3X2SA

Crystal structure of pyrene-conjugated adenylate kinase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
214
Chain Sequence
b'MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDCGKLVTDELVIALVKERIAQEDSRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLCEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Excimer Emission Properties on Pyrene-Labeled Protein Surface: Correlation between Emission Spectra, Ring Stacking Modes, and Flexibilities of Pyrene Probes.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr. mds42
molecule tags Transferase
total genus 73
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x2sA00
1KK0A 3EARA 1XXHE 4XWAA 1E0JA 3AKEA 1T6NA 2FF7A 2IC5A 5A5GA 1UBGA 1N6PA 1YRAA 3SHWA 3OHMA 4KSBA 2JLZA 4M1OA 2JASA 3ZLJA 1IOZA 1GL7A 4PSKA 3AF2A 1ESMA 3SJBA 3J81k 1W36D 1KNXA 3C5HA 1RPZA 4DIDA 1SVLA 4V0KA 3I61A 1UKVY 1XRJA 3TK1A 1T3HA 4TQ9A 4D4LA 2PJRA 4DLWA 1KDTA 5DLQC 1UAAA 2BHRA 3ZDQA 2F3TA 3FDIA 2GNOA 2NGRA 1WF3A 4I1SA 4B3XA 1DO2A 4DLXA 2MSEB 4HAZA 2VRWA 2OV2A 1RE0A 1SXJC 2O8FB 4Q4AA 3QXHA 1Q1QA 4FWTA 1E9DA 1ZM9A 1VECA 2ZR0A 2QAGB 3F0TA 1Y3AA 2GBLA 4ZO4A 2CMKA 3KX2A 2DPXA 4US1R 3R7WA 2H92A 3EZ6A 1US8A 2D74A 4EFNA 2V55B 4B73A 1YR9A 1PV4A 2XGJA 3ONWA 4IOKA 4G5QA 4LYHA 4POAA 1DE0A 1NVWQ 2Q3MA 4RZ2A 3K8YA 4YLGA 1E2JA 1L4YA 2ZRNA 4A0HA 4C4PA 3CZPA 1XEWX 3QENA 1R0XA 2JIZD 2IYWA 1VIYA 3FVQA 4TT3A 4CDGA 2LKCA 2EQBA 1E1RD 4UXHA 1RKBA 1P9RA 1XJ0A 5DNYB 4QC2A 1CXZA 3U6BA 2GAOA 4BFXA 1CS4C 3K0AB 2CJWA 3X1ZA 4ZI2A 2XNDA 4RY2A 4EKDA 3VR2A 2E9SA 2QORA 3DOFA 3R8FA 1W5TA 4Q4JA 4ZKEA 5EQTA 1NSTA 2GZAA 3RRZA 3UIEA 2PT5A 2C03A 1Z6XA 2HLDA 2QT1A 2XZLA 4D25A 2FMXA 4TMKA 3ADKA 5JMTA 2O8DB 2SHKA 4NMMA 4DCNA 1MV5A 5TB5A 2O8CA 5B2ZA 5AJYA 3CUEF 5FTNA 3TW8B 5CIWA 4R2HA 1E9AA 4O3MA 3LXRA 5TVKA 4LYFA 5K8UA 5CYPA 2OLKA 2UVQA 1UDXA 2AFIE 3WNCA 5JSZA 4A2QA 4WXRA 3VR4A 4L5BA 4DDVA 2ZRLA 3GJ5A 3QF7A 1EFCA 3KXKA 1OKKD 3LBNA 3SQXA 5IDVA 3O8CA 1UBCA 2ZRIA 3K0FA 5AK0A 4ZIRA 1QG2A 1VIAA 2W0MA 2OEPA 2VHQA 4CRWB 1U94A 4G3XA 3CO5A 3A1UA 1G4UR 5EE9A 2DR3A 2GETA 3SI7A 2F1HA 4PANA 3NBZC 4URWR 2IYVA 1H8EA 4TYNA 3GPLA 2OG2A 5FR1A 2FEMA 2QPTA 1YZTA 2ZR9A 1G1MA 5F2EA 2YWGA 1OFHA 2WJGA 1Z0IA 2R6CA 3CF6R 2QSZA 4Q03A 4UKDA 5F98A 2QPAA 4NYMR 5D3QA 1EGAA 2QMOA 5C4MA 4TYYA 2OCAA 4OI0A 2ONKA 3QVVA 2NO6A 4QOSA 1P73A 3RANA 4D81A 3MGCA 5EXSA 3U3MA 1W4AA 2FFQA 1NJFA 4ERNA 1XFAA 3I4LA 3RYTC 4B2IA 4QNRA 2NQ2C 3A1VA 4K46A 3HU1A 4BLTA 1S8FA 4WA7A 1FX0B 5G40A 3MAAC 3NEYA 3DM9B 1NN1A 1NBME 4DDWA 3O8BA 2FEOA 4DSUA 1CR0A 1N5IA 1OXUA 2ZRFA 2VHCA 1GRNA 5KSPA 2ZYVX 5FOSA 1GL9B 1DAHA 1GNQA 4GBMA 3HU2A 3K9HA 5DISB 1FQJA 2W2XA 5K8IA 4FMCF 1S9HA 1SVWA 2Q9CA 3QSYA 1NF3A 5AJXA 3CF0A 2ZI4A 5JWOA 2A5YB 3EXAA 2VL7A 2IS6A 1PLKA 1W0JD 2JDID 3UXMA 1A82A 1BS1A 1R7RA 4FI3C 4LK2A 5LD2B 1KTVA 1P2SA 4OL0A 5J40A 4C30A 1OXSC 1VHTA 4TMVA 1IXSB 5AWFC 4FXPA 4UNRA 5KSOA 5FTKA 2O8FA 4AIIA 3Q7QA 1G19A 3CNNA 1GKIA 1T0JB 1ZM2A 2QAGA 4KODA 3EZ9A 3RHFA 3THYB 1LS6A 3AVXA 2ATVA 2A9KA 5IF9A 1WCV1 2GJ8A 5HPYB 3ND9A 1KO5A 1TQ2A 4DXAA 3L8ZA 4OBEA 4X8MA 1KO1A 3IILA 5CDFA 1TQ4A 5C1BA 2O8EA 3KDSE 4S2EA 1KKMA 2BM0A 4B35A 1BMFD 2GEVA 1JPNA 4B3GA 1DO0A 2JA1A 1HEIA 2OBMA 2LKDA 1ZVQA 3EC1A 4L9WA 4PC2A 5C4GB 3VQTA 3I72A 1W49A 4OQXA 2RGXA 2ZUBA 3HYTA 1IHUA 3RABA 2CCKA 2BBOA 1G8GA 4B33A 1WRBA 4CEHB 4MITA 2F1JA 3K9NA 2AWNA 2VP4A 3WRYC 1SKQA 4W5WA 2BVNA 3H2YA 3K0AA 3AEZA 1G5PA 4DSOA 4FW9A 1LF5A 1P75A 2ZRDA 1II8B 3BD9A 3P32A 4N0EA 1Q1ZA 3F3YA 2CCJA 5B64A 4HI0E 1UF9A 1DELA 2O0KA 5HKKD 2O8DA 2Z0MA 4HZUB 1II0A 2R6DA 3TAUA 5GJBA 1HQCA 4XD7D 2ONJA 3QKUA 3BIFA 3C4JA 3CNLA 3MWKA 4PZZA 5HE8A 3WP1B 3CRMA 1KSJA 1SXJD 1XD9A 3A4LA 2OLJA 1GRRA 3ZJYA 3TLXA 4QJ3A 4BLSA 3DPUA 1W5SA 4OQLA 1DAIA 2GWHA 4MRPA 4AYWA 5J5CA 1QHXA 3B8HA 3BORA 1N0WA 4HZIA 1U81A 1CEEA 5UKDA 1CJUC 3VHXA 3K70C 1G291 3L0PA 3X1WA 1LS1A 1S3GA 1QG4A 2WJJA 1KJWA 2Z43A 2QBYB 3PEWA 2WIAA 3DMNA 1P2VA 4KLNA 1XTQA 2HXYA 4G5SA 1M7BA 2RCNA 4DLZA 1DEKA 3WBKA 3M4YA 3A58B 2J59A 1S4QA 1XEWY 4OQFA 4Q7KA 5FFMA 5KPJA 1XPRA 1OFIA 1XXHB 2BMEA 1IONA 2V1UA 1G20E 4B3BA 1FZQA 1PZNA 2YOFA 2Z6VA 3KTAB 2V7QA 4LV6A 1CJTC 3RS0A 3AVWA 1G3IA 1N0VC 1B23P 1CRQA 2AX4A 1U9IA 3B85A 4Q21A 3PUVA 3GLGE 4PPFA 2EYQA 2LCFA 1E2HA 4PO9A 4QBHA 4O0MA 4B3FX 1E4VA 2QT0A 1NMXA 3LV8A 2AN9A 1CRPA 5J4KA 3AP2A 1NN0A 2ZE8A 3W5IA 1NN5A 5IK2D 1GRQA 3GJ7A 1XJCA 3WYFA 1FX0A 2ZI7A 4PPQA 2VF8A 3BE4A 1JEDA 2NPFA 1NVVQ 4JLPA 3B1VA 1DAFA 2DBYA 4FMDB 1X1RA 4KSCA 4I1OA 3TE6A 1J90A 4KFRA 2QQEA 3MCAA 3O8DA 5FI0B 4OJKA 4C7OB 1Q21A 5D3MB 1E0SA 4Q5IA 4PC7A 4QM7A 4OI1A 2GEDA 2X2EA 4L8GA 4TMTA 4B76A 1MT0A 4PXAA 4QFMA 2UZ3A 3QXJA 5AJWA 2OFWA 2R8RA 2VP0A 5SZKB 5HZKA 4I4LA 2CHQA 1JQJC 4JLNA 4BRWA 3KQNA 3C15C 3C7KA 4CEJB 2OT3B 1E69A 2JJ2D 1CR1A 2ZANA 4LJ6A 3TNFA 2X19A 3JVUA 2VHTA 3DHWC 1NLYA 3MSXA 4UXJA 3ZS9A 4P0TA 1KDOA 3QXCA 4KU4A 1N6OA 2IYSA 3KFVA 3OIVA 2REXB 4RD6A 1T5LA 1G8YA 3TUIC 1W2HA 3A1WA 2BM1A 5AUNB 3ND8A 2OM2A 4JLMA 3CWZA 2GCNA 1TU4A 3WBJA 3SHFA 1LB1B 4I99A 3BFXA 4ILEA 1XTJA 2GJAA 2X1VA 2ZRKA 4JVNA 3KXLA 4PX9A 4A1FA 3R9XA 2A3RA 4R7ZA 5JS7A 4MGYR 3VU9B 1ZYUA 2KBEA 2ZS7A 1EFRA 2ZR7A 3SQWA 3L0SA 1HH4A 1U0LA 3B5JA 3A8TA 3LAWA 4PAMA 1ZD8A 1N6RA 4C0BA 3VTKA 2CLCX 3IO3A 3QEOA 2OSBA 2WJHA 4TTQA 5BQ5A 4OK6A 2ZROA 2C98A 1TQDA 2P5TB 2L0XA 3T15A 3W6PA 2O8BB 3BWDD 4TTPA 4W5HA 1E2KA 4Q48A 1L4UA 1II8A 2FSIA 4YXWA 3OFND 821PA 4ZKDA 3ICEA 3LQRA 2WWHA 4GZMA 1ONBA 2VBCA 1UADA 1Z47A 3U7EB 3LA6A 4HZUA 2X2FA 3QOFA 5KU1A 3DZ8A 2DWOA 1AKEA 2IHYA 3O8RA 1IN6A 2PT7A 2VA8A 2V6IA 2ZJZA 3B2EA 3B9QA 3ZZTA 4Z1MD 5L3QB 4GOJA 3RS3A 5B30A 1OH5A 3X1XA 4G5OA 5DYIA 3QY0A 3HYRA 2P6UA 4DT1B 1Q57A 4A4DA 5E7IA 1E32A 2J87A 4YMTA 2HF8A 6Q21A 4LGMA 2QTFA 4TZ6A 2EWWA 2HUPA 2XXAB 5FOTA 2PJZA 2JJ1A 2F3RA 4RD2A 5SZIA 3SYKA 2PLRA 4BZPA 2KBFA 4DLTA 1G16A 4F93B 2ZU6A 2WTUA 2QBYA 3A36A 3K09A 5TXGA 3LRPA 3CR7A 2QRNA 1IBRA 2C77A 2GF9A 1IN5A 2NIPA 3AV0B 3LDAA 5FI1B 3SJAA 2J0SA 3D3QA 1DARA 4ZDWA 1OHHA 3MMPA 4QHYA 1XXHA 1NLFA 1ETUA 1C1YA 4BFUA 3KTAA 2XB2A 2CXXA 4A0FA 2GDJA 1NY5A 3FFAA 2QE7A 4BFTA 1K5DA 2QZ4A 2ZYWX 3JZAA 4D2IA 1XTRA 2ZUCA 1XP8A 4ESHA 3Q85A 2PMKA 4HDOB 1LV7A 4AY2A 2IT1A 4C0SA 1CF4A 4JVSB 4RD4A 1VTKA 1ZIOA 5P21A 1OF1A 4EQ6B 5KOYA 2R9VA 1XD8A 2IYUA 2QI9C 3CW2A 4BPBA 1XMSA 5BN3A 5KO2A 4D80A 1W48A 4LPSA 2CL0X 3L8YA 3LQQA 4U5XA 3U7HB 2BBTA 1S2MA 5HTKA 4Q9IA 4E09A 1ZAKA 1J7KA 2VP9A 3GJ0A 1SXJE 2YJTD 4QKQA 4M1TA 2RGCA 3WHLA 4XVRA 3DMDA 1KK2A 4E07A 4L4UA 3K70D 1KAGA 5JECA 1YZKA 3OEHA 4C7OA 2GZHA 2WWIA 3EPJA 1JB1A 2BBSA 3BH0A 3UMRA 4IOJA 3FGNA 1SHKA 3B82A 4KV9A 1G21E 5B58C 2EU8A 2O0HA 3LW7A 4ZDJA 2V54A 2H17A 1FUUA 1M2OB 4DCTA 3NHAA 4HYYA 2ANCA 4LHXA 2QRZA 2C9OA 5FL7D 1GIAA 3VFDA 2KWIA 4LY6A 3RSLA 2DWPA 2K5UA 4CEJA 2AXNA 5HCIA 4IEIA 4ZI3A 4R98A 4C2UA 2FSGA 1JR3A 3AKYA 1ZNXA 5SZHB 2ECKA 3AF3A 3KJEA 1N5KA 4KFTA 4C0QC 5K8TA 1HT1E 3Q5EA 1W36B 2XAUA 3NVAA 1KMQA 4IDHA 4DUGA 1DAKA 1E2IA 3A6PC 3VMFA 5KTYA 3WMEA 2MSDB 1JXOA 3W6NA 3IHLA 1VYUA 4M1MA 1QVRA 3I73A 2WKQA 4Q4LA 4M9SA 4TMZA 4K8OA 2AKAB 3AVPA 1JJVA 1AQUA 4WBSA 4CT5A 3FKSD 1ZC4A 2PZEA 4A82A 3WNDA 1U99A 2OBLA 2IXFA 2NO9A 4JKYA 1QHGA 2CLDX 2HYIC 2C95A 2O8BA 3ZIAD 5DH9A 3CH5A 4IFBA 2YOGA 4IXNA 5JJLA 2C5LA 5CLQA 2ZIAA 2WICA 3QQ5A 3GEHA 4ESVA 4BE7B 1WBDA 1H65A 3AVVA 3H0KA 1EESA 4Q7MB 4BECA 1AS0A 2B7BA 4KVGA 4HLUC 4O25A 1TPZA 1XD2B 1KY3A 3K53A 3GJXC 1R5NA 3AF1A 4JJKA 1S0UA 121PA 3ZGXA 2QPOA 4UNQA 1I4TD 5L3QA 2XZPA 2ZAMA 5A4JA 4DT1A 2REOA 3K0SA 2HJVA 4U02A 3PFIA 1TX4B 2FWRA 2R6GA 4PC1A 4P4SB 3GLGB 4KBGA 2XOKD 5LBIA 2ZYUX 1XB2A 5TV2A 1KIMA 2I3BA 4M53A 4DB2A 4DSNA 3HPRA 4JLOA 1YHNA 3Q8XB 4UNSA 1FNMA 2C96A 2DHRA 3U61B 1IQPA 3TBKA 4TSFD 1DAGA 1E9SA 4TWZA 1P6XA 3AF4A 3BFVA 4NYJR 4DIEA 4AYXA 3NBFA 3QPWA 1QHHB 2QGNA 2V8OA 1ZP6A 1NBMA 4FCVA 4EUNA 5JI2E 1M1YE 4E22A 1F48A 2WOJA 4JSTA 4HB2A 1KO4A 4B6FA 3BAFA 1BH2A 1OW3B 2RMKA 3OF5A 2PZGA 3FMOB 1FMLA 2G1JA 3HP1A 2W6JA 421PA 1SVSA 2VF7A 2WWWA 4L16A 4A8JB 1AM4D 1JEEA 5FBWB 4C0KA 2GILA 1S96A 2DFKB 3GD7A 4AKGA 1JNYA 3ASZA 4F7WA 4NYIQ 3CKLA 3L0IB 3FMFA 4EQ6A 2JAQA 4BEJA 2ZRGA 1QVAA 2ZUDA 4PHFA 5FR2A 4DRZA 3QEJA 3LH5A 4BLRA 1OYWA 2VEDA 1E96A 3OEED 5HCNA 4HLQB 4RZXA 4DLVA 2JCSA 2IWHA 1XNJA 1ELOA 4M1KA 1K8RA 1MR3F 1RRGA 2CCGA 2ZAOA 1KI6A 1XZPA 4WAUA 5DIFA 5E95A 1NNEA 1KO7A 2D06A 1YJ5A 3DVLA 4DVGA 2GK7A 1UPTA 4EPVA 3RC8A 2V1XA 2WHXA 3KKQA 1HURA 5KDDA 3WHKA 3V4FA 3I1FA 2GEUA 3PUWA 4EFMA 4EJSA 2KE5A 1RRCA 1NMZA 1AJEA 3P1JA 1DAMA 2QROA 4IKEA 4QBGB 2IX3A 2FA9A 3I8SA 1CJKC 1KK3A 4DEXA 2KJQA 2IEYA 1HE8B 2RHMA 3QPVA 4LUCA 1NLZA 4NYMQ 2OO7A 4XSGA 1W44A 4IHQA 4DLYA 4V0NA 1XEXA 1R5BA 5DHAA 4IVQA 2F43B 2ZJAA 1UDWA 3ETLA 2HJGA 1Q3HA 4Q47A 2ZJ8A 5KPDA 1CJVC 4BZXA 2JLWA 1ZMXA 4RZUA 1X3SA 1N6NA 4CVNA 2WWXA 2ZRPA 1DG3A 3QI2A 5FOVA 2NMVA 1XEFA 3L0OA 4QRHA 3U5ZB 5J4VA 3U3JA 2HXSA 3SDZA 1U9IC 3QVUA 5HE9A 3TVTA 4FMBB 2YV5A 4LJ8A 3LBHA 1YR7A 1J8MF 2HLDD 1GILA 1G9XA 4DDTA 4GOXA 4IJMA 4KFSA 4G0NA 4RCYA 4LBVA 1IJFA 2MMGA 1Z0FA 4M1WA 1EFUA 4V0ME 1X6VA 1J8YF 2GVZC 4URVR 5BN5A 1XD2A 1E79D 2GJ9A 4PPGA 3CF2A 2DFTA 3AP1A 1T91A 3T1VA 1MOZA 2JLVA 2IA5A 1Z6TA 4PR0A 2RGDA 1KOFA 4Q9KA 1UEIA 2IYYA 1E2GA 1E2LA 1UBFA 3KKNA 3P27A 5L3SB 2AL7A 2JLRA 3KFXA 4URZR 1EXMA 4MRSA 4LC1A 3B9PA 5IHPA 1Z83A 4F91B 4Q9JA 4DCVA 3SR0A 4FMDF 5EE3A 1J70A 1S9DA 3L2OB 721PA 4P4SA 3VKWA 3GLGA 2LWIA 2WVJA 2P0EA 1H8ED 3EA5A 3CNOA 1R4AA 1IY0A 2ZI9A 1II9A 2WAXA 3G5UA 4OHYA 2ZQ5A 5E7MA 1RYFA 5EE5B 2P65A 3K1JA 2Q9BA 1YQTA 4ZCMA 4II7A 1FTSA 2A5FA 3C16C 2ZXUA 4B34A 2ZSFA 4RD1A 1QHHA 1N6IA 1XF9A 1OB2A 4V02A 4UJ5A 2IS4A 2JLSA 3E5HA 3OIUA 4HAVA 2JLUA 1SXJB 1MKYA 4OYHA 4F38A 4F4IA 5LPNA 1DPFA 2EFGA 2VSOA 3VHLB 4Z54A 5JBQA 1FTNA 1OXTA 4KYUA 1NP6A 4Q1AA 4AG5A 2JJ8A 2J0UB 1MO6A 4PC6A 1ZNZA 3AGQA 4TLCA 1P9NA 4X8HA 3W3ZB 4D0GA 3WYGA 1XDBA 1OJLA 2A78A 4URXR 3GLIE 4P4UA 4A8JA 1FP6A 3GJ3A 5JI3E 3U6KA 2XX3A 2P3SA 1F2TB 2AFHE 1AA9A 3SJZA 2WSSA 4TYWA 2O52A 3ZQ6A 3ZVLA 1JR6A 2H57A 1U90A 1E94E 2YINC 3QIAA 3DKPA 1EWQA 3M1IA 1HUQA 4NU0A 4C9BA 3S1AB 3LY5A 2ZJBA 3SOPA 3CWQA 5AR1A 2RAPA 1KSFX 1BYIA 3SBDA 3IKJA 4RFVA 1OH6A 4GSYA 4D6PA 2GXAA 3NDPA 1GTVA 1RZ3A 4Q7LA 2PCLA 2RGEA 4FCTA 3W6OA 4NCJA 4KO8A 2ODNA 4AWXA 3VNVA 2P2LA 4OK5A 4U7DA 1H8HA 4DZZA 3KJGA 1XCPA 2FNAA 3GEIA 4HAWA 2ZI3A 2EFDB 1JAHA 2QY9A 4DCUA 3QBVA 4G1UC 4TQAA 1T3SA 2OCYC 5FPTA 1IN8A 1LTQA 2AK3A 1BYUA 2FGJA 2ZYTX 5AUPB 4A2PA 2OHFA 4CF7A 1UBEA 3VKGA 3CR8A 3GFTA 4B48A 1SKYE 2F43A 3KQLA 1GFIA 1NKTA 3W8RA 1GVNB 3C5CA 4P4TA 1LFDB 2BMFA 4DC9A 2YNMA 1WXQA 3U7GA 1P72A 5TDHA 2AD5A 3KJIA 2A2ZA 1R0ZA 3VR5A 3LXXA 3NC0C 2JDIA 1ZCBA 4NZYA 1ZM7A 3DOEA 2H16A 4H1VA 1EWRA 5JWRA 3U4QB 2ZSEA 1UM8A 4GP6A 1C9KA 3K0CC 2J41A 1ZU4A 4IFEA 4QBFA 4KITB 4D4MA 3DDCA 1JAIA 2N42A 3EZ2A 4XWKA 5FOXA 1Z2CA 1ESNA 3EAQA 3RAPR 5EP4A 3F8TA 5L8VA 2BCGY 5EE0A 3DEFA 1RC8A 2Q3FA 1QZXA 4BUJA 2PZFA 1CKEA 1P9WA 4EDHA 2ZPTX 3NG1A 2XEXA 1MH1A 3NDBB 3P4XA 4HEJA 1XWIA 4KYIB 1G4AE 1ZM3A 2XSZA 4LBWA 1BOFA 2VP6A 3T5GA 2Q9AA 1N3BA 2J0QA 4B3DA 3NHBA 3A1SA 4MA4A 1CLUA 1GSIA 1OYYA 2D4HA 2JLQA 2WZQA 4A9AA 3RC3A 2WV9A 3Q3JB 3TJZA 5EZ5A 4KI0A 3WP0A 1KMHB 1OIXA 5L3SA 1A1VA 5KDLA 2ZS8A 5FOUA 1JJ7A 1VDZA 3BJIC 4GFDA 1X1SA 5C46F 2C2HA 1IXZA 2EYUA 4M9QA 5G53C 2QN6A 4NCHA 3T1OA 2J1LA 1P4SA 1RVDA 2G77B 1W0KD 2ZJYA 4NCKA 1WE2A 1E0AA 3SFVA 4JBYA 4TLAA 1OXVA 2J7PA 3T35A 2VH5R 4HATA 3VKHA 2VP2A 4WZBE 5LB4A 3CRQA 2BJVA 1WQ1R 2A5JA 4HLDA 4MGIR 4TL7A 5HKKA 4GRAA 1HV8A 3QBTA 3N70A 1N6LA 1OSNA 2EWVA 2GRJA 3SC3A 1O87A 4Q1BA 1Z0KA 3IPYA 1W47A 3IUYA 4PTLA 3WXMA 4WVFA 1T9HA 4MKIA 1Q0UA 1R8SA 2D2EA 2G0TA 2QQ0A 2OAP1 1PJRA 2I1QA 3HR8A 3TMKA 4HUTA 2J0UA 2BWJA 4JBXA 2ZE6A 4Q1EA 2C99A 3BK7A 2RHDA 2BBWA 4XTCS 4GMXA 1P5ZB 3QKSB 2DCUA 521PA 1Z2AA 4MUAA 5KNDA 1L7VC 1MO4A 2OXCA 1N25A 1F2TA 1KI1A 3LX5A 4B2LA 1OIVA 3BOSA 3KL4A 4N3NA 4QGAA 3KUCA 3AF0A 4IW3B 1EG7A 3KKPA 4PO8A 3TQCA 3U2QA 4AKIA 3L43A 4MDEA 2IWRA 3S1AA 2MMCA 4ABYA 1PVOA 2YWFA 4UNNA 5BWMA 2REBA 5KSYA 1XMJA 2GTPA 4KLZA 3BXZA 5DSZA 2C8VA 2KB0A 5JEDA 5BYKA 1G5TA 2P6NA 4OI2A 5FBVB 1N0UA 3ZD6A 1Z6YA 4DB4A 3IEUA 4OHWA 4LZZA 1SVKA 1A2BA 2GK6A 2NPIA 3D7MA 3M0EA 1KO8A 5IK2A 4EAQA 1UKEA 4M1SA 1CULC 2WBLC 1NG1A 2CL6X 4DCSA 2A7QA 4TMWA 5CB8A 4URYR 4LBZA 1OT3A 5EXXA 2QMEA 2CDNA 2WPDA 3THYA 4IDQA 1RRPA 3FMIA 2ZTSA 3PVSA 4RZ3A 1COWD 2CK3D 3K70B 1Z6AA 1M74A 1EFRD 3QG1A 4BEBA 2FPMA 2ZRCA 4CT4B 3A37A 2FZLA 3OAAD 4M4SA 1WP9A 2VQSA 2WKPA 5F9FA 2RB4A 1YZLA 3P20A 3HPQA 3CX7A 4ZV4A 1AQYA 3TQFA 4M22A 4BGDA 4DLRA 3IIKA 3U4QA 4QHSA 2H7VA 4EPWA 2JJ2A 4CEHA 2DWQA 1A4RA 2CLSA 4RFSB 2QEQA 4MYHA 1IAQA 1TL7C 4LX0A 2JGNA 2HT1A 1G7RA 1RIFA 2ZU0C 4JLKA 3AUYA 5TY0A 3BB4A 1KHTA 2DFLA 2WJIA 3MLEA 2WJVA 2QAJA 2G1KA 4Q1CA 1AS2A 2Q21A 5J4YA 4PSAA 4QGGA 3IPXA 1QDEA 2GCOB 4QGFA 4UQOA 5JHHB 3R9IA 4B2PA 2XZOA 4HB3A 3U44B 3FHOA 2B8TA 1KY2A 3PCRB 2PEYA 3TUJC 2ZRAA 1KSHA 1KMHA 5FBLB 4Q02A 4AKHA 4RD3A 1S1CA 1IM2A 1G8FA 4GP7A 4BQSA 1HTWA 3IBYA 4MRRA 3SNHA 1D8TA 3GLIB 1G41A 3H4MA 1W2GA 4OHZA 3V9PA 5CK5A 1ZRHA 4EJSC 1RFLA 4DWJA 1CTQA 3EX7C 4TYPA 2Q6TA 4TL6A 1OHHD 1E1QD 2DFNA 1Z0AA 3DL0A 5FTMA 3KB2A 1SQ5A 2ERXA 3SS8A 4A2WA 4JIMA 3W34A 4RSGA 4A6XA 4PZLA 2JLYA 2OCPA 3GJ4A 3ADCA 3OZXA 2YHSA 2GBLC 1NVVR 2ZETA 3TUZC 2ZSBA 4B32A 3GLFE 1ZNYA 4GPTA 5C18A 2QE7D 5EP2A 1OV4A 1I4LD 3KKOA 4K81B 2J5XA 4UNPA 5E4FA 5ANRB 2O5VA 1Z07A 3LLMA 1GOTA 1G7TA 3NH9A 4JYBA 3TSWA 3UMFA 4ZDIA 1RW4A 2CNWA 4H9GA 2VHUA 1J99A 1AGPA 5FL3A 2HV8A 2G0NA 2GHIA 1S3SA 1ZUIA 2ZEJA 3AB3A 4G5GA 4CYMA 1DOAA 1N5LA 4QHTA 4XWOA 1QHIA 3QKSA 4DLSA 3IEVA 4TQUS 1X8LA 1KI4A 2ZJ2A 4B74A 1FNNA 2ZVQX 2PMDA 3UATA 4YMVA 5FUXA 2F6RA 3NC1C 3EZ7A 4MH0R 2W6IA 4KXFB 1KNQA 2CHGA 1DAEA 1TF5A 2IBMA 4IEEA 3OEHD 3OE7D 4ASUD 4M21A 3IIMA 1SKYB 1EX6A 2VP5A 5EUQB 1VYTA 2PH1A 1F6BA 1N6HA 3EWAA 1N6KA 3HJNA 4S35A 4D4JA 5DN6D 5D3MA 1NJGA 5JJIA 2F7SA 4Q01A 2ZVPX 2CVFA 1XTKA 5GVSA 1WMSA 1GG2A 2Q3HA 3EW9A 2GXSA 4YMSA 3QE0A 2RGNA 4HAXA 1JR3D 2OUKA 4FWIB 1VCIA 1IXRC 2AKYA 3B60A 2FN4A 5GJCA 2H1LA 3GFPA 2G88A 5AJZA 3BH7A 3K9LA 4DUGD 1Q3TA 5CK4A 1QHSA 2ATXA 1QHNA 4JYCA 3QKTA 3B1XA 1XMIA 4Q18A 4TLDA 2J45A 2EFCB 1KJYA 4V0MA 2FE4A 3THWB 1KI7A 1P2TA 1XPOA 3LD9A 3C41J 4DLUA 4PHHA 3VU9A 1ZU5A 4YDSA 2I4IA 2Q0HA 3LVQE 2CHVA 1VG9B 2IW3A 2OILA 3FE2A 5JWHA 5J47A 3UMSA 4Q7JB 1K6MA 2ORWA 2W2VA 3N2IA 1E2PA 2CVHA 2WOOA 4AC9A 1MO5A 1US8B 1TMKA 1P60A 3HR7A 3WNBA 3MUFA 3IGFA 4GOKA 1G7CA 1L8QA 5E3HA 4RFSA 2ZJOA 1AZSC 3VAAA 5FPKA 2ZRMA 2FU5C 2WAYA 1CR4A 2HDNB 3LO5A 4TMXA 1YE8A 3W8NA 3QXSA 1ZM4A 2GZDA 4M2LA 4FIDA 5CM8B 4WZ6A 4H1UA 2ZM5A 3THXB 3IQWA 5EZ6B 2IYZA 4QNMA 3SBEA 4OI4A 4JMPA 1TF2A 3BC1A 4HDCA 3GJ6A 3OESA 5JZVA 4LV5B 3AGPA 3AP3A 3CONA 3PITA 4PQYA 3U44A 4P32A 4TTRA 2D3WA 2FSHA 4OJQA 1W46A 4UJ3A 1R10A 4YC7A 3AKDA 3FKSA 4BFVA 5HR5A 3CPJB 2VIIA 5IRCD 4B47A 5JJKA 4N1AA 5J4HA 3GJ8A 3GLIA 5FPSA 1R5OA 3NTUA 2N1BA 4Y0AA 1G8PA 4PQRA 2XXAA 1BKDR 1HY3A 3GQBA 4AURA 1UKYA 1NBMD 1E6CA 5L3RA 2QMUA 5E7JA 3REFA 4DKXA 4TYQA 1QF9A 3NWJA 3MFYA 3SZRA 3KQHA 3DZDA 2QAGC 2ZI6A 1KSGA 4JVMA 3CRRA 3LVRE 3X2SA 5CITA 4JS0A 3K0FB 1D2NA 1DS6A 2W6JD 1CP2A 4PPNA 4RJLA 4B71A 8OHMA 1T0HB 4QJ5A 1HT2E 2IF2A 3HDTA 4AK9A 4QXAA 5H68A 2W83A 5DI3B 2ZRJA 3AVYA 3TH5A 3PR1A 4HUQB 4URUR 1Q20A 2F55A 2IS2A 1GKYA 2BJWA 1KKLA 3T06B 5JHGB 1CJMA 4M8NE 4BLOA 1FQKA 4BFSA 4TSFA 2X77A 2ANBA 1JBKA 4JLDA 2FV8A 1T5IA 2PEZA 2A30A 4IDPA 3DKVA 2ZRHA 3BFKA 1OLOA 1T4GA 1W4RA 3AVOA 1G7SA 4OQNA 3I5YA 2CE2X 1J2JA 1XJQA 4XH9B 5FTLA 3SYNA 3I5XA 3PENA 2GCPA 3R9WA 4R9UC 4JSYA 3EIEA 1FP7A 1M34E 1E2DA 4LHZA 4OHXA 3W90A 4G5RA 4EPTA 4P33A 1WB9A 3MJRA 3NBXX 2BDTA 2G83A 2RGBA 1N5JA 3U3RA 1E99A 2DY1A 4Q66C 4W5JA 3IBGA 4NTZA 4EIWA 1QRAA 2XJ9A 3VX3A 2R6AA 2YZ2A 3M6AA 4PC3A 3RRYA 3SEAA 4DBLC 4UXIA 4A36A 3Q9LA 5FH9A 3OEEA 3UKDA 3B7GA 3DO6A 1D2MA 5FUYA 2Z4SA 4R2IA 2WSMA 4OK3A 2D62A 3FHTA 4M9ZA 2VYFA 3CB4A 3G0HA 4YMWA 4TL8A 5EE1A 3ASYA 3B1YA 3W9YA 4ZCIA 3THWA 221PA 4TT3D 3RNLA 2BEJA 4MGZR 5EUMA 4LCBA 1P7CA 1RRFA 1VCOA 1VKJA 1Z08A 3MG9A 1Z06A 1ZC3A 2OE2A 1T8TA 1KDRA 3B1ZA 3W5JA 4XTRA 1GKUB 4M0LA 4E5UA 3KZ1E 5AUOB 1E3MA 2XNDD 3ZVRA 4MDFA 2QTVB 2YKGA 1U8YA 3B13B 4LHVA 4AI6A 1EK0A 1SHZA 1YKSA 4OKSA 3THOA 1YZQA 3AKCA 3QUSA 4LRWA 4LYJA 3I62A 1VG1A 4CW7A 4R71A 1HQYE 4U00A 2O8EB 5M04A 4YMUA 5EP1A 4NH0A 4P31A 1R0WA 2VTKA 3BB3A 1Z22A 1R6BX 3TW4A 5HZHA 5DO9A 3REGA 4ZDKA 1Q22A 2KI5A 3THXA 4JLBA 2ZE7A 3D8BA 4D4KA 3ECCA 4GI7A 3IQXA 3SJCA 4ITRC 4MYUA 3GLFB 2IYRA 3PIRA 3KJHA 1MO3A 2B7CA 1AK2A 2JLXA 3HWSA 2GKSA 2JIZA 4XOIA 3T5DA 3JZMA 1YU9A 1E1RA 1JR3E 1LW7A 4NPHA 2EVWX 4MYTA 3LNCA 2J3EA 4QG7A 3AQ4A 5G41A 3CBQA 3L82B 4KAXA 4TL9A 3TRFA 2OBNA 4LJ9A 4MRVA 1PLLA 1D6JA 4PFSA 5AJVB 4HSEA 2ZSDA 4F92B 3MJHA 3CH4B 3IIJA 1XX6A 4NYIR 1OH8A 3GLHE 4QBIA 5H8WA 3BERA 3CIOA 2AWOA 2PBRA 4LDJA 3C14C 5LD2C 1Z8FA 3Q5DA 2OAQ1 1E79A 1XMVA 4X8OA 4CZ2A 3CM0A 3BB1A 2FFHA 1JQLB 2Y8EA 2UZIR 5JEEA 3TSOA 1S1MA 2AR7A 4KFUA 2NOAA 1ZUHA 1OKKA 4HDQB 2EFEB 3RS4A 2FOLA 5DI3A 1X86B 4EPYA 2H8KA 3W3AA 1DADA 4WW0A 2WSSD 1ZJ6A 5FPYA 4PHGA 3V00A 1XTSA 4HUQA 1U0JA 3AUXA 2IEZA 3LBIA 1NN3A 3EASA 4DSTA 3HU3A 4MKGA 4AG6A 4IRUB 4GT1A 3CLVA 2ERYA 1OXXK 2I1VB 1E0KA 4YQFA 2JATA 4IDOA 2RGGA 1U2RA 1W4BA 3VR3A 3X1YA 2FJUA 2ZS9A 4CEIB 3D31A 4GZLA 1X8JA 2BOVA 1TU3A 4C0AC 2CL7X 4JT4A 4F4CA 3N2EA 2GJKA 2NTYC 2J46A 1NRJB 5BW8A 5B57C 1ZD1A 1H8HD 2QTHA 4HAUA 3B1WA 2ODBA 3IDQA 5JFGA 2J7KA 3BRWD 4JZKA 4LI0A 1MRSA 2PX0A 4JL8A 5EJEA 4Q19A 1W1WA 2NZJA 2RKOA 4XSHA 3ZVMA 3P4YA 2ASEA 4HLUA 3PEYA 1E9EA 3UPUA 3CPEA 4PAOA 3KKMA 1NG9A 1GM5A 2F1RA 1K5GA 4GMDA 1KDPA 3AVTA 4LC0A 3PUZA 4E03A 2GF0A 4WIAA 1JXMA 2PCJA 4LYAA 1LVGA 5G3YA 1ZW6A 3ZVNA 3TR5A 1VMAA 1JI0A 4MQBA 2Z4RA 3ZZUA 2A5DA 3PEVA 3E2IA 2GA8A 4RD0A 1TEVA 1P3JA 2C9CA 3B6EA 3K09C 3MD0A 3T61A 4C3ZA 5KYKA 2GXQA 2IS1A 1QBKC 1XU4A 3UG7A 4FD2A 1M7GA 4A6PA 3KUDA 2H5EA 2PL3A 4M1YA 1HA3A 1NKSA 3CPHA 2NO7A 1W0JA 2R2AA 1Z28A 2DYKA 4Q9LA 4WZAE 2IUSA 3FHCB 4BLPA 3UWKA 4A0RA 5SZJA 3GP8A 1TNDA 3RWOA 1OE0A 5L3VA 4NONA 2IYLD 3PEUA 3ZH9B 1U8AA 5FTJA 1TUIA 5C2JB 1Z0DA 3H86A 2R62A 5CIQA 2AD1A 3ADBA 3G82C 3A4MA 1LNZA 1I2DA 2VSXA 2XSZD 1E2EA 4Q4HB 4RCZA 4LV8B 4V03A 3EPLA 1G3QA 4NCIA 3ZS8A 2VHJA 1GWNA 1FOEB 1PLJA 1YZUA 3RS7A 2NO1A 1BMFA 3PXGA 5BYJA 3QKRB 4HB0A 1JECA 2YWHA 5FUWA 3GLFA 1WA5A 4YDHB 2OZEA 3SFZA 2MSCB 4LJAA 3U3KA 2WWYA 2VSFA 1UEJA 1NI3A 4JLJA 4ON9A 1D2EA 1KI2A 3CX6A 1NVUQ 2J7PD 3T1QA 1EX7A 3TGPA 1B0UA 1KI8A 3EWSA 2J0VA 5CJPA 5JRZA 2ORVA 1N2CE 1IJEA 4Q1FA 3ZYCA 2V9PA 5CB6A 1A2KC 3FTQA 1TUEA 4CGZA 2RGNC 4KBFA 2N46A 4X8LA 3R8CA 2R6FA 3KQKA 1F3OA 2C78A 3LW8A 3WY9A 4LPKA 1G3UA 1DVRA 4JL5A 1G3RA 1VG8A 1WDTA 5DE3A 5FBRB 4XD7A 2V7QD 2ORIA 4V0LA 3PG5A 1IN4A 4WOPA 4DHEA 3EA0A 3GMTA 1SXJA 1AN0A 2WMOB 2Z83A 3ADDA 4QL3A 5KDOA 2NO0A 1LY1A 2KSQA 2B92A 2A5GA 4LJ7A 2V3CC 1XBTA 3AVQA 2VO1A 4L15A 1G6HA 4Z51A 1W0KA 3RVBA 1IN7A 2YVUA 1Z6GA 4DJTA 3QG5A 1T3LA 3EIHA 4JJZA 4GNKA 4B75A 1FW6A 1GL6A 1SULA 3VNUA 2X8AA 3H84A 2PX3A 5JCPA 2QL6A 3U3OA 3WYAA 2IUTA 5FUVA 4ARZB 4KJZA 1YRBA 3X1DA 4C0LA 3U7FB 4P3YA 1R8QA 1D9ZA 1TADA 1C4OA 4CEIA 4BFYA 2GAAA 1GNPA 4JVLA 2HCJB 2OESA 3GFOA 3ZZ0A 1F2UB 2YWEA 3BBPA 2IYQA 2XTNA 4M9XA 2PLFA 2XTZA 4I1UA 4EPXA 3Q7PA 1IY2A 1AZTA 1X8KA 3TKLA 5JLJA 1E2NA 3A4NA 3EZFA 2E87A 1VCMA 4JLVA 4FCWA 1D5CA 3EPHA 3BGWA 1SVIA 2W00A 5AUQA 3UK6A 1L2TA 2V4ZA 4IOLA 4PQFA 1SVMA 4NE2A 4HLCA 2WIBA 2QG6A 4MUBA 4V0OA 2WPDD 2FG5A 1E9BA 4F4JA 1RJ9B 3RLFA 2WM9B 4Y0VA 1Q44A 3NEJA 2ZI5A 4J0QA 4EFLA 5TMPA 4LJ5A 1U8ZA 4FN5A 2R44A 2DB3A 2FPKA 2RGAA 1G6OA 1IY1A 1SZPA 3CX8A 3IHWA 3C8UA 1GDDA 1T8UA 2IL1A 2ZE5A 4BLQA 2IXEA 4C2TA 2E1RA 2QMHA 4QJ4A 4ACAA 3U60B 4Q9HA 3VR6A 4XVUA 1CU1A 2HF9A 2VLIA 2BKEA 5GVRA 2JEOA 4NDZA 3TAHA 1DG1G 1ANKA 1I2MA 1KI3A 5GJVC 3T34A 1TQ6A 3V4RA 4C0HA 3WRXC 4RVCA 2B6HA 1YZGA 3BH6A 3P26A 2EFHB 3QXXA 1M6NA 3FKQA 4QGHA 4ACBA 4YXWD 1TF7A 4TZ0A 2D7CA 4EPRA 4IOMA 4MRNA 5CLLA 3N5CA 2YC4C 2XB4A 2OFXA 3ZD7A 3GLHB 3FB4A 1COWA 2CK3A 4NCNA 2OFOA 4Q4HA 3KXIA 2P6RA 4US0R 2CBZA 4US2R 1TTTA 3O47A 4MYCA 3FWYA 1OH7A 3OAAA 4KHZA 4W9MC 4A0GA 2FX3A 3QKRA 4JT2A 3DM5A 3I8XA 3TVDA 2WWFA 5G3ZA 5EP3A 4FMCB 1R2QA 4D26A 1E4YA 1HYQA 2HCBA 2V6JA 4BZQA 5KNBA 1ODFA 1ZNWA 4NL4H 2JJ1D 3LLUA 4N0DA 1GNRA 1VCNA 3EC2A 5K8LA 2FH5B 4XJXA 1MRNA 3PQCA 2NZ8A 4NP6A 3RWMB 5ELXA 5CDFE 4BRUA 1UFQA 5F3WB 1P62B 1HE1C 5KHOC 2FDCA 1ZD9A 3PV0A 1NY6A 3OFNA 4MKFA 4PO1A 5KUTA 3OIWA 2AK2A 2WKRA 3QF4B 4IXMA 1VPLA 4JL6A 5IT5A 4BWYA 2EW1A 3VX4A 1SVOA 1AIPA 1UKZA 2BMDA 1E2MA 1GUAA 2CNWD 2YOHA 3RSOA 4Z1MA 1BIFA 2UKDA 2G9NA 3PJRA 2IHBA 4D0LB 3LFUA 3EIQA 1KGDA 2YYZA 3SN6A 1W36C 1Q1BA 4LJ4A 3FPAA 4XIGS 2FFAA 621PA 2GVDC 4LWZA 4LSGA 5JRJA 1R0YA 1TEXA 5A0FA 3Q72A 4MGKR 2W6ID 1ZIPA 3I92A 2B21A 1E1QA 2XJ4A 4JKIA 1E2QA 5DHFA 3E1SA 4FINA 2R65A 3I3SR 2C04A 3TSZA 1AS3A 3K9GA 1AKYA 4ARZA 2CEAA 2ZJ5A 4TLEA 4D82A 3WMGA 1YR6A 2TMKA 2QP4A 4OQMA 4LBYA 4O2RA 2GESA 1Z3IX 1WBBA 1G8HA 3K0CA 2IK8A 2G6BA 2YC2C 4NBSA 4B43A 3OIYA 2FZ4A 4Z8XA 3T1TA 4A92A 2B8WA 5H70A 4B6EA 1MABB 1CR2A 1YR8A 5LB2A 3PUXA 4DEYA 1F2UA 2HYDA 2QSYA 3FFBA 1GP2A 1BO6A 1KYIA 2WJYA 1XCGB 4YONB 5GJWC 2C9YA 2W58A 2FGKA 3K0EA 3WMFA 4CIDA 1LF0A 2F9MA 4NYJQ 3KB1A 3UWOA 2D2FA 3A1TA 4LHWA 5FPHA 2ODWA 3RS2A 4PAQA 2QM8A 3AH8A 1G17A 1P61B 3NXSA 2OXRA 4RKFA 3SU8A 1KI6B 2HEIA 1RJ9A 1O3YA 3QJYA 1ZINA 5H1YA 3FOZA 3SE0A 3RDPA 3OE7A 4ASUA 2BV3A 4MKHA 2ZITA 1G3MA 1QHYA 2QA5A 2QGZA 4LOAA 5LDDC 1AGRA 2FSFA 2GJSA 3UG6A 4EJSB 3TR0A 2NG1A 1XZQA 1Z5ZA 5DN6A 2BIFA 4GL2A 1XPUA 1RYHA 4ZCLA 4JLAA 5FOWA 2ODEA 3AM1A 3CRVA 3MWYW 1YVDA 4BFZA 3CZQA 3F5FA 1JALA 4Q4AB 4O2LA 3EG5A 3T12A 3LWNA 5FL7A 5KNCA 2BC9A 1VYVA 4B3CA 5BXQC 4LJYA 3R7WB 3FYHA 1XEXB 4C0JA 1GAJA 1CIPA 1G18A 1XTIA 2ZRBA 2P5SA 2HT6A 2BKUA 2RH5A 2W2TA 3TIFA 4HAYA 4A8JC 2G3YA 1ZUNB 3NKVA 4GDFA 4D0NA 4IVRA 1PUJA 2FFBA 3GLHA 3H1TA 3MWLA 2WWGA 2BMJA 1NIPA 4BASA 2IF0A 1NIJA 3FMPB 1P2UA 4I81A 3RS5A 2GCOA 1UJ2A 1FFHA 1OFTA 2OCBA 4HB4A 4NKRA 4RKEA 4BFWA 4AKEA 1FL9A 1VHLA 1W7AA 5FBQB 3R20A 1OB5A 2QNRA 1FMJA 2CJWB 1DBSA 3I32A 4Q1DA 5JCZA 3B78A 1M8PA 3SYLA 1G64A 4Q4JB 2QUZA 1EFTA 3NH6A 3KQUA 2D7DA 3CRW1 3ZIAA 1Z63A 4L9SA 4DDUA 4ZPXA 2O8CB 2XITA 5CM9C 5DI9A 5DYGA 1E9FA 2AXPA 2F1IA 5TARA 5F9HA 2WMNB 2AHOA 2XTMA 2BCJQ 3LX8A 1DTSA 1OIWA 1NSFA 1ZBDA 3QF4A 2IUUA 3MWJA 4QM6A 1TAGA 1Z0JA 3EPKA 1V43A 5JSZB 4AYTA 4Q00A 1F60A 3GEEA 3MRSA 4PHTA 3ZQJA 1SGWA 3NBYC 1CBUA 1KZGB 1OFUX 2F9LA 1KAOA 1Q1EA 4NHOA 4ZIRB 1NVXQ 1KJZA 5EXTA 2GXUA 3AVUA 1KK1A 3QPUA 2QP3A 1EFHA 2W0SA 4W7SA 1V5WA 4Z8YA 4LHYA 4KVAA 1E9CA 5KSZA 2IYTA 4IDNA 2H18A 1ZCAA 2XOKA 5CJ2A 3PUYA 5GADl 2J9RA 4AD8A 2FPLA 5EXPA 2XNSA 1GITA 2QU8A 4PSVA 1YZNA 3ICQB 3BS4A 1Z29A 1PUIA 1VG0B 2QENA 2Z5FA 3GCGA 4TN1A 4XVQA 2O0JA 4TLBA 5J4LA 1E2FA 2CE7A 2IXGA 3IO5A 4KCGA 1G5RA 4G01B 3RRMA 4I1VA 1E9RA 1M7HA 3RRNA 1U98A 2ZSAA 2ZREA 1GZSA 2VPPA 1D9XA 4PZYA 5CYOA 1A5TA 1U0HC 2QP9X 2P67A 1NMYA 1Q12A 1MABA 1OPXA 1NL3A 2QM7A 5JS8A 3VR1A 4JBWA 1FUKA 1E98A 3QNUA 1JPJA 4B44A 3NIBA 5BN4A 4A15A 1FPMA 2IYXA 4IVPA 1KZ7B 4WXPA 1KI9A 3D6TB 1Y63A 5DGXA 1I4DD 3UANA 1F5NA 3E70C 1A7JA 2BEKA 1W4CA 1XCMA 4OHVA 3JVVA
chains in the Genus database with same CATH superfamily
3A31A 1KK0A 3I01A 3EARA 2H06A 1XXHE 2YRWA 1C3OB 2EEPA 1T6NA 2R5WA 3IB6A 1YRAA 4UTRA 1A0OA 3C6MA 1OGJA 3K32A 3H9EO 1GUBA 1W6RA 2DOKA 2E1PA 4MULA 4KSBA 3WGNA 3OQMA 1BXZA 3N8HA 2JLZA 2XMSA 1FE8A 3M6MD 2JK0A 3AF2A 3GRCA 2HRBA 4DIDA 1PR0A 4V0KA 4HMPA 3L8EA 3AHGA 1D0VA 2Q4OA 3TZKA 4D4LA 3RUIA 4ZRMA 3DVAB 2ZGVA 1KDTA 1SMKA 4R2XA 5DLQC 3U09A 3FJYA 1ZWKA 2NGRA 4MIKA 2C7QA 4YB8A 4KKXB 4RPLA 4FYXA 4MZXA 2VRWA 2P27A 2GM5A 1HEYA 2OV2A 5KKNB 3AR7A 4BQIA 2VYVD 3CLTC 3D8TA 4WCVA 1VECA 4H18A 2HH9A 1Y3AA 1XLTC 2P4HX 4HFNA 4QLOA 4CM5A 4US1R 3G0OA 3BA6A 3EZ6A 3F9CA 3BZUA 3WZLA 2D74A 4EFNA 1VJDA 2I9PA 4NZZA 3OZIA 4HJRA 1YR9A 4L0QA 2WFZA 1JMVA 4NK5A 2ZJ4A 1L5ZA 5JAZA 4MUYA 1OYVA 5CDGA 1NVDA 2EP5A 3N8IA 1S8NA 3KQOA 1ZXXA 2XCIA 4HVTA 4KH1A 4R6XA 3IMKA 3QENA 1RI5A 3UXYA 4P0QB 1Y7TA 1XHEA 2DBVO 2IYWA 3MGAA 5AKIA 1VIYA 2PG3A 1QFZA 1UH5A 2P69A 3HB5X 4TT3A 1U65A 3O2SB 1P9RA 1GEEA 3SSOA 1CR6A 1XJ0A 4YRTA 2PYDA 4CMAA 2FRXA 4BFXA 1CS4C 4GX2A 3E4DA 1DX4A 3ACBA 4UU8A 1YFZA 1HBJA 3KOXA 3QFSA 4H3HB 3X1JA 3QHPA 4MS1B 3L0CA 4ZI2A 1M1UA 3C1UA 3P2JA 4RY2A 3UFXB 3VO1A 1HYHA 1ZKDA 5JY6A 4MYRA 5KC9A 1KU0A 3R8FA 3S6JA 4LGVA 3UW3A 3QGMA 5EQTA 3T3NA 3UIEA 2PT5A 2QT1A 5K0CA 4D25A 1VBKA 2FMXA 4D8YA 3ADKA 4KE7A 3UT6A 2EX0A 4G2TA 5WRFA 1MV5A 3IOEA 3U1TA 2DUWA 5DLYA 4BNGA 4DCNA 5HRUA 4ARCA 1VBMA 3CUEF 2O8CA 1N8KA 4L3OA 4O3MA 4Y6RA 4BO4A 4LZPA 4DIUA 1GD1O 1IFXA 2C59A 4HNAA 3SSNA 3TGWA 3W9BA 3WNCA 3HMQA 1UDXA 2AFIE 3KTOA 5F52A 3VR4A 4EO4A 4DDVA 3SF0A 1WABA 4Q12A 3IBCA 3LBNA 5IBRA 3SQXA 5HKAA 5IDVA 3BICA 1VMKA 1C8KA 1R6TA 1WUTA 5K3AA 5LXTF 4PTYA 3H83A 4LW8A 2HBRA 4ZXFA 1VIAA 3CZMA 3VHXB 3UM9A 5FHQA 5K0ZA 3P9KA 1U94A 3BIXA 3NETA 3ROGA 2XKBA 3EZNA 3HACA 3PNQA 2VRCD 2W48A 4RHYA 2XF2A 4UM8B 2WHPB 2CVZA 4B4UA 4W5OA 1JTEA 2F1HA 3MB8A 4PANA 5FPPA 2BFCA 3TCKA 4EA8A 1EK1A 1GLGA 3AT1A 2AFRA 3IEMA 1K89A 1Q19A 1A77A 4FGJA 4XFDA 2FEMA 3EQ7A 2NV2B 3ZOZA 5LP6A 2EW8A 2MYTA 1G1MA 5DCYA 1IK4A 3SHVA 4RJJA 3BCUA 4DGSA 1W52X 5IANA 2AYXA 2QSZA 3U0BA 1NWHA 3AR2A 2IEIA 4BOYA 1YBFA 1YS1X 4QT4A 3JQ6A 1RBYA 5ECYA 2OCAA 5A9SA 2ONKA 4QPCA 3ZXIA 4URFA 5AKLA 2X9QA 2NO6A 4HTFB 4KIFA 2BLLA 1VP9A 4CKEB 3MUNA 2F62A 4UU0A 1W4AA 3A2MA 4MVWA 2PLAA 1Z26A 3QXGA 3PGA1 1XFAA 4RZIA 4N39A 3OZUA 5EKSA 4B2IA 4ZAVA 4DWWA 4ILKA 4L22A 2PVSA 2E49A 3OCVA 3TNJA 2W98A 3HU1A 4BLTA 1UC4B 2ZTLA 4FE4A 1NOIA 3AEYA 3LIIA 4MGEA 1PL8A 5G40A 3MAAC 1F7VA 4MHTA 1G5IA 2VAXA 4LWPA 5F3WB 4Z0PA 4BTEA 4QTYA 3ICOA 3STVA 1N5IA 3PNSA 4U63A 4HGZA 4Q3DA 1GRNA 3UHFA 3WIVA 5MN5A 2ZPAA 1L7AA 4Q7EA 1RIIA 1S2GA 4AJOA 3G2QA 3HU2A 5ESRA 3S8YA 3L04A 3G6WA 4OXQA 3BN3A 4D9HA 3IE0A 3QSYA 1R37A 5HF8A 2IH2A 1NF3A 3D81A 4GWLA 3IERA 1AK1A 1XMPA 3BHMA 1QU3A 2VL7A 1NBAA 3EF3A 3ENZA 3WGHA 3DVAA 3QVOA 3UXMA 5BR1A 2LNDA 1BS1A 2EIHA 1VB5A 1LXCA 2VYCA 4KQ9A 3L07A 4FI3C 3MJEA 4LK2A 4Z0NA 1ONNA 1GGMA 5LD2B 2XF8A 4Q82A 2J9ZB 5KSOA 3T7AA 1IXSB 4FXPA 5G0WA 4YXFA 2H4XA 5FTKA 2I9KA 3U0VA 1T0JB 3CSSA 4NPCA 3FZYA 3MAGA 3P0EA 5K99A 2PGOA 3THYB 3N0VA 2I4OA 3GT4A 2A9KA 5IF9A 5AVTA 1ZK2A 4YHHB 1OI3A 5HPYB 3ND9A 3PLNA 1KO5A 1QGYA 3O31A 4PTZA 1FS5A 2QUKA 3L8ZA 3OPMA 4OBEA 4RW0A 1TQ4A 1JDJA 4GWGA 2GZ3A 4B35A 3GLUA 3ORSA 2WVGA 1JPNA 3TQTA 2Z6UA 3EC1A 3F90A 4B3GA 3PXBA 4FN4A 2VUSA 2QRQA 2VDOB 3ENWA 3MM4A 3PQ8A 4NZOA 2XEDA 4UAVA 4OQXA 4YCDA 1P7VA 2VUTA 3RABA 1Z4OA 3DHVA 1T5HX 3W06A 3BIJA 1QU2A 2CDAA 2IODA 3QKWA 2EHDA 2ZWIA 3OURA 4GUDA 2CSUA 3NIGB 1O97D 3FPFA 3K9NA 4C89A 2HU7A 3N76A 1K9SA 3ZKAA 1NTRA 2F8LA 2P62A 4RDCA 4W5WA 2YY7A 4MS1A 5B1HA 3E48A 4FW9A 1LF5A 3PPIA 3UFXA 4EUFA 3ILVA 2IPXA 5AW9A 3H04A 2FW0A 1IZ8A 2QRVB 3BD9A 1USUA 4N0EA 2PMCA 5FB3A 3IP8A 5I51A 5B64A 3AXTA 2CUZA 1WXEA 1UF9A 4TX1A 2O0KA 3LHDA 5T8KC 4AF6A 4DG9A 4J0DA 3JQBA 2ACWA 2FW7A 3CT4A 4RHTA 2B94A 2Y2VA 3TAUA 1AKVA 4H16A 4XD7D 5ICFA 1MDFA 2ONJA 3QKUA 5HJ7A 3C4JA 4J3NA 4PZZA 5HE8A 5FP0A 3HJRA 3CRMA 2HTEA 1IPHA 4BO7A 4DILA 1SXJD 3RD5A 2XWQA 1JHOA 4XRGA 3ZWQA 3OA2A 1GRRA 2WF9A 3DV0A 1CY8A 3OWHA 4FGWA 4LMRA 4BLSA 3WX0A 6ABPA 3DPUA 1W5SA 4QIHA 3ZG6A 4CIVA 3BCRA 5EIFA 3ETCA 4U7TB 4GBJA 3RTBA 1RBQA 2A67A 3CLHA 5J5CA 3STYA 3I2FA 2XV1A 5UKDA 1C1DB 5LFAA 3VHXA 2D54A 4M9UA 4NOLA 1PKEA 1PTJA 3RBZA 2FXIA 1Y7PA 3Q12A 4F3NA 2H7YA 1QG4A 1QF6A 2IBTA 1B8VA 1KJWA 13PKA 2EKZA 2GF2A 2R00A 2WHPA 3AETA 1HSOA 3F5SA 1KYTA 2WIAA 3FR7A 3JALB 1DNPA 2K7ZA 1Z4IA 5EINA 3ZHZA 2Z09A 2RCNA 3IX7A 3NOXA 4G1CA 4YGXB 4CKYA 3WBKA 4ENSA 5EJ4A 1ODLA 1BXKA 1C2TA 2J59A 5CP8A 1XEWY 4FFOA 3U81A 5DHPA 3AOEA 1O95A 3L06A 2HWUA 4KGZA 4UUAA 3ILSA 1IONA 1NQUA 3F8WA 5E6UB 1PZNA 2YOFA 1RAHA 1WPXA 3ICWA 4BL5A 4UC0A 1CJTC 4P3NA 3RS0A 3AVWA 1LDGA 1N0VC 2HZ7A 1E2UA 1CRQA 2AX4A 1U9IA 4AKSA 3B85A 2Q3DA 3HXMA 4CN9A 1M6VB 4PPFA 1CS0B 4HTFA 3LP5A 4PO9A 1E2HA 2EJCA 1IBSA 4ZQCB 3SCZA 4B3FX 4U9HS 3FSRA 1E4VA 2FQYA 2X7XA 3EXIB 2QT0A 1Z4LA 1NMXA 3H0EA 4ITVA 3LV8A 1L5OA 2O05A 4G9GA 1X87A 3L6RA 5JXWA 1PDOA 2QZPA 5LWQA 3OZ7A 4IJVA 4PSUA 3R7DA 3CXRA 1O4WA 3PFGA 4EMBA 5ITSA 3WYFA 3DSRA 4R01A 4RLFA 3VA7A 2B9EA 1PUXA 2ZI7A 2YZMA 1NUAA 3KHSA 3PNOA 4PPQA 2W11A 1ZI8A 5AOCA 2NPFA 2FMUA 4JOSA 2YBEA 2A9FA 1EZZA 2DBYA 1YL6A 1GGFA 1LPAB 3A9WA 3TD2A 1JJAA 3A9VA 1E66A 5KWEA 1Z2OX 4U4AA 4MWBA 2QQGA 4KSCA 2PXAA 4E2ZA 1C81A 5HK9A 1J90A 3SQNA 4RESA 2TMGA 1ODJA 1HKUA 4QUJA 5FI0B 1YBMA 1M5UA 1OLXB 2CYAA 3B12A 3QBDA 2A9QA 4LVUA 3I53A 4OI1A 4RQUA 2X2EA 3QY9A 1X0VA 3MMZA 5B53A 4YR9A 2JFZA 3AVXA 1V96A 2OFWA 5CCXA 1MB0A 2VJLA 4ZT7A 2CHQA 4PGMA 1NQTA 1WB4A 1EU1A 4MV6A 3ADPA 4DBZA 1IHPA 1R50A 4MPRA 2JJ2D 1QTQA 1CR1A 1EAYA 4WESB 3TNFA 1DC3A 3JVUA 3D8SA 4ZYXA 5L7WA 1EDEA 4KU4A 3ESAA 3KFVA 2ODAA 1BVRA 1GUFA 2REXB 4KLAA 1OBFO 2PDAA 1G8YA 4PY2A 4QVGA 5E0KB 4ARVA 3HVKA 5IJ0A 2GT1A 2QOEA 3QMWA 5A05A 4M38A 3GW8A 3TLJA 4EGQA 4GXTA 5AW7A 4PEVA 3DP7A 2ZRKA 5ALWA 1AOXA 4INOA 4A1FA 2HI0A 2A3RA 3ISVA 4GOND 4R7ZA 3VU9B 4IZ6A 4D9MA 2ZR7A 1DRVA 5FAXA 3SQWA 1U0LA 1CPYA 1DDOA 2AZDA 1WU8A 1BXRB 3EQ9A 5DBIA 2HEGA 4XXHA 3PC4A 4M89A 1DAOA 2PL5A 3FZEA 4FHFA 3WGGA 3GCDA 2HMAA 4TTQA 5BQ5A 3A4TA 2O8BB 3T15A 5A2GA 2C4NA 5FFNA 1C3EA 4OQPA 4YA6A 2J3MA 3TWOA 1I94B 1L4UA 1Z75A 4BNJA 2G9QA 4YXWA 1A4UA 4RC9A 2VUHB 1CIJA 1L5HB 1WXIA 2CN1A 3KAJA 3O4IA 4OHOA 4XQ0A 5EMKA 3RSGA 5IDXA 5C8YB 4JP3A 1UADA 1Z47A 2X14A 3U7EB 3ZY3A 1QE0A 1KQ3A 2C7RA 1X2BA 2PANA 4L51A 2Q41A 4D5EA 4LECA 3GRKA 3DZ8A 3DEYX 3PQFA 1AKEA 2IHYA 4JEIA 1IN6A 2ZJZA 1O5IA 1ZSVA 5K1ZA 4Z1MD 2VDLB 5L3QB 1CFZA 2HGSA 5E2AA 4TVOA 4DT1B 4ENRA 1QTNA 1RTTA 2EJWA 2I7VA 3AIMA 1KS2A 1QCYA 1W29A 2AJ8A 4OG2A 5G0VA 3Q2KA 3QM1A 1XRLA 2J87A 3O7WA 1N1MA 5A3VA 3U1VA 4TPKA 5F4ZA 5BMVB 1P5HA 4XYEA 2EWWA 2HUPA 2XXAB 5FOTA 1LZKA 2QUIA 4F1WA 4F72A 2XZTA 3F71A 3P9YA 4E33A 2KBFA 1UZLA 3AK4A 4DLTA 4JUBA 4F3KA 3B48A 1DRJA 5IAJA 5CD1A 5CA1A 3TEFA 4LSMA 3KR1A 4EEXA 4YRQA 1RPNA 2ZK7A 3DZFA 1MTZA 3CR7A 4P38A 4L57A 3UHAA 2VDKB 1IN5A 3DLHA 2J0SA 1U3TA 1VL8A 2J3DA 3D3QA 1PR4A 1YS9A 3IIIA 4EW2A 5JNRA 1CUZA 1F20A 1P2BA 3DL4A 4QHYA 1NLFA 1FQWA 4KUEA 3PNVA 3PHBE 2FSVA 2IH5A 2HWYA 1F06A 5EHIA 1C1YA 1RXIA 5E6UA 5GZ1A 3GEBA 3JZFA 4D92A 2XB2A 4H0CA 4NAVA 2GDJA 3BILA 3ROPA 3VPAA 4BFTA 4FBGA 4LYEA 2V6FA 2QZ4A 3JZAA 4AMBA 4D2IA 5LQAA 5EIXA 1I33A 1JH9A 4MWTA 3WTBA 2GHTA 1M6VA 3IYLW 1CS0A 3KSAC 1V5FA 3PUKA 4WKNA 4AY2A 4UW9A 2P9EA 1CF4A 3GBPA 3GHYA 3OTIA 1ZEMA 3QV2A 1VTKA 4J4TA 1ZIOA 1OF1A 5KOYA 3HO1A 1C7JA 5AHXA 3VC7A 5GONB 4ME6A 4CIXA 1D4AA 5KNDH 2JJMA 4Y9RA 1B73A 4D80A 3DEHA 3K0BA 3T5PA 1KYZA 3KJZA 4B5LA 5BSRA 3ELYA 4O4LA 4E09A 1S2MA 1Y6GA 2VBIA 4KQ2A 1J7KA 2YJTD 4D9EA 4QKQA 4M1TA 4NE9A 4WERA 1EX9A 2RGCA 3ST7A 4XVRA 3WHLA 5DBFA 2YHIB 4QOGA 1C1HA 1KK2A 1UPAA 2HK6A 3GARA 1JEJA 2YHUA 3V6LA 2BZ1A 3BGDA 5JECA 4MUHA 4UMFA 1YZKA 1FJXA 3OEHA 3GJTA 1OLXA 1XWWA 4NEGA 4TS1A 2WWIA 3T3OA 3A1NA 1JB1A 4Y2SA 3PKZA 4IQ8A 3E3OA 4IOJA 3L1UA 3UMRA 4WKCA 3B82A 3H42B 4H3VA 1G21E 3D43A 4MVJD 2GLUA 1VPWA 1N8NA 3VZQA 1RXWA 2RJ3A 4ZI7F 1SHUX 4RQBA 1M2OB 4DCTA 3I9OA 1CNMA 1EVZA 2YVAA 2QRZA 3QMPA 1Y6RA 2C9OA 2SNIE 2TECE 4HNGA 3VFDA 4B1FA 4R5MA 4L1KA 4EJ2A 3RSLA 2DWPA 4DNQA 2FK8A 4WESA 2AV6A 3ERCA 1VDMA 4H1TA 4ZI3A 2FSGA 1BTOA 2PD3A 1WF6A 4IR7A 1ZNXA 2CT8A 2HY7A 3K31A 4JB2A 2OHOA 2WHRA 5AK4A 1MW8X 2R7LA 2IUFA 3KJEA 3SFTA 4K9SA 5K8TA 3C2QA 1J2TA 1HT1E 3U1BA 5ABPA 1QTRA 2XXJA 2BSXA 3N8GA 2FPXA 2WU4A 4ZXPA 1WSBA 4CCAA 4DUGA 4K6MA 4X90A 1TA0A 4NQZA 1MW9X 2P68A 2PSDA 2C1XA 2VATA 4X9XA 3W6NA 3IHLA 1HPLA 1QKIA 4BU1A 5IWAB 2Z9CA 1JAXA 3BBLA 2BI7A 3VI3B 3HUFA 4TMZA 2C54A 1HDYA 2AKAB 2NX2A 1X94A 4K8OA 3B5EA 4YP1A 1BXRA 1Y80A 1GRVA 5KYTA 3HKEB 4FDVA 4N12A 4ZGWA 1SB9A 3BD7A 2X23A 1ZHHA 2WD9A 2GGSA 4UQPA 3N05A 2OBLA 4W1QA 3U4HA 5KS2A 2NO9A 4PPYA 4N7JA 1CP3A 2CXOA 1ZD5A 1VL0A 2HU5A 2QN7A 4RS4A 5DH9A 3CH5A 2O8BA 2X2PA 4ZHQF 2YOGA 1ZJWA 3R7NA 3TKAA 2C5LA 5CLQA 3B3AA 1GNLA 1IIBA 1LFAA 3GEHA 5G02A 2WUDA 1E5DA 1L5NA 1H65A 5DBHX 1L5HA 1N3YA 3DE7X 5B1DA 1Z0SA 2Z3VA 3RODA 2HU2A 1KAHA 4F5YA 4PW0A 1ESDA 1XD2B 1WQ3A 2GEBA 3HXKA 1QG0A 5C5CA 3VKUA 1Z4KA 3IDAA 4KXVA 1GRCA 121PA 4I1IA 4BNNA 2RH4A 1EWVA 1DT5A 3M34A 2QPOA 5L3QA 1DBRA 1TZBA 5C81A 3QLUC 5IU6A 3U17A 4DT1A 4U8HA 5DEOA 3K0SA 2DLNA 2WJWA 3AHCA 1YJQA 5JZ9A 4OOFA 4P4SB 3GLGB 3AUUA 3KV3O 2ZVDA 3WKDA 4CT0A 4UTVA 3RVQA 1IMOA 4DSNA 3HB4X 4RTKA 4CKZA 1U1IA 4L07A 2DHRA 3IL2A 2I7XA 1M1NB 1UMCB 3AI1A 3HCAA 2F17A 1U3VA 3IAXA 2GCGA 1DAGA 4GUAA 2JGEA 5SV2A 1ORHA 3AF4A 4TWZA 4NYJR 4DIEA 4F1JA 3QJGA 4E51A 3TFOA 2A9VA 5B3KA 1QGED 1QHHB 2MU1A 1JQKA 1UWCA 1Z8HA 2EDCA 1NBMA 2NZYA 3PD7A 2WOJA 2I2FA 4GC5A 1X0XA 3AJ9A 4DSAA 1BH2A 3X43A 1IBKB 3OF5A 2H4WA 2GZSA 4DBVO 2J3QA 1Z2DA 4JEUA 2AQIA 1KBOA 2QV7A 2R8YA 1NR5A 3EIUA 5DHUA 2W6JA 4F8YA 5IKMA 4G1EB 5B12A 3GLSA 3HJTA 4O4HF 1AM4D 2C7BA 4OXXA 3GD7A 1BVYF 5CT9A 5K2OA 4RX1A 3Q7EA 2YWCA 4MP3A 4WRRA 2CFIA 3SC2B 3L0IB 5C3MA 3C45A 3FMFA 4FYWA 4ZT6A 2BUCA 5GONA 2ZUDA 5HS6A 3UWSA 3HZRA 4DRZA 2JA2A 2E89A 1E96A 4RZXA 2FEXA 3BSFA 5K3FB 3I2YX 3KOUA 1KH3A 4UFPA 2X4GA 3C6XA 1Z5NA 3ZV3A 2J6BA 3P7MA 3B3JA 1QO0D 2JI6A 1PJZA 2I78A 2YHIA 3FYSA 5FQNA 1HQKA 1PEAA 2NW6A 4KQXA 1CDEA 3JQBC 3EQ6A 4Z9AA 4EPVA 4E31A 1Y8CA 1I4WA 4TKZA 2NSDA 3WI7A 4DPKA 1U8UA 2Z4TA 3H4TA 4UVDA 4EFMA 3VSEA 3IT2A 1NMZA 1MUUA 3H6HA 1GTMA 1V2HE 2QROA 4ND1A 2IEAA 4QBGB 1DQYA 4QLAA 4TZKA 1CJKC 5CT6A 3RRFA 1KK3A 5F12A 4MV4A 4TZTA 2XRZA 3Q2OA 1BHQ1 4HH4A 3GA5A 3HVUA 1A88A 1XP5A 1GPH1 3ZDBA 1HE8B 1K0FA 1PHPA 4LUCA 1PIWA 1IOWA 1PTJC 1Y3BE 2X9GA 1DKRA 2J6IA 5K5EA 3HJFA 2R00C 2XUDA 1T0UA 1XEXA 4FB4A 5IULC 3OFVA 4IVQA 2F43B 2IEGA 3KQYA 4FT2A 5JAOA 4N18A 3C3JA 1Q3HA 4Q47A 3TRKA 5EHNA 3C97A 5HS4A 1D0SA 5K05A 2QRJA 4RZUA 1X3SA 5ILGA 3G0IA 4J0GA 4CVNA 2WWXA 4G97A 3S2EA 2PGNA 1DG3A 3N07A 1GXSA 1P6QA 2L82A 2NMVA 2PLWA 3GLTA 4HBZA 4ZC8A 1DJLA 3QH4A 4Q9NA 1NQVA 4EG3A 5KQLA 3H75A 4CF6A 1N1DA 3U3JA 4Q3AA 4B31A 2P2YA 2AVDA 3KD3A 4BDTA 1U9IC 3D2BA 2J30A 3QVGB 3QVUA 1ZWLA 1TM2A 1BN7A 1JHVA 1GU7A 2VP3A 4OGWA 1TM5E 1VGRA 3OE5A 3TVTA 3U4GA 3LBHA 3OZVA 2HLDD 2X0NA 1G9XA 1EGVB 3DFFA 4PAWA 3THRA 3D6MA 4HF7A 4UQLA 2HFJA 1DXYA 5KYXB 4BKMA 4TVSA 1CF9A 1J21A 4RCYA 4LBVA 4RFLA 4L7VA 1Z0FA 5G0UA 1M2NA 2GVZC 5IC4A 2JC3A 2QLNA 5JQGB 1XD2A 1F38A 1U9CA 2D1YA 3IUEA 1E79D 1W59A 3FPSA 2X0EA 2Z98A 3CF2A 1JFFB 4IRMA 1T91A 1MOZA 2IA5A 2R25B 1SHLA 2HRCA 2IV3A 3KVVA 3LBAA 1XQ9A 3BDAA 1F17A 3MBKA 1UBFA 3P27A 3KKNA 3S2ZA 1J42A 1WZIA 2AL7A 3PHLA 5B3JA 5A62A 3M1YA 4XDZA 1ILWA 1J0XO 1Z83A 2Q1YA 2R7KA 1T9BA 4B3JA 1KS9A 4D9KA 4D5GA 5C7IO 4FMDF 5LU8A 4MNTA 3L2OB 4BVLA 1FVOA 1CJSA 1EJ0A 2DG2A 4P4SA 3W3AD 3ZXUB 4F96A 3HBAA 2NLOA 4DDMA 2LWIA 2MSLA 3C3BA 1H8ED 2E6UX 2FHPA 5AI0A 3R7BA 3PE6A 4QXOA 4IF4A 1N0HA 5EIAA 3TECE 2PZBA 2G8NA 5EKTA 5G1PA 1TD9A 4IXDA 1UMCA 1RYFA 3E9MA 3K1JA 3V4LA 5EJ7A 1W30A 2DPYA 2Q3JA 3IMGA 4YPOA 5JYBA 4OU5A 1ZRNA 4ZCMA 4HWKA 3Q4GA 4YTEA 4B34A 3UPTA 2FZWA 1QHHA 1ISHA 1E3WB 3ESQA 3GGSA 1YBHA 4V02A 2CMGA 1Z0UA 3EODA 3I52A 3PBKA 3DT8A 4J0FA 4DABA 3T7RA 4I5EA 3S7ZA 2UXCB 1L7DA 3D6FA 3Q0IA 3LP8A 4F38A 4AY5A 4QSMA 3H5RA 4Z54A 3OUUA 1RKQA 1OXTA 4WNYA 1RWVA 1ZK3A 2DH5A 1ZNZA 3A25A 3AGQA 4TLCA 3SJUA 3VI4B 4D0GA 3LHFA 1V9LA 4CWAA 1L7NA 2EQAA 4RV4A 8ATCA 4W5NA 1F8XA 5ENVA 1YWGO 2R4QA 3DXXA 3HNPA 2IXDA 2X9LA 3PHGA 2H2HA 3SEQA 4JAVC 1ZESA 1T36A 3SC2A 2AFHE 1EGMB 2O2ZA 3CUKA 4CQJA 2INGX 4PN7A 5ILOA 1Y4DE 4BVHA 1XDZA 1NA5A 1Y1RA 2EARA 5CLIA 2PQMA 3ZQ6A 1JR6A 2H57A 3DKPA 1GTL1 5F5NA 4IGIA 5JJBA 1Y48E 3F5QA 4NU0A 1LI4A 3LY5A 2UZ0A 1IM8A 1XF1A 3SXUA 2WU3A 4I4NA 4CMIB 5BOSB 5K51A 2JFVA 2PFKA 2XRFA 3ENQA 4GPEA 1FEZA 1RZ3A 3DYIA 4Q7LA 2PCLA 4HKTA 2RGEA 1G63A 1K7XB 3SKYA 4O5OA 2PXCA 1TZ2A 2I3AA 2ODNA 3GRFA 1RYZA 5IMSA 1EHIA 2IZOA 2WIFA 3KJGA 3KZMA 1DWOA 1XCPA 3MAJA 2FNAA 1N57A 5EGNA 2XUQA 3SMVA 4HAWA 2PV0A 3PEEA 1MPTA 2H31A 2EFDB 2ZI3A 3A4IA 3BRWA 4FEYA 3PYMA 4B83A 1HKHA 5LIPA 2OMKA 2CWDA 3NAGA 3A14A 2AOTA 1CF2O 4MO2A 1JHAA 1LTQA 1P1IA 4CU2A 1BYUA 1DIOB 1YACA 2P4QA 2ZYTX 1ULBA 2QWXA 3M6XA 4CDRA 4LF9B 4B4KA 1ACJA 2ZB3A 1Q91A 3VKGA 1DQRA 2KYRA 3RPEA 4XVCA 2F43A 4FB5A 2VDWB 1GVNB 4P4TA 1PNTA 4A3SA 2EC5A 3DUWA 1NRWA 4DC9A 3ONEA 2OM6A 3U7GA 2G4LA 1E0DA 4ZAYA 3HP4A 4J7AA 1UMBB 1H66A 2AD5A 3KJIA 1WKBA 5COAA 1I5OA 5EVCA 5P8WA 1CUHA 4RIEA 2FSVC 4KWCA 4WEQA 5DNWA 3T7IA 2G07A 4XQGA 3OPNA 5T6MA 5HWSA 5T6BA 1BNCA 2HPVA 1HG0A 1L7XA 4NZYA 4O02B 1QP4A 3WIBA 3M6WA 3OICA 2CBXA 4QBFA 3K0CC 2J41A 4LVCA 5A4KA 1AE1A 3QVGA 4BPRA 3DDCA 1JAIA 5GMOA 1U8TA 2CNKA 2ZSHA 3E7DA 1YJXA 3EAQA 1YA8A 3C98A 5GPBA 5EP4A 2F8TA 3GIDA 2B8EA 3IS3A 2IVZA 2XNHA 2WA2A 1DV2A 4JUDX 1SU8A 4BUJA 2PZFA 5KYXA 1CKEA 1P9WA 3A9UA 2AW5A 2O8NA 2FPUA 4QU0A 3C3YA 4GZ6A 2HGZA 1ZSYA 1XA3A 3GMDA 4A8TA 4YRNA 5F33A 3DEJA 4KYIB 2HN9A 2Q50A 3TS1A 2Q6IA 1YGPA 1ZM3A 2RHRA 5JQGA 3GZTB 2J0QA 3NHBA 2R84A 4DE5A 1JFFA 4MA4A 4YO8A 1CLUA 1GSIA 2CNLA 5CHEA 4D9CA 1YFLA 3RC3A 2WV9A 2HV9A 4KI0A 2IY7A 4PG5A 2FWMX 1OIXA 5KDLA 5FOUA 1JJ7A 2CB0A 1DUSA 3NUZA 2PT6A 3TLZA 1X1SA 5AKYA 5C46F 3FI9A 1IXZA 2QN6A 5AM4A 4MB2A 4MWSA 3T1OA 4OSOA 4QREA 2PUCA 3F7TA 1Y3IA 1U3UA 1PHRA 4HRVA 3T35A 2VH5R 5BWNA 1G55A 2OK7A 4U7DA 4ZOQI 5LB4A 2DC1A 4W1PA 3CRQA 2BJVA 3GOQA 4GRAA 2QIOA 3FNBA 4GSLA 2O07A 4ZZIA 3AFMA 3VPCA 4COOA 2GRJA 1WWKA 3SC3A 3KB8A 4Q1BA 2DJIA 3AEXA 3DOJA 3IUYA 4PTLA 4QATA 1ZY2A 2CXSA 4LAFA 1T9HA 3CE6A 3DDWA 3EFHA 4ZOBA 5L6MB 2D2EA 2WM3A 1HYBA 4PZUA 1TVKB 3MJTA 3EH2A 1LDNA 1XXLA 2X1LA 3CTPA 2W90A 3CIFA 2ROQA 2ZE6A 1NVBA 3OPXA 4Q1EA 3IP1A 1EI9A 3HUUA 3K2QA 2AYZA 2WHEA 3TPFA 3V8QA 4GMXA 1P5ZB 4RJKA 4GPBA 2Q5EA 4MUAA 4KWIA 1VSUA 1JZQA 4EDFA 5AJHA 1U7UA 1N25A 1V4NA 4FZVA 4XE5A 1ATZA 1IVNA 3MT7A 4TV9F 2A3NA 4CF3A 3PLAE 3AF0A 2WZCA 4IW3B 5E9WA 1UDBA 2AE2A 2Q45A 4MQEB 4QQ8A 1QUEA 3CKKA 1SH7A 4KGXA 4AKIA 1ZW1A 1YOBA 3BKXA 3L43A 3BL5A 3THSA 4TRJA 3AHJA 3I09A 3E9ZA 2Y1EA 1G9SA 2WD7A 1M5RA 1PVOA 4YUXA 5BWMA 5KSYA 1XMJA 2E6KA 4UM5A 5DX8A 5K8VA 3BXZA 5LCXA 4CMIA 1QB7A 5DSZA 5BOSA 5C53B 2KB0A 4LXTA 3AESB 1CW2B 3TMAA 1JQDA 1PVDA 2W7TA 3M83A 3ZNQA 4BNTA 5JEDA 3OQHA 3I5AA 3VR6D 1VGQA 3FLAA 1E3DA 2AJLI 2H9AA 1SVKA 1J8QA 4ZKDA 1BC5A 4PYJA 3U7IA 3U9LA 4HRXA 1PE0A 4BVFA 1ABFA 1F51E 1RWBA 2A1UB 3OQPA 1PTKA 4EVQA 4JYZA 3KZXA 2PIDA 1NG1A 3S8MA 4DCSA 2GTIA 2Y93A 3HZHA 1ONOA 5CB8A 5KAPA 3WO0A 1G8SA 2W6MA 1I24A 3P9SA 4Q39A 5H5JA 5FEUA 1OT3A 1GYRA 1OAOA 2CDNA 3AHEA 1XMXA 2FMIA 4IDQA 4L3WA 3A7DA 4I46A 5AHKA 3PVSA 2POQX 3Q8MA 1A04A 1EB9A 4W5RA 3FPCA 3K70B 2ZYDA 1Z6AA 2VDWA 1A2OA 1EFRD 3L46A 4EKIA 3Q40A 1TUGA 2Q2OA 4X66B 1TM1E 2FPMA 2XBLA 1BHSA 2VDVE 1V5EA 2GNAA 5LQNA 1CYDA 5HNKA 2JGDA 4M4SA 1SBTA 1UMBA 4Q3NA 4X1OA 5K45A 4J4BA 2X3YA 3HPQA 4KLCA 4ZARA 1BE8A 2O4UX 1R88A 5BV2P 3I58A 1SXPA 3DYVA 3PE3A 4EG8A 1AQYA 3PX3A 4M22A 3TQFA 2C1ZA 2RGYA 1I3OA 2K2WA 3RADC 3B6MA 3V9AA 1HE2A 1A4RA 5TS3A 3UJ8A 2W5UA 3EC7A 1NJSA 2BGJA 2GCEA 1IAQA 1ONPA 1TL7C 2OORA 3MELA 3VMMA 4IO1A 3ZNNA 2PUBA 3FI0A 1ZVKA 2GA9A 3H5TA 3TOSA 2HT1A 4N65A 2A59A 2FPRA 5CG2A 4QWMA 3JQ7B 3JTMA 3OOHA 2CXUA 1I3KA 4DMCA 2AMFA 5TF0A 4P5PA 4FE3A 7GPBA 5A5EA 1E1MA 2YXBA 4QGGA 3O2NA 1QDEA 1GKKA 4EM6A 4Q3CA 3T3PB 3DA8A 1KY2A 1R9MA 2OP0A 4WHMA 5EHQA 3ZIDA 4IEFB 4N82A 1CEQA 3F1LA 2B1GA 2ODQA 3AIOA 5FBLB 3UUFA 2VCEA 5H8WA 2I4MA 1IM2A 4EYKA 2WYHA 3ZXYA 5B7GA 4B3TB 3IBYA 3W5DA 2UYYA 4N0PA 1C9NA 1J56A 1P7WA 4TM8A 5ESWA 3V4ZA 1EFPB 1SZDA 4C4TA 3V97A 3GLIB 4OHZA 3PS9A 4NZ9A 5M34A 1MD9A 4DWJA 3L7YA 4N0MA 4AJ1A 3M6LA 1WTAA 4TYPA 3GQBB 1P5FA 1R4MA 2Q6TA 2YV4A 4L08A 4TRRA 2CBGA 2DFNA 4ZYVA 3DL0A 3T4PA 3SS8A 1P1BA 1W5AA 3G2HA 1IY9A 1KR5A 2H63A 3LZCA 1UKCA 1K75A 2AN1A 3KKLA 3MOIA 3OZDA 3E35A 4OHUA 1TM7E 2ZETA 4I8XA 4IV0A 4PIPA 4U2CA 5F5LA 4WX2B 1ZNYA 3WL8A 4EZIA 2QE7D 3OSUA 4K0RA 4K81B 4X44A 2J5XA 3H11B 1B26A 3HMKA 1F6DA 3LLMA 5CFNA 1W0CA 5JAIA 3NH9A 3J81A 1DTWB 1NU8A 1YL7A 1D3AA 1NTOA 3KZCA 3TSWA 2KLHA 4IHKA 1TVKA 3I2HA 3W9UA 1VJTA 1U2DC 1PQWA 2YN4A 1RW4A 2ZWMA 4HFMA 4MA0A 4ND4A 3OWOA 4U7WA 4H9GA 3WGQA 4CM4B 4EW1A 5JC1A 1P1HA 4B87A 3SLGA 5M7EA 2OBYA 1FXSA 3COYA 5IW8A 3KJFA 3HLKA 2GHIA 4G5GA 1FDWA 1S3SA 2ZEJA 3BWYA 3DMHA 3MSCA 4Y6SA 5T7BA 1J00A 1VI6A 3LK7A 1PK8A 2O2EA 3JQCA 4V39A 2V7XA 2X6QA 4G25A 3VTAA 2G9RA 1X8LA 3O38A 2WWVD 4GGMX 4I66A 4B74A 2JCVA 4MAMA 3NANA 1SC9A 4AUEA 2GN1A 4MI9A 1MG5A 3KAPA 1AO0A 3L4KA 1B6TA 1J49A 4MQEA 1U9YA 2PTGA 1Q0HA 1UPUA 4Q93A 4EMUA 2H6EA 1TF5A 4PBTA 4IEEA 3EXEB 4DIBA 5JSKA 5FCDA 3OE7D 2JFFA 2ZBRA 4UU1A 4QELA 4M21A 1SKYB 4ZP1A 1DJPA 1VYTA 2PH1A 3EWAA 4AY6A 3HJNA 1C9JA 1V37A 4D4GA 3AESA 3F5DA 5DN6D 2HA2A 3IAM6 4Q3OA 3QUTA 3QVSA 4C5AA 4Q01A 4R8SA 5GWXA 1EFAA 2CVFA 2BRUA 4UATA 3K71B 3EW9A 4HQNA 2B5WA 2DTDA 2FWIA 4YMSA 2BZSA 2RGNA 4CL2A 4HAXA 5KNCD 2A1UA 3O2JA 3ANTA 3H0CA 5BV0A 1NASA 3FPGA 1K3TA 4CU5A 1IXRC 1X80A 2AKYA 3B60A 4ZVMA 4C6TB 5ICMA 1HRKA 2H1LA 2Y1CA 4O29A 1L4MA 3VYTB 2G88A 2G80A 2VNAA 4RABA 3VYWA 2VS1A 4R2MA 1QH0A 3JQGB 4E7OA 5I47A 5IH7A 3K9LA 2FPGB 1O94A 1Q3TA 3FCYA 5T4FA 3UC9A 1QHSA 4E3WA 1ADBA 5EMHA 4F21A 5KJCA 3AR8A