4RUKA

Crystal structure of phosphoapantetheine adenylyltransferase ppat/coad with coa and pyrophosphate from pseudomonas aeruginosa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
157
structure length
157
Chain Sequence
NRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 56
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4rukA00
1NZJA 2A1TS 5J58A 3S3TA 2J4DA 2JA2A 1O94D 4HK4A 4PBRA 3C8ZA 3UMVA 4YP6A 4U7JA 1MB9A 1IH8A 2YY5A 2QJOA 3H99A 2VTBB 4ND7A 1HYBA 1IQUA 2QJTA 1K4MA 4ZT6A 2E89A 1WXHA 4JYZA 1N77A 5TEVA 2DUMA 2J07A 2PZAA 3E27A 3H9CA 4JXXA 4XSVA 3M5WA 4DNXA 5KHAA 1Q77A 4KR9A 1GZUA 4EFKA 4MWEA 3AFHA 1QRUA 3N8HA 4L2IA 3HFJA 1MOPA 2ZP1A 2OQ2A 4RPIA 3SP1A 4H3SA 4Q16A 3Q12A 1O97D 2IP1A 1J21A 4JFAA 1TEZA 2QTRA 1KAMA 3FG9A 3N2YA 1QU2A 4YP5A 4MUGA 1QU3A 1LI7A 4G5FA 1KQPA 3SEZA 1F9AA 2CV2A 3P0JA 1GLNA 2J08A 5HG0A 4I6GA 1WZ2A 1NURA 1LW7A 2QUJA 4EG1A 2E0IA 4MUJA 3U1VA 4ND6A 4JXZA 2DXIA 3VU8A 2DPLA 1N1DA 5H7XA 1YUNA 1ZH6A 3IUEA 1XNGA 2CYAA 4MUFA 3CVYA 1H3NA 2NSYA 2R5WA 2CV0A 3RK1A 1LI5A 4EF6A 4EG7A 1VL2A 1RQGA 1NUQA 5JBNA 2X1MA 4S1OA 3CVWA 1PFUA 2V0CA 3TNJA 4MW2A 3N9IA 2QUHA 3CLRC 3LCJA 3SEQA 5LLTA 2CSXA 2AKEA 1N78A 4EG4A 1N75A 1X8XA 1Q19A 1WOYA 3IMCA 1F4LA 4XFDA 1XNJA 2PIDA 3H9BA 1IHOA 4GRIA 3KFLA 4MW6A 2A1TR 2PZ8A 3QE4A 1O0BA 2DEUA 3SDBA 4K0RA 1O0CA 1N2JA 3N05A 4R2LA 3TZLA 3FDXA 4WNYA 1M83A 3FNRA 1PFVA 1K92A 1QRTA 4HJXA 4NZPA 2XRZA 3KT3A 1ZH0A 2EJCA 1FFYA 2A1UA 2WSIA 1F7VA 1U7XA 1J09A 2TS1A 1NP7A 3RBAA 1KKUA 4PBSA 3IDFA 3SZGA 2YXNA 1WQ3A 2D5BA 1TFUA 4I6EA 3HV0A 4DJAA 4ZCRA 1YIDA 4J76A 5DK4A 3I05A 4CDNA 2GKSA 2GOYA 4MW0A 1QQTA 1A8HA 3FHJA 3IODA 4I6JA 3CVXA 2D13A 3H97A 1I6MA 4U63A 4KR6A 4NDAA 1U7DA 5FNZA 1V47A 1YULA 5AHWA 2WB2A 5EKDA 4ARIA 3UY4A 1ZUNA 4MUNA 3MXTA 3ZJVA 1OWNA 4MUIA 3NBKA 1SURA 3RK0A 4KPUA 1H3FA 3FH0A 2RE8A 4MWDA 4MW4A 3ZGZA 5F23A 1G8HA 1VBKA 4DDHA 1M8KA 4KKVA 3DLAA 4MW9A 1KAQA 2X0KA 1GN8A 1PG0A 3JXEA 4ARCA 4MVCA 3ILVA 1VBNA 1QTQA 3ND6A 1TQ8A 1KH1A 1I6KA 4P2BA 3TS1A 3GLVA 2CYCA 3CLTC 1F7UA 3FWKA 1KR2A 1NUPA 4YBRA 1KORA 2YWBA 1NUTA 2J5BA 3D6VA 1M8PA 1KP3A 2D54A 3ZIUA 1J1UA 1R6XA 3PNVA 4MVXA 3VGJA 1MC1A 4PBTA 3INNA 5DASA 3GMIA 4MQ6A 1KH2A 1MJHA 3CVVA 1NI5A 2VTBA 5FO1A 3P52A 2XRYA 1M8FA 1MAUA 4MWCA 3KT6A 4CT0A 4NAHA 1G8FA 3PRHA 3Q10A 3PNYA 3CVUA 4J75A 1JGTA 3ZUGA 4X0EA 4MVWA 4L2IB 4MLPA 2PG3A 4F3RA 2CYBA 3CLTD 4G6ZA 1TYCA 4ZCQA 1O94C 1PFYA 4QREA 3IMGA 3FOCA 2DETA 4Q93A 2J09A 2C5SA 1TYBE 2QUIA 3G5AA 3ELBA 5BNZA 3MLAA 4GU5A 1J20A 3A2KA 1WXGA 3RHSA 1JECA 3PXUA 4EG6A 1EUYA 1O96B 4EG3A 3UOWA 1QNFA 1JIJA 4KPUB 1ILEA 1H1TA 1WY5A 1EXDA 3ZJUA 2DR2A 1Q11A 3AG6A 1OBCA 3IVGA 3TZEA 4MUHA 1H3EA 4DDKA 2X3FA 4MWBA 2HZ7A 3BL5A 4MAFA 1GTRA 5DB4A 2PXHA 4CDMA 1ULHA 4CQNA 4MVYA 4DLPA 1O95D 1O6BA 2QTNA 4MUKA 3COWA 3VRHA 1T6YA 3DPIA 3LE8A 1N2HA 1OBHA 3GUZA 1V8FA 1VBMA 5DEOA 5IJXA 4AQ7A 3L93A 3G59A 1QJCA 2H2AA 3H05A 3NBAA 3IVXA 1DNPA 4DDMA 2RD2A 1FYDA 1ZJWA 4DE5A 1M8GA 3ZXSA 3FETA 2Z08A 1JEEA 3IOCA 3A4IA 1MBZA 4NX2A 3HGMA 2E21A 1TYAE 2QJFA 2CFOA 5KWVA 1MAWA 4R2MA 4WSOA 4ZT2A 1VLHA 4OUDA 2Z3VA 3CLSC 1JZQA 4MULA 1JEDA 4YP7A 3COVA 2AG6A 3UK2A 4KR7A 3K9WA 3FI0A 1N2GA 1BS2A 1CT9A 1R6UA 1NYLA 3ZJTA 3ISJA 1EFPB 3UC5A 2QTMA 1N2BA 2H29A 2GM3A 2A84A 1KQOA 4UZEA 1IQRA 3DV2A 4JZYA 1I6LA 5FO0A 1OWPA 3X1MA 3CLRD 1EFVA 1IRXA 3MLBA 4OJMX 1WXFA 1T9GR 5HUHA 1Y42X 4AS1A 4EG8A 4NAUA 1IVSA 3Q4GA 5LFAA 2CV1A 3X1KA 1GTSA 4A91A 1T9GS 1KH3A 5TGTA 4BWVA 3TQOA 1KP2A 2JAXA 4ZT5A 1I2DA 5TEWA 4ZCTA 1JZSA 1GAXA 3IH5A 4F4HA 4E1AA 4R0NA 1G8GA 1K97A 1IFXA 3QTTA 3IOBA 2QUKA 3L92A 2G36A 5K0TA 1JIIA 1M8JA 1WJGA 4MUEA 3A04A 1NUUA 4NATA 2ZUFA 3CR8A 3SYTA 1MRZA 1Q15A 1WQ4A 1U3DA 1KQNA 5J5AA 2YWCA 3ZXIA 1JIKA 2PFSA 2NZ2A 3FIUA 1JILA 2HGZA 2IJGX 3MMXA 2X1LA 3ND7A 1XNHA 4UZFA 1O97C 3IVCA 5J59A 1YIAA 1WXEA 1S4MA 1YUMA 4HJRA 5IHXA 1B6TA 1D2RA 1OD6A 3IUBA 3KT0A 4MW1A 3AKZA 3HMQA 5HUJA 1N3LA 1UFVA 4ZT3A 4ZCSA 1N2OA 1PFWA 5TS2A 1EUQA 2V0GA 2CT8A 3AL0C 2A4MA 2BTEA 1P7PA 4QBTA 1TYDE 4RUKA 4OUDB 2EL7A 3AG5A 3F3MA 1OWOA 2JANA 2CUZA 2WQ7A 3COZA 2DLCX 3MUEA 4G5YA 5LM3A 4PY2A 1G59A 1PG2A 3CLSD 4EG5A 3P0IA 3RFFA 3A05A 1NUSA 2A88A 1K4KA 4MW5A 2A7XA 2HMAA 1NSYA 3AIIA 1U3CA 3HZRA 1WXIA 3COYA 1JHDA 1YI8A 2E18A 1IQ0A 4U8HA 2BYTA 3D6UA 4TS1A 1COZA 3IMEA 3KT8A 2B7LA 2O5RA 4ZT7A 3SZ3A 3X1JA 1J1ZA 4EGAA 1J70A 3CLUD 1EFPA 3OTWA 2A86A 1N2IA 1T6ZA 1JMVA 3K32A 3QTBA 1O95C 2OV4A 3IOEA 4QRDA 2Z09A 5H16A 1M1ZA 3ND5A 1MB2A 2O8VA 4XFJA 4HPWA 1O96A 3PNBA 4ZT4A 3NV7A 2VXOA 3CA8A 3OP1A 3TQIA 1X6VA 3HL4A 2A1UB 3CLUC 2DERA 1WKBA 4FZJA 3DO8A 2I1LA 2ZUEA 1GPMA 1OWLA 5KCMA 3LOQA 1EE1A 1T6XA 5K0SA 4K03A 1R6TA 1QRSA 3FY4A 4YMIA 3RJZA 1U0BB 1EFVB 2IELA 2AZXA 1EJ2A 3G6KA 1N2EA 4MW7A 2PZBA 3P0HA 1O5TA 1XJQA 4ZCPA 2WQ6A 1OWMA
chains in the Genus database with same CATH superfamily
1JH8A 1ZEJA 3LQFA 1HTWA 3LDFA 4PBRA 1M5TA 4JOCA 4CCSA 1QRAA 4KP7A 3E2IA 1C9EA 2IZ5A 3PDIA 2FRDC 2VHYA 1NNSA 2VP5A 1U8FO 5CVUA 3S68A 4BLTA 5B7QA 4CV2A 1PHRA 2IOYA 4Z4IA 3R9XB 3H99A 1RXIA 3HPQA 5JNTA 2OHJA 4KU4A 4MYDA 4EW1A 1TTTA 1KZ7B 5JS7A 1W5EA 4DG5A 4TT3D 4E15A 4GDFA 2EZ8A 1YK1A 3E2PA 4ASUA 5JMWA 5K4GA 1FTQA 2WUFA 1BCSA 3D0KA 4CMIB 4YMVA 1PWZA 3FOWA 5ERXA 3TQQA 4AAYA 1FP4B 4KR9A 3ZDXB 5LA6F 4MWEA 5BQ3A 4YRJA 1TLLA 4HTFB 4Z7OB 1GKUB 2EDCA 4JYMA 1JG6A 1Z75A 1TIPA 4FSDA 5GGXA 2VK2A 4FEGA 1L4FA 2XUQA 2Q9UA 3E9YA 1S1CA 3HSSA 4Q16A 1WO8A 3IDQA 4Q4JA 5CYPA 2IP1A 2PUWA 2VPPA 5HEKA 4EPYA 3LQYA 4HXFB 4G8JA 1JDUA 4NULA 2O06A 3NO4A 4W5TA 1QO9A 2ZQYA 4K46A 5DYTA 1H2XA 1VZ2A 2I1VB 4DLAA 3DZKA 2J33A 4FE4A 3QX8A 1LI7A 1XD2B 3KWLA 1Q1BA 3W4JA 1Y1TA 3HKDA 1POXA 1R0RE 2H59A 3MWEB 1KAOA 4Y2HA 4HMOA 4JJ6A 3B51X 2J0EA 3ES9A 5DIFA 2QT0A 3DUFB 3PYMA 4NENB 4A7PA 4B6OA 2KI5A 3MTIA 4ARZA 1Z2PX 3DKRA 4RLSA 2M6LA 3TD9A 4YAKA 4HDRA 1Z74A 2XGMA 4IZOA 4UM5A 4C14A 1PLLA 4BASA 2ONYA 5ALSA 2Q2VA 3B9QA 3L02A 4EY3A 3UXMA 4V0LA 5D85A 1WEHA 2PY6A 4OM8A 4UM8B 1QH8B 2OBXA 1CZRA 2G88A 3IKMB 3MVEA 4Q7KA 2OYCA 3M5CA 1OAOA 3CZMA 4IGAA 1FCJA 3EAQA 1PWEA 4F8EA 2JLSA 2DT5A 5DTMA 3C39A 4TUYF 5F3WB 1PFUA 4NCJA 3LECA 1QORA 4I3HA 1X92A 4Q34A 2XEXA 2B35A 3ENWA 3SEQA 4NCHA 4NBVA 4L5IA 2GXSA 3DEKA 1K6MA 4JBGA 5DNCA 1XEXA 3ADOA 2C9CA 2BH2A 1VA4A 3WYBA 4CCYA 2G1UA 1ZAKA 3EA0A 3N86A 1XNJA 4RCYA 4F6CA 3KBOA 4D4IA 4BJ5A 4LGYA 4GRIA 4XSHA 2P9EA 2AKYA 5KNDD 2R8BA 3H0EA 1E6LA 1DS6A 2W2TA 4HUQB 3QNWA 4X20A 1D9XA 5CDSA 3SU8A 3OQIA 1E4EB 1SOAA 3ND9A 2OEPA 4NZPA 4NFSA 1EDOA 2FEOA 1OFUA 3KT3A 3LY8A 4DYHA 3CX7A 3LDUA 5A3RA 1MJGM 1TZCA 1G9XA 2AQKA 3LV8A 3FFAA 2ZT7A 4BFCA 3KLBA 4PFJA 5L8VA 5FR1A 1E5TA 4RTKA 1A98A 5IW8A 2RHJA 5LD2B 2VA8A 4J3JA 3F4LA 2Y9MB 3N2ZB 1RTTA 4WCVA 5AI8A 2V03A 2V98A 3K73O 3MEQA 3JAKB 3EPPA 6AT1A 1FMTA 3NANA 4Z51A 1WB9A 1CR1A 1A2BA 4Q19A 1G4AE 2QLFA 3T9DA 4XLTA 5GV7A 5L6LB 4RFSB 3T7IA 3WXMA 1N6IA 2Y2UA 3I05A 1UEJA 2I2CA 3EQZA 4IGIA 4Q4HA 4WN9A 3WO1A 1QQTA 1GNQA 1U1GA 3T3MB 2YW2A 4IYJA 4PCUA 1Z7YA 2G5PA 3EZ7A 5FOVA 4DXAA 2D6FA 1ZWKA 3TUJC 3NHZA 2WSLA 3MW8A 3K0AB 3Q88A 1V5WA 2NAFA 1U7DA 3RRXA 3GLQA 4E5VA 1V47A 3A1EA 1YVPA 1PUXA 3C3YA 3RYIB 3TB6A 2QTTA 1ZCZA 2B1IA 5L3ZA 3V8VA 5A9RA 3JQ8A 4MCAA 1QHFA 2IYOA 3ORFA 4JT4A 3I5YA 3NBKA 2FHPA 1PJAA 1NZDA 1EP2B 3N59A 4IXNA 4KPUA 5CLFA 5CFZA 1I0IA 4B83A 4EVQA 3A6PC 1L5WA 1A9RA 3OLCX 1XO1A 4LGVA 4FFLA 1AUOA 4FGSA 2WM2A 4HMQA 3PE3A 1IOVA 4HX9A 3AVPA 1E2DA 5JXIA 2GN9A 1AUXA 3TUZC 5ES4B 2CHVA 221PA 4U7HA 4GVXA 1TUEA 3AHDA 4XCQA 4B74A 3VKHA 3C7DB 5EWLA 4AXXA 3TN7A 2PA3A 3EGXA 1T26A 3B6JA 1Y9EA 2VWHA 3JYPA 4MPRA 2FEXA 2C5BA 4A0SA 1NP6A 1H93A 1QVVA 1QE0A 2OGZA 3CPSA 2PRKA 1IXKA 3MT8A 4JUDX 1ZHOA 1P61B 3R5TA 1XLWA 1G16A 2QOEA 1HOXA 2EKPA 4IY1A 2P6MA 1U0HC 2R6FA 3ICQB 4TV9B 4JJEA 1U8CB 1ID8A 2IF2A 2FFQA 1B00A 2JGAA 3D6VA 1VHLA 3JS5A 4UFPA 5ICMA 5KYXA 1J1UA 1PR3A 2VJPA 1Z9BA 3DMTA 3ANMA 3GWGA 1D9ZA 4JLUA 1H5UA 1I14A 4BUCA 4Q4DA 4AJKA 3EVTA 4BJ3A 4EDHA 3WNQA 1JYEA 1MJHA 2PUCA 3S28A 3LCCA 2H5LA 1WMEA 5DNWA 3U4GA 2I8LA 2J9FA 2JCSA 5T5QA 1XCPA 4P7BA 4PPFA 4FGUA 3ROGA 4C4SA 4UMDA 2AOVA 2PT7A 1IHXA 1O58A 1O87A 2ZOSA 4H6PA 4RLHA 4UEOA 4CCYB 1ZD3A 2ATCA 3HBMA 4A8TA 1CJVC 5AJUA 2OA0A 1WUJS 1YL7A 3FDZA 1U0EA 2HJGA 3HZZA 3R3ZA 2AUMA 3WGGA 1HT3A 1T0UA 3JU3A 1DMSA 3I5UA 2WJAA 1KDTA 4RK7A 1HYGA 5AK6A 3HFGA 5FCDA 4BNHA 2C57A 2Q1TA 5DZSA 2Z2KA 4I8DA 2R97A 4GKVA 2FGKA 2YMPA 2PVCA 1P5HA 4LF7B 3VR3A 5GADl 4M88A 1QFSA 3U81A 2H2WA 2DETA 3GEDA 4ALLA 4AD8A 2AI3A 1R5OA 3P2KA 1GL7A 4WZBA 2HU8A 4W5QA 3RGWS 2J09A 4P5EA 3R6GA 2QUIA 4RU1A 1M6EX 1QGUA 4LHSA 5C5CA 2AI1A 3WLLA 3ZCSA 1N25A 1OLOA 3PR3A 5BYBA 1O9HA 4BEJA 3LP5A 4C3ZA 2HMWA 4QGFA 2JATA 1VPTA 1RE0A 4FM9A 4KXLA 1GT6A 2QAGC 4G5GA 2V7PA 4KNYA 3AONB 4P1ZA 4LMRA 1Z29A 2P6UA 3WMEA 2CE2X 1KU0A 1NQVA 1OA1A 4KHZA 4O4HA 1KI6A 2VAPA 3ER6A 5CA0F 2VAXA 4YCLA 4M8NE 2Y1KA 4QPNA 1Q11A 3JTMA 2QD4A 5C4IA 4JV5B 2PGNA 3UICA 3PEUA 4K40A 3ROEA 3W90A 1KI3A 2C5LA 2IVFA 3EA4A 1L1FA 4C6TB 4C21A 4YAIA 4Z49A 2PUFA 2VCEA 1V4BA 2ZBRA 1Y4DE 1U3FA 2O48X 3EIXA 3EXIB 4O2BB 8MHTA 4JHLA 3AVTA 3DXZA 3IHLA 2AYYA 4Y2YA 2PT6A 9MHTA 2SNIE 4DM3A 2CNNA 3TTWA 5L3RA 2I6SA 3V4PB 1NHWA 1SXJB 3VRHA 5BNTA 1U2DC 1RADA 4I66A 1QCYA 3BREA 4CKWB 3H18A 1JQDA 4MI6A 4LY9A 1I2ZA 1QGED 2FPUA 5TF4A 3VZCA 1OU0A 1ODTC 1YACA 3TNLA 2ZRHA 3GPDG 3FF4A 4F06A 4KE6A 3WP0A 5IZCC 1FYDA 1WCV1 2DBZA 1MH1A 1PK7A 3A1TA 3MTQA 3L7JA 1KYZA 1LI4A 3RUIA 3ZXSA 5MN4A 1U31A 5CA1B 1VMAA 3K70D 3HVUA 4YRMA 2G09A 4JLAA 1L3BA 4FNGA 4M21A 1E3SA 4EI2A 3LX6A 2O7VA 3ZVKA 4AJEA 1Z3CA 5M29A 1WULS 3CLSC 3FHLA 4R2KA 1X1TA 1WMFA 4H18A 4E09A 4MUAA 5B55A 2V4MA 1GYPA 1UADA 3D2CA 4JLWA 1U99A 5KB3A 3NEJA 4CM1A 3FVVA 1FTGA 5K2OA 2CFRA 3FLAA 3GRCA 4DMKA 1PGOA 1QE3A 2YOHA 1DKPA 3FOZA 1FUYB 3LF2A 3VNRA 2VHJA 1X1RA 3V7UA 3ZE9A 2G67A 1JJIA 4L7VA 1IBCA 3R3YA 1RXCA 3NBYC 4TRNA 3OFND 5K0CA 5DDIP 1JG1A 4O2RA 3GNSA 1SVSA 1KQOA 2NGRA 4JSRA 5KX5A 3BGWA 2PR2A 3RU3A 1MC4A 3DONA 2J0SA 2CHEA 2VJCA 3LUHA 4NV0A 5LMCA 3G2OA 2F1IA 5CA0A 1WXFA 4LTNA 1OI4A 3RVPA 2O8FA 4WFIA 4BKRA 2PKXA 1WCIA 3D7RA 1PR2A 1HM5A 1XZPA 3ILYA 3SYNA 2JKVA 4ER7A 5FT9A 5LZ2A 1A4IA 3D6TB 4A91A 2P3LA 3WIVA 2H11A 3FBGA 3WYDA 4RE6A 4ZT5A 4G0UA 1NLYA 4EHNA 3TL6A 3PXBA 1MGPA 4YJFB 3D6FA 3DHVA 2H17A 3VAAA 3F5DA 2J3JA 2Y1FA 4O59O 1CIVA 2WZQA 2OCKA 3K4HA 2C8LA 4YAJA 1LBTA 3DZIA 3UJAA 1AT1A 2O5EA 1QIFA 1QHYA 2WK1A 1YVDA 3SXJA 3GLIB 4GQBA 2BFEA 1Y63A 4RHCA 1DUSA 3ZNOA 4DV1B 4ZAXA 2AFIE 5FV7A 5HZMA 3RIXA 3R20A 2VO1A 3EG9A 3PC6A 3GYBA 2Z3WA 4MYHA 4R0MA 1WBDA 4ZOBA 4MSUA 4BDSA 1UM8A 3HWRA 1DXOA 3WADA 2AYXA 4FZ5A 4HAIA 1CZOA 1KI4A 3UMCA 1ZAYA 2F1JA 4AM8A 1FL9A 1SQFA 3IC5A 1LTQA 4UZFA 1WP4A 2WF7A 1G8MA 3EK2A 1DJNA 4Q66C 4NYMQ 3WLRA 3O3MB 3JWEA 5CFPA 3T3IA 5ICGA 5ELLA 3D4NA 1PKEA 5EIFA 1XZBA 2V7TA 2H51A 1N8NA 1ZMBA 2P9QA 3MMSA 1NJ8A 4ZT3A 5I7VA 4ZYTA 4B09A 2ZBDA 3BSSA 3U6KA 4Y6QA 3GZTB 4QQNA 1NNLA 4YTEA 2QX8A 4E21A 3R6DA 1Z2EA 1TDJA 3PQ5A 5LXTF 2IH2A 2J3QA 3O1LA 4A1FA 2HDWA 3HU1A 4KLZA 3RV4A 1YRQA 2HA7A 4B17A 4PNPA 2WAMA 1E1LA 1WHSA 1NQ5A 3I3OA 1HPLA 4B7XA 4WK4B 3R0VA 3UWOA 1VG0B 1XIVA 1TAHA 1R6BX 2J8ZA 3KJNA 5C81A 3GLHA 1NI3A 4MINA 4UUQA 3BICA 4YAWA 1B8OA 1E59A 2GVDC 1JNXX 2H85A 4PIMA 3U3DA 3AM4A 2IZ7A 4BO7A 4YRKA 5IXYA 4HZGA 4IGFA 3DCYA 2GEBA 4AG6A 1LU9A 3C6QA 3K09C 1KEWA 5IHPA 4LJYA 1YRYE 3U9TA 1J9ZA 1GQRA 2GBPA 5JNRA 2AUTA 4BFVA 3QI7A 2HY7A 4TS1A 3AOEA 1QQAA 1UK8A 3CW2A 4Y9SA 3G89A 3ML1A 9LDBA 1ZD8A 2VL7A 4PICA 1D4AA 3BZWA 1SUEA 4WXPA 1OAAA 2YCBA 4C0LA 5I7WA 3GPLA 1BJKA 4HWTA 4ZKEA 2FW0A 5BSVA 1N2ZA 1SKYB 1O95C 3O91A 5BT9A 2I7DA 4MP3A 3EJWA 2FU5C 1SQ6A 3TPZA 1FU7A 5PGMA 4LCEA 3G2LA 4MQFA 4YQZA 1O96A 4WAUA 3EZ2A 2LKDA 1LPPA 5AW0A 5KX5B 2XD4A 1UPFA 3O26A 4E7PA 3ZBTA 2V7XA 1GOTA 3KOOA 3PICA 1RXUA 4L0DA 5COAA 5DO9A 2CKDA 5H3LA 5IJ0B 4Z1MA 5KVCA 4DIEA 3R74A 3D3NA 1FFWA 2AG5A 4K8OA 4URYR 4DWWA 2EXXA 2A1UB 4HQNA 1JLLB 3ACBA 1SUPA 2QE7D 4R1NA 4TZ0A 2HM7A 3K6RA 1Z33A 4B2LA 5AVWA 1HH4A 3FJOA 3T1HB 1JSLA 3ASVA 3DW3X 2H18A 5IN5A 3UXEA 3OCJA 5KOYA 2VDUE 5AW8A 3LFTA 3HJGA 2VPQA 4QO8A 5DBIA 5DN9A 1W47A 2RGBA 4WOBA 2AMVA 2GM4A 2WD9A 5FPKA 1C0IA 3ZY6A 4DANA 1Y3HA 5KSWB 4IQ4A 5JWOA 4Z53A 2AF4C 1RAHA 3B3FA 4R9VA 4Y2GA 4YNBA 3UGTA 1CZLA 1NA5A 3UUWA 4QLBA 1DZIA 3WNCA 2JGEA 2MINA 3L7KA 1IN7A 1R64A 1CR6A 4DRXA 5JJIA 3EQ9A 3N6VA 1Z5VA 3Q2OA 4G86A 4B71A 4JQCA 4BWYA 3NOVA 3SZOA 5C1DA 3PA6A 3U3OA 1B2LA 1SGWA 2CBXA 2H00A 1DG1G 2VG8A 1FFXA 3IPRA 3V46A 4B7AA 4UU1A 1NF2A 4FEAA 4YB8A 1WXHA 4EITA 3PGVA 1CUXA 2GNOA 3ZDZB 5IXSA 4WK0B 2C2OA 2A9KA 2J07A 2OQIA 2QTWB 5C0OE 5AESA 2AKAB 5BQ5A 3EPHA 1WTCA 3IP9A 1GG2A 1XKQA 3IO3A 2O0MA 4QQKA 5TQVA 1RI5A 2HK8A 3OM1A 4QXQA 3GCWA 3QV2A 4RPIA 3AFGA 4OL0A 3WYCA 2VJDA 1CUYA 5JS8A 3UZUA 5H3CA 4R4JA 2J41A 1C1HA 4F2PA 2DC1A 1SZCA 2ZRKA 3WLIA 4EF4A 5AFSA 1Q1AA 3OCCA 2AWOA 2XUOA 3U17A 4GP6A 1DC6A 5C35A 5LNK6 1O6GA 3KVYA 4IKEA 3RNOA 4QKQA 1KI9A 3BILA 3DNPA 4MUGA 3ZJTA 1B15A 3HYCA 2J3MA 1JJBA 1ZJ6A 3LUJA 3UV3A 1SUDA 3SWWA 2IX3A 3H2JA 3IQDB 3QVJA 3KKKA 2AG0A 3M89A 1G2PA 1JTFA 5FV4A 4MIYA 5CJPA 3DG9A 2CJWA 1RZRA 1Y5NA 2B25A 5D3ZA 3TZQA 1F2VA 3D6MA 2C9BA 2JGFA 1YB1A 4ALIA 2DHCA 2AT1A 1WVGA 4JU8A 4A82A 4MV4A 4B4UA 4R71A 2DPLA 4JP1A 3ADDA 4L8WB 1GTZA 5CLLA 1NAIA 1ZZGA 3TQHA 4Z4HA 4MUFA 3CVYA 3TJMA 4N5MA 2ZRDA 3WKBA 2C4UA 2GXQA 2R5WA 5EQFA 1XALA 4N5NA 4EG7A 1GPJA 2PX4A 3A6GA 3P4UA 4NDNE 1IM8A 3PFCA 4PO8A 1AJEA 3OICA 5J23A 3EGDB 5DXFA 5AI4A 1T3LA 4NF2A 4YMTA 1QHHA 1O4VA 2QEQA 4QQ8A 5GV8A 2YXBA 3ZVRA 3TKYA 3ZQKA 2QMQA 1FQJA 4PGMA 3TBHA 1E1QD 4X6UA 4F7WA 3TR5A 4RQBA 3SS7X 3QVXA 4G5XA 3RR2A 4TZ6A 1LJ8A 3PWSA 4C7MA 4OF4A 4ER5A 1IDN1 3DPUA 2HFJA 1T3SA 3ZH2A 2A57A 1NY6A 5HCUA 5JZMA 2A9RA 1LGYA 4LOLA 5WRFA 4ANFA 1H05A 1QHSA 2ZULA 5I51A 2OD9A 1RBYA 2FZ5A 2ENUA 1IDOA 1RWOA 2AN4A 1E3MA 5IUNC 5F76A 1WMBA 2I3ZA 3T0GA 2E2WA 4MQEB 1PBTA 2ISCA 4G8CA 1R4NA 3ZHCA 3VJLA 4QGSA 1DAIA 1WABA 1M6YA 1S9DA 3EIHA 3O8QA 1W85A 4LE0A 5AW7A 5ADUS 1QFYA 3IPLA 2JI7A 1PT7A 3LBFA 1XZKA 2A1UA 2HGSA 2XQKA 2QMHA 4H08A 1NMXA 3I04A 2AEEA 2JFXA 4EL0A 1JNYA 3KQTA 3IBSA 5K05A 4HWKA 1SC1A 2ETXA 4O4IA 5DLYA 3W5HA 2YXNA 2YZ2A 1NX9A 1WQ3A 3KZXA 3LXUX 3OZVA 1UOOA 3D2LA 3ZGYA 1MEEA 4BOYA 4C7VA 1TB4A 2WT4A 3C6XA 3V42A 3BJRA 4BNYA 4CN8A 2I4IA 5LU9A 4EENA 3U3ZA 2GKSA 4OJTA 1AX9A 3A1WA 2NU8B 1P5RA 2AOUB 2WJGA 2BCGY 2HSGA 2O50A 4PRZA 3C4QA 1EFRA 2Q3EA 4MR8A 4QPCA 4EEKA 7REQA 1V26A 2MR6A 3T54A 3O75A 3B6ZA 1KQ3A 3HC7A 3I1IA 3M83A 4HSGA 3GW8A 4LMPA 3LS2A 5G1NA 3WA7A 5EP1A 1N32B 1YMQA 3TI7A 4HWSA 4LYHA 4D4MA 1GT91 4X61A 3R4CA 2PD3A 1X8LA 4URXR 3SX0A 5AHWA 4MGEA 2FEPA 4UCFA 3B7GA 4HDSA 2O6LA 3L6OO 3O38A 3EOAI 4AG5A 1MH9A 3ZJVA 3LH5A 4RW0A 1EFCA 2CMKA 3FZYA 3MMZA 4OQNA 3RK0A 4B43A 5LP6B 2PCLA 4IHJA 4XCVA 5SZJA 5HF8A 3RJMA 4MLZA 3ZLUA 1AA6A 4QTYA 3DMHA 3LW8A 4I1UA 3GJXC 4KOAA 5IH3A 3TK1A 4IDPA 1VBKA 4DA6A 5F23A 1Z63A 1H8EA 5CX1B 3PX2A 1XFDA 1FP7A 2I6GA 4G0NA 1KAQA 3A7DA 4E13A 1GN8A 3OPMA 3WMFA 3UAZA 4MTCA 3ADPA 3H11A 3OZRA 3PQ4A 1Q1EA 4P3OA 2BBWA 2JK0A 2P40A 1OA0A 5FLXA 1TUBB 3RRFA 4KMOA 4XH9B 4ZGBA 4KK3A 4P2BA 5EN4A 3W2FA 4G0VA 1XDDA 4CI0B 3MNFA 1O2DA 1Y1RA 3D8BA 2VC2B 4MQ5A 4A1OA 5KTPA 1YS9A 4R5MA 1J39A 5CAEA 3QIVA 1JG3A 3CHYA 2VHCA 3ITDA 3SOZA 5KTRA 1UK6A 1NUPA 3ZI7A 1E2PA 1L7DA 1R6AA 2ODTX 1VFNA 2LDBA 1XCOA 2NPOA 2BCEA 2WAAA 2DPXA 3W0LB 1N92A 1QF9A 2Q0QA 1ZJ4A 4G0XA 4UPEA 2BFFB 3LT5A 1USKA 1R6XA 2HSWA 4D9MA 1V1JA 4E08A 2K4MA 4HQRA 3VGJA 4OQLA 4MTLA 1KKMA 5KX5F 4WOKA 2IYFA 1B4DA 2YYZA 1MHPA 2Q3DA 5AVJA 3VSBA 3GPIA 1FIUA 5C46F 5K8JB 4OO3A 3CVVA 4EJ6A 2NOAA 3MWJA 3X1YA 4KWCA 4W82A 1QF7A 5EWJB 1H6AA 4IIBA 5GJCA 1GQOA 1H2FA 1E4EA 1OIWA 1XR3A 3BWYA 3DWFA 3IEMA 4MWCA 3QVWA 1FMJA 1N6HA 1R0WA 2I54A 1DQRA 1P2GA 3GXOA 1CQWA 1ZH2A 5JMPA 1G8FA 5TDHA 3RAGA 1E5QA 1A72A 1VIVA 1NN0A 2NZVG 2BIFA 2ZAYA 4TT8A 4TTJA 4ZTBA 2JB9A 3DV9A 4I8IA 1VB5A 1F1BA 1HMYA 5HQJA 2HK9A 1XZGA 1RYFA 1SC9A 4PAOA 2R6R1 1N8KA 4OREX 4XI9A 5EHQA 4X64B 5E8RA 1DO0A 2PG3A 1YR9A 3BL6A 2QQGA 3A9TA 1ZRHA 3TE6A 4RCVA 4OV6B 3WOHA 2FLWA 3IQZA 1PLKA 4AY5A 2RFLA 3HA3A 3T1QA 3CT6A 1ZFNA 4LYFA 5BV1A 4EKGA 2XT6A 4BVGA 1T4GA 4I8XA 1XAIA 3U13A 4ND5A 1J33A 5BVGB 4M7RA 4EQ6B 3O7WA 1VE5A 2WWXA 3KDPA 4D8WA 4MGIR 5A62A 3K0FA 4IJKA 3D7LA 4GKBA 1U0JA 1VP3A 1ULSA 2WJVA 3NHBA 4MKFA 4Q93A 3I83A 5E95A 4AJ9A 4FHZA 2ZUTA 4LJLA 3ZK8A 2O2YA 2JBHA 3G5AA 4E5NA 4R8LA 4PLHA 5B57C 5DXJA 2JD0A 2VP9A 1F5SA 1YVUA 3DE3X 3MLAA 1PFGA 4MNTA 1BXKA 1ZBDA 4OXKA 4N0PA 4YK7A 1CUSA 3V7YA 4L4ZA 1QKIA 1DCTA 3B60A 2W90A 2ZW9A 1FYEA 4NZMA 2VWQA 4UTZA 1TE2A 1NT2A 3BT7A 4RF3A 4R6XA 2OG1A 4P84A 4J8PA 4G0PA 4LJ7A 1P62B 5DNDA 2GFIA 2J5RA 1H1TA 3OQVA 3OFKA 2KQUA 2WKPA 4KPUB 3VPBA 4DABA 1EXDA 5EUQB 1HNWB 1W8IA 1TC2A 3IVGA 3UT5B 4MVJA 1H3EA 5HCIA 4CQJA 1UJ4A 4F9TA 2XVXA 1TM5E 3TE7A 3TFQA 3COJA 3RKRA 2BJWA 3P9YA 1Z7BA 3JD0A 3Q9UA 1ULHA 5DFAA 5IAAA 5EA2A 5IAOA 3H11B 1L4UA 1RQPA 2QTNA 4GOND 4XD7D 4MWZA 5E4YA 3VNQA 1EK1A 4AJOA 5IK2D 2Z2YA 5CW1A 1RP1A 4Q4CA 3I6ZA 5LP1A 2VHTA 2HYIC 1E9DA 2C3YA 1K8ZB 1UDCA 2FGJA 3O7MA 5C3UA 1RDFA 4MKXA 1KPGA 1ZA1A 3S0JA 4EGSA 3ZLJA 1FSPA 3TZCA 1YJBA 2F17A 2X23A 4DKJA 4TS4A 5JI2E 3HI6A 2F48A 2P5TB 4MYCA 1JVBA 2YBEA 3CWQA 1V37A 4B0PA 1Y5RA 1BFUA 1FEZA 1GL9B 3OTHA 3S8MA 3T95A 4B32A 2OFPA 1QMPA 1TTPB 1LNSA 3I6MA 4IKOA 1X87A 4J2HA 4ZZ0A 1XD8A 3JVUA 1MAWA 1RKXA 1HF3A 1Z82A 1XJWA 2PRZA 1VG8A 4WADA 4P0TA 4MX8A 1M1YE 2QDKA 1T0BA 2AG6A 1NQUA 1NX6A 2JAQA 1NM5A 5LUBA 3TNYA 5DYWA 2LRHA 4UNIA 5JH7A 3AEYA 1HEUA 4LOKA 1WE2A 4WN9B 3VO1A 4Q1DA 1YAJA 4ID3A 3VHRA 4O2BF 2NXEA 1GGFA 1M7GA 1W6UA 2VDRB 4I4NA 4BP8A 1WKVA 4CUKA 1BS2A 1R0KA 1XXHA 4M1YA 3D8NA 4IEFB 1BWRA 3T1NA 1GO2A 2QS9A 3FSEA 1VLZA 3WLMA 1ZICA 4BQEA 2H8KA 1ENYA 4GIBA 1O6ZA 1B8NA 2ZJ7A 2IU0A 3T34A 5BMVA 4W1PA 4PLFA 3L7NA 5FO0A 1R6DA 4GZLA 2G7MC 1Z0AA 1D5CA 2DPGA 1IVYA 1W8DA 2Y77A 5F1KA 4A5OA 1T5LA 2Q6LA 4R2XA 5A7FA 5LZ5A 3L1KA 1U6KA 4ZJUA 3OX4A 1DBVO 4DEVA 2OAQ1 3Q4GA 1MO2A 5EHIA 4NFHA 1XXHE 3D3WB 1QDEA 3EH2A 4CKBA 4TWRA 1ACLA 1JN0A 3KQMA 4W7IA 1HR0B 3LO5A 1JZSA 1BMTA 4EY5A 3FKJA 4V0KA 1NF8A 1C41A 3EEQA 1PJ4A 4BCCA 2IDJA 3EF3A 4C5AA 4YI3A 3V4LA 4R9NA 5B4UA 3L8EA 1CUHA 1GCGA 2VHZA 5LQCA 4EVSA 1YNOA 2QRHA 1X86B 1PVVA 2HIMA 3B9BA 1VGVA 4ZVQA 4W5OA 4HF7A 2XIQA 3A7EA 3G6WA 3G2KA 4RK0A 4EKDA 2PUVA 3ICPA 4O2LA 4Q03A 3P9ZA 4U0JA 4F4JA 4AIRA 4J4BA 4ARVA 2ACWA 2BE9A 1SR8A 5B4VA 3OPYB 3LDHA 1Z2DA 4RSHA 2IP2A 3G8BA 3E7XA 3ROQA 1XXLA 2X86A 4BNWA 3DMPA 1WDWB 1AKYA 2WE7A 4WL0A 3V8EA 4CMEA 1YGYA 1GJRA 4AY2A 3CUUA 1Z6AA 1Q7EA 1XN1A 4D96A 4XQ0A 4EYKA 3AY6A 4TS3A 2RB5A 4OH7A 1M2EA 5KWJA 6Q21A 5LL6P 2QRLA 4PHCA 4UBLA 3FJYA 2J7PA 4YCMA 2A0FA 5TIIA 1IM2A 1DQNA 2PV0A 3GX1A 1YQEA 2JFOA 5CDTA 4K9KA 5BOSA 3W8DA 4GOLD 4OUDB 4D57A 4XYLA 4KREA 2JA1A 3LUCA 5DBFA 4E2WA 4GQIA 5DBGA 2ZI5A 3LT1A 4QG3A 2UZIR 3QLJA 3O4GA 1NRXA 2A0KA 2PUHA 4DR7B 4JU9A 1OTYA 2JVJA 3LQ4A 1A77A 3GAMA 1F4VA 4MA5A 3LIPA 4JSYA 4OA8A 1O89A 3BZBA 4HAYA 3P0IA 4CIBA 3DTVA 1TFRA 4MKGA 3RVKA 4OFZA 1NWCA 1E2LA 3QBEA 4MW5A 4HRAA 5J4KA 4CKWA 5JLAA 2QKYA 5K0LA 4UE2A 2POQX 3FCUB 5CG1A 5CFLA 4PNZA 1ZCJA 2UVDA 3H1GA 1K68A 2DFVA 1Q20A 4ICIA 2WSMA 3ZGVA 5CHEA 1GPBA 3TIVA 1T25A 1TQDA 5IYZA 3EXG1 4UQPA 4G5SA 4GWGA 4ZT7A 2B7LA 3KM0A 5LBIA 1US8B 3MOSA 1KVQA 2IWRA 2FWJA 1T6BY 1NP3A 1JMVA 3QE2A 3QWHA 1C7RA 1ZD4A 2ZIEA 1ZI6A 2CVPA 5DM60 5T64A 4M4SA 3NWBA 4MRVA 1PNRA 3R09A 4CF6A 4OU4A 1EXMA 4PX2A 4DSNA 5CA1F 1NJFA 1KKLA 4JEMA 3ZHOA 5EE3A 2RH4A 2D1RA 4KIJA 1UXOA 4X8MA 2XVYA 1UP6A 3O3OB 4EFLA 4QELA 4UKDA 1E94E 3AY7A 4IMJB 1LK7A 3ZK7A 4C87A 2Q21A 3GFQA 1NV8A 1ZUD1 2JFNA 1Z18A 2AQ8A 1WB6A 3HPRA 1P9LA 3LOQA 1YSCA 4YRCA 4PSKA 4Q6BA 2DCMA 1LA2A 4C3UA 1QVZA 3H1TA 3OT4A 2QN8A 5K20A 2BKUA 1ZSNA 3VSCA 2IELA 1UINA 1QP4A 3EN0A 3KWFA 2W70A 4UMFA 1Q22A 4CLHA 1FDTA 4L1KA 2VTVA 3Q7SA 3MAJA 5CCXA 5IYZB 2O2ZA 2C7QA 2HDNB 3GLGA 2X9VA 2B37A 1LC0A 3CRRA 3PXGA 2IYEA 1L0BA 2WQZA 3BA6A 4HK4A 5CA0B 3WGKA 4KLAA 1ORRA 2QP4A 5F3RA 1NC1A 4FFOA 1J0XO 2ZRNA 1FS6A 2V7BA 3L6EA 4H1VA 3LJKA 1G6OA 4RD2A 2OCLA 3D6NB 3R3XA 4U7JA 4F3KA 5C8VA 4LYDA 1CLEA 1BDMA 2F67A 2QRMA 4YX9A 1XL0A 5C18A 1HYBA 3FCAA 4H7EA 4JYZA 4BKOA 5DXAA 3OJWA 2XECA 2YIDA 1T3HA 3MRSA 5JAHA 3W1WA 1JIQA 4O08A 2C7PA 1VXRA 2PR7A 3VVCA 5LWQA 4GSLA 5CH5A 3RBXA 2HT1A 4LYJA 3HFJA 1TMOA 2OQ2A 1H4SA 2X19A 1Y8RA 3RIYA 4KMSA 1DWQA 4OHXA 4I1SA 2J7KA 4JAVC 4ACAA 3PRKE 4I55F 3DV0B 5BSKA 4FDTA 1DEHA 1SKAA 3TQRA 2XJ4A 1QU2A 4B3XA 1CC1S 3QMPA 5FNVA 2OYSA 3ITEA 4FKBA 2XXJA 4R9UC 1XU9A 4Q7EA 1KXZA 3BMQB 3FMGA 4LPSA 1GLNA 1P81A 1L5RA 2ATIA 3AR7A 4LJ4A 4R8VA 4Z0NA 1WZ2A 3ANLA 1SCKA 1SXHA 2X22A 2ZYTX 1KFBB 3NHUA 1UBGA 3DC7A 4ZKDA 2GEFA 1FJGB 2AEMA 2E48A 2IYQA 5A02A 4JXZA 2LTAA 1MP0A 1Y33E 3H4VA 4YJGA 621PA 1VJGA 2G28A 1GSAA 1TEVA 1Y1QA 1P29A 2O4CA 2YBDA 4M9ZA 4MRSA 4MPPA 4X71A 1K8RA 1KOJA 5DGTA 1A1SA 1Q0RA 2I1WA 4TWZA 1TJ4A 4IBOA 5IC4A 2ZRQA 3AEQA 5H7XA 4DLSA 5EJ5A 4HT3B 2EJTA 1RNLA 5BSRA 2NTJA 3C3PA 4BX2A 3GK3A 4M6WB 4G41A 5FTLA 1IBKB 3KQYA 3L2OB 1L8QA 3STVA 1LI5A 3I9NA 3N0RA 1FNSA 3KL4A 3R0JA 3KYDB 3QXSA 1OFIA 3DMNA 3EG9B 2C03A 3IBFA 4GPAA 4AICA 2I55A 2YCLA 2AK2A 1JDPA 1ZDMA 1N6KA 5F33A 2O54A 5IT9A 4HWRA 2QU8A 2Z2XA 3CZCA 4KVZA 3NHWA 2I4NA 4B4OA 1YFLA 3GEPA 3GA5A 1YS2X 2VDJA 4BU0A 3BHMA 4B5KA 3F6PA 4CQMA 5BR4A 2W8ZA 4KQWA 5JXWA 1ABEA 3NEYA 4G5QA 4M1WA 3AR8A 3A4TA 1ECCA 4EEXA 2JHFA 5KTMA 1NQAO 1ZGCA 1IOZA 3L6DA 2E4XA 2A14A 4ZYUA 3K92A 1E7RA 1XUOA 5HGXA 5A4KA 2YNMD 3H8JA 2BC9A 3PK0A 4H1HA 5D87A 4AMZA 5HWSA 3OLVA 1ZKDA 2IYLD 3N05A 4UBNA 5TJHA 1IUNA 1BXRB 1M0WA 2NSJA 1Q14A 3VOTA 4DIKA 3FGNA 1IJFA 3WLSA 4TKLA 4HJXA 1UKYA 3QE3A 1JHZA 3SDZA 3DTNA 5B36A 1BXGB 2ODPA 2X76A 3PPIA 3K0FB 4TKUB 5GVSA 5D1NA 1EGVB 1ABBA 2NVWA 3V5NA 4ZK6A 5LLDA 1F7VA 2O8BB 4H0NA 1M0SA 3ZZUA 4YAOA 1NW4A 2OBLA 1TF5A 4GPBA 2Y1CA 2ZE7A 4DKXA 2NTYC 3HNRA 3K6JA 1Y3FE 3A6HA 4PPYA 4V03A 2G17A 3FHCB 3QZUA 4J2TA 1JX6A 4F04A 4YUZA 2GZHA 5IASA 1NQXA 1QC5A 2OECA 3PWTA 1RXSA 4LISA 3WIBA 4D7AA 5JZ9A 4U9UA 3ZWVA 4U4AA 1JDSA 3FFWA 5ENZA 2FSHA 3J7AC 3IXLA 1TKAA 3O92A 4QX6A 3ROMA 4ZCIA 2N75A 2XUIA 3JQAB 3VXKA 2P9TA 2YY7A 4DBLC 5LD2C 4ZVPA 3HBFA 4PO1A 3RIHA 1GFSA 1YBMA 1T8TA 2XQVA 3OU7A 4IDOA 4KR6A 4LQCA 4YP0A 3WFIA 4AZ3A 3SQWA 1QB7A 3DXYA 1QLWA 1KYQA 1O94A 1US8A 4DMLA 4YP1A 1M2VA 1Y1LA 2O0JA 2WEKA 2FPOA 2JZCA 4TSFD 5ER6A 1K63A 4B84A 1Q1QA 2ZUSA 2IIBA 1JA1A 1D7AA 1THZA 3BVPA 2BMAA 3BCHA 3HXPA 5K8IA 1R9JA 1OKKD 1OXUA 1CQJB 4EKYA 4PG5A 2EF0A 4FQ7A 4ATNA 1CF9A 2GM5A 1ISHA 1USWA 3CZ4A 2M98A 5I4KA 1N5LA 1XBTA 3CEJA 2EYUA 4PXAA 4LHYA 4PNHA 3OD1A 1W19A 4G1EB 4HEQA 2P4SA 2VYFA 2QMYA 2RBEA 4FHGA 1YDFA 3MFYA 3MWEA 2AXQA 3BOSA 3UUGA 1LDEA 5HGJA 4ARCA 1EMDA 2HCJB 2AD5A 2VDWB 4KO2S 4CG0A 1J2YA 3SQMA 1OASA 1C1XB 4BJ6A 4LF5B 4EDFA 4EGCB 2WVHA 4O4IF 3RAEC 1IZ7A 5JZSA 2X5KO 3T7DA 1YI0A 4PC6A 1Z26A 4GR4A 5B7NA 2F7SA 4NESA 2XA9A 2CXTA 2W2XA 1F7UA 2HPAA 5B2ZA 5JYEA 5IEJA 3HZHA 2KE5A 2YWBA 1MX3A 3F7NA 2AJLI 2JZOA 3OZXA 4AO7A 2FF7A 3R7WA 4KYUA 4M8IA 3T5PA 3IE1A 1MOQA 1ZN2A 1XJCA 3K70B 3WYGA 1OC4A 2JHGA 4MVXA 3JX9A 4G09A 4KNWA 4E2FA 3CBQA 4J91A 1REQA 2DE0X 3NHMA 3QOFA 2BISA 4XQGA 5JMOA 1Z6XA 2BZ1A 1KJWA 1UJCA 3AIOA 2Z4TA 2RHLA 2GLUA 1Y89A 1LJUA 1GLVA 3AHFA 1TMYA 1XVIA 2ISSD 1CNEA 4GOOD 4LXIA 4M98A 4O0LA 4Q82A 1IQPA 3LY5A 4YRRA 3ZU6A 3ER8A 4JWKA 2ZTUA 4LVOA 4MB0A 5JPIA 4NAHA 3HXTA 3KX2A 4L16A 4LYGA 5JMTA 3Q10A 4Z4FA 1JGTA 1F6BA 4DNPA 2QTBA 4W99A 4MVWA 2H1CA 3W79A 3WLFA 1AB5A 1II8B 3AJDA 2ZIGA 1CIPA 1UP7A 3CLTD 1JQBA 3K94A 3NEPX 1YVRA 4G6ZA 5JXHA 1TQ6A 2X15A 4D9JA 1T8UA 3T5TA 4R3NA 4OHVA 1ZGJA 5ALUA 3R3VA 2D1QA 4B8YA 1XMQB 4LV5B 3WE7A 2QPTA 5IT4A 4FLEA 3H2BA 4I50B 1AH2A 3V80A 3STHA 2FRVA 3VYVA 3CBGA 5DNYB 4C05A 4ADSG 1L5HB 1JAXA 2H7YA 5KC9A 3C97A 4BGDA 2ZJZA 1FNNA 2HCFA 3VU1A 2ECPA 1J20A 2F00A 3EMVA 2EIHA 4B3FX 5I5EA 4R54A 4HXEB 5HKKA 1ZO8A 3AEKA 1JECA 3PXUA 4IIFA 4PZDA 1FU8A 2H7XA 1RQ2A 1WZCA 1MJNA 2ZVJA 4TRRA 1GGJA 3QPCA 4TN5A 2ZXFA 2X0EA 3ZVMA 3BHIA 5B6JA 4A2WA 5K3CA 5B3JC 3HHPA 2PZFA 3CT4A 1AKWA 4RFLA 1G21E 3H13A 4B45A 4LNUB 5A3QA 5KTNA 5DLPA 3BWBA 1QG2A 3VH3A 2XYQA 3TZEA 5CEFA 2H2DA 2WWTA 3A70A 3HCCA 4NWIA 1I4WA 2IUFA 3BWEA 2WJJA 1U3VA 4K9NA 3TIFA 1YKGA 1DPFA 1OPRA 1T10A 2HWWA 3BTSA 4X84A 5H82A 1DC5A 2Y1GA 4JYCA 4CDMA 1I4LD 2ZUWA 3QA9A 3R0QA 3CKLA 2ODEA 2X4LA 2AJBA 1O95D 4IH4A 4IOMA 4MUKA 4P38A 4F4UA 1TMKA 1H8HA 3JQ8B 3MZ0A 4KQEA 2QM0A 2A9JA 2GBFA 3A9VA 4J1TA 4UJ5A 1YR8A 5HFJA 3ETCA 4LWOA 5T8KA 4HNAB 4C3VA 3WLQA 4JJ7A 1PCXA 2I2BA 2PQ2A 4LSMA 4PM4A 4B3JA 1DL5A 1E7WA 1L7XA 1OPXA 2JH9A 4I50F 4PAQA 5JECA 1G20B 3PD0A 5LZ9A 4Y1GA 1Y6FA 2EOAA 5A0VA 1T5IA 4B7ZA 2Z08A 3WLNA 4AX8A 2PGDA 5DHUA 4F3CA 5DN6A 1ZN7A 5EMJA 4TLCA 4OATA 3OCWA 1DMRA 3MRTA 3DMDA 4UTXA 3C5HA 1I36A 5BNWA 3OZAA 3QEKA 1AV7A 3Q3GE 4RF5A 4RK5A 1VFPA 1ETHA 1E0SA 5DF1A 2CLEB 3ONDA 4JB2A 4KCGA 1BE1A 3N2KA 1MLDA 3PJGA 3SOPA 3GJSA 5KSOA 3R0ZA 3LRXA 4F2WA 4KR7A 4N40A 5CK4A 1P5FA 5FX2A 2HA2A 1ZIPA 1GVNB 2F4NA 5FBVB 3DWEX 4QU9A 3NTLA 1P0QA 1V7CA 2ZCJA 2IV3A 4UQLA 2IYZA 1E2KA 2QUAA 4O5AA 1NXXA 4R2IA 4HB3A 3EVDA 1QG4A 1G291 2FPWA 1EEHA 2GM3A 2W6ZA 3H9JA 4AECA 5TC4A 2Q4RA 4MEAA 3CZQA 2ACEA 5BMOA 1S02A 5KYUA 4JI7B 3SYKA 4OBEA 3TZBA 2OG2A 2HHLA 1FRZA 4O8CA 4ZI7B 1U2EA 3PG5A 2HJSA 2OXTA 1GRNA 1Z36A 2Z6AA 3L8MA 5GAJA 5KNBA 4NCNA 5KPDA 2CDNA 1F17A 3K0SA 1MIHA 4D80A 3MTJA 2QM8A 1DJPA 2IBMA 5KJEA 2ICAA 1JYSA 4MVJI 4XWAA 5FNVF 4BBPA 4EARA 1OUMA 3M2TA 4C7XA 5HQ3B 1NT4A 2BM1A 1W1WA 4Z4QA 3OIVA 5L7TA 1PJBA 1IAVA 2CLDX 3CN9A 3GP3A 1W5AA 2XPCA 1AN9A 1OW3B 1R4MA 1WBJB 3DAFA 3MXOA 1IFXA 4JSTA 4OQPA 5H68A 3X43A 4ZC1A 1UL1X 2ZVPX 3AKYA 4CTMA 3OTQA 4W8HA 2C0CA 1XF1A 3S27A 1USIA 4OX9Y 4DQ0A 3SYLA 5EIOA 4E33A 1LDBA 3GUYA 2VPXA 2YL2A 1WS6A 3EVZA 3OEYA 4EPTA 1WPXA 1U0NA 3M9LA 2Z6UA 2CFIA 4DQUA 2ZUFA 3ISVA 4PYJA 2R6DA 1C8VB 3UPUA 2EWVA 3CR8A 1HWYA 2JASA 3SYTA 4EWLA 1X1SA 1V9SA 1VQ1A 5CDUA 3I1FA 1NJ2A 3NXKA 2I76A 5CH8A 2Q4EA 3PV0A 1PW5A 2AXPA 2Q4DA 3E58A 3I28A 1JILA 3IFSA 3REFA 3SIPA 3GVHA 1JJFA 3JASB 2ZS7A 1PZMA 1ULAA 4LMAA 4F2DA 4CDRA 5JQGF 5MFPA 2E4WA 4BV8A 3UCEA 3M3DA 3B3JA 2MSDB 2XB9A 2R25B 3G5MA 1E4OA 2WKWA 1LV8A 5E4FA 3D0OA 1NJSA 1PQ4A 2F43A 3L0BA 3NDPA 3PQDA 2VZEA 3N58A 2IW1A 2IEDA 3I2GA 3AWDA 5CNMA 5JZVA 1P74A 1SAYA 1OWOA 2D5LA 2FEMA 4WXHA 1JEQB 5GQSA 4JJAA 1W4ZA 4PFQA 1CU1A 2IDKA 3GPCA 4GLJA 4MYSA 3GYGA 1PGQA 1GITA 2HQSA 5IH7A 1E92A 1S8OA 1MAHA 3TLBA 2V1XA 4PYKA 4Q9DA 3T1OA 3FVTA 1G59A 2R8EA 3CLSD 3SJUA 2HK6A 4WACA 3EF1A 4Z8YA 3ZWMA 1MW9X 3LIIA 4LTDA 2H9AA 1XEWX 3R7SA 3OAAD 4JVOA 3BERA 4Q9IA 4US0R 4RX1A 1VBFA 3AV3A 2GVNA 3MWLA 4V0NA 5EKTA 3JAMA 3COYA 4KHPB 3T3NA 1KJ9A 2CMHA 1WVIA 3AKDA 4LYAA 3I92A 1MT3A 1SCIA 1UPCA 3GDWA 1G18A 2JJ1D 3I9V6 4U8HA 4G2NA 3HKDB 1SG0A 1X1EA 4Y6OA 3EXFA 2OCGA 3MCZA 4RSGA 3B13B 3JD2A 4YCAA 5TR9A 2DR0A 4IXTA 2FFRA 1IZ9A 4WZBE 3ZE0B 2XCSB 2WKRA 3SXPA 4EJSA 3GNLA 2CW5A 1C2YA 5ECGC 1B74A 4PZPA 4HDSB 3LHIA 4K7JA 4I1VA 3KXIA 3K35A 1L7MA 3DOJA 4G8BA 1ZIXA 1JKMA 4RH1A 2QVGA 3AP3A 3GDHA 1CY4A 1XLTC 2MSEB 4ZDWA 3ZWXA 3JQ9A 1QCZA 1BDBA 4R69A 3E9MA 2P9BA 2X2EA 3PXDA 1SCBA 1RVV1 4JUBA 3NV7A 1RPNA 3ED5A 5AW4A 1YZVA 3O8QB 4P2GA 2EBFX 2MMCA 4XW2A 3NHLA 5L7YA 1AGPA 5HA5A 3TTVA 2C8JA 3KQUA 3AFMA 2SCUB 4TKVB 2R751 3LP6A 2ZE6A 1AO3A 3DXFA 1CIJA 4CTJA 4G1FA 3JZFA 1QRSA 4GYJA 1KEKA 1XTQA 2B82A 1GSOA 2UYCA 1K9VF 3GGGA 3GA0A 4Y2UA 4QXPA 1FSSA 4RDHA 4EBBA 3I2KA 1JHVA 3RVOA 2X14A 5IKXA 2EW8A 3MCAA 4YQFA 2NU8A 2WTEA 4GC9A 4JLKA 2WJZB 2B6NA 5FBQB 3WRXA 5IPFA 4AWXA 5TLSA 2GF0A 2YKGA 3BWVA 3NHJA 4RVUA 3VR5D 1OGYA 3DC2A 3NONA 3I53A 3GGOA 2EERA 2QX7A 2C7BA 4MICA 1YL5A 4FP9A 3T7EA 3WYAA 1NZJA 2A1TS 4K1LA 1CULC 3ZVNA 2Y1DA 4RNCA 2ZZNA 3F9RA 3HJHA 2COEA 3VC2A 2NVUB 4RHEA 4MS3B 3L4JA 2QLJA 2B21A 4I2VA 4RIEA 4OQZA 3TZHA 3BB4A 1BQ3A 3DBIA 2PLFA 3GRZA 2QAJA 3AUSA 4PWYA 2LXNA 4ZAWA 5JJKA 2HO5A 1W73A 1IQUA 1HK7A 1K4MA 5TQJA 3RAJA 4EY4A 2V6MA 1LFDB 1QLJA 5FP0A 1FVOA 2PZAA 3UHAA 3BM5A 4CUJA 3CPEA 1EVYA 3A9CA 3M5WA 1E3TA 3R6WA 3VR3D 4AJJA 3P5BA 4BP9A 1XZQA 1GRQA 5K3OA 1S3GA 1L3IA 2CNWD 3ON5A 3UYKA 4HV4A 3N1UA 4Z3DA 2IBTA 2ZP1A 3RTEA 1YHYA 1Y8AA 1GAEO 2H4WA 2DGDA 4QXAA 1LBHA 3P9XA 3K72B 4DLKA 4FIDA 4Y9DA 1TF2A 3OHPA 4JD5A 4QDZA 2GBCA 5G1OA 4MV3A 3EEOA 2DSNA 1VM6A 5KPJA 2I0FA 4UARA 1NN5A 3HCEA 2R0QC 1N9GB 1BKSB 1YZQA 2X2PA 4KRGA 2P2LA 4G37A 4EUEA 3R5HA 3WAGA 1TQ2A 1BMFA 2HMYB 2WJPA 4XRGA 4RVOA 3GJ3A 1OI7A 1ARZA 1UDAA 1AY0A 1IHUA 3MJEA 5HG0A 5TMBA 3PLNA 4REQA 1FNMA 3UO8B 3DFFA 4R68A 5EHXA 1TJNA 1KYWA 4GX2A 1Z6QA 4FFWA 4KSYA 1FLDA 2C82A 4NAVA 4NBTA 2XZTA 3V8RA 1HDIA 4WBNF 2ROQA 5CM8B 5CW2A 4PZ0A 4UOZA 4FSHA 2HMVA 3TXYA 1HLGA 4S35A 1PD0A 3RSZA 1KZYC 1P73A 3ZJYA 1DSSG 2NO9A 4K6MA 5EQTA 5EXEA 1SK8A 1YRLA 3S4YA 3GUUA 1N1DA 4PTYA 5J1SB 1PJ8A 4MV1A 4ZTUB 3NAZA 2QR5A 1ZH6A 4GR9A 1RZ3A 1K8QA 2ZZKA 3Q3VA 4HXGA 3TOSA 1U0RA 2G40A 3C2QA 3FYHA 2D8AA 1KZ1A 3JARB 4PX3A 3OZUA 1T8YA 5ALIA 3WHIA 2R00C 4B31A 2UYYA 4EVRA 3DULA 3TTTA 1G8PA 1M5UA 1NUQA 2OB1A 3TSYA 2GJAA 2IYYA 3ZCRA 3C3KA 4QFBA 3CVWA 3KB8A 4HRVA 3HB5X 2V7QA 3TNJA 4F9FA 2QSJA 2WV9A 2RIRA 5BVHA 5CJ2A 4QO7A 3SQLA 1ODLA 3N9IA 4BEBA 3N8NA 3TPFA 5LP6C 5HM6A 3E3OA 2PCJA 3EXFB 5HZKA 2J6CA 3WIUA 1XDSA 2IYPA 3TXXA 4QPDA 1UBFA 4MI3A 3ZNQA 3A58B 3KKEA 3FTCA 1O0SA 2JNWA 2XMRA 1DKUA 4FFMA 4FHDA 2V6FA 4TLEA 4NARA 1NMZA 4AMYA 3U44B 1IHYA 1EG7A 3AF2A 1MB4A 1JE0A 2WSSD 3NDRA 3UQYS 2G8LA 2KW5A 3RK4A 4Z2AA 4D25A 4IO1A 3WSTA 3L77A 1CHDA 4Y2JA 1ZNZA 1J8FA 2DQSA 3AB8A 3IVRA 3MYRA 2COUA 5KTKA 5JCXA 4YUWA 4B46A 4O4LF 1E9VA 1ZD9A 1SOMA 2O2EA 3JSAA 4PLVA 3W2IA 4FNOA 1A5AB 1LS1A 2ZRCA 3RCBA 1FVHA 3KAQA 3LUKA 1M1UA 5HRUA 3QEBZ 2PUDA 5H4GA 3O95A 4DA0A 2TS1A 3A28A 1STOA 4Y7DA 3UT5A 3RBAA 2PUTA 3FDFA 5DRTA 1YR3A 2MINB 4EX7A 2P3QA 4YMSA 3WL5A 1TFUA 3NTXA 4P3KA 2ODNA 3OMLA 2CMFA 2HSEA 2Q29A 4ZCRA 4YH1A 3B6MA 2PD6A 3K9LA 4DLUA 2IH4A 5DK4A 1KF0A 2IL1A 2F6RA 4XJXA 4BATA 1LLUA 1K98A 4HY3A 4LKRA 3C98A 3DOFA 2Q2WA 1WUTA 2W71A 4FGZA 4R98A 2V8OA 3TOCA 1YRWA 3V6MA 3RADC 4Z0HO 1R27A 4ETMA 3BFJA 2D13A 4DJDC 1D2NA 5BYKA 1ORIA 3H97A 3P9CA 3BSWA 4LXXA 1ZSVA 4ARUA 3BXEA 3EHDA 3JY6A 1N9ZA 2HDHA 1HFJA 4EVIA 4H3HB 4CKBB 1N2CE 4WOCA 4LMBA 1Y1SA 2RG1A 3H83A 3W2TA 4LSGA 3GF4A 4TWAA 4ON9A 5IP5A 2PPLA 4RESA 4BVJA 2KS6A 1X7ZA 2WB2A 1C4OA 4FXOA 2HJRA 5F2NA 2E4VA 4MUNA 3QMVA 1KRXA 3MTBA 3GP8A 4AUNA 3DZDA 3ZHTA 4GPIB 1PT6A 4JJFA 2XUKA 1C7IA 1JFFA 2B1RA 1I0ZA 1G8HA 1NWHA 1QH8A 2CGEA 2R1TB 2QN1A 2WFAA 4HNHA 3T7CA 1FRNA 1HBJA 3PFFA 1NLFA 3KC2A 3BA1A 4MW9A 4D5EA 1SHTX 2CD7A 3OQNA 4J0CA 1LDYA 1E66A 5MGNA 3FNQA 3G5UA 5DX1A 2B5OA 1YU6A 1VBNA 2G0TA 1SZPA 2VYNA 3EQ8A 2DFPA 3GBSA 4KDFA 3L5KA 3CS3A 4II7A 1PUIA 4PU0A 5FUVA 4KIUA 4IWXA 5BW8A 5KQMA 5C51B 4BLQA 4LGCA 3G23A 1PT5A 1U63A 3SKVA 1RQXA 2F8MA 3EZXA 4F96A 4UVIA 4DTCA 3OHSX 4RPGA 4ER6A 4J3FA 2FEAA 1KQFA 1SELA 2W2LD 4KQXA 3PQ3A 1MJGA 5FJIA 4DGQA 3L05A 5GJBA 3OF3A 4UASA 1VKRA 1AM4D 2HMTA 2XXAB 3V8BA 2NUAB 1K2WA 1KRHA 1ADFA 5F2EA 1R0BA 2XHZA 4MCIA 3SHQA 2PWZA 3PRJA 4LECA 2O2HA 3ZDDA 5C8ZA 2D0PB 3K5PA 2AC2A 4IL5A 4WN3A 1F8FA 3GO4A 4HEHA 1DZ3A 4A2QA 4A2PA 1QO0A 1A0OA 5JY6A 4OI0A 3VKGA 5CXSA 5E6RB 3U4CA 2VJNA 4DMHA 1L5ZA 2DY1A 5EWMB 5EIXA 4DR6B 1M34B 1JPNA 3P52A 1X70A 4MJLA 2VJLA 1SOUA 3L4BC 4HNAA 4ZWNA 1MU0A 5EY5B 1YB7A 3PRHA 3SF8B 5EKXA 4IXWA 1UMBA 2LZ0A 3NM4A 4Y3UA 2OV2A 1NV9A 5GP1A 4B87A 3A9WA 3SHOA 4IIGA 4DZTA 1IMJA 3R44A 3SICE 4NZNA 1SA0A 1Z47A 4BO4A 2C2KA 4OJNA 2CYBA 2GD1O 4OMDA 4NFYA 4DCSA 4WZ6A 1SOVA 2XGJA 4KFTA 2QK4A 1R4NB 1NUAA 3ILSA 5J2UB 4L8YA 2J9XB 1H2ZA 3OQHA 2RK6A 4ZZ3A 5F73A 2OBMA 3WLPA 3RS2A 3FRHA 2Y92A 3DDCA 1NF3A 1EM8A 5FWAA 4OJKA 4RADA 2PK3A 2ZROA 1TYBE 3UXYA 1E9FA 3TGWA 4UHJA 1JKJA 3DHNA 5FF9A 3HKBB 1ECLA 1Q1ZA 1SCDA 3HH8A 1N5RA 2LIPA 4YAUA 2NSDA 3NWEA 5SZHB 2Q27A 1D1PA 4AYWA 1SZJG 5A7HA 1ESEA 2AYZA 3ILXA 1SXJD 4HDRB 1Q3HA 4FINA 1EUDB 4F6RA 1T3ZA 3HFRA 3NDJA 4WLEA 2HNKA 4QECA 1P2UA 1ORDA 3CY6A 3VO2A 2O3JA 2QAGB 4YCJA 4CYMA 3OBBA 4TYMA 2W83A 2ZYAA 3DGEC 4DTIA 4OX9B 2WOOA 2DR2A 3A31A 3BH0A 3G0HA 4MUHA 2BCJQ 4MPTA 3VI3B 3MTGA 5KYGA 3EDQA 3TW8B 2DUJA 2Q0HA 3AJRA 4I81A 4XA8A 2BGUA 4U00A 4X95A 3W05A 4I2NA 2REQA 3I3SR 3BAZA 1ATIA 2NADA 4GYWA 4RAOA 3DJYA 2QQ5A 4AP9A 3M81A 2OY0A 3MILA 4F84A 1B42A 5J3JA 4V3BA 4LGMA 3WYEA 1XPUA 2FQWA 3MD0A 4UNPA 1SVWA 4ZQHA 4NPCA 4A0RA 4D79A 1JBEA 3V7WA 5JTTA 1RRFA 4JEHA 4D4GA 1GVHA 4ER0A 4M8LA 1C0PA 2ZRGA 2BFOA 4M22A 4N12A 4QOEA 4UDXX 3LPLA 3WSVA 5KYWA 5JTUA 2G63A 2B4AA 3AHIA 5AM5A 1XKLA 4F92B 1XCJA 3GV0A 2C2BA 1AKRA 1MQ8B 1RXEA 2G76A 3DOEA 4UHCA 5DI9A 3N75A 4ZVVA 3VSEA 5I9IA 2B7CA 1W96A 3RDPA 3OT1A 5D2CA 3B1ZA 2MMGA 3EOBI 4GUAA 1PL8A 4Z9XA 3RBZA 1I7DA 4EECA 1P1IA 4JVMA 1L2TA 1GXSB 3G02A 3IIKA 3IKLA 3BXPA 4EGJA 1VMDA 2NXJA 3GUVA 3OLWA 4RPLA 1YC5A 1I32A 3DDZX 3L7CA 5LBTA 2XX3A 3RJ9A 1RYZA 1E3WB 3A1UA 3IIIA 1XPOA 4CLEA 3MS7A 2AX4A 3ZD9A 4C76A 4C88A 5E1DA 2CHGA 4JROA 2CC2A 2BE7A 2Q99A 3X2EA 3PJFA 1FMCA 4HH1A 1TW2A 5HBGA 3AR3A 4F3NA 4JKYA 4R7ZA 2W2VA 1YCGA 3ZNPA 2ZKLA 1W35A 4RC9A 1VSBA 4YALA 4O4HB 4CR7A 4L08A 5E6RA 1BXZA 2XB6A 2QYHA 2ZJBA 4R16A 5KKCA 1TU3A 3AYXB 2WLTA 1NYQA 1SXQA 1PLJA 2Q7DA 1XKTA 2YWJA 4JZYA 5JQWA 1PRYA 5FB3A 2E55A 2QG9A 1I3NA 1NVTA 3K9GA 1X3LA 3NM6B 3W7AA 1QDLB 4N0DA 3SC4A 5LFAA 3JQ7B 2DF8A 2JKYA 5EP4A 5IS2A 3ZK9A 1NU6A 1KBOA 4LJ9A 4TLLB 4EZEA 4UHDA 1OAKA 2P79A 5LQAA 2RHGB 3Q7QA 2Q4BA 1EKXA 2BM9A 3WNZA 2VDWA 3DHWC 1XZAA 4NJMA 4QDUA 1FMFA 1GUBA 3CRMA 3PC7A 4U2FA 4A15A 5IABA 1RHMA 2CUNA 1SG9A 3GMDA 2G83A 4H31A 3WWDA 2V5VA 5F35A 4YMLA 2JHCA 3F47A 3STYA 1P2VA 1RACA 3AZPA 2ZT5A 2QMUA 1E6UA 2HWKA 3LUBA 1FC0A 3DFZA 1B8UA 2NAPA 2XADA 2K6GA 2QRVA 1LVHA 4N0EA 2L82A 1Z13A 1OHHA 4MV9A 4A92A 1XK7A 2ZCUA 3AERB 4I1IA 1PVDA 2D5AA 1UT6A 5HBRA 5T57A 1WQ4A 1KDYA 1A82A 5J5AA 1NBHA 3M70A 4L27A 3S2IA 3W77A 1UWCA 3W8NA 1E1CB 2H9YA 1ZSYA 1XTKA 2GHRA 4Q0MA 4UBIA 5FOWA 3WLAA 1A2OA 4UCWA 4IIJA 3GLFB 2IHVA 4CU2A 5JXGA 1MT0A 3A0UA 3GR6A 3DR5A 2ZYVX 4QWMA 4ZOQI 1F12A 4URWR 1XPJA 2DH5A 1VE9A 2FA9A 5A0TA 3I9LA 2DFLA 4ZV4A 1SEPA 3OG9A 4S2EA 4F5WA 1N3LA 1FUIA 1BXRA 3CUYA 4HWPA 4IHKA 1EUQA 4UXJA 3UAOA 4XAQA 3RS0A 5LP6A 2CT8A 5FTKA 1XA4A 4PPGA 4WLUA 2GCEA 3RFTA 3PVZA 3QMWA 4KEAA 3AG5A 3EIWA 1UC9A 3GLTA 3OMXA 4FGLA 3WDSA 4CM5A 4Q3AA 2ZANA 4Q1EA 3AW9A 3U9LA 2FY8A 3L7BA 1L5LA 1W4RA 2FSGA 2PQ6A 4LDAA 1AHHA 1MENA 3AL3A 1GQFA 5LU8A 5CCEA 3VISA 5FWDA 2EIXA 3FCEA 3QW2A 3DUWA 5FL7A 4B6FA 4BGEA 4E3ZA 5ERYA 3A4MA 3LQ2A 5AVUA 3K9BA 3AETB 2EQ5A 5CYFA 3S2FA 2ACVA 3SF8A 1NQWA 4C07A 3L04A 3QVUA 2OCIA 2GX6A 4V38A 1L5SA 1F0YA 1LC3A 1TNDA 3QVGA 4UBMA 4DLYA 1EVLA 4K6FA 3A2NA 1BKDR 1WXIA 2Q6VA 1L5MA 2OV3A 3CMCO 2W4IA 1PP4A 3HYTA 1Y9ZA 4HQLA 4Q12A 5DTIA 4YUAA 1UBSB 1TQ4A 3RQSA 3QK7A 4UHHA 3LXXA 1DKNA 4A36A 3WL3A 5ALQA 3OZGA 4MJ7A 5JRJA 3IIEA 1QGDA 2FKAA 3OKFA 3P4XA 4TWIA 4YUVA 1ZN9A 4TMWA 2I34A 1VRCA 3CEMA 1JIXA 1GPWB 4URFA 1J99A 2A86A 3AJ8A 4IUDS 5GZ6A 5SY4A 2GZDA 3IAAA 5G4KB 3IEPA 3QOWA 4L4SA 1FXWA 3I9KA 3UJCA 3VHXB 2C99A 3THYA 3UGKA 1AXGA 1X8JA 2DCUA 2HQRA 4MK4A 1H8HD 1E18A 4LK2A 5JSKA 3GOHA 3LCVB 2DTXA 2I03A 4RHTA 1L5YA 1NMQA 3FW1A 2FJPA 3OP1A 4G81A 2YFHA 4H15A 3TM5A 2O8CB 2R65A 1T8SA 5T7BA 3F2IA 5JO0A 2CL5A 3UTCA 1SVKA 3ZHRA 5IZCA 5BUCA 2GN8A 4GLLA 5KTTA 5TQ2A 2Q62A 1B0UA 2ERYA 1NVMB 4K03A 5J2UF 2BZGA 2C3UA 3I72A 4G1BA 1GV1A 4GL4A 3FY4A 3ZGLA 3S29A 4JJ4A 4R2HA 3QE0A 5E7MA 1E6WA 1ZL0A 5DP2A 4Z9BA 3SLKA 2I67A 5BSWA 2PZBA 2RI0A 2OO3A 2QVXX 1A27A 5AO9A 3TZKA 3C6YA 4CIDA 2IYNA 5A5GA 1HG0A 2J4DA 4GPEA 5F9MA 3SM9A 4RDCA 1NQTA 3N76A 1CUIA 1ZJYA 2FI1A 1VIYA 3O94A 1ZOSA 4RXTA 4UATA 2C78A 2JC3A 4M0EA 2CK3D 2YQ5A 4PVDA 5LQJA 1V6AA 2RJOA 2QJOA 2YY5A 1MAVA 4EA9A 2VTBB 1SQSA 5HIAA 3OSUA 3B20A 3P45A 1XZ8A 3H2SA 1S8FA 4ASUD 3SX4A 4UNNA 5TEVA 1BG6A 1XTUA 3HBLA 1E1QA 1VKHA 4KYIB 3AHGA 4UEKA 3RU9A 1GL6A 3WB2A 1UWVA 2XITA 2YWDA 3HJTA 3OEHA 1JSZA 4X60A 3ZVLA 3ZHSA 1F6DA 3DBRA 4HQ6A 2FKNA 4L8GA 4NE2A 4ARAA 3DYIA 3PX3A 3NHKA 3IT2A 4M7WA 1HE3A 3DAPA 4F2HA 3ICOA 2UYOA 3ICWA 1NG9A 2Q49A 4RS4A 4YJDA 5JADA 4X65B 1K2VN 1C7QA 2JVKA 1RXVA 5CXUA 3N2YA 4TVKA 3E3AA 1XROA 3KALA 4NBWA 5T4FA 1YK0A 3DQPA 1P9OA 1I2CA 1OU4A 2FETA 5BT8A 2O8FB 2C00A 1EI9A 1S2NA 3L8DA 3LYUA 5EG5A 1NURA 1YZ3A 1ESMA 3DT8A 4LKOA 2XWSA 1Y7TA 5JSZA 5BR8B 2Q3HA 5ELXA 1FLAA 1XTSA 2J59A 4GSYA 1R8SA 2X0NA 3HN7A 1E3DA 4RKQA 3FIJA 1IY0A 2AZ4A 5ETJA 5JFTA 3NNDA 1HDRA 4HNTA 1H4QA 4JLMA 1UODA 4Y6PA 3JCZA 1UF9A 2V9ZA 1TCUA 4PZ9A 3SJAA 3WK7A 5HYVA 1JFRA 1CUFA 4RQAA 3EMKA 2WFLB 5BN4B 3W2GA 1YUNA 4CQLB 4BAUA 3FTPA 4FYYA 4HG2A 1ATZA 2PWBA 3BJZA 4MI9A 3V8NA 3QLUA 4ZYYA 4R8SA 5IT0A 5ER9A 1UMCB 5LQNA 2JLZA 4OXQA 3NR2A 3BRWD 4ZQBA 4ROTA 5IBCA 1VL2A 3E0QA 3OZIA 4G5HA 3CUEF 1QP0A 2A3NA 3FYUC 3C3JA 3P20A 4G5OA 3ZWDA 3E9QA 1E8MA 2JFVA 3OO0A 5GMOA 5KDDA 1CWUA 4KPYA 3KKQA 1AIPA 1L4MA 3AO0B 1L4KA 3QKIA 4IZ6A 3HXMA 4OLBA 5JD5A 1N9GA 3OY7A 2P27A 4RDXA 1N75A 1TX4B 3CUSA 3D0QA 1LNZA 4N65A 4XFDA 1WXQA 3H3XA 1L5FA 3RRZA 3K71B 4B3BA 4UM9D 2C92A 1KI7A 3CG4A 2WB4A 3Q2IA 4B9AA 2IYRA 2G0AA 2A1TR 1GGKA 2PDAA 3LVQE 121PA 4A6XA 4AZ3B 1IY2A 3E9RA 1K7SN 2CL6X 3I8SA 5CB8A 1S2DA 5TPZD 3SDBA 2I2DA 4K0RA 2ZB3A 4UMVA 3UB4A 4YT8A 4V1CI 4J16A 3KLPX 1EJ6A 2NO1A 4J9UE 2LUOA 3R9KA 2FZCA 4AJ1A 1T34A 1XZIA 3MTDA 4MUBA 4NCXA 3RUEA 2Q1WA 1HO3A 1DEKA 5EJIA 2EBUA 2ZAOA 3M3PA 4URUR 1YJXA 4QU0A 2HU2A 5JNWA 5LDHA 2UUAB 2O8EA 1B0ZA 3A37A 4QEDA 3AI3A 2BEKA 4XVCA 1NJ1A 3CZAA 4HB4A 1KIAA 3PU6A 2GRUA 3TF5A 1ZXXA 5PNTA 1E2NA 1KKUA 3IQIX 3Q3CA 4PBSA 5CUQA 5J1TB 1BCRA 4K9QA 4YAGA 5CX4A 5A5EA 2D5BA 4EUHA 1K6IA 1ZW1A 1C5KA 2XQFA 2ZBEA 3EPLA 2FR8A 4ETWA 2DMRA 2FXIA 2OBNA 1NOKA 6REQB 1D4FA 4F6RB 4HGOA 3ABIA 2H92A 1HZJA 1KC1A 2JJ1A 4PC7A 5D6NA 2R4UA 4D92A 1TT5A 3CE6A 3FHJA 1W49A 3CE9A 2VTEA 2Q7OE 5HPYB 1BFDA 2W6PA 1YE8A 4HADA 2FZLA 3NBFA 1CZHA 1UK9A 1I6MA 3MCTA 4QU5A 3FBTA 2CXNA 4CMJA 4I9FA 2PZJA 4PZUA 4XOUA 3U4DA 5JNVA 3K9CA 2GGSA 5CLIA 5JVDB 2Q3LA 2VAVA 1MOSA 1V16B 4HMPA 2QPLA 2R7MA 7ABPA 3M6XA 2UXDB 3HO1A 1R16A 1XK6A 1O8CA 1LWNA 1QFZA 1QK3A 1SWWA 2QD2A 4KH1A 4UTRA 5CGZA 2ZZMA 3UAXA 1MQAA 5JRDS 4Z4CA 1WLYA 4TS9A 2VYQA 3AIKA 3X44A 1W36C 2J5QA 1KVUA 1V7QA 2ZYUX 3E61A 4MMYB 3O21A 1MXFA 4PC3A 2YW9A 4PF1A 4WFQA 5FPTA 3ZTYA 4AY4A 3ZCUA 4B81A 4DDHA 1ZCFA 1VE7A 1Y82A 2ZRAA 3GPBA 1SXGA 3CF6R 3QJGA 4NJOA 1HLFA 2M6RA 1T1GA 1AQIA 2B5WA 2EF1A 3H2HA 4KQCA 4MVCA 2VJQA 4MZDA 3CKMA 3LOPA 1B2RA 1LTKA 2CZQA 3TJRA 1NKVA 1QGAA 1X74A 2JGDA 4FFVA 3BTVA 4NPAA 3RJ5A 4IICA 4YRAA 3CF4A 3HWWA 4FYVA 1KSJA 1X0XA 1XHFA 5JH7B 3B1VA 1SQ5A 5CBPA 4FZRA 3GLVA 4JWTA 3HKEA 3QUTA 4G5RA 3KIPA 4DAEA 3QVKA 2GYYA 5L3SA 4MP6A 3GGJA 2BWJA 4LX8A 1H69A 1JXAA 2PN1A 1NUTA 1T9CA 2Y05A 4CJXA 5A9SA 4TLAA 1IN4A 2P68A 1DOAA 4GM0A 4JJ8A 2PKQP 3EVEA 3PNVA 4KYVA 5CP8A 3V9PA 3TRJA 4OFXA 3WNDA 2D1SA 4UQOA 3TG2A 1H2EA 1K7CA 4GX0A 2QRKA 4KE8A 2BFNA 2CHFA 2GCIA 3B48A 1KMQA 3VSAA 1X7GA 2X7JA 1U7HA 3PSHA 4AULA 4HWGA 1K66A 3CCFA 1P75A 1HQKA 1AUPA 5ILGA 1VZ3A 5I47A 1M1NB 421PA 5KWSA 2BZSA 1P4GA 5FA6A 5T6BA 4CT0A 2J9GA 3QBVA 2O8CA 4BO2A 4DR2B 5B37A 2AMLA 2JAOA 1LRJA 4WNIA 1U8YA 1YQQA 1SRQA 4COKA 2PUBA 3VTAA 2E5FA 3M8KA 1LDMA 4EHKA 1UBJS 1PGJA 3G7SA 5B7GA 1B8PA 2IEIA 1NMEA 1ISMA 3IQEA 2HREA 2EBWA 1Q0HA 3K31A 3L43A 1VKNA 2VVTA 2D4AA 3HLKA 4QREA 3VYSB 4XUCA 1OH6A 4B85A 4ZO7A 4JI1B 1AD2A 2OAEA 2R8PA 1EP1B 1D4ZA 1U4OA 2G9VA 3O2QB 5T3YA 5HRCA 4DV5B 3MQFA 2PZGA 1G20A 3ELBA 5IJ9A 4OQMA 1EAYA 3TLXA 3OJEA 4P7GA 2RB4A 4C7JA 2C42A 1RIFA 3LZCA 5EZ6B 3G9XA 5J2TB 4EG6A 2EC5A 1KZGB 1HG1A 5DU2A 3WK8A 5I7UA 1Q16A 3RHFA 4J43A 2HTFA 1UFQA 4Z86A 3U6BA 3KJXA 3DWIA 2OVFA 5E9JA 2XA2A 7MHTA 1E64A 2E85A 1K8YB 1V3QE 3G1TA 4FJ2A 3FGZA 3KEQA 5E2BA 5EIHA 1LSOA 1CJMA 4ZOEA 3AF3A 1CUWA 4ITVA 1QHNA 1V6SA 1Z5PA 2FQXA 1U8TA 4YCBA 1G20E 5DB4A 1OXVA 3TLEA 1OBVA 1FBTA 3PI6A 2G9RA 1E1RD 3BIJA 3HCFA 4LE1A 5TVKA 4CODB 4MGYR 4XASA 2I2WA 4QJIA 5J2UA 3IAS1 3KSZO 1KMIY 1OBHA 1PTKA 2A67A 3ESBA 3OU2A 4GEKA 5EIWA 5LQUA 2ACKA 4PRYA 3TVYA 5DKFA 2ANCA 3GGCA 3H05A 2XD9A 3HEBA 5DX0A 1XNRB 4R1SA 4BLSA 1V6CA 2Q46A 4MO2A 5ALWA 2OC9A 3LHFA 3RLIA 2Z56A 5C34B 1WQ1R 2NU9B 1HDCA 1E5XA 1QYIA 1BX1A 1RP7A 5A03A 2BEUB 5IWAB 1XTTA 1TO2E 4BTVA 3MWDB 3A4IA 4M60A 4NX2A 2VP0A 4OJYA 5IARA 4A0GA 2Z8YA 3OM8A 5C5IA 1RHKA 1Y7HA 4YWJA 4DMMA 1E6MA 1LX6A 4LFBB 4NCKA 2P65A 3WSWA 1DDGA 4I3FA 2PWYA 1SU7A 1KHHA 4PONA 3G2JA 2HV9A 5K51A 2OZPA 1EGQA 5IJAA 1G9SA 3ROTA 5FOTA 1CETA 1F2UA 4N18A 4PG6A 4UE6A 1I4TD 2FN4A 1L8LA 4WIAA 2VBIA 2CF5A 1K7FB 4ED9A 2PMKA 5AD1A 4X1IB 3G49A 3ISJA 1PR4A 1EFPB 2AJCA 4DJJA 4U3JA 1DLIA 2EFHB 4U02A 3H9GA 2C83A 1XWWA 2C97A 4DEYA 1AN0A 4TKZA 1GA6A 1M34A 2BD0A 2YXPX 1I6LA 4MAAA 3LPNA 1YR7A 1E6EA 3CLRD 5AI5A 5E2IA 1WTAA 4IHQA 1SHUX 1RHRA 4IQGA 4J90A 3IA7A 4Q4HB 4XR9A 2WTNA 1X15A 2PUAA 2OZKA 3OLYA 3OZSA 4QOJA 2DX7A 2WUWE 2ZB2A 3NHRA 4TL6A 1MMFB 1PIWA 2H4JA 3L1HA 4IDAA 4OHMA 4MVJM 2AEJA 2C9YA 4ZQCB 4NHEA 2NXCA 3PB3A 3VDNB