4RUKA

Crystal structure of phosphoapantetheine adenylyltransferase ppat/coad with coa and pyrophosphate from pseudomonas aeruginosa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
157
structure length
157
Chain Sequence
NRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLFSLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANMNRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Transition of phosphopantetheine adenylyltransferase from catalytic to allosteric state is characterized by ternary complex formation in Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa 2192
molecule tags Transferase
total genus 56
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4rukA00
1TFUA 1Q77A 1JIIA 3P52A 2QUKA 4JYZA 2XRYA 3N2YA 1H3NA 1OWPA 3TNJA 1U0BB 1T9GS 2BYTA 3CA8A 1IQUA 1YUNA 1VL2A 1N2IA 1NSYA 2JA2A 2JAXA 4MW5A 3ZXSA 2D5BA 4MVCA 2G36A 4WNYA 2J5BA 2ZUFA 2ZUEA 3ILVA 2PZ8A 3PXUA 3TQIA 1WXFA 1XNHA 4I6JA 1F9AA 1QNFA 1COZA 1M8JA 2OQ2A 1EUYA 3DO8A 3MUEA 3Q10A 2IJGX 4MWBA 3TS1A 1JGTA 3VRHA 1N77A 1MAUA 3SZGA 3CVVA 2YWBA 2O5RA 3H99A 3KT8A 4Q16A 3IOBA 1N75A 3FHJA 4XFJA 3ZIUA 2QTNA 1ZH0A 1QRTA 4JZYA 1S4MA 3CVYA 1NURA 2B7LA 2A4MA 4EF6A 1NUSA 1NUTA 2DETA 2A88A 1QJCA 2HZ7A 1GTRA 2J08A 2AZXA 3COZA 5J59A 1KORA 1NYLA 4CDMA 4OJMX 4ZT3A 2X3FA 1N2OA 3KT6A 1OD6A 3AIIA 1KP3A 1IFXA 1K97A 4TS1A 4MUHA 4RUKA 2Z08A 1NUUA 1JMVA 2PZBA 3S3TA 3CLUC 4ARCA 1OWOA 3HL4A 4GRIA 3HMQA 2O8VA 1KKUA 3KT3A 3M5WA 3D6UA 2ZP1A 3CLSC 1JECA 2GM3A 1XJQA 1F7VA 4JFAA 1IH8A 2X1MA 3FETA 5DK4A 3Q4GA 4HK4A 4AQ7A 4XFDA 3ND6A 3QTTA 3QE4A 3RK1A 3FDXA 3E27A 3UOWA 2A1UA 3BL5A 4X0EA 4ZT7A 3SZ3A 3HFJA 5JBNA 3JXEA 3FG9A 3CLUD 5F23A 1WY5A 2X1LA 1KH3A 1G8HA 4G5FA 4KPUB 1KQPA 1MAWA 2VTBB 2DPLA 3CR8A 4PBRA 4YP7A 1UFVA 2H29A 1J70A 5KCMA 2CYAA 3HZRA 1T9GR 2CV2A 2J09A 3PNYA 1U7XA 2H2AA 3CLSD 3IMEA 3G5AA 1MOPA 2CV1A 2A1TS 3Q12A 3N05A 1WQ4A 1H3FA 1LI7A 1IQRA 1O94C 1OWMA 1J09A 4WSOA 4CDNA 1WXIA 3ZJTA 1F7UA 4F3RA 1KH1A 3IDFA 5FO0A 4ZT2A 3NBAA 1M1ZA 5HG0A 3VU8A 2V0GA 3AG6A 1ILEA 1N2GA 1QU2A 4Q93A 2CYBA 3VGJA 1O96A 1VBNA 1M83A 2A7XA 4MW0A 4MVWA 1J1UA 2QUJA 3IMGA 2TS1A 1IHOA 5FO1A 1KH2A 5J58A 1O97C 4MVYA 1O94D 2QJTA 4K0RA 3SEQA 1N2HA 4ND6A 3CVUA 1O6BA 3FOCA 1Q11A 3OP1A 3UMVA 2VTBA 1Q19A 4YP5A 2WB2A 5KWVA 3N8HA 1FFYA 3IVGA 3GUZA 5K0TA 3AL0C 3ZXIA 2NZ2A 1MBZA 3K32A 4G5YA 1TYBE 4MLPA 3COYA 3IMCA 4MUGA 1LW7A 3RFFA 3UC5A 1PG0A 2J4DA 4U7JA 3ND5A 4OUDA 1GZUA 3A04A 1WXEA 1JHDA 1TEZA 1J1ZA 1O97D 2E21A 1GLNA 4HJRA 3IUEA 4UZEA 5K0SA 4MWEA 1N78A 4S1OA 1EXDA 5TEWA 4DE5A 2QTRA 1NUPA 3AKZA 2CYCA 1IQ0A 3F3MA 3U1VA 3UY4A 1PG2A 4MULA 4ZT4A 3N9IA 1H3EA 1JEEA 1JILA 4PBSA 4YBRA 3X1KA 4KKVA 4EG3A 2DEUA 1OBCA 1B6TA 2CUZA 2DUMA 4ZT5A 3GLVA 5LFAA 4R0NA 1EJ2A 3NBKA 4MW9A 2Z3VA 1R6UA 4E1AA 1NI5A 1TYDE 3A4IA 1T6YA 2A1TR 3SEZA 2A84A 4I6EA 1J20A 2D13A 1ZJWA 3NV7A 2R5WA 4CQNA 3KFLA 1OBHA 1EUQA 1WZ2A 4JXZA 2AKEA 2PZAA 2WQ7A 4YP6A 3X1JA 3FI0A 3IVXA 5LLTA 1K92A 1VBKA 1ZUNA 2A86A 4U8HA 3IOEA 3MLBA 3IOCA 2X0KA 3IVCA 3PNBA 4MUIA 1N2BA 1ULHA 1QQTA 3HGMA 4ZCPA 5H16A 2PXHA 3SDBA 4MAFA 3L93A 4R2MA 2VXOA 3RHSA 4DLPA 1K4KA 1MB2A 4L2IB 1EFVB 2IELA 4QRDA 2WSIA 3H05A 2E0IA 4ZCQA 1M8KA 3ZJVA 2YWCA 4UZFA 1J21A 2EJCA 5BNZA 1U3CA 2E18A 3SP1A 1I6MA 2RD2A 1JEDA 1PFYA 5AHWA 3FIUA 3TQOA 1N2EA 4MUFA 1YI8A 4R2LA 4ARIA 4H3SA 4MQ6A 1X8XA 4MUKA 1MRZA 5KHAA 4NAUA 1JZSA 1N1DA 3H9CA 1WQ3A 1M8FA 3I05A 2DXIA 1KAQA 1WXHA 3COWA 1KQNA 2CV0A 4DDKA 1G8FA 1JZQA 1MB9A 1RQGA 4YMIA 1PFVA 1V47A 4KR7A 1WKBA 4BWVA 4DDHA 4K03A 1N3LA 1IVSA 1TYCA 1ZH6A 3LE8A 1M8GA 4HPWA 4I6GA 4NAHA 4PY2A 4CT0A 2IP1A 2GOYA 2I1LA 1EFVA 1TYAE 1VLHA 2QUHA 4PBTA 4GU5A 5HUHA 4KPUA 3G59A 4ZCTA 1HYBA 3HV0A 2WQ6A 4EGAA 3ZJUA 1GPMA 3DPIA 2Z09A 4RPIA 4NATA 5DEOA 3IODA 1KAMA 3INNA 3SYTA 4EG4A 2GKSA 1F4LA 2QJFA 5TEVA 3L92A 4MW1A 3CLTC 1Y42X 1SURA 3P0HA 2PFSA 3A05A 5DB4A 4J75A 2YXNA 4MWDA 1G59A 1GN8A 1BS2A 1N2JA 1WJGA 5EKDA 4KR6A 4MVXA 1I6KA 2YY5A 3CVXA 1R6XA 4MW7A 4NDAA 3UK2A 3ND7A 3PRHA 1NUQA 1O95C 1YIDA 1WOYA 5TGTA 1IRXA 1K4MA 2D54A 3CLRC 3C8ZA 4AS1A 1D2RA 3CVWA 1YULA 3H9BA 4ZCRA 4ND7A 3FWKA 1GTSA 3CLTD 3MMXA 2CFOA 1GAXA 1QTQA 2PIDA 2QJOA 1XNGA 1YIAA 2A1UB 3G6KA 2AG6A 3RBAA 3QTBA 3LOQA 3LCJA 4FZJA 1OWNA 1Q15A 3IUBA 3P0IA 3ZGZA 3OTWA 1O0CA 3DLAA 4QBTA 1I6LA 4MW2A 1QU3A 1O95D 1PFWA 4NZPA 5IHXA 1A8HA 3X1MA 1MC1A 3TZLA 3P0JA 3IH5A 3CLRD 4QREA 3D6VA 2JANA 1X6VA 3TZEA 3H97A 4MW4A 1KR2A 3AG5A 4U63A 3PNVA 2DR2A 1O0BA 4XSVA 3KT0A 2HMAA 4P2BA 4DJAA 5H7XA 2C5SA 2V0CA 3K9WA 1QRUA 3MLAA 2HGZA 1R6TA 2J07A 1FYDA 2XRZA 5LM3A 1G8GA 1MJHA 4MUEA 3MXTA 2CT8A 3RJZA 1O96B 1CT9A 4EG7A 1NZJA 1QRSA 3ZUGA 1EFPB 4F4HA 1KP2A 1I2DA 3FH0A 2DERA 2RE8A 4A91A 5TS2A 5DASA 2PG3A 4G6ZA 3ELBA 3COVA 1H1TA 5FNZA 4EFKA 1WXGA 3FY4A 1TQ8A 4JXXA 2OV4A 1VBMA 1NP7A 1M8PA 4EG8A 4MUJA 1T6ZA 4MW6A 4HJXA 2EL7A 4ZCSA 2BTEA 4MWCA 2QTMA 4OUDB 4EG1A 1U3DA 1YUMA 5HUJA 1XNJA 1V8FA 1DNPA 3DV2A 1JIJA 5IJXA 2QUIA 4EG6A 3AFHA 1U7DA 1P7PA 4MUNA 4L2IA 2E89A 2CSXA 4KR9A 1OWLA 1LI5A 3RK0A 4NX2A 4ZT6A 3A2KA 5J5AA 1EE1A 1JIKA 2NSYA 1O5TA 4DNXA 4J76A 1EFPA 4EG5A 1KQOA 3ISJA 2DLCX 1T6XA 3FNRA 1PFUA 3GMIA 4DDMA
chains in the Genus database with same CATH superfamily
5LQMA 4QYIB 3AR4A 5TB5A 4AXBA 2IBTA 4Y6RA 4EI8A 1QX3A 1ZQ9A 1GAJA 5ALIA 4TQUS 3FHCB 4MVJM 3TWOA 4ETIA 5JSUA 4BLVA 3T0FA 2JCSA 1ISPA 3VDNB 1FS6A 3V4SA 3IAUA 2F1HA 4AJKA 3PEEA 2EP5A 1N92A 3F6RA 4RYDA 4LDQA 1EU1A 5C5EA 3KU4A 1JXOA 1S5PA 1QR6A 2AW3A 3NJ8A 3IMFA 4YQYA 3T7RA 2EZ8A 3DE5X 1YU6A 3VU9A 1DAMA 2Y68A 1ZZGA 4XLTA 2WIAA 4PCUA 5JY6A 5KQPA 3PIRA 4QBIA 3F2IA 2W6ZA 3T7SA 1E8DA 2ZUFA 4X92A 3WGIA 2QRVA 4RD4A 1YQXA 4DLXA 3HHPA 1EDZA 4Q24A 4JZKA 2HPHA 4Y2SA 4F7WA 4TM8A 1RM5A 4EO7A 2GCEA 4F2DA 4S1NA 4EVIA 1JGTA 3JR7A 2RKBA 1UCFA 3VRHA 4OHWA 5AK6A 1L5YA 3ADOA 3HN2A 2PU7A 1K3UB 5KTRA 5BN4B 2XTAA 1UOPA 5T8KA 3ET4A 2I7TA 1R8SA 1X8JA 3K8OE 4ND8B 5HP4A 5EC8A 4YCDA 3RRMA 4U7HA 3WKBA 3WK4A 5HGXA 4NECA 3MS7A 3PC6A 1KI7A 2YZKA 5AM2A 5EMNA 4JBNA 1JDSA 4DMFA 4DIFA 5DWQA 3KEFA 5IF9A 4JLUA 1H2WA 5KWJA 4UCQA 4DIMA 1NKSA 1NV8A 3IA7A 5T4EA 2NU9A 3HKCB 4G4JA 5J59A 1F2VA 5C1PA 4FJ2A 1UC8A 1DU4A 3AEYA 3WIBA 1DQYA 1M2VB 2W0SA 3UWPA 1ZWLA 2FW9A 1A9ZA 2JGLA 2ZRFA 4EUNA 1NMXA 3AIIA 1MR3F 3LGAA 1X9GA 1IY1A 1K9SA 1GGKA 2Z8ZA 4KWHA 4OQNA 3C7KA 4BKRA 3G5LA 5KSZA 4HF7A 4U2CA 1F9EA 2PRKA 1XPRA 3JTMA 4BBJA 4LK2A 4IOJA 3K16A 3S3TA 5KDDA 2VDNB 3L4JA 2TMGA 3QXSA 3A1WA 1EUCB 4E14A 1X80A 1CR6A 1FFEA 2IHTA 3HMQA 3QP9A 1B41A 1GZDA 2ZR7A 4WBSA 2OO3A 2R7KA 2FW7A 2AA3A 3G2OA 3N2GA 4GMFA 5DXJA 3C1AA 1JKJB 3WIVA 1U3FA 2ZP1A 5FUMA 3KEMA 4MHOA 1JT9A 1UJ5A 1YZKA 3L77A 4WZZA 5J23A 3FMOB 2AE2A 1ZOLA 5D7BA 4ODIA 3VOBA 2AG1A 5LJIA 5REQB 3UZUA 4BFYA 2XVXA 1QKJA 2Q0HA 3WK6A 5HKBA 4FOOA 1OAAA 2XEXA 1II8B 3DE2X 5KDOA 1E5QA 4ZEWA 4UFOA 2WUGA 2WYUA 5K20A 4GOJA 1EFDN 5KWEA 1WDKA 2OBMA 3SSOA 3ZHRA 4JLDA 3SZ3A 1Q0QA 3IVAA 1RWMA 3UCFA 3C7CB 4GMKA 3LCMA 5FNVF 4D44A 1Q44A 1O5OA 1T3ZA 3UEOA 4RTSA 1BWQA 4M6WB 5FTWA 2WK1A 1JG6A 2QU7A 3AXSA 4DLTA 1QHXA 1J70A 4FDMA 2QMEA 4BLQA 5ALPA 4CNBA 4NMXB 2CYAA 4PAMA 2CV2A 1ULTA 5A5GA 3PNYA 4QUKA 1K6IA 2H2AA 5HDQA 2VP6A 4I1OA 4IJQA 1QSGA 4LA4A 3FSJX 1H3FA 1X13A 4MEAA 1F12A 1JE0A 4WSOA 1ANKA 3PYLA 1VCHA 1RCTE 1W6UA 4CKXA 2ONYA 3NEYA 2IEGA 3MG9A 3IURA 3O4GA 4QDUA 5ITZA 3GFSA 1YWGO 3JAKA 3PFNA 5JXWA 1XO1A 3C5WP 4JEIA 2HK9A 2QZ4A 3AG6A 3E15A 2J41A 4RIHA 3UG6A 4I1VA 4H1UA 2V4MA 1VLQA 2XWSA 4PICA 3WJ2A 5HKKA 4CLHA 3V4RA 1FNDA 1RW4A 4Q15A 2PZLA 4O0MA 1ZM9A 1R5BA 2FCRA 2JGJA 2XA9A 1VBNA 1T5SA 3GT4A 3LSYA 3VM6A 1TOAA 2HU8A 3IMGA 2B8WA 2TS1A 3G0IA 5CA1A 5BW4A 1QCZA 2J4CA 4B4DA 3FXAA 2Q5JA 3FMPB 5GZ3A 3HXMA 2O8EB 1Y9EA 5C5CA 2PMDA 1KZHA 1GILA 5IM4A 4IO1A 3VISA 1AKNA 2W4QA 2FFBA 4XIYA 2ZUSA 4JBIA 4Q9JA 2B2XA 1QE5A 1BGWA 1ZW6A 2C3UA 2I54A 1E6LA 3FOCA 3OP1A 2HPZA 4HWOA 3EDMA 4CMBA 4TKZA 3OIWA 4PYLA 4HVAA 3TCXB 4M0PA 2XUPA 4IGIA 3H1AA 3EPJA 1C5KA 2GAFA 1ODSA 3ZWQA 2RB5A 3C8DA 3PTZA 4Z4GA 5IUKC 4FYYA 2F1RA 3PQ8A 4KH1A 5IC5A 3IMCA 3F7TA 1SZDA 3ILSA 3NJRA 1MVOA 221PA 3Q6IA 4KMSA 4A5OA 2RGXA 4DZZA 5K0GA 3TPFA 2PL1A 4YPVA 3VMMA 3H84A 4UCWA 3VC1A 3KDAA 1JR3D 5A6SA 1W4RA 1JHDA 4KLZA 4XSHA 5CFMA 3Q7IA 2FUG1 1TXGA 1C7ZA 4HJRA 3OZSA 4UZEA 4WX2B 3RC3A 3MT9A 2AXQA 4S05A 3ESAA 1EXDA 2J48A 4Q21A 4TXNA 5K03A 2X40A 3ZE8A 4EJSB 1W87A 2R68A 4ARUA 2GB4A 1NBIA 1XFDA 5KNCA 4MULA 3IBSA 2GPBA 4ZT4A 3MD9A 2DT8A 1NW8A 1T9HA 3L7BA 3U5TA 1CQWA 2B4TO 3A3KA 2YMQA 2VRCA 2HCRA 1XCPA 2JIBA 3BAZA 3R23A 4UDNA 4UUNA 4X94A 1II9A 4GOLD 1O4VA 1PK9A 1YU9A 3HJFA 4L8VA 1PJRA 4NWIA 1KJYA 3T1YB 1Z0KA 2R79A 4LRTB 2JLYA 2FXVA 2OVBA 1ONPA 3QX8A 4BVFA 5ADWA 1NQOA 2HA5A 4HAIA 3VZBA 1AZWA 1U0SY 3B12A 1JDUA 4JR1A 3ZPXA 3KLBA 3KVYA 3IR6A 2CLIB 2ENWA 2Y2VA 2OXFA 3MJSA 1Q2XA 4DT1B 5HVNA 2BEKA 3AT1A 4GRDA 1M33A 1DBWA 3OEHA 5F52A 1WUJS 4F60A 4R3NA 5DI9A 2WUDA 2VHXA 1KI9A 3ZHOA 1U3GA 4XYMA 5EVCA 4CLEA 4FGSA 2HF9A 2WQ7A 2QORA 4H77A 4W7HA 1HTBA 4RULA 1ECCA 1PP4A 2DPGA 4YASA 3ZI7A 3IHKA 1J00A 1L8AA 3FKSA 4LXIA 4B3HA 3PQ4A 3OZRA 3Q5EA 3PFWO 4PXYA 3IOEA 4D74A 3I2YX 3VPXA 3GDOA 1U98A 3PNBA 4MB0A 4KXWA 4CETA 5AHKA 4AZWA 4NYIQ 3JQ8B 1APBA 3KOOA 4AKIA 3T1NA 4B47A 4DA9A 1SVKA 5EJ8A 4BGEA 1XZMA 4R1PA 4EYOA 4ZDIA 5JMWA 3ROXA 1B23P 3DZIA 1RYDA 1TJ5A 3CF2A 3FNFA 3AF0A 1E3IA 2WAYA 3JQAA 3S68A 3M1AA 5LQDA 1ORWA 1QG2A 4FGKA 3K72B 4X64B 4CM7A 1ZOSA 2MWMA 3GXOA 3K92A 3BXPA 3BAFA 4ME6A 1BN6A 2GVZC 1H8EA 2PLFA 1H4TA 4ZCQA 3JZIA 1U4NA 1ISRA 4TV9F 3ZJVA 1YF3A 3WYNA 1NFQA 4XVHA 1JFSA 1W4BA 1C1DB 1JQJC 1PJ2A 5ILOA 4BZXA 3G0GA 4OYRA 2IEAA 5ALQA 2O06A 1L1EA 1XU7A 1XKLA 5SV2A 4MHSA 4E7PA 3K1AB 5I6DA 4Y30A 1GYPA 2BI4A 3AHEA 4M8NE 2WG0A 3GLRA 1I6MA 4TQAA 5HF5A 4DLBA 1EXMA 1RPJA 3ZU6A 4B46A 3LVFO 3HY6A 4A6XA 1XF9A 3PKZA 3EXIB 2I2DA 1J4AA 1L4KA 2VPYA 3UPUA 2JJ2D 2QPOA 1SIWA 3FCCA 4K5QA 4ETNA 2WJGA 3EUAA 4J0IA 1KU6A 1XHLA 3P0EA 5KHAA 2DHDA 3TGPA 3GD5A 2XUDA 5EVJA 2EWMA 4MQMA 4Q9NA 3K0EA 3OU6A 5J4VA 1KETA 3ZV3A 4ZVSA 3H9JA 4XVRA 1Y3BE 4E5YA 1ULUA 3G79A 2ZPUA 4G4SP 4ZU3A 2PQMA 2RGGA 2VJKA 5SYNA 5A0FA 4S04A 5KUTA 4JEMA 1FJGB 1SXJD 2B8TA 3H1EA 4KQ1A 3A6JA 3FPKA 1HFWA 3FPHA 4KR7A 2JCXA 3WFIA 3O4RA 4G23A 4DIOA 1K63A 2EG5A 3AHJA 1FLVA 3W5DA 1HDEA 2WPDD 1XOIA 5FUXA 3RKRA 1U28A 1TA9A 3E81A 3FN4A 1BCSB 3N59A 4CR6A 4KO2S 4D25A 4ARZA 1TLLA 3L18A 2IXBA 2CMFA 3EY4A 4JUCA 5FNVB 2PUVA 4GI5A 3LXXA 1YR6A 4QRIA 2H52A 3KKLA 4GBJA 4KPUA 4DREA 1C30B 1VKOA 2RGYA 2VA9A 1HR0B 1IZ7A 3D3NA 4WLEA 3OPYB 3MWEB 1OY1A 1RJWA 2BKVA 4JJ4A 2GAIA 4J29A 1VL5A 3C2QA 3FB4A 4NATA 1Y7LA 1OV6A 1B26A 1ZU4A 4JJZA 2RKWA 3FNQA 2BELA 3DL7A 3F6PA 4IVPA 4MKZA 2GKGA 5I3ZA 3CNEA 1GVNB 1EX9A 1XROA 4CM6A 4D9FA 1GA6A 1VZ2A 3A05A 2NXNA 1MW8X 1PJ4A 3DBLB 4MWDA 1N2JA 2O54A 4ITUA 3E3AA 1E2PA 4OP3A 4C4RA 4TQ9A 2C2XA 1TW3A 2D5CA 3ED5A 2GJ4A 2ZJAA 4HNGA 3BE4A 4UATA 1ND6A 5JSHA 5DGIA 4MS1B 1KEWA 4D5GA 2VJDA 3PEFA 5GJVC 1E9BA 3H2JA 5AJVB 1YA8A 2CCKA 2B94A 1B0AA 2HREA 2P4EA 3AR8A 1DT3A 3L4SO 5AVYA 5LQUA 1DTSA 2GR9A 4U6SA 3AM5A 2HDOA 1GU0A 3O8OB 4ZOBA 1PR5A 4WJKB 4ZXPA 1RJFA 4LUCA 1PCXA 3MMXA 3AESA 1VE5A 3A1VA 3QU9A 1TVCA 3D1VA 4PPQA 2FMFA 4J3FA 4LY9A 5DYGA 5KZMB 3F5SA 1EVEA 2NM0A 4HMPA 4ALMA 2BOVA 1QFJA 4NU8X 4X54A 3RBAA 1T8WA 3ZHTA 5HJ2A 5DHPA 3LCJA 2QUZA 3JQ9C 3P0IA 4OXKA 4DCVA 2RHCA 3EN0A 5H4GA 4QYWA 4MLZA 2BRUA 4NBNA 4QPCA 4LOLA 3VDMA 4UQLA 4FKMA 2QN3A 4HAXA 1TC2A 3EQ8A 3L7KA 4KQMA 3CUVA 4FZRA 3B53X 4WAUA 5K7SA 2P7HA 2X0FA 1JTVA 3B2NA 3TZLA 4D45A 1QZXA 3VAAA 3G5TA 3RIHA 4F2WA 1F20A 1CJMA 3CZRA 2PT9A 3BJZA 3F4BA 4HFRA 1QVRA 4JODA 2VTDA 4XQ9A 3FRIA 3ZDBA 1P5HA 3E3OA 1YZFA 4YAUA 1VRVA 2NU8A 5JQGA 1NVUQ 4FILA 1W8IA 1Y9DA 2EATA 3H04A 3AUKA 3HY3A 4OQXA 4OHRA 4M98A 4RPLA 4YRRA 2OCYC 4INJA 2V0CA 1U9IC 3NYWA 4YCNA 1CP3A 4H4CA 4UTZA 4AJEA 1C8VB 1X19A 1E3SA 3KJGA 3TK1A 3EIXA 3HZZA 3DW1X 3DAFA 4BO2A 1VQ1A 2OHOA 2R5FA 4WN9A 2DFLA 5ALXA 3SQLA 4DCUA 2VHTA 5EIWA 3NUQA 1O96B 2XUGA 1G8KA 3NC4A 1CT9A 1OBOA 4KEAA 3L6RA 4MWZA 4YDSA 1PEKE 1OA1A 4ZN6A 4P3YA 3GEHA 4F9GA 5IYZA 3HFRA 1CUBA 4B74A 3EIHA 2W58A 2ZRGA 4EB6A 5AJTA 2IE8A 1WS6A 2PRJA 3KPJA 3DCNA 2OCGA 3NYRA 2X15A 4CR7A 5TS2A 2PSSA 3AFGA 3WYDA 2PL3A 3CTPA 3QIAA 1UDAA 1K3TA 3AXTA 3IULA 3LIPA 5LXTF 4BFXA 3NMUF 4UAUA 2I1WA 1DIGA 1U2TA 1I94B 3DC2A 1JVBA 4NCAA 5LKRA 2VJYA 3HDJA 4DNQA 3X1ZA 1LLQA 2XWQA 1A7UA 2BZGA 3LY7A 4PFSA 3RQIA 4B5LA 1OIVA 3AEUB 4O2LA 3DEYX 5F73A 1CQZA 2QN9A 4MW6A 1L7PA 2E1RA 4FYJA 1GUDA 3ONVA 1W30A 1FLNA 5E0KB 3CO0S 2BTEA 1X8KA 3I0ZA 4G65A 1MF7A 4FFOA 4NARA 4A2CA 1U3DA 5AKZA 2PEZA 3SBEA 5A3QA 3CZQA 3A3PA 2QRKA 1G6HA 1K1EA 4CU2A 3NHRA 4RQBA 5BR8B 3DYIA 2GN0A 5WRFA 3HB9A 1E3MA 2YCLA 3ESQA 4WBNF 1JBQA 4WCFC 4EI9A 3WXMA 1SXIA 1XFAA 2IOFA 5ECDA 3VVBA 3PEYA 2ZWVA 2GWHA 1C7FA 5LQJA 3DMGA 2GRAA 2PVSA 3AK4A 3K05A 1DCFA 5G0TA 3KZ1E 4IQ8A 2I7CA 4KE8A 4WUVA 1V9CA 4TV9B 1JAZA 4HEA1 4ZXFA 3IFSA 1Z68A 2O2DA 4B6RA 4M88A 1XT6A 4MARA 1SR8A 5TRTA 3INTA 4GQAA 4ZYYA 1UBNA 2E82A 4M46A 1G4UR 2HBRA 5CLLA 1A4XA 5DNCA 3RHZA 4EX6A 2QN7A 3R9XB 3C14C 4UVIA 3UA3A 2W00A 2WLSA 3RAGA 3CX8A 1NRWA 2NVUB 1P61B 4JX8A 3DBRA 1T8TA 4YPFA 1PL7A 3WLIA 1DRUA 2MMGA 2WM9B 1IQUA 2GFQA 1HOXA 2J9XB 3USES 1XU9A 4PE5B 3DOFA 4NV3A 4QODA 2JAXA 4GPAA 3QSGA 3QLUA 4NF2A 3QVSA 1QGUB 4X41A 3VU1A 2C9BA 1KJ8A 4IICA 4J6EA 2PJRA 2OUIA 1DTEA 5A62A 2IQ5A 4WNCA 1U94A 1KFCB 2CE7A 2GH1A 1YL5A 1TKRA 2RAVA 4GX5A 4WVLA 2RBGA 3FTDA 3JD2A 1DXYA 1E61A 4ZVQA 3TLCA 1LDGA 4JLSA 4BKPA 4S0XA 3EX7C 2H1CA 4HOYA 3QW4B 4FFBA 4LE2A 4MWBA 4RWZA 3ZY2A 4HNUA 1GTG1 3L6UA 4O8ZA 3N2KB 1KXJA 2ZYAA 4ZC1A 2AMJA 3E18A 4JN6B 4BMXA 3DL2A 4LNUA 1KMHB 2H0AA 6CHYA 1AG9A 3RUHA 4OMDA 1TU3A 4XAQA 5B7PA 2HRCA 2KSQA 4LJ8A 4D3DA 5BVHA 5T6BA 2B7LA 4QULA 5K4GA 5I8ZA 2DETA 2PL5A 4POOA 4B9AA 4CMEA 3I9NA 5KVSA 1SKBA 2J08A 4QGGA 1SVWA 3W79A 3BVPA 2ETVA 3QUBA 2VJNA 1LI4A 2KYRA 5FTKA 1J5EB 3AUYA 1LWOA 1ST3A 5FUVA 3ZGVA 4PNHA 5HBGA 1S7CA 4PC3A 3D7MA 4M0KA 2IHYA 2OLKA 3DE6X 5FWXA 4LY0A 5C1DA 2XMPA 2MINB 9LDTA 1SXQA 2X7XA 3VZCA 2KI5A 3HXPA 4JGGA 2GYVA 5EXPA 3KRTA 3FKJA 4EO4A 3CN9A 4E2FA 4ZK6A 4X44A 1SCUB 3LHDA 3NDJA 4FKZA 1CY7A 3S81A 4IY1A 4NMHA 3CY6A 1SGWA 1FP1D 2FQQA 3MELA 3TAUA 1E2LA 3RRJA 1ESDA 1UBJS 4R68A 5C8YF 2NUAB 1WTCA 3RI3A 4KMOA 3AEQB 2O8DB 3GJ6A 1RI4A 2PH1A 4HB4A 1IOWA 2WF5A 3L4BC 1U6JA 4IHJA 4EL5A 4W5TA 1U7UA 4FFWA 3B8HA 4YHBA 3EW9A 3W3AD 1I2BA 3PSHA 4TLBA 4HEHA 1A9OA 4D81A 4CKCB 4E94A 4QXAA 4A6EA 3GDHA 5AVQA 4HK4A 3MTQA 4KGZA 1ZN7A 1TLFA 4LI0A 3M2TA 4PANA 3QTTA 1P7WA 2PNFA 5JHHB 4J43A 1M6VB 2IEBA 1RWOA 2QRLA 4WLUA 3NM5A 4TTIA 5C31A 2G08A 3FYTA 1AM4D 4YA6A 3RSLA 3KLNA 1IULA 4CR8A 5CT5A 3DE4X 2XCTB 2ODPA 1NPYA 3GT7A 2DTDA 4MK4A 3ANMA 5FA6A 5JVDA 3AUXA 3ISTA 3UHAA 3WG9A 3LUFA 3WC4A 4F71A 3X1JA 2DPLA 4CEJB 3ZVMA 2VF7A 4BEVA 3CRZA 1HRKA 2VK1A 1NXWA 5JG7A 4BMDA 4OQZA 2ZAOA 3A0RB 4NBSA 2A1TS 3G85A 5JO9A 3UT5B 2R8EA 2W6JA 3WOVA 5GZ6A 5B3LA 2C8VA 3WRXC 2Q9BA 2XOEA 3OX2A 3BF8A 4OI4A 4B4WA 5KOJB 5L4SA 1ESEA 2ADFA 5K0CA 4MKFA 4OI2A 1A8PA 1L7RA 4YT5A 2PKXA 4MWSA 3VPFA 5HTKA 2O2ZA 3F73A 3EGOA 2P4HX 3EMBA 3A3NA 3EIWA 2Q4RA 2X5OA 2EXXA 1T0HB 3BF7A 1LLCA 5E7QA 2FEMA 3NWEA 1IJFA 2FJUA 1N36B 3EB9A 3U09A 2O3QA 2OZLA 2IXAA 3RIGA 2JIDA 3IAS1 3O8NA 4Q93A 2Q21A 3WYBA 1D2NA 3AJEA 4PLCA 1MT3A 5FFNA 2ZJYA 5G0SA 4TWRA 1K7EB 4I50B 4L3WA 2X0JA 3UV3A 3ESDA 4LWPA 4I4LA 2EFJA 2BH9A 1IHOA 2ERYA 5F78A 3FUXA 5KSOA 4WFJA 2ERCA 5T3UA 2QM8A 1ZISA 2H92A 1ZXXA 2O4CA 4FMDF 2I2AA 2JFXA 5HIAA 5EIOA 3A6PC 1RZVA 4OX9Y 5LXTB 2UXDB 3ZLUA 4JXKA 4F5EA 1FTNA 4AW9A 3FSGD 2OY0A 4HDKB 4IKOA 1YS7A 1UBTS 2HNKA 1E9CA 2VXYA 2J6BA 1SJ9A 1YDMA 3NBQA 3NANA 3DL0A 4JKOA 5CM2Z 4LHWA 4YMHA 3G2JA 1OTYA 2M6SA 3K0FA 1SFRA 2NVWA 5LWQA 5K0TA 2W6MA 3TM5A 5AVTA 1RLTA 4ZI2A 4UM9B 4MLPA 3LY9A 1ZAKA 1NJ6A 2XNCA 1NM5C 2QX8A 2G71A 2BFOA 1Y5LA 3B48A 3CLKA 3EXHA 2FSVC 2ZYWX 2O7NA 5HOQA 1FX0B 4EBBA 3M49A 4HDRA 1OX4A 3KCQA 1OC2A 1U2RA 3OE7A 3V8NA 1J1ZA 1OHHD 1RHMA 2QTWB 4PYRA 1CFZA 4WBNB 4U5QA 3L0IB 3V5NA 1QF6A 3NHUA 4Q00A 4XB6B 5G3YA 4Y2RA 2ZYVX 3KEGA 3F3MA 3PZRA 1SBZA 3U1VA 3AP3A 3DZCA 2BFAA 2JBWA 3PQDA 3UJ8A 4YRZA 1VJDA 4HNHA 2JD1A 5AKXA 1J1IA 1XHEA 1CJBA 3FUVA 2WAOA 5AK0A 1P1HA 2QS9A 1GNPA 1ZJ6A 4Q4JB 5DYIA 3LQ4A 1C9KA 3VR4A 4Z54A 1QFZA 3IPCA 1PVOA 2Y71A 3R24A 4PSAA 2ZWAA 2PBRA 3IAXA 3WI7A 4D99A 1DC8A 4GKBA 3NPAA 3R5SA 4UBKA 1LNQA 3LKZA 4ABTA 2MSCB 2FZKA 3BXFA 1YB4A 3B85A 5IN5A 3OE4A 3G2LA 4IQ0A 1XYGA 1A96A 4DL9A 3MQ2A 2K7FA 1UADA 6Q21A 3PF9A 5JMOA 4D3XA 3OQNA 1NFFA 3NV7A 4D4LA 4RKQA 4OEHA 4C4OA 1QFXA 3RGGA 3FYSA 1WCXA 5FA8A 1M0TA 5LLTA 2CMDA 1PZXA 1TIKA 3L02A 3P7MA 1ZUNA 2A86A 2OHVA 2C7PA 1XMSA 2NO1A 3HA3A 5BQ5A 4B09A 4QLBA 2E5LB 4HKTA 1Y80A 4FYWA 1H5UA 2Y4OA 3PFCA 3UTCA 4C03A 4GEKA 4JJ8A 3PEUA 4DQLA 2QBYB 4J4BA 2CXTA 4MUIA 3BZWA 1TIPA 3L04A 2FEWB 3NONA 1J9ZA 3OUTA 2Q1TA 1RQ2A 5DHUA 3T5MA 1T3SA 2BGWA 2PXHA 5D51S 4BO3A 1GU1A 2QMOA 4YJ3A 3WBKA 3NU1A 1WKVA 1JIXA 1BCRA 1FUYB 4JP5A 3ROMA 2WA1A 2MHCA 2R6DA 1MOSA 3N8KA 3OZVA 3ZZUA 2O1XA 3R40A 4P4UA 3EZ2A 4K6CA 3S70A 4CMHA 3K70C 3NS7A 2JATA 2PQ2A 2FKNA 3V6MA 3IUPA 5IEBA 2IGTA 3IJEB 5AK5A 3T7TA 1IDOA 3H8VA 3K3PA 4P7FA 4DNOA 2VK4A 1D09A 1DZIA 2YHIB 3MTEA 5IANA 4ETMA 2JGNA 4HPJB 1IEXA 1YXMA 4MYTA 1J07A 4FSHA 1WABA 2E18A 2YOGA 5FPYA 4E2ZA 1H4SA 1KAOA 2VRNA 2YN2A 1EG2A 4BEWA 4YRCA 1ZKMA 4B45A 5KB3A 5KDLA 3EPLA 1MC8A 2JFUA 2XXBA 1EHYA 2FWJA 3MTGA 4LRUA 2I6FA 4X84A 4BCCA 4EB8A 2GI4A 2ZJFA 4F4JA 2HKIA 3D8SA 2Q49A 4LNHA 1X7XB 4N5IX 1P4SA 1DKUA 2HLDD 1SU6A 4NRDA 1XQWA 1LDEA 5H3CA 5I9TA 5K8VA 5AW2A 5EMHA 2WM2A 1Z56C 1LDBA 3HA5A 3COWA 3RJTA 1YOBA 5BYAA 4NBKA 3PBKA 1GQQA 2A5JA 2CJPA 2CLLB 3O31A 5CH3A 5EJ9A 4KIWA 3R3HA 4P84A 3PCTA 3QVVA 4FEEA 1DO8A 1XNQB 1IYZA 5D6OA 3VMFA 4CNQA 4B3TB 1HNNA 5TJHA 1VPLA 3LVRE 3PGKA 1ZH6A 1JDJA 3SXUB 3LGXA 3TW8A 2IEIA 2REXB 4HLDA 4KR2A 1WEHA 3BJRA 4NYJQ 1EFVA 1FSFA 3SS8A 3HVRA 3VZRA 1S96A 3HEBA 4QDZA 5JWHA 4JMPA 2F00A 1XQVA 1PT5A 2QDKA 4IIEA 4HUJA 4OXQA 3I9LA 2YC4C 3GEPA 2Q46A 5DX1A 3NHWA 3K4HA 1JXAA 3CEHA 1QHHA 5EQDA 5FPSA 3AFOA 3SEFA 4DMRA 1ODTC 1KBOA 2G6TA 2V7GA 2WIFA 1XP8A 4C30A 3RAPR 3T61A 4AVYA 1JN0A 2R0QC 4K6FA 3CLTC 3DOJA 4RSGA 3E9ZA 3M6MD 1GKKA 1Q0RA 1S0UA 1Z39A 5B2FA 1AKVA 3CKKA 1T9CA 2ZYHA 4LAFA 3NKLA 1YQUA 3A1SA 4NONA 3CCBA 4MRPA 3E22B 1NMYA 1C3JA 3G82C 4MDFA 2I7XA 5CUQA 5ABPA 5FXMA 4NOLA 1YAJA 4MW7A 2Y1XA 4FCTA 2F6RA 3FAZA 4NKRA 5TGTA 4CKEA 3OUZA 3ZBUA 3J81k 4KO8A 3QUAA 4KCGA 2CMKA 2I6XA 4IRXA 4PV7A 1WMDA 3S1AA 3TLXA 4IUYA 1DAGA 3HKEA 2ZYSA 1CS0B 2P68A 2HRBA 4XUCA 4D9CA 1BD4A 4J9VA 5CVJA 1VP3A 2W6OA 3QKWA 5CYOA 2JZOA 1AGYA 4K9MA 1FXWA 3GAAA 3E23A 3OLXA 4BQOA 4DM4A 4F72A 4NCXA 4F3TA 4QVGA 1G6Q1 5KYYA 5LZ4A 4GLOA 1U9ZA 3UMBA 1RKBA 1KYTA 3D4BA 1AURA 3VTAA 1CUCA 2W37A 3EMVA 2IE0A 4LIPD 3QX9A 4I8XA 4OL0A 2GGSA 1CY1A 4LYHA 4DUZB 3ZGZA 1B3BA 3BIWA 1O0CA 1CR4A 1DUSA 2XE4A 3JQBA 3QXXA 5KO2A 1QP7A 3TG2A 3SVLA 1QDEA 1E5LA 1CSEE 4X00A 2A9RA 3ECSA 3KHUA 4ED9A 1MC1A 1Z7BA 3X3HA 4CWAA 2IPAB 4O4LB 4P9NA 5FUWA 2D1YA 2QZJA 1Q74A 4RTOA 2XCLA 1BVHA 1AKTA 2PUWA 3GZNA 3L79A 4MR9A 3QV2A 2Q5IA 2Y93A 4GWKA 4LXGA 4ZVRA 5PGMA 5JNVA 4KB5A 1IJKA 2HEIA 3GLFE 1F6DA 4MR7A 3M1IA 5ALKA 2MIIA 1OLSA 1ZUHA 2FSFA 2GETA 2ZI6A 3A1EA 3P2EA 5AXCA 5FBVB 2A5DA 4MA0A 5F5XA 1PDOA 3BIJA 5FPQA 3JQGA 2L42A 4P3KA 1BMFA 2OKGA 1ZVKA 2PFGA 4TL6A 1OE0A 4W8HA 1T5LA 1F14A 3OSZA 5DFAA 3MHPA 3DFZA 3VKVA 2ON6A 3AIMA 3EXFA 4B3IA 3IT2A 2XRZA 3LQQA 1ZJYA 3A6LA 3VR6D 3E0QA 5K3OA 2QVGA 4Q3CA 4MUEA 3ETHA 4XDGA 1OLUA 2P65A 2PMWB 1IMOA 3VHXB 5ALMA 1QMPA 4J2OA 4F4HA 2BFNA 1NI4B 2B34A 3KXLA 1E1DA 2B6NA 2H9AA 5IXJA 4OGLA 3P9IA 5DT2A 4RVUA 3PPXA 1NBAA 1KDTA 3DZBA 5G4KA 1NUAA 4ZVLA 1R8YA 3KQMA 4MQBA 4RV9A 4URWR 1M5RA 5T41A 5IMSA 3MHTA 3GP3A 2BTQB 2J7PA 4HDNA 4R40A 4D56A 3ZYZA 1KIAA 3NCTA 4R5HA 4E1BA 4EPTA 1WUTA 4YRNA 3H65A 3OFKA 1E7YA 2XDWA 1OSNA 3IUYA 4BATA 4JI0B 4CG3A 3DC7A 4GKAA 1T6ZA 2YYAA 4E2WA 3OFJA 2Y1GA 4N49A 4NENA 5E7MA 3UKDA 4BRSA 3EYWA 2IOHA 1PR6A 4CV3A 5E4TA 3L7YA 3LUDA 3B6EA 4EF5A 2AD5A 121PA 4MKIA 2VJMA 3TOSA 3FHLA 1SKYB 5HUJA 1OA0A 4GNKA 4QQ8A 4GD3Q 3HJGA 4JT4A 1CE8B 2R6R1 4YCSA 1U7DA 2XNSA 2BCEA 1R6AA 2R8OA 2BDTA 3GLGA 1C3EA 1G5QA 3D8TA 5ENZA 4H6VA 4EAQA 3IO3A 2FTKE 3I30X 5D3MB 4ZU1X 4D3ZA 5KJ6A 1SHZA 2O7QA 1IBCA 5DZSA 1DUIA 5AVSA 4AJ1A 2G0NA 3V4ZA 4AO7A 1IUOA 3GQBB 4Q66C 4E7OA 4DCJA 3CH5A 3CJQA 1QX4A 2B1QA 3DLTA 1TF2A 521PA 4M9ZA 5TXGA 4CCAA 5HM6A 1EA5A 1AF4A 1TFUA 4UPVA 3UAGA 2ADMA 3PUYA 3S99A 1DC6A 4M1TA 2IHNA 5AW0A 3M9XA 5CLIA 1GAQA 3Q9LA 1BSVA 3SC3A 3GD7A 3QFFA 5IP5A 2HHLA 1Z74A 3S2GA 3U81A 3BICA 4ZANA 4DFDA 4E51A 1NT2A 5CJ2A 3CA8A 4Z4IA 3FHTA 4PZPA 1DFGA 1E6KA 1AQLA 4J7XA 1EHCA 3GRVA 2PLNA 3PHBE 2BSQA 4MVJE 1L8XA 1Q0PA 1SCNE 1UJMA 4ZO7A 1TUBA 4JLVA 2WU4A 1RS0A 3ZDDA 4KNWA 3O0DA 1H6DA 4Z2YA 4A23A 2JIZD 3SK0A 1RM3A 1OR8A 4G1MB 1IN1A 2PZ8A 4Z7JA 4X65B 1ZD1A 1M73E 3IP9A 3TQIA 4HWRA 2EW2A 2UV8A 4M55A 3W5UA 4TM7A 4V24A 1DXOA 1JWLA 3HSKA 4RJKA 1E1RD 3DZKA 1NUHA 3W5IA 4C7JA 2FN7A 3GG9A 3ZV5A 5BQ3A 1XTQA 4MVJG 3JAMA 3BEOA 2BJWA 3TAHA 5EPUA 3KPUA 1LA2A 1OASA 2B1IA 2Y8EA 4WCFB 1B16A 3C3EA 1MV5A 4JZYA 4Q7JB 3RTAA 4ZMRA 1YRYE 1PX2A 3D2CA 4IXWA 4QRHA 1NUTA 4Q6WA 4RW0A 3UFXA 1MX1A 5K3SA 4JGIA 3F1LA 8AT1A 1K5GA 2O19A 1AKMA 2IL1A 1ECBA 3H5NA 2JW5A 1PR3A 1P7YA 1V8BA 4IDNA 2XBUA 3F1KA 4L8GA 1AH2A 4ZT3A 3NP7A 3R44A 4PTYA 3G49A 3RANA 4X45A 1CB7A 3I5YA 3FNIA 2VYQA 3I4CA 3ASVA 2JGMA 3P9ZA 2XMGA 1WMSA 3PSAA 1FUKA 4X1KA 4TS1A 2ONZA 3EODA 3C6MA 2EIHA 3WY9A 3Q7TA 4OB7A 5BN5B 3UKOA 4HUTA 4GXRA 3LUAA 4KP7A 5K3CA 4EM6A 4UE6A 2ZBGA 1EXVA 5IKMA 2AG8A 1PO7A 1RQRA 1O8CA 4P4SA 1KKUA 3UH1A 3W3AH 3Q3VA 2NAFA 1A9YA 5AJYA 5JDCC 3OO1A 4CEIB 3NFRA 2VPIA 4HZUA 2WAMA 2CUTA 2QTVB 4DJEC 1I51A 2X9LA 1F7VA 4KBYA 4AZVA 1RHUA 2A1IA 4UOQA 1UXIA 2ODBA 2WZDA 2WKSA 4TVSA 3KKOA 3WKAA 2ZDQA 3QKRB 1MU0A 5EZQA 3P9NA 1VYUA 5CTJA 2EKQA 4XIGS 3T4EA 2XUOA 4B32A 4FHFA 4J0CA 1KJ9A 1QK4A 1TCAA 2XCUA 3PRKE 4YMWA 2Z2KA 5JBNA 3IUSA 3DE3X 2BGIA 3FG9A 3QVOA 1U2ZA 1RBYA 4LY3A 4TLLB 5C7LO 1G5IA 2HFKA 10MHA 1B8UA 4AS2A 4BBPA 1KQPA 1MAWA 3CR8A 4PRZA 3GH3A 1YHNA 1HI9A 5FTLA 1WAMA 1X7ZA 1W19A 2HA7A 3CB4A 3I6IA 3WLFA 5F3WB 1Q6YA 1WB5A 3I9V6 4V2IA 3CLSD 3BERA 2ZTMA 4LHVA 1K5DA 1XWIA 3GGPA 3S6JA 1B2RA 3G5AA 4W6ZA 1A69A 2CXOA 4R1UA 5EZYB 4DR3B 5E1DA 3N05A 1TMOA 2AZ4A 5GV7A 5SZKB 4S12A 4DRXB 3B8EA 1JEJA 2LVBA 1CPYA 3NT2A 4WEOA 1JEYA 4EW1A 3RAFC 2WJWA 2JVIA 1N5IA 4RY0A 2I3BA 1SKQA 3O2SB 1OZ0A 4WLFA 1XQYA 2QLFA 1W2WB 2P5UA 4G1VA 2EWWA 2ATCA 1P7VA 2TRSB 2V0GA 1ECGA 1WVGA 1MJNA 1YZGA 2GBFA 1PFKA 2MR6A 2NQTA 3L8GA 1E9DA 3PFIA 3Q6MA 4LGVA 2CZQA 4XYEA 3THWB 4FYIA 4YAOA 2CYBA 4BN4A 4KX3A 4Z1MA 3L6BA 4AIIA 2PXXA 3DKIA 3VR0A 4GECA 3NHFA 4I66A 5EYPA 4M2LA 1LV7A 3HGQA 5I7SA 1SN7A 4XD7D 5IAJA 1WD5A 2A0KA 3AR7A 3VOSA 5A4DA 3O4HA 3E7DA 3E7WA 2NP7A 2C95A 4R9VA 1P8AA 2DKNA 4GR9A 4IZ6A 3ICWA 3UWSA 1KZGB 2UDPA 2VL7A 1YIOA 3UBTA 4BBAA 1QHGA 5K0FA 1Y3HA 1IN7A 5KVQA 1LVGA 2W6ID 4DUYB 4YFVA 1KS2A 1N6PA 3NALA 1Z13A 1L7VC 1K98A 1SEVA 3R5XA 3D2LA 5E7JA 2BZ0A 3HDQA 1QGOA 4D9HA 5L9AA 3DHEA 5CVCA 4K9QA 5FFMA 4QYMA 1MBZA 2IZ7A 3K32A 4QOGA 1PUIA 2WJHA 2WV7A 5GV8A 1DIBA 1V37A 4NBWA 4KVZA 4QPJC 4ZKEA 1PYGA 2VPQA 6NULA 1VECA 1Y4UA 2J4DA 2VWPA 3AFMA 3NTLA 1XXHA 2LV8A 2ST1A 1I7SB 3THXB 3BMQA 3MNFA 3T9DA 1JXQA 1UZAA 2IXEA 1VJRA 3P20A 3A3YA 3D9QX 1MABB 3NHKA 5IAGA 1OI2A 1C1YA 4Q3NA 4YLYA 2RIPA 1KEUA 2VUHB 3HJRA 5AR1A 5IK2D 4NS1A 2HU5A 3V4OA 1O9GA 2PD3A 3GFVA 4BU0A 2XZPA 4B3XA 1W5SA 2HI0A 2IPOA 2EDAA 1NC1A 2F3TA 3NVMB 1UIRA 4H4DA 1BH2A 2DWCA 3BRSA 1WMAA 1H6CA 1UODA 4FMCF 4AKEA 1Y3AA 3OPVA 1NLUA 2R00A 7ADHA 3X1KA 1I5OA 3ZQKA 3EZFA 3KJZA 3OWOA 4MA5A 1L5KA 3UGTA 4B7XA 1PR2A 2NP6A 3RLIA 1UUFA 3ST7A 3SF8B 2JEYA 1UAAA 1TYZA 2IZZA 1J8FA 5FR2A 4ENVA 3ZY6A 4QYIA 2FPIB 1IWOA 1KVTA 4O2AA 2OC4A 1EK2A 2YQ4A 3A25A 2QQEA 1NI5A 1KJIA 1GGJA 3A4IA 3X1XA 4XX0B 4YRPA 3CEAA 4JL5A 5E6RB 3URKA 3QPAA 2NO9A 1X1CA 1G63A 1HL3A 2F4NA 2XLBA 3BX1A 3QE2A 2Q1UA 4JLBA 4PYIA 4WVFA 4AWAA 4RGBA 2QAJA 4X60A 4EFLA 1C7IA 3KFLA 1TUGA 2FPOA 2H4HA 4ZVKA 1EUQA 3AEXA 2QTBA 2X0DA 5DLQC 4C4ZA 3L1KA 4QVIA 3NHZA 5KQMA 1RMQA 2RSLA 4YAFA 2Z4SA 4OK6A 3IPRA 2BMWA 1E1CB 2GJSA 4H59A 3IELA 4BC1A 3F98A 3N0RA 3DBVO 3P19A 5JALA 2GM4A 1OOEA 3AUFA 3EIOA 3VJKA 4HV4A 4QKQA 1K5HA 3TTSA 3L0OA 4QOFA 4DY4A 2FEAA 2NYRA 1DIOB 1JLKA 2P2SA 2XOXA 2Z1NA 3ODPA 5LYJA 3WL5A 2Q4OA 4U00A 1CY6A 4C0XA 3FTCA 1BVRA 5BN4A 1I7PA 1W36B 3UW3A 1YASA 1OZGA 1QE3A 4ND8A 4RD0A 5IUNC 3D6MA 3Q7QA 1P60A 4N7BA 4KN5A 3SYNA 1VC2A 2HMTA 3HR4A 3SZOA 1NDUA 4Z2AA 4DCTA 3HCEA 4V0ME 4RDXA 2ZTVA 4CCYB 2FLVA 3HKCA 3EMKA 4XCQA 1UM9B 1Q3HA 1SXJC 3LI2A 1J21A 2QX4A 1UT5A 2BP7A 3FFWA 1M2VA 1P73A 2MSLA 4Q0MA 1UBGA 2D2XA 2YR0A 3WS7A 3WBJA 1KAHA 1M74A 3KHKA 4UREA 4WT7A 2DG2A 5AKYA 3Q87B 5HQ3B 4F38A 4C2BA 2DGDA 4BO8A 1Y6QA 5DPMA 1KJJA 4Q7KA 5LDHA 3RADC 2A0FA 1NN1A 1SBCA 2BGRA 4CV0A 5IEJA 5BP7A 1P33A 1T1GA 2G4CA 3PA8A 1Z6QA 1DBRA 2X19A 4LBZA 4PS1A 1ZU5A 1NVFA 3ETDA 1VIDA 1MFPA 3VTKA 3H3XA 5C9ZA 4WKGA 5B3KA 3MW8A 5FIUA 2JJQA 3LF2A 2ZB7A 3G2MA 1E2DA 1S01A 5DBIA 1NJ5A 2CV0A 4B31A 3KJFA 2YVLA 3PC7A 4B7ZA 3R4VA 4M8KA 3RD5A 3AU9A 1I10A 4H35A 1FNCA 2QG6A 3RQSA 5KQGA 2ZYTX 4PSUA 4JD5A 2ZJ8A 1GU7A 1II8A 1W94A 3OE1A 1LC3A 1M8GA 2DHRA 2JJ1D 1R5NA 3SDZA 3SFVA 3L7AA 4IWNA 4UTNA 2EX1A 3GZTB 4TTQA 3FF4A 3HMKA 3A27A 3T5TA 4IG9A 2QMQA 4MWTA 5CHEA 2EBFX 3DQZA 3ZWYA 3UJHA 2ZTUA 1ZGZA 4M6WA 3LJKA 4QQNA 3K70B 1JSRA 3QHPA 2X58A 3ZJUA 4PWZA 3AKDA 3WSWA 3ZHXA 3EGXB 3DTVB 4LVUA 5EE9A 3RRZA 1DG1G 3INNA 5HF6A 4AMYA 3EWSA 3AJ8A 2UAGA 1V95A 4P4GA 3BQMB 4UBIA 3H5WA 2AFHB 1R0CA 4TLMB 4X63A 4BRZA 4D1YA 3WHLA 2R8RA 4WNAB 4YXWA 4UFPA 2PFSA 1U2GA 1OXMA 1G59A 3MAGA 2X23A 5FHRA 4JI2B 3B1WA 1EFRA 2Q4DA 4UD6A 4FKBA 1BEEA 2HQOA 4H18A 2GS9A 1W581 7GPBA 4F92B 3IR5A 3PRHA 3WKCA 5JAQA 1N7JA 1FIUA 1ZSYA 4D8UA 3OQIB 4TKUA 2GNOA 1K8RA 3MK31 3QKIA 5CFQA 1E5VA 2CL7X 3D3WB 1YTLA 4H0NA 4CIDA 1NBWB 3IT1A 2FMKA 3HKDB 3LL4A 3PICA 3NR2A 3WNQA 5BUSA 3RT7A 4C4SA 1A1SA 5KU1A 2DMRA 3EQ7A 1X9IA 4F2PA 3GNLA 1ZOPA 2XXJA 4E88A 3CSDA 3L0CA 1L4HA 1CIVA 2QHXA 1I7LA 1PGPA 1QVVA 2QF7A 4YAJA 3ASYA 2ZRNA 3LO5A 3QVKA 4BV9A 2SICE 3BSSA 1AF7A 1HE5A 4D98A 3OQBA 4ZQGA 2O2JA 3IBGA 1OI3A 3BSFA 4UU7A 1RPZA 2YXDA 3MS4A 4KX5A 1E58A 4PONA 1E0AA 2NSLA 3M33A 1Z2PX 1VCNA 4KE7A 5ERXA 3TO5A 2WKPA 5A9SB 1Q15A 1G3RA 2RHHA 1RPAA 1KBQA 2IOFK 3CYFA 3OTWA 1PHPA 4QU5A 4QBTA 4OSPA 4PLHA 4PAWA 1SK8A 2OR3A 4DLLA 4LKRA 2Q7XA 2OCLA 2LDXA 4BE7B 2VYVA 1OFVA 2VKTA 3DS8A 3WSVA 2PMFA 2E1PA 5LIPA 1KY2A 4XEUA 4RHXA 1GPUA 3NXSA 4AULA 4Z1OA 2XR1A 4E3WA 4JI8B 4S1TA 4PZUA 3WL7A 4V1CB 2V9PA 1QB7A 4GGPA 5GY7A 3T5PA 4FDTA 1C4OA 3II6X 2MU1A 5IXSA 3VFDA 1T2EA 2F1IA 2DFNA 2HXGA 4BHTA 3LHKA 4ZI3A 2WUFA 5JPIA 2WAXA 2D0OB 4I5GA 4E2XA 1AQJA 4HGQA 4DARA 1M2GA 3B89A 3KYDB 3S1LA 5FTNA 2VDKB 3VR6H 1MB3A 1WDTA 2JJYA 1AV7A 1E2QA 2V74B 1K7SN 3IILA 4RSMA 4F86A 4CHGA 1ENPA 4KXNA 2P9YA 5KS2A 3UT6A 1J5XA 4LECA 5CJJA 1FTSA 3GPCA 1VI2A 3CRQA 4G24A 3VZQA 1M2HA 3AOGA 1XRJA 2V8OA 3WYCA 1QRSA 3FW1A 4XR4A 2QR3A 2ZKIA 2RI0A 2HQ1A 4CN9A 3VYRB 3VNQA 1DV1A 1XJ5A 1FBNA 5FJJA 4PS0A 4RD2A 3Q3HA 2AVDA 3CPJB 4RSRA 3GLUA 3QPDA 4TLAA 2PU5A 3O73A 1P7ZA 4A91A 4HNSA 5C8DA 3ICQB 4AD8A 2AFVA 4DT1A 2BHRA 1RJGA 1M72A 2JGEA 4NSNA 1VB5A 3Q85A 1USVA 3H5VA 3NCHA 2NTVA 1EJ6A 3HJCA 4M9RA 5DGTA 3CS3A 5ELMA 5HIIA 3UFBA 5LPNA 5ITVA 4RMJA 2IHVA 1ZVJA 4JXXA 1VHQA 4GX1A 4Z4CA 2J3QA 4LHZA 4PPYA 1QFYA 5I7HA 1TC1A 3DJYA 3OIVA 4AP6A 1XAHA 2WUVA 3OX1A 4Y1RB 4DEYA 5E3HA 1Z63A 3Q0EA 3LW8A 4OV6B 4YFYA 1XMPA 1JJFA 4KQKA 1XWFA 3JQ8A 4RJTA 3FPLA 1GZ4A 2D2IA 1JLLA 1WF6A 3NEPX 3AIOA 4KAFA 5CW1A 5F77A 1L5LA 4BNHA 1V8FA 3OG9A 4ND2A 3KO8A 5A0VA 5JATA 3D7SA 1OPXA 5DTRA 4ZODA 1J8MF 1NSTA 4HDSA 4DZTA 2I4IA 4NCHA 5EP3A 2G9NA 1GCGA 1BTOA 1PK7A 4U9IS 4D0RA 3JX9A 5ICMA 2VSXA 3IKLA 1YZQA 4XM0A 1WPQA 2JC3A 3DR5A 4C4AA 3ER9A 1ENYA 4ER3A 1YD7A 3F6CA 3QYAA 2AQKA 1PUJA 2A3RA 3BQ9A 1FY2A 3LV8A 3NWOA 2OZKA 1C1DA 2YHAA 4WWHA 1LXCA 4HS4A 2HD4A 3FYUC 1RFGE 4RK0A 2X9QA 3I8OA 1JIIA 3K1AA 2B4AA 2AUNA 2ZVJA 3BILA 3EOAI 3DF9A 3G89A 4CN8A 1EP3B 4G8CA 4L9SA 1A8QA 1NNI1 5BUCA 2O3JA 3EXIA 4WOBA 5MDHA 5AOAA 4DR5B 4IIVA 3DFIA 1EWYA 3H5IA 4LQLA 4MO2A 1U0BB 4E46A 1I2MA 1FUIA 1Z29A 5K3AA 3WL3A 1UJBA 1P2UA 1VL2A 3N8DA 4I7EA 4D80A 1YC5A 4E1VA 4EUEA 4E07A 4IDHA 4NBTA 3SQOA 3H5OA 3D59A 4Z3KA 1C8BA 1URPA 1N3IA 2CLHB 3FPEA 2JASA 1YVUA 3V2IA 3CQ9A 4I5DA 4P98A 2ECKA 1EX6A 3KXKA 4PNZA 3QNWA 4LXTA 3T3MB 3ZNPA 4EELA 3DMNA 2HK6A 3THYB 1EUYA 3Q10A 2V8BA 4XOIA 1YCFA 3ZIAA 5CFLA 5EQJB 2EZ4A 4NI5A 1ORVA 4X7MA 4F97A 4RNCA 1X1DA 3TBHA 1BCSA 2F4VB 4HLUA 3WLQA 1EQUA 3LC1O 1W5FA 4RMGA 3VPCA 4B87A 2GA8A 3BYZA 1IPEA 3IOBA 3M2PA 1PL0A 2WB4A 3N2ZB 3VHQA 3IEIA 3R4CA 1ZGAA 5AJUA 5H80A 5C7IO 2B8NA 9LDBA 4B3BA 1C30A 1XLTA 3HNOA 4H7EA 4TT3D 1OBFO 4EGCB 1TL7C 1WV0A 2XHZA 3H4VA 3MWEA 3OPYA 3TE7A 4EVSA 4B4KA 2AHRA 3R0ZA 3SS7X 2WSSD 3UK1A 4AO6A 1KE1A 4E22A 1GTRA 5JE8A 3WK7A 5L7TA 4KSBA 3FROA 5HPYB 1XIVA 4KI0A 4GYKA 4GVPA 2GERA 3SGLA 3H2GA 4HQ0A 1EYZA 3UICA 1GPH1 1SNYA 3SIRA 4FZVA 3GHHA 3L8MA 1PV4A 4AY6A 4IBOA 5J4LA 2P62A 1T9ZA 3DBLA 4BNXA 2WFAA 4X90A 3OWXA 4Z53A 2C0CA 1GSOA 5L3SB 1X77A 2Z08A 3OJFA 1NUUA 4A0HA 2WJYA 4OQYA 2PZBA 4M49A 4INZA 4ARCA 5LQKA 4WK2B 1CUJA 1W0KA 1Y7PA 1ZCBA 3B1ZA 2XJ9A 1AX9A 1SQGA 1OZAA 4LCJA 4MS1A 4UUOA 5I4KA 5JAMA 3QEBZ 3TL2A 3BMXA 3EA4A 4FMBB 3I73A 4QUDA 5K6AC 3QX7A 2ZYUX 1NDHA 3DMFA 4RNDB 2BEUB 4ZHQF 2FP3A 1Q22A 3UTDA 1LX7A 1L7DA 2PGIA 4W1QA 2NZYA 2YY6A 2X1MA 2LWIA 3FE2A 3O8OA 2ODEA 3LDHA 3I4FA 5D3ZA 2B36A 4AN0A 3CC8A 4FCWA 4R1QA 4RELA 4TSFD 2YWJA 3G2HA 3RU7A 4PHGA 3BL5A 1P75A 5FBQB 4ZT7A 4FGWA 1WZIA 4BIMA 5K0JA 4E33A 4KRFA 2GMWA 3S7ZA 3PFBA 1B1AA 1PZEA 4HNAB 4C14A 2BCGY 1L5SA 1S3SA 1YONA 2PA3A 1YQGA 2QW1A 3BS4A 3CURA 1G8HA 3DFFA 3FVRA 3K9GA 1K4YA 2AB0A 2H1OA 3E9YA 4FZ5A 1Z0ZA 4EI2A 2JFGA 3ZWXA 1NXPA 1PFQA 1EXNA 4FR0A 1DJOA 2FWNA 3L8DA 4K26A 2PANA 4RF5A 3ZGLA 3ZHSA 2DB3A 1P44A 2IVZA 2MSKA 2D74A 4IQFA 2C9OA 3JWPA 1J25A 1N9ZA 4TN1A 4LW8A 3UN1A 2G40A 3E9QA 3RIEA 2X9GA 3HPQA 1YB1A 5J5VA 4CDNA 2ZYIA 3DTYA 3AVPA 3BE8A 4PLVA 1OI7A 1ZM4A 3ICOA 2HWXA 1L7OA 2HTEA 1R4MB 3IDFA 1J23A 3QEAZ 3RVSA 3GLSA 5KOHB 4E4YA 4OHFA 5BSRA 1PYDA 3NLLA 4JB2A 1BQEA 4Y6SA 4BO9A 3WZLA 5B55A 1NG9A 4BPBA 4OFWA 1Y5MA 2J9ZB 3QVLA 1QRDA 2I99A 5D1HA 5UKDA 5C8XA 1EDDA 5F2OA 4FB5A 1SHJA 2H85A 4EY6A 4YJHA 2Z0MA 5LP6C 4DV3B 1O96A 3TIGA 4C1BA 1E7WA 4PCLA 5ER6A 3CH7A 1TGYA 1KK1A 1M83A 3O92A 2Z2YA 4NBUA 3DMPA 4HTFB 4LJ4A 5H83A 3RROA 4OATA 4PZCA 4UUBA 1NC3A 1XF1A 3K9QO 3WK8A 2RHDA 2WD9A 2ZM5A 1OXSC 4KPFC 1GG9A 5IKXA 2OOKA 3DMYA 2C29D 4MVYA 3SD7A 2R8XA 4FIZA 4DC0A 1XMQB 1ZNWA 1E1QD 1DKLA 2EGGA 3MRSA 1V96A 1PS8A 4YJFB 4JJ7A 2NXCA 2QUBA 1CUIA 1RI2A 2PGXA 3C1UA 3AUJB 3IB6A 3AGQA 4EZEA 2IYEA 3AETB 3H18A 4BV2A 3BXOA 1OC4A 2XUIA 4LFCB 4DXHA 4MCAA 1SC4A 1LK0A 1F0KA 1P0PA 4TKMA 4WD3A 1GTL1 5EPEA 3TNYA 2WFLB 3CUSA 1CXZA 1EP2B 1XSEA 2W6NA 3GOQA 3QM1A 3KPWA 4J7CA 2GPJA 4ZYVA 1WDWB 4UNQA 3TQHA 3HJBA 3ADPA 1HDCA 4B43A 4MV0A 4CF5A 3PHCA 1HNWB 5DF1A 5DOZA 5GJBA 1UOQA 1E3JA 1KYIA 3G1WA 3ZH9B 1EVQA 4KO3S 3ZTTA 4BTEA 3K96A 2BGTA 1KJQA 4RORA 1NYRA 2R7NA 1ZVQA 5DYTA 3RBXA 3A58B 3WV4A 3GJQA 3MT8A 1D4ZA 1ZIDA 1LB1B 3TJRA 1L2TA 1T9DA 4ROSA 4ND3A 4Z3DA 3UY4A 4HC4A 3WNBA 4Z7QB 2R6AA 4HH3C 5F1OA 1RYEA 2QN2A 4WK4B 4YCBA 2XMSA 4F6LA 1KZ7B 2XITA 1B6TA 1Y63A 2CUZA 2DHCA 3E8SA 4AWXA 2J85A 2QK4A 4TN5A 2LGJA 1IHDA 2ZAIA 2XYGA 3ECCA 3DZDA 4QFCA 1QV7A 5C8ZA 1ODKA 3B82A 3HN6A 2J1LA 3ZD8A 5CCBA 2RHMA 4ONEA 2IHUA 4KN9S 5IAAA 4FPXA 1U0HC 3R9XA 3ENVA 3U13A 5JRJA 1JKMA 2ZXEA 3VYWA 1QP4A 2NVUA 3U9SA 1JFVA 5A71A 4EPXA 4XJSA 3TW4A 3WLPA 4G5XA 1CDEA 3QI7A 2UVPB 1T4CA 1OB5A 4ZU6X 1Z2AA 1GL9B 2M6RA 3BULA 2PZAA 5G0UA 3U3ZA 5JTUA 1WZ2A 5CITA 2YIDA 2LKDA 4OD0A 2ZJ3A 1BWRA 1AZLA 1BHSA 4LS3A 3CE6A 2CUKA 2BGJA 1AGRA 1WLYA 2P11A 1YRLA 3EF1A 1KEVA 1DAOA 3OT1B 4YAEA 2XWBF 1N2ZA 4YJ2F 4UOZA 5I8WA 1Z2CA 2GF9A 1U2DA 2FE4A 3HCAA 1US8B 3INGA 3IVCA 3MWLA 3WO0A 2DWQA 2PFKA 2FZLA 3LK6A 4DRYA 1IBSA 3DV0B 2Y3IA 4B82A 1JPNA 1FP4B 3P8ZA 3N2KA 3HN7A 3QVTA 2VVTA 4L27A 3QXGA 1T2NA 4L95C 4N3AA 5ITWA 3T3OA 4OB6A 1QYCA 1DEHA 4COKA 4NFSA 4M53A 4B4UA 4NG4A 5G1NA 4DV7B 2QP9X 3EQ6A 4P1ZA 3RPEA 3BBLA 2P4SA 2C03A 3EGCA 2G9UA 1NWHA 3HR7A 4DLUA 4MVJP 4QXQA 5FWAA 5IMBA 3SSMA 1VLZA 4YUXA 4OYHA 4L7QA 4Q3KA 5BOSB 3ZVNA 1I01A 3TLYA 1L4FA 3MWDA 2YWCA 5EWJB 3KKZA 3ZVRA 4ESOA 1GADO 1F8XA 2ODAA 2SBTA 3BJEA 4EHJA 1JYEA 4C2UA 1I2ZA 1L5QA 2R6HA 4IIUA 1K8QA 3TRJA 4JELA 4RTQA 1QQBA 2PUAA 1ZCZA 2FA9A 2RHLA 2VHZA 1IC6A 1KFBB 1W25A 2ZOSA 2MINA 3G0DA 4IF4A 1QE0A 5A3VA 1DWQA 1V1RB 2GX6A 3UWKA 3TEMA 5AHWA 1Y1LA 1E2KA 1NN3A 1LZLA 1PTKA 3I42A 1V7CA 4TL9A 3TQOA 5F3RA 3OQMA 4V0LA 4W8GA 4YXFA 2QR5A 3CUEF 1GG2A 2X0RA 4MUKA 1MRZA 3DQPA 3JAWB 4LISA 1W29A 2NUAA 4WECA 3A06A 2O8DA 2P9CA 4IV8A 3K6JA 4BMOB 4FR2A 4CVNA 1XPOA 1C0IA 2YJNA 3N8GA 4OSEA 3TQTA 1FDTA 1U11A 1EPUA 3DBIA 5AJXA 3MJEA 1CUVA 4NAVA 3C3KA 3OOSA 4YO8A 3VDQA 4RM3A 3VPSA 4Z5XA 1L3BA 4PQGA 4BWVA 2AQ8A 1J2YA 3QX3A 4IXNA 1M6VA 2QTGA 3L46A 3OLWA 4YR7A 3OZFA 4UM7A 3W1VA 2IX9A 3WGYA 3TQFA 2H51A 4DS3A 5M34A 2A5FA 1GNRA 2KHZA 5L8VA 4RGQA 3T06B 3GDWA 2Q6VA 5JNWA 1RWVA 2E6UX 2DBZA 4X6XA 1JB9A 2OFOA 4BN5A 1WG8A 1H66A 3G59A 1V2GA 5EESA 4IMIB 3ZW8A 2NZUG 3I76A 3L0SA 4YRDA 4E5NA 1TLTA 2D1FA 5DEOA 3L1IA 3UJ6A 1TTTA 2VHCA 3GGGA 5L4LA 4EGJA 2CJWA 1Q7CA 1SXJB 2O3TA 2M1ZA 2WVGA 5FBZA 3V7FA 5TIIA 1YCDA 3AOEC 5IKEA 3GLFB 2IITA 2X8WA 1SU4A 5KOJA 3QQPA 2B82A 1XX6A 1PEDA 3ZU5A 4EQ6A 1U90A 1SCDA 1M0WA 1RRPA 3HO8A 2AI3A 1ZOOA 4JVSB 5KKNB 3NOVA 5CIWA 2ZRBA 2IUYA 1YE8A 2OBBA 3T6KA 3HJTA 4YDHB 5CA0A 2ZM6B 4FGZA 4BVAA 3GJZA 5JZBA 3CWQA 4G97A 5EIBD 1N3YA 1ZC3A 4G0QA 1XEWY 1K4MA 3Q3CA 1N1GA 4FUQA 4IWYA 2YDYA 1U5CA 3D5TA 2ZCVA 1EUDB 1L5VA 3L0DA 4X24A 3CVWA 1F17A 3A4YA 3W9YA 4C6TB 1LEHA 4D9JA 4I50A 3JRWA 1ZUWA 2WU0A 3K4QA 3RUDA 5JEEA 1J24A 1O2DA 3BIOA 3AMVA 4TRRA 5BV0A 4FFMA 4UNRA 2WV9A 1C29B 2VHUA 4J07A 4UD2A 5TV2A 3TQQA 3VTZA 5C8VA 5CG1A 2WICA 1E7QA 3WL6A 5TS3A 2IDJA 3QPUA 1D04A 2ZUVA 5DGDA 1SUPA 1QIMA 2CNWD 1VM6A 2V3WA 1IY8A 5DLPA 4ZVOA 3UANA 3IAAA 3VO1A 5HKOA 3L4EA 4XWWA 1SRRA 2X0NA 1UBUS 1ZGJA 5KVCA 3DEAA 4IGKA 4PLZA 3B13B 1JQEA 1NVTA 2AIRA 3ESYA 4QU9A 1J9EA 4DYHA 4EYKA 2NMVA 3MWYW 3GFQA 1SULA 3A2MA 3NBUA 2DY1A 3QOYA 4GFDA 1U7TA 1JPUA 2JCBA 5CX1A 5G0VA 4DB2A 4P0TA 1JDBC 1F0PA 1YB7A 1XQXA 2AJ8A 3CPHA 1MQ8B 4R2WA 1XDDA 4MW4A 1GRCA 4JBXA 2VF8A 4GE3A 2C5GA 1UFOA 3R5JA 4CLOB 4M86A 3W1WA 1GOTA 4MNTA 5EJ7A 5IJ0B 2ZXFA 5LQSA 1DIRA 2VC2B 2VAMA 3G5MA 5HQTA 1T10A 2B37A 1QCCA 2OPBA 3JSXA 5FR1A 1A2QA 4DRZA 4Q7QA 4GBGA 3UAZA 1U7OA 4AMGA 3K0KA 3KU1A 3AKYA 3QPBA 4JSYA 1N0IA 5IASA 1U8CB 2J9FB 1FU7A 3RTEA 2I5PO 4OTZA 3R7LA 3ZQUA 5TVGA 1T5DX 1TU0A 3RKUA 3JVVA 1KDPA 1N9GA 5JXHA 1FYDA 4ZARA 4JI3B 4O4JF 4LG1A 1E7MA 4LV5B 5TPZD 1QHFA 2W93A 3BH0A 3EIFA 4J1SA 2NPFA 4TPKA 4AF6A 3RJZA 4OFBA 3CZAA 4Z7NB 4L78A 1E6CA 2XXAA 4GKKB 1XRQA 4PAQA 3HZHA 3CU5A 2IYWA 1GRVA 1P1FA 3W5HA 5B7QA 5ALRA 1MAVA 1ETUA 2I6SA 4GX0A 4XRRA 4C0LA 4FM9A 2K7ZA 4FYXA 4L73A 1SWWA 2Q8NA 2VG8A 3C6YA 4DLNA 1ESCA 3A6GA 4B84A 1U6IA 1X14A 3L8ZA 4Z49A 4EHDA 4AKSA 4A8TA 4D4HA 4WESB 2AEJA 1WP9A 1R8JA 3DBHA 4C87A 1FTYA 1UQUA 4YJ2B 3IIKA 3I04A 3SR0A 5LMNB 1G20B 3EVNA 3P5BA 4PCAA 2O8FA 2IP4A 3EWNA 3PITA 1E3LA 1PR0A 3RSSA 4LZPA 2QBYA 4N0EA 2DECA 1G17A 1I32A 5F1YA 4UPEA 1HETA 1WV1A 2QDXA 1R16A 2BFWA 3PFKA 4H3KB 1Z15A 2OO5A 2ZR9A 4LJYA 3VC2A 1XZQA 1T26A 2SNIE 3ETLA 2C92A 4OA5A 1NYQA 2WILA 1V8ZA 2BFBB 4G81A 2D06A 5DGXA 5AK3A 3RJ5A 3ZCTA 2PO5A 4LSZA 4D43A 1J9GA 5K3DA 3LRPA 4LQCA 3LT2A 3ZHCA 1AGPA 4KUHA 4Z9BA 4BWGA 2BUBA 3JWJA 4Q82A 3RBZA 4QDTA 1ZOIA 4NX2A 1CY2A 5JYEA 2YC2C 3DGFC 1V1MB 3DXYA 4IEEA 1I4EB 5J5AA 4AP9A 3TKYA 3TUIC 1C1XB 2QIOA 4D96A 1T91A 1DRVA 4LX8A 2FEKA 2YHIA 4IMRA 1N7GA 2LDBA 4A8PA 3ILHA 5AQEA 1XDSA 3KJIA 2AK2A 1CEXA 2FU5C 1PLJA 2AX3A 1ZA1A 2ISQA 4F4DA 3ZK8A 1VKJA 4RCYA 3P52A 1VIMA 4GH5A 2JHPA 2M98A 4QFMA 4DTIA 5IABA 1U9JA 4B0PA 4JYZA 1Q3TA 1KRXA 3QE9Y 1BXGA 4MIEA 2IV3A 1GARA 2BM9A 1T35A 3PUJA 1JR6A 4AY3A 2CW5A 2V5UA 1X7XA 3LY5A 2H63A 1N1EA 1EESA 4MV6A 4U3JB 4C7VA 2XYRA 1CF2O 3C70A 3TTYA 4CLDA 4R0MA 1YUNA 3PT9A 1I3MA 1ORHA 4JYMA 4QUJA 4HATA 2X6TA 3AVTA 5IJWA 4MA4A 1UDBA 4MV9A 4QZVA 5BNFA 4IUDS 4DHEA 1YZVA 3SNKA 2VXCA 1X94A 4LNAA 2D3WA 2DQ4A 3BN3A 3AVOA 1UPXA 3DHYA 1DL5A 4L7VA 4M0EA 2QA5A 4KWTA 1XNHA 1NIJA 4G8BA 3VH3A 3HS3A 1LRLA 2JHGA 1RDFA 3REFA 3V97A 2COKA 2BFCB 2EVWX 3KJEA 1XQ6A 1VLVA 1DTWB 2LXNA 4AT1A 3V9PA 3SZGA 1NF3A 1D1PA 2YWBA 4UDYX 3K0CC 4GPEA 4IMJB 5A4AA 1QPBA 3DWFA 3OEEA 3RARA 3LP6A 2IHBA 3H1TA 4OH7A 4UE2A 5G53C 2A4MA 5JECA 1XJCA 5I4BA 4N65A 3H11A 3C3XA 2BLLA 5HKKD 1QYVA 1SELA 4Z7OB 1XMJA 3VV2A 3W8NA 2AMFA 1GT91 3VPAA 4P0PB 1F6BA 2W4IA 1Z34A 3X2SA 1HF3A 1PR1A 1SA0B 1XRNA 3TBKA 1KNQA 2YZMA 4I99A 4YBZA 4IW3B 1KEZA 3SJBA 2ILTA 2LP4Y 2L69A 1OD6A 3FYUB 5DDIP 3IE1A 4JUAA 4G0ZA 3UMFA 3V00A 3FDZB 1T8UA 3K4PA 3T0IA 2YZ7A 3E22A 3IJPA 1WTAA 2IGBA 2D5IA 3IYLW 4U2DA 1DRJA 5JOQA 2QYHA 3SZRA 3WWOA 4AKGA 1NBOA 3GRFA 1GNSA 5DBGA 2K87A 4ENQA 1GVHA 2QX9A 5L3RA 3WQRA 1OWOA 4P4TA 4IJKA 5L6MB 1JH8A 4MV1A 2VDPB 4Q03A 3WLNA 3TNFA 4KWEA 1P39A 1C9YA 4M9UA 3U3XA 1K8YB 2GK7A 3CLSC 1HEYA 2CMHA 3BWMA 3PQ6A 1ISFA 3EG9B 4IPTA 4DCCA 4HNTA 2GZ3A 2P0AA 1XJQA 1YTUA 4JFAA 5IXYA 1CS0A 1ZXLA 3LC2O 4MV7A 1WUHS 2H31A 5EJIA 4TYYA 3HYSA 3BB1A 4U7WA 2WTNA 4KBGA 2JI9A 2QLNA 5M3BA 2TMYA 3TLMA 1TAGA 2IYOA 1ZMTA 3DLPX 3HXTA 3OFVA 4NFHA 1SG0A 4OF4A 1LLDA 3R3UA 5JWRA 4DUGA 4EY4A 1X1BA 3VPGA 1IEQA 2WHEA 4C6HA 2C82A 2PZMA 4WLVA 3FX2A 1KOFA 1KPIA 2D5LA 4NBLA 1JQDA 1COWD 1TJYA 5KOYA 1QIDA 2XF2A 3PIDA 1ELOA 3EULA 2JLAA 4EHFA 4BDSA 1I0ZA 3F78A 4MZDA 5AW8A 1PJZA 2CD7A 4O4LA 2BDUA 2VRCD 3C7DB 4R16A 2UZ4A 1PGJA 3HZRA 1RVDA 2EHJA 1BEUB 4BB6A 1SIBE 3ICCA 4HX5A 1SM4A 1QO0A 1Z7EA 2JA1A 4JB0A 5LMZA 3FDJA 4XGIA 1GRRA 5E95A 1LI7A 3ACCA 3DFUA 3ZDAA 4HXFB 1RRGA 2XYPA 4UKDA 4YMLA 2J3DA 3D2BA 3CMMA 1RM0A 1VA4A 3ONEA 5FYQA 1KH1A 2UYHA 1O89A 5L95A 3MCVA 2GTPA 4TWZA 4L22A 5EEHA 1EQAA 1FFBA 2GHIA 3OEHD 2WSMA 3M6UA 1KYZA 2HV8A 1J2EA 3PE4A 5MN6A 3UPTA 2G5GX 5K0BA 1N2GA 2PLAA 1TMGE 1U5BB 2WF7A 2XKBA 3B51X 1N4AA 2NQ8A 4JI5B 2FOLA 3H2HA 3USCS 3FOZA 3HI4A 4RMIA 1CDDA 1NF9A 1MMFB 3KKQA 4OOFA 3GIWA 2QWXA 3JW8A 4D4MA 2CDRA 3VHXA 3T1TA 2FPLA 1WHTB 1F3LA 4JP1A 1OX6A 3BG5A 5J58A 1NKVA 3T9FA 1ZUD1 4Y0NA 5K0LA 2QAIA 2Z57A 3ZU4A 1NMQA 2R1TB 3EC1A 1TKCA 4K81B 5BRNA 2NO7A 1L3IA 3FCEA 1PNVA 3VX4A 1RXSA 2KW5A 3ENZA 2QKYA 5E7IA 3VR1A 3ZEIA 2OQRA 4BO7A 2BTQA 2P2YA 3C1OA 3PGA1 5IKOA 4H7PA 5BV1A 3JQAD 1QH1B 5HNKA 4D26A 4MX8A 5KWSA 1YJBA 1Z37A 4KXQA 3PJGA 2ZIAA 1LSSA 3MMPA 1L5FA 1M9NA 2P6MA 3LVBA 3Q2OA 1QVWA 4HEQA 1SKUA 5CRIA 1H8ED 2RG7A 5F76A 3TM4A 1DQSA 3UCEA 1QLHA 3DVRX 3I53A 4Y9SA 7REQB 3VBEA 3L01A 2IUTA 3EVBA 1PG0A 1FDUA 3GEIA 2XADA 4HQRA 5JUWA 1IY9A 4E09A 4YUAA 5BSKA 1ADJA 2P9EA 4LYFA 4FNOA 3UGKA 5JJLA 4IZHA 1PNQA 1CHNA 5I7EA 1CE8A 1HYHA 2NN3C 1F8UA 1WQ1R 4S1OA 3KSZO 5H02A 1CW2B 3UAYA 4CDGA 4MVJI 4Q18A 3DHNA 3N8IA 5DLYA 2R8ZA 1U9IA 4KFCA 2Q0SA 1VIVA 5D3MA 4W5JA 4G9BA 4XPZA 1HG0A 1F5SA 3K5PA 2YCBA 1BC5A 3EFEA 3K09C 4PBSA 4L8LA 1ETHA 1ZRSA 2IYUA 4INAA 3C1TA 3M6XA 1X1TA 3HUDA 2YFQA 1WCYA 1Z0AA 1OIXA 3GQBA 3HU2A 4BQRA 1DQNA 1FP7A 5LP6B 4XYGA 3T1OA 1BAPA 3MAAC 2R4UA 4L5BA 4GGOA 2J3EA 4WGGA 1AUVA 4H16A 4JENA 3HHEA 4RV5A 4I4TF 1OKKD 1PT6A 3KVNA 5I9LA 5M2QA 4E1AA 3C4JA 2ZI4A 3DSRA 1B8OA 3O9ZA 2XNKA 4BNFA 1YA6A 1TYEB 2VH1A 2YRFA 1OBVA 3JTEA 4MYSA 3O03A 2G17A 2FDCA 3CVJA 1TT5A 3JYNA 1RE0A 1G7CA 1QFMA 4PFQA 3CNNA 4NABA 4JOBA 1R5OA 2AKEA 1Z7WA 5E4FA 4YP6A 1IZ9A 5BQPA 1W4CA 4GM1A 5BPHA 4JUDX 4B6OA 1U8EA 3WGVA 1IUKA 4IX1A 3O5AA 3DW3X 4MGIR 3P5SA 5HTOA 5BWMA 3M6FA 1IPFA 2CLDX 4RYLA 5F7XA 3DEKA 5KYNA 4W9MC 1YE5A 2B30A 4KLNA 3GMDA 4G86A 5HMLA 2PX2A 4E5UA 4CEHA 1O6CA 1PQUA 2B98A 2P91A 4HNQA 4CMJA 1XE3A 1O94A 3AIKA 2FNAA 4WOJA 3TXAA 2BMAA 3AH8A 4MGHA 2IZOA 4S1WA 4U7TB 3WA6A 4W5RA 3NGXA 1R18A 3Q3JB 2XD9A 4A7PA 3K6KA 1T3TA 1YOVA 2JAPA 4P82A 1KXZA 1V1JA 1Z9BA 1T15A 3FLEA 4BNNA 4DOMA 4P53A 3Q8LA 4WCFA 4TZ6A 1KO5A 1RXIA 3WGMA 3ZV7A 3DOCA 2ET6A 3BE6A 3LQ1A 4C0KA 4KR3A 2CEKA 1M1NA 4DMKA 4FGUA 4GBED 4X6UA 4KXFB 2E0IA 2ZU6A 2XGJA 2QB5A 4TGLA 3UJDA 3WFJA 1ZX1A 2QTAA 4U7DA 4I19A 4AWBA 3ZWWA 1V7PC 2G8LA 2EJCA 2AFIE 2JKYA 2IYRA 1O8BA 1QZUA 4K9PA 3IP7A 1ZCAA 2G1PA 3ZHUA 3IEVA 3PNLA 3I2KA 3U7IA 3ZKWB 1L7XA 4ZYXA 2DQZA 3CFYA 5IZCA 4PG6A 4Y9UA 1RAFA 4Z0NA 3W78A 4JP3A 2PT5A 3PHJA 3S40A 3TR0A 5BN5A 2P5TB 4P7BA 3KB1A 3U4CA 3NWJA 3QWBA 3MQ4A 1XG5A 4B3MB 3DEJA 4WE3A 2Q1WA 4ZCLA 4AZ0A 4GS5A 3HP7A 4U0JA 1BEZA 2JGDA 3DKRA 1RAGA 3IBYA 4IS3A 4BC0A 1QC5B 5JSZA 3NG1A 4L8WB 5T4HA 4CMIB 4KBFA 2JFHA 4RPHA 4EARA 4JI7B 3UUGA 1ISHA 4WGFA 4KZKA 2RBEA 4CW7A 2I8LA 1SPXA 2QTVA 1JQLB 4H7FA 1H4VB 4II7A 2HJSA 2WWGA 4KYTA 4RXUA 4DA4A 3KK0A 1V0JA 1WKBA 3OPNA 4I1YA 1SY7A 4JC4A 3VNSA 1BS1A 2E4ZA 2K6GA 1N2CB 1OQAA 5FJIA 4GDFA 2DC1A 4MYDA 4CG1A 5CURA 1OFUX 1W2GA 4UBOA 3QFRA 5B4UA 5HJ7A 1ZMBA 3IERA 2QRUA 3ZX4A 3FNGA 1XJ0A 4AYTA 3UMYA 1R88A 1NMEA 2HWWA 2Z2IA 3NH6A 2C7VA 5AW3A 3MIIA 4RZXA 3PLRA 2JEOA 2HOQA 2IYLD 3P9KA 4EVRA 5DXFA 9MHTA 3KD2A 1F8FA 5ULLA 1GFWA 5GAJA 3VKGA