3KPYA

Crystal structure of hpnmt in complex adohcy and 6-chlorooxindole
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kpyA00
1Z3CA 3GCZA 3VC2A 1D2HA 2E5WA 5E2BA 5H02A 4ER0A 3BWYA 1X1CA 4ER5A 2YR0A 4XCXA 2ZBQA 1EG2A 5ICEA 5FA5A 1NT2A 1XVAA 3FUUA 3SGLA 4C4AA 2I6GA 3I58A 2ZZNA 1N2XA 3G7UA 2O05A 2PWYA 3TMAA 4F86A 2Z6UA 3BWCA 4EKGA 5GWXA 5ICFA 3KPYA 4U7PB 2IGTA 1X19A 3TM5A 3CJRA 3B5IA 1JSZA 3FRIA 1Y8CA 3UJ6A 1ZQ9A 3FYCA 2LD4A 4PYLA 3P97A 3FTDA 3TLJA 1BHJA 3VYWA 4IKPA 4PGHA 3ELWA 2JH8A 3Q7EA 4PIMA 3M6UA 3LL7A 2BZGA 5LQRA 4R8RA 4HSGA 3DXYA 2QY6A 5F2NA 2UZ4A 4RTPA 3LPMA 1P91A 3PFGA 3FUVA 1ORHA 3KR1A 4X41A 2JH9A 1P39A 2PY6A 3KPUA 4RVFA 3SR4A 2JHCA 3LCCA 4F84A 5KVAA 4DM3A 2PXAA 3HA3A 3HCFA 5FULA 2UYQA 1NW5A 2F8LA 2JHPA 2ONYA 4LWOA 5KQSA 5LR6A 3R6TA 1RI3A 3R24A 2O06A 5EHGA 3RW9A 1JG1A 1R8YA 4PGGA 2HNKA 3S68A 4AZWA 4EKIA 2BM9A 2AZTA 2R6ZA 3LBYA 3M70A 2AOTA 2B78A 3M6XA 3TKAA 5EGSA 1NW6A 1X1DA 3LX6A 4EMSA 3PLAE 3DLIA 2AS0A 2BR3A 1D2GA 4HC4A 4C08A 1QZZA 4RSRA 3BUSA 2ADMA 3EVCA 4LECA 4KIGA 4Y2HA 5DTQA 1WXWA 3KQPA 1DUSA 5JR3A 3GRYA 3RIEA 4HTFB 1FP1D 1HNNA 4GOND 1XDSA 1F3LA 4OA5A 5EG5A 1VL5A 3HP7A 4KDRA 3OU7A 2UYCA 2IH4A 4GQBA 4E2XA 3LCVB 1WY7A 1RI2A 3HA7A 1BOOA 1P1CA 1UFKA 3QOXA 5K03A 2GS9A 3KR0A 4FGZA 3HTXA 2AN4A 1AV6A 3EEYA 2QM3A 5C1IA 4OBXA 5BW4A 3CJQA 4KDCA 2HR1A 4KVZA 3WSTA 3OCJA 3KR9A 2HMYB 3GNLA 1UWVA 5FA8A 3FTEA 3C0KA 3G89A 4P7FA 4XUEA 5EIWA 4XUDA 1PRYA 5DX1A 3FZGA 4ATNA 4C03A 1SQFA 4IV8A 1G60A 4HG2A 2AOUB 5T67A 2NYUA 4CTKA 1WXXA 2ZCJA 1SUIA 4WXHA 2VDUE 5DPMA 1KPHA 5IH3A 4E2WA 3HVKA 3SSOA 2NNWB 2GPYA 3KQTA 5C9ZA 5K0JA 3K0BA 5K0LA 3ER8A 3BXOA 3FPEA 4MWZA 5P8WA 1NW8A 1ORIA 2YXLA 4KWCA 4O29A 2PT9A 5EMLA 3TOSA 3G2PA 3DMHA 2FRXA 2GAFA 4RV9A 4F85A 1QANA 2PX2A 1KPGA 3TR6A 3IHTA 1R18A 3D2LA 4QPNA 2UYOA 5EKUA 2A14A 2B9EA 2ESRA 4X60A 3UJDA 5CD1A 1VP9A 2GH1A 3GJYA 1RI1A 3ER9A 2EJTA 1M6EX 1NBIA 1JG2A 1VP3A 2AOTB 3OZRA 2VDVE 4L7VA 3F4KA 2CL5A 5HOQA 3GU3A 3KQQA 4YMHA 3R3HA 4OQEA 4XUCA 3KQWA 4RYLA 4IV0A 2OB1A 4QTTB 2G72A 2ZWAA 1YB2A 3JWGA 2VS1A 1WG8A 2Y1XA 3LHDA 2JG3A 2OB2A 4YUYA 1EJ6A 1U2ZA 3LKDA 1EQAA 5DXAA 4H0NA 5EC8A 2EFJA 3E8SA 4EK9A 1L3BA 2GB4A 3QOWA 2UYHA 2NP6A 3JWIA 2OXTA 3I9FA 1G38A 4PNEA 1VIDA 2Z6AA 4MQ4A 5ICGA 5ICCA 5B1SA 1M0EA 4RTJA 3UFBA 3P9CA 1RJFA 3KQOA 3R0QA 4GOLD 1O9GA 3B3FA 5EZSA 5FADA 3UJBA 1NKVA 3G8BA 1SKMA 5CVUA 3FRHA 4E30A 4MHTA 9MHTA 4YUXA 3ELDA 4RTOA 2BR5A 2PXXA 1FP2A 4ER6A 3EVAA 1I9GA 3BGIA 4FS8A 4LG1A 1RJGA 1G8SA 4IWNA 2QRVB 3G2OA 3L8DA 5K0NA 2FPOA 5CUQA 2IDKA 4BP3A 1AQIA 3ME5A 3FPHA 5EEGA 3EGIA 3EMBA 1EJ0A 2AVNA 2O07A 5HZMA 1P1BA 2CWWA 4R8SA 4RTSA 4JXJA 5U4XA 2ZIEA 4AZVA 3UA4A 4A6EA 4PYQA 2P7HA 5CVJA 4C04A 3HM2A 4DCMA 2XVMA 4M38A 4PONA 1YFJA 3KR2A 5GM2A 5BW5A 2NXJA 3IEIA 4GUAA 5E9QA 4PYJA 3IYLW 3HCCA 5HIMA 4YUWA 4YMGA 1NW3A 2ONZA 5EZQA 3CBGA 3TPZA 3TM4A 3PX3A 5DM1A 1R8XA 5IKMA 1RJEA 3C3PA 4YUZA 2XYRA 5FQOA 2ERCA 3O31A 1Q0SA 5ERGB 3CJTA 1VQ1A 2NP7A 4EVIA 5K05A 2AOWA 1QAOA 1XDZA 1ZGJA 1FBNA 2ZW9A 3C6MA 5EEHA 1R00A 1JTFA 2BH2A 3KHKA 3DH0A 3P2IA 1WS6A 4CKCA 3NWEA 1QYRA 4X1OA 3SVZA 3K6RA 1G8AA 1NV8A 3VC1A 4PCLA 3MCZA 2AN3A 3MB5A 3UBTA 2YXEA 3A4TA 3P9IA 5HFJA 4G56A 4Z2YA 5GIPE 5DRTA 3C3YA 5LSAA 3DTNA 8MHTA 3O4FA 3SM3A 3I53A 4RVGA 2IPXA 4X61A 4POOA 2P3QA 2GA9A 1QAQA 4A6DA 5EIFA 3DP7A 3HCAA 2PSSA 5EKXA 1FJXA 3TFWA 3MAGA 3OZTA 5K0BA 4RTNA 1TW2A 4FT2A 4RTKA 3E23A 2ZZMA 3UJCA 5FHRA 4RTRA 5DX8A 2IP2A 3EVBA 2PV0A 1DCTA 3NWBA 2DPMA 2ZZKA 2YVLA 4QVKA 5DTMA 3UJ7A 4BLVA 3B7PA 1XJ5A 4R05A 4GOOD 3FUXA 3P9NA 2WK1A 3M4XA 3BZBA 2PT6A 2YX1A 3PVCA 1YFLA 2AOXA 3P9KA 3CGGA 2H11A 4DKJA 3NDIA 5GOZA 4OA8A 2I9KA 3BKWA 4CTJA 1NBHA 2AN5A 3FPFA 3THSA 1ZGAA 2Z6QA 1XTPA 2P3LA 3T0IA 2P35A 3EVDA 5HIKA 3FUWA 5E1DA 2N47A 5K8VA 3GXOA 3EEOA 5FUBA 4QTUB 5EQJB 5LQNA 2FHPA 3PTAA 1NE2A 1KHHA 2OYRA 5M5BA 4OX9Y 5EHIA 1SVUA 1I1NA 2I62A 4OBWA 5HEKA 3REOA 1QAMA 3ELUA 2C7QA 1NV9A 1X1AA 1ZG3A 3HCEA 3KU1A 2OY0A 2ZTHA 3M33A 5FCDA 2YTZA 3BGVA 3OZSA 3MTEA 4PYKA 2V74B 2IH5A 4C06A 2OZVA 2ZIGA 1ZKDA 2IIPA 2ZVJA 3A27A 4FT4A 4GEKA 5E1MA 5E2AA 1L3IA 5GM1A 2CMHA 1T43A 2G71A 1L3CA 1EIZA 5CVEA 3SSNA 5LQUA 1JQ3A 3G2MA 2C7PA 5BP7A 1YF3A 5GP1A 4QQNA 3NTVA 4E33A 4PYNA 2FK7A 1TW3A 2EJUA 3A26A 1FPQA 4WVLA 3Q87B 3MGGA 3OU2A 3UA3A 1I4WA 4R6XA 5FWAA 4RVDA 5LQAA 1IXKA 5LQCA 1AQJA 2QE6A 3HCBA 2OBFA 4M7RA 3SXJA 4E2ZA 3P8ZA 2XBMA 3U81A 4BP1A 4UOEA 3OFKA 3P2EA 2B3TA 4ISCA 1JTEA 3EVEA 1O54A 2OKCA 3OPNA 3UJ8A 3CKKA 2P1DA 3P2KA 1JG3A 4GF5A 4PYIA 3LSTA 3KPWA 5K0GA 5KYGA 2IDJA 1R74A 2G8NA 3B3GA 3GIWA 5E9JA 2O57A 4V0QA 3PT9A 5FQNA 4DQ0A 3NMUF 4DA4A 2PXCA 5DM0A 3NDJA 1B42A 2ZBPA 3OFJA 1V39A 4FR0A 2NXNA 2B2CA 1VPTA 3G5LA 1EAMA 2YQZA 2PX5A 3EGEA 3EGVA 3HEMA 4PINA 2C7RA 3G8AA 5C0OE 2XYVA 3KQMA 5CCBA 2WA1A 1SG9A 3AWIA 4PIPA 2ZWVA 2FK8A 4PWYA 1L9KA 2ZFUA 3NW9A 3BWMA 3UZUA 5T6BA 3HA5A 1XXLA 5FWDA 4RTLA 3R9XB 4QQKA 2ORED 3EMDA 2AVDA 4E31A 4ER3A 2CKDA 1H1DA 3DULA 4K6MA 2VP3A 3O7WA 2IFTA 4OQDA 3EVFA 3B3JA 3DOUA 5K0FA 3OU6A 2BM8A 3LDFA 4DF3A 3PFHA 3FPGA 2IH2A 4AZSA 4PYMA 5EVJA 2ZULA 3ERCA 5K0EA 4RVHA 4YV1A 3UWPA 4BY9E 2V7EA 3LECA 4P58A 4CXMA 3X0DA 7MHTA 5FTWA 2I7CA 1YUBA 1G6Q1 1RJDA 2NXCA 4GC9A 1JSXA 2Y1WA 3LKZA 2XYQA 1O9HA 4HGZA 1IY9A 3CC8A 4QDKA 5D1NA 5HIIA 3T7TA 4U7TB 3KPVA 5E8JA 3RODA 2IBSA 3A7DA 4E2YA 1WZNA 4LWPA 5DTRA 5GIOE 2DULA 4RTMA 3LDUA 2P7IA 3HVHA 4R6WA 1KXZA 4P7GA 2WA2A 3G2QA 1KP9A 3KQSA 3LGAA 1KPIA 3NJRA 5E1OA 5F2KA 4NECA 5HIJA 3A7EA 2PWPA 2XVAA 3B89A 3KKZA 2YXDA 4QPPA 5DM2A 5DM4A 5EMMA 4KIFA 4CKBA 3PB3A 5CVVA 3PX2A 4HRAA 4FP9A 2AOUA 3DXZA 2VZ9A 3T7SA 5K01A 10MHA 1MHTA 3NVKI 2EX4A 2PKWA 1VE3A 3LBFA 1YZ3A 4YUVA 3GRRA 3EPPA 5E9WA 3AJDA 2FYTA 4P7JA 2P41A 5E8RA 2ZIFA 3TRKA 3A25A 3HVIA 3MERA 3FPJA 3KPJA 1VLMA 1TPYA 3HCDA 3NVMB 1SQGA 5DX0A 1OR8A 1JQDA 3P71T 4KRGA 2EG5A 1KYWA 3UJAA 3VSEA 3I64A 2Q41A 4GC5A 3FTCA 5EMJA 4QVGA 3FUTA 3DR5A 4E32A 4Y30A 2P3OA 5JUWA 3JWJA 4FZVA 3CCFA 1R6AA 5DLYA 1JR4A 2OO3A 1KYZA 1XCJA 3AXSA 3ELYA 4AX8A 3MTIA 2PVCA 3AXTA 5MHTA 5EOVA 1MJFA 3DMGA 3HVJA 5FHQA 4ZTBA 3V8VA 3GRUA 3GO4A 5DRYA 2HWKA 3TKYA 4HH4A 3SX0A 3FTFA 3C6KA 4V0RA 3JWHA 3SMQA 1XCLA 4BLUA 1F38A 3H2BA 2AOVA 5KS2A 1HMYA 3LCUA 1RI5A 2FCAA 3GDHA 5DSTA 1NW7A 1RI4A 1KIAA 1XDUA 5DSXA 5DXJA 5DT2A 2P8JA 1INLA 1KR5A 4RWZA 2H00A 2G70A 4FSDA 3UJ9A 4CKEA 4QDJA 2JHAA 2ZSUA 3GRVA 3PS9A 3SSMA 4RX1A 3HNRA 5K09A 2C7OA 4MTLA 4DCGA 2ZBRA 4GOMD 4YV0A 4HGYA 1JQEA 2P40A 3G88A 2QRVA 1AF7A 4BLWA 2PX4A 5G02A 5KQRA 3OE5A 5EMKA 3MCTA 3EVZA 3V97A 3G5TA 3BT7A 3GGDA 4KW7A 3DMFA 4X63A 1JG4A 4MIKA 2YUIA 4E70A 2PLWA 2O0LA 3ANXA 2KW5A 4CWAA 3I5UA 4PCAA 1BC5A 5CVDA 3T7RA 2NXEA 5BXYA 5E1BA 5D1HA 1UIRA 1D2CA 5DWQA 2VDWA 1SUSA 4GBED 3E05A 2AR0A 5EPEA 1DL5A 3DLCA 1Q0TA 1X1BA 1ZHFA 3GWZA 4AZTA 1BKYA 1PJZA 2OPBA 3LDGA 3KQYA 4FSXA 4C07A 4ER7A 3AY0A 2JJQA 3ID6C 3QV2A 3EVGA 2HV9A 2PBFA 3OE4A 3M6VA 2QYOA 5GINE 2PX8A 1G55A 2H1RA 5CM2Z 2G1PA 5F2OA 1IM8A 1L1EA 1YZHA 2PGXA 3BWBA 4RTQA 1N7IA 2HTEA 3ORHA 4P7KA 4AUKA 2CMGA 5LQJA 3E7PA 3CVOA 1N7JA 4M37A 5T64A 2BR4A 5CIYA 4M36A 3DXXA 3MQ2A 3MHTA 3IV6A 3KQVA 3M6WA 2B25A 2GLUA 2R3SA 4DMGA 5K0CA 2IBTA 1VBFA 2PJDA 2ZLBA 3BGDA 3BKXA 3FYDA 4C05A 4EQZA 3THRA 4B17A 1M6YA 3TQSA 5HILA 3GRZA 4DZRA 5LQKA 4HTFA 5CCXA 4YV2A 4PYOA 3DUWA 2K4MA
chains in the Genus database with same CATH superfamily
3Q0TA 1PNVA 2F9LA 2H1CA 4GPTA 3L6DA 4DPKA 3NT5A 2V7XA 2NZ2A 3ZLJA 4FE3A 3M6MD 1NT2A 1XF1A 4FLEA 3D02A 4MUYA 3SFTA 3SGLA 2NU9A 2KX7A 1Z0ZA 4RSMA 1KH3A 4DUGD 1DX9A 2FW6A 4N3NA 2B8EA 1Z47A 1Z2PX 1XTQA 2EHJA 3LLMA 4H6WA 4F4UA 2IX3A 2IGTA 2W2TA 3JPYA 2QGFA 5JG7A 6ABPA 2ROQA 1CT9A 1ACJA 3C7TA 5BOVA 5EKTA 2OG1A 4FS3A 1UP6A 3O74A 1NXQA 1U7PA 4TTJA 2LD4A 4JI1B 1JDBC 1DC7A 3P97A 1VB5A 2A1TS 1KAHA 1TM2A 2V5AA 1A7KA 2JI9A 3FYUC 3IBGA 4JUCA 3I92A 3M6UA 4RD6A 2QMYA 3TFQA 3DXYA 2TMGA 1WB9A 2G77B 2TMKA 3L6EA 1N75A 4E5SA 3GJXC 6ADHA 4UDNA 2WYIA 4HQ0A 4FOOA 1JLHA 3L4JA 4QUHA 4F84A 3OLWA 3LPCA 1NVBA 2BFBA 5D86A 2F8LA 1BXZA 2JHPA 1W4LA 3ZLVA 4C4ZA 3M5PA 1L5KA 1KVRA 3AR4A 4QAQA 4BUCA 1JG1A 2NTNA 2V9ZA 4Q9NA 1PU2A 3PXXA 2RJ3A 3F2VA 4R8KA 3KZMA 3LBYA 1E98A 3N6XA 4O4IB 1DWPA 3M6XA 3AV3A 3ZX5A 1DKPA 5C81A 2CXUA 4INPA 5ELXA 1M1ZA 4DANA 4PQRA 2QDKA 5TC4A 1L5NA 2QDXA 4DSNA 4ZAVA 2GJ9A 5U1PA 4FN5A 5JPCA 4LFBB 4TN5A 5DW3A 3TVDA 4IFTA 4DCUA 4YCLA 1Y3BE 4CM4A 3H1AA 4XXHA 1NOKA 4FK8A 5DLEA 3TOCA 4YRNA 3I30X 1NU8A 4GX5A 3S3TA 2B8TA 4BUJA 4MW1A 5C8ZA 3D3KA 4YYEA 5HJEA 4MMXB 4QKQA 1UFKA 4E5KA 4MQLA 5KTOA 4KPUA 4L0CA 1G9XA 3D7KA 3LQ4A 2AQ8A 4LZPA 1NOJA 4MW9A 4E7OA 1SBTA 3JVEA 3LMKA 1USWA 2WIDA 4C01A 1EI9A 1IHYA 1JEYA 4OM7A 1X6VA 2GKGA 3UAWA 4EBBA 4BAZA 1Y81A 1MRZA 4JA0A 4ARUA 5BRJA 1PRYA 2GM5A 4IQ0A 5AOVA 3JQ8A 4IDGA 2EZUA 3VOSA 1KJWA 5F4BA 2FZKA 3NP7A 3K9CA 4OSPA 4OGFA 4C03A 3IUSA 4CTKA 4GSKA 2VDPB 5CFMA 3HWWA 2H2AA 4LYYA 5FI5A 4EG4A 4Z4FA 5FBWB 1AMNA 3G2JA 1LWNA 3HDQA 3SSOA 1NTOA 4EW6A 4OK5A 3EYWA 1OKKA 4JJ6A 1DKNA 3A37A 3H8VA 3MELA 1EFCA 3MYYA 2YXLA 5HE9A 4FYYA 5P8WA 2G63A 4AKSA 4C5CA 1TM5E 4P34A 3IEMA 4N9QA 3QIAA 3V8EA 4A73A 4TZ0A 4L8WB 3B6JA 1X13A 1JKJB 3A6JA 1BD4A 3KSRA 4I4TF 3RTAA 1E9DA 2QRLA 1U7TA 4YRSA 1KQ3A 3AERB 3GJYA 4MQFB 5HYVA 4IYRA 2FTKE 1JAZA 1LU9A 1RE0A 2FLWA 1QH1A 3GVXA 4I3GA 5AJWA 4C4SA 1VSTA 1KRHA 2CL5A 4BNUA 1TAUA 1ZOPA 3EOAI 5FWYB 1Y37A 4BRZA 4TVOA 1IHDA 3R3HA 5LBUA 3RABA 3HB5X 4RU1A 4ALIA 1BU5A 4QHSA 5AM2A 1P60A 5FJIA 3BILA 1X0VA 4PX2A 4QTTB 3S8MA 1V11B 2V03A 4DOMA 1C1DB 1UBTS 1YB2A 4GYJA 4Q4AA 1SU7A 1Q7TA 1Y82A 4BKRA 1H5UA 3IDOA 3K70D 1J8FA 3LKDA 1RC8A 2RHRA 5ALTA 3T38A 1NJ8A 1DFIA 2ZB3A 1I2BA 3OQIA 1KMQA 1QYDA 3H9QA 5BMVA 3DO8A 5CFPA 5JCPA 4TL9A 4M0PA 3LAWA 1DKLA 1X9GA 1IWBB 1DEKA 1XAGA 1H2YA 4JYMA 2GNOA 3D8NA 3OZDA 2G80A 1QH0A 2R47A 3FGNA 1JIKA 3NS7A 3R0QA 2GZRA 5ALGA 3UJBA 3Q7RA 4YX9A 2B6HA 2Q7OE 1A72A 1G18A 2QZPA 3IDQA 4GPZA 2OV3A 3NYIA 2WP0A 3OZEA 4NZ9A 4RIFA 2JKYA 3UT5B 5ALIA 3EVAA 4F8YA 5B30A 4FS8A 3GDWA 4UBNA 3JASA 3W90A 3K09C 5TDHA 1IQRA 3NIDB 4RELA 1BG6A 1W2HA 1H4VB 3UENA 3ZI0A 3EXG1 4LQCA 3RUAA 4EAQA 3MRXA 5HZMA 2CWWA 5JDIA 4TV8F 5MN6A 4Y18A 3IEVA 1NG9A 5MDHA 1FRVA 1KI4A 1QYVA 2ZIZA 3TR5A 4EPVA 5IAOA 4KSYA 5E3JA 2FSVC 4K6KA 1OLSB 3WFJA 4JOCA 1KYIA 1STOA 5CIQA 1U65A 1YB5A 1Y5NA 2HDWA 4JASB 4Q3NA 5AFSA 5KTTA 1MC8A 1RPTA 4IJ5A 5GONA 4C0WA 5GTDA 5IYZB 5IZ4A 5KHOC 1T4DA 2ILVA 4J7UA 1EVIA 4HDRB 1UWCA 1PS0A 1XMSA 1XU7A 4KOEC 2JASA 1W5EA 2WIJA 1P1KA 2G9ZA 5ERGB 2GN4A 4D9HA 5JQGA 1C7RA 5IC6A 2NT4A 4KE9A 3UAXA 3T5CA 1QAOA 1TQ6A 1XDZA 3K8QA 5EEHA 3VSCA 4EP1A 1M8FA 1NURA 3KDSE 4LI3X 1RYZA 1WRBA 3A0RB 3RC7A 5K20A 3U16A 1NBAA 1M8PA 5FNVA 1JBKA 3I8OA 1AURA 1IBRA 1YB6A 4LE1A 1EQUA 1GKIA 4PCLA 2WY2D 5B6IA 1HLFA 1VKJA 4J1NA 4L9WA 4EUNA 1ND5A 4DXDA 5H9VA 4KZKA 2ASVA 1GNLA 2P1RA 1VL6A 1D5WA 2BM0A 3AFNA 3DTNA 1TRKA 4FKBA 1DWUA 1XRSB 4FLFA 4WCFA 1KDVA 4PR0A 5EHZA 4TLEA 1U2SA 3OPXA 3HR8A 3IUYA 2TECE 1KQGA 2Y67A 2VNSA 1Q1AA 1RFGE 2PSSA 3HKBA 2J3KA 3IQXA 4CKYA 5DNCA 1Q0UA 1VDMA 4RZQA 4EGCB 5K0BA 4FT2A 4WZAA 2GD6A 4XZ3A 2Q2OA 4LQ4A 4MGKR 3T95A 4D4HA 2ADOA 3ZJYA 1XWWA 1W87A 4LYEA 4C21A 1TQ8A 2GD1O 3V8MA 4AMYA 5CA0B 4WZBE 4BO5A 4TZKA 3QVWA 4L4UA 1V48A 3BTOA 3P9KA 1EM6A 4JBNA 2H11A 1ULUA 3RYHA 1XLVA 4GOXA 2V4UA 1XZCA 4YY3B 4EHIA 1J22A 1R9GA 4E7PA 5JSQA 1S4MA 4KO8A 4YCDA 1MKYA 4F5EA 5M2QA 3S8EA 2PA0A 1GHTA 1IN4A 5JW6A 1L5WA 4MR9A 3FCSB 4S04A 1HYGA 3K0FB 1NASA 5KSWB 3TL3A 2IS2A 3EIHA 4QU9A 4FKZA 2OCDA 2AHRA 2Z9CA 2VJDA 4IWYA 4JKYA 3V7FA 2PGNA 1U7ZA 4EMTA 2Q4RA 2OCGA 4O2AA 5B4TA 3VA7A 2RK6A 1TXGA 5C53B 1AKMA 1SVUA 3QLUA 4OGLA 4D4MA 3DTYA 1AMOA 4OHYA 3ELUA 4W1PA 1IY0A 1NV9A 3HCEA 4OXXA 2QMEA 4A03A 2GEVA 4NAHA 1CUAA 1LDNA 2VSQA 5I8PA 4IHJF 4NATA 1DAPA 3RUEA 1TMKA 2ZAYA 5A4FS 2C4WA 1KFCB 3AUJB 3L0CA 5K8CA 1ZVVA 1IWPB 1JAXA 1ZNWA 4PGMA 5BSMA 3ZWOA 1JXQA 3L79A 2SKEA 1PGQA 5JJLA 2A9KA 2I6TA 4KQIA 3STXA 1N5RA 3W8FA 3P9ZA 4HUTA 3HGTA 1VE6A 3ZD6A 2IELA 3DKRA 1HOTA 2C20A 2JAHA 2R68A 3ES9A 2JRLA 2W2XA 1IMJA 5CJJA 4CKWB 2D7JA 2QUBA 2WZBA 4NCHA 2ZYUX 3L1HA 1T9KA 4ZOCA 1Z0JA 3L1IA 1B8OA 2C3PA 3WGGA 2ZBEA 1XZGA 1WOYA 1SZDA 2JAXA 4W8OA 3EVEA 1ZVMA 4MGHA 4EUFA 1RYBA 4RF3A 3DYBA 4X95A 4EABA 5IWAB 5JSZB 4NBUA 1OYVA 4UUNA 3E5NA 2NSJA 4AJEA 1T0PA 1E4EA 3G68A 4G5OA 1A8IA 1DRUA 1VE9A 3RH0A 3OZXA 3L8GA 3CF0A 4DIUA 4C89A 4DA4A 1V1MB 4G0PA 2NZVG 3RF7A 3T7AA 5CLFA 1QBKC 4Y2PA 1FDOA 5AI6A 1JXAA 4C20A 2BKAA 4KX3A 1O96A 1UFQA 2P65A 1PT8A 1SBQA 1N5DA 2ZJYA 4JLBA 4JVLA 2PGOA 2EIXA 3KTDA 3P96A 4IGAA 5DNDA 3K2BA 2DTDA 3AB3A 3BWMA 3F8TA 5KNCA 5J2TA 3KSBC 1VXRA 1YDMA 2VQFB 1XQ9A 5EP2A 3E8MA 1ISHA 3Q1LA 4LJSA 1GUAA 1HQCA 1UEIA 3IDSA 1LD3A 2WIGA 2XEXA 4JP2A 5DEOA 2CKDA 2IOHA 5AKLA 3W2IA 1OXSC 3VZPA 1FQWA 1RE1A 2M2IA 2VZ8A 3JATA 2ZSJA 4NQRA 5D6OA 4QQFA 4UHFA 4W6QA 5EE3A 1XQWA 3LDFA 4Q1EA 2EEPA 4XUGB 2CSXA 5AKEA 4FEYA 3DKPA 4YH1A 1LW6E 1OY1A 1WB6A 3D7SA 3ZCTA 3H1PA 4TV9A 4CQJA 1Z13A 2Q3JA 1UJ2A 3LECA 1K2VN 4RADA 4CMKA 4D6YA 3I6MA 3D2BA 4NNJA 5H3LA 1Y5LA 3ZDFA 2QYTA 3G6KA 3PUXA 1DT3A 5G0WA 3T7TA 2K6GA 1W96A 3L7YA 4I0WB 3QEBZ 5IABA 3RV4A 2WU1A 2VP2A 4BNKA 9ATCA 3DCJA 1M66A 2AFHB 2C2GA 1SOVA 3JQ7B 1QG6A 1ZRNA 3NJRA 2CVFA 3DT6A 4QXQA 5BQXA 2MINB 2PNJA 5JS7A 2CFRA 1EU1A 4KYUA 1U6KA 2QRPA 2XVAA 3ABQB 1CRLA 2J4FA 3KCQA 1JHVA 2DBQA 3EF3A 3MXTA 1AQYA 2D54A 4QWWA 5EJ7A 3GLVA 1OA1A 1OLXB 2JIMA 3LC2O 1EUZA 1OZ0A 3PHHA 4MSUA 5JXHA 1W35A 2IKSA 3RCBA 4ZI7A 4P83A 4D0SA 5KOHB 5ICSA 2CDRA 2JLRA 4XIJA 3RK4A 1IPFA 1DMSA 3VNBA 3VNVA 2PKWA 2Q8QA 3L06A 2CB0A 2PM8A 3H9GA 5FJJA 4CM8B 4BFWA 1DHTA 3BULA 3L6RA 3N74A 1JGTA 1VCOA 1W1WA 2IU0A 2P41A 5BV8A 1DC3A 4AQDA 5F98A 2QRMA 2OV8A 3IBTA 2W93A 5KREA 2LUOA 2OYSA 4Z8XA 1PCXA 1SQGA 2O2DA 1JRLA 1T5LA 1FNDA 3C4VA 2GCNA 2YWBA 3A58B 4QYSA 1NOIA 3L4BA 4OL9A 3C45A 3OX1A 1UMKA 221PA 2HEIA 4MKHA 2DJIA 4JJZA 5L9AA 3O8CA 4DJAA 4JXZA 3T9AA 2ACKA 2XA9A 4ETWA 4DQVA 1E2PA 3CLHA 3L7IA 4JBWA 1NQVA 2R85A 4I5DA 2NZ8A 2Q2WA 2I1QA 5MN4A 4UTZA 2OO3A 2BDTA 1XCJA 2Q9BA 3KHTA 1CJSA 4Y2YA 2Q28A 3C5HA 1BD3A 1ETUA 1MJFA 3LO8A 4AK9A 1F9EA 1VBNA 3GRUA 2PLFA 4UVEA 2C5FA 2LP4Y 3PDCA 3C39A 3TJZA 2HDHA 4QM6A 2FSFA 4JZYA 4D2IA 2MTBA 7ADHA 5BNTA 1N6HA 3P5SA 4Q6WA 1OFUX 1G291 3IESA 3N1UA 3ZQ4A 3PNOA 2RHBA 1EG7A 3P9SA 5K3EA 2ZEJA 1H93A 4C2TA 2P8JA 1PF7E 1ADJA 2QR5A 1G7RA 2Q4DA 2WABA 3OC6A 3RUIA 5E6RA 1OYWA 2R6DA 4B7UA 4D8YA 1VJCA 2BGIA 4H27A 1XRJA 4BLSA 1E66A 1G8KA 2VPQA 3B70A 4GBGA 4JC0A 4ZOQI 4D42A 2YL2A 4Y1RA 2HA3A 4MGZR 3ZS9A 2H08A 3QWHA 5TPWA 3LGXA 1VE5A 1W4ZA 1BTOA 1Z88A 2ZUTA 3ZTYA 4BNXA 1U2DC 2FWAA 5JH7B 3B78A 2PLWA 1M0WA 2OA0A 3I0MA 4DSTA 4MUNA 4PF1A 4Y3UA 1OCEA 2YCBA 4MP6A 4MICA 3FHTA 3VC7A 4EY8A 5IT5A 2CNKA 4C0HA 5E1BA 4D9MA 1BROA 1P1RA 4DIOA 1NI4B 3IKJA 3CA8A 2JAPA 3RT9A 5HUJA 1OVGA 1CULC 3SLGA 3MOSA 3E05A 3A9VA 1PL8A 3HUUA 2YUTA 3PF9A 4G89A 5EY5B 1ML4A 5B5SA 3H1FA 4MLZA 1GR1A 3L8FA 4O0MA 4N7BA 3EVGA 3K20A 4NBNA 1KQPA 3CNLA 4AMGA 1P9LA 2GWHA 2XUAA 2YN0A 4KWEA 4EYQA 3KV3O 3LBIA 3LT2A 3AU9A 4G2NA 3BD7A 1YL7A 2RBKA 2V6JA 3I1IA 4OB8A 4RZIA 3WE7A 5K8UA 2CYAA 4CL8A 621PA 5HRCA 2HU7A 4P7KA 1JHMA 4ZKEA 5TJ9A 4AUKA 1XMJA 3B7GA 2O0HA 4RYDA 2JGMA 5DWDA 2J6BA 4PGAA 5DXFA 3S7ZA 3IVXA 5JMPA 3H3JA 3DXXA 3MJRA 3NOOA 1CNMA 2E4ZA 1GGHA 2APJA 3MJTA 1OT5A 1U4NA 3NAMA 4MROA 2ST1A 4EQZA 3EZXA 2QG6A 3TNLA 1PLLA 2DQZA 3BL8A 1VKOA 3UXHA 4DWWA 1U63A 1KJQA 2LV8A 2P6RA 1CR1A 4IJQA 4JA2A 3DUWA 1FXWF 2PNFA 1CUZA 2E5WA 5BSVA 1KVQA 2VZ0A 4BECA 1UPFA 3C5VA 3WLIA 2AI3A 2OCLA 1COWA 1MC1A 2YR0A 3M82A 3RS0A 1EG2A 3M9XA 1RXWA 4CCAA 2YHIB 3PT5A 5C8YF 1PVVA 1G4UR 2XCLA 2ZZNA 1P33A 1TUBB 4IVQA 1T0HB 2HJSA 3TLBA 4Q3BA 1AXGA 4X62B 5AVKA 4IGEA 1FQOA 4DABA 2QX8A 1XHLA 4NMLA 4NP6A 3HS3A 3WLPA 3L6BA 4DILA 1QGYA 1T5BA 2JH3A 1W59A 1ZZEA 2VJNA 3QUAA 3TUIC 3O26A 3TFOA 5ALUA 1EBFA 2IHNA 4YJGA 2R97A 4R16A 4PIMA 3LL7A 5T6MA 3X2FA 3M3HA 4Q16A 5CW2A 4J4BA 4GRDA 4JBYA 1SG6A 2C5GA 3NI2A 2PMKA 3N6VA 3RO7A 2OQRA 2V54A 4QARA 2OO5A 1P91A 3DAPA 3FUVA 3QLVC 2NWQA 3E4CA 3M81A 4RZXA 1S2LA 4ZT6A 3S5JA 4CMJA 2W2MA 4LHEA 2FCRA 4TKLA 5IZCC 1QBGA 3HCFA 2HU8A 1C3XA 1YZKA 2EW2A 3IC5A 3E9EA 4C2BA 2NU7A 5ESDA 2EDCA 3WL8A 3UPUA 3AV0B 4P4SB 1SBHA 1XTBA 1XDDA 3RF6A 4NU5A 3QM1A 5EFZA 2HF7A 1GAXA 1NSTA 1P45A 1XZHA 3E9RA 3L8YA 4IL5A 2MYTA 1LDEA 4RSRA 2BMFA 1KAGA 3EVCA 3VTZA 4HMPA 4DT1A 3O8QB 5A4AA 4IF6A 3TI7A 3T3PB 3GW8A 1EGVB 2AC7A 3K3PA 4B4WA 5ALKA 3W5UA 5EJ4A 1FTWA 1H6AA 4YLYA 4CODB 3KZ1E 2UUPA 3BIWA 2HBQA 4KDRA 4TL8A 4JMPA 2OCXA 4GQBA 5CRIA 1R3UA 5LPNA 1BOOA 2PK3A 5FTKA 3ESBA 3LUFA 5K03A 3ICOA 4WLEA 1W36B 2DXIA 4RACA 2ZT5A 4NJOA 3W7AA 5A02A 1N2CE 1UDXA 4BIIA 1RZRA 3QEMB 3FCAA 1I2CA 3ZU3A 4Z0TA 1N25A 2C0QA 1H8ED 4ND7A 1T8RA 3UUGA 3FOAA 3C0KA 2M6LA 4D25A 2IZ7A 1IZ8A 3HB4X 2W2LA 4XUEA 5EIWA 1XMOB 1AK2A 3PWTA 3WLOA 4NDNE 1XXHA 4X93A 4UM9B 3DC2A 3AEUA 2ATCA 2UUBB 4YMVA 5JATA 1P2BA 3AHEA 3PXDA 3ICEA 3B51X 3C85A 4ZZ2A 1U9IA 1YUMA 1N6IA 1G20A 2PZEA 3GAFA 4RH1A 5FPTA 2AXEA 3BXOA 1LLQA 3FPEA 3MA0A 3TOSA 5K2OA 4KWCA 1J0BA 3TK1A 4AYTA 1QO0A 1W25A 2Y0PA 1YS4A 5A4DA 2WJYA 1MXHA 2R1VB 1ORDA 2DSNA 2BAGA 3GVIA 2C9YA 5GVSA 1L5RA 1YBVA 1NNSA 1YTLA 3JQ9A 2CGEA 3TIVA 3WK9A 5CEFA 2NZJA 3K4PA 1QV6A 3R76A 1WTCA 2AJCA 2C2YA 3F2IA 1FFYA 2WTNA 2OXEA 2FLVA 2AG5A 5E38A 3LK7A 4LDNA 5I5GA 3KLMX 5LXTB 5LM3A 3KD3A 1V41E 1P1JA 2C8KA 2QD5A 5DYIA 4CN8A 1V8PA 1ZGCA 2MWMA 4WXMA 4B46A 4RFLA 3JARA 2JIZA 2Q5CA 4RAOA 1GPH1 3DAGA 3PNPA 4INOA 4Q4DA 1WXQA 3AHCA 4YRCA 4EK9A 1P3Y1 2HJGA 3C7DB 3IQDB 2CL7X 3PEEA 4IM7A 1YQQA 1QCYA 1ZRHA 3GLFE 2NTEA 4PNEA 2HPZA 4EJSC 4HH3C 1TAHA 3A1UA 3T1NA 2GZDA 1I2DA 4TLAA 1RJFA 2BTQB 2I87A 4Y67A 5CXQA 3N2ZB 1N1MA 1SY7A 2H8KA 3B3FA 4GOLD 4V0NA 5AIBA 3LS2A 5LYJF 3B9PA 2BJWA 4ZCTA 4AKGA 2X76A 1R4MA 1ADCA 2KPOA 4ERXA 1Y6FA 3VR5H 4WNCA 3I2JA 5KPDA 1WXFA 1AQIA 5EJ6A 1XELA 4G4GA 3JQFC 3EMBA 4NV1A 2O9JA 4J0DA 1P6XA 1HQYE 4YJKA 2WFZA 4R8SA 1L7OA 2CHEA 1EM8A 2NUPB 3E9DA 4UREA 1I7DA 3G5MA 5D3MA 5JXIA 4HWKA 5CVJA 2M32A 1CJCA 1MFPA 3VOAA 2W70A 3V7UA 3ROKA 3RWBA 1SHKA 4V0ME 2C8LA 2J3EA 4AP5A 2CXNA 4DE5A 4N8EA 3P0HA 3Q3EA 5AW8A 1TVMA 4N76A 4HRVA 1N3BA 4PYJA 3K6SA 3HCCA 4EZBA 1NW3A 4J0EA 2MR5A 3FOCA 3U7EB 4C4OA 3MAJA 1E0JA 2ZG6A 3TH5A 4J90A 1Y9EA 2Y66A 1CYEA 1X8LA 3CFYA 1JPJA 1NULA 1X9HA 2H1FA 1KZ4A 2WWXA 2ZW9A 2QVYX 1YS6A 1Y89A 3AM4A 4FI3F 2WF6A 1R00A 4KQCA 4NL4H 1O2DA 1XR3A 3AF0A 5H1YA 3DYIA 4XVHA 1TKRA 5IBCA 2RC6A 1TVCA 2WIAA 2I4LA 1Y5RA 5LUAA 1EXVA 2Z57A 3LPNA 3GPBA 2WHXA 2VAPA 3K6RA 2AEFA 1ECJA 2EU8A 2VKQA 1JFSA 3FNBA 3KVOA 5A05A 1Y8QA 3HFGA 4YWJA 1RPZA 1RWOA 1YHZA 2ZRMA 1GNQA 1P8JA 3WLJA 1ZGGA 4Z2YA 1Z2OX 1A8SA 1ZD2P 1J90A 1T2AA 2D4HA 2QE7D 2ZBDA 3TSAA 2ACEA 3NZEA 4QXOA 5ELMA 3REGA 3SKVA 5KYKA 3W5DA 4X61A 2PKQP 2P3QA 1OC2A 1ZISA 3TDNA 1MU0A 4EBFA 3DVRX 2HBZA 3LVQE 3EWAA 5FF9A 1QKKA 3HXOA 1UKEA 4OMUA 2PV0A 3KTOA 1YNOA 3AUFA 1T35A 2FQ1A 2RHGB 5AJHA 1IHPA 4KGDA 1N5IA 5EMNA 1G2PA 3N59A 1GGFA 7ABPA 4MQMA 4BV9A 5A5VA 4CCSA 1JEAA 3P0JA 4YLGA 2CHVA 1I0IA 2EW8A 2F3PA 4KXWA 5KKCA 1ES9A 5LYYA 3GP3A 4B6EA 2QTFA 4MW0A 4TLLB 2CZCA 4ARVA 4RPLA 1KIFA 2Q8NA 3MJDA 4KZPA 2C3YA 5TT1A 3THXA 3AGQA 1VRCA 2VOJA 3OMXA 4NAUA 3GXOA 3NVAA 4QECA 5L40A 4UBIA 2D1QA 4H3SA 3ABZA 4WH0A 2E1PA 2FXIA 3HU5A 3OSUA 4EATA 3MNFA 1QTQA 4DR2B 4BRUA 5DB4A 5JAUA 3O0DA 1UF9A 4OX9Y 2KLBA 4GPAA 4PZAA 4WK0B 2QJRA 2R8BA 2TYSB 5LQDA 2C5HA 3IQHX 3M33A 4B4VA 4CIXA 4E03A 1AS0A 4CKCB 3JQAD 1U0HC 1VLZA 5SY6A 4DJEC 2AYXA 3G8YA 4OGKA 1FFXB 2AI2A 2Z1DA 1W1IA 2AH5A 3DFFA 3HDGA 4NR0A 4TRNA 5ALRA 1ZK2A 2C96A 4C7VA 3R77A 3WR5A 1YIDA 1FZQA 4HQLA 4FWBA 4EMUA 3HXMA 2PKRA 2QLMA 3Q4GA 4G1EB 3C8MA 4CCYA 4F3TA 4BVLA 4TMTA 3W5CA 1YL5A 1DAOA 2QTVA 3OM0A 4ETMA 2JLZA 1IXKA 2AF4C 4CL0A 4TKZA 3N0RA 1N2JA 5B3AA 4CTOA 1ACMA 3OUZA 3AESB 2FG5A 3UK1A 1LNQA 3ZBUA 3GGJA 3OEEA 5FOUA 1WMDA 2A1IA 4QG3A 2VYFA 3OFSA 2XF2A 1DRWA 2XUZA 1NBME 4JUFA 4GF5A 4M60A 3TIGA 1L7XA 5T57A 4EWLA 2X1HA 4RJKA 5HTOA 1YK1A 2JGDB 4B9AA 1N78A 1FRZA 3NMUF 4L50A 5KOJB 4UU8A 2XUDA 3LWDA 1P9WA 1UBMS 3JAWA 2JFYA 4TPKA 121PA 5DGCA 3FSEA 5TE9A 3NYQA 4JVOA 4KR6A 5TMPA 2GEJA 3E7WA 1SN7A 3AEZA 1Q3TA 2MMGA 2YBDA 2ZWPA 3OAAA 2Q3EA 3CN9A 1Y9DA 1PGJA 1YJAA 8ATCA 3G7SA 1XXLA 1LRKA 5FWDA 3IA2A 1G5PA 1NVUQ 4OOEA 4NTZA 1CZHA 1BO6A 1EJBA 2E21A 2EDAA 2NO0A 4PBSA 3RUHA 1EGAA 2XQIA 4ZC8A 1ZBDA 3DTVA 3O7WA 2HSEA 3DC7A 2JFPA 3VNQA 5IVIA 1NUSA 4LTDA 3ND8A 5D7BA 5FX2A 1HDXA 2XWJI 2RHLA 2X5OA 4V2IA 1DWOA 1G21A 3Q2OA 4C76A 1BXRB 3QFCA 7MHTA 1EH5A 2NXCA 1TT7A 2REBA 3RFCA 3SZGA 5JNSA 4A2PA 2W6PA 1IY9A 3QPDA 1VTKA 1ZN7A 4U7TB 5ANRB 4HY3A 4OUDB 1ZUD1 4BJ1A 2JEZA 2X5JO 3V42A 3KQHA 2O0MA 4YCBA 4TMZA 4JROA 5A3VA 1AO0A 1PJAA 2H1OA 2EERA 4KBGA 4CKBA 2OHHA 2BFWA 3N8NA 4GAEA 4MKRA 4HEHA 4G37A 4BASA 1K3FA 1YZFA 5HF6A 2AOUA 5DYNA 3H5LA 1K6XA 1MHTA 1CDZA 2P9BA 2RAUA 3GRRA 5E9WA 1A7UA 4O08A 4WBNB 3EPJA 1XMQB 2QMUA 2J46A 3WRWA 4ALNA 1CJTC 1D03A 2XNDA 4W6ZA 3FOFC 1IIRA 1PDWA 2FSHA 1FP7A 2RHOA 1VZ2A 2RHJA 4OJTA 4QUDA 4Y1FA 3NETA 2ID8A 4FFSA 3PCRB 2GN8A 5KNLA 2FPWA 4BE7B 1E2EA 3IT1A 5HUHA 1YA6A 1PSWA 4YI3A 4X5OA 4AW9A 3K4HA 3L93A 5ETJA 4KR3A 1G1AA 3DR5A 4KVAA 5TMBA 1YAHA 2X0DA 4UKDA 3JZFA 4BLPA 3LXXA 1UBKS 3GWGA 4IIYA 3SX2A 3V6LA 2ZU0C 3CCFA 3J80A 1FEZA 4D79A 4G63A 4FMPA 3F73A 3IOYA 4PLFA 4PO3X 5CJ2A 4LRSB 3U3DA 4B85A 2WD7B 2H51A 5DYWA 4BQFA 3ESXA 1SVIA 2X0RA 4AJ9A 2HWKA 1N6OA 1EQ2A 4LW8A 3T15A 2UZ0A 4PN3A 4CV3A 1BCSB 2LCIA 2QIOA 2DLNA 2N0SA 4C4XA 1KQNA 2H48A 2PWZA 2AN9A 3DCNA 4H6VA 4UBLA 2FF7A 4WGFA 3ZCRA 4B7CA 4AMBA 2OP1A 1ZY2A 1B7GO 4DMMA 2CVZA 1EA7A 4LZLA 2ZSUA 3QVOA 4A2WA 3FG9A 1XEXB 1ZLXA 4RCYA 1UXHA 2TMDA 2W4MA 3M6AA 5ALEA 1N6NA 1G5TA 5DCLA 1X14A 5C46F 3I37X 1WBDA 3PC2A 4IMPA 3NDBB 3ANTA 3SX4A 3USCS 3OIVA 5IJZA 4AJNA 4G0VA 1HYEA 1R0YA 4UBMA 3SHFA 5KQRA 5JVDB 2PS1A 4G5QA 4A0RA 4IUBS 5BYAA 3FSGD 2PUEA 3TZEA 5I9IA 2C9BA 1SRRA 1BDIA 1WETA 1Y42X 2Z1NA 3HBLA 2O0LA 3NM6B 3O8OB 3DCIA 4I55F 5F5XA 3T9EA 3P4UA 2XKJE 2VYVD 4E15A 2DAPA 2WSSA 4RF2A 4KFTA 3BMQB 4BLRA 1FJHA 1DV2A 3OIYA 1BWPA 1PVOA 2XBLA 3I09A 5DWQA 5JJKA 4KV9A 5AI9A 2P9TA 4OHCA 4XSGA 1FQJA 4BBPA 1BVUA 1XGKA 2QYHA 2ZYDA 1Q3KA 4L3WA 5DLPA 1ENZA 2C9DA 3QKIA 2OPBA 1R10A 4M21A 3WB2A 3WIDA 4YV1A 1M6VA 3PFCA 3QV2A 4X3CA 3H8WA 3S2IA 2HZBA 3SEQA 2NM0A 1AKNA 3BMNB 1I3LA 1G55A 1A04A 2W58A 3HABA 4JBIA 1HFKA 4BBZA 1N5OX 2E89A 2BKVA 5IJXA 2G1PA 3ZDQA 2Q3CA 4PV7A 1D1QA 1J1IA 3Q8LA 2H18A 2QLBA 2RDMA 4DVJA 1II9A 1LPNA 4H7EA 4AN4A 4BO1A 4DNXA 2AE2A 4KQKA 2DT8A 5KEIA 1QIDA 1GNPA 2IYYA 3ECCA 4HDMA 4M37A 2GAIA 1I33A 1Q2XA 1KI8A 3V8RA 5MN5A 1E1KA 4ZQGA 3PZBA 3QXGA 3QTBA 3B53X 5ILOA 4CQLA 1LBIA 1H85A 1M1NA 3A9RA 3B1JA 1V1JA 3A2MA 2OBXA 3DEIA 3QH4A 3JV7A 3OT4A 3QHQA 2AI1A 4ZP1A 4V0OA 4EB0A 1E79A 3FMVA 1MABA 4ZJUA 2F3QA 2K4MA 5H3HA 3TZKA 1MXFA 2KQUA 3EA4A 4ZZ0A 1PG2A 2HTFA 5JAHA 4YMWA 1NXXA 2A6PA 4XCXA 4QM7A 3GCGA 3GCWA 5TVKA 4DMUB 1C0LA 4JT8A 4U0JA 2H1VA 3VR4A 4XGIA 4J7XA 1OYYA 3KJIA 4HNTA 3HEBA 2O8DA 1XQVA 5FL7D 4OYLA 2FG6C 5CLIA 3SJBA 3UAOA 1JR3D 1OFUA 3D8HA 1ITZA 4ML3A 5L3QB 2IDZA 2YMLA 5LKAA 3TG2A 3T5DA 1F0YA 3GLGB 2DWCA 3D6JA 3P1JA 4PYLA 5BQ3A 5CB0A 2AUMA 4S1NA 1QE5A 4Q7JB 1H1TA 5FPHA 2BEVB 1IEVA 2UZ4A 5A2QA 4JP5A 5A0VA 1Z07A 4KUHA 3WGZA 1T9BA 4N03A 2PMBA 2QMZA 2HREA 4A2QA 1EINA 3GZNB 3A1EA 1F2TB 4K9SA 3EPRA 4YT4A 5FULA 1FTNA 1IM5A 1M73E 3LJKA 4U2DA 4WN3A 1MB4A 1RI3A 3QJYA 5IT0A 3D8BA 3PFWO 2C9OA 4X1KA 3FDIA 5FNZA 4IF4A 3IHLA 4DKXA 4INJA 3WK5A 2B78A 1X1EA 1XWFA 2Q5LA 1WA5A 4PBTA 4ZT2A 1KTIA 1RC0A 3IKVA 1ZXLA 1Z83A 2FPUA 5ES4B 4B48A 4HAUA 4YNBA 2A5JA 5EXTA 1QFYA 2ODWA 2ZSDA 3JD3A 4NMWA 1FP4B 2WJ6A 4U02A 4EW3A 1WXWA 5DM4A 1D4OA 2C2WA 1E2BA 3D0OA 4K7JA 4CNBA 3HUDA 3U3XA 5C52B 3JQQA 1SO8A 4K3VA 1FQKA 2HQBA 4D9CA 1SUFA 1B1CA 2NOAA 1DBIA 1QP0A 1TADA 5GMOA 1ZSYA 5LQSA 4MDEA 4NYMQ 1U1FA 1P1CA 3KP1A 1RRCA 4FEEA 4M99A 4QFCA 3RC3A 1JLLB 1P80A 1MNAA 2K7ZA 3H9BA 4U6SA 4XPIA 2ZYRA 3GVPA 3V8PA 2VN8A 3BJZA 3FPAA 2Z5FA 3N86A 3NCHA 1LUAA 4KXQA 1QRSA 1AV6A 4KDCA 4JAVC 3P52A 2I8CA 1QQ6A 1GXSB 3U31A 3GPDG 4NQZA 1Y4DE 1CQIB 3B1YA 3UJPA 1W46A 4F3KA 3PGKA 4KREA 3UGTA 1SRQA 2G5CA 1AF4A 2PBZA 4B33A 1RWKA 4XVCA 3ROZA 3ZI7A 1QOZA 2YY6A 2J41A 3UCXA 2P4EA 1YRAA 4R2JA 3ZJTA 1PQWA 4LVUA 1XCOA 3QELA 1W4BA 3U7RA 1T36A 2JNWA 3TRHA 2AC2A 5BT9A 2JA1A 2GDJA 4O1MA 5KTSA 3TUZC 4IVPA 4P84A 4P4NA 1XPRA 1ZW1A 2YASA 3G2PA 3MJCA 5BY2A 8OHMA 4PZEA 3LBAA 5HJ2A 5B2ZA 5BWCA 3CVVA 5JBQA 4RFVA 4HAIA 1BMQA 1PTJA 4MS4B 3WGMA 5DHQA 2RCNA 1YBFA 2VOEA 3AEKA 3TRDA 3UJDA 1HC7A 2J1LA 2OXFA 1JVNA 3NONA 2HJRA 3OF2A 4A0FA 3D0KA 2E2WA 2Z04A 3U4DA 1MH1A 2QRJA 2XOEA 3N2GA 1KERA 2XIQA 4QXRA 2J9YB 2NO5A 3G85A 4L6AA 2GWRA 4U63A 2F90A 1NL3A 2YH2A 2XT0A 3L8HA 1BX0A 4KUGA 1MGPA 1JAHA 4H1WA 1CLEA 2Z1MA 4J76A 1N77A 1Q2UA 4JBGA 2FGKA 1QF7A 2VAVA 2FEKA 3EQ6A 4QNMA 3QVVA 3MWDA 1N0WA 3RSCA 2ZXUA 1NQOA 3W78A 2VTVA 4ZARA 1R9NA 1EZZA 4WJZA 2H2IA 3MF4A 1GGVA 3I9FA 3JY6A 1E3TA 1FFBA 1RZ3A 2PX3A 4L73A 4YREA 3UAGA 1OI7A 4UD2A 4ZMSA 3I0NA 1VIDA 4TKUB 2AJDA 2R751 3AP2A 4TXMA 4XX1A 3KSMA 1U28C 4ZYTA 5ICGA 3WNVA 2Z6AA 5EZYB 1A5BB 1SKMA 4H1TA 2HUNA 1GKUB 3C3WA 4EJ2A 3F96A 3FRHA 4IUDS 4Y0AA 2X8JA 1W4AA 4N5HX 5BR1A 4FBLA 4IOKA 1SUAA 4XM0A 2ZSFA 1GPKA 1KK2A 5EUMA 3WLMA 3BMXA 2YHUA 3GZTB 2ALJA 3NEAA 3G2OA 4AMUA 2VJBA 2PL5A 4BP3A 4PW0A 5EIHA 5AVOA 2LZ0A 4HQRA 5I9TA 3M4JA 3PUWA 5L3SB 3W5AA 3L40A 5SYNA 3RS7A 2BKXA 1O8BA 1A7AA 2ODNA 3D1LA 3ISJA 1RIFA 3MMPA 1A9XB 4JX9A 1A0OA 1R0XA 4I4NA 4I50B 5CVTA 4W9RA 1ADFA 3HPQA 4M0LA 2B98A 1ZA1A 5L95A 1Z7BA 4LK2A 5EPOA 3ICQB 2O8BB 3CW2A 4LSZA 3IEXA 3I04M 4CCWA 1LPOA 1XEFA 3DOIA 1TC1A 3BEOA 1I94B 4MEBA 4HZUB 4WKBA 2VRCA 1R6VA 3QXHA 4Q4HB 5HCIA 5BR8B 3CY6A 3EXG2 5EJIA 1HZJA 3EW9A 3PFBA 1CRWG 2XYRA 3QKSA 5FQOA 3CCBA 5HCUA 1W9HA 3QKRA 4L4SA 1Q0SA 4H2DA 4M1MA 4ONEA 5KVCA 4DV5B 4OQPA 3IPRA 5ES3A 1E2NA 4UAUA 2XUGA 4CR7A 5JTTA 4JLMA 1N2ZA 2HM7A 3KHKA 2DEUA 3NH9A 4K8OA 4ZA2A 5KYUA 3LUJA 4D8WA 3LRXA 3EQ2A 3ZK8A 3WNZA 1N9GB 1J5XA 5HPYB 1Z73A 4TV8A 4IO0A 2VUTA 3V00A 1GQ2A 5IG2A 1P3JA 2BELA 1PK7A 2QU8A 2WZQA 4PSVA 5H59A 3VAAA 1Q7EA 3WAKA 5INTA 4TT8A 1EESA 1EK1A 1K8YB 3EFOB 1TVKA 2B1QA 3S2UA 3F6PA 2QLNA 1VJ1A 6REQB 1TEXA 2PIAA 4PVCA 2GEKA 3K1ZA 1ND6A 1IFXA 4HGRA 3P0IA 5EKXA 4QXPA 1GEGA 4UHKA 1FJXA 2QJWA 3KD2A 3RAJA 4MPPA 2ETXA 3S40A 2X1LA 4BO4A 5EVCA 4GLOA 4AJ1A 4E51A 1DPFA 5ILQA 2VHXA 4ZCQA 5LLDA 3SIPA 4S12A 3C3CA 4DBLE 2XWPA 5IM4F 1WEKA 1E8DA 1MB0A 2OORC 1TF2A 2WZDA 4HYQA 5B58C 4HVLA 5HJ5A 5JYBA 1JWLA 4EEZA 3BZBA 2MSCB 4PZCA 4HDKB 1RWWA 4AIIA 3GRPA 2AOXA 5J1SB 3LTNC 2XKKA 1TQ4A 2AXQA 3O3CA 5CT6A 4PFKA 3RYFA 5JMOA 2ZRLA 4LF6B 4IICA 3WQQA 4Q9HA 4H0CA 2X9GA 3L2OB 4IGKA 1P6UA 4MPTA 3STVA 4G36A 2X0KA 2BHSA 1WDMA 1WJGA 2JFNA 2P35A 3FOBA 5DJ5A 4XWOA 2AR7A 4DV7B 3CMCO 3O4HA 4KIJA 3FBGA 2D5IA 1N33B 3EDRA 2QL9A 2H9IA 421PA 4KG7A 4DRYA 4EL5A 2OKGA 1ONPA 5HEKA 2E4AA 4LOJA 3F4BA 4D3YA 3B82A 3ZTTA 1XN1A 2F62A 3DR3A 2ZTHA 4BQOA 3A6LA 2QLLA 1UKZA 5EWMB 3SE7A 3OZSA 3WBJA 2QLJA 5KYYB 1YIAA 2CLCX 2FN3A 2W42A 1RRGA 1D8AA 2B8NA 1NBOA 1E2IA 2OZVA 5TPZD 3TIFA 4BP9A 3FVQA 1L7DA 1Z5WA 4DJJA 1T5HX 5L8VA 4ZEVA 4XWWA 1WIWA 1B26A 1YCHA 1JV2B 1H4TA 1NPYA 4P5PA 5GP1A 6GPBA 2BFAA 1WR8A 4TTVA 4DA9A 2ADFA 5LQCA 1C8LA 1FFDA 2AUTA 1YMQA 2J5QA 3E3OA 1E9FA 4G4SO 2QJOA 1AKRA 4EHFA 1W85A 3RVQA 4ZVPA 1X87A 1PR9A 1SVKA 2PR2A 2A59A 4FDLA 5IDWA 4LIPD 2YJ6A 3BHJA 2YFHA 3KEFA 3ZEAA 4ZGGA 1LVHA 4OM8A 3I23A 4ARZA 4YMUA 1WQ4A 1E58A 2AW3A 4IHJA 3T0GA 5JEEA 5E9JA 5ESRA 2ZI7A 5J59A 4MP3A 3W6NA 4B6SA 2PXCA 2FR8A 3AP1A 3E27A 1B42A 4I8XA 3G5LA 4BATA 3B52X 4BNYA 3MGAA 1UZNA 2CEAA 1W5TA 4QSMA 3JVUA 5HQ3B 4A3SA 2R5WA 1P3DA 3IJRA 1YJBA 4LSGA 4R3WA 4DMRA 1KR2A 3GLTA 1C1HA 1UK9A 3LY7A 2DFPA 1EP2B 1S96A 3L46A 3DHWC 2XYHA 1V7CA 4YFYA 1OV4A 4F4CA 1P0PA 2OOKA 1CEQA 1J25A 1MB2A 1RLIA 2Q5EA 2ZITA 4GYWA 2VDKB 4AF6A 4RIHA 4ZJPA 4R7TA 2RGYA 4BC1A 1ESNA 2R86A 721PA 4MAAA 2WKSA 3I42A 1FYDA 5BRAA 3DPUA 2PU7A 3CISA 3EC7A 1ENPA 1W8IA 2SECE 5SICE 4C7XA 5JC8A 4FOPA 1HY3A 4NZPA 3V4OA 4DHWA 2AC4A 3PJEA 5CB4B 4U7WA 1NVVQ 2GAJA 1K06A 3AM1A 3EBPA 3ETJA 4ABYA 1MG5A 1RLJA 3J81k 5J3JA 2WYHA 4BDTA 1WCIB 1LH0A 3S2GA 1CEXA 3T1VA 4D0NA 2IXTA 2P30A 3F3MA 3K0KA 3IQGX 3L43A 3M9WA 4BPBA 4O4HA 1N4AA 3GLQA 3VOBA 5IVKA 5T8KA 5CTJA 1DKUA 4PNZA 5GIOE 1ZUNA 2NQTA 2QX4A 3HVHA 2JFQA 2M6SA 3O75A 4IIJB 4J43A 3VH1A 4U7DA 3QI2A 2NAFA 5F2KA 1VHDA 3KUDA 3VHXA 2WFLB 3HH8A 5DM2A 3QWIA 4D98A 4OL0A 4D80A 5H83A 5A4IS 2I33A 3R7NA 1DJPA 4DLSA 3K05A 1Z5OA 1FNNA 3KAQA 4FP9A 3V55A 5K4HA 1ONBA 3SICE 1L6IA 1VJRA 5DBGA 1V2GA 4YYZA 4YO8A 2PZKA 3TIXB 2NO7A 2PS3A 3OC0A 4JQSA 5C7OO 4MKGA 3BCUA 4J1TC 4KHPB 4BNWA 2X2PA 3A25A 5DBIA 3W3AD 3FPJA 5HHTA 1K66A 2FFHA 1A8QA 5AKIA 3UYLA 4XVRA 1S7GA 5BYBA 1EDEA 2BFFA 2QMHA 4OAOA 4PQYA 1IY2A 4GKVA 3IB6A 3THOA 3IODA 4E5YA 5EJEA 1P4AA 3AKCA 1P44A 4RQTA 2QT0A 4O1HA 4LRTB 3FUTA 4UMVA 4P9NA 2P3OA 4PG6A 1OB2A 4LV6A 2DHCA 1MX3A 5DHAA 3I9KA 1IY8A 3LSYA 2CD7A 4GWKA 4MR8B 2I2CA 1XAIA 3NBQA 4EKYA 2I29A 4D74A 1U94A 2JCVA 4P92A 1NMYA 3BM5A 4POAA 3I39X 2A2ZA 4KE6A 5AVJA 1WHTA 3UO8B 3H5VA 3EK2A 5DHFA 3K1AB 4GX1A 4F2DA 3TGPA 1E2UA 1PZXA 1E61A 2G07A 2B36A 2QAIA 3GLHA 4B7ZA 1E9SA 4AF8A 4E46A 5C1BA 1KARA 2Y1CA 3OJXA 2ECFA 5DXJA 2H4XA 3QE3A 4RWZA 1UDWA 4YO7A 3HSSA 1KETA 4IIUA 1W94A 1O95D 2WYOA 2YVAA 1J7JA 1IN1A 4AKTA 4GRAA 1A9OA 1AKYA 4WV3A 2D7DA 2BD0A 4Z7OB 4GYYA 4Z0NA 4OOFA 3JRNA 4JP3A 2W0SA 2HMSA 3RS5A 5ALSA 3ZZUA 1WUTA 3Q1KA 1FMJA 5HVNA 2YS7A 2WF8A 2H4ZA 2CNBA 2Y0BA 3J7AC 1CW2B 1Y8AA 3V1LA 2FR1A 2R8PA 3R5XA 4DNPA 4KO4S 1KGSA 5MFZA 4HFMA 2NAPA 4HDSB 4M1SA 4QEDA 1DDGA 1G66A 1LK7A 2P90A 2WU3A 4YRAA 3GEPA 1QHNA 2EL7A 3UC9A 4KQHA 4V24A 3IELA 1PW5A 4MVJF 1LDYA 5L7WA 4QYIA 3ZK7A 1L2TA 4LDRA 3KWJA 2O48X 4EHLA 3RBXA 2ZSAA 4WDRA 4E6PA 5ALFA 2W2QA 1X1BA 1ZHFA 2Q6OA 2DQ4A 2RGNA 2C54A 4HLUC 4YRQA 5G1OA 3T1OA 3ZHXA 4C07A 5BSFA 3GB9A 3MOIA 4YJHA 2IYSA 3NEYA 1RKXA 2GBLA 2OFWA 3KV1A 2QYOA 4EHBA 3C1TA 3S55A 4DZTA 1I4EB 2OFXA 3VU9B 5C5IA 1U0TA 2BFMA 2IV7A 3W2EA 1XZMA 2OD9A 2OXRA 2B5VA 4JWTA 5THQA 3EXFA 2OGWA 3UGJA 4XGRA 2XZPA 3D8SA 2R7LA 1N7JA 4LUCA 2BCJQ 3E9YA 5CIYA 3MQ2A 3WGKA 2VTBA 1AKEA 3AHJA 3W77A 1VM6A 4GHWA 2O2GA 4G9EA 4K05A 2ISSD 2Z95A 3DL0A 2EKZA 3KAKA 2C92A 1NRWA 2W22A 3FDFA 3FYUA 3K8ZA 4MEJA 1WLSA 3H3FA 3IP6A 3QFFA 4EGJA 4HDNA 5BR4A 5JSUA 2QAGB 1H2RS 2YRWA 4IDPA 4PYOA 3STWA 3ZHOA 5KVAA 1K0FA 1UMDB 2GN0A 1D2HA 2XR1A 5JCOA 5JIBA 4GI5A 4K9MA 4CIYA 5LOVB 1MZPA 5NLLA 3GFBA 2NACA 2P2YA 1OVMA 4U7FA 2JFFA 2VDRB 4RD4A 2QTZA 2G7ZA 5CIWA 1KDYA 5AKYA 1NJ5A 1S6YA 1ZN9A 3W5VA 3TQOA 1I2ZA 2XMBA 4MV4A 3T5MA 3A4LA 1NRJB 5KJ6A 1T29A 2PPLA 3OEWA 4ZYWA 1IHXA 3HN2A 4ZRNA 3UYKA 3CJRA 3B5IA 4ZQIA 3H04A 4PG5A 4B47A 4WMLA 2XGMA 1B1AA 4X84A 5LQRA 2GILA 4K0KB 4IDDA 5COQA 4DDVA 5JNWA 1COWD 2E4UA 1SVNA 4N0MA 1Z9BA 4R31A 2V59A 4CLXA 2J5KA 5TQVA 3MHPA 1QQAA 4Z53A 4OLHA 4IZIA 3UJ3X 1GGNA 1WXHA 3FTQA 2FPMA 3H5NA 2HLPA 2W8BB 1NE7A 2A9JA 1LS6A 3ITEA 3NH6A 4JSRA 2R6AA 1GTRA 2QRGA 4IMJB 4C3VA 2XF8A 1CUYA 4FU0A 2EZTA 3O1JC 1DKOA 2QK4A 2BLLA 4PZDA 5EIBC 5TX7A 5AJUA 4S05A 1XP8A 3ACCA 3DZKA 2Q0HA 4ADSG 1IPHA 3MT0A 3SS8A 3V33A 4BKMA 1ZESA 2AD5A 1JI3A 1NNUA 3TW8B 2WMDA 1QFSA 3WOHA 2G82A 1X7XB 2X9VA 1D4FA 5DTQA 1UKVY 4KJZA 1FTYA 1QTIA 1WVMA 4LCBA 2OILA 3OPYI 1GNTA 4XOUA 3EG9A 4H77A 3L07A 1W34A 1G9SA 1XDSA 1MDBA 3R5JA 3ML1A 4LY9A 3AIIA 3IAM6 4OP2A 2R48A 5DI3A 5B2FA 4C5AA 1S01A 3NEJA 4RE5A 2BBWA 4RV5A 3LWNA 4D9JA 2J9FA 2QW0X 3Q12A 5FFNA 4BNTA 2A0FA 5M29A 3EULA 3X3HA 3FUCA 1JHYA 4C29A 2GI4A 3LGSA 2AYZA 2FWBA 3DXFA 2BMEA 3H87A 2YJZA 5JXGA 4KVZA 1PWXA 2IWHA 2W4IA 3H18A 4KIUA 2MU1A 2BRUC 4UCWA 3ANSA 4HEA6 2ZAIA 1NT4A 1ZJJA 2A94A 2GPWA 2XNKA 3U0BA 1NPDA 1QF9A 4S2UA 3IP9A 4W7IA 3CEMA 1PR5A 4HG2A 1L4BA 1QE0A 4RIGA 4W5HA 2NO9A 4HXYA 3T7JA 4BHTA 2G6BA 5LMNB 2D5AA 4Z1MA 3F3SA 1KAMA 3SOPA 4QTZA 5HSGA 1C7QA 4ZO7A 4YASA 5K0LA 2H7VA 3JRWA 4O29A 1RZRD 2PT9A 4LC1A 1AVTA 5F5NA 3H42B 2QX6A 2FRXA 3DMHA 3II6X 4RV9A 5BV2P 3F1KA 1R4NA 1M5TA 1GNSA 1HF3A 1MQSA 1P2TA 3A6GA 3BMCA 3KOOA 1A95A 2QZJA 4D3FA 5J47A 2W2LD 4TGLA 3OJCA 5DBOA 1HDGO 1OREA 1BNCA 1T6BY 2GK3A 1YBMA 2WFMA 4Q7QA 1G63A 1CY2A 1YZTA 2WTUA 1YQXA 3RFFA 4DSAA 4IS3A 2OWEA 4OP3A 3EMVA 4Q7LA 2GERA 1BFKA 2HK6A 3ROTA 4N0QA 1G16A 1WM1A 2MCFA 1AOXA 3TNJA 4L9SA 3GEMA 4KX5A 4JVMA 1C8BA 3RQIA 2BP7B 1QIIA 2GYYA 4JBHA 1DUVG 4LJKA 5CT9A 5F7ZA 1K7XB 4U9IS 3DZ8A 3DVAA 4QYMA 4ZYXA 4ZPJA 3AI3A 2TRSB 2W00A 2AG6A 3GOHA 5FFMA 3E0XA 3AOGA 4B3FX 4RETA 1W30A 1BWRA 1ZD4A 2P2LA 1K92A 2FWMX 4PX5A 4YUYA 2BYTA 3DEKA 3QHAA 3I8SA 3CZCA 2CXSA 3RSZA 2JI6A 2EFJA 4YP9A 3KB2A 4DYDA 2K7FA 1L3BA 4BO3A 1VLQA 4W1QA 1NFQA 2D5CA 1NZFA 2XZTA 3TVYA 3ST7A 4CG2A 4YP6A 4MV1A 3CUEF 4NONA 3DE3X 3QI7A 4RPKA 1NXTA 2BUCA 2J3HA 1JNYA 3EASA 4MQ4A 4YJ3B 1M0EA 3EPHA 1K4YA 5BR7A 3OQNA 3IR6A 4CKEB 3QLEA 4F3YA 4REOA 1O9GA 4WASA 2HA4A 4BX3A 4KR2A 3UWMA 4UZSA 3SKXA 1IBMB 4RTOA 2YJ5A 4M9RA 1GDTA 2JIZD 1PGOA 4MA0A 3SR3A 1YZYA 3UNXA 3D0RA 3TQQA 3LCJA 2QS9A 3MUOA 5J4LA 1W0JD 1Z4LA 3DDNA 4GM1A 5CUQA 3GHHA 4F92B 3CUYA 3FOEC 3G0BA 1C81A 1QYWA 4D4IA 3CF6R 4YAWA 4LRXA 1K7YA 3L7AA 3MJFA 4EX6A 1MP0A 3KJZA 1ST3A 2IYEA 3DDZX 2OCBA 4ZREA 1YC5A 3ZYZA 3VPCA 2ZIXB 5AJVB 1IOVA 3D31A 4HEQA 4UAJA 5ITZB 4J91A 4MWTA 1EFAA 5JEDA 1QPZA 2QJTA 4IIBA 3BN3A 4P0QB 4ZZIA 3AR6A 4C2AA 1T9ZA 3SVTA 1YRBA 3H2ZA 4LKRA 1ST2A 4ILEA 2ERCA 4OHWA 4BFTA 1NTRA 1JA0A 2HRBA 3LO5A 3AGPA 4NJMA 4ZMBA 3F6BX 1QF6A 1Q19A 1TLLA 4I9UA 4PEVA 4E08A 2R6CA 3YASA 4W9MC 3VYVA 2F43A 4KXFB 1QYRA 4Q4AB 3GAMA 1SWWA 1T5IA 3ND9A 4IJWA 1GKLA 1G8AA 4X1OA 3A14A 4X97A 5DASA 3GP5A 2ANCA 4K6OA 3OQIB 1GG5A 1M2FA 1NBEA 1U2EA 1UJ5A 2GYUA 1G9TA 4JGBA 4WLNA 1MX9A 4UE3S 1KO5A 1GG9A 5DRTA 3BA1A 5FL3A 8MHTA 4X44A 3DP9A 4RHTA 2OHXA 1KDZA 4GXTA 3RSHA 4QYXA 3B8HA 1CZRA 1E62A 1EX1A 1VPDA 3Q2IA 4LOAA 4N47A 1GADO 1BWSA 1F14A 1HKHA 3CPHA 3DP7A 3HCAA 3O73A 3VZSA 4HAOA 2DETA 4IX1A 5I5EA 1T3HA 3F5FA 2QYSA 2OGZA 4CL3A 3BZWA 1LC0A 1D2MA 4G0OA 4UUPA 7REQA 2AKYA 4JQCA 5FPQA 4DUPA 1O0BA 1EFTA 1D04A 1C4OA 4US2R 3FPBA 3JASB 4BE4A 4NBWA 3F6CA 4GLBA 5LMCA 3GBVA 2C57A 4DBZA 4NK5A 4URHA 4FM9A 2YX1A 4H3VA 1JFLA 3GD7A 4LYAA 2MOKA 4O4JB 4RY0A 4QUGA 3DHEA 3WKDA 3QWFA 1ISFA 1QYXA 1XRLA 2ZRCA 4S0ZA 4IUCS 4KO3S 1N5MA 5A3JA 2VHTA 3OE7A 2MSNA 1QR2A 4IP0A 4NPHA 1P9OA 4WCDA 1CF2O 3RTEA 1EDOA 3AMVA 2P3LA 4HNAB 5GV8A 1VKZA 3DFMA 5AESA 5K8VA 3MINA 4YQZA 2YQ5A 4G1CA 3TBHA 1HX7A 1M1YB 3ANMA 2VQSA 3CPEA 3F49S 3PA6A 1JHXA 3G13A 2VFAA 3WSVA 4BMDA 2XWQA 1I2AA 2OMEA 2XOKD 2I4OA 4R2IA 5IEBA 3NDRA 2YWJA 1WP4A 5C4GB 1E3DA 2X1VA 1XD2A 1RLOA 4QOEA 3A4YA 5KPJA 4MWEA 5DIZA 5DTJA 5FCDA 1T6XA 5CM2Z 3NHYA 3BGVA 3GAZA 4OSEA 5L3RA 3QBTA 3TL6A 1E2KA 1JJ7A 4R1TA 4W7HA 4D9EA 1HGXA 2V7WA 1X77A 3C5WP 3KUUA 4A5SA 3HJNA 4TMWA 1G4HA 2FI1A 3GJ5A 3GUUA 2H7XA 3KT8A 3ORFA 5E2AA 3EAFA 1T43A 1L3CA 3SYKA 2WB2A 3GT0A 4KAFA 4MVYA 2G9RA 3B6MA 4C4PA 3ZGZA 4E33A 1A69A 3RT1A 4BFLA 4DTIA 3I8XA 4EZEA 3VKVA 1V0JA 2IYUA 1AZSC 1VCIA 4WCFB 3ZK9A 3MGGA 2CMDA 2XZDA 4R6XA 5FWAA 4RVDA 1ZJ4A 4BYMA 1HDOA 3O4RA 1PYDA 3I6IA 2WWRA 5HMLA 2ET6A 3HKBB 3CZPA 4XEHA 5AM0A 3WB1A 4R1PA 4KVGA 3PHLA 2PX6A 1B00A 2EQ5A 3T3GA 2G1UA 2HYIC 2GT1A 1CS0B 1W0KD 3ESZA 1G8YA 1GL3A 1FSPA 4FMDF 2JFUA 3HCOA 4R68A 5KYGA 1AK1A 1XTUA 1Q17A 2NQ2C 2XW6A 1PG5A 5EKSA 2G8NA 3JR7A 5JAQA 3TLXA 2X2EA 2QAGC 4JQZA 4RZ2A 5ERYA 3RFUA 3OF5A 1DRJA 2D1RA 3T9CA 4XW2A 3M1LA 3RYHB 1KJZA 2G7MC 4GGOA 2NXNA 3T7EA 5DV9A 2PX5A 5F3DA 2VAXA 1XFDA 4KNYA 3DF9A 2WICA 1M6HA 1Y5MA 2VPYA 2ES4A 2G67A 2R6FA 1LGYA 3OEED 4A1OA 4XR4A 5FBLB 2JLBA 4MP8A 2E9SA 4ZYZA 3L6CA 5BORA 1ADYA 2GHQA 5ERXA 3X1WA 4P0PB 4O4IA 5EP1A 2NSYA 2P8SA 4XFJA 2D1YA 2V0CA 5ALJA 5B3JA 3R7SA 5AVQA 3WAGA 4W5TA 4AJHA 2GMWA 3AINA 1F0NA 4QJ5A 1EP9A 1OI3A 1RZUA 1HSZA 1Y7HA 2P9FA 3B3JA 3VO2A 5EWLA 3DMYA 2FQXA 3I6ZA 3B2EA 2HEGA 2QTCA 3L0ZA 1T6NA 5J9FA 4NH4A 4GXNA 1DG3A 1E6LA 3WKAA 4F6RA 3QPUA 4RVHA 4W5OA 3A6FA 4BY9E 1US8B 3PL5A 4HX9A 4BVKA 1H0HA 2YW9A 2ZI4A 4BMXA 1E0DA 2F3TA 1RJDA 4GC9A 1KY5A 1RFLA 3BYZA 1ZIOA 5LNK6 1G19A 3BEDA 3LIIA 4UMDA 1O6BA 3ROQA 5LP6F 1KEVA 1SURA 3CLTD 3ENWA 3RODA 3EY4A 4JKIA 3DZGA 5KSPA 3PX7A 2DULA 3DTVD 4OX9B 1M1UA 4FYIA 2I1LA 1RWPA 3PYMA 5B3LA 1D9XA 1E6EA 3KYCA 3WDLA 3BL6A 3VBCA 2ZJ1A 2FWRA 3DOOA 2XXAA 1C3LA 1N1EA 4MRMB 4GYKA 5IBRA 3RVJA 3UJHA 2OQVA 2XLCA 1KMCA 1EZ1A 4XR9A 4D81A 3TECE 5AM5A 4ZJYA 5K8TA 1LDGA 2OBLA 1SKYB 4IQ4A 1NPTO 1C41A 1P1FA 4YRDA 3NV9A 5JCJA 2Q6TA 3S8YA 1PG0A 3EPPA 4MUEA 4R1LA 3E5MA 4Y6RA 1EXDA 1P29A 1FNMA 3WIEA 4P7JA 3TRKA 1HA3A 2CLKB 2VBIA 3O95A 1GLNA 1SWVA 4MJ3A 4S24A 3OT5A 2R6HA 3I6BA 1GTJ1 1NMSA 1N57A 2E4XA 2R79A 2R2AA 4PFSA 1PNRA 1CP3A 1D9ZA 2OGTA 4OKNA 1NYRA 3VUFA 4LF5B 2Z5GA 3AERA 5CITA 3EIOA 1Q21A 1FU8A 5LLTA 4DLTA 3QPWA 2P4UA 3OKFA 5EMJA 1SG0A 3GFSA 1MT3A 4FZRA 4Y30A 5FWYA 2WB4A 5E4YA 3VX3A 1NXSA 3JATB 3M9LA 3KFVA 2LCQA 4Q4CA 3PD1A 5A3QA 3SSAA 4JB3A 3PD7A 1NUQA 3PZRA 2XNDD 4C2UA 3EF1A 1C1DA 4NAVA 1DU4A 1YXMA 5TNXA 4TV9B 3DMTA 1U5CA 4Z7JA 2XPCA 1YH3A 3DB2A 3CWCA 1U2DA 1JHDA 1QHSA 5SZJA 3LUGA 4GX0A 3OZWA 3H2BA 2AOVA 3KWMA 4MQEA 4REMA 1GGEA 1YS2X 2YMQA 3WGYA 3ET4A 3IDZA 2OHFA 3ZGOA 4C7MA 2I8LA 5HGJA 4J03A 3RHZA 4CV2A 1AQUA 2QTHA 3F3KA 4TTSA 1FSZA 2JIRA 4QDJA 1Y8RB 5D84A 2OP0A 3HNRA 4ME6A 3VYTB 1NWCA 2OFPA 3VUEA 4EY5A 2FSPA 3M6FA 2OV6A 1UBHS 3BIOA 4MAMA 4KMRA 3UT5A 4N8DA 4V0SA 1C80A 1L7PA 3M83A 4KLNA 5MF6A 1V6AA 4Q9KA 1ID8A 1JMKC 1P19A 4BLWA 4UQLA 5EMKA 1NHGA 1Z6PA 4MWCA 3MRVA 3P7MA 1VYHA 2J9ZB 2WHPB 3IBCA 4CEJB 1PK9A 5EXEA 4L5YA 4XGQA 2OHOA 3MWJA 3SF8A 4RHFA 4BKQA 3ZWCA 3UHFA 2G9VA 3C3XA 1UIRA 2LDBA 2A9RA 1D2CA 1MD9A 3E3LA 2AKAB 3JQ6A 3KOUA 4ITUA 2B69A 4YCSA 5KVVA 1ATZA 1JEQB 5EPEA 2J9XB 4F4FA 2GJAA 5IYZA 1Z5GA 4DDUA 1SD1A 1OMOA 1THGA 1Z4NA 1PJZA 3F90A 4LBVA 3IGFA 1E6WA 4B09A 2JJQA 1ZNQO 5TY0A 4BIMA 2GKSA 3NATA 3ZY6A 5HM8A 2ZJAA 5ITSA 4BFCA 2W8ZA 1HT2E 2AQHA 4LY0A 2AZ4A 1C4KA 2EZ8A 3SQMA 1VL1A 2XSZA 3MTGA 4BO6A 1OBHA 2CHUA 1WU7A 2I22A 1GIAA 1Y3CE 2GSWA 3PPXA 4XWTA 5EE1A 2DERA 5G53C 3VPXA 4WKPA 5AUQA 2QRUA 4L72A 4X66B 1VFNA 1EUDB 3LWBA 1VLHA 4HBZA 2FZVA 3DE7X 3DLPX 2BR4A 2ZM6B 2WAXA 2OK7A 4PLYA 5B1EA 3M6WA 4L8YA 4QG7A 1CY1A 1OIWA 1RXVA 2R3SA 4GWGA 4L5BA 3G2HA 3B1FA 2WVAA 1JALA 1H9CA 3OIFA 4BNDB 2BGTA 1DELA 4LRWA 4PZZA 1WABA 2P79A 2EG9A 3GNQA 4V39A 2HA2A 4J1QA 4Q3OA 4TTTS 2PUCA 4OXYA 2RI6A 4KR9A 3RGGA 4XDYA 1K6EA 2FSGA 4MXDA 1TJPB 1LCIA 1GRRA 4JQYA 4OHRA 2BGWA 5CA0A 1V4VA 5ICEA 2IXFA 2VJCA 2Q3HA 4EUHA 1W4CA 2QUKA 4GM4A 4ZVNA 3GHYA 4F8EA 2UU9B 1SBYA 3CKLA 1HBJA 1Y7PA 2F4VB 2Z2XA 4G67A 2HWXA 2FE4A 2RHDA 4LV8B 2GF9A 4KK3A 4PYRA 5COAA 3QMVA 1CF4A 1BGWA 1RS0A 2Y68A 3DEZA 1F8YA 3VM6A 3BE5A 1Y8CA 1AU9A 1ZQ9A 1CUFA 2OUIA 4BZQA 1NVTA 2WU4A 1V37A 3L7BA 3K0FA 2HSWA 2GETA 4ZI3A 2WV9A 1CU1A 2QUAA 2GCPA 3QPBA 4BZXA 1BFUA 1U90A 4QDUA 3PQ5A 4RVUA 1E5LA 5CEJA 5PGMA 5AIAA 3FTPA 2M1ZA 3LPMA 2B4AA 4EHKA 1JJFA 2VYQA 5TQ2B 3JX9A 1E64A 3L0BA 5F73A 3FZQA 3VR4D 4AKEA 2RARA 5BSEA 4JI2B 1PJCA 2FEOA 1CIJA 1VPLA 2YYSA 1KEZA 3ZCSA 3MTAA 2XDWA 1YACA 4LYGA 2NPOA 4JLDA 1JFFA 3JQEA 2DECA 2DR2A 2GAOA 1LBHA 3DEFA 3G8DA 4MUMA 2BM9A 3I72A 3HB9A 3W79A 6AT1A 5K0TA 1N2GA 1LPBB 2R1TB 4URZR 5IVHA 4B79A 2VNKA 2DWUA 3T3IA 1Z68A 3GFTA 4DQKA 3MWLA 3AZPA 3MW8A 1GSIA 3RS2A 5CYGA 2QP4A 3BUSA 1EX6A 4FIZA 3KYIB 4EB8A 5HG0A 4CKWA 2J0VA 4AJ4A 1DUSA 5AUOB 5MFPA 4J8PA 2NO4A 4TX1A 3ZCXA 2PUWA 1KWGA 3FVWA 1HNNA 4M8LA 5T4EA 1RYEA 4IDOA 3UV6A 3H7AA 5KVSA 1UWKA 2V7VA 3RRFA 2ZTVA 1IOLA 4QPZA 4MAFA 2VI5A 5T4FA 3ZH9B 2QWXA 3W04A 3W4KA 4BNFA 3MT8A 4QTYA 3WWPA 1T1GA 3JCZA 3G2KA 1LTKA 2Q07A 3D8TA 2JHGA 1A5TA 1II8B 4LXUA 2LPMA 4NMMA 5ALLA 1V1MA 3ZN2A 5EGNA 4FHCA 4G0NA 2IKQA 3V4PB 1J0EA 1T9GS 1EX7A 4WCFC 2XCIA 3RTDA 3ITDA 4N82A 1AO3A 1PYGA 1ZQ1A 3OZCA 3HBAA 3LT0A 3F1LA 2PWBA 3FIJA 5T67A 3WFZA 4PG8A 5L53A 4DJ5X 4HLCA 2ZCJA 3COSA 2VDUE 1UJCA 2NV2B 3EG5A 3HVKA 4XCQA 1XZJA 2I6UA 3KQTA 4NYMR 3FM9A 1BE1A 4XFDA 2KI5A 4TXHA 4Q3CA 5I9SA 4ZAWA 3OQHA 1K8RA 1UBNA 3UMBA 1IL0A 1T91A 2Q21A 1CJKC 4JELA 4CQMA 4WJLA 4F85A 4GD3Q 2AFIB 2GOYA 4LE0A 3C70A 2DU8A 2X1MA 3AL3A 4KQFA 1WKVA 1T3TA 4Q1AA 5JDCC 3I5YA 3L7CA 1VMEA 3CX3A 4FLMA 5B7GA 2ESRA 1FDSA 4F93B 3A3PA 3I5MA 1UAGA 2XITA 4S1VA 4XIIA 1PZMA 1NQTA 3QJGA 4I5EA 4ZV9A 4TYYA 3OZRA 1Z6TA 4ZXFA 2BSXA 3ICPA 2CE7A 3MT7A 4DT1B 3C3DA 2AFHA 2OQ2A 1BJTA 1S3GA 2LRHA 1VGQA 1U2QA 2Y9PB 3L5KA 3PQ6A 2JFBA 4LDQA 4RDXA 5TF0A 2MINA 3AEQA 3DVQX 3O92A 3PDWA 2MR6A 2PXHA 3QLUC 3ZPXA 4ETNA 2EWMA 4RHXA 4XWYA 4M53A 3AFHA 2NP6A 4UOZA 1DRVA 1OLXA 1ZM7A 2D7CA 3C4QA 2AHOA 3KSZO 4ZD6A 1T24A 2O3TA 2XA1A 1XTZA 5KOHA 3KYBA 4KGZA 5BV1A 2XCOA 4K87A 5JPIA 3WY9A 3R8FA 1I13A 2QIPA 3PPWA 3UFBA 2ENWA 4CM8A 2O2XA