4C2BA

Crystal structure of high-affinity von willebrand factor a1 domain with disulfide mutation in complex with high affinity gpib alpha
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
199
structure length
199
Chain Sequence
LHDFCRSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VON WILLEBRAND FACTOR
publication title Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 58
structure length 199
sequence length 199
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4c2bA00
1LFAA 1MQ8B 2NVOA 3ZDXB 1U0NA 1UEXC 2ICAA 1FE8A 1MQAA 5LN1A 5KYUA 3HI6A 1AOXA 2O7NA 4WFQA 1SHTX 3TXAA 3T3MB 3M6FA 1DGQA 4C29A 1T0PA 1ATZA 1PD1A 1IJBA 2M32A 1N9ZA 1M2VB 3GXBA 1M1UA 3TW0A 1XDDA 2NUPA 3BN3A 5E6SB 1FNSA 1IDN1 3TVYA 5KYUB 3FCUB 4C2AA 3ZDYB 3K72B 1MJNA 4UM9B 1U8CB 1JEQA 4DMUB 1BHQ1 3ZQKA 3T3PB 3EGDA 1IDOA 3EGXB 4HQKA 4WK4B 4F1KA 3N2NA 4IHKA 2X5NA 5KYYB 2VDOB 1JEQB 2I6QA 1JEYA 1JLMA 5BV8A 3PPVA 3EH2A 2QTVA 3V4PB 3EGDB 4XW2A 4CNBA 1AUQA 3QA3E 1L5GB 4HQLA 3NIDB 4NEHB 3HXOA 4CN9A 3VI3B 1T6BY 1MHPA 2I6SA 3PPYA 1DZIA 2VDPB 1V7PC 3EH1A 1XDGA 2I91A 3RAGA 2ODQA 3EOAI 5HJ2A 4Z7NB 5E6RB 4HQOA 3FCSB 4G1MB 1CK4A 3PPWA 1YVPA 2IUEA 1JV2B 2WINI 1BHO1 3V4VB 2NUPB 4WJKB 1PCXA 1ZOPA 4NENA 2XWBF 1M2OA 5E6UA 3Q3GE 3E2MA 4PN7A 4Z7OB 2NUTA 4UM9D 1U0OC 3ZE2B 5HDBB 4HQNA 3EOBI 1QC5A 5KYXA 4G1EB 3K6SA 4IGIA 4NENB 5E6RA 3BQNB 1MQ9A 4A0QA 4CN8A 1SQ0A 3PPXA 2VDKB 4JDUA 5E6UB 5KYWA 1JEYB 1AO3A 1IJKA 3NIFB 3EG9A 1ZOOA 1PD0A 3NIGB 1QC5B 4BJ3A 1PT6A 3IJEB 2VDLB 1M2VA 4HQFA 3VI4B 1M10A 3EFOA 5KYWB 4O02B 1TYEB 4UM8B 5E6SA 2XWJI 1N3YA 1QCYA 3EG9B 4FX5A 1SHUX 3K71B 1M1XB 2VDRB 4C2BA 4F1JA 3ZDZB 2VC2B 2WW8A 4MMZB 3EFOB 3ZE1B 3EGXA 5HGJA 3ZE0B 5KYNA 3HXQA 1RRKA 3IBSA 3TCXB 3F74A 4MMYB 5ES4B 2B2XA 2VDNB 4MMXB 1CQPA 5KYYA 2ODPA 2XGGA 2VDMB 2VDQB 1YVRA 2ADFA 2NUTB 1RTKA 1NA5A 4WK2B 1ZONA 3F78A 5KYXB 4WK0B 1XUOA 3K6SB 1OAKA 1RD4A 4M76B 4Z7QB 3BQMB 1MF7A 4IXDA 1Q0PA 1RS0A
chains in the Genus database with same CATH superfamily
3B9RA 2QRHA 2F4VB 2QU8A 4KR7A 4B87A 1YQEA 5A9RA 4ZXPA 2LGJA 4REQB 2O7NA 1P2FA 1UJ4A 2IDKA 4IP0A 5JT1A 1MXHA 3OH8A 1CQJB 7MHTA 1X9GA 2YIJA 1ATZA 2AQKA 3E9DA 4K9NA 2Z8YM 4PX2A 2A2ZA 4K9QA 5EJ4A 3RS2A 3T5CA 1OQAA 1Z0FA 3UQZA 3ROQA 1KY2A 2O52A 2QTZA 3JRXA 1LDYA 3RVMA 2WOJA 3U81A 4RTQA 3SI7A 2VOJA 2Z57A 2CLKB 3OPQA 3ZBUA 1KQ3A 2GK7A 3A6FA 2GZSA 2EERA 4QGFA 2PIAA 1BMFA 2CGEA 2HSZA 4RTOA 2PLWA 3R0IA 1WZNA 2D5AA 2R60A 5F78A 3LAWA 3ZWWA 1MX5A 2XNHA 2EATA 3DLCA 3N9IA 3VH3A 4FLMA 3RWOA 4B80A 5J47A 1B76A 3VTKA 3I9LA 2P5UA 1TVKB 3QFFA 1DTWA 1RT9A 1V16A 3U19A 3IVRA 3WDLA 3WC4A 3TDNA 1SXIA 2HV9A 4F7WA 3S8MA 1A7AA 1L5OA 3H3FA 2CLIB 2Y1LA 3VC1A 3ROXA 4H0FA 1VFPA 3BIOA 3I28A 1NVVR 4L6AA 4C1BA 1RNLA 5E9QA 6REQB 2GGSA 3LZ6A 3OFND 4EEZA 2YJ3A 3THRA 4DYDA 4DSTA 3KCNA 1HL7A 5TIIA 1YTUA 4YAEA 4CKXA 4DA4A 2R2GA 1UR5A 2J31A 3ELBA 3A4LA 4HYQA 5CEFA 3HACA 3PPWA 2C3MA 1OTHA 4I5GA 3C8UA 3C3PA 3FUUA 4HN2A 5DI9A 2JFZA 2I2FA 1QU2A 3VNUA 1O77A 1J4AA 2V6BA 2V6JA 4L8FA 1QHYA 3T06B 2R1UA 1WBJB 5KWJA 3C6MA 4ZWNA 2B69A 5TJHA 4ZIRB 2QQFA 1BMQA 3PC3A 4R71A 5AW8A 1M76A 1XVIA 2QN1A 3AJ8A 3G7UA 3PTZA 5UKDA 2QQGA 4ABYA 4C6HA 2Y27A 4DQ0A 2NUTA 1ZAKA 4Q47A 3OOEA 4DLKA 3G88A 2JKZA 5FL7A 3JVUA 1K4YA 2XE7A 4RSRA 2WJIA 5K8VA 4PV7A 3SNKA 3ZY4A 3BHMA 3M9WA 3RTEA 2YVAA 1CUBA 4C0QC 3I1JA 2W00A 3RVDA 4MR8A 4JGIA 3O2JA 3UKOA 2Q9AA 3FX2A 2V4MA 2ZUEA 4KYIB 1DWPA 2ZB7A 2ZI6A 3MJFA 3R09A 4Q0MA 1QB7A 3AF0A 1JZTA 3WKEA 4ZCMA 4WBNA 3OKCA 4WNIA 2GB4A 3QY0A 1J00A 1RI4A 1T3ZA 3TRJA 5BN4A 1FYXA 4EZIA 2H0AA 4MV9A 3MJRA 3TLYA 2IYVA 3LOPA 1Q83A 3I01M 5FWAA 5MFPA 3EIOA 4DHWA 4BNIA 3H19A 2X8BA 5IHXA 4ND3A 2ONJA 3UGJA 3PEFA 1BCSB 5TSDA 2YFQA 2HSJA 3LHIA 1Z2NX 1FU7A 2Y0BA 3HTXA 2N47A 2Z8YA 2JHPA 2L2QA 3IO3A 1OI3A 1ZGAA 2C4VA 3GMIA 1YBMA 3D5EA 1QZZA 2CFOA 3O1IC 4IIGA 1XN1A 2N1BA 3T7IA 4Z1MD 1OD6A 1Y9ZA 3SSNA 2HT6A 1XMIA 3DMNA 5EERA 5K0ZA 2X5JO 4ZQHA 4WPGA 4E21A 2B4KA 1IN5A 2MYUA 3ONNA 5ALPA 2BKXA 1G8GA 2X77A 3DH0A 2VHCA 4H7IA 4JVMA 3TD2A 4ND4A 1H4TA 5BWLA 3TWOA 4Q6BA 1K8YB 1LTQA 1LLFA 1N8SA 3EFEA 4NMMA 4I9UA 4ZEWA 4R51A 1OWNA 3WNDA 1L7PA 1AQ6A 1NVUQ 1PFGA 4RPLA 2HYDA 2D2XA 5I3CA 1TDJA 3REFA 3CEJA 3LCVB 3TVYA 2XCOA 1Z75A 4BMNA 2BR4A 3LKBA 5BQPA 3ENKA 4F8EA 1QIDA 4OGLA 1PQYA 4AUEA 1WB6A 3C7TA 4HX9A 4R1NA 1XZDA 1C8VB 5JI3E 2WPDA 4BBAA 4PHFA 5IBQA 1JKFA 2WD7A 5FFFA 5ALNA 3WKDA 2ZROA 1MFZA 3S28A 4KHZA 1F06A 2WC1A 2CZGA 1IOZA 1JJBA 4MULA 2R97A 4AMBA 3AKZA 1OREA 1R5JA 3ONEA 1HE8B 4M55A 3MRSA 5IC6A 3X43A 1W47A 1PT5A 5LD2B 4EI7A 4CMIA 1YVUA 3B6ZA 2HTEA 3AKDA 3UATA 4J75A 1GCAA 2BM1A 2QL7A 3MIZA 2H4WA 3NXSA 3ESRA 3OJLA 4JKIA 4TWIA 1P2DA 4DMMA 1PFQA 1E9AA 4HI0E 4MV8A 1IG3A 1GPAA 4WXRA 3EVGA 3RC3A 3OA2A 3VOTA 3WWOA 1V41E 1MG0A 3LT1A 4QUJA 4NMWA 1P6XA 4IXTA 5JMPA 4EFNA 1AB6A 2VDVE 3C14C 4Z4EA 2ATEA 2W4QA 4FD3A 4L5IA 5PNTA 5TMPA 3MT9A 1CDOA 3FHTA 3WIVA 1NI5A 1X6VA 3I2GA 4V03A 2PFGA 2XF8A 3JAMA 3RYHB 4MUIA 1XA0A 3E9YA 4A2QA 4UNIA 3PUIA 1G20B 3Q2IA 5FHQA 4M1MA 1D6JA 3KXKA 4XEHA 2G9NA 5KIAA 2FZVA 1ODFA 3C1UA 2RGRA 1OYYA 2CFIA 3GFFA 1JQ3A 3I01A 3L04A 4XDYA 2QR5A 4XQCA 3DFMA 5EZSA 4PSAA 5KTOA 1ECJA 1GIAA 4RV4A 4RV9A 1QMGA 4RKQA 1Q15A 5FI3A 2D5LA 1LZLA 1FLAA 3HHPA 2VSQA 1NXOA 4DCPA 2PL1A 2J0VA 3O9ZA 3EQ9A 2IHYA 4JB0A 4OHXA 2XRYA 1RWWA 3I3OA 3T7EA 1U4NA 2WJAA 1EB8A 3K0AA 4RTRA 4MV5A 3U17A 3E5RA 4I08A 1AVTA 2HKIA 3ETGA 3ZGLA 1Z35A 4MV3A 2JEYA 1SWVA 1T34A 1UBRS 2HJSA 2VF8A 2X8JB 4FXOA 5FJJA 1FBNA 4EA8A 3NHUA 5ALIA 2JJMA 2A9PA 4UDOA 4RSMA 5JXHA 5EESA 1QHEA 4R8VA 3ZBTA 5BSGA 4ND5A 1CY6A 4FOOA 2VG8A 1T35A 4XJSA 2AFRA 4ZKEA 3I61A 2H3HA 2IBMA 1JAHA 3D6TB 1DWUA 4OKSA 4JC4A 3OG9A 4BRUA 5AVJA 2C9MA 1JEOA 1J0DA 1NVGA 3LX5A 1T0JB 3P8ZA 4XTCS 1IQRA 4H3VA 3HCBA 2ZBRA 3A9WA 3RSCA 1VE5A 4G09A 3ONDA 2GN4A 2AC4A 1YJAA 5TRTA 2CUZA 2EKDA 1PNVA 2O7QA 4LQCA 3VC7A 4GKJB 3EA5A 5FR2A 1PSWA 4PM4A 5DNVA 4L2IB 2IHVA 3TEMA 4MUAA 4F4HA 5CYGA 1XQ6A 2D1FA 2QW1A 1EVQA 1MENA 2OORA 3N2KB 4JUCA 3BD8A 3V4SA 4G2NA 4D45A 4EJSC 4TTTS 4EUSA 2H5IA 3AUXA 4R0VA 2VA9A 3KXDA 3GA5A 4EUFA 4Q9IA 1J8QA 1Q1NA 3VH1A 1QXSA 3ZVRA 5ITZA 4M0CA 1VGRA 5AHRA 2QTCA 5TV2A 2KBFA 3H5AA 2Q4BA 3GX1A 3L77A 5E7IA 2KLBA 5IT9A 2ZW9A 3KYDA 1S9DA 2FDXA 5K20A 4JD5A 3T15A 1S2NA 4P5EA 3TLXA 1MPXA 1PGOA 3KVOA 3WGQA 1ZZGA 2Y71A 1DXHA 1IVNA 3IOYA 3A4VA 3O3CA 4EIWA 2PZLA 5A62A 1T1EA 3F6RA 2LKDA 2O8FB 4PANA 3PQ7A 1Z34A 3L0CA 3P0HA 4OBEA 2JJQA 1E1YA 3RC9A 2VNIA 4QREA 4R1PA 1W52X 2E7ZA 2WKSA 3DE3X 2PPVA 3DMPA 3N87A 3W1EA 5EJ7A 1AV7A 2I2DA 2X6TA 1JWBB 4NYJQ 2ZSFA 4MXDA 1GTRA 3H84A 1SUPA 1UBTS 3JQ9C 5AXCA 1C7QA 3LZDA 4DADA 1F14A 2PMFA 4D8YA 1PE0A 2JJ1D 3DNMA 4G5SA 4QO8A 2H0QA 2X0NA 4BE7B 1EGMB 4U3JB 4BOYA 4YRZA 2IZ6A 1D4ZA 1NU6A 3EIHA 1QX4A 2P2DA 1PJZA 3PNSA 3GRAA 1DIAA 3IP9A 5C4MA 1DCKA 2FSIA 2GCPA 2QNBA 5EWMB 2I6XA 2QDXA 3LLUA 3QXJA 3OHMA 1LJUA 1M8KA 2VYCA 1I33A 2YJZA 4OK3A 5B1SA 3UJDA 3ZK9A 4W5OA 1NWCA 2OAEA 1E1DA 3CSSA 3I6YA 1US8B 5C8YF 1AQUA 5ALMA 1JDPA 4LAFA 3R7AA 2R86A 3RTGA 1CRPA 5L7TA 4DV4B 3L8FA 3W2EA 3UQYS 1KBOA 3GVIA 3PT9A 3EQ7A 1JVBA 2QRZA 1DCMA 1ORDA 1VSUA 3RVNA 3VI4B 4Z7JA 1Y8ZA 1SRRA 4MCJA 4XCXA 1ZICA 3QWAA 2HXSA 2JJ2D 2WPNA 3BIWA 1KEPA 2XQKA 3JQ6A 3I09A 4JC0A 4JNKA 3WRWA 4K8OA 3EX7C 2Y99A 5IASA 1FNBA 2BIFA 3NBQA 2B1QA 3WBKA 2EBUA 1VZ3A 1W76A 2FH5B 4E5KA 3IPCA 4PFSA 5EJEA 2H1SA 1R4MA 3VPBA 3FHLA 4NE2A 4TN5A 1NQ5A 5M2QA 1X1DA 1WKVA 4RH3A 5FPHA 2OVBA 1L7QA 1RRFA 3BXFA 4XEUA 1Z83A 2P3QA 3AHFA 1GU7A 1DEOA 1Z4QA 4G56A 2FP4B 2H9IA 2HSWA 3G68A 2IYZA 4CF3A 3D8RA 4HRVA 5FTWA 3AZOA 4GZ3A 2F7SA 4C0SA 2Z3VA 1C1DB 3T3IA 5TPWA 4FYMA 1E6CA 2G0AA 1UBNA 1I24A 1RM0A 4PAWA 1XTUA 2IYTA 4FMPA 2QX6A 1KC1A 1Q0PA 3VR4A 1CJBA 1RS0A 1ZD3A 4HUQB 3AUTA 4N4AA 3I37X 1TRHA 3H8SA 4I1VA 1I3MA 5B3LA 1T36B 3OHSX 2AWOA 1YS2X 2QD4A 2FPPB 4YBZA 5LP1A 2JFWA 4XH9B 5AK4A 3WK7A 4DRXA 1T4BA 3BKWA 4KO1S 3VU3A 2ZGVA 3FPCA 1LFDB 2OILA 3PFIA 1EWQA 4OGKA 1IMOA 2A5LA 1EEXB 2JFXA 4UU0A 2ZBUA 3K73O 2IZ5A 4UEOA 1KOLA 1SXGA 2Q6LA 2A58A 2Q5LA 1ZMTA 3W3AA 3MTJA 1O4VA 2KBEA 1PJCA 2BT4A 3KPYA 1L5KA 4EGFA 3HB1A 4CIWA 3RVJA 1BHQ1 4DCVA 2H1LA 4EJMA 4F2DA 3KJQA 2Y68A 3ZWDA 5C52B 2CL0X 3U4HA 1F9EA 1HE1C 4BIMA 5FXMA 2GUWA 2ZRAA 5HRCA 5GZ3A 5JQWA 1USWA 4EB3A 1C1HA 1YMQA 1PJ2A 2XMBA 5DPMA 4ECAA 2RE8A 3WLIA 5MHTA 3LUHA 3KIPA 3K4QA 4TRNA 3KZKA 2IL1A 2D2EA 4OQXA 4DTCA 3DW1X 3QJ5A 3B9PA 1JGTA 1JDUA 1RRMA 4I9HA 5TC4A 1VBKA 3FLAA 1ZU5A 4TKUA 5AWFC 2O1XA 1QPZA 1EAYA 3WTBA 4UOEA 2CUNA 3ETJA 5DNCA 3BGSA 1AU9A 1Q14A 1UP6A 5CT9A 3NNSA 2P79A 2PMEA 4BFSA 2JIMA 4JZKA 3RBXA 1VL0A 4U2GA 2E1RA 1JR3A 2JGFA 3FPJA 5G41A 1OPXA 2QRNA 3DUFB 2IYNA 4KKXB 4EMUA 3BZUA 2Q0SA 1CFZA 3NEAA 3NVKI 1VLLA 2J3QA 1Y48E 3DAPA 3E9ZA 2J7KA 4F84A 5AW6A 2VJKA 4NABA 1QGUA 2BFAA 1OWOA 4TYNA 3FW1A 1B41A 3HWX1 3MHPA 5JXIA 3KTFA 1TQHA 3LCUA 5TS3A 1BFKA 2R4TA 4HBZA 5KWIA 1WOMA 3JQQA 4W7HA 5I8ZA 5KU1A 2EDCA 3DXZA 2Y1WA 4RLQA 3QUQA 3T3HA 1Q7CA 4Q21A 4PLFA 4EJ6A 3SHTA 4S0XA 2CNWD 2V5VA 1XTJA 1ZNWA 2Q41A 1DC7A 2LUOA 2WP0A 3D2BA 3NIFB 3P4YA 2AE1A 4TSFA 4ZZ2A 1QYIA 4I66A 2Z6VA 3UMJA 2YXNA 2B34A 4WOKA 4HFMA 4CR6A 3AI2A 1O97D 1VJ5A 1KVTA 2BE9A 4H77A 4JJFA 1YR2A 3BSFA 4BMCA 2MSDB 1Y1QA 2GAFA 2HU2A 2VQDA 1EGAA 2GN2A 5LA6A 1HF3A 4HYTA 3ZBPA 1EE9A 3AIMA 2XUIA 3NHSA 4M9ZA 1O3YA 5I7WA 4NPAA 1V96A 3V1KA 4PYIA 1ZCAA 3PNMA 5SZJA 5LQKA 5ARDA 2ZIXB 1CD5A 4HSEA 5CG2A 4DR4B 3SJCA 1JALA 2HDOA 2FOIA 2YWJA 5TGTA 4EM6A 1ESMA 5KOIA 3EWAA 3CZCA 3HCOA 1V1MB 2XVXA 1PQ4A 4QOJA 4XIGS 4XSVA 1UDCA 1E58A 3TAXA 4G1BA 3TRHA 4LSGA 5JO9A 3FNQA 3H04A 3N0VA 4ESOA 2XQGA 4HQ6A 5KNDA 1XRLA 4OAPA 3HCPA 1TECE 2HJGA 4HDNB 4B3IA 4ZDKA 2GZ3A 4XYGA 2OGZA 5IEBA 1OLXB 3PZBA 2OHFA 3CN9A 2CV2A 3UUFA 4C87A 4LVNA 1JA0A 1VHWA 1AJEA 5J3JA 3CKMA 1BA3A 1NFQA 5FYDA 4CLHA 5J23A 3UYKA 1VMDA 4K40A 4IOLA 1PFVA 1UJBA 1QG2A 3CISA 2RIPA 3FNFA 2YFYA 4JEUA 3RQSA 3PUVA 3TI9A 4YP1A 3U7IA 4YFVA 2NTVA 1EWRA 2QX7A 1AUOA 2IYQA 3AF6A 4GD3Q 2CN1A 1USKA 1G2QA 1O95A 3BMNB 1MGOA 2Y1FA 4ZVNA 1XRJA 3IDQA 1TVEA 5K8IA 3P26A 1POWA 1CQWA 2MMCA 2YBEA 3TG2A 3PXXA 1SD1A 1G38A 4W8GA 1SC3A 1QDEA 3HKCA 3LBFA 4GR9A 1H5QA 2Z9CA 4BO8A 4CMKA 4DVJA 5CFMA 3LA8A 1P60A 4BTLA 1Q77A 1Q7TA 1W5FA 5BSKA 2EWMA 2FB9A 3GHHA 3VZSA 1MX1A 3RUEA 4GX2A 1HYGA 3M6VA 3UK2A 3U48A 3HKEB 4AMGA 4ZAFA 2ZTUA 5A3SA 3VPAA 4HZIA 1U0HC 4G86A 2WIDA 2PFKA 4PY2A 1U1IA 4QDKA 5K4AA 2OCBA 2PKWA 5EWJA 2X1MA 3RRJA 3HJUA 3BC1A 3CE9A 3VO1A 4Y9DA 5JMOA 3CYFA 2Q5OA 2C2WA 5KKCA 3CCFA 2LBPA 1C9YA 1HQDA 1CY1A 2OM6A 2GARA 4F2WA 3J80A 3SZLA 1SEPA 4XSHA 3B2EA 4DMHA 3GJQA 1ISJA 2C7BA 1M9NA 1CZLA 3OY7A 2DBZA 1NBAA 4KV7A 3KKQA 5E2AA 2VLBA 2AD5A 2Y05A 2I3GA 1T13A 3LUBA 1VHTA 2OK7A 4PIMA 4E1VA 4DWVA 5BY2A 4JXZA 3PC4A 1SZDA 3IMKA 4A15A 5AW1A 3VYVA 1A69A 3STHA 2YXEA 2XXBA 2FOLA 4CTNA 4EY5A 2HWWA 3NBAA 1P4AA 2P77A 4W8HA 3UHPA 4Q1CA 4S0ZA 2BEWB 3S2SA 3V8QA 4D8UA 1MEJA 1M0SA 3RW9A 2ABWA 3WGLA 3X1WA 5JZVA 4IDCA 3USZA 1KSFX 1WA5A 2YJGA 3N7UA 2O8EB 2HCFA 1IN6A 4DLZA 2VF4X 5K6TA 2F1JA 3QVSA 4FDAA 2H2AA 1Y5IA 2YXDA 1TLFA 1WTCA 1WHSA 3JD4A 4NESA 3I5MA 1SXJB 4WV3A 2ZRNA 5CH5A 3GYGA 4IDQA 2Q0XA 1OC2A 4MDYA 4R68A 1ZOOA 5FOQA 4TTRA 4G2TA 2RCNA 4CR7A 5AVVA 1F2VA 4LHXA 2HF2A 2MINA 3EDRA 4ZJZA 3AOGA 1DPGA 1N0VC 2IYLD 3MYRA 3V7NA 2A92A 3DHYA 5D7BA 3G1UA 2C1XA 4TS9A 1Q0TA 2I66A 1Y8QA 4TYMA 3H1BA 3G2LA 4DDUA 4EHDA 4PEVA 3VR1A 3JAKA 5AOCA 1EWKA 2C04A 2NIPA 4BV9A 5EJ6A 2BUCA 3MYYA 1E18A 2CBGA 5DO9A 1IB6A 3JQRA 1NSTA 4TS1A 2VTBB 5EJAA 2YWGA 1J90A 2WAXA 1XHEA 2E49A 2ONKA 5G02A 3DBLB 4O4LA 2XNDD 3B6EA 4IGEA 3OFKA 4RADA 4BVHA 1OXVA 5EJ9A 3QXSA 2H8KA 2VPPA 4S1OA 3JX9A 3TJZA 4A8PA 3K94A 1YXMA 2AK2A 3DVLA 5A3JA 2C4KA 3AXTA 2RH4A 3NC0C 4P2BA 1E4EB 3AEQA 4NZNA 4ARAA 4F8YA 2W6NA 4M1QA 2VNHA 1K8XB 1BXGA 3CF2A 3WSVA 4MLDA 1TZBA 2WU8A 3IP6A 1NNI1 3FE2A 3GPLA 1PDVA 2V4ZA 4M7PA 2IDZA 3W4JA 5FKJA 2YXPX 5JSHA 1TMYA 3OOWA 3OZTA 4OK5A 4P5PA 5CXUA 4LCEA 4LZOA 4QU5A 4MVJH 3VR6D 1CJUC 2AZMA 5I45A 3IFSA 3OIWA 3B6JA 1U11A 5B2EA 1FEZA 3GVCA 3KQSA 1YZKA 1XEFA 1KDTA 2OPBA 4U7TB 5F9HA 1EI9A 4BATA 1VGQA 3HDJA 1KEEA 3ZDYB 4KWEA 2G40A 3TQQA 4PQGA 4DNXA 1QIGA 2CV1A 3VPHA 3T3OA 2ZTLA 1X80A 1XVLA 2XB4A 1YSCA 4LTDA 1UXGA 3ETCA 2PMDA 3CNHA 4F7DA 4CV2A 4PNHA 4ZYUA 2HWUA 2RARA 4MA0A 1JPNA 3W8EA 2P5SA 2JFFA 1VJ0A 4DLPA 4EPTA 1E99A 2QVZX 3WYDA 3KEGA 5CFNA 2D7DA 1M1NA 2WUVA 4OSEA 3HKBB 1QJ4A 3H2KA 4ZYWA 1D6MA 5E4YA 3V2GA 2WMOB 2X5XA 2YWHA 2B20A 4K9SA 1OT3A 4J4TA 1QFJA 1XEAA 2H06A 1TUIA 3SS9X 4HQOA 3AONB 4HB2A 3TB6A 1J2RA 4E03A 3OF3A 2HAEA 4F4FA 5LZ7A 3MELA 5HXAA 4ERNA 1JLKA 1Z8NA 1W44A 4ZEOA 3UFXB 1GCUA 2XWQA 3K5HA 1PWHA 4UAGA 4R7TA 3CZMA 4IY1A 1Z5OA 2QTFA 3F0TA 2R8OA 4QWMA 4CKYA 1URPA 2OESA 3OJXA 4KQXA 3A4TA 1G7SA 2DKNA 3OETA 3GPBA 3PXCX 1IUPA 4H16A 3JYLA 4PQYA 1P0QA 1T2AA 4BN5A 4P82A 1UANA 2GFQA 2CYBA 2R7LA 2ZT6A 1DADA 3UJ8A 4E5NA 1ZGGA 4ZDIA 1NJ2A 4TVOA 3SYTA 3EPJA 3KSUA 3K1YA 1PZGA 2J5QA 4RWZA 3KXPA 1EXMA 1JXQA 1BX3A 2RHGB 4NCXA 1SUBA 4PXSA 4UCXA 3GLGE 1PGJA 3OO0A 1QNLA 5AKEA 4EPXA 2ZIFA 2ZB2A 3NHKA 3IE1A 2ZP1A 2F9FA 2VF5X 3AR8A 2X9VA 4I1RA 5GV7A 2ADOA 3ZWQA 5FUWA 3VDQA 3AF5A 2Q9BA 3DFKA 3FCOA 4RF3A 3LV8A 4Q4HA 1X94A 1EZ4A 3ZJVA 1Y3HA 2C4WA 2NAPA 4TKMA 2POCA 4MPDA 5HIIA 4EHNA 3DAHA 1UZAA 2FG6C 3ANXA 3HFJA 3UENA 3THWA 3PBKA 5J4YA 1CUFA 3UJ9A 3K8QA 2PKQP 4H4CA 4J0KA 2ZRCA 2XB2A 1TEHA 1WVIA 1Y42X 2AG6A 4GEGA 5JXGA 1GCGA 5B53A 1GFWA 1OFUA 4DWOA 4MJ7A 2FLWA 3FTQA 3F5SA 3L4BC 2XGGA 3IT0A 4NH4A 2WYVA 3V46A 2PS0A 4MRSA 4HNSA 1Y5RA 1JTEA 2A9RA 1VXOA 3EXIA 4BFUA 1CJSA 1N25A 4IOJA 3IVMA 4CM7A 5EXDA 1A98A 4NF2A 2OV6A 1C7JA 4R0MA 3V4FA 2BD0A 1P2VA 1TZ2A 5DN6A 2EKZA 2WWFA 3QGMA 4L4UA 3ONWA 4R2HA 1W30A 2NPOA 3AYXB 2HSDA 2WVJA 1G5QA 5LU8A 2JFVA 2JF0A 1XDWA 3ICEA 1AKRA 1N2JA 1ZRSA 1ZVJA 4RDCA 2V1UA 3E5HA 3TD9A 2F67A 4FFWA 1K68A 5M5BA 1YO6A 3HVIA 1P4GA 2P78A 3U7FB 3O8OA 1QQTA 5B3JA 4KWIA 3AVVA 5DTMA 1KI7A 5DYWA 3RBZA 1ZG3A 5DLPA 2ISQA 4CV1A 5EKSA 4DLSA 1AS2A 1THMA 2GH1A 4PE5B 1JG2A 3ORQA 3HO8A 3EUWA 3HXKA 3SKXA 5BW8A 3LLSA 3U40A 4D9FA 2HO5A 5KSOA 3KAQA 1VHDA 3AI3A 1WP9A 1D0SA 1VPWA 2WYUA 3DXFA 5GIPE 2CLEB 4GBED 3GFQA 3LW7A 1YULA 4MV6A 4UDNA 1F17A 2X13A 3ABOB 5CRIA 3THWB 2W2VA 3FYDA 4HNHA 5D1NA 4YI5A 3ZE6A 4ARZB 4TT8A 2W22A 4LJ6A 2BOVA 2OXEA 5C37A 3FFTA 3PPYA 2ZJ1A 5L6LB 1H4VB 2JCSA 1TZCA 5G53C 4N12A 5FL7D 3PE3A 3IAHA 3VM6A 5JSZB 1ECGA 1ECCA 1F0NA 3TN7A 3NBXX 5EVJA 2QTVB 5PGMA 1SVIA 1KO5A 3OZWA 1SB8A 4EHJA 5KHLB 3AQIA 2X9LA 3KVYA 3NPMA 4PBSA 1HMPA 5AMXA 1N6RA 1U02A 4JKYA 3VHRA 3JRWA 2NTNA 3V4VB 4R01A 1NMZA 1O4WA 3QEMB 1FPQA 5JH7B 4XWGA 4G4GA 1KDOA 1G9TA 2HUNA 4KQJA 1OZGA 3AKEA 3LOQA 4HFNA 4H1HA 1OLOA 1T8RA 1CB0A 2GPNA 2IPOA 5AVRA 5EIWA 4BNJA 1FTGA 1IIBA 2FQ1A 3MBKA 4FHCA 3WIBA 3PJDA 5FNVB 4CI9A 1UIMA 1WD7A 3LHKA 3P71T 4C04A 5HZGA 5MN4A 3OZBA 3QFHA 2CVZA 1CY8A 1W85A 4IDAA 1SAYA 1E7RA 1UP7A 4NNPA 3VVBA 5A4IS 5KTYA 1O0BA 1DEHA 2FFBA 1TRKA 4DKXA 1SU4A 1M6NA 1PYDA 1EGHA 5CVVA 4LYHA 1F2UB 1Y0BA 2TSYB 1G6KA 3GC6A 1Y7TA 5CNJA 4OH7A 4COKA 4GM1A 4TTPA 3R7BA 5F7XA 4CI0B 2VDWA 1UC8A 1EE1A 2BKVA 3UHJA 4D7AA 1XLTC 4HH0A 5IJZA 1C4OA 4RIEA 5C1OA 3W78A 1OYVA 1RU3A 3TLMA 3U09A 3KCQA 1SXPA 2BEVA 1O0CA 4O02B 3W34A 2X4DA 4G5FA 3BXEA 1K98A 2PT9A 5J2UF 1X8XA 3K2QA 4Y0VA 3NTLA 2Y2UA 2F3UA 3VU8A 1Z8HA 1H65A 1TCCA 2BBTA 2D00A 1F51E 1FL9A 5B7NA 1IM8A 2HGZA 3DZIA 1ZBDA 1MX9A 2Y1CA 1PU2A 1XKTA 3MQ4A 4F1WA 3QSYA 1HYEA 3URKA 2BZSA 2C2KA 4A91A 2AHRA 4OHPA 4A73A 1GKLA 3C43A 2ZUWA 4JS0A 5FWYB 5J1SB 1A8UA 4XOIA 5I7AA 5TMEA 3W6ZA 3UK6A 2UXDB 4PGFA 2HMSA 3D7MA 3D1LA 3N05A 3D5QA 2ZRKA 1E4OA 4QULA 5LLTA 1OAKA 2WPDD 5F3RA 4JYZA 3BQMB 1K06A 5JSKA 4WOCA 1T3LA 1ZX1A 3NKVA 4FVTA 3ZU5A 5KYKA 4O29A 4D81A 2FUKA 1SBQA 3H3XA 1FLVA 1MA0A 3IV6A 1W0KD 1COWD 3JVIA 4JU8A 4O2AF 1P9WA 1VCNA 2WIGA 1A9QA 1KH2A 1DKPA 1QGOA 1UQTA 1U4OA 1VKHA 2RG1A 5DF1A 5EHQA 1CB7A 3EDYA 3H2ZA 4L72A 4P35A 1IHPA 2GBGA 4YJ2A 1JB1A 2YHIB 1A7UA 3DE0X 1N0IA 1KP2A 2YR0A 1Z2CA 3CPEA 4JHXA 1DAOA 4CCWA 1ZD8A 2K7ZA 1G5IA 2J59A 1E6KA 4LRQA 821PA 2OKCA 1ABEA 3DG9A 3AJEA 4GI7A 2EKBA 5K7SA 4FGZA 5C5EA 4FR0A 5DCUA 3R5JA 1Z28A 3PQ8A 4X7RA 1X86B 2FF7A 2B25A 5DSTA 4LFCB 5CFOA 5DBGA 4DMKA 5I5GA 1V3QE 1CNFA 2DBQA 4TTQA 4DOMA 1A8QA 2UVQA 1GGKA 2WI8A 3QI7A 3A3PA 1EM8A 3WHKA 2P9CA 4FDUA 3KU4A 1FUYB 3C6KA 4I1YA 1RAHA 2BF7A 2PYZA 3K2IA 2A1TR 1XAIA 3Q6IA 5LDGA 4ZHQA 5B6IA 4XQEA 3IQWA 2PL5A 3QUAA 4R3WA 2JASA 3NU1A 1NUAA 3GLTA 3LF1A 1KJWA 3P0EA 4YJDA 1DZIA 2OV2A 4EEXA 2LPMA 2VXOA 4LF6B 4W9MC 5IRCD 3BK2A 5DX1A 4CTMA 5A03A 4DCJA 5CB6A 1ZKDA 2ERCA 3K1AA 1J9EA 3H0EA 4YASA 3OLYA 4V0ME 3RIYA 2COEA 2XCTB 3KDSE 4G0QA 3ZE7A 3CQ9A 4DBLC 1C3OA 3R23A 3PL1A 2O1WA 1GRQA 4KXYA 5JS7A 1H94A 1I1HA 1XTSA 4CM4B 4FZVA 4P7KA 2BCGY 2GZAA 3G6WA 3IESA 3OU2A 3NR2A 3R40A 5IZCC 4MUYA 2HCTA 3R3JA 3EAQA 5ALFA 5EFOA 4EJFA 4RTLA 3K0FA 1P45A 1XQVA 2RSLA 2BSAA 2TECE 4MQ6A 4NIMA 1OF1A 3IXQA 1KYWA 2G63A 3PDCA 4NEQA 5EQTA 3RABA 4CUJA 3U3XA 3VR2A 2HIGA 2W0MA 1B2RA 1C7ZA 1KQOA 2XBLA 1FIUA 1AO3A 4FBLA 5KJ6A 1PTJA 1YZQA 2R00A 3HMKA 4QBIA 1E2QA 5CHEA 4M88A 3F90A 5FD8A 5A5DA 4MOWA 5J9FA 3HGTA 5MF6A 1G98A 2HQ1A 4IDEA 1Y6GA 2NU9A 1KSHA 3BXGA 2V9ZA 2L19A 5IAAA 1QYVA 3RUCA 2BHNA 2QJRA 2ZQZA 2ZTVA 4LXXA 2BPOA 2ZSJA 5AOBA 3SBDA 1E60A 1T9GR 2G8LA 3B6KA 3CMCO 4U8GA 4KYTA 3AV0B 4GRDA 5BMVF 2A5DA 3G6KA 1OJ7A 3ZXUB 4D6XA 2QL6A 2WYIA 3HL0A 4LBYA 1R8XA 4EO9A 2UUBB 1Z74A 5JCZA 1LV7A 3SN6A 4CFYA 1ZXBA 1JSCA 3MB8A 2W42A 4ZOLF 3LY7A 2AOTB 3W5VA 2C7GA 2ZB4A 3FJYA 2FSPA 3PGKA 3NVAA 4N3AA 5HNKA 2QTNA 1JE0A 2VK8A 2O57A 1F4PA 3DE5X 3LSYA 4IQ0A 3R3VA 5CX4A 3W2IA 4B3HA 6LDHA 3OU6A 1JHVA 1RLIA 2QXUA 4IXNA 4JYMA 4WZAA 1NP3A 1GGHA 2H1VA 5D2CA 3ZHOA 2D0IA 4BZXA 2AZXA 3C41J 1I3NA 5A7HA 3KQTA 4CIYA 4DR6B 4WHMA 3GL9A 5KI6A 3B5IA 5DEOA 2PGIA 3S68A 3VSEA 5JVDA 4MQBA 4M7WA 1AB5A 4ZI7B 4JX8A 4U7GA 1UKBA 2CEKA 3MUEA 4FYVA 1VSQA 4LKRA 5BVGA 3VOSA 1FUKA 5JZ9A 1VP3A 2KE5A 1IEQA 4F0JA 4COOA 4GC9A 3F7NA 1FNSA 1U3TA 4Z8YA 1KEWA 3K72B 2Q6KA 3DTTA 4QXAA 1PT9A 1OZHA 3Q1LA 4L16A 4LRWA 2VVTA 1FP4B 1YI1A 3AP1A 1Z22A 4PONA 1AKQA 1XA3A 1ULUA 2BHTA 2VSFA 2IHJA 2IEGA 4FOLA 3HB7A 4I55F 1BCRA 3O4HA 4KN5A 2V97A 1T8YA 2IWHA 3NALA 2BR3A 1I1OA 1KWKA 3KJNA 3AUKA 3M4NA 2WYHA 1ZRHA 3EQ6A 3NGMA 2I03A 4REMA 2EBFX 4Q05A 2W2LA 1I7DA 3LUCA 4KLNA 1H6AA 3T5BA 2CMFA 5CB4F 1X13A 3D3JA 1P5ZB 4GGMX 1ZI6A 5HF8A 3HY4A 3KYCB 4RSHA 1Z5UA 3CWCA 4DAOA 1Z0SA 4QJ3A 1BXRB 1C3LA 2HMUA 1E2NA 4AU1A 1WDLA 1LDBA 3ISVA 1U5BA 4YRKA 2O4CA 1GRCA 3IUPA 1HLDA 2Z2ZA 1ZIOA 5MGBA 4B3MB 1VCOA 3VUFA 3O0DA 4OI0A 4HPJB 4XUGB 5SY6A 2OAGA 4MV1A 1JLRA 4YAOA 1E63A 1MCZA 1OA1A 2OVFA 3VHQA 4E2WA 1U7WA 4UJ5A 1P1KA 2WA2A 2Y0CA 4HKTA 1UZLA 3PQCA 1WZEA 1I5EA 1VMAA 3FM9A 5FI5A 1DEXA 3NTQA 5JD3A 1XZCA 4V02A 2R66A 3JXEA 2CD7A 1PG0A 3H9JA 3OZSA 3ADKA 3V7UA 3M7IA 1P0PA 3WQBA 4AY3A 5HKKA 4CCYA 3P19A 1DEAA 1V11B 4YRAA 3RD5A 1N2HA 3CINA 3X1MA 4QRDA 2SHKA 2IS1A 5IH3A 2JLCA 1W36D 1AKTA 3SBEA 1NDQA 4D9MA 3OKPA 3QVKA 4IFIA 4V0LA 1Y3DE 3OT5A 4QPCA 3P9QA 1TM4E 3EEBA 3A4NA 1FDRA 2ZPAA 3TZEA 3B3JA 4X20B 1FU4A 3EZ6A 4HRYA 1KA9H 2HEIA 5CP8A 1N3YA 1M6YA 2P69A 2WT9A 1XIVA 4GQBA 4RXTA 3ZZUA 2HGSA 4D02A 5K3DA 4WNAA 2DE0X 1VPLA 5IU6A 1ECPA 2JCBA 3VGPA 2HHJA 1SCAA 3ZG6A 1J5EB 1BW9A 4AO7A 4F97A 4CKEB 2YCLA 3P45A 5LQCA 1RRKA 4AP6A 3BTSA 3D4LA 1I0ZA 3TLBA 4FEEA 1WDMA 1BGWA 1I0IA 1VIDA 3FPSA 4XIIA 3W3AD 3DOOA 3NRJA 1HSZA 4CETA 1QH9A 5COAA 1TAQA 3RTCA 4HB3A 3F78A 1HLGA 3DM9B 5JWRA 2PGNA 4RMNA 1S9HA 1MAWA 1H9CA 3HJCA 4UASA 3L7MA 1BH2A 1RLTA 2J9FB 2Z43A 1I8TA 4P08A 3INNA 2HRRA 3IV9A 4A8JB 4JV5B 1EFVB 4R7GA 3VVMA 1ADBA 4FCWA 4V0KA 3WRXA 2FETA 2W7TA 4DSUA 2AOUB 4N48A 3T41A 5DLEA 1Z6PA 1T0PA 3PSHA 1QOQB 5IBCA 3LDFA 2AJCA 4KPEC 1L5FA 3K9HA 4I3FA 3M70A 4B6PA 4O3FA 1V1RB 1KRHA 4ONEA 5LJIA 1DDIA 4YQEA 3VR5H 1XMOB 1XKLA 4D1YA 3S1AA 3FTCA 2XMDA 3N8DA 2H3EA 3AB8A 3KLBA 4FWIB 4MRNA 1GZSA 3BGVA 1RWBA 4IEEA 3TLGB 4AS1A 2UXCB 5LD2C 2ATIA 1BEEA 3N8IA 3A70A 3I3SR 1IHUA 1ODIA 1P1FA 4V39A 3FPEA 3OUTA 3WGKA 3ZLUA 2NV0A 1LBTA 1M8FA 4PHCA 3GYBA 3O8NA 4QUHA 4CMBA 1E0KA 1J5PA 1XDUA 3ZLBA 2ZZKA 4MYCA 3UG7A 3UMSA 1L5HB 3UMVA 2HI0A 3KUXA 4JLAA 5ICGA 3U62A 2AFIB 5CVTA 2DPLA 4C5AA 4AKGA 4Z8XA 1IE3A 1HYBA 2YN2A 4OGWA 1W4LA 1EDZA 4G26A 3JZIA 4D4JA 4HAXA 5CGZA 5HCNA 1E3TA 4RM3A 4UFNA 1K5HA 1G3QA 5CX1B 3UBMA 2C8VA 3ZNQA 3VSBA 1XD9A 3QF7A 5BOSB 3L46A 1LUAA 1OHHD 5JAUA 3RAGA 2O3TA 5CM8B 2DUWA 5HJ2A 1M1YB 1CKEA 4KHPB 4N5LA 2AZDA 2NO0A 3KKNA 3DOJA 2ZR0A 4BKQA 4FHGA 2OYRA 1NMQA 4R0NA 5FPPA 4DMGA 2C3PA 3N2GB 1CR1A 1ZK2A 3U4IA 4CU2A 3HCAA 3FMIA 4RE6A 5BNIA 1ICIA 1LK0A 2YMQA 3BERA 4N01A 3NHWA 4JMPA 7REQB 1R6VA 3T0IA 1ETHA 3ND6A 4D3DA 4QODA 1R4ZA 5JYCA 4GX0A 4I1PA 2VH2A 1B43A 4FFLA 1SU8A 4LE2A 3PK0A 4KQ1A 4DXAA 5CFQA 2Q1YA 3DUWA 1SIOA 1ORWA 3LUJA 1ZMOA 4DJJA 4BX9A 5JZOA 3P9SA 4OATA 4O4IB 3KKMA 4JDUA 4UZSA 3A9VA 3IELA 2ZDHA 1T0BA 5EJGA 3QPUA 1SG6A 3LQFA 1FK8A 2RGEA 3ETEA 1O0SA 2ZJ5A 4LSMA 4MI6A 5FTLA 1RHKA 1K6EA 3NTRA 4DA0A 2ZDQA 3MJSA 4DSNA 8LDHA 5KNDD 2ZUFA 1GA4A 3GCZA 3MILA 4G9BA 2JBHA 4DRZA 5C18A 4BXOB 1BE6A 1GZHB 3PC8C 3NDRA 3OT1A 1K4MA 2DGDA 1V3UA 2GD0A 2IYYA 4M6WB 1RR6A 3PITA 4D79A 2VT7A 4QDJA 5JCJD 3BOSA 2YWXA 1KJIA 1YQXA 4NBLA 1YCGA 2CJWB 5BN3B 3INYA 4MS3A 4MRPA 4R9RA 1KEUA 1VE1A 1FA9A 2O7VA 4D3XA 4Z3DA 1N2OA 1SOVA 4OQYA 2CJXA 3LLVA 4RHXA 5I9NA 5KS2A 2FWRA 1SVKA 2PJUA 4J3NA 4MICA 4G37A 3G7SA 2JI4A 1GCOA 1JWAB 1R4NA 1G19A 1TOAA 1YWGO 2HM7A 4FSDA 3RVBA 2KW5A 1C2TA 5JEDA 3E9RA 3Q7EA 2ZM6B 4IIJB 4GHWA 4R9SA 4F71A 2PU7A 1NXSA 6ADHA 2UZ4A 3NTUA 4B75A 1MRNA 3MT0A 4KN9S 3L1UA 2F48A 2Q5FA 2I6TA 3N2LA 2WUGA 3L6OO 4JSYA 2HF8A 4KFSA 3MNFA 1RD4A 4QHSA 4R1LA 5CBPB 4US2R 1ND5A 4BMPB 2WTXA 1DHRA 3D4OA 2O23A 1WULS 3PDJA 3FNGA 4CL8A 5HGXA 2C96A 4RTMA 1S3GA 1B4DA 1R37A 1TW3A 4RHUA 1DHTA 2C98A 3CT4A 3QQ5A 1DIRA 5FEMA 4NFSA 1RM3A 1O9HA 2FA9A 3GT3A 3ID6C 1PWZA 4GQAA 3I04M 5HOEA 5REQB 3EAFA 3FR7A 1JB9A 1RJFA 5HE9A 4DXHA 5CEJA 1H0KA 4LXTA 1P2BA 3V9AA 1PQWA 4NV1A 5KYUB 2DWCA 4YY3B 1EX9A 3F96A 1UT8A 4NNOA 4U6QA 4D80A 3O0TA 4IICA 4ALMA 4WESB 2WSLA 3OCZA 1QS0B 3M4ZA 3PQ6A 5DHRA 1YDMA 4Q9JA 3BGIA 4UHJA 3FBTA 1LDGA 4M1SA 3FKSA 2PKRA 1ZA1A 4EITA 2QTGA 1WCYA 5DM2A 2H2DA 4YJFA 4B2IA 3NZEA 4E09A 3RKSA 4U2KA 4X3OA 4V0RA 3V4PB 2OZEA 1SUCA 2QQEA 3H5WA 1Z0DA 3JU3A 4Y6OA 4B3CA 1OAOA 4IIFA 4EP1A 1Z7EA 3T1OA 2J0EA 1P29A 4AJHA 2FR8C 2YDXA 4KU4A 1NPTO 2GSWA 2GCEA 2JIQA 5AI6A 2HSEA 3STXA 3B6IA 4RIFA 1HNXB 1HZJA 1E1RA 1E6EA 3L8HA 5F77A 2C58A 3BIXA 1VRWA 4C78A 3GFVA 1ZIYA 2C5GA 3E4CA 4QFMA 1X7GA 2AI2A 4X1IA 1ZM9A 1SUWA 2B8TA 4RQTA 3ER6A 3A3NA 4KGDA 1ADGA 2E48A 1CF9A 1E2GA 3QFTA 4DZZA 2AIRA 3KWFA 4GP6A 1RKUA 2IEBA 4WIAA 3GWZA 4OHZA 2BW0A 4B85A 2Q46A 4DS3A 3IDZA 3OEEA 3R5SA 2DSNA 1MAVA 2GF2A 1CTQA 2W6PA 4NLLA 4OMFG 2CWDA 1FVXA 3EZNA 4HNRA 3A4YA 4LMRA 2R8ZA 1XFAA 3DMDA 1GPH1 2A9QA 1D2HA 3C8DA 3HYLA 5AO9A 3SQWA 1OBVA 5IT5A 4IQFA 3JZAA 3LVRE 4D3ZA 2J4FA 4II7A 5BN1A 2FN4A 2A9VA 4QUGA 3OUUA 3DT6A 2I4RA 3ELUA 4AICA 3U9LA 3CF4G 1G63A 1TXGA 2AOVA 1P1BA 1Y6FA 4Y2HA 5D6OA 4LUCA 3NDPA 1F5NA 1AZWA 1E3WA 3WLTA 2OXRA 4OKIA 5A4AA 2XXAB 5TF0A 4C0KA 2JIRA 2G1UA 4MP3A 1TAUA 1OZ0A 5CR9A 3CIOA 3KM0A 1UWKA 3EUAA 3P9XA 3O94A 3EXHA 4L95C 1NAHA 2IV2X 3MMXA 2PM8A 3T9DA 5BQ3A 4PU0A 3U3DA 2B7BA 4LOJA 1VA4A 3ER9A 4JCCA 3H75A 5F23A 1YQ9A 3BSSA 2XZPA 3I04A 5D3KA 1FCJA 3F6BX 2IS4A 4UM7A 1WAMA 3T9BA 1TJ3A 2VBCA 2TMGA 8MHTA 2WABA 1IPHA 1E94E 2EFYA 1BVUA 2CDBA 1A4UA 1VIMA 1Q3HA 4GLJA 4KQIA 4RE5A 1R8QA 3SBOA 3T61A 5AW0A 5LKAA 1J2EA 4WECA 1JH9A 4QASA 3ND8A 4H4EA 3PLAE 3YASA 1L4UA 1ESZA 3OTIA 2FWPA 1LLQA 3AUUA 1TA9A 5JC1A 1NNSA 4D6YA 1GL7A 4BLRA 1I13A 4H7KA 1F38A 1WOYA 3V55A 2PUCA 1NBMD 5K45A 5C51B 4GL2A 2J3IA 4CE6A 4HNVA 1TKCA 1QIHA 3H1EA 3ILXA 5F21A 4C05A 3MGAA 4EG7A 1WW8A 2GO7A 4PYNA 3ETNA 4OUDB 3JWGA 4FSHA 3B1VA 3RS7A 4OI4A 1W6RA 3I5XA 1TMKA 1ABFA 3LC7O 2VUHB 1PWEA 5F2EA 4YAWA 3VKFA 1IBLB 2DH5A 4RM2A 1EZZA 4JQYA 4YNBA 5B6PA 3G2IA 3EISA 1DO2A 1ADCA 2JATA 2PSHA 1J6UA 3U49A 4D82A 1WKCA 4WKOA 1R3UA 3C15C 3EBPA 5BPFA 3RSHA 4I6GA 3EFHA 3SHVA 1DX9A 5KYYB 4MV0A 1GT91 2W8ZA 2WSIA 1FB5A 1RWQA 1W29A 1JQDA 4M36A 2FW1A 2H52A 1E0JA 1XCGB 1HDZA 2ID7A 4M1KA 1VPEA 1RLOA 2GAAA 1PL8A 3WYCA 4JUBA 4IF6A 2ZKLA 2BONA 4EKGA 3M9LA 4J3JA 1IC6A 3S8EA 3KAJA 1SKAA 2C2ZA 3A1WA 4BEBA 2BGMA 3CW2A 4KUHA 3DKRA 4EH1A 5A02A 5HX7A 3FJOA 1R9MA 3UJ3X 4AZ3B 4QX6A 3MGGA 1LDMA 1XMXA 5FDFA 1GFIA 4YYZA 1VKJA 5HTKA 2ZT5A 2GCGA 4BQNA 2PV0A 4C2UA 3OFVA 1IXRC 3K16A 2FEWB 4HX5A 5JAHA 4HHEA 1QTIA 3HUUA 1VLVA 1YK0A 1A96A 3QEKA 4NP6A 4F9TA 5JAZA 3I4FA 1GDTA 3V32A 1KR2A 4I7EA 1PEYA 3GDGA 2X7XA 3BIJA 3W2HA 5K0NA 3RFVA 1QUFA 1GUAA 2G5GX 4P54A 2O1SA 3LQRA 1IK4A 5A4KA 3R0VA 2HJHA 4IFEA 3VPSA 3L0DA 2FEMA 4QLAA 3TMAA 3RSOA 2Q7DA 5G1PA 5JHHB 3N58A 1PFUA 4QPDA 5D51S 4H6VA 2B9EA 4Q1DA 1S01A 4XYBA 2NT3A 2BC9A 2LXNA 3N8KA 4KXMA 3JWEA 1SIBE 1NF2A 3QV2A 1R9NA 2WB2A 5DN6D 4HPXB 1CJMA 2ILVA 2BEUA 5ISMA 5BURA 3KZ1E 4M89A 5IBRA 3OPYI 1SPXA 1IHXA 1SHKA 5H3HA 1BWPA 2NUBA 2JLYA 4MW2A 2YUTA 1ZM3A 2QMUA 1J1UA 2QKYA 5MN6A 1AM4D 1F9AA 1YE5A 3MCWA 1E2DA 4QHYA 4O4JF 2EW8A 1S8AA 2IYRA 5KSPA 3QLVA 5EKDA 2XMPA 3E9EA 2B2XA 2GPSA 4C6RA 4YV7A 1PJ4A 1PGPA 4DQDA 4BZPA 1LJ8A 3BD6A 5E7QA 2RIRA 4QPPA 4IRUB 5H3CA 5KVCA 1L6RA 2WSSA 1XRQA 2C00A 5B7QA 1ATIA 1QLJA 3W5SA 1U7DA 5LZ5A 3W77A 1IZ8A 1P7PA 5T8KC 2IYUA 4BVAA 2F90A 3EQ8A 2X5KO 3BRSA 5BRNA 1WNTA 5B12A 2WE7A 1IOLA 1GNQA 5BUSA 3QX3A 2ZAGA 3LTEA 3C98A 2PE5A 1QF7A 2G07A 4KQ2A 4HAUA 1DQZA 2F1IA 3T3DA 5GTDA 2FKNA 4YT4A 3N0XA 1NFFA 1QKKA 3F6PA 4LXGA 2OXIA 3UEOA 1SUFA 3MWEB 4FR2A 3T52A 2OCAA 2UZAA 3PRHA 4ER6A 5K8JB 1CVRA 1TIBA 3NHMA 5ARCA 2DBVO 2VUUA 4ZVRA 1Q6YA 3TQOA 1X1AA 2OB1A 4IIXA 2Q0HA 1A5BB 1UDXA 3MJEA 3UV6A 4B3TB 3A27A 1A2QA 4L0QA 4KOEC 2NZVG 3TUJC 3HFRA 4I5FA 5SZHB 1DRWA 2ZSIA 2IOYA 4P58A 2IHKA 3TF5A 5L3QA 1V43A 4RZIA 2H9YA 4KR2A 1KQPA 3CNEA 4RHTA 4L50A 5LBIA 3BILA 1CS0A 5DT9A 3UMCA 5F1YA 1JLLB 5T6BA 4DA6A 2AFHA 3S1SA 2ZJ8A 1RI2A 1IUNA 2QIOA 1E7YA 2TMDA 1ZVVA 4ZAXA 4BLSA 1PW7A 1XB2A 4DIFA 2FPGB 4TVBA 4U02A 3WISA 1BDMA 2VYFA 3FOCA 1O08A 4GOXA 1P3DA 4GF5A 4MI1A 3ULKA 1RMYA 4E31A 3T5PA 2TS1A 3DHNA 5T4BA 4Z7NB 2IXEA 2XDQA 4RVSA 3VAZA 1NOJA 1S1MA 1L1RA 1ZUHA 3VRHA 3WJ2A 5FB3A 2GNAA 4JKOA 1IL0A 4B74A 2XD4A 4RK0A 5KX5A 3SXUA 4JUAA 4PYKA 4DDHA 3HM2A 4EL5A 3PNOA 2WHRA 4NBWA 4PLPA 4BX3A 2XRMA 1QLWA 3RVPA 1TA4A 3O8RA 1IAQA 1SXJC 3K05A 2AN4A 3NUZA 5AK5A 2FPOA 5IM4F 1KOFA 1WQ3A 1Z13A 2YY5A 4F3YA 1E7QA 3I9MA 2Z04A 2IHZA 3ZYCA 1H2ZA 1PZMA 2J9XB 3VPFA 1F12A 1XDZA 4PN3A 1NONA 4RENA 1G21E 1Q0ZA 5JSQA 1JDZA 5CYOA 3F73A 3C45A 2W48A 5AICA 3SLRA 4F4JA 1CRZA 3EBOA 1Z26A 2O8CB 4RGQA 1VC2A 2I78A 3QMMA 1OWPA 3D7SA 3A3KA 3PYXA 3FI9A 4CEIB 3Q3EA 2JHFA 3HJTA 3OIDA 4JZYA 2Q2QA 1U7PA 3GEBA 3GXOA 3T38A 1OB5A 3LWDA 2OCGA 1Z2EA 3ICOA 1B16A 3NHBA 2ATXA 3ZPXA 4EKNB 5C5IA 2PBFA 1FRFS 2Q5HA 1P44A 4A36A 1X7WB 2AL7A 5ALKA 1CUAA 2XUFA 4KC0A 3SZOA 4ZAWA 2PAFA 4B7UA 1WNFA 4C0JA 3VAYA 5KCMA 3KJEA 1G41A 2AZTA 3FSGD 3OQVA 3VHXA 4C43A 1PS9A 3OM1A 3AESB 3DM5A 3H5NA 4PSVA 1H9AA 1KR5A 5ALDA 1YRQA 2ZYIA 3DEIA 4MQ5A 5GP1A 1DBIA 3D3NA 4C06A 3ENZA 1AQNA 3KP1A 1EG7A 3ZJTA 1PZEA 2EHJA 3E3OA 3G2JA 4OU4A 5AI5A 4YT2A 1E96A 4G85A 4DPKA 1GPMA 2QZSA 2VP5A 1HQCA 4URFA 3WQRA 3NCHA 2M6SA 3CLHA 2XJ4A 2FJUA 1OWLA 1ZVQA 2PV7A 2F8MA 3FTDA 4FMCB 2CHEA 4RL4A 4IEFB 4PLYA 5EQJB 5JDIA 4IZHA 2I8CA 2JAPA 2ZLBA 3ZYZA 2X0IA 1IJEA 1DG9A 1PL6A 2ZR7A 5ALJA 1FFWA 4Q5IA 2NMVA 2PTGA 5FT9A 1T8TA 3O83A 4QT4A 5LQMA 4WLVA 1U2GC 2EG9A 3PDHA 3NTVA 1GJRA 4BU1A 3M1LA 4LX0A 3HQ4O 2I4MA 1ZYUA 4OXQA 1TU0A 2AK3A 2HA2A 5FOTA 3DP7A 4EUEA 3NKFA 4WNYA 1OE0A 3IIKA 3LBYA 5DK4A 2PZMA 1JR6A 4ZVMA 1QHHA 2Q7XA 3OZGA 2IUTA 4DMUB 4OO3A 3TD6A 2PJZA 4H1TA 3NV9A 5IC5A 1QRUA 4E33A 3D6NB 2HJRA 4EYQA 2XMQA 3H5TA 2Z08A 2VHUA 3T9EA 1ZGZA 1G64A 3MUOA 1TT5A 1AN9A 4A2WA 1MPTA 2IZ1A 4OGGA 3FYUB 1O2DA 2P2NA 2DXIA 2W6IA 4PFKA 2ZB3A 5EQFA 4ENVA 3B52X 2XF2A 5CXXA 3G1TA 3ELWA 1AKNA 1MEOA 1TIPA 1XQ9A 2BF4A 1XTPA 2E37A 4EY8A 4JLVA 4Y7DA 4OB7A 4EYOA 3U4QA 3I2IA 2VHWA 5FTKA 5FWXB 5F2OA 3ZBQA 2CNLA 2YN4A 4GX1A 2XECA 3QFRA 4MEAA 1ZK1A 5LBTA 2IXGA 3CZ4A 1NBME 2PZAA 4K6MA 3VR2D 3PTAA 4CKBA 1HKUA 2XNJA 1GQFA 1BYIA 5ELMA 1ZSYA 3BFPA 5LMZA 3ADBA 1A9ZA 1TM2A 4LSZA 4OM7A 4YT5A 4F21A 1G2OA 5DTEA 5LNK1 1I5RA 1S8NA 2QLJA 3E18A 3HWSA 3KPVA 1RWMA 5C1BA 3RYCB 3ROZA 2FQQA 2GZHA 4QYWA 3WXBA 3ZTTA 4JR0A 3WLHA 2DPGA 4DR1B 5DOVA 3EZLA 3MK31 4PQRA 2PZBA 2HIMA 4XB2A 2WIJA 1KWGA 2EZ9A 1U8UA 4YVFA 1BVRA 3EWSA 1CE8B 3AEKB 3O38A 2QTHA 1Y1PA 3VSAA 4UVEA 2YVQA 3HK2A 3PPXA 4FGSA 1OBCA 1XJ5A 2X76A 1MB3A 4FYXA 4RJIA 4Y1EA 4MUGA 2O7SA 2WDZA 1E0SA 2H7YA 2R4UA 3I6MA 2R1VB 4UPDA 3R7SA 5D5QA 1L5VA 1UFQA 1L4KA 2JGMA 1F5SA 2P8JA 4LNUB 3JYHA 4KLAA 3C3EA 4RAOA 4UBIA 4BX2A 4LY0A 2AI1A 2PT7A 3F7OA 4C08A 2ID8A 1VG1A 4ETWA 2Q4DA 1U7OA 3QITA 4Y6GB 5E6SA 4G5OA 2I1QA 4A82A 5AUQA 3EG9B 2GHIA 2WOOA 1ZD1A 3SP1A 2GPYA 1ZJYA 2VJPA 2ZVPX 4O3MA 2BUAA 1U81A 1QZTA 2UYOA 4AMVA 1SGWA 3OZDA 2C9DA 3WV4A 1KTIA 5B2ZA 1MHTA 1YZVA 3I72A 2H6EA 2OZLA 4HWOA 4BLOA 2PS1A 4H08A 3ASYA 2FW9A 1OV4A 3KQLA 1W88B 1VE9A 4C6TB 1RC8A 3KV3O 5HE8A 1WMBA 2WKQA 2IODA 2YN0A 2ZJ4A 5GIOE 4UPVA 5D86A 1ESEA 1OILA 3FZYA 4MKHA 3DLBA 2WJPA 3JTEA 2NO4A 1E0DA 1QONA 4ZQCB 4V1CI 4JSTA 1MORA 2PCLA 1TAGA 4R2IA 5IT0A 2MYTA 2XV1A 1ZN7A 1TM3E 2GDZA 4UMDA 3UJ6A 3P9CA 4AJ2A 4ZZ1A 1BE0A 1B14A 2I3ZA 4PNPA 5LP6B 1XJ0A 3GW8A 1IN7A 1DIHA 7ABPA 5A9SA 5DI3A 4YRPA 1XTZA 2R7KA 2ECOA 3THYA 1FP1D 1VOTA 1AF4A 4HZUB 1I14A 4NPCA 1OTYA 2OHVA 2P9EA 5BNZA 4I6EA 1N7JA 5ERGB 1G16A 2ZRGA 3OQIB 4QZVA 1DT3A 1MJNA 1XROA 1X1RA 1JVNA 2QAGC 2ECKA 3HCDA 4HDRB 3SIRA 4B8YA 2WA1A 2GKOA 1UT5A 2ZSHA 2F64A 5D3MB 5J5VA 1J07A 1FDTA 1YOVA 3EFBA 1PTKA 3DTVA 1GRVA 4F5YA 1I1QB 3U2QA 4KG7A 1UM9B 3C2QA 3I6QA 2IFTA 4MYSA 3DZDA 3EC1A 3LYHA 4G5HA 3D6VA 3NOXA 9LDBA 1DP4A 1F6DA 1V7QA 2VNJA 4Q7KA 5YASA 2LDXA 5AJUA 4N47A 2MSEB 3WSTA 3V1MA 1DCFA 2ON6A 4YQFA 3HY6A 2R6JA 1XX6A 3THXB 4LHWA 2ZBGA 2YS7A 3GG9A 4LDJA 5CT8A 2IVZA 3RAFC 2OZKA 4KMRA 4BJ6A 3KUKA 4LYJA 3JV7A 1U80A 1AIPA 2I91A 5KNBH 2VHZA 4RMHA 1YGYA 1WF3A 5HKKD 4DWJA 3GN1A 3MLBA 4CM5A 5I7SA 4UNQA 2X41A 3OLWA 4FKMA 1EINA 3CUYA 3HJAA 5EXXA 1C3EA 3DCIA 5H3LA 1MGPA 1YL6A 3CW9A 2RGBA 2FZGA 2VHTA 1XK6A 4FMBB 4BNGA 3TMYA 3L93A 1U9IC 3HVRA 2JEZA 4OLHA 3VZCA 1UK8A 2QJOA 3SICE 5B64A 1D9XA 4JP8A 5FL3A 2CY0A 1PO7A 3SLKA 1ZJJA 2IHBA 4BNMA 1I2MA 3FBWA 4V0NA 4DT1B 3KRTA 3QELB 4ACAA 1JG1A 2EGHA 4JOCA 4J4BA 3JARB 4JP2A 2HW8A 1T0IA 3DFZA 4B45A 3R0XA 5F1PA 4PZEA 1N5KA 1ZOLA 4KIWA 1FXWF 2OOSA 1IBRA 5I47A 2OCLA 3ES9A 1D7OA 1N0WA 1YUBA 1T5SA 4HH3C 4YI3A 1ESNA 3BDVA 4EY7A 3WRYC 1VYHA 2BGKA 2X0RA 2YS6A 2BI8A 4QYIB 3T34A 3U3JA 3PQ5A 3U16A 4DY4A 4G0WA 1N2CE 1VLJA 1QVAA 4DLBA 4LC9A 1NIPA 4K9MA 1VL5A 4JEIA 2ZRQA 4QICA 4NXMB 2R7NA 3K0HA 3AFNA 3CH5A 4MQUA 2DFLA 1G8PA 2XOXA 1WCIA 3QKSA 3OIYA 1RC0A 4B3BA 2AN3A 2INGX 4FMDF 5C53B 2X19A 3DBHA 3NP9A 5DWQA 3T7AA 3NWOA 3RS8A 3OMLA 3NHRA 3WICA 5JH7F 1E62A 3CRVA 4F2GA 3BCRA 5KYNA 2R8RA 1H2YA 4AF6A 4Z53A 2AC2A 1O6BA 2B21A 3JALA 3D1VA 4GOJA 3C6YA 2QRUA 3TQCA 4F11A 4AZ0B 3ZHSA 4WJZA 4AROA 4K2HA 1RYBA 2ADFA 1ISPA 2VPYA 2FRDC 1P33A 3HXTA 2FUCA 5FNVF 3M0EA 2RAPA 2O7RA 2PX2A 3H9QA 2J0UA 1J97A 5DM60 1WCXA 2Q3BA 3QP9A 4XPIA 5DBIA 3PUKA 5TQVA 4HVAA 2R8XA 5HUHA 1Z45A 4FGLA 2FZ5A 4PSCA 4M86A 5CJPA 5G4KB 1NBOA 1MR3F 4JIMA 4FFNA 5IJAA 4BMYA 1HEYA 1U7XA 4WLFA 4X1YB 4DBLE 2HNBA 2P7IA 3K1TA 3UT0A 2GCNA 1I4DD 3BDAA 4NJOA 4B34A 4XWOA 4JI0B 2QN2A 3VDNB 3SEZA 1SN7A 4WCFA 4O2BA 1NM5A 3U4GA 3QLEA 1N4AA 3SFZA 4C2AA 2YIMA 2ZAIA 3ELYA 3RUPA 5L9AA 5LXTA 1P2TA 3I34X 4I46A 1T10A 3RSZA 1AE1A 1BSVA 1N3BA 1W4ZA 3Q10A 5DHSA 1EVLA 4QE3A 1MNAA 1RJDA 2I34A 2OAP1 2ODAA 2DUNA 3ISJA 4RKEA 5AIAA 5B1IA 5ADVA 2KI5A 1EUYA 1VL1A 2VTEA 3N53A 4HJRA 5IYZA 2BRUA 2RBGA 3CVVA 1K2WA 3HLKA 2IIPA 3SJBA 5IC4A 3QI2A 3L4KA 1KC3A 1VIAA 3G49A 3UYLA 2ANCA 4HAWA 4QC2A 1PVVA 3H7IA 5B4VA 1AUQA 2ZIAA 4EY3A 2A1UA 5ILGA 2W6CX 2BTQB 1KIFA 3O6VA 4N8EA 1C9KA 4L15A 4ZCSA 4II2A 1DVRA 1W8DA 2V8BA 1GAXA 2N3ZA 1N4DA 4BAZA 1NJGA 2H4JA 3DPSA 3NAZA 2B99A 4RKRA 4Q7EA 1HOTA 4TWJA 4E6PA 2VJYA 1ZXLA 2QAIA 3E23A 3Q12A 3DE4X 5AKLA 1RYZA 2DC1A 1GUYA 2GM9A 3JYQA 4PYMA 3SYLA 1UBGA 1A9YA 4Z51A 3JYOA 5ALOA 2H65A 1DRUA 1JEJA 1MIHA 3FGNA 5IF3A 5DEIA 4CW7A 3IVCA 1J9ZA 1N0HA 1LPNA 5ARBA 4LOKA 2Y4OA 3NBKA 4QELA 2ACVA 1M2OA 3SJUA 2DLCX 2ID9A 2RONA 5LNK6 1P75A 3K8ZA 2PUGA 1L8AA 1I5OA 4I4IA 2D8AA 3DXXA 3DAFA 2DR2A 1WJGA 4WFIA 4OYYA 4DUZB 2ONCA 2VK4A 3IQEA 4D8WA 4F5ZA 1NYLA 1RKBA 2CBXA 3B70A 2QTWB 3FUTA 3QU7A 3NJ4A 4GNRA 3RYIB 4W5JA 2NX2A 2WKWA 1K89A 2ZPTX 1HYQA 4HFRA 1K5DA 1SCUB 1T1JA 2HRZA 3RU7A 1KMHA 2V9PA 4LVOA 1KEVA 1C81A 2JH8A 3LCJA 2GKGA 4WXEA 3Q8LA 4U7WA 4P1ZA 4QJBA 1ODCA 4ZT2A 2GJSA 2O06A 4NKRA 4J91A 3GGDA 4POAA 4KR6A 1UJCA 2PWAA 4NICA 5C7LO 1VKZA 5FORA 3MJHA 4DILA 3B1YA 4FNGA 1EDEA 1BVHA 5BQXA 1GSIA 2FZEA 3HR4A 1JRLA 2Q4EA 4PWYA 4OPMA 4GE0A 1XHFA 3O8QA 5HIMA 5JAOA 3L7BA 2NO7A 2RC5A 2HWYA 1M6VB 4JWTA 1D6SA 2FQXA 1XMVA 2O0MA 5CPBA 3RRXA 4P3KA 1PBTA 1VZ2A 4U9IS 1ZGJA 1VYVA 1XAHA 2IXAA 3CGWA 3V48A 2GJ8A 4MGEA 2XX3A 2DPHA 2SCUB 1VIVA 3PXEA 4P22A 2PO5A 3LC0A 3QNUA 4A0FA 4RULA 5FR1A 3IILA 4L8WB 4P83A 4HGZA 5F76A 2QROA 1UXKA 3IA2A 4HP8A 3IHTA 4AKSA 5C32A 1PR5A 4ZDWA 3IC5A 5E6RB 5GONF 1OAAA 4ITUA 3NHPA 4ZC1A 4TTIA 3SGLA 3LKDA 4EF4A 4MWCA 3ACBA 4WJLA 4TXHA 4TN1A 2B8NA 3MGBA 4JUFA 2CZQA 4FCTA 3ZXYA 2NXNA 3AGQA 4CMEA 2WWRA 1ZLXA 3EUFA 1SURA 5A5VA 4MYDA 1PFWA 2MTBA 3JQAA 5BR4A 1V26A 3GG2A 1Q21A 3N7TA 3CF0A 2NUPA 5FF9A 3TW8B 3EEOA 1NVKA 2CDNA 1RHQA 1UP4A 3OCYA 1NUTA 3Q9SA 4JJEA 2NUAA 1E0AA 4OIMA 1Z4IA 2JZOA 2WG1A 1V6SA 1GXSA 3A7DA 4YJHA 4BJHB 1OGYA 2HFJA 2O0HA 2XYHA 2AH5A 3IV7A 3JQ7B 4D6PA 4YMLA 1V2GA 3BMCB 3PJEA 4XLLA 1E2EA 5EZ5A 4G0UA 2CZCA 4YRSA 3KJFA 1MP0A 1OMOA 1LRLA 3AVTA 1NE7A 3C3KA 3ANTA 1B74A 2XB6A 4LRSB 1RIIA 3KYJB 3L0BA 1KJQA 1KU0A 4WT7A 3RAPR 1CBUA 5TF4A 1OXXK 1OI7A 4QBKA 2OCDA 1XZGA 2N75A 5M04A 5M29A 4PHTA 2W0SA 3ZLTA 5FIUA 5I9MA 1QCCA 2JIBA 1PI3A 1YQQA 3EH1A 3NJRA 1ZESA 3DBRB 3D2LA 3H83A 4H7JA 4DG5A 2ZXEA 2EOAA 1I2CA 5HF6A 1DCTA 1K6MA 3QH4A 1S3FA 5T3YA 5DHAA 2YVKA 2OBXA 3ZOZA 3KR1A 1NZJA 2E1PA 5CDYA 3GZNA 4AG5A 1OT5A 2O0LA 3ORHA 4NENA 5JS2A 1WU8A 1HEIA 1I36A 4U39A 3GELA 4A8HA 1Y7HA 3M83A 3F1LA 1FMLA 1TVCA 2XAAA 4JGGA 2WFLB 4PN7A 4YRGA 2B2CA 3CU5A 1OIXA 1QBGA 4IOKA 3MWYW 2L17A 3SSMA 5KYXA 1WXGA 3QE0A 1H2FA 4KH0A 1QV6A 4LYGA 1M72A 4W6QA 4UUQA 2EJWA 4W1RA 2VYNA 2ZB8A 1AQIA 3IPYA 4L85A 5J63A 4DANA 1MNQA 2QRVA 2GX6A 3NUGA 5EPUA 3V8MA 1I4EB 2IQIA 3A37A 5HZKA 2C3YA 2JCXA 2ZBPA 3G0IA 4ZT5A 1ZMRA 5M34A 1OZFA 3FTEA 1A4XA 4KBFA 4EG8A 2AMFA 2WWVD 4E88A 3AC0A 3WGMA 2EP8A 4Q7QA 3OJOA 3X2EA 1O94C 4UM8B 2P11A 1DTSA 3VU1A 4TYPA 3QIVA 2Z4SA 3MQ2A 3IT3A 3EWIA 3PC6A 1E9EA 1KTVA 4RK5A 1UC4B 4PO8A 4M0PA 3RVKA 1P4JA 5EG5A 2UVDA 2GA9A 3ABZA 3DO6A 4UNSA 1ZCFA 1JHPA 4IAOA 4ZAYA 3EFOB 4XVHA 2CC2A 4NI5A 3ODGA 4DQKA 5CITA 3DNFA 2WTAA 4MMYB 4HVTA 3SF8B 4GBGA 1TD9A 4BV2A 5LWQA 4A8JC 4X90A 1KYYA 1WB9A 1UJ2A 3O7WA 4IUBS 4BCCA 4PSDA 3TPZA 5DHQA 4E5DA 2IYXA 1NRXA 2D5CA 3QU5A 2HOQA 2HADA 2Z1DA 5FLYA 4YWHA 4HLUA 5K6AC 5TDHA 4G5XA 4BO7A 1T2CA 3OMWA 3RF6A 1MABA 2R6HA 1CZOA 1FBTA 2B8EA 1W0CA 3VZQA 5FP0A 5E9AA 4KE7A 4Y18A 1LBEA 4EGJA 5AD1A 1TM5E 4RMGA 2IH5A 3G5AA 1MB0A 4QYMA 4TQGA 4B71A 2PDAA 1G1AA 3F49S 2X2EA 2PX5A 2I4TA 2ZIUB 3GOQA 9MHTA 3KE9A 2RBKA 4MVJF 5ABPA 1LPBB 1SXHA 2X4LA 2XT6A 8ABPA 4KFCA 1WMDA 3H2HA 3KE8A 4UCQA 4WDQA 2GWHA 3RU9A 2QUKA 4E2FA 2WU1A 2QVGA 1KFEB 3DOUA 3LUGA 3ZN2A 4YLYA 2FFAA 2BMJA 3ASZA 3P2KA 5EKTA 4F4IA 1QP4A 4E30A 3IMGA 4KE6A 5CD1A 2PMCA 1Z9BA 4WKCA 5WRFA 1QK3A 3IEMA 1KKMA 3K5WA 3IRVA 1P2UA 4NU5A 4B2YA 1FZTA 1V39A 1V35A 1QYCA 1NF9A 2H5JA 3TLJA 1U2QA 3TZKA 2LE0A 3ZXSA 4H2DA 1RKXA 3LBNA 1EVYA 5JBQA 1M6EX 5HOQA 4F60A 2HX1A 5F4ZA 4KGXA 1KL7A 2O2ZA 4BFVA 4DY6A 1U2SA 3SIWA 1VFNA 2FPSA 2HNKA 2VCYA 3NIWA 3ISTA 3VJKA 1JHYA 4E11A 1NX9A 2WIBA 3WLAA 5BSEA 1Y5LA 3FNBA 3EA0A 1G55A 2RGDA 3PLRA 3GZJA 3UT5B 4FFOA 3UWKA 4UTVA 5C31A 5IEJA 2EFCB 4QOIA 2ZJZA 1P1HA 4LK3A 5K8UA 2EKQA 5CT4A 1YB2A 1OCEA 3JATB 1J99A 2GXSA 4ALLA 1N3LA 4KLCA 3V8BA 3VPCA 2YKGA 4D9HA 3BH6A 3DOHA 1Y3AA 4GMHA 4LHYA 3ENVA 4XGQA 1XAJA 3COZA 5EZYB 1UKAA 2CMKA 1E1KA 1ZK3A 1D4AA 2KSQA 1S2MA 1A2KC 1XELA 3IT2A 2QVXX 1IY8A 5GY7A 5LWHA 5TS2A 5HTOA 4JAVC 1NW9B 2CXUA 1Q1AA 1IOWA 4BQQA 5ESRA 3JQFC 4MR9B 4DDMA 2FMFA 2WFMA 3NOVA 4GE3A 2CNBA 2VPZA 1WVMA 3L8GA 4RA9A 1TVMA 2H51A 4KAFA 3BM5A 4DLUA 2P7HA 1D2MA 3DYVA 4BBPA 5A0TA 3ED1A 1XWFA 1C1YA 2V45A 1H2HA 4MUKA 1DL5A 2ZI7A 3OTHA 4EG3A 1SKUA 2CXRA 3IUEA 1X3SA 3M82A 5P21A 1TO2E 1BJKA 3AVOA 3GEDA 2MU1A 4I50A 3ZX5A 2OENG 1NRIA 1LSOA 4C0LA 1L5YA 2VTKA 4I4TF 4URUR 3TOXA 2Q8QA 3IDSA 5BR1A 3BE8A 3MAJA 3GAMA 2VDLB 1UAAA 1NVBA 3IHLA 4HQFA 4C0BA 1ZVMA 2GCOB 2WHPA 1SQ5A 4MPJA 2Z4RA 4NZPA 1NVWQ 4TKVB 3A6HA 3JYNA 4NZ9A 2GYWA 1JDSA 1V4NA 4CL2A 5KHOC 1KZ9A 1O58A 3GJ3A 3B38A 3LUKA 5E0OA 3NDBB 1KI4A 3IUYA 2Q1WA 1N2ZA 1VKNA 4EWLA 1JEDA 1FRQA 5ALGA 1L3BA 1QZXA 4Q7LA 4XM0A 2VHJA 2P9GA 3Q4GA 4J16C 3ZV7A 2E4YA 1YB7A 3F6CA 4HDOB 1R00A 3NFYA 5A71A 4IQGA 1G5FA 4BPBA 5F3WB 2VIIA 1UXIA 3K4HA 1P61B 4JJ7A 5JZMA 4LBWA 1O6FA 1XALA 1Y81A 4REQA 5AKYA 2PRZA 3UY4A 5HKBA 1CQJA 3CURA 4JWKA 5G0TA 4OHKA 4BVGA 1MAHA 3I05A 4IXDA 4WN3A 5D8DA 2GKSA 4BUJA 1X7XA 4HNUA 1J24A 3TFQA 3GUZA 4YWJA 5FWNA 3E82A 2B9VA 2D1SA 4L51A 3WLEA 4B46A 3INGA 1GWNA 2H4FA 3DHEA 3HJNA 3HA3A 3ZHVA 4RD4A 4P4UA 1UMDB 2B1IA 5H68A 4A8TA 5DNDA 4O1HA 5IVHA 4ETIA 4HDKA 3ZI7A 3IKVA 3ZQJA 2W8BA 1ORHA 1JFVA 2OFPA 2WV9A 2C2YA 2AJTA 2OBNA 4I6JA 3NUQA 1BTOA 3SLGA 2BGRA 3PKIA 4EI8A 1NMSA 1YJ5A 2DKOA 4XYLA 5JC8A 3W6PA 3VYRB 4CKZA 1B23P 1MC5A 1HQKA 4ZODA 2I29A 1FS5A 1ZGBA 2WJ6A 4P7FA 3ZCUA 4EABA 4J43A 6REQA 5I7FA 4DTIA 1AG9A 5KTRA 2CW5A 4MRMB 1QIJA 1JEYA 1GD1O 2N0SA 2ONZA 4LEIA 4ZAVA 5I9SA 4LOIA 4UHBA 5J4HA 2YRWA 2J1LA 3X3HA 3HYSA 2ZCJA 1NVFA 1AQYA 3G02A 1I6WA 2PX3A 8ADHA 2OLKA 1DI0A 1T15A 5T67A 2Q9UA 3I58A 4H1WA 3FY4A 3RJZA 4RQAA 1AA6A 4PX9A 2NVBA 3M5CA 4FNOA 4ZIRA 3GJSA 3I64A 1T2DA 2V3WA 1J0EA 2GPBA 3NS7A 2MSLA 3WQQA 5DNAA 5EIAA 1I80A 4HGQA 2IKQA 4M22A 4QGHA 1E2KA 3MWJA 1BHO1 5AW2A 1WXXA 4W7SA 1C9MA 1GGMA 2H2WA 3TW6A 1T3SA 5IVKA 1PUJA 1LPAB 4DCTA 4EUHA 2NT4A 2P9QA 4MI9A 1XQYA 7GPBA 1MAAA 2Y1OA 4UM9D 3PXAA 2HF9A 1F20A 2REQB 2ZVQX 2WF6A 4IMPA 1XTBA 4FUTA 5CCBA 2BCEA 1CS4C 4QXPA 5DB4A 4EHIA 2XTMA 1QCZA 4LRYA 4AP5A 1RPAA 3F5DA 3LGSA 2IPXA 1BDJA 4MQMA 1JLHA 3DCJA 2X1HA 3GGPA 4MLCA 1VE3A 1MZPA 5DHTA 4JENA 2E9SA 3R3YA 1TTHA 2VF7A 3C3WA 3L8DA 4JBIA 4PG5A 3H8VA 3RC7A 4BZWA 1O9GA 5FAKA 5GINE 3ADDA 1M1ZA 1N8TA 1ZL0A 2DT8A 3WI7A 3VR4H 4EG1A 2OGUA 4PC2A 5CA0F 2HD4A 4PZUA 3ZDEA 2XWJI 1W1WA 4RY8A 4AFNA 3L4SO 1RQPA 5F51A 3Q8WA 1Q7GA 1MC1A 3G9XA 1YD7A 5INTA 2ZBVA 3DGEC 1EVJA 2UZ3A 5BVHB 2IU6A 1J70A 1CULC 2QB5A 1XTVA 3IAXA 3O4JA 2MSKA 3LQ4A 3PCTA 2ADMA 5DW0A 5FBRB 1DAKA 3TDKA 3FOZA 1LI4A 1P18A 2E6UX 3CSUA 3FNHA 4NU8X 2WD9A 1DAGA 2GPJA 1D4OA 3X2FA 2Q3CA 3VGJA 4DM3A 3SQOA 4C7OB 3U0BA 2WSMA 3UB3A 2HLPA 3AZPA 1PG2A 5JIBA 1C30B 1UWLA 5A04A 4Q3EA 5IKOA 3LSTA 4ZC8A 1KRXA 1UMKA 2AG0A 4BB6A 1L7EA 2C03A 2JK1A 3IIEA 4LZPA 4IH1A 5K01A 1K1EA 2NTJA 4BO5A 3DD1A 4LJRA 2O3QA 3KQPA 1N9ZA 4DV2B 3JQPA 4UTZA 1UDRA 3UW3A 1PBNA 3ET5A 3D8TA 1MMFB 2QD3A 1CSEE 3JYPA 3LNTA 3NC4A 5IP5A 3QPWA 3VZPA 3LPLA 1UK6A 4ZYTA 4OHYA 4QWWA 1HA3A 1AXEA 2P90A 3WMFA 1FFSA 3D6FA 3TH5A 3ZWKA 4AN1A 1CR6A 1DELA 2DFVA 3JVVA 4IG4A 1UBFA 4Q1EA 3ZE8A 5THKA 4ZYVA 4YCLA 1XZNA 4UQOA 4UAUA 4CQLB 4GVLA 1NUQA 4TTAA 5DNWA 4B7XA 4NHEA 5K0TA 3FCEA 1T4MA 3ZWXA 1EGQA 5B37A 3D3QA 1ZH4A 3DDNA 3IUNA 3I9OA 3I4CA 4X54A 2E3JA 4J7AA 4RZ2A 3GLFE 4RK4A 4TSKA 1OXBB 2BI7A 4EHBA 2XGSA 3REQA 3R24A 3FPLA 2P35A 2QYTA 1F0YA 2E6KA 3H87A 3CG0A 2VDPB 1OX6A 4RVCA 3SE7A 1IBKB 2YJNA 4LTNA 1FDUA 1Y4SA 1FFXA 3ITDA 2FZLA 3ZJUA 1G0NA 3VU9B 1HE3A 2YIDA 1O54A 4CODB 2XQFA 3FF4A 1G20A 1X1TA 5DGHA 3FVWA 3ORYA 2C2BA 1XCBA 4WJKB 5BR7A 2J30A 2XTAA 2WVGA 1Q22A 4NMLA 2G77B 2V5AA 4ZARA 3W79A 5BP7A 1OBHA 1MH1A 1SQGA 4NU0A 4TLLB 2CLDX 1UKVY 3IQHX 1J06A 3KZOA 3MBOA 3VKUA 3I9V1 1HORA 2MSWA 2ENUA 2Z1MA 2DFKB 2PD4A 3CKYA 4B7ZA 4B3RB 3QKWA 2A7XA 3V9PA 1EUCB 4F91B 1GA1A 2G88A 1Z62A 2O9JA 4IJMA 4C14A 5ITSA 4KPFC 1UJ6A 2EGGA 5CA1A 1H5NA 1Y7LA 4TWRA 1GLVA 1DTWB 5KNDH 5DN9A 4X24A 3S7ZA 2VJBA 1KJ8A 2CHVA 3MRTA 5E7JA 2X4IA 2YHUA 2WMDA 2X0JA 4I1OA 3UMYA 3UJPA 1BWSA 3TCNA 4GMDA 2GF9A 4RVFA 1FNCA 1U28A 1DJQA 1O6CA 4U63A 3N1UA 3UHAA 5K99A 5A06A 3KHUA 1PDWA 1U5CA 5ESWA 1O7JA 1ETUA 3UKJA 4PAGA 4DL9A 3EB9A 1FYWA 2J6HA 2V8OA 3OF2A 1GYRA 3NNDA 4RMIA 5KYTA 4RKFA 2Q21A 1VSTA 1K3TA 1E2LA 2J7PD 3RFCA 4B8ZA 1OTXA 5B58C 1N92A 2ECFA 5IFLA 2C9CA 1PQPA 3B48A 5FTJA 5G2OA 2ENWA 2XEXA 4R54A 4TS3A 5CYPA 1ZN8A 1LBQA 3WLJA 2PUEA 3PHIA 1GO2A 3PZRA 1HNNA 2VP2A 1Z4OA 2NUTB 3H16A 3LKZA 1NA5A 2YNMA 4QEKA 4Z86A 5KHAA 2P2LA 3N2KA 3FTFA 3L82B 4FOTA 3DV2A 1QGED 4NFYA 3DTVD 5COBA 2XMZA 1KIMA 4RPGA 4RD0A 2JFPA 1P3Y1 4Y98A 4DIOA 3QVVA 1PJSA 3M4JA 3AJDA 1DC6A 1AKWA 3L3BA 4RTPA 3ZOKA 1TFRA 2NSJA 2WTMA 4XI9A 3EGOA 5EQDA 1SXJE 2D4HA 3EGIA 4WE3A