3KPYA

Crystal structure of hpnmt in complex adohcy and 6-chlorooxindole
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kpyA00
2P1DA 1JG4A 5K0EA 5HIMA 3M6WA 5EEGA 2G70A 2NXJA 3G89A 3BGDA 2ZTHA 5DRTA 3O7WA 1YFJA 3M6VA 5K05A 3R9XB 2GA9A 2UYQA 3BWCA 3A25A 1JTEA 5CD1A 1JR4A 2GH1A 3EVCA 3HM2A 2YTZA 5DT2A 4A6EA 1FJXA 2HR1A 4AX8A 2XBMA 3SSMA 3TM4A 4QPPA 4GBED 4X61A 1QZZA 1BKYA 3GNLA 2AN3A 3JWIA 3A26A 2PV0A 4YUVA 4AZSA 1T43A 4PYIA 5E8JA 1NW5A 1FP2A 4PYNA 3EVGA 1XTPA 2G72A 2JHAA 2ZFUA 4OBXA 4QQKA 4POOA 5DPMA 1G38A 3HA7A 5EZQA 3HVIA 1EIZA 5LSAA 1O54A 5P8WA 2ZZKA 5KQRA 4KVZA 5HIKA 1NKVA 2ZWVA 5E2BA 1NW6A 2IBSA 4E31A 5DM0A 3S68A 2ZZNA 2IP2A 2EG5A 5CVEA 3TPZA 3NJRA 3KPUA 5E2AA 3UJCA 1M6EX 3HP7A 5K0JA 1P1CA 3M33A 3GCZA 5FCDA 4DA4A 2C7OA 3B89A 3HCDA 2NP6A 4L7VA 5LQKA 4V0QA 5EC8A 5K0LA 3A7EA 3KR2A 5DX0A 4PNEA 4EK9A 4OX9Y 2CMGA 2NYUA 1R6AA 1NV9A 1V39A 4P58A 4PGHA 4PYQA 5HZMA 1PRYA 2FHPA 4E70A 2PXXA 3PX2A 9MHTA 5G02A 1P1BA 2YXLA 2AN5A 3FUXA 1RJGA 3UZUA 4WXHA 2Y1XA 5ERGB 3ORHA 4ER3A 5DWQA 3NVMB 5GM2A 3PLAE 2PWPA 5GIOE 2GB4A 2VDWA 1DCTA 4F84A 5EEHA 3NWBA 4CTKA 4DCGA 2BR3A 4IV8A 1WZNA 1BOOA 2I6GA 2XVMA 3LDUA 3R3HA 4GC9A 3G7UA 1WXXA 2R6ZA 3EVAA 3G2OA 5FHQA 3EGVA 2UYOA 2ZLBA 3OU7A 2PXAA 3EPPA 4HSGA 4OQDA 3UWPA 1D2CA 3X0DA 5KYGA 2VZ9A 3SR4A 1N7JA 3T7RA 3GRYA 4GOLD 2FYTA 2V7EA 5LQRA 5CVUA 5D1HA 4LWOA 3PFGA 1RI2A 3B5IA 3ERCA 5ICGA 1DL5A 3NW9A 2V74B 3WSTA 2BR5A 5CCBA 5E8RA 1N2XA 5C9ZA 2ADMA 4CKBA 1SUSA 4QDKA 2OB2A 5DM1A 5H02A 1O9HA 2XYQA 2BM8A 2Z6QA 1ORHA 2OPBA 2FK8A 2O07A 3FRHA 2VP3A 4EVIA 3KHKA 4ISCA 4QVGA 5K0CA 3PT9A 5DTRA 4AZVA 2ZCJA 2AZTA 4E2XA 2KW5A 3FTCA 3KPVA 1Q0SA 5LQCA 3TR6A 2G1PA 4PYOA 3REOA 2YXEA 1L3IA 1XDSA 1U2ZA 3B3FA 3BWMA 5EMLA 3LPMA 4HH4A 4UOEA 3MTIA 4K6MA 2CL5A 3I53A 3KU1A 2O0LA 3SMQA 3SVZA 1AV6A 2NP7A 3KQWA 5EHGA 4Y2HA 4C07A 1HNNA 5CCXA 4ATNA 3DTNA 2IGTA 5GIPE 1UIRA 2AR0A 3PVCA 5T64A 2QYOA 1SKMA 2DULA 3GRUA 5EZSA 5F2NA 3KQQA 4E2WA 1O9GA 3FTDA 2C7RA 2PX8A 2CWWA 2ZBQA 3HCEA 3I64A 3BWBA 1ZQ9A 1OR8A 5EGSA 3O31A 3PX3A 5K0BA 3M6XA 2JHPA 4KWCA 1KYZA 2OXTA 1L3CA 5GM1A 4E32A 4QQNA 4GC5A 3G8AA 1G55A 3P8ZA 3FUUA 1L1EA 5B1SA 3HTXA 1XXLA 1PJZA 1WY7A 2HTEA 5KS2A 2UZ4A 5K03A 2AOUB 1VP9A 1G60A 2PVCA 5C0OE 4GOND 2OO3A 3AXTA 3FPGA 5DRYA 5K0GA 3L8DA 5EMMA 4XUDA 5E1OA 3K6RA 3OZTA 4RTMA 4R05A 2O57A 3P97A 4OA5A 2AOWA 4PYLA 4RVGA 5FHRA 2G8NA 5LQUA 1JSZA 4PCLA 5HILA 4LWPA 2ZBPA 4GEKA 3HVHA 5E1BA 1YZHA 4C4AA 4C04A 2NXEA 3GGDA 4PINA 4R8SA 3NVKI 1EJ6A 3C0KA 2YQZA 2P35A 3LBFA 2VS1A 3LCUA 3CBGA 5GP1A 10MHA 3BGVA 3EEYA 3FUWA 3CJTA 1NW3A 2P3OA 4XUCA 1VL5A 5FADA 4A6DA 5K09A 3UJ9A 2IH4A 2H1RA 4RYLA 3KQPA 5FWDA 4OQEA 4ZTBA 2B9EA 4EKIA 2NNWB 4RWZA 2Z6AA 1ZG3A 2UYCA 3FZGA 4YUZA 1AQIA 1VIDA 4RTOA 2VDVE 1JG3A 1ZGJA 4RV9A 4MHTA 2ZULA 5LQAA 3KKZA 2G71A 1XCLA 3LX6A 5FA8A 1EG2A 1KPGA 1R74A 1KR5A 3GU3A 4FR0A 1XCJA 3Q7EA 5EKXA 3IEIA 3NTVA 3F4KA 3T7TA 5BXYA 3AJDA 1X1CA 4KIFA 5D1NA 5EMKA 1MJFA 2Y1WA 3HCCA 1QAQA 2IH5A 1KXZA 5E1MA 4PYKA 5DSXA 2YX1A 3EMBA 3OPNA 4RTRA 8MHTA 2PGXA 3LHDA 4YUYA 5LR6A 1KHHA 4BY9E 3FUTA 1INLA 2GAFA 3R0QA 3ELUA 1QANA 3A7DA 3V8VA 4KRGA 4PIMA 2IIPA 3HA5A 4QPNA 3KQOA 3ME5A 1RJFA 3JWHA 4AZTA 4RTJA 1NV8A 4RTQA 3CVOA 2PKWA 3AY0A 4DMGA 1ZKDA 3HCFA 5HFJA 2Q41A 5IKMA 4LECA 3O4FA 3KPJA 5CVVA 2JH9A 1KYWA 1RI3A 1RJEA 5BW4A 2HMYB 4DZRA 1HMYA 3HCBA 3TRKA 4MQ4A 2ZSUA 3E05A 2NXCA 3FYCA 1TW2A 3LSTA 4EMSA 2IH2A 4AUKA 1KPIA 2XYRA 3ID6C 3P2IA 5F2OA 1NE2A 3GJYA 3KQVA 4YMGA 1SG9A 3DLIA 4QVKA 3FPJA 3ER9A 4AZWA 4HGYA 3VYWA 1X19A 4MTLA 3THRA 1G8SA 1RJDA 1I1NA 4Z2YA 3G2QA 5EIFA 1SQFA 1FP1D 4XUEA 3UA4A 2QRVB 2AOUA 1H1DA 2HWKA 3DXXA 4CTJA 4ER7A 3B7PA 4KIGA 4F86A 2P40A 3BUSA 4BLUA 1NBHA 2ZZMA 3LECA 2AS0A 1F3LA 4GOMD 4M7RA 3BKXA 3RIEA 3ER8A 1UWVA 4QTTB 4C05A 2E5WA 3DULA 4FS8A 4MWZA 3GDHA 4DF3A 2FRXA 3GRVA 1IM8A 2PT6A 5GOZA 4BLVA 2UYHA 2PY6A 2YUIA 3KR1A 5EG5A 3RODA 3GO4A 1NW7A 1WXWA 3KQSA 2B78A 2PX2A 4RTPA 1JQEA 1QYRA 3SM3A 2O06A 2BM9A 3KR0A 3K0BA 3UJ7A 1EAMA 4RX1A 5HEKA 4BLWA 4YV2A 1SVUA 3TFWA 2IBTA 3I58A 3RW9A 5MHTA 4KDRA 1SQGA 3MGGA 2ONYA 4YUXA 3BWYA 3LL7A 4Y30A 4PCAA 3DOUA 3LCVB 2P3QA 7MHTA 3G5LA 4ER5A 1BC5A 3B3GA 1TW3A 1R8XA 4RSRA 4RVFA 4CKCA 4EKGA 5M5BA 4YMHA 4FT4A 4R6WA 3KR9A 2JJQA 2H00A 5BW5A 1NBIA 3FYDA 4GOOD 2EFJA 5EQJB 3UJ8A 3KPYA 1EJ0A 3GRRA 3P9CA 2K4MA 5FTWA 5K0FA 4RVHA 4XCXA 1Q0TA 2ONZA 3ELWA 3DR5A 2HNKA 5LQJA 3KQYA 2BZGA 3MERA 1QAMA 2O05A 3E7PA 2P3LA 1JG2A 4WVLA 5KQSA 4E2YA 5CVJA 1JG1A 3P2EA 5FQNA 2PWYA 2PX5A 3OFKA 3DXZA 4CXMA 3Q87B 2JG3A 1XDUA 1NW8A 3OFJA 2XYVA 4FSDA 4HGZA 3FPHA 3OCJA 4KW7A 4FP9A 1BHJA 1XJ5A 3C6MA 1NT2A 1VBFA 1VE3A 2ESRA 3OU2A 5DLYA 2YR0A 3GXOA 3DH0A 3P2KA 1FPQA 3EVBA 4PYMA 3P9IA 2EJUA 4YUWA 3OU6A 3NWEA 2NXNA 4FGZA 3LBYA 4QTUB 2AOXA 2I62A 3ELDA 4C08A 4ER0A 1R18A 2C7QA 3IV6A 3MQ2A 5DXJA 4E2ZA 2Z6UA 2GLUA 1TPYA 3EEOA 4OBWA 3TLJA 2OYRA 2IPXA 4FSXA 5EHIA 3TMAA 4C03A 1JTFA 3HVKA 3PS9A 2PBFA 3T7SA 1XVAA 2HV9A 2QRVA 3BKWA 4IWNA 3QOXA 5T6BA 3AXSA 2YXDA 3TOSA 3TQSA 4KDCA 1VLMA 5DTMA 3LGAA 2VDUE 4R6XA 2P41A 2OY0A 3V97A 4YV1A 1M0EA 2ZW9A 4HG2A 3GIWA 3EVFA 4RTKA 2CMHA 1JSXA 4OA8A 5JUWA 3DXYA 2PSSA 2EX4A 3MTEA 1SUIA 2FCAA 3DMHA 3P9KA 3E23A 4G56A 2BH2A 3G5TA 2IDJA 3VC1A 1QAOA 4NECA 4X63A 5FULA 5BP7A 5IH3A 5HIIA 2AVDA 2IFTA 3A4TA 4GUAA 4HTFA 1YZ3A 2QY6A 2R3SA 3C3PA 1B42A 5EOVA 3UJAA 1R8YA 4HRAA 4LG1A 5DXAA 5K8VA 4HC4A 4PYJA 3UBTA 2JH8A 4U7TB 2WA2A 4E33A 2AOVA 3MHTA 1RI1A 1XDZA 3C6KA 5CM2Z 3FTEA 2JHCA 5K01A 5EPEA 4BP3A 5K0NA 5HOQA 2PLWA 2B2CA 2FPOA 3EVDA 3MCTA 2B3TA 3UJ6A 3QV2A 1WG8A 2ZIEA 3THSA 1N7IA 2ZIFA 3GRZA 2I9KA 3EVZA 2QE6A 3ANXA 4IKPA 1D2GA 3FTFA 5F2KA 4CWAA 1KP9A 3BGIA 3JWJA 4QDJA 2ORED 3MAGA 5E9WA 3BZBA 3CKKA 4DQ0A 3LDFA 1G6Q1 4DCMA 3KPWA 4CKEA 3UA3A 5JR3A 1JQ3A 2DPMA 5C1IA 2AN4A 4PIPA 1WS6A 5KVAA 3KQTA 2AOTA 3TKAA 5E9JA 3SSOA 1G8AA 2I7CA 1VQ1A 2AVNA 3EVEA 4M36A 4FZVA 3FUVA 5FUBA 4DKJA 2OZVA 4C06A 5DX8A 3MCZA 5E9QA 5CIYA 4RTNA 3EGEA 1FBNA 3FRIA 3HEMA 1I9GA 2PXCA 3VSEA 1X1AA 4RVDA 3OZRA 4DM3A 3HCAA 3OE4A 5LQNA 3M4XA 2A14A 2B25A 4P7FA 4X1OA 4BP1A 1Y8CA 3BT7A 3P9NA 3SXJA 3DMFA 3DP7A 2P7HA 3QOWA 4V0RA 5T67A 1IY9A 4YV0A 2ERCA 4HTFB 5EIWA 1VP3A 1YUBA 3HVJA 3UFBA 3PB3A 4U7PB 5DX1A 3DUWA 2WK1A 3FPFA 2ZWAA 1YB2A 2FK7A 1L9KA 1ZHFA 5DM2A 5GINE 3G2MA 5FWAA 1AF7A 2ZIGA 5CUQA 4RTSA 3LKDA 3PFHA 1AQJA 2C7PA 4X41A 5HIJA 3TKYA 4MIKA 3CC8A 3C3YA 3H2BA 3D2LA 2OB1A 3BXOA 4PONA 1Z3CA 5DM4A 3AWIA 4GF5A 3M70A 3I9FA 1JQDA 3ELYA 4M38A 3E8SA 3SGLA 2OBFA 3CJQA 1X1BA 3A27A 3UJBA 2OKCA 2PJDA 3IYLW 4PWYA 3T0IA 3U81A 5CVDA 4P7GA 4P7KA 3SX0A 3PTAA 2EJTA 2P8JA 3UJDA 5U4XA 3NDIA 4RTLA 3G2PA 3KQMA 4H0NA 3LDGA 5EKUA 2ZBRA 2LD4A 3HNRA 1RI4A 4M37A 2AOTB 3CGGA 3P71T 2PX4A 2PT9A 4X60A 1YF3A 5E1DA 5EVJA 3FPEA 3EGIA 3GWZA 3CCFA 3MB5A 2P7IA 4O29A 3NDJA 5ICCA 4FT2A 1ORIA 1R00A 3DLCA 3I5UA 1D2HA 5ICFA 3R24A 4PGGA 1P39A 4JXJA 5FA5A 1ZGAA 3NMUF 4B17A 1P91A 5GWXA 4EQZA 1I4WA 2GPYA 4ER6A 4E30A 1RI5A 2GS9A 2XVAA 3LKZA 1MHTA 2H11A 3M6UA 1M6YA 3CJRA 3SSNA 2N47A 3G8BA 1KPHA 2WA1A 1F38A 3EMDA 5DSTA 3JWGA 4F85A 2BR4A 3B3JA 3LCCA 4R8RA 1L3BA 1KIAA 2IDKA 2CKDA 1EQAA 1IXKA 3HA3A 3IHTA 4IV0A 4GQBA 1UFKA 5EMJA 5ICEA 3OZSA 2F8LA 3R6TA 2YVLA 1X1DA 3G88A 3DMGA 3OE5A 3TM5A 1YFLA 2QM3A 1DUSA 5DTQA 3VC2A 5FQOA 1VPTA 4P7JA 2ZVJA
chains in the Genus database with same CATH superfamily
2F00A 3QTBA 3X1ZA 5C8YF 3L7AA 2ES4A 1YZNA 5ALGA 1C29B 1VA4A 3O4VA 1DKMA 2PLFA 4XTRA 2C7GA 4DJ5X 2JAPA 4LSZA 1Q2UA 4ZCLA 4B4OA 2DWQA 1IMOA 1T6ZA 1VI2A 2UYQA 2W6PA 3CO5A 1DIBA 1ZWLA 1KJIA 4XVQA 3MTGA 1G41A 1TOAA 3N6VA 4L27A 1UJ2A 3A26A 3DC2A 1P0QA 2EFHB 3B7GA 3KSBC 2FDXA 1T2DA 1JEYB 1ZH0A 3LX4A 1EX1A 4MWOA 3E7FA 3BSFA 4AMUA 1PR2A 1UKAA 1Z25A 3D7MA 2AIRA 2DFPA 4LOJA 2ZIVB 3AZOA 3DF9A 4D9GA 4K9SA 1MG5A 3TNLA 2Q8PA 1UDXA 3L7LA 2J3DA 3QEAZ 3A4IA 4BB9A 3EIQA 1CUGA 5KU1A 2O2IA 1NLFA 3AK4A 3KXKA 1N0IA 3YASA 4ZXFA 1GTG1 1SK8A 3T3PB 3UJCA 1A2OA 2WHPB 5FCDA 1NYQA 1GZVA 1PGJA 2HA2A 2UZ1A 3R9IA 1D0SA 3KT3A 3KR2A 4XFDA 3AKYA 3KOXA 4MUMA 5DOVA 2FHPA 5IANA 3PX2A 4AKTA 4Z4GA 4XA8A 3CLVA 3ZW7A 3U3OA 3OF2A 1VIYA 2Y1XA 3E2MA 4NNJA 3WDSA 3N2GB 1B8NA 4KDFA 4LXYA 4CEIA 2W37A 2VTDA 5AIAA 1W76A 4INZA 4DSAA 4L3WA 4PZ0A 4V0KA 4NYMR 3NHBA 3ROGA 2JI9A 4DCGA 1GCUA 3G68A 4KQWA 5ALVA 5C4MA 3SJZA 4AXBA 4HAIA 4X3OA 1YS2X 3HV0A 5LDGA 1E3TA 4F92B 1UK8A 3EGVA 4ZN6A 1EWVA 1KOJA 4MKFA 3UWPA 2GRAA 3HBLA 3EWNA 3JQBC 2VZ9A 4G4JA 2FPLA 5FOSA 5KHAA 5LQRA 4D99A 2P9ZA 1CUWA 4EITA 2DY1A 2D5AA 2PEYA 4RLSA 4DJJA 3OPXA 2D2VA 1DPFA 3CEMA 3LXRA 2Y1EA 4U3JB 1AA6A 5F98A 1BFKA 5D3KA 3SR0A 5HUJA 3BAZA 3STVA 3IV7A 1CWUA 3K6JA 1E3LA 3PQ8A 3HGQA 3EWSA 2ZIXB 4HP8A 1JDTA 1T24A 4A8TA 1WQ3A 2AZTA 5JSQA 5MHTA 2XBMA 1MJHA 4XWKA 4M3NA 3VO8A 4JVNA 1U2ZA 2AQIA 4PICA 5BNWA 5HM6A 1F9EA 5FPKA 3DWIA 5JFGA 1RHUA 3RS8A 3I53A 2ISCA 1M66A 1VJ1A 3MFYA 3RSHA 4KCGA 3LXUX 4F97A 4WA8A 2ZJZA 3KQWA 1JEYA 3VR3D 2A9KA 3WIEA 1VRWA 4E03A 4L08A 2HO5A 5CDUA 4PFJA 3UOWA 5CM9C 1L8AA 2GHQA 5F2NA 1KEEA 1EGVB 2IXEA 4BASA 3OZWA 5T8KA 1QP4A 1JJ7A 4WZBE 1P6QA 5BO5A 3P0RA 3I64A 1HYGA 5M7EA 2WVAA 4EDHA 4KWCA 4DHEA 1SHKA 1TZKA 2XUOA 2ZKIA 4J29A 2D0PB 4TV9F 1IE3A 2WHPA 1J5PA 2QVZX 2WG1A 1G55A 3NJ4A 2ISSD 2DHRA 4YYZA 4KUEA 1XRLA 1RQLA 1REQB 3SNKA 4E0BA 3TZQA 4GGMX 3PQFA 1L0BA 1ILEA 2YFHA 4PZ9A 4CI0B 1VMDA 4YCCA 7MDHA 5KNDD 3RTCA 1JB9A 2BEUB 5GZ1A 3LUBA 1TA4A 2O57A 4QTXA 3VC7A 4OA5A 1KJZA 1Q17A 1YONA 3B36A 3Q85A 1KZYC 2Q2VA 4N3GA 1KVRA 3VHQA 1JA9A 1JSZA 3KLMX 3N87A 4K7JA 3N2GA 4G2NA 5HILA 5MFZA 2W2LD 4GEKA 5CMLA 3ZD6A 1I7PA 3JZDA 1A88A 1GPAA 3D6MA 4N6GA 1QIDA 2YC2C 4AN0A 4CL3A 4TN1A 3PXDA 5JMPA 4OJNA 4M7WA 2BCGY 3EEYA 3UWOA 1XK7A 1WMEA 2YS6A 3FUWA 4OP1A 2ZDHA 2R1TB 2G0TA 4MXDA 4LSMA 3V4FA 1G63A 2IH4A 1JPUA 4ALKA 4I6JA 1SC4A 2W6QA 4I50F 1U0GA 1KR2A 4ZCSA 3AIOA 5A5DA 5EJMA 3IJRA 3FZGA 3FOBA 2BFEA 4EY3A 4FZJA 3D8TA 2NYRA 4BFYA 1DAMA 3ZJTA 4ZO7A 4U3JA 5HIJA 4FR0A 5JBIA 4R2LA 3Q7EA 2DZDA 1UK9A 2PZKA 4R0VA 3F4KA 2O3SA 1E1YA 4WJKB 1U3UA 1X1CA 1X0XA 5DNEA 3R7DA 2WWRA 2B61A 3CNOA 1LUAA 2BONA 1NBME 1Z47A 3OFVA 1GNVA 2CBGA 3HCCA 3DTTA 3JXEA 2VPPA 2QTWB 4WK6A 1KXZA 2CMKA 2WUEA 3BBPA 4MVJF 3AKDA 5AK6A 5DULA 4CEHB 1K98A 2PH1A 3RF7A 3DOEA 1MXFA 3OKPA 4YUYA 1KIFA 1D0VA 4JR1A 2V1UA 2WLTA 2X7HA 3FGZA 3IVAA 2EGGA 3V8VA 4TWAA 3ZLBA 1PWXA 2AF4C 1P7WA 2VHZA 4F1KA 2HW8A 5J3JA 2LIPA 1VKZA 3PQ2A 4KQGA 5F4ZA 2AKAB 4LV5B 4WK0B 3JRWA 3KFVA 1M2HA 1XKTA 1LI5A 3DBRB 4FN4A 4CNQA 1XELA 2C8LA 1GG9A 2HQOA 2FUCA 2WWTA 1KH2A 4NS1A 5CVVA 2XECA 2XA2A 1T1SA 1UWCA 3HJUA 1HMYA 3IO5A 5TSDA 1FFHA 1CF9A 3NZEA 1JALA 3FYCA 1LC0A 1UBEA 3A6LA 3DBIA 4J7CA 4OHMA 3RHZA 2IH2A 4L9RA 2GAIA 2OFOA 5AVYA 4JJKA 5C4IA 3RVRA 3GOQA 1FIUA 3GBSA 5IMSA 3VGJA 1P9LA 2AR9A 3ND6A 4NMXB 4S05A 2I7VA 1VCHA 3K5IA 2BZSA 3TEJA 4DRXB 1FP1D 1NBOA 1REQA 3OOJA 5DGCA 2GD6A 3ETJA 1FX1A 2ZUTA 4DL9A 2ZAMA 2Z1DA 2OWDA 3L49A 2NUAB 4YJ3B 1ZI8A 2A67A 1AGXA 1X9HA 1RLUA 2G4CA 2BEUA 3NOOA 3SFZA 2CF5A 2VQFB 3IX7A 4GOMD 4XCVA 4J6FA 4FQ8A 2FWIA 2OENG 3S2UA 1JA1A 4DMFA 2RGRA 1NIPA 1YCGA 3DULA 3DVQX 4DF3A 4CIAA 4L75A 4X93A 1T29A 3RC3A 4BLVA 4BB5A 1EK6A 3GY0A 4RK4A 1U3VA 1ES9A 1SCBA 3CLSD 2EERA 1XTUA 4BJ6A 2PX2A 3D5TA 1V4VA 4K0KB 2O06A 1BDMA 1P4RA 1RNLA 3HCNA 5EJ2A 4OFWA 2J85A 4RC9A 1B43A 2GASA 4BLWA 1FTYA 1DFHA 1ESEA 1TUEA 3IB3A 1MORA 1ZH2A 3KHUA 4FHCA 2DUWA 2OESA 3B13B 4PR3A 4ERNA 5IT9A 5EIXA 3MGGA 5LC1A 2E9SA 4ZYUA 2FWMX 1KVUA 5HMLA 2BP7B 2VJAA 4X00A 9ATCA 4GM1A 1QKJA 2X3UA 1VXRA 4RSRA 1NP3A 3Q11A 1NBMD 1QDEA 3FLEA 1Z7BA 3KVNA 4EGQA 3J81A 4LF5B 4EDFA 3VR6H 4UU8A 1Z4MA 2GCOB 3EIFA 5CLFA 4KFRA 3UHJA 2WY2D 4MB6A 2HRRA 1ZJZA 4O4IA 1E6UA 3OZFA 1XZQA 3ZU6A 2CLLB 3STUA 1E4VA 2I3ZA 5K0FA 4JI6B 2XKBA 4CEHA 1JEEA 1X77A 3H3FA 4YACA 1LDBA 4B3FX 4TV8B 3VU9B 3FNQA 1T5DX 3PLNA 1QAMA 5I7SA 5KQSA 4ZEXA 2DQSA 1X39A 3WBBA 4W5TA 3E2PA 3R0IA 2PX5A 2R1VB 4QGSA 5M29A 3FOEC 2B0JA 2VF2A 1DVRA 4M1YA 1XDUA 4M1KA 1E1RA 4ZVKA 4GKVA 2NQTA 3CF4G 4QZVA 2CWDA 3NTOA 4LDQA 1NAHA 1TRKA 1YDFA 3PNPA 3R3UA 3C6MA 3VOBA 1LA2A 1D04A 1FQWA 2IEIA 3DAFA 1MQ8B 4CN8A 3KSMA 4KITB 2GJ8A 2QV7A 1P3JA 1C7IA 1R9GA 1VHTA 1X7XA 3AI1A 3D3KA 2ZTSA 3QRWA 2BW0A 4NMLA 4O1HA 1NQVA 2VWHA 5LM3A 4UXIA 4RIHA 2B2NA 2IHYA 3DHEA 4CM5A 4OIMA 5MFPA 4H3KB 2POCA 3KM0A 2O19A 1N3IA 3D4NA 4L28A 4MMXB 2GHRA 4XOUA 1ZONA 1QE5A 2X19A 4UBKA 3SKXA 2FN7A 3MD9A 1KMCA 1EI9A 4R7GA 1VRVA 4MJ3A 2RAPA 2H2DA 1IQRA 4DRXA 3AXSA 1CHDA 4B46A 3JAKB 4KDCA 2QRPA 1WXGA 3ENVA 3K71B 4B2YA 3R0JA 2NUAA 4YJ3A 3RKSA 3AVTA 2GVZC 4NJEA 3PFFA 3GHHA 2QRNA 4K5QA 2X9VA 3U2QA 4MV3A 1GQSA 2QRGA 3TBHA 2X8WA 1R5NA 3QMPA 1MCZA 2F3SA 2WNHA 3GFGA 1YZKA 3H9BA 1PQWA 2VNIA 2CBZA 4H7HA 3PGKA 1XEWY 4OLJA 2IHZA 4PSAA 3W5HA 3NONA 1IDN1 4YCMA 2OVFA 4FMPA 5BSHA 3PITA 3U16A 3TIXB 3EEIA 2C00A 3EOZA 2XI4A 3UJAA 4CKZA 4HRAA 2QKYA 3G49A 1GNSA 2YVQA 4U9HS 3IR5A 5TGDA 3FPAA 1CNMA 3ZOZA 3UNXA 8GPBA 3MHTA 2KBEA 4OX9B 2BP7A 2JHCA 1XVLA 3DBLB 4XX1A 5H83A 5I6DA 2FPRA 2Q2NA 4N6NA 3KZ1E 1RIIA 2GXQA 2Q4BA 4NTZA 5ENZA 4G0QA 2VUSA 2IF2A 5IVKA 1KYYA 2FETA 2YJTD 4M9QA 4PHGA 4AMBA 3D4PA 1WG8A 5F3RA 4PZEA 1P2TA 3L4KA 2IS2A 3CTPA 1TYCA 2ZXEA 5JXHA 3ANXA 2OECA 3GRCA 2BRUC 3OBBA 4PF1A 2IE0A 2JAXA 2LPMA 2WW8A 2IU4A 2XX3A 3QYFA 4L9AA 4QDJA 4E4YA 2CNDA 4KWIA 5E9WA 2NQ2C 1H22A 5AVKA 1A3CA 3TOXA 4A5SA 4ENWA 4LMRA 2IWRA 3TBFA 1IN5A 1R6UA 1ZOLA 4TV8A 3VU9A 4X6XA 1M5RA 3C43A 4N7RA 4KK4A 4ZYLA 3EVEA 3R44A 2R1VA 4BGEA 3HA2A 3QP9A 2JGLA 3HPRA 3E5NA 4BEVA 4EA9A 3TNDA 4UDXX 1U2EA 1RJWA 1RWWA 1D6JA 2C03A 3NPAA 1PKXA 3P9PA 1W9HA 1YZGA 2C2GA 5C8DA 1I2BA 2MT9A 3KHSA 2HPAA 4UOZA 4FMDF 2I3BA 3RSQA 5JS6A 2V4ZA 1ISGA 1BU8A 1HWYA 1NVXQ 1RQRA 2QTGA 1JW9B 4YT2A 1LRLA 4FEEA 1XRPA 4EYKA 4JU8A 1LXCA 1IVYA 1M0SA 4M0DA 3IHLA 1EHCA 2W58A 2Z04A 1FB5A 1TUGA 3PHBE 4AJHA 4DZZA 2IPNA 1ZC4A 1BX3A 2Y2UA 1LBIA 5DX1A 1KP2A 2QQ0A 3N2IA 3FPFA 4A2PA 2BSXA 4C6SA 3EDCA 4HH3C 2UU9B 5C51B 1GAJA 3OF5A 4L8WB 5HGXA 2XDAA 4WBNB 3LPNA 3JAKA 1Z29A 4P1ZA 4F12A 5AVWA 4UEWA 2IPMA 1JVBA 1TECE 4GMHA 2L82A 5FYQA 4KO4S 3SGLA 2BFDB 2I87A 2VF8A 4QUGA 3I5AA 5I7WA 1Q77A 3PGXA 1U63A 4AI6A 2OKCA 3L4BA 3UXMA 2YRWA 2DHCA 3MPOA 2X7XA 1W4AA 1DARA 1H23A 3IV9A 2BGNA 3GVIA 4XRRA 5HQJA 1HRDA 2VBFA 4U2CA 2I7DA 2YRFA 3KYJB 1EVYA 3S2FA 4DDHA 4L8YA 1OZ0A 1UT6A 2PX4A 3IMCA 3PL5A 4HB0A 2A9JA 4NATA 4YJHA 1TFUA 2C9OA 5AOVA 3EGIA 4NHEA 4BFZA 2D1QA 5ALDA 4WV3A 2NN3C 1OPXA 4UMDA 1TM3E 1J2RA 3LWZA 4DCPA 2ZI7A 2EYUA 3IIJA 3LQRA 4TKLA 3OP4A 2NZ8A 3OCWA 4INAA 1L5FA 4MS3B 1ZW6A 2BIFA 5F5NA 3IPAA 1EP1B 2V0CA 1OQAA 1ESMA 3G9XA 4QTZA 2I99A 3FCOA 5J47A 3M6UA 4H6VA 3ZCPA 4CW7A 3HRKA 1RKUA 2QUIA 4NJMB 1R27A 4XGNA 4G41A 3PFBA 3K2IA 5LLTA 1E69A 3T1TA 1A5TA 1QVRA 4LHZA 2VOEA 3HC7A 3IQZA 5CNJA 5HZKA 2A9QA 3FXAA 3K0FB 4LA4A 4ZKEA 2YQ5A 4HQ0A 5B58T 4E5YA 5JIBA 2ZSAA 3ZIAD 2AW3A 3Q3IA 1CX9B 3CLUC 4GQBA 2ADOA 4MB2A 3SYMA 3ONVA 1RFGE 3AJ8A 4FW9A 3V5NA 4YUAA 1SOWA 3MM4A 1OI7A 2C2XA 5K2MA 4AIRA 1J2JA 1PK9A 1P9OA 3BGDA 3D4IA 5JWHA 1KFEB 5C1PA 2QHXA 2QZ4A 2RHBA 3PUJA 2BDEA 3KG2A 4R98A 4BFTA 2CE7A 2OCXA 1W0KA 5K0EA 4LQCA 4DIMA 5B55A 3LC2O 3SC4A 4XYGA 1IOVA 3TIVA 5DMHA 4BO5A 3WB9A 4EPWA 3B2EA 1BX0A 1DP4A 3OPVA 1JS1X 3A0UA 3Q41A 4R2XA 3KCQA 4UJ3A 3A25A 1N2GA 2ZPAA 5DHAA 3WMFA 3NNDA 4Q4HB 5H9WA 5L3QB 4YXFA 3OM9A 3TIGA 3P0HA 2Q0HA 4PHCA 4QX6A 1MOPA 1W35A 1G42A 3NTXA 3LGSA 1VA5A 3OKAA 1TUIA 5FP0A 3URMA 3KTAA 1UM9A 1H8HA 1FP2A 2JGEA 1NG9A 2JVKA 4POOA 5EJAA 4ZVQA 3MQ4A 1CRQA 1GAWA 5EZQA 1U02A 4JDUA 2G88A 3AHGA 1V7CA 3LYUA 4WBNA 3BCUA 4ZI7F 3SPXA 3KB1A 2F1KA 4QUDA 3Q2KA 4ZAVA 1ZRNA 4IFIA 3U3DA 3RUIA 2ZZNA 3HU1A 4ALLA 2BFDA 2IP2A 5I01A 3TPZA 3DWEX 3E9QA 4LC9A 4U6NA 4FX5A 1J0DA 1PBNA 3IELA 3KRTA 5K3DA 3TRFA 3K5WA 4EW1A 3KQKA 3LUKA 4YRFA 2Q3HA 2BE7A 1PZFA 2DQYA 3FKQA 3S0JA 3HCDA 3AEQB 2ZJ5A 4DJTA 4L7VA 5K3FB 4AJ1A 4BX3A 1YI0A 1J56A 4JLUA 2AXPA 3S70A 5K51A 1GAXA 1YQUA 4DLSA 5CNKA 2GLTA 3ABQB 3DSRA 3WGOA 5FWNA 2ZOSA 4EF4A 9LDTA 2PXXA 4EY7A 4NCNA 4GT1A 2G17A 3II6X 4CCWA 5A5GA 3U4DA 3KFXA 3BTVA 2W6IA 3PUZA 3GD5A 1GGMA 5EXEA 1ULZA 4AD8A 2GXSA 1C9NA 4TTTS 4I3HA 5G0SA 1GA1A 1G2IA 2HWWA 3NFRA 4MS3A 5FOWA 5AVQA 5M04A 1S4MA 2YV2A 4FR5A 3I0NA 1VJ5A 4UU0A 3I1IA 4N5NA 1DCTA 4MR7A 3DMTA 4NOKA 2P78A 2PYZA 1K88A 2YJ3A 3OOWA 2IITA 4NJMA 3QPAA 4DV2B 2W8BB 2C78A 3LVBA 4HYEA 4F4CA 3C74A 4IDBA 2ZUEA 5FHQA 2PZAA 3EPPA 3Q4GA 5FWYB 3OQIB 1PX0A 3K0FA 5KYGA 4S0ZA 4N12A 1KEPA 5I4IA 2WWWA 1SB8A 2FN8A 5BT9A 3VYTB 3EH1A 2A84A 3AQIA 4ND8B 4I36A 3UJNA 4QYMA 2VJDA 3L07A 3WSTA 2JBWA 1J0BA 2VKQA 1AY0A 2NO7A 3UAXA 1I5OA 1ZMTA 3K9CA 3W2EA 4YA6A 1K7EB 1Z33A 3N0RA 4PSKA 5A02A 3O90A 2GZHA 3A9VA 4ZRMA 3CE9A 2BGUA 5ERXA 2RH9B 1G8YA 1RAEA 3FLBA 4XCQA 4DUGD 3E35A 4OGKA 5T8KC 3D7LA 4M49A 2CKMA 1LRKA 1P19A 2AC7A 4JUCA 3TOZA 3FY4A 3T06B 1WR8A 2I91A 3KZXA 1ZU4A 1JMYA 2XMDA 1Z7GA 4X3PA 3P0IA 2HBQA 1DBIA 2JFQA 3MMXA 1KSHA 4LVUA 2DU8A 4MYHA 5DEOA 4AROA 1FL9A 2VSYA 3L9WA 2AEEA 2CL5A 3PQ3A 2O0LA 4FDAA 3SMQA 1O6ZA 4IDEA 1WW8A 2PSHA 5HVNA 1PTJA 3FAZA 4ATNA 2J6IA 2JFFA 3PVCA 2WFMA 2WWHA 2EBHX 1V47A 4IIEA 2AQHA 4IKOA 3C3EA 3ROQA 2O59A 1P5FA 5AUPB 3U7JA 4D57A 3VX4A 1GU7A 4YJ2A 3N1UA 4AQ7A 2V8BA 3L5OA 4Q9JA 4LN1A 4JVLA 3Q6MA 2M9MA 1WIWA 4E22A 4MKIA 2COUA 2PHZA 1DBWA 5AW9A 4DR7B 4QUJA 2JHPA 3QF4B 4I1RA 2WJ6A 3F73A 1MAWA 3HUUA 1VB3A 1KTVA 2WMOB 1N6HA 1SZDA 2VJBA 3AEQA 3FUUA 3IAXA 5B6PA 5K3FA 3KLBA 1OD6A 1XNRB 2RMKA 4L5CA 1S2DA 2QN1A 1CY7A 2VF7A 3C6XA 2AOUB 3NM4A 3KJNA 4URHA 1N2SA 2HV8A 5ER9A 3HSYA 1DPGA 1Z4KA 5HJ2A 4ZODA 2B6HA 4K9RA 2AZDA 4F0JA 2YY6A 5BSFA 3H5VA 3K6RA 3EYWA 2PUDA 1XTZA 4UASA 1TYEB 1G66A 2VAVA 5BQ3A 3OWOA 3TLCA 1GUAA 5FR1A 3EMKA 4LC0A 2UZAA 4QD3A 1FUEA 4RE6A 4WCDA 4AULA 4UXJA 3O3OB 2XMQA 3RHFA 3CVYA 4IRXA 2WJIA 3C0KA 2YQZA 3DZCA 1ZM4A 4KACA 2BV3A 2VK8A 4TYWA 3CJTA 3VTAA 1ABEA 3IIEA 1RM5A 3CF0A 2ZVQX 4RYLA 2CJYA 4BNYA 3SJAA 3JQGB 4OREX 2A59A 4EP1A 3NIFB 4WN9B 4DT1B 1ZG3A 5FWYA 2UYCA 4TYPA 3W4KA 2QTZA 4KAXA 3H0CA 3OTOB 3FNGA 3DWGA 2PH3A 4OU4A 5AKZA 1YKSA 4HDMB 2PKCA 4N9WA 3C3MA 4BV3A 3A58B 3CNHA 3LX6A 2CXSA 4WFIA 4O4HF 3NTVA 1NRIA 3CFYA 3ETNA 3FZNA 2EC5A 3QLTA 4DC1A 2CNWD 4N5IX 3EGXB 1KGSA 4G25A 3TF5A 1A8QA 5EKTA 3PWTA 1V11B 4DTIA 1RZVA 1GZDA 3PNYA 1RADA 2PGXA 1XLVA 5HKKA 4LAFA 3O3MB 5AK4A 3OJWA 4M1EA 2CY0A 4EHDA 2LCQA 3Q8XB 3I52A 3I04A 4QYTA 4WZBB 5GZ6A 4DIUA 3PEUA 1NIJA 2IIPA 2WUWE 3EBOA 3ME5A 4TVKA 5JZBA 1W36D 1UFOA 3VNVA 2H18A 3HZOA 3HDGA 4FFNA 4BFLA 1VMKA 2ZT7A 2NTNA 3S2GA 1AC5A 1MC1A 5ALSA 4EY5A 4DZTA 1NVAA 3FGPA 3MMNA 2AFVA 2IUFA 4JU9A 1WBJB 2VCHA 3KJHA 4GYYA 3OVMA 1VKRA 3E05A 4IH4A 2H7YA 4RD1A 2VZ8A 4UNPA 4TTIA 3SZMA 1NRJB 2A4KA 3E0QA 1OXUA 4IHKA 5IH7A 1MX1A 1U2SA 3B1KA 1TM1E 1WULS 3W6ZA 3QF4A 3GJYA 3KQVA 2VQ3A 3IUPA 4HMPA 2VHXA 3E53A 3VYWA 3EY9A 4FI3C 3THRA 4U0KA 5CB0A 3RUAA 3OJLA 1DKNA 4F2PA 2QRVB 2AOUA 2RGUA 2YIVX 2Z58A 4BNGA 4CTJA 4F60A 1KKMA 1NBHA 1OOEA 5I4BA 2XVYA 2J3KA 2AS0A 2ZB2A 3NHFA 4A6PA 4K3UA 2JAWA 2QYTA 2GRJA 3P4XA 2B6NA 5A7HA 1QVWA 2W6ZA 3BKXA 3K0KA 4ZQIA 4D26A 1N25A 2E0IA 4C0XA 2A2ZA 3DOIA 5IKOA 4ASUD 1IOWA 4CG0A 4F45A 2REOA 3IXLA 5A3RA 2WB2A 5LMUB 4G0OA 2NIPA 1XA3A 1EK0A 1X14A 3GRAA 4IW3B 1N2IA 4DA7A 4FE4A 4IGKA 2B78A 3SHWA 4RTPA 2QVLA 4G24A 2D2XA 1SHUX 3LQQA 2XVZA 2AJBA 1KI1A 1RLMA 4RCVA 1MNAA 4R5HA 4EYEA 1TTTA 1YB5A 2O7QA 2YBDA 4AO8A 3VZDA 2DUUA 4AKEA 2Z2JA 2KE5A 1J24A 4WN9A 4IM7A 3CR8A 1C9EA 1SG6A 2QMEA 2VPZA 4EY6A 2XXAB 1Z18A 4NOMA 3LCVB 2P3QA 1QG6A 3ILSA 3AEKB 5C53B 3H9JA 2DKNA 1CRWG 1H1LB 4HDNA 4HDMA 4JBHA 3SE7A 4IVNA 3KEOA 4Z9AA 4CR6A 3CZMA 3RSSA 1QQBA 4XTCS 4OSOA 1SZPA 4MVYA 3CX4A 3GJQA 4X64B 4TMFA 1QHYA 1U6JA 2JCXA 3EGXA 5IBPA 5KTSA 2FFJA 4NAVA 4KR6A 3TG2A 3NBUA 4D9IA 2VF4X 3MJ4A 2HN9A 1NZFA 2VNSA 1JYEA 5DHUA 1XBTA 2SKEA 3E7PA 4WVLA 3TRJA 5HFAA 1PK8A 3H65A 4P4TA 5K9ZA 3MN1A 4DV3B 5KCMA 3V1NA 1S2GA 1W96A 1X8KA 3PLRA 3T1HB 3KYBA 3SEAA 1AQNA 1VBFA 4D8TA 3A3NA 3VR2A 3T0GA 3KQUA 1XK6A 2AUMA 4ZHSA 4JI7B 2EJUA 3WLLA 3WFZA 4DYVA 1GUZA 4L4UA 4AMZA 5AKYA 4YGYA 2I29A 3Q40A 1GTL1 1G3QA 3ELDA 1B0AA 1Z45A 4TWRA 1W8IA 1M2JA 4DSOA 4NEQA 2GZDA 3FMGA 2REBA 2RGEA 5FBLB 2YIJA 1NNLA 1K3UB 2J31A 2CW5A 1T5IA 3IT3A 3AVVA 1I32A 4HNTA 4EIWA 5T4HA 2Z56A 4P38A 1YBMA 2RGXA 3PS9A 4P7BA 3O2NA 2QRVA 2JGFA 3IEXA 3O2QB 3QOXA 3SS9X 2C4HA 2YXDA 1R0YA 3H1TA 5TGTA 3BZUA 3MWGA 1LPAB 4NZOA 4QOFA 4YV1A 3TMYA 1WXHA 3GLHE 1YQ9A 3DW3X 4MGKR 2CMHA 4LXXA 1B93A 3WLNA 2RK6A 2FQQA 3P9KA 3PVSA 4PAWA 5JCZA 5HF5A 4TT3D 4Y18A 2HPHA 3UMGA 4OMFG 4GD3Q 3QNMA 2AVDA 1Y81A 2IFTA 2IHBA 4BJ3A 1ITZA 5A3QA 5J9FA 1WSAA 2R6FA 1EJ2A 4MW5A 4GBJA 1CNEA 3IAEA 1WDLA 3VX3A 3PCRB 3M8KA 1SKYE 2Z57A 4ZQBA 2WSBA 4GL4A 3HBJA 4ZTZB 1ODSA 2QMZA 2VA9A 3FF4A 4KUGA 3WLRA 3FSEA 2VI5A 1SUBA 2XXAA 3H11B 4W7HA 2H2IA 4PG8A 2NMVA 1CB7A 3V46A 4Z86A 2DVMA 3AEKA 3HUEA 1E9EA 1JBQA 1H1LA 1XHEA 5F76A 1T1RA 1U9IA 3RSFA 5KSOA 1MV5A 4XM2A 2EKPA 4GZ5A 4DXHA 2VAXA 1CY8A 1E9AA 4KVAA 5ITZB 3AR3A 2VKTA 3JPYA 3KD3A 3PXUA 3BZBA 4KNWA 3ADOA 2XE4A 3GP5A 3I9OA 4DCMA 2O8FB 4TTSA 3W6NA 4IHJF 2AEMA 4XM0A 1UBJS 2N3ZA 3QX8A 1ZJ5A 4FW8A 1Q57A 1SXPA 2RAFA 3UMFA 2BHRA 4FZRA 4BIMA 3FUVA 1KJQA 3QUSA 2XTAA 1MX5A 3JQ8A 4JB2A 4ZQEA 1V3VA 5E9QA 2NNLD 3RRNA 4RTNA 4I7EA 4I1PA 3SE0A 1SUWA 5KNBD 1CZUA 3D6TB 3AKEA 3PKJA 4X3CA 5AJWA 1JP7A 1K8RA 2QZJA 4POAA 5G0TA 2JH3A 4I0WB 2WJGA 3NT5A 1PIWA 4JODA 1GPJA 2XT9A 3RVQA 3UKJA 4YMTA 3SSAA 1RQPA 2VP4A 1CQIA 3IR7A 1A5ZA 2JI6A 3L7OA 5JZSA 4HGPA 4BKUA 1BFDA 2D0IA 1HURA 2R87A 5AICA 5BOVA 4B45A 5EI5A 1YUBA 1GZ3A 2WAXA 3V80A 2X86A 4Z0TA 3GAAA 3L4BC 5I5GA 4ACBA 4CUZA 2AK2A 4F96A 1S8AA 2XPCA 2QX9A 4LHEA 4R1MA 3ROKA 5BSMA 3SXPA 4OHYA 2ZCUA 5K0GA 1LX7A 2C2MA 1FUUA 3A14A 4UCWA 4GDFA 2HDOA 3E1KA 2W48A 4F6CA 5FNZA 4DR2B 3PPYA 4WKGA 2ZIGA 5CUQA 3ZNPA 2MWMA 3IO3A 3WRXA 2ACWA 2C7PA 2E4AA 2VSFA 2NQ8A 1OBCA 1A2KC 3LE8A 2M6LA 3OMLA 4C01A 3M70A 3EUFA 4EHJA 3U3MA 4KXVA 3WMXA 2EIHA 1KC1A 2H08A 4LGMA 1FSFA 3GUVA 1BA2A 1DO2A 4EJFA 1BMTA 4WLFA 3FWHA 4M60A 4P7KA 2VDKB 5JAMA 2D6FA 3IP6A 1L5YA 2B1RA 3CPJB 4MJLA 5CVCA 1L8XA 1E5DA 2DTDA 2C7BA 2L19A 2FX2A 1CC1S 1J49A 3LZ6A 3M2TA 1D3AA 3P71T 1KDYA 3T1YB 4IDFA 3DVSX 4RD6A 4RA9B 5KYWB 2NWQA 4GI2A 4DA8A 3BFKA 3MB5A 2P7IA 3L6OO 4TXJA 2RAUA 4RXUA 1QIMA 4PZUA 4BFCA 3H11A 3VZSA 1MC5A 2A7XA 3Q5GA 3B2QA 1EUDB 1DADA 3FVQA 4UHBA 1V5EA 2D5IA 2NYAA 3CLRC 4FHZA 1ZK2A 1GKIA 4KXXA 5AKJA 2OK8A 3CH6A 4OG2A 4ZZ2A 3ZE0B 4DDKA 1EXNA 1GAQA 5ITZA 3OLXA 3E3AA 4PGFA 2ZSEA 2O3UA 1QMPA 4M0CA 4R8RA 3VJKA 3F6BX 1L3BA 2OCPA 5B3LA 3VKGA 2VZLA 5EQDA 2SICE 1JPVA 4BX9A 4G97A 1F2VA 2BFNA 3IVCA 2LUOA 5AM2A 4WVFA 1HNZB 2BEVB 2Q5OA 3AYXB 3WE7A 5CVTA 3MWDB 4MV4A 1JXMA 1Z7YA 1FMTA 3ILYA 5KVVA 2CL0X 4JBXA 3OX1A 4EATA 2QS9A 3ABRB 3ZQUA 5TDHA 3R8XA 4DCJA 4KO1S 2UZ3A 4XIFA 1HBJA 5A03A 4OAOA 4AB1A 2Q2OA 3ORQA 3GUZA 4EI2A 2WJ3A 1JR4A 2WYWA 2YWCA 3D6NB 4QQFA 3EC7A 3CY6A 4L50A 3DFMA 1JLLB 1WUIS 2SNIE 1P7YA 4CFZA 4JT2A 5AVJA 3R7AA 1PDVA 3OFNA 2AN3A 1I1OA 3ZWNA 4KPYA 1V2GA 2PA3A 4O3FA 2FZ5A 1T43A 4LOLA 3VHLB 1E2DA 2G6TA 2GSWA 2WDPA 4M21A 4XLZA 3ZDCA 1ZCFA 1JN0A 5B36A 2ETXA 3BDVA 3IEVA 1A8UA 1CJKC 2R65A 3KWJA 4N5MA 3R7BA 1QZXA 2QQGA 1EIZA 3OQJA 2E7ZA 4JCCA 1GNTA 1O54A 3B2NA 1SU8A 4B40A 5JAOA 2JEZA 3KOUA 4ALIA 2ZI6A 3NNNA 1VLJA 4TWJA 4OQYA 1QDUA 3WZ2A 2PQ2A 3G1UA 3RRJA 4BS9A 3Q7QA 1JYSA 3IT2A 3B53X 1MOZA 3L6UA 3LXMA 4MEAA 3WNDA 5ILGA 3QWFA 3HP7A 1ECGA 3QKTA 2Y2VA 4MHSA 2NP6A 3WYNA 2YCBA 1LU9A 2DPHA 5CDGA 2CJFA 3DMTC 2C9YA 3JWPA 3OZIA 4X20A 2JGJA 2YY7A 2AMJA 2NVWA 4IG4A 4KIWA 1FY2A 3T7CA 2DMRA 1W25A 1IY0A 4DLYA 4OO3A 5KYWA 1M2FA 3HUTA 1EP2B 4RXMA 3LO5A 5BOSB 4A10A 1TA0A 5ES4B 2IVZA 4OATA 3UCFA 1DBQA 1R15A 1GV0A 3DVRX 3BMCB 1DXHA 1ULBA 1F3OA 1KOLA 1G7TA 1Y7LA 1WMSA 3DFUA 3UF0A 1YC2A 1O95D 2G4VA 4QG7A 4AWXA 3O95A 1I3KA 1WZNA 1EDBA 2VAMA 2YHBA 4GC9A 4N3NA 3HLKA 2BGGA 1PEDA 2NZXA 3ENZA 2GCEA 3QKSB 5ITSA 2D2EA 1TJNA 4HEHA 1THGA 1U1EA 3PD1A 3GGSA 1YK0A 1JFFB 1VLVA 2FZLA 4M83A 1JSLA 1KQPA 3WQBA 1TM2A 4WZAE 4ODIA 1KTIA 3WYBA 2AB0A 1LBEA 4AP6A 2FSGA 2W00A 2G76A 3PL1A 2ETVA 3EZXA 2BEVA 3A06A 3NW9A 2BR5A 1TVMA 3MWDA 3B5JA 4LBYA 1HQDA 4CTMA 4Z6KA 1VC2A 4IRUB 4QEKA 1PTJC 2HEGA 3TOCA 3RBAA 3JR3A 2CXHA 4I2NA 1UK7A 3DFIA 3H6KA 2IYAA 4R1LA 4C3VA 3D1JA 1ORHA 1QIEA 2VP3A 2DUNA 3PT9A 2GAOA 1GTSA 1KEZA 1XD8A 3KPVA 1KK2A 3EZGA 4TL7A 5WRFA 4U9UA 5ALYA 5AM4A 1TU4A 4JYBA 4PG5A 3EPRA 2HCBA 2HJSA 1JLLA 4TRJA 3S2EA 3CURA 3FSGD 1GWNA 2BCJQ 4H4EA 2WILA 3GZNA 3FLMA 4X44A 2Z9DA 5KDOA 4CG1A 4JEUA 2AWOA 1V3UA 4LY0A 2EKZA 1B41A 4RNDB 1ZVVA 2DFVA 1QQAA 3R6WA 5IN5A 1N1EA 4OH7A 1ZAYA 1I30A 4FBMA 1E9FA 3KALA 5UKDA 3EXG2 3GRUA 3GCDA 2ZEJA 4DARA 3EXHB 4C0JA 4KN5A 3KBBA 4C0LA 3DAOA 1SRRA 1AO0A 1G3UA 1YNSA 4GNKA 2C4KA 2ZJOA 2A0WA 4JCOA 1RSZA 3TQTA 4E32A 2V7BA 2NO0A 2NACA 3EOAI 3UFXB 1F1JA 3L06A 3IUNA 5CLGA 3NXKA 2VAWA 3HACA 2PBZA 3LSYA 3VNRA 1XHFA 3WWDA 5DRYA 1G7SA 3AL3A 3FPGA 1VTKA 5E38A 1JEQB 5CFOA 1AUOA 4Y9UA 5H8WA 1IXSB 2P5SA 4JKIA 4RTMA 1I4EB 3I8SA 4I1VA 4AN1A 5F7JA 3PXXA 4U2KA 3N70A 1W87A 2J3IA 1Z9BA 5BOSA 3LIPA 5L95A 3P97A 2RJNA 1HDOA 4LGVA 4YR7A 5U9CA 3QKRB 1DT3A 3RJMA 3UAVA 3H16A 3MWFA 4LWPA 1CE8A 5THXA 5CH8A 4KV7A 4W8HA 5KTOA 3QITA 5EUQB 1G20E 2FMHA 3OY7A 4CIDA 2AC2A 3H75A 4Y7CA 5ESRA 3LCUA 1JAZA 2V9CA 3DF7A 1DOZA 3LKBA 1C1XB 4RHTA 2JA2A 3UICA 3WGTA 1ZRHA 4CL8A 1VL5A 3OT4A 4I14A 1TFRA 2P2ZA 2QD2A 3QKSA 4HDCA 4Y1FA 3QUCA 1Z17A 3VH1A 4EKIA 4Z8XA 1JFFA 2QPOA 3ESXA 4QUBA 4YUZA 3FJ1A 1PI3A 4NWIA 2ODAA 1JG3A 2FUEA 5AJVB 3RFCA 3SLKA 3KKZA 5H0IA 1GAEO 1KFJB 3H2JA 1A9PA 3MPUA 4XQ9A 4EB8A 4YCBA 5FA8A 4B7ZA 1XCJA 3WGGA 1V26A 5U4QA 1N32B 4Z1MD 5EMKA 4AJIA 1D07A 4JVOA 2HCFA 3Q9UA 2WJWA 4C1NA 4QICA 3SF8B 5AVXA 4UZSA 3AKCA 1XAHA 3EMBA 3NYQA 1P5JA 2FPUA 4ESVA 5JJIA 1XFDA 2BMVA 2WABA 2ZG6A 4CHGA 8ATCA 4IOJA 4J1SA 4AP9A 5KNDH 3TD2A 3UMCA 3IRVA 3PE3A 5GGXA 5JSYA 3A7DA 2MU1A 3ZDBA 4BEJA 2GARA 1FFAA 3GPDG 4U00A 2N0SA 4QPNA 4E5VA 1NXQA 3T6KA 1IB6A 3JWHA 4P2GA 1YZLA 5TJ9A 1EDEA 5LMZA 3LY9A 1UKZA 5KO2A 2FX3A 2GMWA 2J9FB 1P60A 4IIXA 4ZYVA 2PFGA 3RVSA 1VPLA 2X0JA 4G3XA 4NYJQ 3KIPA 3TAXA 1F48A 4BQPA 3A1SA 3UK2A 3I2GA 5BW4A 4B5KA 4RM2A 2D4HA 3TRKA 2YWEA 2PPVA 4HTAA 4US2R 1I3LA 3OD1A 5DYGA 4TLLB 3HPQA 2CLIB 3N6RA 1A96A 4UBOA 2XWPA 5F2OA 3TVDA 2IODA 5FFNA 3MJRA 3ML1A 3UKDA 3W05A 2PKXA 1A77A 2IEYA 2REQA 4WA7A 2H57A 1PHPA 1SG9A 3IXMA 3R6DA 4OAQA 4RMNA 1CZRA 3RVBA 3UFXA 3ZDAA 3C5WP 1JHDA 3I3OA 1BH2A 3REFA 3VR4A 2JGKA 3C7TA 3WYCA 3G2QA 1Y37A 4IF4A 1UDWA 1BYUA 1C14A 3A4LA 3BHIA 3C5EA 1H1DA 4GMKA 4XUEA 3TQRA 5JAHA 2LBPA 2JJ2D 2XJ4A 3LX8A 3PJGA 3V33A 3WNZA 5JI3E 4JJIA 2QZSA 5CR9A 3KOYA 3H9UA 5LD2C 5H5JA 4MGIR 2WFZA 5FX2A 1AGYA 1X7DA 3T5AA 1XX6A 3U4MA 2E5WA 3F7OA 2DPGA 3L0YA 3N7TA 3QKRA 4HL6A 2D2IA 4IFEA 3GBVA 3NASA 1P7VA 4J94A 3HR7A 4OYYA 2FGKA 3JZFA 2AHOA 2FW0A 2OBMA 3WK7A 5KWIA 3KYCA 1XZHA 2HMSA 2XUZA 1JQEA 1QYRA 2O2DA 4IJVA 1KK0A 1C1XA 4YV2A 3PC8A 1G98A 4L85A 5L45A 4WJLA 1GY8A 3D31A 3I58A 4HEQA 3QG5A 4QU5A 4WXPA 5IC5A 4Q3OA 1RPTA 5D86A 1PEKE 1IATA 2WWFA 2QLLA 2BKLA 2IQ5A 3ESZA 4JGIA 4G81A 1IK6A 2XAUA 3I42A 5SY4A 3NYWA 1RCFA 2E3JA 3KB6A 1MP0A 4MROA 2GQ0A 2FA9A 4ER5A 3UYKA 2X14A 2GX6A 1PFVA 2YS7A 1UPXA 4LJYA 2GK7A 3QGMA 2JJQA 3TLGB 4UAJA 5JQGF 3INNA 5JCOC 3OFSA 2FJ0A 5GMOA 3M1YA 2W2TA 5E4TA 4F9TA 3SF8A 2G5GX 4DCSA 4JJGA 2Z5FA 3PE6A 3BG5A 1Z82A 4L16A 1SAYA 3RTDA 3ZCSA 4CKWB 3T34A 3ZWWA 1XRMA 4OJMX 4KR7A 3CWCA 1AF4A 2O05A 2Y1DA 3A6EA 4RJKA 5FB3A 3TRIA 4J7AA 2OD9A 1J06A 3Q87B 4GLJA 1MO3A 4U2FA 4YMWA 1MR3F 1NFFA 4Q1FA 2WF5A 2OMEA 1HX7A 5FJIA 1Y6GA 4C2BA 2ZJ1A 2J9FA 1T1EA 2PKYX 3V1TC 3P2KA 2QX7A 3I2IA 4LE1A 4W9NA 1RXSA 5FOQA 1U5CA 3O8RA 1UDBA 4YQFA 1YE8A 2XEXA 1EZ1A 4FLFA 1PS8A 2Q5HA 3FFWA 3IPYA 2ZJ4A 3N0XA 4P6VF 1IQPA 4JXKA 5J63A 1NLUA 1LV7A 5EJ6A 1LB1B 1VJCA 1FDRA 1G8MA 5B4VA 1WQ4A 5DXJA 2QW0X 1RPNA 5PGMA 3T5CA 2XUAA 2CHEA 4WI1A 5C7YA 3LNTA 4UUMA 4XR9A 2ZRMA 3L02A 1AS2A 1ZUNB 1ZFNA 2JNWA 2O8VA 1MNQA 2YZ2A 221PA 4H59A 5AKKA 3ZGOA 1NI4B 3A6FA 3AY6A 3IHWA 2YWRA 5AJUA 2XGJA 1M0EA 2ACVA 4FDVA 1GKKA 4Y9TA 4G5XA 1ZYUA 3BA1A 3EVFA 3F47A 1JSXA 3IXQA 2QN6A 3D7SA 3NC4A 4QGAA 3NGXA 4M0KA 4YWHA 4DSZA 4F04A 2RHLA 4HQOA 3BJEA 2II6A 1XPOA 4LJSA 5CG1A 4XGKA 2B35A 4JVMA 3GROA 3N2EA 5G0UA 5AVVA 1U9IC 2YWDA 4DBVO 5EZYB 1VL8A 5AXCA 4EUHA 4AG6A 4JFAA 4MVWA 3ZUPA 1VPEA 4JHXA 2FR1A 1I0IA 2QY6A 2YW2A 2FWRA 3RAGA 5IZ4A 2UUPA 4OYRA 5IJXA 4Z99A 1R16A 1E1MA 1KMNA 3F6CA 2ORIA 3FD8A 5T5QA 3SDSA 1VZ3A 3VI3B 1W46A 4PV7A 2J0UB 4S12A 7AT1A 2FPGA 3PIRA 1ICEA 5EXPA 2ENWA 2P4QA 3W2IA 4GVXA 3VXKA 1CCWA 3WDKA 4HAWA 1Z6XA 4EA7A 2XZDA 5LOVF 2RFLA 4ERXA 2G77B 3NTRA 1JTVA 4KRXA 5BVHB 1PNRA 1NPYA 1C4WA 1L5HB 3VC3A 1Q7CA 3IVXA 2OZKA 3OT5A 4OUKX 2I03A 3WSVA 1OYOA 3P27A 4MYUA 5F2KA 2FPSA 1KP9A 4NCJA 2B5OA 1GPKA 1E3EA 1L7EA 1Z73A 2DWOA 2XKJE 4FYWA 4D8XA 1ZMXA 3UA3A 4CE6A 4DRYA 1JA0A 3I6BA 4CKWA 2HLNA 3R5JA 2AN4A 4PIPA 2O2GA 4H7DA 4R1UA 2WIFA 3WMEA 4B76A 2DE0X 5E2IA 5KVAA 4B7UA 1ZNQO 1AKEA 5FR2A 2W71A 4MA0A 1YL6A 1M73E 2PFKA 3IEPA 5A3VA 4RHCA 3VVBA 1OKKA 3GLRA 1RKVA 2GZRA 2EJVA 5K4AA 2OC9A 4K87A 1FBNA 1G8FA 3ZGNA 2F62A 3VMFA 3WHIA 1UP6A 1Y3BE 2MOKA 3C7KA 3OE4A 1QTRA 2CK3D 1DFIA 2FGJA 4R2HA 3VKUA 2Y1LA 1UDRA 3WRXC 2H29A 1RAFA 1U0JA 2JC3A 3VU0A 5MN6A 2WJPA 4E5NA 1ZOOA 4KE9A 5BUCA 1E9SA 1VE9A 1PGOA 1T8PA 3V9PA 4LF7B 4R9NA 3GLHB 4DV4B 1GQYA 2YWHA 4JMPA 3SJCA 4P31A 4TZ0A 2WK1A 2I6QA 3CWQA 3LQFA 1Q0QA 1E58A 1L9KA 3O93A 1VJRA 5DM2A 5DHTA 4ZEMA 1D09A 3G2MA 1IYZA 1ZUNA 2X9GA 4DAEA 3ONWA 4GZ3A 4MAMA 1HOXA 1TA9A 1PN3A 1MC8A 1NI4A 1RDFA 3CG4A 5CXXA 5ITWA 4TT3A 1L9XA 2J32A 2Z9CA 3AHJA 3C3YA 4KQJA 3H2BA 4ACAA 3BXOA 3WZMA 4YV7A 1L7AA 3L7BA 3ENQA 5CW1A 2PX0A 1ZL2A 3QWHA 4PO3X 4Z4EA 3MGBA 4PRKA 3WGIA 2X8LA 1K5GA 4NDZA 3FDFA 1ZIXA 1KQ3A 2WOOA 3O83A 1EDZA 1I51A 5DV9A 2BJHA 5EZYA 1X8JA 2PG3A 1LQUA 1Y4AE 4XFKA 3SOPA 4A8HA 2FOIA 1N77A 2B69A 1RXUA 2DWPA 2ODBA 2Q3MA 3ANSA 4H0NA 2ZBRA 2VDMB 2PRJA 1XA4A 4I9HA 4MW9A 3SEQA 4B6OA 1DJMA 1UMDB 1Z07A 3RKUA 3BF8A 1O3YA 4INPA 3KOZA 1GGNA 1KAEA 3PFIA 4H6PA 5HF8A 5B37A 1F7VA 3A2KA 1QNFA 2J0UA 2R1UA 1HXHA 3LC7O 3QFCA 1QFXA 1AHHA 4HFMA 1UBMS 4O29A 2WICA 4RS3A 3KWMA 1R6VA 3I92A 4PZAA 1GITA 3FGOA 2VPIA 4ILEA 5BVHA 1D2HA 1M7GA 2OHGA 3E0XA 3CX7A 4FX2A 1KORA 1KARA 1P39A 2CUTA 2OXRA 1L5HA 2ZXFA 1P91A 3PI7A 4IUDS 2B8JA 1DJPA 1I0LA 4QDOA 5C34B 3WHPA 4ER6A 1RI5A 3QXJA 2QRLA 4TWIA 3AHFA 2X5NA 1U7WA 5SZJA 5HUHA 3USZA 3MXOA 1K9SA 1RC8A 2A1TS 2ZS9A 4P3YA 5F51A 5AJYA 3BHNA 3IMEA 3JWGA 3F8TA 3L5KA 3V1UA 4AX4A 3AF6A 1PQUA 1TT7A 3C2QA 4OEHA 2FN4A 1XCGB 4CODB 3HA3A 4OTZA 4DG5A 3PD7A 3ECSA 5ICEA 3CH5A 4CMGA 2CFSA 4MCIA 3WMGA 3D6UA 3RYTC 3VPXA 5LCXA 3FDZB 3H97A 3AW8A 2ZITA 2X1VA 2IOQA 1E2LA 3M82A 4IMIB 4NU0A 5DIFA 1P3Y1 3UK7A 1B4DA 2ZJAA 3I1JA 4OQXA 3A6GA 5EUCA 4YRQA 5BMVF 3QOFA 3VYVA 3PYXA 4G65A 5C46F 2ZTHA 5FUWA 3O7WA 3M6VA 4BMPB 2Y1FA 1W29A 2XHEA 4QLOA 3MELA 1TO2E 5IAGA 1J4AA 1MW9X 5I9IA 3AIMA 4FDTA 2H07A 3C24A 4AX8A 4Z4FA 2HWYA 1KI6B 2DPYA 2FX5A 1U0LA 3CNLA 4X61A 4CTNA 1UIMA 1Y5MA 3GNLA 3GX1A 4NL4H 4QAJA 5E7QA 3SS7X 2PV0A 4FB5A 1ST2A 2A35A 3IEKA 2H59A 1L4NA 2TECE 3CF2A 4OBXA 4TM8A 4LK3A 4YH1A 4H15A 2XA9A 5BORA 4WZ6A 5D5HA 1QOZA 4EUSA 5BV8A 3LT0A 4J1TA 1T8SA 1ZMRA 4QE3A 5H80A 2ZZKA 5IYZB 3AW9A 1NKVA 1PX2A 2ZWVA 4FLMA 2WWGA 4R40A 4IZOA 1U80A 3F6RA 4LQ4A 1FMFA 2WIAA 5J4VA 4JI3B 4CIYA 2VT2A 3FM9A 2EG5A 4L0QA 3DL4A 3SHQA 2GPSA 2RK3A 4Y8VA 5AI8A 3ZXXA 4A1FA 4IWXA 3RTAA 2FZGA 1I3OA 1TCVA 4I1SA 4CN9A 2JIRA 1HEIA 5E6RB 1U8ZA 1H2BA 1TPZA 3Q9NA 4WJZA 1Y34E 3E4DA 3TLBA 4LOKA 5LQKA 5FYDA 1UMDA 3PHGA 4OX9Y 4EZBA 1JH9A 1V39A 1N5JA 2XLCA 1E4OA 2ATEA 1VHJA 1P1BA 5G02A 5CA0F 1VJTA 4CCSA 1L4GA 2ZANA 5JJKA 5CA1B 3UZUA 1H0KA 2LNDA 3KKLA 1C8BA 2NTEA 1UM8A 2FSFA 2W2PA 3DZ8A 3L6RA 3LFHA 2REXB 4HVAA 4G37A 1Q1QA 3KV1A 2CV2A 1EB9A 1POWA 3EGOA 1NUQA 3IOYA 2A33A 3TDKA 3UAYA 1BOOA 2XVMA 4H0FA 4JOQA 4NESA 2SBTA 4KJXA 5CGQB 4DDWA 3QVOA 5JNRA 2WWYA 2VTBA 4KMOA 2CVFA 3O92A 3TIIA 5DCUA 5J1SB 4Z7OB 5IF9A 5IAAA 4OQZA 3TL2A 1KBQA 1Z5GA 2Z43A 1MIHA 3STYA 4CQMD 4MUHA 3B5IA 4PLPA 3W6UA 2PXHA 4RYDA 5E8RA 4IIJF 1EUYA 2GPJA 4RSGA 3WDMA 2VSXA 2VSQA 1KOGA 5I45A 2OHJA 4RABA 1PQ4A 3ZWYA 2E5LB 2BM8A 4D92A 4KQIA 3S1AB 3FRHA 1U8UA 5LA6F 2ZT6A 3NGMA 1T9BA 4RA6B 3Q1KA 4NLLA 1Q0SA 3B6ZA 3D0KA 5EP1A 4D4MA 3UXHA 3T95A 521PA 1XP8A 2PS1A 3R3YA 1U28A 1KI6A 2EW2A 4MW1A 2Y99A 3VBEA 1T3HA 1U8EA 3F3MA 2BUAA 3H0EA 2I67A 4C08A 4CUJA 4M86A 3SVZA 5JNLA 4EG5A 4F6RB 3IOEA 1CQPA 1F4PA 1RWNA 2FWJA 2VJCA 4C07A 3BXGA 2EATA 3MD0A 5EHIA 1C7EA 5C1OA 2WTXA 4GE3A 2X2EA 3ISJA 3AHIA 5IYZA 1TF7A 4X94A 1NYRA 4MDEA 4C3OB 3VR5D 5A1JA 4LXQA 5K0BA 4HXYA 1Y6RA 3BWEA 5AK0A 4RADA 3NOVA 4UTXA 1WEKA 1ECCA 1V7ZA 1Z08A 2B99A 4IZHA 3C4QA 1J21A 1SCUB 1I2ZA 1KO8A 1WSWA 2QZPA 1OTHA 3M5CA 5JASA 5E6RA 1XXLA 1WY7A 5DYWA 1VRCA 1SZCA 3VNQA 4KAJA 2BI7A 1P2GA 2OO3A 3NVAA 3AH8A 4RORA 3DQPA 4FGUA 3EZ2A 5C81A 1BJKA 4RMHA 5JJBA 2AD1A 1CRLA 1GUFA 3AIIA 4MVJP 4YGXB 3S7ZA 2JFPA 2AOWA 1I80A 4QFBA 4UE6A 3P94A 5I8ZA 5CA1A 2ZBDA 5KYYB 1TMOA 2V7QA 2EW1A 1CG6A 3G8CA 1VBNA 2DLNA 1P2BA 1QHXA 2B20A 1W93A 3JYPA 3QVTA 4WZAB 2NV0A 3GLIE 4V39A 5LYJA 3OLVA 4D02A 5ALPA 4EPVA 1I01A 1AB6A 4ARCA 1JYFA 4BNTA 4YVFA 2QZZA 4LQLA 1AD2A 2ODNA 1NW3A 4MWDA 2XUGA 1NQTA 1FF9A 2OLKA 3C1TA 4RWZA 2JIDA 2FMXA 5DHFA 1TM5E 2J6CA 1AQIA 2PVSA 4GICA 3MRTA 4UU7A 5CW2A 4K6HA 1O0BA 1A9TA 1WMFA 1J1IA 3UXEA 5HTKA 5LQAA 1JQLB 4QWWA 2QVYX 1PFGA 1PUIA 3LLMA 2QR3A 4KRFA 3GU3A 4ZZ0A 3ESDA 2C54A 3RYFB 5J43A 1U4NA 2AMVA 2H9YA 4PGAA 2NU6B 1TNDA 4Q3DA 5F5LA 5HZHA 2GEUA 5GY7A 1GQQA 3GC6A 3N8KA 3QA9A 5L3RA 3S1AA 5LXTB 1U8YA 3SHOA 1FLNA 3ON5A 3V4PB 4XRGA 5BYKA 5FUQA 3PUHA 2WHRA 3AUKA 2VJLA 1KO7A 4RA6A 2KQUA 1DWPA 2E89A 1SUAA 2GFHA 2O5VA 1JECA 1QTIA 2JGAA 3AP3A 3N75A 3NGLA 4ZCIA 1IVNA 2GCGA 4BY9E 1UR5A 2GCIA 3L18A 3CLTD 1FP6A 4DABA 1QYIA 2R6JA 1RHJA 1YC5A 3DHYA 3I01M 1GJRA 4NDNE 3WQQA 4OP2A 5JPCA 4KNYA 3SCZA 3SQXA 2NVUB 4MS1B 4TKUB 5A4AA 2OV1A 4UFOA 1U8XX 5J2TF 4L2IB 1P4GA 3R2JA 4NAUA 4F5EA 1N8SA 2J5QA 2QRZA 4RXTA 3ZLVA 1NVVQ 2IHJA 3CEAA 1N3BA 4Z2AA 4P08A 1ULSA 4C0HA 1RJEA 5DBGA 1MT0A 3O75A 4DDVA 1GG5A 1AQLA 2WG0A 4MV0A 2NU9B 3JYLA 3LLVA 1KJJA 3NYIA 3PUWA 1BKSB 1XL1A 2CDAA 4LCJA 3RRZA 3U7IA 1GZUA 4NDAA 4IKEA 3TLXA 1I10A 1GR0A 5ADWA 1F8YA 2DPXA 4D4IA 1IUOA 3GQBB 3B60A 1O77A 4NCBA 4P22A 3U80A 4PG6A 3JZAA 1K5DA 1YFJA 2R4QA 5JNSA 4KXWA 8LDHA 3PC8C 1HLPA 1NOKA 1USGA 5EJIA 3T1QA 4CCYA 4W82A 4BNHA 5DM70 3WLAA 3TVYA 1SB9A 1U99A 4G4SO 1WF3A 2TMKA 2RHMA 2YYZA 2OFPA 2VIIA 2EHJA 3NALA 1S6YA 1K6JA 2CGEA 2FQXA 4FTWA 4NFHA 5KYYA 2PT6A 5PNTA 1J09A 2PQ6A 1JDZA 3WWOA 3IVMA 2VC2B 1TVEA 3R4VA 2FAXA 2XWBF 1SUPA 3KQSA 1ODIA 5DCLA 4ZDWA 4XGRA 4DA0A 2BFOA 5J23A 4K88A 3EEFA 2CXNA 1JSRA 16PKA 1X70A 2C7VA 2Z8XA 4XQGA 2ONJA 5EP4A 5IMBA 1CQXA 3JARB 1ZHOA 2QP4A 1DKPA 3GGGA 5C31A 3SKYA 1K66A 4JFRA 1SQGA 3GLSA 3KTDA 4UDOA 1HZJA 1RYBA 1A7UA 1WPQA 4J9UE 4EHBA 3BWYA 1X0VA 3LL7A 2MINB 4RK5A 5LUBA 5TEVA 4AJPA 2HJ9A 4PPQA 4Z1MA 3KWLA 1V5GA 4HZUB 3QXHA 3WK9A 4CKCA 4Z4CA 5KJ1A 1M34B 1YZVA 2G9ZA 4M9UA 3KK0A 4R6WA 5JEDA 4YAJA 3H5OA 3K0CA 1B74A 3QOYA 5I9SA 3RYFA 2IPLA 3FYDA 3GNTA 5I9MA 3MGAA 3OX3A 3UJ8A 1NR1A 3JYQA 3KPYA 3LT2A 3NB0A 2WFAA 2NPOA 3I2FA 4H7PA 4E14A 4W9NC 4ZEOA 2Z2ZA 1VHWA 1B3RA 1MB4A 1HTWA 1WDTA 2GGSA 4IIDA 4MRSA 2W4MA 1JHUA 1ISJA 1KS2A 4LPSA 1NUAA 2BZGA 2AA3A 2H85A 5DTEA 2I4MA 1XEXB 1CVLA 2GEKA 2IY9A 3OESA 4WEQA 3IDSA 4Y67A 5KWJA 3M34A 2JG3A 2MIIA 3EPHA 2PLAA 4J0JA 4MS1A 5L3VA 2G9UA 1PT9A 4B4WA 1QONA 2R1ZA 4L2IA 1YS4A 4X6LA 5F1KA 4I9NA 1ENOA 3O5AA 1YAJA 4ZI5A 4A0FA 3OLZA 1LPNA 1DRWA 1YIOA 3HB5X 5IK2D 3O2SB 3K1TA 4KTVE 2PS3A 4GP6A 2EKBA 4YRGA 3QE9Y 4IEFB 3DMRA 4GMXA 1ZH4A 2O3QA 4JJFA 4UQPA 5AP9A 2NU9A 3V7WA 2W4IA 1NVKA 2FZCA 1AK2A 3BOSA 3W3AA 4YFVA 4L6CA 1G3MA 3CZ5A 4URWR 2F8TA 1SA0B 3GQBA 2IPXA 3H4MA 4G86A 2Y3IA 1VLLA 3I05A 3TMAA 4DDMA 4MRMA 2Q4RA 1PLLA 5D7NA 4EY4A 2OLJA 5ALHA 2QXUA 1BE6A 3IQGX 2YYYA 4X66B 4ALNA 1Z0JA 4P9NA 1Z38A 4R8MA 5HK8A 2H31A 1RAHA 2RHOA 1K2WA 5CFQA 4W5NA 2E4YA 4LRUA 1GGJA 2WM2A 3AGPA 1U98A 4F4HA 4HQRA 2IBTA 2OBLA 2UZ0A 2EX4A 1SUIA 2ZKLA 4ZYYA 2BYTA 2ZGVA 3HY6A 3LFTA 3HVRA 2E4VA 1QAOA 2X2PA 1IY2A 1KU0A 4ZU3A 2D54A 1TZBA 5LN1A 4LVNA 4ZMSA 1IZ7A 3JW8A 4OQ4A 2VN8A 3MTQA 4ZOCA 3HBMA 1ZOSA 3WWZA 3EEBA 4EECA 1OX6A 1RKQA 4A0SA 4LWZA 1V1RA 1DRKA 1CQZA 1T9AA 2ILTA 1T5LA 2VRNA 3OCUA 1IY8A 1HYQA 5E0KB 4K9PA 3PXGA 2GCNA 5LFAA 4B35A 4Y2TA 1YBVA 2MINA 2YJ4A 4JN6B 1VIMA 2I6XA 3DPIA 4HZUA 5L40A 3FW1A 3B6IA 4H35A 1M34A 2QVCA 2WTBA 1DEOA 1PQYA 2OHVA 2ZIEA 4AG5A 1UZLA 1WMBA 1H5NA 2NOAA 5B7GA 2XNKA 4PPNA 2FB9A 2ZAGA 1KJYA 1CUIA 5AOCA 1OXKB 4JA0A 1QXSA 3B1ZA 1G6Q1 1EFAA 1HT0A 1H2RS 1MGPA 4BNFA 3ITNA 3MC1A 4N39A 3A37A 5C1IA 3AERB 3ZU2A 1ODJA 1XEXA 2I7CA 1C7FA 1Z2DA 3HO1A 2FR0A 1OGYA 4YIHA 1IDOA 3UMJA 5MDHA 2XRZA 2H2GA 4HUQB 3IPLA 1YCDA 1X38A 2J7PA 1HLFA 2GYUA 3CNQS 3KKMA 1YDGA 3RS3A 4EL0A 1JDJA 3P2JA 1J70A 3AVWA 3CUUA 3NATA 5K0ZA 1KO4A 4X1OA 2QVGA 4K86A 5K8IA 2SKDA 3AUUA 1OWOA 1IXRC 1GPH1 3G0HA 3BWDD 5T67A 3H5NA 2EJBA 1IY9A 1SMKA 4PZLA 1DAPA 1Z4NA 1U3DA 2V6FA 3BXPA 1BQEA 5G4KB 4DLZA 5HK9A 5B30A 3AEUA 5JC1A 3UWDA 2FDCA 3LLCA 3CG0A 3QIVA 5HKAA 5AW3A 5AJTA 4JJAA 3FWZA 2WE8A 3GP3A 4XLTA 1DEXA 2CZGA 4J0GA 4FC7A 4O8CA 1AF7A 1WSDA 2X5JO 5I48A 3PFHA 3WWPA 2PAFA 1ESDA 3CNBA 1MO4A 3CC8A 2R7KA 5D84A 3D2LA 3EZYA 2R8ZA 5F1YA 3TPFA 4D0RA 3MILA 2BFPA 3K8ZA 5KOJA 1M8JA 1PFKA 1A2BA 3MLEA 4WADA 4U63A 4LYYA 1GCIA 3DAYA 3E8SA 1YVUA 4M38A 4OQFA 3ICEA 1IG3A 3EAQA 4MHOA 3AFIA 4QASA 2A5LA 4LBVA 3GGPA 3NDPA 5H4GA 4KXYA 4LS3A 1JR2A 1PCXA 4M22A 5F12A 1GYQA 1JILA 3UK6A 2DECA 2R8EA 2VJMB 2LD4A 3OIFA 1P7CA 1DUIA 4IEIA 5EZ6B 3L4EA 1OZAA 1X1RA 4R9UC 5D6OA 4HDAA 3GT0A 5HJ7A 3HXTA 4NIMA 4XWWA 3BL5A 4L4SA 3K0SA 4WW0A 4MS4B 4DLNA 5ERYA 4B87A 2O2XA 3ORFA 3SBOA 1PZGA 3W5CA 4N48A 2QTFA 2HSZA 2F90A 3KO8A 3M9XA 4EB6B 2IDMA 2ON6A 4WT7A 3AB7A 4GR9A 1N0VC 1Z6TA 3DE5X 2ZSKA 4G8BA 2VJQA 4IXDA 1R1DA 1F12A 2QJTA 3FMFA 5EESA 1EFRD 1GPMA 4LYHA 5CLLA 3QM1A 2DBZA 3SM9A 2P9TA 4BNWA 2DBQA 1CXZA 2YWJA 3R6GA 3CN7A 1BEZA 3AERA 3COVA 3L7KA 2I6FA 3RIXA 3UUEA 2FZWA 3SZGA 3V32A 5CITA 3OZSA 1Z5PA 3ABIA 4LUCA 1PWEA 4M55A 1NXSA 1PZNA 2PEZA 5DLDA 4CBVA 5FPQA 5BQPA 1R50A 3K1YA 4B8WA 2HQRA 3L9XA 4KXMA 1MPXA 2OGWA 3AY3A 4HUQA 4II7A 3C70A 3J7TA 5B7NA 4Z9XA 1WB4A 3O38A 4GKJB 2G70A 4ZC8A 2PIAA 5CXUA 3KEFA 5K05A 4J1TC 2GN2A 2VNKA 2WLSA 5F1OA 1U94A 5CB4F 2B3DA 1VYUA 3P0EA 3T7AA 3AI3A 4CF4A 4QT4A 2A0YA 2DBYA 4PZPA 4I9GA 2HR1A 3L8YA 1J9EA 5HG0A 5KPJA 5F9FA 3OT1B 1PT6A 1K06A 4GBED 3C7CB 2D5BA 3H8WA 4B3CA 4V2IA 3JWIA 5L3SB 3X2SA 3USCS 3DOHA 3K9HA 4PYIA 5BMOA 3C3KA 4PYNA 1ZCBA 1X7ZB 2QTAA 1DQYA 4CDMA 1JHQA 2GKOA 1P0MA 2G63A 2PSFA 3HVIA 4RQAA 3SBXA 5JBQA 5LSAA 2JLYA 2D5CA 3RC9A 4ZZ1A 3VYSB 2VEDA 2WSIA 3L7NA 4ZGGA 4WCFA 5L3QA 1NW6A 1NL3A 3PTLA 4N7JA 3U3JA 1P3DA 3JQFA 1C7ZA 2W6JD 2A78A 3OG9A 3PQ5A 1GR1A 2O7VA 2OLEA 3NM6B 4GWLA 5AD1A 2Y4OA 1IQ0A 1P1CA 3Q2IA 4V0ME 3VZCA 4BBJA 4F3YA 3ASYA 4IGIA 3T99A 3ZPXA 1Q95A 4GHWA 3L0PA 4K9MA 4BKOA 1RXVA 1MUUA 4P4GA 1FBTA 1R6AA 2QL9A 3BQNB 5SY6A 5H3LA 2OYCA 3Q6IA 1N2JA 1C4XA 1U8TA 1QBKC 1VECA 2ZJFA 3L43A 1ONBA 4MS4A 2V5UA 2WUDA 1EMDA 3LKVA 4MKRA 5H1YA 3VRHA 2IEDA 3L8FA 1QR2A 1LVHA 3MINB 4IR7A 3TW8B 3VU3A 1OFTA 2ONKA 4XJSA 1K7CA 2BD0A 1UXOA 2YXPX 2QAIA 3HCOA 1LDMA 2GB4A 2ACKA 5EQFA 1NUHA 2A1IA 4WXYB 5JY6A 5AHXA 1PFQA 3O8CA 2HRZA 4UBLA 4WX2B 3UAOA 3IBTA 2NT3A 3ROZA 4KKVA 4Y2SA 5BRAA 2OZPA 2A94A 2AFRA 4IY1A 1N7JA 2B7CA 3BGSA 3GRYA 3F96A 5BN3B 4CV0A 5D1HA 2WP0A 3LUPA 1KGDA 1KMHB 1U28C 2X3FA 4L8FA 5G1NA 4II2A 1KWGA 1IAQA 5CDFE 3D81A 1MO5A 5TY0A 3QMMA 1Y7TA 1NTRA 1YK1A 3Q3GE 5KYUB 4QDKA 2J0SA 1PR9A 4Z7JA 1L5RA 1ZCAA 3IS3A 3K16A 2FSPA 4JUAA 2PUAA 2GEJA 2Q5EA 4DY4A 2O4CA 2OPBA 3O4GA 4PM4A 1XQ1A 1W48A 5EP3A 4ZV9A 4N1AA 2HF7A 3VYRB 3L41A 1WZIA 5ISMA 1E0DA 2HA6A 4JXXA 1A82A 1NUPA 2FR8A 2G36A 3VJLA 1OTXA 3MK31 3AVXA 5LP6A 1XDSA 2WD7B 2JCGA 3KU4A 3B3FA 1NJ8A 3QK7A 3OT1A 5DK4A 3WB1A 1U1GA 2XBLA 4FHDA 3FMIA 4KYUA 3GLGB 1E6LA 2Z1NA 2BKAA 1U9CA 2C0QA 4GGOA 5ALMA 3ROPA 4BDSA 3QE4A 2C3YA 5EHGA 4FC6A 1ZN7A 3TD6A 1X7ZA 2GT1A 1L8LA 3LO8A 3VM6A 2OK7A 2DYKA 3B3QA 1ECPA 3DE7X 3GEPA 4ROSA 4C3UA 3WGZA 1ONSA 2YVKA 4B6GA 3FNFA 4E11A 1RWXA 3H5WA 1C8KA 3BWBA 1U2PA 4CMEA 1GZ4A 4QBHA 3I3SR 3HY3A 3C45A 3LZDA 3R3WA 3KZVA 1VLQA 1WUTA 4NFYA 5TC4A 1BVHA 4B34A 3OLWA 2Q27A 4DMRA 3S27A 4K9LA 3NBMA 4S3MA 2JJYA 2HTEA 1JV2B 4HXGA 3KUXA 4DCVA 5K03A 3HU2A 3QU5A 2X6TA 4PPFA 4PU0A 1JZTA 3KT8A 4BO9A 5A4DA 3OIUA 1A9SA 1AZTA 1SWVA 1A69A 4BUZA 1JAXA 4JI0B 4GRAA 3L40A 4UBJA 1EM8B 1E2BA 3TW8A 1PYOA 1VPDA 4JT4A 3MINA 5DWDA 4XI9A 2PA0A 2HF9A 2V7VA 1MTOA 3ENWA 3QXGA 4XJVA 3WQHA 4MYTA