3KPYA

Crystal structure of hpnmt in complex adohcy and 6-chlorooxindole
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kpyA00
3B3GA 2ZTHA 3ID6C 1JG4A 3FUVA 2I6GA 3BXOA 4X60A 3LL7A 3HCDA 4YUWA 4WVLA 3BGDA 3GDHA 3KQQA 3GIWA 1OR8A 3NDIA 3SSMA 10MHA 3EVDA 4QVKA 4EK9A 2NNWB 1QANA 5CD1A 1IXKA 4DM3A 5HFJA 5M5BA 3FTFA 1R74A 2AOUB 3BWMA 2GPYA 1X19A 1L1EA 3LPMA 1KYZA 1O54A 3AWIA 3IV6A 5GM1A 4AUKA 3ELYA 4E2XA 4ER7A 4RTOA 4DA4A 5IH3A 3VC1A 5EIFA 3TKYA 3SSOA 4G56A 4WXHA 2K4MA 4BLVA 3EPPA 4P7JA 5EKXA 5HIKA 5EMLA 1PJZA 3A4TA 3I64A 3C0KA 2UYOA 2VDWA 5DXJA 4EKIA 1FP1D 5K0JA 2QM3A 2C7PA 2FPOA 4PIPA 5DX0A 4YV2A 4DCGA 5FWAA 2PV0A 4P58A 4RX1A 4R05A 3FYCA 2ZIFA 3JWGA 4RVDA 2PXCA 3TM5A 4FT4A 4C04A 5LQRA 5LQJA 3GRUA 3MGGA 1KIAA 2BH2A 2HV9A 5DSTA 4YV0A 1N7JA 2FYTA 2ZZKA 4GC5A 1JSZA 1FBNA 1NBHA 4POOA 3FUXA 1R8XA 3HA7A 2NXNA 2ERCA 3EEYA 3NVMB 4OA8A 1AQJA 1QYRA 5DM1A 1WS6A 3DLIA 2G72A 3M6UA 5E9WA 4GOLD 4RTJA 1JR4A 3KQSA 4RTKA 3P8ZA 3KPVA 5T64A 4QPPA 1XXLA 2EJUA 1NV8A 5KQRA 5DRTA 4OX9Y 3MAGA 2OBFA 4PCAA 4XCXA 4XUDA 2G1PA 3Q7EA 1UWVA 1O9HA 4KVZA 4FP9A 5DTMA 3T7TA 2PY6A 2P3OA 4ER6A 3P9NA 4IV8A 5HIIA 1FP2A 2AOUA 5CUQA 3T7SA 5K09A 1UIRA 2YR0A 3BGVA 4BP1A 4KIGA 4PWYA 5CVUA 4PYOA 5EC8A 3R0QA 3LKDA 3NJRA 4QQNA 3P9IA 4AZVA 5KS2A 1RJGA 5FHQA 2AOTB 3HVIA 3JWHA 2UYCA 1WXWA 1KR5A 5E2AA 1SQGA 3LDUA 1RJDA 2JH8A 4O29A 2BM9A 5JR3A 5P8WA 3QOWA 4RTPA 1RI3A 2CMHA 3AXTA 4X61A 2JJQA 4GEKA 1JG1A 3C6MA 3CC8A 3NDJA 4EVIA 3KQMA 1B42A 4F85A 1BKYA 1VP3A 3GO4A 2ZZMA 3HEMA 3CJQA 1JQEA 1X1DA 5FUBA 1P1CA 1X1BA 5LQAA 4B17A 3REOA 1ORHA 1MJFA 5CVVA 2CMGA 4C4AA 5ICFA 3WSTA 2GH1A 4ZTBA 5CVDA 3B3FA 3FPEA 2C7OA 3M33A 2V7EA 3OE4A 5DWQA 3OE5A 3OU6A 4L7VA 1H1DA 3BWCA 4RTMA 4KIFA 3DXZA 4E2ZA 4YUZA 8MHTA 2EX4A 1KHHA 4X41A 5HILA 1G8AA 2UYQA 4PGHA 1YFJA 1Z3CA 2AN3A 1BOOA 4XUCA 3PFHA 2P35A 1HMYA 4IV0A 4YUVA 2CL5A 1NBIA 3AJDA 5F2NA 5K0CA 3I9FA 3X0DA 5FTWA 1AF7A 3I5UA 1Q0SA 1F38A 3HCBA 2XVMA 3GRYA 9MHTA 3PB3A 3LSTA 3M6WA 3R9XB 2OPBA 1I1NA 4HG2A 5IKMA 2ZSUA 2PX8A 3MQ2A 1NKVA 1RI1A 2NXEA 3LCUA 1INLA 3UJBA 3KQVA 3HA5A 2ZVJA 2DPMA 2AOTA 3CBGA 2OY0A 3P2EA 2YTZA 3MB5A 1Y8CA 2PVCA 3G2MA 2FRXA 5K01A 1RJFA 4DQ0A 3A7EA 2ZFUA 2VDUE 4QTTB 5DSXA 2Q41A 4MIKA 2EFJA 2ZIGA 2P41A 4U7TB 2OKCA 2ORED 4QDKA 2IP2A 3G2PA 3Q87B 5DLYA 5KQSA 1M0EA 5BXYA 4HH4A 2O0LA 3FTCA 3B3JA 4FR0A 3HVKA 5K0FA 2BR5A 3KQTA 3CVOA 3UA4A 3FPFA 2AOWA 1RJEA 1VQ1A 5EHIA 5LR6A 4MWZA 1P1BA 5HEKA 3P71T 3IYLW 3DP7A 5K0EA 3BWYA 2GA9A 2HTEA 1AQIA 3M6XA 4OBXA 4E2YA 2JHPA 4QVGA 4AZWA 1ORIA 3H2BA 2AVDA 4M38A 3UJAA 2AN5A 3GU3A 5E9QA 1XCJA 1NE2A 2QE6A 4QQKA 1DCTA 3FRIA 4A6EA 2Z6QA 3HTXA 2AVNA 3HA3A 4GBED 5FQNA 3GWZA 3T0IA 5EOVA 1FJXA 2VDVE 3SM3A 3G7UA 3GCZA 4OQEA 5LQCA 3G89A 3EMDA 1XDZA 2PKWA 4CKBA 3I58A 4R6WA 2A14A 1V39A 4FGZA 1WG8A 4GOOD 1JQ3A 4NECA 1VL5A 5EZQA 3JWIA 4LWOA 3ANXA 4RSRA 1U2ZA 3FPGA 3M4XA 4RTLA 1P39A 1N7IA 3DUWA 4FSDA 4LG1A 4Y30A 1X1AA 2ZULA 3K0BA 4V0QA 1SVUA 3QV2A 5E9JA 3NWEA 5EIWA 3MHTA 2AN4A 2YUIA 5BP7A 4U7PB 4M7RA 5EEGA 5H02A 3JWJA 4PYJA 1R18A 3T7RA 5HZMA 3I53A 3DMFA 4E31A 5K05A 3DULA 3KPJA 1VP9A 2IDJA 2ZBRA 1YZ3A 4XUEA 1QZZA 5EQJB 4CTKA 3FPHA 5FA5A 1SG9A 2GAFA 2G8NA 3GRVA 3KR1A 5C0OE 1D2GA 4EQZA 5DX8A 2I9KA 1M6EX 3BT7A 3TQSA 4YMHA 2B9EA 2I62A 3BKWA 3BWBA 1T43A 3TFWA 3ELWA 3FTEA 5EPEA 3LBYA 3A26A 3EMBA 4HTFB 4ATNA 4PCLA 3ER9A 1WXXA 1XDSA 1XJ5A 2ONYA 2PXXA 3DLCA 3NTVA 4PYIA 5GP1A 1JG3A 3OZTA 4QDJA 3PTAA 3G5LA 5E1DA 3NMUF 4PYLA 5U4XA 2NXJA 2DULA 4ER5A 1BC5A 3GJYA 5DTQA 4Z2YA 1SUSA 3FTDA 5EKUA 5K03A 3PS9A 2OO3A 4P7FA 1KPGA 5DM4A 2IGTA 4HRAA 3BZBA 4KRGA 3TR6A 2UYHA 3BGIA 3THRA 1L3IA 3PLAE 2BM8A 2P1DA 1JQDA 1NV9A 2O06A 3EVAA 2ESRA 3HVJA 1EIZA 1ZGAA 2EJTA 4RVGA 2XVAA 5EVJA 1KPIA 3DXYA 5LQKA 5EG5A 5K0BA 3SR4A 2Z6UA 4KW7A 2WA2A 3DR5A 4PYQA 2R3SA 5DRYA 3R3HA 3FPJA 2Z6AA 3EVEA 4E32A 2PSSA 5FHRA 3FUWA 3P97A 4DCMA 3UJ6A 1RI5A 2H00A 2C7QA 3UZUA 2YVLA 2YXEA 3EGIA 2ZLBA 4FSXA 4E30A 1L3BA 2JHCA 3GXOA 3B7PA 2OZVA 2O07A 2FHPA 5BW4A 2UZ4A 1XTPA 3DTNA 4IKPA 2IBSA 3QOXA 2GLUA 3LDGA 2PX5A 2G70A 2CWWA 1TW3A 5ICGA 2G71A 4R6XA 1YFLA 3HVHA 3DMGA 4HGYA 3UJCA 2VZ9A 4HTFA 1AV6A 3HCFA 2IH5A 3LBFA 1F3LA 1L3CA 5GM2A 3TRKA 1O9GA 2NP7A 5E1BA 1R8YA 1R00A 2H1RA 2WA1A 1QAMA 3G2QA 5CM2Z 4C06A 3EVBA 5KVAA 2B25A 2F8LA 3PX3A 4LWPA 3SX0A 3DH0A 4P7GA 2NP6A 3HCAA 4AZSA 1QAQA 2B2CA 3OU2A 3RIEA 3FZGA 2P3QA 2P3LA 4RTRA 5E8RA 5GIPE 2HNKA 2XBMA 3G2OA 1ZHFA 3AXSA 3G8BA 4RVHA 2Y1XA 3SMQA 4C05A 4FS8A 4YV1A 1RI2A 5HOQA 2VS1A 4JXJA 3C3YA 1HNNA 4M36A 5GWXA 4LECA 2E5WA 1JG2A 1EJ6A 5CVJA 3UWPA 1UFKA 1D2HA 1VLMA 1RI4A 1JSXA 1ZQ9A 3KR2A 3KQWA 4DZRA 5K0GA 3PT9A 2ZWVA 3SXJA 2ZIEA 2FCAA 2N47A 1QAOA 2OB2A 3EVFA 5FWDA 1KP9A 1ZG3A 4AX8A 4DMGA 1YUBA 1NW5A 3TOSA 4DKJA 1PRYA 4YUXA 4RV9A 2AZTA 3CJRA 3ERCA 2IH4A 2IFTA 5LSAA 5HIJA 1XDUA 1R6AA 2C7RA 1TPYA 4BY9E 4R8SA 4PONA 1VPTA 3M70A 3KQOA 2AOXA 2PWPA 3M6VA 4GQBA 2YX1A 4RVFA 1NW3A 3GRRA 5E8JA 4BP3A 1DL5A 1IY9A 3DMHA 3MCTA 5DM0A 3B5IA 3C6KA 5LQNA 1EQAA 2WK1A 3FRHA 4RWZA 4KDRA 1KYWA 2ZBQA 4ISCA 4YUYA 2PWYA 3TLJA 2ZZNA 1SUIA 3P2IA 4PIMA 2P7HA 5DPMA 3ER8A 5T6BA 2ONZA 3KR9A 1KXZA 3FUTA 5FA8A 2B78A 4GOND 3RODA 4ER3A 3R6TA 2KW5A 1P91A 3SVZA 3OFJA 3UA3A 3KKZA 4QPNA 3LCCA 3MERA 3O31A 2ADMA 3F4KA 3P9KA 4H0NA 4R8RA 5E1OA 4C07A 3LCVB 3PVCA 2YXDA 4GOMD 3NWBA 3ME5A 3TMAA 3O4FA 5B1SA 2FK7A 1YF3A 3C3PA 5DX1A 2QY6A 3LGAA 5K0LA 3TM4A 5MHTA 2ZW9A 4FT2A 2QRVA 3OZRA 5EZSA 3UJDA 2PX4A 1YB2A 4HSGA 1JTFA 4RTNA 1DUSA 2PXAA 3OFKA 1EG2A 5ICCA 3LHDA 3V97A 4F86A 3KR0A 3VC2A 2BR3A 3KPYA 5EMMA 4RTQA 3EGVA 2B3TA 4X1OA 4IWNA 4E2WA 2QYOA 2P40A 3UFBA 4EKGA 3LKZA 3HM2A 2AS0A 2NXCA 4GF5A 4BLWA 2HR1A 5G02A 3S68A 4RTSA 3UBTA 3LX6A 4A6DA 3G88A 4PINA 5EMKA 1IM8A 4M37A 5DXAA 1TW2A 1WY7A 1MHTA 5EHGA 2H11A 2OB1A 5C9ZA 2PX2A 1EAMA 4OA5A 2BZGA 5KYGA 3ORHA 4OQDA 1G55A 1SQFA 3VYWA 2GS9A 3P9CA 1NT2A 2PBFA 5CCXA 3EGEA 4GC9A 3HCCA 3K6RA 3KPUA 4CWAA 1VIDA 5GOZA 4ER0A 1ZGJA 5BW5A 3EVZA 5JUWA 2JH9A 3TKAA 3KPWA 5LQUA 1EJ0A 5K0NA 5DT2A 1ZKDA 5F2OA 5C1IA 3GRZA 1YZHA 2NYUA 5T67A 1I4WA 3HP7A 5DTRA 3THSA 4F84A 4K6MA 4E33A 1Q0TA 7MHTA 3CGGA 3BUSA 3B89A 4HC4A 3TPZA 4KWCA 1NW8A 3IHTA 2VP3A 5K8VA 1X1CA 3CJTA 3PFGA 4OBWA 5EGSA 3UJ7A 2ZWAA 3CKKA 1I9GA 3KU1A 1NW6A 3L8DA 4QTUB 5D1HA 4C03A 3NVKI 2BR4A 2IPXA 3FYDA 3BKXA 3HCEA 4PYKA 2I7CA 2XYRA 5GINE 2XYVA 1KPHA 3KHKA 3GGDA 4GUAA 2OYRA 3UJ8A 1NW7A 4CKEA 4MQ4A 3OU7A 5ERGB 4MTLA 4EMSA 2P8JA 3IEIA 2IDKA 1WZNA 2R6ZA 2EG5A 5FQOA 2OXTA 1G38A 1JTEA 3A27A 3E05A 3RW9A 2XYQA 4PGGA 4FZVA 5FCDA 3G8AA 5HIMA 1XCLA 2O57A 4AZTA 2AR0A 3MTEA 4PYMA 3OCJA 3EVCA 2PLWA 2IBTA 1FPQA 5F2KA 5E1MA 3HNRA 3EVGA 3A25A 2AOVA 3AY0A 3EEOA 2LD4A 2V74B 4RYLA 3G5TA 5EMJA 1XVAA 3UJ9A 4PYNA 2GB4A 4YMGA 2ZCJA 2IH2A 1VBFA 2HWKA 4HGZA 4MHTA 3DOUA 2O05A 5D1NA 2FK8A 1G60A 2PT6A 3CCFA 4P7KA 1D2CA 4CTJA 3KQYA 3P2KA 3E8SA 2JHAA 2QRVB 5E2BA 3OPNA 3VSEA 3FUUA 1SKMA 4V0RA 3KQPA 5FULA 4CXMA 3LECA 4Y2HA 5CCBA 3E7PA 1VE3A 1BHJA 4X63A 5FADA 1L9KA 2PJDA 5CIYA 3LDFA 3GNLA 3SSNA 3PX2A 3MTIA 1N2XA 3OZSA 4E70A 3A7DA 3E23A 3R24A 3V8VA 5CVEA 1M6YA 3ELDA 4PNEA 2JG3A 5ICEA 3ELUA 5EEHA 2CKDA 3MCZA 5DM2A 2YQZA 5GIOE 4KDCA 4CKCA 4DF3A 3SGLA 2Y1WA 3DXXA 4UOEA 2YXLA 2P7IA 4BLUA 2ZBPA 1G6Q1 3D2LA 3U81A 4C08A 2IIPA 3O7WA 2PT9A 1G8SA 3NW9A 2PGXA 2HMYB
chains in the Genus database with same CATH superfamily
2FQQA 2O1WA 2XUPA 1FS6A 1OPRA 2IYQA 1S4MA 3FUVA 2P1ZA 1JIUA 4D0SA 2C84A 3Q0TA 3EXIB 1A2KC 4M9UA 3R7DA 4LPKA 1VXOA 2JLZA 2IYTA 3SF0A 2N9UA 3UN1A 1O6FA 3LUJA 1ZGZA 4I8IA 4QOSA 1OR8A 4R41A 2XRFA 2FPLA 1BOFA 1Z25A 3L5OA 3DBIA 1J99A 1E6EA 2W2OA 1WIWA 3AB7A 3LCRA 3PPYA 3K0FB 3QELA 3K70C 1IXKA 1IWBB 3AIIA 2GBIA 5DYIA 3FOFC 3GN1A 3HXQA 1DC6A 2R6AA 2JFVA 3HPRA 2UZ0A 4AFNA 1B6TA 2J30A 3C8UA 3FVRA 4JB3A 3AWIA 3A6GA 1CUWA 2OLJA 4I99A 1OBHA 1AMUA 1MV5A 4Q9DA 1XPRA 4JLWA 5EFZA 4DZZA 1B8UA 1YL5A 2GYWA 3SSOA 3PVSA 3BWVA 4NESA 3VM6A 5BOSB 2Y99A 1MEEA 1B2LA 1SQ6A 1S7GA 4RACA 3COJA 2JJMA 4F8JA 2E5FA 4C14A 2X23A 1O6BA 1LDEA 4KQMA 3WI7A 3FSRA 2NAPA 3TCKA 4V1CB 2I4LA 4GR5A 3SQLA 4EJ0A 2WTEA 4XR4A 5A0FA 5J2TF 4F1JA 1DBIA 3LHSA 5JROA 2V45A 4REOA 1JXOA 2Z5FA 3GA5A 3GCGA 3DQQA 1TLTA 4IX9A 4JLMA 4K05A 1WV0A 3PTZA 4Y6LA 5I9MA 5JH7B 4WN9A 4DYVA 3L1UA 3B9PA 2REQB 4KQ2A 5DKFA 2WTUA 3F49S 2ZZKA 2XUIA 3PPIA 2V7WA 3BREA 1XZLA 1RLIA 4X1YB 5HDBB 4URVR 3N0VA 5LD2C 1BXKA 2G72A 4Z5XA 2AIRA 1WB4A 3BYZA 4RTKA 1BVYF 2VJQA 2YN4A 4JLNA 1WDKA 2AT1A 3LXXA 4LZAA 5I6DA 1QTIA 2QX8A 4GICA 4HS9A 3MJ4A 2W6IA 3W5DA 3E5NA 4Q1VA 5HIIA 3UOGA 5K09A 1NMQA 1YQUA 1U2DA 1JT9A 1UIRA 1KZ7B 4RFSB 1XVLA 1JLLA 3KT6A 1ZGCA 4UUOA 2NAFA 1G41A 2PX3A 4QEDA 2Q3CA 4PWYA 2JIZA 4PYOA 3RQSA 4DJFC 2P9FA 1A8IA 2I33A 1FY2A 5FOQA 2KE5A 3HVIA 2BI8A 4P2BA 4LBVA 3EF3A 4WFJA 4AUEA 3UHAA 1SQGA 4WASA 4R9NA 1HRKA 1WW3A 2H4YA 3IURA 4GYWA 1A4RA 1WV1A 4ZANA 2Z2KA 3N8GA 3QXJA 3LW7A 3OPYA 4K6KA 3V4VB 3R6LA 4A5SA 2AZDA 3IQIX 1U0EA 2I8CA 2QX9A 3LQKA 2C2HA 3JVVA 3PC6A 3ZEIA 2YV1A 5K8JB 4I6JA 3FF4A 1BKYA 2VEOA 2VF5X 3O2JA 2IVFA 4FSHA 3U4DA 4EDFA 4EJMA 3GNTA 1E0KA 1RLTA 1QO7A 2VP4A 3CNNA 1YUNA 1X1BA 2EVWX 4QFDA 1M76A 1PN3A 1M2NA 2BM1A 4FZ5A 1GPWB 4GI2A 4PSAA 1P4RA 4ZHQF 3OQ1A 3CQ9A 2LTAA 2F9MA 4B2LA 3OLZA 2C77A 3BJIC 4FCCA 2CHQA 1KO5A 1N1MA 3BEOA 1MP0A 3FCXA 3EIOA 5HILA 1ZJJA 2FPIA 2PNJA 2RCYA 3GNSA 3SS8A 2C94A 2ZYAA 2NVBA 3ZY5A 1EB8A 1HMYA 2O0HA 4YUVA 1NSTA 1CDEA 4ENQA 4J03A 3WLSA 2AI2A 2PGJA 4PLYA 3ENQA 4IIYA 1GV0A 5JV5A 5I45A 1NLUA 1E3SA 1U1GA 2BY4A 2FP4A 4KP7A 4UE3S 1PL7A 2D5IA 1T10A 4NF2A 2VBGA 1W30A 3EQ6A 1FQOA 3MQ2A 1IN7A 1AURA 4I4CA 5LA6B 2NXEA 3R0VA 1INLA 4GEGA 4IUYA 2JGRA 3HY4A 4L8LA 1O89A 4EENA 1YU6A 3CEMA 4HDSB 2YL2A 2SCUA 1JU4A 3B8HA 2JIBA 3JR3A 3OLXA 4KQKA 1TVKA 3PQCA 4MKHA 4B8ZA 2ZSBA 2O8BA 4NEHB 3RFFA 4ZQHA 1YZQA 3BMNB 4X45A 1MEOA 2J7PD 2IYOA 1JDZA 1Z47A 3ZU6A 1Z17A 3CLSD 1CBUA 5JFGA 1FUEA 1ISSA 3KE8A 2PMCA 4WJKB 1PHRA 5ECDA 2BR5A 1CTQA 2CZQA 5LR6A 2GAIA 4H1WA 3V8NA 5LQDA 4Z6KA 1JYEA 2ZBUA 3NEPX 4KQXA 4XZ3A 4ZXFA 2C4UA 2E4XA 3O8QB 4RS3A 4M1WA 3IKLA 4TMTA 1YVDA 4R16A 2XUAA 2YNMA 4PNPA 1PLKA 3BMQA 4DREA 1M72A 2PUFA 1PWEA 1SUPA 1DG9A 5IX8A 3K0CA 1Z4OA 1GZ7A 2AN5A 2ZREA 4H0FA 1QCCA 4L5YA 5DBHX 5SY4A 3TAHA 3NXKA 3ZV4A 4ZV4A 1O58A 1AKYA 3CF2A 4OIFA 1JJIA 3V8PA 2XT0A 2PYIA 2XUHA 1E6KA 1P2VA 1CUCA 1V11B 4P83A 4AD8A 1HH4A 2REXB 1LF0A 1YE3A 5K8IA 2MYTA 3G82C 1NUTA 3OIVA 3KAJA 5LC1A 1VHTA 2H16A 3NBUA 5E9JA 1OLUB 1JEAA 5JXHA 3WL8A 5B1YA 3ZHZA 3U4HA 5ITWA 4PSUA 2QHXA 3CSDA 3KJEA 3S2GA 2DH6A 1IN8A 3G68A 1T4BA 2GK4A 5KTNA 3BG5A 1FE8A 3QVXA 5FA5A 5ER9A 5CB8A 4LQLA 3D0KA 1GNLA 5DX8A 2XECA 2OHOA 3I2IA 5AM2A 5ALRA 1EWRA 4KMRA 2I9KA 5FWXA 2E4AA 4P86A 2OCGA 1Z82A 1IWOA 2FG6C 2C95A 4YASA 1B3BA 5MF6A 1HDOA 1JR6A 3ILYA 1IEWA 4WNIA 2BTQB 2OBXA 1LCIA 1KYQA 3MIIA 5HTOA 5CAEB 1RQXA 5FORA 2WSIA 1YE8A 4QOFA 3MELA 3NTVA 5KYUB 4CL0A 4ND8A 4EJSA 2QENA 1W87A 1A5TA 2EJCA 2B92A 3HDGA 3QWBA 5DF1A 5FLEX 5IDXA 4PTLA 3PQEA 1L4GA 2WAAA 4LVOA 4DUPA 4O1IA 3FTDA 2F1IA 3DC2A 3HZRA 2FGJA 3KJZA 4DBLE 3AU8A 2ZIAA 4HVTA 1SH7A 1WW8A 1SKYE 2O2HA 2YVUA 3KJGA 4RELA 4UE6A 5JD3A 4DPLA 1NDUA 4WV3A 3KAPA 1O4WA 2NACA 4F4HA 3OP1A 1EFLA 3AGQA 3BH6A 3BXFA 4MQBA 3SQNA 5A1JA 2QU8A 8ADHA 1QPZA 1UDRA 1J1UA 1ZH0A 4FOTA 4IHAA 3IIKA 3KNZA 5C5EA 3HYLA 5CDGA 4YPOA 1JQLB 1IY1A 3FUCA 5EVJA 1XLTC 1KPIA 1U31A 2DFVA 5FWYA 3TPCA 3PJDA 5EG5A 2NT3A 4F46A 4TLAA 5KYNA 1CVRA 1E5QA 1KS9A 1RU3A 2GX6A 1UBMS 3DEKA 3VKVA 5ADHA 2Y6UA 1E3IA 2PRIA 1MO3A 1B6GA 2CLDX 3BWXA 5HGJA 4K9DA 4FB5A 4JI5B 2Q27A 2J4FA 5CH8A 4N12A 3GARA 1ZUNA 5EJGA 3K9NA 4N0MA 2B20A 1JTVA 3E9YA 2AK2A 5KQPA 2ERYA 4O8ZA 3RK4A 3WIUA 4DANA 5DNAA 4E30A 2FDCA 2QZ4A 4FDTA 1WQ3A 1SGWA 2ACEA 2ROQA 4JBLA 5BR8B 3NUQA 4F92B 4IKPA 2FPXA 4QODA 2IBSA 3L01A 4JVSB 1ZD1A 5AJVB 3SHQA 1XZNA 1Y37A 2VCHA 2W2NA 2JGFA 3H5NA 1H5QA 1X7DA 3F6PA 4S1OA 3HVHA 3M1LA 4PRKA 3QSYA 2ZETA 2PRYA 4XJXA 3TH5A 3HCFA 2ABWA 1KXJA 3RASA 1F3LA 1YQEA 1I4DD 2JVKA 2P8SA 5BSTA 2NP7A 1G42A 4BNDA 1KY4A 4O4HB 2H1LA 1F3OA 1W59A 1THGA 4OGLA 2C29D 3SJCA 1HE3A 3JAKB 2CHUA 4L8WB 2WE7A 3SX0A 5BR4A 3V48A 5B1IA 1GEGA 5ADWA 3AG5A 3BDVA 1TMKA 3CH6A 4N8EA 3RS3A 2FX5A 3QEMB 4RD3A 4BGDA 4JP1A 4LWZA 3I01A 5GIPE 2QYSA 2XBMA 1JHYA 5BVHA 4Y0VA 5DNUA 5JZOA 4KLAA 4PG7A 5K4AA 2FW6A 5GWXA 3COPA 3JQBA 4CIWA 1ODFA 4QELA 4UPVA 5JY6A 3U9TA 4D3DA 4C0HA 1PK8A 3DTTA 4D3ZA 1WUJS 4HQ6A 4AJIA 3C3AA 4IKOA 4GG1A 3K4PA 4Y2XA 3EVFA 2E4YA 3JD4A 3KEOA 3WOVA 1GPDG 2AR7A 1E94E 3GUVA 3LWZA 1PRYA 2Z1NA 4UPEA 5A7GA 1SK8A 4BFZA 5A3JA 4CIYA 1XDUA 4DNXA 1KEKA 2VCYA 3RIXA 1Z45A 3GEPA 2O2GA 4R7TA 4C0KA 5TQJA 3R5SA 4KG7A 5DYNA 1X8LA 3GRRA 4G09A 1RZUA 3L1VA 4W8OA 4IIGA 4ARIA 4FJ1A 2GEUA 2O8VA 1OUMA 3TLBA 2FMKA 3DWIA 1A7AA 4F9GA 1PSWA 3JQ8B 4YVFA 2RKOA 4BLSA 4J2HA 4PIMA 2DHEA 3CIOA 2XDQA 3G9ZA 4KODA 5T6BA 1U7ZA 1RRMA 1SPBS 5FA8A 4GVLA 521PA 2FEXA 1EGHA 2PH5A 3FRJA 3P9XA 2IW1A 4WACA 4PZYA 1ORTA 1TC1A 3I23A 1BE6A 1E6UA 1ESZA 4NCNA 4ZVSA 4D8WA 3L0DA 3FSGA 4LVUA 5E1OA 4YLGA 1U0GA 1O5TA 1G8KA 3NHFA 2PH7A 4MVJD 1E5TA 4MP6A 3NWBA 4M53A 1ZBQA 4IMIB 1L8XA 2OWDA 3D64A 1EFAA 3W5AA 4C0QC 4MQMA 5JCOC 1KDOA 2PRZA 1HMPA 4NZOA 4LNUB 3UUFA 3ZGLA 1BJRE 2EW8A 2QRVA 2AEJA 3IA7A 5BNWA 4EX6A 1S2NA 1TFUA 3TUIC 1K68A 3V97A 3TNJA 3UT5A 3BDAA 1RWMA 1KK0A 2BR3A 4J0FA 4R69A 3SBXA 3T1OA 4DGQA 4HI0E 1UBGA 3MB8A 1D4FA 1BHSA 4G5FA 1SWVA 2VAPA 4PSVA 1NPDA 4ZVOA 1P4JA 3VU1A 4D25A 4ZQEA 4WESA 3ICQB 4KR9A 3ABIA 3UBTA 5H5JA 3B3QA 1L7EA 4QARA 3I01M 3N2EA 1OA1A 4TTTS 1IM8A 2CF5A 2B83A 4BUCA 1Y1LA 1P4SA 1NMEA 3HU5A 4LV6A 4UEWA 5CA0B 1ZHOA 4ZAYA 3VMMA 1AQNA 4OQDA 1G55A 4LJLA 2PZEA 2GS9A 4JT4A 4H17A 4L6IA 4IICA 5CA1A 5AI0A 2HLHA 1EQ2A 1THMA 3EGEA 4EO4A 4DV4B 4NLLA 2WPNA 4EI7A 3I0ZA 1RM3A 3ZWBA 1NI5A 2D13A 4DIDA 2ZYGA 2VNKA 1DEAA 5JDIC 1LPPA 5KYXB 1SUBA 5BNZA 4Q3OA 2GM9A 2O5RA 2G9RA 5T67A 3YASA 4MEAA 1Q0TA 2VT3A 5CFRA 1YVPA 1QYCA 1VC2A 1T9HA 2CMFA 3REQA 3NALA 1CT9A 2RBKA 4U63A 3MTGA 3TDNA 1OCEA 4B43A 4YMWA 2OCXA 3KHKA 2OYRA 3MEQA 1T9DA 3WADA 3O0TA 2WZDA 1QE0A 1V8BA 4DSTA 2EG5A 3ZHBA 1GQRA 3IP7A 3N2GA 1F17A 1N5LA 5DN6A 4JJKA 1MQSA 3E7WA 4C6TA 4P6VF 1GNTA 1OVGA 3QE9Y 4FZVA 2GBPA 4B75A 1WVMA 1XCLA 5KHLB 2X42A 4JJFA 1ICIA 2A4KA 3G13A 1KOLA 4AZTA 2F3SA 2ZCUA 3LUGA 3WQBA 3PUIA 4MZXA 4DDKA 5HNKA 1XMSA 1F8YA 2EIHA 2R9VA 3JXEA 4TWAA 4DLVA 2LD4A 1E1CB 5JU6A 1B0AA 1AZTA 2WIKA 3KTDA 1P5RA 2Y4NA 4WT7A 2DPLA 4L4ZA 4XTRA 3UJ9A 1H4QA 1CP3A 2XQVA 5BRNA 2GJ4A 1M83A 4HRXA 5D1NA 1OU0A 2CVPA 2G7ZA 2WHRA 4I46A 4JFAA 4AMZA 2NO1A 4DV0B 1YJQA 3HP1A 4CQNA 1YJ8A 4QT0A 4J75A 4UCWA 3RROA 5BSRA 1NUSA 1GUFA 2IU6A 2J3EA 2ZT6A 1RC8A 1K4KA 2YXNA 3C85A 4YRBA 4P0TA 3FNRA 4IRUB 5DT9A 2E1PA 1GPJA 2HEIA 3DVQX 3JAWA 2CDNA 3KZCA 3MTIA 5FOTA 5D3KA 1AMNA 3AETB 3FLAA 3FDFA 3I9KA 4TYWA 3QYPA 4UFPA 4TRJA 1FXUA 3DO5A 1DJOA 2XADA 4LGYA 5AYVA 3U2QA 5M7EA 1SB9A 3LLUA 6YASA 2Q9AA 1CYEA 4TROA 4JX8A 1G7CA 1RXEA 3MLAA 4TGLA 2XCIA 2A92A 1N5DA 2GBLA 4UBLA 1KQFA 1Z0JA 3H5AA 3DZIA 5FA6A 3RGGA 2BBWA 1F6WA 1MW8X 5DDIP 4U5XA 1V4NA 1N8TA 3QJYA 3R20A 4M21A 2RHOA 3WLMA 4WBNF 1Q12A 2R5WA 3UC5A 1FRVA 4NNOA 1ZH6A 2HIMA 2QU7A 3I9NA 1ZESA 3T7JA 4WVLA 2XUGA 1M34E 2YHIB 3IIMA 3JQEA 2IUUA 2W4MA 5KWSA 2ZOSA 4W63A 1LTKA 3F5SA 3HV0A 10MHA 2QJFA 3EVDA 3GW8A 4DLKA 5F9FA 5B1DA 2QPAA 4DG9A 2EBFX 5KOJA 1QANA 3D4OA 4N01A 2CVQA 5IDQA 1AJEA 5IDVA 5CFPA 1QV6A 1KZ4A 2V7QA 1T9CA 1YDGA 2FG7C 3DKVA 3PNYA 2HNAA 4UJ3A 1RAHA 4DKXA 1MH9A 3RO7A 3ZZ1A 1E0AA 1C9DB 4GNRA 2C7BA 4YAFA 1N7GA 3EWIA 3SQDA 4PV7A 3E35A 2RI6A 2DGDA 2FDRA 4KSCA 3BMCA 4DR5B 4XVUA 4EKDA 3IP3A 1BFKA 5KKCA 1JDPA 4UNSA 1P3Y1 3TTSA 4Q9AA 1DE0A 4EQ6A 5HIKA 5DBOA 1KETA 4OJQA 5TX7A 1AQYA 3NRBA 1BX3A 2OLKA 2VDWA 4DMHA 4RANA 4EKIA 1U8UA 3N2KA 3KXIA 4ZVQA 1NKTA 4GKJB 2WD7B 4OK5A 1G63A 1V26A 3OKCA 4RQTA 2WJZB 4AG6A 2PWZA 3PYLA 2WM3A 4O2BB 3GT3A 3OM9A 4U1RA 2NZWA 1EFDN 2H2IA 3K92A 2VYQA 4TKUA 1P5ZB 1LX7A 5A05A 4EL0A 4G1VA 2FMUA 4DV2B 2BH2A 2ZQZA 5ELMA 2DYKA 3ONDA 2B6NA 2EZ4A 2HYIC 1FBNA 1E64A 1R6BX 3NVMB 2NXNA 4I9UA 4WA8A 1QYRA 4G4GA 1PJQA 1LK5A 4O2AB 4TVKA 4WKCA 4GZMA 4RTJA 4TN5A 4I5EA 4K5QA 1O6ZA 3KQSA 3M4NA 5U1PA 1FQJA 2PX0A 1C1DB 2V96A 4ZOEA 3MGCA 2CLLB 3L7IA 2EJUA 1XN1A 4GOXA 5F9MA 4BVBA 5IARA 1GT91 1C1XA 1W4BA 1T13A 2H1HA 2EHDA 2PU7A 5GONB 1CUGA 3RTDA 3PNKA 4KV9A 1TUGA 4ZGWA 3AVXA 3L49A 3FBWA 2AOUA 2J67A 1TQHA 2HSJA 1FVXA 2HCBA 2XQFA 3EK2A 4EVSA 4PY2A 3H83A 1GAWA 1ZC4A 3R09A 1T1SA 4BASA 2JGLA 5E3JA 3EPHA 4CLEA 2O1SA 1Y3IA 2R7KA 3BAZA 2UYCA 2JEYA 4Q4AA 2YJNA 3LDUA 2AXNA 3F7NA 2QUBA 1DFHA 2FSSA 4PQGA 2V1UA 3BGOS 1JMVA 2OGUA 3DLBA 2C7VA 2FZEA 3CC8A 1NRWA 1PU2A 2QT9A 1RRGA 4H31A 5EUMA 4UM7A 1OVMA 3KWJA 4XWAA 3RYHA 2ZZMA 4JVLA 4U2BA 3UK7A 3FYTA 1UPTA 5CT4A 5ICMA 4ZV7A 4MVXA 2CMGA 2OV6A 4IDOA 1AT1A 4C4AA 1P44A 3H2IA 5ELXA 2GD0A 2GH1A 1PUJA 1GZ3A 1P81A 2AUNA 2V7EA 2OHXA 4X1KB 5J63A 3VAYA 3MUOA 3ASVA 4RTMA 1NRIA 4NBLA 2W70A 3IIJA 2HOQA 4QG7A 4AYXA 5A0TA 4DM7A 1F06A 2E1RA 2F1RA 2G76A 3X3HA 2P35A 1J0XO 2G04A 2I87A 4IWXA 5JG7A 1FDRA 1LXCA 3ZBPA 2ZRDA 1N2HA 2P9HA 2G6BA 5D87A 2Q9CA 4K9OA 4YCSA 4AYTA 1KJQA 2IIQA 3UPTA 3F3KA 3X1ZA 2XVMA 3MFQA 2JJ2A 4FE3A 2VJMA 3LSTA 4DFDA 2A6PA 1YULA 1Q3HA 2A94A 3W3AA 1Z8FA 2ZBVA 1UKCA 4N0DA 1AU9A 4R40A 3MOGA 3ANTA 1BS9A 3RYIA 1NYRA 4YP5A 2V54A 2IYRA 1QR2A 3DMRA 5GV7A 1CB7A 1CE8B 2H5LA 2XPCA 3LRTA 2ZVJA 2IQ5A 5ALGA 1JSRA 1YC2A 4MQ5A 1HT3A 1L1FA 3ZYCA 3GCXA 1KH2A 5L7YA 4U7FA 1GR1A 1NVDA 1G20A 1JILA 4GNKA 2AX4A 2OZKA 3KM0A 3AFMA 2EL7A 5CEFA 1IEXA 3IQFA 4MYHA 4BQPA 4FEGA 5KTSA 4PZEA 2WNHA 1QK5A 2Y1GA 3A6PC 1I2CA 2B8TA 2AOWA 5IKEA 3ZWXA 2Y0CA 1VSUA 2G77B 4IH9A 2JATA 2XRMA 3P71T 3VUFA 4EG6A 1BXGB 5K45A 4YJ2F 1QIGA 5ESWA 3PEWA 2QD4A 2V6MA 1L0BA 5T4EA 5BV8A 3Q3IA 3WC4A 4GPAA 1TIBA 2C2WA 1OXBB 2FJUA 4AY6A 4EX7A 3HA3A 2QT1A 5I8ZA 1XHFA 3MXTA 2R00C 4OBEA 4FHGA 3SS9X 1MH1A 2V5AA 4GXQA 5CFQA 1DKNA 2I6FA 5I9BA 3BD7A 4HLUC 3EMDA 4Z7NB 1CQWA 5EVCA 1ICEA 3L5KA 5JCJA 2PL3A 5IM4F 4OHFA 2SBTA 4R6WA 3DTVB 4FGZA 4IGIA 3UENA 4GOOD 5KJ1A 5FUVA 1GZSA 4UKDA 1U2ZA 821PA 1UFQA 3NM4A 1P1HA 3I9OA 3UXHA 2BDUA 1Z7BA 4QJ5A 5KEIA 3H3JA 1RYEA 1XZBA 4N3BA 1V7CA 3PQ5A 1AVTA 3HU3A 1RACA 4Z86A 5FNZA 3DMTA 4UW9A 5A4DA 4NH4A 3OC0A 1E20A 1XEXA 3DKKA 1A9RA 1YS9A 1IPFA 2GCIA 4CTKA 4Z0PA 3X1DA 3C24A 1M6EX 1RQRA 3QPAA 4URHA 5TY0A 2UYGA 4DLSA 1GPKA 4BNZA 3LBYA 4K03A 5A5FA 4UTXA 3HO1A 4PCLA 1PWYE 1LW6E 1CFZA 1PFWA 1SIOA 2PXXA 3QVGB 4PYIA 1MA0A 3PICA 4HNTA 4WN3A 4HVAA 3ZE0B 3GPDG 1Q0RA 1SEPA 2GF9A 2EP5A 4YCJA 2RHLA 2VL7A 4KH0A 4BO6A 1AS2A 5FPPA 4GU5A 2P67A 1KPGA 1NFRA 1WX1A 1XL1A 3BL5A 3N5CA 1IJFA 4CCWA 4ZPJA 2FX3A 4NJOA 3NORA 3ILXA 4YCMA 1QKKA 1KEVA 1T5SA 2EXXA 3O75A 4NV0A 2JBHA 2ZI6A 4GKBA 4P34A 5D5HA 4J43A 2WQ7A 3FLMA 5IN5A 3N7TA 2JFYA 3FWZA 4GYJA 4F1KA 2P65A 3IBCA 4DDTA 3DEHA 2OD7A 4I1PA 3UICA 2DBVO 5EXDA 3JD1A 1E7MA 5ADVA 2WFZA 4QFMA 2WA2A 4GFDA 4EB6A 2HJGA 4P2GA 4A9AA 1IHXA 1XTVA 2ACKA 3W5JA 2Q50A 4EG0A 1QV7A 4KXUA 1QPBA 4JD5A 1Q91A 3TS1A 4N5IX 1LNZA 2TYSB 3EODA 3O21A 4PFQA 3NP7A 3OKPA 1JPUA 3ACDA 3VPCA 1MENA 1GCIA 4FSXA 4RDCA 3BIOA 3PITA 3GJ4A 1N1DA 1XGKA 5J23A 3I4CA 3RJ9A 4UMDA 4G5GA 1B1AA 2AW3A 1X80B 2XDWA 1NNUA 1E4VA 1W8DA 3ETJA 3QOXA 5EZYA 3BRCA 3E9RA 3OT5A 4ICIA 4NY1A 3HBAA 2OV1A 4XARA 3SDBA 3UJCA 3TEJA 2IHBA 5LP1A 2P6PA 3I32A 3JQCA 1Q1EA 2P90A 4RABA 3K05A 2VPYA 2DPXA 1KQPA 3OIUA 3QPUA 5GM2A 4G65A 1CJMA 1NQXA 1ZY2A 2NSDA 3PNQA 3S6JA 5ER6A 5JAUA 3G2QA 3LCMA 2DQYA 2BZ1A 2ADFA 1YASA 2EARA 1GY8A 3ETHA 3LY7A 3TZQA 2GYVA 1FEZA 3LY9A 1YRBA 3KQLA 5EQTA 2NP6A 2WUDA 3VHXB 4P98A 1D04A 1OFUX 1N1GA 3EH1A 2PKEA 1XAGA 3ZYZA 3RIEA 1USUA 2P3QA 4Q7KA 4RIEA 4B3TB 1V41E 4DJJA 3HDTA 5DGCA 1NC1A 1QKJA 2JAWA 5CM8B 2QLBA 4JXJA 1HR0B 2EWVA 1VXRA 4YJGA 3RS8A 3DAOA 2VDMB 4OI0A 3BQNB 3QKSA 4P4GA 4M9XA 3PT9A 4XOUA 1OA0A 1JHZA 2HJSA 5JZ9A 4LHZA 4V2IA 4Y6SA 5A5GA 4AX8A 1P1JA 1A5AB 3AHEA 3ICPA 2HA3A 4BE9A 3DVSX 2AYZA 3E9NA 1WKCA 3PUXA 1E4EA 4GSLA 4OUKX 4BFLA 3F2VA 3MQ4A 5AUNB 4BY9E 1TPYA 3KYCB 3MJTA 1HNXB 1FLVA 1K6EA 2X8BA 3M6VA 4FXPA 4XDHA 5CT9A 4JGGA 5T4BA 4HUQA 3TW8A 1DEXA 4AW9A 1AUPA 4I4TF 4PAOA 4D1YA 3HEAA 3KYJB 1HETA 3PU6A 5LQNA 1RPAA 4DN6A 5CGZA 1DAHA 2JFXA 4JEMA 3ZCPA 1S02A 4WERA 1KI1A 1N2SA 3GJ6A 2R68A 2ZIXA 2EF1A 3OMLA 1SELA 3ORQA 4FNGA 1JZTA 4R7ZA 5E7MA 5AQ1A 4LJSA 1KXZA 4U0KA 4ZCIA 3IR6A 4XI9A 3LVQE 4WCVA 3QLUC 5NULA 1CJVC 2ZUFA 1XOIA 4E3ZA 3II6X 1GQQA 1JHDA 4H6VA 4ND4A 5GZ6A 5ULLA 3CVVA 4CZ2A 3GOHA 1TCUA 4S1TA 1N8NA 4OBBA 3T35A 1R0LA 3WRYC 4JX9A 1QUFA 4U7WA 4RAQA 1NN0A 1YUMA 2F1OA 4YHBA 3SZGA 1BQEA 2IYWA 4PE5B 5CYOA 3AJRA 3PDUA 1DAGA 1I0LA 3OBBA 1Y48E 1CEYA 3ZTTA 3AINA 5AVXA 4XPIB 2PXAA 4Q66C 1J39A 6AT1A 5EJAA 5C3MA 4BKPA 4O6VA 4EW2A 4HKTA 1CERA 4L72A 1XEFA 4KVAA 4O4HF 1KR2A 1J42A 1OU4A 1UBKS 4GBGA 3ZI0A 3K5HA 2BTEA 3EY4A 2B3TA 1J9ZA 2XAUA 3JSXA 3CUKA 4IM7A 5F5LA 1MZVA 1XQXA 1JDSA 1QG2A 2EBHX 2G4CA 2VJDA 3RU2A 2H4ZA 1P9LA 1WRBA 4PZZA 2Q6OA 2HDNB 2O8EB 2C99A 4W5QA 2DCUA 3DA8A 4CQLA 1V43A 1H6CA 3CURA 2IPAB 4PINA 1E4YA 4IJWA 3E7FA 3Q3GE 2H11A 3I0MA 1FXWA 1GNQA 1L6RA 1FYWA 2RONA 4V0NA 3QUQA 2O0JA 3STHA 5IFLA 1LX6A 3VR4D 2IW3A 1MB0A 3LIPA 3LPLA 2FSFA 4OJYA 4AJJA 1M2OB 4FR5A 3WGVA 2BKEA 4BN0A 4BNXA 3PNMA 4BNGA 2QD2A 5LM3A 1NF3A 3IB6A 3IT0A 3B5JA 3B51X 3L6EA 4GH5A 3GOQA 5B6JA 2ZUDA 2AWNA 3ZE9A 2ZE5A 1MXHA 2VF8A 3FCUB 1RKQA 4HC4A 1YI1A 1YRAA 2R6FA 3EUAA 4EUEA 3EN0A 4HDCA 2W6QA 2AYYA 5IJ0A 4Z4GA 5DCUA 2CXSA 4CDNA 3NB0A 4LZNA 5F77A 3RVBA 3OQPA 1QYVA 4IX1A 2NQ2C 4CKEA 1T5TA 4OHYA 3RS9A 3T7EA 1Y1KE 3MWEB 1M0EA 1GKUB 3VOBA 3OTHA 4X7RA 4YCDA 4DLWA 2AD1A 4X90A 1A7KA 4H3KB 3RDPA 3PXUA 5K1ZA 4W5NA 1LLCA 3C6BA 3PE4A 3RW9A 4F06A 3UAWA 1XD2A 2ZJAA 5FCDA 1X0VA 1H66A 4RA9B 4ZAGA 3O8CA 2ZYTX 4PYMA 1CQIA 2J32A 2NVUB 2B34A 4N0PA 3FAKA 5DJ5A 3ADOA 1YA8A 1IM2A 1S7CA 4CMEC 4JWKA 4R1OA 4YRDA 7REQA 4HGZA 4QJ4A 2ZR0A 1L7RA 2P4UA 4FHDA 1XXHB 3EB9A 4WOKA 4JLDA 1N0IA 2QVBA 1HURA 4HFJA 2DJ5A 3EVTA 4NBSA 5E2BA 4PX9A 4DDVA 4UUMA 4L51A 3SJUA 1RS0A 2VA8A 5G40A 1KORA 3GUUA 4H08A 5EE3A 3W79A 4KWHA 3L1JA 4OL9A 3B2QA 4S12A 4QFCA 2YY6A 3IE1A 4INJA 5C1PA 3VKGA 4NHOA 1MDFA 3GT4A 4ZT2A 2WU0A 2VTBA 1Z22A 5K3BA 1OV6A 1GGMA 4MW1A 1GHTA 1G8YA 3RREA 1Y3FE 2B4QA 3ICCA 2VSFA 4JODA 1HQDA 4X8LA 3L8YA 1X7WB 4OGWA 5EP2A 2J7KA 2OUKA 3FWNA 1UBUS 2VJOA 3DYIA 1WMEA 1JKJA 2QTFA 2NTEA 4WTOA 1Z4QA 4ZJPA 4A8HA 3HCOA 4I8XA 4PHHA 1U94A 1UOPA 3PHCA 4YC7A 1G19A 1EM8A 1G3IA 2CBZA 3MWGA 4LZOA 3T1YB 2JPDA 1J2TA 3KV1A 2FWRA 3OEHD 3ID6C 3AVPA 1JG4A 2P9EA 4EAAA 5KYWB 3NC1C 4MYCA 2P0AA 2H2WA 4D81A 3VNUA 4TS1A 3AFGA 4G5YA 4KJZA 3VPHA 2G25A 2QAGC 5F7OA 1SUCA 1GFZA 5IYZA 3VH2A 2Q0HA 4U8HA 1UBLS 3AFNA 1SR8A 3PDIA 4RA6B 2QPLA 4Q9IA 2I7DA 1FDUA 2FWBA 4I5DA 3T5TA 2B8JA 1A82A 4HWOA 4IRMA 6ADHA 4EHLA 2YWDA 3SX4A 3ABOB 5K99A 4CM4B 1WHTA 5LNK1 2O8FA 1LK7A 1ZN2A 2JGDB 3PZBA 4JSRA 2WIFA 3MD9A 5JCOA 3RHSA 3L8HA 4YP7A 5D8DA 1FUUA 3LQQA 3NT2A 3V1TC 3VSAA 2HREA 3WHLA 2ZDGA 1U6KA 5LXTB 2OG1A 2GZHA 5I47A 1ZYUA 1EGVB 3NKFA 3SFZA 4GX0A 2Z58A 2QVLA 2BFWA 3K3PA 5CK4A 2ZIVB 2VRWA 4NNPA 3TVDA 1H2AS 2UYOA 5TE9A 2H2AA 1Q6ZA 2PHZA 3BH7A 1WMDA 5CDYA 1N6KA 4D57A 3REFA 2FPOA 4YRSA 4AUNA 1HF3A 1KEZA 4FZ3A 4G9EA 4J76A 4EA7A 5AM0A 4G2TA 5GZ3A 3OFND 1QVRA 2XMPA 4JXKA 2VYVA 3JVDA 3TGWA 3EZ7A 3GLQA 4FZJA 1TVMA 2QTHA 1UJBA 2UVPA 1JECA 3AUFA 1JA0A 1Z2DA 2WKWA 4F9TA 4V03A 2OV8A 3DZFA 3QXSA 4QGSA 4G9BA 3V9PA 1D2AA 1Y6QA 3EXAA 4F5ZA 1E98A 1YAJA 4NAVA 4Q1FA 4JEIA 4IXMA 1KDRA 1H1LA 3UK1A 2F3UA 2JAHA 1L5WA 1XZ8A 2PUAA 1MAVA 1DWQA 4B4WA 3HKCA 4P81A 4B4UA 2FOIA 1TI7A 4CKWB 3B6EA 4NMHA 5AKKA 1FJGB 1NV8A 5FYQA 1YCDA 5KQRA 1JEYA 2OBFA 4M4SA 5JDIA 3VVBA 3DE2X 2FUG6 1Y1TA 3P0HA 5DB4A 4EI9A 1RWWA 1ID1A 1HDIA 2P3OA 3KALA 1U99A 1H2BA 3LVBA 1JAIA 3BGVA 5DXFA 2MSDB 1X1SA 4A0RA 2BFBB 2OZEA 3GVCA 4LMPA 2AOTB 4B7XA 1U4NA 3EF1A 4QGBA 5K3DA 4M76B 2QJTA 4XYBA 1UDBA 3DZKA 1EDOA 1RJDA 3DB2A 1OXSC 1GUAA 1JQKA 1OF1A 3WGZA 3D6UA 5JR3A 1HE1C 4LNAA 1I4EB 4OI2A 1T5OA 1EAYA 3ZK7A 4NHEA 4BWYA 2JJQA 1FP4B 3AEKB 3QBEA 3B6MA 4GEKA 4MW5A 2HA2A 1LQUA 2X8JA 3NDJA 4QOIA 1VP3A 2XKAA 3OIFA 2H7XA 4HDKA 4HP8A 2Z1DA 3KL4A 3M82A 2IHTA 4PLTA 1FDWA 1XP5A 2YBEA 5K6AC 1YOVB 3TDMA 1WLSA 1FU4A 3W8RA 1W96A 2E49A 1WB6A 4W6ZA 5BPFA 1FNDA 1FW8A 1RWKA 4AKIA 5BW5A 1D9XA 4FCTA 4R2XA 2HYDA 2XWJI 1TB4A 5A2GA 1KYVA 1W2WB 1G8AA 1N9GB 2UYQA 2YIMA 1Z3CA 3CW2A 2AF3C 2A0UA 3O2SB 5HQ3A 3IQZA 1CCWA 4IILA 4O2BF 3RYTC 2FW9A 1DIBA 3WRVA 5K0CA 5GGYA 1M8GA 3H42B 3R7LA 3O2QB 3ROGA 2W9XA 1ZRHA 2Y27A 3UMYA 2WMYA 4RFVA 2O1XA 3I6ZA 3KUXA 4P5DA 2GVDC 5ILQA 1KOJA 2F00A 1GAJA 3PXGA 5HRAA 3A9CA 5IF9A 4WADA 5IKMA 4DMLA 2GPSA 1Z0KA 3U17A 1HT2E 3GZTB 3NRCA 5JNUA 4D6XA 1P19A 3O8NA 4YAGA 2NU8A 4L3WA 5LPNA 1UMBB 4PYRA 1N6OA 2OY0A 2C9ZA 2HPVA 3OF5A 1BO6A 1M8PA 1NURA 1VECA 1X14A 3P2EA 4IO0A 1Y5LA 4KN8A 3G2MA 3FSJX 4KXYA 1TIPA 1Q16A 5JSZB 4DQ0A 2VDUE 1PV2A 3P0JA 4WH0A 1DDOA 2FZKA 5EWMA 3WBBA 1N2ZA 1P4HA 1X1QA 3GV0A 4TVSA 2ORED 2CHVA 5HUQA 2W0SA 1EFTA 2VZLA 3Q6IA 1GKYA 4FR0A 2Q2NA 3FY4A 2RH9B 2VWGA 5K0FA 4QFBA 1FW6A 4CQMD 2VDOB 2DU8A 1GYPA 4YJ3F 4KR6A 2OKGA 5K0EA 3GRPA 3L0YA 1RFGE 4JC8A 1AQIA 4IOKA 4D9CA 1WY5A 1Z73A 3I76A 4FN4A 3M6XA 1HBJA 2BKUA 3CT4A 3JQPA 1AHNA 4MROA 5TV2A 3R3UA 2OD9A 5TS3A 1CQJB 5E9QA 5J2UA 3V8MA 2HO5A 1EFKA 3R9KA 5AJTA 1DCFA 2AFIE 1IRIA 3AP2A 3WLNA 3K1AA 5T4HA 3CR8A 1GA1A 5EOVA 5LMZA 1B26A 1VYUA 3GCZA 4HWRA 1Q2XA 2BD0A 1FTWA 2ZJOA 4BKOA 3G89A 2R1VB 1XBTA 1ZM9A 5BNTA 1K86A 4UM8B 3E48A 1ND6A 1VL5A 4D45A 3HN6A 4DR6B 4ACAA 4CCAA 1IYZA 1T34A 2NOAA 3BSYA 4QTZA 2VLIA 3GY0A 1TC2A 2GSWA 2ZULA 5F7ZA 4B6PA 4CE6A 4LSGA 4TLCA 3DONA 1EXVA 4A0SA 3T7RA 4ES6A 2IZ0A 3TOZA 4C7OA 3I53A 2FRVA 3DULA 4RQBA 4F3KA 4CIVA 2X5KO 2WP8J 4EF6A 1X8XA 1QMPA 3RKUA 1LBEA 3I5AA 3L4SO 3N8KA 2G8NA 5I7FA 1NG9A 5CLFA 1MPTA 1Y7IA 2EHJA 3OOWA 4ZU3A 2LWIA 3GFVA 5AKIA 2BMFA 4R1UA 1G2PA 4J0EA 1HDZA 1DBQA 4QXMA 1OJ7A 3WBKA 1M5RA 4QDZA 1LEHA 2XGMA 4Y2RA 3U0BA 2GPNA 4DLPA 3C8DA 4LOJA 1JG3A 3C70A 4QDJA 3T9FA 2GK3A 1JF8A 2GDZA 4IH1A 3NMUF 1OXXK 2A9OA 1J4AA 3ZKAA 3Q5DA 2Y0PA 2Q5IA 1R0WA 4Z3OA 5TVKA 1EU1A 4RJIA 3KOWA 3PS9A 2COEA 1CUUA 4HX9A 3QLVA 1Y0BA 2CE2X 3BK7A 3MYYA 1ZMBA 4Z1OA 4CFZA 4N76A 4L27A 3TR6A 1E6LA 5H16A 4YRJA 1MOSA 4PXYA 3HR4A 4OFZA 4XQEA 4N82A 1MBZA 1ZWKA 5FBKA 5GJCA 3L04A 3QMMA 5BT9A 1QZ3A 1UMKA 1ZGAA 1TM4E 2Z30A 2C5AA 1X8KA 3SIXA 4AROA 4C30A 3VTKA 1XYVA 1XC7A 2GD1O 1QS0A 2SICE 3B82A 5K0BA 4PNZA 4YALA 1Q44A 3DYVA 1U7DA 2BEVB 2Z04A 2OECA 2CJWB 3LSYA 2VRCA 2BP7A 4JEHA 3IAS6 3L6CA 1YRLA 4OLFA 3AP1A 1Y4DE 3ZZNA 3ZCQA 2HY7A 1KDVA 1ZCZA 1SKAA 1CY1A 3UJ6A 3PEUA 2YVLA 2QRHA 2ARKA 4PPGA 2UKDA 3AHIA 3K5WA 1E1KA 4JLSA 1SBIA 4LSZA 4QU0A 4ALLA 1REQA 5ICSA 2PH1A 3F47A 3W6ZA 1FJ2A 4EA8A 3F8TA 3I9MA 1Z75A 3ANLA 4ZEVA 3F6CA 1M7BA 2BGGA 2A1TS 5DWDA 4TL6A 4QDUA 5BR7A 4IKEA 4NOLA 3INNA 2OFFA 3BGWA 1VM6A 1VL0A 3BJZA 3SR0A 3WB9A 3OEED 2IY8A 3ENZA 2UXDB 2BRUC 1LLUA 2O7VA 2ZUEA 1V2GA 4GLFA 2C9MA 3H2YA 4RK7A 2HM7A 3U3XA 4QWMA 5DGIA 3RAJA 1Q1QA 5BRAA 5JSQA 3OWHA 4MULA 3V7FA 5CM2Z 4KMSA 1NSYA 1QAMA 2QYHA 1TRKA 1E5VA 3KTAA 1PLJA 2QTMA 1EJBA 3OKFA 4NBVA 4BE7B 1IQ0A 3V4SA 3WRWA 2HUPA 1A27A 2X40A 4MW4A 3L8ZA 4C5AA 5HCUA 1OC4A 3OU2A 4YXWD 4MIYA 3FFWA 4WLEA 5C8YA 1KAHA 3T0FA 2SECE 3S0JA 4C05A 5C8DA 2GN4A 4RGBA 5AVWA 3U7GA 4FFBB 1QKIA 1C4KA 1F2VA 5DMHA 1H2FA 3FDXA 2WB2A 1LQ2A 2R47A 3IPYA 4GD3Q 5BYBA 4RF4A 2HCFA 1PQWA 4XCVA 5FTMA 3KQWA 4D56A 3NGXA 4DHWA 3IMFA 5AI8A 5JZSA 2KI5A 1M2KA 2W93A 1Y9DA 2FCAA 4A8PA 4TSRA 2PMEA 1QH9A 1RCUA 2FFAA 2ZXEA 2D1FA 1JDJA 3H1FA 3ZHXA 4XUGB 3VDNB 2VZEA 2R97A 1KC1A 1YH3A 4ZT4A 5KTTA 5LWHA 4KPUA 2J7PA 2WJ6A 3S2EA 1SCIA 2A33A 3K32A 3OHSX 1EWTA 4O2LA 3M70A 3AX6A 4YAIA 5TPZD 4AXXA 1FLAA 1UR5A 5A2QA 4MW2A 2BZ0A 2HRBA 1V6AA 4TKVA 1KK1A 1QHHB 4BCCA 1ENZA 1YB1A 3WJ7A 4G5QA 3W5SA 4CT5A 3R4CA 4IUDS 4R7GA 4DIFA 1A0OA 4PG4A 3ZKWB 5HVNA 4ZI5A 1ZJYA 4ZFNA 4JJ8A 1TM7E 3KR9A 4H15A 1IUKA 1XFDA 1MB3A 4EM6A 2ZTLA 1PSZA 5E0OA 3A4NA 4OL0A 2KW5A 2IHNA 2ZRGA 4DILA 1P0PA 5LLSA 3OD1A 3Q8KA 4R71A 2YJTD 4TLDA 4M7WA 4IZIA 1LSJA 3MWYW 3PVCA 2QDKA 3DBOB 3JASA 3SJBA 3PUKA 3UANA 1HPLA 4JLPA 5DI3B 3LX8A 2V7TA 5AVJA 3E22B 2EWMA 4J6FA 1B23P 3MCVA 4CGYA 3U7QA 5G1PA 4DB2A 3NBMA 2J59A 3ZDQA 2FLKA 4CFSA 4DABA 5AFSA 3PX7A 1RHMA 1FUIA 1Z16A 3I92A 2P4QA 3CTMA 4NE2A 3ZJ4A 4BNUA 3WISA 4PGFA 4DCJA 2NPIA 3IEXA 2X6QA 3NHLA 3GZ4A 3NIDB 1IOVA 4CNBA 4EUNA 3S5JA 1K75A 1JFSA 3MJSA 3ZWNA 1RHUA 5CJ2A 2J9RA 1IN1A 3UCEA 1OXKB 1Q15A 4NCHA 1KY2A 4OCZA 1Z2PX 3TQOA 5TF0A 2AS0A 2HR1A 4DQVA 3UT6A 4MKRA 3QGMA 3ADPA 4RGVA 3S68A 1IOZA 3GRKA 4A6DA 3ZVRA 4C88A 4CDRA 5J4YA 2DUMA 2DBRA 2OK7A 2XNSA 3OX2A 1N5KA 4ASUD 1DKQA 1UBJS 5LQMA 5BT8A 2ZWOA 2WSLA 4KEAA 3DLTA 2BZGA 5KAMA 1QH8B 4Z3KA 1GRRA 1T8YA 4HH0A 4NENB 3X2SA 1RXUA 1FDIA 1V7PC 1PZHA 1VRVA 4NMXB 4TL9A 3AF4A 4OMDA 1ZVVA 5KOIA 4GC9A 1OX4A 3HCCA 1TD9A 3K6RA 1VIDA 4K9MA 4PLZA 1L4NA 1SXJE 3L0CA 4PPYA 4WY8A 2WVJA 2WYHA 1RE1A 2JH9A 4NIMA 3S4YA 3ZHUA 1FSSA 3MPUA 3KSAC 1XG5A 2EFCB 2FPKA 3PYMA 5LQUA 2WKSA 2C7GA 2I5PO 4WCFB 3UAZA 5HP4A 3EHEA 5B4VA 2NYUA 3HLYA 4DVJA 1RWVA 3I04A 1FSGA 5FWYB 4HMOA 4RL4A 1BRMA 2O7NA 2Q28A 3BE4A 1PZFA 3V8EA 4UXIA 1Z0UA 3PXDA 3ECAA 4NYJQ 5EGSA 1QU3A 1BS2A 1NW6A 3C5CA 3ZY3A 3ZQJA 1SU8A 1KZ9A 1ZK4A 3O2NA 2X7JA 4LYEA 1YE5A 1M2HA 2I7CA 3WIOA 4JU8A 1KARA 2XYVA 3QK7A 1EUQA 5ALDA 3FXAA 1DAKA 4YFVA 4EI8A 1II8A 1ST2A 2P4HX 2AUMA 3OY2A 4G1MB 4MS4A 3FHJA 4IL5A 4P8RA 4TVBA 5B6PA 2XMCA 2YMPA 4GQIA 2XYGA 2G0AA 4PEVA 1B3RA 3JD2A 4COKA 1L4FA 1Z08A 3V6MA 1UPXA 4FE7A 4RD4A 2PA0A 4FB4A 1KKUA 3HCPA 3GPCA 4E6PA 5EJ5A 1TEHA 3NHSA 3R0XA 4HDOB 4NCBA 4AKHA 4P31A 3A25A 3AY0A 4XAQA 1ODJA 3VOAA 4HATA 3WKDA 5KNDA 4KV7A 3RSLA 3LUHA 3ISTA 3MOIA 3OPVA 1XZJA 2BGUA 5EYPA 2NZJA 1TKBA 3KKQA 3ZWVA 1C3OA 2NO6A 1OFTA 1VZ2A 1OYVA 2O05A 1ZS9A 4XEHA 5BQ3A 5DCWA 2PT6A 2JRCA 4BMNA 5BVGA 3DNFA 1GA4A 2YRWA 3GDWA 4MPRA 5EXXA 3NOVA 2J5QA 2R6CA 4MAMA 2J0VA 2KM1A 3GX1A 3IPAA 1DTWA 2W8ZA 1SK9A 5DCLA 1YR9A 5HOEA 3HFSA 3EGOA 4LRXA 4E70A 4EI2A 2HIHA 1VE1A 4ETNA 1QU2A 3ZIDA 1XRNA 3LYHA 1RLUA 3CEAA 2HADA 3NYIA 3IAM6 4JJIA 4KQJA 4UULA 2BFNA 4X6LA 4GAEA 2RK3A 3O1JC 3TTVA 5K6TA 1PD1A 3CSUA 4RIIA 4RF3A 5DU2A 2YXLA 4B3CA 1VMIA 4RIGA 2IQIA 1C8KA 2WI8A 3U81A 4ZZ0A 5G0WA 4BN5A 3PVZA 4IIBA 1KBZA 4ZOQI 2JI6A 2NUAB 2XCOA 5FLXA 3BMXA 2PGXA 4IR7A 1AGYA 4P82A 4IIXA 3WIEA 1C0KA 1ISPA 4J0HA 5JO9A 1GPAA 4DAOA 1L7AA 1W2HA 3HCWA 3BXOA 3P27A 4IZOA 1TTPB 3C8HA 4RGYA 3H6KA 4FW8A 4P80A 4QQRA 4YACA 3UPDA 4E5SA 1FCJA 1U9IC 4J0JA 3I04M 3KQQA 1JIJA 3GIWA 3O0DA 1OI3A 5JXWA 1UPUA 3NDIA 4YDRA 1TM3E 2JVJA 2DAPA 3CRRA 4IINA 4IIJB 5C37A 1FX1A 1MV8A 3G79A 1MABA 3OMWA 3GLGA 2GPYA 3EQ9A 4XVCA 4I19A 1R12A 2W37A 4I08A 2Q5LA 3O3MB 3LPMA 1SHJA 1TUBA 3HDYA 3IJEB 1CZHA 3AI2A 3MQFA 3OZAA 4N54A 2JIDA 4OJTA 4WCDA 2P6OA 1OH7A 2GWHA 5AHXA 4RWEA 2BUAA 2C58A 4Y1FA 1K4MA 2B4TO 1JZSA 4N8DA 3A9VA 2FMHA 4FYHA 3JVUA 4QBGB 2YS6A 2Q6VA 1YZNA 3PNSA 2BBTA 2DT5A 4BJ5A 4F04A 4ZI7B 2Q6TA 2ZUWA 3I64A 4LC1A 1I01A 2IX3A 4DDWA 2H29A 3Q1KA 3W5VA 2ZI4A 3EAFA 5ALEA 4AECA 1D1PA 1XTSA 3I9LA 4JJZA 5AI6A 4B3XA 4P58A 5CH5A 2CN1A 4IIHA 2JFGA 3WQHA 4OQQA 3NBYC 3BWEA 1BH2A 4OG2A 1YZLA 4WOCA 5A4KA 2XGOA 1AUVA 2C97A 3PDHA 3U44B 2PUGA 4EPWA 3CN7A 2R7MA 5CITA 2JGJA 4WFQA 5GQSA 3DMPA 2VRNA 3O90A 5UKDA 4DLBA 4HWSA 1VMEA 5IABA 4X84A 1G6HA 4J8PA 4HXYA 3UXMA 2A1IA 4EJ2A 3AL3A 4WPGA 1RQ7A 1DHTA 3DFZA 2HSDA 4GLLA 3WYBA 3A1EA 1NLZA 3AO0B 1JMKC 3P8ZA 4YJHB 5T64A 3RUHA 3T3GA 4AY3A 3A3NA 2OVBA 3MAGA 3A2LA 3WTBA 1ESDA 2DJIA 4C3OB 3L7CA 2I2WA 2GM5A 2JZNA 3ZJYA 3GRFA 3P9NA 5TEVA 5CUQA 3B9BA 1MIOA 1T2AA 3FOBA 1GUBA 1AZLA 1U28C 4EEXA 1TZMA 2OD2A 4CGZA 1FYXA 2PFKA 3R8XA 5INTA 4QOJA 3P2MA 3NT4A 1OFVA 3DCJA 5CFNA 3D6VA 2ZVPX 5T3UA 3CM0A 3R7SA 5JALA 4TYPA 2B30A 4PBTA 5TQVA 3AR3A 4EATA 1ODCA 1J70A 2ODEA 4Q21A 2FRDC 3GEMA 1SRQA 1D2RA 2V03A 2VJCA 1ADCA 2Y92A 2ZUBA 3QOWA 4TWJA 4X1IA 1HZZA 2WPDD 3MUFA 4O4LF 5IVDA 3K1ZA 1P6QA 5AW1A 3KWLA 4TKZA 1W4CA 5ALLA 4BGVA 1PJBA 2E6KA 3GO4A 4QG3A 3AF6A 2J3MA 3IOMA 1JHUA 2VT6A 3RVJA 2CL6X 1X15A 2VH2A 3CZQA 4O3FA 4PR0A 1T8WA 3HADA 1RXSA 4W6QA 4B17A 1ORHA 5L9AA 2IH2A 1NW9B 3OLWA 5GGXA 5LXTF 4IDEA 4YHHB 1PZMA 1Y8ZA 5LZ9A 1GZDA 1RM5A 2PZKA 5HFNA 3J80A 3V7NA 2GPAA 5HRCA 1OZGA 4TV8F 2HJVA 2YOHA 1JFLA 4Y7CA 5FKJA 1I2ZA 2X19A 1YJXA 5AM5A 5KZMB 1GGFA 4MUEA 4CM1A 2BKXA 4OGKA 3AONB 4M1SA 4GI1A 2GWRA 3V7YA 4FD3A 1NNI1 2ZT8A 3I9FA 2V7PA 4LV8B 5T6MA 3X0DA 3EGDA 5BYKA 5KWJA 3L02A 4AB1A 2G1AA 5I4IA 2XZPA 3GRCA 2CK3D 3TNDA 4ZYLA 2R44A 4MB0A 1T4CA 2OPBA 3O93A 2RD2A 1PNRA 4D8YA 5L6MB 2N1MA 1TT5B 2ZSUA 4HXGA 4HB0A 2PX8A 3THXA 1NKVA 3ZCRA 1SBZA 4UCXA 1Q3TA 2R7AA 4BNYA 3PPXA 2MIIA 2Y9MB 3G6WA 4F72A 5LIRA 3A6ZA 4EG8A 1AKWA 2DPMA 2YVKA 3H1BA 3N6XA 1U2GA 5IBRA 5IJWA 5JDCA 4F93B 3LQFA 3PGVA 1G7SA 2ZAYA 1MB2A 4DBLC 4E12A 1ZJ5A 4E2FA 3GP8A 1DAMA 4QUAA 2HIAA 1K66A 4IDGA 4UU1A 5LZ8A 3U4QB 3DOHA 5BW8A 2ZZNA 3AB3A 1G6KA 2AG1A 2P41A 3VZQA 3K0EA 2OKCA 1WABA 2QAIA 3D7LA 5IAKA 3B2EA 1RKBA 3SQWA 3TQQA 3IAFA 4DARA 2FSPA 1A98A 3WP1B 1CF4A 3IT1A 2JFHA 5KNBD 2J3LA 3BJRA 4BTLA 1TL7C 3VVLA 1WU8A 1SPXA 2XBLA 3WWDA 3BWYA 3IUNA 2HFJA 2IEDA 3FLEA 2X0IA 4LVCA 5GVRA 1UODA 5P21A 4UFOA 3ZNQA 2QD5A 3NTOA 2JLAA 4QVGA 3RIGA 3PA8A 2GZMA 1R4NA 1T8RA 2J6BA 4M38A 3WB0A 2P62A 3I1YA 4H77A 1QSGA 4F60A 1QLJA 3CW9A 4RETA 3MPOA 2PR7A 4UREA 2AMYA 4YRQA 1FX0B 3A3YA 3QHQA 3M6AA 4Q3DA 2PRKA 2PKWA 4IDBA 1VE5A 2ENUA 5EZQA 5GVSA 1Y6JA 2XODA 2H5EA 3M3DA 3DW3X 2ZU0C 3NX4A 3O82A 3WA6A 3WLOA 4GZLA 5LP6B 5JJ5A 1SIWA 3L40A 3DZHA 1V1MB 4IJVA 2YJ6A 2ZUTA 3TSYA 5K51A 3TUJC 4U7PB 1Q50A 2ZT7A 3BIWA 1R15A 1L5VA 4BWGA 1PWXA 3KUDA 4CMKA 1D7OA 1ZUHA 1YCGA 2ZSKA 3FJOA 2YMLA 1W6RA 4I1UA 2VDRB 5AUOB 5JOQA 4JP3A 3JR7A 4E3WA 2V3CC 2R85A 3ZK8A 1SD2A 1D2MA 1R5BA 2BFDA 1ZL2A 2Q2VA 1S2IA 2WU1A 3BKWA 2A7XA 4R2WA 3S40A 2JCBA 3WG9A 1SQSA 3FTEA 2PFGA 1GRVA 3ES9A 2UAGA 3BHIA 5ALKA 4PZPA 3Q0IA 2GN0A 2JHGA 4HTFB 3WGNA 3TTUA 4HFRA 3RJMA 1L6IA 4F96A 1Z4MA 3GP3A 3WIDA 1N77A 2PGOA 2VOEA 5HM8A 2X0FA 1VPLA 3JQAA 4Y9SA 1KZGB 1DFIA 2ZVQX 4ARUA 1I5OA 3AMVA 4WHMA 3QVKA 4EOGA 3OZ7A 2OO3A 4RK0A 5JLAA 2IGTA 3P9YA 3VR3A 1FTGA 2ZB3A 4ZAWA 3GG2A 3R7WB 4ZO4A 1P7ZA 4I9NA 4S04A 4KK3A 4W1PA 1KNQA 1UK8A 5EXEA 5FFFA 2P1DA 3T5MA 3PKIA 3HVJA 1BWPA 2P3SA 4TS9A 1PW5A 5A9TA 4JEUA 3RNLA 2JGIA 4D9EA 4YJKA 4OK6A 3LFHA 3SR4A 3ROXA 4KW7A 2PSJA 4Y2QA 2XITA 4F8EA 4XWKA 3LUKA 1M8FA 1ZOLA 2X4LA 2UV8A 3FCSB 4RKRA 5DYYA 5K6AA 2LZ0A 2BFMA 3P9SA 4B6GA 4G0ZA 4DMFA 2HFKA 4TYQA 4RD1A 2NQ8A 5H80A 5FHRA 4D0GA 1UQUA 4MJ7A 2HNBA 4FILA 3UNXA 4D9GA 3ZU5A 4LY9A 2H00A 4ARZB 1GPUA 1BIFA 2A3NA 4R3NA 1U80A 2MHCA 5HF6A 5TPWA 1F7UA 3ZHTA 5EJ8A 1SBNE 1K7YA 2WF7A 3K8OE 3OCWA 4RK5A 4YCLA 1OE0A 4BCDA 3W4JA 1C9EA 3CU5A 3E18A 3HZZA 2PX5A 2I8LA 2J9XB 4MCHA 4JKIA 2G71A 4HGYA 1K8YB 1OWOA 2FPGA 5FPQA 3PCTA 4H2DA 5L40A 3GZNB 3R2JA 2IH5A 1IAQA 2Q21A 3TRKA 2IHVA 4GPZA 4E94A 5JISA 1DT5A 1MGOA 4CEHA 1R00A 3LGXA 1JIVA 3OJXA 1Q1GA 4BATA 1A50B 5LOVB 4CLHA 2B25A 2XXAA 1AGRA 1EJ2A 4G4SP 3K96A 1LUAA 2NU7A 2BHRA 4F2HA 3R8FA 4X9XA 4MK4A 2F2TA 3JQGA 2XQIA 4R3WA 4ADSG 1VBKA 3MMZA 1GL6A 2XUZA 3WL5A 5HOQA 1B76A 1YTLA 3LHKA 3QRWA 2FR0A 2WJAA 3R7FA 3SQMA 4ERNA 3OCYA 2Q3JA 1JZQA 5JAPA 3U7JA 3AR9A 2QP3A 1L7QA 1UBHS 4MKXA 4RDHA 5BN4A 4A73A 3F5DA 4GW3A 5CNIA 1ISGA 2N47A 3LBHA 4FMPA 5CGQB 3PUZA 3C5HA 3MS7A 2HWWA 1GTZA 3OM0A 2ODQA 3QHAA 4FYMA 3ZJTA 3E9DA 2IFTA 3L8CA 4FDLA 1SCNE 1QONA 2V3WA 1VRWA 3AM3A 2BFFB 2IOQA 3MTAA 4HL6A 2PGAA 4IH4A 4R8SA 1LC0A 1D7AA 2JI4A 2WKQA 4FMDF 2PWPA 2I3BA 4IMRA 4RZXA 1EP1B 3BAFA 5FV7A 3AKEA 3R3ZA 1PNVA 2FSVA 2ID9A 3FF1A 3NVAA 3P2JA 5IW8A 5IFKA 4JBIA 1X39A 3RS5A 4DIMA 3FRHA 3MINA 1LS1A 2HXYA 2P4SA 5IBQA 4ISCA 3UMGA 1KEEA 3KO8A 1NASA 3B52X 4J3JA 1M2WA 1NP6A 3I83A 3ZWPA 4IDNA 1OHHD 2QQ0A 1PT6A 3IEPA 1HE4A 1TQ2A 1DEHA 3O8OA 2B78A 3R40A 4F4DA 3CB4A 3N05A 3W6PA 4OSEA 4RLQA 3KKZA 1YBHA 2D1SA 1Z5VA 3L0SA 3M3HA 3F4KA 3MERA 4G0QA 4Q12A 4BGEA 4CUJA 2ILTA 1I7NA 2KSQA 3CF0A 1TLFA 3LCVB 4MUMA 5EHQA 5B37A 4C0WA 5COBA 2XB9A 1IG3A 5B2FA 2F4NA 4TXNA 5DULA 4PLFA 1YF3A 1ZK3A 4PO8A 2Q46A 2PPLA 3MLEA 3RVLA 5IULC 3ZX4A 3EPKA 3Q98A 1JG6A 4FT2A 1C7EA 1KGDA 4CU5A 5K4GA 1H05A 1FDOA 4ITVA 4J16A 5LYJB 5BSVA 3N6VA 1ZNYA 4DLAA 3HFJA 2WD9A 3MLBA 1TZJA 5EIOA 1NONA 3WFIA 2W5UA 4F4JA 2A9FA 4MVJG 4KPEC 1HLPA 3ELBA 4MVYA 2WTAA 4QAJA 4KACA 4II3A 1PK9A 4EHJA 4P5PA 4UHCA 3OC6A 4A16A 1X8JA 3LKZA 2J3DA 1WDLA 4PVCA 2NXCA 2JGAA 4D8UA 1KO1A 2ISCA 1H69A 1C3XA 3DDSA 3WGQA 2XBUA 4NYMQ 3LQ1A 1NQVA 4WXYB 5LU8A 1VSVA 3BIFA 5BSKA 2C00A 3VMFA 1XN4A 1DBPA 3JQFC 3K9WA 3U6KA 5EIXA 1T36A 2OB1A 2AG5A 2OO5C 5IDWA 2QJRA 5E9AA 3ORHA 4RPJA 3WGKA 1ODIA 1PL8A 3FNFA 4DNQA 4E5VA 1Q7TA 1NKSA 1KAQA 3EXFA 3UBMA 2FY8A 4D82A 1CRZA 3JARB 5CCXA 4HNSA 2ZM6B 1XU9A 1KDZA 4B8WA 4MGYR 2J6IA 3KPUA 4CWAA 5KUTA 3W5HA 1JALA 3GEHA 1DPFA 1I0IA 1ZGJA 4H1TA 5L3VA 1MVLA 3G5AA 4MWOA 1W1UA 1K92A 1UDAA 3EEBA 5FI5A 1EE9A 3SDZA 3DTYA 3DS8A 5K0NA 3D7MA 3GRZA 1YZHA 4LOKA 4CLOB 1N2CE 2NU9B 2GN6A 1A2OA 3UK2A 1NW8A 3AIMA 2VUTA 1CY8A 1X1CA 1G2QA 1DBWA 2C2XA 1YCFA 1GU0A 3MIZA 1OROA 1JNYA 3CBQA 3KU1A 2A5DA 4H6PA 4HGOA 2BMDA 3MSXA 1HG1A 5ALJA 1CR2A 1YOBA 3RM3A 1AA9A 3PRYA 3THYB 1PEKE 1Z4JA 2H54A 5F21A 3HI4A 5JIBA 1YFKA 4LE2A 5FTKA 2O8DA 3TVTA 4D46A 3HEBA 1WZNA 4JYMA 3K16A 2XA1A 3S2FA 1KY5A 2BHLA 2DQSA 1W34A 1QG4A 3QTBA 2GK7A 4FDUA 4C20A 4HLNA 1JBQA 1NW4A 3NAGA 4N3AA 4N5HX 4QYIB 3VR1A 2J9YB 4R1TA 4UBJA 1HYQA 2PLWA 3HKBB 3EUWA 4EJ6A 4WBXC 1ZVMA 4Z9BA 7AT1A 2V74B 3IS3A 2OYSA 3UJ3X 3TG8A 5F1YA 4PYNA 4Q9HA 1I36A 2W6ZA 2Y2UA 2JCGA 4WDRA 5AQEA 3W2IA 2OBNA 3BFXA 1ADFA 4Y9TA 1R0BA 4CI9A 1VTKA 1WWKA 4S1NA 1GVHA 3G1WA 4Y2JA 5HM6A 4CXMA 4Q16A 2GTPA 3OOJA 5IWAB 5CCBA 3R5FA 4AN4A 3WKCA 2VJBA 3S1AB 3E3MA 1E8MA 3QLEA 4IXNA 4Q1DA 3IJRA 3QVVA 3HCRA 5HMLA 3CRZA 1M6YA 3TLGA 5EY5B 4GBJA 5JQGF 1KL7A 2QL5A 4LKRA 3GR6A 1QHXA 2PL1A 5DM2A 1ZISA 1P45A 1D03A 2PYDA 1CS0A 3EBLA 4M55A 4UVGA 4WRRA 3I6IA 2JI8A 2QA5A 1U0SY 2HT6A 1TCBA 2P7IA 2AGVA 3LRXA 2Q1WA 2RMKA 3RAGA 4QLAA 1IMOA 1G8SA 4J7CA 4OEHA 4ZO9A 1P4GA 3FOCA 2Q2OA 3HMKA 1U5BA 3A9RA 1E9SA 4QPDA 2YHBA 1WLYA 2OE2A 1NVBA 1ZOOA 3KLOA 2J9GA 2HQOA 4M99A 1PDWA 3I0NA 3LL7A 4URZR 2FEPA 1KQ3A 1I4OA 2NT4A 3H8JA 3QI2A 5THQA 4BPBA 1EKXA 1EWQA 3DE4X 3LT2A 1Z68A 2W6MA 3EZNA 4WCFC 1AHIA 4QVKA 1ATIA 3M83A 3B38A 3VNAA 3DT9A 1NYLA 1QUEA 1BROA 1M5UA 1SAYA 1SU7A 3CX6A 5CD1A 1R74A 2R2AA 3EYWA 2Y1KA 4UXJA 1U1IA 4H3VA 4DA6A 5HG0A 3K6JA 2IEGA 2X0EA 1BFUA 3L7BA 4KR0A 5J2TA 1CLUA 4JU9A 1V71A 4BVEA 2ZS7A 4RK4A 4LZPA 1A04A 1FUYB 1NBAA 3ODGA 4M0CA 1SZCA 4OXIA 4PRZA 5COAA 1DC8A 1JLRA 2VQ6A 3DAYA 4Y2PA 3ZHYA 4RCYA 4F45A 1ABEA 3O73A 2HSZA 1BVUA 1Z6GA 3NANA 5MFZA 1M1YA 3GLRA 3B7WA 5DXJA 2J0SA 2GHTA 2QM3A 4MUNA 1E7RA 2HMVA 3C2QA 3QKUA 3TNFA 5L3RA 4ZZIA 5I4BA 4I8DA 1XL0A 2I3DA 4XYGA 3OE7A 3WMFA 1FLDA 1J2JA 1NNEA 5JJKA 3AVVA 5LQRA 2XF8A 4E7OA 1XZPA 4D92A 3GGOA 1CP2A 1Z2CA 1S8AA 2VP9A 3LZ6A 4BMCA 4POOA 3FUXA 3ADKA 4HGQA 2X13A 4DRXB 1WS6A 1DKMA 3QOFA 4R1QA 3BRWD 2Q3MA 3T95A 4RNCA 3ZV7A 1TF5A 2WFAA 5H0IA 4DA8A 3VJMA 3CX3A 4QPPA 4QUHA 5DRTA 3WB1A 4B44A 4BEJA 1XTUA 3T8YA 4XX0A 5JS1A 1XNJA 4TQ9A 2O3SA 2BFAA 4J29A 5DTMA 1AIPA 1JHPA 2AI1A 4E22A 1H42A 2DHRA 1FP2A 3G2KA 2AG0A 1E89A 2H63A 2P2NA 2CXUA 1W0KD 1Y42X 3CWZA 4MV8A 2FMFA 4P0PB 1K7EB 2I22A 1E2QA 2ODBA 2JLVA 3DTVD 5A03A 1JX6A 1KRHA 4QL3A 2CLHB 5KQMA 5KS2A 3V4RA 2D59A 1NG1A 4KIJA 1Q57A 3DT6A 2B37A 3KZNA 2IUEA 4UNRA 4BV8A 2PJZA 4ZHQA 1GGJA 4O29A 3HVUA 4I5IA 1JXAA 4DR4B 4YLYA 2A1TR 1LVHA 4MNTA 2ANCA 1RI3A 3X1YA 1C41A 2XRZA 2LPMA 1QYWA 5B7NA 1QRUA 1NX6A 1DAOA 1JG1A 2WUEA 3AZOA 1S3IA 4H9GA 3THWA 3K30A 2GKGA 3V1KA 4MLDA 2ZIWB 2QQEA 3E2MA 3BFJA 4MZDA 3V5NA 1H2RS 1UJ4A 4MV6A 1QF6A 1DZ3A 1VOTA 2GAOA 4UHKA 3MWFA 2XVYA 3DHEA 3V42A 4ZCPA 3CONA 4IDFA 2R1TA 3TTWA 3U56A 1M3SA 2GLTA 2Z83A 5FEMA 2M1ZA 5IBPA 3CPEA 1IN4A 1MG5A 5JAQA 2GJKA 2XCRB 1EQUA 1FZQA 4S35A 3AVOA 5AVQA 2Q5FA 3HB1A 4YUZA 2HQRA 1F2UA 5KI6A 1PAUA 3QVOA 3TSWA 3BL6A 1XVUA 2XT6A 3PXXA 4W4TA 5B3JA 1STOA 2UXCB 2PLRA 1V9LA 4AF6A 1G64A 2RAVA 1OWPA 5EQDA 4AQ7A 5DBEX 3ND5A 8AT1A 3HBFA 3TB4A 5AHRA 2P77A 3NPAA 4MUGA 5LU9A 2R4UA 4CDMA 2HEGA 2FUG1 2HA6A 5TF4A 1EVZA 2X7HA 4F2WA 2Q3HA 3WIVA 3KVYA 3OP4A 4PSCA 4V3BA 3OUUA 4M6WA 4C7BA 1RZRA 3E5MA 2X8LA 4M1QA 4OGFA 3N0WA 4OIMA 5FL7D 1WBBA 1RI1A 2D3TA 1QBGA 3HWWA 4HAOA 3RI3A 5B57C 2KPOA 4KVFA 4KQ1A 4WN9B 3SYKA 1LVGA 1NHWA 2VQDA 1TM5E 4GQAA 3EG5A 3MB5A 1SVOA 2YXPX 3RF6A 2W2MA 3GUYA 3GQBB 2AJLI 2CJXA 4BKMA 2ZYHA 4XWGA 2H1WA 1U9IA 1RQPA 2B4YA 3GGPA 3HXLA 3OLVA 5DW0A 3D2BA 5CFZA 2FSIA 2O0LA 1EVYA 4JT2A 2DP4E 4QRIA 3D5TA 2CV0A 2GVNA 4KH1A 4Q47A 5FYDA 1H85A 2Q3LA 2O8NA 3OEHA 1ELOA