B32A 1Z08A 3U6BA 1D2MA 1R0ZA 3UG6A 2IYTA 3T1OA 1AK2A 1YZLA 4AIIA 2IK8A 2PMDA 4A92A 4TYYA 3AUYA 3NWJA 5TB5A 1FTNA 4RZUA 4KITB 5AJWA 3AVPA 1QZXA 1XTQA 1SVIA 4CT5A 3DKVA 4CT4B 2A30A 2IS6A 1OT3A 3K1JA 2ERYA 4Z51A 2ONJA 2PJRA 3OAAA 3OAAD 1XFAA 4X8HA 1D9ZA 3KDSE 2OCPA 2CLDX 2GK7A 1RVDA 1E9SA 1VHLA 5FTLA 4D4KA 1RZ3A 1IHUA 1D9XA 1XTKA 3A37A 4KODA 1AN0A 1AQUA 1R5BA 1TADA 4QG7A 4DDVA 1NIJA 1RRFA 4TLBA 4I99A 3ZH9B 4GDFA 4PC6A 4BFZA 2ORWA 4EIWA 2G88A 2I3BA 1KI9A 5JS8A 1W7AA 2IX3A 1IJFA 3H4MA 1E2EA 2C5LA 3WHLA 3AF1A 1QHSA 2OCBA 4ZPXA 3HR7A 1A82A 1VKJA 2CK3A 1U2RA 2XXAA 2J9RA 1Z2AA 2FNAA 4JZKA 4TQ9A 4C0JA 1US8A 2BMEA 2ZJBA 2WWFA 2BJWA 3A58B 4HZUA 1W44A 1GOTA 4IKEA 3AF3A 3CR7A 3CIOA 3O8RA 1WP9A 2JLXA 1SVWA 1ZNXA 3PXGA 4NONA 3TSZA 1BMFA 4MGKR 4HATA 1BMFD 1MKYA 1R8QA 2VP4A 2ZXUA 1DAKA 2QMUA 4Q4AA 2Q3MA 4UNQA 4MYUA 5FUWA 2E1RA 3KXIA 2W6IA 5JHHB 2ZS8A 3H86A 2QT1A 1D2NA 1KZ7B 4G5QA 1IXSB 4B2LA 1AS3A 1OFTA 2KBEA 2XITA 3TQFA 2B6HA 1I4DD 2F1IA 5F2EA 4I81A 3BK7A 4PPQA 1BKDR 2ZSDA 1S9DA 2ZRLA 4BFSA 3AKDA 3EZ6A 4LDJA 3ASYA 4LJ5A 2IW3A 4LPSA 3CB4A 5SZHB 1A2KC 1K5GA 2D62A 5KOYA 4C9BA 3TGPA 3FFBA 2B8TA 3K0AA 3WP1B 1IAQA 3DPUA 3EXAA 1UADA 1U0HC 2W6JA 4KBFA 4US0R 4Y0AA 5JWOA 3GJXC 4G3XA 4ERNA 3ADCA 3GPLA 3TVTA 4TMWA 3EC1A 3GLHA 2OAP1 2FZLA 3ADKA 2ZAOA 3EASA 3F8TA 4OK6A 1XMSA 3RWOA 5F9HA 1FPMA 1RIFA 4B76A 2W2TA 4QKQA 2ZJZA 3ADDA 1TTTA 1G3UA 1S1CA 4OHWA 4BFYA 1MRSA 2FGJA 5J4VA 4IDHA 3LD9A 4ARZA 2C99A 3OFND 2BKUA 4KSBA 2ASEA 2ZI7A 1KI6B 4FCTA 2QQEA 2WJHA 2IHBA 5DI3A 4RZXA 2BV3A 3FOZA 1U8ZA 5CYOA 4JLKA 2ODWA 2VH5R 4P4SA 5BWMA 3PEWA 4OI4A 1L8QA 1NSFA 3BD9A 2HLDA 1GKIA 2HLDD 2GBLC 1E1QA 1BO6A 3IBGA 4MRPA 4KVGA 1E1QD 2FPMA 3SJCA 4D0LB 5J5CA 1YZQA 3VNUA 2GXSA 1I4LD 2K5UA 2FFQA 3THXA 1J8YF 1E98A 4LBWA 3RS7A 4BEJA 1PVOA 4B3FX 1FQKA 1NN1A 1OIWA 1FUKA 1M6NA 3I8XA 2GCPA 2AX4A 4LUCA 3ETLA 3U7GA 1N3BA 2FPKA 1P60A 3UMFA 1W4AA 4LJ4A 5FUYA 3DZDA 3CZQA 3OEHA 4HLUA 2G0NA 121PA 4O3MA 1E9AA 2J46A 2QMEA 3FVQA 4JT4A 4V0MA 1JXMA 3I8SA 1G4AE 4Q5IA 2ZRGA 4W7SA 4QGHA 2QUZA 4D0NA 1W4CA 3DKPA 4NBSA 1SULA 4RKFA 3V9PA 2D06A 3W5JA 2O0KA 3B85A 2IYQA 3D6TB 3BERA 5FTNA 3K0FA 1T91A 2GTPA 1R2QA 4MUAA 3SI7A 2J1LA 1E96A 1Q12A 4BLTA 3B1XA 3MMPA 1QHHA 4DKXA 1I2DA 5AJVB 5FPHA 5K8TA 4H1UA 2ZE6A 5CLQA 5TY0A 1DVRA 3SNHA 2CDNA 2VSOA 4BASA 1PJRA 2C2HA 4WBSA 3MRSA 5F9FA 2EYUA 3EW9A 4TN1A 3EZ7A 4LV6A 3X1ZA 3WNDA 3LW7A 2R8RA 2FZ4A 4HLDA 3SZRA 2OBLA 4JYCA 1CXZA 1ETUA 1S4QA 1CJMA 2ZS7A 3P20A 3AB3A 2H18A 1G3QA 4DLYA 2IWHA 2RH5A 1RRGA 1KDRA 1KDTA 2OUKA 1SGWA 4RD2A 2CL0X 5JSZB 4BGDA 3TR5A 3THYA 2C9CA 4FMBB 4GRAA 5FFMA 4HI0E 1SHZA 5GVRA 2XNSA 5L3VA 3W3ZB 2HYDA 2AN9A 1EFRD 1AZTA 5G3ZA 3SFVA 2ZR9A 4NHOA 1YKSA 4B3CA 1IY1A 3I32A 3X1YA 2N46A 4C0QC 2OG2A 1HE8B 4F38A 1BYUA 3LV8A 2ZRPA 4Q7KA 1TU4A 4O25A 2RHMA 3ZS8A 2A2ZA 1FTSA 1T8UA 1DAEA 1NMXA 1JQLB 3C15C 5JLJA 1NNEA 3CNLA 2FV8A 2QM8A 4DLVA 1IN5A 2QT0A 4Q4JB 4RZ2A 5CLLA 5A4JA 2FSIA 3SEAA 4B3XA 5GVSA 2NIPA 5KSYA 2D4HA 2ZI5A 3EWAA 3Q85A 1X1RA 4PZZA 3VFDA 3TMKA 4KYIB 3I5YA 2WKRA 3QUSA 2R9VA 3K0CC 4JLPA 2D2EA 2OILA 4DLRA 1HT1E 1KOFA 2J0UA 4B3DA 4QBGB 4P33A 3DHWC 1T3SA 5CIQA 3KTAA 3OESA 5CK5A 3LLMA 2QAJA 1E2KA 3RWMB 2RGEA 1CKEA 1E4YA 1Q1ZA 4M1OA 5TV2A 3LXRA 4UXIA 2J87A 2XNDA 3Q8XB 4AYTA 2XNDD 1KSJA 4A2WA 1XP8A 1YR6A 1OB2A 2IS1A 2CHQA 5GJVC 2O8FA 4EDHA 1TMKA 5EZ6B 4DT1B 3QVVA 5FUXA 3QPUA 2IXEA 1Q1QA 1XWIA 4PPGA 4UNSA 3WYAA 4AD8A 4TWZA 2RGNC 4JMPA 5UKDA 4EPVA 2QTHA 1F5NA 4NCHA 3T1TA 1HH4A 5CM8B 5EE5B 1ZAKA 3QXJA 1OFUX 3UWOA 5B58C 2IXFA 2Z6VA 2QAGA 2REXB 4YMWA 1ZD1A 2FH5B 4GMXA 2O8BB 3NIBA 2EFGA 2F43A 5B2ZA 2OLKA 3UIEA 2OV2A 4XIGS 1HA3A 4DIDA 3NBYC 3B60A 3ZIAA 4R71A 5HKKD 4CEIA 2OXRA 3CWQA 2TMKA 3SU8A 3T61A 4Q4HB 1IJEA 1XB2A 3OE7D 1RRCA 4RCZA 3U4QA 4YMTA 3RRZA 2HCBA 2ZSBA 2A5GA 3QPWA 2PZFA 4TYNA 1J70A 4HDCA 2JJ1D 4QOSA 2IHYA 4B2PA 2A3RA 5G53C 2G83A 2QMHA 1J8MF 4OK5A 3QEOA 1E1RA 5FBQB 1E4VA 1SKQA 3EG5A 3K0FB 4RFVA 4PHGA 3BBPA 4HYYA 3M6AA 5BN4A 3GP8A 2ORVA 1AIPA 4P3YA 1P72A 1GKYA 4MRNA 4BFVA 2C77A 5K8LA 4PSKA 1CEEA 1MRNA 1XF9A 3ASZA 3BH7A 4DZZA 2BCJQ 4I1VA 4JJKA 1XTRA 2ZUDA 2AWOA 1IY0A 3UKDA 1R5NA 2JATA 4HUQA 4A6PA 2ZITA 2IXGA 1Q0UA 3T1QA 4DLUA 2QM7A 1U8YA 1XEXB 1JXOA 2FG5A 3EA5A 1P73A 2F1HA 1E2GA 1OXVA 1VIYA 3DVLA 4XWAA 3AM1A 3H84A 1IN8A 1Z28A 2NZ8A 2IYZA 2NG1A 3CX6A 4CEJB 2F7SA 3LO5A 2AD5A 3THYB 2FMXA 4MYTA 3E70C 1P2TA 3VR3A 2RGXA 3KKOA 4LI0A 3VR2A 2JLYA 1IXZA 3R8FA 4EJSC 3L0SA 3W8NA 2OBNA 4TYPA 3VNVA 2QP3A 1DAFA 2W83A 3GJ0A 5KSZA 1NSTA 4UNRA 3PCRB 5KNCA 1IBRA 1Q20A 3HYRA 4OL0A 2V3CC 2GJAA 1B23P 1ZM2A 3AVOA 1KKMA 3PG5A 4GOXA 2GCOB 4G5RA 1UM8A 1G3MA 2GAOA 2ZETA 1XMVA 2WJVA 3DM5A 4BLSA 4MRVA 4M2LA 4U5XA 2DPXA 1S9HA 5DYIA 4NP6A 3O8BA 1FW6A 3CONA 4A8JC 1YRAA 2W2XA 3UPUA 2ZI6A 3W6NA 4LBZA 4HZIA 1MO6A 1R6BX 1SXJA 2XOKA 4RD3A 4TL7A 1SXJD 2HXYA 2XOKD 2QPOA 1A4RA 3AEZA 3P32A 3QKTA 1Q3HA 4R2IA 2J0UB 5FTKA 5FBVB 4DLZA 4ZKEA 4IFBA 2VP9A 5CIWA 1CIPA 3WBKA 1N0VC 3BFVA 4XTCS 1DELA 2GXAA 2J45A 5D3QA 1OIVA 5EQTA 2QU8A 4G01B 1VTKA 2ERXA 3B1YA 4C0BA 3FKQA
chains in the Genus database with same CATH superfamily
3M5WA 5KSWB 2DPMA 1PHRA 2C88A 4BPRA 3IT0A 3STXA 1RHQA 2B21A 4PC7A 1D1SA 1G21E 1N2CE 1VI5A 1XCGB 1XTBA 2DSTA 4YLGA 4FLEA 4AUNA 1IBCA 3TYXA 4UM8B 2OCYC 1SCKA 4HSGA 1KY2A 3KJXA 3E23A 3ZDQA 2EX4A 2BFDB 2OCKA 3DONA 3JQPA 3PUKA 4LVNA 4YBRA 1Q19A 3I0NA 2C95A 4L4UA 4ZICA 5EGNA 4JCOA 3L8ZA 4G9GA 1S96A 4R1TA 4CKZA 5BURA 4W5NA 1WAMA 2OLEA 1O54A 5AOBA 1G5PA 3DOUA 5HQ3B 4P82A 3FROA 5AHOA 1H0RA 3RREA 3V1MA 5EQFA 1YQQA 3PNQA 4DRZA 4MRMA 4E2ZA 1A4UA 3WTCA 2QUKA 5AHRA 4V1CB 4NK5A 1JIVA 3NBAA 2RKOA 1I01A 1LDYA 4PO1A 4YI3A 5AOCA 1GHTA 1L4BA 4I7EA 4AZWA 1IRIA 2O52A 4JYMA 5HP4A 3HZZA 5CFOA 1E9BA 4LSWA 4IILA 3VTFA 3SYKA 1DO0A 4MITA 3A26A 3KV3O 2ZFUA 1E7RA 1OWOA 5E9WA 4N39A 4JI6B 2VTVA 3TNYA 2PTHA 1W5SA 2QN6A 4N0DA 1F2UB 2V5UA 3B9RA 3DEKA 4D26A 2OB1A 4NBVA 1K8RA 3WJAA 4WLUA 1PLLA 3LL4A 4AJKA 2ZJ8A 3GJ8A 3T38A 2H7YA 3KVRA 1I2CA 1T0UA 2R1VB 2O1XA 2ZP1A 4OOEA 1RHRA 3VZSA 3INRA 2AC7A 2QZZA 1ISMA 1ZZGA 2HPVA 2YIJA 3WMWA 1TL7C 4MR7B 5BVGB 3SX2A 3CT4A 3WLSA 4TL9A 4WBNF 2Q9AA 2AGVA 1XPRA 3INTA 2PGIA 4BMVA 2P9TA 4WZ6A 5I47A 2GN0A 2HHJA 2Y0EA 3ZJUA 1P0CA 2EDAA 1T0BA 3OH8A 5LL6P 1ODCA 1XHFA 2WVHA 1IIBA 1TXGA 1VKZA 3HBLA 1CRQA 1P6UA 4YAFA 1KDPA 3FPLA 3U1TA 4AWAA 3KSAC 1W85A 3OPYI 3N2GA 2GI4A 1VHDA 2W2KB 3N2ZB 3NC1C 4X1YB 2VDNB 2HK9A 4H2DA 2VJAA 5K0NA 3NHSA 4QOGA 4XYLA 3MINA 2ID4A 3B9QA 2FN7A 1NF2A 3EPRA 1E2QA 2CVHA 4PW0A 1UINA 3I9LA 4WGFA 1YO6A 5IDYA 2GILA 2CMFA 3TFQA 1Y1RA 3TGWA 1K63A 3OZXA 3VKWA 2JG3A 5JBIA 2FFJA 4LY0A 1TUBA 2X8LA 1NLMA 4L2IB 1L6IA 3X1KA 4CM4B 5AW8A 2MTBA 5G02A 5IK2D 5E6SA 1SHKA 1YQEA 3AUXA 3ESXA 1QF7A 3L7NA 1Z4LA 3BD8A 3Q11A 4XJTA 4P98A 5LU9A 1R3DA 2IBSA 1MOZA 4MV9A 4RESA 2RHJA 2WQ7A 1RW4A 2HQSA 4WBNB 1QIHA 4FDLA 1D5WA 1KEVA 4CIAA 3HBAA 3R7DA 2OC4A 4MQMA 4D8UA 3C97A 1W0CA 2KB0A 1X1AA 4KO4S 3VSCA 5HKAA 2WTBA 5EFZA 1CRWG 2E7ZA 1UKEA 1IU9A 2OT3B 3A1VA 1WM1A 2E5FA 3GF4A 2PFGA 3HFRA 3LOPA 3PJGA 2ZRDA 4PF1A 4QECA 3DPIA 3NETA 1T3HA 1U31A 1DFGA 1C9YA 2BRUC 3NONA 5B7NA 1J1UA 1F60A 4YCNA 3MELA 4BQOA 1JHDA 1NATA 2FQXA 3GELA 2P40A 1UAAA 2CHFA 1Y9EA 5ELLA 5CEJA 7ABPA 5IVHA 3W5SA 3ST7A 5DN6D 1PT6A 1QGZA 4ZMRA 3ZOKA 5B3LA 4BN0A 5I7EA 4EPRA 4TKMA 2H0RA 1BAPA 3OC6A 4NYMQ 2JLWA 4OG2A 2ACKA 1M0EA 3ZXUB 5BYKA 1C3JA 1HFJA 4U7DA 4X61A 2N1MA 2Z3ZA 1NU6A 3LXUX 1HPLA 1RMQA 1T34A 4U7HA 1UBGA 2PLRA 2QYSA 4PC3A 4H1WA 1AMOA 4EB6B 2ZWMA 1GNSA 1F0KA 2YZ2A 1M54A 1Z5WA 1Y8QA 3QK7A 1HRDA 1REQA 1ZD5A 3U4IA 2GXUA 1PEDA 4MVWA 3T12A 4EA9A 4PAMA 4JLWA 3CCFA 3GAMA 4F4JA 1FP1D 1Z5PA 2ZJ1A 1W48A 2IU4A 5LU8A 2RH8A 3HU1A 4JQZA 4FOPA 1W9HA 2BKEA 3R6LA 4INZA 1AKWA 3HYLA 5EKXA 4ETNA 1U5CA 3C7DB 5IN4A 4DB2A 1SD5A 4TS1A 1IULA 2X6RA 3H1EA 1A1VA 2JGDA 4PONA 5FYQA 1EWTA 4QOJA 2JIZA 3VC1A 3FETA 1HE5A 2R7AA 3KNZA 4LJRA 3BSWA 4AJLA 2FSSA 2BDTA 2VTKA 3DBVO 3FM9A 4GR5A 1AZWA 4BFWA 3A9RA 1RTTA 2WHXA 5JVDF 2AH5A 3W8RA 3VYSB 3HDHA 3LBHA 4B3IA 1LV8A 3A2NA 3AIOA 3QE9Y 2BEKA 2WTXA 3GVXA 1DTSA 3C2QA 5F64A 2C2WA 4GBGA 4XGQA 3EFEA 2R4QA 1RLOA 1F1JA 4HDMA 1WZUA 3C6MA 4K5QA 4PX2A 3K6JA 4MS4A 5AK6A 4D80A 1TM7E 3DEFA 4HB3A 1TQ2A 1J23A 1XRJA 2OV8A 3ZWXA 5AQ1A 1N3LA 2FG6C 3EIFA 2Q7OE 4DCCA 5K4GA 2YXBA 3T15A 3I9MA 4RC9A 3IEPA 2B7BA 1A9YA 5F7OA 2NO7A 1G5HA 2R4TA 1DFHA 1XLVA 3C48A 3ZW8A 4D4HA 1KKUA 5BSGA 3L4KA 5DLYA 1U7PA 1UC8A 1JALA 1P0PA 2ERCA 1ZFNA 1JJAA 1WUKS 2ODTX 2IEYA 3LAWA 3V6MA 1V8ZA 4HGPA 5DM0A 1EJ2A 3RKRA 1RXSA 1AGRA 1G20E 1VLVA 1CZNA 2B82A 5HJ2A 4R8MA 1JA9A 3MJSA 4CTKA 2EP8A 4F3KA 4MQ6A 3MS4A 2NAPA 3P1JA 5C37A 3JYOA 4URFA 3TL3A 3SOZA 2PX2A 5K7SA 2Z9BA 2FJPA 1NBME 1E7MA 1IHYA 3WLQA 3TUIC 5KU1A 5K0GA 5LA6F 4AKEA 5A6SA 1YC5A 1KERA 4PZPA 4RMNA 1XDZA 1ONPA 2PV7A 4X6XA 5C4IA 3O9ZA 5TQ0B 2IYPA 1RJEA 2EL9A 1PLKA 2O0HA 3A6HA 5JVDB 4HVTA 4GVXA 3NBXX 1RJ9A 4U2BA 5HMMA 3PRYA 2JI9A 3PFIA 4B0PA 5LMNB 2ZVPX 3H9UA 2XZDA 4H1VA 1NJ2A 3B38A 5E95A 1OX4A 3D0KA 3MINB 4ZVMA 3B9BA 3I1FA 3FUWA 3HVKA 3WE7A 4RPLA 3GLGB 1KH1A 1RYFA 3GOQA 1JB9A 3NR2A 4NU0A 4IAOA 3T9EA 2CMHA 3ZY6A 3O2JA 4DBLE 1D5CA 1Z83A 2IYVA 2W48A 1QH1A 3OPNA 2WP8J 4MLCA 3PEUA 3U3XA 3WRVA 4JLJA 4K26A 5L3SA 2CV2A 3BDIA 4L57A 1T5IA 3NOOA 1TCUA 3URKA 3CUVA 3DC7A 4AKGA 2D00A 1HYBA 3OQPA 3FTFA 2EJVA 3LXXA 4IEEA 4LBYA 4Y6PA 1F12A 5EC8A 1YHYA 2GEDA 1COWD 3HC7A 4IJKA 2FFRA 4QX6A 2R65A 5BV8A 1X7XB 2PSSA 2XI4A 3PVZA 4YJ3F 2MSCB 3ODPA 3MTAA 5LA6B 3U9TA 4CMKA 4BKMA 4WK2B 4KRGA 2DQYA 4GO1A 3UC9A 4JBIA 3X2FA 1U1IA 1USGA 1C2TA 1E99A 3KQMA 3L4BC 3GR6A 5JJKA 3D2LA 3AVTA 2C5GA 4IIDA 3RU9A 5DYGA 1WY5A 1TYBE 2Q8NA 4WXEA 4ZAGA 4CDNA 1O4WA 1X38A 3HCCA 5A7FA 2IPOA 1JAXA 2C4WA 2WAMA 1NXSA 2PZJA 1XNRB 1KHTA 5C80A 1E62A 2MSLA 2QUJA 3KSBC 2WK1A 4FS3A 1P5HA 1I0IA 2CLFB 2FSFA 2ZAMA 3AFIA 4MO9A 5C18A 4PHTA 5JJ5A 2OHFA 4GAEA 1EK2A 4UPVA 2O2XA 1QKKA 2QRMA 3OJXA 4PIPA 3UHJA 1QU2A 2OESA 1SUBA 2PGAA 3QFRA 4WZBE 2WICA 2OV4A 3M6XA 3GLIE 1IVSA 4JXZA 1TE2A 4DLNA 3RFVA 2Y1WA 3UJ8A 2CHUA 4S35A 3MIZA 5H7XA 4ZOEA 5CG1A 2OZLA 3M4YA 3PDCA 4QBFA 4F2GA 3GRAA 5IZCC 3OLCX 5J4HA 2FZKA 2LKCA 2X3FA 4Z7OB 3EARA 2PH7A 2D74A 1VP9A 2IUFA 2QA5A 3GROA 4PVCA 4N6OA 1I7DA 1N25A 3U3JA 1KVUA 1OZHA 1T0JB 2JAUA 2JJ8A 2VDOB 5SYAA 1HE2A 2E4AA 2HK6A 3H5TA 4YJ3B 3E3AA 2FVXA 3E6AA 3C3PA 4ZVNA 4UTRA 5IJ0A 1BXZA 1XVTA 2RC5A 1BVHA 4OV6B 1HNXB 1DWUA 1R0XA 1QO9A 4MWDA 2AOXA 4B74A 3W5CA 3D4PA 2O0MA 4N0PA 4ASUD 4ZQBA 1T5TA 4WLVA 5E7QA 3E27A 1U8UA 5DTMA 3OBBA 3C3DA 2P7HA 2Q99A 3ZN2A 2Y27A 4C1NA 3N58A 3KVVA 1XD9A 2Y67A 3H2BA 1IY9A 4NV0A 2OA0A 2JFWA 5JS2A 4I8XA 1Y42X 1EXVA 1QCCA 1YR1A 2FSHA 3BB1A 1ESDA 1G7RA 3HVUA 5DLPA 1UZNA 2PUEA 3OEWA 4FFBB 4WCFB 1E2LA 3A6ZA 3R8XA 3VU0A 3VI3B 1Y7PA 4HLNA 4WA7A 3IAM6 3H5OA 4UHCA 3PXEA 5DWDA 1UKCA 4V3BA 3EWIA 1XZBA 2C94A 3U3RA 5K8JB 4OXKA 3OPQA 4OHXA 2GZ3A 5FHQA 5CFQA 3GB9A 5I7OA 1KFBB 4Q4LA 5T4FA 3A6EA 4AKHA 3BL8A 4LYDA 2DPYA 4OP2A 3PJRA 3IGFA 2WMDA 1ZGBA 3FYHA 4KQCA 4NNPA 5B6PA 1CUUA 2NPFA 4Q03A 2RGNA 3V4OA 5JI3E 4Z3OA 4D25A 5LP6F 1OVGA 5HQJA 1GADO 1TZMA 3WYGA 1CB0A 4LSZA 4QUJA 2I2AA 1W4LA 4N54A 3A1DA 4RA9A 1T5SA 4TS3A 3TDNA 3ZWYA 1HDRA 5DLQC 2C97A 4ZCSA 4HWPA 1H8EA 2AJ8A 1MB4A 1YIAA 2YBDA 4MUXA 4M9ZA 4RYLA 4TT3D 1DFIA 5DGTA 5LQJA 4KQWA 3KBBA 5JBNA 4D8VA 3ZWPA 3MT9A 4FOSA 1CE8A 4EMTA 4JJEA 4BEBA 1E3DA 1KIFA 1IAVA 1V7PC 4LHXA 1F7VA 2HGZA 3EQ9A 4ZVVA 2IYSA 1JAHA 1YQWA 2ZYIA 3GN1A 3QEJA 1U5AA 3CRVA 1YR7A 2DBVO 4RV4A 1I6LA 2A9RA 3AJAA 5DP2A 4AF6A 2VZEA 4DQVA 1PGOA 1Y3FE 2K2WA 1Z3IX 4YYEA 3M5CA 1QV7A 3TJMA 1GGFA 5JCPA 5JZ9A 1U8TA 1T4GA 3WA6A 4D4MA 3I9FA 1R8JA 3B2NA 5BPFA 3KELA 3FKSD 4B6FA 2VAPA 1Z0IA 5E2BA 4F9FA 1OI3A 3CGGA 3P26A 2Y2VA 5KYVA 5CM2Z 1LRLA 4QFDA 3QU5A 4DIMA 5KC9A 5LSAA 3UXEA 4PPNA 2K87A 5JEDA 5GZ3A 1G6HA 2VRCD 4E03A 3WB1A 1SURA 4CMAA 1XCMA 2VLIA 1R9MA 3IHLA 1V2GA 2DWCA 1CRZA 4FDTA 3C5CA 2WWVD 4M7PA 5TR9A 3BMCA 2M1ZA 3WGQA 5LP6B 2VHCA 4BXOB 1NR5A 5EA2A 5JFGA 2L0XA 4B2YA 1VPLA 2GN6A 1WLSA 1JDBB 3GJ5A 3LRPA 1U1EA 1B2LA 1N2OA 4MVJM 4PZLA 2D5IA 4JP1A 4DF3A 2HK7A 2G07A 4PRYA 1GY8A 1Q84A 1S2MA 1CNFA 4R3WA 4WIAA 5I51A 2ZYSA 3HQ4O 4I6EA 1E5TA 2EKLA 1ORWA 2IF2A 1DRVA 2WAYA 2WYOA 5BW4A 2B1IA 2R2GA 4GE0A 2PTGA 4E6PA 2AKAB 1E3TA 5A3RA 3OCCA 5HOQA 3EXFB 1CF2O 3DVAA 4URYR 3ZZTA 1SBNE 4J0QA 4B6SA 2OV1A 4W1RA 1DKQA 5B1HA 1ZR2A 2H17A 2FG7C 3UICA 3U4MA 2I1VB 1XD8A 1JB1A 4IZ6A 3ZTTA 4IGFA 4GRIA 4N5MA 4E94A 5IAOA 4N5NA 1JR3A 4RQAA 4GI3A 1ZI8A 4W1PA 4FBMA 1RYZA 3FN4A 3VSDA 1H8HA 2PUVA 3T3PB 3OD1A 3UWSA 4UBJA 4AJ9A 2BGMA 2J4FA 1XBTA 2OZLB 2DYKA 4DWWA 4TQUS 3KZNA 3ZNNA 2VWHA 1YAHA 4ILKA 4NVRA 4MW6A 2IZ0A 1KVTA 3WL4A 1CY4A 2G6TA 4NEHB 2JGEA 1UBRS 4PAWA 1WF3A 4EPYA 1B73A 4WXRA 4JJ6A 3HK2A 3KTFA 2QDKA 1Z6TA 2QYOA 5J2UA 3FCXA 3W0LB 3IPYA 4E5MA 4HWTA 4KXMA 1M76A 1VCOA 1NVVR 1Z4PX 2OMEA 3AFNA 3NYRA 4LNHA 5D8DA 1HNNA 2H1FA 5IJ0B 1CUSA 4R16A 1KTVA 1T5BA 8LDHA 1D6JA 4QE3A 3T95A 3N28A 1OZFA 3VISA 3O4FA 3GRFA 1EE2A 4Q7LA 5DNWA 4XOIA 4NL4H 1ZM4A 3FWKA 3SZGA 3ZY2A 1KZ6A 2V6GA 4TTPA 4UDXX 3O0TA 1ZM7A 4MP6A 1MR3F 4KV9A 3ROPA 4CNBA 2G77B 4NYJR 1XL1A 2JGFA 4RKWA 3U7QA 4DYVA 4FSHA 4AXBA 3A6KA 3L1IA 5CDUA 2JAPA 4TTAA 4G5OA 4QYXA 3G88A 3I2IA 1L5RA 2ORYA 2X7JA 5L3RA 1N2BA 3IIJA 2H5IA 3CWZA 4XRRA 1OFGA 3FSRA 2J5KA 3D7RA 3R0JA 1V43A 3CF6R 5HILA 3WDKA 3PL5A 3IVCA 1L1QA 5KTNA 1VG0B 3IURA 4IJ5A 3MBKA 1MJGM 1E92A 3ADBA 4E5DA 3THXB 2PS1A 3ZDFA 3RSFA 4PO3X 1GUAA 1LF5A 2G5GX 4HQNA 3JWGA 5EXDA 3M34A 2AMJA 5DN9A 3G0BA 1THTA 3SE7A 4ARAA 3SMQA 2IUYA 5DBFA 4O5AA 5KTKA 4ZAYA 1I3NA 3B70A 1ENYA 3PUIA 1GQFA 1QOZA 4V39A 2NUTB 1TT5A 3I9OA 5AM0A 4WKOA 4ZMSA 4YUZA 3AP1A 5A2GA 1VMEA 2DHQA 4F2WA 4KIJA 4X8MA 3EBLA 3IV6A 4C03A 1U3WA 2C7GA 1NBAA 1N6HA 2FWRA 2MYNA 3GVCA 1A9ZA 3NDRA 3C98A 3UAOA 3WQQA 5KTOA 3LWNA 1O9HA 5GJCA 1TDJA 4RVNA 2GYWA 2XQVA 1E32A 1YRHA 2POCA 2QORA 5TT1A 1M75A 1QQBA 4LF6B 1KO7A 2H2GA 3GWZA 3LG2A 4J03A 1FJHA 4XLZA 2HAEA 1KMQA 5DZSA 3ABRB 4BYMA 2VAVA 4FMCF 4NZ9A 5D85A 1DCFA 2BFCA 4KR2A 3V4PB 3SS8A 2WJWA 3SJ7A 4TZKA 3QW4B 1KTIA 3UWDA 4X54A 3DLIA 2X0EA 1V35A 4BLUA 3KKQA 3C8UA 5B4UA 2JEOA 3WGHA 1AGNA 5BYJA 2BSQA 1T2EA 3FX2A 3AVYA 4WXPA 4DCSA 3VU9A 4NBLA 3TM5A 4DDUA 3LE8A 1D8AA 1NN5A 4OQNA 4X62B 1Q3TA 1YR9A 3NH6A 2C07A 1TYAE 3EWNA 2QP4A 3JSXA 4JJ4A 5U9CA 1L7MA 5K2OA 3KE9A 4NOKA 1QWOA 3NH9A 4PZEA 1SBIA 2QENA 1AHNA 2ZKIA 4ICIA 2VP3A 1JHQA 1ZSYA 1XTZA 3O4IA 1UBFA 5B37A 3S55A 1RJGA 2YV4A 4BMDA 1V1RA 4ND4A 3KXDA 3MWKA 4YCJA 4DLSA 3D6UA 2JCVA 1TJ3A 4LRXA 4J8PA 3RDPA 5AVYA 2CL5A 3MUOA 1V5WA 2GVDC 4RKYA 4UJ3A 1FMFA 2PO7A 3D8RA 1YB2A 2MSNA 4MQEB 3PGA1 2H1OA 3CXUA 3KU4A 2BHLA 2OBFA 1PVDA 2VYQA 3ESCA 1VYVA 3SG0A 2DQ4A 3DVAB 2ZYGA 4HQLA 2QRZA 1VMAA 2UKDA 1XZQA 4FMCB 4WLFA 3QNUA 2H2AA 1J2RA 3R9WA 4JKYA 1S1MA 3ASVA 2AN5A 4Q19A 5FTWA 1GP2A 3SE0A 3R3XA 4FFDA 1Z16A 1L4NA 1GRVA 1PWYE 3IBSA 4AW9A 1HEYA 1Q6ZA 1BRMA 2QTAA 1AM4D 1FRQA 2OB2A 3W4KA 1I5RA 4WOCA 5T4EA 2RAFA 2YOFA 2AR7A 4L0CA 1HOXA 3I72A 3UCFA 4WLNA 4BLQA 1P81A 4HXFB 4BQFA 4YMVA 4MV1A 3LYUA 3OUTA 1SG0A 2D4AA 4QO7A 1D03A 1YZUA 2FX2A 3IEIA 4I66A 4UZSA 3UK1A 1CETA 4L4RA 1R4AA 2RHRA 3WK8A 4KO1S 4B8YA 4DM4A 3MOIA 3QMWA 3TKAA 2ZWOA 2V59A 3ZGXA 4TPKA 3VGJA 1FZQA 4EL5A 5F5LA 3F67A 4BO5A 1YVEI 4RULA 4KTVE 3L1VA 3OFJA 5BT8A 1UMBB 3Q7TA 2BRUA 3Q7SA 4I50F 4A6XA 3PXDA 3HBMA 4X63A 3PD7A 2ZDHA 4FWBA 5AYVA 1GPMA 4NCXA 1KYVA 3E4CA 3G59A 4JKIA 3DTVD 1OH6A 4OF4A 4QATA 3UOGA 3V8NA 3A4VA 3G5AA 4O2RA 4HB4A 3TXXA 2X8AA 3KJEA 1I33A 2G71A 5FL3A 4PC1A 2OBYA 1UMCA 4LCBA 2GPNA 1BDBA 1TM1E 1TOAA 2ZJAA 4FZVA 4RGVA 3T9FA 4ALJA 3G5LA 5BQXA 1VLZA 1WQ4A 2RI1A 4WN9A 5ETJA 4EHDA 1EUCA 5CDSA 2HCTA 4YCBA 3PDUA 3RWBA 1LFAA 4ACBA 3E61A 3NI2A 1O8BA 4OXQA 3PGLA 1TCAA 3P0HA 4RMGA 2EJUA 1GZ7A 3H18A 4V1CI 1P3DA 1LPSA 2QAGB 3UOWA 3FVWA 5L6LB 1G8KA 1NKVA 5TQ2A 2JFGA 2F43B 2FRXA 3ICVA 4XIYA 1WKVA 2HA3A 1H2WA 3L7JA 2YN2A 3B3QA 1PQWA 1HUQA 1WD7A 1TZ2A 1M8FA 2WHPB 2PLFA 3OY7A 4RMJA 1EPUA 4OQ4A 4TRRA 3OOEA 3WWCA 1GPDG 3HCDA 4H77A 1CFJA 3PYMA 3PRHA 2HPAA 4DMLA 5JAHA 2AKEA 1EK1A 2WM8A 4I50B 4M38A 1PK8A 5FO1A 1C1XA 3GLTA 1WZIA 3L4EA 4GVLA 3TEJA 1GPWB 5LYJA 4GEKA 2XB4A 2HWXA 2WJJA 4B5KA 1X1EA 4TLDA 3UENA 3RUPA 3O8CA 3MYYA 1M2HA 2Y1XA 3TX6A 1O6GA 4JDPA 3CB2A 4F2PA 1L4LA 1HYQA 5JG7A 1QYVA 1VECA 3PHJA 4RKQA 5BN4B 1P7CA 3PPWA 3PQ8A 5J5AA 4ZCRA 3RLFA 4Z6KA 5GADl 2AOVA 1EKXA 2L17A 4HAIA 5B58T 4CCYA 3C6ZA 5IARA 2VHXA 2VHJA 4B48A 1SRRA 4G0XA 3E48A 3DO6A 3BB4A 1J0BA 2NUAA 3F5MA 1DADA 1FC0A 3G5TA 1E6KA 2WUEA 4KP7A 5CX4A 4WL0A 3ONEA 5JSYA 1R6XA 1ICIA 3ANYB 3WKBA 3TW0A 1OC4A 2PWZA 1GCIA 1UOOA 3FCEA 5EUQB 4UHHA 3U4CA 3VU9B 4JK3A 3X1JA 6ADHA 3F8SA 4YP9A 4LJAA 4QEDA 2GN4A 1NTRA 4K6KA 5L8VA 3C74A 4PSUA 4NNJA 3KLMX 2QN9A 4C29A 2AEMA 3GP3A 4CR6A 4L8LA 3TTXA 1YTUA 3QLEA 2IJGX 4GR4A 4EQ6A 1CIJA 1XU4A 2HT6A 3CO5A 2XMBA 2O2HA 2DUWA 4WH0A 4EW1A 3A06A 2QD2A 3N8KA 4IPTA 1YE5A 5DXJA 2CNWA 1Z73A 4UAJA 3GZ4A 3M1IA 3PRKE 4C21A 3D8BA 3WWEA 4PZYA 1SC9A 4QTYA 2BBOA 2BFPA 2BUAA 1EFTA 5TF4A 3F6YA 2NTYC 2A6PA 3UAZA 2XVXA 4D99A 4E08A 3ETDA 3USZA 5EEGA 2AQ8A 3ZV6A 1PW7A 5LQNA 1QHGA 4ESVA 2EWVA 5K0JA 2ZT6A 1DRJA 4MQ5A 4M1ZA 3OLXA 2YXLA 2C9YA 3GP5A 1N1DA 6LDHA 4M89A 2R7NA 4AN1A 3DLBA 4L8YA 4BKOA 2A0WA 3RUDA 2BDUA 1DC5A 1P31A 4KREA 2FX3A 3BK1A 4LG1A 5CMLA 3L18A 4D8XA 5BWOA 3WIOA 2DKOA 2VPQA 4JJGA 3MGGA 4F86A 2PJZA 4C04A 1EP3B 1HMPA 4ZEXA 4R41A 5KVQA 4Z5XA 2WNHA 3NV9A 2C8KA 5REQA 2E4XA 2FEOA 4DC0A 1UOEA 2VJKA 5MN5A 2B69A 4KX5A 3VO9A 1U5BB 3WSWA 4QGSA 1GU1A 2JLRA 3N0WA 3L4BA 3QI2A 1XHEA 2AC4A 1VBFA 3D6NB 4PX5A 3I4LA 4HGOA 4YJKA 5B2EA 3PE3A 3BMQB 1ZIDA 1ZC3A 3VPCA 2UZIR 2RAVA 4G8JA 4XKJA 3MWYW 4G5GA 1JL3A 4JA0A 3PFWO 4XEUA 4UBIA 4G0UA 3PK0A 4OHYA 3HA2A 4GEGA 1QGDA 3I9JA 2YDXA 2XRYA 1BHO1 5FTJA 4DBLC 1Y4AE 4JUDX 1UBLS 3AERA 5CURA 3C6YA 3SY8A 4A8PA 3C3XA 4CLOA 1WZNA 1N0IA 2P0EA 4U39A 2WWYA 3AEQB 3NBQA 1KR5A 2OQRA 4DXAA 1HK7A 1HQYE 1ZMOA 2W6QA 3CKYA 4N9QA 1QCZA 1UXOA 3I6YA 3NTQA 3IFSA 5IZCA 5DI9A 1MA0A 4B4OA 2FMUA 2FP3A 2RGGA 2FLKA 1RZVA 3OM9A 2H7VA 1HFKA 1EBBA 4INPA 4LEIA 5L7YA 3B5IA 1ZRSA 3ETHA 4XAQA 2YHUA 3G7NA 2VP5A 1H3EA 1E2BA 5KYGA 3VR4D 3AILA 3QPCA 1I7PA 1SBTA 2HRCA 2VOEA 1MC8A 2H2WA 3DF9A 1GFWA 5HUQA 4JBGA 4P4TA 4ZEWA 4BIIA 3UJCA 5SZIA 1T6NA 2VT7A 4YC7A 3C4JA 1KYZA 1PO7A 2DKNA 1PZHA 3IV7A 4CLDA 4C7VA 2EX0A 1RXUA 2BDEA 4XQGA 1V5IA 2TSYB 4GZ5A 4DSNA 2PUFA 5A4DA 3B6MA 3CZ9A 2QW0X 2HYIC 2C7PA 1N33B 4JL5A 2XCTB 3D3QA 3AVUA 3C3KA 3I9V1 3PNBA 3GRUA 1EVKA 3GDOA 4Y8VA 3UFBA 1ADBA 4BV3A 4U5QA 4NS4A 3GD5A 1HDOA 3MK31 1PFKA 1SXJE 3VVCA 5T7BA 1R3UA 2H92A 2IYNA 4MKIA 4DZTA 2Q0HA 4D9CA 4ES6A 1KL7A 1YB7A 1QLJA 2YXDA 2ZUVA 3VKUA 4BNKA 3UMGA 3G8AA 2VXOA 5JS1A 2HA4A 3ZJ4A 3TRDA 1XD2B 2JK0A 4RFSB 1PJSA 1ZG3A 2PUAA 2ZBVA 5CDFE 3GLRA 3PWTA 4TKVA 4YYZA 4NPCA 1KMCA 1CUVA 1Z5ZA 3RRYA 3AL2A 3A1UA 4CHGA 3RUCA 1EA5A 1TQ4A 1JHVA 1Z6YA 3GN2A 5DF1A 1NQVA 1GZ5A 2IYUA 4EO4A 2Q3CA 4FKBA 1SHTX 1CU1A 1LPBB 1Z0JA 2NO1A 5TMBA 3VHXB 2H4JA 3T7EA 5LQCA 5JNVA 3A7DA 1EFPB 3IPCA 4H18A 5EQJB 2GBCA 2HJSA 2VT3A 3KYBA 3ND5A 4XTRA 4EQ6B 1GQYA 2H1SA 3CPEA 4ED9A 4OATA 5AXCA 1NXXA 4E33A 4OK3A 1UP4A 2P4HX 3DC2A 2KM1A 4TL6A 1ISFA 2YWBA 4BMXA 5DB4A 4IFTA 2M2IA 4DMKA 4JP2A 4KHPB 4XGKA 2ONKA 3KDAA 2EZ8A 1ZQ1A 1U0SY 3QBVA 1ZXXA 4GPTA 4TXNA 5K3OA 4RTPA 1K2VN 1FU4A 1JDUA 1WUYA 1ZGHA 3ILHA 3O3MB 2BM1A 3DP9A 3LCJA 1TM5E 5H9VA 1COWA 3KX2A 1IEQA 3GFTA 1VG9B 3RT1A 2X1MA 5A4IS 1GRQA 1ZD8A 4FFOA 3QE3A 5K4AA 1MX9A 4I3FA 1K1EA 3UMVA 2F8SA 1OXBB 2E21A 1XPUA 2IPAB 1ZXLA 2QRLA 3BL6A 4LJLA 3KPVA 2QD4A 3ITDA 4NDZA 4NR0A 4HNQA 4X20A 2PD3A 3QWBA 4OOFA 2DT8A 5C8YA 3COVA 4OFBA 2X14A 1WULS 3D6JA 3GRKA 1K5DA 5GZ1A 1DGQA 2OBMA 1NN0A 1C3XA 4F93B 2GM5A 2WV9A 4KXQA 1VPDA 1LDMA 1OAKA 1XN1A 2HFKA 3T4UA 4BVLA 4XQCA 2BAGA 4P3OA 4LVCA 3FNQA 1EE1A 2EVWX 5LZ8A 5HHTA 3H9BA 2EGUA 3HBJA 3FWZA 4XLTA 2C5SA 5DVZA 2FU5C 5JRDS 1Q0TA 1YL6A 1X7YA 2EFHB 4GNKA 3M70A 5K3BA 1N9GA 3IA7A 1YB6A 3W3AH 1JBKA 1RWWA 1NNLA 4FNMA 4F56A 2Q5JA 1SBQA 1RAFA 3D3KA 1QB8A 3HCRA 4HS4A 3ZV5A 2NTEA 4FS8A 3C0KA 5C53B 2IX9A 2P3QA 2RGAA 2V4ZA 4QREA 1V11A 4ARSA 5CEFA 1Z63A 2PD6A 1EAYA 1O7JA 1L7NA 2PFKA 4UD6A 4IHAA 2D5BA 2PCLA 4MGYR 4Q12A 1OT5A 1Z0ZA 1E1CA 2GOYA 3N0VA 2GFIA 5IXSA 5LQDA 3GNLA 4N8EA 1HYEA 3OSUA 4UHDA 3UT5A 2N75A 4E14A 2WSMA 2X9QA 3O03A 1IQUA 1JEAA 5HZMA 4EAAA 4A10A 3AERB 3G8DA 1VKNA 4CL2A 1N9ZA 2JIBA 3LC2O 5CB4F 2B5WA 2KSQA 1YA8A 4IIBA 4ZDIA 3IC5A 3GHYA 2WTEA 3WWYA 2C8VA 2OY0A 1GG2A 1FP4A 2HA5A 2ZBQA 4PSAA 1VBNA 3KLPX 4ENWA 1NNSA 9ABPA 5IAAA 1GXSA 2QD1A 3E0XA 1RACA 4C4RA 1SUCA 2KW5A 4KFTA 4LRYA 1NBHA 2QMZA 1K7XB 1YNSA 3K0EA 1L5WA 1YRWA 1T8RA 4GOND 2WWHA 5FPTA 3CJTA 3L7LA 2ADFA 4XGNA 4RPGA 2MINB 3RLIA 4EKNB 4URXR 1PSWA 1R88A 2LGJA 4RDXA 2H2FA 4JUBA 3C70A 3N2LA 2F8LA 2HWUA 1GFZA 5KAMA 1MW9X 3AY3A 4PYKA 2A67A 2WTNA 2C3OA 5EHZA 2O8CB 4M54A 1B00A 1CY6A 1NQOA 4FMDF 1PK7A 4FDAA 4EKYA 1D2GA 4GDMA 4B45A 1M1YB 2G3YA 3LWDA 3JQAD 1KYYA 4WOPA 2J0SA 5HDBB 1OH7A 3RHTA 4OQLA 4HH0A 4MKGA 1O87A 1OLUA 2QVCA 3DE2X 3HB0A 3I01M 4MWCA 3MXOA 5IVIA 1YULA 5HUJA 1JWLA 3CF0A 4XM1A 3TDMA 1QP4A 4YR9A 4LZOA 3CJQA 1TC1A 1H1TA 2EJTA 2OYRA 2ZTSA 3R75A 3V4RA 2B92A 3H16A 3IMEA 3DAHA 4GQBA 3WNCA 3WKEA 4UNIA 4BGIA 1NKTA 1AA9A 1U7OA 3QH4A 3QUBA 4Z0HO 5I7HA 1C1DB 5CB4B 3E35A 2HBZA 4N5DA 4AX8A 2NZJA 2JEYA 4E5NA 3W9SA 4E2YA 4KHZA 1H4VB 4GPEA 2L19A 3FPFA 4BZQA 5HZHA 1ABBA 1MQAA 3VR6A 4RIGA 2HRDA 2H2HA 4TT3A 3LX4A 3PWZA 3REQB 4CTJA 3SQLA 1PS0A 1QIMA 5C46F 4Z9BA 3AP2A 3HJCA 2I6SA 1XQ1A 2L42A 3GGSA 3IQDB 2J9GA 4FW9A 2NV2B 4U2EA 3U3KA 4Q4HA 5F7XA 1BC5A 1GPKA 1EGVB 5HCUA 4U1RA 3KQLA 1QR2A 1I36A 4CEHA 2DCUA 1MV5A 1Y9AA 3OIGA 3NXKA 4FMDB 3RUFA 1YZYA 3P2IA 5INTA 3PXAA 2AN4A 3FKSA 4XB1A 4AS1A 2H65A 4Y67A 3FG9A 1IPEA 1L4UA 2HTEA 2F4VB 1CQJB 1G1MA 1UDWA 1EFVA 4ND7A 3AB7A 2REOA 2ECKA 3MUEA 4EQZA 3KQWA 4RTKA 4EUSA 4P34A 1IN6A 3BJIC 3CNNA 1E58A 1XKXA 3H2YA 3KHKA 4XJXA 2HWKA 3KO8A 5IKMA 4MHSA 2O7RA 3GBVA 7REQB 2GLTA 4WDQA 2V98A 1DXQA 3GPBA 5ITZA 3LRTA 3V7NA 1XU9A 1Z6ZA 3G1WA 4X7MA 2WTUA 3GAAA 4RABA 5HK9A 3AU8A 2AB0A 1Z4OA 5F1OA 4M9QA 4ETIA 4YV7A 1DOAA 4B71A 1G21A 1K66A 1N2CA 2ICAA 3MCAA 4AZ0A 4RLFA 3I42A 1S4MA 4CL0A 2VXBA 2AQKA 2QY6A 2WDZA 1OXXK 4OU4A 3CE6A 2I22A 3IDAA 2WI8A 4KW7A 2GS9A 3N1UA 1Z0UA 1AG9A 4NY1A 5TX7A 4D82A 1UEJA 2I6UA 3PQ6A 4RSMA 4CCSA 1ATIA 3VPXA 4U2KA 2O6LA 1C3OA 5K09A 3C6QA 4PLPA 3HRHA 1S2LA 1YS7A 2ECPA 4G9EA 4BO3A 4KIGA 4CEJA 1YONA 3QX3A 2CVPA 3D31A 2OD2A 2XAUA 2Y9PB 1WHTA 3BQ9A 3V1TC 2Q5IA 1A27A 1N6IA 4HGNA 2MYTA 3ANNA 4L9AA 4V38A 3FYDA 5FOXA 2H85A 5E7IA 5HDQA 4OI1A 2IS2A 3EZ9A 1V11B 1LTQA 2I29A 2NO9A 2DXIA 2FZ5A 2Q0SA 2B3DA 4AY2A 4OHBA 3T5AA 3JRWA 1V96A 4KQIA 3DV0A 3OQVA 3UMCA 1GSAA 1G8JA 1L7VC 1VM6A 3TUJC 3W9YA 6GPBA 2UUAB 3Q40A 1JKJA 2HQOA 2D1YA 4EGAA 5HGXA 2BEJA 2VG8A 3O6VA 1X39A 1UMDB 1QC5A 2CFCA 4RCVA 1W36D 1OYVA 4FJ2A 3E15A 4LX0A 3SF8B 4XPZA 3OQNA 4OLFA 2FE4A 4IOJA 2AK3A 4XIJA 2KS6A 4YRZA 1FP4B 1KAHA 2OFWA 3B9PA 4CKEA 1II9A 3ZHBA 2Q2VA 4EG8A 4ZI7A 3MRVA 1DJOA 1UQUA 5KVCA 4DYDA 3FCOA 2G8NA 4BU0A 1L7OA 3R6TA