4RUKA

Crystal structure of phosphoapantetheine adenylyltransferase ppat/coad with coa and pyrophosphate from pseudomonas aeruginosa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
157
structure length
157
Chain Sequence
NRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
total genus 56
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4rukA00
3ZJUA 3N8HA 1R6XA 1EFPB 1PFVA 1NZJA 5IJXA 3HV0A 5J58A 2NSYA 1YIDA 2HMAA 4ZT6A 1PG2A 2QTMA 4H3SA 3TNJA 5TEWA 1N2EA 1S4MA 4YMIA 3COZA 4E1AA 1KH2A 1O96A 5KWVA 3IOBA 3LOQA 3AG6A 1K97A 4RPIA 4KKVA 4MUNA 2CV0A 4HK4A 2WQ6A 1MC1A 3VRHA 2VXOA 1TYCA 1JHDA 3CLRD 4ZCQA 1OBCA 3PNVA 3ILVA 1X6VA 1V47A 3Q4GA 2D5BA 3H99A 3NBKA 2E18A 3JXEA 3SP1A 1EFPA 1OBHA 3COWA 3MUEA 4U63A 3IUEA 3CLSC 4BWVA 3AFHA 4ARCA 5TS2A 4J76A 1WQ3A 3IDFA 5TGTA 4ZT2A 4ZCRA 1F4LA 3CVVA 3IODA 1FFYA 4JXXA 1RQGA 1FYDA 2Z08A 4K0RA 3TZLA 5K0TA 4YP7A 5LFAA 1I6MA 3P0HA 1Y42X 4AS1A 1LI7A 2QJFA 1G8FA 1VBNA 1I2DA 2B7LA 4ZT7A 1V8FA 1LW7A 4PBRA 3VU8A 4G5FA 1WY5A 3IH5A 2ZUEA 4MUFA 3AKZA 5KHAA 3ZIUA 4KPUB 2BYTA 4WSOA 4ND6A 1OWOA 4DJAA 4MUEA 1KP3A 1GTSA 1IVSA 3FETA 3ND6A 4K03A 1EJ2A 3Q10A 1WXGA 1CT9A 1JMVA 3CA8A 3IOCA 1M1ZA 1WKBA 3G6KA 3CVXA 1NUPA 4HJRA 4MW5A 1N2HA 1QRUA 1U3CA 1VLHA 3RK1A 4DDKA 1GN8A 3K9WA 1Q19A 1SURA 3RJZA 1KQOA 3PRHA 4XFDA 4KPUA 1DNPA 1N3LA 4MUGA 2CYAA 2Z09A 4MWEA 2PZ8A 2RE8A 1H3FA 3M5WA 3KT0A 1WXIA 3H05A 3N9IA 1Q15A 1QRSA 3X1KA 1R6TA 3DO8A 3CLSD 1VBKA 4EG3A 1F9AA 3NBAA 2CV1A 4NATA 1YUMA 3TZEA 1VBMA 3PNYA 2RD2A 1XJQA 5EKDA 3HFJA 4EG1A 4WNYA 3P0IA 4ARIA 2J07A 1O96B 3CLUD 3A4IA 4U7JA 3OTWA 1EE1A 1ZH0A 4MVCA 4MWBA 1IRXA 1MB2A 3UMVA 3IVXA 4NDAA 1U7DA 2IELA 4KR6A 4UZEA 4OUDA 2IP1A 1G8HA 1NI5A 1WOYA 4MVXA 4CDNA 3MXTA 4MLPA 1MAWA 3AIIA 4MW4A 2J5BA 4GRIA 2DETA 1O5TA 1MAUA 1M8GA 3FWKA 2GM3A 3I05A 1JIIA 4MWDA 1OWPA 2QJTA 4S1OA 2CSXA 1TEZA 3CLTC 1TQ8A 3X1MA 4MW9A 4I6GA 3N05A 1U7XA 4P2BA 5FNZA 2XRZA 1KKUA 4R0NA 4EG7A 1H3EA 2A4MA 4EFKA 4EF6A 1KH3A 2D13A 2DERA 3KT6A 1I6KA 2R5WA 3ZXIA 4EG5A 2DLCX 1EFVB 3LCJA 1J1ZA 1KQNA 1JZSA 2H29A 4R2LA 4ZCSA 1N2JA 2YWBA 2AKEA 5J59A 1ZH6A 1H3NA 1KH1A 2QUKA 4CDMA 3TS1A 1NUUA 2CYBA 3IVCA 2WSIA 2D54A 4FZJA 4R2MA 1JILA 4Q93A 1N2GA 2H2AA 3IMCA 2CUZA 1WXFA 3CLUC 3SZGA 4EG4A 2CT8A 4MUIA 4U8HA 4QBTA 1O94D 2QUJA 1U0BB 2J08A 1T6YA 4PY2A 4YP5A 5F23A 1NUQA 3FIUA 1M8FA 1QQTA 4MUHA 3CR8A 1KAQA 3BL5A 5FO1A 1COZA 1N1DA 3Q12A 1TYAE 1EFVA 3QTTA 1WJGA 4DE5A 1J20A 4A91A 1IFXA 3CVWA 2EJCA 4EGAA 3RHSA 2DXIA 1HYBA 2AZXA 4MULA 2A1UB 4MVYA 1KR2A 3PNBA 2TS1A 5DASA 2E21A 2X3FA 1N75A 5K0SA 3COYA 4MW0A 3RBAA 2QUIA 1K4MA 1N2OA 1WXHA 4L2IA 3QE4A 3ZJVA 1M8KA 3C8ZA 1MBZA 3G59A 1UFVA 4NAUA 2HZ7A 3FG9A 5AHWA 1N2IA 3UY4A 4Q16A 4ZCPA 3IOEA 1GZUA 3FH0A 3ND7A 3U1VA 3CLTD 2DUMA 3GUZA 4QREA 4JFAA 1JEEA 2X1MA 3AG5A 4DLPA 1TFUA 1JIKA 3S3TA 4OJMX 1QRTA 1JGTA 1N2BA 2A1UA 4ND7A 2A1TS 3IMGA 4F3RA 4OUDB 1YI8A 4MVWA 1Q11A 3X1JA 2X0KA 3FNRA 3INNA 3P52A 1QJCA 3P0JA 2OQ2A 1G59A 1NURA 5J5AA 1O94C 3ISJA 4MUKA 5LLTA 2E0IA 4ZCTA 4PBSA 4KR9A 4NX2A 2A1TR 2G36A 1BS2A 5H7XA 3TQOA 2A84A 3KT3A 1IQ0A 2WQ7A 1TYBE 5TEVA 1I6LA 3UC5A 3UK2A 3HMQA 5IHXA 1K92A 3G5AA 1JZQA 2QUHA 1A8HA 5HUJA 5HG0A 4DNXA 1IHOA 3MLAA 4CT0A 3FDXA 3MLBA 3LE8A 2EL7A 1T6ZA 1YIAA 3L92A 4ZT3A 4J75A 1QU2A 4G6ZA 3KFLA 4NZPA 1OD6A 1PFWA 1QTQA 1GTRA 4CQNA 4QRDA 3SYTA 4EG6A 3ZGZA 3QTBA 4MW1A 1PG0A 3CVYA 1ZJWA 2YY5A 3FOCA 1O95D 5DB4A 2HGZA 1GLNA 3A05A 4RUKA 3PXUA 1TYDE 3CVUA 2PZBA 3SDBA 1MOPA 1KAMA 3SZ3A 1N78A 1NP7A 5LM3A 2E89A 4ZT5A 2DEUA 4HPWA 1Q77A 2YXNA 3ELBA 4MW7A 2QTRA 3A2KA 5DK4A 5HUHA 2PFSA 1O97C 1OWLA 2IJGX 2JAXA 1H1TA 3H9CA 2A86A 1J70A 4JXZA 3HGMA 1JEDA 4I6EA 1YULA 3D6UA 1MJHA 4L2IB 4MW6A 4ZT4A 3K32A 3E27A 5H16A 1MRZA 1JECA 1J1UA 2QTNA 1LI5A 1ZUNA 2PG3A 3ZUGA 4AQ7A 3ZJTA 3ND5A 1M83A 3VGJA 5JBNA 1IQUA 2WB2A 2PZAA 1PFUA 3COVA 2QJOA 3RFFA 3H9BA 1VL2A 2AG6A 3AL0C 1O0BA 1NUTA 2J09A 1GAXA 4MQ6A 3TQIA 2DR2A 1R6UA 3ZXSA 3UOWA 3HL4A 1ULHA 3RK0A 4DDMA 3MMXA 1O95C 2CYCA 4YP6A 1EUQA 1NUSA 4NAHA 2A88A 2PXHA 1D2RA 3D6VA 1IQRA 2GOYA 3GLVA 2BTEA 4HJXA 4UZFA 1X8XA 2DPLA 1WQ4A 2XRYA 3L93A 1NYLA 1OWMA 2ZUFA 4YBRA 4X0EA 2CFOA 3SEQA 1GPMA 2JANA 3GMIA 4MUJA 1O6BA 1KQPA 1KP2A 3FY4A 4G5YA 4MW2A 1YUNA 2I1LA 2A7XA 3CLRC 1JIJA 1O0CA 4F4HA 1OWNA 3DV2A 3DLAA 2ZP1A 3IVGA 1J21A 2OV4A 3N2YA 1O97D 1NSYA 5FO0A 2JA2A 2VTBB 2PIDA 4XSVA 1MB9A 4MWCA 4JZYA 4I6JA 4XFJA 1T9GS 1B6TA 5KCMA 2NZ2A 1G8GA 1PFYA 4EG8A 1EUYA 2CV2A 1XNGA 1WZ2A 4JYZA 1F7VA 1KORA 2J4DA 3SEZA 3IUBA 5DEOA 4DDHA 4GU5A 2GKSA 1ILEA 1QU3A 1T9GR 3FI0A 3DPIA 1K4KA 1XNHA 1T6XA 2Z3VA 1F7UA 4MAFA 2O5RA 2V0GA 3A04A 4PBTA 2V0CA 3HZRA 2X1LA 3NV7A 3F3MA 4TS1A 2VTBA 1M8JA 1M8PA 1WXEA 4KR7A 1QNFA 3IMEA 1J09A 1IH8A 3FHJA 5BNZA 1XNJA 2YWCA 3H97A 3OP1A 1EXDA 1N77A 3KT8A 2O8VA 1P7PA 1U3DA 2C5SA
chains in the Genus database with same CATH superfamily
1HYEA 3KFXA 4PLCA 3QLVA 4D0RA 6AT1A 5KQLA 3ZU4A 1B76A 2QZ4A 3BWEA 1N5OX 4IHKA 3WKEA 1DAPA 4LC9A 2HT6A 3CU5A 3VU1A 3ZIAA 4ERXA 4PLFA 3O8RA 2KLHA 2DZDA 4YMIA 1J22A 2PXXA 3DW3X 1E1LA 1UBSB 2GPAA 4FCTA 3AYZB 3KZNA 4OOEA 1LWOA 2PTHA 5J1SB 1ZZEA 5AOCA 3IEVA 1ZMTA 3D6FA 3RIHA 4RE5A 5TB5A 1YMQA 2NZVG 3HB7A 1IPEA 4Y67A 1MC1A 1QO9A 1EDZA 1SOMA 3VRHA 1HQKA 2Z3WA 4XB1A 3D7SA 5DIFA 2V5AA 5U4QA 2RKBA 1DBSA 4F3KA 1WXWA 1ISHA 5C35A 5IYZB 2IHNA 3DT6A 3KEFA 4PR3A 5FAKA 1JH8A 3ITEA 4EATA 1P0IA 2V7UA 1LRLA 3OIDA 4G2NA 1OFTA 3PVCA 1A9SA 4QBKA 4TUYB 1T2EA 4YJKA 1REQB 3DMGA 7REQB 1BYUA 4FGLA 5A9SB 1II9A 1JYFA 2VCYA 4CQJA 4U0KA 4PLVA 4QX6A 1U0EA 3TB4A 1W0JD 1X1CA 2X77A 3JTEA 4AN0A 1BD3A 2ZIAA 1XZQA 3EEQA 3PJDA 2XQIA 4LWQA 4OLFA 3T3GA 3V4ZA 5CCXA 4QUKA 2IUYA 1M2VB 3TZQA 3PHGA 3TRIA 4LDQA 3W5JA 3UAZA 3IV9A 1QQ5A 3IIMA 1Q74A 3JQCA 3FNFA 4IPTA 5CT9A 1UBEA 4B4OA 4F21A 1Y42X 1ESDA 3HVRA 4DR1B 4HDKB 3AV3A 4GF5A 4HO1X 2Z83A 4L7VA 1VBNA 2GHTA 4LTNA 1U3FA 1O57A 1E6WA 1UFKA 2PX0A 4OXIA 2G40A 1LW7A 2POCA 5IYZA 5KYYB 5KVAA 3E58A 3VU8A 1JP7A 2GCNA 2CLDX 2ZUEA 1RHQA 3IBSA 4TUYA 4A6PA 1REQA 1I2ZA 3ND9A 5FFMA 1XHFA 7REQA 5A9SA 3I5YA 2DFKB 4HZIA 1NVVR 3OZGA 1N5JA 1F5NA 3BK2A 1R8JA 3P4UA 2YJNA 1DUVG 1WCWA 3NFYA 3FHCB 1LBSA 2ZYDA 3AETB 3FPGA 4JENA 5ERGB 3RRMA 4EI9A 3OTIA 4XM0A 5AKKA 1Q83A 4MOWA 1EJ0A 4M1TA 3RLFA 3ITDA 1E32A 1M2VA 2XVXA 3VR4A 1EJ2A 3IPLA 2OM6A 1TU4A 4J8PA 2J87A 1KL7A 4G8BA 3A36A 2VHJA 1K89A 3B3AA 1Z35A 3E81A 5IMBA 5L3VA 3OEHA 4HDKA 5HF5A 3RYCB 4P38A 3HN2A 1XQWA 3HR8A 5LMZA 4G86A 4EFLA 4C6HA 1RS0A 4L0DA 1R4NB 3T61A 4EQ6B 4N8EA 1HLGA 1KBQA 2TECE 2XUFA 1GUDA 4NESA 3RAFC 3OH8A 1ORTA 3T3OA 4RBNA 1QHGA 2ZAOA 1YE3A 3C4VA 4MITA 4QDXA 4TL6A 5FA6A 4BX9A 4ZICA 3HYNA 4TWZA 4XFDA 2C8KA 2AEJA 3EA0A 2B6NA 2V4UA 3VJLA 3DR5A 3CSSA 4CTOA 1XDGA 2A0YA 3AETA 4X62B 2GD6A 1W4AA 4KUEA 5E2IA 1P2BA 2AXEA 2QZJA 3JRNA 4QVGA 1L5KA 3CUWA 1ZWKA 4WOJA 1YVPA 2BR5A 1EK6A 4UM8B 3KKNA 2CLMB 3EUWA 1WXQA 4HDMA 2CVPA 2YN2A 2PX2A 2XDAA 3O75A 2QN7A 2XOKD 4IQ4A 4JBGA 4KAJA 1CR1A 3TMYA 1MOSA 3EVFA 1BWSA 2WTMA 5ISMA 3RU7A 1N25A 1DX6A 4H7EA 2QL7A 4GGOA 4IDHA 5KIAA 4QVIA 1ODJA 3NJRA 4XIGS 5C4MA 1R4NA 4EQ6A 1R27A 1KYWA 3BWBA 3HY3A 5IC4A 1P60A 5HCIA 3NVDA 3S1LA 4DC1A 2F4VB 1RPNA 3ASYA 3CLUD 5JYBA 1VBFA 3EXG1 5KC8A 3N76A 5DT9A 2ZZNA 2AMVA 2OAEA 1S2NA 4S24A 3WQSB 4UD6A 3SEFA 3W7BA 3ZWNA 1V1MB 1W47A 1PEDA 3F4KA 1JAZA 2Q5FA 1A27A 4QUBA 3WGUA 4F8JA 3V1MA 1H4VB 4O4JA 2G9ZA 3CH5A 3UAYA 4C22A 3AJDA 1GDTA 2VPQA 3O2QB 4HDAA 2R7KA 4BMVA 4OUDA 1IAVA 4RH0A 4IXDA 2UUBB 2DFLA 4HBGA 2EWWA 4U2CA 1FX1A 4GR5A 2GTIA 1X2EA 2I55A 2RHLA 4F8YA 2CF5A 1A98A 4UTOA 1QO7A 3NONA 3E7FA 3OCJA 3V1YA 5JCZA 5CB6A 4QDUA 4YCMA 2PANA 1SG9A 1JIVA 5UKDA 4R8RA 5G0TA 1TPZA 4N5MA 4E7PA 3SLRA 1ZNZA 2E7ZA 1AKNA 2O7VA 5FEUA 2ZVJA 3QV2A 3ENZA 5DPMA 1V1MA 3RV3A 4TLBA 5LMUB 3ER8A 1Y37A 4JJZA 3BCRA 3SYRA 2VDPB 1H2XA 5GADl 4RMGA 4LNHA 1VXOA 3DCJA 4KI7A 2BMJA 2FN7A 2ZBDA 3N8NA 4R0NA 5ALXA 4B32A 2RGWA 3W5BA 2CXXA 4C4XA 5IKEA 3BMOA 4RD4A 5ALHA 4XB2A 5B7NA 5I4IA 4EMSA 2OHXA 4PLTA 1OXXK 3F9IA 2A5FA 5IDQA 2PWBA 2UKDA 3E84A 1Y4SA 1RM4A 3ZHBA 5T4BA 3HJAA 1JA0A 1N7GA 4Z99A 4AO6A 5DOVA 4R2MA 2UYOA 1LBIA 2G1PA 3OQIB 3EZ9A 4QG7A 2W4QA 3B8EA 3MQFA 4B0PA 4E07A 2O2YA 2CT8A 4EY6A 2PS0A 3OIGA 4QBTA 5JPIA 3OY7A 5B6JA 3BB1A 3MD0A 5JNTA 1NVVQ 1XEXB 2LKDA 5GJBA 2YWFA 4LZLA 1L4FA 3ZBUA 2Q3LA 2W98A 2QTCA 3ME5A 1QV6A 4F91B 1P62B 4D9HA 4E88A 3NXSA 4H7IA 3TVDA 4M36A 1Y7LA 3A1VA 3LDUA 1KAQA 4LC1A 1HDEA 4L8WB 4BX3A 3O8DA 4AYTA 2ZJ5A 3AEUB 4N6NA 5EPEA 1UPBA 3VSDA 1FJHA 3GDHA 4IBOA 5I9MA 2OA0A 3O95A 1DJQA 2SNIE 2ZBUA 5C1DA 3HJNA 3K0AB 2IOQA 2AS0A 2EJCA 1MFZA 1ZVQA 3WHKA 1Y5RA 5JY6A 3MTAA 3DE5X 1KR5A 1PDVA 1PL8A 1Q6YA 1YMUA 3BIOA 4PSDA 4EUEA 2WEKA 2F2TA 2JIQA 1L1EA 3F7NA 3TOZA 2NAPA 2B1GA 1IZZA 4QUGA 1KYZA 2V74B 3FWZA 3VR2A 4RDXA 3TGLA 4IOJA 3CT4A 3HO6A 1XZCA 2IHTA 1XEXA 3ILYA 3QHPA 4R6XA 3NTXA 1X38A 3PDJA 4WGFA 3FG9A 5I7AA 5TVKA 6YASA 1I3NA 1Z25A 4JBYA 4MYSA 4BO1A 3D6HA 4YREA 2X22A 1UAAA 1CR0A 1DTEA 3ND7A 3AVXA 3AEUA 4OIFA 2IFTA 2Z8YA 4MZDA 5IN4A 3OP4A 2RG1A 3T4EA 2E5WA 3B1XA 4I36A 5F64A 3ZU2A 5L51A 4YHHB 2ZM6B 5DYNA 1XJCA 1Y7IA 4D25A 2R8YA 3K0AA 4IOMA 4GPD1 2Y0CA 3TNDA 1ZKMA 4EHNA 1HFJA 1XNRB 3NWJA 3WMRA 3TAHA 3UIEA 1E18A 3FFWA 3OU2A 2EFHB 3FTDA 5KQSA 2CF6A 3TD9A 2QG9A 3PFFA 4NG5A 4PW0A 4Q3EA 4UOQA 4FHGA 1Q5PA 2PMFA 2R8ZA 4GMDA 5DVZA 1LLUA 1PJTA 4C2AA 2FX2A 5JI3E 2QL9A 4G0YA 1UMCA 4NFSA 3H1AA 4L7QA 4EJMA 5KKCA 5CMLA 3WK5A 1X9HA 2ZE7A 1YJAA 2JHAA 2CJXA 3O8QA 5AK6A 3RC2A 1PT9A 3SS7X 1BWRA 2QTAA 5CLHA 4BC0A 3Q2OA 1DRKA 4EL5A 5C46F 4PPYA 2WY2D 2A7QA 2PH3A 1AMNA 3RUCA 4NG4A 1N2CA 1GPKA 1GG8A 4GPBA 4PICA 1I7SB 4ACAA 3OTHA 4CMIA 1NDQA 4ZP1A 3S70A 1G9SA 2ZI7A 3S2IA 5HVNA 5KTPA 1Y33E 2C54A 3UWDA 4GLBA 5IHXA 5K1ZA 1G1MA 1RQXA 3OJWA 4OMCA 1C7IA 2PUVA 3AUKA 3ZDAA 2PSJA 2JFUA 3KKQA 1C30B 2W2KB 4OQQA 5IABA 4E2ZA 4DR4B 1T9DA 3RWOA 5BSVA 1MVOA 3UEOA 1Y1TA 1XD8A 3L05A 4BO5A 2BKXA 1E6UA 2FPKA 1GADO 2GBLC 4KIGA 1YI0A 3LY7A 5LD2C 2VSQA 5THQA 4L3WA 3VAZA 4EJSB 1VHLA 1RE1A 3LLSA 4V2UA 4B7CA 2PXCA 1KO1A 3BTOA 3HRHA 3DOUA 3I6IA 5CB4B 2AXPA 4RPCA 4MDYA 3ZHOA 2IOFK 1GPUA 3STTA 4CHTA 3U7FB 1H8HD 1AUPA 1LF0A 1NW5A 4DV4B 3N70A 4DB4A 2QN1A 2V7TA 3ZE8A 1LLDA 2DBYA 3C16C 4K6KA 1ZK4A 4EMTA 4RKRA 2VYQA 3GCXA 4RUKA 4IAOA 3TZHA 1P0CA 2PLAA 1EVYA 4AZWA 4NYJQ 1P9WA 4NMHA 3D2CA 3PGKA 4DMUB 5T7BA 1NG1A 4NCNA 1Q16A 2OPHA 4DA9A 1PDWA 3NASA 5AKEA 5DGTA 5KTSA 5LQRA 2XEXA 1XP5A 1WMFA 1E9CA 4TS3A 3ZDRA 4EY4A 4KDEA 5AI0A 4EJSA 3TRHA 5M3BA 4OLJA 2ODEA 1P0PA 3U4AA 2RARA 1J0XO 3I23A 4L0MA 4L3VA 5IBPA 5F78A 3TLEA 4AP6A 1L5SA 2H7CA 2P91A 4B46A 3QIAA 3MMPA 1VDMA 1KPIA 2WIKA 3O3NB 3WBKA 1CB7A 3JQQA 1EKXA 4EJ6A 5CVEA 2GXQA 2BWJA 4R1QA 4LF5B 1CZNA 3N0XA 2Y1DA 4HAYA 1NLYA 3QYPA 1VL6A 2WB4A 3CN7A 5HKKA 2EP5A 2QTNA 3BE4A 5BVHA 3D6NB 2BTOA 2C3UA 4X84A 5E9QA 1E6CA 2P5UA 4C2TA 1KRHA 4UBNA 2YDYA 3TR0A 2IDKA 3ZDZB 2Y66A 4X3PA 3OZEA 3W7AA 4L76A 2YJTD 3KB6A 2OP0A 4UMFA 2C4TA 4EFNA 4O33A 5I7FA 4MCHA 5A2QA 3FUUA 1PFUA 1WB5A 3NIBA 2NU8B 1JU9A 3VNQA 1CF4A 2OP1A 1GNSA 2YRWA 3AVQA 2HSJA 4S35A 2RGUA 3TVTA 3NM6B 3WL7A 3T1OA 3EQ2A 3HO8A 4JR2A 4RD2A 1GOTA 2J09A 3CGWA 3IT2A 3T7RA 2KSQA 1SD5A 4TTJA 3MQ2A 4PZCA 3FRHA 3SC4A 5JD6A 2VHXA 5BV2P 2NVWA 3SE0A 1BX0A 4D9JA 4HNHA 3KE8A 4R0VA 4LGMA 1ZN2A 1UKCA 2C97A 2AYYA 1XP8A 1MA0A 4TYYA 4NR0A 3EF0A 3HYTA 1NV9A 1NKTA 2GOYA 1OLSB 4TT8A 2BTEA 1JMYA 1KJ9A 2VNIA 2WE8A 2Y1LA 3FVQA 1ZQ1A 4Z51A 4BQOA 1RKXA 5E1OA 2FF7A 1A7UA 3N0VA 3QPBA 2F3TA 3HDQA 3SNHA 3PKIA 4UPEA 1QHEA 3G2QA 2R6GA 1HE1C 2QLNA 1J0AA 2H92A 2NU8A 2GYWA 2XLCA 3HXPA 3JQDA 5I8PA 1TMYA 4L85A 1X42A 1B15A 4Q4CA 3T4UA 1VPDA 4ZYYA 1RRKA 1RJ9B 1W48A 3RROA 1ZJJA 1NF3A 2N1BA 3ZQJA 2HA0A 3ZIDA 1XLTC 4UPVA 2ORED 4HDSB 5TS3A 4H17A 3WC4A 5GP1A 3EZFA 1JDNA 5K6AA 2FJPA 1D6SA 1P74A 1VECA 1DAEA 3ESBA 4M1WA 1VKZA 2VTBB 3GFSA 2PBRA 3WJ2A 5G0UA 4MRAA 1J23A 1SA0B 4BJ5A 3FMOB 3MJRA 4I6JA 2DBRA 2Y9MB 3RYHB 4FFRA 3G2HA 3KJGA 1ZM3A 3STWA 2AOTB 4Q01A 3ADBA 3BK7A 4B9EA 2EX0A 3KOOA 3UUEA 3VHRA 3GUUA 3HB1A 1N3YA 4US1R 2GTHA 4QE3A 2DC1A 5LA6A 3OLVA 2GVDC 4BCCA 3KL4A 3RUPA 3B85A 3R09A 2XNKA 3WP0A 5I51A 1CU1A 2E4ZA 5EVJA 2ZKLA 4B84A 1PJRA 2UVDA 4JGGA 1RJ9A 1X1TA 5HDBB 2ZSEA 1HLPA 4MR8B 4ZAFA 2JCGA 5TRTA 3R44A 1LCIA 2R7NA 3DO6A 3IDOA 4TKLA 3VV2A 3OBBA 2R5FA 3GGSA 4HDSA 4HEA1 2ZR8A 4DARA 1TD9A 2UXBB 2YHUA 1OAKA 1L5VA 1TB4A 4Q9KA 1JEOA 3DVAB 1UZAA 1Y3HA 1NN1A 3SHTA 1GNPA 2HCRA 5EEGA 4BTVA 2VTBA 2WFLB 4MYTA 2O4UX 1L5YA 4E15A 3DZCA 3QWAA 1A2QA 2C7BA 1SA0A 4HZUB 4GFDA 4KBYA 4KQKA 4RKFA 5DSTA 4I5FA 3S7ZA 1VL1A 3RYHA 5IAAA 4GKJB 2VAXA 2ZBRA 2QT0A 1J56A 3GLFE 3V8PA 3RASA 4GPZA 4U00A 1GPNA 1PFVA 1SIOA 1C0IA 1Q7GA 2NSYA 4IKPA 3SZMA 2QVLA 3AHDA 5FTNA 4H3SA 2GARA 3EOBI 3AR8A 4LHXA 2GK3A 4R51A 4BKPA 5CA0B 4EHLA 4PGGA 5REQA 1FS4A 2GRJA 1FLNA 1Y3AA 1UKVY 1UKYA 3OPNA 2QJRA 3H9QA 2O0JA 1SC6A 4JZKA 3ZKWA 1HFKA 4EHFA 4Y7CA 4F4JA 1JV2B 3DVAA 3P9IA 5FI1B 4YGYA 5JXJA 3JQ6A 2DR3A 2LXNA 3WZLA 4ILEA 4Z49A 1HDYA 2XB8A 3CF4G 2WFLA 4BLSA 5A1JA 2ZRMA 3GZNB 2FP3A 4HZUA 3V80A 4D56A 1NMQA 2P4EA 2FG7C 1XUOA 2YWJA 4Q48A 4BAGA 1P1FA 4CLOA 2DM6A 3SU8A 1DLJA 2VVTA 2M32A 3HBFA 3RJMA 4JI2B 3FUWA 1Z5NA 2BBSA 3IEXA 3FTFA 4PRLA 2Y1EA 1I1QB 5TS2A 2FWIA 5CA0A 1BHO1 3GJTA 5DTJA 2UYCA 4YONB 3ZWBA 4NBNA 4IEEA 5AK5A 3AVYA 3ZK9A 4TM7A 1IE3A 1W5BA 3AF4A 1ST2A 1YVDA 3U4HA 4DMLA 5CW1A 4PG8A 2ZRJA 2IE8A 3PD7A 4Q3KA 1G0OA 4TXHA 4BB6A 4CMGA 1XIVA 3NW9A 5SYMA 2H4JA 2ZRDA 3FZGA 3IPAA 4XX0A 1UBNA 4NY1A 3ULKA 4JCOA 2I0FA 2P77A 4G2TA 3VYWA 4XSGA 4OKNA 3GZNA 3VYRB 3VKUA 3KU4A 1DSSG 3IT0A 1P9NA 1D8TA 1M2HA 1IDN1 2LE0A 3CT6A 3O47A 1C9MA 1NQOA 2IKSA 1BXGB 3EK2A 3H8SA 4BASA 2QV7A 2VDOB 1KI7A 5HQJA 1P75A 1SOAA 4JL5A 5TIIA 1WP4A 2H31A 1AZTA 1DRVA 2WPNA 5CFMA 4MA0A 3E9QA 3WNQA 1YZLA 3Q7TA 2X3UA 1G291 2X1HA 3UPTA 3NNNA 3K1AA 4Q4LA 1S01A 3FCYA 3F9RA 5MN4A 4DN6A 1EUCB 2DP4E 1EVQA 1DIBA 1OH8A 3EXEB 1NI3A 5DYGA 2QLMA 2G9RA 3F8SA 3EASA 1N5DA 5DJ5A 2BIFA 3UA4A 3EWIA 1M0WA 4LZPA 5EQTA 3CVXA 4JL8A 3W04A 3LP5A 3HWWA 4EHJA 2J3JA 1DU4A 1I2BA 4S1VA 4PAMA 5JZ9A 1KWKA 1FNCA 3I2IA 1VPLA 3DONA 4YJHB 4EKDA 1VLHA 4HAIA 4IIUA 4YLYA 4Y9UA 5K8CA 1USGA 1V3TA 5HIAA 5U4XA 1Q19A 1Z6XA 1JWAB 3L7MA 2H4FA 4WIAA 3SDZA 1BXGA 3X1WA 3E15A 2QDXA 3BULA 1KQOA 1OI7A 2FWRA 2R47A 2LW7A 3BICA 3QBJA 3T5TA 3ZLTA 3ZPXA 4B3DA 3TL2A 2WICA 3DV0B 1G9XA 2IITA 3QFRA 4MRSA 1ABBA 1IMOA 2WM3A 3EJ6A 3KXIA 1KAGA 2VJKA 3PGXA 3SC2B 1E0JA 1F0KA 3EGCA 4Z3DA 1EUCA 5AW3A 1MQAA 1D2CA 2F90A 1L7OA 4BMNA 1QRSA 5B2ZA 1W6RA 3TW6A 1EEHA 3DO8A 2I29A 1B8NA 3CNOA 4G23A 4PVCA 1UADA 4G5QA 3I32A 5E8RA 4UC0A 4M60A 3FLMA 3EXIA 2WAOA 1VG1A 1NW8A 3OLWA 1IQPA 4YJHA 1N0IA 2QE7D 4FMDB 5LQSA 3DZJA 1RACA 4UU1A 2IQ5A 3MW8A 3V4OA 4CFZA 5AJHA 1XFDA 3ELWA 2JLVA 2WU1A 1QFMA 3U4DA 1QVRA 1Z0FA 5JD5A 4O2BF 4YRSA 2BF4A 4TV9B 4PF1A 3BMQB 3DV0A 3BGDA 3FTEA 4Y6OA 4CG1A 2BEKA 2Q7XA 5BSEA 2IBSA 3UK1A 2QRMA 3SC2A 2AXQA 4MHSA 1AXEA 1VLZA 3WMGA 2QRVB 4BX2A 1CYDA 5L9AA 1J99A 1HT1E 2IHUA 4V39A 3I04A 2JCXA 2PZFA 4DCVA 2P6MA 1SBQA 2JLYA 2PGIA 3PTZA 4QOSA 1ECJA 3TSCA 1XCGB 1AE1A 4QWWA 2YIMA 3TOSA 4BQQA 2OV8A 1BJKA 1JQEA 2BGLA 3CSDA 3BREA 4UUQA 2OO7A 4JMPA 2PD3A 3JWPA 1E5QA 1GG2A 2GM3A 4N3BA 1J5XA 1OWPA 1PJLA 3RTGA 2XIQA 3QYAA 2O8BA 2CVFA 2NQ2C 1E64A 2F55A 1HLFA 2BZ1A 3IJRA 5A5GA 3VO8A 4TV9A 1Y9AA 2NACA 4UUOA 3TQFA 3GPLA 3L01A 4CKEB 3FNEA 2W6PA 5C34B 2QRVA 3H75A 2B8JA 4IV5A 1TQDA 2ISSD 1PUIA 4XGRA 3ZWAA 1K5DA 2XUGA 2JAOA 4CEJB 3FRJA 4OK5A 4EFKA 2VF4X 3SSOA 1JHMA 3TECE 5IS2A 4MPJA 5THXA 4KHPB 4KODA 4EG5A 4NMMA 3LCJA 3UGQA 1VSTA 2FGJA 5M34A 5COQA 5J5CA 2O48X 4OHWA 2H7XA 3L77A 1N2JA 4B3BA 1CBUA 3MJFA 5M2QA 4AY2A 3RIXA 3DAGA 2BJHA 5HOQA 1K7XB 2P2NA 4GXQA 4MPPA 1WXXA 1GUBA 2FLWA 4TTQA 3IUMA 2EQ5A 2OPBA 4EG4A 3NHZA 1ZRHA 5ALNA 3SAJA 3VZRA 4PVDA 4L4YA 2P79A 1UBFA 5JDIC 3R40A 3GP3A 1F48A 4YCBA 4C29A 4CKEA 3N59A 1E2NA 5BSTA 3R6LA 1E2MA 1H2RS 1W5SA 2ZGVA 4MLDA 4R41A 3W6PA 4XCXA 2COEA 4CEJA 2TMYA 3FIUA 4L8GA 2A0XA 4TWAA 2NU9B 4MQMA 2Q41A 4MUHA 1DIHA 2ET6A 4X6UA 4MTCA 1YJ8A 4QD3A 4LHSA 2X0DA 2OFWA 3ZJ4A 1V3UA 1HE3A 4YCSA 3WYGA 5BW8A 2ZIXB 1RZRA 1PHPA 3Q0TA 1CUWA 3DMNA 3JVIA 2IL1A 4PINA 3WL5A 3ZDEA 2QQ5A 1A8SA 3A25A 5C5DA 2QE6A 3HQ4O 1W0KA 3FWNA 4Q3LA 4AP9A 3KQPA 1U7ZA 2C98A 3DWGA 4TM8A 3LL7A 4MULA 3SBOA 2QMZA 1PU2A 1GT91 1PTKA 1V8OA 4TMVA 3AB7A 2B7CA 3N74A 4U5XA 3CZAA 2HA5A 2YHSA 3FMVA 1AQ6A 1NP6A 4E6PA 4YPOA 4MMYB 2OV6A 1R5NA 4JOBA 5JRDS 3FZNA 2QUIA 2C0PA 2D5AA 2GFIA 5HIIA 2QDKA 4KR0A 4H18A 2Q4RA 2XHEA 4B45A 3AKDA 3CY6A 1C3LA 3RDPA 2JKVA 1TA0A 2JBHA 4UU8A 3E8MA 4X7RA 2NU9A 1QMGA 3A3PA 3IOEA 4G1FA 4D9KA 5C53B 1R0XA 3FFTA 3GJRA 2G83A 4OM8A 5B58C 1X7HA 1ONBA 1KYTA 4ZXFA 4PXSA 2ZIXA 5EKSA 2QM3A 3DE3X 4JFAA 3P2IA 1ZHFA 4CMHA 3V48A 1Q0PA 1UJ6A 1XN1A 2XE7A 2ZJ0A 4L4RA 4OAPA 2W2VA 2WG1A 3VYSB 4Y2GA 1V11A 2IEIA 4XVHA 3TUZC 3GJQA 4I1SA 2O0LA 1PIWA 4YO8A 5HJ2A 1W9HA 1FYWA 3KB8A 3ZG6A 2GM4A 1HL3A 4P54A 1FNSA 3ZX5A 5EL0A 4KWCA 4XQEA 3RJ9A 4YMTA 3TG8A 2IBMA 3LDFA 1MJFA 5B1YA 5DLPA 4IV8A 1IBMB 1NURA 2HWUA 4ZHQB 5BO5A 1CHDA 3SM3A 2FW8A 4A6DA 1B16A 3K0FB 3BQMB 2RDMA 1BFDA 5DNEA 2P7IA 1HXHA 1CQIA 3BMNB 4DUYB 1AZLA 2OFPA 2GEKA 1WO8A 4KQHA 1Y6JA 7MHTA 4IDEA 2WM9B 4FNGA 4W1RA 5LZ4A 4ARZB 2IXGA 4BFZA 2YRFA 1OKKA 1FP7A 1LQUA 3H5LA 1V0JA 1PNOA 3OZUA 2W6QA 4O4HB 5CK5A 4IUYA 3D4LA 5B4TA 3RLIA 1YOVA 4DILA 2G4CA 4JYAB 5KYVA 4DCGA 1OAOA 4PYIA 3V2UA 1A1SA 3GJ6A 2Y1FA 3PF8A 2X8JA 2VA8A 4IUBS 4H9GA 4EEXA 2DTXA 3GGCA 3IBGA 2Y1OA 4AKIA 1A5TA 1QTQA 1RBQA 1N9GB 3K0FA 3S40A 1JX6A 3O9ZA 2X4LA 1GSIA 4E1VA 3OTQA 5FV7A 4HRXA 3ZHXA 5C5IA 4AJ1A 3PGA1 3BMNA 4H7JA 4D3DA 2YY5A 5I5EA 1O77A 1XVVA 4TWIA 1L4BA 4ZWNA 1MMFB 5EE5B 1JFVA 2G77B 2HLDD 3A9RA 2DE0X 3CRQA 3OQBA 3RSHA 4ARZA 1MV8A 3HKBB 1L5QA 4K9OA 4PYLA 5KNBD 4P80A 3T6KA 2G63A 4AURA 3RTCA 2JS7A 4N3GA 4R83A 2PZBA 4GVPA 1Y5NA 3I6ZA 1II0A 2FZEA 2H7YA 3H4TA 3FVWA 3HB9A 1ZLXA 4CMCA 3DD5A 3F7OA 4B4WA 3QOXA 4UM9B 2Q5IA 4DSTA 5U1PA 2XAUA 4B82A 2H1CA 2QI9C 2JVJA 4HTFB 1P17A 1QZ3A 4KMSA 4C1NA 3KSRA 2YXNA 3PUIA 3ELBA 3K0EA 1K6JA 4LZWA 3VR4H 4DA6A 1U5CA 3LTEA 1O89A 4N82A 3PSHA 5JXHA 1YR3A 4RULA 1OWLA 4M1KA 2OBXA 4TVKA 3NMUF 2LGJA 4FSDA 5JMPA 4DV7B 2VSXA 2XOEA 2ZUBA 3ZQ4A 3HBJA 4OHBA 1JBEA 3IO5A 4UVEA 3S6JA 3H8VA 3OURA 3QVXA 4JLDA 5HFAA 3STHA 3X2SA 4L2IB 1OIXA 5LYYA 4I4CA 2M6KA 1ZW6A 5BORA 3OM8A 3DTYA 1VJGA 4ZI3A 3RHFA 3FAZA 1NTRA 4ZOLB 4ZRNA 2Q62A 3HYLA 4QU0A 5EMJA 2YVKA 5HYVA 1BSVA 3GJ4A 3I28A 3OZXA 3PC6A 4QEZA 2E49A 5C8YF 3MD9A 4QARA 1KE2A 1P45A 5E2AA 1P1KA 3S0JA 1DV2A 1BDHA 4LGYA 2PZKA 2JLWA 1RVV1 3K9LA 4H15A 1K8ZB 4HTFA 1PFGA 3OM1A 4HDNB 4XB6B 1LDYA 2VJMB 3NHPA 5KSWB 3VKFA 3COVA 3RFFA 1SWVA 3NM5A 3ZXUB 5CX4A 2OD9A 3ZLVA 5EN4A 4BX0A 4DIFA 1O0BA 3B2NA 4N5DA 1GAXA 1UBUS 4H0NA 1H5UA 1LX7A 4MH0R 4DKJA 2HRRA 1TC2A 1DEOA 1TVEA 3L4EA 3MC1A 1YS9A 1HE4A 4OY3A 3OPVA 5DTQA 1IHDA 2R48A 3HL4A 3FDZB 4BB9A 1KRXA 2IEBA 3D6JA 5B1EA 1HZZC 1YONA 3UYKA 1NUSA 1Z68A 4ZOLA 5FHRA 2VKQA 1S02A 3D6VA 4QOHA 4W1SA 5EUMA 3E35A 1IQRA 4E12A 2UZ4A 5ESDA 2G1JA 2I03A 1QHHB 2Q6TA 4MDFA 4AULA 3K2EA 3OBIA 4GVXA 3PXXA 3QEOA 4N3CA 4OHVA 1FYFA 1B8OA 2AK3A 1UQTA 2X76A 1QVVA 2H51A 4TWJA 4MUJA 5DNWA 1GL6A 5GTDA 1RVDA 3H2IA 1IXYA 3S1SA 1EWVA 1OAAA 5FJIA 1VDZA 2XGGA 4D9FA 4XGIA 2GPTA 1E4EB 2IA5A 1EQAA 1U8AA 4JBLA 3L8GA 4P4NA 5EGSA 4B3FX 3BYZA 1TW2A 9GPBA 1X0XA 2FZ4A 3AVWA 1JIJA 3AUJB 5FYDA 5HIMA 5BN5B 3HA2A 2RSLA 1L3IA 1OWNA 1RT9A 2A9FA 2W8ZA 3FDZA 1E2GA 2AHOA 1HTWA 2ZP1A 4PZAA 1FNBA 2N0SA 3SLGA 3Q5DA 4HD8A 3F98A 4A6XA 1OH7A 3BE5A 1Z6TA 4YO7A 1H1DA 3PIIA 1DE0A 3DBIA 4PHFA 2P11A 5FO0A 3D1JA 3M1AA 2C2GA 1AS3A 4K87A 4MZXA 1LS6A 3ABRB 4GNKA 4U2BA 2FSVA 1PQUA 3USES 4LRXA 3LT5A 5JZSA 1C3JA 3ZHYA 1QHHA 4LRWA 2RH4A 2HOQA 3GJ8A 1PV1A 1OJLA 1RADA 1RFLA 4HWRA 4PN3A 4Y2UA 3L7BA 3CO0S 4JN6B 3T5GA 2CFTA 1P31A 2PJUA 5KSZA 1RSZA 1WZ2A 4E31A 1T13A 3C3BA 5E7IA 1LDNA 2C95A 3V8RA 1A4UA 1P3JA 2N9UA 1J9ZA 3CW9A 4XX1A 1E4EA 5CYPA 4OXRA 2YWRA 4PFJA 4M55A 4Q1VA 2ZWPA 1DWUA 4M6WB 1T9GR 2ID8A 2FUEA 4IGKA 4YUXA 5HBRA 5BN5A 4FYJA 4QVKA 3OOHA 3FUCA 4DL9A 3IQFA 3VUFA 1Z08A 4XCQA 1KK1A 1DFIA 1L3CA 1KO7A 1ORHA 4P34A 3MT9A 1XYYA 4KXNA 4OU4A 3SHFA 3PWSA 3QTLA 3ICCA 1TDJA 2NG1A 4OH7A 4WESB 2W6ZA 3FUVA 3KQQA 1P7PA 1S8FA 1GT6A 1U3DA 3G0OA 3H0EA 4X90A 3QPDA 1KU6A 4HWGA 1MT3A 1R6XA 1WB6A 2DLDA 2R65A 3ZHTA 1EFLA 4ND2A 3P7MA 4II2A 4TZ6A 4Q9LA 5A4AA 2EG5A 3F6SA 4GKAA 4K2HA 3KNZA 4WN9B 4TWBA 2YFYA 1ZIYA 1RRFA 2IYOA 1K7CA 2EKDA 3GDWA 4D9MA 1NRIA 3ZWDA 4M1MA 1U2QA 8ATCA 2EEZA 3KVVA 4EKIA 1ATZA 4BVGA 4C6TA 3EGVA 2XDWA 4HLUC 3WNBA 3GFBA 3GP5A 1EP9A 1MX9A 1W49A 4OYYA 4X7MA 1DC3A 4JLVA 1QNLA 3VR5D 3WMWA 3IUPA 4DLUA 3M9XA 1PFQA 4JVOA 1GQQA 1V9LA 3LOQA 4LNAA 5KC9A 1E0AA 4BVBA 1GRQA 2X7XA 4RW0A 3WOVA 2GVNA 4MVJG 3T8YA 1XKXA 1JALA 2F6RA 2WYWA 2O3RA 3NPMA 3T7DA 3LHFA 4RADA 5F5LA 2VHYA 4R9VA 2RH5A 5JZOA 5EMHA 4GM0A 3RREA 3FOEC 4EQZA 5C81A 3JQFC 3FTCA 4EJ0A 3U1BA 3CB4A 4YGXB 4FFSA 1H42A 1QR6A 3BD6A 5I7HA 3PUWA 2WMNB 2PVCA 4KOEC 1BMFA 5FLEX 1CUGA 1WULS 4WN9A 5F4ZA 3BXXA 5FI5A 4ZTUB 1Q22A 2GI4A 2XAAA 4ALIA 1CJVC 3IDFA 1VYUA 4RD6A 1X8LA 1HSOA 3UCEA 3R76A 3ABZA 1O1YA 2OMKA 1M7BA 4YT2A 5DTMA 1E6LA 2XXAB 2OV1A 1NVDA 3BQ9A 3OTGA 4YP7A 3JYLA 2AI2A 3W7VA 5I7RA 2QI9F 2D6FA 3U7EB 1RLMA 4HGNA 2VJOA 4MS4A 5DCLA 5FORA 5CFLA 5K6TA 5DBOA 1AGYA 4EY7A 4BBZA 4F3YA 1G63A 2BUBA 4H27A 4J16C 3TGWA 2FCRA 2E4XA 3IRVA 4MYRA 2FU5C 1FE8A 3U7HB 1ZAYA 2GO1A 3HYRA 1A7JA 3FBTA 3OFSA 4FOTA 1WETA 1X77A 2E55A 4M8IA 3R6DA 3ECCA 2C1XA 3NV9A 4R3UC 2L19A 2QUZA 4PC6A 1FZTA 5LQDA 4PQFA 4YDSA 4BYMA 5ICEA 3PFWO 4QPZA 1QWOA 1XHLA 3DMYA 5T6BA 3SCZA 4PYMA 1YJXA 4DIMA 4ZYLA 3GNQA 5J5VA 4IWNA 1BDJA 2GCPA 1ADGA 1KMHB 1XR3A 4LKRA 4TSRA 4F5DA 3OESA 2RBEA 1E9DA 4LDAA 3T7EA 4DLKA 2CHFA 3AV0B 3FHOA 1NMYA 1PJ3A 2PZMA 3T41A 2R8RA 1QF7A 2WU0A 2Y1KA 3DT8A 3F6CA 3KS9A 5WRFA 3JVDA 3T4XA 4A8TA 3K70C 2ZYVX 2I2AA 2VEOA 4E5DA 1H9AA 2HSZA 4QAJA 1EDOA 1Q1GA 4UFNA 4WZ6A 3HEAA 3MLEA 3R0IA 2CFCA 4CDRA 2YN4A 4G81A 1NQTA 5ERYA 1B00A 2NPFA 3CJQA 5D84A 4UE6A 2B20A 3FHTA 1JQ3A 4RK6A 4IJMA 3ECAA 1UPAA 2YJ6A 2WFMA 3G2MA 4IHAA 2MJLA 3I45A 4BMSA 5E1DA 2H4ZA 1QGUB 1ZJWA 1HFWA 5FH9A 2XF2A 4I5GA 4OQMA 1QIJA 4JLJA 4B31A 2PL1A 1MABA 4IO0A 3GEEA 3Q8LA 3OSUA 2GHRA 2XJ4A 3NUQA 5B1IA 4KSYA 1ND5A 2FI1A 4L8LA 3SBXA 3WV5A 3P20A 4DNPA 3MCZA 4W6QA 2XGOA 3ND8A 1OE0A 1P9RA 4QASA 1CDZA 1ZGZA 1E5XA 2KYRA 4GI3A 5AVRA 4D4KA 3W2HA 4RH3A 2RGXA 4OCZA 1M1NA 2FPIA 2VT3A 4PPFA 4RVFA 4E33A 2AEFA 1G98A 2QRGA 1K0UA 4MVCA 2GZ2A 3IPRA 1MB2A 3UMVA 3AHFA 5E6UB 1CJTC 3Q9SA 1TLLA 4K05A 3T4PA 1P9OA 4WBNB 1D6MA 1T0BA 2A94A 2ODNA 4NV1A 4TQAA 5KYUB 5AI9A 2EJBA 3G6WA 1E60A 2PO5A 3LCRA 4IIYA 5EJ2A 4CUKA 4AJOA 3W5VA 5A05A 2PX5A 3ZS8A 2B69A 4IICA 3Q3HA 3L0CA 2WLTA 5LP6C 4L6IA 4MW4A 1T4CB 4QBGB 3DULA 2OBNA 2YQ4A 1WV0A 5AFSA 2IZ5A 2H1WA 3LUGA 3CUEF 4NYIQ 3E5HA 3SC6A 3UXHA 4G1MB 2HCFA 3L0IB 3EVCA 1BHSA 3W5DA 3R9IA 3Q98A 2FTKE 4JLAA 4M8SA 4YH1A 1JFTA 5KWEA 3K70D 1R0BA 3C74A 3TOXA 1OC4A 3UMRA 3HRKA 4DREA 5AVVA 1S3IA 3K9CA 2OWDA 2FN8A 3KO8A 2F43B 3WHLA 2DQSA 1WOMA 3LIPA 5K51A 1SC1A 1HE5A 4KQ2A 1YQEA 5DHFA 2XZPA 4NV0A 2AN1A 5FJJA 1AQNA 5E6UA 5A0TA 5DGCA 1X3LA 4CU2A 1XB2A 4WBNA 1JXQA 4LJ7A 1JG7A 3K0CA 5EE1A 5KYUA 4ZGWA 4QO7A 1W29A 4BLWA 2MYNA 3C0KA 4LJ9A 4DIBA 4ZOCA 5EMLA 3MMZA 4RZHA 1FPMA 2D13A 1HLDA 1D1SA 1MTOA 2HHAA 2A33A 2K2WA 2QLLA 2Z0MA 4BQSA 1P8JA 3A4LA 4Z0NA 4JNCA 4BTEA 1RKVA 1JZSA 2I6TA 1T4CA 1TO1E 1P5JA 4X7BA 4BN4A 1TEHA 3LUPA 4V38A 2Y76A 3AHEA 5J59A 3EUFA 1IYZA 1I10A 3H9EO 3WLMA 4BNIA 1HC7A 2GILA 4CWAA 4E3ZA 4I1VA 4UHBA 1Y5MA 2W6IA 4EA6A 3LM8A 2VPPA 3I9V1 1W5AA 2QBYA 4ZVQA 4EKNB 1SAYA 3AEKB 3IMCA 4RS4A 4FCWA 3BFKA 3VC1A 3CXUA 3TNFA 3OE5A 1F2UB 4LZOA 1T3SA 2W9XA 2VK2A 3N58A 3W8NA 4ZKEA 3GMSA 1OH6A 3WBJA 1U8EA 4M1ZA 4PIPA 1DL5A 1FDUA 2A57A 4OQDA 1OI2A 3KJFA 3ONNA 4XCVA 4Z5XA 5DCYA 3BL5A 3ZZ1A 1FDOA 2XBLA 2ECQA 2VHZA 1OI4A 3QF7A 3WSWA 4HQOA 3LGXA 3K92A 1TQ2A 4N0PA 4UXIA 1SU8A 3GQBB 1CR6A 5EIFA 4AKTA 4DE5A 4FHDA 3ZVLA 3KCQA 3HDJA 4GM4A 2QTZA 3DP9A 3G49A 4W9NA 1MXHA 5J47A 2MWMA 1BD4A 4WBSA 4FONA 3AHGA 3IBTA 1HG0A 5JJKA 4NCKA 1G0NA 4E30A 1JPVA 4JT9A 4DS3A 3AEKA 4MEAA 4KOAA 1PW5A 1Q0TA 4M9QA 1UFOA 4NECA 4AMUA 5C52B 1XVTA 2RHOA 2X6RA 3EXAA 4WLEA 3ZJVA 5C1BA 1MX5A 4OGFA 2QPLA 4ZAWA 2B92A 1DCTA 3DNFA 4I3HA 2IPAB 3HUUA 2WMYA 3IOMA 3PZBA 1N1MA 4UBMA 3F7TA 4KACA 4N7JA 5AW5A 4HGYA 2GZSA 1Z7WA 4HWPA 3U1VA 1Z34A 2A9OA 3C48A 2DWQA 4UAGA 3PX7A 3SJ7A 1M0TA 1I2CA 2D4AA 4TROA 2AG5A 3GQBA 5AQ1A 3AR3A 3EVTA 5AI8A 2CSUA 4KXUA 3JQ9A 1AN0A 1JGTA 1KBOA 2OVBA 5C8DA 1S9HA 5JUWA 4JGBA 2A4KA 2X8WA 3GYBA 3RVKA 3VDRA 4U6SA 2OXCA 4MYHA 1F6WA 1Z0JA 2FWMX 3BB3A 2XTMA 3K6JA 4UU0A 3FJYA 2OXTA 2WYHA 4WASA 2UUCB 3ZGXA 1FSSA 3QELB 2QL6A 2ZT5A 5JCOC 1YFLA 3LQYA 2JLSA 3A4TA 5JDCC 1CUYA 3TJRA 5KPJA 4U7TB 1QRRA 5CJ2A 2ZAIA 3N2IA 3I6QA 3NHYA 4M49A 2PFGA 4Q9JA 2WJAA 4KV9A 1CVRA 2WIBA 4F7DA 1CZKA 1GUAA 3C3KA 1U8ZA 3PKJA 1KY4A 1MW9X 3QGMA 4YRJA 4EL0A 3D1VA 5F1OA 3O4RA 2COKA 3WKCA 2WPDD 1OR8A 4ENPA 4NVRA 4WKBA 2EDCA 3DT9A 4GMXA 1HSZA 1EK1A 2WU4A 4RIIA 3FTNA 2VLIA 4PGFA 4R84A 5B4UA 1LPSA 2G6TA 4N1AA 5DNAA 4YRIA 5BYKA 1ZESA 2I7XA 2C94A 4M9UA 2AR0A 1H94A 3EQZA 2GHIA 4OFBA 4X85A 3TVYA 1E9VA 4AM8A 1UJ2A 3QELA 1E0DA 4GR9A 3GFRA 3GDGA 3UAOA 4F12A 4Z4CA 1U0GA 1AHNA 4FKZA 1V39A 3C15C 2NVUA 4QGBA 3O4GA 2W2XA 1R3DA 3DVSX 2FETA 2RCNA 1VYHA 2ZW9A 2G4VA 3M34A 1M66A 1V48A 3L8FA 4WACA 5H4GA 1FLAA 1ORVA 4AN1A 3CVYA 1EFRA 1ULUA 3LBFA 1GZVA 1W36B 3PVZA 4WLUA 2XCTB 3PRKE 2HV9A 2HJWA 1R00A 2VJQA 1O94A 1U2GC 3PK0A 3RRNA 4ZVLA 4CG3A 3CSUA 2QTLA 4PXYA 1KSGA 3GFGA 3UYLA 2JLRA 3WGYA 2Q8PA 4P3XA 1BQ4A 2JAWA 5EIXA 2NGRA 3T3MB 2IZOA 1L4NA 2PVSA 3SHWA 5F3DA 1DAMA 4B47A 3DTTA 1XOIA 2WIGA 1QYDA 1QHFA 2OKGA 2IIBA 1KDTA 4GX5A 1ZEJA 4G97A 2YWXA 5DM1A 3W8EA 4RMJA 2IW1A 1D9ZA 1HNWB 3L6UA 5LP6F 5JCJA 4M99A 1YRAA 2QTRA 4J0DA 3AESB 5K6RA 1SXGA 2C2MA 5GWXA 1SIUA 3TR6A 4AS2A 5MF6A 2JAXA 2I67A 4QUAA 4LE0A 1R6VA 3AONB 2WK1A 2XCUA 3T0IA 1MVNA 5B7PA 2AFHA 3GVIA 3QHQA 1DIRA 2ZTSA 2E4AA 2QVBA 3GAMA 4C0LA 3U39A 4R8SA 1CZLA 2GFHA 5EHZA 3DFFA 3OIUA 1ZMRA 3DYIA 4EEZA 3TK1A 1JECA 1Y5IA 2I8LA 1EDBA 2FK7A 2G8LA 1G9TA 1HV8A 4O8ZA 2R4TA 3GXOA 3U3RA 4LOKA 3UVEA 2J3HA 4S2EA 1SXPA 4I9UA 1JS1X 1YMVA 3T0GA 4JUFA 4HVTA 2WSSD 2XCQA 2EBUA 2FRXA 4MQ5A 5CYFA 5FWYB 2JL1A 3DBHB 4IM7A 1YVUA 1ZYUA 5DLEA 5K3BA 1Y4AE 1C3EA 2D7DA 4TZ0A 3BEDA 2O20A 4XUGB 5FLYA 2PCJA 1WVMA 1MO4A 1NXQA 5DM0A 1IRIA 4LY0A 3UHJA 3ZR4B 3OEWA 4NCBA 2JRLA 4P3NA 1FTWA 1YAJA 1X2BA 2VP3A 4L27A 4Q6BA 1BFUA 2CZGA 2O5CA 5IFLA 1ULHA 3AW8A 4LRQA 4P83A 4QYWA 2CL0X 4W9RA 4D44A 4EECA 4EG0A 4OVKA 1SBIA 4TSFD 1P4AA 4DXAA 5ADWA 3QOFA 4C7JA 1ZHHA 2P41A 2B4YA 4NAHA 3TNYA 1N6LA 5JAPA 5JJIA 3HVIA 1DAHA 1XTKA 1V5EA 3DHVA 3JD4A 3HXLA 4FJ2A 1X8XA 1XKLA 3ZTTA 3RAEC 4HQNA 2J3MA 4LDJA 4XWTA 4EWLA 5FWYA 4TLAA 3FLBA 1N6HA 3CZQA 1VYTA 3DBHA 3ED5A 3QEBZ 2FDRA 1QCDA 1J0CA 1E6KA 2BFNA 2R6R1 4ASUD 4PQGA 4TTSA 3UV6A 5EJ9A 2H3HA 2JJ2A 1D0IA 1THGA 5D3QA 2XWPA 4MYUA 2R00C 4R2KA 4ARUA 1BROA 1WZNA 3IB3A 5JC8A 1QSGA 2LIVA 1L4HA 5BQPA 2P6UA 1BW9B 1AO0A 3K53A 4JC5A 5F5NA 3PXGA 4KQEA 2F3RA 1HG1A 4F4HA 4DNOA 3SBDA 2UZ0A 2QW8A 1XRRA 3DQQA 1UQUA 2OV4A 3DLAA 3IP3A 3O94A 4HRAA 1O9BA 1Y6ZA 3T0FA 4LF4B 3ICQB 4IIFA 2VP4A 3WLPA 5AICA 2AJDA 2VZ0A 3IPYA 1P4RA 3DKKA 1NLMA 3KTAB 4XSVA 4MUGA 5GZ6A 1E7YA 2YS7A 4RXMA 1F2TB 4X6YA 2J0UA 1PLLA 4BWFB 3QUQA 3HWSA 1E92A 3ZS9A 1TRHA 1XEWY 2FE1A 2ODTX 2GERA 3ZI4A 5CVTA 1QGOA 4XZ3A 2CV2A 4N47A 1E3IA 1XNGA 4A8PA 5EE3A 3P2JA 4FR0A 4MARA 1NASA 1Z15A 1RTTA 3IUBA 4PZYA 2JPDA 2EF0A 4QGSA 5ARBA 4GU5A 5BSRA 1A88A 2F9FA 1BW9A 2HNAA 2AQHA 4MV4A 5F12A 3EG9A 3WGHA 4INOA 4DBVO 3ZNQA 1QGYA 5L6MB 3G1WA 3BDIA 2XUQA 4R1PA 2QM8A 4C03A 4EGQA 1LV8A 1HMYA 2ORIA 2P2ZA 2YVLA 3PL5A 2IZ0A 3DEAA 2SCUB 2VSYA 1JKXA 5KSOA 1FDRA 3ANYB 4J03A 1WXEA 1OB5A 2JGDB 4LWZA 2HSDA 3L0YA 3KTAA 4DADA 1ACJA 1J09A 1RJWA 5CT5A 1FP6A 3ADKA 4HG2A 4MUKA 3AEXA 4Q12A 3WGOA 2V58A 4BS9A 1LPPA 4GEKA 4RPHA 3NTQA 2HRBA 4G37A 3SJBA 2ZITA 4R9NA 3WQBA 1UWLA 4TLDA 2BRUC 3GROA 3T9AA 3LUJA 1AGXA 1W0JA 4PX9A 1RWPA 2GN8A 4EHHA 1DV1A 1MH1A 1TUIA 2YFKA 2NSJA 4M7WA 2GJAA 4WI1A 1Y6QA 4CN8A 5HW0A 2ZQ5A 1W76A 3EXHC 1JDBB 1B26A 3G2OA 4DSNA 4BEJA 4H1TA 2FR1A 2JBAB 1MB0A 2PN1A 3QVTA 4J3FA 4NICA 3U44B 3R6TA 1XROA 4RPIA 2HLNA 3NRCA 4LJYA 821PA 1EX9A 4OD0A 2SCUA 3CMCO 4HYQA 1ZJZA 4IKOA 4TT3D 4F4UA 5HJEA 2JGDA 4M88A 1XDWA 2DGDA 4PLYA 3VR3D 3DFZA 4UFOA 4W5TA 2BVNA 4EKEA 3K73O 4NARA 3I9FA 1C3VA 1X14A 2ZWVA 4M46A 3H99A 4UVIA 3GEBA 3A1WA 2VPWA 5LYJB 4PYJA 1JHRA 1GQRA 4DLZA 1DINA 1Y7HA 5DI9A 2XUKA 3NCTA 3OC6A 3MHPA 1TVMA 3C70A 2GK4A 1W75A 1QBKC 3FD8A 3DEJA 3FFAA 1ZCJA 2AW5A 3NQ41 4O4LF 5CA1F 2CJPA 5ALQA 1RP7A 4AF6A 3I9MA 1T2FA 5BR4A 2OCYC 3NU1A 4BAZA 4G1EB 3G23A 4A92A 1SCAA 2JBAA 2QAGC 2Z08A 3AJAA 2B1JA 5K0TA 1BU8A 1I6MA 2ZSBA 5C32A 1Q7BA 4I66A 3SQLA 3ZVMA 1DJPA 2P2YA 1UF9A 1Q7CA 1I2DA 2B7LA 4FB5A 2RHCA 1VPEA 3OETA 5DISB 3TTWA 2AYZA 1V8FA 1RNLA 2OZEA 4HQFA 4M2LA 4KXLA 1Z5OA 4KBFA 1J42A 1MNQA 3PENA 1K6XA 1C81A 1KA9H 1NI4A 1Z0SA 2DECA 1U7WA 1GTL1 2EYQA 2HJHA 1L5FA 2WDZA 2YFQA 4LHZA 5EA2A 5AXDA 2WJWA 4F06A 4BV8A 3PRYA 3NBFA 4LG1A 2FZCA 2WJVA 4MROA 3ZIUA 2RBGA 4ND6A 3VTAA 4B3GA 3M9LA 3HO1A 5LJLA 2Y1GA 1VMEA 3OI7A 3L7IA 2YIVX 2CCGA 3QI7A 1ACMA 4EAAA 3IKMB 3N28A 2ANCA 4MQUA 3JVEA 3Q3EA 3QVVA 4XARA 1U9YA 3KR9A 2FMHA 1ULZA 4IJ6A 1R8QA 4LBWA 1ZCFA 1E9RA 3OG9A 1OV4A 3ONFA 3IVXA 2BONA 3QH4A 2C5HA 3DOFA 4JLBA 2XOKA 3T5CA 1Z82A 4HJRA 4MO2A 2P4QA 1C14A 1X3SA 4PSCA 4MQEB 5EIHA 3RFTA 3LKZA 5K0JA 2W6JA 3RU2A 1A5ZA 4Z4QA 5AKXA 3WYCA 2XMBA 2BJVA 3R6WA 5FPHA 1SKAA 1MF7A 1XDBA 2C5BA 2CBXA 3K9WA 4GP6A 4PZEA 1LFDB 4RL6A 2RHGB 1IUNA 1I3CA 3L0DA 3MJEA 3NHUA 4BX8A 1F2DA 3R41A 4LDNA 2GR9A 5FTWA 1X15A 1RYEA 3LVBA 5DT2A 2GPSA 5C5CA 4X65B 1ISRA 2ZZKA 4H1HA 2QUBA 5BMOA 3LLUA 4JQCA 3FPCA 5CLLA 1GRNA 2P68A 5I01A 1F3LA 5DMXA 3DE6X 2R62A 1UINA 5LB2A 1CETA 3X1KA 1G8YA 4IEFB 4OYLA 1DMSA 1AMOA 1ONPA 1NNEA 4JKYA 2FLKA 1PNRA 3NBAA 1J2RA 1G8MA 2IEGA 2FN4A 1MQ9A 1SR8A 4HZGA 3AFOA 4MQEA 4MTLA 1TTPB 4ZV7A 2G5CA 2H5EA 3QPAA 1K8YB 4LMPA 3FKSD 1H9CA 3HA3A 1ZN7A 4WW0A 1KKMA 5JWHA 4D96A 2DKOA 2Q5LA 4WZZA 4DC9A 5J3JA 1MIHA 5EKDA 3INRA 1I7DA 1L8XA 1ND6A 1GCUA 2CNDA 4HB3A 4D45A 1T29A 5EWLB 4R3NA 4DCJA 2H3EA 2PUHA 3TN7A 1QIEA 4H7DA 2VEDA 3C6MA 3LMKA 1Q44A 2WIAA 4XI9A 5ALZA 3Q7SA 5AI5A 1EE2A 1E3TA 2FHPA 4RPLA 5GAJA 4DG5A 1P0FA 1JA1A 4TTTS 1U02A 3ZNPA 1YZTA 2NXEA 2R7LA 3C97A 1G5QA 3BHNA 4UZEA 1H1LB 2V4MA 4P4UA 3WB9A 2QVCA 1KI3A 3LPMA 1MU0A 4JI1B 5ENZA 1R6AA 3DOJA 3OT4A 2RMKA 5JWRA 2WHEA 1CNFA 6ABPA 1WOYA 3AMVA 3MXTA 4UNQA 3EH1A 3T7SA 2EZ9A 5BSGA 4ZQIA 1KE1A 3FOFC 3ZVRA 1MAUA 4YRMA 1IN6A 3ZY3A 1YAHA 3TI7A 1WY7A 3E03A 4FNMA 1LPBB 3KOYA 2FQYA 1K27A 5CIYA 2ZWAA 3KQTA 3ZD8A 3LIIA 2IRWA 2O14A 5EWLA 5B12A 2KB0A 1POWA 1CUBA 1MDFA 3KVYA 1WF3A 2IUUA 3SYMA 1KTIA 1SZDA 2V6BA 3L7OA 4P2BA 4WFQA 2PBZA 4N12A 1JG2A 2V5UA 1TX4B 3HR4A 1UDCA 5KWJA 1PG5A 3NIFB 1WUIS 1IATA 1XAIA 3NT4A 1PLJA 1P5RA 4WUVA 4YP9A 4ZVKA 1IVYA 3B3JA 3UCXA 3B6EA 2YL2A 3KUCA 4UULA 1CZUA 1G60A 3F47A 3HB5X 3PEWA 2YWBA 1T8RA 3P9QA 1IEXA 2B94A 1M2KA 3S2FA 1IXZA 2H4XA 1K7YA 2OV3A 3D5QA 3WFZA 2PKXA 2G71A 1HT2E 2P9FA 2OY0A 1LS1A 4P0QB 3G7NA 3KJXA 5F73A 1ZINA 3IMKA 1WABA 5F3RA 3L1VA 1EQUA 1H5QA 4LYDA 1Q21A 4RCYA 2VBFA 1UIRA 4ND4A 5EINA 3W6ZA 1RLTA 1PZNA 1GZ4A 2C7RA 4YP5A 1AH2A 3LDHA 4FVTA 3CWCA 1A50B 1PUJA 1X92A 2OAQ1 4I3GA 1OYYA 4WN3A 3T99A 3X0DA 2ASEA 5DV9A 3TRJA 1VA5A 1ADBA 2VP0A 1AHPA 5AVXA 1JSZA 1IOLA 1YCFA 5FO1A 5IAJA 1Y48E 4I4TB 3D81A 5IF9A 2OCGA 1FDTA 4YLGA 3C7TA 3EVZA 5KSYA 2IU0A 3ZCVA 3B52X 5FBHA 1E1QD 4QRIA 5AUQA 2XCRB 2V45A 4HADA 2J0EA 2BFEB 1CNMA 4IG9A 4QQKA 2R96A 2OYCA 2CY0A 4AECA 3A9WA 3BT7A 1CRZA 1BMTA 3HADA 4LYJA 2F1IA 3PNSA 3UB2A 4PO8A 4OB7A 3VU0A 1OLUA 1S9DA 2BMEA 1KVRA 4BNKA 5DM4A 5DBIA 3PE3A 3X1YA 3G5LA 4JJAA 2OQRA 1ESMA 2ZJ8A 4Q9HA 4RV4A 1WIWA 4ARSA 4HQKA 1DRJA 2MTBA 3ORQA 4D8YA 2DT8A 4C3VA 2HUNA 1U04A 2DTEA 3UY4A 3PUKA 4LJ5A 3VPBA 5AW7A 2OZKA 3ZDXB 4IQGA 4W5HA 1I4LD 5C1IA 1GPLA 1BJTA 2O0MA 3E61A 4FDAA 1ZI6A 4LFCB 5I47A 3ZQ6A 2BI7A 1XA3A 3ZGNA 3C5WP 3D4BA 2OBFA 3GLIB 4J90A 1G7SA 3D6TB 2BFEA 5SY6A 1S1MA 2XYRA 5FBRB 1HEUA 3ZW9A 4ND7A 2NO1A 2ZBEA 2ONCA 4AG3A 4JVLA 4K46A 4F3RA 1GTZA 3FPKA 3H83A 2FUNB 1GPDG 4TXMA 5P8WA 4D6YA 2Q1SA 2BUCA 4QPDA 4WADA 1QXSA 4CM3A 1PK7A 1ZA1A 2ZE5A 3VSBA 1GU0A 1ZKDA 2FP4B 1MEOA 2G28A 2D74A 2PV0A 1SQ6A 3BX1A 4KNWA 2E0IA 3AINA 4M7RA 1DG1G 3K2BA 4JBHA 5E3IA 5BNWA 2WWYA 3C8DA 1S7GA 1PZXA 2HFKA 2QD1A 2VJBA 3P32A 4D80A 1YK0A 4JCCA 3QA9A 1USVA 2Q2WA 3D3JA 3IKVA 1B1CA 2A84A 4GM1A 1E9EA 1HPLA 4B5KA 1Y8RB 4AY6A 3FZYA 1WL8A 1CV2A 4QUJA 1M2GA 3WWPA 1NU8A 3L4KA 3GLIA 2JLXA 1V6CA 3FIJA 4RFVA 3VR1A 2WU3A 3KRTA 5L7YA 3O26A 2NQ8A 6CHYA 3H3JA 3GLRA 5HKBA 3ANNA 1BFKA 4DNQA 1YTUA 3ASVA 4C0XA 3P2YA 4QODA 1B41A 1U8CB 3O0DA 1OVMA 3ZWWA 4ZOEA 5FLXA 4DVGA 1SULA 3OQHA 1GL9B 4KN5A 2FP4A 5KAMA 1OD6A 4NZNA 2P3LA 4IXWA 3DC7A 5D3MB 2DUJA 4N9QA 3NBXX 1J7JA 4DVJA 2CJFA 1ZI9A 3L0SA 3V42A 3S5UA 1QFSA 4LXIA 2IHVA 2JLUA 4QICA 1MJNA 2PQ6A 3QWHA 1PL0A 3BORA 3L7KA 5KQGA 3IJEB 3LLMA 3DO5A 3IKLA 1D4AA 4UDYX 3JYOA 5ALFA 4BFUA 3WL8A 1P61B 1EX1A 1PNTA 2QAIA 3IAFA 1KY2A 5JXIA 2H2HA 1QLWA 4PX2A 5FBWB 2ZRIA 1TJ4A 4REMA 1JXMA 2PIAA 2EBFX 3KJEA 4I1PA 3UWSA 5LMNB 3ESAA 1C7FA 3KXPA 1AF7A 1E7SA 2WUVA 1RQLA 2JCBA 1RKQA 3BHIA 2PCLA 3NUZA 3W05A 4BU1A 4EA9A 3DBRB 4MXDA 1V6SA 3FCOA 5CYOA 1VLMA 4ZT5A 1SNYA 3DDCA 3IE0A 3Q3VA 2WWXA 5CXXA 4F56A 4HB4A 5D3MA 4LBYA 2C7OA 2PD4A 3TOVA 4LFAB 2CXTA 5HUHA 3CNHA 4HOYA 4KQ1A 5DKFA 4BZZA 5KUTA 3JR7A 1ZOLA 1SOUA 1V37A 1QAMA 1NXVA 4CI9A 4L0QA 4PHTA 4DANA 2AX4A 1FEZA 2GBLA 1JQLB 1C5KA 2HHJA 2MU1A 4L5JA 3W90A 3RF7A 4ZVUA 4ON9A 5CLIA 1WCYA 1CWUA 1WZEA 1DX4A 3ZTWA 1ZUWA 3KWJA 5G0SA 1C2TA 2NLOA 1UT6A 1RWBA 3WLIA 1ISIA 1TQ6A 2AGVA 2BGGA 1FNDA 3CB2A 1TK2A 1ST3A 3TEMA 4DWOA 1T1JA 5EKTA 1P6QA 2J67A 2GCIA 1Z45A 5AJYA 1FP1D 4KRYA 2DFNA 3UWOA 3DBRA 2VZEA 1QZXA 3MWEB 2ZRNA 4XIYA 4A26A 4P0PB 1RLIA 5JE8A 4D0NA 4ZQEA 2LR0A 2QYHA 2WUWE 2C5EA 2NXJA 3IIEA 1DS6A 1YE8A 2AG6A 1P7VA 3C6QA 3AL0C 3K16A 3E0QA 2QWXA 3OLYA 2OT3B 4ZREA 1H22A 2E48A 3E9EA 5BWCA 1SUSA 1SUCA 2PMCA 2Q1TA 3TRFA 1XMQB 5FWAA 3TQRA 3AP2A 2IQIA 2ECFA 3RK0A 3TJMA 3E1KA 4AZTA 3P2KA 1N8NA 2Z4SA 5MDHA 1RPJA 3TTTA 3WA6A 4LSMA 3C3DA 4ETIA 3NBUA 1O6CA 4W82A 3BIWA 1XEWX 2P1RA 1RYYA 3G82C 5BWBA 2YHBA 1R12A 2RGEA 2V7QA 3LNCA 5BRJA 1QIFA 1AC5A 4FJ0A 1KEKA 3KQWA 1EA5A 2ZE6A 4BNXA 1N2XA 4OSEA 1U1CA 2WMDA 4C04A 5DTEA 4U7GA 1XMVA 2CFOA 3ET4A 4ARBA 1WAMA 2W2OA 1UEIA 2OCPA 1KQPA 4HTAA 1Y9JA 2HEGA 4TMTA 4CI0B 5DX0A 2LDBA 3OLXA 5FTKA 2MMGA 4EPXA 2BUAA 1JW9B 5DP1A 5GJVC 4C7XA 2CXRA 2OV2A 4DA7A 2RK4A 4S2UA 5T4FA 1CUFA 3ZGLA 2QR5A 1KC1A 1ZBDA 2DHEA 3GH3A 3ZD9A 2P0YA 3TLBA 2WHRA 3TSAA 3RVRA 3JZFA 2PIDA 2Z57A 2AW3A 4NE2A 2P9TA 4O2BB 5HDQA 4ICIA 5F2OA 3VR4D 3TPCA 4COKA 4CTMA 5BV8A 1T9GS 2Q2QA 5I9TA 3UFXB 5AM3A 3OQOA 3BWDD 3K96A 4FP9A 1ISPA 4GI7A 5EMMA 4Z9YA 4BIMA 1OFUA 1BEUB 3EA4A 2Z30A 1F60A 1NNSA 3E8SA 4PYOA 4K9PA 2JKZA 3LWBA 1EIWA 5KVVA 5HF9A 2GRAA 1I5RA 3TG2A 3A2NA 2FX3A 1J9EA 5DNUA 4GX2A 4A82A 2FR8A 4CM6A 2ILTA 5IJ0B 3CW8X 1HDRA 1T0IA 4Q66C 4QELA 4F6CA 5CG2A 4OAOA 4OMFG 1C8KA 1A5SB 2YKGA 5GV8A 2OZVA 3UOAB 2H0AA 2P69A 4XJVA 2DWCA 5H1YA 2P62A 5B1HA 3AY7A 2EGUA 3F3MA 4GOJA 1W1UA 2CGEA 3NHLA 4X1IB 4B4VA 5BNZA 1L2TA 3G2JA 4JUCA 2HA3A 1NVAA 2NTYC 2E4UA 3O92A 2F48A 4J7XA 4Y6SA 3UFXA 3E23A 5BQ3A 5I3CA 3ZJUA 4K40A 1T2DA 1XQVA 3OWHA 3GY0A 3LBYA 3IJ5A 4HL6A 2VDUE 2B2NA 2XY4A 3M6WA 3QX9A 1G2PA 1KDYA 5JAOA 1Y4ZA 4O2AF 1OYOA 2MOKA 3GJ5A 1WTCA 4LI3X 1EP3B 4MWTA 2UYHA 4K7JA 4ZQHA 4Y6PA 4E2YA 2HDWA 3NJ4A 2GPJA 5FOVA 1FXSA 1UZNA 3TLZA 4AKGA 1WMEA 1S2OA 3AZOA 4QBIA 3WIBA 3DKVA 4Y0AA 4H0CA 5C37A 3R24A 3SSNA 4A6EA 4JY7A 2D2FA 3QLEA 2AVNA 5IVIA 2CV0A 1BVRA 4HK4A 2JIDA 1NT4A 3OCZA 2PZEA 5IVDA 4M7OA 3EH2A 2FSPA 1TYCA 2FPOA 3AH8A 3DVLA 3QE9Y 1JHDA 3OM0A 3HJHA 3LZ6A 4FGSA 4ZCQA 1YNOA 3U3KA 3E5NA 1PS9A 2BLLA 1NRWA 1R7RA 1L7XA 1YK1A 4YCAA 3SP1A 2ZUTA 4U63A 4E51A 2AOXA 3B6MA 1M2OB 4IR7A 5AKHA 2VDWB 4K5QA 3SLKA 4EIWA 2Q99A 4ZTZB 5CFRA 2D59A 4EHKA 1W93A 4RHTA 1HUQA 1O0SA 3GJ0A 2BJWA 3ZYCA 2OD2A 1DBIA 4G0PA 5JG7A 1RRMA 2P2LA 3CGGA 1US8A 3DDHA 2MYPA 1G7CA 3NC4A 2V96A 4DR6B 1PQ4A 3W9SA 3UWMA 3QVMA 1Y8CA 1QIMA 2Y1CA 4E5YA 1XG5A 2ZJ6A 2YCBA 4NCIA 4CR7A 3D0QA 2EU8A 3N0TA 4D0GA 1Q17A 4GOLD 3ZY5A 1H2YA 1W0CA 4C4RA 3MTGA 1IZ9A 1SCQA 7GPBA 2VDWA 2HWKA 3N2GB 5FWXB 5I7SA 1XAGA 4FYXA 3D5TA 4UBKA 3H5OA 4JC0A 1X1RA 2XWBF 4RJIA 5E9WA 1P18A 1ADJA 1QZZA 2Q8NA 3PGLA 5JLAA 3L0PA 3RKSA 1JHPA 1XTUA 3ZDYB 2EKBA 2IVFA 1W73A 2BDTA 4OXQA 3UN1A 1WKBA 1KFCB 4JEUA 1EVJA 4YHBA 4C6SA 2ZJ1A 1SK9A 2D5CA 1D7OA 3EBOA 5TT1A 1B8UA 1P5FA 1W88B 2G07A 2H1LA 4D82A 3U9SA 4CMEC 2VG8A 5CIWA 5FBLB 1MH9A 2GCOA 2EZTA 3EISA 3S55A 1EJ6A 4DA8A 1UP4A 1XLWA 4DUPA 3CRZA 5ALRA 4PSVA 1J1IA 3RWMB 1NATA 4WCVA 5KTKA 3LRTA 4DUGD 3GT7A 2JDID 4U7HA 4YPVA 2CLHB 5A5DA 5AUOB 3OICA 3N2GA 4Y2QA 4JI5B 3ZJYA 3NBMA 4MWEA 3R0JA 3R7WB 3WO1A 3H7IA 4NOMA 2XUPA 4X93A 2J9YB 2JJQA 2J41A 2Q4BA 4Y7DA 1OV6A 3V2IA 3WNCA 1O87A 2C4VA 1CUIA 3ZV5A 2FFJA 4MICA 4CCWA 4RHUA 5A1TA 1VBKA 1OILA 5LIPA 2X5OA 2NPIA 3MVEA 1G8KA 3VR2D 4AVYA 4QXMA 1DAIA 4UATA 4OI4A 3P0RA 3MJDA 4N7BA 2ID4A 1BCRB 1VKHA 1V8BA 3EEYA 3K31A 3QIVA 5D5QA 3VTKA 1W88A 1KRWA 3R0XA 3C41J 3OZDA 5IK2A 1RPAA 3M4YA 2AX3A 1NMZA 3HFJA 3HACA 1T2AA 5JECA 2M6SA 4ARIA 3CNEA 2OBLA 3OD5A 1BIFA 1NPDA 4RD3A 5DHSA 2YMQA 2GF2A 3FI9A 3OTWA 1GUFA 4RACA 1QFXA 1DDOA 1M5UA 3KYIB 4B7AA 4P7JA 1ZUD1 1V95A 2CEKA 3G88A 3U4IA 1IHXA 2J7KA 3AF3A 3RUDA 1U98A 2Y27A 2CLKB 1NJ6A 4RLSA 2K2QB 1SUPA 3QFCA 2PKRA 3D7MA 4I1OA 3R7WA 1ANKA 1SQGA 1VFPA 4EJSC 5AW8A 1WNFA 1ZG3A 3NI2A 1S2MA 3K2IA 2M6LA 1PE0A 1J24A 1OZ0A 2P5YA 2HMUA 4B3MB 1BCRA 2BFCB 3DLPX 4YECA 3WHIA 4DWWA 3RYFB 2FFQA 2Q5HA 4IOLA 2QRQA 3DAYA 4G4GA 5BN4B 1ADYA 2J9GA 3AF1A 2JJ1D 3I12A 4OL0A 3TBFA 4F11A 4DDVA 1MENA 1R9JA 5GGXA 1T8SA 3S8YA 3RADC 2Z1DA 1RWNA 2D5IA 4J0EA 4L1KA 5JC1A 4BOYA 1KPHA 4KQMA 2C4MA 4FMPA 3SZLA 1RHRA 3MTDA 4D0SA 4Z53A 2FEWB 4AFNA 1I4TD 1A4XA 2QXTA 1CY1A 1GKUB 1PT5A 1NVWQ 2WJZB 5HKOA 3T3HA 1V8ZA 5CFQA 2W71A 4IYRA 2ZUUA 4BNLA 4A23A 1ZOPA 3RR2A 5JSKA 2GUGA 3GN1A 3NNSA 2X19A 3JY6A 3QKIA 5ALMA 3WK9A 4EF6A 4WINA 1FQWA 1QYWA 3ER6A 1I6KA 1GGMA 2FSGA 1IB0A 1WB4A 1GZ3A 3FHLA 2IHJA 4TOIA 5TX7A 4DXHA 4JU9A 2CCJA 2BFCA 2NUAB 3KFVA 5CDHA 2ZTVA 5C8YB 3OHMA 4L74A 5BN4A 4MO9A 4FGUA 2PLNA 3TS1A 2CYBA 2WSIA 3JQ7B 4HQLA 1GLVA 3A8TA 4IIXA 1E58A 3A2LA 3AF5A 3LUCA 3R5HA 2YVUA 1Y63A 3G5UA 4PCLA 5BW6B 5AOBA 4C76A 1E3MA 3NDJA 4OLBA 3M1IA 2H2DA 1TUGA 2BCJQ 4FGWA 1UBMS 2VT6A 2QUJA 3M4ZA 4JWKA 3B3FA 5G3YA 4KKXB 2VP6A 1KJJA 1TM5E 2DBQA 1OXTA 2CKDA 3MUFA 2ZT7A 4G5HA 4O0MA 5AQEA 4PLHA 3SS9X 3LQ4A 1L1FA 2VK4A 4D4IA 4UJ5A 2K6GA 5FQNA 3BXZA 4V03A 3OJLA 5H9VA 3IJPA 3Q12A 2XYPA 1KF0A 1JLSA 1U65A 3Q0IA 5DH9A 3HJFA 4QOIA 4A91A 3ZDQA 4ZD6A 2HRDA 1U3TA 5C8YA 3TIFA 4L07A 3GEMA 4H1UA 2A1UB 5FTLA 1KO4A 3QVUA 3JQ7A 1KR2A 4BJ6A 3D8RA 3UHFA 5A6VA 2J5QA 2ZI5A 2J6IA 5H83A 2PX8A 3HKCB 1IIBA 1KI2A 1B8PA 3KXDA 2ZJYA 5DW0A 4OU5A 4LF6B 4Z0TA 1D6NA 1VE7A 4AB1A 4UAVA 5HKKD 2QTFA 1UFVA 4PFSA 3KQSA 1FRQA 4G26A 5P21A 5BOSA 4XA8A 3CZ4A 4HH0A 2QX7A 1CLUA 5I4KA 5F3WB 2EAUA 1W46A 3OVMA 3D8HA 4FPXA 4Q4JA 1YZQA 4GEGA 2IYWA 4IXTA 1R64A 2IHZA 3IQWA 3KIPA 1TFUA 1JFFB 5CPBA 3VKVA 4BJHB 4F93B 1I94B 2VUSA 3VKGA 4B7ZA 3IEPA 3OMXA 4BZWA 2A1UA 3FOWA 3IOYA 5GV7A 3VPHA 3IHKA 1T9ZA 5TPZA 2B3TA 1JVBA 5BPFA 1U0OC 3N2LA 1F6DA 2I2DA 4K8OA 1UDWA 2G7ZA 2IP4A 1YGPA 3MBIA 3KBBA 1M6YA 2ADFA 1Z6PA 3P0JA 4FIZA 4FQ5A 4WEOA 2B98A 4GE0A 1B7GO 2FA9A 2C20A 2DY0A 2FCAA 2P4SA 1XSEA 3NOQA 3CONA 4Z3KA 2VF2A 2Q9BA 3L5KA 4YJDA 4G8JA 4QYSA 1J7KA 2IXAA 2JIOA 3EGDA 3T1TA 4BLTA 3Q85A 4OYHA 4B6FA 2LIPA 1OROA 1PSWA 3BILA 5I9BA 2NQTA 4ZYZA 1G41A 2F00A 3EEBA 5LQNA 3HK2A 4G9EA 4C4PA 3Q2IA 4WGGA 1P73A 3QE3A 1JFFA 4H3HB 4I8IA 1I3MA 5KNBA 3R5SA 1ZJ5A 1IHPA 2VSNA 3D54D 3ZXYA 1A8HA 1DO0A 1TUBA 4L8VA 5LLSA 3V4SA 4D8UA 4QECA 3SSAA 1CUEA 2KLBA 3TYXA 2ECPA 4TYQA 3Q6NA 4UQPA 3FMPB 2WP8J 4X92A 1CZOA 3UJDA 5C7IO 1F51E 1H2ZA 4CCSA 4GS5A 1L4YA 3PC7A 4QHSA 5SY4A 5ILOA 1QB7A 2ZR7A 3BD8A 4M9CA 5GM2A 4DSOA 2PE5A 3RS9A 4RCVA 5ICCA 1A77A 1RZVA 3GA5A 1IN8A 4MVJI 4DIUA 1X7XA 1KXJA 1E3EA 1R9GA 1NXWA 3QTBA 3HDYA 3RNLA 1OOEA 2PO7A 2R8PA 2YV2A 2I2WA 3HDGA 3VH3A 1N0UA 2VBIA 3CXRA 3EPPA 3FVRA 5FPYA 1DZ3A 2JFHA 3OA0A 3IQIX 4JUAA 1P4HA 4TLLB 3Q9NA 4ROTA 4F2GA 2PGJA 4C06A 2REOA 1Z8NA 4AUEA 5U9CA 1DI0A 4AJ2A 3BCHA 3FPFA 4Z6KA 1N78A 3ZE7A 4GICA 1CFZA 2E85A 2GPYA 3GLKA 4RA6B 5A0FA 1ODFA 1PD0A 4W8OA 4KQJA 4E5NA 3RC8A 4TMYA 1UJCA 1ZMOA 2KX7A 4X3OA 5D1NA 3HB4X 1Q77A 3ZE6A 2V6GA 3OKAA 5B37A 4A1FA 4ZAVA 4MW7A 4D02A 1V71A 3NHMA 4CQMD 2YVQA 4LC0A 3LO5A 1W59A 4EENA 3HPRA 4YACA 5HK8A 2PFSA 3TW4A 2M9MA 2YTZA 5DCUA 4AZSA 5EJ8A